4OKIA

X-ray structure of the nucleotide-binding subdomain of the enoylreductase domain of ppsc from mycobacterium tuberculosis
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
NEAATFGVAYLTAWHSLCEVGRLSPGERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phthiocerol synthesis polyketide synthase type I PpsC
publication title Insights into the catalytic mechanism of the DH domain of the Mycobacterium tuberculosis polyketide synthase PpsC and architecture of the beta-carbon processing domains
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 63
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature ec 2.3.1.41: Beta-ketoacyl-[acyl-carrier-protein] synthase I.
pdb deposition date 2014-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4okiA00
3EAGA 4J9UE 5IAAA 3D3EA 4CQLA 3GPIA 5HBRA 5C5IA 1NQOA 4K9DA 4YJGB 3S2FA 5CDTA 3GVHA 3FR8A 1T2CA 3FTPA 4ALLA 4LGVA 1PJSA 1R37A 4GVXA 1ISGA 1DB3A 4WNIA 4CLOA 1NYTA 2UVDA 4JJFA 1DJNA 2X9GA 3CSDA 1ZXBA 2PGDA 3WXBA 1PJQA 1NPDA 5IDWA 4YVFA 4J0EA 1IE3A 1VJ0A 3GZNA 4RQTA 1ISFA 3SX2A 1ORRA 4Y8VA 1O0SA 1Y5RA 2UUOA 3IAHA 3PYXA 2RH4A 4MP6A 3DONA 4U5QA 2POQX 1HDGO 2CSUA 4BO0A 5JCJA 4CM4B 1TLTA 2Y1EA 4CLEA 1T1RA 2R6JA 4DREA 2YUTA 3HG7A 1ZSVA 4Q3DA 2GRAA 1PR9A 4YTEA 2X23A 3DOCA 3KYCA 1R66A 5DBGA 2G17A 3ITKA 3ICCA 4TQGA 4YT8A 3F5QA 3T4EA 1RYDA 1YOVA 2PTGA 1QYWA 3DFZA 4NU6A 5K6AA 3H3JA 4MJLA 4AJ4A 1EVJA 1LLUA 1DIBA 5EQFA 1B14A 3GLQA 4BO9A 2YFQA 4GWGA 1UXHA 2QW8A 1AUPA 1FDSA 1ZMOA 2C2YA 1PJTA 1I32A 2PA3A 5U4QA 1PR3A 1G6KA 2B35A 4FC7A 1PWZA 4I8XA 3ZWOA 1DSSG 3VPFA 1N92A 2UV8A 5ENDA 1VJTA 1Z45A 4QUKA 2SCUA 2FHSA 1ZJYA 3CUKA 2PKQO 4FDAA 3IC5A 2AW5A 3H5NA 1YQGA 2RHCA 1NR7A 3M1LA 4RF2A 3S1LA 2DPHA 1ZSNA 2A9FA 4NZ9A 1E1MA 3OJFA 2DPGA 4P22A 3VVCA 3V1TC 2DU8A 4CM6A 4DC0A 2QHXA 4L8VA 4N54A 3WSWA 1B3RA 1I2BA 2NU6A 3B70A 4M54A 1KEVA 1LSJA 2HKIA 1KEPA 1VL0A 3QE3A 3G1TA 4O63O 3U09A 1A4UA 2Y0EA 1PJLA 1WVGA 2LDBA 2O50A 2VHWA 4RORA 3M2PA 1LI4A 3MWEB 1F8FA 3PFWO 1XLTA 5AXDA 5U9CA 3WICA 2FR1A 1UUFA 4FFRA 4XR9A 3GG9A 5JY6A 2CY0A 5COBA 1ONNA 3K31A 3RVDA 4A2CA 3ZCXA 1H6DA 3WMXA 4AJNA 1LNQA 5KTKA 3GFGA 1U3TA 3WLEA 3W4KA 4IQGA 1JVBA 2YV2A 2VT2A 2UUPA 3L6OO 1PQPA 1H9AA 4BIIA 5JSFA 3S8MA 4NMHA 2P4QA 1PJCA 3GDFA 4CMAA 1AHHA 4L4RA 3ASUA 4EJ6A 2P9EA 3L6DA 2HUNA 2YW9A 3Q0EA 4XD2A 4DQUA 2RHRA 3GUCA 1H5QA 2C59A 1JKIA 1C0LA 3AUUA 3VDRA 5EN4A 5CEJA 1TB4A 2CF5A 1ZK1A 1YB1A 2NUAA 3PYMA 4J91A 1HYHA 3B1KA 3ZWYA 3TZCA 1ZUD1 4OIMA 5TS3A 3V2GA 1YE3A 1R4MB 1Q7GA 3FR7A 3DBLA 4XGKA 3WTCA 2G76A 2G0TA 2P68A 1EMDA 5I8WA 1B15A 2ZB3A 4PLVA 3TZQA 1ZEJA 4HFNA 1W6UA 4J6FA 3F4LA 3ROMA 4BO4A 1P1HA 3LK7A 2HMTA 5F5LA 1NQTA 1VKNA 1YBVA 4JIGA 2HMWA 3JTMA 3DFUA 5A5EA 1HT0A 3A4VA 1U4SA 4W6ZA 1GL3A 5L45A 2P5YA 3FNGA 4NDNE 1FDTA 2X8LA 4UVDA 1LSOA 4CM3A 1JW9B 3N74A 2QZZA 2D1YA 3ZI0A 3DZIA 1SO8A 1I3KA 1H9BA 1P1RA 8ADHA 5DDIP 1AHIA 1HZJA 1KETA 2E48A 2GNAA 3EYWA 2O2YA 2O2SA 4I08A 3WGZA 5THQA 3ETDA 4CV0A 3I4FA 3TQHA 1DBVO 3JQGB 2IZ0A 4FFPA 4NR0A 3ZHZA 2BD0A 4GKVA 4D3SA 4A27A 5CDGA 1OAAA 4PLZA 3MJ4A 4H7PA 5COQA 4Y6SA 5A05A 5L53A 1XU9A 3DMTC 1T2FA 2D59A 2Y05A 2VYVD 4W7IA 3CINA 4YT5A 2BFPA 3ICPA 1R12A 1A5ZA 4IZHA 4YQYA 4AJEA 5KVCA 4J4HA 1LSSA 1YDEA 4JX8A 5L51A 3RUEA 4U8GA 2EKQA 1D1SA 3QIVA 4BNIA 4PG6A 5FYDA 3CEAA 4TKMA 1NPYA 1K0UA 1FXSA 2J5KA 4RVGA 2I3GA 4CLRB 5TGDA 2GERA 4CJXA 2ZK7A 1MG5A 1GU7A 4RCVA 3D64A 4CM5A 5DBFA 4KDEA 1XYGA 4DYDA 2Y0CA 4JJGA 3V5NA 4RVFA 2JCVA 3HB5X 3WYCA 1ZK2A 4QO7A 3GGOA 3DBHB 2EG9A 1A7AA 4A03A 4CR6A 3PJDA 3E03A 2H5LA 2EXXA 3H9EO 1ZMTA 3OIDA 2PK3A 2VWGA 5JS6A 3ABIA 1YL6A 3JQ7A 1B16A 2TMGA 3U4HA 3NTOA 1T25A 4OOFA 1GFSA 5JLAA 5FEUA 2CUKA 2VRCD 3KYBA 3NUGA 3F1KA 3DHEA 1IHYA 3PQEA 4NFYA 4TKLA 1YONA 5AOVA 4BOYA 2WSBA 3WJ7A 4IGFA 1DC6A 2OZPA 1NASA 4NBVA 5TSDA 3WSVA 2ZTUA 3WYEA 5IZ4A 4IJWA 2AQKA 2D2IA 2I66A 3MTJA 4JK3A 5JDCC 5AXCA 3PJEA 1AGNA 3FBGA 3I3OA 3M1AA 2EKPA 4Z3KA 1Q1NA 4EYEA 1N7GA 1E1LA 1RYEA 3GVPA 1JWBB 3WWYA 2DTEA 1ML3A 2Y1OA 3C8MA 5K6AC 1EUDA 2WM3A 1CWUA 1X7DA 3LC1O 3ST7A 1NAHA 2ZTMA 4UREA 5BSFA 2QQ5A 1HXHA 3QWBA 1ISMA 4M89A 4TSKA 1M6HA 3UN1A 4ND2A 4YWJA 1ADGA 3TZ6A 1BW9A 1E7MA 2HK8A 3E5RA 3KRTA 5TRTA 4DPMA 3QSGA 4IZIA 3CMMA 4YYZA 4ZJUA 4GGOA 1EZ4A 1M67A 1EDZA 1HDRA 1K2WA 3ZU4A 1WDLA 4BUCA 3WQRA 4HWKA 4KTVE 4TRJA 3GT0A 4R51A 3WGOA 4D79A 3BTSA 4RZHA 3QW2A 3I9KA 4WCFB 4NHEA 1JAYA 5JAIA 4UUNA 1HE2A 4DMLA 2O3QA 1EK5A 3PTZA 1PWXA 5G0UA 3NAQA 1VC2A 1E5QA 1M66A 4FGSA 3NEPX 4XB1A 2QZ9A 4CMGA 1UH5A 2ZIZA 2RBEA 1UR5A 3H9GA 4L76A 3SJ7A 3JYNA 2X5JO 1ZSYA 4BGUA 3R6DA 3WGYA 4WKGA 1ISJA 1B7GO 4OH1A 3ZNQA 3OH8A 1MFPA 4L4SA 2X22A 2BLLA 4KDFA 3ZU3A 5GZ3A 1UXGA 3JD3A 4RLSA 3O9ZA 1VE9A 4NFSA 1GZ4A 5T64A 1D4FA 1M76A 2DM6A 3U62A 3LC2O 1JQBA 4EUHA 2VYVA 3BXXA 4MVJM 2YV1A 1A72A 3KYDA 2DBZA 3RKRA 2DUUA 2A92A 2DUWA 3CIFA 4PFJA 5EIOA 2O7QA 9LDTA 3FPCA 1GQQA 2Q4EA 4K28A 3DAFA 4YT4A 1UAYA 3L4SO 2HJRA 1DDOA 2OFPA 3ZWBA 1DFGA 2ET6A 3OICA 4TVOA 2VQ3A 2JJYA 3HDHA 3R3SA 4CM8B 4K1LA 2ZTLA 4I5FA 4ZRNA 3ZHYA 1E7RA 5I7SA 2C7VA 5DCUA 1J6UA 1ADCA 3LLVA 1DEHA 1EVZA 1QORA 2NVWA 4Q9NA 4NQZA 5JC1A 1KOLA 1A4IA 5JXWA 1GQ2A 4BMVA 4HFRA 5IN4A 3HJAA 4F3YA 1JTVA 1EQ2A 1UDCA 4ALKA 1MG0A 5JW6A 3LT1A 1ENZA 4XQ9A 4D3DA 3OEYA 1BHSA 2O4CA 3V2UA 2I6TA 2OO5A 3GFBA 3NGLA 2E4AA 4BNKA 4E21A 2P91A 4N5LA 1MXHA 3OJLA 5GY7A 2QRJA 2PLAA 4NJOA 1IYZA 4IJUA 5A02A 2IYOA 4BGVA 5JBIA 1EUCA 1TEHA 5G0SA 2VRCA 1QYDA 3Q2IA 3A1NA 3UOGA 3DHNA 1DIRA 1X7GA 3GMDA 3IQDB 3VPXA 5BSGA 3TL3A 2HK9A 4WLNA 1ZH8A 2C29D 3WTBA 4TRMA 2P4HX 2J6IA 5A9TA 4IDEA 5CDYA 5L40A 3GGGA 4MIYA 4CV2A 2X9VA 1U3UA 2NM0A 5B4UA 3PRJA 4CQMB 4TVBA 1PZEA 3P2YA 3TOXA 1NAIA 5JMWA 4RVDA 3JYOA 5I9LA 5A1TA 1I33A 3INRA 4FQ8A 4U6QA 5A9SB 2Q45A 1EBUA 2W2KA 2NU7A 3D3WA 4YQZA 3OQBA 4DYVA 4XR4A 1U9JA 1B2LA 2DC1A 3IKVA 4YB8A 4AICA 1Y7TA 4FOOA 1I10A 1GZ3A 2W4QA 3ZV4A 1BMDA 4Z0PA 2I9PA 4UUOA 3DL2A 1R16A 2EEZA 4LCJA 2JHFA 1SCUA 4PLFA 4A26A 3F1LA 4BKQA 1Z73A 2NTJA 3UGKA 1PJ3A 1LRKA 5A03A 1U28A 4MKRA 4R5HA 1BG6A 1O94A 3F3SA 3SVTA 3BMOB 4GLOA 3VH2A 3WGTA 3GEMA 3IUPA 5EERA 1XQ1A 3MCVA 4Z9FA 3DBVO 2D0IA 4OMUA 3C1TA 5L7TA 2FN7A 3LT0A 2PH3A 1PX0A 3LZ6A 1DRUA 4IDGA 3PPIA 3KB6A 4Y67A 3PFFA 3ZWWA 3EC7A 3V2HA 3DOOA 3JQCA 1ZEMA 2Y66A 1KY4A 2FZWA 3I9OA 1XU7A 4YPOA 1WZIA 4JQCA 2GF2A 1EBFA 2OBYA 4EUEA 3NX4A 1H93A 1LLCA 2O23A 1P3DA 3ZHBA 1W73A 3PHLA 5A3JA 1X15A 2WMDA 4J1SA 4R16A 1EVIA 3ROKA 1ENPA 1YDWA 1E7SA 2ZJ0A 5IZCA 1SAYA 3AWDA 3IOYA 2J5RA 4ALNA 3QVWA 3DZFA 1B0AA 3PWSA 3HN7A 4OO3A 4Z3DA 1RJWA 3DXFA 3BTUA 4QSMA 1QR6A 4P4NA 2X58A 3IIEA 3FN4A 3STHA 2JCXA 4MPDA 5AVOA 3UCFA 1UP7A 3ETEA 2NQTA 2JAPA 5DN9A 5DNAA 5ES3A 4E5PA 2X5KO 4PIVA 5ILGA 3G17A 4P4LA 3QWAA 5L4LA 1LDMA 3JQAB 5DCYA 4DPLA 1DAPA 1IY8A 1Y8RA 2Q2VA 2VZ0A 2WD8A 3ROPA 3DZKA 4JBIA 2DQ4A 2I99A 1T24A 3AK4A 3JQAD 4MINA 3KOUA 4DC1A 5BR7A 2YZ7A 2CMDA 4BNZA 3WBBA 4U6SA 1GYPA 4OJNA 2CDBA 1AXEA 4HXYA 2JD1A 1E6UA 1GCUA 3ETGA 4KUEA 2FOIA 2Y93A 1LRJA 5H81A 5EQDA 1LQUA 4BB5A 3GGPA 2HMSA 4A10A 3RC9A 3GMSA 5EL0A 1QXSA 4F46A 3DEYX 3OF2A 5IXYA 2NACA 1X7HA 3GA0A 4R1SA 1Z7BA 1P1KA 4DL9A 3QQPA 3PIIA 1U7TA 3OQ6A 3HZZA 1C1DB 1U8XX 1Y8QB 4DLBA 3I23A 2BI7A 2C0CA 3K5PA 2C82A 1D7OA 2DVMA 3UH1A 4I5EA 4NNJA 4JP3A 2VCYA 4OXNA 4J7UA 5AYVA 4IQ8A 4A0SA 2DT5A 3T7EA 4RVHA 1P9LA 3D4NA 4I9UA 2PGJA 3UW3A 4HFMA 4DQVA 2B5WA 2D3TA 1H2HA 3B20A 4CM1A 1HDOA 1MV8A 5HTOA 1G0OA 5KJEA 3OIFA 3O8QB 3WLFA 4OSPA 1ZO8A 5EJ2A 4D0RA 3IDSA 1FK8A 5B4VA 5H82A 3KV3O 1X13A 1N2SA 4KUGA 1BXGB 3F46A 1JKJA 3HB4X 8LDHA 2WWRA 1T1SA 3GC6A 5F21A 3QJ5A 1B8PA 4YT2A 3AM5A 1U4OA 4FR5A 5A04A 3GN2A 1E3EA 4PG8A 5TT1A 1DPGA 1CEQA 1R4NA 2X0NA 4ZQGA 3RCBA 3RFVA 5TLSA 2ZJ1A 5T8KA 5I9MA 1E3LA 2BMAA 1YQDA 2FY8A 1T2EA 5COAA 5A4DA 5KIAA 1ZVMA 5HA5A 1NM5A 4YJHB 4EUFA 3KZVA 2EP5A 4K6CA 4OHUA 2OXIA 4AJLA 4PG7A 1NP3A 1JU9A 1O89A 1UZLA 3LC7O 3QV1A 3FWNA 4I9NA 2VT3A 1YVEI 4B3IA 4HFJA 2CFCA 1BVUA 2YY7A 4B8WA 3I6IA 4BNXA 1ONOA 1U2DA 3N58A 3K96A 3GRPA 5L7YA 4GMGA 4LRTB 1VJ1A 1E7YA 3HNPA 3JYQA 4E13A 1K89A 2WD7B 3EZYA 3PK0A 2ZQZA 4UEKA 3FNFA 5TT0A 3OECA 1GADO 2RCYA 3ZU2A 3INGA 3QRWA 1HLPA 2DAPA 2DBVO 2G1UA 4KQWA 3DC2A 2PD6A 1LDNA 1TVEA 1UXIA 3FCOA 4L75A 3WGQA 1RM5A 4XYEA 3WQSB 4IJVA 3SC4A 3WFIA 2B4TO 2Q1TA 3BYZA 3JQAA 4II2A 4ND1A 4PLGA 4CMCA 1GPDG 3UCXA 4PGFA 1LTHR 3OFSA 2JHGA 1JLLA 2WYWA 3NV9A 2X5OA 4GX1A 2DFVA 2Q1UA 2X6TA 1ID1A 5JY1A 5G4KB 3PIDA 4CMIB 4XCVA 1HSZA 4WASA 1NVMB 3QA9A 1HE5A 1SB8A 2PZJA 4Q3EA 1HRDA 2YDXA 3DTYA 1A7KA 3KVOA 4RDIA 5CPFA 3RIHA 5HWSA 1V3VA 1LDBA 2EGHA 1PIWA 2CZCA 4WOKA 1YXMA 2AEMA 5TJHA 3TRIA 4AJIA 3AM3A 2BFOA 1ZKMA 1CIVA 3LF2A 4FW8A 4LN1A 2BGKA 1C0IA 3PI7A 4PG5A 3LDHA 3EW7A 3WG9A 2ZYAA 1TT5A 4NK5A 2QYTA 2ZCUA 1YGYA 1L7DA 1ZK4A 3O03A 4LVUA 1CERA 4RPJA 2GUGA 3OBBA 5ICSA 2AXQA 4H16A 1PEDA 1JN0A 4OL9A 4EJMA 1GUZA 4YAGA 4J1NA 2CD9A 1PS8A 4D3FA 5I7EA 1U5AA 3E8XA 4BNHA 1SEVA 1HL3A 1NWHA 3GF4A 1IHXA 4BS9A 3VKVA 3C7DB 3DB2A 1YB5A 3NT5A 1H6BA 3SJUA 2EP7A 2I65A 3HDQA 2Z5LA 3SLGA 5LDHA 4JGBA 4XZ3A 2AQHA 4EITA 1ZZEA 3BMCB 9LDBA 1VLLA 5IXSA 1P0FA 3EHEA 5HS4A 1QYVA 2Q49A 4X54A 3HHPA 3BMNB 1DO8A 4WOJA 3VVBA 1O6ZA 3QP9A 3OQ1A 2GD1O 4E2XA 2V6MA 2UYYA 1N9GA 5F1OA 4BO2A 2AG8A 4B4UA 1F17A 4DXHA 1DRWA 4R01A 3LF1A 4NJMB 1FDVA 1S7CA 3QVOA 1PTJA 5B1YA 4Z9XA 3IP3A 3VPHA 1EEHA 4LW8A 2YHIB 3BMQB 4ZU3A 2D5AA 3ZH2A 1E3WB 3VPGA 2X86A 3GEGA 2YJZA 4CUKA 5DBIA 1DIHA 4IDDA 4YJGA 4XGIA 4N5MA 3KSDO 3PLNA 4CL3A 3GNTA 1UP6A 1YWGO 4HUJA 4Y6RA 3QLJA 3WFJA 2GYYA 2O3UA 4FSHA 5G2OA 5U1PA 4YJFB 2O48X 4J2OA 1W8DA 4CMEC 2C5EA 3DAPA 1QRRA 4BO8A 3TFOA 4MVJF 4BV9A 4IMRA 3OM9A 1U2GA 3RFTA 1YQXA 2WEKA 4G81A 1BRMA 1GYQA 4R4JA 2AEJA 1MFZA 1CDOA 4YACA 3BAZA 3E18A 4BNTA 5IJZA 3V8BA 1M2WA 2J3KA 3NTRA 4ZQHA 2Y99A 4LMRA 4XIYA 3ZV6A 2PY6A 3HDYA 3DTTA 3KTDA 4CMBA 1SNYA 1KVRA 5THKA 5JMPA 3WX0A 4CM4A 1LLQA 2CVQA 1WP4A 3UICA 1A9ZA 1UJMA 3FRJA 3O4RA 3OMLA 3VH3A 5K0ZA 3RI3A 1LJ8A 1NQAO 3HDJA 2Y1FA 3LVFO 2Q99A 4FBGA 3BIOA 4L9RA 4LSWA 3ZWMA 3GPDG 3K8ZA 5CDUA 2NADA 4PLYA 1XSEA 1P31A 2GASA 3ON5A 1D3AA 4JNKA 3T7CA 3W1VA 4BNGA 3VZPA 5L9AA 4YAJA 4XQGA 3UAGA 3NDRA 2DLDA 4OKNA 2VUUA 4CV3A 2Z1NA 3ZNPA 5BQFA 3GNSA 3DO5A 1E5LA 2I76A 4CPDA 5AXAA 4IGEA 1IZ0A 2NU9A 3L9XA 3WNVA 5DP1A 4B4WA 4DVJA 4IDAA 1HWYA 1NFQA 3ZGYA 2WDZA 3OJEA 1CJCA 1PU2A 3F6YA 2A4KA 3DOJA 1JA9A 4N18A 3ULKA 4BVAA 1ZNQO 5KJ6A 3GUYA 3JQDA 2Y0DA 5T8KC 4INAA 5FFFA 1GEGA 3IUSA 3GG2A 4N5NA 3RQSA 1V8BA 3ZNNA 2V7PA 3TFQA 2J3HA 4AJHA 5ER6A 3A14A 6ADHA 1LSUA 1ENOA 1E77A 1H2BA 3OSUA 4IDBA 3IP1A 1Z7EA 4H15A 1BXKA 3NDIA 4C7JA 1OC2A 2NU8A 5BNTA 2PV7A 4HADA 1UAGA 2HAEA 1SBYA 1I3MA 5EMHA 4EEXA 4IXTA 4CV1A 5ADHA 4LMPA 2HLPA 3L4BA 3BTOA 3E48A 1EE9A 5A9RA 3ZNOA 1EE2A 1LDEA 3RUCA 3QWFA 4AJKA 1YJQA 2C20A 5JYDA 4YAIA 4UEOA 3H7AA 4MVJH 1GD1O 3DBRB 3GAFA 2VN8A 3F5SA 1GUYA 4ZICA 3QVTA 1RM4A 4CUZA 2NTVA 2YDYA 3CZRA 3CPSA 2FRDA 2OGUA 1N1EA 3HE3A 4M49A 2IRWA 1LUAA 3LU1A 3PWZA 3GVXA 2C2XA 3FNHA 3H2ZA 3LLSA 1O5IA 4CLXA 4XRRA 4RPKA 1QLJA 1NXQA 1TT7A 3WB9A 2JL1A 3AJRA 3N7UA 1GQYA 3TZHA 1R4MA 1YO6A 3PQDA 4P4GA 4ZRMA 4Q39A 4AJOA 2H9IA 3VOSA 1ULSA 2CNBA 5C7IO 6LDHA 1CF2O 3UFXA 5TIIA 1OOEA 1LLDA 1KVQA 4GSKA 1XQ6A 4EDFA 3PWKA 4OXKA 4IIUA 1HDZA 4IM7A 5A3VA 2JD2A 3VTFA 4MVJP 1QKIA 1GPJA 3W6UA 1JWAB 2VHYA 1HTBA 5T6BA 4AL4A 3PJGA 3JCZA 3L9WA 5B37A 4LCEA 4Y6PA 4BNNA 2ZQYA 4G5HA 1PQUA 3WOHA 3ONFA 1J5PA 2OMEA 2JFGA 1C14A 1QYCA 2FPIA 4GWKA 1M75A 3RFXA 5FI5A 1NR1A 3BTVA 4GX2A 1DHTA 4Q3NA 4BNLA 2PWZA 4UAGA 1HLDA 4E32A 5KJ1A 1HYGA 2NVUB 4OAQA 5ENVA 3JQGA 2NQ8A 4IINA 1SEPA 3MZ0A 1VRWA 4QO8A 3RROA 3WIEA 4U0JA 4CMHA 4NBUA 5CG2A 2P9CA 2EERA 4E2WA 3B1JA 4J1QA 4D44A 1JAXA 2VHXA 1LU9A 3NDJA 3ZWNA 5I7VA 4M8SA 1C1XB 5JDIA 1NVGA 3RU7A 3TN7A 3ANNA 3I52A 1GAEO 3I9JA 1RM0A 1IULA 4WLUA 4Y98A 2I67A 2WYVA 3U49A 1PJBA 4BB6A 3QY9A 1XWFA 3AOGA 4R9RA 2GSDA 3OJOA 1PS0A 3WGIA 2R00A 3PZRA 4IXWA 3MWDB 1CQJA 3JQ8B 4CLRA 1P74A 3AY7A 4J9VA 4QQRA 4XWYA 4E31A 5IG2A 1AE1A 2I5PO 3WR5A 2BH9A 3Q9UA 4PN3A 3OEWA 4HP8A 1YKFA 3RASA 1E1KA 1W4ZA 2YFHA 1P1JA 3G3EA 4YRBA 1ZXLA 3I5MA 4ONEA 3VDQA 3DBHA 3RWBA 3ZN2A 4NBWA 1H0KA 1D8AA 3FHLA 3KO8A 1U5CA 1HE3A 2GPTA 1XIVA 4J16A 4J2HA 4ALJA 3RC2A 4O1MA 1T4BA 4RPHA 3SLKA 4EZBA 4QT0A 4IS2A 2DKNA 4S1VA 1F0YA 2O3RA 3C7AA 3BHMA 4JP2A 4B8ZA 5DP2A 4DBVO 1DHRA 3COSA 1DFIA 4G65A 2CVOA 2W8ZA 3JQBA 4RGBA 1E6EA 1C0KA 1GCOA 3A9WA 4E33A 4M55A 4WGGA 2OL4A 4IIVA 2TMDA 4CQMD 3B6ZA 4FS3A 4YRDA 4EW6A 5KWEA 5ILOA 3TPCA 1WZEA 2G5CA 5KCZA 1JVSA 4CM7A 3A06A 5I8ZA 3H5AA 3AUSA 1RKXA 5L7WA 1QV6A 1BVRA 1XG5A 4G2NA 4TZTA 2FPPA 1VL8A 5DOVA 4BO3A 1MA0A 4GI2A 4MOWA 3GHYA 2O3JA 3HN2A 3DAGA 4R54A 1LX6A 2HMVA 4Q3BA 1NX6A 3DWFA 1GY8A 3DDNA 1ZW1A 3RC7A 1KC1A 3L6EA 5TX7A 5KNLA 1R6DA 2AMFA 1MLDA 1B8VA 2Y68A 4WEOA 3NTQA 4B3HA 2VUSA 3EGOA 3S2IA 1PZGA 5I9NA 4A5OA 1YL5A 4CL8A 5K9ZA 4BL5A 1G1AA 1OI7A 3CZMA 4WCFA 3VPSA 2FZEA 3S2EA 5HRUA 5JYEA 3RKUA 4KOAA 3RAJA 2EWMA 2X0JA 4BMSA 3MJTA 5G0TA 4XDZA 2PZKA 4CQLB 4XJSA 3TWOA 3H3FA 1BTOA 5G0VA 3W4IA 4ROSA 3LSYA 4GAEA 4UULA 3TOZA 3IKTA 3E82A 4URFA 1KERA 5DULA 4NBRA 3R3JA 3HSKA 4ND4A 4PCVA 4RQUA 1RWBA 2XOXA 1MP0A 1R0LA 2CDCA 2A35A 5C37A 4CLOB 5BT9A 4O6VA 1K6JA 4XJTA 4BO5A 1E1NA 5ITWA 2HRBA 4PLCA 5FF9A 3GR6A 1E7WA 2GZ2A 2EF1A 1A71A 3ZWVA 4L0QA 2ZCVA 3GZNB 5L95A 4TMFA 3TF5A 2IEBA 2EJVA 5JFOA 3QWIA 1P1IA 4PLHA 1MUUA 1YRLA 2PNFA 1PL7A 2P9GA 3WWZA 4E5NA 4ZQFA 4ALIA 3VC7A 3OA2A 1MC5A 5JE8A 2QIOA 1I0ZA 4P38A 4CM8A 2BHLA 1EFKA 1PGJA 5LDGA 4MIEA 3SEFA 3KYCB 4MIOA 2VOJA 3ITDA 4EGFA 3L07A 4L74A 4Z0HO 5JAMA 1PGQA 4OYRA 4F6CA 3M2TA 1YOVB 1E3JA 3KSUA 1I5RA 3C1AA 3BZUA 4WLVA 2PZLA 4IPTA 2B4QA 3KLPX 3A28A 3P7MA 4EEZA 3WIDA 1X1EA 3JQ9A 4JBHA 4YA6A 3BHIA 7MDHA 4WCDA 1EUZA 1FF9A 1PGPA 2CF6A 1KIFA 1U7HA 4QFCA 4OSOA 3WDSA 4GGPA 2ZYDA 2GZ3A 2GR9A 4BNVA 5TJ9A 2B37A 2AHRA 1I24A 1VI2A 3H5RA 4PVCA 2ZB8A 2GN6A 2OOSA 5C3MA 3PP8A 2Q2QA 1J0XO 4J90A 5KVSA 5AXBA 1NBOA 4KUHA 1E7QA 2V6BA 3ZV3A 1L7EA 3GOHA 1WXDA 3H4VA 4E5MA 1YBMA 4E12A 2Z95A 3AUTA 1HE4A 3WS7A 4FFMA 1UXKA 4CLDA 4J7CA 3W8DA 4XGNA 1DXYA 2JKVA 4HBGA 2W98A 3RUIA 4CQMA 4DUPA 2NNLD 4BMNA 1E92A 1HKUA 2OP0A 3PEFA 3E9NA 2OUIA 1F06A 3RJ9A 3U0BA 5A9SA 5CFZA 1XKQA 2XXJA 4IS3A 5ER9A 3Q1LA 4GBJA 4FJ0A 2PD4A 3RD5A 5IDXA 4I1IA 4ZN6A 1VL6A 3I9LA 3AI1A 5JDIC 2EIHA 4UVHA 5BNIA 3B1FA 5TNXA 4R9SA 2Y67A 1FDWA 2Q3EA 3ASVA 3GDGA 4R5MA 4J43A 4ZA2A 4B3JA 4HV4A 1NHGA 4RVSA 4YDRA 4E5YA 4NG5A 4PZCA 3AU9A 2RIRA 4MVJE 2ZKLA 3GDOA 4E2ZA 5JNLA 2GN4A 3K6JA 2FSVA 2X4GA 3ZU5A 3KEOA 3BMOA 3PHGA 3RUAA 1IL0A 1I8TA 4WEQA 4YAEA 1W0CA 3WGHA 3X2FA 1ADFA 1KBZA 2VNSA 3HQ4O 2D8AA 4WLEA 2VWQA 1WNTA 4E3ZA 2DTDA 1GR0A 4R41A 4W9NA 3SC6A 1Y5MA 4CMJA 1A9YA 4FIZA 4YCAA 2EHDA 3ZHXA 1PZFA 3E5MA 2IXAA 2NLOA 4JLWA 5BSEA 1WMBA 3P2OA 5CEEA 3HUDA 4JJIA 3TNLA 3PZBA 2HMUA 3WQQA 5JAQA 2O3TA 4ND3A 4AG3A 4IMPA 5EINA 3HWRA 2F1KA 4XRGA 3F4BA 4GH5A 1T4DA 3DBLB 4ZQBA 1P44A 4QTZA 3T4XA 5IFLA 2AQ8A 3VTZA 3C24A 2GN9A 2VRBA 1I36A 4RLHA 1EVYA 5F5NA 4DRYA 4LSMA 4MKXA 3HFSA 4RO0A 1LBEA 1DLIA 1UP4A 3S2GA 1CQIA 4ID9A 1PS9A 3NJ4A 5F1KA 4B7XA 4OOEA 1ENYA 3JQBC 5JCXA 3MJEA 3JQFA 2HQ1A 4LISA 4FPXA 2Y1GA 1V3TA 3IMFA 2FPGA 3PDUA 1KY5A 2JCYA 2W90A 3VKUA 2IEDA 1FJHA 1NNUA 4QX6A 5C7LO 2WJPA 4B4VA 1N5DA 4D45A 1GDHA 1O95A 5C7OO 2IE0A 4DIBA 1KEWA 2D5CA 1Y9EA 3OA0A 4HY3A 1EQUA 4GKBA 3EVTA 3RBZA 3RUHA 4J7XA 4EI2A 1FDUA 4OM8A 2BGMA 2BRUA 3KHUA 3I9NA 5F3RA 2GDZA 2ILTA 1SOWA 4GPD1 2LDXA 4B4OA 3E9QA 4F45A 5JDCA 1LXCA 4A73A 2B5VA 4J4BA 3ZW8A 1ZK0A 4IDCA 1JKFA 1IPFA 1TI7A 4WK6A 2VZ9A 1IB6A 4DTIA 3JQ6A 3FPLA 3C85A 4DBZA 4ZQEA 2GLXA 3LT2A 2H1SA 3JD1A 3WYBA 3VZQA 4GLLA 3JD4A 3U4DA 2HJSA 3NT2A 4WCFC 1DAOA 2O3SA 1OMOA 4BKRA 2XF8A 3MJSA 4OGWA 4JCOA 3DR3A 1ARZA 3U4CA 1C1DA 4RZIA 1ISIA 4BNJA 3WBFA 3K9QO 1Y8QA 4XYBA 4EJ0A 3KUXA 2BI8A 2P2SA 1EK6A 3JYPA 5DCWA 4OQZA 1TXGA 1WLYA 3JV7A 4E2YA 4YEDA 4E5KA 1K6IA 3MJCA 1F14A 2EW2A 1NFRA 3H8VA 4PLWA 4QFDA 5IZCC 3GRKA 3AOEA 3H2SA 4TWRA 1SB9A 3K73O 4Y9DA 1E6WA 3JQ7B 1ZIDA 2HU2A 4WLFA 4DGSA 1HDXA 3JQEA 4D0SA 2EW8A 4BO1A 2AEFA 5HS6A 1MGOA 4E4YA 3KEQA 1U3VA 2C07A 3PXXA 5FWNA 1MB4A 2VYND 1PZHA 5JC8A 2NWQA 3O8QA 4NIMA 4RL6A 5IN5A 3TZKA 2AE2A 1P1FA 3EMKA 1Q7CA 4KQXA 4BQRA 1YS4A 3ZWCA 4UUPA 3ADOA 1AN9A 1BXGA 3RBXA 3MEQA 4RDHA 3RJ5A 2WE8A 4BKPA 4Z6KA 3AY6A 1MX3A 1I2ZA 5DT9A 3CH6A 1N8KA 4HX5A 4UVEA 4R1UA 3ANLA 4QXMA 4PLPA 4GX0A 2E49A 2NV6A 2XXBA 1X14A 2O7SA 3FTNA 1UXJA 1QV7A 3JD2A 5KVQA 1DC5A 1GZ6A 4NI5A 4Q3CA 2X9NA 2AE1A 3JQ9C 1HF3A 1ONPA 1WPQA 1DIAA 2GGSA 3FI9A 3OHSX 1BW9B 2HDHA 4A7PA 4BNMA 1X1TA 2P5UA 3JYLA 4YJHA 1J49A 5B4TA 1CYDA 4PLTA 2B69A 3GVCA 3VZSA 4EBFA 4MDHA 2DBQA 4YBZA 1NWCA 4XA8A 1T2DA 5ICMA 4MVJI 2YQ4A 1PL8A 2R2GA 3CKYA 3F47A 1V35A 1YH3A 4XQCA 5KKCA 5T5QA 3RSHA 3R1IA 1D1TA 4CLHA 4CR7A 2YV3A 3RUFA 1U1IA 2DFDA 4H3VA 4XX0A 2WD7A 5IDQA 1R0SA 1BSVA 3PHHA 3X2EA 4BNFA 1B3BA 1O8CA 4WE3A 3CMCO 4J3FA 3ZV5A 1QP8A 4XKJA 4OXYA 4MVJD 3Q3CA 2PZMA 3EK2A 2EGGA 4P8RA 1XR3A 4L4XA 5HM8A 4BKOA 4BGEA 3DZHA 2OBNA 5KJCA 4N7RA 1Q2XA 1F8GA 1I30A 2I3AA 3O38A 4R68A 1QYXA 3OETA 5G4KA 2VWPA 4CMIA 3SXPA 4KZPA 1PJ4A 3KXDA 3KYDB 2WTBA 3W8FA 3TDKA 2H6EA 1A27A 2QRLA 4J0FA 1EDOA 1YL7A 1LRLA 2J3IA 3MJVA 1GYRA 4RV9A 5T57A 2HCTA 1NQ5A 1DJQA 3ADPA 3Q11A 4W9NC 5CEFA 5GZ6A 3G0OA 1B8UA 1ZBQA 2PD3A 2VZ8A 2Y1DA 2G82A 4E0BA 5FI3A 4U0KA 5ITVA 1V9LA 2BELA 3K2BA 4IY1A 5DF1A 4IJKA 3ANMA 3GK3A 4M1QA 5L4NA 1E3SA 2UAGA 2X1HA 1N7HA 3ONEA 1DLJA 4D43A 5JAZA 4TRRA 1T26A 2QRKA 4D41A 2OP1A 1G0NA 4XYMA 2IZZA 3I4CA 1DOHA 5JPIA 1PQWA 3G49A 1ZJZA 2PFGA 3GN1A 1V6AA 2PH5A 4AJPA 3IJRA 1K5HA 3U5TA 4XB2A 1JDJA 3BHJA 2JFFA 4YRAA 3PGXA 3RU9A 4ESOA 3KM0A 3JQFC 4NH4A 1Z74A 4LK3A 4R1TA 2IODA 3D5TA 3BMCA 3GEDA 1P33A 4FJ1A 2V6GA 1LEHA 4DLLA 2H63A 3ZDFA 2VYNA 2QYSA 4D7AA 3KSZO 3BMNA 4TZKA 4CR8A 1UDBA 1LDYA 1P77A 2FMUA 5TQVA 3F9IA 5I7FA 2J3JA 1HETA 3PGJA 1KVTA 1Z6ZA 2YQ5A 2VNAA 1M6WA 4K6FA 2WE7A 4IQ0A 3TJRA 4JXKA 5T67A 2ZYGA 1IPEA 4NJMA 4S3MA 4PVDA 1S6YA 4CM9D 2NSDA 3LT4A 1ZFNA 3JD0A 3V1YA 1I2CA 1UDAA 1SOVA 2YHIA 3BMQA 1E3WA 1R15A 3GH3A 3ENKA 2BFAA 2W2KB 1OZAA 3D3WB 4BQPA 1Z82A 3W8EA 1AXGA 1RPNA 4KWIA 3AI3A 1Q0LA 2Q1SA 1GUFA 3GHHA 5LC1A 1KC3A 4YXFA 4ND5A 1XGKA 4GQAA 2W2LD 1GTMA 1Y6JA 4HNGA 2PKRA 1HDCA 3LYLA 1QLHA 4QECA 3K2EA 5JO9A 2FP4A 3GAZA 1OBFO 4YJFA 3HFGA 4F6LA 1F12A 4L73A 4R3WA 3QVXA 2JD0A 3PQFA 3ZZNA 1XA0A 1HZZA 3ROQA 2J5QA 3GNQA 4E30A 3G79A 2Q50A 4KP7A 1XELA 4YJDA 4E6PA 5KOIA 1YJ8A 1BXZA 4C7KA 2Y1CA 1H6CA 3S55A 2EKLA 1NPTO 4ZVVA 3DMYA 1EFLA 3VZRA 5IDYA 2QG4A 4I5GA 1UZMA 2DTXA 3QVSA 1DFHA 4WECA 3DZBA 2EJWA 4WJZA 4DIOA 4DLAA 5L4SA 1O9BA 3BA1A 3WMWA 3AOEC 4B79A 1WAMA 4RVUA 5GMOA 4BV8A 4ALMA 3RBVA 2X7HA 4MVJA 1B26A 2DBRA 2F00A 1BWSA 5EPOA 3M6IA 3I6QA 2IDZA 3U4IA 4AVYA 1FMCA 4ITUA 3E1KA 2BFMA 4ZGWA 1VSUA 1DIGA 4XDYA 1Q7BA 2FR0A 4AJ1A 4BKUA 1LC3A 3NJ8A 3PJFA 3G1UA 1X0XA 1WDMA 2FWMX 3PDJA 3D7LA 4FFOA 4I9HA 1E0DA 3NT4A 3HADA 2PKQP 4NPCA 4KMSA 3UHAA 4B7CA 4DPKA 4O0LA 1J4AA 2VTEA 2VWHA 2B83A 3AY3A 2AG5A 1BDMA 1V0JA 1XDWA 4LVCA 5A5FA 4RPLA 3ZWPA 2ZB4A 3VH1A 1YBAA 4HKTA 1MC4A 2YYYA 2V6FA 3H9QA 4TROA 2IXBA 2FR8A 1TA4A 4FB5A 4IBOA 2V65A 1VKOA 4RJTA 1UZNA 3D4OA 3WNQA 1NVTA 1SMKA 5KVVA 3EZLA 1Y8RB 4FN4A 4CMKA 2CVZA 1QMGA 3UUWA 4D42A 3QHAA 3FBTA 4PG4A 2RH8A 1HEUA 3AU8A 2XAAA 3AM4A 1MXFA 1PL6A 1Q0HA 1BGVA 1QG6A 3U3XA 1OC4A 2BF7A 4Q3AA 1U8FO 1Y9AA 1DC3A 4CUJA 2BKAA 3D5QA 4O5OA 4R69A 1I3NA 3AUAA 3R0IA 4FC6A 3KETA 4MP8A 4UEJA 4UVIA 3AFMA 4TRNA 1C0PA 4DQXA 1IOLA 4NU5A 1X0VA 3H9UA 4J1TA 2Q4BA 1K6XA 3VH4A 3D0OA 2VOEA 2ZB7A 4DIFA 4FFNA 5J23A 4Z0TA 2B4RO 3EVNA 5DZSA 4FJ2A 3E6AA 2HRZA 3DBRA 5DOZA 1T2AA 4QEDA 2VHZA 2E37A 2VTDA 1E3IA 4PRKA 2X0RA 3ENNA 5EESA 4NBTA 1XEAA 2VHVA 2X0IA 5TF4A 4CM9A 1N1GA 2IZ1A 2PGLA 3DZGA 4DMMA 3EUWA 2O4UX 7ADHA 1I01A 4HNHA 5F1PA 2OHXA 2Q2WA 4B7UA 4M87A 3W6ZA 2A94A 5CP8A 3CXRA 1ZCJA 2PR2A 2YHUA 3EY4A 1CRWG 2HO5A 4GSLA 4C4OA 4OQYA 3PHJA 4RF4A 2W2LA 4FGWA 4GX5A 4FCCA 3MOIA 1P45A 1Z75A 2CDAA 3GZ4A 4I5DA 1WDKA 1L1FA 4GVLA 4RPGA 2C7GA 3DQPA 3ZWXA 2Z1MA 2UDPA 4NK4A 3DZJA 1WWKA 3H9JA 4R1NA 4WNCA 3FD8A 3H6KA 2NVBA 4W99A 1SZJG 2E6UX 5KKAA 3UF0A 1VPDA 5A06A 2ZATA 4JROA 5B12A 3FF4A 3IL2A 1WW8A 4R3NA 3W4JA 4UUMA 2B0JA 2BGLA 2GCGA 5G4LA 1R4NB 4XYLA 3MOGA 2NTNA 4UVGA 3UKOA 1NFFA 4XIJA 1VM6A 3U9LA 3ZW9A 4J49A 2GO1A 3NGXA 3UXYA 3C1OA 4XQEA 1XCBA 2VUTA 2NVUA 3AFNA 2C54A 3H65A 3GY0A 3OIGA 4DWVA 1IZ9A 3ORFA 3Q6IA 4IUYA 4RF5A 3L4BC 4KWHA 3UVEA 4ZD6A 1I3LA 3V1UA 2JAHA 3NRCA 3EDMA 5CHEA 2B36A 4BNWA 2EV9A 3DHYA 3FWZA 4BO6A 4MKZA 3OP4A 1R0KA 1C1XA 1WMAA 2Q46A 5BNFA 4M86A 3I9MA 4RF3A 2HK7A 5L3ZA 4Z9YA 1PGOA 5JCJD 5KJFA 4D46A 5CAEA 1H94A 2Q1WA 3D4PA 4NFHA 5IF3A 4PRLA 2XPCA 3ZWAA 1HSOA 1K3TA 1KVUA 4ILKA 4W82A 2ZTVA 3JQ8A 1KVSA 1Y1PA 2AQIA 3OJ0A 4J4TA 4JN6B 1DRVA 1PJ2A 1ULUA 1IUKA 3RUDA 2OORA 4AJ2A 4DA9A 3ONDA 4YAKA 5CG1A 1QSGA 1DC4A 3TSCA 1KYQA 1Y81A 4FFLA 1ZK3A 4IDFA 2C5AA 2RAFA 4PZEA 1YB4A 1C3VA 3IS3A 2FSSA 4MVJG 3L77A 5CPBA 3VHRA 5TC4A 3NYWA 3FNEA 4BGIA 5CDSA 4ZHSA 3C3XA 5G0WA 4GMFA 5H83A 1ADBA 3CTMA 3C7CB 3P5SA 4K26A 4MP3A 5MDHA 4WLOA 4WUVA 5MGBA 1NTOA 2GZ1A 1RM3A 3AI2A 3LQFA 5JO0A 3PHIA 4W7HA 1H6AA 2IYPA 2GN8A 4CMEA 3K92A 1CETA 3NKLA 5GZ1A 1P0CA 3FSRA 1KS9A 1LA2A 1XHLA 3GQVA 1TT5B 4JBGA 5AQ1A 4XEHA 1NHWA 3IJPA 1KEUA 1GV1A 3PLRA 3O26A 1LDGA 2E82A 4PZDA 4XYGA 4AFNA 4LRSB 4OKIA 4MO2A 4BHTA 2J8ZA 3KBOA 1HDYA 1Q0QA 3E9MA 1SC6A 1OFGA 3Q2KA 3AW9A 4II3A 4YR9A 1LQTA 1HYEA 1VSVA 3PYLA 3PVZA 3RC1A 5LCXA 5BSHA 3D1LA 1PGNA 3KLMX 1SPXA 3MTGA 4WPGA 4BO7A 4FOSA 3CE6A 3GVIA 4W4TA 2QX7A 1GEEA 4FD3A 3P19A 2R00C 3TL2A 1PSDA 1V3UA 3Q9NA 1BDBA 2WYUA 3DMTA 2AA3A 1U3WA 3VAZA 4O59O 4BNUA 1LC0A 3I83A 1GV0A 2HSDA 3JSAA 3K30A 4BNYA 1ISHA 3INTA 3WGGA 1N9GB 2D4AA 3WJAA 3SBOA 4U7WA 3L0DA 3I1JA 4KTTE 4AJJA 3UCEA 4CODB 3QWHA 4GL4A 2JFHA
chains in the Genus database with same CATH superfamily
2C2MA 4GMDA 1JIXA 1GDDA 2QRNA 3CTPA 3AB8A 1GSAA 5FQNA 4I4CA 4PAGA 5CTJA 1NMEA 3G2QA 1V5EA 1NQOA 1ECBA 4INJA 3GW8A 3HUTA 3RB8A 2ZJOA 4WI1A 1A96A 4BLQA 4IDHA 5CDTA 1QTRA 4D4GA 3C3DA 5KSZA 4LGVA 1PJSA 4KH1A 1LFDB 2IE8A 2I0FA 1HV8A 4GVXA 5FDFA 4QNRA 3T7IA 4UCXA 4TWJA 1N6IA 2OLJA 3GNLA 3CO0S 1X80A 4JLDA 2QVGA 1NYTA 4KXMA 1VYTA 4HDMB 1NG1A 4UATA 1NPDA 3QU4A 1NVBA 4KE8A 2AXPA 4J0EA 4QU5A 1IE3A 1VJ0A 2IYWA 3BH7A 4KQFA 1IOZA 2P9BA 3ISJA 4RLQA 5TQ2B 3QLUC 1T0PA 2DR3A 2PXCA 3K8OE 3SX2A 4B2PA 2XCOA 1Y5RA 1XXLA 1ZD8A 4NV0A 3NHFA 2AC2A 2CSUA 1UOPA 2XT6A 1ZIPA 9ATCA 1YZYA 2PFSA 4D5EA 2Q28A 2GRAA 5I7AA 3MJHA 2WABA 1YULA 1RPAA 1MZVA 1ZD5A 2AW3A 1Z2EA 5DBGA 3TI7A 2F6RA 4BLSA 2G17A 4QNMA 4QULA 4TQGA 4YT8A 3O2SB 2JGAA 1NVFA 3DDOA 2H5JA 1CJTC 1UEJA 3DFZA 1QYWA 3ER6A 3NOOA 4MJLA 5L3QA 1QAOA 4IX9A 2PQMA 2VJOA 2WVJA 4X8OA 4RD1A 1FRFS 1LLUA 1SK8A 4JL6A 1II8A 2YFQA 3R0JA 2ASVA 2CXRA 2PANA 3JAWB 1U1EA 1W2WB 4GWGA 3UWPA 1D6SA 1QHNA 4CYMA 1ZMOA 8AT1A 4DF3A 1PJTA 2PA3A 2FWPA 3G1WA 5EP2A 1FBNA 1G6KA 1RCTE 2IDJA 2O5CA 3TGWA 3RSQA 2AFVA 3ZWOA 3H11B 3K0BA 2O0MA 5KMGB 4X3PA 4JYAB 1RYZA 1T9CA 3F96A 3TH5A 4N8DA 4FFSA 4Y1RB 5K3FB 1JLKA 1M7BA 2YN2A 2FHSA 3D8SA 3DVLA 4MEAA 4DMGA 1XCJA 1ZJYA 3HBJA 3IP8A 4LBVA 5CMLA 3SZLA 3GA5A 2COKA 1NLZA 4FDAA 2AW5A 1K5DA 1J9ZA 3VYUB 2RKBA 1NR7A 1DCFA 3M1LA 4RF2A 3O4FA 3V2IA 1N36B 4UU1A 2QQEA 3UKDA 3OJWA 5JWRA 3UY4A 4KO3S 3NI2A 5EE5B 1N3LA 3PF9A 4EG0A 4CM6A 3PBKA 4IXDA 2DU8A 2QSZA 3LCMA 1FFYA 2R25B 3ZX4A 4M6WA 1LBQA 1W0KA 4B3FX 1N77A 3ZGNA 5CJPA 3OD5A 1PWEA 1LWOA 3O82A 4N54A 4EARA 1LPSA 2Q6OA 3T9AA 1W88B 3VFDA 1I2BA 3IP7A 2MR5A 1C4OA 4KVGA 4QTUB 5JRZA 2HKIA 1Q3TA 3WLRA 1NJ1A 5BQXA 2IDMA 1ZX1A 2A14A 4H6VA 3G1TA 4H1WA 3WNDA 1A4UA 5FPHA 2XWQA 4AZSA 4MHSA 2WPDA 1TKCA 1XF9A 3AHHA 1GNRA 5K45A 1KFJB 3KL4A 5AXDA 1XLTA 4EYOA 1SGWA 4KPUA 1ACLA 1WCYA 3N07A 3QUAA 4LXIA 3SDZA 3H84A 3IUBA 5ESXA 5K0NA 5JY6A 2CK3D 1X1QA 5COBA 3RVDA 3WKBA 3ZCXA 2XCRB 4RLFA 1QV9A 4MYRA 4WKOA 3WMXA 5TXGA 1NXTA 4I81A 3WLEA 3OFVA 4F5DA 1JVBA 3IP6A 2VT2A 1JDPA 2C3OA 4UM9D 2QMYA 2UUPA 2ZVJA 3L6OO 2PKYX 3SMQA 1QGAA 4MA0A 3TBHA 1PR1A 2VG8A 1Q0PA 2P4QA 1PJCA 4B4KA 2OORC 4CMAA 4UHHA 4L4RA 4RAOA 4QOSA 1KK1A 3DFFA 1EKXA 2HUNA 3Q0EA 3R74A 2XYGA 3GUCA 5EIWA 4Y2TA 4YCMA 2PJUA 3NHBA 3SFVA 3DEJA 3IHKA 3OPNA 2DFKB 1TB4A 2QMQA 3BDIA 4EF6A 1NYRA 2J45A 3FYSA 3PYMA 4D9KA 3B1KA 2AI3A 4C0QC 1POXA 2FE4A 1Y1SA 4G1FA 5TS3A 4DLTA 1B23P 1K98A 1R4MB 1ZD3A 1Q7GA 4KXQA 3GIWA 1NXPA 2CVHA 1EGAA 3HYTA 2FN4A 3KZNA 3KR9A 3RTBA 2G0TA 2P68A 4C5AA 5I8WA 5EIBC 3TZQA 4Y6GB 1EK0A 1XQWA 4FUTA 4JR0A 1E2JA 5CLFA 1CQPA 4KACA 3ZZ1A 1RRVA 1JE1A 1YBVA 5LVAA 2JASA 3DFUA 3FTDA 3ZY5A 3RTGA 1BKYA 5A5EA 5LQJA 3NWBA 2JLBA 2OVFA 2JRCA 3D2LA 3OURA 2RGNC 2RB5A 1FIUA 2KLHA 4FGLA 4AP6A 5ALUA 1JIKA 3CLRD 3DMDA 5J4LA 4G4GA 1MHPA 1OXKB 4I46A 3N74A 1XVIA 3TLBA 3SC3A 2QZZA 1D6MA 1JH8A 3DZIA 5BURA 1I3KA 1WPRA 1H9BA 5LYJB 2CLFB 3FYDA 2KHZA 3GYBA 5DDIP 2ZLBA 4OUDA 1TOAA 4KDRA 4TSFD 2IOYA 1C81A 3F67A 1KETA 1G8KA 1L5VA 3EYWA 4KYUA 5DYGA 4BP3A 1EPUA 2O2SA 5K2OA 4G0WA 3VSDA 4XDHA 3WGZA 3B53X 2GARA 4N12A 2B9EA 5THQA 5LNK1 2Y92A 4UHDA 3EPJA 2IZ0A 3C3YA 3ZHZA 4PC7A 4UPDA 1IWOA 5KYXA 2O8EA 2JA1A 1MW8X 3MTAA 2HN9A 3EQ9A 3NHPA 3C8UA 4U6NA 3KR0A 3U3RA 5HQTA 2Y05A 2D59A 5HPYB 3RK4A 4B1FA 1CIPA 3CINA 4YT5A 2VA9A 3PENA 3D02A 4CDMA 4V0RA 3U60B 2WG2A 1A5ZA 1I3OA 1G3UA 4IZHA 4YQYA 4D80A 5KVCA 1A9XA 4HRYA 3C98A 3R3XA 4JX8A 2QWXA 3OEED 3RUEA 1XCOA 4U8GA 3GEBA 1QG0A 3EXG2 1OAOA 4PG6A 5HBGA 4F8JA 2P0EA 1UFVA 3VKFA 3GJ0A 1K0UA 2FSGA 2IZ5A 3SLRA 1DAEA 3A6HA 5IKXA 2J5KA 1H23A 2WUWE 5AVKA 2ZUSA 4U5XA 3U7QA 1EWYA 4GYWA 3TGPA 1GU7A 3AJDA 3MJRA 1DO0A 2E9SA 4RCVA 1UINA 1IUOA 1ORTA 2PMBA 4FCWA 5F9MA 4P3KA 2Q41A 2C2BA 3V8RA 3ZBUA 1LK7A 1IXKA 2O52A 3MFYA 1RJ9B 3QMPA 5IANA 4EL0A 3HC7A 4YI3A 1XL0A 3GT4A 2JCVA 2QW1A 4H17A 4NF2A 3WYCA 1AA6A 3OKPA 4AIRA 4C0AC 2BEUB 2J4CA 2XYPA 2P79A 3D0QA 3UZUA 4JI0B 1XVVA 2R6GA 1ESDA 4JT9A 2W2PA 3WLAA 3H9EO 3OIDA 4TN1A 2YFYA 1COWD 1NQWA 1QNLA 2VWGA 3AHJA 1R4ZA 3JQ7A 1QWSA 3Q9LA 4MI3A 4R71A 5JS6A 1OWNA 3OZBA 2TMGA 3LX6A 5D5HA 1T25A 5DWQA 2OCAA 4RHCA 2D7DA 1JBEA 2HOQA 2VRCD 4D6XA 1KY3A 3DHEA 2C4HA 4OHBA 2VK1A 3RG8A 3OIUA 4B83A 2CK3A 1I4LD 2V3WA 3OI7A 4BFUA 2A9KA 2D3WA 1GLVA 4IGFA 2CL0X 3NIDB 4BEWA 5KWSA 4Q7MB 3L4KA 2YIVX 4KXWA 3WSVA 3ZDBA 4KYTA 2W83A 1L8QA 4EJSA 2OA0A 1NGSA 2HUPA 2I4LA 3M1AA 4TV8B 3CN9A 1QJ4A 3TQFA 2ODQA 4EYEA 1N7GA 1I2AA 2HGZA 3FNQA 3P2MA 5EXPA 1JIVA 3I04A 5AI9A 4CHGA 2Y1OA 4KXLA 4Z4HA 5BSRA 4YUYA 2WM3A 1CWUA 2GEBA 1SKYB 1NAHA 2ZTMA 2X4LA 3DBOB 2X8AA 3Q7SA 3SGLA 2FPPB 1BU8A 1TIBA 2QVLA 5AM1A 1M6HA 3UGTA 4RTQA 1GAJA 3UN1A 4R84A 3Q3IA 1YBFA 3I5YA 2R5FA 2Z57A 3R8FA 4K8OA 3LY9A 3E4CA 1UODA 2VJNA 2OQVA 2O0JA 2ZYRA 5FLKA 2CJXA 2AD5A 5KINB 2O8BB 4B0PA 3A2NA 1EIZA 1TJ4A 2XQJA 5TRTA 4NBNA 1PP4A 1Q15A 4IZIA 2BCJQ 4GIBA 4GPAA 3VO2A 1M67A 2JEYA 2Z9DA 5KDDA 3L7JA 1QS0B 2C92A 3DLPX 4HWKA 3GT0A 2GN1A 3NM4A 3BTSA 1EFPA 1OIWA 4RZHA 3ND9A 3UEOA 4DC9A 1YR9A 5EIHA 2XDQA 3RLIA 4G1CA 1AHPA 2ZXFA 3G8CA 4NHEA 3PC3A 2H08A 1KOFA 2NO9A 1J70A 2WUVA 4OJMX 3TMYA 1MQ8B 2YHSA 3EGEA 1SCKA 4LQLA 3UT5A 2J87A 4AU1A 4WESA 4DMLA 1IBMB 1M5TA 1PWXA 5G0UA 3DPSA 2AF3C 2RGGA 5CVTA 4FGSA 4CCYB 4XB1A 2PLNA 3C4VA 3GUVA 5C4MA 1O97C 2QPAA 4QBIA 5IAKA 4L76A 2RGAA 2JGIA 3SJ7A 1ZSYA 4TSFA 4BGUA 4URUR 1C2YA 1O4VA 1DV2A 3FMOB 3L84A 1RRKA 2XCQA 4P4TA 4XWWA 2PE5A 2PVCA 2QXUA 4I3FA 4LQDA 4D4LA 1NLUA 4QGSA 2JVKA 4U2DA 1XLTC 3ZNQA 1JQ3A 1O7JA 3H19A 1G20E 1I5OA 4TS1A 2GYWA 3ZU3A 2N75A 4CI9A 4E14A 1D6JA 1T1GA 4RLSA 2ZIXB 1VXOA 4NFSA 5T64A 3IBCA 1OVGA 1QF9A 3EBLA 4A91A 1XMPA 4RXTA 1LTQA 1C8VB 2QEQA 3BXXA 4MVJM 5ALPA 5AKZA 3KYDA 1YZ3A 2W6NA 3M6MD 4D4JA 4DJ5X 2XWBF 2DUUA 2PMWB 3UJDA 1AMNA 2O07A 4IIFA 1V16B 3GLFE 4E08A 3CRRA 4K40A 3AEQA 3OEEA 1HGXA 1LKZA 2O7QA 4KR6A 2Q4EA 4IWNA 1L4LA 2X8JA 2JGRA 3PGKA 4YHHB 2QGNA 2YVKA 3FPGA 3EIEA 4Z4FA 3RS0A 3OICA 4K1LA 2ZTLA 4TKUB 1FZTA 3S81A 1FX1A 1KJ8A 4F3NA 1HBJA 4LPSA 1J6UA 2FMTA 2OHFA 1DEHA 5K7SA 1RNLA 2N46A 4PBTA 4ZOAA 1D04A 1W9MA 1QO0D 1KWGA 4A82A 4H6PA 3V8MA 1GCAA 2I4MA 1A4IA 2NXWA 1N8NA 3I9V1 3OU7A 1XEXA 1GQ2A 4JLJA 3K32A 4HFRA 4N0PA 1VA5A 5DPMA 4HF7A 1OTXA 5IN4A 3Q3EA 5BSTA 4LF9B 3UK7A 1JTVA 3T15A 1UDCA 1D2CA 3GLUA 4P32A 1MG0A 3HBNA 2WU1A 1I3CA 3VISA 1ENZA 1JQLB 1MO5A 4WDQA 3RWMB 4K9PA 4DBLC 5HKLA 1NKTA 3MF4A 1COWA 5AJHA 2E4AA 4N5LA 3D59A 3HLKA 4N8EA 5GY7A 3HTXA 3RK0A 3UIEA 2W6OA 4NJOA 1F0NA 5A02A 2IYOA 2VJAA 2W0SA 4JEUA 4PO8A 1EUCA 3ENZA 1TEHA 3P27A 4WKNA 3QELA 4BMPB 5CCBA 2ZVDA 1Y9JA 1RLUA 2VRCA 3Q2IA 3UOGA 1OBCA 1DIRA 3KJHA 5AVQA 2FXVA 621PA 1YBHA 3IQDB 3K53A 5BSGA 3TL3A 3VTAA 4JBLA 4WLNA 3TINA 2J6IA 4H7DA 1BCSA 2QOEA 1SUCA 3M34A 5EE1A 5A9TA 5L40A 4MUGA 1YD7A 2NSJA 5LQKA 5IVPA 2P2GA 2HI0A 2NM0A 2VUIB 1OWOA 3IDQA 3N2ZB 1KI2A 3EWNA 2ZSIA 2QM8A 2ZRHA 3P2YA 5CYOA 1BWQA 1NAIA 1XROA 5JMWA 2H16A 1J1UA 4YYEA 2UUBB 2X2OA 3INRA 3HLTA 4D56A 3LPNA 1EBUA 1RC0A 1B76A 5K3DA 3D3WA 3E7PA 1FSSA 2WFLB 3OQBA 3QEOA 4YQZA 4DYVA 1AURA 2XE4A 1UPXA 1EFVA 1Y6GA 1ND6A 1AKEA 1OV6A 3IKVA 2JK0A 1WIWA 3CZ4A 4MYDA 4Q01A 4S2EA 3ZV4A 2HBRA 3NPAA 4WGFA 1ZA1A 2I34A 4Z0PA 3DL2A 4HQ0A 3ETCA 3BSWA 1C9DB 2V5VA 4HB3A 4A26A 3F1LA 1YZTA 5EJFA 1UBKS 3TOCA 5BP7A 5LQAA 1VG8A 1XMIA 1Z73A 4KV9A 4GOND 2FZKA 4FYJA 5AW7A 4WOCA 3QUBA 2QZSA 4QXAA 8OHMA 3BH6A 2Y6UA 3CE9A 3MUNA 4YRSA 1K68A 3IUPA 4JOSA 1TEZA 1AH2A 3C45A 4DAEA 2IYRA 1XQ1A 4PU0A 5DASA 3SBDA 5AW4A 1A9OA 1ZRNA 4Z1OA 1ECFA 4GWLA 3TGLA 3R5HA 3RNOA 2XITA 2XYRA 3LZ6A 4LDNA 5AM5A 3E3LA 4IDGA 3SIXA 3VJMA 1KMCA 4XXHA 2J5BA 1HTTA 2GTIA 4KFSA 4LXTA 3QA3E 2V7VA 2Y66A 4WA7A 2W6CX 2X2PA 1KY4A 1ODJA 2FZWA 4JKOA 1GGMA 3B7GA 4XW2A 3D8TA 4HPWA 4GZ6A 4YPOA 2HXYA 4JQCA 3LC0A 4R98A 4ENTA 2QI9C 2CLHB 3NX4A 5GONB 5JZSA 4C2TA 4C4YA 4X00A 2CV2A 4M3NA 1G38A 2I1QA 2XE7A 3ZZUA 1FMFA 3QVKA 3R7FA 1RRGA 4P86A 1GQSA 4V0QA 4EY3A 2C7BA 2ODWA 3BWBA 4HZIA 4RA9A 5A3JA 1N7IA 2WMDA 3RYFA 4M0FA 4U7JA 4FHCA 4I55F 3HEMA 3HMKA 3VX4A 3ZE2B 5IZCA 1XZFA 2D1FA 3MLBA 5E7JA 4BX8A 3PIRA 2O54A 5JSHA 2B4AA 2WTEA 4JCCA 4Z9BA 1NNLA 4ALNA 3QVWA 4OJKA 1GPNA 1NU6A 2XQFA 2ZIXA 2VDOB 4BE7B 1YACA 5AK3A 2NO1A 1ZISA 5IUJC 5JS7A 1P2SA 4OO3A 4Z3DA 1RJWA 4FYXA 4X63A 5D6OA 1MX1A 2FPGB 1SIUA 4QSMA 4HDNB 4EJSC 2WTMA 4MGKR 5JVDF 4P4NA 4Y7DA 4WXYB 5MF6A 4IIEA 4Q7KA 1EBBA 4EGCB 4ZYZA 4XM1A 1KKUA 4MPDA 4EMTA 5I45A 5KQPA 3L7BA 3FPAA 3HKCB 4DMCA 3UCFA 4E1AA 1BX0A 1ZYUA 2NQTA 2JAPA 3GGSA 4EG1A 4M60A 4OREX 5ES3A 1XNJA 4KPFC 4E5PA 2J0SA 4PIVA 3FPJA 3EGIA 3PT9A 5KSYA 2NAPA 4FCVA 4DPLA 2XBUA 2WTXA 1Y8RA 3FLMA 2VZ0A 3AVVA 3T4UA 1ZHFA 2P2ZA 3OF5A 1GPAA 4MDFA 4AP9A 3KOUA 3OPYA 1QWOA 4OI1A 2VXYA 1YZHA 4DC1A 3M49A 2CMDA 4UDOA 3V33A 4DR3B 1QO0A 1GYPA 1UOQA 2GAIA 5AKLA 3ZLUA 1U5BB 3IUEA 5JQGA 2CDBA 1AXEA 1PSZA 5TMEA 4XLTA 1HZZC 4AT1A 3U2QA 4N48A 2JD1A 2BZSA 3ETGA 3IEKA 2CJWB 1ZIXA 3PUWA 1QGDA 1QNFA 3SFTA 3CNBA 2TSYB 1IZYA 1K06A 2Y93A 1LRJA 3T5BA 4AZ3A 1FPQA 2CDRA 5EQDA 3BXOA 4IQFA 3RSCA 3F7OA 4QBHA 1QH8A 5A1JA 5I01A 4I0WB 4YMWA 1CUXA 4A10A 4DWJA 1E9AA 3RC9A 5KTMA 4MUYA 1FDRA 2XT0A 5KOHB 1QXSA 4F46A 5AM3A 3DEYX 1OH8A 2WI8A 4MVCA 1X7HA 4F06A 1DC8A 3CLRC 2A2ZA 3GA0A 4ESVA 1PJ8A 4KSCA 1GZDA 1RHMA 2JBWA 2AEEA 2QLLA 3JQRA 1Y3CE 3OQ6A 2ZR0A 3A3OA 3PIIA 2A0WA 3V32A 4UW9A 3V8EA 5EE9A 4AKEA 1PV4A 4TQUS 2PX6A 3QMMA 4HYQA 5CBPA 1JFVA 2OESA 3WAJA 1MZPA 4MAFA 1Y8QB 4DLBA 3WVNA 4G89A 3ZXSA 3I23A 1KO5A 1NLMA 1BEZA 3G68A 4YP1A 5B6PA 4FE4A 1G63A 1D7OA 1JDSA 2WICA 2YL2A 3BB1A 3LY7A 4NMMA 3UH1A 4I5EA 3GRZA 1TKRA 3UMVA 4R2KA 4FIDA 1QE5A 1DKNA 4OMCA 4WZBE 2VCYA 4J7UA 2ZRJA 1S8AA 2QTHA 3DDCA 3TIVA 1MOQA 1MDBA 1TK3A 2IPMA 2A33A 1Z6GA 3HRIA 1V5FA 4WCVA 2VRNA 5G02A 2ZUWA 2ZRAA 1M8JA 1VHJA 3UW3A 1D4AA 1N25A 4HFMA 5KOJA 4LOHA 4Z7JA 3ZJVA 4CM1A 3E61A 3RC8A 3P97A 2O6HA 3EFEA 5DMXA 4AO6A 3RAFC 5GGYA 2CXUA 5C5EA 4HGZA 2WF6A 2AMYA 1IDN1 3AP2A 3E22B 4IICA 3D0KA 4QDXA 4KXUA 4WT7A 3LWZA 3VX3A 3M4NA 4F0JA 2PUBA 4TZ0A 3IDSA 5E2BA 3ZCPA 3FVVA 1FK8A 3GRRA 4C4PA 2GT1A 5FUVA 5KTTA 4OA5A 4MW9A 3KV3O 3KKQA 4PXAA 5HCIA 4KUGA 4A8JC 3BCHA 3F46A 1URPA 3FYHA 1I0IA 2CCKA 5LMCA 4KMMA 4WBNB 4GS5A 4YT2A 2I7VA 2D06A 3KR1A 3TLEA 1U4OA 1W6RA 3T5AA 3GN2A 1HOTA 4M7WA 3LWNA 4KZKA 3ZBTA 4PG8A 1VPVA 2GKOA 5TT1A 2V5AA 1R4NA 2X0NA 4QC2A 2PLFA 2WJWA 1XZ8A 4K6OA 2JAQA 4J0CA 2IV2X 5CBKA 4F86A 4BPBA 2WY2D 1UBCA 5KNBH 2XB4A 1OREA 2FY8A 2QR3A 3A1EA 1Z28A 3D8HA 4RWZA 5A5VA 2ODAA 3BIJA 3SF0A 2ZAOA 2OGSA 5SZJA 4XASA 1NM5A 3T1NA 4RTSA 4GKJB 2EP5A 4K6CA 4OHUA 3J81A 3W6PA 4PG7A 3QLVA 3QV1A 1UZLA 4BMXA 3NWEA 3ZGXA 4B32A 1SVUA 2HIHA 2C1EA 4MUAA 3SNHA 1JEJA 4NOMA 2YY7A 1RIFA 4JA2A 4B8WA 4BNXA 1F5NA 2H1RA 2R7AA 4H6WA 4L5YA 2JFNA 1ONOA 4WQMA 3K96A 2VPPA 5L7YA 2H7CA 3PNLA 3JZFA 1F60A 3QXCA 2SHKA 1VJ1A 2B4YA 2YV5A 3HNPA 3JYQA 3PD0A 3PK0A 4XX0B 5J4VA 1V5GA 2E4WA 2QORA 2WMOB 3EIQA 3GZTB 4FDTA 3VBCA 3OECA 1JHUA 1TU0A 3ZJUA 2JARA 1GUAA 2IEGA 2C0PA 3ZU2A 1B42A 3DMFA 3NWJA 1W4AA 1HLPA 3OOWA 4PZPA 5FFMA 2PVSA 2QLMA 1W5BA 1KYXA 3FCOA 1GNSA 4LYGA 3WGQA 3D5EA 1SCJA 5AVWA 4M2LA 1T13A 1D2MA 4JB2A 3AIMA 2B4TO 4RX1A 2G9QA 2HRQA 5BQ5A 5K0SA 1IJKA 1GPDG 1Y6RA 4FLFA 4G0VA 2V3VA 2XF2A 1ZGCA 3FROA 2JHGA 3OFSA 4GOJA 2WYWA 2GOYA 4QUBA 4HEA6 2X5OA 2PEZA 3NEAA 4GX1A 3AWIA 1BE0A 4ZVSA 2DFVA 2Q1UA 1ID1A 3N0TA 3PIDA 1QHGA 4LRYA 3MMZA 2WAOA 2YZKA 1HE5A 1SB8A 1PJAA 3LBYA 2PZJA 1B8NA 2PSEA 3LCJA 2YDXA 3N2GB 1IU9A 2XZTA 1DBWA 3DTYA 1V7ZA 4FYHA 4RDIA 5L8VA 5HWSA 3WA7A 2CZCA 4YROA 4BLTA 2AEMA 5C51B 3KL2A 3TSZA 2BFDA 5HIIA 3AM3A 2JVIA 3EOAI 4XJVA 2BVNA 1GVNB 3SEQA 3VR5H 2IVFA 5BVHB 1KOGA 1BOOA 1LGYA 3T95A 2QZPA 3AXTA 3R2JA 3WK7A 1K7EB 2WZDA 2GK4A 4PG5A 3THYA 1NMYA 5ALYA 1SHZA 4MZDA 4BU0A 2NUBA 1XZDA 2OMKA 4WACA 2YINC 1ORWA 2PWPA 4GEKA 5AI5A 5AR1A 4E88A 1L7AA 1ZK4A 2AFIE 5F33A 2YWEA 5JFGA 3MPOA 5C8DA 4ZT6A 3F73A 1MHTA 3NDPA 1PEDA 1UJ6A 4X0EA 4TMVA 1ZBDA 5ENZA 3U4QB 1VGRA 2J48A 2MMGA 3VAYA 4LQ4A 4LFAB 1U5AA 1OE0A 1WCV1 3UFBA 3F4KA 1SEVA 1NWHA 3FPHA 1IHXA 4RELA 4BS9A 3VKVA 5IT4A 3UKJA 1GA6A 1O1YA 1WLSA 2J32A 3C7DB 3DB2A 3IE0A 3NT5A 2CXOA 5F2NA 3LX8A 5KYKA 3RK1A 3ER9A 3SLGA 3AYXB 5F7XA 3QF4B 3N28A 2AQHA 4PS1A 9LDBA 3C7TA 1VLLA 3V7NA 1PHRA 5K6RA 1QYVA 2Q49A 4QGBA 1C4KA 1M2GA 1W19A 3DOUA 3HHPA 2XYVA 2IYUA 3HP4A 4M1WA 1M1NA 5JCXA 1RIIA 2QX4A 4NAHA 4G5RA 3OQMA 1UWCA 1C7IA 1R74A 4ENSA 2OCIA 5JNWA 1JU4A 1LNSA 2P1DA 3NBKA 5F1OA 4BO2A 5DLEA 3DSRA 1HFWA 4JD5A 1I14A 4LJKA 1DRWA 1AHNA 4REMA 3DZDA 3LMKA 3P26A 4MSUA 1FDVA 1G18A 1HPLA 1T9GR 4NJMB 4Z4QA 4U9IS 4DOMA 4UARA 4X1KB 3VPHA 4LW8A 5JNUA 5BUZA 4DJAA 3W9YA 3BMQB 3D3QA 2QT9A 1F20A 2NVOA 3O6VA 4TM7A 3UPTA 5GJWC 1DIHA 1VG1A 2JW5A 2IWHA 4ARBA 1IQUA 2Y9PB 3I6ZA 4P4SB 4YJGA 4OATA 2WSIA 4XGIA 5DXJA 1N75A 2BMVA 1KI6A 3HO6A 3WO0A 3DCIA 4WZ6A 4B73A 4YRRA 3QH4A 2IV7A 4EA8A 2QL9A 3FTCA 4IJ5A 3ZE8A 2GYYA 4CFYA 4TV9B 3DC7A 3CX8A 2XNSA 3I2IA 1ONSA 4UE6A 2CVFA 3ZHSA 1SURA 3NEJA 2W2OA 4XFKA 2HL6A 5JECA 4PTZA 3ZEAA 4BO8A 4ZMBA 5GVRA 4BV9A 3WP1B 5KNCD 1H9CA 1A9PA 3WLQA 4I3GA 1F5SA 3RDPA 4KDCA 2AEJA 3HRHA 1MFZA 1CDOA 2WFMA 5AK4A 4YACA 1GPMA 2NPFA 4YP7A 1K7SN 1M2WA 1XAGA 2VTVA 4PCUA 1LH0A 4M98A 4XIYA 1YHNA 1Y9ZA 2BKUA 3ZV6A 1KVRA 4WFJA 3GCZA 4GPEA 1DZIA 1JIIA 3VKWA 3CF6R 4MRMA 3LJKA 1LLQA 4R1LA 4EVRA 3BBPA 4PZZA 1WP4A 2HIMA 2NZYA 4OQDA 4RBNA 4WUTA 3UICA 4QM6A 3O4RA 3AONB 4Q9JA 4V38A 1JQ5A 2SKCA 4EQZA 4QQFA 4EG4A 4LZJA 1NQAO 1L5RA 4PGHA 1TZKA 4EYSA 1XB2A 3D7KA 1EJBA 2ESRA 2R9VA 2OQIA 3QGMA 3E7WA 5EZYB 1XSEA 2VNIA 1N2CE 1GTVA 1SD5A 2GASA 3OOHA 1ZNXA 2K7FA 1W36D 1MRZA 1WXXA 1EHIA 2V7TA 1U6JA 1VMDA 2GAJA 4QYXA 1ISRA 3VZPA 1Z22A 4ZO7A 4YAJA 1WJGA 1T3TA 2ZGVA 2L18A 2P9FA 2GESA 2VUUA 2GJSA 2IKSA 3HCOA 2WJ3A 2VJQA 1JR3D 3RS4A 2K5UA 3IP9A 1UZAA 3GNSA 3PX2A 3DO5A 4MTLA 4LZZA 2ZTSA 4KR3A 1GAWA 3IHWA 2I76A 2FWIA 2XB8A 4CPDA 1HQYE 4BPRA 5IW8A 1VJRA 2V7EA 3NHAA 4FDUA 5KU7A 4FI3F 3D7SA 1F2UB 3IAS6 2CHUA 2NU9A 3WNVA 4BWYA 1TW2A 4B4WA 3GLIE 2O2IA 4ZCRA 1RI4A 1FJ2A 4WY8A 1Y3DE 4YCLA 4UMDA 3FDXA 1MABB 3IXMA 1CJCA 4OHWA 1G8JA 2XYHA 3F6YA 3SHQA 1XRJA 3VU0A 2PUCA 4LSZA 2HRDA 1JA9A 1ZD9A 5L6LB 4R8KA 3ULKA 1ZNQO 4DZTA 1RFGE 1AS0A 1L4UA 3GUYA 2Y0DA 3ADDA 1L5LA 3SXJA 4X90A 5JSZA 5FFFA 1KFCB 1BA2A 1YJAA 1WO8A 4TV8F 3A10A 4AMVA 1GR1A 1NM5C 2G71A 2RGEA 2XRMA 4I19A 5AHXA 1FUKA 1GARA 1E20A 4HN2A 4M21A 2JGDA 1GNPA 3HY3A 3WMRA 4W5WA 2W37A 4EJFA 5ER6A 3S7TA 1CUZA 1ZVVA 1ENOA 3D2BA 1H2BA 2EZ8A 3LA8A 1DQSA 1YHZA 3OSUA 2OHOA 4LNHA 4BMCA 3M4XA 5JARA 2VUHB 4OI2A 2BGWA 3TEFA 3KQWA 4Q4JB 4GQBA 1U1CA 3MWEA 3DNMA 2CB9A 1QFXA 3ZE0B 5BXYA 2NU8A 2IU0A 5IVKA 2PV7A 4DCUA 1UAGA 1R8XA 3R5KA 5JZMA 3TMKA 2QSYA 1RHKA 2GXUA 4EEXA 5EJ9A 5ADHA 3H0KA 3UJHA 4BFZA 1KO4A 2QL5A 4ZVOA 3BTOA 3BG5A 1EE9A 4DT1B 2K2WA 2ZANA 2AYXA 1IEQA 1IWBB 1S3SA 3KT6A 4HN4B 5A9RA 1UBMS 2W22A 1NIJA 2R6ZA 3DV2A 4PAOA 4HDSA 2C20A 3QBDA 2PSDA 2WINI 4I6GA 4UEOA 4YAIA 5EHZA 1EJ6A 2R1VB 3TM4A 3MWJA 4RKYA 2PBZA 1I9GA 5HFJA 1CR2A 1F3LA 2HSEA 4HNSA 1K5GA 2W2MA 3SF8A 1DT3A 3EISA 4HTFA 2V59A 2OCDA 5DYNA 1NJ2A 1VBKA 3CPSA 1T4CB 2AJDA 1M33A 1M0EA 4HDQB 4ZYTA 2HYIC 3PWZA 3RFCA 4TYNA 1XZCA 4MYCA 1LBHA 4X20B 2O1EA 3LLSA 1Q7RA 4RPKA 5H3HA 1TT7A 1N0WA 3HA3A 3N0VA 8GPBA 3N7UA 4MAMA 2G6TA 4XSVA 1A5AB 2H1IA 4WIAA 4OAOA 2H9IA 1Q1QA 2I6SA 2BFFA 2MIIA 2OZVA 2XLBA 3HKDA 3ZPXA 4E1VA 5C7IO 5TVKA 3B9PA 3Q3GE 3RREA 4BMYA 5GWXA 3SDBA 3ENVA 2EX1A 2V1UA 2XADA 2NSLA 3NHLA 4QYIB 1UBJS 2H7VA 4HT3B 2CFIA 3R44A 4KXXA 4AUNA 2FQYA 4GD3Q 1N6RA 1P2TA 2I03A 3ECCA 5KNCA 2PT6A 4I1RA 4HI0E 2BN4A 4LK2A 4MVJP 3W6UA 3G0GA 3EPLA 4AL4A 4KXNA 1RQLA 1ZUWA 2HPHA 4MPPA 3MILA 2FZLA 2QYHA 3ELBA 5EE3A 4Y2SA 1R0RE 4B47A 4M38A 2H3HA 4MWBA 3ZXUB 4EGJA 4BV2A 1IMJA 2HMYB 3W5BA 4YRJA 3ONFA 2OYCA 5HZGA 4Q3OA 3I5UA 3OPVA 1C14A 2WJGA 2FPIA 3AF5A 3U61B 3KDSE 1X9IA 1SXJE 2HXSA 2PPVA 3ZHCA 4GX2A 4Q16A 4XVCA 4W9MC 2J4FA 3EZ7A 5K01A 2MYPA 1UMDA 4HZUB 3B60A 3MXTA 5GJBA 5ITZA 4LJ6A 1RHUA 4OAQA 3V00A 3OQOA 1SEPA 3MZ0A 1VRWA 4LC0A 2PSFA 4QO8A 3RROA 5LQUA 4NBUA 3FW1A 4EI7A 2EERA 3E35A 1M74A 3B1JA 3GD5A 4J1QA 3VU9B 4Z4GA 1ZMBA 3CF2A 4MQFA 3NDJA 2R4UA 2FEWB 1EAYA 3QY0A 1FQJA 2W6QA 1JAZA 3L05A 4NYJR 2UVPA 5BSKA 3T41A 2CXTA 1E94E 3H13A 1JR3A 3TQOA 2WYVA 5BWNA 2L42A 1P7YA 1XWFA 1X94A 3OVMA 1U0EA 2GSDA 5CAEB 3KEMA 1II0A 3OJOA 4KGXA 1PS0A 2BBOA 1I4TD 3UWSA 2ZWMA 2DR2A 2YX1A 1PDWA 4YUXA 2FFQA 1CQJA 3KQNA 2EBWA 3PC2A 4XM0A 4CIDA 1XEFA 4KQMA 1FDOA 2AMLA 3FMGA 4XWYA 5EHXA 2H2WA 4P2BA 3CW9A 3UMBA 1UBTS 1WVIA 1MRSA 3V4VB 2UYHA 3Q9UA 3N8IA 1ZOSA 2D2VA 4HP8A 1H3EA 4UAJA 4LC9A 1GT91 4F71A 4OG2A 1FYEA 1W4ZA 4HEJA 1XZIA 3FYUC 1EP1B 4LGYA 1P1JA 5ALHA 4JDUA 4JXXA 1X7YB 4NNPA 3BWEA 1RE1A 1NUQA 1A8UA 2H4XA 1FFBA 4TTVA 1CR0A 1B6RA 4LY9A 5AFSA 4EY4A 2HU8A 1Z39A 1P6UA 1T4GA 2IIBA 1VL1A 1XIVA 3JWPA 1CUSA 1LJUA 5DWDA 4LWQA 1CUCA 5I8PA 1XLUA 2H1HA 3KNZA 4IS2A 1G19A 1H4VB 4HXFB 4YO8A 1NXSA 1EFAA 3EVAA 5BPFA 1SVOA 2WM8A 2OECA 2REQA 3SHTA 2IJGX 1ZOIA 4DBVO 1MVOA 4UHJA 3ZH9B 3E9EA 3LKVA 2CVOA 3JQBA 4KQ2A 2TMKA 1E6EA 2N9UA 1GCOA 3U0VA 4E33A 1EWVA 4M55A 3LA6A 1JECA 1HEIA 4WGGA 4DNOA 4CTOA 2OL4A 5B7GA 4G09A 4JU8A 3B6ZA 2AHOA 4FS3A 1XNHA 5KWEA 3TPCA 2XQVA 1X3LA 5G1OA 2V1XA 5EKTA 4EHIA 2W6PA 1J8DA 3A06A 3K9WA 4MH0R 5I8ZA 4EATA 1OHHD 5F2KA 1EE1A 2PM8A 3W5CA 2P0AA 1QV6A 1A5SB 1E0JA 5FTLA 4PO9A 3R7DA 5A4MS 3IE1A 1BH6A 4HDOB 4KAFA 4FX2A 3FZYA 1FMTA 4N3CA 3N6XA 3FDIA 4R7ZA 2O3JA 3C87A 1EFUA 2Z8YM 5I51A 4Q3BA 3DWFA 2X6RA 5H68A 5HJ2A 3JAKB 4G85A 4UNSA 5MFZA 1GY8A 1VMAA 3OCJA 2IW3A 5D84A 3EEOA 4MGZR 2P27A 3WIBA 3MB5A 2BWJA 3OOJA 1R6DA 5ICEA 2AMFA 3TPZA 1WETA 1BX1A 2Y68A 1X1BA 3NTQA 1BQ3A 5EVCA 3MELA 3L0CA 1MOSA 1X9HA 3HNOA 4NE2A 1SBQA 1CUWA 1FX0B 2NTEA 4R7GA 3HO1A 2B99A 1HORA 5DLYA 4CL8A 2ZEJA 3KSMA 1G1AA 4O4IF 1OI7A 3RRMA 1H2AS 1UT8A 1T91A 2RMKA 2QX8A 4F72A 2I78A 1ZGGA 2ZVQX 1KDTA 4KOAA 5D86A 3KLNA 5CLIA 4KI0A 2EWMA 5G0TA 2FN3A 3K7EA 3G23A 1PWYE 2GCPA 3U44A 1FXWF 3GGJA 4R2MA 4XJSA 3OUTA 3AIIA 1R27A 3M6WA 1Y0BA 5KYGA 5DSZA 1GNVA 1I2DA 1G8MA 4XH9B 4GAEA 4TS3A 1U4NA 3QYFA 2WYIA 2XQGA 5I3CA 5J1TB 2C1XA 3E82A 4GRDA 4D9EA 1KERA 3CLHA 2ZBRA 1S01A 4DILA 3AINA 3HSKA 3B1VA 1L1EA 1NV9A 2HDNB 4JQSA 4QHSA 5L3RA 1RWBA 4EZIA 1W48A 1X42A 2WKQA 1KQ3A 4XFJA 5C37A 2I2BA 1DELA 4O6VA 1K2VN 1H1TA 1SZDA 1E1NA 3LQ1A 2XECA 1T35A 3T5GA 1IVYA 2VBCA 2GBLC 4M88A 4UOEA 2QNBA 2GETA 1FYFA 1YVUA 3HEAA 4FT2A 1P3Y1 1BRTA 2GJAA 5L95A 5LBTA 4IHQA 3WMFA 4DB4A 3TF5A 1FYXA 2P35A 2EJVA 4NVRA 4N40A 5JFOA 4PLHA 1P1IA 1F8UA 1IEWA 2PMEA 3TLZA 4L5BA 1P61B 2FPSA 1IBRA 1PL7A 1N5LA 2VH2A 4E5NA 2LKDA 3SKYA 2ERYA 1M10A 1T3SA 1Z68A 1FPMA 3AO0B 1DUVG 3GJRA 3OA2A 3OCYA 1FQKA 2F48A 3LVBA 1Y1QA 4OH7A 4TL7A 2PLRA 2X0EA 1I0ZA 1CUAA 2D00A 2YTZA 5DHQA 3RSLA 4CM8A 1QCZA 3KZCA 2VOJA 2JATA 4QBKA 4UFPA 3F2VA 1KHHA 5CX4A 2OO7A 4KN9S 4OYRA 4U8HA 4EW3A 4CMCA 1SWVA 1XPOA 4QVIA 1YOVB 1H3FA 5JZVA 3PVCA 3LV8A 1KAGA 4UTRA 5ICCA 2JH9A 4IPTA 2IY8A 3GAMA 3HB0A 3PDWA 4D9BA 4CXMA 2CMFA 4PFKA 3ZI4A 4YYZA 4JOCA 2REBA 3WIDA 1NW5A 4JBHA 2OFFA 4AK9A 2BM0A 7MDHA 4WCDA 3DPIA 4MNTA 5LKRA 1PGPA 4RVCA 4DNXA 4QFCA 5CUQA 3L93A 3A1VA 3PUIA 5M34A 3IQIX 4IILA 3HBFA 2ZYDA 5MGNA 2GR9A 1VI2A 4FOLA 5E2IA 4PVCA 2XLCA 1PEYA 3UATA 3JATA 2D5IA 2OV1A 3W34A 3HXMA 2OOSA 1Y1KE 1YI8A 2WSYB 3PP8A 1X19A 2EKBA 2EDCA 3ILYA 3A9CA 5AXBA 4CN9A 1ECLA 2QM7A 3IR5A 3OHPA 4IKEA 5GP1A 3I2JA 1J20A 4DUPA 3GZJA 1I94B 4BYMA 3WS7A 4RSGA 2I8LA 3F97A 3H6HA 4LZWA 3RODA 2BR4A 4PRZA 1MB2A 4WBNF 1RC8A 4YFVA 4NESA 4D92A 1U8YA 3EFOA 3MNFA 4BMNA 2BKVA 1E92A 2FLWA 3DNFA 4JELA 4LRWA 5HGJA 2NU6B 2GCOB