4OKIA

X-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the catalytic mechanism of the DH domain of the Mycobacterium tuberculosis polyketide synthase PpsC and architecture of the beta-carbon processing domains
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Phthiocerol synthesis polyketide synthase type I PpsC
total genus 63
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.41: Beta-ketoacyl-[acyl-carrier-protein] synthase I.
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4okiA00
3Q1LA 4CQMB 5K6AC 5KVQA 1VPDA 3FD8A 4ZD6A 2CD9A 4LCEA 1NPDA 3DQPA 4GVXA 3WXBA 3WLEA 5BNFA 4RZIA 3Q6IA 3BYZA 2XAAA 5L9AA 1WAMA 5A5FA 2X9GA 5IXYA 2CUKA 4YTEA 3FPLA 2J5QA 3Q11A 3PLRA 1VC2A 1X0XA 5FFFA 1A7KA 4AJEA 4QUKA 4GBJA 4D0SA 1QYVA 1K6IA 5JDIA 2YZ7A 2YDYA 4PGFA 5THKA 1Z73A 4BMSA 3CINA 1NPYA 4TQGA 4B4WA 4BO7A 3R3JA 4DC0A 4RGBA 1A27A 5IG2A 1IE3A 3MJTA 1PJ4A 1WMAA 4E5KA 1ZBQA 5DCWA 3PVZA 4Z6KA 1CJCA 3BMOB 2O3RA 3DBRA 2XXJA 3JD2A 2PH5A 3V5NA 5JAZA 3F47A 1DFGA 1NASA 2BF7A 3GVIA 3OHSX 4CJXA 4FGWA 2D0IA 4ZU3A 5U4QA 4R54A 4XCVA 1JU9A 4XYMA 1KIFA 1PJCA 5JCJA 1OZAA 5KJFA 1E7MA 1JVSA 2V6GA 3UCFA 1XELA 4YRBA 3KVOA 5HS6A 2PGDA 4NBTA 1A5ZA 1U7HA 1Z82A 2OP0A 3LT4A 2OBNA 1E1NA 4E3ZA 4UEJA 1P3DA 3I9JA 1R66A 2YJZA 3HDJA 4IINA 4QO7A 3VDQA 4BNJA 1KOLA 3X2FA 3TJRA 2NWQA 4BL5A 3KM0A 2HU2A 1FMCA 1HE3A 3H65A 4E2WA 3K30A 3KYCA 2BFPA 1LLUA 3ZZNA 3KHUA 4PG7A 1AHHA 5JPIA 1P1HA 1E0DA 4NBVA 5THQA 4Y6SA 1BGVA 3I4CA 1Q0HA 4EJ6A 4M8SA 4A2CA 3DWFA 2NV6A 3GVCA 3NGXA 5F3RA 3DHNA 3GHYA 1UP7A 1Y9AA 2PZMA 2WD8A 3WWZA 1DC4A 4CLOB 3JQEA 1YB4A 4J0FA 2GGSA 4BGUA 4XGIA 2CF6A 2O3UA 1NR7A 1PZFA 3LLVA 4CMEC 3DBLB 1ZK3A 5I7SA 3DMYA 4ZQFA 1DRVA 1PX0A 4BV9A 4RZHA 4JBIA 4LRSB 3Q9UA 1C0PA 4I1IA 2NU8A 5AXDA 4IDBA 4MDHA 4MIEA 3ZWMA 1A9ZA 3WWYA 4FOOA 1I2ZA 3G1TA 3RJ9A 1Y8RA 4R01A 1FK8A 1IPFA 5C7LO 1JAXA 3GGGA 1PJQA 1Y6JA 4FS3A 5TT0A 1LQTA 1R0KA 3F46A 1QXSA 4IQGA 4R1SA 5BR7A 1KETA 1X14A 3BZUA 3PK0A 1E1KA 2W2KB 4JQCA 3V1YA 2ET6A 4Z9XA 1BSVA 1Y8RB 4CM7A 3WGIA 3OJLA 2NLOA 4IJUA 3HE3A 3PYXA 5F5LA 1DHRA 4LSWA 2P68A 4Y9DA 1D8AA 1CRWG 3GF4A 5HBRA 1H2BA 4E5YA 3NKLA 2NACA 1HYEA 4N5MA 2B83A 2VYNA 4WASA 4AJLA 1EK6A 3I9MA 4R16A 3OMLA 4XB2A 3UW3A 5EQFA 3Q3CA 2O3SA 2YYYA 1HRDA 4W9NC 3EAGA 4DMMA 3QWIA 3WSWA 4E12A 2ZB4A 2FMUA 1FF9A 1Y1PA 3ITDA 2Y0CA 3U4CA 1X1TA 4B7XA 4NK5A 4QTZA 3BMOA 3DBRB 2GN6A 4GH5A 4XIJA 2TMDA 1B8UA 2ZCVA 3DZGA 5DDIP 1N7HA 2PNFA 2HUNA 5IZ4A 2HMVA 1IL0A 3RJ5A 1ZUD1 2O7QA 4BO4A 3CE6A 3WGTA 1HDCA 1GQ2A 3ON5A 4AJIA 1XQ1A 2OMEA 4CMKA 2FR0A 1V3TA 1G0OA 4Z9YA 1ISJA 1DXYA 3UXYA 4NFSA 3BMQB 2GN9A 2HJSA 3I9OA 4MP3A 4K6FA 2IODA 1CIVA 3AFNA 2V7PA 4DIFA 2HMTA 4M55A 3SJ7A 5LDHA 1R4MB 2ZK7A 1DLJA 4FFMA 3U3XA 3WQRA 1YJ8A 4I5EA 4XQEA 3D5TA 4XGKA 3NDIA 4BUCA 3V1UA 3LF1A 4FN4A 4H3VA 1I01A 3KYDA 4MVJE 4RVGA 1G0NA 2X5JO 2DTXA 2YHIB 2QX7A 2QZZA 4KQXA 4YJDA 5JCJD 1E3IA 4GL4A 2QYSA 3F9IA 3W1VA 1PGOA 1BW9A 4B79A 3ENKA 5U1PA 3RBXA 4BKUA 1GUFA 2WTBA 2FHSA 3NRCA 5CEFA 4U0KA 3WQQA 2VHVA 4J9VA 1LC3A 3P19A 3RUAA 3OECA 2B37A 3GOHA 4BKPA 5T8KA 3H4VA 1HZJA 3C24A 1TVEA 4H7PA 1YBAA 4ZQHA 3ZWCA 2W2KA 4G2NA 3I9NA 4MVJM 1DC5A 3WX0A 4AJPA 4BNFA 2Q4BA 2OL4A 4H16A 3WSVA 4AFNA 3IJPA 3RC1A 5KJEA 3ZHZA 4L73A 3H9UA 3F4LA 4LVCA 1KC3A 3GK3A 2DAPA 4Z0TA 3N7UA 4EI2A 2CDBA 1LSUA 4I9HA 1UJMA 1YJQA 4XB1A 2P4QA 3RQSA 4CM3A 1YBVA 2DQ4A 2LDXA 5HTOA 1H94A 2NVUA 5IDXA 2GR9A 4A7PA 1SZJG 3O8QA 2EKPA 4PLZA 4E5NA 2ZJ0A 1YOVA 3K6JA 1DLIA 2NQTA 4Q39A 4TZTA 1JA9A 1XU7A 1E3EA 1HETA 1CEQA 3GMDA 3ZWWA 3H5NA 3VC7A 3E82A 4AG3A 1HDOA 4BNTA 1JWBB 3VH1A 3BMNA 4L4XA 4MVJG 4RF2A 2Y1CA 3QSGA 3HUDA 3HNPA 4RDHA 3OIDA 3EVNA 2DFDA 5TJHA 4MINA 3MJVA 3NDJA 4EUFA 1UP4A 1GEGA 3ICCA 1FDVA 2XXBA 4IDFA 1UR5A 2E48A 2EEZA 1GD1O 3FRJA 3QVTA 2DKNA 1GDHA 2FP4A 3VTZA 1J4AA 1K0UA 1NVTA 3QP9A 1SPXA 4ITUA 3ZNPA 1H6BA 1XU9A 1PJ2A 3NAQA 5JBIA 4G81A 1IPEA 1MX3A 2NSDA 4GPD1 4KTVE 3TZHA 2PH3A 1K3TA 1M75A 4ZRMA 1IHXA 5JO0A 2I3GA 4AJ2A 1A4IA 3MOGA 1SAYA 2W2LA 4MVJA 3GMSA 3JQFA 3WNVA 3IKVA 3U4DA 3FI9A 3DDNA 2POQX 5G0TA 1LLCA 2ZQZA 4CV1A 5L7TA 1EQ2A 3ZN2A 4XDZA 5HA5A 5A9RA 4L4SA 4OSPA 1EFKA 4RVUA 1Q2XA 1ULUA 3HADA 3TRIA 4GSLA 1FDUA 3KEOA 3KB6A 4MVJH 3WICA 2G0TA 5CPBA 4P4GA 1UZMA 4CR6A 4DRYA 4JX8A 4FFRA 4UULA 4CQLA 3FBGA 4BO3A 3QWBA 5A04A 1GFSA 2B35A 1CWUA 3IJRA 3AW9A 4PLYA 2O3TA 3QV1A 4WCFB 4TVOA 3FN4A 2PKRA 1IB6A 1BWSA 4DGSA 2Y66A 3JD3A 4YR9A 1UDBA 1GQYA 5EIOA 1R0SA 5ICSA 2ZB3A 1LDBA 1ZW1A 4RF5A 3QWHA 3BMQA 1OBFO 4IMPA 5ITWA 1RM4A 3IL2A 1DOHA 5A1TA 3JD0A 3V8BA 1BXGA 5TS3A 2V65A 4J2HA 3ANMA 3WTBA 4BKOA 5CDGA 4A73A 1RJWA 4E5MA 1GY8A 1ZEJA 1D3AA 3SC6A 2AQHA 1A7AA 2WD7B 1Z7BA 1LDYA 3E6AA 1N1EA 3ICPA 1B8PA 5A3JA 3GT0A 3A14A 1NX6A 1L7EA 4HNHA 3VOSA 5FWNA 5TIIA 1U3TA 3ST7A 3H9JA 1NWCA 2DTDA 3DZBA 1ZK2A 3GR6A 5HM8A 4RV9A 2C07A 3WYCA 2AEMA 4DIOA 3S2EA 1QP8A 1E3WA 2Q1TA 1SB8A 4CMBA 5ER6A 5IAAA 2VHYA 4TVBA 3TWOA 1T4BA 4FBGA 5I9LA 2VZ0A 4S1VA 1QYCA 1C1DA 3JQGA 1DEHA 1M6WA 3GN1A 4DPMA 2VCYA 3DZJA 4PRKA 5J23A 4BO2A 1P33A 1EMDA 3DOCA 2FPIA 4HFNA 9LDTA 2X5KO 4IZIA 1L7DA 4U6SA 3KZVA 3DHEA 2PY6A 2QRLA 4OQYA 4YDRA 1J49A 4D42A 4P38A 1R16A 3JQ9C 3GQVA 4QECA 5KKCA 1KVTA 1G6KA 2WE8A 2YV3A 3NV9A 4ZHSA 4D3FA 4RDIA 5JAQA 2EERA 2F00A 2WMDA 2YFQA 4RVSA 1LTHR 1G1AA 4TRNA 3SX2A 4U5QA 2V6BA 1ADGA 5A05A 3S8MA 2X7HA 4J1NA 4L4RA 4I08A 4IMRA 5I9MA 4FOSA 2Z5LA 2WEKA 3IP1A 1I5RA 4HWKA 3F6YA 2X58A 1IY8A 3JQAA 3WIEA 1F06A 1HT0A 2BGLA 2JFHA 4GAEA 1M67A 3VPXA 2ZJ1A 2GSDA 3LC2O 2O50A 3WGYA 1N1GA 2VHWA 1X1EA 3L4SO 4LVUA 3OP4A 3DZFA 4EW6A 4XDYA 2EKQA 3I83A 2Z1NA 4XR4A 2DUWA 2LDBA 5DN9A 3ROPA 4D79A 5IZCC 2GCGA 1NWHA 3SVTA 3GFGA 2CDCA 2IXAA 2OFPA 4NBWA 4CL3A 1C0LA 5G4KA 1BXGB 3DFZA 4E4YA 4QSMA 4LCJA 2RHCA 1YGYA 4R3WA 1M76A 5I7EA 3UN1A 1OFGA 1LUAA 2E82A 1C3VA 2FR1A 4Q3BA 1N9GA 1SCUA 2C29D 1PS0A 3DBHA 2Z95A 2I3AA 1LEHA 3WGOA 4TRRA 4PCVA 2PZLA 4J91A 5KVCA 1NQOA 4B8ZA 5ICMA 5JLAA 3DTYA 3ADPA 3PDJA 4RVFA 3U49A 2J5KA 2HRZA 1O6ZA 2C2YA 4YAGA 4Q3DA 1DIGA 2IZZA 3WTCA 2B4TO 5L4LA 4ID9A 1IULA 1E77A 3GZNA 4DREA 4JBHA 3RROA 4CMIB 1VL6A 1XLTA 3EVTA 3S2GA 4MIOA 2O4CA 3JQ9A 3IQDB 3DMTA 4WCDA 3FR7A 1GPDG 4YAKA 4KUEA 3CPSA 1AHIA 4K1LA 5G0WA 4K28A 4WKGA 3W8FA 3WGZA 4A26A 3AWDA 4Q3NA 1EEHA 3JQAB 3EYWA 4AL4A 3UGKA 1QV6A 3DO5A 1YONA 5DT9A 1EE2A 4J90A 2QHXA 3HJAA 4WLEA 1X7GA 5T57A 3FNEA 3ROKA 1HDYA 2P5UA 1DRUA 4ALIA 3I9KA 2HQ1A 3TZCA 2BLLA 1KVQA 1P45A 1KVSA 5K0ZA 1DJNA 5KIAA 4R3NA 1ISFA 2BGMA 1DIRA 3G17A 4BO1A 3ASUA 5CFZA 4CMCA 3JQAD 3VZQA 1U28A 4PFJA 3A06A 3ZNOA 1ENZA 3P5SA 3L6EA 3HG7A 1GL3A 3BHIA 1ZKMA 2VWQA 1U8XX 3PYLA 3JQ7B 2FR8A 3LDHA 1NVMB 5AXBA 3B20A 1ISIA 1RWBA 1SEVA 4MOWA 4K26A 4YJGA 1LA2A 1U5CA 3LQFA 3F1LA 3CUKA 3CZRA 1LRKA 2VT3A 4GGPA 3JQGB 4KWHA 1XEAA 4UUOA 2AE2A 4J1TA 4AJ1A 1NQ5A 3GPIA 2BMAA 1R15A 2YFHA 4EGFA 1PJBA 3ZHXA 4BNHA 4NMHA 1U3UA 2BI7A 2Q3EA 3WB9A 2VWPA 2W4QA 3GZ4A 1PQWA 3L6DA 3SXPA 3TSCA 1PJSA 1QV7A 2HJRA 3PTZA 3SEFA 3E5RA 1E3SA 4HBGA 3GDOA 4ND4A 1LSSA 1U8FO 1PZHA 1DIHA 2IEBA 3VPGA 3WYEA 1ZSNA 2X23A 3NDRA 4HX5A 3AM4A 2JCYA 3KTDA 3EC7A 3TNLA 4XX0A 3O38A 2WSBA 3CIFA 4GWGA 2D59A 4FFOA 3ZV5A 3JYPA 1ONNA 5A9TA 1BXKA 1QYDA 1EBUA 3RUCA 1VE9A 1ZNQO 1U2GA 2QG4A 4PLPA 1N8KA 3ZHYA 4E2ZA 1I30A 4FW8A 3SJUA 3MTGA 1HSZA 2FRDA 4BQRA 4CL8A 3DAFA 1VLLA 3L6OO 4O59O 3JQFC 3QWFA 3K8ZA 1KBZA 3B1FA 4PLHA 3AJRA 4DC1A 4LMRA 3VZPA 3WLFA 5GZ1A 2VTDA 5GMOA 4JJFA 4DMLA 3TFOA 1C1XA 2FPPA 4JJIA 4CMIA 2P4HX 3ANLA 5L95A 4R5HA 3GN2A 2FN7A 1O9BA 3JQ8B 1ZH8A 3JD4A 2G82A 4BB5A 1GR0A 4PLGA 4XQ9A 2EWMA 3B1JA 2GLXA 1RYDA 2ZTMA 2WYUA 1WNTA 4IUYA 1XKQA 3QIVA 4CM1A 3GDGA 5I9NA 4BKRA 1P77A 1MC4A 5CG2A 4JIGA 4A0SA 1PJ3A 1Z75A 4GLOA 1J5PA 1IYZA 4B4OA 3WOHA 5FYDA 3DAPA 2E6UX 5AVOA 3UF0A 4E30A 4FQ8A 1PS9A 3ENNA 3NTOA 4BNWA 1ZIDA 3UH1A 3PLNA 3VZRA 2VYVA 1Q0QA 3EZYA 1EUCA 1F8FA 4YAEA 1ZSVA 1UAYA 4CPDA 1QRRA 5DULA 3E1KA 4AJNA 1Q7GA 4CLRA 3ETDA 4YT5A 2Q46A 1T2DA 3RC2A 1VL0A 5DF1A 4BIIA 3H2ZA 1MXHA 2HSDA 5A02A 2HKIA 3K92A 4QQRA 4D44A 1WZIA 3TZQA 1VJTA 2CVOA 3GVXA 4XQCA 4XYEA 3GZNB 2IYPA 2NU6A 2YV2A 1KC1A 4UUMA 2RAFA 2I65A 4ND5A 1E5QA 3BMCB 1YOVB 4IJKA 4GKBA 3OQ6A 2OP1A 2B69A 2ZATA 1QLJA 4RPGA 3E9MA 1LRJA 3RSHA 2B5VA 4EYEA 3BXXA 5EJ2A 1RM5A 5CEEA 4WE3A 1TB4A 1V6AA 5HRUA 3VPSA 2RBEA 3VTFA 1XHLA 1KYQA 2BRUA 3HHPA 4D41A 1N2SA 4ZVVA 1GCUA 1SOWA 3GRKA 3RU9A 4Z3DA 2X5OA 3F3SA 4O63O 4ONEA 4BNIA 4ND1A 2BKAA 2O3QA 2WYWA 3PHGA 1SMKA 1Q7CA 2X8LA 4N54A 1I3KA 4WEOA 4E31A 5DP1A 2VHXA 4EJ0A 4OKNA 1BG6A 2YY7A 3E18A 2OOSA 4DPKA 1AGNA 2TMGA 4S3MA 2I66A 1PZGA 4KP7A 3VZSA 2J5RA 4MKXA 2ZKLA 3ROMA 2OGUA 1ISMA 1B7GO 4OKIA 4OJNA 3BAZA 1Y8QA 2IYOA 4G5HA 4F46A 1HSOA 4NI5A 3GNSA 2HMSA 2Y05A 2DPGA 3VVCA 2DBVO 5ADHA 1OOEA 3FR8A 1GAEO 1NM5A 4RQUA 2IDZA 3ZW9A 3RAJA 2JAPA 5F1OA 1M2WA 4AVYA 1D1SA 3SC4A 4N5NA 2VYVD 2Q2VA 3SLGA 1NVGA 1AE1A 4AJ4A 1T1RA 3BTUA 2NM0A 4IGFA 5A3VA 2C2XA 3OEWA 4BV8A 3VAZA 4IIVA 4M87A 3VKVA 2Q49A 4ZQEA 3GAZA 3WGQA 3JQDA 3M1AA 1NTOA 3NGLA 4HADA 5JC8A 2I99A 3LSYA 1F14A 3DBVO 1P9LA 5CDTA 2WD7A 3H7AA 4R68A 2PZKA 3EUWA 4KZPA 4X54A 1K6XA 4CV3A 4TROA 4Y98A 4OHUA 2G5CA 4CLEA 2GNAA 3E48A 1E7QA 2C54A 3QA9A 2DUUA 1T2FA 1YB1A 1MA0A 1HDGO 4W9NA 2I9PA 3JQCA 1YVEI 1S6YA 3KXDA 1JVBA 2XPCA 1DPGA 4OYRA 2WDZA 1WP4A 3ZI0A 1E5LA 3EK2A 3ULKA 4MVJF 4OAQA 3MJCA 1ZK1A 2EW2A 3V2UA 1PL8A 1EDOA 5DBFA 3EGOA 3G0OA 4FJ0A 2HK8A 3GPDG 1E1LA 1ZK4A 2EXXA 3RUFA 4IQ8A 1VKOA 2RIRA 3HFGA 1D1TA 3UUWA 4OO3A 4W7HA 4XYLA 2O23A 4D46A 2DVMA 1CERA 2EP7A 1DC6A 3GFBA 3KLMX 1DFHA 3BIOA 3PQDA 2B5WA 4NU6A 5K9ZA 1KVUA 5COBA 2H1SA 3PP8A 1S7CA 5I7FA 4FCCA 5TLSA 3DFUA 4BNGA 4FGSA 2Y1FA 3I5MA 4YYZA 1JQBA 1U3VA 1U7TA 2D2IA 1ZJYA 5IN4A 2FOIA 3IIEA 5KJ6A 3F1KA 1A71A 2G17A 2Q2QA 3Q2IA 1WPQA 2Q45A 3IP3A 3MEQA 1E92A 4NG5A 1ZSYA 5IJZA 4D43A 3FF4A 5L3ZA 2ZTLA 4BKQA 1DC3A 4DQXA 4RPHA 4WLFA 3EDMA 1E7RA 3PGXA 3I4FA 5B4UA 1V0JA 3U09A 3RUDA 4IDAA 2DBZA 1O89A 5T64A 1IHYA 4R9RA 1K2WA 2YW9A 1GEEA 3CMMA 4LK3A 3UHAA 4GMGA 4O0LA 3ZW8A 4M89A 4Q3EA 3JTMA 5TC4A 4R4JA 1HLPA 5ITVA 2OORA 4B3JA 1ARZA 1D7OA 3GAFA 4DIBA 4Y8VA 5BSHA 3OEYA 3EHEA 1YXMA 4HXYA 5JYEA 3TZKA 4LGVA 4FC7A 4J4TA 3RU7A 4BO8A 4NFHA 4EJMA 5A9SA 4NIMA 3TZ6A 4D7AA 3W4JA 2FZWA 3GH3A 3FPCA 3QVXA 4M54A 5BSGA 5KOIA 1JLLA 5AXAA 3AUSA 3UKOA 1EK5A 3LC1O 1H9BA 1KEWA 3MOIA 5LDGA 4PIVA 1DDOA 3V1TC 4CLOA 3W4KA 4NK4A 4PVDA 4DYDA 5JYDA 2I6TA 1CETA 2CVZA 3PIDA 1PS8A 5FF9A 3ORFA 1DHTA 4NJMA 5TRTA 3HDQA 4H15A 4XYBA 1JDJA 2AEFA 2UDPA 4NR0A 1J0XO 2NADA 1LC0A 3DMTC 4RJTA 5JY6A 1Q1NA 4TKLA 1Y7TA 3JYQA 1H9AA 1N9GB 2UAGA 3L07A 1LDEA 4CM8B 1VSUA 4HUJA 1WDKA 1QG6A 3MWEB 1DAOA 1XSEA 3P2OA 4BNZA 3PZBA 3N74A 2Y1DA 1YL6A 1WMBA 3CMCO 3OJ0A 3PQFA 5EL0A 2AQIA 4BO9A 3GVHA 4CM4A 4ZJUA 1DBVO 4UVEA 2OZPA 2VUTA 1JKFA 1ADFA 1WVGA 3ZWXA 4WLUA 3P2YA 4J7UA 1ULSA 4AJJA 4ESOA 1Z6ZA 4UUPA 5TGDA 3DHYA 1U3WA 2QW8A 1NQAO 3TFQA 3MJSA 1MB4A 3KSZO 5L45A 4JLWA 3ZGYA 1H6DA 4F6CA 3AU8A 1NR1A 3K2BA 2VWHA 1P0FA 1AUPA 3H9GA 4D3SA 5T67A 1SBYA 2DBQA 4YT8A 5CHEA 1UZNA 2PV7A 4IXTA 1VM6A 3H3JA 3D5QA 2EJVA 1R4MA 3DOJA 1E7SA 3RI3A 4IBOA 4HFRA 4IS2A 1Z74A 1LLDA 1LDNA 3IUSA 3A4VA 3VHRA 5CAEA 1PWZA 6ADHA 2VZ9A 2D5CA 2GO1A 3E03A 1ONPA 3DR3A 4KDEA 4XYGA 5CG1A 3FWNA 1L1FA 4P22A 3OA0A 3WFIA 3JYOA 4UUNA 2NNLD 4FJ1A 1GZ4A 1HXHA 2W90A 4DUPA 4CODB 2B36A 4JNKA 1NHGA 3ANNA 2FSSA 3O03A 4DWVA 4EEXA 1MXFA 4J16A 1ISGA 4QXMA 1CQIA 4FSHA 3WGGA 3TDKA 4YPOA 1PU2A 1U4SA 2EJWA 4M86A 1XDWA 3FTNA 2FWMX 3D3WA 2FSVA 2NVWA 3D0OA 5IDYA 3H6KA 1P1KA 1I32A 2ZB8A 4OOFA 3HQ4O 3IOYA 1B3RA 3INRA 4ALMA 3NT4A 1ZO8A 4UREA 5IF3A 3GHHA 4HFJA 4I9UA 1X13A 5L40A 3KLPX 4PLTA 1B3BA 1E7WA 2ZIZA 4IDDA 2Q2WA 3IDSA 4RPKA 4JGBA 4WOJA 1ZZEA 4CM6A 1HE5A 5EN4A 1KEVA 2Q99A 5IDQA 2YHUA 3OIGA 2AA3A 3ZNNA 5H81A 1GPJA 2Y93A 1GZ3A 1K89A 3GC6A 2JJYA 4Y6PA 2VRBA 2A94A 1WWKA 2D8AA 2HK9A 1RKXA 3NJ4A 1DSSG 3PWSA 5JFOA 1YQDA 3PHJA 2Y68A 2ZTUA 4W82A 2GN4A 4BGEA 4CLRB 2AQ8A 4RVHA 4RCVA 1V8BA 3BHJA 1P1JA 1H93A 2BGKA 1GZ6A 4UVDA 4A10A 1B2LA 3MCVA 4BGVA 1EE9A 2EGHA 1YDWA 3F5QA 4FFPA 4PLWA 3IUPA 2IZ1A 4B7UA 1DAPA 1ADBA 3HDYA 3QLJA 3H9QA 3K5PA 2X4GA 1T2EA 1N7GA 4C7KA 4CQLB 1VL8A 4IIUA 4OH1A 1P1IA 4TKMA 4EBFA 5L4SA 4CMGA 4EUHA 4UEKA 1V9LA 2D1YA 5TF4A 4CUJA 2PR2A 3OM9A 2EV9A 1WDLA 1MUUA 3O8QB 1OI7A 2VRCD 3HFSA 5IXSA 1PL6A 1HKUA 3DL2A 5DOVA 1KERA 4DLBA 3BTOA 1TXGA 1ENYA 3JD1A 1LDGA 5ENDA 3G1UA 3FWZA 5ENVA 3M6IA 1EUZA 1R37A 5G0VA 4IZHA 3D4OA 4OMUA 4IXWA 5T5QA 3VPFA 5A5EA 4J2OA 5JDCA 4LSMA 2Y0EA 4ZGWA 4JCOA 3KYCB 4PVCA 5G0UA 1FXSA 2HO5A 2X0NA 3ZCXA 3F4BA 5JW6A 3U4IA 4WLOA 3DONA 3C1AA 4R1TA 1VKNA 4KOAA 4J1QA 5KTKA 1W73A 2R6JA 5DBGA 1DRWA 4XRGA 3K96A 4OOEA 4BOYA 1EVYA 4FC6A 4BNVA 3Q0EA 4YA6A 4FPXA 4YRDA 4DBVO 1PZEA 5JDIC 2AEJA 4U8GA 3F5SA 3H8VA 2DM6A 5EERA 4F6LA 3RUEA 4WJZA 2H63A 2NTNA 1W4ZA 2W2LD 1I3NA 3E9QA 3HB4X 4WNCA 4E5PA 4YQYA 3S2IA 3WFJA 4BVAA 1CF2O 3WJ7A 1JW9B 5IDWA 5DBIA 1YWGO 2J3IA 1XYGA 5H83A 4LMPA 4Y67A 5K6AA 4L74A 3C1OA 3I1JA 3HWRA 4YAJA 3QQPA 1EZ4A 4L75A 1OAAA 3ETGA 1KS9A 2JFGA 3AY3A 1EFLA 3DOOA 1HWYA 4II2A 2AG8A 5IZCA 3CSDA 1PEDA 3NJ8A 3PQEA 1DB3A 3EMKA 2BFOA 4ROSA 5KNLA 4PLVA 4II3A 1LNQA 4ILKA 2HLPA 3GGPA 3PGJA 2BI8A 4RQTA 3FTPA 4ZN6A 3ZU4A 1ZVMA 1E6WA 4UEOA 4B4UA 2HMUA 1JWAB 1MFZA 1LRLA 1SEPA 3GDFA 1J6UA 3QVOA 1KVRA 4AJKA 3UAGA 1QYWA 8ADHA 1UP6A 5G4LA 4XIYA 3C7DB 1UDCA 3R6DA 2X9VA 3OH8A 1TT7A 4HNGA 4P4NA 1UAGA 5C7IO 1GCOA 1I3LA 4OQZA 2EHDA 3OA2A 4HV4A 2FY8A 4NZ9A 4CMAA 4CM9D 1P74A 2NUAA 3X2EA 1BW9B 5L51A 1I3MA 2GZ2A 2VOJA 3IKTA 1PIWA 4PZEA 3PDUA 1MV8A 1GYQA 1E3WB 4O5OA 3OF2A 4A5OA 3PJEA 3DZKA 4CMHA 2P9EA 2GZ1A 2CY0A 1GQQA 4ALLA 3K9QO 3AY6A 2IZ0A 4W6ZA 4WGGA 3ZWVA 4RPJA 5IFLA 3BMCA 1IZ9A 1BMDA 3L4BA 2B0JA 2PD6A 2NU7A 2VOEA 4LN1A 2J3JA 5FEUA 3GGOA 2PTGA 1LSJA 2PGJA 1YO6A 3DAGA 2RH8A 3ZWOA 1M66A 1R4NA 1LXCA 3WGHA 4HFMA 3R0IA 2X6TA 3S1LA 4JXKA 1IOLA 4NH4A 3JQ6A 1DJQA 3DZIA 9LDBA 5I7VA 4CM5A 2OO5A 4WPGA 2YQ4A 4WUVA 3INTA 5CP8A 2A9FA 2P5YA 4DQVA 3RASA 3C1TA 4IDEA 3PFFA 2C5AA 3PHHA 5CEJA 3LZ6A 2PFGA 2V6FA 4CQMA 4GX5A 4B8WA 1XGKA 3AK4A 2AMFA 3JV7A 4WLNA 1GUZA 2JD1A 2YUTA 3U0BA 2QZ9A 3A9WA 5JO9A 3T7CA 4XA8A 3JYNA 4WECA 5JXWA 4ZA2A 1CYDA 2C59A 4ND3A 4BHTA 5JY1A 4YJFB 2VHZA 4CM9A 2C7VA 2J3KA 3AOEC 4DLLA 2DTEA 5BQFA 3QRWA 3ITKA 3BTVA 3IS3A 7ADHA 2H9IA 1PR9A 2DU8A 1DO8A 1PJLA 1C1XB 2Q1SA 4MKRA 3NT2A 5TSDA 2YV1A 3KO8A 5DOZA 1B8VA 2X0IA 5B4TA 1NAHA 3KRTA 1V3UA 4I5GA 5TQVA 4Z3KA 4L0QA 1QYXA 1F12A 3U5TA 3PIIA 4B3IA 1A72A 2DBRA 2R00C 4L9RA 3RKUA 3W6ZA 3LT1A 4CV0A 4OSOA 3UOGA 5HWSA 5LC1A 4BGIA 5ER9A 2JD2A 3NUGA 3ZV3A 3AY7A 3DBHB 1V3VA 3ABIA 3WBFA 5JE8A 1C0KA 1E6EA 3RC7A 1FDSA 1WLYA 4NJMB 3PHLA 4E0BA 1Y5RA 1B16A 5DZSA 4CV2A 4B4VA 2GZ3A 3KOUA 4ZQBA 3C8MA 3EW7A 2DPHA 3E8XA 2YQ5A 4J3FA 4YCAA 2G1UA 1DIAA 3S2FA 3VH2A 2CDAA 3KSUA 4MVJI 1XWFA 3ZWPA 3PFWO 1LX6A 1UXJA 3WG9A 1NAIA 2JHFA 4OXNA 2P9CA 4QO8A 3C3XA 3AI3A 1HL3A 4MO2A 1T24A 3DXFA 1QLHA 1NXQA 3L77A 4GX2A 2CFCA 1ZXLA 4YT4A 5A4DA 3JYLA 3ZU2A 4KWIA 5HS4A 3K73O 4GX1A 3Q9NA 3OICA 2GDZA 2YHIA 3B70A 3U4HA 5COAA 3NX4A 4OM8A 3I6QA 2RH4A 5KVVA 1F8GA 3PYMA 4JROA 3ZNQA 1I24A 3D1LA 4CMEA 1I10A 2HMWA 3BTSA 1OC4A 2CSUA 1ONOA 3AM5A 3GG2A 4LW8A 1RYEA 5JC1A 2ZB7A 1PQPA 4EEZA 2VTEA 1GV0A 4YT2A 2QRJA 2VWGA 3KYBA 1HEUA 4TRMA 1C1DB 3JCZA 4BO0A 1YH3A 1HZZA 4J0EA 4PG5A 3VH4A 2WM3A 3TPCA 4M1QA 4I5DA 1WXDA 4RO0A 3D4NA 3UVEA 5B4VA 2GN8A 4YBZA 5C37A 3GNQA 2DFVA 1A9YA 1LJ8A 1ZEMA 4GI2A 5TNXA 1KY5A 3B1KA 3KYDB 3G49A 1Z45A 3QY9A 3M2TA 1EUDA 1H6CA 1UXHA 2GYYA 2PD3A 4UVHA 1KEUA 2OXIA 1PGPA 4NDNE 4NBUA 4RVDA 2CMDA 4EZBA 5BSEA 3GVPA 1UUFA 3KEQA 4N5LA 3ONEA 4WLVA 1MLDA 5T8KC 1Y81A 4R41A 4XEHA 5L7YA 5KWEA 4E21A 4ND2A 1PGJA 4NHEA 1GV1A 2BH9A 3H2SA 4CM4B 1YQXA 4PN3A 2G76A 3M2PA 3OFSA 1PGNA 4TMFA 4WOKA 3WDSA 2VYND 1IUKA 4QFCA 4GKVA 3T7EA 1R4NB 3GUYA 4R1NA 3TL2A 4DPLA 2RCYA 1PGQA 3D4PA 4E13A 1A4UA 3L9WA 3I9LA 3W8DA 3CKYA 4J43A 1QR6A 3JQBC 4JBGA 4J9UE 4YRAA 1PTJA 5GY7A 2GPTA 2CVQA 3OJOA 4OIMA 1ZK0A 2NTJA 1TA4A 2DC1A 3DC2A 2JD0A 1ZMTA 3PWKA 4PZDA 3TF5A 2O48X 3AI1A 1ENOA 2NVBA 4EDFA 4MVJP 2Y1OA 1MG5A 1AN9A 4YB8A 2VN8A 4GWKA 2VQ3A 4KUHA 1F17A 1ZJZA 3MWDB 1Q7BA 4BNNA 3CTMA 4U0JA 4FFNA 5ILGA 1NHWA 5A9SB 4JP2A 1B0AA 4KTTE 1GYRA 1BTOA 2JAHA 2H6EA 1AXGA 3NTQA 1ISHA 2I5PO 1MG0A 5KJ1A 3WQSB 4XWYA 3PJGA 1LI4A 1NP3A 1V35A 2GD1O 2Y99A 1WW8A 2EF1A 5AQ1A 1ZFNA 4KUGA 4Q9NA 4FR5A 4QT0A 3SBOA 1SNYA 1JKIA 1GUYA 3VPHA 3E9NA 3R1IA 2NVUB 3OQ1A 3G3EA 1GYPA 1XQ6A 2E49A 3NEPX 4KQWA 4MPDA 4HY3A 4XJTA 2HRBA 3LU1A 2AW5A 1I2CA 1K5HA 2UV8A 4LRTB 4RL6A 3WMWA 1NYTA 4E2XA 1ORRA 3D64A 1U1IA 4XRRA 4Y6RA 3I52A 4ALKA 5A03A 4YJHB 4DA9A 2O3JA 2W8ZA 5G2OA 3LF2A 2F1KA 2HK7A 3ZWYA 1ML3A 3GRPA 3O4RA 4GLLA 3DTTA 1MGOA 6LDHA 4YAIA 4GQAA 3FCOA 2AQKA 3RWBA 1UXGA 4TWRA 4ALNA 1Y5MA 5G4KB 2AG5A 4E2YA 1RPNA 1QKIA 4CR8A 4C4OA 4DLAA 5JSFA 2BFAA 1P0CA 4JN6B 4ZRNA 4BMNA 4PZCA 4IDCA 4DBZA 4YVFA 3JQBA 2C20A 1UXIA 2Y1GA 4J7CA 3RVDA 1HE4A 3CZMA 3WJAA 3GA0A 4PG8A 5JNLA 3PPIA 2BD0A 1MFPA 1YE3A 3CH6A 1NQTA 5H82A 3LK7A 4YACA 3LC7O 3UCXA 4CMJA 2IXBA 1RM0A 3V2HA 4IM7A 1N92A 4R5MA 4A03A 4INAA 3I6IA 1HTBA 4FD3A 3HZZA 5JAIA 2NU9A 3H5AA 1BXZA 5TX7A 1EBFA 1M6HA 1FDWA 1GTMA 4XKJA 3RD5A 4D45A 4UVIA 2PD4A 4MKZA 1UZLA 2XF8A 2QYTA 3MTJA 3OJEA 4J7XA 4J1SA 2FPGA 4GGOA 3H5RA 4I8XA 2GRAA 1CQJA 1NFRA 2Y67A 2ZQYA 2ZTVA 4E33A 1XR3A 2D5AA 5CPFA 3TL3A 2CZCA 3CXRA 3O9ZA 1ZXBA 1B26A 1H5QA 1T2CA 2OBYA 1Q0LA 3DEYX 3A1NA 2UVDA 4FFLA 1HYHA 3P7MA 1H6AA 3KV3O 4DVJA 2X22A 4AJHA 4Q3CA 2WWRA 3I23A 1PWXA 2CNBA 2I76A 4HP8A 4L76A 1CDOA 4LISA 1ID1A 1EDZA 3RUIA 2VZ8A 1C0IA 8LDHA 2EG9A 1H0KA 4N18A 1P1RA 3W6UA 4BO6A 3M1LA 1I33A 3PWZA 4IY1A 1AXEA 4R1UA 1X7HA 1T25A 5EINA 1XCBA 4E6PA 3HB5X 1R0LA 1E6UA 1TLTA 4UAGA 1B14A 3GNTA 4MJLA 3UFXA 3PRJA 4NJOA 5JMWA 3FNGA 5B12A 3R3SA 2QIOA 1NFFA 2WE7A 2R2GA 1HDXA 4IJWA 2PKQO 5JAMA 3ONFA 2D3TA 5CDUA 2HDHA 1XIVA 1NBOA 4IPTA 5KJCA 2ZYAA 3N58A 4QX6A 4DTIA 1BDMA 5C5IA 1E7YA 4U7WA 1LU9A 4Z0PA 4W99A 2PKQP 4WEQA 2QQ5A 1B15A 1I8TA 4TZKA 2CF5A 4NQZA 2P9GA 2J6IA 1X7DA 2PLAA 2RHRA 4MVJD 3NYWA 1HE2A 2JCXA 1BVUA 4RF4A 5EPOA 3ZH2A 1ZCJA 5BNTA 1W0CA 2EW8A 3AM3A 4FJ2A 2VNAA 3OBBA 5KKAA 5AXCA 3PZRA 1SB9A 2O2SA 1WZEA 1YQGA 2VUSA 4PG4A 2ZCUA 5DP2A 5TT1A 2UUPA 5A06A 1FJHA 3ZU3A 5L53A 2UYYA 3PXXA 5G0SA 4D0RA 3B6ZA 3PJFA 4URFA 1JKJA 3IAHA 1EVJA 1RM3A 3BHMA 4BNMA 2Y1EA 2EP5A 3EY4A 1JTVA 4N7RA 4YQZA 1U4OA 3L9XA 1LBEA 2Q1UA 3TOZA 2JCVA 1O5IA 3JQ7A 1VI2A 1X0VA 3RCBA 3ZWBA 3K2EA 2O4UX 3GEMA 3GG9A 3G79A 1BHSA 1JAYA 4G65A 1E3LA 2V6MA 4IGEA 1MP0A 1T26A 3ZDFA 4QFDA 4RPLA 1LLQA 3V2GA 3LYLA 1H2HA 4R51A 4CM8A 3ONDA 3MJEA 3FNHA 2E37A 4PLCA 3ASVA 4B3HA 1Z7EA 2AHRA 3IC5A 4OL9A 4NBRA 1NNUA 2A92A 3GLQA 3GY0A 3AOGA 4RLHA 2I67A 2OHXA 4HKTA 3LT0A 1DFIA 1X15A 4BNKA 1LDMA 4Z9FA 3STHA 2YDXA 3ZV4A 3S55A 4CUKA 2WYVA 4FB5A 3LLSA 1C14A 4TRJA 2XOXA 4CLXA 4BO5A 1YB5A 4YWJA 4GSKA 4J6FA 3QVWA 3CEAA 1XA0A 2C5EA 1P44A 4RLSA 1LSOA 1D4FA 4AICA 4CLHA 4NU5A 2B4RO 5I8WA 4IS3A 4GX0A 5IN5A 1T1SA 4O6VA 2C0CA 4D3DA 3FBTA 4GMFA 3VVBA 5FI3A 4DXHA 2C7GA 5JCXA 4IJVA 3C85A 3JSAA 3QW2A 1TEHA 1OMOA 1YBMA 3PHIA 4BNYA 4F45A 5F1PA 4XGNA 1KY4A 3H3FA 1E1MA 5L4NA 3K31A 3OETA 3GEGA 4DL9A 2WJPA 5EQDA 4R69A 4K9DA 4NPCA 4XR9A 3RFVA 4ZICA 1YDEA 2PWZA 2EKLA 2PK3A 4BMVA 1PL7A 5GZ3A 4J49A 5DCUA 3OSUA 3TQHA 3A28A 3U9LA 1K6JA 4BNXA 4XQGA 1F0YA 2B4QA 3QVSA 2JHGA 3AUAA 1EVIA 4YXFA 4CR7A 2QRKA 2FZEA 1BVRA 2P91A 4XD2A 3RFTA 4WNIA 4PRLA 4A27A 4Q3AA 1YRLA 3KBOA 2PZJA 5COQA 3NTRA 4UVGA 3WIDA 2GERA 4OXYA 5B37A 1HLDA 2Q1WA 1E3JA 2Z1MA 3JQ8A 1YS4A 5BNIA 5C7OO 4RORA 1DIBA 4P8RA 2DT5A 2IRWA 4Z0HO 3EZLA 1YL5A 1T4DA 2JFFA 3T4EA 2DLDA 2ILTA 5JS6A 1U9JA 3LVFO 1W8DA 4K6CA 2PA3A 4R9SA 3QJ5A 4CLDA 5T6BA 4DQUA 1PR3A 2PGLA 1HYGA 3GUCA 3MJ4A 1UXKA 4TSKA 3RKRA 1YL7A 2VRCA 4E32A 5EMHA 4EUEA 3MZ0A 3NT5A 5DNAA 4O1MA 1SO8A 5BSFA 3E5MA 3U62A 4IDGA 4BQPA 3ADOA 4MP6A 4QEDA 1MC5A 4MP8A 4AJOA 7MDHA 1TI7A 5CDYA 2ZYGA 3WMXA 5B1YA 3QHAA 4RF3A 1BDBA 1GU7A 5F5NA 4ZQGA 1UDAA 3LT2A 1N5DA 2W98A 4JK3A 2JKVA 1O8CA 3HDHA 3O26A 3H9EO 3FNFA 5FI5A 4WCFA 4WCFC 2C82A 1IZ0A 2A4KA 4MIYA 4PG6A 4BB6A 1OC2A 3ETEA 5DCYA 3RBZA 2H5LA 3KETA 5AOVA 3ZV6A 1PSDA 1XG5A 3PI7A 3Q2KA 4I5FA 4J4HA 2VNSA 3WS7A 1FDTA 4BNUA 2Y0DA 3VKUA 5MGBA 3T4XA 2AXQA 5JMPA 4U6QA 3W4IA 4JP3A 5ILOA 3WYBA 4YJGB 2O2YA 4YEDA 3COSA 2D4AA 3TN7A 4CQMD 2R00A 3ZWAA 5C3MA 5JDCC 3RBVA 1HF3A 3RUHA 2HAEA 3AU9A 3OIFA 5MDHA 5BT9A 2AE1A 1NPTO 1QMGA 1KEPA 3W8EA 4ALJA 3UCEA 1VRWA 3WBBA 3ZHBA 2ZYDA 2OUIA 3DB2A 3FSRA 5F21A 1O94A 2JL1A 2Q4EA 3C7AA 2X1HA 4L8VA 2BELA 1R12A 4YJHA 2J8ZA 3C7CB 3D3EA 3AOEA 4M49A 3ZU5A 3PEFA 1QORA 1VJ0A 2UUOA 4XZ3A 4W4TA 2X86A 3RFXA 2GASA 4XJSA 3SLKA 1PJTA 3GEDA 5TJ9A 1P1FA 1R6DA 1ENPA 1W6UA 3UICA 2NTVA 3ZWNA 3AI2A 2IEDA 1TT5B 3D7LA 4JJGA 4P4LA 3L0DA 1Y9EA 2BFMA 4IQ0A 1O0SA 1BRMA 1T2AA 3BMNB 2GF2A 2NQ8A 3HN2A 1I2BA 1EQUA 3ROQA 1VSVA 3HSKA 1TT5A 1Y8QB 4NNJA 4WK6A 4BNLA 4YJFA 5CDSA 4W7IA 4EITA 3I3OA 3VH3A 1ADCA 2Q50A 4GVLA 5GZ6A 3OQBA 4BS9A 1VJ1A 1NFQA 2HCTA 4KMSA 4FIZA 3INGA 1UH5A 2E4AA 2VT2A 3KUXA 4KDFA 3QE3A 4OXKA 2P2SA 2VUUA 3L4BC 4DYVA 1SC6A 5EESA 4OGWA 5F1KA 3VDRA 5KVSA 4B7CA 1I0ZA 1JN0A 1QSGA 1HDZA 2GUGA 3WR5A 3RIHA 5I8ZA 3FHLA 3AFMA 4C7JA 2BHLA 4J4BA 3DZHA 2EIHA 1I36A 1GADO 1SOVA 3OJFA 3QWAA 2X0JA 3BA1A 1U2DA 4NFYA 5LCXA 2X9NA 3RC9A 1EVZA 4I9NA 1HDRA 1LQUA 1P31A 4PLFA 2X0RA 3AUTA 3DBLA 4FDAA 5U9CA 4CUZA 1ZMOA 2EGGA 1PQUA 5L7WA 1U5AA 5ES3A 2J3HA 3WNQA 1WDMA 2SCUA 3KSDO 5KCZA 2IE0A 3D3WB 3PJDA 3TOXA 1O95A 1YKFA 2O7SA 3AUUA 3HN7A 3IMFA 2A35A 5AYVA 4F3YA
chains in the Genus database with same CATH superfamily
1H5NA 3FX2A 3RPEA 5B3KA 4YRQA 5DM70 1R0YA 5C32A 1NPDA 2FZGA 2H2WA 2PGIA 3DQPA 1TYCA 3WXBA 4MWZA 3TOSA 1BS1A 3GJ0A 2CT8A 3VR2D 3BYZA 5ALDA 4DJFC 3BIFA 2HU8A 2SHKA 4Y3UA 4CN8A 3IBCA 3RODA 3H2JA 4KEAA 4PC3A 2F1IA 1B6RA 3KUUA 4FEYA 5FFFA 4S12A 2FPGB 4KW7A 4L8GA 3UK0A 4D0SA 4IDQA 3B3AA 1QYVA 2HBYA 2X40A 1DCFA 3FVTA 4BMSA 2I62A 3H8SA 5TE9A 2P1ZA 2P7HA 4QUDA 3CX8A 1VQ1A 2GKSA 4AF8A 3G0IA 1WMAA 1ZU5A 3RSOA 4TUYB 3K0KA 3TBFA 3A9CA 3MMNA 3VYUB 4BLRA 3PVZA 3GBSA 4ATNA 3DLPX 5FUQA 2XY4A 4KN5A 3JD2A 4BNDA 4CKCB 3EC2A 3HVIA 5JAZA 4HEJA 2FTKE 1MQSA 3I1FA 2VDKB 3M6VA 2XD9A 4XUGB 1T43A 3VZCA 4CJXA 4LWZA 5HE9A 1EHCA 1X19A 4F4UA 2ZRGA 1XNJA 4F9FA 2PJRA 1JU9A 1Y3CE 1PJCA 3MUOA 1JILA 1ZGJA 2BDTA 4UMEA 3H4MA 1E7MA 1JVSA 1ORVA 5IAGA 2R8XA 1NBMD 4R3UC 3D7SA 3HGQA 4AKSA 2AZTA 4KODA 5HS6A 2IIPA 5CLIA 1H8HA 1VGRA 2G04A 5E4FA 1Z82A 3D6HA 2I6FA 1K2VN 2OBNA 3C6XA 1QDUA 3O31A 4RZ3A 3SPXA 5FDFA 4UEJA 3BK2A 1CY0A 4C1NA 1I9GA 1S9DA 4HVLA 1RP1A 3FW1A 3DQZA 3O2JA 4BQNA 1YQTA 5CB4F 1J0CA 1Y1LA 4GP6A 3ILVA 4WNAA 2XT9A 3VSBA 3OZTA 3J7AC 3KM0A 2ZIFA 1HE3A 2GYWA 3PXEA 2Y76A 4E2WA 3GRVA 1W5FA 3K30A 1YVRA 3KYCA 3NDPA 3STWA 4B3DA 5J1SB 2CE7A 1EVEA 3HKCB 4JH0A 1LBIA 1MCZA 1Z5NA 3LKBA 5KAMA 2VJCA 1UBGA 3C3WA 4LTDA 3WAKA 2KJQA 3AKEA 2H11A 2ISCA 1JJVA 4Z3OA 2Y1WA 2BKEA 2GVDC 3V7UA 3ORHA 1NRXA 4JQZA 4YRCA 2H00A 1ZU4A 5JCPA 1C7FA 2GTPA 2WP8J 4A2CA 3NTLA 4AWAA 4NJEB 4JUIA 4ZVTA 3QFSA 3DHNA 4FWBA 3UJ8A 5NLLA 3VA7A 2VP3A 4HI0E 4OH7A 3WC4A 1PDOA 3ZCSA 3FXAA 1A9SA 2IPMA 4XGIA 2PT6A 4K8OA 4EA7A 3WNDA 4JBNA 1JG4A 3ZBTA 4CMEC 3TJZA 2OILA 4ZQFA 3SS9X 3G89A 4GP7A 4H1UA 1V1RA 3AR9A 4F4FA 1NOKA 1II0A 4YRKA 3W6NA 1VIVA 1DPFA 2O1SA 3CGGA 3W5IA 4I1IA 5AK3A 3ZTTA 3TPFA 1MO4A 1ZM7A 4IDBA 1U3FA 5E6SB 1NYQA 3DCIA 4K0RA 1A9ZA 4MIEA 5JS2A 4M0UA 4E09A 4A15A 2PLFA 3HBJA 1Y8RA 3T5GA 3O47A 1IPFA 1Z4IA 3U3ZA 3GGGA 1PJQA 2NUPB 3K2QA 3O0DA 5KINB 3EQ7A 4L57A 4DNPA 3F46A 1CSEE 1S02A 3QYJA 1SZCA 1JXOA 2CFRA 2FQ1A 1M72A 4JQCA 2ET6A 4UDNA 4ZI7B 3CF4A 1GPKA 4A8HA 1KBQA 1QUEA 1X1QA 1NV8A 2HCJB 1QHXA 3IPLA 1O03A 2QN2A 5ILQA 5CJPA 4C5AA 1DHRA 2FE1A 4LSWA 2YFYA 5CHYA 1XZCA 3B53X 4Y9DA 4Y9SA 5HBRA 4NCBA 3DWGA 1XMSA 4QRHA 2J9GA 4BQOA 5BXYA 1H8EA 4XWWA 4D9NA 4EQ6B 1DAIA 1XZAA 3DUFA 3GFTA 4N5MA 2B83A 5KHLB 1KQPA 2F8LA 1WPGA 4IIBA 4OU4A 4AJLA 1IN1A 5A4KA 4XB2A 3OMLA 5EQFA 2IOYA 4LDNA 5I4KA 3Q3CA 3R3HA 1H8HD 4YI5A 3ZIDA 3GXBA 4B44A 2RHMA 1U80A 2EG5A 3LUHA 3QV2A 5H7XA 2ZB4A 2FMUA 1CDEA 3PKJA 4B7XA 4QYMA 3U6KA 2WJIA 2J85A 1XI2A 3DBRB 4GH5A 4O4IF 4I4LA 4OATA 4XIJA 3SX0A 2TMDA 4GC5A 4X3PA 4C4XA 1J20A 1A95A 2Y1LA 3THWA 3LO8A 1N7HA 1QPBA 3TCKA 5A3SA 8OHMA 1UM9A 2VHTA 1MABA 4MS1B 3ZXXA 1VMAA 3D3QA 3GJSA 1V5EA 3B9BA 3NXSA 4N3GA 2V6IA 1L5HA 1E3TA 3AP3A 5T4FA 3ENVA 4LV8B 2JBAA 4MCHA 4LWOA 2ZTSA 1Z0KA 2ZRKA 5HMMA 5HFAA 1JBQA 1OPRA 3ZCRA 4DIUA 1TQHA 2OMEA 2YXBA 2FR0A 3PLAE 2HW8A 1DXYA 1FU7A 3UXYA 1V5GA 4PZYA 4CIYA 1RHQA 2HJSA 3I9OA 2TMKA 1RWNA 4K6FA 4MR9A 1CIVA 3LUFA 1CQPA 4MQEB 3IXLA 4S0XA 2HMTA 5LFAA 4QPZA 2AUMA 2UZ1B 2VF8A 4KQ9A 4DJJA 4E5VA 5ICEA 2CN1A 2FZ5A 1T2UA 1EDBA 3E81A 4FFMA 4JKIA 2QAGB 3CRMA 4KQHA 3PE4A 5K0JA 1NI5A 2VEDA 1VLQA 2G1KA 1ZGGA 4BUCA 4Y6OA 3V1UA 4QXRA 3LXXA 1DEOA 3QPUA 2NT3A 5I7UA 1EUYA 1NMZA 1JXAA 1RAEA 4RVGA 1G0NA 2QL9A 3G8DA 4L85A 1SQ6A 4E5DA 4MYCA 3N9IA 3RVSA 3SE7A 4UNPA 3G0GA 5JCJD 3VNUA 1SG0A 1ZRSA 4UEWA 5B3LA 2BSAA 4WVLA 5FA6A 2YMMA 4V0NA 3AFOA 1XTUA 3W1VA 1K92A 3AC0A 1IB0A 4B79A 3IIMA 4XFJA 3PUVA 1VPWA 3ENKA 1R6XA 3KJHA 1T9HA 5U1PA 3RBXA 3PX2A 4DT1A 1O9HA 1RYBA 1BD3A 5F51A 4BRUA 3NRCA 5CEFA 1SCQA 3RIGA 3WQQA 2AFRA 4M9SA 5AVKA 3OECA 3ZHOA 1WHTB 4RULA 3BXHA 3GOHA 3R3UA 3I0ZA 4BKPA 1MNAA 1AZSC 2J0QA 2IKSA 3A10A 4QFBA 3VR5H 3NYRA 2H07A 4FR2A 4LHWA 3NBYC 1JFVA 4LE0A 4TL7A 5D1HA 4KNYA 1V45E 4HXGA 1NURA 1TA0A 1P9WA 3HY4A 2X19A 5AW1A 3I9NA 2Y1XA 3F8TA 4MVJM 3NP7A 1ZI9A 1ECJA 5AKLA 1AKYA 4H16A 1T5IA 2OL4A 3GIWA 3ILXA 4HK4A 5BSUA 3WSVA 2JJ8A 5KQMA 3RC1A 2QTRA 4A8JC 1OBCA 1CTQA 3BIJA 3JZDA 4QDTA 1UWVA 4HO1X 3KQKA 4AYWA 4H3KB 2DAPA 1VG0B 1NNSA 3H83A 4N8SA 1UJMA 4D98A 4FMPA 4XB1A 2YWGA 2HGSA 2I7TA 1SBNE 2VJPA 3A9TA 1YACA 2DQ4A 1LBHA 4HDOB 4NMXB 1MDBA 4QUHA 3TTSA 3HYSA 4QQ8A 1CJKC 1SUEA 2PQ0A 3MTEA 4IW3B 2PX6A 4A7PA 5IDXA 5LQRA 1U7UA 1ODCA 2EKPA 4PLZA 3N70A 4KBYA 4E5NA 1YOVA 2NW6A 1HR0B 4AMGA 1Q7TA 2PT5A 3HZHA 4Q39A 1U0SY 1XJCA 4FFBB 1BFKA 1HETA 1CEQA 2G5GX 3BBLA 3GMDA 1TTTA 1RJDA 4KR0A 1IN7A 3KJNA 4MS3A 2PZAA 2V9ZA 5D1NA 3E82A 3QPAA 5FRDA 4Z51A 2H1VA 2IPOA 3ELWA 3H87A 3JR3A 4L4XA 4RF2A 4TWIA 3DMGA 4I6GA 2W22A 3ZE6A 4Z9BA 3HM2A 3IE1A 3VZBA 3OU7A 5E3IA 5JRZA 1P19A 5HK9A 2GF9A 2V9CA 4YK7A 1AK2A 3L7LA 4EUFA 1UP4A 1GEGA 1P3JA 1KYWA 4A8JB 3SFTA 3F74A 4XLZA 4C0QC 2J33A 3I37X 1I1QB 3AHIA 2OB1A 5M5BA 3O2NA 4GOLD 1J4AA 1K0UA 3QP9A 2O8VA 3MMXA 4ITUA 4I3GA 4Q03A 2H54A 1XU9A 1PJ2A 1L5GB 3R77A 2B82A 3ZNPA 2X1MA 4HEA6 1SBZA 4W1RA 4D9GA 4BMDA 4G81A 1TIPA 2OG1A 4GPD1 4KTVE 1YE5A 2CNWA 1A4RA 3D7NA 4ZRMA 3HRIA 2B98A 4IG4A 2OEPA 3ANXA 3JQFA 4D74A 2GPYA 1C29B 2IUSA 5CLLA 3B3JA 4PAMA 3ZDCA 4NAVA 1NBHA 4FE3A 2P9HA 3MS2A 1FQJA 5GJCA 3I72A 4G1BA 1KFCB 1TUGA 1ZAKA 3H17A 3CF4G 2X8JB 1YZNA 4HATA 1P1BA 1PDWA 3K1ZA 4ZT4A 3QKTA 1ULUA 3HADA 3ZCPA 1FDUA 1TC1A 5MHTA 3MAAC 4R40A 2G0TA 2ZBRA 3W5DA 2HJVA 2EWVA 4OX9B 4CR6A 1ZUWA 4DRYA 4UULA 5DGXA 2H5JA 2OC4A 2PX4A 3O92A 2WAAA 5IARA 4IDPA 5CNKA 5EJ5A 1QIKA 1SQSA 1SKBA 3IJRA 5DN6A 2CUTA 3N2NA 8GPBA 5B2FA 4AYXA 2FEPA 1JJ7A 3R3YA 4FHDA 4MJXA 4ZT6A 2Q5CA 4D96A 3OQNA 2PMFA 4TVOA 3FN4A 4CCAA 1NN0A 1AUQA 1COWD 4H7EA 1T3LA 4DGSA 3BXGA 3E58A 3G7UA 1MZVA 2OG2A 1GQYA 5ICSA 3H2BA 3TB6A 1HC7A 1ZW1A 4RF5A 1UJ2A 3F67A 3REOA 2OD7A 2QZSA 5DGTA 3IL2A 3SXUA 4UCXA 2RARA 2V8BA 3AR2A 3JD0A 1OYVA 3V8BA 1W36B 2V65A 2X2PA 4J2HA 3CIOA 5FHRA 4EARA 3OJWA 5JCOA 4QFMA 4A73A 5CDGA 1CC1S 1KDOA 1O6GA 1ZEJA 2WT9A 4BFXA 3SC6A 2WT4A 4GPBA 1R9MA 1XQVA 3R5KA 1M1YB 2BM9A 1M2OB 5LVAA 4KG7A 2ZPAA 3PICA 5EHNA 1K27A 4HNHA 5HM6A 3M9WA 1OYYA 4C6RA 5FWNA 3PB3A 4LIPD 2HHAA 1UC8A 4GXNA 5EP1A 3HU2A 3FVVA 4L3OA 4Q3OA 3URKA 4X63A 1Z7YA 3S2EA 1QP8A 2B9VA 4JUBA 2RC5A 1GKUB 3Q7IA 4MTCA 3WV5A 5LQCA 3KPUA 3A6KA 1SB8A 4TKVB 5IUJC 4CMBA 3QVMA 2Z4RA 4IIGA 2VHYA 4TVBA 4YV2A 4L15A 1MDFA 5FOQA 4FBGA 3S5UA 2AN4A 3B7PA 3LL4A 1P2FA 1QYCA 1C1DA 3HB7A 4I8IA 1M6WA 2XKAA 5AM0A 5FBHA 1D2EA 1KXJA 3V00A 1DAHA 1QH8A 3DOCA 1M2EA 4FQ5A 3O91A 5JUWA 1PX2A 1WR8A 1FB5A 2XNKA 1SQ0A 2JFZA 2Q6VA 2V6JA 2QRLA 4R2XA 1T8RA 2P5TB 4BMYA 1L4FA 5FLEX 1KXZA 4YDRA 1J49A 1A8IA 2RJ3A 1VHLA 1Z37A 3N5CA 2AOTA 2O8EA 3EDCA 3AVXA 4LKRA 3IAS1 1LPOA 1I51A 1G6KA 1KDVA 1RC8A 1NIJA 721PA 2BUCA 4HL6A 1ZWKA 3FOAA 3RYTC 5P21A 3FPHA 2CLIB 2IH2A 1Y1TA 2I3BA 3LFUA 3BMXA 4F4DA 2YYSA 1X1DA 2EERA 2QTTA 1YRBA 1GN8A 1CV2A 3CKMA 3R0ZA 1G1AA 4TRNA 2OCKA 4U5QA 1RFGE 1IWPB 1ADGA 1USGA 3NVMB 3TRKA 5KNBA 3S8MA 4IEEA 2X7HA 1QJCA 4Q4HA 2QRZA 4OXQA 5DLDA 1E9BA 5BSVA 5CT8A 2CJPA 3RANA 1RPJA 1Z6PA 1HQCA 2QT1A 2QGFA 4K2AA 2Z5LA 1LWNA 4TT3D 1YCFA 3JZAA 1IY8A 3I2IA 1HT0A 1XPUA 1USWA 5ALIA 2JFHA 3RS4A 1PVVA 2IYYA 3SIXA 4RXTA 1CRZA 3DO8A 4L2IB 4UKDA 4BZXA 3U1BA 3LMKA 5AVJA 2A78A 2KSQA 3OE4A 4OI4A 4TLAA 4EVQA 10MHA 3SIPA 3LDFA 1X1EA 3VNRA 3L4SO 1W2WB 5LQAA 1W48A 2WVJA 4H60A 1ZNYA 5DK4A 5K2OA 3OP4A 2OM6A 3W2FA 4XDYA 6REQB 1C9JA 3NWPA 2DUWA 4OCZA 3ROPA 4OHWA 2GCGA 4CL3A 2CDCA 1NU8A 3TVYA 4I55B 3GPLA 3TE7A 3BCUA 1HI9A 1BWPA 1MT0A 3JSXA 3PDWA 4GWLA 4FYJA 1YR8A 5EHQA 1T3TA 3L84A 2XVXA 4DM7A 5B7GA 1M76A 5I7EA 1FS6A 2JBAB 4A6DA 1QFSA 3UN1A 5T4EA 4ZI7A 4NYMQ 1S5PA 2DJ5A 1C3VA 2FR1A 3QXCA 2QMZA 4Q3BA 1W34A 3IMEA 1FP4B 1CUAA 1PS0A 2JLBA 3AFGA 3DBHA 5J5CA 1EJ0A 1LEHA 1FVFA 4JQSA 4O5AA 2ZJ3A 3FSEA 3GJ7A 3WGOA 3U1VA 1GITA 1E2MA 4MITA 1NQOA 2F3SA 1PK8A 1XTKA 1YQUA 2HCBA 2WFMA 2V98A 2WILA 3I09A 4EI9A 3E8SA 1ID8A 1LBTA 4G67A 1G66A 5KCMA 4AZWA 4HVCA 2HRZA 3UENA 1P80A 4NENB 2J5XA 2C2YA 4CG1A 3UHOA 4L7QA 4MR7A 1PBNA 2SKDA 5CLFA 2C5GA 4CCWA 4Q3DA 1JBKA 3TDMA 1UC4B 1D1QA 1Y5IA 3DF7A 1NW4A 3CEMA 4ID9A 1E77A 1MRSA 2C2GA 2CK3A 2HLHA 1PKEA 2W58A 3UJ6A 4GXTA 2VAVA 1VL6A 3KU4A 4P80A 3PNLA 2C2KA 4F0JA 2Q5OA 3IQDB 4YHBA 4Z4HA 2P9BA 2W0MA 3LV8A 2XHEA 1P4GA 1M34A 3IDFA 4YAKA 5AUPB 5KOJA 4KUEA 3SR3A 4XVHA 1AJEA 1I7NA 1CUYA 4EF5A 3CPSA 2YRXA 2AKAB 4URVR 5JAPA 5G0WA 3H4IA 5HEKA 1PR1A 4K28A 2HSEA 4PZAA 2WV7A 5DHTA 1JU3A 1WA5A 3U3KA 2W6JA 2F1HA 4DQ0A 1TUIA 3AWDA 2P2DA 3OUTA 3JQAB 1RW4A 3MQFA 4KVFA 3WJ1A 4UNNA 3UGKA 4YYEA 2HIAA 2HLDD 3DO5A 3BWEA 2C4HA 3OZAA 4TYMA 5DT9A 1COZA 3AINA 3HBLA 3GLIB 1THMA 1X7GA 1XZDA 4D5EA 1HDYA 2P5UA 2A9QA 2ORVA 3I9KA 421PA 4F38A 1L3IA 3CV3A 3TZCA 3UT0A 3URMA 1KTVA 1NYLA 4JLVA 1R9GA 4PHTA 3FHJA 4GPZA 3IEMA 5KIAA 1UBRS 4WMLA 1ISFA 3M89A 5DCLA 4NZZA 1AQIA 5KYUA 1F20A 2XA1A 1T3ZA 3CRNA 1YT5A 5BUSA 1J24A 3T0GA 2G72A 3G1WA 1V39A 1BU5A 3ZNOA 5CGZA 4JLMA 2FW7A 3W5SA 3M6FA 5JBQA 3EXIB 2I91A 2QLFA 4BLWA 3U7RA 3NAZA 2C7OA 3OHPA 1U28C 5BXQC 2P6MA 5AW8A 1QCZA 2OHOA 1Q91A 4YJGA 2FX5A 4WESA 4P3OA 5AESA 1JQAA 2ICAA 1RPAA 1U5CA 4BB0A 3AJEA 4DMGA 5DI3B 3DC7A 1C9NA 1EX9A 1SBHA 2BFFB 3O82A 5SZKB 2PQ2A 3CZRA 2ANCA 2VT3A 1LK0A 1IRXA 1VKHA 1XEAA 3PBKA 3IURA 4J1TA 5E9WA 1M5TA 5EIWA 2PRKA 1ZICA 3ZHXA 3VKGA 3VU0A 1U6KA 1GTG1 1U3UA 3C4VA 4BASA 1Z2CA 2VWPA 5DXAA 3SXPA 3T95A 1AB6A 1YQQA 3ETLA 3K9LA 4A6EA 2E89A 3A1WA 2QB5A 3PTZA 1R74A 3FHOA 1NBME 5F2EA 3TAXA 1W44A 1W9MA 3IKLA 3HJHA 3RHZA 4EFDA 4US2R 3GDOA 1OPXA 1OU0A 1LSSA 3VPGA 5F52A 3E5HA 4HX5A 2AKEA 3ICOA 3AM4A 1HPLA 5EZYF 3KTDA 4FNGA 3CIFA 4K86A 4GWGA 4X1IB 4OU5A 2D59A 3ZV5A 2W48A 4MI9A 1GGHA 4ON9A 1EBUA 3R7WA 5INTA 2C9OA 5JAHA 3R5TA 3WWCA 3KZOA 3SKXA 2WPDA 1WMFA 2B1GA 1NF8A 4MV1A 4XVQA 4A91A 1NR5A 1ZMBA 2H1IA 4MYHA 4ZK6A 4CL8A 3TLZA 1VLLA 5IC5A 1JEOA 2FG7C 3V2IA 1U3DA 3TE6A 4C7MA 1CZKA 1YZLA 4DDUA 2F9FA 3DG9A 2BISA 3ZHRA 5IM4F 2BMVA 4JJFA 3R2JA 1QF6A 1RQ7A 3A05A 3KQOA 4JJIA 1A9OA 3R8XA 3O8OA 1WW3A 1KS2A 3VC1A 4B45A 3L0SA 3VR2A 5BNZA 4HGOA 4LHEA 3GN2A 1GVHA 3ZIAD 2QS9A 1ZH8A 2IXEA 1BXRA 1FJ2A 1TQDA 3KWMA 2EWMA 3B1JA 1C50A 2JRCA 3LHFA 3ND6A 2WYUA 1XKQA 2AN5A 1KI8A 3LZCA 4N0EA 4CM1A 3GDGA 1E79A 3PNBA 4R2MA 4F3RA 5BY2A 1EP9A 2O8BA 5I9NA 4ISBA 2NXNA 2IS2A 1C3XA 3B8HA 2JAUA 4A0SA 4C4RA 2M32A 3ZUPA 2IHTA 1T6YA 5AVOA 4OHFA 2WWXA 3B1VA 3EISA 4LC1A 2Q07A 4HXFB 4FQ8A 3R20A 4U9HS 4FKZA 2GXAA 5E6UA 5ALLA 2V7VA 1QU3A 1Z88A 2BHRA 1VA4A 2ZRNA 3NTOA 1KMHB 5F4ZA 5EUMA 1P0IA 4GE3A 5BSTA 3VZRA 3ED5A 1WXXA 2ZIEA 3EZYA 4J94A 4CPDA 3LOUA 1NE2A 1Y33E 4N3AA 3NAGA 1QRRA 5DULA 3E1KA 3WB2A 3NYQA 2HIHA 2IEGA 1Z22A 4OMFG 4DB4A 4MUKA 4YT5A 4ZJYA 1H42A 1WIWA 1KDZA 3GLGB 3E3NA 3MELA 3FWYA 1FU8A 1ECGA 3K92A 2H0AA 2BW0A 4IH1A 1PCXA 5DEIA 4ZCSA 4CW7A 3CF6R 3RVBA 2CVOA 1KSFX 5CVJA 4MS4B 3GZNB 4XYEA 3WLHA 6GPBA 2H16A 2IYPA 2YV2A 1RZRD 4DAEA 2XE6A 2CLSA 3DL0A 4L3WA 4YCLA 2E4VA 3DXZA 4F71A 1FOEB 2I65A 1E5QA 3P9SA 1TVCA 1YOVB 1PD0A 2JGKA 4WX2B 5AJYA 3NM6B 3X1WA 3IAXA 4Q7QA 4NE2A 4P7GA 4IJMA 2YUIA 1NNLA 2EVWX 1QLJA 3O4HA 4RE5A 4JZYA 3RS0A 1U0HC 1X42A 3EIEA 3ROTA 4UFPA 2B5VA 2Q6IA 4EYEA 4NDZA 1RM5A 1OXSC 1ZI6A 1EM6A 3KOOA 3KJQA 1C4WA 1C81A 1V6AA 2QY9A 4C0HA 2BOVA 2O07A 1N0HA 1V7PC 2QYOA 1XHLA 4GZ3A 1JHZA 1HG1A 2PSEA 5D51S 1DP4A 1GWNA 2J0UB 3F3MA 4RL4A 5EWJB 1KKMA 3OOEA 4H6VA 3TECE 3IPRA 4EO4A 4ONEA 3G85A 4UE2A 3GCGA 4OK3A 5I7AA 4EW3A 3LDAA 5FKJA 1F2UA 2YQZA 1Q7CA 4HH4A 4BU1A 4CETA 2B3DA 2X14A 1N2XA 4H6PA 3L6BA 3OU6A 1BMFD 5DP1A 2GTIA 5IS2A 1DWOA 4JJ4A 2XB2A 1BG6A 1J5XA 3A7EA 4DPKA 1TJ3A 2VT7A 3P2IA 3FTEA 2BGNA 4Q9IA 3UMSA 1AIPA 3C14C 4G1UC 1JPJA 1PZGA 4WKNA 2P6PA 4WFKA 5C81A 3AGPA 3VZSA 2J5RA 4RJKA 4MKXA 2ZKLA 3L1UA 5D3QA 5EWMA 5FFNA 4ARBA 5CYGA 5K3DA 1ICEA 1SURA 2IYOA 2WHQA 3UHJA 5CK5A 4W1PA 3MGBA 4NI5A 4F21A 4A0FA 2WBLC 3KVVA 4D9IA 4REQB 5DLPA 3RG8A 3OLCX 2Q4RA 1QG2A 1NM5A 4UAJA 1K7SN 1WTAA 4Z8YA 3QI7A 3G9UA 1PP4A 3I1YA 4ZZIA 1D1SA 3PNYA 3KALA 2Y9MB 1KKUA 1SQFA 2VYVD 1A9QA 2XMRA 3A6EA 1AE1A 4MQUA 1MA3A 4BCCA 2C4KA 4AJ4A 4I4NA 1T1RA 1CZLA 2C2XA 1ZC4A 3OEWA 5I9SA 3UJ3X 3KKLA 4BV8A 4EYKA 5ALVA 3UGJA 4IIVA 1Z07A 2NTYC 2ZOSA 2AVDA 3O90A 1EIWA 2FPOA 3I8SA 4N7BA 1NJ5A 1T4GA 3GAZA 3E35A 3OO0A 4IIEA 3WGQA 4B3MB 2XI4A 1H2ZA 2I99A 3LSYA 1KK3A 2RE8A 5LXTB 2WD7A 2WIFA 3H7AA 4P08A 1I5OA 1POWA 1GGJA 2WG0A 4CT5A 4Y98A 4AXXA 4G86A 3EUEA 2XB6A 5KNCD 2PL3A 2C54A 1Y6RA 4HPWA 4B0PA 1YB1A 2C0QA 3FZEA 4ZQIA 1Q6ZA 2I9PA 1OXUA 3HKDB 3INNA 1Z29A 4JENA 3JVEA 5TARA 3PSHA 1J33A 1JVBA 1L5HB 1DPGA 3H13A 2WDZA 1JR3A 1TQ2A 3IQIX 3WK4A 4A3SA 2W7TA 1E5LA 1BMFA 5EG5A 2CLCX 4AJ9A 2FRDC 1ZR2A 3DH0A 3RWOA 4L16A 3ONVA 3QVUA 1XZPA 1ZK1A 1EX1A 1DG9A 3M6XA 5DNEA 1H23A 1PL8A 2Q5LA 1BEZA 5AKEA 5DBFA 3V2UA 2BBOA 2QNRA 3PUHA 3VV2A 4EB3A 1YR2A 3CG4A 4RK5A 4OYLA 5IK2D 3USES 3N7AA 2G77B 1E1LA 4B47A 2R8ZA 3RUFA 1VKOA 1P6QA 4YRLA 1P4HA 1KGSA 1Y7LA 4ICIA 1ZR4A 2W2VA 2O23A 2DUMA 2DVMA 2WNSA 4DFDA 3VPAA 3G8AA 4RENA 4Q12A 1DC6A 4GD3Q 4NOMA 5HIMA 1YR7A 3O8BA 2B5WA 4G0OA 3OEHD 3G5MA 1V3QE 5CVTA 1RXSA 2OQ2A 1QVZA 2M9MA 3EXFA 1KSGA 3LVBA 4DCGA 1Z63A 1U8ZA 3TQFA 5K7SA 1SM4A 3UG6A 2GJSA 1NQUA 5D5QA 1KIAA 5FQOA 4FGSA 1W4BA 1E99A 1GFZA 1ZJYA 1RMYA 4EGQA 1SVLA 1TX4B 2GK3A 4ZYVA 2LCIA 2A5LA 2N1BA 5E4YA 1XZLA 4KWTA 3HYNA 2RGRA 3GEIA 4O2AA 2ZRIA 2JIRA 3SJBA 1U04A 2FEKA 1I7PA 3A31A 3R9IA 4PZPA 3MUEA 2XYHA 2NSLA 1AT1A 3NP9A 5AK6A 4BKQA 5AVZA 1DC3A 1ODKA 4LDAA 2EFCB 4DQXA 1QRUA 4RPHA 4WN3A 4LHXA 2KS6A 4AO6A 1YNOA 2AJTA 4IDHA 1DXOA 4NMWA 3S40A 2ZT5A 3WIUA 4E22A 1N9KA 5K8LA 5KX5F 2L82A 3U09A 2DBZA 2FR8C 2QUAA 2WIGA 2RHDA 4H7KA 3ZW8A 1L9KA 3AERB 3CMMA 1U9YA 4LK3A 2JFWA 4M89A 4UTOA 4C04A 5HUHA 3OX3A 5TC4A 2CBZA 3T35A 5ITVA 2XNHA 1G8AA 2OORA 3EVCA 3ZLVA 3VYWA 1ARZA 1D7OA 4UATA 3GAFA 1H5UA 4BCBA 2C57A 3B2NA 4ZTUB 3HYRA 4HB2A 5BSHA 3MHPA 3HK2A 2J30A 3OEYA 1E18A 3EHEA 2O0KA 5EKSA 1NT4A 3L7YA 2C9ZA 2GVZC 3QBDA 3QMVA 4HXYA 4MYRA 3EODA 3TZKA 3WYFA 3JWHA 4EATA 4F9TA 5EXEA 1T5TA 2DSTA 3HCCA 3P71T 1Z2AA 3QEMB 4PYLA 3JASB 3GH3A 3H0EA 1SKQA 1Q95A 2HHLA 4X6YA 5KOIA 2C96A 2VEOA 5J4KA 5B1IA 4IKOA 4M1KA 1K06A 1MAAA 1M7HA 1POXA 2I8AA 2PZBA 1KEWA 4ME6A 4H3SA 1E6KA 3P94A 4WT7A 3V4PB 8ATCA 3OX2A 1HNWB 3HU1A 5FF9A 3ORFA 1DHTA 1Y3FE 2A1UB 3E3LA 2PS1A 4NJMA 4PO9A 1G6Q1 5LQSA 3HDQA 5CA0A 3OLVA 2P9FA 4V02A 2B1IA 2XMBA 3P9KA 3BZWA 3BD8A 4FFVA 4AY6A 4OMCA 2MT9A 3DMTC 5F2OA 4RJTA 4JI2B 2PYZA 3ETHA 1K68A 1E2FA 3NDBB 2WJJA 1QIDA 4RLQA 1Z16A 4J76A 1M1YE 4G41A 4CM8B 1WU8A 1FPQA 2ACVA 2OO3A 3IBFA 3IYLW 1DAOA 1GXSA 4G97A 4ZOLA 1JEQA 3P2OA 1ZGZA 2O1XA 3RT7A 4E1BA 4DY4A 4RSHA 4GL2A 4BV3A 1LNZA 3CMCO 4G8DA 4NU8X 2IVFA 4HZUB 2AQIA 4XQEA 4CM4A 4YXWD 4IKPA 4UQPA 1DBVO 4B17A 5AW0A 4K7JA 2YVAA 3WWDA 3FH0A 3MFYA 2J07A 2ETVA 3ZCVA 1S4MA 4KL8S 1QCYA 3G9XA 3NBUA 2QOEA 4C08A 1U8TA 3SDSA 2NP6A 3V3KA 3CTPA 2BY4A 5LZ8A 3GRCA 4RSRA 2JB9A 3EFEA 3IP9A 4ARSA 1L7MA 3QHPA 2YWFA 4H4EA 1E0SA 1NNI1 4F6CA 5JISA 3QPDA 2Q0HA 3H9GA 4D3SA 3TTYA 1SBYA 5D7BA 5E1OA 3W2IA 4WXPA 1O0CA 1DJPA 3ZR4B 1VM6A 5FTWA 3SEAA 4ZIRA 2Y0BA 2WOOA 2EJVA 4UBOA 4FEEA 5LMNB 16PKA 3U3RA 1N9ZA 1E7SA 2JHPA 5DNWA 1G17A 4B82A 4Z7OB 1Z74A 1LLDA 3QFCA 4WH0A 2FPRA 1XZNA 1LDNA 2OHIA 2VZLA 2ADOA 4FMDF 3A4VA 2X41A 3TZLA 3VHRA 4BMPB 2MU1A 5DYTA 4KAXA 2VZ9A 2NZ8A 1MW8X 4MUJA 3QX3A 1Z4NA 1JHDA 4KDEA 4IICA 2O2XA 3B5EA 5H8WA 4RV5A 1AMUA 2XCIA 4LCBA 5EVJA 3JYOA 1A50B 5CFOA 4GLJA 1BDIA 3ELDA 1N33B 1TZ2A 4DUPA 2ACWA 1LZLA 2IHKA 4JNKA 1FSSA 2NAPA 2WSLA 3NCTA 3OCUA 1Q16A 2IOFA 3PEVA 4XB6B 4C01A 4DWVA 4EEXA 1MXFA 1YZVA 1ISGA 2I54A 3GV0A 4PBSA 3MVEA 1ODTC 3RVOA 6Q21A 4L50A 2H51A 4U4AA 2ZM5A 2CLEB 2FW8A 2VAMA 3LDUA 3SIWA 4AKTA 2FWMX 5CH8A 3H5IA 1JL3A 4O8CA 2HT6A 2YS6A 3CR3C 1E63A 4G0PA 2C7PA 3DR5A 4MB6A 4MWSA 3H6KA 1P1KA 3A4TA 4HPXB 3A7DA 5AW7A 2ZYTX 4DWOA 2GPNA 4ALMA 3C98A 4ND6A 4QREA 3FCEA 3GHHA 1AV7A 3IAUA 4G09A 5FOSA 4D0LB 2QRVB 4EHLA 3JW8A 3C41J 4HH3C 4UNRA 4P0PB 3K4QA 3KE9A 4FU0A 4IDDA 4TQ9A 3O8RA 3PF8A 4ZOLB 1Z0AA 4CM6A 4QJ4A 5FT9A 1KEVA 1TEXA 3SK0A 4B3GA 3TW0A 2QN9A 4M9XA 2R7LA 4BLSA 3H11B 5HJEA 2DB3A 3HKEA 2CUNA 1EGAA 2RGBA 3ZNNA 3HKBB 5ECGC 1GPJA 1CHNA 1J2EA 5TGTA 3HO1A 3SYKA 5B7QA 1K89A 4OD0A 2CHUA 1IATA 4LNAA 3ZE2B 2WTEA 1Z2PX 3EZ9A 3SKVA 1JYFA 1NJ8A 5DMXA 2FPMA 1RT9A 3F8SA 5JFOA 3PHJA 3R3XA 4G26A 4ZVMA 1EA7A 5FAKA 2PS9A 2V4MA 5JS7A 3IQEA 4R8MA 2QJTA 2NO4A 2QVBA 2ZBDA 3RNOA 3FTQA 3KSBC 3MPUA 1ZJ6A 1QP7A 3BHJA 1XEXA 3MWJA 4JOCA 4IIXA 5AKKA 3KZMA 1JXQA 4L8YA 1G9XA 3IOEA 1YJAA 3DE7X 3EXHA 3ZE7A 1YR6A 2CC2A 3ZKAA 1ZL0A 3FHTA 2AXPA 1EE9A 2M6RA 1VE6A 2V5VA 3JASA 4LSZA 4RD0A 4J8PA 4PLWA 3UY4A 5HTKA 3RSLA 2BMWA 1DAPA 1KMNA 4ZV7A 1ADBA 2XYPA 1ZD2P 3K20A 3H9QA 3O4FA 4GP9A 1XA4A 1GRRA 1T2EA 2B6HA 4KFSA 1A2KC 1MU0A 1N7GA 3DT6A 4OH1A 2FEXA 2PX3A 4XASA 3CJTA 4Z3KA 3OZWA 5C8YB 5DBHX 3A3NA 1BD4A 1EVLA 2D1YA 2O2HA 5TF4A 1MB9A 4RHUA 3WKDA 4RKWA 2POCA 1L5WA 3LXRA 3HFSA 4K5QA 1QVRA 3DLBA 1SKYB 1Y5LA 4Y0NA 4OV6B 3GJ6A 3JRXA 1BCRB 3Q8WA 1KERA 1VKJA 1TXGA 3CUTA 1ENYA 3JR7A 4JT4A 2BTQA 1PQYA 3JD1A 2BJHA 4ER6A 1LDGA 4RIGA 5ENDA 3EX7C 3VV3A 3G1UA 5ENVA 1G9TA 2DWUA 1PR5A 4X66B 2LVBA 1VOTA 1EUZA 2P9QA 4KPEC 2GBLC 3QOWA 2ZM6B 2JFXA 4RJ2A 3WLJA 2PUFA 3T5DA 2I78A 1ULZA 1NJ1A 5JDCA 3HL0A 4J2OA 3SG0A 1G4AE 4D9KA 2AJBA 2DRIA 4RK1A 3AESA 4KPYA 1A8SA 4K6OA 5KSOA 5C52B 4W9MC 3KYCB 4HDCA 1AB5A 4PVCA 3R6LA 5FL7A 2HO5A 3SZGA 2OCPA 2X0NA 3TXXA 3ZCXA 3TNYA 2EGUA 3F4BA 3W77A 1JLKA 1XMJA 1FNBA 4I2NA 4U5XA 3U4IA 5CX1A 3V4ZA 1YCHA 4C29A 2BAGA 4GFDA 4L22A 3ROFA 1G1MA 2VJDA 4XIGS 4LE1A 2A5DA 3H6GA 5D8DA 4E4TA 1DRWA 4WOBA 4CG0A 2WUGA 3NW9A 1EVYA 1AMNA 4H4DA 4CIAA 3NH9A 4ZCLA 2PRZA 4JAVC 3OZGA 1PZEA 2FW1A 2RGXA 2AEJA 3I2HA 1ZNZA 2H18A 3BFKA 4LDJA 5EKXA 3WP1B 5ALMA 4KN8A 1KARA 4HJXA 3Q72A 3VNBA 3VSEA 5EVCA 3TNJA 5CCEA 5F78A 4DG9A 4IO0A 3OF3A 1KF0A 3E9QA 1I3NA 1WVMA 3OZRA 4EAQA 3WFJA 5ARBA 5HCIA 3WJ7A 3VR6H 1X1BA 1A97A 5IDWA 1TZBA 2J3IA 4H77A 1XYGA 3KZ1E 4AN4A 1OX5A 2HCFA 4M6WA 4W9RA 4LC0A 3CF0A 3D7MA 3HWRA 3OQMA 3A4LA 1EZ4A 2WSYB 2C3YA 1OAAA 4P3NA 2WA1A 1EFLA 2ZWOA 1ZMRA 3DOOA 4II2A 3CSDA 3NJ8A 2QU8A 1K08A 2YS7A 4C05A 2BFOA 5KNLA 2YNMD 4PLVA 4ILKA 3GXOA 3K9HA 3K0EA 3PGJA 2VNKA 3CH4B 2BI8A 4FT4A 3FGZA 1YJBA 4H59A 4KQGA 3TMKA 1FDRA 1JWAB 3ZYZA 3INYA 4AJKA 1RRFA 5EHZA 2XUKA 3L5OA 3IQFA 5KWVA 4RM2A 3N8HA 1YZKA 1VI5A 1EQAA 3F3YA 2I1QA 2O0JA 1PHRA 3UXMA 2DERA 1B2RA 4IL5A 3DVAB 3OLWA 1I3LA 3JQPA 2EHDA 1T2VA 1U2DC 2XV1A 3KQTA 3NHLA 3FA2A 1J0BA 2FY8A 4GPEA 4DHWA 4CM9D 1J00A 3CW2A 1I80A 4HX9A 1HV8A 3DOIA 2ZS8A 3TLEA 3DFKA 3PQCA 4D80A 5ICFA 4LFAB 3X2EA 2VUIB 4E08A 3MTDA 4ZVUA 1NTRA 5KQRA 4IDNA 1N6HA 3FPSA 4PZEA 1MV8A 1PV2A 1GYQA 1VXOA 3EXIA 1DT3A 3EDOA 4G01B 4TWZA 3DGFC 1UBFA 3ZTWA 2WU4A 1JIVA 3PJEA 3PNKA 2BTEA 1B1CA 3EZ6A 2P9EA 2EFEB 2GZ1A 4UZSA 2H92A 4A8PA 1CFJA 1QH1B 4IO1A 3WLOA 4RGYA 4ERNA 4RPJA 3S44A 3EF1A 1LV7A 3H5WA 3RLIA 5LPNA 2X1LA 2P3OA 2JI7A 1GJRA 4LN1A 3WHPA 3W3AH 3GGOA 5LL6P 4XPIA 3N87A 2IF2A 3H05A 1LVUA 1KR2A 2JZNA 3DAGA 5KNDA 2RH8A 4Q6BA 4I5IA 1M66A 1WSBA 3TM4A 1LXCA 3ECAA 4FZ3A 4HVAA 1IU9A 4QOFA 4ZYYA 4CKXA 1IOLA 2VVTA 3JQ6A 3DZIA 3SEZA 3AUXA 1MJFA 5FOWA 2OO5A 4WPGA 4BQSA 3SF8A 1WUIS 3INTA 2AMYA 2Q3BA 2QQFA 5CAEB 2IIQA 5IDVA 2IV3A 5IT0A 1GT91 5A4MS 3U17A 5KTNA 2VA9A 3C1TA 1N36B 3QNWA 4POOA 4G0MA 4LA4A 3LZ6A 1OJ7A 2PFGA 3RLFA 4FMBB 4KVZA 1SULA 3UHFA 1XGKA 3AK4A 2AMFA 1X94A 3IT3A 4A1FA 1CUZA 1MR3F 2DT8A 2JD1A 3F5DA 3WK5A 3EDRA 1RYNA 1QB8A 1ZLXA 1IHDA 3KAPA 4XA8A 5JXWA 5HF8A 4WFIA 3CNQS 2XXAB 2QW1A 3B38A 4JLPA 1QIHA 5JY1A 1MX9A 3N2ZB 3ZDDA 4ARCA 1E98A 2VTBB 3DEKA 4CM9A 2C7VA 4GYJA 2J3KA 4JB3A 2DTEA 2QTVA 1N0VC 1PT5A 3BREA 4AUMA 2PPVA 3ITKA