4OKIA

X-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the catalytic mechanism of the DH domain of the Mycobacterium tuberculosis polyketide synthase PpsC and architecture of the beta-carbon processing domains
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Phthiocerol synthesis polyketide synthase type I PpsC
total genus 63
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.41: Beta-ketoacyl-[acyl-carrier-protein] synthase I.
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4okiA00
4WLOA 4DGSA 1ISGA 4YRBA 1U3TA 3U5TA 3QVOA 1O95A 1DC5A 1WPQA 1WLYA 4NNJA 2UYYA 4NFHA 3DMTC 1X14A 2IYOA 1C0KA 5T6BA 5B1YA 1KERA 1P74A 5JCJA 2X7HA 2VHVA 2FR8A 1E7RA 1NWCA 3AFNA 3TFQA 1ONNA 2PZLA 3D3EA 5EINA 3LK7A 1DC3A 2VHYA 3AUUA 2I3AA 1A72A 2OO5A 4H7PA 4QFDA 4XZ3A 1Y8RB 3PDUA 1ZCJA 2HO5A 4BO3A 5EIOA 2AEJA 3BMNA 3OEWA 3WMWA 5U1PA 2IXAA 3WGHA 3C1AA 3DO5A 1GYPA 1OZAA 3BHJA 4JCOA 4RV9A 2EW8A 1BGVA 2P9CA 1V0JA 2XF8A 2NV6A 2VWHA 5CEFA 5JC8A 4CM1A 3H2SA 4MVJE 1VLLA 5G4KA 5BSHA 1DC6A 2EHDA 4M86A 4OO3A 5LDGA 1PGJA 4YT2A 3ETGA 3HQ4O 5ADHA 3KBOA 1YE3A 1J0XO 4N5LA 5KOIA 5DDIP 3QW2A 5EQFA 4NBVA 5CDTA 2I6TA 2YW9A 2Y0CA 4G81A 2BFPA 1ZK0A 4WCFA 3GDOA 4R51A 3PYMA 3RWBA 3K5PA 3OFSA 1HDGO 3CPSA 4Z0PA 1DLIA 4LRTB 1A9ZA 3WBFA 3ENKA 3KYCA 2Z5LA 4JBGA 3EAGA 1BVRA 2C59A 2AEFA 1UP4A 2IDZA 1PZHA 3F4LA 3GGGA 3HB5X 3O8QB 4DPLA 5IAAA 1X13A 1P9LA 5T8KC 1GYRA 3ICCA 4JROA 4N18A 4BO8A 2ZB7A 3ROKA 2OXIA 3DOCA 1WMBA 4IMPA 1RWBA 4IY1A 5JFOA 3NTQA 3RKRA 3EHEA 3FSRA 4GSKA 3MOIA 3CIFA 3GNQA 3WFJA 4AJJA 3AM3A 4IDBA 3VPXA 1N92A 1DIHA 2B4RO 3ZWYA 4CQMD 5G0UA 3RBZA 2GLXA 3FBTA 3T4XA 3AK4A 1JAYA 2NTJA 1I2CA 4UUOA 4E5MA 3JTMA 1RYDA 2AMFA 2W2KB 3NJ4A 1UP6A 1IPFA 2XPCA 3EZLA 4JLWA 4W7HA 3MTGA 1GUYA 2FHSA 4L0QA 5DCYA 3M6IA 3M1LA 5CFZA 2B5VA 4CMJA 5LDHA 3CE6A 4UVIA 1E3LA 2X0JA 5A9RA 4QX6A 3FCOA 4PGFA 1PJQA 3ZH2A 1XU7A 2EP5A 1DIRA 1NFRA 2JJYA 3DL2A 4R16A 3UH1A 2D59A 1Y9EA 2GN8A 3D5TA 2B83A 4CV3A 2OP0A 1R4MA 3F46A 2NACA 2P5UA 1LRJA 2VN8A 1FDVA 3NJ8A 3BMCB 3RASA 3U3XA 3L0DA 5JXWA 2OBYA 2VTDA 4A03A 1H94A 1DFHA 3W4IA 2WYVA 4BNGA 2I99A 2DQ4A 4OKNA 5IZCC 3GFGA 1T2EA 1NWHA 3RKUA 4D46A 2NU7A 5KCZA 1EVYA 3INTA 2FZWA 2O4CA 5JO0A 1KY5A 2V65A 4P4GA 4W6ZA 3AY3A 1V35A 4Y9DA 1ZEMA 1XDWA 2GD1O 4KTVE 5JS6A 1GD1O 2VHXA 2VRBA 2W2KA 2Y67A 3K2EA 4JBIA 2CUKA 1Q2XA 3LLVA 1ZUD1 4NBWA 3ZU5A 3HN2A 4DMLA 2Y1GA 4EJ0A 1YB1A 3ZNPA 1VSVA 2AE1A 3LLSA 5A4DA 3H9UA 4IDAA 2WM3A 3GN1A 2O48X 4QSMA 3FPLA 1GUFA 1UDBA 4DIBA 2JFGA 5HRUA 4UVEA 1LDMA 4YRAA 2FY8A 3CMCO 3ZWWA 4BO0A 3ZV3A 2DVMA 5K6AA 2FSSA 3CUKA 3K73O 4OL9A 4RORA 5TF4A 5IG2A 3OQ6A 2GSDA 3ONDA 3H8VA 1R0SA 4D0SA 4ZRMA 4EUHA 2X8LA 4UAGA 1Z7EA 4CODB 1PGPA 3GNTA 3WGYA 1IHXA 1I30A 1NAIA 4E2ZA 1Q0HA 3VH4A 3UAGA 1ZEJA 4MP3A 4RVFA 3W6UA 4DLAA 4NU5A 2NVUA 1KVQA 3E48A 1HDCA 3L77A 3QRWA 4BNJA 1DOHA 3V1YA 4PLGA 5L9AA 4B3HA 4TROA 3O38A 2ET6A 1NP3A 2FPIA 3LT1A 2VRCD 4O6VA 4FFLA 4HX5A 2J5KA 4IIUA 1YXMA 1K2WA 3VKUA 1ML3A 2EP7A 2ZKLA 1NR1A 3E18A 4CLEA 1IB6A 3PJFA 5KJ6A 2PH3A 3L4BC 4QUKA 2NTVA 1P1FA 3B20A 2I9PA 5F1KA 3OJLA 4FFMA 3KZVA 2PLAA 4NFYA 1A71A 3D64A 4AJ1A 4QQRA 3KTDA 4K1LA 3W4JA 3E6AA 4ND1A 1YB5A 1YGYA 5DCWA 4TKMA 1CERA 4CV0A 4L8VA 1PJLA 3DZKA 1A9YA 3BZUA 3WG9A 1BHSA 3DBRB 4IJWA 1QMGA 1W8DA 3ZHXA 1ISFA 2P9GA 1UXGA 1ZK2A 2ZQZA 3RBVA 1KYQA 3WR5A 2QG4A 1EVZA 2O3RA 1WP4A 2YJZA 3BTVA 1T1RA 4PZDA 3G1UA 3I9OA 3QWAA 4KUEA 3O9ZA 1WAMA 4FFPA 3QA9A 3RFXA 4ESOA 2D5CA 1T1SA 1KOLA 5KKCA 3LSYA 2DPGA 3G0OA 4WCDA 2EGGA 3JQ9A 4IJUA 4EJMA 4RVSA 2P68A 3TPCA 1LDNA 3U4DA 3RCBA 1Y7TA 2V6BA 3L4SO 5ER6A 3ROMA 4TVBA 5TNXA 3ABIA 4LRSB 4BQPA 2H9IA 1ZO8A 4E5PA 4BS9A 3DBLA 4R54A 1TT5B 1JVBA 1OAAA 1E7MA 2IE0A 3JQBC 4XYEA 1ZSNA 4B4UA 3JYOA 4D3SA 4GWGA 1TT5A 2JAHA 9LDBA 1LLDA 4N5NA 2X1HA 1RM3A 2C2XA 3DFUA 2RHRA 1E5QA 1LSOA 2WE8A 4E30A 1QXSA 7ADHA 1DHTA 4N7RA 3LQFA 4XB2A 4AICA 2G5CA 2A4KA 3S2GA 1OOEA 4FBGA 3A06A 4J9UE 3N58A 3FBGA 1ISHA 2B36A 4JQCA 3FTPA 1A4UA 5KJ1A 1FDUA 3MTJA 4NHEA 3JD1A 4IUYA 4OQZA 1XR3A 2JL1A 3V2UA 5KJCA 2IXBA 3GUYA 1GEEA 2O7QA 2Y0DA 4L9RA 2HK8A 3K92A 5CAEA 4RPHA 1K89A 3P2OA 1N2SA 4P38A 5EQDA 2RBEA 5TQVA 4DQVA 1ZXLA 4CMAA 3TL2A 2D4AA 3A28A 4BGVA 4YAKA 4RF2A 4K6FA 1ISJA 2YHIB 5JY6A 5BQFA 4YACA 2NM0A 1Y8QA 1GADO 2AW5A 2P2SA 4LN1A 4KZPA 4XEHA 3PFWO 1MXHA 1O6ZA 3VH1A 2IZZA 1W6UA 1YJ8A 5TSDA 2WTBA 5A3JA 4HADA 1V3TA 4BO4A 4CM5A 5TLSA 1HT0A 1E3JA 4E2YA 3TDKA 4DWVA 4IJKA 3HB4X 2VNSA 5F1PA 1FK8A 5FF9A 3SLKA 2PFGA 4BV9A 5KVSA 3UF0A 1QV7A 1QV6A 3OBBA 3S1LA 4EITA 1GV0A 4LSWA 1EVJA 5I7FA 3Q3CA 2J3JA 3LC1O 1LLCA 2GUGA 2AG5A 2DKNA 4FOOA 5EERA 1HDYA 4B7XA 4IDDA 3BMOB 2CMDA 4CMCA 3COSA 7MDHA 2PZKA 1EUZA 1HETA 1I3LA 1U5CA 4YCAA 3OECA 5H81A 4EW6A 2B35A 4U7WA 1QYXA 1U2GA 3JQ7A 3A9WA 3KUXA 5A02A 3DXFA 3GN2A 4EEZA 5LC1A 5BNFA 5K0ZA 1SAYA 4BNIA 4DLBA 2VCYA 3H4VA 3KV3O 3L9XA 2RAFA 2FPPA 3RC7A 4MINA 4D45A 1E5LA 1E3WA 2EF1A 1Z73A 3PI7A 1BDMA 3JD0A 4YRDA 4ALKA 3OMLA 3QSGA 3U49A 3L6EA 3ZWPA 4FFRA 3DOJA 1ENYA 1LC3A 1NYTA 1P1RA 1TLTA 4HKTA 2QZZA 3AU9A 4WOJA 5C37A 4ZQHA 4XCVA 3UHAA 1E3SA 4ID9A 2BGLA 2D8AA 1GTMA 2YV3A 1G0OA 5L4NA 5A05A 5L51A 3RUFA 4MPDA 5JDCC 3TZKA 2H6EA 2HSDA 1E0DA 3DBHB 5JDCA 5F5LA 1UDAA 1ULUA 2DU8A 1DIBA 2VOJA 5TT0A 4QO8A 4WUVA 3H5RA 3QJ5A 4FFNA 3PQFA 1I24A 3V1UA 1MB4A 3GLQA 5CP8A 2BGKA 3C7CB 1BRMA 3KHUA 1UJMA 2XXJA 2IZ0A 5C7LO 4IZIA 2D5AA 2GN6A 2CF5A 1PJCA 4HNHA 3FHLA 2ZCVA 5A9TA 1BXZA 3GOHA 4YT5A 3WYEA 5KTKA 1KVUA 3ZNOA 1JA9A 2E4AA 2Y1OA 2UVDA 3E9MA 3STHA 3QIVA 3QV1A 3QVXA 4Y6SA 2PK3A 4M49A 4Z0TA 3UGKA 2VNAA 5COBA 4W99A 3CINA 3DAFA 1PWXA 2DBRA 1QG6A 4A26A 3DMYA 3AI2A 1I33A 4O59O 1E1MA 1YKFA 3VTZA 1PS0A 4LVUA 4XA8A 3AOEC 2HKIA 1KS9A 5ILGA 5TIIA 2HUNA 3D1LA 3AWDA 5J23A 3NV9A 5I8ZA 3WNQA 4NJMA 1H2BA 3QVTA 2Q1SA 4YAGA 1E77A 1YWGO 1YH3A 3NAQA 4ZQBA 4XYMA 3WWYA 1QKIA 4RO0A 3LC7O 4BGUA 3OQBA 3QE3A 4DC0A 3AM5A 3SXPA 1DJQA 1DFGA 1YL5A 2EWMA 2WE7A 4GMFA 2H5LA 3ON5A 3ZZNA 3GZNB 1LDEA 4BNLA 2NWQA 4YPOA 4B4VA 2X0RA 3PHLA 2D1YA 3IIEA 3JQ6A 1HYEA 3CEAA 5BSFA 5G4KB 4O63O 3MCVA 1KVRA 1VRWA 4J3FA 1BG6A 2BFMA 2VYVA 3R1IA 3OA0A 9LDTA 4FIZA 5JYEA 1ENZA 1MA0A 1DJNA 4I5DA 1XIVA 5A9SA 1N9GA 4GI2A 2ZB4A 2W2LD 3BTUA 3O26A 1AE1A 2PR2A 3OETA 1Y9AA 2X86A 4KP7A 4MIOA 1AUPA 3S2IA 4J1QA 1Y8RA 2IODA 3FI9A 2C54A 1B8PA 2J5RA 1EBUA 4XYGA 4CM3A 2E6UX 2I65A 4RLHA 2BI7A 1DHRA 5C3MA 1TA4A 1E7YA 2HAEA 4LW8A 1MP0A 1GEGA 1T4DA 2YV1A 1J6UA 3QP9A 4H15A 2D2IA 5IZ4A 1RYEA 3K9QO 1GCUA 1PR3A 1NPYA 4J91A 4XR9A 3DAPA 1M6WA 2GCGA 4ILKA 2X23A 1QLHA 1S7CA 1DAPA 2GN9A 4L73A 1F06A 1KY4A 3O03A 1ONPA 3SEFA 3NYWA 1XU9A 2CY0A 4ZD6A 4XQCA 4R5MA 4L4RA 5ENVA 4R9RA 2ZYDA 4YAJA 2BFOA 1ZVMA 1DSSG 1VSUA 2C7GA 1F0YA 3NTOA 4WCFC 4AL4A 4ZQFA 4E4YA 1PGNA 2DM6A 5GZ1A 4BNVA 3PIIA 4MVJI 5AXBA 2BD0A 2PH5A 3FTNA 3GC6A 5DOZA 4EBFA 1Y81A 5MGBA 4B8WA 2HMUA 3EVNA 3B6ZA 1UDCA 4NJOA 1AHHA 1LDYA 3WGQA 1MFPA 4RDHA 3H3FA 2YY7A 3GVIA 3PRJA 4UEJA 4J7XA 3KXDA 4IQ8A 3RJ5A 3VH3A 3Q2IA 2X4GA 4J9VA 3LT0A 3Q11A 3WQRA 4IXWA 4MKZA 4YJDA 4BNYA 4DQXA 2Z1MA 3WICA 4YTEA 3EUWA 1KEPA 1O9BA 4ROSA 1HWYA 3INRA 4RVUA 3TL3A 4TRJA 3DDNA 4B3IA 4TRRA 5A9SB 4PLPA 4QXMA 1HRDA 5BR7A 1TXGA 2JCVA 2HLPA 2GO1A 8LDHA 4M54A 4JNKA 5IFLA 4CQMB 1YO6A 3HWRA 2NTNA 1A7AA 4PZCA 4X54A 2VZ9A 1U3VA 4WOKA 1BMDA 1TB4A 1VPDA 2POQX 2QYSA 3BYZA 3IC5A 4I9UA 1VKOA 4J7CA 4XDZA 3SC4A 1PQPA 5CDGA 5JE8A 3C7AA 1Y8QB 3LVFO 4YVFA 4QTZA 5TRTA 1U4SA 3ASVA 1WWKA 2FPGA 4I9HA 4AJPA 4MVJM 3ZW9A 1D1SA 3HG7A 3RBXA 1Y1PA 3WGGA 4BQRA 5I8WA 4IM7A 4N5MA 4QFCA 3JQGA 4XX0A 1VC2A 4J49A 1EK6A 2WEKA 4MIEA 3GGPA 2QRKA 4CMGA 1Z74A 3Q6IA 2YUTA 5A5EA 2DLDA 4ITUA 2QZ9A 2V6GA 1PR9A 3K2BA 2Y93A 3K6JA 3PVZA 4NK4A 3GT0A 5G4LA 4BOYA 1LSUA 3GF4A 1HDRA 3ZW8A 4ND2A 1R6DA 3PTZA 3OIGA 4NIMA 3F3SA 3C24A 3GPDG 3DONA 3OP4A 5H82A 1ZZEA 4MKXA 5L40A 1YQXA 3TJRA 2NVBA 4NG5A 5JCJD 2CVOA 3RAJA 2J5QA 2NVWA 4CV2A 1R4NA 5HS6A 2AEMA 3CH6A 4CMIA 4NBRA 3FD8A 4CPDA 4G65A 1CQIA 3IQDB 3F1LA 1NFFA 2ZYAA 1C3VA 2ZTLA 2P9EA 4I9NA 1H6DA 1GR0A 3CSDA 4CV1A 1F17A 1P3DA 4DMMA 3W8EA 3DR3A 5JLAA 4J2OA 1JVSA 3SLGA 3VOSA 2C07A 1C1DB 2VTEA 4J4BA 4JIGA 1T2CA 3W8DA 3DB2A 1UH5A 1GU7A 1K3TA 2GNAA 4ALLA 1ADBA 4TZTA 4WECA 4PLZA 2PA3A 4DQUA 3N74A 2G17A 1QYCA 3UICA 2O3QA 1H9AA 4R1SA 1QRRA 2OGUA 2EKLA 4PVDA 5JY1A 4CL3A 2G1UA 2GGSA 4J1NA 2HMTA 3AU8A 4YQZA 3ZHZA 4H3VA 4JJGA 5A03A 4AJNA 2VWPA 3JD4A 3H9QA 1MXFA 1DXYA 4OKIA 2BFAA 2IRWA 2BHLA 2OORA 1EFLA 4FQ8A 2CDCA 1LQTA 3KVOA 3GDGA 2ZK7A 3RFVA 4MVJD 3JSAA 3RC9A 4CJXA 2PV7A 1GCOA 2RHCA 3GHYA 3PFFA 4HWKA 4R3NA 4TVOA 1U5AA 4D0RA 1VJ1A 4XRRA 1LI4A 3L4BA 1KBZA 4RVDA 4JK3A 2VZ8A 4YT8A 5ICSA 4JXKA 3JQCA 2XOXA 4FDAA 2F1KA 3MJTA 4JX8A 4ZU3A 2R00C 1EQUA 1MFZA 4RPLA 4A0SA 3WS7A 1EZ4A 4PLTA 4P8RA 5A06A 3UFXA 4B4OA 2Z1NA 1B15A 3JD3A 1NTOA 3DZHA 3ZWNA 1PGQA 3ENNA 3C1TA 4WNIA 4GX5A 4GX1A 2HMSA 3CTMA 3KEOA 1OC4A 1AGNA 5T64A 1ZSVA 2DBVO 3JD2A 4WE3A 1L1FA 1KVSA 3GQVA 5BNTA 2E82A 2Q1UA 2AQ8A 3FR8A 4B4WA 4PLHA 2QRJA 3K31A 4PLFA 3VVCA 5DN9A 1KEWA 4KQXA 1U3UA 2AG8A 1Z82A 2Y1EA 3INGA 3QWFA 1XWFA 3R3JA 3IL2A 5DCUA 3JQ9C 3KO8A 1YQGA 4E2WA 3AI1A 3IS3A 1ZIDA 3E9NA 4FC7A 4E21A 2PZJA 2ILTA 3SBOA 3OIDA 4XWYA 5KKAA 4RF4A 3I6IA 1UZNA 2OHXA 1T2AA 1VE9A 4JP2A 4BHTA 2QX7A 2PGJA 1VL8A 2JD1A 3C7DB 5H83A 1IULA 2DTEA 4MP6A 2BKAA 3DZGA 4IS2A 4CMKA 5F5NA 4TKLA 1DO8A 4XYBA 3ZDFA 2J8ZA 4FJ2A 1PGOA 3RC1A 1P31A 3JQDA 1LU9A 4NBTA 1XG5A 3U0BA 1E7WA 3DZJA 3ADPA 1VKNA 2CVZA 1G0NA 1KEVA 2X58A 1PSDA 3I9JA 3TN7A 3H5NA 3AY7A 3RC2A 3WXBA 1EEHA 3KYCB 3LT4A 4CUZA 3GK3A 3WQSB 1YOVA 3NT4A 5TC4A 4FFOA 4ZJUA 4G2NA 3VTFA 4IPTA 3Q1LA 4YT4A 5L4LA 2W90A 4DYVA 4F3YA 4DL9A 2AQKA 3N7UA 3RUAA 1UAGA 4ZQGA 1HDXA 2R6JA 2B37A 4NPCA 1I2BA 3TZHA 3ZN2A 3UOGA 1QR6A 4E5KA 5L7YA 2PY6A 2Q1WA 1XHLA 5F1OA 2EIHA 3ASUA 1FJHA 1ZK4A 5TGDA 4GAEA 3TFOA 2A94A 4YJFB 2PGLA 1ZSYA 4MVJA 4L76A 5TJ9A 5HS4A 3F1KA 4YJFA 4JJIA 4WEQA 4UEOA 1LDBA 4FPXA 3ZWMA 1TVEA 1NASA 4YXFA 3GPIA 3HE3A 4GKVA 1MUUA 1N1EA 3NTRA 1R0LA 4CUKA 4FC6A 4E33A 4NQZA 3WDSA 1IUKA 1LQUA 5EJ2A 3ZNQA 5HTOA 3MJEA 2O4UX 3KSDO 3EVTA 5BSGA 5JDIC 2EJWA 3S2FA 3U9LA 1HE3A 1LTHR 1LNQA 5COAA 4BNKA 3GEGA 2I5PO 3DBVO 1EUCA 3KRTA 1JKFA 4D43A 1TI7A 1J4AA 2EKPA 2DT5A 2RH4A 3QVWA 1LXCA 4CM7A 4GGOA 1DIGA 1L7DA 1BWSA 2UUOA 3KYBA 3WSWA 1VI2A 2BF7A 3SJUA 1YBMA 4BMVA 4RF3A 1Z7BA 4PFJA 4Y6PA 1PZGA 1CIVA 3DZBA 1P77A 4Z0HO 3IDSA 1OC2A 3RI3A 4RPJA 4U5QA 2J3HA 2I67A 5G2OA 3VZPA 4D3DA 4BB5A 3JYNA 5DF1A 1Z45A 1LA2A 1R4MB 4JGBA 5FEUA 4AJIA 4BNZA 1NFQA 3ONFA 4IDEA 3AOEA 3H65A 4BIIA 1K6XA 3PDJA 5CDYA 3WLFA 1UZMA 4U0JA 2EXXA 2YHUA 4YAIA 4PCVA 3OJ0A 5TS3A 4OYRA 1ZMTA 1LX6A 2B4TO 3U4HA 1IOLA 1YBAA 3QY9A 3LF2A 5I7VA 3CKYA 3QHAA 4FOSA 3AM4A 2IEBA 5I9MA 3B70A 1LUAA 4D44A 1PQUA 3GVXA 1AN9A 5DZSA 5EESA 3X2FA 3T7EA 4WLEA 3ZNNA 4BB6A 2NUAA 1B16A 3WMXA 1GYQA 3G17A 2BMAA 3RUIA 1M66A 4WLNA 1PS8A 2EEZA 3UVEA 4PG4A 1JKIA 6ADHA 3HUDA 1HXHA 1B7GO 3E82A 4BNWA 4HUJA 2IEDA 2DTDA 1GQ2A 4OQYA 3PWSA 2TMDA 2JFHA 4E31A 2DUUA 4DUPA 3WBBA 1RKXA 3RQSA 5FWNA 1LSJA 1O5IA 1OBFO 1EDZA 2O3UA 2YQ5A 1U1IA 3DC2A 1F8GA 1B8VA 5AQ1A 1BSVA 3OIFA 1Z75A 1IY8A 4E5NA 4DLLA 1YBVA 1U7HA 3VPGA 4CR6A 2WMDA 5AXAA 2ZCUA 5I7EA 1I32A 1SO8A 1C14A 4C4OA 4FGWA 3ST7A 1FXSA 3M1AA 4DBZA 1ZJZA 2X9GA 2P91A 2OBNA 1NHGA 2FR0A 3VH2A 2O3JA 3W6ZA 3H9JA 1Q7BA 2G76A 3JQFC 5ES3A 4OOFA 3TZQA 3OEYA 4R1UA 1K5HA 4Z9XA 4PRKA 1P44A 4DYDA 4TSKA 4CLRA 1GDHA 3U62A 5BSEA 2VWQA 5G0SA 3BMCA 3DZIA 5FFFA 4CLOB 3GR6A 3WTCA 3TZ6A 4NI5A 2HK9A 4Q3CA 4FW8A 1GQQA 1I36A 5TJHA 3ETEA 4IDFA 1IZ0A 2GASA 1DRWA 2BLLA 3P19A 3WYCA 1YJQA 3ITKA 3V1TC 1I5RA 3WIEA 3L6OO 4DPMA 3JYQA 4WLFA 4XQGA 4GX0A 3D5QA 3DOOA 4C7JA 1LSSA 5BT9A 1GQYA 3TNLA 4HV4A 3HDJA 5CDSA 4RJTA 5ICMA 4EUEA 4MDHA 3V5NA 3KSUA 3X2EA 3C1OA 3F5QA 4L4XA 1EMDA 3BMQB 4I5GA 3WTBA 1ADCA 3BMQA 1FDWA 5B4TA 2GPTA 4C7KA 3GG9A 5GY7A 3HDYA 3KOUA 3PGJA 1ZFNA 2IYPA 3HSKA 4R68A 1N7GA 2EKQA 4IJVA 3ZU4A 3CMMA 5CEEA 1KVTA 5F3RA 1A7KA 2JKVA 3DBRA 5CPBA 4W4TA 5U4QA 3DHEA 2W2LA 2YDXA 2AQHA 1V3UA 1ENPA 4XD2A 4CMHA 5JBIA 1LRKA 2VYVD 4S3MA 4HP8A 3HFGA 4CLOA 1HDOA 5AOVA 3P5SA 3LU1A 4CL8A 3PZBA 2W4QA 1PEDA 4R69A 3OF2A 1Q0LA 1F8FA 4YA6A 3TOZA 3I9NA 2BH9A 4R1TA 3OQ1A 4KMSA 1OI7A 4XYLA 5ILOA 4ZICA 1SC6A 1QYDA 1H93A 2YV2A 4OJNA 2VUSA 4AJ4A 1WMAA 4Z9YA 4NH4A 1ORRA 3VKVA 3ROQA 4J4TA 5T57A 3DZFA 3DHNA 1VJ0A 4BNTA 2Q4EA 1UXKA 4YAEA 1KEUA 4TZKA 4PLVA 2GRAA 4KWIA 1E7SA 2BELA 3PP8A 4E5YA 1NVGA 1X1EA 5JW6A 4AJLA 3RUEA 3VPSA 1U8XX 5JAQA 3WGTA 4OAQA 1CF2O 4CM9A 1EBFA 4RQTA 5KJEA 1P1IA 4ALMA 2NQTA 1OMOA 1M67A 3AFMA 4R1NA 1QSGA 2O23A 4Q9NA 4XQ9A 3RU7A 1YRLA 2OFPA 3I3OA 1WZIA 1GUZA 4WEOA 3FNHA 4DC1A 2O3SA 4FSHA 1MC4A 2ZTVA 3ZV5A 1P0CA 1ZMOA 2A35A 5JAZA 3W4KA 4FS3A 4LMPA 5JO9A 1UUFA 4CUJA 3PIDA 4CM8B 5KVQA 1X1TA 3IJRA 4D41A 4BKQA 1SB9A 4WLUA 2BI8A 3QWBA 4PG5A 3FRJA 5B37A 5JNLA 3ZWBA 4EGFA 3I83A 1I01A 4Z9FA 3ZWXA 3KB6A 5TT1A 1P1KA 2HK7A 3OH8A 5HA5A 2XAAA 3KETA 3AUAA 4FJ0A 3W8FA 5G0WA 3ANLA 2YHIA 3RD5A 4BUCA 3KYDA 3D4OA 1HF3A 1XEAA 2GZ3A 2VHWA 5JMPA 2VYND 1I3KA 4D3FA 3EYWA 4EI2A 2JD2A 4MP8A 1QORA 5CHEA 1GAEO 4I1IA 5IZCA 1CRWG 2OP1A 2Y1FA 3F47A 2CFCA 1U4OA 4DXHA 3LZ6A 4BKUA 3GAFA 4I8XA 4WASA 4BGEA 4XR4A 4F6LA 4J6FA 4O0LA 6LDHA 4YJGB 5U9CA 1E3IA 1X0XA 1XCBA 3MJVA 2WJPA 3MOGA 4OXNA 1H0KA 3A14A 4LGVA 4J90A 4LK3A 3GHHA 4YBZA 5JDIA 4WLVA 4OH1A 2PTGA 2Y1CA 3D3WA 5L45A 1CEQA 1JLLA 4BMSA 4Q3DA 1PS9A 4M89A 3NT5A 2O7SA 4QO7A 1O0SA 3C3XA 1R15A 3ZCXA 2HMVA 3MJSA 1JWAB 4A2CA 5IN4A 4NFSA 4ALIA 4E13A 2FR1A 1ZBQA 1B0AA 1NBOA 1AXGA 3H2ZA 3GMSA 2HMWA 4II2A 3ZWOA 2Y68A 5A5FA 1WDLA 1W4ZA 2EV9A 1N9GB 3HZZA 4Y98A 1BTOA 3PYLA 4BV8A 3GG2A 1R37A 3JQAD 5IDWA 3LF1A 1Q7GA 1O8CA 3CXRA 4UREA 2QIOA 1M2WA 4RZHA 5COQA 1W0CA 4CM4B 2W98A 4PIVA 3GZNA 4OHUA 1UXHA 1HEUA 2CDAA 1B3BA 4ND3A 1GFSA 1NQAO 1U28A 4R5HA 5IN5A 3PYXA 4K6CA 4ZN6A 2RCYA 1DDOA 3R3SA 1P1HA 5F21A 5JYDA 3DAGA 4FN4A 2G0TA 4L75A 4N54A 4GX2A 3JCZA 4BNFA 2Q2QA 2ZTMA 1EE2A 4E32A 2EG9A 5A04A 1B26A 1HLPA 1HLDA 1YOVB 5IF3A 2NU8A 2BGMA 4NU6A 2A9FA 3D4PA 3WWZA 1HZZA 1B14A 1LJ8A 1MLDA 3DBHA 1DRVA 2Q49A 1G6KA 1HKUA 5HBRA 3KM0A 1A27A 1K0UA 5L4SA 3NEPX 5KJFA 2PKRA 4L4SA 5HM8A 3UW3A 2EGHA 1VL0A 3NDIA 4GWKA 3GEDA 4YJHB 3ZU3A 4R9SA 1NQ5A 1J5PA 1NR7A 4LMRA 1Q0QA 2JFFA 4YB8A 3QWHA 2NU6A 2VZ0A 3NRCA 5L7TA 1CWUA 4UVHA 1PJ4A 1UZLA 3WB9A 2DFVA 1NAHA 1NQOA 3TWOA 1ID1A 4F45A 1Y5MA 1P45A 2HJSA 2C82A 3F4BA 5T67A 1PQWA 2DBQA 2J3IA 2Y1DA 1B2LA 4CR7A 5L53A 3VPHA 4UULA 3DEYX 4UEKA 5GZ6A 3NGXA 1SBYA 4RL6A 4RF5A 2UV8A 3PGXA 2J3KA 1SZJG 3E1KA 2VHZA 1UR5A 2X9VA 3DHYA 3ANNA 3H3JA 4E0BA 4WPGA 1BVUA 3AI3A 2Q3EA 2GZ1A 1Z6ZA 2R00A 1XELA 2F00A 2V7PA 1GY8A 1RM5A 4WNCA 1ZH8A 3UCFA 1HYHA 3EY4A 3ULKA 1DLJA 3LYLA 3GRPA 3K8ZA 4MKRA 4BNUA 5DP2A 2QHXA 1PIWA 3I6QA 3S55A 2AXQA 3WGOA 4BO5A 1SNYA 3OICA 3B1JA 1E1NA 1EVIA 4GBJA 4IBOA 4WJZA 1PJTA 2GN4A 1K6JA 1MV8A 4ZQEA 5EL0A 3TF5A 3R0IA 4LVCA 1X7HA 2WSBA 5HWSA 3JQ8B 2QYTA 3FPCA 3ADOA 1PJBA 4MVJP 4D7AA 3GUCA 5I9LA 1BXGA 4QEDA 3PQEA 2VRCA 3PXXA 3V2HA 5IJZA 1VL6A 2H63A 1VM6A 3TQHA 2OMEA 3NDJA 4BNHA 3GDFA 5CG2A 3Q2KA 4DRYA 2DBZA 4XB1A 4A27A 4HFJA 5KWEA 1EK5A 5JAIA 4YJHA 4K9DA 3RSHA 3ROPA 2CZCA 3RUDA 4IIVA 3IKVA 4F6CA 3AOGA 4FB5A 1EFKA 1PX0A 3I5MA 4JBHA 3VDRA 5MDHA 1LC0A 5CPFA 4L74A 4S1VA 4FCCA 1E1LA 4TWRA 5KVVA 2FRDA 4JP3A 3L9WA 1T25A 3GY0A 3IP1A 2O2SA 3D4NA 5TX7A 4CMEA 3OA2A 5JMWA 2IZ1A 1PZEA 5I7SA 4OXYA 1ISMA 2AQIA 4O5OA 4HNGA 4YWJA 4BNMA 1Y5RA 5ER9A 2I66A 3RIHA 2FZEA 4KDEA 5K6AC 2GYYA 1R4NB 4GSLA 3KSZO 1N1GA 1TEHA 2EERA 1S6YA 2CSUA 3ZWCA 4RQUA 2Q50A 2H1SA 4D79A 3ETDA 1H6AA 1T2DA 4W82A 3DQPA 1GPDG 3H7AA 3BTSA 1BXKA 1ZJYA 4U8GA 5C5IA 2ZJ0A 3IUPA 4OOEA 1XQ1A 4BNNA 2HU2A 3AUTA 4ZRNA 5GZ3A 2JD0A 2DPHA 3E03A 4GPD1 2B0JA 2PZMA 3I9MA 1ADGA 2AE2A 2P5YA 4K28A 2G82A 3DBLB 1Q7CA 2R2GA 3SVTA 1HE4A 4ZA2A 3T4EA 4I08A 4Z3KA 4HBGA 3PHGA 3I9LA 2GR9A 4XIJA 5IDYA 1O89A 2FSVA 2NVUB 4ALJA 1WVGA 4PVCA 2CF6A 1JTVA 1H9BA 2CNBA 4Q39A 1Y6JA 2A92A 1NVTA 2HRZA 3PPIA 5K9ZA 2NNLD 4CQLB 3TRIA 4FD3A 1C0PA 3GVCA 1PZFA 2Y0EA 4CR8A 3WGIA 3PJEA 4MIYA 3QVSA 2W8ZA 3PHJA 3L07A 1PTJA 2C0CA 3IP3A 4IZHA 2GERA 5DT9A 3U09A 3ZV4A 4OSPA 2ZATA 4NK5A 3WJ7A 3K96A 4EEXA 5THKA 5KVCA 3ZWAA 2NQ8A 1P1JA 4URFA 3TZCA 4J0EA 2WD7A 4RVHA 3HJAA 3UCEA 3UXYA 3OHSX 4WCFB 5L7WA 3P7MA 2VOEA 2VYNA 4W7IA 4AFNA 3UUWA 1HYGA 3EMKA 3OJFA 3WNVA 1M76A 1EQ2A 2Y05A 2YYYA 2EJVA 2ZJ1A 3D0OA 1CQJA 3I4CA 4J4HA 4MVJF 1KIFA 1MGOA 4RVGA 1RPNA 1XSEA 4II3A 2VUUA 1BDBA 5DBFA 4E12A 4ZHSA 4M55A 4DREA 3HNPA 3EGOA 4KOAA 4P4NA 3O8QA 4BVAA 2X0IA 1LLUA 2Q99A 2YQ4A 1D1TA 1I3NA 2CD9A 3DFZA 3I23A 4UUNA 3EC7A 3G49A 3WX0A 1HDZA 4W9NC 2YZ7A 3BMNB 1HZJA 2C20A 3VZRA 1FMCA 1QYVA 1RJWA 3KYDB 1AHIA 1ZK3A 1R12A 3NT2A 3ZV6A 3HDQA 4ND5A 5CEJA 3IAHA 1OFGA 2P4HX 3FWZA 4Z6KA 2FMUA 1EE9A 1MG0A 3F5SA 1A5ZA 1YB4A 4M8SA 5DOVA 4OM8A 4WK6A 2GDZA 2ZQYA 3ORFA 1JAXA 1PJ3A 4YEDA 4GLLA 1YL6A 2V6FA 4AJ2A 1XQ6A 1C1XA 1ZK1A 2C5AA 2DC1A 5AVOA 5B4UA 4HFMA 5JAMA 4XIYA 1AXEA 1C1XB 2C7VA 1E92A 5LCXA 1WNTA 5ITVA 1YS4A 3CZRA 1Q1NA 4CM9D 1JKJA 3BAZA 1DBVO 2OOSA 3H9GA 4QECA 4OMUA 2B5WA 3KEQA 4PLWA 4R3WA 3QLJA 4B79A 2V6MA 2O3TA 3E5MA 2DTXA 3FR7A 5EMHA 3PWKA 2D3TA 4U6SA 3JV7A 2BRUA 3JQEA 3L6DA 5GMOA 4CLXA 1XYGA 2VWGA 3UCXA 1WDMA 3GNSA 2JCXA 4NZ9A 2AHRA 4CLRB 2DUWA 1LEHA 3VAZA 1E3EA 4PRLA 3JQ7B 1CJCA 5JPIA 1FDSA 3EK2A 1K6IA 1YDEA 2OZPA 4Q3AA 4YYZA 4INAA 4HFNA 1GZ3A 2CVQA 3E5RA 4R01A 4U6QA 1ONOA 3PQDA 3GA0A 1IHYA 5EPOA 3FNEA 4I5EA 4IGEA 4XQEA 4EDFA 1C1DA 4P4LA 3RVDA 3EW7A 1DIAA 5IDXA 1YVEI 1PJ2A 3WOHA 2Y99A 1KC3A 3GFBA 3LC2O 1DEHA 1QYWA 3AW9A 3RFTA 1T24A 5THQA 3I9KA 4U0KA 3BHMA 2UUPA 3ZWVA 4R41A 4BKRA 3H9EO 3MWDB 2PNFA 1C0LA 3DTTA 1E7QA 1MX3A 3C85A 4KWHA 1RM0A 1E6UA 3GEMA 1CYDA 1T2FA 4CQLA 4Y67A 4J43A 2FN7A 3UKOA 1IPEA 4QT0A 1U8FO 4DTIA 3VZQA 3PHIA 4XDYA 2O2YA 3U4IA 3AUSA 4PZEA 1E6EA 2ZTUA 3BXXA 3NKLA 5G0TA 2E49A 2PD6A 3GAZA 4A10A 1B3RA 3WLEA 4UUMA 4RZIA 4TRNA 1JWBB 1WDKA 3PEFA 4DBVO 1UXIA 4ZVVA 4Z3DA 1I8TA 1NNUA 2Q4BA 3HHPA 1FDTA 4GLOA 3JQFA 3GVPA 3HFSA 5ENDA 4EJ6A 4GGPA 4CM4A 2ZYGA 4XJTA 5A1TA 1ISIA 2C2YA 3I4FA 3PK0A 1LDGA 4IS3A 2DFDA 4KDFA 3M2PA 1IYZA 3VZSA 2NLOA 1I3MA 4Q3NA 4PN3A 4CLHA 3MWEB 4A73A 4BKOA 1M75A 8ADHA 4PG6A 4RLSA 5DBIA 1X7GA 2HDHA 5KIAA 4BKPA 3WQQA 3AJRA 3BIOA 4FGSA 5IDQA 4DA9A 4A7PA 5DNAA 3NX4A 1KETA 3GRKA 2WYWA 3S8MA 4ALNA 3ONEA 1GV1A 4AJHA 4J0FA 3ZU2A 1M6HA 4P22A 1YDWA 4PG8A 2JHGA 4HXYA 3PZRA 1IL0A 1JW9B 3KLMX 4GMGA 3FWNA 4DIFA 2J6IA 1DB3A 2QW8A 3Q9NA 1HTBA 3RJ9A 3RU9A 3VDQA 2VT2A 4AG3A 1N5DA 1F12A 4CLDA 1I10A 4BO6A 1D3AA 1NX6A 3LDHA 4E3ZA 1DRUA 4IDGA 4CM6A 3HN7A 1NXQA 4BMNA 1EDOA 4FR5A 3EDMA 1NQTA 1E1KA 4YJGA 3JQGB 2LDBA 3B1KA 4JN6B 2C29D 1CETA 3ICPA 1HE5A 1NHWA 2ZB3A 1PL8A 1XKQA 3GH3A 2YFQA 4B8ZA 4Y6RA 4IQ0A 3WSVA 1NVMB 1UP7A 3Q0EA 2Q1TA 2JHFA 5JSFA 1XGKA 1SOWA 1XA0A 5B12A 1GZ6A 2YFHA 1RM4A 4ZGWA 3GVHA 2I76A 4KUHA 4KQWA 3VVBA 3R6DA 1P0FA 4UVDA 3JQ8A 1NPDA 3K30A 4YDRA 4MOWA 3RROA 1DAOA 4Y8VA 1R66A 2O50A 2Q2WA 1PU2A 4LSMA 1I0ZA 1WXDA 4CM8A 5CDUA 1UAYA 3Q9UA 3G79A 4AJKA 4WKGA 5AYVA 4GVLA 2PKQO 4AVYA 3HDHA 2PD4A 5JCXA 2X22A 4XGIA 5I9NA 4UUPA 2X5OA 4J7UA 2Y66A 4NBUA 1HSOA 1U7TA 2Q45A 3GZ4A 2LDXA 4B7CA 1ZKMA 1N7HA 5KNLA 5FYDA 1NM5A 2XXBA 2Q46A 1JDJA 3BHIA 1KC1A 3FNFA 1DPGA 1B8UA 4MVJH 3OM9A 4J2HA 1NPTO 4IXTA 1PL6A 1A4IA 1T4BA 1X0VA 2NADA 5DULA 3OSUA 1QLJA 2FP4A 4HFRA 1H2HA 4LISA 4PG7A 1V8BA 3C8MA 2X9NA 2JAPA 2QQ5A 4PLYA 1DC4A 1TT7A 1ZNQO 2HJRA 2VUTA 1IZ9A 3I1JA 4OSOA 3VHRA 3E8XA 4IQGA 2ZIZA 3RUHA 4JJFA 4J1TA 1H5QA 3G3EA 3ZI0A 3RUCA 4RPGA 1J49A 4NJMB 1F14A 4B3JA 1WZEA 2EW2A 4DIOA 1W73A 2WD7B 3F6YA 4HY3A 4IDCA 1G1AA 2X6TA 2DAPA 1ENOA 3P2YA 2NU9A 1V9LA 3F9IA 2E37A 1D4FA 2B69A 2UDPA 3V2GA 3ITDA 4EYEA 3V8BA 4M1QA 3PJDA 5L3ZA 3H6KA 5T8KA 1GPJA 3TOXA 1U3WA 3FF4A 4E2XA 4EUFA 3JQAA 2ZB8A 4BO9A 5CG1A 4Q3EA 4BNXA 2VT3A 1PL7A 4MJLA 2Z95A 3PHHA 3QQPA 2RH8A 5C7IO 1VJTA 4KTTE 1U2DA 4EZBA 3S2EA 4CMIB 2GZ2A 3IOYA 2I3GA 2HCTA 4NMHA 4XRGA 4YR9A 4GH5A 1FF9A 1PJSA 3O4RA 4OGWA 4XGNA 5G0VA 3W1VA 1SPXA 1O94A 1YQDA 3EZYA 5T5QA 1D7OA 2JCYA 1P33A 1WW8A 4BL5A 4OIMA 1PWZA 2OL4A 4BGIA 3AY6A 2E48A 5EN4A 3WFIA 1BW9B 1C0IA 2X5KO 3MEQA 1LRLA 2FWMX 3SX2A 4AJEA 1SOVA 3NUGA 3VC7A 5B4VA 1SMKA 5A3VA 4GKBA 2WDZA 4CMEC 3DWFA 4FJ1A 4CQMA 3QWIA 1LLQA 4MVJG 2UAGA 4IINA 2NSDA 4ND4A 4R4JA 1R16A 1JN0A 5IXYA 3DMTA 3I52A 4RDIA 1X15A 1L7EA 1ZW1A 1JQBA 3IUSA 1IE3A 3JYPA 3WJAA 1ULSA 3ANMA 4YQYA 4O1MA 1T26A 4E6PA 3KLPX 1EUDA 2B4QA 1QP8A 3SC6A 1DFIA 2PKQP 2OUIA 3CZMA 4OXKA 4KUGA 2WYUA 3JQAB 4D42A 3VPFA 3GMDA 5IXSA 4UVGA 4WGGA 2CDBA 1X7DA 4NR0A 4TMFA 1MC5A 2HQ1A 4IGFA 3A1NA 4CMBA 3FN4A 2AA3A 2YDYA 5JC1A 1LBEA 2HRBA 4J16A 2RIRA 4F46A 1N8KA 4LCJA 5C7OO 5DP1A 1H6BA 3FNGA 3D7LA 1GL3A 1D8AA 3IJPA 2WWRA 2TMGA 3GGOA 1ADFA 3E9QA 4GQAA 4IMRA 1BW9A 1SEVA 1SB8A 3PLRA 1YL7A 4BO7A 3TSCA 3HADA 4AJOA 4DPKA 3IKTA 4Q3BA 2VQ3A 4ONEA 4XKJA 3MJCA 3NGLA 3MJ4A 3ZHYA 1UXJA 3OJEA 3A4VA 3BTOA 3LT2A 2C5EA 3MZ0A 5L95A 1HL3A 3IMFA 3BMOA 1JU9A 3DTYA 1E3WB 2D0IA 5ITWA 4J1SA 1H6CA 2P4QA 1U9JA 3H5AA 4XJSA 4B7UA 2GF2A 4GVXA 4A5OA 4LCEA 2Q2VA 3U4CA 3G1TA 4BO1A 2PGDA 1R0KA 3D3WB 3PLNA 4H16A 2X5JO 5AXCA 1MG5A 1BXGB 4NDNE 3WYBA 2FOIA 3UN1A 3BA1A 3OJOA 1SEPA 2PD3A 4K26A 4RPKA 4GL4A 1YONA 5FI5A 1SCUA 4DVJA 1I2ZA 5AXDA 2X0NA 4TQGA 2WD8A 1HSZA 2SCUA 1ZXBA 3NDRA 4W9NA 1HE2A 5FI3A 3M2TA 3ZGYA 5BNIA 4MO2A 4BO2A 3PJGA 4M87A 3JQBA 1ARZA 1GZ4A 3T7CA 1E6WA 4RCVA 4RGBA 4TRMA 2PWZA 3WIDA 3JYLA 3PWZA 4I5FA 3ZHBA 1V6AA 5DBGA 3B1FA 4PLCA 3WGZA 4XGKA 1CDOA 1XLTA 2QRLA 4G5HA 1V3VA 3SJ7A
chains in the Genus database with same CATH superfamily
4WLOA 4CL0A 1IN1A 4MV0A 3L4JA 1C3XA 4MR7B 3HVHA 2VA9A 2AKYA 1DC5A 1WPQA 2FLVA 3RQIA 5B2FA 1XMOB 4JI7B 2I6UA 1Z5UA 5T6BA 5EWLB 3V4FA 3M6AA 2HWKA 3B51X 4YNBA 5E6UB 4HWTA 4UTRA 3NORA 3QE0A 4HB0A 2Y71A 5JCJA 2VHVA 3EVBA 3PNQA 4TLBA 5J4HA 1Q11A 3KE8A 1KMNA 3KZNA 2PZLA 4I4IA 3IJ5A 4KMOA 3OP1A 3FW1A 2Y27A 3QBDA 4LQ4A 1CZNA 1DG1G 5KTNA 1R88A 2OO5A 4QFDA 3E2PA 4XZ3A 1GPBA 3SYKA 2FI1A 4FE3A 1L5WA 1K1EA 4DV7B 3VJKA 1RWWA 5T7BA 3Q6MA 5C5CA 3LBHA 1G66A 4F6RB 3OEWA 5U1PA 3O84A 2J6CA 2ORYA 5KTMA 4EENA 1VG9B 2FWIA 1XVUA 3MXOA 1S7GA 2I4TA 1ZJ5A 2P9CA 4FFBB 4JWTA 4ZGGA 4EAAA 1GNTA 3ZTYA 5LJIA 2XCRB 2NV6A 3ZDEA 5JC8A 1VCHA 1XF9A 3DAOA 4JLAA 5G4KA 2IKQA 2P62A 1NYRA 4OO3A 1JG4A 5LDGA 2G6BA 4TMKA 1NJSA 5A7GA 2WSMA 1XCPA 5H7XA 3R8FA 1E63A 1YE3A 2GN2A 5HK9A 4HGPA 3WHIA 2GXUA 4XUDA 2ZSUA 1N5MA 2JS7A 2HWWA 2ZWAA 3FLBA 4RM3A 5C4IA 5CDTA 3D8HA 3LDUA 1XCGB 2XW6A 4G81A 2YJ4A 4MUHA 4UNNA 3TR0A 3CZ9A 3KKZA 3BSFA 3MUOA 2V54A 4WCFA 3TINA 5LZ2A 2UYQA 1CB7A 4DUYB 1B0PA 3PYMA 2VEDA 3H83A 1K9VF 1ZOLA 2AD5A 4MAMA 4PBSA 3IDOA 2DKOA 1S2LA 1JG2A 3V8QA 4C0XA 2C99A 3ELDA 1QIMA 4JBGA 5AHRA 2WF7A 1E1QA 4DPLA 2GHIA 3G2IA 3O8QB 1X13A 1P9LA 2APJA 4MR8A 3OBIA 1SR8A 1XKTA 3ND9A 1ID8A 2GPWA 3ROKA 3L2OB 3DOCA 4K6OA 3KTAA 4WZ6A 3CQ9A 3CLTC 1WMBA 3CNEA 3L0SA 3N5CA 1VYUA 3U26A 3SQXA 1G8AA 4Y1EA 4CNQA 2BONA 2I71A 4MQMA 3RKRA 3FSRA 2XTZA 3CIFA 3OIUA 3SYMA 1D4AA 1IJFA 2ZJZA 4UC0A 4V0ME 2H2DA 3NYIA 5JVDB 4P2GA 13PKA 3FBTA 3H75A 3VNUA 1TK9A 1TGVA 1EFAA 4YV1A 3H8SA 3N53A 4K1XA 3EASA 3RK4A 4XPZA 1PEKE 2QY6A 2TMKA 4QPNA 5DRTA 3QLEA 3G6WA 5HIJA 4TL7A 1M6EX 1PZMA 3JATB 1GRQA 1A2OA 1TEXA 2HNAA 4L0QA 2QM0A 2FP4B 3GJ7A 3E4CA 3MAAC 2B5VA 4HL6A 2C88A 5LDHA 3CE6A 4DCCA 5FTWA 1FUEA 2K2QB 3C39A 5EGSA 1VLVA 4FFBA 1XTRA 2FP3A 2ZIGA 4XWAA 5LLSA 3QZUA 1UBLS 1NFRA 3HU2A 4P3XA 3PSAA 3EDQA 5CYOA 1Y9EA 2GN8A 3A3KA 4LYYA 1VJDA 1L9KA 2JIMA 5AKYA 2AOWA 2NSLA 3OLXA 3IEMA 5EI5A 2WOOA 4L78A 3F6SA 1L5OA 3DCJA 3RS2A 2IP4A 4B5KA 1GKYA 2P75A 1MAVA 1U0JA 4LV6A 5K3CA 3L0DA 2H59A 3U3XA 3WL6A 5JXWA 3D4BA 1RYNA 1TM3E 1DJPA 5LD2C 5HZHA 1W5SA 2ZYSA 4JZKA 4MQ6A 2WC1A 3WGLA 1RP7A 2O54A 2RBGA 3ZJ4A 1KPGA 2DQ4A 1REQB 2J9XB 3GLSA 3SIWA 3GIWA 2X8WA 3T0FA 2X8JB 1AQUA 1NV8A 3T3IA 1NWHA 5KYTA 1W59A 1PBNA 2OB1A 3RVRA 4YMIA 4D4JA 2ECKA 2ZWMA 3INTA 5JO0A 1BJRE 3E22A 3EPKA 5DXAA 1C4WA 1RRMA 2Y4OA 3AY3A 1V35A 2JH9A 3IIJA 3LDAA 3NAZA 1VDZA 2FV8A 3UV6A 5D84A 2OCDA 3V7FA 3EVZA 5E8RA 2AFRA 3ODPA 3UTCA 2PA0A 4MO9A 1OZ0A 4URVR 3IV7A 2QL5A 3LLVA 4JQSA 2GVDC 1ZUD1 1J22A 3ZU5A 2R6R1 1N8SA 2Y1GA 4KQJA 5AIBA 4MUMA 1NLYA 3ZNPA 2RGUA 2B99A 2WUDA 1M1YA 1LTQA 3P9XA 3OWHA 3ME5A 3QLUA 2MR6A 1UDBA 2JFGA 3QVGB 3IPLA 3TM4A 1BXRB 2ESRA 4YRAA 5JVDA 3IEVA 2FY8A 3CMCO 4TWJA 3RIGA 3CF4G 3B3FA 4JFRA 4BRSA 5IG2A 5EWMB 2XD4A 3Q87B 4L9WA 1U7OA 4J94A 3RE1A 1P2SA 1JAHA 4YCJA 4C0KA 1NONA 2Z4SA 2X8LA 3Q3EA 3SY8A 1Z7EA 3ZCVA 4EUHA 3KPVA 2A5LA 4YHBA 1GITA 5BW4A 4QXOA 4EGCB 2H9AA 4MS3A 4GQIA 3HA5A 4Q9JA 3L7DA 4MP3A 3ZY4A 1IHUA 4XVUA 3W6UA 3EVDA 4EYSA 1NDHA 2EX1A 4ZCLA 2NVUA 2R751 3F67A 2WM9B 3QRWA 3D8RA 3L1JA 1SKUA 2H08A 4EGJA 3O38A 2ET6A 4FWBA 1R8XA 5K8UA 3K6RA 1C4XA 5ARCA 4HX5A 1DX4A 1DNPA 4GSYA 5DSZA 2EFDB 4MUIA 5FADA 1C1YA 3VYTB 1K2WA 4C7VA 1ML3A 5H1YA 3A6FA 3CRMA 3S68A 1WSWA 2PH3A 3N6XA 4QUKA 5KVAA 1AGXA 1YRYE 1P1FA 1BGWA 2PXHA 5F1KA 4QDOA 4TQUS 3OJLA 2AMVA 3KZVA 4FFMA 4NENA 2XCIA 4NFYA 4QKQA 3WAJA 3M4NA 3W4JA 4DHWA 1RXUA 1KNXA 2BM0A 1H42A 4NHOA 4PW0A 1YGYA 2IP1A 2RAVA 3QXSA 4CV0A 3MVEA 1PJLA 3DZKA 1T5IA 1CKEA 2FXVA 1A9YA 1GO2A 4J03A 3VHQA 2ENUA 4LJ7A 3WLHA 2R4QA 4KDRA 1OXMA 3CC8A 4PSUA 3RBVA 2X1VA 4D3ZA 1RXIA 3R7DA 5GPBA 2EEPA 2QLLA 4QQNA 2GPYA 4R40A 1RWXA 1WP4A 4RBNA 5FOUA 3UPTA 4HAXA 1N2HA 3G1UA 3JVDA 5I47A 2VBIA 3CEPB 2H2AA 3QA9A 5IJ9B 1KOLA 2DPGA 3IDQA 1LBTA 2UZ4A 4N9QA 1BDIA 4EJMA 1DUVG 1R1DA 2CGEA 2JIDA 1OLXA 1TUGA 5BRNA 2Q0SA 1R18A 2OXRA 1U7UA 4RA9A 3LYUA 4YRJA 3QNUA 1UQUA 1LNSA 3Q3IA 5BMVB 4FINA 1RZRA 3RCBA 5KEIA 3MHTA 2CHQA 1SXJB 2COEA 1UOPA 3EARA 3EZ2A 1QHEA 1Q57A 1T5SA 1YQWA 3DBLA 4R54A 3VZBA 2PJZA 3U7IA 2IE0A 2QN3A 3VI3B 3I01M 1ZSNA 4BVLA 1P3Y1 4C4PA 2O5EA 2R4UA 4MULA 4QAJA 4XFJA 1BMFA 5ESWA 4D3SA 3GLIB 4D9GA 3EQ8A 1SXPA 4N5NA 1CBUA 2LXNA 3MSCA 3UJBA 1Q1ZA 4IG4A 2RHRA 1PUJA 2VLBA 3C3MA 2WE8A 4D8WA 2J30A 4U4AA 3IAS6 1XDZA 4XB2A 4W1RA 3V32A 1VPEA 4QULA 3I76A 2Z5VA 2AR7A 4FBGA 5FBLB 4F9TA 1SBQA 1TZBA 2C4UA 5AK5A 3UMRA 2XSZD 3FBGA 3KPYA 3DLIA 4BP9A 3P5BA 1L7MA 4IZOA 1OZFA 1T8UA 3MCWA 4NHEA 1XLTC 2CWDA 1NX9A 3V2UA 1FFEA 1TQDA 3NPAA 4FBMA 3G85A 3GUYA 1AA9A 4P7GA 3PF8A 1I14A 4M76B 2V7GA 2X4IA 4RJIA 4V02A 5FV4A 3M5WA 3K92A 4HH1A 2V6IA 3ZLTA 5CAEA 3KSAC 1K89A 5HSGA 2FZKA 1IZ8A 1O9HA 5AVJA 2BL4A 3TEFA 2RBEA 2Q6IA 4DQVA 1FCJA 2I7TA 3B6MA 3QW4B 3HA3A 2D4AA 3VNVA 4U3JA 3V97A 5IN4A 4FOTA 5FOSA 4RF2A 3LGAA 3X1WA 4K6FA 1TJPB 3IQWA 4ND8B 4JGIA 3S2ZA 2FGJA 1L0BA 2CL7X 3DV0A 4NPHA 4YRFA 1PEYA 2JF0A 1O97D 1SGWA 3UWOA 4D9MA 2I6SA 1Y8QA 2SICE 2P2SA 3C74A 4YGYA 2IS1A 5K8CA 3FGOA 1O9GA 5EZYF 1P6UA 1UFVA 3PFWO 2WYIA 3LCJA 1MXHA 1U3CA 1XF1A 1W6UA 1DDGA 2WF6A 3QH4A 4R7GA 5DNUA 5TLSA 1HT0A 4ECAA 3O4IA 4S2UA 1B0UA 4MRNA 1CG6A 4EECA 5FF9A 2EW1A 2ZSBA 3WLQA 1GPNA 2GAIA 4EJSC 2ZIAA 1K4MA 3VOTA 1X7ZA 2I1LA 2NYVA 4KBGA 1JEEA 1E0JA 4NZOA 3S1LA 3TQIA 4EITA 2IX3A 1O4VA 2Q8NA 1IJKA 4W9MC 2PRJA 2VXOA 3FMPB 3QBEA 5K6RA 2UVQA 4KHPB 4R1QA 5EERA 2BHTA 1HDYA 1ORVA 3KX2A 3MSXA 3BMOB 4RCYA 3SJBA 1ZVVA 3QIAA 4B48A 3J7TA 2WLSA 2FU5C 4EHLA 1YV9A 5G41A 1U7ZA 1I3LA 3KSBC 1PNTA 3PE4A 5CT6A 3LBIA 3CZ4A 1XTBA 4OQXA 1SXJD 5FBVB 4M0EA 2QX4A 4KLCA 4U2GA 5KDLA 3G88A 3KZXA 4A91A 1KS2A 1PYDA 3PEYA 3WWCA 5IVKA 1NLFA 4EWLA 1YAJA 4ZV4A 4EEZA 4TMYA 5LVAA 2RMKA 1SAYA 5HM6A 2IPOA 2VCYA 3TVYA 1X7ZB 1YB6A 1Y5NA 3L9XA 1WB6A 1XPRA 1X7WB 4D45A 4J3JA 5FNVA 1JEYA 1C80A 1BDMA 2COKA 4YRDA 4Q9LA 2FMIA 1WUIS 1IWOA 3OMLA 4GECA 2IXTA 4ERNA 4ENUA 2WUGA 4AP6A 5J43A 2CL0X 2YNMA 3NHZA 2XBMA 3UWPA 1L7QA 1M3SA 4ERXA 5KU1A 3TR5A 3MNFA 4UD6A 3ZWPA 3EFHA 4NYMR 3AU9A 1JLKA 3P96A 4ZQHA 3ZDDA 3T8YA 2NO9A 3UHAA 1E3SA 1I2AA 2BE7A 2ZOSA 4LXXA 4ZDIA 3NGMA 1KIAA 2QRHA 4WACA 2QR2A 3H1TA 5EXDA 5JROA 4ODIA 4G9BA 4MMZB 1SKAA 1QRAA 3F71A 4IIYA 3TW4A 2AMJA 3MUNA 4FT2A 1ULUA 2VOJA 1FNBA 3HCOA 3OAAD 5DLYA 3SQNA 3QJ5A 1ZUNB 1EP3B 4FFNA 2HPVA 1V48A 2LNDA 4QPDA 1BS2A 1SBTA 1THZA 3FHJA 1V1JA 1UJMA 2XXJA 3VYUB 2HIAA 4LF9B 4IZIA 3EH2A 3IPXA 1Z22A 2X9QA 1DOZA 1J25A 2CF5A 4AURA 4HNHA 1YRAA 1CDZA 5KI6A 4NYJR 4AS3A 4IO0A 1PNVA 3TXAA 4EFDA 4ZCTA 4YT5A 4AKSA 2BWJA 1HTWA 1VE5A 2B94A 3LO5A 5KTKA 4FFVA 4K9SA 1KDVA 1BC5A 2LE0A 1JA9A 4X1KA 2E4AA 2Y1OA 2UVDA 3O9VA 2FYTA 2O8BA 1BH2A 4H17A 4JQZA 4Y6SA 1ESMA 4M49A 4UEWA 4C0HA 5LQAA 2ZRNA 2ZVDA 5IPFA 4Z0TA 2XGSA 2YWBA 5GOZA 2EQBA 3CINA 4BGDA 1NATA 3IUBA 1QG6A 2VHUA 1XZGA 1QZ3A 1FP4B 3R20A 2I7XA 5TPZD 1KS9A 4B6EA 3ODGA 2C7OA 5ALPA 1EB9A 2KBEA 4TXHA 5SZKB 4X65B 3G8YA 5AI0A 4B5LA 4NJMA 2JJ1A 3ZDQA 5BV2P 3AETA 5ELLA 2HJHA 2I80A 4KR9A 1YWGO 3NAQA 2FKAA 1FP1D 4ZQBA 3WWYA 1KMCA 3FSGA 4PU0A 5LYJB 4PN7A 4X8HA 1SIBE 2HCJB 3AR8A 3KNZA 4C0LA 4DC0A 1RW4A 3SXPA 1QP4A 2FEOA 3RSLA 2IH2A 1DFGA 1X38A 2ORED 1I1OA 5FKJA 1JE1A 1X7WA 3IJEB 2FFRA 4TKVB 3GZNB 1VLZA 3ZZNA 1E0AA 2J41A 3C1UA 3IAFA 1LDEA 4ZT2A 4B83A 4BNLA 3N39C 2A1UB 4B4VA 4K05A 4TT8A 4DW8A 1HYEA 3MQ2A 5AJXA 5BSFA 3KQWA 4BEVA 1HA3A 1YF3A 3T94A 1BG6A 2VYVA 4E11A 3C15C 9LDTA 3D31A 4ZYTA 1CRQA 1EWYA 1MA0A 4I5DA 1WU7A 1U7PA 1JXOA 4L57A 1ZD8A 2OAGA 3T5PA 5K3OA 1D6JA 2A9JA 2W2LD 2WDPA 4K9LA 3WC4A 3TLKA 2VSFA 3AG6A 1DPFA 4X1YA 2PR2A 4J0HA 3RSSA 1P9RA 3DWIA 4KP7A 4M9UA 1AUPA 3HUEA 4AUMA 5ABPA 2C54A 1B8PA 2J5RA 4R71A 4WBNF 5A5VA 3LX8A 4XYGA 1T1EA 4OFZA 3FZEA 3PCXA 4RQBA 3BC1A 2WVHA 1OQAA 3OOYA 5C3MA 3CF0A 1IAQA 4OH7A 1G42A 3T1NA 1E7YA 2IXEA 2IHNA 4BQQA 1J6UA 2ZZKA 4AQYB 2NZVG 1EK0A 2D2IA 3ISJA 4I55F 4DJTA 1RYEA 3K9QO 1Z18A 3INYA 1V1MB 3WRXC 3WL3A 3LQQA 1NPYA 2OV4A 3KTOA 4J91A 3HDGA 3K8QA 5KNBD 4G26A 2I4LA 1BH6A 4ILKA 4MZXA 1FVXA 1JMKC 4CF4A 1C7ZA 3VPCA 3GUVA 4B84A 4ZT4A 2GEBA 4L6IA 4JI5B 1TIKA 1D2GA 2Q0QA 1S7CA 3Q3JB 4HX2A 3FXAA 1JSRA 4G5XA 2J9ZB 1GNLA 2LRHA 4URUR 3NYWA 1XU9A 3AW8A 3K4PA 4ZD6A 4KNYA 4R5MA 1M5RA 2JPDA 1KSJA 2ZETA 2HLNA 5ENVA 4IDOA 2ZYDA 1NA5A 4R9RA 1TJYA 3TTTA 3FDFA 4YAJA 4JMPA 2VK2A 1MVLA 2C7GA 1IG0A 2REQA 4PWYA 3ZQKA 1NG1A 2O8FB 2F43B 1V8PA 2K5UA 4PPYA 1MDFA 4WCFC 4CYMA 2AKAB 4IIDA 1P9WA 3OQOA 5H16A 4BJ5A 3PIIA 1X1DA 3PDWA 1IHDA 1L5FA 2BD0A 3FTNA 5DOZA 5MGBA 3U17A 3LHDA 4B8WA 4RKWA 1K3FA 1NF2A 2IV2X 4B35A 3EVNA 4QDJA 3B6ZA 3RFFA 4B6FA 3N9IA 1FP2A 3PE6A 1TMYA 2AG1A 4OBWA 4OI2A 5D7BA 3LYHA 4F0JA 2I55A 3WGQA 4BLPA 1J00A 2WMOB 3WK9A 2YY7A 4AS2A 1UOQA 2R48A 4JLOA 3UJ3X 5KMGB 4IQ8A 3EGDB 3RJ5A 4DV1B 3Q2IA 2VFAA 1XK6A 2X4GA 1ICIA 1MJGA 4JELA 4B2LA 3M70A 1OHHD 4IXWA 3UFXB 3VHLB 3O8OA 2Z1MA 3DP9A 4MTCA 3DE5X 1KEPA 1MRNA 4CHGA 1CQXA 1QBKC 2D06A 4I2VA 6REQA 5T4HA 4B3IA 4KBFA 3HJFA 2WQZA 4BC0A 2QQFA 3KVNA 3TXXA 3IURA 2DWPA 1B73A 1Z3IX 2HLPA 2ZUSA 5BN4B 4GM4A 3QELA 4M54A 1ZOOA 4V0LA 5IFLA 4MS1B 4YDSA 3HWRA 4FB4A 4MDEA 4ZC8A 4DAEA 4PZCA 1JJIA 3D6MA 1JIUA 1U3VA 2VZ9A 5CK5A 1BMDA 2HW8A 1VPDA 2POQX 3BYZA 3C3YA 4I9UA 3WK4A 4CIAA 3GUHA 2ZYUX 1VIAA 1PQPA 3H1EA 4KQEA 4YMTA 4JS0A 5JE8A 2MCFA 1TF5A 1BEEA 4US0R 4QTZA 3BQ9A 3V4VB 4L95C 3ITEA 3DEKA 1U4SA 3OZCA 3V80A 4E09A 3RTBA 1YKGA 2V3CC 4BLUA 5BVHB 2XKKA 1T4CB 3ZW9A 2HX1A 2Z2YA 2FPUA 4CEJA 4A2PA 4ZYYA 4EW2A 1Y1PA 3M9WA 4BQRA 1E1YA 4G1MB 2RC5A 3JQGA 1W6RA 4XX0A 4DCOA 1M34A 4EQ6B 1MAHA 4IDPA 4YN3A 1O0BA 2VHQA 1X70A 3Q6IA 2YUTA 4JLVA 5A5EA 2WFMA 1C8KA 2XB2A 4ITUA 1FMLA 4PYOA 3ZTWA 2H1RA 1PR9A 3LGXA 2OHOA 4A6EA 3K6JA 5G4LA 2D13A 1M73E 3UMJA 4N49A 2R6ZA 4L5IA 3ZW8A 4BCCA 3DZDA 4TTAA 2SECE 1AQJA 3KOOA 3OIGA 5BR8B 5C7OO 5TB5A 1YCGA 2HV8A 3E9YA 3FGNA 4KJXA 4OGGA 1G5IA 3GPDG 4ZYWA 1ZJ4A 3UTDA 2C5FA 4RELA 5EPUA 4TM8A 5L40A 3FYUC 2V4ZA 2GFHA 3RVBA 4J0QA 1KAGA 4QATA 1QJ4A 2P6UA 4ARZA 4M37A 3FOZA 4XWTA 2J5QA 4EX6A 5DEIA 2NVWA 2JLCA 3ETCA 1R4NA 4FLEA 5F9FA 2AEMA 4CPDA 1GL7A 1PFWA 4G65A 1T4GA 2IZ6A 3C3AA 3IQDB 3K53A 2ONKA 5CJ2A 3GJ6A 4D5EA 3IP7A 4LHEA 1U3FA 2GCIA 1H6DA 1GR0A 4DLRA 1BAPA 1GLVA 2A9PA 5C34B 3W8EA 3O83A 4AT1A 4DLXA 3DR3A 2JBAB 3MT9A 4RPLA 1ZGCA 4S24A 2A9KA 3VOSA 4D9HA 3JRNA 1YIDA 4GXQA 1ISRA 2HMAA 2VTEA 4J4BA 3GIDA 4NRDA 4NPAA 2BHRA 4IIJA 2PEYA 4YRLA 2A7QA 4LJLA 4KXQA 2LVBA 4CQNA 2OLKA 1CIJA 4LDNA 4D9CA 2W6ID 4CCWA 3NHAA 2VBFA 2P67A 4UJ5A 4IHAA 1EXMA 2O3QA 5KC9A 2OZEA 3OT5A 4YCLA 3FYDA 4ZCQA 3T3OA 1GRNA 2JCGA 2Y8EA 1DJOA 1ZCZA 5FPSA 2NYUA 1QJCA 2BP7B 3OZEA 5LP6F 3D3NA 2OGUA 4LZJA 2WVGA 5AKGA 2AUNA 2FZ5A 2XWQA 1R0XA 1IBCA 2YWXA 3MN1A 3ZHZA 5J58A 2IHUA 5A03A 4LMBA 2DBYA 4AJNA 1KYZA 2PXAA 3WMRA 1DXYA 4MTLA 1YMUA 4MDFA 1JYFA 2BFBB 2K87A 2IRWA 5TVKA 1GTRA 2OORA 4IFBA 4EUKA 1EFLA 4DWWA 4Y18A 1QCYA 4BB9A 2WZCA 1VE1A 2CDCA 3KVOA 4DCSA 4LDAA 3PHBE 2C57A 2ZAYA 1PEAA 2PMWB 1CF4A 3RFVA 2ZRAA 1U0OC 2VEOA 3ESQA 1N5JA 3RC9A 3VOAA 1DC8A 2ES4A 2EF0A 5JQGF 5CITA 2VP0A 3MS2A 4RZSA 3K8OE 3C5EA 1M72A 4JR2A 3V8MA 2J48A 3AR5A 4B1FA 4XRRA 3RYFA 4F60A 6AT1A 1KBZA 4RVDA 3ND6A 4JK3A 4LF7B 2R8BA 1XAGA 2HA2A 3R9XB 1G17A 3UATA 4AY4A 3BIWA 1SCIA 4WXMA 1Q7RA 4UPVA 3MJTA 1RR6A 2XVZA 3LPCA 3VV2A 4F21A 2XKBA 3OMWA 5AESA 5EWJA 3WS7A 3VHXB 1HKHA 4QZVA 5DNYB 1SWVA 3IUQA 1I7DA 1EVLA 2F4NA 3QVVA 1OIVA 2BFBA 4BASA 3NBYC 4EGSA 1K7YA 5A06A 4JJEA 3ZXUB 2Z1NA 5MN4A 1B15A 1XDGA 1AT1A 2FQYA 4GRIA 1PGQA 2YBDA 1J56A 4GX1A 2XVMA 3ETJA 2CJWA 4KEAA 4UQPA 3C6MA 3QX9A 1ZSVA 3QKSB 1L1FA 1RXCA 1KVSA 4A23A 2E82A 3PUYA 1WXHA 4S35A 2Q1UA 2AQ8A 3KJGA 2ZRCA 2A6PA 1RE0A 2JGRA 1QK5A 2QRJA 3WVNA 1G8MA 2IPLA 3VVCA 1E6MA 2H7CA 4KQXA 4YUZA 3ZW7A 5DNDA 1TQ6A 1U3UA 1TJ4A 1U31A 2AG8A 2D2XA 3DV0B 3R3JA 3TDMA 1Z63A 3B38A 3HR4A 5DCUA 3VVLA 4V0MA 4O8ZA 4M1TA 4R8MA 3RGWS 3UG6A 4ZOAA 3ZOZA 1JE0A 1IB0A 1AQYA 1FFXA 2XUQA 2ILTA 1H0HA 3SBOA 3OIDA 4RIGA 3LY8A 1Y48E 2WM2A 3A6JA 2HO4A 4XWYA 4J3NA 2J6HA 3JPYA 4EYGA 1F5SA 3HI6A 2VR1A 3ER9A 2O19A 1YU6A 1DKRA 2QX7A 3UANA 4MROA 5E8JA 2LIPA 2PGJA 2PU5A 3BH0A 2ORVA 3DCYA 1WXXA 2JD1A 4DBLE 1W36B 3ORSA 4MP6A 2WWXA 4R81A 5JAPA 3S29A 1RZ3A 5LZ8A 4CMKA 2WR8A 3EJ6A 1DO8A 4TKLA 1AMOA 3K9GA 1MF7A 1CZUA 1WUTA 4J0GA 4XOIA 1DQPA 1LK7A 3CLHA 3TCXB 2G9NA 3TQQA 1PVVA 3NNNA 4PAOA 3SSMA 2ZIXA 5ILQA 1KJIA 1XAJA 3BRQA 1G0NA 1IVYA 1WQ4A 1XZNA 3ZOKA 4BFTA 3H5NA 4X6LA 3RC2A 1XV5A 2YZKA 2GWHA 1EEHA 2C3PA 2JLBA 4ETIA 3K9BA 1VE6A 3L8YA 1M2JA 1NVKA 3NT4A 3O4FA 1CJMA 1PDVA 4FFOA 4G2NA 1ZQ9A 1I5EA 1D09A 2HYDA 3I5UA 1ZHFA 4IPTA 4EKNB 4YT4A 5AUPB 1L2TA 3ZY5A 1XFDA 3DTVD 4NZYA 3UJAA 4F3YA 3KLNA 3PQCA 1UAGA 2ORWA 3A25A 3E3MA 3L01A 4QUGA 4ZQGA 2B37A 2XKJE 4PRZA 4R84A 5F77A 5EJ6A 3H5LA 3TZHA 3CIOA 3X1KA 2QW0X 4NVRA 1P2UA 1NJFA 3GFRA 1QDEA 3ZN2A 3HM2A 4U9UA 3SDSA 4Q5IA 2Q27A 2Q1WA 2ZDHA 4FYYA 1NT4A 1TIPA 1Y3HA 1ZAKA 4HLNA 1FJHA 5LA6F 1ABBA 3BBPA 3TFOA 3FCSB 5C51B 1KPIA 2A94A 2D0OB 4C1BA 4KCGA 2C8LA 1Y6RA 3VJRA 4L76A 1C50A 5TJ9A 3PQ4A 4YJFA 4CTKA 1V45E 4JIMA 4L28A 2QNIA 3TLZA 1QHIA 1Y33E 1XTUA 2VAMA 2VT6A 4MWEA 1LDBA 4FPXA 4OYYA 3TW6A 5LZ5A 3ZWMA 2QLJA 2YNMC 3HZHA 1TVEA 3VMMA 5IT9A 3GPIA 1JSCA 3N2EA 1T9GS 5ALHA 4GKVA 4MXDA 1N1EA 1QP7A 1MA3A 2C3OA 2D7JA 3IE2A 4NQZA 1C5KA 1RT9A 1CS0A 3VDMA 1KH1A 1W19A 5HTOA 2O4UX 3KSDO 4C87A 2ZSJA 1R8JA 3OOWA 4I81A 5A3QA 5BSGA 5A4KA 5JDIC 4JEHA 3S2FA 5B7QA 3AF2A 3H1AA 4GI3A 2G4CA 1WX1A 4FMBB 5FNZA 4QTYA 3CGWA 4OJQA 4IJMA 1GLGA 1NC3A 2J7KA 3GWGA 3OZRA 5DYIA 2NMVA 3KRTA 4G0WA 1JKFA 2MSEB 2OKCA 4P5EA 3VPAA 4D43A 3BWMA 1GSHA 3S2YA 1VI6A 4D97A 5CVCA 1J4AA 1RQ7A 3OM1A 2UZ0A 4AG6A 4ZDJA 2RH4A 1V1RB 1KSFX 2XZPA 1VRVA 3FFTA 4CM7A 4JL8A 2CLSA 1XD2B 1DAHA 1M1XB 2QM8A 2PJDA 3IA2A 4RMNA 3RF6A 4BMVA 1NW9B 5GV7A 2BCGY 1E6LA 4PFJA 4H4EA 4Y6PA 1CY0A 3STWA 4XDHA 2GEKA 3VU9A 1GNPA 1DMRA 2W4IA 2PLNA 1OC2A 1SHTX 2OVBA 3OQMA 5G1OA 2AYXA 1SA0A 2EIXA 4U5QA 4BKUA 3ACCA 2H48A 2J7PD 3EQ6A 6REQB 4K2HA 5CA0F 5DF1A 2GK7A 1R4MB 3HXPA 1YA6A 2WWIA 1CY6A 2QZSA 3W2HA 3PUZA 1S01A 3JSXA 5JZBA 2ISQA 2EZ4A 2HOQA 2PX2A 1N2CE 3Q0IA 4O08A 2OAQ1 3H65A 4MUJA 5J4LA 3QMWA 3AF6A 1KBOA 5EJAA 2QN1A 2YMPA 3FFWA 5CDYA 1JFRA 1UZMA 1CV2A 3D6HA 1OAOC 3MTQA 1NKSA 4RVNA 4DIUA 1CF9A 4F4UA 5KZMB 1DTWA 4TKUA 1H1TA 1Z4MA 4MRVA 1LX6A 3H05A 4XJVA 4ZAZA 3TAHA 3U4HA 7REQB 3ZQJA 5LWQA 3LF2A 3KLBA 4OP1A 1F8UA 2WIDA 3GJ8A 3CKYA 3G7NA 2B34A 2BCEA 3MCZA 3JWPA 3IGFA 4OV6B 3O7WA 4G85A 1PQUA 3S81A 2Z8ZA 5E6SB 4DE5A 4KE6A 2ZRQA 4MQ5A 3GLFA 1TYAE 4TV8B 2AXEA 4JHXA 4M7PA 2P30A 5MN6A 2WSLA 3G17A 1M9NA 3CEHA 1EGVB 1VCOA 4RTQA 4X1YB 1MQ9A 1JKIA 1B7GO 2F6RA 4BNWA 1Z0IA 4XUGB 2A84A 1D6SA 1MBZA 4UE6A 5DI3A 1G21E 2PL1A 5EUBA 2C61A 4UU1A 2P9YA 4RY9A 5IF9A 1LSJA 3BGVA 3FRIA 1UBGA 1OBFO 1TM7E 2MMGA 4GPEA 3H11B 4IQ4A 4Q66C 1GUBA 2QVCA 1B8VA 3ECCA 4F9GA 3M6VA 1QFYA 3O3MB 4GHWA 5DW3A 4DM4A 1Z2AA 4GUAA 3MRSA 4EG6A 1IY8A 5CT4A 1YBVA 4K8RB 1FDIA 3Q8MA 1RPTA 3WYDA 3T3NA 3VSDA 4FGWA 3ST7A 3T38A 1FXSA 3M1AA 4FD2A 5B6JA 3TTSA 4PO3X 4GBGA 4U9IS 2HDWA 3EISA 1GFWA 3C6KA 3AVTA 2P91A 3I1IA 3GLUA 2QXUA 3IQIX 4MUXA 4QPCA 3WXMA 5AO9A 3VH2A 1J07A 2QYOA 1EGAA 2VCHA 2XT6A 1L4NA 3C3BA 1FTYA 4MVCA 4MI3A 4A4DA 1K5HA 1Q91A 1OAKA 1Q1BA 1QKJA 2GWRA 4B2PA 5BSEA 4WX2B 1GPAA 4DLPA 2FRVA 1X1SA 4MQFB 1MVNA 3FUUA 5FFFA 4CLOB 5FX2A 5AVRA 3TZ6A 5HE9A 1V96A 1MOSA 2IYZA 2XWJI 2W48A 4NI5A 4WGFA 4JLDA 4FU0A 3SC2A 3ZJYA 1H2XA 2ZANA 4DQKA 1ZBDA 2EGUA 3B1WA 4KPEC 2Z2KA 1I36A 4C1NA 3ZHSA 2X5NA 2FWJA 2RH5A 4RX1A 3WADA 3ZE0B 2BLLA 4MWZA 5KU7A 1YZYA 2FSPA 1NSTA 3V1TC 4UDNA 2SKEA 3L6OO 3ZYCA 2J0UA 5K2OA 1XPUA 2OXTA 1V9CA 1M0SA 4Q3KA 3HU5A 3VR1A 3G5LA 4GX0A 5BV8A 2ZKIA 1T9ZA 3SHQA 1LSSA 1GQYA 3TNLA 2CJXA 4U7HA 3W2GA 2QTVB 3KSUA 3X2EA 1U99A 3F5QA 4L4XA 4NCKA 3G8DA 5TPWB 3UUFA 1BCRB 2B5OA 3HB7A 2VJKA 1AN0A 2E87A 1VJCA 3R5FA 4BP1A 3L06A 3U7EB 4IFTA 5JRJA 4KRGA 4N3CA 2GPTA 4C7KA 4FE4A 4G8BA 3MFYA 5GY7A 3KOUA 2PWPA 3L3BA 1ZFNA 2IYPA 2WPDD 4P34A 3RVJA 2R6FA 3CXUA 2HSJA 1FDRA 3EXIB 5D3MA 3X1ZA 5LA6A 1UBFA 2FRXA 3QXXA 4MZDA 1OW3B 2F48A 5F3RA 4L5BA 3DBRA 4N7BA 2EJUA 5U4QA 1C8VB 1Z0UA 1L7VC 2CEAA 2XTJA 2YDXA 3E1GA 1KIMA 3ZD9A 3ZE6A 3P9NA 1ICEA 2IXGA 5KTTA 4HRAA 2V0GA 1GL9B 1S3IA 3U61B 1ZYUA 2VDLB 1MJFA 1T0JB 2PM8A 5BSKA 1KYXA 1RLUA 4QDXA 3PD1A 2HWXA 1RXEA 1H3NA 1JLSA 3BQNB 4MUEA 1C9DB 1JR3A 4NS4A 1NQXA 1T4MA 1JVNA 1YVDA 2ZBPA 3LU1A 3PZBA 4Q7KA 1PEDA 2LCFA 2ODBA 2X4DA 4R69A 1UQTA 4F3CA 3OF2A 1E6KA 3LCRA 5A4IS 1T9AA 4GKJB 5JNVA 4OYHA 1JZQA 2X2FA 2PIAA 3TOZA 1AZWA 2BH9A 4R1TA 1W0KD 3L1HA 1XMQB 5C4GB 1IDOA 2B25A 2YVQA 4NOLA 1K97A 2C03A 1KP9A 4ZVNA 3HP4A 3IQEA 2ONJA 1WMAA 1EFHA 1I9GA 1R64A 3QEMA 4BWGA 5T57A 1VJ0A 3RVLA 4EVIA 4DDTA 5FOTA 4JI2B 2BF4A 4LNAA 2PUWA 5CXUA 3BD7A 4N39A 4OIFA 2DPXA 4N0MA 4QYMA 5C46F 3AFGA 2Y1WA 4L7VA 4OU4A 1E7SA 2P6MA 5F4ZA 1NVGA 4EHAA 2W37A 3CZ5A 4YAOA 3ZI7A 1KR2A 1HK7A 1UADA 4CM9A 1JGTA 1EBFA 2QR3A 5KJEA 1P1IA 2GUWA 3QTLA 4ALMA 4P08A 4HDQB 3F7NA 4G23A 4Q9NA 3RU7A 1YRLA 4X5OA 5FB3A 5CLFA 3J81k 3FNHA 3EF0A 1T9HA 1GGKA 5KNDH 4UNRA 4F9FA 1TO1E 3GXOA 4KQ6A 4FSHA 1ZX1A 1AXRA 5B36A 2PS0A 3DFIA 1M7GA 3Q98A 3SDBA 5SZJA 1UMCA 1BD4A 4HTFB 4B45A 5JAZA 4QPZA 5JO9A 4NOMA 4YROA 3MAGA 2WHXA 5IDVA 3E23A 4N0PA 4CM8B 1MPXA 2D0DA 5DM2A 3C3CA 1IHOA 1IK6A 1RXYA 2Z09A 3P26A 3O91A 4RIFA 1AVTA 2I0FA 2BI8A 4J0IA 2OTCA 3AHJA 4XSVA 4WKNA 4G84A 3T3PB 2W00A 5EFOA 4R9VA 3ML1A 4PG5A 5IBQA 5JNLA 1W88A 3KOMA 1IN4A 4YPFA 4CKWB 8OHMA 1L5QA 1I01A 1OKKA 2GD2A 2I29A 1OXBB 3B82A 4YXWD 3D8UA 3ZDRA 1KTIA 3K9WA 2AJDA 3ZQUA 3ZWXA 1UKEA 4HNSA 4AY3A 5JQGA 5K4HA 5HA5A 4C6SA 4KVGA 2Z4TA 2I78A 3ANLA 3RD5A 4YH1A 3AFHA 3FWPA 2O8CA 4DQ0A 1DTSA 4H1VA 2VYND 3R9XA 4EI2A 4MP8A 2FSGA 2PAFA 2BGUA 1U0NA 5CHEA 3C48A 1JT9A 5NLLA 4I1IA 4LHVA 1TW2A 5AJTA 2W6JD 4AK9A 2JZOA 3L7NA 1U4OA 3FA2A 5FIUA 4EATA 5I7RA 2VSNA 4TYYA 4F6LA 5H8WA 1PAUA 4J6FA 3OKAA 1IEWA 6LDHA 1BYIA 1HM5A 3KB1A 2KS6A 4YJGB 3MTBA 4Y0AA 3MJVA 3C8UA 2XMBA 1CUEA 2QMOA 5HCUA 1JALA 4PNZA 4QU8A 2AIRA 5F51A 1ZNWA 3EQ9A 4LK3A 5IHPA 4WLVA 4OH1A 1PR2A 1NMEA 3D3WA 1JLLA 4J0KA 2ZUTA 2W5UA 2C96A 2WF8A 4QO7A 3VV3A 1N36B 2H8KA 1FFYA 1O0SA 2QL6A 3C3XA 2OC4A 3IEKA 1R15A 4U3JB 3UMFA 2HMVA 3ZCXA 4PSDA 3ZD6A 1JWAB 5J59A 4ALIA 4IIJF 2MMCA 4GPIB 4ZAYA 1ZBQA 2CEKA 1TK3A 3ZBTA 2G40A 2F3PA 1RCFA 2P1RA 2R2AA 3QENA 1QHHA 5CCBA 3X1MA 1Q17A 2GBPA 1F0PA 4Z49A 1JG6A 2HMWA 1W5EA 1XRSB 3EVFA 5A5FA 3MWKA 4MLCA 2E1PA 1Z13A 3L7BA 4PCLA 3AKZA 4X64B 2IBMA 2JC3A 3FVRA 1R37A 3VBEA 3VPBA 3WLOA 4AMBA 5C81A 3LF1A 2OORC 3KL2A 4O1IA 1FRFS 1J8YF 3AB8A 1CZRA 3CXRA 2R47A 5DE3A 2QIOA 4RZHA 2YWHA 3PFNA 7YASA 2WU8A 3K71B 3EA5A 2W98A 3SICE 4JC5A 3OIWA 5CLQA 3TCNA 2CLLB 2FEKA 3BL8A 1S2GA 1M6VB 1N2OA 1YQEA 2ECQA 2XGOA 2OHIA 3W5SA 3KDSE 2AZXA 5IN5A 3MTAA 4NV0A 5EZYB 3FCCA 3IMKA 4WFJA 5A1JA 2X4LA 3P0JA 3N7AA 2PMFA 3GPCA 4CT0A 5F21A 5JYDA 2CK3D 4L75A 1Y4ZA 3DKVA 3R7AA 1G9TA 1Z0SA 3PFHA 4ID3A 4JMLA 1LPNA 1PFGA 5BP7A 1BWRA 2YY6A 5K1ZA 2YS6A 1YDHA 2EG5A 4EVSA 2Z43A 2QLMA 3CKMA 3SCZA 1HLPA 2FDCA 4U5XA 2PE5A 1YR3A 4LKOA 4ZVPA 2DUMA 3DSRA 5CGZA 2NU8A 1F6BA 2RI6A 3T34A 4COKA 4X66B 2A9FA 3D4PA 3EZGA 3O8NA 1HZZA 1ZVKA 2FH5B 2Q3LA 4HQ6A 1DRVA 4OHXA 1G6KA 1NBIA 4IL5A 1OH6A 4IDNA 4TSFA 4BFYA 1VPVA 2R62A 4FHEA 1P6QA 3QGMA 1SHJA 3NEPX 5KJFA 4TLMB 2ZRPA 3EHDA 1W85B 2YRFA 4I9GA 3AUFA 5F12A 2Q8PA 3UW3A 1MZPA 1C41A 3G59A 1N0WA 1CEXA 1I51A 4GWKA 4LOJA 2HJ9A 4TYPA 4WV3A 4MW4A 2R7NA 1IBSA 3R5XA 3HY6A 4R9SA 4A8JB 2D2EA 1EWQA 2JFFA 4F93B 2V97A 3NLLA 5C8YB 5L7TA 1B74A 2JGLA 4M0FA 4UVHA 5CK4A 1U94A 1NJ2A 1SXHA 2A5DA 2DFVA 4G56A 4PC2A 3FCAA 4YASA 3UT0A 1NAHA