4OKIA

X-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
b'NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phthiocerol synthesis polyketide synthase type I PpsC
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Insights into the catalytic mechanism of the DH domain of the Mycobacterium tuberculosis polyketide synthase PpsC and architecture of the beta-carbon processing domains
rcsb
total genus 63
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.41: Beta-ketoacyl-[acyl-carrier-protein] synthase I.
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4okiA00
2YQ4A 4ALIA 1E1MA 5DULA 1QSGA 4H16A 1XSEA 1A9YA 1HDGO 2VUUA 1VJ1A 5TRTA 4DIOA 2I76A 1Y6JA 4K28A 3EY4A 3EDMA 4PVDA 2AE2A 3JQCA 4A73A 4DL9A 1X1TA 2Y99A 4W7HA 2BGKA 4D46A 5G0UA 2Q2QA 1MFPA 1XQ6A 4DBVO 5JS6A 1T2DA 2QZ9A 2ZB3A 2JD1A 4CLOB 1BGVA 3M1LA 4N5LA 2X23A 4MVJA 4YQYA 4XDYA 5HTOA 5B4TA 4ZHSA 3LF1A 3GR6A 2G76A 2P9CA 4G5HA 3A28A 4CR8A 1XDWA 3L9WA 2VTEA 3H65A 4ZU3A 3GAZA 3CIFA 4D3FA 3E6AA 2Y67A 2GSDA 2FP4A 1Y8RA 5BQFA 1MG0A 3GVXA 2EW8A 4AG3A 2VWHA 2BGLA 1I0ZA 1W4ZA 5CAEA 5T8KC 1LEHA 3HDJA 3DFUA 2O48X 1T4DA 3FPLA 3VTZA 4GX2A 1ISJA 1I3MA 5TJHA 1MG5A 2J3IA 2EWMA 3KM0A 4AJHA 4Y98A 4NFSA 1Q0HA 3R6DA 4L74A 1VPDA 2DBVO 1LDNA 1IYZA 1Y81A 2ZTVA 3PDUA 1ISMA 3QWAA 1U2DA 4IY1A 1I01A 4AJ1A 2VYVD 5JMWA 3BAZA 2EJVA 3OIGA 4XYLA 3CEAA 2JHFA 5KJCA 5HM8A 3KB6A 3DZKA 1EMDA 3DDNA 1PZGA 4CMBA 3RJ5A 2B69A 4II2A 1DIRA 1TI7A 4NBWA 3OECA 3UXYA 2W90A 1ZK0A 1E7SA 4FCCA 1I5RA 3KUXA 3AU9A 1WDLA 1TT7A 4YJDA 3ZW9A 1KIFA 1UR5A 2UYYA 4OH1A 1H2BA 3RFXA 4CUKA 1XWFA 3PHHA 4J0EA 3B1FA 5EIOA 4RDIA 1XCBA 4J90A 5C7IO 3ZWAA 3GAFA 3DBVO 5L45A 1QMGA 1IPEA 1V35A 1SZJG 2WWRA 2YHIB 5DBIA 4C4OA 2GZ2A 1GEGA 4PG4A 4WCFA 4AJ2A 4IQGA 3C7AA 4ALMA 3MCVA 4JN6B 1YKFA 3JQAD 4DPLA 4E12A 1N7HA 4CM4B 1Y1PA 1DAOA 1SMKA 3C85A 4AFNA 3ICPA 1J49A 1E3SA 1Y5MA 3PDJA 3DOCA 1KERA 2AE1A 2O3SA 4IJKA 4CUZA 3OA2A 3QV1A 4RVGA 4XCVA 4NK5A 1C0IA 1ZO8A 3GFGA 5TJ9A 3UCXA 1SB8A 4WOKA 3GC6A 2CMDA 1NPYA 1X13A 5C5IA 5CFZA 3TL2A 3INTA 3L6EA 2FR0A 1EUCA 1WVGA 3ROMA 2NUAA 3LSYA 1ISIA 4TKLA 4RCVA 4DIFA 1LLCA 1P44A 4J0FA 4WJZA 1RKXA 1ISGA 2IYOA 1ZEJA 4E4YA 4FIZA 1WMBA 4XZ3A 3FRJA 2P9GA 1CETA 1M66A 2VYND 2Y0EA 4J1QA 3V5NA 2Y1CA 3ONFA 3B1KA 3RUDA 1YJQA 3IOYA 1LNQA 2QIOA 4KOAA 1U8FO 1X15A 3JYPA 3K5PA 3T7CA 2CD9A 3CMMA 1DIAA 2YQ5A 4CM6A 4BUCA 3PTZA 1EBFA 1P1FA 2ILTA 1UAYA 3UVEA 1ULSA 2GERA 4IUYA 4FGSA 1TLTA 2UAGA 4B3IA 2HRBA 4NBRA 3PHGA 3X2EA 1DJQA 2BD0A 1UXKA 3CSDA 2YW9A 2CDBA 1DAPA 4XEHA 5DOVA 3OSUA 4PZDA 3HN2A 4LW8A 1ZK3A 2D1YA 3E1KA 4P22A 4BNNA 3WNQA 3ENNA 3UCEA 5A03A 1E1KA 1DB3A 4CLRA 1O95A 4GSLA 1HZZA 4RVFA 1DLJA 1I24A 3TRIA 2NU7A 4WLOA 1UXIA 2IZZA 2Q99A 2W8ZA 2PZMA 3EHEA 1PEDA 3TZ6A 1Y9EA 1KEVA 1UP6A 3SLGA 4D43A 3GGOA 1Y9AA 1B8UA 3I52A 3ZWXA 1MV8A 3ANNA 1VKNA 2Y05A 2OXIA 3F4BA 4PLVA 4RO0A 4YJGB 1P45A 1YE3A 4J9VA 4DC0A 1HYGA 3SLKA 2FR1A 2W4QA 3ONEA 4R9RA 4J1SA 4CV0A 2VWGA 4BNHA 4W82A 4AJ4A 3IQDB 3AM4A 2FY8A 1XHLA 4M49A 3ZWCA 1YONA 4EUFA 4E6PA 4BL5A 2P9EA 2X5KO 5JXWA 5TT0A 3G0OA 3WYCA 2Y1OA 4B4UA 3GRKA 4PRKA 5T6BA 3S1LA 1CWUA 4LMRA 2QRKA 4E2WA 9LDTA 1ARZA 5CDSA 4ALNA 3VAZA 1GUZA 2EG9A 3U4DA 3C1TA 4BV9A 1DEHA 3RIHA 1TVEA 3TZHA 4IXWA 4R68A 2D0IA 2FZEA 3T4XA 1YBAA 2A35A 1FDUA 2BI8A 1JDJA 4BNIA 5A02A 4M1QA 5I7EA 1N1EA 3LC2O 3VZQA 5COQA 4B4OA 2D5CA 2VNSA 3BMOB 3PZBA 4FFMA 3FHLA 1PU2A 3KHUA 1B15A 4HUJA 3DBLB 3PWKA 2CDAA 2JD2A 2R2GA 4PG5A 2ZCUA 5A5FA 2CDCA 3VH2A 1Z75A 2Q46A 1HLDA 1A72A 1MLDA 3K31A 3V2UA 4Z6KA 5FF9A 3HHPA 2AQIA 3L77A 2JCVA 3ITKA 4CQMA 4PIVA 5DDIP 3TOXA 1R16A 2X0IA 2HCTA 3RI3A 1L1FA 4RL6A 5JFOA 1Y8QB 4WNCA 1PJBA 2YY7A 5IN5A 1Z73A 1LLDA 3KSUA 2O2SA 4RZIA 1OC4A 3K96A 4J2OA 2Q3EA 4YAGA 3KVOA 2FR8A 3FTNA 4AVYA 5JAMA 3ZWNA 1M6WA 3AY3A 1QRRA 1E6WA 4FJ0A 4I5FA 1WPQA 4IQ0A 5A04A 2AHRA 2NVUA 4BGUA 2H9IA 4GLLA 3FNEA 3ROQA 3PWSA 4CMJA 1U4SA 3BMCB 3GHYA 4CM5A 4YAKA 1BXGB 5KVSA 1X7DA 4B3JA 2UUOA 4ITUA 3G3EA 3OHSX 1OFGA 3GDFA 1GY8A 3WSWA 1VI2A 3WMXA 1O8CA 5A3VA 4WNIA 1U1IA 3RC9A 4BO5A 5I9NA 2JCXA 2I5PO 4F6LA 3RUHA 1KY5A 2GN6A 2W2LD 1PZHA 4NBTA 1KC3A 3LF2A 3IKTA 4E13A 5BSHA 4LVUA 1BHSA 1PR9A 4CV1A 1ZK4A 2C20A 4ND5A 4Q3EA 4CM1A 2OOSA 4YEDA 3K9QO 4D45A 5BSGA 1ISFA 4WCFB 1SCUA 2NV6A 2Z1NA 3FNHA 3S2EA 3VPSA 2Y1GA 3V1TC 4XQGA 3CXRA 3KTDA 3CMCO 1ENPA 5JO9A 3T4EA 2EKLA 4WPGA 4A03A 3DHYA 5CHEA 2WEKA 1PL8A 1YOVB 1UUFA 4WKGA 2ET6A 1EUDA 5JE8A 1YJ8A 3BIOA 1W6UA 3GG2A 4HWKA 4PLCA 4PLTA 4ZQBA 5KJ1A 5KJEA 1YOVA 5JAQA 4YPOA 3GHHA 4EYEA 1Z6ZA 4BB6A 2Q1TA 5B37A 1IL0A 3U9LA 5CG2A 3JQ7B 1GR0A 1EK6A 1QV6A 3BMNA 4HFJA 5IXSA 3S55A 3PHIA 2VHVA 5DCWA 3HNPA 1LC3A 4QEDA 3UICA 4P4LA 1IHYA 4WASA 3S2GA 4NK4A 5IAAA 2X7HA 2X0NA 4OKNA 1P3DA 2JHGA 3ADPA 2YYYA 3ULKA 3PFWO 4RV9A 4NR0A 5F1OA 4GH5A 4XB1A 5AVOA 2GD1O 5B1YA 3PP8A 4DBZA 2NSDA 3NV9A 2PV7A 4EDFA 4LISA 4QTZA 2CSUA 2DVMA 1PJ4A 3DWFA 5EPOA 1S7CA 4Y6RA 1SC6A 1WAMA 4H7PA 2NACA 1JU9A 4OAQA 3UW3A 4Y8VA 1RWBA 3QQPA 3WTCA 4ID9A 5JCJA 4I9UA 4BKOA 4DIBA 4HBGA 2BKAA 3RASA 2R6JA 3O8QA 3CUKA 3O8QB 3RUFA 5I8ZA 3AM5A 3CH6A 3D0OA 4JXKA 4U0JA 2Y1DA 5JNLA 2E6UX 2FZWA 1HSOA 4RPKA 1KEPA 5JDCC 1YH3A 5L4LA 1B3BA 1S6YA 1KVQA 1ZSYA 3JD0A 5CEJA 4IXTA 2DM6A 3W4JA 3UOGA 5G0SA 5DF1A 1LBEA 4L4SA 2GCGA 1PGOA 1U7HA 1UP7A 1XLTA 3I23A 4ND1A 3Q6IA 3ZWOA 4EUEA 2AQ8A 4RDHA 5ICMA 3HDQA 4TZTA 5COAA 1HTBA 1PTJA 4AJLA 4HNGA 1U3WA 3IAHA 1EDZA 3GVPA 3PHJA 1JW9B 2AEMA 5CPBA 2AEJA 3DBLA 1I3KA 3RU7A 3ABIA 3ZHXA 3DOOA 4GVLA 4J9UE 1UXJA 4IIUA 4CMKA 3FWZA 1YL7A 1ZMTA 2EXXA 4XRRA 2ZCVA 4PLYA 1AE1A 2ZATA 4OXNA 1EE2A 2PWZA 3V8BA 5JW6A 1WDKA 3LLSA 4CJXA 3VH1A 2BMAA 5A05A 2AEFA 4WEOA 3PIDA 4GKBA 2PZKA 4YDRA 3DAGA 1CEQA 2JAPA 4INAA 2X8LA 4IDGA 2VUTA 1R4NA 3DONA 1X7GA 4FN4A 1EZ4A 4CM7A 1CDOA 2VHXA 4FFPA 4IZHA 4RPHA 1ZSVA 5KNLA 1YB5A 2B35A 3B70A 4P4GA 4WGGA 3WQQA 2AG8A 3FTPA 4J4BA 3WR5A 2P4QA 3ONDA 2JAHA 4BO1A 3D3EA 1O6ZA 4FOSA 1NR7A 1SOWA 4Z9FA 4BO3A 2I3AA 4BNVA 4YJHA 1ONNA 4BNKA 3JD1A 3JQFA 3QVWA 2PGJA 1WNTA 4XGNA 2VYNA 3ENKA 2RAFA 2IXAA 2B4QA 2E48A 3AJRA 3DAPA 1E5LA 5IDQA 1U8XX 1U3TA 3OH8A 3GEDA 1LDBA 4HFNA 3RBZA 3ZU2A 1VSVA 1C3VA 1PS9A 3NJ8A 5A3JA 3RWBA 1P9LA 3PWZA 3W8EA 4DRYA 4CMGA 4UREA 2VNAA 4XD2A 3WOHA 3OEYA 1U7TA 2HMWA 3WSVA 1PJ2A 4PFJA 3KZVA 3ZWMA 4CM9A 5H81A 3FSRA 1IZ0A 2FSVA 4Z9YA 1K2WA 3JQAA 3GA0A 2YV1A 4TSKA 4NIMA 1HETA 4HXYA 1CQJA 3RCBA 1HLPA 3DBRA 2EJWA 4WCFC 3TZKA 1SOVA 2CF5A 4MINA 1R6DA 3DTTA 1FDSA 3TJRA 4BNTA 3N74A 3QW2A 4KQWA 5AYVA 2H6EA 5L53A 2PKQP 1RYEA 2AW5A 4K1LA 2P5YA 4R5HA 4N7RA 4ZRMA 1D1SA 3EK2A 3CZRA 3Q0EA 4FDAA 3RU9A 5HS6A 1BTOA 4YRBA 3PJGA 1QYCA 1ZMOA 4R01A 3FR7A 3DAFA 4WLFA 1SPXA 3PYXA 1A5ZA 2IZ0A 2GNAA 1PJ3A 2IE0A 3D7LA 1O9BA 3NDIA 3SC6A 1YBMA 1ZZEA 1KC1A 1HL3A 3WXBA 3RD5A 2Q1UA 3H8VA 3LC7O 5IFLA 3CKYA 3PJDA 3MOIA 4D0RA 1J0XO 1OBFO 3FR8A 1J4AA 3QRWA 3JQ9A 1OOEA 2J3KA 1VM6A 1EVIA 3JQFC 4XGIA 4R51A 4GKVA 3LU1A 2FOIA 5GY7A 1JKJA 1QV7A 1ADBA 2C0CA 4MIOA 1SAYA 4NMHA 3OQ6A 5LDGA 2Y66A 3E9NA 5G0WA 2X22A 5FWNA 4R41A 3HADA 4B7UA 3PXXA 2D59A 3VDRA 5TNXA 3BMQA 4ZQGA 4Z0TA 4XDZA 4ZN6A 2X9NA 1DLIA 1QLJA 2Y68A 5CDYA 5L7TA 4Z3KA 2GN4A 5IDWA 2IXBA 4MVJM 1C1DA 5L7WA 3TOZA 4GLOA 1DHRA 3GMDA 1HEUA 1NVMB 2B36A 1O94A 1ULUA 1NHWA 4Q3DA 1LDEA 5IF3A 4Q3AA 4CM8A 4NDNE 2GDZA 4DXHA 2ZIZA 3WJAA 1RM0A 1ZVMA 2ZTLA 3B20A 3QLJA 1BWSA 3IUSA 3JCZA 4CL8A 5BSEA 4HADA 5IXYA 5KJ6A 2C7VA 3LT4A 3ZI0A 1RPNA 1J5PA 2VCYA 4AJIA 4JCOA 3WGGA 4XR9A 2PD4A 3WGHA 1XELA 3S2IA 1PSDA 2VYVA 1LSJA 3VH4A 3NKLA 1LTHR 5JCXA 3NTOA 3GGPA 2POQX 3HSKA 4QQRA 1VRWA 1D8AA 2XOXA 1FDVA 3RUCA 3C24A 1DSSG 1PJSA 2VWQA 1DRWA 1GCOA 4WECA 5ER9A 1YDEA 3ASVA 1YXMA 1PS0A 1QYVA 2HQ1A 3WGQA 3ZNQA 1TT5B 4W4TA 5ILOA 3P2YA 4DTIA 5BR7A 4Y67A 4A27A 5HWSA 2O3TA 3R3SA 4KP7A 2O50A 1J6UA 4UUMA 2VHYA 1UZLA 4UVGA 3OJLA 2B4TO 5A9RA 4WOJA 1A4IA 4Q39A 3RC7A 1A9ZA 2EEZA 4EUHA 2CFCA 1DRVA 3I9JA 3W8DA 4MVJE 4O63O 3UCFA 3ROPA 4CR6A 1R0KA 4B8WA 3TF5A 4KDFA 3H9UA 3FN4A 1YQDA 4I9NA 1TA4A 3O9ZA 5I9LA 2NQ8A 4DPMA 2Q4EA 1ENOA 4XRGA 3BTSA 4QFDA 3LLVA 2JFHA 2VRCD 4CMAA 3QWIA 4L0QA 3QIVA 8ADHA 2OGUA 4Z0PA 2C2YA 1H5QA 4J6FA 4YT5A 2PKRA 2I6TA 1G1AA 1Y8RB 2DLDA 3NEPX 3IUPA 1IPFA 1XA0A 3BMOA 4AJNA 1H2HA 1CF2O 3NT4A 4TKMA 5JY6A 1NPDA 4HNHA 3JQBC 1EEHA 2J5QA 4PLHA 3TL3A 3IP3A 3I3OA 1KVUA 3JD2A 5L4SA 3L6OO 3ADOA 4GX5A 5JYDA 1MC4A 1LQTA 5A9SB 1VL6A 3DBHA 3QVTA 5TC4A 4D44A 1Q0QA 1ZH8A 3DXFA 4J4TA 1XEAA 1PX0A 1GADO 3R3JA 1GZ6A 4Q3NA 1U2GA 1B14A 1VC2A 3K73O 4OM8A 1ONOA 3GUYA 2O7SA 3VPHA 2QYSA 4IDEA 4RF3A 2AG5A 2NWQA 2PK3A 5A9SA 2F1KA 3K30A 1N2SA 1DHTA 3WWYA 1M67A 1HT0A 3WBBA 1A4UA 1PR3A 4IGEA 4OOFA 2HRZA 2ZB8A 4XGKA 3KXDA 4IDDA 4BKRA 2J8ZA 2QW8A 1DIHA 3OQ1A 4ZA2A 4WLNA 1U5AA 4L8VA 4E5NA 3PJFA 1T4BA 4HFRA 4FBGA 4FFNA 2VT3A 2DFDA 3G17A 2YDXA 3UHAA 5H82A 1KVSA 2WDZA 1XYGA 4N18A 4BNFA 3U5TA 1MUUA 4EITA 4TRNA 3QSGA 2IYPA 2JFFA 2YV2A 3GRPA 5DP2A 1XIVA 3TWOA 1BXGA 4PLGA 3BTOA 1IULA 1U9JA 3WYEA 3H9GA 5C37A 1D3AA 4FJ2A 2I9PA 5TSDA 1DRUA 3A4VA 1TEHA 4J49A 1GDHA 4Y6SA 5KIAA 2OUIA 3L0DA 2HJSA 3C3XA 3CE6A 2NU9A 3DMYA 4J43A 1X14A 1ZIDA 2DU8A 2Z95A 5CPFA 2GF2A 2HUNA 3GVHA 3O38A 2EGGA 5G0VA 1TXGA 5COBA 4BNGA 1UDBA 4JNKA 5DZSA 5ICSA 3IL2A 2CVZA 4L4RA 2VZ0A 4J91A 1VKOA 4U5QA 3W1VA 4OO3A 1K5HA 4J7XA 1H9AA 2V65A 4QX6A 2FHSA 3ZV5A 3E18A 5EINA 3WS7A 1CIVA 3OIDA 3V2HA 3INGA 5K6AC 1YRLA 3H9QA 1LDMA 4N54A 1ZW1A 1DFIA 3DMTC 5JDIA 5TS3A 4U6QA 1D1TA 4QFCA 4YYZA 1VL8A 2ZJ0A 1Q1NA 2NM0A 1YQGA 2GR9A 1G0OA 3DOJA 3F9IA 4A7PA 1BDBA 3SX2A 2FRDA 2HAEA 4GPD1 4KZPA 1B26A 4GVXA 1U5CA 3GG9A 5F5LA 3UN1A 2A94A 1YL5A 5FYDA 1C14A 1B7GO 2V6MA 1LUAA 3I83A 2FSSA 4ZQFA 1E7QA 1Z45A 4HV4A 3JQ8A 2HMUA 2DPGA 1GV1A 3GDOA 3GLQA 3DBHB 4Z9XA 4IM7A 4W9NC 5CDUA 2I67A 5KKAA 5K6AA 2BLLA 4XJTA 1U3UA 2AA3A 2BELA 4RORA 3GNQA 2O23A 7ADHA 1SEPA 2CVOA 1ENYA 1RM4A 1I2ZA 1LI4A 3G49A 1LXCA 3K8ZA 3NRCA 3HDHA 3QVXA 2Y0DA 4FW8A 4YWJA 1Z7EA 4K9DA 5IN4A 4CL3A 3MJEA 2VHWA 3N7UA 2Q1SA 3OIFA 5L4NA 1V3UA 1M2WA 4CODB 4D79A 1E3LA 1EFLA 1NBOA 2VN8A 3I4FA 4NBUA 3OFSA 2DTXA 3R0IA 1ZNQO 3QE3A 5JSFA 2Y1FA 4BGVA 1C1XA 4CV3A 3GT0A 4TMFA 4QUKA 3JTMA 1R15A 2O4CA 1JAXA 1DXYA 1T26A 3KLMX 5JAZA 4YT2A 1ZXBA 2O2YA 4MPDA 1I10A 1ZEMA 3UAGA 3JV7A 3PPIA 4CPDA 5JMPA 4BMVA 3AI2A 3L4BC 3QHAA 4RPJA 3I4CA 1Y5RA 1WWKA 5KJFA 1NQOA 1Q7CA 1B16A 5EJ2A 3ZWWA 5AXBA 3AM3A 3GH3A 1H6DA 1H6AA 4KDEA 1SB9A 1K6XA 4NFHA 1MP0A 3SC4A 3Q9NA 1MB4A 1X7HA 1JVBA 2D8AA 1PWZA 1F8FA 4BGIA 5KTKA 1PL6A 5F1KA 1M6HA 2GO1A 5GZ3A 3RQSA 1T2AA 1T2CA 1XKQA 4M54A 4W9NA 3FPCA 3D1LA 4W99A 3VPXA 3E9MA 3DBRB 4TRRA 3MWEB 2ZB4A 3AOGA 1W0CA 1H93A 1NX6A 4TQGA 3VKUA 2PH5A 4CQLB 4LK3A 2EF1A 3VZRA 2W2KB 3MWDB 4QO7A 2DKNA 4FGWA 3FI9A 3E82A 4CQMB 4W7IA 2NTJA 4YXFA 2GYYA 5B4VA 2P5UA 4Z0HO 4O6VA 1A27A 1HXHA 1JKFA 3H9EO 4M89A 4E30A 3WJ7A 4MP6A 4UVIA 3UKOA 2HK8A 4NJMA 1UXHA 2NVBA 3EGOA 2BRUA 3Q2IA 2O3QA 3M6IA 3NT2A 2GLXA 5B4UA 1PWXA 3DZJA 4U8GA 4U0KA 3WWZA 2JFGA 3WMWA 1E7MA 1O5IA 1QYDA 4I9HA 4J4HA 1DJNA 2VRBA 1MFZA 4KQXA 1YGYA 3BTVA 4K26A 4KMSA 4MJLA 3AI1A 5I9MA 4BQRA 1JTVA 5A4DA 3MJVA 3MJSA 4BMNA 1OI7A 1P1RA 1CQIA 4RZHA 5LC1A 1N1GA 4ND4A 2V6FA 4QXMA 4BNZA 1UH5A 3DL2A 1WZEA 2RCYA 2V6GA 3ETDA 3TQHA 3PK0A 4OJNA 5G0TA 3BZUA 4PLPA 4BO8A 1K6IA 3LK7A 1LLUA 3H3FA 3K2EA 4JJGA 2GASA 5IDYA 4ZJUA 3PHLA 5IZCC 1E1NA 3FBTA 3SBOA 1NFFA 1IB6A 2X1HA 3WB9A 3JQDA 3U0BA 3SVTA 1SEVA 1ADGA 2Q4BA 1HDYA 4WLEA 4GWGA 4M87A 2PH3A 3RKUA 4O1MA 3FBGA 3FD8A 5TGDA 2FPPA 4DLAA 5C7OO 2CNBA 1MA0A 3KEOA 4IZIA 1R0SA 3COSA 2CZCA 1GEEA 1O0SA 1VE9A 1JA9A 3H2SA 1JAYA 3IIEA 3RFTA 5U9CA 2WYWA 4CLHA 1A7KA 3F47A 1E7WA 1M75A 4ZVVA 4GGPA 1T1RA 2PZLA 2X9GA 2NNLD 2YFHA 3DMTA 3ETGA 5DOZA 4ZQEA 4PZCA 4BNMA 2GRAA 1GAEO 3BYZA 4ALLA 1UAGA 4XYMA 1LSOA 2PY6A 4DLBA 4Q3BA 1E7YA 1ZCJA 3HN7A 3GY0A 3WLEA 4BIIA 3EVTA 3ZW8A 3L6DA 2LDXA 1SBYA 4Y6PA 1Y8QA 2C2XA 2CY0A 3HB5X 3HUDA 3WGOA 1HDOA 4WLUA 3H2ZA 1KVRA 1JKIA 4FS3A 2PTGA 4KTTE 4KWHA 4R54A 4B7XA 2OHXA 4Y9DA 2DC1A 4PLWA 2D4AA 4ZGWA 3JD3A 2WD7A 4R16A 1KYQA 2YZ7A 4YJFB 4RVHA 1XGKA 4A5OA 4OXYA 4YAEA 3ZNNA 5FI3A 3H5NA 3NX4A 3BMCA 3QY9A 4OL9A 4TRJA 1A7AA 1SO8A 2CVQA 5EN4A 2NVWA 3IJPA 3FNGA 1K3TA 4BNJA 1H6BA 3NTQA 4PN3A 2RHCA 3OETA 3WGIA 4E33A 1LDYA 4UUOA 1V9LA 2IZ1A 4H3VA 4JX8A 1P0FA 3PJEA 4DWVA 3F5QA 2OMEA 3VTFA 2IODA 2SCUA 1MC5A 2WE8A 1LRJA 3GN1A 3EAGA 5JO0A 3KSZO 3HB4X 3P2OA 1N7GA 1VJTA 3MJCA 4HY3A 1FDWA 1LA2A 3L4SO 4QSMA 1ML3A 1BW9B 1NAHA 1B2LA 3F6YA 2JCYA 2DPHA 1PQWA 3L4BA 3VC7A 4XB2A 1NTOA 3KRTA 4DVJA 1XG5A 4UVHA 5JDIC 1KS9A 1I3LA 1Q2XA 1EDOA 4TVOA 2PKQO 1LSSA 1U4OA 5EQFA 1Q0LA 4F3YA 3DFZA 5JCJD 5T67A 1QKIA 2X0RA 4DQVA 2EKPA 4QECA 1GYQA 2DQ4A 2WMDA 5TT1A 2ZJ1A 3KV3O 1NQAO 2WM3A 3QJ5A 4R1NA 4GAEA 4CM4A 4LRTB 1Y7TA 3FNFA 4PRLA 3RUAA 2Q49A 2H5LA 4YT4A 5EERA 2AXQA 3AK4A 3NGLA 2UV8A 1YQXA 2R00A 3D64A 4GL4A 4UUNA 1Z7BA 3ZV6A 2FMUA 3ETEA 1P1HA 2XPCA 2EKQA 3BHIA 5L3ZA 4MOWA 4RLSA 3E03A 1LU9A 4FPXA 4NU5A 1EVJA 2G82A 3IMFA 3QVOA 4URFA 4YVFA 3WQRA 5KKCA 4JBHA 4CLXA 1DBVO 2C5AA 1A71A 3H5RA 1DIGA 3JQGB 3I9LA 3O4RA 5JLAA 2J3HA 5H83A 1FF9A 4BVAA 3ZV3A 2TMGA 4ALKA 4BNLA 5A9TA 2W98A 1HE5A 1JWBB 2Y0CA 4FQ8A 2HK7A 3I9MA 2P91A 3KBOA 4BB5A 4AJOA 5L95A 4M55A 2GGSA 4NG5A 1PIWA 2PLAA 1GZ4A 1E3JA 3O03A 5TLSA 3ZN2A 1HF3A 4BS9A 2E37A 3TFOA 1L7EA 1E7RA 2UUPA 4O5OA 4EGFA 1HE2A 5ENDA 4PVCA 3ZWVA 4YJFA 4NBVA 1RJWA 3T7EA 3KETA 3AUTA 1Q7GA 4MO2A 3ON5A 1NM5A 2R00C 3AWDA 4A10A 2J6IA 1UJMA 4GWKA 1QORA 1CJCA 1I36A 3HDYA 1IUKA 3RBVA 3G79A 3H4VA 3ZWYA 5TIIA 4MVJG 4B8ZA 1E5QA 4NI5A 5I7FA 1CYDA 1P1KA 1NNUA 2XF8A 2GUGA 3PEFA 3K92A 4LN1A 3OF2A 2O3JA 3D4NA 1NFRA 4YBZA 1K6JA 4F45A 4UAGA 5I7SA 3PQDA 1HKUA 1B0AA 2D5AA 1TT5A 3GN2A 4JBGA 1CERA 1F14A 4W6ZA 5DT9A 3STHA 2C54A 1GQ2A 3BTUA 2FPGA 4FC6A 4ROSA 4ZRNA 2P2SA 2B5WA 4G65A 2OZPA 3GUCA 2HMVA 4RF5A 4FJ1A 3KO8A 4MP3A 5IZ4A 3C7DB 3CZMA 1BVUA 4P8RA 3A9WA 2W2KA 4G2NA 1RYDA 2I3GA 2PGDA 3OJ0A 4JGBA 2HMSA 5AXAA 5ILGA 1JQBA 2HJRA 3NT5A 2AQHA 2P4HX 4HFMA 3X2FA 3ZZNA 5I7VA 1C0PA 3OQBA 1PZEA 1QLHA 1OC2A 2E82A 2WD7B 3JQBA 4MKRA 2NU8A 2OORA 1UP4A 3PI7A 4BO2A 2G17A 2X4GA 4LMPA 1T25A 3VPGA 4XR4A 4IQ8A 4R5MA 3PLRA 4U6SA 4E3ZA 4FFRA 4WUVA 2D2IA 2NTVA 2BI7A 2C82A 3FWNA 1HE3A 1HDZA 3PGJA 4ZD6A 3VPFA 4II3A 3A1NA 4B3HA 2B4RO 4GI2A 2BFPA 2Q2WA 3HG7A 1VJ0A 3LT0A 4I8XA 4YACA 3WYBA 4DLLA 3MJTA 2AMFA 1NWCA 4CMCA 4D7AA 3AUAA 3ZCXA 4I5EA 4XWYA 4B4WA 2QQ5A 1NVTA 2FN7A 1NYTA 2X5JO 3AUUA 2HLPA 3C8MA 5L7YA 1FDTA 4E5KA 5MDHA 4IPTA 3RC1A 1F17A 4QT0A 5B12A 1IHXA 4RQTA 4YR9A 3PZRA 3BHMA 1X0VA 1KY4A 2ZYDA 4X54A 2ZYGA 4XKJA 1GYPA 5HRUA 1HWYA 2G0TA 3MTJA 4K6FA 4K6CA 1QP8A 4UULA 4E31A 2C29D 3P19A 1HDRA 1W73A 5HS4A 2OFPA 2B0JA 3DZHA 3DHNA 3WIDA 3PLNA 2RBEA 3I6QA 1MXFA 3TSCA 3TZQA 3GF4A 5BNIA 5L40A 4EJ6A 1AXGA 3WX0A 5KWEA 2X0JA 2YV3A 1RM5A 1JVSA 3FCOA 2PD6A 4J7UA 4P4NA 4U7WA 1NQTA 1KOLA 3GVIA 1EK5A 4E2XA 1N9GB 3AU8A 4TROA 3RUEA 5CP8A 3JQGA 1PQUA 6LDHA 4CLOA 2RHRA 1B8PA 2EGHA 3NJ4A 1LSUA 2B83A 3BMNB 2H1SA 2IEDA 3W6ZA 1MGOA 1E3WA 4NH4A 4TWRA 6ADHA 5BNTA 5DNAA 1GZ3A 2O3UA 5T5QA 5BSFA 3F1KA 3ORFA 2JL1A 5C7LO 5J23A 3A14A 1G0NA 3KYCA 3JYLA 2G5CA 5I8WA 2WYVA 4PLZA 3VVCA 3U4CA 2UVDA 5K0ZA 4J1TA 1ENZA 1ZBQA 4R1UA 4EW6A 5L9AA 4G81A 1FMCA 1C0KA 1ZJYA 1HYEA 3DZGA 5F21A 5MGBA 4KUEA 4Z3DA 2HKIA 4OQZA 1FK8A 1WMAA 4ESOA 3H6KA 4CM3A 4D0SA 4M8SA 3ITDA 2EHDA 4MKZA 5JBIA 1P74A 4RJTA 1R66A 3I5MA 3RROA 1GQYA 3KEQA 3LT1A 4OKIA 5CG1A 4IDFA 4DYDA 2PZJA 2BHLA 4YCAA 4WE3A 3DB2A 4LCEA 1BSVA 2TMDA 4I1IA 4WCDA 2HK9A 3EZLA 1LRLA 3OICA 4KUHA 4LVCA 3WGTA 4TVBA 4EEZA 4IDCA 1XQ1A 2I66A 3EVNA 3WNVA 1BVRA 1E77A 1ISHA 1LQUA 4DREA 4MVJD 2DT5A 5THKA 4CQLA 2Z5LA 1GUFA 1SNYA 3GZNA 1LDGA 2PR2A 3WFJA 1AXEA 2WSBA 3E48A 4XIYA 4J3FA 5AXDA 5JPIA 1QG6A 4NJMB 2E49A 2VHZA 1GPJA 3BXXA 2D3TA 4L9RA 4OIMA 4OSPA 3U09A 1UZNA 4CMIA 4MKXA 1FXSA 4NZ9A 1XU9A 3MZ0A 4TZKA 4NPCA 5CEEA 4NFYA 4YTEA 3HZZA 2V6BA 5THQA 5A06A 3A06A 5GZ6A 1R4NB 4J16A 5DN9A 4BKUA 5KVCA 4FD3A 1DC5A 1XR3A 4N5NA 1T2EA 5TQVA 4HX5A 5ENVA 1KEUA 3I9KA 3O26A 4NQZA 4XYEA 1YWGO 1PJLA 4BO0A 4DMLA 4O0LA 1EVYA 2DBRA 3WGYA 1BXZA 1JLLA 1PQPA 5T8KA 1NWHA 5F3RA 3JD4A 3I6IA 1WXDA 2PD3A 2V7PA 3D5TA 1WDMA 2VOEA 3JYQA 4MIYA 4YJHB 3VZPA 3ZNPA 1NAIA 4DPKA 2FPIA 5LCXA 3C7CB 1YVEI 3RUIA 4BO6A 4S3MA 4D41A 4EBFA 4UEKA 1BW9A 3QWFA 4WK6A 4NHEA 4GX0A 3GQVA 1GFSA 2RH4A 4MIEA 1R0LA 1EFKA 3RAJA 2A92A 2H63A 3Q9UA 1QYWA 4BKQA 1XU7A 1GQQA 2OO5A 3H7AA 5DP1A 3ZH2A 4CQMD 2VUSA 4YAIA 2G1UA 2HU2A 4DUPA 4EJMA 4FR5A 3GEGA 3HFSA 1QXSA 2X58A 3TDKA 3WFIA 1DOHA 3H3JA 4XQEA 3EZYA 3KYDA 3Q1LA 4UEJA 4MP8A 3I9OA 5LDHA 1P33A 1YB1A 4QO8A 2IRWA 4ND2A 1MXHA 3AOEC 2J5KA 8LDHA 2Y93A 3OJEA 5ITWA 2HMTA 5KOIA 1DFHA 1VL0A 3GMSA 4IDAA 3PYLA 3WLFA 1E3IA 1R37A 1DO8A 4BO4A 4CLRB 2DBZA 1BMDA 3ZU5A 3SEFA 2I99A 2DTEA 2ZKLA 1R12A 2WTBA 1HZJA 3GPIA 3HE3A 3P5SA 4CMEC 1UDCA 1ZJZA 4E5MA 1UXGA 1T1SA 3JQ9C 4ZQHA 4GGOA 1C1XB 1V3VA 4N5MA 1ONPA 1V0JA 2A4KA 4WEQA 3MTGA 3KOUA 3JQEA 2DFVA 5JC1A 1GTMA 3HQ4O 4F6CA 2O3RA 3VHRA 1L7DA 3DEYX 2ZYAA 2QRJA 1LJ8A 1OAAA 3D3WB 3D3WA 4IJUA 4JP3A 4RPGA 5ER6A 4AJJA 4DGSA 1KVTA 3TZCA 5CEFA 3Q11A 5AQ1A 4YQZA 4A2CA 3ICCA 1BDMA 3LVFO 1GD1O 4FSHA 1DPGA 2EIHA 4R9SA 1NHGA 4J2HA 1I3NA 3LDHA 3KYDB 5GZ1A 1HYHA 3IP1A 3G1TA 3PGXA 4DA9A 1GCUA 1YDWA 2OBNA 3GDGA 4IJWA 4R69A 1GYRA 4FFLA 4J7CA 1IOLA 3QA9A 1GV0A 3D4PA 3RVDA 1PGPA 3E5MA 4BO7A 4BO9A 3QVSA 1P1IA 4IJVA 1AUPA 3S2FA 4OHUA 1N9GA 2OP0A 5KCZA 4GX1A 3K6JA 3IS3A 5DCUA 4BNUA 4EJ0A 4D42A 3DO5A 3U4HA 5EL0A 3WBFA 5DBGA 4OMUA 1E6EA 2J5RA 4BQPA 4OQYA 5TX7A 1D4FA 3NDJA 2PA3A 3AY7A 2GN9A 2IEBA 2VRCA 2RH8A 3K2BA 1PGQA 1NR1A 3OBBA 3H9JA 1RM3A 1P1JA 1N5DA 3DC2A 1KETA 5G4KA 1PGJA 2B37A 2EERA 3KYCB 4ILKA 2DTDA 3DZFA 3OP4A 3IDSA 3NUGA 5CDTA 3V2GA 4L73A 4JLWA 1JWAB 4BOYA 3JQ8B 4GQAA 5JDCA 2DAPA 4B4VA 2EV9A 1B3RA 4RPLA 3DZBA 4CLDA 5G4KB 5U4QA 4NJOA 1ZK2A 1HRDA 2CF6A 7MDHA 1DC3A 4RF4A 4AL4A 4IMRA 3JQ6A 1PZFA 3MEQA 3QP9A 4YRDA 3WG9A 3BMQB 3E9QA 3BHJA 1BRMA 4J1NA 2YDYA 4LRSB 1N92A 4EEXA 4YRAA 5FI5A 4MVJH 2I65A 3ANMA 2Z1MA 2ZK7A 1ZFNA 3TN7A 2ZTMA 3F1LA 2A9FA 2AQKA 2NADA 3GGGA 4O59O 3W6UA 1M76A 3KYBA 4A26A 2XXJA 3DQPA 3ANLA 1ADCA 5T64A 4H15A 2VTDA 2JD0A 4JIGA 1U3VA 4PG7A 2VZ8A 1E92A 2BGMA 2GPTA 2YFQA 4OGWA 3C1AA 2OL4A 5HA5A 1I2BA 1E1LA 4MVJF 1KBZA 3ZV4A 3GOHA 1F06A 4JJIA 5KVVA 5IG2A 2UDPA 1ORRA 5DCYA 3NYWA 1H9BA 3AUSA 3AY6A 4D3DA 3GZNB 3W4IA 5ES3A 3U62A 5A5EA 2YUTA 1H0KA 2ZTUA 3FF4A 3PIIA 4WLVA 3TNLA 1ZK1A 4AJPA 3ZGYA 3EYWA 4FFOA 3RBXA 4PZEA 4OYRA 3ZHZA 3JQAB 2C07A 1V8BA 4Q3CA 5T57A 3M2PA 4HP8A 4BV8A 3F5SA 4NU6A 1I30A 3HFGA 5K9ZA 3GPDG 3GNSA 3OMLA 4MDHA 5BNFA 2DBQA 1AHHA 1V3TA 4E5YA 5G4LA 1EE9A 1I8TA 4IS2A 3TPCA 5GMOA 3D4OA 4MVJI 1UZMA 1ZSNA 2WD8A 4C7KA 1OMOA 4IIVA 2HDHA 3DTYA 4BGEA 2VT2A 4DMMA 3JQ7A 5ITVA 4AJKA 1WW8A 4XQ9A 5G2OA 3GZ4A 3UGKA 4IMPA 1ZKMA 1FJHA 3WICA 1HSZA 5L51A 5CDGA 4RVDA 3F46A 4DQUA 4R3NA 1D7OA 9LDBA 1PL7A 2Q50A 3TFQA 1DC4A 3NAQA 3I1JA 4IS3A 3KLPX 3JYOA 3VKVA 2NU6A 4E2YA 4YB8A 2C59A 4OOEA 1IZ9A 3DZIA 4R1SA 2PNFA 4A0SA 4I08A 5FEUA 1AN9A 1E0DA 1H94A 4F46A 4TRMA 3UFXA 2HO5A 4CMEA 5EESA 3D5QA 3Q3CA 1E3WB 1IE3A 4BNYA 1K89A 4E21A 1YL6A 2PGLA 4GSKA 4ONEA 3DR3A 4E32A 4IGFA 4KUGA 2O4UX 3UH1A 2J3JA 2VWPA 1VSUA 3AW9A 4LCJA 1EUZA 4OSOA 1NASA 1YO6A 3LYLA 1QR6A 1U28A 1EBUA 4JK3A 1Z82A 4P38A 4FB5A 4GMFA 3WQSB 1WLYA 2VZ9A 4YJGA 1CRWG 3G1UA 3GEMA 3SJ7A 3ZWBA 5JYEA 3Q2KA 2X9VA 1WP4A 4CUJA 4EZBA 1PGNA 1PS8A 4Q9NA 1DC6A 4JBIA 5A1TA 4CMHA 1X1EA 3M2TA 2Y1EA 1W8DA 5FFFA 2Q45A 1YS4A 1NQ5A 4I5GA 4CM9D 5U1PA 3QWHA 4DQXA 1LC0A 2ZB7A 4L75A 1EQUA 2FWMX 1R4MB 4LSWA 3U49A 3F3SA 2ZQYA 3B1JA 5HBRA 4DYVA 2E4AA 3OEWA 4XYBA 2XXBA 1IY8A 2WYUA 4UVEA 3EW7A 2X6TA 2XAAA 3E8XA 1KEWA 3ST7A 1HDXA 1E3EA 4LGVA 4NNJA 4XA8A 1LLQA 4YA6A 4D3SA 2F00A 2IDZA 2Q2VA 4IDBA 1K0UA 3PFFA 2VOJA 2BFAA 4E0BA 1O89A 4IBOA 1BG6A 3PQEA 4BNWA 1HDCA 3VVBA 3U3XA 4R1TA 4CV2A 3NGXA 1AGNA 3RKRA 2OP1A 5JC8A 4IINA 4CMIB 4BHTA 5JAIA 3LC1O 2NLOA 5ADHA 3HWRA 4CR7A 2JJYA 3VDQA 5IZCA 3ZDFA 1F8GA 3PRJA 1Q7BA 4UVDA 3H5AA 3VZSA 3CPSA 4KWIA 1ID1A 3CINA 1H6CA 4PLFA 4YT8A 4RGBA 3UF0A 3B6ZA 4OXKA 1DDOA 1P0CA 2RIRA 1JN0A 5EMHA 4BKPA 3IKVA 3LT2A 5F5NA 3SJUA 3WDSA 3ROKA 3BA1A 1HE4A 3L07A 5IDXA 2O7QA 2BFMA 2BF7A 3OJFA 2P68A 4JP2A 3GFBA 4PG8A 4CM8B 3MOGA 1ADFA 3EC7A 5JY1A 1NFQA 3ZNOA 3U4IA 4C7JA 5TF4A 5IJZA 1C1DB 3NTRA 2CUKA 2LDBA 3PYMA 2PFGA 1MX3A 5BT9A 3VH3A 3SXPA 1ZXLA 4E2ZA 4KTVE 3RSHA 4RVSA 3VOSA 4AJEA 2HSDA 1B8VA 3AFNA 4ND3A 1DFGA 5EQDA 1E6UA 1QYXA 1F0YA 5DBFA 4BNXA 3EMKA 3CTMA 4FC7A 2QYTA 3INRA 1LX6A 5F1PA 2QRLA 1PJTA 4HKTA 4XX0A 2DUUA 3LQFA 3PQFA 4BMSA 2OBYA 4FOOA 2YHUA 3QWBA 2C7GA 3V1YA 1BXKA 3N58A 3RFVA 1T24A 2QZZA 2QG4A 2YHIA 2WE7A 4RQUA 1G6KA 2C5EA 1DIBA 1TB4A 3M1AA 1PJCA 3S8MA 2VQ3A 5AOVA 3ZHBA 4ZICA 5C3MA 1R4MA 1V6AA 1NXQA 3ZWPA 3RC2A 4DC1A 1NVGA 1P31A 3JSAA 1UDAA 4R3WA 1LRKA 3W4KA 2BFOA 3IC5A 2YJZA 4JJFA 4L76A 3UUWA 1AHIA 3AFMA 3GVCA 4RLHA 5AXCA 1GUYA 4RF2A 1GL3A 1GPDG 1T2FA 3GNTA 1I2CA 3I9NA 3R1IA 2NVUB 4UUPA 1NP3A 3JYNA 2W2LA 3OJOA 3WGZA 3WTBA 3EUWA 4ALJA 4XYGA 4B7CA 1EQ2A 3F4LA 4LSMA 4PGFA 2QX7A 3KSDO 3W8FA 1C0LA 2Q1WA 2X5OA 4M86A 1VLLA 3ASUA 1YBVA 2NQTA 2QHXA 3MJ4A 4GBJA 4B79A 3HJAA 1I32A 2B5VA 2EP7A 4MVJP 1X0XA 1ZUD1 2BH9A 2NTNA 4XQCA 4R4JA 3P7MA 3GK3A 1YB4A 3ZU4A 3L9XA 2GZ3A 3AI3A 3LZ6A 4S1VA 1NPTO 3NDRA 3AOEA 4I5DA 4JQCA 2EP5A 4L4XA 3ZHYA 2JKVA 4E5PA 1WZIA 1P77A 3OA0A 4AICA 3PVZA 4UEOA 1N8KA 3DHEA 4PCVA 4XJSA 2EW2A 2X86A 3RJ9A 3ZU3A 2ZQZA 4YAJA 3OM9A 2DUWA 4GMGA 3V1UA 1I33A 4XIJA 4PG6A 1GU7A 3E5RA 3IJRA 3WIEA 5KVQA 4EI2A 3C1OA 4JROA 1EVZA 2GN8A 2WJPA 1OZAA 4CLEA 2GZ1A 1PJQA 1F12A 4RVUA 1Z74A
chains in the Genus database with same CATH superfamily
1MH1A 3MGBA 4F5WA 3F8SA 4JEIA 1CCWA 4KE9A 2IPNA 4TUYA 1Y6JA 1VZ2A 2JAWA 5DHTA 4BDTA 4JUFA 3COVA 1U0EA 4U2EA 1EJ2A 3EDMA 2XE7A 4LZJA 3WWPA 4CCSA 4A73A 1IN4A 2Y99A 4Y9UA 5LKRA 4W7HA 1M1UA 1AGRA 5G0UA 2BGRA 4DBVO 3SBXA 10MHA 1T2DA 4I50A 4DS3A 2XODA 2ZB3A 1D04A 2JAQA 2JD1A 5EJAA 4IL5A 4HNVA 5JXGA 3QNUA 3KAPA 1QAMA 1BGVA 4Q4HA 5IVDA 3MC1A 4FXOA 2IXTA 4YQYA 5HTOA 4HGRA 4W7SA 3HBNA 4MVWA 2E9SA 2MSNA 3EH2A 3GR6A 3R3XA 3HB9A 4RTPA 2QN6A 3AMVA 3DD5A 2A0UA 3GAZA 2Z6VA 3CIFA 1XVAA 5FBHA 1CR1A 5FPSA 4KXMA 4D6PA 2FP4A 4IIBA 1P2VA 2E87A 3KR0A 3RHSA 2EW8A 3TKYA 3FZGA 1W4ZA 1Y7IA 1Z15A 3CF4A 3NLLA 2LCFA 2C2HA 1LEHA 1CKEA 3VTZA 3M1IA 1SR8A 3MUNA 3Q7PA 3EOAI 5JZOA 1P7YA 4RWEA 1I3MA 2HA4A 3MA0A 2G4CA 3R9KA 1GDTA 3WAJA 2VHTA 1OKKD 4QRHA 5TQ0B 5LZ2A 3RVMA 4ED9A 4MQEB 2B21A 3EE6A 3BXPA 2V5UA 4ME6A 2X7XA 3KHKA 1Q0HA 1XTUA 4MPTA 3ZBTA 4ARIA 1VPDA 5L3QA 1JFSA 4DRXA 4P2GA 4LJ9A 3QWAA 1ISMA 1PSZA 4J0HA 3OPYB 1Y63A 2NGRA 2DPYA 4IY1A 1RFLA 4V0ME 2VYVD 2ZRPA 3SYTA 1I4TD 1XZNA 3TLEA 1OYYA 3A58B 3E5HA 5CFPA 4I1OA 2R1UA 4FNMA 1E8NA 5AI4A 5B55A 1J09A 1UWKA 2JHFA 5KJCA 5HM8A 3QFTA 5F3WB 3KB6A 3DDNA 1UKZA 1PZGA 1X7WB 2PS1A 3L8DA 4CMBA 3AKZA 2B69A 1NBMD 4NBWA 5I9SA 3LS2A 3HCRA 1C30B 1ZK0A 4FKZA 4QGBA 2D1SA 1NKTA 3S2UA 1DBQA 3EFEA 5LNK6 3AU9A 1VB3A 3HKCB 2C2ZA 3KJEA 1Z28A 1PV2A 3BHNA 3QBEA 3UYLA 3FSGD 4LHSA 4C3ZA 1M7HA 2FWBA 4PPGA 3LUJA 3PSHA 2JRLA 1XWFA 1WXGA 4AZ0A 4CUKA 2HA0A 4YH1A 4ADSG 5JXHA 5IYZA 3HJHA 1HQYE 1GRVA 1ZBDA 3L4EA 4YMVA 3A6KA 2C7BA 3OZFA 4HRXA 3KL4A 3KQUA 2RB5A 2YBEA 3GAFA 1P6QA 5LQKA 2O2EA 2ZWOA 4PNHA 1WSBA 1YC2A 1AD2A 5ECWA 1ILEA 5CU7A 3AFOA 3KFXA 4U00A 4D80A 4Q4JB 4OHXA 1LWOA 4ALMA 4JN6B 1YKFA 3JQAD 1Y9DA 4E12A 1N7HA 1CDZA 1EM8B 4IRUB 1LFAA 1DAOA 2I8LA 4KYVA 4I1PA 4HSGA 5A1JA 4YQFA 1NF2A 4AFNA 4HXEB 4Z99A 1EWYA 5IBPA 3SSMA 5CT6A 2HJHA 1G7CA 1VL2A 4GXTA 1KERA 3QPCA 3USCS 2F3UA 1OAOA 3W90A 4GOND 4CHGA 4RDCA 4ZMSA 1SCIA 1QKJA 3AVYA 1XMXA 3QXHA 2PZAA 3QV1A 2GEJA 4D8YA 2GZAA 4EJSC 4RA6A 2LNDA 5EG5A 3SS8A 5ADUS 1C0IA 5F4ZA 3UCXA 1SB8A 3PGKA 2IOYA 4E5VA 3GC6A 1X13A 5C5IA 5K4GA 3TL2A 1EDDA 3INTA 1UWVA 5AW0A 2BH2A 4ZHQA 5H9WA 4M1YA 1AUQA 4FBLA 2FR0A 3AINA 3ZCPA 3ADKA 4M6WB 3BCUA 4MQUA 4NC9A 1EUQA 3ND5A 3FVVA 2IEGA 3HPRA 4V03A 1QHEA 2O0JA 2O2DA 1P44A 4QIHA 1FP6A 1YZNA 3NIFB 3NPAA 1O97D 4B6GA 4ENVA 1FVFA 1RKXA 2O8EB 1OU4A 2L17A 4QU5A 1D2RA 5CCEA 2P8JA 1O58A 3E15A 3FETA 5AHRA 1T0HB 1ZEJA 1JR4A 1PBTA 3IEMA 3KAQA 2OCDA 3FRJA 3ETLA 4XZ3A 1CETA 5DBOA 1OTHA 3BWDD 2YWFA 4HQRA 3EF1A 3ONFA 3B1KA 4YALA 2E0IA 3IOYA 4Y2UA 1XNGA 5JYCA 2C95A 3RS4A 1Z9BA 2QIOA 5EE1A 3TDNA 1X15A 2XUKA 4AX8A 1DIAA 2YQ5A 3FCAA 1XZDA 4BUCA 3PTZA 1Y82A 4EUNA 3HNRA 2XMRA 2I2DA 3UVEA 2WHEA 5C4MA 3GFOA 4G0MA 4G23A 4NRDA 1I80A 3CO5A 3FAZA 2UAGA 4GEGA 4V3BA 5D84A 5KU1A 1UBUS 3OT4A 1QH1A 3PHGA 3K70B 1H5UA 4UDXX 1IOWA 1KRHA 3PENA 4I3HA 1UXKA 3CSDA 1YI8A 4EL0A 2CDBA 1OH6A 1RWOA 4WA8A 4XEHA 3UPUA 2R11A 1Q95A 4EKDA 1DMRA 1VRVA 3HN2A 4PZDA 4RJ2A 1ZK3A 2D1YA 2NYUA 3CH5A 3KQPA 3IMEA 3I1FA 4O08A 3O1LA 4X3CA 4EQ6B 3P32A 2HZ7A 5C4IA 1FLNA 3UENA 1ACLA 1RVV1 2JLWA 3TQSA 2ZI9A 4S24A 4UHCA 5AO9A 3UCEA 3DNMA 3IQXA 1Q6ZA 3G2NA 5A03A 1E1KA 5IU6A 3LZCA 4MLZA 1N9KA 2QLJA 2QE7A 2DY0A 3G7NA 5ES4B 3J81k 3T3EA 1OX5A 4C05A 4RVFA 3UT5B 3VPAA 4M0KA 2QTVA 3AONB 1KP9A 2PT9A 1UXIA 4KIUA 2W8ZA 1OILA 3AF6A 2QPLA 2PMBA 2YRFA 3V4OA 1DBRA 3CVJA 3O3NB 1GNQA 3M6WA 2H0AA 5JS8A 3CIOA 1TYBE 1T2VA 2IEYA 2OORC 1PJAA 1VKNA 2VNIA 3VUFA 4C6SA 2PWAA 2Y05A 2OXIA 4PLVA 3RR2A 3I6YA 3V9PA 4ENSA 1MO2A 3DGFC 5EHQA 2HL6A 2XGMA 1OZFA 2G5TA 3CWCA 4BFTA 1QO9A 2Q7DA 1HYGA 1OAKA 4BV2A 1FQKA 2WVHA 2QTTA 5MFPA 7GPBA 1BJTA 1KPIA 2FPRA 4R9RA 4D99A 2XUOA 4AECA 3OU7A 7REQA 3JR3A 2XGSA 5D7NA 4NU0A 4WXHA 3AM4A 2P5SA 4BLWA 1NVFA 1U1EA 1XHLA 5KO2A 1WCIB 2DB3A 5P21A 3NM5A 4RTQA 2EWWA 3PEWA 2X5KO 5FPTA 1GNLA 1TL7C 3G0OA 2VPQA 5JXWA 2RAUA 5KYXB 3KEGA 3ZD9A 4PRKA 3WLKX 1P7VA 4I6JA 2INGX 5J5CA 2FFQA 2QRKA 2XY4A 9LDTA 3EEOA 1BJKA 1MAUA 4ALNA 5HIKA 4NE2A 1NG1A 2KBFA 3HR4A 4GMKA 3KS9A 5ALXA 3SJBA 3ZE8A 4BV9A 4D6XA 3QEAZ 4QUHA 4IXWA 4FI3C 2BRUC 3CZCA 3WLNA 4C6TB 3COPA 4IX1A 4RZQA 3CLUC 1K7EB 3P71T 2CWDA 2OK7A 2BI8A 5FB3A 2YJGA 1C4WA 4KFRA 2ANBA 2NW6A 5A3QA 4JLNA 4I3GA 1TAHA 5COQA 2JAOA 2VNSA 1KP2A 1M8PA 3IEKA 5HUQA 1PYOA 4UNNA 1RRCA 2WU3A 1FFXB 1CFJA 2CZQA 4KWTA 1NXPA 4PY2A 2OCPA 2NUPA 4BVBA 3RM3A 3E3AA 2C0QA 2CDAA 2JD2A 2YJTD 3EXFB 3ISTA 3L0OA 4DADA 1Z75A 5GJBA 1T4CB 2ECPA 2HIHA 3AETA 3WK8A 5EMMA 3K31A 2VKTA 3P2EA 2GZDA 3HHPA 3L77A 1W49A 5IVKA 4PIVA 3B2NA 1W48A 5K3SA 5T3YA 4A6XA 5E0KB 1ZVKA 2X0IA 4PNEA 2PTHA 4IJ5A 5LZ8A 4DDUA 3SZRA 5HZGA 1JG6A 3V32A 3KJFA 1ULZA 2MCFA 4UEWA 1Z73A 3KOMA 1LLDA 2GPAA 1EGVB 2XE6A 3NC0C 4GP9A 4NCAA 2RH9B 1Q1QA 4RZIA 1OC4A 3K96A 2M6RA 2VJYA 3EZFA 4MVYA 4IIDA 4N03A 1VIDA 4LJ6A 1KO7A 3T5GA 1OW3B 2FR8A 2YRXA 4AVYA 1JLRA 1HA3A 4CXMA 3HVRA 1M6WA 3AY3A 2RAVA 4QYSA 5I7OA 1QRRA 4IQ0A 4M83A 4AIIA 1H2WA 4C2BA 2AHRA 5H3CA 3K0FB 4W1QA 3PCXA 3WIOA 2H9IA 2ZIVB 3A11A 4LG1A 5BRAA 1SKUA 2O05A 3E4CA 3FDZA 4KWEA 2WM2A 1GKLA 1U4SA 3BMCB 3GHYA 1FYVA 3O3OB 1BXGB 3F7NA 4CM5A 1YCFA 2GFIA 1L3BA 2WJVA 2GCPA 2X2EA 3DJFA 2XVMA 4EY3A 4QUDA 4B3JA 1S2GA 3MINA 4ITUA 2V7XA 3BJMA 4CYMA 3N2IA 1VJGA 1UC4B 2W00A 1OFGA 3GDFA 1GY8A 2VG8A 1VI2A 4LSGA 5HCNA 1RZRD 1VE5A 1O8CA 4IDNA 4DXAA 4WNIA 1Z2CA 1D9ZA 2VDLB 3RC9A 4F6LA 1TFUA 4JYMA 2EYQA 2WLSA 5J43A 2VXYA 3CZAA 4HBZA 1KK3A 3QOXA 3FOAA 2YQZA 4X95A 3BXOA 2VP2A 1L7QA 3L1IA 3NWEA 1PR9A 1ACJA 3P8ZA 2OV6A 1ZK4A 3U48A 2BFBA 5E1OA 4DCOA 1XEFA 2PL5A 2AJCA 1LFDB 4N5HX 3GJ5A 2VT7A 1I0IA 4F4HA 5LBIA 5KTOA 1ISFA 3CLHA 3L0CA 1RI2A 1SCUA 3ORQA 4GPAA 2NV6A 3QPUA 3FNHA 4P92A 4ZEMA 3VPSA 2IS6A 1QIKA 2ARKA 2BAGA 1AO3A 2W7TA 1GNVA 3CMCO 2QU7A 4XQGA 5THXA 4ZJYA 2EKLA 2J9ZB 3D1VA 3GUHA 5GTDA 2WEKA 1UBGA 3IAM1 4H35A 2W9XA 4MUEA 3QXGA 2ET6A 1QH9A 1GGHA 2O6LA 3PFBA 4MV3A 1SVUA 4NBNA 3BIOA 4BLSA 4YASA 5JATA 2R44A 3GG2A 4PLCA 1XXHB 3LDFA 5KJ1A 3U40A 3KOWA 3KOYA 3EGXB 1NVKA 4BB6A 1JDBC 1J42A 2I7CA 1SUDA 4O4IF 1AZLA 4R7GA 5FH9A 5CG2A 4DC9A 3F49S 1WUKS 3JQ7B 1EK6A 1QV6A 4R2JA 4D82A 5JBQA 2Z8XA 3DEAA 3ILSA 5ESWA 3PHIA 4Q1VA 3LW7A 4I1SA 4N3BA 1MDBA 3MD0A 2VZLA 5KHLB 3IIIA 5LBTA 3AF5A 3HCOA 1BN7A 4I55B 2X8WA 3LL4A 4P4LA 3MXTA 1DRJA 1Z4KA 2X7HA 3ED5A 1EX9A 3OM8A 4F9FA 2NV0A 4JHXA 4AKIA 1L8QA 2IC5A 2NUTB 4DDTA 1PE0A 2VXCA 3PFWO 4OK3A 1E64A 3GLIA 3RT9A 4NR0A 5AVOA 1N1DA 5FUXA 1BX3A 2DHQA 3H2GA 3M9XA 2V9ZA 3EWSA 4KDRA 3RIGA 4EJSA 2P9ZA 1MDFA 1X9HA 5ALTA 4LISA 5EPOA 1DTEA 4KPGA 4BPRA 4ZI3A 1S7CA 1OAOC 3EYAA 4RJLA 1QWSA 1DP4A 1W25A 2F64A 1ORIA 1JU9A 4OAQA 1KQNA 4Y8VA 4YRZA 1KFEB 1RWBA 2CLIB 4YO7A 1KY2A 5JCJA 5AW2A 4K9NA 1REQB 2PSHA 4CT4B 5CD9A 2BKAA 3F7MA 2R6JA 1IJKA 3CUKA 3O8QB 1Y3CE 3UATA 3CH6A 1O54A 4HAZA 4KHZA 1SBIA 2FZWA 1E32A 1X19A 4RZXA 2OHOA 1P7WA 1KIAA 1VMDA 1ZPDA 4EY4A 4PQYA 5L4LA 1B3BA 3HBMA 5CEJA 2GZHA 3IE2A 5G1PA 5JPDA 3ZCVA 1Y6RA 1HOTA 4LKOA 2DSNA 5C1IA 3UOGA 3SC2A 5DF1A 4F2GA 5B6PA 1XLTA 3DR5A 2AL7A 4IILA 1GU1A 3UWSA 4EUEA 2AQ8A 2O0LA 2QEQA 3HDQA 3W5SA 4QOSA 3ETNA 4A16A 2ZUEA 3R3VA 2JJQA 4LYEA 3DFKA 4O5AA 1KAQA 5COAA 1HTBA 4WFQA 2ACKA 4R9VA 1JIQA 4V2IA 4X61A 5F35A 3NBZC 2G4LA 3GVPA 5DYIA 3PHJA 1CR2A 1JW9B 1RHQA 1RPJA 1Z22A 3MM4A 1IG0A 1WHTA 4X85A 3SYLA 5CPBA 1RCTE 3Q3IA 1N3IA 4X1YB 5E1MA 3DBLA 1H66A 3R7FA 3VSEA 1FP2A 5EHIA 3ZWQA 3UK6A 5IKOA 1KSHA 3LP8A 2X2FA 4GVLA 4FFDA 4OUKX 5ALHA 4F12A 1CUCA 2PMFA 3B8HA 2H57A 4IIUA 1ESMA 2EXXA 1K3UB 4FLFA 1XKTA 2R1VA 2JJ1A 3MELA 1E9SA 3SQXA 1L5ZA 4LJ4A 2W83A 2PE5A 3NQ41 1KZYC 2VK1A 1TGVA 2ZATA 3UUFA 1UKAA 1F2UA 3DP9A 1JXAA 1T8PA 2QVCA 3LLSA 1J23A 4MH0R 2VDNB 1NV9A 1X80A 4R7TA 2VATA 5A05A 5HSGA 2FPLA 3KSAC 5HBGA 1QHYA 3LDUA 4YDRA 5GAJA 2P0YA 4N7MA 1CEQA 1R4NA 1I4LD 2FX2A 3DONA 2I80A 2JJMA 1JDZA 1UK7A 4FN4A 4MA5A 2E1RA 1OIXA 4FFPA 4J16C 4I3FA 2OXEA 1KDOA 4MAAA 3QUSA 2WG1A 4RPHA 5AW5A 3VV3A 4Q5IA 4ZI5A 3VI4B 4DXDA 2EJCA 2AG8A 3T4PA 3UMYA 4NCBA 3SOPA 3G85A 2JAHA 3EZ6A 3D3EA 1O6ZA 1RAIA 4JELA 5EI5A 2CFTA 1T15A 3WL7A 4XGQA 3ADDA 4YUWA 2I3AA 3NG1A 2R9VA 1VJCA 3E81A 5FBKA 4D9GA 4TLBA 3H5TA 5KSZA 1H4SA 2JLAA 1FU8A 1A2KC 3WL3A 2PGJA 1WNTA 4K2AA 1UINA 2VYNA 3ENKA 4N9QA 1OLOA 2RHJA 1EFPB 4MW0A 3TLCA 3TQRA 2Q21A 3RH0A 3C1UA 4IX9A 3VZCA 4CWAA 2J3QA 1U8XX 3OH8A 1NSYA 3A2MA 3V8NA 5L3SA 1CF4A 1VSVA 2R0QC 2YNMC 4DR2B 1ORHA 4RY9A 3PE6A 4TMKA 4XUGB 4HZUA 1PS9A 1AQ6A 4G24A 1N6HA 2ZRIA 4WXPA 1CUUA 2CNKA 2XMPA 4M9UA 3KIPA 4EIWA 3WSVA 4TTSA 3IVGA 2ZJYA 8OHMA 1XP8A 3DE6X 1JEEA 2ORVA 4CM9A 2WJIA 1DEKA 3DL0A 1W44A 4KSBA 5FBLB 2FSVA 4ZTBA 3SSNA 1OFUA 3TYXA 1QRAA 4EMUA 3GA0A 2YV1A 4W63A 4OMFG 5L6LB 4EQZA 2VUIB 5ICEA 4E51A 4TSKA 1SKBA 2VSQA 5FR2A 1R2QA 3PA6A 2X40A 3MWEA 3ILVA 1X9IA 5EUQB 3G6KA 1NXSA 5FT9A 5EKXA 1OZ0A 4YRGA 4XUCA 4Z3OA 3H16A 2OVFA 1OXXK 1A97A 3N0VA 2XUDA 4X63A 3DEHA 4MUJA 4ND7A 4WY2A 1KAHA 3QW2A 2OY0A 2Q5FA 2H6EA 5AT1A 5LLTA 1R0YA 1G2OA 2BFEB 1P5RA 2YNMA 2WVJA 1ZG3A 2G8LA 4ZRMA 4NYMR 1GXSB 1XDSA 3B7WA 4YRBA 1QYCA 1T9GR 1ZMOA 2WDPA 1S9HA 3DAFA 1Z37A 3KQYA 5F98A 1R5OA 3L6CA 1YHZA 3QLUC 1A5ZA 4OB8A 2GNAA 5DRTA 5LKAA 1O9BA 3NDIA 4PTZA 4Q9DA 1YBMA 3C45A 1N6KA 3C41J 1FMLA 1KK1A 1HL3A 1L4MA 2FP4B 1JXMA 4MV1A 4RC9A 1UEXC 3FMIA 3WXBA 5BWMA 1H85A 1K98A 3QFCA 1NW9B 3UMSA 3H8VA 5IFLA 1BCSA 1W75A 1P62B 3I72A 2XB4A 3G2HA 4COKA 2H52A 1M9NA 2ZFUA 5A4FS 3ACBA 3PJDA 3KKQA 4ZYZA 1J0XO 3QRWA 2WVAA 4UCXA 5CH3A 3G9XA 1OGIA 4MR7B 4Q9AA 4QLOA 4BU0A 2O2XA 3NALA 4L4UA 4GKVA 3LU1A 1Z8FA 3QUQA 5EYPB 5GY7A 4N47A 4UQLA 4MIOA 1NXXA 1GVNB 4B3GA 5LDGA 4B6RA 4Q4JA 3SIWA 4I5IA 2XT0A 4Z8YA 3RVSA 5CB4A 5CDFE 4UBOA 1UK9A 4WACA 3RYCB 2QD1A 3NIDB 3N0WA 3VU1A 4EVQA 5IX8A 2QMOA 3B3GA 3VDRA 3ND9A 1C3EA 5TNXA 4D96A 4EKGA 2R8BA 5GIOE 2DPXA 3BMQA 4ZQGA 4BRZA 4JL8A 3ZGXA 3FRHA 4D4MA 1BGWA 2Y68A 4W8HA 5L7TA 4I4TF 3CQ9A 5IDWA 3C6YA 3EA4A 3HKBA 4XFDA 4OQMA 1EKXA 4IJMA 4KYUA 2N1MA 3ER6A 1DHRA 3GMDA 1K1EA 3HYTA 3M6LA 1J7JA 1NHWA 4Q3DA 1LDEA 1YR3A 1I4OA 4DA7A 1KR2A 1T3LA 4CM8A 3OMWA 2WZBA 1N32B 2WB2A 1E5TA 4ZCQA 1ZVMA 2B6NA 1Q15A 2XVXA 3PCRB 3WJAA 4EA6A 5IXYA 1FP1D 5KJ6A 3QV2A 3RVPA 3UMFA 3L01A 2F1RA 1C7FA 1P29A 1ZR4A 4JNCA 1RI3A 3STWA 1T2UA 1XELA 1AZWA 3GLSA 3WK4A 2VYVA 1LSJA 3N28A 3PRYA 2JI6A 4HN2A 4NP6A 1LTHR 2AOVA 1NJGA 1ZN7A 3ADCA 4KAFA 4LECA 3NTOA 3GGPA 3ZZ1A 1N2GA 1JQJC 2POQX 3ROFA 3I5UA 3DNPA 4RTJA 4XM2A 4KL8S 1WB6A 2BM0A 4K6OA 3C16C 1FDVA 1EWQA 3MPUA 5BSEA 3AR5A 2HQBA 2HT6A 1UODA 1YXMA 4IHKA 4O2LA 3ZNQA 4F8EA 1D2GA 1TT5B 1VMIA 2JEOA 3PNOA 1ODLA 4MR7A 4TV9F 5ILOA 3P2YA 1KO5A 3V33A 2CK3D 2FI1A 2B4AA 1BE6A 2Z04A 4BJ6A 4ZREA 1QRTA 4A27A 5AR1A 3OX4A 4KP7A 4HDRA 1AGPA 3CR8A 3II6X 1HUQA 3IILA 3S0JA 2A5FA 4B4KA 5A9RA 2C4KA 2F9MA 1A4IA 1R27A 4EUHA 4FX2A 5JS7A 2QRPA 3GBVA 1JWLA 1JDUA 1E3TA 5ALDA 1RKVA 5FBRB 5ALLA 5FL3A 4KO3S 4UFPA 2NMVA 2WTNA 3R3HA 4YJKA 1R0KA 3GUZA 4BMXA 4S0ZA 1N5IA 2E4UA 1XRQA 1N5LA 4WSOA 4OXIA 5FOSA 5I47A 1KYYA 3T15A 4LBYA 1T5BA 1UJ2A 3SC3A 2PL1A 4I9NA 4RPIA 4QXRA 1NUSA 3ZBQA 3AUKA 3DCJA 2ZJ5A 2G28A 4BAUA 2VBCA 1H4TA 4XRGA 2AYXA 3FOEC 4F85A 5LZ9A 3QZUA 2GM9A 1MPTA 4QFDA 4XSHA 3VV2A 4MAFA 2VRCD 4C7XA 1TYDE 3JAWB 4ZOAA 4DRXB 1N2IA 1DBWA 4L0QA 1GSAA 2GYWA 5HUHA 2JGIA 8ADHA 1Z07A 4M0CA 2C77A 3UV6A 4FYYA 4Z0PA 3OWHA 2C2YA 2ONZA 4YHHB 3AY0A 4MRRA 4RENA 121PA 1IPFA 1XA0A 2IPLA 1L7AA 4ZIRA 4TKMA 1NPDA 3O92A 4HNHA 2CCGA 5DGXA 1WP9A 5JTUA 4MQFB 1EEHA 2J5QA 1I1NA 2ZPAA 2WILA 1OHHA 4CL2A 5CD1A 3OI7A 2HF8A 3L6OO 6REQB 3KJZA 4HWRA 1IAVA 3ER9A 4AMYA 1CQXA 4MUMA 4N12A 4TV8A 1S02A 1QK5A 2RHHA 3PVSA 2Y1WA 4II7A 4TTPA 2VJMB 3WGJA 3OPYI 5KC8A 2RHMA 4TYWA 1ZOOA 2FQWA 2RG7A 5DNCA 3BFPA 1Q0QA 1ZH8A 3DXFA 2UZ0A 3TIVA 3FAKA 1GADO 2F4NA 3CX8A 1L1QA 4ZI7A 1OX6A 3WYAA 1FC0A 5IBCA 3GCXA 1ONOA 2PUVA 3GUYA 3OLWA 4TGLA 1NYQA 5FO1A 4IDEA 4RF3A 1SKMA 4X20A 2AG5A 2FCAA 1AJEA 2IKSA 2NWQA 3MIZA 3T41A 1C80A 2F1KA 3K30A 2H8KA 4AY3A 5A71A 1QIDA 5LQJA 1DHTA 5BN3A 1TZMA 4C4TA 3JR7A 2NYAA 3HCNA 4K9SA 3EZ9A 4DA8A 1A4UA 5K8JB 3OZEA 2HRZA 3OIYA 4LXHA 2ID9A 1FP7A 5D6NA 2J8ZA 1OB5A 1P4SA 2H7YA 2ZI7A 3OQ1A 3W77A 4L8VA 4HH1A 4I8IA 1VYVA 4FBGA 3DLTA 4FFNA 3GCDA 3TAUA 2VT3A 4BN0A 4B71A 4B44A 2YDXA 3G5UA 5CNJA 4IDHA 1XYGA 2FQYA 2WIFA 1KTVA 5LA6A 1K8RA 2YV2A 4N48A 1BRTA 5EFOA 1E2HA 3GRPA 4NEQA 5AKLA 1L5NA 3BGVA 3H8WA 1YB2A 4KXWA 3AEQA 4EYSA 5IT4A 4PLGA 4OI0A 1O4VA 3PI6A 3BTOA 1U9JA 1ZJ6A 3NZEA 3U6BA 3IXLA 1YRHA 3GU3A 1L5GB 1VE7A 3KSMA 1KY3A 2XQGA 4J49A 2HSEA 3GJ7A 3GRRA 5ITSA 1R3DA 1E98A 2CB0A 5LJIA 3QHPA 4N7BA 2HJSA 1V96A 2NU9A 4J43A 1X14A 1ZIDA 4W1SA 2D62A 2GHRA 1GSOA 3AEQB 4U5XA 2GD0A 5AK3A 1NXOA 3UJ7A 3W1WA 5CIWA 2EGGA 1K75A 5JPCA 1TXGA 1ULTA 3OPXA 4L6AA 5KDDA 1NDQA 4Q9IA 2P6UA 3BXFA 5ICSA 5ICCA 1V4BA 4G4GA 1P72A 1WY7A 3OIWA 2MSCB 4N1AA 5FNVB 3CLVA 4KR9A 3MQ2A 3PKIA 4TMWA 4K3VA 5LYYA 5HOQA 3V2IA 4Z6KA 1XF1A 1VBKA 1ZONA 2FHSA 2HCRA 3LPMA 3ZD8A 3ZV5A 4DUGA 4AI6A 2J0QA 4OLAA 1CIVA 2PT7A 2F9LA 1YBHA 3V2HA 3ISVA 4KH1A 1QNFA 3EARA 1ZW1A 5G3ZA 3D7NA 1O97C 3GCZA 3K20A 4ETNA 5LP6F 2FA9A 3TJZA 4UARA 2C5LA 1M5TA 5TS3A 3KZKA 3B48A 2ATEA 1SBNE 1D2NA 3TXAA 3O8RA 3ADBA 3GJ8A 1E9VA 2NM0A 2JLRA 1G0OA 1P91A 3IRVA 3SE7A 1BDBA 1RI4A 5FQOA 4K2HA 3V1MA 2Q6VA 5JRDS 3NTLA 1CJVC 1P1CA 2Z0MA 2FRXA 3GG9A 5JLJA 5F5LA 1NVXQ 2A94A 1YL5A 3VYWA 1XD9A 5FYDA 1B7GO 2V6MA 1BMQA 1VLHA 1VZ3A 2R4QA 3UH0A 4CQNA 1LUAA 3EZ7A 2O57A 4KPFC 1CLUA 3MRSA 1E66A 2FUG6 5BWBA 4ZQFA 1UF9A 1ZMXA 3RTCA 4HV4A 2HMUA 2QW1A 4Y2TA 1CUYA 4IM7A 2B82A 4QGAA 4W9NC 5CIYA 4TZ0A 2I67A 5KKAA 5K6AA 1Z16A 2ONYA 5JV5A 4OSEA 4XJTA 4E1AA 2E1PA 2PQ2A 2HZBA 3QX9A 1Z26A 3W6PA 3NRBA 4M0DA 4O4HB 3T8YA 2WUEA 2D74A 4FDLA 5CBKA 2BEWB 1E1QA 1LXCA 3HCCA 4YWJA 3R9IA 3UGKA 4MTCA 4TMVA 3Q8MA 1DG3A 1UBCA 2CUNA 2DHRA 4XPZA 4Y0NA 5L4NA 2HM7A 2IVZA 2JZOA 1VYUA 1TUBB 2QE6A 4CODB 2DETA 4UBJA 3MBOA 1GTRA 3M5DA 4WKPA 4AWXA 1OU0A 4FFVA 3I4FA 1XNQB 3UQZA 2DKOA 1EFRA 1ZJ4A 3AI7A 4NBUA 3GW8A 5H7XA 2XZLA 3TLYA 1TVMA 3FYHA 1CUXA 1Z5OA 3GT0A 4TMFA 5JWOA 1WUIS 3PXEA 5DCLA 4QUKA 1MVNA 1JAXA 4Q00A 3OF5A 4MYDA 3NM4A 4QGHA 5JAZA 2V96A 1P0IA 2O2YA 1Y9ZA 3GJ3A 3E1SA 1I10A 1ZEMA 2DY1A 4LDJA 4W9RA 4WMLA 3W3AD 2WSMA 1T8YA 2ACEA 4P7GA 3TBKA 5E95A 3C5CA 3IEPA 3AI2A 1GAWA 3HYSA 2ES4A 4RPJA 5EP1A 2ZOSA 1N57A 3PXUA 3D6HA 2Z6QA 3VR5H 1NQOA 5KJFA 1OTYA 1PTJC 3HBAA 4MKFA 3KE8A 5T4HA 4JAVC 2IYLD 4G89A 3ZWWA 1GKKA 2A0KA 1V1JA 3GH3A 4PO8A 1VLQA 4RAOA 1RDFA 4BLUA 1PLJA 2BHTA 3FPBA 4WTOA 1A2QA 2BC9A 5DE3A 3I1IA 4LF6B 4HYQA 4K0RA 4NFHA 5E6RA 4QLBA 2O5EA 3Q9NA 4AAYA 1X7HA 4TS1A 1EDBA 1WCWA 3R3UA 3UHOA 1FLAA 1I3CA 3KZXA 5KTKA 3OZBA 2QNIA 2XSZD 1M6HA 3MTAA 5LJLA 2DSTA 2HJVA 1Y3DE 2OV4A 5LOVF 3RQSA 3CVUA 4M54A 2WSSD 4DHWA 2E18A 4W99A 2C57A 1Z4MA 3E9MA 3FCCA 1TW3A 3DBRB 2VK2A 3DMPA 3KXLA 1H2RS 1L6RA 2CLDX 2VAWA 2QDKA 2ZIXB 3KLNA 1W0CA 4LC1A 1AMNA 2QQ0A 1H93A 3H87A 4K05A 4KI0A 5DNWA 5EE3A 3G5MA 1ZOSA 2EF1A 4B0OA 3MWDB 2B78A 3ECAA 1TEVA 4FILA 2GJSA 1AK9A 3ONWA 1DQSA 1K5GA 5JIBA 2ZE5A 4W7IA 1XVLA 3EMVA 2GYYA 3ESBA 2ZIXA 1YS9A 2C8VA 4X7RA 2J1LA 2H5EA 5IC6A 1U28C 4CDNA 5ALIA 2B3TA 4KRFA 3LBNA 1RJGA 4QATA 4E30A 2O8DA 3M89A 3N59A 4MP6A 4ZK2A 1ISSA 3UKOA 1DEAA 2PGOA 13PKA 2H9AA 3LD9A 1TVKB 3EGOA 4UNSA 2VPYA 1L5MA 3Q2IA 5CYOA 4YCSA 2O3QA 3C15C 3IELA 5KNDD 3M6IA 1AQJA 2QAGA 1PWXA 3FMVA 3G8BA 4U8GA 3CGWA 5C1PA 1QZZA 3PBKA 2WUVA 2Q9BA 2PH7A 1O5IA 3G0HA 4LOHA 3RC8A 3COJA 3JZIA 3RHZA 1SQFA 4WZAB 5IF9A 1EP1B 2ZETA 1D9XA 4MGHA 2F4VB 1OJ7A 4LDPA 3BTVA 1MCZA 4MJLA 1Z6QA 3AI1A 5I9MA 1OWOA 2PCLA 4BQRA 2VH1A 1S3SA 3LUFA 3MJSA 5DLEA 4POOA 2B8NA 3K53A 4RZHA 4ND4A 2V6FA 5ICFA 3ZGZA 2DGDA 3N6VA 2HV9A 1K6EA 3FNIA 5F5XA 4BNZA 4TV9A 3BDIA 1WZEA 2QKYA 2V6GA 5BOVA 2QORA 2CCKA 4JJGA 3P9NA 1FSSA 3UG6A 3P0IA 2IOHA 1L1RA 3PXDA 5IZCC 4WGFA 3FBTA 3ANSA 3SBOA 2ZRHA 1SBCA 3H1BA 3A6PC 4Q4DA 1R6XA 3TMAA 4F56A 5IASA 4OATA 2X1HA 5DH9A 3A4MA 2BGGA 4R2KA 3RT7A 4NZMA 4FN5A 4NV0A 3L6BA 2WSIA 4N0PA 4WLEA 3N6RA 4ZO8A 4M8KA 4O1MA 3FD8A 1M33A 2VHJA 5ESXA 4LOIA 3KXIA 2TECE 2QXTA 4EB0A 2UYCA 3HB7A 2F1JA 3FA2A 2O8DB 5EWLB 2V6JA 1O0SA 3RFTA 5I48A 1XDDA 1F9EA 2GBLA 3H2SA 1CZNA 5BN1A 5E2IA 4GPZA 3F47A 1YMUA 4ZVVA 2Q1XA 1T1RA 3PR1A 2FZ4A 3ETGA 5DOZA 3PPYA 2XUQA 2QTFA 4BNMA 2OB2A 4W5HA 3ZXSA 2BHRA 2Q3CA 1LSOA 2PY6A 4Q3BA 1E7YA 4JFRA 1US8A 3HN7A 1EQAA 2M1ZA 3PXAA 3RE1A 5JH7A 5KX5A 3TECE 4GOMD 3EVTA 3OE7D 1PKXA 2RFLA 4U2GA 1YZFA 3AR8A 5SYAA 4JI3B 2C2KA 1OH5A 3NHLA 4PWYA 2H31A 5FEMA 5G02A 2YZNA 1A8HA 4UBNA 5J9FA 4B33A 4LF7B 2CY0A 4H59A 4KLRA 2V45A 3U9TA 3ZK8A 1EG7A 3HUDA 4HS4A 1H8HD 1HDOA 1M1XB 5IM4A 5JH7F 1Y8AA 2ZT7A 3AIMA 4AP9A 3A4IA 2ODBA 4P0TA 4FS3A 1JLKA 5CDHA 3RB8A 2CLMB 2GRUA 1F8XA 4KWHA 3CVVA 4CFZA 2OHXA 5T6MA 4ZGWA 4EBBA 4LXUA 5FD8A 2FE1A 4R16A 2GVDC 3FUTA 4RVHA 3A3PA 1AUVA 3CKMA 4LJSA 4ZYUA 2GBIA 1UK6A 1ZRMA 3R6WA 4L3OA 5FI3A 1PW5A 3BAFA 4A36A 3UMVA 3QY9A 2O7NA 3JPYA 4LYGA 1L7BA 4IV5A 3B13B 3FNGA 5KPJA 1MEOA 1E20A 3KB2A 3NV7A 5C81A 3KBBA 2QAIA 3NTQA 2G63A 3KR1A 2QBYB 4HDKA 4RCYA 4GI1A 4DV6B 2OQVA 3NHZA 4XD7A 4G84A 5BN4A 3KKLA 4E33A 1LDYA 3BIWA 3CLUD 3GO4A 3IMKA 3L5KA 1Y80A 1S1CA 3KOXA 2HC9A 2M6LA 1P0FA 5CK5A 4F2HA 3K2QA 4UAVA 3VX4A 4E11A 3MYYA 1YRYE 5HFNA 2BFWA 2IODA 3GN1A 1B00A 1W9HA 2H11A 2ZE7A 3V97A 3I2YX 5JO0A 4H3HB 3IKTA 3ROTA 1FQOA 1JSRA 2NUAB 3VNSA 3DLBA 3MJCA 1WUJS 4UE2A 1FDWA 1KYVA 3OESA 1C7IA 3L0PA 4RKEA 4RZ3A 2ZSUA 2BEJA 6AT1A 3THXB 3N07A 3IAM6 1ML3A 2P9BA 4IR7A 3F6YA 1B2LA 1QGYA 5IK2A 1YIAA 3TTXA 4XDHA 4BNDA 3TEFA 3UJCA 5DXAA 1KF0A 1I3LA 4BEWA 1Q2XA 4LZOA 3BGSA 4TVOA 1KMIY 4R6XA 4JJ4A 3MWGA 4GI3A 4I8DA 3DWIA 2YY5A 4B80A 2OWEA 4BJ1A 3GRCA 3ZVRA 3D8NA 3IAUA 2FSVC 2QS9A 3DEFA 3JWPA 5FLXA 3KVRA 3W7BA 5T67A 1QKIA 4FNGA 2EKPA 1GYQA 4Z7NB 5CCBA 2QZ4A 3FPHA 4JLMA 3KV3O 2ZS8A 3O9VA 1II8B 5E6UA 5JSZA 4X97A 2Y2VA 2PMKA 1P61B 4GAEA 3STYA 5LOVB 3PDIB 3Q7QA 5T4BA 4PRLA 1Y98A 3RUAA 1NUQA 2XKKA 2OB1A 4YT4A 3NHKA 3AK4A 4HMPA 4WNAA 1TM2A 1YQXA 2Q4RA 3OT1B 4GL4A 1Z7BA 4B31A 3ETEA 2COUA 4ZC1A 2RAPA 1UPBA 5L3ZA 4M1MA 2PUGA 1TPYA 1JYEA 3KZCA 3NNSA 3E03A 4OI1A 2G82A 4H1TA 4HC4A 4URFA 5BR8B 1QVRA 3M7IA 2DX7A 2C5AA 3T7IA 4C08A 1GA1A 1A71A 2ZYIA 3H5RA 1DIGA 3O8BA 4MKGA 5DTIA 3ESZA 3UB2A 4C14A 4EKEA 3WDMA 2J3HA 5H83A 4PS1A 4BVAA 1ULHA 3H97A 4PQRA 4KRGA 1JHVA 3D2BA 1J99A 1TQ4A 2G8NA 2JASA 2W98A 2IXFA 2Y0CA 3KBOA 3P4YA 1RXYA 2HFKA 2P91A 4J94A 4AWBA 2AR7A 4BB5A 2JGLA 2FJPA 3JALA 2HNBA 2PLAA 2C9CA 1GZ4A 2F67A 3IURA 4MQLA 3O03A 3TRFA 2CFSA 2CV1A 1HEYA 2JGJA 5KYVA 4OYHA 2JLQA 2VAVA 1T5OA 2BVNA 1A88A 1DNPA 3IHKA 3CG0A 2E37A 3AYXB 1A5AB 1L7EA 4MR8A 3ZQUA 3ZWVA 4PVCA 2QPAA 4E1BA 4MITA 1RJWA 1U7UA 5FOWA 1JFTA 1JE1A 3EH1A 5L3QB 5EVCA 3AUTA 2C31A 4UTRA 2IYZA 1GP2A 1JPNA 2ADOA 2IF2A 1NM5A 3AWDA 3OJXA 1ZJJA 2X8JA 3SS7X 5JRJA 4GWKA 1KMMA 1TU0A 3NYIA 4WZAE 1CJCA 4ZOCA 3I0ZA 1PVDA 3A1WA 4N8SA 1TADA 5H1YA 4TXHA 2OCGA 5TIIA 3VUEA 2KHZA 3QX3A 1YRBA 1KYWA 1ZLXA 3P45A 4UJ5A 5DASA 2QN1A 3OZCA 2CE7A 3RYTC 3OOEA 1RQGA 4C7MA 1OSNA 4ANFA 1KSJA 3TW8A 5E6UB 4C88A 1L5KA 1CYDA 3THWA 1TK9A 5LOVA 2J31A 1G5RA 4G8JA 4DMUB 1JBKA 1DWPA 2FPPB 3EMBA 1TRHA 2J7PA 5KOHA 3QU4A 3D4NA 1JAZA 4N39A 1NFRA 4WXYB 4YBZA 4NMWA 5DKFA 3UG7A 3E22B 3IP5A 1B0AA 1XNJA 2D5AA 3CRQA 1DTWB 3QLTA 3SD7A 3AVTA 1TT5A 3LPNA 4JBGA 1CERA 3RS9A 4W6ZA 3PNKA 5DT9A 2QDXA 3STHA 1IVNA 1GQ2A 1PT7A 5EXEA 1UANA 3KSBC 1IHPA 1ICEA 1IEVA 4XXHA 1FS4A 3WRYA 4U6NA 2GBPA 3JZDA 4C87A 2JW5A 1NV8A 3GLGB 4IIHA 2HMVA 3BL8A 3FX2A 1JG2A 1WTAA 2POCA 1T6NA 4JZYA 3K71B 1G8AA 1TIPA 3FYSA 4GOOD 1NXWA 4P3KA 4YRLA 4NNPA 2C5FA 2NAPA 4EG8A 1RYDA 2O19A 5IP5A 1DG1G 5AJUA 4FK8A