4OKIA

X-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Phthiocerol synthesis polyketide synthase type I PpsC
publication title Insights into the catalytic mechanism of the DH domain of the Mycobacterium tuberculosis polyketide synthase PpsC and architecture of the beta-carbon processing domains
rcsb
source organism Mycobacterium tuberculosis
total genus 63
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.41: Beta-ketoacyl-[acyl-carrier-protein] synthase I.
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4okiA00
4L8VA 1NQOA 1WXDA 2QX7A 4DQVA 1DOHA 3ETDA 2PKRA 3M6IA 1RYEA 3DHNA 4U6QA 5DCUA 1D1TA 1A7AA 1GU7A 2P5UA 4UULA 1N5DA 1I32A 3D3WB 1DEHA 5DNAA 3WLEA 2AQIA 3E1KA 5KVQA 2EIHA 4YAKA 3RJ9A 4Q39A 2FR8A 4RQUA 1B3BA 4BKOA 4DPKA 3K92A 5DOZA 1MC4A 1YL6A 2E49A 4KWHA 1Y8RA 1FDVA 3WQSB 3ZV6A 3K73O 3RAJA 4BO8A 1LXCA 3BHJA 1QORA 2C2YA 1NVMB 2EP7A 5HWSA 4HFJA 1HSZA 3GLQA 2IZ0A 5CP8A 2LDBA 2Q2VA 2HMSA 1I8TA 2EEZA 3QA9A 4W6ZA 1BXZA 5AXBA 4QQRA 1GUZA 3ASUA 4GH5A 5CG1A 1PSDA 2ZQYA 4RPHA 4R16A 2UVDA 2X0IA 3GY0A 3PYXA 4NR0A 4E5PA 1LDNA 2HDHA 1U4SA 3JQ6A 1E1KA 3HB5X 5F1KA 2UYYA 3IJRA 4OGWA 2E82A 3NT4A 3FPCA 4OOFA 3Q2KA 4EJ6A 2B69A 2OL4A 4BMNA 3GZNB 4L4RA 1N7HA 3OHSX 4OSPA 4CMAA 1A4IA 1QR6A 1NHGA 4MVJF 3PEFA 3NX4A 1Y1PA 4I5EA 3U62A 1B14A 5F5LA 2GO1A 2UV8A 2O3QA 4D41A 4XR9A 1RJWA 4WOKA 1X0VA 3OP4A 2NVUB 3LQFA 1ZSYA 2P4QA 2EW8A 3IL2A 4FDAA 4DLLA 2AMFA 1MFZA 1HF3A 2I65A 5LC1A 2DU8A 2Y0EA 4B4UA 4DXHA 5L53A 5HRUA 2BGMA 3EW7A 3WSWA 2TMDA 3PFFA 1W4ZA 2DPGA 2FSSA 2DBRA 3NAQA 1U3VA 3KLPX 4YR9A 2WD7B 2P9GA 1QSGA 3LT0A 1FDWA 4KMSA 4UUPA 4MKXA 4FC6A 4BNIA 3I9JA 1WNTA 1XA0A 4FBGA 5G0SA 5U4QA 1ZO8A 4M54A 2VZ0A 4ALKA 5KJ6A 3GA0A 1Q0HA 5CDYA 5EINA 4ND5A 3AK4A 2G1UA 4YJHA 3E9QA 3FRJA 1CQJA 1Z73A 2BGLA 1SEPA 3COSA 3E82A 2IZZA 4DBVO 3PJDA 4CLOA 5IXYA 4P8RA 5CEJA 2HQ1A 5CPFA 5GY7A 1O89A 3RC9A 2RHRA 1QKIA 4A03A 4N54A 2CMDA 2X0JA 3C1OA 3GPIA 1H0KA 3JQ9A 3C1TA 2HK7A 4QXMA 3SEFA 3E18A 4LVUA 2GUGA 1LLUA 3ON5A 1PJQA 5L9AA 5I8WA 4IS3A 4G81A 2A35A 2PFGA 1D4FA 2EKLA 4RPKA 4YAGA 3ZV5A 4G65A 1LSJA 2EHDA 3GNTA 4GX5A 1GADO 5A9SB 3BMQA 3GG9A 1GZ3A 5JY1A 4NFYA 4XDZA 5J23A 4E12A 4JN6B 3DFUA 4JK3A 1E3WA 3R3SA 4FD3A 4Q3DA 2GN8A 4J2OA 3AFMA 1I24A 3ZNPA 3UAGA 5HS4A 4R1NA 5IFLA 1SEVA 5G4KA 1RM5A 1WWKA 2B83A 4BQRA 3AM5A 1KVSA 3PLNA 1HE2A 3JD3A 4WNIA 1LJ8A 2IYOA 3UFXA 4DQXA 1FXSA 3VH2A 1B26A 2NADA 1K2WA 4YPOA 1HE5A 3WR5A 1DC3A 2P91A 3T7EA 3DHEA 2YDXA 5CAEA 2H63A 2D2IA 1MFPA 3LK7A 2GRAA 3D4NA 4I9NA 3FI9A 5H81A 5FWNA 1K6XA 1DFGA 3C8MA 3N74A 1IE3A 1K5HA 1P3DA 2XXBA 2E48A 3I52A 4A0SA 4XJSA 1I2CA 5IZCA 5H82A 4YAIA 3GK3A 1BWSA 4LISA 2Y67A 3RUCA 4E33A 1TXGA 1GTMA 4ITUA 3BTSA 2FR0A 4AL4A 5I7FA 4IDAA 1DXYA 1DRUA 4OQZA 1OC4A 4K28A 2VYVA 3H65A 1JA9A 1NQ5A 1I3MA 1W0CA 5KJ1A 2VYVD 3LC1O 4KDEA 2Y0DA 4JBHA 3RC7A 5F1PA 1YBAA 3FN4A 4W7HA 3VPFA 1SNYA 4I5DA 4CM9A 1UXJA 2YUTA 4YDRA 1I33A 4CM9D 5IF3A 4ALNA 3NYWA 3IC5A 5IJZA 3ZZNA 3IP1A 3KEOA 4CM3A 4PG6A 4QX6A 3LT4A 2Y1DA 2HK9A 5LDHA 3TJRA 2B4TO 1I5RA 4J1TA 4KZPA 1NNUA 4XR4A 3HN7A 1XSEA 2Q4EA 4IJVA 4WCDA 4N5MA 4BGUA 2CZCA 3K2EA 3R1IA 5ER6A 2VHZA 5TX7A 4JNKA 5AOVA 3PRJA 1LDEA 1E7SA 3C7AA 5U1PA 4ZICA 2PD4A 3M1LA 3AI1A 3ST7A 4B3HA 1F0YA 3PHGA 5EPOA 3RC1A 5AYVA 4U7WA 4XIJA 4W9NC 2EV9A 3CZMA 4UEKA 1YJQA 4E32A 2CF5A 3JQGB 1CJCA 3O9ZA 3L4BC 2JD1A 4IXTA 3OQBA 3ZV3A 3QVXA 1YH3A 3UVEA 3VDQA 4GPD1 2X9NA 1ADFA 1ISJA 4MDHA 1ZZEA 1BMDA 2G0TA 2VRBA 4PN3A 1H5QA 3E6AA 3DMTC 1PGNA 2PD6A 5JMPA 5TT1A 4BIIA 1SCUA 1EFKA 3W8EA 5I9NA 1P44A 3C1AA 4OJNA 5G0VA 4TRMA 4Q9NA 2C7VA 3FCOA 3L77A 3CXRA 2D0IA 4WECA 4R1UA 1MXFA 3Q0EA 1NFQA 3I4CA 4HBGA 3K31A 1HDCA 3DTYA 3GQVA 1WVGA 1ZW1A 2X22A 4ZQBA 1GYPA 1U7TA 3ADPA 3H7AA 1U8FO 1ML3A 4Z0PA 5JAIA 4O1MA 1PGPA 4EW6A 1CERA 3ZW8A 4D44A 1NQAO 1ENYA 1GYRA 1Y8QB 2X58A 1ISMA 2Q1UA 4CMGA 1C0KA 4CPDA 3QSGA 4YJGB 1ISIA 2WE7A 2E4AA 5H83A 4FB5A 1DIHA 3NJ4A 3FNFA 2BRUA 4XGIA 4J90A 3M1AA 4PLZA 4BUCA 1E1LA 1SPXA 1I2ZA 3AI3A 3ITKA 2NTNA 4BO6A 3CH6A 1LSSA 4PRLA 7ADHA 1QMGA 1ZCJA 2WWRA 1BHSA 4CM4A 3AOEA 3OMLA 3RROA 2CD9A 3U0BA 4G2NA 1ZEJA 1TT7A 4RV9A 1ISGA 4MKRA 4HY3A 4PVCA 2GCGA 2VZ9A 9LDBA 3IKTA 5DP2A 1SOWA 3WYEA 1N1GA 3ANNA 1XHLA 4RVSA 2Q99A 5IDYA 3WGTA 1YDEA 1O5IA 2GSDA 3U4IA 4E2ZA 1YL5A 5AQ1A 3FSRA 1ONPA 3E8XA 4CMEC 4J6FA 1NAHA 1ZXBA 1E77A 2YY7A 3D3WA 3PGJA 4FGSA 4WK6A 5I9LA 2OFPA 3PP8A 4BNGA 4PRKA 4M86A 3H8VA 2O23A 4XYMA 1D3AA 3I4FA 3WYBA 3HWRA 1VJ1A 4OO3A 1ZSNA 2C2XA 2O3TA 5IDXA 4G5HA 5KTKA 2R00A 2HCTA 3ONDA 2ET6A 1DLJA 4ZVVA 5BSEA 1GPDG 4JROA 5DBIA 9LDTA 1UH5A 1YJ8A 1W8DA 4I9HA 2O2SA 1T1SA 2DVMA 1PQUA 1DJQA 4NIMA 5COBA 4EUHA 2P9CA 5THQA 2EJWA 1S7CA 4ZHSA 3MZ0A 3VPXA 3BHMA 4YRBA 4P4NA 2OP0A 3H2ZA 1ZMOA 1D7OA 1I30A 3I23A 1XELA 2GN6A 3KRTA 1C1DB 1HZJA 3E9NA 3NT5A 4HFRA 5I7VA 3GZNA 4GWKA 4BGEA 4FPXA 2GN4A 4OHUA 5KIAA 1NX6A 1NPYA 1YS4A 5ICMA 5TJHA 2HO5A 1MLDA 3U4HA 1JKFA 1LUAA 4BO7A 3GVXA 4LCEA 2NM0A 1GQYA 4YCAA 2FRDA 3UKOA 1Q7CA 3JQFA 3LVFO 4MO2A 1GUFA 1ISFA 4E30A 4YQZA 1LQTA 4Q3BA 3U4CA 3ZHXA 1WW8A 4NK4A 1YKFA 3OIGA 3V2GA 2NVUA 4Z3KA 2ZYDA 1EVJA 3F5SA 5FI3A 3ZWWA 3GVIA 2VHYA 5AVOA 2VTEA 2X9GA 4X54A 1ZFNA 2NTJA 3SBOA 4D0SA 5U9CA 5TRTA 4CJXA 4TRRA 3RBVA 3ULKA 1YB4A 1R4MB 4ZU3A 3ITDA 3ZHZA 4GVXA 5ITVA 2WD7A 4N5NA 3TWOA 3HHPA 5JE8A 3GGGA 1GFSA 3BMCB 3HSKA 5LDGA 4CMKA 2DTDA 2JHGA 1DIRA 1U5CA 4MP8A 4BB5A 4J16A 3MJTA 4P22A 3GEDA 3TZ6A 2BI7A 2A4KA 4KUEA 3T4EA 4Y6PA 4IS2A 3BMQB 3IUPA 4B8ZA 2BGKA 1YO6A 4NBWA 4BGVA 4KP7A 1VLLA 3NTRA 1CETA 4JXKA 1MA0A 5A5FA 3NDRA 3OIDA 4KUHA 1C14A 2POQX 4OXYA 2X8LA 1NPDA 1FJHA 2B5WA 2QZZA 4RPLA 3C24A 4Z9XA 5MDHA 4YYZA 2O48X 3DTTA 5DBFA 5TNXA 3RKRA 1IB6A 2C0CA 4GLOA 1T4DA 2P68A 2ZQZA 1TA4A 4ROSA 5A9SA 1M6WA 1WDKA 4PLWA 2AEMA 4XQ9A 3WYCA 3UCFA 2VUSA 2DPHA 4K26A 4II3A 1N7GA 4CQLA 4RF2A 3M2TA 1ZK3A 3AY7A 5JAZA 1LRLA 2UUOA 4TWRA 3JQ7B 4RVFA 4EDFA 1MP0A 1E7RA 2JKVA 5JXWA 4Z0HO 3TZHA 4UVHA 2NU9A 2AQ8A 4PLHA 2AG5A 2Q1SA 2ZTUA 3DO5A 3JQEA 4JJIA 2EXXA 3LZ6A 4CV2A 1UR5A 4B3IA 3EY4A 2VQ3A 3DMTA 2YYYA 3I83A 3TDKA 5FF9A 4PFJA 1PR9A 1X7DA 2Q2QA 3EDMA 2J3IA 3GRPA 1OI7A 1K6IA 5JNLA 2X5KO 4QSMA 5JYEA 3HUDA 3KYCB 4GL4A 2O3JA 1NFFA 4HADA 4RQTA 3TZKA 4WLUA 4IPTA 4CV1A 2PKQO 5ENVA 2XXJA 3STHA 2FWMX 1V8BA 4BNZA 1GR0A 3R0IA 2Q49A 3L9WA 3SVTA 2J8ZA 5HS6A 1P1FA 4CMCA 2NACA 2XPCA 4RVGA 4XCVA 1ADGA 5G0UA 4DWVA 3K6JA 3PVZA 4YAEA 3MJCA 2DBVO 4IIUA 1KERA 1Y5RA 1SB8A 1OZAA 1GCOA 3VOSA 2PZKA 1ZIDA 1HWYA 3W6ZA 1B16A 4ALJA 3D1LA 4IY1A 1LDMA 1I36A 2H6EA 3PWZA 5A3VA 4IDEA 4WLFA 1H6AA 3AUSA 2R2GA 3WWYA 1IY8A 3G1UA 4XKJA 4OM8A 4N7RA 4S1VA 4U0JA 4GGOA 1UAGA 1UDCA 4PLGA 2A9FA 4QFDA 4BNUA 3WJ7A 1V9LA 1PGQA 1J49A 3WMWA 4EUEA 3OEYA 5A9TA 4XYBA 5L4NA 2ZTMA 5HM8A 4JJGA 4UUMA 1V3TA 3D3EA 1ZNQO 3A28A 5GMOA 3RBZA 4UVDA 1D8AA 2PLAA 5TSDA 3VTFA 1EDOA 3OECA 1J6UA 3PJFA 3B1FA 3BZUA 2OUIA 1GY8A 1DDOA 2BELA 2BF7A 1CWUA 4DMLA 1Z7EA 3GH3A 5GZ1A 1JVBA 3F6YA 3IJPA 2P9EA 4XQCA 5TF4A 2GZ1A 3GHHA 2PK3A 1GPJA 1KVQA 4I1IA 3GOHA 4J7UA 2C5AA 1I3LA 4NI5A 4RDIA 1DFHA 2C20A 1TVEA 1VJTA 4L0QA 1UAYA 4PVDA 1LC0A 2I76A 1IZ9A 1T2FA 4Z3DA 3JQGA 1ONOA 1Y9AA 3MCVA 2IODA 5IN5A 1NVTA 3VH4A 1HDXA 1WMBA 5COQA 5C7IO 3HNPA 5EESA 1P0FA 3QWAA 2WYVA 1XIVA 1PX0A 4R9SA 1NM5A 3ZHYA 4FCCA 5ILOA 1QV6A 4QO7A 2ZIZA 4FFOA 1QV7A 1U28A 4YACA 3NTOA 1XKQA 3TFOA 2W98A 3FHLA 5JC1A 2YQ4A 1J5PA 4AFNA 2HAEA 4HV4A 1BVRA 1HE3A 2VOJA 2I99A 1MG5A 2P5YA 1AXEA 2VHXA 4Q3EA 1R66A 2QIOA 3AM4A 4BNTA 1ID1A 3KUXA 3I9LA 3NUGA 3L4SO 4O63O 4B79A 1KVTA 2DBZA 4JJFA 3DWFA 4DRYA 2C82A 1Y8QA 1YQXA 1Y81A 2EG9A 3NEPX 1H93A 3EAGA 3PJEA 4YBZA 4CM6A 2QRKA 3HDHA 3LU1A 4YJGA 4DPLA 4JX8A 1A9ZA 1B2LA 2J3HA 4DIBA 1KEPA 3EC7A 1KEUA 1OBFO 3X2EA 4EGFA 5DULA 1DC4A 1JKIA 2HMVA 4W99A 1Z7BA 4IMPA 2IXBA 2GN9A 2OMEA 3ZU3A 3KV3O 4I5GA 4MVJA 1NWCA 1U2GA 1XLTA 2PZJA 4TQGA 5EL0A 3I5MA 5BSHA 2EKQA 3H9EO 4MVJD 1OC2A 2P4HX 1VE9A 4ZN6A 2ZATA 4A73A 1Z6ZA 3MJVA 4K6FA 1JAXA 2P2SA 3UHAA 3C7CB 4A5OA 4Q3NA 5ILGA 2F1KA 1BG6A 2ILTA 3N58A 3I9NA 3PZRA 4UUOA 4Q3CA 1PWXA 4ALIA 4IDBA 3QP9A 2J3KA 3WOHA 2D8AA 2FHSA 3MJEA 3CEAA 1EBUA 4MIEA 5CEFA 1O94A 2Z1NA 3GF4A 4Z9FA 3L07A 2TMGA 4MVJG 3HG7A 1X7HA 3V2HA 1ZK0A 4R1SA 1GCUA 2WTBA 2JCVA 1PZGA 3DXFA 1T24A 4DIOA 4BB6A 4FFPA 4AJOA 1UJMA 1V3UA 5L7WA 1U3UA 4FJ0A 2CVOA 3EVTA 2LDXA 4ZA2A 2VHWA 1MV8A 4L4SA 2VWGA 2OHXA 4CLEA 2YV1A 3VPSA 2C54A 1M2WA 2WMDA 3FNGA 4RLHA 4E0BA 5L51A 1DIAA 5JBIA 2D59A 3K30A 3WQQA 4MP3A 2JD2A 3W4KA 4RZHA 1ULUA 4BGIA 1EUCA 2BMAA 3AUTA 4BMSA 4EI2A 3WGIA 2X4GA 4GMFA 3QVWA 4YT4A 3BAZA 1C1DA 2WDZA 4YRDA 2V65A 3GNSA 1D1SA 3AOEC 1QRRA 2PGJA 5F1OA 1GUYA 3ZHBA 4HX5A 4LMPA 3ZWBA 2X23A 3VC7A 1PZFA 4CUZA 4DGSA 2PGLA 4UVEA 5DZSA 1LI4A 4AJHA 3DONA 1YONA 2Y1OA 2HMUA 2FR1A 1IOLA 1P1RA 3PQEA 1WP4A 3RCBA 3JQCA 2XOXA 4ND2A 1QYVA 4EJ0A 2WSBA 1MC5A 4XJTA 2AHRA 3WJAA 3ZU4A 3JYNA 3BMNB 4B4VA 1E7QA 2AEJA 4H3VA 4M55A 1VPDA 1WPQA 3OA2A 4LMRA 2H5LA 1R4MA 4EJMA 1KVUA 4HWKA 1N1EA 3DAFA 3PXXA 3KZVA 4A27A 1PZEA 2R00C 2W2KB 3PHIA 3OBBA 4IJUA 4E2WA 3BMCA 2JCXA 4XZ3A 5TC4A 1YVEI 1ZJZA 4A2CA 2I3GA 1EVZA 4CL3A 2HK8A 4ZQFA 5JS6A 2BD0A 4BKQA 1YOVA 2WEKA 4BV9A 4WOJA 3IDSA 3GUYA 3WGQA 4MPDA 4XQEA 1PIWA 2NLOA 3PIIA 3SC6A 4IDCA 4XB1A 1ENPA 3BXXA 3GUCA 2AA3A 2G17A 2PD3A 1G0OA 4CQLB 1NXQA 1HDZA 3WS7A 2AG8A 1P9LA 5DDIP 2ZB3A 4H7PA 2Q3EA 1VSUA 4IZHA 4FN4A 3VZPA 4CMIA 4BO2A 2RHCA 5CPBA 1BDBA 2EGGA 3G49A 4WASA 3JQ8B 3TZQA 3WGYA 4AJ4A 3A4VA 3OJFA 4WPGA 3RUIA 1C3VA 3JQFC 3WLFA 1IHYA 3C85A 4B4OA 1DJNA 2F00A 1LDGA 3I9OA 2JCYA 3KSUA 4B7CA 1ONNA 1PZHA 4R5MA 1ENOA 4PIVA 1ORRA 3GGOA 4XDYA 4BNKA 4BQPA 1ADBA 1BDMA 3HFSA 4NJMB 3AY6A 4OXKA 1I0ZA 1ZXLA 4ND4A 3PJGA 1VL6A 6ADHA 1IPEA 1WLYA 4W7IA 3WX0A 1F12A 1I2BA 3DOOA 1K89A 1BSVA 1AUPA 1E7MA 2A94A 2NTVA 4QT0A 3JQ7A 4RGBA 1Y7TA 4R3NA 2VT3A 3PHJA 3PK0A 4FJ1A 1PQPA 1PJLA 3QWIA 1HDGO 1XG5A 4MJLA 3U9LA 2Y99A 3VPHA 5A06A 1HXHA 1JKJA 1Q7GA 3BHIA 4LSMA 4DYDA 4XX0A 2D4AA 5G2OA 3EUWA 3P5SA 4CM5A 2RIRA 3GN2A 2IEDA 2Z5LA 4M1QA 3KYCA 1U7HA 1UXIA 4DYVA 5GZ3A 3PQDA 4CV0A 4M87A 2JFHA 2B4QA 3O38A 1DBVO 2HKIA 4J0FA 3OJ0A 2DTXA 1ADCA 4WUVA 2SCUA 1FK8A 4GBJA 3WGZA 3ZNQA 2UUPA 5L7YA 2DTEA 3GNQA 1E1NA 4Y8VA 4B4WA 1PS8A 3VVCA 2J5QA 1PR3A 3DQPA 3FWNA 2J3JA 2VNAA 3D7LA 4B7XA 4FOSA 3H3FA 4XYLA 4KTTE 1IPFA 5A04A 4GMGA 3AWDA 3KVOA 1DFIA 3QRWA 1PS9A 3QHAA 3CSDA 1H6BA 4O59O 2CFCA 2Q1WA 3UICA 5IXSA 3WGGA 3KYBA 2G82A 2YHIB 2EWMA 4GWGA 4FSHA 4FW8A 3CE6A 3HDJA 4J1QA 5IG2A 3VKUA 4JLWA 1CIVA 5MGBA 2VN8A 2DKNA 4B8WA 1A7KA 5JAMA 4I08A 2B36A 1P33A 2EKPA 4TKLA 3DZFA 3D5QA 1KVRA 4WCFB 1H9AA 3ZWYA 4HNHA 1JLLA 5K6AA 4ZRMA 3TZCA 2PA3A 2YW9A 5THKA 5IDWA 4QECA 4TROA 2G76A 2QRLA 2WJPA 3L9XA 5B4UA 3MWEB 3DL2A 1H9BA 4GKVA 1GYQA 3WFIA 4LVCA 4Z6KA 2WE8A 2CSUA 4RO0A 3FTPA 4PCVA 5T5QA 3E03A 2O50A 4DQUA 1OOEA 1HEUA 1OAAA 2BFAA 2WM3A 4CLDA 3DZBA 4JP3A 3LF1A 1LLDA 1RPNA 3TNLA 1GD1O 4YA6A 1LEHA 4IQGA 3DOJA 4INAA 4PLFA 3M2PA 4IJWA 2GERA 4QFCA 1BW9B 3NDIA 3PDUA 2FPGA 1ZKMA 1HYEA 1Y5MA 1DSSG 3UGKA 3PZBA 3SC4A 2FOIA 3HDQA 1XU9A 4GKBA 4XD2A 4Y9DA 2AE1A 4DLBA 1UZNA 3PYLA 1F8GA 4PLCA 2VHVA 2R6JA 4YWJA 4CLXA 1VJ0A 3IUSA 3L0DA 5AXCA 5IAAA 4ZQGA 1PGJA 1I3NA 4XYGA 2DUUA 3TFQA 2IDZA 1VL8A 2D1YA 2B0JA 4CR8A 3HQ4O 3EGOA 5ENDA 1R4NB 1X0XA 3Q11A 1YB5A 2ZTLA 2QG4A 2V6GA 3IMFA 4O0LA 3U4DA 3LT1A 3ZWAA 1PJCA 2IEBA 2ZB7A 3W6UA 5CDSA 4L76A 2VNSA 3RFXA 3F5QA 2IXAA 3FF4A 3K9QO 2NNLD 4LSWA 5HTOA 5ITWA 1M76A 4GQAA 1GV0A 4NBTA 3EZLA 1HDYA 3D5TA 2V6BA 3HN2A 2NQTA 4NQZA 4BS9A 2VUTA 1E3SA 1HSOA 3GDGA 1HLPA 3WQRA 3B1JA 4IDDA 4YVFA 4MVJM 4D43A 3W8FA 2VYNA 3LYLA 5A5EA 1IHXA 3AI2A 3CMCO 2VYND 4LW8A 2J5KA 3JD4A 4IINA 4CLRA 2QQ5A 3GMSA 1F06A 2DAPA 1Q0QA 4XA8A 1P1HA 4XIYA 5CHEA 3BTOA 1HDRA 3ZU5A 4BOYA 1JWAB 1Z82A 4ILKA 1R6DA 2HLPA 5TS3A 1PS0A 1PJ2A 4ALLA 4RVHA 2DLDA 1X1EA 1YL7A 1P1KA 2GF2A 4E5YA 3TF5A 1L1FA 1A72A 1EUDA 1N8KA 2BH9A 1GL3A 4XRRA 4AJEA 2I67A 1KC1A 1ULSA 3MJ4A 1MGOA 4JQCA 1BXGB 1K6JA 4A10A 2ZYAA 1LRJA 3H5RA 4MIOA 4OSOA 3SX2A 5BSGA 4QEDA 2PV7A 3OQ6A 1E5QA 1A27A 4CQMB 1YGYA 1HDOA 1AHIA 4BO1A 4R9RA 3DDNA 4CM8A 4DA9A 4E2YA 3ONEA 4L4XA 1P0CA 3NGXA 5AXAA 5JCXA 1WDMA 4M89A 4Y67A 3PLRA 4AG3A 4KTVE 3DZKA 1P1IA 2X0RA 3ABIA 3ZWCA 3O03A 4B7UA 3VAZA 3WTCA 2D5AA 2B5VA 1DAPA 5DCWA 4IBOA 5KKCA 4C7KA 1X13A 3L6DA 1O6ZA 4GGPA 4D3SA 3DBLB 4ID9A 3DB2A 3LLVA 1HETA 4U5QA 4U8GA 4CLHA 2A92A 2VWHA 4GAEA 1YOVB 4YRAA 1EBFA 1B7GO 4JP2A 1JVSA 4E3ZA 3BMNA 4UVGA 1EE9A 1VC2A 3AOGA 3GHYA 4R54A 3OETA 4ZJUA 3GZ4A 1F17A 1XCBA 3WFJA 1ZBQA 4BV8A 1E7YA 1DRVA 5TGDA 4PLTA 2GASA 4UEOA 4IQ8A 4XEHA 3TOXA 3CMMA 4II2A 4CMIB 5C7LO 2Q4BA 1O0SA 2X5JO 3RVDA 2W2KA 2CVQA 2Q2WA 3F4BA 1JTVA 3QVSA 1I3KA 2D5CA 2FMUA 2PNFA 4BVAA 3ZV4A 4GI2A 3ZGYA 4ZRNA 2IE0A 4XQGA 2AQHA 1YDWA 1U9JA 1EE2A 5C37A 1TLTA 1GEEA 1UUFA 5CFZA 2VCYA 3QV1A 4YJFB 4QTZA 3RQSA 2YV3A 2ZYGA 3GVCA 4ZQHA 2OO5A 2O2YA 2E6UX 3A06A 1WAMA 3TPCA 1R16A 1YBVA 4GX0A 1BRMA 4K1LA 5BSFA 1NPTO 3JQ8A 3L6EA 4OAQA 1PL8A 2EP5A 3IP3A 1OFGA 1PL7A 3RKUA 4MKZA 4DIFA 1YRLA 2O3UA 2V6MA 2Y1FA 3RUEA 3ZNOA 1R12A 4RLSA 2PGDA 1SOVA 4NBRA 4EYEA 3ZN2A 3WG9A 2JAHA 4NJMA 3H9QA 4O6VA 1E3LA 3DZIA 1AGNA 2G5CA 2JHFA 2ZJ1A 1W6UA 3CTMA 4NMHA 4WJZA 4GSKA 1NTOA 2HMWA 2I9PA 3RASA 3I9KA 5C7OO 1CF2O 3WWZA 1KEVA 3FNHA 3RFVA 1LU9A 1T2AA 2BLLA 4YTEA 4A7PA 3ROKA 3NTQA 1R0KA 4NH4A 3PTZA 3OF2A 4TZKA 4B3JA 1S6YA 3ZNNA 4R01A 4RJTA 3ENKA 1R37A 3L6OO 3GVHA 4D79A 1TEHA 4FFNA 4P4LA 4F3YA 1PJ4A 3D64A 5IZ4A 4GX2A 1Q0LA 3WDSA 1DPGA 1FDUA 3RUAA 3GMDA 1GDHA 1DRWA 3U3XA 1IULA 1T2DA 2O4CA 2OGUA 3CINA 1KBZA 3ZWPA 1ZK4A 1O8CA 2HSDA 3GEGA 1NASA 2C29D 3A9WA 3ORFA 4DMMA 1PWZA 2O3RA 3AY3A 2JFGA 5JDIA 3QWHA 3RWBA 4ZQEA 2IZ1A 4J9UE 1CYDA 2NUAA 5JDCC 1UXKA 3E5RA 3MTGA 4YXFA 3K8ZA 1XGKA 2B37A 4EEXA 2QHXA 5BQFA 3H9UA 1VL0A 3KSZO 3LC2O 3H9GA 4JIGA 3FBTA 1EK6A 2GZ2A 4GX1A 2RCYA 3UXYA 5L7TA 3WNVA 2OP1A 1CDOA 1DHTA 1JQBA 5JCJA 1AXGA 3ZH2A 3CZRA 2C5EA 2HRBA 1ZEMA 2YHIA 5JCJD 3E48A 4C4OA 3TRIA 1M66A 1UXGA 4JBIA 1JDJA 2GZ3A 5L40A 1E1MA 4RF3A 3OICA 3ROMA 2BFPA 1UXHA 3P2YA 1V35A 4AVYA 2CDCA 4IQ0A 4WCFA 3UW3A 3FNEA 5CEEA 2FN7A 5CDUA 3IQDB 3EMKA 1XR3A 3UN1A 1E7WA 1N9GB 2Y1EA 3B70A 1EZ4A 1K3TA 3GR6A 4E21A 2X6TA 3EHEA 3D4OA 2YQ5A 4A26A 2PKQP 3U09A 2HUNA 1C0IA 1Q7BA 4MVJP 3HZZA 2BFMA 3JCZA 1RWBA 4HUJA 4RZIA 3I6IA 3DEYX 3OSUA 5K9ZA 5I9MA 5A05A 3CIFA 1IL0A 1GEGA 2ZKLA 1HTBA 3Q6IA 1KEWA 2DBQA 4RPJA 1BW9A 1DC6A 1C0LA 1EEHA 2DC1A 3LT2A 5EERA 3S8MA 1LQUA 1TT5B 4BL5A 3BTUA 4IM7A 4AJKA 4RCVA 3OM9A 2D3TA 1MXHA 2QZ9A 5ADHA 3OA0A 2HRZA 3AW9A 3R3JA 2PH3A 1KY4A 5TJ9A 3LLSA 2YFQA 4ND1A 3DAPA 3FD8A 1MB4A 2Z95A 5EQDA 3GEMA 3AUAA 2FPIA 3AM3A 4MP6A 4MVJI 1GZ4A 5TIIA 3TL2A 1QYWA 4K9DA 3NJ8A 4BMVA 1I01A 2PZLA 1R4NA 2QYSA 3JQBA 5K6AC 3WTBA 1PJBA 1RYDA 1ZK2A 4S3MA 4KUGA 2FZEA 1E5LA 2ZB8A 3VH3A 3PWSA 3ETEA 4C7JA 4DC0A 2GR9A 3NDJA 3WNQA 3R6DA 1DIBA 4J91A 2HMTA 3S2IA 4CLRB 4IDFA 5KVSA 5KJEA 3TN7A 2NQ8A 1YQGA 3O26A 3JSAA 4OKNA 5A4DA 3EVNA 4MVJE 3VVBA 1UDAA 3VTZA 3S55A 3MEQA 1BVUA 5JO9A 4XRGA 3HB4X 4TVOA 3FR8A 2YHUA 3T7CA 1KIFA 2Y93A 1T4BA 4FFMA 4BNLA 4J7XA 4U6SA 3BA1A 4FS3A 4I8XA 2PWZA 4FC7A 3ICPA 1JW9B 4KDFA 7MDHA 1UP7A 3F1KA 3KB6A 2Y0CA 1T25A 3I9MA 1Q2XA 4J2HA 3NRCA 2I5PO 3EZYA 3G0OA 3HE3A 1EQ2A 3Q3CA 5BNTA 4E4YA 1NQTA 4CMJA 1XQ1A 2DT5A 3KXDA 1H2BA 1NHWA 3GVPA 1E6EA 1VKOA 2GDZA 5EMHA 4OXNA 4IDGA 3GFBA 4CM8B 1VKNA 5L3ZA 1FDSA 3HJAA 2RH8A 3DMYA 3DHYA 5L4LA 3NT2A 5EJ2A 5DT9A 4OL9A 1WMAA 2PZMA 4XYEA 1TB4A 3RU9A 5L4SA 1Z45A 4BNJA 4BO0A 4D0RA 4AJ2A 5JLAA 3ETGA 1NR1A 3DBRB 4GSLA 3GN1A 1XU7A 3S2EA 2C59A 1O9BA 2YJZA 5F3RA 1G1AA 4YT8A 3F1LA 1C1XB 3B6ZA 1BXGA 1QLHA 3QW2A 5DN9A 4AJLA 5JMWA 2UAGA 4O5OA 4BO4A 5TLSA 2EF1A 1YWGO 2C7GA 5T8KC 4F45A 4CQMA 3W1VA 1R15A 4CQMD 1ZUD1 5KVCA 5HA5A 1SMKA 4EBFA 4PZDA 3JD2A 2OBYA 3GAFA 2DQ4A 1E3IA 5DP1A 3OIFA 2NV6A 3KM0A 5JFOA 2V7PA 2C07A 1F8FA 2PY6A 3HDYA 3JQAB 4J43A 3G17A 1LC3A 5DOVA 3W4IA 1MUUA 3P7MA 1O95A 3ZCXA 5JSFA 2FZWA 4BNYA 1RM3A 3QY9A 3DBLA 3TL3A 1CRWG 5T67A 4UVIA 3QQPA 4E6PA 4GVLA 5KJCA 4M8SA 3ZW9A 1X1TA 3CPSA 3I1JA 4OH1A 3ZWNA 4R51A 3S2GA 1QYXA 2GPTA 3HFGA 4NK5A 1B15A 1T26A 1TI7A 4CUKA 4H15A 1HKUA 1MX3A 3MTJA 1EVYA 1NBOA 3OEWA 4BKUA 5COAA 1PU2A 1LSOA 4WEOA 2H9IA 5JDCA 5A02A 3UH1A 4U0KA 4YJDA 4IXWA 4HXYA 3V1YA 1LLCA 1A71A 4TMFA 3GPDG 3IAHA 3WIDA 5CG2A 1JU9A 5T57A 4Q3AA 5T6BA 2ZJ0A 4HFMA 4BNMA 4J1SA 4TZTA 1BGVA 4RF5A 4YJFA 1PJTA 5DCYA 3VZQA 3S1LA 3FTNA 5ER9A 3DBHB 1KETA 1EMDA 1GV1A 2BFOA 2NVBA 4Z9YA 3KYDB 1U3TA 3QJ5A 3KBOA 2GNAA 3QWFA 5KKAA 1ZJYA 1T1RA 4DBZA 2Y1CA 4NJOA 4EEZA 3DZGA 3OJOA 1V0JA 4JBGA 2Y1GA 3F4LA 3IOYA 4CR6A 1DHRA 4QUKA 1B0AA 2GD1O 2W90A 3V2UA 4CM1A 1A4UA 5F5NA 2WYUA 3BMOA 4ND3A 4URFA 1QLJA 2Y05A 3WBFA 4CUJA 5HBRA 2OOSA 1E92A 4NHEA 3VDRA 5F21A 3AUUA 3PI7A 1WDLA 4BNFA 4PG4A 1W73A 3V1TC 2XAAA 3V5NA 4LRTB 3WGHA 4IUYA 4BHTA 3A1NA 1XWFA 2Y68A 1LA2A 1H6DA 1ENZA 1YE3A 5BT9A 3G79A 5JO0A 1YXMA 5EN4A 3W8DA 1LLQA 3H6KA 2YZ7A 4E5NA 5JW6A 2BI8A 2J6IA 4MVJH 3SJUA 3WB9A 4KWIA 3QLJA 4CM7A 5JAQA 4BO9A 3JV7A 1L7EA 4WLVA 2OORA 3C3XA 5FYDA 4XGKA 2JD0A 4AICA 4R3WA 3AFNA 1L7DA 5A9RA 1UP4A 2Q46A 4FGWA 5KCZA 3E9MA 4CMBA 5FFFA 1C0PA 1ARZA 3WBBA 1X14A 2B35A 4EITA 3BTVA 2XF8A 1U5AA 3PPIA 2NWQA 3F3SA 2CY0A 4DL9A 3JD1A 1XQ6A 4PLYA 5B4TA 4FJ2A 1SBYA 4UEJA 1X15A 2CDAA 1PJ3A 3F9IA 2CNBA 1VI2A 3AU8A 4J49A 1M67A 4IGFA 3EK2A 1UDBA 2CDBA 3DZHA 3H3JA 4YQYA 4BNWA 4HFNA 4RL6A 5KOIA 4AJIA 2OBNA 4XGNA 4IGEA 4D42A 3RD5A 8LDHA 2YFHA 4RORA 5TQVA 2RBEA 2GLXA 2X7HA 4R5HA 3OQ1A 4E31A 2PH5A 3QVTA 4L9RA 1PTJA 2VUUA 3P2OA 1U4OA 2VOEA 3VZRA 3U5TA 4Y6SA 1VM6A 4OOEA 1R0LA 2Z1MA 5LCXA 1KS9A 2I6TA 2VWPA 2EGHA 4L74A 2YV2A 3JQDA 3ONFA 3UUWA 4BNXA 3PHLA 1EK5A 3K96A 4TRJA 4YB8A 3QE3A 2AE2A 3O8QB 4J4TA 3T4XA 3VH1A 3IKVA 4P38A 2Y66A 4WLNA 2QRJA 3V1UA 2FSVA 3Q9NA 5AXDA 3VPGA 3KO8A 3PHHA 2HU2A 3RUDA 1N9GA 3BIOA 5DF1A 3VKVA 3Q9UA 4W4TA 4PGFA 4WKGA 4DLAA 4BNHA 1P77A 1NVGA 4OQYA 5KJFA 5JDIC 1U2DA 3RI3A 2HJRA 3ZWMA 3AU9A 3GFGA 6LDHA 2EERA 1NR7A 4M49A 1KYQA 4J9VA 1V6AA 2O7QA 3JYLA 2JJYA 3KTDA 2Q50A 3H5AA 4BKPA 5BNIA 3QVOA 4IZIA 3F47A 2X5OA 2V6FA 2ZCVA 4AJ1A 2IRWA 2EW2A 3OFSA 4TRNA 4J7CA 4HP8A 1HZZA 1KOLA 5C5IA 3H4VA 1LNQA 1TT5A 3NKLA 1WZIA 1VRWA 2H1SA 3GT0A 3GGPA 4NFHA 1H2HA 1YQDA 4XB2A 2IYPA 3UCXA 1PGOA 1FDTA 5T8KA 1DIGA 4K6CA 5I8ZA 1B3RA 5ICSA 5G4LA 3N7UA 4F46A 1Y8RB 1ZH8A 2YDYA 3ZWVA 2DUWA 4DPMA 1HE4A 1UP6A 3RFTA 3ANLA 3INTA 1VSVA 3PDJA 2JAPA 3ZWXA 5A1TA 4MOWA 3JYPA 4WCFC 4ONEA 4J4BA 5T64A 4OMUA 2VRCA 3DOCA 4YT5A 4NNJA 3FPLA 1NFRA 2VRCD 3PFWO 5I7EA 3O4RA 1Z75A 2DFDA 1DAOA 1E6UA 1U1IA 5IDQA 2VT2A 1ISHA 2AW5A 4DUPA 3KOUA 3WSVA 3WMXA 1EQUA 3JTMA 5GZ6A 2PR2A 4BO5A 1XEAA 4J4HA 4XWYA 2OXIA 1N92A 4RF4A 1HRDA 4PG5A 3S2FA 1JN0A 1U8XX 2QYTA 3QWBA 4J3FA 3SXPA 4DVJA 2RH4A 4IJKA 1DLIA 1HYHA 1K0UA 3FR7A 4BNVA 1AN9A 2CF6A 3ENNA 3AJRA 3PIDA 1PJSA 4TSKA 3W4JA 4DREA 5JYDA 1OMOA 3MOIA 3GDFA 5B37A 3ZWOA 1WZEA 1YBMA 3EYWA 4R68A 2O7SA 3G3EA 3INRA 4W82A 2WD8A 4NPCA 4FIZA 1J4AA 1P1JA 5KWEA 2VZ8A 4ESOA 2CUKA 1EDZA 1UZLA 2ZK7A 1NWHA 3JQBC 4HKTA 3FBGA 4PG7A 3TOZA 3C7DB 2NU6A 4D3DA 4RPGA 3DBRA 4D3FA 1C1XA 2QW8A 3JD0A 1B8PA 1LX6A 4NU5A 4YJHB 1HT0A 3UF0A 1I10A 1YB1A 3DZJA 4YAJA 3SLGA 1G0NA 3RUFA 2EJVA 2CVZA 1IUKA 3G1TA 4ZD6A 2FPPA 4CLOB 4NDNE 1BTOA 3U49A 5CDTA 5L95A 4NZ9A 1SZJG 1LSUA 3PYMA 4IMRA 1GZ6A 4OYRA 2FY8A 1IZ0A 4YT2A 1H94A 3LDHA 5K0ZA 4Z0TA 3P19A 4WGGA 1T2CA 1KY5A 3DC2A 3JYQA 1RKXA 3WXBA 3MOGA 2O4UX 1AE1A 2UDPA 3LF2A 3JQAA 1NP3A 2O3SA 4L75A 1Y6JA 3JQAD 1G6KA 1QG6A 3ANMA 3PGXA 3H5NA 4WLEA 1DC5A 3RJ5A 2VTDA 2X1HA 1E3JA 4N5LA 4EUFA 4AJJA 4E2XA 3K5PA 4LCJA 1RM0A 4D7AA 3K2BA 5EQFA 4PG8A 1E3WB 1E3EA 2I66A 4NBUA 1IYZA 4AJNA 4R69A 4J0EA 4J1NA 3DAGA 3QIVA 4BNNA 3V8BA 5I7SA 4PZCA 5G4KB 3B20A 1J0XO 1F14A 4RDHA 2I3AA 5B12A 3HADA 1QP8A 4Y6RA 4WEQA 4N18A 3UCEA 2W8ZA 3H9JA 3DFZA 2Q1TA 1B8VA 1CQIA 2DFVA 5A3JA 1ZK1A 1T2EA 3ICCA 1A9YA 4FFRA 4JGBA 3BMOB 3RU7A 4EZBA 4ZGWA 3MJSA 1RM4A 4D45A 4E13A 4BO3A 1LDBA 1XYGA 3D4PA 3OJEA 4CODB 4PLPA 1E0DA 2GYYA 1DB3A 3DBHA 2JFFA 4KQWA 4W9NA 5JY6A 4CV3A 3KYDA 3ADOA 2B4RO 3RIHA 3JYOA 3L4BA 1H6CA 3D0OA 3Q2IA 3PQFA 3FWZA 4LRSB 1UZMA 5ES3A 2Q45A 3KLMX 1AHHA 1PL6A 4F6LA 1QYCA 1SB9A 3ZDFA 5L45A 2AXQA 4BKRA 3F46A 1LRKA 4GLLA 1U3WA 5FI5A 1QXSA 5BR7A 4LK3A 2JL1A 4D46A 4KOAA 3RC2A 5G0TA 2W4QA 4I9UA 4FR5A 4UREA 3A14A 4H16A 4WLOA 1SO8A 3ROQA 1PQWA 4TKMA 4CL8A 5KVVA 3JQ9C 1N2SA 3DBVO 1SAYA 2E37A 4E5MA 3RBXA 1EFLA 3WIEA 2X0NA 2BHLA 4KQXA 3VHRA 3WGOA 3ROPA 3NGLA 3H2SA 4E5KA 1GQ2A 5DBGA 1Q1NA 1R0SA 3OH8A 3E5MA 8ADHA 1SC6A 4WNCA 5KNLA 1X7GA 5C3MA 2NU8A 3KETA 5FEUA 1ZVMA 3ZU2A 1JAYA 1Z74A 1FMCA 4JCOA 1A5ZA 1EUZA 3OJLA 3RUHA 1PEDA 3GRKA 1P74A 3NV9A 3TSCA 3TQHA 3CUKA 1CEQA 2DM6A 5B1YA 1ZSVA 5JC8A 4R41A 4I5FA 4MINA 4MIYA 3KHUA 4RVDA 2VWQA 3I6QA 1E6WA 3KSDO 3VZSA 2HJSA 5B4VA 1MG0A 4TVBA 1HLDA 2AQKA 4PLVA 2ZB4A 4FOOA 5BNFA 5IN4A 1XDWA 5TT0A 4AJPA 2NU7A 1P31A 3GG2A 4NU6A 5JPIA 2FP4A 4QO8A 1JWBB 3SLKA 3X2FA 4FFLA 2NSDA 4NG5A 4P4GA 4L73A 4Y98A 4CMEA 3IS3A 4NBVA 3MWDB 5G0WA 5IZCC 3GDOA 2RAFA 2X9VA 4LGVA 3CKYA 4UAGA 4WE3A 1KC3A 3GC6A 4IIVA 1P45A 3UOGA 4OIMA 3GAZA 1LTHR 3INGA 3SJ7A 5CDGA 1FF9A 1M75A 1M6HA 1ZMTA 1GQQA 4R4JA 1BXKA 3WICA 3O8QA 4ALMA 1V3VA 4DC1A 1GAEO 1HL3A 2WYWA 4RVUA 4F6CA 4R1TA 2PTGA 1B8UA 3BYZA 2BKAA 4YEDA 3DR3A 3LC7O 4CMHA 1NYTA 1NAIA 4OKIA 4CR7A 3IIEA 1HYGA 4FQ8A 2GGSA 4PZEA 3LSYA 1EVIA 2OZPA 4CM4B 4UUNA 4DTIA 3PWKA 2ZTVA 4HNGA 3I3OA 3KEQA 5EIOA 3ZI0A 1QYDA 2ZCUA 3RSHA 4LN1A 4NFSA 2W2LA 3ASVA 2NVWA 1DO8A 2W2LD 3B1KA 2AEFA 1LDYA 2X86A 1Y9EA 2J5RA 5A03A 3Q1LA 1LBEA
chains in the Genus database with same CATH superfamily
4L8VA 1NQOA 1SZCA 2QX7A 3F7MA 1SIWA 3PC7A 2PVCA 3ETDA 3A6GA 3HXMA 2PUBA 5FKJA 1GGJA 1WKBA 1J99A 4L5JA 4U6QA 1M7GA 2P5UA 1NNSA 1RXEA 1I32A 1TO2E 1V2GA 4JU9A 1C2TA 3WLEA 4PN7A 3R0ZA 2WUDA 3E1KA 2EIHA 5KVQA 3QOFA 4D9JA 1N1MA 4Q39A 2AJ8A 3T5GA 1B3BA 4BKOA 4F8YA 3PGLA 1ILWA 4Y7DA 4JSRA 3K92A 1MC4A 1HE1C 2E49A 4AT1A 3IR7A 1FDVA 3WQSB 4PYNA 2RHHA 3RAJA 4OHWA 4MS1B 1QFXA 3QPBA 2C0PA 3DVSX 2CVHA 2GTPA 4FONA 1JQ5A 2J1LA 1G20A 2QSZA 5J4YA 1NJGA 3SYNA 3GLQA 1AGYA 1PYOA 2LDBA 2Q2VA 1I8TA 1NVDA 1EFPA 1KDRA 1BXZA 4F6RA 2XNSA 5CG1A 4GH5A 3QG1A 5DW3A 1H2WA 2I4IA 5DYYA 2IDMA 4HWTA 4R16A 4RPHA 1WJGA 2ZWOA 3O1IC 3LQYA 4KVFA 5EIFA 2C1ZA 1C50A 3HB5X 2UYYA 1TKBA 3ME5A 1SQ0A 1OXMA 1XEWX 3WIVA 2NV0A 3Q2KA 4NZOA 4EJ6A 1JIIA 2G0AA 2J32A 1VRVA 5LZ7A 2YIVX 1Z2DA 4MA4A 2GPAA 4OXXA 2R8OA 3MD9A 2W2MA 4DA7A 3BD9A 1U7WA 1SWWA 2CFSA 3ETJA 5ADWA 1NHGA 3RRNA 4RSGA 3G59A 2B9EA 5IEJA 3UTCA 2CLFB 2Q3CA 3QVKA 2Q5LA 5HBGA 1B14A 1DAGA 4RM3A 5F5LA 5JLJA 4IIJF 5K3AA 5H3LA 1AK1A 3SKXA 2WHEA 1YAHA 2XQVA 3O2JA 1OYOA 1LF0A 3BXOA 2XCIA 1AA9A 3FDZB 3OEHD 4WOKA 1RFLA 1X0VA 4YAWA 1ELOA 3OP4A 3TIIA 4C30A 4JYCA 2QX8A 2P4QA 3V8QA 4YV0A 3LBFA 4JJKA 2C2OA 3Q3GE 1MFZA 3AVWA 5GONB 2I65A 1RYFA 3UMJA 5L53A 4EAQA 4RHCA 2XCSB 5C34B 1ZM4A 2TMDA 3O90A 4GLBA 3PFFA 1W4ZA 5B36A 4QUDA 4ZVQA 2AG1A 4LBZA 5GTDA 3HJTA 4MJ3A 4OFWA 1U3VA 5C5DA 4F11A 2N3ZA 2X5NA 2WB2A 4I55B 1FDWA 2QV7A 4RZ3A 3G2PA 4X6XA 4ZI5A 2IV2X 2A30A 1WNTA 3S68A 4BNIA 5U4QA 4AY3A 5I8PA 5JJBA 5KJ6A 4ALKA 3OWXA 1RW4A 1Q0HA 3COPA 3KLNA 4HDMB 5IS2A 2V6IA 3K5HA 4YJHA 4F1JA 5J4KA 4LE0A 2FUCA 5AK0A 3AR7A 3BB3A 1KEEA 3R9XB 2VF5X 4PNPA 2R8ZA 3SQWA 2QP3A 4Z1OA 3SR0A 2IZZA 3TM5A 1F3OA 3GRCA 3PJDA 4LNUA 2WIGA 1NY5A 3D1JA 4P8RA 5CEJA 2I7DA 3AL3A 2HQ1A 5AW4A 5HKOA 4NPHA 1QHNA 1XZPA 3PNBA 5ICCA 2AUNA 2HCRA 2JI9A 3OFND 2WY2D 4HRVA 1EX9A 3KQSA 4A03A 4DCCA 5K09A 2P65A 1CD5A 3TLJA 1ZR2A 2JATA 4JXZA 5CVTA 1KXZA 1SCAA 1VLQA 1ZNZA 2YJNA 2HK7A 2OHOA 1GNPA 1NUTA 1XHFA 3I6YA 2IU0A 1Y9ZA 1Y48E 2WQZA 1JI0A 2PNJA 3SEFA 3VHLB 4CCAA 1DX9A 4ZYLA 5A4FS 3ZGVA 1CQXA 3UJBA 1PJQA 3NAZA 5K0NA 1Q1QA 1XWWA 5EG5A 4IS3A 1ACJA 4PX9A 2A35A 1IXSB 2PFGA 5I8WA 3IDFA 4AY4A 3DD1A 3STUA 2EC5A 4R84A 4G65A 1LSJA 4GX5A 4M6WB 1EXVA 1FVHA 1GADO 3G9ZA 3H2BA 2D3WA 3AGPA 3GG9A 3MQFA 3R3XA 5A9SB 5JY1A 3BUSA 4G37A 1E9SA 1MRZA 1XJQA 2DX7A 3ZGOA 1X1QA 5KYXB 1CB0A 3DFUA 1T1GA 2BBTA 2P27A 3GWGA 3TOVA 3G2LA 4UTPA 4ZHQB 2L82A 2QYHA 1GVHA 1E3WA 5IMBA 4HN4B 1M8JA 4M99A 4Q3DA 4Y1FA 5BMOA 1FOEB 2WSIA 3ZNPA 4YCCA 1XZBA 3OZEA 5HS4A 4R1NA 2G70A 2FRDC 1SEVA 5G4KA 1HDEA 4XD7D 4G5OA 1O5TA 3TIGA 1F4LA 1HE2A 2MYTA 1JR3A 1R2QA 3EGXB 2IYOA 3JD3A 3KR0A 4B6FA 4DQXA 3KZXA 4ZCTA 4KB5A 5THXA 1V11A 1W5FA 4O4HB 1L8OA 1V4VA 3GJ6A 3GFQA 1A0OA 4UE2A 3MUEA 3T7EA 4L72A 3FVQA 1FYDA 2H63A 2EZUA 3R0JA 2D2IA 1ABBA 5AH0A 3FM9A 2HDNB 2G25A 3FSGA 3IOMA 4MUYA 1K6XA 3ABRB 4AQYB 5LOVF 3I52A 3WRVA 1VCHA 1ZISA 4BB0A 1W4RA 2YHAA 1WCIB 1L3BA 3IA2A 2FSFA 3L93A 4L6CA 1FS6A 4PHFA 4YAIA 4LISA 3AHJA 5B6JA 2Y67A 5CFQA 1TXGA 5F98A 5JH7F 3BTSA 4ARUA 4F97A 3Q12A 3AWIA 2YYZA 1FU7A 1QK5A 4H3KB 3GLRA 4L5BA 1MNQA 3V4LA 5K0TA 5DKFA 1DRUA 3IR6A 1OC4A 3LYHA 4K28A 2VYVA 5LNK6 1Y6GA 4IHJB 4RY2A 2X13A 3LC1O 2Y0DA 4D9GA 4ZEOA 1YBAA 1XJ0A 2HGSA 4I5DA 4YH1A 3W9BA 1J07A 1IY0A 3AB8A 3MVEA 4NAHA 5EVCA 1I33A 5FUBA 5T4BA 4BZXA 2QN9A 1XZFA 1PW7A 1CUEA 1QH1A 4E07A 2VK8A 3C2QA 5BSTA 4R2IA 1Y3CE 1D9ZA 2P9JA 1IHPA 4TTPA 1OF1A 4CM3A 4KZKA 4LJSA 2ORYA 3BGIA 2XMZA 3A1WA 4OQXA 2QTVB 1I5RA 1JDVA 3O91A 4UAUA 2R1TA 4YMIA 5LP6A 1M1UA 4KZPA 4J0GA 4ND7A 3AQIA 1LKZA 1UKAA 5CM9C 3IXMA 2R8YA 4IJVA 2ETVA 4DZTA 1S2OA 1IZZA 4BGUA 2CZCA 1Q3TA 1J8DA 3K2EA 3R1IA 4D80A 1DC8A 5ER6A 2VHZA 2AFHE 4JNKA 2ZROA 3SMVA 1RLIA 1UFOA 1XZAA 1SKUA 3NPMA 4XVHA 1EP2B 1LDEA 1DTSA 1E7SA 1NKTA 2X8AA 1DQPA 5D7NA 2OBFA 4G25A 5KX5B 1FQKA 2ABWA 1M1ZA 2O7NA 3D3NA 3R76A 3OURA 4ZI7B 1Q6ZA 4L51A 4AZ0A 1EK2A 2ODAA 4O4LA 1B74A 3RSLA 4QASA 3PDHA 1F0YA 4PANA 4D9HA 3RC1A 5AYVA 1NVBA 4CCWA 1P73A 3TXAA 3EPLA 2A0KA 3OCWA 2B25A 2J0QA 5H68A 4E32A 4Q4HB 2HIHA 1RAIA 2O59A 3L4BC 1SXJD 2JD1A 1E69A 4COKA 3C6QA 5EHZA 1YH3A 2A9RA 2ECPA 3AJAA 4NCNA 3UG6A 2PRSA 4BECA 3BXPA 3E35A 1NLFA 1ZZEA 2G0TA 1IBCA 2NO0A 2MOKA 5F3WB 1EVEA 2I78A 2FTKE 3RVMA 3TCNA 2XQIA 2H1FA 5JMPA 2QSUA 2Y4NA 4L95C 1U65A 1D6MA 1SCUA 1ZOIA 4MEAA 4BIIA 4WZZA 1RXVA 5G0VA 4JC8A 1VXOA 4X84A 1GXSB 4I81A 3T7JA 2VP0A 4UJ3A 2D0IA 4YP7A 1MXFA 1VDMA 2E4VA 4IVNA 5EPUA 5HQJA 1ZI9A 4GL2A 3KJEA 3HRIA 4BEVA 1JF8A 4MEBA 1M73E 4ZQBA 3E53A 1GYPA 1UM9B 3LECA 2R6CA 1T5IA 3UKDA 3IE0A 4LXQA 2P2ZA 3EX7C 1CUGA 2F3PA 4O1MA 2Q3MA 2ZRKA 3HYTA 5JQWA 1JEDA 3FOCA 3CURA 4QC2A 3A58B 2Q0QA 2PBLA 2ZT5A 1NQAO 1SELA 2YN2A 4Q1DA 4ZTZB 1VSBA 5K01A 3A26A 1SQ5A 5KYUB 2CWDA 1C0KA 1MW9X 2Z6VA 1ZW6A 4HQNA 4WXEA 2G09A 1OV6A 3KKQA 1L0BA 3LA8A 4UHDA 2E4AA 4FB5A 3PDIB 3PSAA 2JDID 2W58A 4JR1A 4W8HA 1ULTA 2VT7A 4XGIA 5K4HA 2BI4A 1SVSA 2J7PA 3B6MA 3M1AA 3PR3A 1BC5A 3HRHA 3AIKA 1XPRA 1XLWA 1C5KA 1I7LA 2JIRA 3CYFA 2NTNA 1D1QA 2ERCA 1LSSA 1F8YA 1GGNA 4PRLA 2F6RA 1QMGA 2WWRA 2HN9A 2HTFA 4CM4A 4OH7A 1M5RA 2BZ1A 2J9YB 3LIIA 5LB4A 1J23A 2CD9A 3NGMA 3RROA 3PSHA 4MUJA 2PUGA 1OR8A 2OXTA 4RE6A 1RC8A 4PVCA 3LHFA 2GCGA 2VZ9A 4ASUD 2JG3A 4EIWA 1SOWA 4MI1A 4ZT5A 1N1GA 4C0SA 4LRYA 4B82A 4RVSA 5C52B 2FEKA 3ZY3A 2CNWA 1BMFA 4O4IF 1SCDA 4AWXA 1YDEA 2XE6A 1O5IA 1QQ7A 5M2QA 5AQ1A 1XTQA 1CR2A 1PDVA 2AXEA 3T41A 3DEIA 2QTCA 3DOEA 2V9PA 3PGJA 4PZ0A 3U7QB 4LC0A 5MDHA 3LL4A 4Z4CA 3PP8A 4FZ3A 1DAKA 4MA5A 2IP1A 4GP9A 3H8VA 2FZCA 3PWTA 4MWOA 4XYMA 2BSXA 4UQPA 4R2MA 5BYJA 1OHHA 1KNXA 2XWJI 3I4FA 4ZODA 5EFZA 2I2CA 3C45A 4MS1A 4WOCA 5CYFA 1F9EA 1ZSNA 3BE8A 1WPXA 1Z3IX 2C2XA 4IO0A 4KE6A 4NULA 3T1QA 1F8XA 1TCCA 3ONDA 2O57A 2G0NA 3BXHA 2R751 4F91B 2X8JB 4WSOA 1Y37A 3ZCVA 5BUQA 1YJ8A 3DMFA 2O2SA 1Q77A 4UC0A 4NIMA 1DJQA 2PX3A 4H77A 2ZBUA 4P35A 1KYZA 2H8GA 2P9CA 4PQGA 2EJWA 3IP8A 2HYIC 2J08A 4ZHSA 2X2OA 3F3YA 4P4NA 1ZMOA 1H05A 3BIXA 3I23A 2GN6A 1W47A 3KRTA 5ECGC 1OFVA 3NT5A 1UOEA 5I7VA 3T1OA 2WJAA 2BV3A 4GWKA 4M0EA 5C4GB 4FPXA 1G8GA 2GN4A 3LCJA 1NX6A 1Y8AA 5FCDA 1YS4A 3D1VA 3VJLA 1Z29A 1P9RA 4XGQA 4F38A 2R4TA 4OMDA 2BKVA 3OTHA 4YCAA 2XUZA 3UKOA 3KZMA 2P2NA 5HSGA 4TTVA 3N6RA 1T5HX 3JQFA 2DR3A 3LVFO 2FG7C 2R86A 4G4JA 3KAKA 4AZ3B 1GUFA 5C8ZA 2OD2A 3GELA 1QUEA 1U63A 4PAGA 1XTJA 1MEEA 4Q3BA 4OLBA 2H4HA 3TR6A 3FDZA 3ZHXA 2ONCA 1YKFA 3GJ0A 3V2GA 1QVAA 1Z68A 4KQ6A 1EVJA 2FLKA 3ZWWA 2IGTA 2R6ZA 3I92A 4PFSA 1XFAA 2PH1A 4DJEC 5KJ1A 5D6OA 2WWWA 4U2GA 1XCLA 1FY2A 1AKVA 1MJ5A 1XLTC 3OM0A 1F4PA 5FHQA 1WCXA 3B85A 5M7EA 5ITVA 4NJEB 1R4MB 4FNGA 4X1YB 3ZHZA 5COBA 3HBFA 4URXR 1Y3BE 1T9GS 1L5RA 5BWNA 4N5NA 3TWOA 4LJ6A 1GGVA 4I55A 3F4KA 3GGGA 1MO6A 2GRJA 4MAAA 4ZOLB 3AEKB 3HSKA 3I2IA 4GYYA 1E18A 2Z3WA 2P3QA 3NHAA 4HDQB 5FOTA 3V4SA 4F4DA 4X6LA 1U5CA 4ZC8A 1XD2B 4IIEA 5C35A 4BB5A 2ZBVA 3LXUX 2V1XA 2RKWA 4YXWA 3ICQB 4TL7A 1JHAA 2RDMA 3GEDA 3QXCA 5KSZA 4RUKA 4B6JA 3R9XA 3LJKA 2V7UA 1JYEA 2W2NA 3H6HA 4BKMA 4M0LA 2QBYB 1O94C 3IUPA 3L8HA 4B8ZA 1YO6A 1VHTA 2CBGA 4EJSC 4ZGBA 4PC7A 1U98A 4PY2A 1RWPA 5LDDC 4MWCA 2MJLA 4JXKA 3DB1A 3DAOA 4PHHA 3TK1A 3UAYA 1GR1A 3VA7A 3W3ZB 4HC4A 4TLLB 3D8HA 4TS9A 1E66A 1BQ4A 2XSZA 3NWJA 3AUYA 1C14A 2POQX 4OXYA 2CDRA 2A78A 2XCTB 4FW9A 5JTTA 1BNCA 5JAHA 5BV1A 2WT9A 1ESMA 2O48X 2YXDA 5TNXA 3OAAD 1IB6A 1JAIA 1NURA 2C0CA 2NV2B 3LOQA 1FFSA 2VYFA 4GRAA 2C5SA 2NPOA 5AKJA 1E62A 4K6HA 3SM9A 4M6WA 4C6TB 2O8VA 5A9SA 2FVYA 3W5HA 1AKWA 1GRVA 2HA6A 3K4QA 3WYCA 5DE3A 2Y27A 5GAJA 4DLVA 2CMGA 2DPHA 2IYTA 1NI5A 1Y4UA 2PMBA 4K26A 5IK2A 3ND5A 3V7UA 5KYXA 4ZAWA 1A50B 4ZHQA 2FOXA 1AKYA 5IVHA 2YXLA 3M2TA 3AY7A 3WKCA 1K5DA 2UUOA 2H52A 2HF8A 4V2IA 1PFGA 2WUGA 4L8YA 5DGDA 1FVOA 3BXEA 4AG6A 3RHTA 3HY4A 5JXWA 4D4IA 1NJ2A 3A0RB 1FUIA 1TRHA 2VBFA 4JI3B 2J4DA 3DULA 4PLHA 2AG5A 1I7SB 2ZTUA 3JQEA 2RB5A 2JIZD 1Y1QA 4JJIA 4BPRA 4HNSA 3SAJA 1W5BA 5AM1A 2QLTA 2YR0A 2V98A 4O4HA 3HKBB 4XX0B 4B3IA 4V0ME 3TDKA 2CEAA 2BDEA 3RU3A 1KDPA 1Z8NA 1OI7A 1K6IA 3Q7QA 1LZKA 3VNAA 5ITZB 3Q2OA 5J1TB 2I91A 4KQJA 1K4YA 2O3JA 1NFFA 2WKQA 4IWYA 4MUFA 2C57A 1FFDA 3DYIA 4FBLA 2G9UA 1ZM9A 3VU1A 5E9WA 2PLNA 4LF5B 2Q5OA 4BNZA 4CDNA 1WCIA 3N1UA 3R0IA 1CTQA 2G36A 2V8BA 4MWDA 2Q7OE 2OB1A 3SVTA 4CMCA 2NACA 5JROA 4XCVA 5LKRA 5G0UA 2H9YA 4Q82A 2WPNA 3RFCA 1IRXA 1JHRA 2NGRA 1ZUIA 3WKBA 2DBVO 2XUPA 5CXXA 2CJYA 3PQ2A 1KERA 1Y5RA 5FXMA 5E38A 2ZIUB 4IHJA 3MRSA 5KNBH 1Z25A 4FGZA 2O0KA 2BGRA 3PC8A 5IKPA 4D9MA 1I36A 4HK4A 4NE2A 3ZQ4A 4M0UA 2H6EA 3PWZA 4W9MC 5KKNB 1D03A 1KE1A 2B9VA 3RV3A 4X64B 4YQEA 4AN4A 1DAFA 1GN9A 2W71A 3CCFA 5AM5A 2II6A 5AW0A 2R2GA 4KGVA 4C03A 1PO7A 2QTVA 4X6UA 3VM6A 2OHIA 4XKJA 4E14A 1SG9A 1UAGA 2FAXA 4GGOA 2AJCA 3A9RA 2Z57A 4QFDA 3WJ7A 4AIRA 1HH4A 2PBFA 4EUEA 4OK6A 3OEYA 5L4NA 2YMQA 4US1R 5HM8A 1DQRA 4RTQA 1V26A 4GI3A 3AMVA 4M0PA 3D3EA 3EGEA 3A28A 4LDNA 5GMOA 5DNDA 4HB3A 3BFXA 1XTBA 3OECA 3TSYA 5CLJA 2ZR0A 3M83A 3RPEA 4BTLA 2JAQA 2HBZA 1B41A 1DDOA 2RK6A 3EVCA 2VH1A 2H07A 3F6YA 3N28A 2P9EA 1TUBB 2GZ1A 3E9DA 3TFWA 4DA8A 4I1IA 1U81A 2GPJA 5BWCA 4KR2A 4HH0A 2C20A 1VJTA 4HRAA 4EATA 1X92A 5B7NA 4EMUA 3CB4A 1LC0A 1T2FA 4Z3DA 5JSHA 3KVVA 3HM2A 1Z36A 4H6PA 2FE1A 3BBLA 5CCDA 2J31A 4BYMA 3W6NA 3HNPA 2WYVA 1P0MA 1XIVA 4FDVA 1MD9A 1PX0A 5BSWA 3OKCA 2UZIR 4KDCA 3SU8A 3ZHYA 4AECA 2P4SA 4EI7A 3H83A 2ZUUA 1J21A 2V7GA 2ZIZA 1LI7A 4NOKA 1U28A 4YACA 1QGYA 4KO4S 1XKQA 4U2CA 2QE6A 1QZTA 3P45A 4MKFA 5ULLA 5JC1A 1G4AE 5AOCA 3AILA 5H7XA 4DV7B 3TRHA 3RYIB 2ZREA 4F8EA 1NVFA 1BVRA 1GXSA 1W85B 3PE6A 3NTUA 3ZQKA 1IAVA 2VOJA 1WNFA 2I99A 3SK0A 1ZGJA 5A4IS 2SECE 4KXYA 4HYTA 1L7PA 4Q3EA 1PJRA 2F17A 1R66A 1KOJA 1QF6A 1UBJS 1UM9A 4J1TC 1ID1A 4BNTA 2QZSA 1PNVA 1S89A 2A4MA 3SOZA 3UK7A 2WJIA 1XCGB 4O63O 2WPDD 4E11A 1XQWA 4DDTA 5F52A 2A3RA 4B45A 1SU4A 2WUEA 4NZZA 2G28A 3DWFA 5C1PA 3C6BA 4Y9UA 2YH2A 3L1JA 1Y81A 3VU9B 5KYUA 3LV8A 2QU8A 3PJEA 1CRZA 1CZRA 3OHMA 4YBZA 2XNHA 1RXWA 2G1AA 4JX8A 1UL1X 2APJA 2IIPA 3PDIA 4YRKA 1B2LA 3HU1A 1IBLB 1KEPA 4OQQA 1JKMA 2XTJA 4FNMA 4FEEA 2X7JA 2HMVA 1FLNA 3C6MA 4W99A 3UXHA 2XYPA 1Z7BA 1G8SA 2XMCA 2IXBA 4E5UA 1P9WA 2PRJA 4JBWA 3DM9B 3K09A 2PZJA 5EL0A 2W22A 3DG9A 3KJQA 3I5MA 3H9EO 3DKIA 3O92A 1SUBA 4MVJD 3RW9A 3I0NA 1X8LA 2C4UA 3L8DA 4EGQA 4ZN6A 2RKBA 3IMGA 4BP9A 1Z8DA 1L5ZA 3W7AA 4RANA 4R7GA 5AVWA 3KB1A 3L8CA 3AKEA 1ZD4A 3LXXA 2CFRA 3UHAA 1UJNA 4FN5A 3C7CB 3K1TA 3P9NA 4QPPA 4B80A 4QG7A 2ZCJA 1ZC4A 1XXHB 2HA7A 2PKYX 2X0EA 4H1WA 4MLCA 1TO1E 3VNRA 1XJCA 5C80A 1G8FA 4BVGA 3PZRA 2A5GA 1YZVA 4GP7A 4Q3CA 4UUOA 1C7ZA 3AM1A 1Y6QA 2DHRA 2CXRA 4HQOA 1CV2A 5LBUA 3C8UA 1BXRB 1D2RA 2W6NA 2FHSA 5CEFA 2RBKA 3B9PA 2WC1A 2BEUB 2Z1NA 3CWZA 3GF4A 2BW0A 2C7PA 3AVXA 3HG7A 2PS9A 1Z08A 2OVBA 3C3KA 4H6WA 2HFKA 2ZSEA 1N5LA 5BOVA 1GCUA 2WTBA 3P1JA 4FR2A 4DSNA 1UZUA 3TLAA 3DXFA 2HLDA 3OE5A 1E94E 1YACA 4TLDA 4WFIA 1X7XB 4FFPA 4AJOA 5BVGB 3ZWQA 4YIKA 5L7WA 1FUEA 2B3TA 1PDWA 5MF6A 1Q0TA 1NT2A 3EVTA 3S40A 2LDXA 4ZA2A 2GNOA 1NW4A 3DLHA 5LBIA 2X8JA 4F0JA 3MGGA 2OHXA 3L2OB 4JQZA 5JRDS 2YV1A 3IP7A 4YECA 3VPSA 3KQNA 1GKIA 5ALLA 1M2WA 4CG2A 4E0BA 1DCFA 2BRUC 2GBFA 3RREA 2O05A 2FSUA 3K30A 1XPUA 1GOTA 2JD2A 3HJFA 2BHSA 4LI3X 2HA0A 3NV7A 4BGIA 1RP1A 1SA0B 5D87A 4TM8A 1T0IA 1K7FB 3DQQA 4MV1A 4PZUA 4YRDA 2XECA 3GNSA 1APBA 3VNVA 4LTDA 1L5VA 4C5BA 1X7ZB 5BN3B 1GKUB 2JRLA 5M3BA 3VC7A 4CUZA 5LM3A 2PGLA 5DVZA 1EK0A 2XITA 4PPYA 4EA8A 2GBPA 2O06A 1U31A 1QH9A 1JJBA 5SYNA 5KTKA 2FR1A 1Z5VA 3MN1A 1C9EA 3SLRA 1P1RA 3WAGA 1RQGA 4RVOA 5FORA 4ZGGA 2QTMA 1QYVA 3TI7A 2BFBB 4AZ3A 4EFLA 4V38A 3M34A 2ZPUA 3WKEA 3BIFA 1GUBA 2AHRA 1C8BA 5IU6A 4B17A 5KYWB 3UB4A 1ZD5A 1UK9A 3BMNB 3WL4A 3FWHA 4FYVA 1E7QA 4DIFA 5BUSA 5CITA 3NP9A 1RJ9B 1EFHA 3RS9A 1OFIA 2C84A 1I7DA 3N2KB 3U7IA 4NJEA 1R4MA 5IANA 4X1YA 5CM2Z 1A5SB 3A3YA 2ZRBA 4GM0A 4U7DA 3K0CA 3LQ2A 4C20A 1SCBA 4C01A 3DAFA 3AEXA 1F1JA 1R5JA 3KZVA 3QBVA 4Y2JA 1H2YA 2V3WA 3PD1A 4OCZA 1PZEA 2VHCA 2W2KB 2E9SA 3M9LA 3BJIC 2OCDA 2MYNA 4O2AF 4NABA 4ZOLA 4QDJA 3AEKA 1EUQA 2UZAA 3MCZA 2BGTA 1YVEI 3KAPA 4XTRA 2GT1A 3DHWC 1CJTC 1XA3A 1XD2A 2I3GA 2IUSA 1EVZA 2EKZA 3FKQA 4PTZA 5F9FA 4ENSA 3NALA 4ZQFA 2BD0A 3JS5A 4PBSA 3EA4A 3G85A 3LCMA 3VOAA 4BB9A 3IIIA 1QVZA 1NUHA 2ASEA 4NV3A 3N6VA 1CU1A 1PIWA 2QBYA 3EZ9A 2BUBA 3L6UA 4BFSA 5JAUA 4WXHA 3R44A 4QM6A 4XB1A 1WUJS 3BXXA 3RB8A 1BD4A 1T3GA 5DBOA 4RTOA 1U0HC 1HDZA 1VJRA 2ZB3A 1B0PA 1N9ZA 2O0MA 4AMYA 2Q6VA 4FN4A 2R48A 5BSVA 1JUDA 1T5SA 2IHJA 3IE2A 4OATA 4WASA 4FFVA 5DX0A 4Q3KA 3THOA 3TZQA 5A7GA 3VGJA 3KLBA 2CKMA 4WPGA 3AX6A 1C3VA 4GI7A 2JH8A 3WNCA 4IGIA 1LDGA 4JLDA 4IFIA 3CLSC 3HR4A 3N76A 5EKDA 4DJJA 1OFTA 2PSFA 4IYJA 5ELXA 1RT9A 3OJWA 4UTZA 4YJ2F 1NW5A 1Z7WA 4XDYA 5KWVA 4BNKA 2CLMB 4BQPA 1ADBA 1BDMA 4IHAA 4NJMB 4OXKA 4C6TA 4N3NA 3SNKA 4QUHA 4OP1A 5AUQA 3PJGA 1SXPA 4FINA 3EFOB 1VL6A 1S4MA 2W8BB 3PFBA 1QCZA 4TN1A 4GLFA 2CXHA 1E4VA 4M8IA 1F12A 3DOOA 1DQNA 1SIBE 3FTDA 2GJKA 1BSVA 3WI7A 3N07A 3A2KA 2HCJB 1Y7TA 1E61A 1TX4B 1WUTA 4U1RA 3PK0A 3ZR4B 2P9TA 3IP5A 3COZA 4ZVRA 4Y3UA 4CN8A 4MJLA 3VPHA 1DEKA 2CE7A 3NHPA 1ZJJA 4Q9HA 4GYKA 1Q7GA 1R5NA 1R8XA 3BHIA 4W8GA 3HKBA 4XX0A 3KCQA 4J0KA 5FOVA 3KJIA 5GGXA 2YBDA 2IEDA 4JR2A 4D57A 3HACA 2LPMA 3W2IA 1M2GA 4M1QA 1V5EA 5ITZA 3WQHA 1U7HA 1UXIA 3QNUA 4DYVA 3PQDA 5DV9A 4Q7LA 4GGMX 3A9TA 2VEOA 1I5EA 4D5EA 1PF7E 1ABFA 3MB5A 1NMXA 1VHWA 3AR9A 4M1EA 3WGZA 4DR7B 1ODFA 1QHSA 4FMBB 1QDUA 3ANTA 3OVMA 5YASA 1XN1A 3GNQA 5CDHA 4EW3A 3EZ7A 1T0UA 3L1KA 5SZHB 4B4WA 4EFNA 2J5QA 4YAUA 5IF9A 3DQPA 1ODJA 2QM8A 2WK1A 5E4JA 2IELA 3ILHA 4CWAA 4FOSA 2GILA 1MOPA 2VDVE 4V24A 1A8UA 1IPFA 1T3HA 4LDPA 1VP9A 3IUYA 1MORA 4HDAA 1T8YA 1CDDA 1DFIA 1PKXA 1NBWB 2LW7A 3KVOA 3VTAA 1K7YA 4JVSB 3NDBB 5C46F 3BGDA 4RULA 4DMFA 4YCLA 2QTWB 3N5KA 5DDIP 4QIHA 3UICA 3ZOZA 1JJ7A 5IXSA 2G82A 5F2EA 1W581 3RWOA 5HXAA 3O93A 2ZJAA 2FEAA 4N8DA 3I9V6 3IHTA 1CY7A 4JLWA 2VN8A 3RSSA 1OTHA 2XE4A 5AW1A 1A7KA 3DGEC 5JAMA 1C7EA 4I08A 2ZUEA 1SVKA 4JLSA 1QF9A 4LXTA 2B36A 2QE7D 4MRSA 4EI8A 3GA7A 4MUKA 1FMJA 2DPLA 3D5QA 3MSXA 1N6PA 1H9AA 3ZWYA 2OXRA 3O4JA 1O8BA 4A4DA 4DC9A 3NRBA 5JIBA 5K6AA 3S5JA 3WK6A 4HNRA 3L7OA 4EVRA 4A36A 1PZMA 4EG4A 3JZDA 2PA3A 4LS3A 3WRXC 4QECA 2P2GA 3OTGA 3ZDRA 1NW8A 1V5GA 4F3TA 3DL2A 1V9SA 1TUBA 1CQPA 1X7WB 2M6KA 2QJWA 3DCJA 4C89A 4LVCA 5K4GA 1IFXA 3B89A 2CSUA 1IY9A 3C4QA 3PD0A 4P80A 4RO0A 1QIJA 1ODKA 5T5QA 2REXB 5TPZD 4PIPA 4DQUA 3EISA 1OOEA 1HEUA 2XVYA 1JJFA 3BX1A 3EF3A 4MYUA 2SKEA 3DZBA 3FJOA 3LF1A 4R2JA 5EIAA 4FEYA 1RHQA 2P75A 4GR9A 3FG9A 3SG0A 2QX9A 4E4RA 2BGNA 4GZLA 5LP6F 3KZOA 3DOJA 2XQJA 2Y77A 3CLUD 4PLFA 2FZKA 4IJWA 4QFCA 1U7PA 4WL0A 5EZ5A 3OESA 3PDUA 1V4NA 3EXEB 1ECJA 5DTEA 2ENUA 3VR4H 3R5FA 1UK6A 4EZIA 4KLRA 1FUUA 2BONA 3DOHA 1HYEA 1EIZA 4C4PA 4CIAA 1CUAA 4LAFA 2IPMA 4JNCA 1H8HA 2DQZA 5B3KA 4Y9DA 1I4LD 2AE1A 3K6RA 3RYIA 1UZNA 2GCEA 1W85A 3HCCA 1OW3B 3F7OA 4K9RA 1DVRA 1F8GA 2JIDA 5EUCA 4B48A 2VHVA 2G8NA 3AERB 4YWJA 1VJ0A 4BX0A 3GYGA 3W2EA 3IUSA 2NXWA 3L0DA 1Q6YA 4LBWA 4WACA 5AICA 2D7JA 3UJ9A 1D7AA 1I3NA 2FPIB 3GUZA 1L3CA 1A8PA 1MC1A 5IWCA 3KPJA 3CN7A 4UPVA 2P2DA 5JANA 3HQ4O 1R4NB 1J2JA 4GPAA 4N0DA 5E2IA 7ABPA 1W34A 3QKTA 4KQFA 3EZGA 3VU9A 3U4DA 1KYIA 3VR3A 4I9FA 3ZWAA 2B21A 4QATA 2ZB7A 1QG2A 4ZO4A 3SHQA 4ZCMA 2HHLA 4DWOA 2WLSA 3BA6A 5LUBA 2VNSA 5I51A 3F5QA 1GSHA 1UCFA 2QGZA 4LSWA 3HBMA 3CX8A 4Q7JB 5HTOA 2W43A 2DF8A 3AT1A 3UOAB 1GV0A 2OV8A 4S04A 5EGSA 1Y9DA 4AS2A 2P67A 3D5TA 4TTJA 3UWPA 3RE1A 2IYRA 2V6BA 3RS3A 3UEOA 4XLZA 1O0BA 2HWWA 2ESRA 2QM0A 1H23A 1HLPA 4FYPA 2I2WA 1N5MA 1MENA 1WG8A 2WF7A 3F6EX 3QPCA 4YVFA 5BRNA 2KLHA 5CCEA 1Z6YA 4KBGA 3GJ7A 4RY9A 2VYNA 3LYLA 1G4HA 1TMYA 3UWMA 2B78A 3AI2A 4M9UA 4ZXFA 3DWGA 3CVVA 4WAUA 1XXHA 2J5KA 1T2VA 4G5YA 3PPVA 1WTCA 2WYOA 4L02A 4PZAA 4EVSA 2QQ5A 3TVDA 4CLRA 3HM9A 3UMFA 5B2EA 2J67A 2NN3C 2OWEA 2ZSFA 2DAPA 4Q01A 5ALDA 2AUTA 3BTOA 4H7EA 2HK6A 4MGHA 3KB8A 3VHXB 3BREA 1ZAKA 1BXRA 1K3FA 3KUCA 4BOYA 1BDJA 1Z82A 4ILKA 2EDAA 2M6RA 4PIMA 2QRQA 2BEUA 2XKJE 3S81A 1IK4A 3QLUC 4ALLA 2F8LA 1L8LA 1MEOA 2CXQA 1WS6A 4H4CA 2PSSA 4WCVA 1KARA 3VC1A 4DDVA 2GKSA 1VLZA 1C3XA 4EG0A 1OQAA 1RWOA 2DFLA 4MVYA 2P79A 4P36A 4YDHB 3I61A 1T4CB 3IO3A 4IIGA 1ZP6A 4X94A 1MMFB 1A72A 1EUDA 1FP6A 1GCIA 2BH9A 1X7XA 2Y9MB 5DFAA 5BVGA 1EIWA 2NTEA 4AJEA 4BMPB 2O07A 1U0LA 3IAM6 4I14A 5AKXA 3KJHA 1MGOA 4GOLD 3AHEA 3HV2A 4JQCA 4CL0A 2ECKA 3G0IA 3IB6A 1J24A 3CVXA 4TUYF 1Y6ZA 4FHEA 2FLVA 3SF8B 2PV7A 3SX2A 3TKLA 1IJEA 4G5FA 3H0KA 1P75A 2IPOA 2YL2A 2O20A 3NM4A 1A27A 4CQMB 3OZTA 1AHIA 1POXA 5K99A 2CK3A 1A76A 3INNA 4DA9A 4E2YA 3ONEA 3CR8A 1SA0A 1U2GC 4L4XA 5D51S 4P9NA 1H3FA 5AXAA 2KX7A 4DR1B 1EGHA 4FZVA 1WDMA 2XEXA 3OFKA 2O9JA 1KY3A 4H7FA 1QX3A 1YNOA 4M89A 4BJ3A 3PLRA 1X7ZA 3OEEA 1J97A 3DZKA 4KI0A 3UAWA 5BN3A 5K6TA 1P1IA 1TEVA 1GRNA 2ZYIA 4LYHA 5TMPA 3ZYZA 3ZWCA 4M88A 3U4GA 1XWIA 3CRNA 1NV9A 5AI0A 4M0FA 4A8JC 5BUCA 2Y2UA 4I4NA 4J94A 5DCWA 5MN5A 4IBOA 1XTKA 1E98A 3ASZA 3L7LA 4YP1A 4GGPA 3KOOA 5DK4A 2BFBA 5AI5A 2FDXA 1QYIA 2PL3A 3I9V1 5JNUA 3MPOA 1P1CA 2YWFA 3KDAA 2C7OA 1YOVB 4YRAA 5KYWA 1JVSA 2GXQA 4GPTA 4IIYA 1QU2A 1FQJA 1AF4A 3BMNA 2DY1A 1EE9A 1VC2A 3AOGA 4G5GA 4R54A 4YGYA 5AD1A 16PKA 1NW9B 1X8KA 1RJ9A 1F17A 8AT1A 1MVNA 1ZBQA 3RS2A 2C3YA 3SZLA 2D2XA 2WVAA 3N2KA 4V0KA 1ECBA 3QJYA 4UEOA 4IQ8A 2BSAA 3FFTA 3I0ZA 5E1OA 3TOXA 1TOAA 4RYDA 2V55B 1OT3A 2ZXUA 3QFFA 1O0SA 3TUZC 4N76A 5A7FA 1EFRA 2W2KA 1ZR4A 1TJPB 3F4BA 1JTVA 5TEWA 2D5CA 3TNJA 2ZP1A 3PFCA 1S2MA 2D7CA 3NO4A 4GI2A 3ZE7A 2PYIA 4ZRNA 4BMOB 1JJVA 3ORYA 4MGZR 4XQGA 4C3OB 3R5XA 1RSZA 5A0TA 1U9JA 1S8NA 4JY7A 4AF8A 2C9OA 1Z0KA 1TLTA 2IZ7A 4TMTA 2BC9A 1LPAB 4BFUA 5JH7A 4EO7A 2Q8QA 1A9SA 1V8DA 1SCKA 3PEVA 4HEJA 4HZGA 3DE7X 1JHDA 1JEQA 4RDXA 2MTBA 1IZYA 2A88A 2VPXA 5GONF 1H1LB 1RXYA 4ZQHA 3UYKA 2O2YA 4EG7A 2N47A 3DPSA 4G8CA 3E9RA 1IIRA 4JX9A 3W90A 3VBCA 3EC2A 3G02A 3GDHA 4GMKA 3O7WA 4B4DA 4BZQA 1CK4A 2PBZA 5T4HA 1DADA 3IP3A 4TS1A 1Z47A 3ORQA 4OU5A 4ZVUA 5C53B 2P0YA 5JFTA 2J9RA 1U0FA 4MKZA 4DCJA 1BE8A 1P29A 3AV0B 3ZDZB 3OUUA 3E8MA 1M8FA 1PP4A 4H60A 4OAPA 3ZN2A 1LFAA 1OGYA 1D0IA 4LHVA 4PYOA 3FGOA 3KQPA 3H9QA 4IUDS 2MR6A 4NJMA 5DHRA 5FA5A 3RIXA 4Z7JA 1AGNA 2ZJ1A 4ZTBA 8ABPA 3A3PA 5E9QA 4GKKB 3OZXA 1M5TA 1TYAE 4HZUB 3EFOA 2FV8A 5F7XA 2W8BA 4C05A 4MYSA 1AMNA 2I9PA 5C7OO 2PZFA 2H9AA 4AUNA 1CF2O 2VI5A 4WZBE 5J3JA 3WNBA 3H9CA 2YVKA 1MJGM 4AK9A 2BLLA 1U0RA 4YTEA 5JOQA 4D3XA 4TTRA 3DC7A 4A0QA 1OAOA 4DY4A 1R0KA 5EHXA 2WNHA 1S6YA 2RC6A 2FZ5A 2F4VB 1NL3A 1TYZA 4LZJA 3KEMA 5E4TA 1PYGA 3SSNA 4RJTA 2VC2B 3DW3X 4IYRA 3WRYC 1TKRA 2AFHB 4MH0R 2R47A 3GPCA 3P9XA 4X1KB 2BMEA 1PJ4A 4LTMA 4YI3A 3VR2D 1OIVA 4HQLA 4Y2SA 3ZJYA 3WDSA 1DPGA 4S05A 1GDHA 3TQSA 1O0CA 1T2DA 2O4CA 1KBZA 2HSDA 1WXQA 2HDWA 4EKNB 1K2VN 5C32A 2PX4A 1NASA 1H3NA 4OHBA 2LUOA 3IPLA 4W5HA 4DCPA 4DMMA 2JFGA 3QWHA 4X0EA 1GZUA 2HHJA 3PA6A 4ZHQF 3T1HB 3EMBA 3L0PA 5EKUA 3WL5A 3HCAA 3QKWA 4G5XA 2RGGA 2O1WA 1JJIA 1UF9A 2XVAA 3P52A 3E5RA 4DE5A 3MTGA 2JGLA 3ER6A 3TEMA 2GK6A 4G4IA 1SU7A 4NX2A 5BQFA 1GFWA 4EEXA 1FSSA 4JIGA 1TJYA 3U4AA 2AOXA 2RE8A 5A3SA 3UMYA 2GZ2A 4BYGA 2RCYA 5AVSA 5KC8A 2V5AA 1YDMA 4X6YA 5L7TA 4MW7A 2OP1A 4D4LA 1CDOA 3EH2A 1JQBA 3AEZA 1BYIA 5EMLA 1IJKA 2COEA 2NO9A 3OMXA 4D82A 3E48A 2Z30A 5AW3A 1QDLB 3IAM1 2I80A 3VAAA 2J5XA 1PWYE 1OX5A 4JBIA 1WZCA 5L40A 2IY9A 3ADCA 4NH0A 4TLAA 3LMKA 3EWNA 3OICA 1WBBA 2CV0A 5K8VA 3DTVD 1QIHA 3P2YA 3I34X 4QYWA 4RMGA 1ZL2A 4IQ0A 3M4YA 2BTEA 2O2GA 5CDUA 1JDSA 3IQDB 3F97A 3EZ6A 1XR3A 3W9SA 2YYAA 4U7HA 3MM4A 5BQOA 1J39A 1N9GB 1QOQB 2X2EA 2Y1EA 3B70A 1CDEA 1EZ4A