4OKIA

X-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phthiocerol synthesis polyketide synthase type I PpsC
publication title Insights into the catalytic mechanism of the DH domain of the Mycobacterium tuberculosis polyketide synthase PpsC and architecture of the beta-carbon processing domains
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 63
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.41: Beta-ketoacyl-[acyl-carrier-protein] synthase I.
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4okiA00
2EXXA 3L6EA 3PJDA 3C1AA 4CV3A 2JL1A 1M75A 1S6YA 2FN7A 2OGUA 2NTJA 3KM0A 1DIRA 2EJVA 3F4LA 1VKNA 1UDBA 2EF1A 3WOHA 2E6UX 1A7AA 2NWQA 3AU8A 4H7PA 1C14A 1Q2XA 4QFDA 3V1YA 5CAEA 4UUNA 1U3VA 3O4RA 4O6VA 2PH3A 5KVQA 4U0JA 1QYCA 4NBVA 1LI4A 1P1FA 1IPEA 1DPGA 3GNTA 3HDJA 4ALJA 3GN1A 4UEKA 1Q7GA 3JQ8A 1C0KA 5G0UA 1VM6A 5GZ6A 1MG0A 4ND5A 1EBFA 3HSKA 2CDBA 3E6AA 3GHHA 3CZRA 4KOAA 4RJTA 4WGGA 1ADGA 4J90A 3RIHA 1Y1PA 5GY7A 1J6UA 1AGNA 1E3WB 1Q0QA 1N1GA 3P7MA 3NKLA 4B4OA 2I3GA 2X86A 4XIJA 1P74A 1PGQA 2CFCA 2PNFA 4XRRA 3PTZA 3NT2A 3VPHA 1N7GA 3GOHA 1T26A 1E3JA 2O7SA 4UUPA 3WQSB 1B3BA 3UGKA 4I9UA 2NV6A 4L8VA 2PY6A 5AXBA 3WGHA 1OI7A 1XA0A 2X6TA 4J91A 2QX7A 2O3TA 1DRVA 1WXDA 1M6HA 4A73A 5C7LO 1KVTA 2PK3A 2B4QA 1CF2O 4CR8A 4YEDA 3RQSA 9LDBA 1I3NA 5KKAA 4WLFA 3ZNPA 3GK3A 4NH4A 1EDOA 1YONA 2UV8A 4AJLA 5AQ1A 5IFLA 5AYVA 2X9GA 5F1OA 1NPTO 1N8KA 2DTDA 4IJVA 5GZ1A 3VZSA 5I7VA 2FWMX 1E7SA 5EQFA 3TZHA 4QXMA 1PZEA 2BD0A 1RYEA 1X7HA 3R6DA 4YJDA 2I65A 1EUDA 3K92A 1FXSA 1KEUA 2IRWA 3NT4A 4IGFA 1I8TA 4Z6KA 3HZZA 2DBQA 2EERA 3Q1LA 4MIYA 4N5MA 1NR1A 4WKGA 3G49A 3JQ6A 1HE4A 1PR3A 2W8ZA 1ISIA 1Q7CA 3EY4A 5I9LA 4GMFA 5HA5A 4XQCA 5DBGA 5H82A 4EGFA 1OBFO 4WCFC 5JYDA 5G0SA 3A14A 3LLSA 5IZCA 3PI7A 4D0SA 4B8ZA 5CG1A 1VSVA 4DYVA 3BTUA 1NFQA 3DBLB 1DHRA 1DC5A 4R1SA 4W99A 2YW9A 1DJQA 3PYXA 2WYWA 4JP3A 1AN9A 2OORA 1G0OA 1E3LA 3VH3A 2VYNA 5ES3A 2X0NA 1ULSA 2YUTA 2FZEA 3UCFA 4A7PA 4EI2A 1BGVA 3JQ9C 4E2XA 3Q2KA 4R3WA 1ENYA 1JW9B 2C2YA 3PJFA 1ONPA 3NAQA 4H3VA 2X8LA 4AJJA 2GNAA 4L75A 2FSSA 1VC2A 4EUFA 1YS4A 1U9JA 2Z5LA 3KYDA 4ESOA 1HSOA 5HTOA 3ZNOA 4NDNE 1E92A 3C1TA 1UAGA 4PLCA 1PGOA 7MDHA 2JAPA 4ALMA 1DAOA 2D1YA 2IZ0A 4JLWA 1BRMA 3KYCA 4NBRA 4B8WA 2O3RA 5CDTA 4CUZA 1ISJA 3M6IA 3ZWCA 3CKYA 4RF2A 1KYQA 4ND2A 3X2FA 2EIHA 4M8SA 4BO1A 2G82A 3LYLA 2C7VA 1HL3A 3TZKA 2QIOA 3W4IA 3TFQA 4R51A 2VT3A 2BKAA 3BHMA 4NU5A 1MX3A 1R15A 2D5AA 3AUTA 3ICCA 3ZHXA 1HKUA 5BSGA 3VDRA 4BHTA 3VTZA 2D3TA 1UXIA 1DFGA 1E5LA 1ZNQO 2QZZA 4W9NC 1JA9A 4DIFA 5U4QA 3JQAD 1T2EA 3EDMA 5G4LA 2Y0DA 4RF5A 1WLYA 1Z7BA 3BYZA 2WM3A 2P9CA 2VHZA 3ONEA 2POQX 1P0CA 4MIEA 3AFMA 2UAGA 5JCJA 5IJZA 4Z0TA 3WDSA 3RUFA 1AXEA 3KOUA 1HYEA 5T6BA 3WIDA 4ALKA 3DO5A 3HUDA 1NQAO 5JCXA 2PGJA 4OSPA 3RUHA 3STHA 1Z74A 4D41A 3RWBA 4CM4A 2QZ9A 4DGSA 1QR6A 1EQ2A 3DAGA 4CQMB 1UDAA 1ZEMA 2IZZA 3I23A 5L4LA 1ZSYA 4FFOA 1OFGA 1U4OA 4NHEA 3RVDA 3QW2A 2W90A 2B37A 3HDQA 4WASA 2PKQO 4JNKA 3KZVA 3WGTA 3H2ZA 3NRCA 4BO2A 3WX0A 3MJCA 3LF1A 2Z1MA 1ID1A 3JV7A 4BV8A 4DVJA 5IDYA 5DOZA 3PHLA 4YT5A 3VPXA 1KY4A 1KIFA 3KLMX 3DHNA 5L7WA 1FJHA 2Z95A 2ZJ1A 1BG6A 1UZMA 5ICMA 4LCEA 5JSFA 1MFPA 4RVFA 4J16A 2DBRA 2AMFA 3VH4A 3JQ7A 2HRZA 4NIMA 5KIAA 1XYGA 4S3MA 2EGHA 5KJ1A 3JSAA 3KETA 1U4SA 3GMSA 4F6LA 1YB4A 4W4TA 2PGDA 4R01A 5I7SA 4XCVA 5BSHA 4RORA 1VI2A 1JN0A 1NR7A 1PJCA 2HDHA 1KVSA 4XZ3A 1C1DA 4A10A 1DLIA 2VTDA 1WMBA 2R00A 3ETGA 3AY7A 2FPIA 3LDHA 4M1QA 1NVMB 3WSVA 4OXKA 1SB8A 3SX2A 3WICA 1LC3A 3DBHB 3NGXA 2EJWA 2DM6A 3ETDA 3VPSA 4KUGA 3GNQA 1T2FA 1T1RA 1O94A 2TMDA 1KEVA 4B7XA 3ON5A 4QQRA 5IXYA 4HWKA 5G2OA 1H9AA 3HG7A 1V9LA 2BF7A 4MVJE 3B1JA 2XOXA 3PGXA 3UICA 1E3EA 4IMRA 2NADA 2J6IA 1VKOA 4S1VA 3BMOB 4JJGA 4IZIA 2HMTA 2I3AA 4JX8A 5H81A 3ZWVA 4BO6A 1NX6A 1UAYA 4LISA 3TFOA 1H2HA 3PDJA 2BI8A 4MKRA 4CLRA 5T5QA 5JE8A 4P4GA 4PVCA 4YJFB 3DZFA 3RUAA 1AUPA 3FBTA 1A7KA 2CNBA 5JW6A 4HNHA 4K9DA 5TRTA 3MOIA 1P1IA 4MP6A 3KV3O 1I0ZA 3DBRB 3C8MA 4NMHA 4CQLA 1DC6A 2YFQA 2OP0A 2DTEA 3T7EA 3SC4A 3PEFA 4MVJI 3IUSA 1N9GB 1DO8A 3H9GA 4JN6B 2F00A 1V3TA 3MJTA 4H15A 3VKUA 4C7JA 3HJAA 1W73A 2EP5A 4AJ2A 2ZATA 5JMWA 4U8GA 3C7AA 3GGGA 4IDAA 3RC1A 1TXGA 2Q45A 5EERA 3WIEA 4EEZA 4WK6A 1DIAA 4TVOA 4BO4A 1I2CA 2C5AA 5T64A 2DKNA 2R2GA 5F1KA 1J4AA 2H6EA 4Z3KA 3NDRA 1YOVA 1N2SA 1QYWA 1R0KA 1XCBA 1Y8QB 3HN2A 4N5LA 4PG8A 4WLNA 4IDCA 3ONDA 4IPTA 2GGSA 5L7TA 3VVCA 3D64A 2EV9A 3RSHA 2VOEA 4IINA 1NVGA 1C1XB 4Q3NA 5THQA 1AHHA 4GKVA 1WWKA 3V2UA 1JWAB 3F4BA 4WE3A 4OQZA 1PGJA 3JYLA 2HAEA 3BHJA 1V3VA 1FK8A 1KS9A 4LSMA 3CSDA 1B7GO 1M2WA 3FN4A 1HDZA 1FDTA 2HJRA 2Q4EA 3GFBA 2NU6A 4RV9A 5COAA 1BXGB 4TKMA 3U5TA 2PTGA 4IDFA 3S2EA 4FFLA 4E0BA 3VZQA 1ZZEA 1YQGA 1YO6A 1BTOA 4D7AA 4C4OA 4PCVA 2VZ0A 2CVOA 3FI9A 1EQUA 1R12A 2B69A 3O9ZA 5F21A 3T4XA 4HP8A 1WDLA 4HXYA 3WGZA 3ANMA 1UJMA 1TA4A 2GLXA 3HE3A 5FYDA 4GI2A 5A04A 5FEUA 3PIDA 4P22A 4TROA 1DIGA 3GVPA 3INRA 4MVJA 3EZLA 3GF4A 3G1TA 2H63A 3F9IA 4ZQBA 1UR5A 5L4SA 3JQ8B 2YV1A 4CM8A 3ZDFA 1ML3A 2VCYA 4DRYA 1CDOA 1BVRA 2P5UA 4KP7A 2JD2A 3DZGA 5JC1A 1CWUA 1FDWA 3I52A 4DA9A 5I8ZA 2Q1UA 3WSWA 1EMDA 1UXKA 4P8RA 4J7XA 5ITWA 4O0LA 6ADHA 3DTYA 4I5DA 1UZNA 4Q39A 4LCJA 2C7GA 4NPCA 3KVOA 4GX1A 3UOGA 2BMAA 3WGGA 5A9TA 4BMNA 1A9ZA 3A1NA 4YJGA 1JVSA 4ZVVA 3W6UA 3L9WA 3F5SA 4BMVA 5BSFA 4BO8A 3FRJA 5ER9A 3N74A 3BIOA 2NLOA 3EVTA 3G0OA 3I9OA 4XWYA 3VH1A 4CMGA 4U5QA 3VC7A 5HS6A 3LC1O 2C0CA 2AG8A 1YJQA 3D4PA 3PVZA 3L4BA 4TVBA 1L7DA 3ROKA 3DQPA 4I8XA 4YA6A 5BNIA 3IUPA 7ADHA 4RLSA 4DWVA 5C37A 1EK6A 1PX0A 3ASVA 3I3OA 2Y1OA 1YBMA 4GSKA 4MP8A 3W8EA 4KTTE 1EZ4A 3GHYA 3UUWA 3WQQA 3GEDA 2E4AA 4DTIA 1Y9EA 2IE0A 4DQXA 3RFTA 1H6AA 2PGLA 2QW8A 4Y67A 1EVYA 1PL7A 1ZFNA 3WWYA 1QV6A 1YH3A 2RHRA 1IUKA 1MLDA 3DL2A 3K9QO 4G2NA 3BMQA 5COQA 3TOXA 1KY5A 3VKVA 3W8DA 3PQDA 2RH4A 1ZIDA 3BTVA 3D4NA 4J1NA 3NEPX 3GVXA 4ZD6A 3AWDA 1T24A 3C1OA 3EYWA 2D2IA 3DHYA 4RVGA 1LQUA 2OBNA 2Q1SA 4PLYA 5DULA 3I6QA 1TLTA 2A35A 4L9RA 3LT0A 3VAZA 4EYEA 2RIRA 4J9VA 1VL0A 4BO9A 3U09A 2C59A 4HFNA 5I8WA 1ADFA 4AICA 1F0YA 1P33A 1KETA 1XKQA 1AXGA 1A27A 1E6UA 1L7EA 3FWNA 1SZJG 5DT9A 5JNLA 1QLJA 2GPTA 3GN2A 3EK2A 3R0IA 1PQUA 2YDYA 5KCZA 1HZJA 1D1TA 3ZWYA 4UEJA 4FB5A 3DB2A 1NWHA 1F8FA 2GASA 1X14A 3DFZA 4RVUA 4WLUA 2E37A 3WNQA 4CODB 4PLFA 1QORA 1T1SA 4QEDA 2Y67A 1IZ9A 1EBUA 3RC7A 1CQIA 4L4XA 4XQGA 1T25A 4PN3A 4GH5A 2UVDA 4GX0A 2C54A 2DBZA 5JY1A 1E7YA 1EVZA 3TDKA 3OJFA 1VLLA 4YCAA 1KVUA 2WE8A 1ZW1A 2O3JA 3KYDB 1UH5A 2J5KA 1P1RA 4IUYA 5DZSA 1PIWA 4RPHA 2WWRA 2YFHA 2IEDA 1U8XX 3TZ6A 5CDSA 1WZEA 2I5PO 3ABIA 4IJKA 1LBEA 1V6AA 2NTNA 3KYCB 4IZHA 5T67A 5A03A 5IXSA 1QYDA 4HFJA 4ZICA 5K6AA 3ITDA 5B4UA 1TVEA 2IDZA 5HWSA 4MDHA 1E77A 2HMUA 1HZZA 3RASA 4ALNA 1NASA 1YBAA 3EAGA 5EMHA 2JFHA 3ZU5A 3UFXA 4ZN6A 4I9NA 1DIHA 4J4BA 3LC7O 1HXHA 4L4SA 2J5RA 4E4YA 3D7LA 4XIYA 2J3KA 3DOOA 4W82A 2JHGA 4XDZA 4P4LA 5BQFA 2V6GA 3BTOA 3GVHA 1GL3A 2G17A 4QTZA 4M54A 4ZJUA 1SPXA 2QRKA 3QVOA 3ZZNA 1PZFA 3C85A 4NG5A 4RGBA 1G1AA 3W4JA 2YV2A 2C29D 3JD3A 3E9QA 2JCXA 4BO0A 1A4IA 4DXHA 5F1PA 3O38A 3ASUA 4FOSA 3CH6A 4FPXA 1RM5A 3DOJA 1ZUD1 3HQ4O 2YYYA 1YVEI 1JAYA 1J49A 5L9AA 5FFFA 4HV4A 1LLCA 1BHSA 4EBFA 2VWGA 3ZU2A 4CM4B 3ZH2A 3M2PA 1DLJA 1CJCA 4DC0A 1UXJA 4DLAA 4BB6A 3LVFO 2IODA 5DP2A 1I24A 1T2CA 2JD0A 2ZTVA 3ZV3A 3DAFA 3I4FA 3K5PA 4DQVA 4EUHA 3AM4A 2O7QA 3KSUA 2DFDA 3TRIA 1WDKA 3L4BC 3IL2A 2YHUA 3CPSA 2ZQYA 3NTQA 4JBHA 2GZ3A 3RROA 3H5RA 1VPDA 2J3IA 3UH1A 4Q9NA 4E5KA 5GMOA 2PZMA 1IL0A 1ONOA 5L3ZA 1H6BA 4NU6A 1F17A 2GD1O 3IJPA 3JQ7B 1E1MA 4Y9DA 3LC2O 2Y68A 1LRLA 4RDIA 3I6IA 4Q3CA 3AY3A 4BL5A 2OHXA 3PWSA 3C7DB 3MJEA 4L74A 4E32A 3GC6A 5F5NA 1E7RA 1N7HA 2P2SA 3U4IA 5IN4A 3U0BA 1HYHA 1JVBA 1AHIA 1C1DB 1M66A 1UXGA 3K6JA 4YWJA 4HUJA 3Q2IA 8LDHA 1DC3A 5LCXA 1K3TA 4FJ1A 2HO5A 5JAZA 1E7WA 3LT4A 1R0SA 4M55A 3G17A 3OFSA 2Q50A 3RBZA 4XQEA 4F3YA 2VYVD 1H5QA 1GADO 4R54A 4GMGA 5TGDA 4PLPA 1UZLA 1O0SA 4YAIA 5JYEA 1SNYA 2B0JA 3T4EA 1DIBA 4R16A 3Q9UA 3S2GA 1T4BA 4JXKA 1E3IA 1IHXA 4FC6A 1KERA 4CLRB 4JQCA 1R0LA 1EFKA 3GAZA 4AJ4A 2GYYA 4IBOA 3IMFA 3IKTA 1PS9A 3P19A 1R66A 3VPGA 3KSDO 3PHJA 4MVJF 3QHAA 5DF1A 1YWGO 1O95A 1G0NA 3GDOA 4YAJA 1GV1A 4YYZA 2ET6A 4INAA 4YT2A 4NJOA 4CQLB 3D3WA 1QYXA 4IM7A 4II2A 4UEOA 5B37A 1P9LA 4URFA 5ILOA 2DU8A 3QE3A 4WLEA 1B8VA 2WYVA 5CDYA 1K5HA 2UYYA 3OBBA 4OIMA 3F3SA 3NTOA 3U3XA 2Q2QA 4OXYA 5T8KA 1R4MA 3HFSA 2AQKA 3VHRA 1DXYA 2HJSA 1BW9A 4JP2A 1W6UA 3N7UA 4R1TA 1YOVB 2GR9A 4CV2A 3F1LA 3TN7A 2OFPA 1SEVA 3DFUA 4OYRA 4MINA 3EUWA 3GA0A 4GAEA 1IHYA 1ORRA 1YKFA 3P5SA 3CMCO 4PG4A 1YRLA 1TI7A 4TRNA 1KOLA 4KQXA 2NU8A 5IAAA 1TB4A 3AI2A 4W6ZA 3A28A 3GR6A 1U3WA 4GSLA 4CM9A 2VWPA 1B16A 2NUAA 3HFGA 4FJ0A 2A92A 4IGEA 1ENPA 4HADA 3MWDB 1NWCA 1I3MA 2AQHA 1Y81A 2HU2A 5JO0A 3INTA 4MVJP 3BTSA 4TRJA 1GTMA 3WXBA 3KSZO 4OSOA 1QV7A 5A1TA 2X1HA 1K6IA 4IY1A 3SVTA 5A5FA 3GRPA 2PWZA 3F6YA 3GRKA 2QYTA 3D5QA 4IIUA 3JQAA 4ZQGA 4IQ8A 4PVDA 5ER6A 5KJ6A 2J3HA 2Y1FA 3EGOA 1GYPA 3GDFA 4CPDA 4RPJA 2CSUA 5HRUA 2ZB3A 5BR7A 2O3SA 2Q1WA 1GEEA 5I7EA 4O5OA 4XYMA 5TLSA 3LF2A 3WTBA 3AI3A 3H9QA 3PYLA 4BKRA 4CM8B 3AUAA 4XGKA 1UP7A 3UAGA 3PDUA 4CL3A 3RI3A 1YXMA 4RF4A 4TZTA 3PZBA 1NQOA 1ZCJA 2VUUA 4JJFA 2WD7A 3DTTA 3JD4A 1UDCA 3ZWAA 2JHFA 4U7WA 1U7TA 3R3JA 1D8AA 1RM3A 2NU7A 4XD2A 5IDWA 4RZHA 1L1FA 3NDJA 3WGIA 1DEHA 2IXBA 4YJGB 2P9GA 4EDFA 1DFIA 2WMDA 3JTMA 4WNCA 1C0LA 2D4AA 1V8BA 3PJEA 4KQWA 2BFPA 2VTEA 4CMJA 2YHIA 2GN9A 4GLLA 1LNQA 1ENZA 2D0IA 1ISMA 2HSDA 3H5NA 2FR8A 2CD9A 3DMYA 3C7CB 3WGQA 1X7GA 4XB2A 4XYGA 4E2YA 1YDEA 2F1KA 3B1KA 3JYNA 2O50A 3QJ5A 1H0KA 2AA3A 3D5TA 5AXCA 2Y93A 1PQWA 2H1SA 4J2OA 4Y8VA 1TT7A 1HE2A 1B26A 4UAGA 4ZHSA 2VYND 1P0FA 4UUOA 2VRCA 4NQZA 1GYQA 4OQYA 3E03A 1E1NA 4P4NA 1P77A 1YJ8A 1NXQA 3F47A 4R3NA 4E5YA 2GN4A 4FW8A 3OJ0A 4WJZA 5MGBA 3TZCA 3BMQB 3HHPA 1O5IA 1LDBA 4FGSA 1U2DA 4L0QA 4J9UE 4LMRA 5DCUA 4RVDA 4E5NA 2VWQA 2ZYGA 1LSSA 5JC8A 1JTVA 1Q1NA 2YQ4A 1ZMOA 4XGIA 5I9MA 3A9WA 3ZU4A 1E0DA 3U4CA 2DPHA 3UVEA 4E33A 1GFSA 3OJLA 2PZJA 3OECA 5G0TA 8ADHA 3DOCA 3I9KA 4WNIA 1BXZA 1GCUA 3DZHA 3OM9A 5CFZA 4AVYA 1VJ1A 3IAHA 2HMVA 4MKZA 2P91A 4RVHA 3AM5A 4CLEA 4Z9YA 5JDIA 3KEQA 1H9BA 1UUFA 4OM8A 4U6QA 4CMEA 2DFVA 2JFGA 5JDCA 5CPBA 3QVSA 3QLJA 2HCTA 3WWZA 4E6PA 3TWOA 1DB3A 4OOEA 3QVTA 1CIVA 2CDAA 1W8DA 1P1HA 5IF3A 1T2AA 2AW5A 3N58A 2OL4A 3V8BA 1NPDA 3DHEA 1MC5A 2VHXA 2NVUA 3PFWO 1GCOA 4LVCA 1LEHA 3L77A 1Y8RA 1Z7EA 4PZEA 4D42A 1HDYA 2VN8A 1U28A 3V1UA 5JCJD 3MTJA 1O9BA 5L4NA 2IYOA 5IZCC 2E49A 4DIOA 1XG5A 3RBXA 4CMIA 2I66A 2B36A 3FHLA 5KJFA 3K73O 3H9EO 3HDYA 4Q3DA 3LT2A 1WDMA 4LW8A 1ZK2A 3E82A 3QWFA 4FQ8A 4CLHA 4LVUA 3KTDA 1KVRA 1HRDA 1D1SA 2SCUA 3F5QA 4NBTA 4BNTA 3JQBA 3GMDA 1N1EA 1XEAA 3I9MA 1RJWA 4PLZA 1C0PA 1FDUA 2Z1NA 1Q0LA 4JROA 1DSSG 4CMBA 2ZCUA 3CEAA 2WYUA 3DAPA 4CL8A 1JKIA 1LSJA 4FSHA 2JD1A 4AJEA 3HWRA 5U9CA 4AJPA 2UUPA 1YB1A 1X7DA 1LUAA 3E5RA 5HM8A 2BFAA 1MUUA 3QWIA 4WECA 5TJHA 5A3VA 2X4GA 2XPCA 4HFMA 3AI1A 3AM3A 2JCVA 3S55A 3ADOA 4BNJA 2W2LA 2O3UA 1NP3A 4E21A 2P68A 4IS2A 3E8XA 1GAEO 4GL4A 3D4OA 5LDGA 1G6KA 3ZWPA 2X9NA 3V1TC 2JKVA 2NVWA 4ZRNA 3MEQA 4FFNA 4E2ZA 5KKCA 4PLHA 3S8MA 4DBZA 4XA8A 4R1UA 5I9NA 5A05A 4YVFA 4OMUA 4CUKA 5KTKA 2LDXA 1I32A 4D3SA 2AEMA 3JYPA 4DC1A 3ICPA 3JQCA 1EK5A 3V5NA 1I3KA 1PJTA 1PJBA 4N54A 2ZYAA 1E6EA 3WB9A 3B20A 3JQGA 1ZK3A 5L53A 4FC7A 1X0XA 1SB9A 3OICA 3LLVA 2ZIZA 2IEBA 3TJRA 3ZHYA 1GU7A 3QWBA 3OEYA 1ZBQA 4O59O 2QRLA 3E1KA 3NTRA 1XQ1A 4HY3A 5JLAA 3RKRA 3KHUA 3PWKA 3F1KA 1K2WA 2J5QA 5CG2A 4PG7A 1LX6A 4OKNA 4WUVA 4JGBA 4M87A 3PPIA 3PHHA 4B7UA 4A0SA 3ZU3A 3JCZA 4XB1A 5THKA 2TMGA 4BOYA 4RF3A 5EJ2A 1PTJA 2HK9A 4R5HA 3ZWBA 4TRRA 3UW3A 4YAGA 5B4VA 2CZCA 2DQ4A 3GEGA 2G76A 5JBIA 1I30A 4F6CA 2ZTLA 3LK7A 1FDSA 2E48A 1BWSA 3IJRA 3ZCXA 2W2KA 4A27A 4GPD1 1I33A 3NYWA 1GR0A 4LGVA 2CVZA 1LSOA 1EUZA 2DTXA 3GZNA 2IYPA 1XDWA 2DLDA 3GGOA 1CYDA 3S1LA 1LQTA 2DBVO 1MXHA 3WGYA 4BV9A 5JDIC 3PQFA 3WLFA 3Q11A 4EEXA 2J3JA 4CLOA 2EWMA 1JDJA 3QQPA 5JDCC 1DRUA 4KWIA 3PZRA 1E1KA 1XWFA 1IY8A 4GWKA 3OF2A 3H8VA 1OMOA 2GN8A 5DBFA 2R00C 2O48X 5C7IO 3MJVA 1NFRA 1ZK0A 1ZJZA 4EITA 1P31A 3ZV4A 1MP0A 1NBOA 3VZPA 4EZBA 2X5OA 1PL6A 1PS0A 4QSMA 1A9YA 4CM7A 2HKIA 1LC0A 4YB8A 1JQBA 2A94A 2IZ1A 4AG3A 4J6FA 4CM5A 3I9LA 3ZW9A 3D3WB 1PQPA 5F5LA 2Q2WA 4CV1A 1R4NA 3IP1A 1MGOA 3DMTA 1I2BA 2X5KO 4YJHA 3W6ZA 1YL7A 1HSZA 2P4HX 3WYBA 4NBWA 2Q4BA 4D44A 5B4TA 1U1IA 2W4QA 1GD1O 4PLTA 1MXFA 3I9NA 3S2FA 5IG2A 5FI5A 4WOKA 4TMFA 3TF5A 3JQBC 1J5PA 5JS6A 4PFJA 5C5IA 3AOEA 4BO7A 4OL9A 1U5CA 2CUKA 4GWGA 1F06A 1R4MB 3PWZA 4XJSA 3RFXA 2ZKLA 1CEQA 3EMKA 3OIDA 1BW9B 1P1JA 5DOVA 2I76A 1HLDA 3B1FA 3O8QA 2E82A 3OSUA 1I01A 1NQ5A 3GG2A 4DLLA 3QVXA 4ZQEA 4FOOA 3WS7A 4E31A 2Y0CA 4HBGA 1R16A 3ROMA 1U2GA 4I5EA 5K0ZA 2EKLA 1YQDA 3CIFA 3FPLA 1SAYA 3PHIA 4RZIA 4ZGWA 5IDQA 3EW7A 3W1VA 1NNUA 1OC4A 2EKPA 4HX5A 3ZWNA 4MJLA 1U7HA 3GT0A 3H5AA 5JAMA 1QLHA 4R4JA 5G4KA 3ULKA 2NQ8A 1JU9A 2XXJA 4G81A 2FR0A 4LRSB 4EJ0A 3ZWMA 3BMCA 2PA3A 4ND1A 5EL0A 1XR3A 4H16A 3DZJA 5JMPA 3KXDA 4DMMA 4IJWA 4JCOA 2B83A 2QRJA 3QP9A 2OUIA 4BB5A 3JQAB 1UP6A 1Z73A 5FI3A 1VL8A 2PKQP 1LLQA 1HE3A 3H3JA 4EJMA 4KDEA 3DXFA 4MO2A 3WJAA 4PZDA 3NT5A 4D46A 3C24A 3SEFA 1R37A 1A4UA 4Q3AA 4BNVA 3ZHZA 1E7QA 1HDXA 1S7CA 3ZHBA 3BXXA 4BNFA 4GGPA 2DPGA 2WJPA 3CXRA 3HADA 5ENDA 1W0CA 1PWZA 3GH3A 4AJHA 4YAEA 1WMAA 1M76A 1Z45A 2FHSA 4PG6A 3UCXA 1EE9A 3HN7A 3IC5A 1O89A 3HDHA 4R69A 4BUCA 4CQMD 4CLXA 4WLOA 4Z0PA 1NHWA 3ROQA 3HB4X 4KWHA 5JAIA 4FIZA 5CPFA 5H83A 2FPPA 4KZPA 4PZCA 1R6DA 3KO8A 1EUCA 1SOVA 4G65A 2NSDA 4A26A 4B4VA 4DLBA 2WD7B 2D59A 3ANLA 3TL3A 1RPNA 3QY9A 3WYCA 4U0KA 4J0FA 3SJ7A 5BNFA 3EHEA 1QKIA 3IKVA 4LMPA 3VTFA 3RUCA 2WSBA 5C7OO 3I9JA 3OQBA 2JJYA 4JBIA 1YL6A 2Q46A 2PD4A 5JXWA 4YQZA 2PH5A 4HKTA 1B8PA 4BGIA 2C07A 2CY0A 3S2IA 5A06A 2GUGA 2YHIB 2B35A 1HTBA 4BKUA 4D43A 4OHUA 3FD8A 4XGNA 2CMDA 3RUEA 4E2WA 2GRAA 1WW8A 2RBEA 2Y1DA 4K1LA 4CLDA 3INGA 3FWZA 4YQYA 3ZNNA 3BMNA 5DN9A 5DBIA 1KBZA 3Q3CA 3TNLA 4K28A 1B8UA 4CJXA 2CF6A 4FJ2A 1A5ZA 1PJ2A 1DRWA 3ONFA 1GUYA 1C0IA 4PG5A 4DPKA 4WCFA 3JD2A 3KYBA 2ZTMA 5BT9A 4WOJA 4IJUA 1ZXBA 4XYLA 2VYVA 3M2TA 4MPDA 4UVHA 5TIIA 2Y1EA 3QWHA 5U1PA 4RQUA 4GKBA 4F45A 1LA2A 2GF2A 4YT8A 3K30A 3L0DA 3ZWWA 1AE1A 4BS9A 3DMTC 1GQQA 1DFHA 1PGNA 2GCGA 3VVBA 1V3UA 5DCWA 1MC4A 3P2OA 5A9SA 5EESA 3JQ9A 4GQAA 4UUMA 5KVVA 3WMXA 4GX5A 2I6TA 4FR5A 4NFSA 4NR0A 3KRTA 4PRKA 3D0OA 4YT4A 4IIVA 4Y6PA 3U62A 3WBFA 4ROSA 1H94A 1U5AA 4E5MA 1WNTA 2VHYA 1JKJA 1LLUA 4WEOA 5K9ZA 3Q9NA 4YAKA 3ETEA 3DEYX 4AFNA 5CP8A 1QRRA 1VL6A 2QHXA 2ZB7A 3QWAA 4LRTB 4R68A 5TX7A 4WCDA 1HDGO 2AE2A 1RWBA 2NVUB 1Y8RB 2ZB8A 2OOSA 3E18A 4QECA 3OHSX 1XSEA 3BA1A 1GV0A 3GPDG 4B3HA 4BNHA 4BKPA 3E5MA 4CMIB 1I36A 1BVUA 3H9JA 3BZUA 3IIEA 4NJMA 4XYEA 1XHLA 2VNAA 3ZV5A 3DR3A 5HBRA 3SJUA 2V6BA 3FTNA 4W9NA 3WFJA 1EEHA 3R1IA 2GSDA 3I4CA 1QSGA 4BO5A 2JAHA 4YACA 3RJ9A 2BFMA 1LDYA 3L4SO 4Z9XA 3NGLA 3G1UA 4BKQA 3FR7A 3UF0A 2XAAA 4QUKA 2VHVA 4I9HA 1I3LA 4E13A 4EJ6A 4J0EA 3AUUA 2I67A 5FF9A 1XELA 2UUOA 2FP4A 1GQYA 4DPMA 5TSDA 2RH8A 4NFHA 4TQGA 1ENOA 1EVJA 3R3SA 3RJ5A 4IDDA 1GZ4A 4CMCA 4AJNA 3F46A 4YTEA 3GUYA 3LSYA 4RCVA 5GZ3A 2FPGA 1Q0HA 2C82A 5TJ9A 4ITUA 4BO3A 1K0UA 5K6AC 2ZTUA 2DUWA 9LDTA 1DJNA 3SLKA 4EUEA 4ZQHA 5TT0A 1WP4A 5L51A 3A06A 4IDGA 1YB5A 4NI5A 5T57A 2B4TO 4KUEA 2VNSA 3H9UA 1YE3A 4FDAA 4OKIA 2WEKA 3MJ4A 4LK3A 2VRBA 3VZRA 3GDGA 3DONA 4JJIA 3RC9A 2CVQA 4E3ZA 1HDOA 2FR1A 4R5MA 2FSVA 4UVEA 5ICSA 1XU7A 1K6XA 4QFCA 5ILGA 2YV3A 4BVAA 3JQGB 2Q2VA 1RKXA 4BMSA 1BSVA 4IMPA 4CM3A 3WMWA 1XIVA 2B5VA 3BAZA 3H65A 1SMKA 4TKLA 3U9LA 1PJ4A 1D7OA 5JY6A 1Z6ZA 2Y66A 3DWFA 1JLLA 5TC4A 1FF9A 3WLEA 1A71A 3OJOA 4CMHA 2GO1A 1VJ0A 3PHGA 5CEJA 4P38A 3KUXA 4CMAA 5L95A 2YDXA 1B2LA 3L6OO 5A5EA 4B4WA 4WLVA 1KC1A 1O6ZA 2QG4A 3ZV6A 4BQRA 4J2HA 4ZA2A 3RUIA 2EEZA 3PGJA 4MVJM 4JIGA 4E5PA 2AXQA 1LDMA 1I2ZA 2W2KB 3ITKA 4QX6A 1PWXA 1KVQA 4CM6A 5TF4A 3WJ7A 2ZK7A 1UP4A 4B3JA 3OIFA 4CR7A 3GZNB 4OO3A 2PLAA 1V35A 1N5DA 1OC2A 1GQ2A 2Y1GA 4XYBA 4XEHA 1DOHA 3QV1A 2C5EA 4MVJG 3RD5A 4YRDA 4CM1A 4CLOB 2BELA 3AFNA 3COSA 2A9FA 5KVCA 3PXXA 1RM0A 5G0WA 1QXSA 1B14A 3ORFA 3NJ8A 2Q99A 4Z0HO 4L76A 3NUGA 4X54A 3Q6IA 1TEHA 1N92A 2UDPA 5IN5A 1EVIA 4PRLA 3OH8A 4YRBA 1YBVA 2W98A 3ANNA 4FFMA 1IYZA 2FMUA 3ZGYA 4O1MA 4PIVA 4QO8A 3ZWXA 5ADHA 1B3RA 1NFFA 3GUCA 3L07A 4CM9D 3JYOA 4W7IA 2OXIA 3WTCA 2OMEA 2P5YA 1SBYA 3SLGA 2ZQZA 2FY8A 3H4VA 3GPIA 5EQDA 4KUHA 4CV0A 1R4NB 1OAAA 1E7MA 4TRMA 2V7PA 4YJHB 3KBOA 1LJ8A 4XKJA 4YXFA 4FFRA 1PS8A 3T7CA 1SC6A 4XX0A 4ZQFA 2I9PA 3EC7A 2EHDA 3RAJA 1LLDA 4YPOA 2O2YA 1Y5MA 2NU9A 4ND4A 4YRAA 3BHIA 1GEGA 3DBVO 1MB4A 4WPGA 2AEFA 4MOWA 4RVSA 4A5OA 5FWNA 5CHEA 5EN4A 3OQ6A 5EINA 5A3JA 1HT0A 1ZXLA 3IOYA 1ZSVA 4AJOA 1HETA 3DC2A 3JQEA 2IXAA 5COBA 3EVNA 4NNJA 1K6JA 1KEWA 2B4RO 3AUSA 4NFYA 3O8QB 4BGVA 4D45A 1ZH8A 2AHRA 2HMWA 1BDBA 4OOFA 4UVIA 5CEEA 1F12A 2EP7A 3UKOA 3ZNQA 2Q1TA 2DT5A 4N18A 5KJCA 3MWEB 2VZ9A 5L40A 3H2SA 1ISHA 1EE2A 2YJZA 1TT5A 3EZYA 1CERA 3NJ4A 2NM0A 1BDMA 4ID9A 5CDGA 1O8CA 5HS4A 1CRWG 2BGKA 3H6KA 5T8KC 3PIIA 1ULUA 4HNGA 3KB6A 3O26A 5G4KB 2DUUA 2I99A 3WBBA 1CETA 2Q49A 4R9RA 4UULA 1ZVMA 1UXHA 1VE9A 5JPIA 3QRWA 1JWBB 2PR2A 2VT2A 3BMCB 1RYDA 3TPCA 2A4KA 2BFOA 1YDWA 4GLOA 1I10A 5KWEA 3CINA 2HRBA 1WZIA 2NACA 3TOZA 4TZKA 1Z82A 3AW9A 3PLNA 3V2GA 4O63O 1ONNA 1A72A 1K89A 3RU9A 4J7CA 5TQVA 4LN1A 4M86A 2LDBA 4L4RA 4DIBA 1WAMA 3ENNA 3K31A 4NBUA 1LRKA 2VRCD 1RM4A 2VHWA 3OJEA 3E9MA 3WNVA 4DYDA 4R41A 4XR9A 5B12A 1CQJA 3FCOA 1X1TA 1HLPA 4II3A 1QYVA 3WFIA 1QMGA 1NM5A 1H2BA 1HWYA 4D3DA 1B15A 3U4DA 1ZO8A 4TWRA 1NHGA 3G3EA 4B4UA 3QSGA 1T2DA 4BNNA 4FFPA 4RLHA 3H3FA 4I5FA 1E3WA 1X1EA 1GUFA 1C3VA 5G0VA 1V0JA 3M1AA 4MIOA 3SBOA 1KEPA 1PSDA 1VRWA 4B7CA 3W8FA 2X0RA 1LSUA 2HQ1A 2FRDA 3TZQA 1XQ6A 3MJSA 2WD8A 3GEMA 4LSWA 2XXBA 1WPQA 3TSCA 1U3UA 3AY6A 4FN4A 3ZI0A 4XR4A 3PK0A 1M67A 3TQHA 2PV7A 4BKOA 1X0VA 4IS3A 3GFGA 1LDEA 3K2EA 1IZ0A 3VH2A 6LDHA 2J8ZA 2DC1A 3I83A 3IDSA 1IPFA 4JBGA 1NYTA 4D79A 1Y5RA 3B6ZA 3PP8A 4PLVA 2HUNA 2PD3A 1SOWA 1Z75A 3ST7A 3BMNB 4K26A 4ZU3A 1EFLA 1E5QA 2GERA 1I5RA 1WVGA 1T4DA 3PYMA 2CDCA 2P4QA 3FNGA 3H7AA 2GN6A 1HE5A 1DC4A 5AXAA 1GPJA 2VOJA 4DREA 3AOGA 3WGOA 3NV9A 4C7KA 3IS3A 2PFGA 2VZ8A 1IOLA 3JD1A 1P1KA 2GZ2A 3OETA 3KEOA 4Q3EA 4WCFB 2C20A 3IP3A 2B5WA 2O4UX 4U6SA 3CMMA 1U8FO 1DDOA 4HFRA 4J43A 2GDZA 3OA2A 4KTVE 3LU1A 4BNIA 1PJQA 5DP1A 2PZKA 2ZB4A 4BNMA 3DZBA 2ZYDA 1E6WA 4I5GA 4I08A 1ZEJA 2DAPA 1F14A 3UN1A 5A9SB 5LDHA 1DAPA 4FD3A 5BSEA 3QIVA 2YQ5A 2OZPA 1KC3A 4N7RA 4BGEA 4AJ1A 1LU9A 2O4CA 3JQFA 3K8ZA 4W7HA 2V6FA 4CUJA 1NTOA 1Y7TA 1YGYA 5LC1A 4R1NA 4B79A 2H9IA 2X7HA 3DBLA 5A4DA 1MG5A 1HF3A 2NNLD 3FPCA 1VJTA 1MFZA 4IQGA 1IE3A 3WYEA 4AJKA 3FNHA 2OBYA 1NQTA 3LQFA 4RPLA 3VDQA 4XJTA 1FMCA 2JCYA 4A2CA 2ILTA 2NTVA 3LZ6A 2G0TA 2W2LD 4FS3A 1E1LA 1PJLA 4GVLA 5JO9A 4CR6A 1NVTA 4UREA 4D0RA 5A9RA 1M6WA 3AU9A 4ZRMA 5KOIA 4RO0A 1X15A 4J1SA 4IDBA 4A03A 1QP8A 2QYSA 3WQRA 4CMEC 1YQXA 1Y9AA 2BRUA 3GQVA 4YR9A 3RUDA 3PFFA 1J0XO 1ZMTA 4NJMB 4RPGA 4OH1A 1LDNA 4R9SA 4OXNA 2WTBA 3ENKA 3GAFA 3FNFA 4J4HA 1ADCA 4E12A 2Q3EA 3RKUA 4OGWA 3WG9A 4N5NA 5F3RA 3C3XA 2BGLA 3GGPA 4L73A 4BNXA 1P44A 2RAFA 4BQPA 2ZCVA 3PLRA 1YL5A 4XRGA 4NK4A 3AJRA 5J23A 3PRJA 2YZ7A 2HLPA 4PGFA 3ZWOA 4RL6A 1XU9A 1W4ZA 3ROPA 4BGUA 1PL8A 1LRJA 5TT1A 1ZKMA 1ISFA 5TS3A 3I1JA 4BNZA 5AVOA 4J7UA 4J4TA 4DBVO 3RCBA 1ARZA 1GDHA 2R6JA 4PLWA 4RQTA 4YBZA 2PZLA 1BMDA 4Q3BA 2WE7A 4NK5A 2O2SA 2HMSA 3K2BA 1E3SA 1PJ3A 4J1TA 1H93A 2JFFA 4QT0A 4DUPA 1LTHR 5C3MA 5A02A 3GG9A 1XGKA 4MVJD 4BNGA 3SXPA 4Y6SA 4BNWA 2NVBA 5DNAA 3SC6A 2PKRA 4ALLA 2AQIA 5B1YA 4MKXA 3QVWA 1U3TA 3RFVA 4CMKA 1PGPA 4J49A 3RBVA 4CQMA 4E30A 1D3AA 4RPKA 4IXWA 5DDIP 1IULA 4QO7A 5L7YA 1PU2A 3UCEA 3OA0A 2CF5A 3CZMA 3FTPA 3CUKA 3LT1A 4UVDA 2BHLA 3OQ1A 4I1IA 2PD6A 4KDFA 2D5CA 3W4KA 3IQDB 1LXCA 2ZJ0A 5CEFA 1ZK1A 3GY0A 4KMSA 3D1LA 3RC2A 3V2HA 3GLQA 2EW8A 1ZSNA 2VUTA 2D8AA 4OAQA 2X58A 4B3IA 3P2YA 1NAIA 2AEJA 3HNPA 3ZW8A 2AE1A 1MA0A 3CTMA 3HB5X 4EW6A 1Q7BA 4GVXA 4FCCA 1HDRA 4G5HA 3OMLA 1D4FA 1SEPA 1H6DA 1HYGA 2NQTA 3FNEA 1EDZA 3QA9A 4IDEA 4JK3A 4NZ9A 3MOGA 3O03A 3I5MA 2X22A 4GX2A 1JAXA 3E48A 2BI7A 3JD0A 3L9XA 3MTGA 3NX4A 2BGMA 2G1UA 3NDIA 5IZ4A 3GVCA 3DZIA 5JAQA 4F46A 3TL2A 4M49A 2EGGA 1LDGA 1P45A 4GGOA 3UXYA 4OJNA 4BIIA 1GUZA 1IB6A 4TSKA 5AXDA 3VOSA 4MP3A 1VSUA 2EKQA 2OO5A 1OOEA 2AQ8A 3DBHA 2YY7A 3K96A 3PQEA 2Y0EA 1BXKA 3G79A 2AG5A 3FBGA 4DQUA 4D3FA 3JQFC 2X5JO 2X23A 1PJSA 4AJIA 3OIGA 3WR5A 3BMOA 2FOIA 3L6DA 1DBVO 3OP4A 3MCVA 4MVJH 1XLTA 5EPOA 4K6CA 4YDRA 3X2EA 4FBGA 2EW2A 2V6MA 3DDNA 1SCUA 2HK8A 4J3FA 5KJEA 2VUSA 1PR9A 2X0IA 3KLPX 5EIOA 5KVSA 4YJFA 5L45A 2GZ1A 5TNXA 1JKFA 3FSRA 4XQ9A 3PJGA 2Y1CA 5IDXA 1B0AA 4DMLA 4DL9A 2DVMA 3ADPA 3GVIA 5CDUA 1GPDG 3JYQA 3DBRA 1GZ6A 3RU7A 3D3EA 1Y6JA 1ISGA 2FZWA 5KNLA 3M1LA 3FR8A 5MDHA 1N9GA 1FDVA 3GZ4A 4WEQA 2O3QA 2RHCA 4UVGA 3ZN2A 4BNLA 1OZAA 3UHAA 2X0JA 2XF8A 2RCYA 4BNKA 3GNSA 4Z9FA 1SO8A 1NPYA 2HK7A 3A4VA 4Z3DA 1ZJYA 2VWHA 4Y6RA 3U49A 2O23A 2V65A 3B70A 3OEWA 4IQ0A 4RDHA 4BNUA 1X13A 1HEUA 4AL4A 5ENVA 4J1QA 2Y99A 3AK4A 4M89A 2Y05A 3VPFA 2EG9A 4PLGA 2VQ3A 2C2XA 3FF4A 3U4HA 3Q0EA 1GYRA 3E9NA 4GBJA 4BNYA 3JQDA 1Y8QA 5BNTA 4ILKA 4XDYA 2OP1A 1HDCA 4FGWA 5JFOA 5AOVA 1C1XA 2G5CA 1PZGA 3DZKA 5DCYA 1GZ3A 1P3DA 1PZHA 5ITVA 1PEDA 1TT5B 4Y98A 1QG6A 5I7FA 3AOEC 1GY8A 1MV8A 4ND3A 2H5LA 1ADBA 1NAHA 1F8GA 3CE6A 4ALIA 1DHTA 3MZ0A 4IXTA 2X9VA 4DPLA 2WDZA 2BH9A 1H6CA 2QQ5A 1ZK4A 4K6FA 4ONEA 2BLLA 1BXGA 2P9EA
chains in the Genus database with same CATH superfamily
4Q1VA 2EXXA 3L6EA 4LXYA 3TXAA 1Z0ZA 3OT5A 4IVNA 1SQFA 2JL1A 1S6YA 2QN2A 2UVQA 4JA2A 3KM0A 4TTPA 5EJIA 1U2GC 1VKNA 1K8QA 4O4LF 2NWQA 4IRXA 2CNDA 1AK9A 3KJIA 2EFCB 1GFIA 3TMYA 3V1YA 1NU6A 1C14A 1V11B 3E22A 1QFJA 2ATEA 2J0EA 3O7MA 1P2TA 4AIIA 1QF7A 4RFLA 2RHBA 4S2EA 1W94A 3D6AA 1GQRA 3G9ZA 2YVAA 3CT4A 3EDCA 4W5OA 1IBKB 2OPBA 1REQB 4UM5A 1PD1A 2AFIA 1Z8HA 1C7IA 5BN5A 1LNSA 5AHOA 1E5VA 3V8NA 5G0UA 2PUFA 1KAHA 2FOXA 4ARCA 1VM6A 2X9LA 1OX4A 4LE2A 4ND5A 4P80A 1YJCA 2O0LA 1SVSA 4TVKA 2YVQA 3D6MA 4KOEC 1CVLA 3JQPA 1ADGA 1MGPA 4N0MA 3RIHA 1R0ZA 1Y1PA 5GY7A 5AW3A 3R09A 4FFBB 1J6UA 1M34B 3CUSA 1N1GA 3P7MA 2QQGA 1HEIA 2I6UA 3K4HA 4B4OA 1Z63A 1JMKC 2HHLA 2X86A 1RBMA 3DMDA 1KNQA 2AXNA 3QSYA 1P74A 4Q01A 4AAYA 2AUNA 1VFPA 4PXSA 2PGAA 4EG1A 5CCEA 2HZ7A 3RYIB 4G0VA 1OLSA 1NG1A 2C9OA 4IDOA 1XEFA 3PTZA 2ZCJA 3GOHA 1T26A 1E3JA 3R0VA 2VXYA 1QHFA 3UGKA 3UKDA 4C5CA 4ZCRA 3NAGA 1HNXB 2D1FA 2FUCA 2LWIA 5K8VA 5CD1A 1K7FB 5AXBA 2AN3A 3OE5A 3LX4A 2FFHA 3OM1A 5AVUA 1QAQA 2HOQA 3LOQA 1XA0A 4MQFB 4WY2A 5E9WA 1XVIA 1DRVA 3QFCA 1AHNA 1Q3HA 5CYGA 5C7LO 4MYSA 2O8DB 1FPQA 1KOJA 4G1VA 4G97A 1AGRA 1E1QD 2W9XA 4I1YA 5T4FA 3VSDA 4AS2A 3COJA 1MJFA 2E18A 4YEDA 3U61B 3JX9A 2ODNA 2VP0A 4DG8A 1JF8A 1EDOA 1XZCA 2IDMA 4R31A 5LB4A 3T3HA 2C83A 1UWKA 3GW8A 2BISA 3O83A 3L6BA 1G3UA 4L22A 2FN3A 4NNOA 2V45A 2WMNB 1VJCA 2DTDA 3ZLJA 1S1MA 1CUYA 1I14A 1CNEA 1RRFA 2GYVA 4RNDB 4JENA 4I5IA 2D6FA 1AB6A 1PZEA 3CWCA 4GMHA 5BNWA 2V7EA 3FJ1A 5KYXB 4ICIA 3AHDA 1XLVA 1RLUA 3QLVA 5J2UF 2XE4A 3HPQA 4QJ5A 3CLUC 4EEKA 1J23A 3PQ4A 4FK8A 4GZ3A 1WHTA 3COPA 5HUQA 2FJUA 1EUDA 1AD2A 1FXSA 1KEUA 3R4VA 4IGFA 1TKBA 1IG3A 3VBCA 3W3AA 2CJWA 3BJZA 3HU5A 5C35A 2DBQA 4LDAA 1KZ4A 1I7QB 5NLLA 1E59A 3PUZA 3ZHSA 4K0KB 4N5MA 3GRYA 1NR1A 3JWEA 4WKGA 1P80A 4EO7A 3BXHA 3G49A 1X80A 3STUA 2IX3A 2W8ZA 1ISIA 3HHEA 2JJ1A 1OHHD 3MOSA 3W2EA 2XUZA 3UTCA 3DWIA 4XQCA 3TVTA 2KMLA 2OMKA 3AESB 4WCFC 4WRRA 2C9YA 2D54A 1F8UA 1O95D 2HNAA 1ISSA 2G08A 3KQPA 3F0TA 5G0SA 3PI7A 2OA0A 2HW8A 5LQUA 4OQ4A 3ER6A 4EZIA 1UDRA 4DYVA 5DTIA 1Q57A 3I34X 4ZQCB 1DC5A 2Q2OA 2D2FA 3FFTA 3L2OB 1WUKS 1S2LA 4YLEA 2YJGA 3VX3A 1O4WA 3AERA 4DUGD 2W0MA 3BWMA 1G0OA 2A5JA 5IJWA 4IOKA 3B1XA 2KPOA 2VYNA 3FB1A 4Y2JA 2ZI9A 2YVUA 5ES3A 5AVWA 3ZE7A 4JXXA 4G89A 3EE6A 4CKCA 1M2VB 1BGVA 3JQ9C 3Q2KA 1U0SY 1UWLA 1UM9B 4KV7A 2R5NA 5H3HA 1ZOOA 4H3VA 2GNAA 1RJDA 5YASA 4NPAA 1RI5A 1N0UA 3ZY4A 3REQA 4EUFA 4ZC1A 1YS4A 4YJ3A 1RXWA 3V7UA 3KYDA 1P19A 2G88A 2I78A 3LUFA 2H0AA 4IG4A 3PKIA 5E0OA 5AD1A 2AF3C 5B36A 1UAGA 1VE6A 4K9MA 4YP9A 3QYFA 3RGWS 4BCCA 1NXPA 1DAOA 1VG8A 1GKKA 4B0OA 2QRZA 1XJ5A 3BGIA 4PU0A 4NBKA 4X95A 1P1CA 3R7WB 4KAFA 4F0JA 1KI6B 1XQYA 4GLJA 5J1SB 4WZAA 5JALA 3L4JA 4PS1A 3L7OA 2O3RA 3NH9A 5E4TA 3B2QA 4JUIA 3QOWA 4I4NA 5SY6A 4ENVA 1UKVY 1H0SA 4YRFA 3ONWA 5EHNA 1GZVA 5BR8B 1J9GA 2Y77A 3IQZA 1VIYA 4GC9A 4IH1A 3D3NA 4M8SA 3RSFA 3HL4A 3SR0A 2C7VA 3FCUB 4EQ6A 3TZKA 1N77A 1V8DA 2E89A 5AI4A 5F4ZA 5INTA 1QZTA 1U3GA 5FBWB 3TFQA 3WIOA 1K3FA 5TV2A 4L6IA 4YS6A 2IE8A 1A5SB 1D4AA 2BKAA 2EQAA 3BHMA 1SCJA 2NYRA 4NU5A 2IYQA 3B78A 2ES4A 4PBSA 4QPJC 5DI3B 2J9FB 5DTQA 1JEEA 1HKUA 3CBQA 5SV2A 5C4MA 2ZM6B 4J0CA 3VDRA 1U63A 5SICE 4NTZA 3E58A 3I39X 1UXIA 1E5LA 1L1QA 2QZZA 5D51S 2PSHA 1T9ZA 2Z2JA 1TJ3A 2EOAA 5U4QA 5EKDA 1R8SA 3M6FA 1RWKA 3JQAD 4YDHB 2XDAA 3MT7A 4EO9A 3BG5A 1QBGA 2C7OA 2AZXA 2AN4A 5JEDA 1F0PA 1B1AA 1FDOA 1KP3A 1BO6A 2E2WA 3EIQA 3KS9A 4M0CA 2QW1A 4HEHA 5FUXA 3QEBZ 7YASA 1P0CA 4K86A 5IJZA 3U40A 1SY7A 3WDSA 4FDVA 3ECAA 1AXEA 2TS1A 1L7RA 5I51A 1VIMA 4IIYA 3WIDA 2BEVB 1OTHA 4PSKA 3AF4A 5JCXA 4D4HA 1ZJ5A 4LX0A 4R2KA 3STHA 2JRLA 4LRXA 3CRVA 1Z74A 2ZRDA 1WMEA 4F92B 1Q3TA 2HJ9A 2C5GA 5HW0A 4WNAA 4BVJA 4QU5A 4R71A 3AVQA 1QR6A 2PBFA 2BE7A 4TL8A 3ZE8A 1O7JA 3SS8A 5L4LA 1EIWA 4DCPA 4FFOA 1OFGA 4PPYA 4L4ZA 3DMPA 5EGSA 4TL7A 2D06A 1G19A 1NN5A 4K40A 2Q5EA 3AFOA 2HFJA 4PYNA 1RI4A 1Y4DE 5B53A 4YMGA 3IQEA 1VGQA 4UTNA 1IZYA 3KQYA 3H2ZA 3NATA 3RANA 3O9VA 3WQBA 3DE4X 4D81A 3LF1A 3TJMA 4WDRA 5TMBA 4DVJA 5GIPE 3AKEA 3KTAB 1HC7A 3A4MA 3H5IA 3O47A 4YT5A 5LP6C 3RVOA 4YLYA 5BN4A 3DHNA 2ZBGA 1QH9A 1UZMA 2P5SA 4LCEA 3UA4A 2AD1A 2EIXA 4W7SA 1CS0B 1R6AA 3ND6A 4P4UA 3MCTA 3VH4A 1U7PA 3BHNA 3OO1A 1EFCA 1SIOA 1ZPDA 2FPKA 2KJQA 4NIMA 3GCXA 1T1JA 4S3MA 1MH1A 2EGHA 5CT8A 3W8NA 4E5UA 4PR0A 1Y6GA 3KETA 3PFGA 2Q9BA 1V4VA 3BFKA 4M1MA 3OIYA 2QTLA 1OBHA 2BHTA 1JXOA 2NZ8A 2X8WA 2WYIA 4GRIA 2C3MA 4L5JA 4MS1B 4DPLA 4I1VA 1OT5A 2WTAA 4XE5A 4XCVA 3X1DA 2PL5A 3AR8A 2HDHA 4L1KA 5FPPA 4LE1A 2WUEA 4ASUD 4IHJA 2P2GA 2LBPA 3AUKA 4ZP1A 2W4IA 5AOAA 4ZVOA 3KR9A 2FPIA 3UHPA 3WYNA 4HLUA 5DNYB 1NVMB 1SB8A 1GA6A 4RA9B 5BRJA 5BQXA 3KJXA 3HKDA 4LYEA 1AKMA 1SHUX 1XA3A 4D5EA 1H66A 3K1TA 1UM8A 1A8HA 2DJ5A 3WYAA 1T2FA 1TO1E 3QELA 4JUDX 2E5LB 4P0QB 1LLFA 3SAJA 3GLUA 4EPYA 4B7XA 1XVUA 5AW1A 3WLQA 3N8KA 2BF7A 3C39A 3LPDA 3B1JA 2D0OB 5IP5A 1E3EA 3TUZC 4IMRA 1GR1A 3I1YA 3VU8A 1PO7A 4K3VA 3X43A 2NSHA 2I3AA 5H81A 4JX8A 3OX3A 1A9SA 4UHHA 5DN6A 3TRDA 1UAYA 1GHTA 4P81A 1NJGA 1H2HA 2XWSA 4GT1A 4JQYA 2BI8A 1FRVA 2BTQA 3ZKWB 1WBJB 1ZM4A 4GECA 3UANA 4PVCA 4FFVA 5JAUA 3DV0A 2EQBA 1CUBA 1NNI1 2WU8A 3QNWA 1MABA 5LVAA 1ZVKA 2CNBA 3UK6A 2VF5X 1H1TA 3G2JA 1W1UA 5MGNA 2ZUEA 1J5XA 4RDXA 3HACA 2ATXA 1WO8A 3MOIA 4G1MB 4MP6A 2H54A 3QX9A 1DC6A 1G21A 2VL7A 2WU3A 1NT4A 2FX5A 3T7EA 1GRRA 4Q3KA 3IUSA 2JGIA 4FZVA 2JGDA 1PWEA 3E9EA 4HLCA 1WB6A 4RBNA 2MCFA 3KJZA 3JXEA 3PU6A 3F74A 1SM4A 4OX9Y 1KEEB 4IHQA 1QGAA 1JSRA 2AFHE 4ER6A 3G0DA 3KT8A 4N4AA 1E4EA 5E9QA 2ORIA 3THRA 2Q45A 4EEZA 2V98A 2QM8A 4KJZA 4LXIA 3BEOA 2YX1A 4RVNA 2ZJOA 3ZZMA 3ZE2B 3ECCA 4H7KA 2C5AA 5T64A 2ZVJA 2R2GA 2L18A 5F1KA 3AC0A 4U7DA 4M6WB 4Z3KA 1HT1E 1BN6A 1EI9A 1QNLA 2C5LA 2NPIA 4JY7A 1N2GA 1N2SA 1QYWA 1XCBA 3P0EA 1Y8QB 4D4LA 2YC4C 4WLNA 3AILA 4GOKA 4BATA 1EZZA 5L7TA 2GGSA 2HJHA 3H42B 3OUZA 3OD5A 5CIQA 2BZGA 1V1JA 3QU2A 4UFNA 3ZVRA 3DNMA 2XMDA 3L6UA 3ZOZA 2PQ6A 5D00A 1QPZA 1RHMA 2OESA 1T0HB 4GVPA 2PPVA 4BVFA 1FNMA 2VBIA 2IELA 1G3IA 2O07A 4N65A 1N0IA 1YUMA 2N47A 2X8JB 3IMKA 3ZDYB 2G8NA 2ZWPA 3JYLA 5JG7A 2GCPA 2WHQA 4Q7QA 4TSFA 1JXAA 4WQMA 1D2HA 4ZVRA 1EUYA 1B7GO 5FO0A 1IHPA 3U3OA 1HFWA 4IIXA 1NA5A 4IFEA 3HCBA 4HAVA 2R87A 4KMMA 5EUMA 3JVVA 1CY6A 4HZUA 3WGUA 4JEMA 1ZZEA 1Y4ZA 1YO6A 4MS4B 2RGGA 4INOA 4NG4A 3DE6X 4HN9A 2ECKA 5TPZA 2VZ0A 3SOZA 1EQUA 1R12A 2B69A 5EJAA 5FORA 1GOTA 2Y6UA 4HP8A 4JB0A 1WDLA 3B3QA 1QIDA 3HEBA 3KB2A 4IILA 4MVYA 4MYTA 3WK9A 4C76A 4E5SA 3CRNA 5CAEB 1TA4A 3HE3A 2BW0A 4D8TA 4IGKA 4LQDA 1FYDA 2IPOA 5UKDA 2PMWB 2QDKA 2HK6A 3FYUB 1J2RA 1DIGA 2YIJA 2Z5VA 1YVRA 3EMDA 3GVPA 5DI9A 1N36B 4JBWA 1LGYA 1O1YA 3O9MA 3F9IA 2BKVA 4GLFA 1OH5A 1H4QA 1R6UA 2YV1A 2VJYA 3ZVNA 1RRGA 1U04A 2Y8EA 3DVRX 3E5NA 5A62A 1CDOA 1O3YA 4PGAA 3EUFA 4B6RA 2GCIA 1KO7A 1DRJA 1M54A 2LIVA 3WADA 2XB2A 1J07A 1RQLA 1Z0IA 3FCAA 1APBA 6ABPA 2CXPA 2GVZC 2AK3A 3TNFA 1Z07A 2OD2A 1S2GA 5SYNA 2EKBA 5ITWA 5P8WA 1BGXT 1UZNA 4I5DA 1G8MA 1F2TB 1YR1A 1DKOA 1FS6A 3HVHA 3FLAA 3NIDB 1BRTA 2ZJ5A 4BJHB 5KSWB 5CXXA 4LGYA 4U1RA 1A9ZA 1BA2A 2B1IA 2W0SA 3RRFA 1GG5A 2ORYA 2Z5GA 4KN5A 3AIOA 1WSBA 2IYYA 4BMVA 1TE2A 2QQFA 4BO8A 3FRJA 2X1LA 4Q4HB 1UT6A 3G0OA 2QUZA 5JZSA 1IAVA 2O06A 4OREX 1LPAB 4H7HA 4F1KA 2CJXA 5HS6A 1L8AA 4G41A 2C0CA 2AG8A 4J94A 3D4PA 2O54A 4CIDA 1X1DA 3G8DA 5IKOA 3DQPA 2B4AA 1FU8A 4YA6A 3I1IA 5K4AA 3ZE6A 3BOSA 3RIEA 1PX0A 1Z7WA 2CLSA 2YBEA 2FE1A 3EAFA 1M2NA 3MPUA 4GSKA 1BFKA 4QOFA 1SRQA 3W8EA 5AVQA 1EP3B 4HRYA 3PNOA 4P34A 2IYAA 2P27A 4DQXA 3BIXA 1G5PA 1AY0A 4KGXA 2PGLA 3U17A 1Q16A 3AEKA 4JQSA 3QMVA 4B71A 1QV6A 1VA5A 1Y6RA 4G2NA 3DL2A 1YZLA 3K9QO 3VKVA 3UH0A 4FYVA 3NCTA 3PQDA 4BZQA 2GAFA 1R18A 4QPDA 2XDWA 4TS3A 6PFKA 3D4NA 4EVQA 2XB8A 1K8YB 2D0PB 3ZBQA 2WJZB 3QI7A 2AJLI 3EYWA 1QIKA 1FB5A 1X7WA 4RVGA 2OBNA 2Q1SA 1A9PA 1EK0A 5DULA 3ZE0B 1II9A 4KI0A 4YRRA 3ZHTA 4LOLA 3T1YB 3GCWA 2W6OA 3ZI4A 2O7NA 4EYEA 1LY1A 4B6EA 3I01A 1ULAA 3LPNA 5TPWB 1FYVA 2NIPA 3KHTA 4BO9A 2C59A 3ETLA 2BJHA 4AZ0B 4Q3OA 1ADFA 4L5BA 2R1TA 3I6MA 1F0YA 4AICA 4W8HA 1FUUA 4MAFA 4O2RA 4Y3UA 1XKQA 1BCRB 1UC5B 1F5SA 1G8KA 4UCFA 2I2WA 2XVYA 4IYRA 5F64A 3U37A 1DEOA 3G5TA 3AYZB 4MEJA 1PNTA 2I1LA 2OV1A 4HDRB 3QF4B 4OQNA 2LIPA 2NO9A 1VRCA 1J5EB 1ZIOA 2VJPA 3IVMA 5IYZB 3SZ3A 4KRXA 3ZWYA 1N0VC 2QUHA 3P27A 1XDSA 3DFZA 4G3XA 4D4IA 1OH6A 1SWVA 1QORA 1GFZA 1W5TA 5TEWA 5L6LB 1B0UA 2YV5A 2QTGA 3GT3A 2GKSA 3KQSA 4NDAA 4N3BA 2NG1A 1E2UA 3THOA 2DBZA 1EVZA 3TDKA 3NBMA 2QN1A 4C2TA 1VLLA 2PGXA 4FR0A 1KVUA 5IARA 1L4YA 1ZW1A 3IUQA 5FHQA 4BE7B 3AB7A 2J5KA 2QLFA 2PUEA 1YV9A 3NV7A 3OFNA 2W83A 4LDQA 3HXPA 1KK0A 2CHGA 2WWRA 4V0OA 4DA0A 2FSFA 3TZ6A 3W9SA 3ZZ1A 2HIGA 2P65A 3ABIA 3CO5A 1I3OA 3HJHA 1VE1A 1YACA 5IK2D 5DX1A 1ZNYA 2WKSA 4IZHA 5T67A 5A03A 2VI5A 5AESA 1E9RA 4XWOA 2TMKA 5KOHA 3QBVA 4JJ7A 1RJ9A 2HBYA 4L5AA 2WJIA 3VU9A 3QU4A 1TVEA 4KVAA 2R11A 3PXAA 3HKEB 3H8WA 4WFIA 4ZOLA 2ZPAA 4OHZA 1Z5ZA 1E77A 3FWKA 1HZZA 4MDHA 1I7DA 4TM7A 2JANA 5D7NA 1TYCA 2JFHA 3FUWA 4GR9A 3CZPA 3ZU5A 1CJSA 3P0RA 4I9NA 1DIHA 1XYYA 3UMVA 4ZN6A 5CB4F 5LR6A 1YZVA 4TXLA 2VPTA 2FQQA 4CEHB 4DLNA 1YI0A 1FQJA 2HDWA 4L4SA 4B2YA 4E4YA 3MGCA 5CU7A 2W43A 1C29B 4O2BB 1L0BA 1U3CA 3BIJA 1Z35A 2J3KA 1WW3A 2XNJA 5K20A 3CNEA 3AHJA 4DJ5X 4P4LA 2P2NA 4XX1A 2V6GA 5FUMA 4GKAA 3GJRA 4TYQA 4V1CA 4QTZA 3D6TB 1YZ3A 1KGDA 2UYOA 3IHLA 2XNSA 4IJMA 1PZFA 2Q5HA 3OT4A 2OQVA 2VQEB 1AZSC 3OHPA 4NG5A 3WNDA 3IDFA 4O3MA 4RGBA 4D9EA 1BROA 1G1AA 1WB5A 4NCIA 1XQXA 3JD3A 1HNWB 3C41J 3E9QA 2JCXA 4BO0A 1RPZA 1UC9A 3EFBA 3E81A 5EMMA 2EU8A 3HVIA 3O38A 3KDSE 4YRPA 4P7BA 3KVVA 2P9TA 3CH6A 1Z16A 2OENG 4KO2S 4L0DA 5H3CA 4YECA 3SHFA 3HQ4O 1XE3A 2EJBA 2FF7A 4I19A 1KDYA 2QQEA 5FFFA 1RYZA 4HV4A 1LLCA 2GZAA 4UJ5A 4C04A 4CM4B 5EHGA 4ZVUA 2OQIA 5HQ3A 4Q12A 1K27A 1N25A 1UXJA 5ESXA 4IQFA 4N6OA 3TUIC 1GNTA 2IDKA 2IPNA 3ZV3A 5GAJA 3ZHRA 2HLHA 5HF8A 1XKTA 5CIYA 1AO0A 2JGEA 4MA4A 1NP6A 4B4DA 2R4TA 2IJGX 3L4BC 4RY8A 1NUAA 4QUIA 4KQ1A 3KHKA 3H4MA 3OMXA 2HF2A 3KKEA 4XM0A 4FNMA 5ALIA 1NBWB 2XDYA 2GZ3A 2P0EA 4BLQA 1GKUB 3EH2A 3H5RA 1J0DA 5DFAA 4Q9NA 3UH1A 4DYHA 3E9YA 5CFQA 1G8FA 2E3JA 2XZPA 3T34A 5GMOA 3ZY5A 2GMWA 4K46A 4AL4A 3ZCUA 1ZGBA 3BXEA 2ZS9A 2A57A 1F17A 4FYPA 4C0SA 3IJPA 4HGQA 1XZHA 2J33A 2ZAIA 4Y9DA 2VJKA 3LC2O 1ZJ6A 4Q4AA 3V46A 4CZ2A 5K3OA 3K6SA 4K8OA 1GFWA 3RWOA 1ND5A 4FYYA 3V8EA 4LRWA 3M82A 3M6LA 4HO1X 1AHPA 4MDEA 3FFBA 2GD6A 4JOQA 4YV7A 1E89A 5B2FA 5IEJA 1P2UA 1P4SA 3MJEA 3X1ZA 4L74A 1E1QA 1Z7YA 3V8MA 3PGVA 5F5NA 2I7DA 2P2SA 3U4IA 3RVJA 1JVBA 3D7MA 3U5ZB 1NGSA 1U31A 1ZL2A 1ADYA 5FPTA 5I7HA 8LDHA 2H5IA 5A5GA 2M6KA 4B48A 4Z4IA 2GBPA 1QWSA 4TMYA 2FEKA 2J7KA 1VPTA 2GCOA 2JPDA 4X1IB 1R50A 5M2QA 4EYOA 5FV4A 3IIKA 5HJ2A 2O8FA 1NXSA 4TXNA 4UARA 3LT4A 1NVFA 4M55A 3CX8A 3G17A 3MTAA 3OFSA 1A7UA 5E95A 1Q0ZA 1KZ9A 1GNQA 4IFIA 4XQEA 2BZ1A 3R7NA 3VYSB 2VYVD 2CSXA 1TO6A 2FKAA 3DLPX 4GU5A 4NPHA 5HP4A 4LPSA 1DQPA 3DT6A 2ABWA 5J4VA 5IRCD 3H18A 1LPNA 2CCJA 3A6KA 3WAKA 4PLPA 3ID6C 3MSXA 4NULA 3U44B 1Y8ZA 4YAIA 3AQIA 3N2GA 5JYEA 1SNYA 2B0JA 2G80A 2HPVA 2Q4TA 3T4EA 2WIGA 4DCUA 1TM1E 3IIJA 3SIWA 4YRMA 4F84A 1DE0A 1YC5A 3P8ZA 2V4ZA 1AXRA 4TL6A 5CBPA 3AVVA 1I9CA 4FC6A 4ZYWA 3OZDA 2WFLB 4YRJA 1H2RS 2ZE6A 4FSXA 1JSLA 1QE5A 3WLMA 3GAZA 4AJ4A 1F9EA 4IBOA 5J4HA 1OHHA 1C50A 2PYIA 3B7PA 3M9XA 4RD0A 1A9XA 4AZ3B 1CDZA 1EWKA 4FD2A 4KRFA 2XT6A 1EE1A 1TTPB 3I30X 3EZ6A 4PQGA 1O95A 4C78A 1O2DA 1G0NA 2HSZA 2YWHA 1VQ1A 4UU7A 3L0ZA 3L8FA 4NJOA 5K3BA 3EC1A 1QYXA 1CUEA 4MROA 4II2A 3A10A 3IAS6 5B37A 1P9LA 4JLMA 1C7FA 3PCRB 1D6SA 4S2UA 4URFA 3VO2A 3HDGA 4DUGA 2VYCA 2D00A 2KSQA 3OLVA 4OYLA 1XLTC 2PXCA 5BW8A 2G4CA 2OFOA 4OY3A 2FMTA 5JVDA 8OHMA 1JEDA 5EWJB 2J6CA 2VR1A 4FGKA 4JASB 1NLYA 4OHMA 4WESB 3UAZA 1QZ3A 2XX3A 2C95A 4QFBA 3H19A 3MD9A 3SX4A 3O4VA 2FV8A 2Q2QA 5J2UA 3BILA 5BPHA 2YR0A 3EWNA 2AQKA 3NC1C 2VF2A 2EVWX 1QQTA 2H1HA 1DXYA 1VCOA 2HJSA 3CZ4A 4R8VA 1QIEA 3RYFB 4LWOA 3PD1A 5HE9A 3Q7PA 5JSYA 1TK2A 5J43A 1JR3A 1OROA 4V2IA 3RR2A 2GR9A 2VIIA 3DPSA 2NYVA 1ODLA 2LNDA 1H2XA 4MINA 4KBYA 5C5EA 2O14A 2AJBA 4GAEA 3FPJA 1SOAA 5K2MA 3VZBA 1RQPA 1NN0A 4OSEA 4KQXA 3UWMA 3PQ6A 1AQ6A 2FRVA 3NKFA 2NU8A 2OFFA 3S1AB 5EIXA 4RSRA 2QV0A 3SR3A 1DG1G 4W6ZA 2X5NA 3EEYA 2O6HA 1JPNA 4ZEOA 4OHCA 3SJCA 2C97A 3ZGNA 2NUAA 3OPYB 5EYPB 1ENPA 4G84A 1C7EA 4J0DA 1V5EA 4MW7A 4FT4A 4C0XA 1K8XB 4MVJP 5AJHA 5JNSA 1SUEA 4QXPA 3CHYA 4LFBB 1GNLA 4FFWA 3GLTA 5J9FA 3VNUA 3JAWA 2PWZA 5A4FS 1DKMA 1N5JA 4FDUA 4RKFA 3U7EB 1PNRA 4IIUA 2PWPA 3JQAA 1KJJA 1FQKA 2QTMA 2ZRNA 4IQ8A 4X92A 3SNKA 3ZCPA 1P3Y1 2CD7A 4UCWA 3VTKA 1EP9A 1GYPA 1SVWA 2A78A 3I6ZA 5KO2A 5KQRA 1RXYA 2W58A 7ABPA 2N1MA 5BR7A 3Q7SA 1A8PA 2Q1WA 2RK4A 4KO8A 4R1PA 1NBME 3HMQA 5D3MB 4XYMA 5JLJA 1XTRA 5HRAA 2F9MA 2BGIA 1N8NA 3TW8B 3PYLA 2XUIA 4CRWB 4CM8B 5DHRA 3B5EA 2VQFB 4CTMA 2OECA 1FZTA 1X42A 4HSGA 2HD4A 2YY6A 4FMDF 3PDUA 5JWHA 5BVHA 2ARKA 5ES4B 5EWLB 3SMVA 3KZOA 1XD2A 1A77A 3VU1A 4PN7A 3KWFA 3ORHA 4TN5A 5LQAA 4QRIA 2IU4A 3CVYA 2R85A 1UBRS 3HBNA 1WZNA 4OMCA 4R7TA 5TMEA 1KMHB 1ZI6A 3IUNA 4ZAGA 3TCXB 3V7FA 3LCJA 3JD4A 4E4TA 2PUCA 4B6GA 2Q62A 1EB8A 2XE8A 1YQUA 2I29A 2CLKB 1U7TA 2X3YA 1UQTA 5DXAA 2OXTA 3HB0A 4ZARA 4YMHA 1JFVA 3NDJA 2O8EA 3N75A 2GXUA 2PLFA 3WQHA 3VR2D 4OHRA 1KYZA 3U7GA 3DA8A 2P9GA 1Z62A 4D25A 2ZPUA 3SBEA 1C0LA 2GM4A 1K75A 5EY5B 4R7GA 5DNWA 4HAUA 2GN9A 4LZWA 2XA9A 1C9YA 1V5FA 2D0IA 1ISMA 4GXNA 5BN1A 2C9ZA 1PV4A 5FFNA 2NSYA 3QUBA 5K7SA 3MYYA 3VAAA 4NJEA 4E2YA 3JYNA 4CMCA 2MJLA 5AXCA 1H0KA 2AA3A 3TGLA 4ESVA 3O6VA 4OGFA 2P3QA 1SBNE 2OLEA 4H77A 3W5IA 3S1SA 2R96A 1UC8A 3QFFA 1Q0UA 3ILVA 1P0FA 4UUOA 1NE7A 2PZBA 2VRCA 4QBKA 4EK9A 2IPAB 4M0PA 4ASUA 1O58A 3C3CA 4U8HA 5AUNB 3WAGA 4BBAA 4ZOLF 1NXQA 1Y4SA 2Q7XA 3F47A 3Q4GA 4E5YA 1KSJA 2GN4A 2B5OA 3AF6A 1H1LA 1G38A 3TZCA 1JJAA 2C31A 4FQ5A 3SX0A 1S2MA 1UKAA 3HHPA 3RS8A 4JU8A 1ORDA 2EWWA 4OATA 1RAAA 2V0NA 4J9UE 5DK6A 4CWAA 5KSZA 2VWQA 4NHOA 3LX6A 3WJ1A 2QI9F 1JTVA 4TGLA 2YQ4A 1ZMOA 4FHFA 4XGIA 5I9MA 5IBPA 4BASA 4RKYA 1E0DA 5JPDA 1NJ1A 2C3OA 3EZNA 2AOTA 4NZMA 4FLEA 3OJLA 5D3KA 1UBSB 3FOAA 4MUIA 2PZJA 5E0KB 4BMYA 1KIAA 3HJNA 4LGCA 4KIJA 1A8IA 3OM9A 3DZHA 1A82A 1H3NA 1URPA 5CFZA 8AT1A 3IAHA 3LXXA 2QUAA 2HMVA 1NW3A 3NHUA 3P52A 4G8CA 2CB9A 2NV2B 4GOXA 4M9CA 1J56A 2FZGA 1YULA 1YS9A 2JB9A 3AETB 3VDNB 3KQHA 3RAEC 5K4HA 3IBSA 3AONB 2CZGA 3R9XB 1UUFA 1GPWB 4U6QA 1GUDA 1GQOA 4I9GA 4UZSA 3WHLA 3T5AA 5JD4A 1FFSA 1FIUA 2QR3A 2VEDA 3IQIX 5C2JB 3K5HA 3QVSA 4YMWA 1XP5A 1UFQA 1W76A 4GNKA 1KO4A 4QIHA 4E6PA 1DB3A 5CJJA 2W2XA 2AVNA 3A70A 4I1SA 4XOIA 3W9YA 5JV5A 3AF2A 1CIVA 1QAMA 2CDAA 3IT0A 4UKDA 4QNRA 3SYNA 5KNDH 1TK3A 5CT6A 3TR5A 4LRYA 1KDPA 1AKYA 3DHEA 3PFWO 2FXVA 4TQUS 4NZPA 1WCV1 3TEJA 2MINA 4LYHA 3A3NA 1LEHA 4F38A 1GKLA 1HDYA 5AK5A 1S4MA 2WSSD 2VN8A 1U28A 1DPFA 3V1UA 2OC9A 5FP0A 2IYOA 4WFJA 4RGVA 1G5TA 1XG5A 1U5BA 3O90A 4BP9A 2NXCA 4ZYTA 3K70C 3RHSA 4QEZA 4MEBA 5KJFA 1Z6GA 2XLBA 1H8HD 3H1TA 2DHQA 4QXAA 5HGJA 1ZK2A 3E82A 2G77B 4ZHQA 1BKYA 3B51X 4LY3A 3QKUA 2WWGA 5F77A 4GNRA 4D8WA 1LB1B 2XCQA 2X3FA 3KTDA 1GSIA 4F2HA 1NSFA 4NBTA 2C77A 3IAM1 2XJ9A 4KL8S 5FPHA 4QKQA 1HQYE 1R8XA 2AKEA 1N1EA 2J0UB 4A92A 2CXUA 3OJCA 4R81A 3CX7A 4DV2B 3GLFB 3ZXXA 4XIFA 2Z98A 2QYOA 2JGAA 3V8QA 5DP1A 2YWJA 4KQ6A 1CIPA 4JROA 1HUQA 4NH0A 3JWPA 1QHHB 4L9SA 2ZCUA 1JHZA 3DAPA 4MH0R 1SHTX 1UWVA 4X3OA 4BN5A 3G0HA 4KVGA 1IN7A 3LKZA 3HWWA 4F6RB 2ZIAA 5LQDA 1OU0A 4PR3A 3SHVA 3VR3D 4AJEA 3AW8A 3EIEA 3JATB 3F71A 1NMZA 4EPVA 1ODKA 2H8GA 3D8TA 5J5AA 3ZXYA 5HM8A 3T1NA 1A50B 2P62A 3E9RA 2OILA 2BFAA 3DYBA 3KEMA 3QWIA 4FDTA 2QY6A 3CISA 3CNBA 3I2KA 1YE5A 3AI1A 1OKKD 3AM3A 1DBQA 2I0FA 3PBKA 4R40A 2W6CX 2C2KA 3ADOA 4RJIA 2W2LA 5GOTA 1K3UB 3BH6A 4GL4A 3D4OA 3ZWPA 5GADl 4X8HA 4ZAXA 2NVWA 4ZRNA 4EAAA 3BULA 3QYAA 4FFNA 1AMOA 2IHZA 5KKCA 2BFFA 1EJ0A 2G7ZA 2X6RA 4PLHA 4HRXA 1Y6QA 2NUTA 4DBZA 3AF0A 1X2EA 1JDBB 2XD4A 1LPBB 2GFIA 4Z3OA 2YL2A 2YN0A 2Q6IA 2WOOA 4FMCF 4OMUA 3OZEA 5KNCH 1L4EA 4NYJQ 3DL7A 4D3SA 3W77A 1EP1B 3JYPA 4E2FA 4DDMA 1CCWA 1SXJA 4DWJA 3FCSB 4N54A 5KWVA 1VJGA 1OLOA 1BS9A 3AP3A 3ZGXA 1QQBA 1SCBA 2ZTSA 2HBZA 4TX1A 1J8YF 1ZK3A 1KK1A 2N46A 3QFRA 4Y0VA 3L1UA 3WK4A 3TB6A 3THYB 1AUQA 2ZIZA 3QFHA 1PHRA 5E6SB 3TJRA 3ZHYA 3ZS8A 2VDRB 3QWBA 2D2XA 3MT8A 2JLZA 1QHNA 2APJA 3RS0A 4HWOA 4KE6A 4DJDC 1H5NA 4MZDA 4QBTA 1LW6E 5A71A 4YRQA 5JOQA 3OC6A 5CNMA 1QH8A 1N2CE 5EWMB 2J5QA 2XMZA 2GPJA 5HFJA 1CDDA 1LX6A 1C3XA 3A6HA 1DAIA 1M9NA 4OKNA 1PHPA 4M87A 4WUVA 5EHQA 1EFPB 3PHHA 5I4BA 3QMWA 4M7WA 3JWJA 3DD1A 4XB1A 2BFDA 1SOMA 1X3SA 4AW9A 4BKMA 4PY2A 4BUJA 2JKYA 2R62A 2LZ0A 3CR8A 5DLPA 4MR8B 1WKCA 5K0EA 4DR5B 3ZWBA 3UWOA 5AKXA 1L4UA 2EJUA 1AZWA 4NATA 2BHRA 5B4VA 1M5UA 2CZCA 1I51A 1PG0A 3GEGA 1QFSA 3IEUA 4W5TA 4IV0A 5JBIA 2CLLB 2JBWA 1CZUA 4F6CA 4X1KA 2ZTLA 3LK7A 1T5TA 2FZKA 5CDHA 3K0HA 3NTVA 2PBRA 2JIDA 3IJRA 3ZYCA 3UHJA 2W8BA 4F06A 4A27A 3KOWA 4POOA 1I33A 3NYWA 3HCCA 4OQEA 3WZ2A 4BQIA 2UUAB 1R9GA 3R7AA 5JSUA 5ANRB 3SM3A 1PNVA 1V7CA 4JBXA 5IW8A 5I8PA 1M6VB 2DLDA 1ESDA 2R751 2RJNA 1G18A 2GF0A 2OBBA 3F5DA 3IPLA 4G1BA 4PRYA 1QIMA 3GT4A 4PAOA 5U4XA 1X92A 2GCNA 2WAAA 1PUXA 2PKXA 2FDXA 2X2PA 2XDQA 3BB4A 3CLTC 1C9JA 3OCYA 3R0QA 1DBWA 3T5GA 2DFKB 2QUIA 2YOFA 3S68A 4DSAA 5E4JA 5EUQB 5JDCC 4KWIA 2A1TS 3TTWA 1E5TA 4RU1A 4YK7A 1WXHA 4TUYA 1SWWA 5TQJA 3IE1A 4JCCA 2OZVA 1Z37A 3AIMA 5C7IO 3NNNA 3LTNC 2W93A 4HF7A 4WXRA 1J2YA 1NBOA 4YXWA 2C5BA 4AMZA 2FMKA 3RIGA 4EZBA 3MMPA 5JS7A 1PS0A 2QMZA 1ID8A 4XVHA 3TNDA 2Z1DA 3DQZA 3UOWA 4TKVB 1Y82A 3ERCA 1E61A 2WNSA 2ISSD 1AVTA 1LC0A 4YB8A 4ZVTA 5BWBA 2IZ1A 2VNJA 3AKCA 3OQPA 1Y9JA 4AG3A 5JJIA 3I9LA 5KAMA 3SIXA 3VC1A 3ZW9A 4EGJA 3ZIAD 2ZW9A 3MRVA 2ZJBA 3PNYA 2I4RA 4IL5A 4NE2A 4CV1A 1R4NA 1I2DA 3IP1A 4B76A 2NO0A 2XYRA 1I2BA 2X5KO 3W6ZA 4Q48A 4B3SB 4NBWA 5CT9A 4TKUA 1U1IA 3G2QA 3TX2A 2V1XA 4PZ0A 1WB9A 3T35A 4NMMA 3S2FA 2GK4A 3JQBC 3TMKA 1ZH2A 5JS6A 2UXBB 5CFLA 4AIRA 1J0BA 2OAP1 1GRVA 2AI3A 2R79A 4ILEA 4LWQA 4BO7A 3ED5A 4RTMA 2XVZA 1GLGA 2ZUFA 1R4MB 1W5BA 2E4WA 1QS0A 3COYA 1Z4KA 4QUDA 4UC0A 4DEYA 4NEHB 2WJ6A 4X61A 3U48A 2JVKA 1BW9B 4RJKA 2DR2A 1HLDA 2H11A 2JJQA 4P9NA 2AR7A 5FKJA 4JBYA 3A9VA 3IIMA 2VT6A 1NQ5A 1SVIA 2FGJA 3GG2A 3A1WA 4JD5A 3CUWA 3PL5A 5CYFA 4ZYUA 2Q3CA 4UE2A 3X0DA 5K0TA 1IM5A 3LUGA 4E31A 5IK2A 1UFVA 3IPRA 4D4GA 1FYEA 1XUOA 4QUJA 3KPUA 1U2GA 2QRGA 1QRTA 3FPLA 1P2BA 2XE6A 1N6PA 1AG9A 1U8EA 4ZGWA 4H31A 3EW7A 1R00A 2GCEA 3W1VA 5K2OA 1OXKB 1Z2DA 1OC4A 2EKPA 1U7HA 2CE2X 1I4TD 1E6CA 1CRLA 1WZCA 3H5AA 4HWPA 1BEZA 4L16A 4MV3A 3WLLA 1I4LD 5DNUA 5JAMA 5CA0B 4X3PA 4P7FA 3G0BA 4MGKR 4P36A 2IHKA 1LVGA 1KDZA 4LRSB 4EJ0A 4WINA 2WF6A 3ZWMA 1YZQA 4J8PA 4YMSA 1ZITA 4DJTA 5IFKA 4ND1A 2C42A 5EL0A 3T3OA 1JIKA 3FMVA 3DZJA 5JMPA 2YWGA 4NMXB 4E94A 4DMMA 3MNFA 3UMGA 5IJ0B 1Y5IA 2O9JA 3BGDA 2EX1A 2HRCA 2G63A 2B83A 4I4TA 2R8PA 4Z7QB 4BB5A 2CC2A 3HCRA 1Z73A 1VL8A 2GEFA 1PSZA 3IR7A 4EJMA 1J8FA 3H3JA 4OQPA 4Z51A 4YCLA 3P5BA 4D46A 3C24A 4ZVPA 1ULTA 1R37A 2DOKA 3PB3A 4F71A 4CGZA 4AZWA 2LPMA 1HDXA 5K0GA 1S7CA 4B6SA 1C81A 1S9DA 4K2HA 1RKQA 2MSCB 4UQOA 2A88A 2DPGA 3CXRA 1NIPA 5CVEA 4PQEA 1WMAA 1TYEB 1Z45A 1FYXA 1ZHHA 2FHSA 2F3PA 2OAQ1 1EE9A 3R0XA 2VDUE 2NOAA 3HN7A 2WKWA 3HDHA 1YS7A 3IC5A 4R69A 4CLXA 4Z0PA 3MHTA 3LG2A 4KWHA 3E4DA 1FVOA 4LYGA 2J67A 2XKAA 2FPPA 4KZPA 1CUJA 1BN7A 4LJ9A 1R6DA 3P2KA 4IUBS 4J6EA 4UNSA 3O4HA 3RLIA 3SK0A 1B6SA 1KARA 3HA5A 1M1NB 4COOA 3ANLA 1PWHA 1XDDA 5KQSA 3S7TA 4MQBA 5MF6A 1K7CA 4B31A 4WZ6A 3EHEA 1EINA 3IKVA 2OZKA 4LMPA 3U2QA 3E2PA 5JCPA 3LFUA 3SG0A 4I1OA 5ALSA 1G6HA 3QVMA 2PGOA 4PANA 3OQBA 2JJYA