1DKRA

Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
298
Chain Sequence
b'NLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRMNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
molecule tags Transferase
source organism Bacillus subtilis
publication title Structural basis for the function of Bacillus subtilis phosphoribosyl-pyrophosphate synthetase.
pubmed doi rcsb
total genus 97
structure length 298
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dkrA02
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dkrA01
3OZFA 5HKLA 1JLSA 1NONA 1GPH1 1TC2A 1MZVA 1XTUA 1YFZA 4M0PA 1Z7GA 1P19A 1WD5A 4RAOA 4RQAA 1O57A 1ZN8A 3ACDA 4KN6A 4RQBA 2IGBA 5BSKA 1HMPA 2GEBA 5BRNA 2XBUA 2WNSA 2P1ZA 3LPNA 4M0KA 1P4AA 1J7JA 1ECCA 2C4KA 1XZNA 1LH0A 4TWBA 1UPUA 1G2QA 1VCHA 1V9SA 1DKRA 4RHYA 2PS1A 1QK4A 1A3CA 1A97A 1OREA 3O7MA 5IAOA 3ACCA 5IPFA 2PRYA 5ESXA 1QCDA 1ZN9A 1I13A 3S5JA 1STOA 1UPFA 2JKZA 1FSGA 1P18A 3OZGA 4RHXA 3EFHA 1Y0BA 2JKYA 4P84A 2FXVA 3NAGA 4M0UA 4WMLA 3ACBA 4LZAA 1DKUA 4RABA 5JSQA 4JITA 1BD3A 4P82A 1DBRA 2DY0A 4P3KA 4ZFNA 1UFRA 4RANA 1A4XA 1I0LA 2H06A 1I14A 2E55A 4RADA 3N2LA 1G2PA 3GGJA 4P80A 2H07A 1G9TA 2H08A 5BQOA 3DAHA 4LZNA 2VFAA 3MBIA 4RHTA 4S2UA 5K51A 3M3HA 1VSTA 2EHJA 5KAMA 1ECGA 4F8EA 1I5EA 1HGXA 1BD4A 1QB7A 4P83A 1AO0A 1DQNA 3HVUA 1G9SA 1A98A 4LYGA 2AEEA 4QRIA 4Z1OA 1QK3A 4FYMA 5ESWA 4X45A 1XTVA 3DEZA 1DQPA 4OHCA 1XZ8A 1VDMA 4RHUA 1P17A 1QK5A 1U9ZA 1OPRA 1BZYA 1PZMA 3KB8A 3LRTA 1NULA 1L1QA 1QCCA 1ZN7A 4JLSA 2PRZA 2JI4A 3G6WA 1A95A 1JLRA 1W30A 1L1RA 1XTTA 3GGCA 4MB6A 4WN3A 1R3UA 5EUCA 2JBHA 5BQPA 3QW4B 1A96A 5JV5A 4RV4A 4X44A 3H83A 1U9YA 4IJQA 4PFQA 1ECJA 4P86A 1O5OA 2HCRA 2YZKA 4LYYA 4PAWA 4QYIB 4P81A 4RAQA 1TC1A 1CJBA 3DMPA 4QYIA 1QB8A 5HIAA 1D6NA 5KAPA 1ECBA 1IBSA 3MJDA 1OROA 3OHPA 5E38A 1GRVA 1ECFA 4LZOA 4RACA 1I0IA 3GEPA
chains in the Genus database with same CATH superfamily
3QFHA 2NTJA 4BNWA 1I1OA 2PX4A 3I53A 1NONA 2D8MA 2P4QA 2V6FA 3EIHA 2A94A 2ZCUA 3V1KA 3OM8A 3R6WA 5CDTA 5BVHA 3TBHA 2O9JA 2PPVA 1OLUA 1I30A 3PZRA 2CXOA 2QL7A 1FNSA 3GQBB 5H02A 2WJGA 4R1NA 4J2OA 3HG7A 3QBDA 2DCMA 4FFMA 1S2IA 2VQ3A 3WHKA 4MH0R 4EA6A 1K3UB 4B2YA 3PUKA 2EW8A 3BTSA 4ZYZA 4PRLA 1NM5A 4HH4A 1KAHA 2CFCA 1DKPA 2QQEA 2YFHA 1M7HA 1U8CB 3NT4A 1HLPA 5FKJA 3JQCA 4C6RA 3FTEA 1PE0A 1W5SA 3MGBA 1QKKA 1QQ7A 1BSVA 3U9SA 4BNVA 4KDCA 5BMOA 1KJYA 4HH0A 4XIYA 4LQCA 2GJKA 1X19A 3UCFA 4HWPA 2VNAA 3FHOA 4D98A 3FPLA 5GZ1A 1E4EB 1SBHA 1FDOA 1BWQA 1ZY2A 4H1WA 5HZKA 2FRXA 4R9RA 3IDQA 1JFTA 1GPWB 2HNAA 3GDOA 3R3WA 2WJHA 2WU4A 2AXNA 1YWGO 4YXWA 3VU0A 1CZUA 3N8NA 3MTIA 1MEEA 4UEWA 3LSYA 1CY8A 4EPTA 2DQ4A 4NBWA 1QQTA 2YWXA 2ODEA 3DAYA 3UCXA 4KC0A 4Q21A 2WAAA 4DILA 3QJGA 5C18A 2WM3A 3A1SA 1KU0A 1SKYB 4JLJA 4DA7A 3QVXA 1E3WA 2Z8YA 4KE6A 1AKEA 4MYSA 2YWRA 4BFLA 3QUQA 5F33A 4PG8A 3B82A 2VZLA 4LSMA 4KGVA 3GLVA 4J75A 4RTOA 4TYWA 2PMWB 4N7BA 2AR7A 2A67A 4A8JC 2XUJA 1I3NA 1NBME 1NJGA 1TB4A 4HFMA 4K7JA 3B2EA 2R84A 2ET6A 3R09A 3WLTA 1OA0A 1T34A 1X9IA 2G80A 3AEQA 1MOSA 3BVPA 3GP3A 4GYJA 4KQEA 4EUKA 1M2JA 1UIRA 3HADA 1R6TA 3M3DA 3V55A 2ZDGA 4ZXPA 4E51A 2ZSKA 1VMDA 1YZQA 1W88A 4AG3A 2P5YA 4QRIA 4ESHA 3IQHX 5F73A 3WGQA 4D4JA 2ZYSA 2FK7A 3EA0A 1NI3A 4PICA 4D3YA 3DHYA 3RSFA 4CG0A 2OENG 4RZ2A 4U9UA 3T5CA 4JASB 1WBDA 2PZAA 2QN8A 2XAUA 3GOQA 5EJGA 1GRQA 5GAJA 1MZPA 2GX6A 3CF4G 3R20A 4R69A 4J7XA 1YQDA 3KV3O 1Q21A 4ND8A 1W30A 3PBKA 2DPLA 3D0KA 3D3WA 4YMVA 4TYMA 5I3ZA 3JU3A 3OPVA 2H4ZA 4GW3A 1I3OA 5FOTA 1BGVA 4PBTA 3RYFA 9MHTA 1P1FA 2VEOA 3H97A 2Q4DA 4EEZA 1GGEA 5DLPA 3PGVA 5IVIA 4EB8A 1HTWA 1Q1QA 1PWEA 1A9XA 4PZ9A 1KI1A 1P1RA 2YZ7A 3EDMA 1J99A 1KKMA 2Z95A 3PENA 4ZMRA 4UNQA 3GROA 5KHOC 3ZWXA 2ONYA 1T26A 3GZNA 3PC7A 4RVHA 3WL3A 3I6BA 4GI5A 1JJIA 1SVKA 2D74A 5B5SA 2QPLA 2WWYA 3DZ8A 4V24A 1ZUNA 4HUQA 1JALA 4TM7A 3AR4A 3DR3A 4TM8A 5KYXA 2RH8A 3AKCA 3CRQA 2UYOA 3ANXA 2CCKA 2C20A 2VDMB 1RRKA 2W22A 1VJGA 1BOOA 3DVSX 2XMGA 4G6ZA 4TLAA 4XWYA 4DLSA 3UHFA 5B3LA 3ZIAA 4KO2S 1M34A 3K1YA 4KWIA 3TINA 1SH7A 3RV3A 2GAJA 3HLKA 1U63A 4ARZA 2GJ4A 1D09A 4OYLA 3DFMA 1E92A 2BGUA 2F8SA 1RYBA 4PZLA 4RHFA 2FN8A 2GZAA 1LH0A 3LRPA 4KAJA 5B36A 3L6UA 1G2QA 1USUA 3U44A 1EEHA 5COQA 5GP1A 2O2JA 4N0PA 4OSOA 1GZ7A 3FYUA 5IUJC 3TAHA 5LZ7A 4E0BA 2HJWA 1WXXA 1J1ZA 4UHHA 3C98A 3GGSA 1PEDA 3KJZA 3CZPA 1S1MA 5DHTA 4B85A 1L7MA 4HAUA 4J0CA 1W0CA 1FXWF 1ZK3A 2OLJA 2QJOA 1EYZA 3DDSA 5LQMA 4F3CA 3P97A 2N3ZA 1OLUB 1NW6A 4FOSA 1SELA 2B25A 3DWGA 3VYRB 3WNZA 5I7EA 3SS8A 5ENZA 5IF9A 4DDTA 4G86A 1ZZGA 2Y8EA 1UBJS 1D3AA 1NVVR 2E1RA 3M6IA 4NX2A 3FNBA 4K9MA 4OBXA 4X3CA 3ZV7A 4B4DA 1N25A 2XCUA 3ONFA 1LW6E 2VHEA 4FTWA 1XC7A 4I08A 4QXMA 4KQHA 3FH0A 4BNJA 3A7EA 5IKXA 5ALEA 2QJFA 1Z2EA 3I04M 4KN5A 5C5IA 3L7NA 1JB1A 2XCQA 1NN1A 3HRHA 2AN9A 3QVJA 3E3LA 4PFSA 2A7QA 4URFA 1K89A 1E1RD 4P31A 5HK8A 5EE3A 2EF1A 3OE5A 1MB3A 4NS4A 1KVUA 3G88A 2ZIGA 4YEDA 3PPIA 2RIRA 3DHWC 3ZKWA 4Q3LA 3O94A 4KVZA 3FDIA 2GN4A 3AK4A 3K4HA 4QE3A 3RFUA 3TKYA 4DT1A 3E9MA 1MABB 1T0BA 1T5OA 3G2LA 5FUVA 1BWSA 4BX2A 4UQOA 4LSWA 1GAXA 2GVNA 1KK1A 3GDFA 2XJ4A 1YE8A 3O8QA 4EHKA 4DG8A 1VRWA 1Z6TA 2AR0A 2X0RA 1P0FA 3ZCUA 3QV1A 4C05A 2E4XA 3AM4A 2GTIA 4MWTA 1ISMA 4CTMA 4HDMB 1C0EA 4MUBA 5AKEA 1J1UA 2G8LA 4F7WA 3RC3A 4DCVA 3BL5A 3CF6R 2BZGA 4Q02A 2DP4E 1SCIA 2Q2NA 1Y3BE 4OL0A 3B85A 1RI4A 4QOGA 5HF5A 1AV7A 2PA0A 3EIWA 4WL0A 3AF3A 3S8MA 2W43A 1BYIA 1NVAA 4RSHA 2PVSA 3G3EA 4DA4A 3H11A 1SHUX 3O82A 4B44A 4GD3Q 3CZMA 2IPMA 2OFWA 4H9GA 2DFTA 3I2GA 4REOA 4BQPA 3COYA 3ICEA 3P2EA 3EB9A 2C7QA 5HQ3B 2IYWA 4DMRA 3II6X 5K3FA 2ZUVA 4PW0A 1O5OA 1RPJA 1L4LA 3LT1A 4MKFA 3SZLA 2W93A 5LBTA 2I5PO 1QORA 3C6ZA 4RK7A 5COAA 5SY9A 3MJDA 3VR1A 3IV6A 1XHFA 2ZRIA 2H7XA 4N6NA 4RACA 5A05A 1FP7A 2YIJA 5FFMA 4X24A 3OAAD 1MEJA 5AKIA 2V6JA 2V7WA 3I9MA 3VPBA 2J3QA 1YS9A 2RONA 4NV1A 1LLUA 5HRAA 4YP9A 1XQXA 1V48A 4DDMA 4RQAA 3E9QA 3RSLA 1N57A 5T4BA 5GJCA 4EKDA 2JARA 3URKA 3NV7A 3UFXA 5LLTA 1NDQA 3UHPA 2COEA 1GYPA 1Y3IA 2A0KA 3WGKA 1XB2A 4KGZA 2IWHA 2ZSUA 5CFPA 4XARA 1SM4A 2F1KA 4BQOA 1NYLA 1JIXA 2VJBA 4XDZA 4X20B 2DB3A 3DCJA 5CAEA 4IJUA 4UEQA 4MDEA 2W2LD 2M6KA 1M8PA 3O38A 5J1SB 1HDEA 3DVRX 1EUYA 1Q0UA 1WZCA 4DDVA 1O96B 3LWNA 6REQA 5KUTA 1T2FA 2C4VA 4Q4JB 1FXUA 4YWHA 2VXCA 2WG1A 4XI9A 1LJUA 3AG5A 4NAUA 2EL9A 3ZCQA 2C96A 5DXFA 5CVJA 1NVWQ 1P6UA 2JAUA 2FQ1A 3E5MA 5IAAA 4XVQA 3TS1A 3U7HB 1FXWA 1A7UA 1I6WA 1W34A 2EFGA 2WD9A 4JMLA 1MT3A 3ZI0A 3DCIA 3HGMA 1S7GA 3KSMA 5EP3A 3ZIDA 5LQCA 1JDJA 1WDKA 3NZEA 5IVHA 2GXSA 4GQAA 3EZ9A 2R5WA 4FYWA 2Q7OE 3HABA 5H9WA 1O6FA 2ASVA 3KAJA 2FPGA 4PLTA 1JF8A 1NVVQ 3BCUA 4LVUA 4W5HA 2QI9C 3WICA 3WGIA 1W2GA 4OBWA 5EPEA 2OTCA 4ZYXA 4M7WA 1BH2A 1P72A 1YZGA 2E55A 3HYTA 4FZRA 2GQ0A 3Q2IA 5IVKA 2ZAGA 4D0SA 4GP6A 3Q3IA 4UBIA 2IPAB 2B7LA 2HEIA 2JVJA 3HY3A 3K72B 4JBGA 3UWDA 2G4CA 2D62A 4GYKA 4BNXA 2N1BA 1CJKC 5DWVA 2GEKA 4MIOA 1RLMA 2NT3A 2PLRA 4G9BA 2PUWA 2PUHA 4HHEA 3F3YA 3H16A 1C2TA 3UJPA 2ZETA 4GBGA 4LZJA 5FADA 5PGMA 4D6XA 1NUAA 5JMTA 3CVXA 4DQ0A 5CFMA 3K70C 4FMDF 3GG9A 4B7CA 3UJ3X 3ABRB 3AR2A 3PS9A 3LC0A 2PNFA 3H5VA 1G3QA 2NYAA 2BFDB 4OYHA 3RJTA 1UWCA 4YRBA 2VJMA 3LUKA 5CT4A 5FAKA 2EKLA 1ZM3A 3I39X 4ER6A 3ZE7A 5JAMA 4WOCA 3VJRA 4HYQA 2C3MA 1F6DA 3H3JA 1TTHA 1DJMA 2B0JA 3I8SA 2W4QA 1RWWA 5JDCC 4P1ZA 4B6QA 3R3HA 4IWNA 4WZBB 1C0IA 1UJCA 2YBDA 1JL3A 1DP4A 1YDGA 2CBXA 1W85A 3TXXA 2AYXA 1IXRC 5T5QA 1P4SA 1UZNA 2FPIB 2JBHA 2Q41A 4FLEA 3UKDA 2R7LA 5JHGB 2KB0A 3EYAA 2DECA 3RVPA 3VUEA 4G3XA 1E7RA 3GV0A 3L7BA 3BMQA 1JB9A 3IDAA 3VQTA 1QNFA 2Q5QA 4PR0A 4S24A 3D81A 1L5VA 4R0VA 3J80A 1L7AA 3D6MA 3NP9A 2BTQA 2XDYA 2YXEA 4Q3CA 1M1YE 3DZIA 3AKEA 3O3MB 3TK1A 1SU7A 2DTEA 1SC9A 1TEVA 2HIAA 3EF1A 3TCNA 1FNDA 1ESDA 4IZHA 3CPHA 2BP7A 3A2LA 3LLCA 5L3SB 4Z0NA 3GCWA 3AQIA 4BBZA 2HC9A 4ZYTA 2F6RA 5DYNA 2WEKA 2IXBA 2PM8A 5EIOA 4ZQFA 2O8EB 1I9CA 3PUWA 4KQXA 5LXTF 1CUYA 1GGFA 2JIQA 4J1TC 3H87A 2ECOA 3NJ4A 4KXFB 1G6HA 1OJLA 3KKNA 1OBHA 1JDVA 3R8XA 3PF8A 4NU0A 4NYJR 4IIYA 4TSRA 2QLLA 3VZBA 3RW9A 1WXQA 3FNGA 3OZVA 3T34A 2YYYA 3NWEA 3R74A 3UTDA 3VZQA 1ORWA 3ZGLA 3D4OA 3M5WA 3O0DA 1WXHA 1XWIA 1VCNA 4FIZA 4UEKA 4EL0A 1P3Y1 1DRWA 5DK4A 4ZVOA 5GZ3A 4Q3OA 2FPKA 2C2XA 4OGWA 4RXTA 4D4GA 5HX7A 1PR2A 2E49A 4A8TA 3OZUA 2HLHA 2PT7A 3PKJA 5LJLA 2ZRGA 1N6KA 3LI2A 2UYYA 2HL6A 3CJQA 1Q1NA 1UKAA 3NBQA 2R751 4MI1A 1VMKA 1Y0BA 4D2IA 1LLFA 3WLRA 4H6WA 1I3KA 2VOJA 3DM5A 1QTIA 1VL5A 4EG7A 2DOKA 2VPPA 3CCCA 3ED1A 1JKIA 3CT4A 4MR8A 2R00C 4US2R 1E3QA 1S2DA 4TLCA 3MUOA 5KYYB 3FOZA 4KK3A 1TCAA 1D0SA 3LBNA 4JIGA 5K3DA 3SJCA 2DE0X 2WSYB 1HH4A 2YWFA 2IDKA 3MLAA 3P2OA 4NATA 4RGVA 1RQRA 1COZA 5TB5A 4MYRA 2J30A 3AMVA 3AR6A 4NENB 4Q48A 4Q7MB 3GHYA 4WK6A 3T9EA 3WL8A 5B58C 3MQ2A 4AFNA 2Q0QA 2YDXA 4HP8A 4MPJA 4HVCA 2R6CA 1M6YA 1W4LA 3FCXA 1G5IA 3IP3A 2WG2A 3WRXC 5C4IA 2H4XA 2O2DA 1SBYA 3WSVA 1HKUA 5KMGB 1NY5A 3CZAA 4G23A 4O4LF 3EGDA 4P93A 5AR1A 4MTCA 3VC3A 1JMVA 4QWMA 1SZPA 5LMCA 1L5HB 1U90A 2PGIA 3RWMB 5KPDA 3VHXB 3AFOA 3ADOA 3V3TA 3VGPA 1QK3A 1ND6A 1SWVA 4IV5A 1AZWA 1R12A 1JG7A 3BUSA 3EC1A 4I5EA 4F9EA 2C88A 4JYBA 1NGSA 2V7QD 4FUQA 1KI2A 1L4UA 1U6KA 4WN9B 2NVUA 1U9ZA 2C5AA 1XROA 4GDMA 1ZIPA 3SC2A 3W6NA 2DUMA 1FDRA 3WLQA 2VUIB 3Q1LA 3HCNA 2ZIFA 1TA4A 2R6AA 1QANA 3BXEA 1QLWA 5AP9A 3KXDA 5IABA 1NBOA 1UM9B 4OAQA 1KDTA 2KQUA 3L8DA 4CM3A 2VT6A 4LHSA 5AOBA 3IBTA 4FFBB 3E82A 3PQ6A 4B8YA 4RV4A 3LCMA 3LHDA 1F2TB 3T52A 4DIKA 5DTEA 1PV4A 2HBYA 2QM0A 4OK3A 3CH6A 1Z37A 1VGRA 2V6IA 3HYCA 3HYRA 3B9BA 3QY9A 3FYSA 4P7KA 2HCRA 5ALOA 2Q99A 3EXHB 5I9MA 4JB3A 4LTDA 2VVTA 4D4MA 4ZGBA 4JVMA 4O8ZA 4JX8A 3W2FA 5BWNA 2OOSA 1FPQA 5KDOA 4OO3A 1AZSC 2ICAA 4B9AA 5FRDA 3BGWA 5EN4A 3LX6A 4FS8A 4FYJA 1EWQA 1Z5PA 1ZS9A 3K3PA 1TQ2A 2FZEA 1GD1O 4HZIA 1DOZA 3U0BA 5LYJF 2PGNA 4A8JB 4IO0A 4RS3A 5K8LA 3MTEA 3GRAA 2HRCA 3RSCA 3TQQA 2KI5A 4M0FA 2REQA 3LT2A 4XVUA 2PQ2A 4PQFA 4XPZA 3SE7A 2QMUA 5KYVA 1ACLA 2EBHX 3FF4A 1KMHB 2J67A 4KRGA 5F9HA 4FFBA 1L5GB 2HMWA 3V2UA 1V8PA 2R11A 4NPHA 3BXHA 1ZPDA 2X4IA 5H4HA 1KO5A 5CB0A 1VPLA 3PDWA 3UXEA 2G71A 2I4RA 2J41A 5E4YA 1VCHA 3RK4A 1R0WA 2G88A 2OD2A 3R5SA 3PUVA 3RRMA 1T4BA 2QVYX 3MTGA 3RRFA 4EMSA 1JQ3A 1OIXA 4FFNA 4UTPA 1KFJB 1V16B 2BFWA 4DBVO 3PNKA 4L9AA 1S9DA 1PWZA 1QRTA 1P2TA 2O0LA 5FDFA 2WFAA 4G63A 5DW0A 2ZJ4A 3ZD9A 4FHGA 4IFBA 1EUDA 2IYUA 3SZUA 1L5HA 4A6EA 4BUJA 4P84A 3H5WA 1LF5A 4MZXA 1Z17A 4UOEA 2WAYA 2PKCA 3QF4B 1W581 3FXAA 1K4KA 1Q5PA 3O4GA 3CKYA 3E9ZA 2HCTA 5ALZA 1Q20A 2PMEA 4Z7QB 1TTTA 2P6OA 5AKYA 2UZAA 4JBLA 2O0JA 2CLLB 2I76A 4PX2A 4EYEA 4HDKA 5LJIA 1GFWA 3LUJA 1EVJA 1H5QA 4Y2TA 5A3VA 1UMKA 3PC3A 1B43A 4LWPA 1ULTA 3D8HA 1MKYA 3AKYA 2NU6B 1ETHA 1N9GB 1BH6A 1U2EA 1M2WA 2B82A 3KYDB 1UBMS 3DAHA 1ZJ4A 4NFSA 4RK0A 4CTOA 4IX9A 1ZCJA 1WB9A 3JQAD 3GJSA 5FWXA 3RSOA 3S4YA 4BMSA 5AI0A 1WS6A 1JMKC 3DBHA 2C3PA 2ZIUB 4PCAA 3RABA 4PC3A 4ZO9A 4HYEA 5GMOA 2F8MA 3SYLA 5I9BA 1IAQA 1Y1PA 3H9JA 5KI6A 1N5JA 5IX8A 2XE8A 1RLTA 2ZZNA 2HSZA 4NFHA 1RU3A 1FSSA 2ZUTA 4ER7A 1BXZA 3QEMA 2BISA 1P77A 5CXXA 1PG2A 4W8HA 3ZQUA 4C3VA 3N3BC 2PSSA 2QUZA 4F6RA 5CH8A 1V6SA 1PUXA 2R4QA 2XNCA 3HKDA 3ME5A 3NIWA 4ILKA 4PGAA 4RPIA 3H9BA 3QW2A 3BXPA 4MNTA 5FWAA 2ZPTX 4G1VA 5HZGA 4I4TB 3TZ6A 4HN9A 1XMOB 4AF6A 5AVZA 1A95A 3ZQ6A 4MB6A 4P3OA 5ALJA 5LD2C 2CW5A 1VPDA 4BJ6A 1U1EA 5IC4A 4DIMA 3W77A 1UP4A 2DYKA 2HA4A 3ZDCA 1BCRB 1KZ9A 2OZLA 5LMNB 4EY5A 2X77A 3GZNB 4QHYA 2J46A 1SBZA 5TPWA 1C1DB 5ERGB 2WAXA 4ZVKA 4ARVA 1I4TD 2WJVA 2BZ1A 1FW8A 2XBMA 1UP7A 3NBXX 2DETA 4C1NA 4HN4B 3IKVA 1ECBA 1Q0LA 1TOAA 2Q6KA 2QVCA 3OHPA 4F86A 2ANBA 4C7OA 1KEWA 2QV7A 3ZTYA 5KWIA 2I8CA 3L1VA 2W6MA 4EJSA 3KSZO 2B6NA 3ILVA 5JVDF 4B17A 5EHZA 2ZJ7A 3OT1A 1PFGA 3FLAA 1KKLA 4IP0A 2R8EA 1HE3A 3IOEA 4TOIA 1U0TA 2BFOA 2V7GA 2YW2A 1VMIA 2FLKA 1PGPA 1MB9A 3L46A 2VSNA 3ZU4A 1XDSA 5G1OA 4BMDA 4K81B 5EMMA 5IHXA 3CEHA 3C3YA 3I52A 4NH4A 4OD0A 3U3KA 3QVGB 4CM5A 3LQKA 1T9GR 4GI1A 3TGWA 4EDFA 2P4UA 5BQXA 3EEOA 3GX1A 2G1UA 1ECCA 2AG6A 2AQHA 1IJEA 2E6KA 2JGJA 1ZEJA 3EZ6A 1UPUA 1GRRA 3D64A 3GVPA 2NZ8A 3K2QA 5DCLA 4ZT5A 4C22A 4RMIA 5P8WA 3U60B 4IV0A 1ZXBA 3PITA 2YWGA 4AZ0B 4RTQA 4Z53A 2OQ2A 3EIFA 2V58A 3IULA 5TT1A 5EHGA 5E7QA 2YNMC 4KJXA 3JZIA 4KZKA 4PYOA 2JKVA 2V96A 1TM3E 1XFAA 3NIGB 4HWGA 1P7WA 2NZ2A 5C7YA 5JS6A 5ALWA 1L5RA 4IZOA 3L82B 3MWGA 1U0OC 4R9VA 1RLIA 1LJLA 3IAEA 4LV6A 3CA8A 4LHWA 4ZVLA 4AO6A 1U1IA 2BFMA 3DJFA 3LDFA 2Q1TA 2JJQA 3T7DA 4CM1A 1X1BA 4TXHA 5TEWA 4IX1A 4CIDA 4XYLA 3OQIB 2A0WA 3IBCA 3MBOA 4NBTA 1D1SA 3IPLA 4DNXA 2J7PA 5FFNA 4P3KA 3B8HA 4JUBA 1C3EA 3UO8B 2XRYA 5CG2A 3BRWA 5D00A 1A4XA 2HA3A 5KX5B 3GCDA 1NG9A 3W2HA 5LP6C 2PX0A 3G68A 4FX2A 4WXMA 4XWGA 1Z88A 4O2RA 3ZHQA 2PZLA 3BOSA 2WDZA 4G4IA 1OW3B 1I10A 4EAAA 4MW4A 1SIOA 2NIPA 4LHEA 2WJ6A 1ZNXA 5A5GA 2JJ1D 5GONA 1EJ0A 3N05A 3DE6X 3NC1C 1C1XA 3LDUA 1Z68A 4FFWA 4LV5B 5F12A 4U8HA 1GFIA 3D7RA 3H2BA 3NOQA 2Q1WA 1RZRD 2HGSA 2JEYA 4LJ7A 1H2HA 4EO4A 1COWA 3NBKA 4D02A 5L3QA 2QBYB 4HCJA 3OZ7A 1Q7GA 3ZGNA 4MP6A 3KE9A 2RHLA 2BM9A 2VK4A 3Q7RA 4YJKA 4L8LA 2QSYA 1YB2A 3TSOA 4I14A 3DHVA 4Y98A 3O2NA 4Q9LA 4ZOLB 2IS6A 4YFYA 3ECSA 3MRVA 4TTSA 5TEVA 2ZM6B 2I6TA 3QITA 1P5FA 4D4IA 1HBJA 3ZV3A 3C1UA 2KBFA 2XNHA 3FSGA 3GELA 1R8QA 4I55A 3RS2A 1GG2A 3LPLA 1SURA 2WTAA 3KWLA 1FUEA 2GTHA 1MC4A 1ZUHA 3PQ8A 3Q1KA 4H1UA 2NZYA 4MYDA 3T7IA 1M8FA 3TLCA 4PVDA 5JDIA 1M8KA 1VZ2A 1XKLA 5JSZA 1DHTA 2WNIA 2GGSA 4E5KA 3B3AA 1BJKA 3AR7A 2AE1A 2EW1A 4LXXA 4YRMA 3KR0A 3RQSA 4F6RB 1KI4A 2IEAA 4R16A 4CGYA 3INGA 3VZSA 1TTPB 4C01A 3ROTA 3DKKA 1DQRA 2Y99A 3IQWA 3R7AA 4DA9A 2GUWA 3IO5A 3G0GA 4N01A 2YUIA 1V11A 2Q8QA 1YZNA 3RBZA 3OPMA 1PFYA 1ZHFA 4YI3A 5EFZA 2B34A 3AHHA 2WJYA 1Z36A 3SYTA 1XTUA 3UGTA 1LCIA 3X2SA 1TJ5A 3FKSD 3KD2A 4UHEA 4P4NA 2CNDA 4Z0HO 3SHQA 3VX4A 3TG2A 3OAAA 4JAVC 4Q1DA 4YJFA 4B81A 3HE3A 2RHMA 3CG0A 5ALQA 2FF7A 2MR6A 2ID8A 4B32A 2CCGA 5KTKA 3GUHA 3DF7A 4FZJA 2QTLA 3UWMA 5K0NA 4YRSA 1NX6A 3KZKA 2FRDA 1BA3A 4UM8B 4K6MA 2PIAA 2L17A 4PRZA 5K6AC 1XA3A 1VJ5A 4UNNA 4E5NA 4I1YA 2LV8A 1MA0A 4A27A 1UDRA 3PQ4A 1X70A 1PZHA 3IUBA 2JIPA 5L53A 5JJLA 1PNQA 3DDHA 2YHIA 3QXHA 4L50A 4KSCA 4KMMA 3BF8A 4J03A 1DAKA 1G6Q1 1LI7A 1ZRNA 1JAZA 2RGYA 4GEGA 3RFFA 4EW6A 1YJAA 3F5MA 2R1TB 1KP3A 1RNLA 2IIVA 4DJAA 3NM6B 4BQSA 4RD0A 3ILSA 2EXXA 2JKZA 4H1HA 1WCYA 2H1IA 1S7CA 4E2FA 1XDGA 4BYMA 4TRJA 2ZRMA 2RG1A 2MYTA 5FL3A 2CNWA 4YJ3F 1V26A 4UZFA 4A26A 1SOVA 4LF8B 1IY9A 1IM8A 4S1PA 3VDQA 4E5DA 1F17A 1AKNA 3HBNA 4QUEA 3HFJA 3HL0A 3IVGA 4O4JB 4Y9RA 5DBIA 3SHOA 1SBQA 3KL2A 4LYFA 3W5VA 2ZIXA 2ZANA 1U2DC 2FUCA 1KJNA 2QZZA 2Y1DA 1OAOC 3PU6A 4AJJA 1IZ8A 2GZMA 1KDYA 3HO1A 2B2CA 1UOPA 1M1NA 3RS8A 4KXUA 4LRWA 3FDXA 4INAA 3UTCA 3FYUB 5BNWA 1DI0A 1P5JA 2O3QA 4XQCA 3ZCRA 8ATCA 3FWYA 4CT0A 1X0XA 1R6DA 4N39A 4UVHA 4EPXA 1DBVO 2XB8A 3H4VA 3LOUA 1R37A 4TROA 4EB3A 5A3QA 2A7XA 1JG4A 2CK3D 4J91A 4MVJH 4R7GA 3FD8A 4G5QA 5ILQA 4X9XA 2IZ6A 4K86A 5H16A 3SFZA 4C0LA 4TSKA 3L0YA 3G8AA 3KQUA 3NBAA 4WTOA 4UOZA 3FPFA 3I1IA 2YOGA 3H2GA 2KYRA 1JXQA 3L8FA 4EA8A 2EZTA 4QPJC 4IVRA 1VJCA 3M4XA 1JJVA 3MN1A 2JVIA 3O74A 1V3QE 4HX9A 4KL8S 5KNCA 1CY1A 4Z3OA 3QHAA 1CF4A 1VRVA 2YXDA 4CLDA 2VWHA 1J70A 3SVZA 1XQWA 1MO4A 1MO2A 5K4HA 1LXCA 4B7XA 3RAPR 4LYEA 2IF0A 3UK0A 3JASB 5FUXA 3U09A 2NU9B 1DX9A 4KRXA 2GF9A 1MAUA 1V5WA 5JS2A 2CYAA 2XVMA 4GUDA 5E6UA 1KZ7B 4BFYA 2EX4A 1KOJA 3GGOA 1PG5A 5M3BA 5SY4A 3PQDA 4JP1A 1LWOA 1ZCZA 4Q7EA 2E37A 4BJ5A 4ZI5A 2ZYWX 1L8OA 2Z6VA 2ZWOA 1QVVA 1WXDA 4JJEA 3RK0A 4IEIA 4DW8A 3ZWPA 4MP8A 1XRQA 2GZSA 1W36D 2CKDA 2ZVQX 2R6JA 1ECPA 6PFKA 1EKXA 2BZSA 3LP8A 1MABA 4MJ7A 4ZVPA 3VYUB 5BV0A 1WVIA 4R8SA 2V55B 3HDYA 1G7SA 1W35A 1U7XA 5KVSA 1XD9A 3EPKA 5JWOA 4IHJF 3A6PC 3NHZA 1RYYA 4B09A 3OE7A 1TVKB 5EWJA 1Y37A 2O4CA 2OHHA 3L18A 3RFXA 4EW2A 5TGDA 1AXEA 1OZAA 2XY4A 2QJRA 1RWMA 3CXUA 5CEJA 1NVKA 1ODFA 2Q5FA 3AEKB 5CM9C 3WMEA 4TV9B 2PGAA 5HQTA 3AVTA 3VAAA 2Z4RA 1CUGA 4RTNA 4G07A 2A5DA 1L8XA 2QLJA 1O5TA 3R23A 4LOLA 4N7RA 4S1VA 4X71A 5KTMA 3U7EB 2JFYA 1GSAA 1QFZA 3B1KA 1W36B 1G59A 3QF7A 5ESXA 4N65A 1YOVB 4NJEA 5LIPA 4M0EA 4W9NC 2GUGA 3KJFA 1SXJE 3ENZA 3LPDA 4R4JA 4IW3B 4R8KA 3H04A 2QW0X 3K09C 2H92A 3HN2A 5AXAA 2WWVD 3SZMA 5DDIP 4AC9A 3NHRA 5KYYA 2DXIA 1Y5LA 1J6UA 1VFNA 3CUUA 4QXPA 1U5BA 2QT0A 4HGRA 3U3MA 3W5UA 4HVLA 1U0FA 2JHAA 4IG4A 2FEMA 1SVNA 2DMRA 2V4MA 4OJYA 1Q7TA 1OASA 2OBBA 2P4HX 1GVHA 2B92A 1SEPA 1WCIB 3M82A 5JAHA 1E1CB 1SC4A 5DO9A 4ZARA 4A0GA 2VOEA 3AR9A 1LQ2A 4KUHA 3SQXA 2AKAB 5CA1A 3EZXA 5AW3A 3O8QB 4NZ9A 5K99A 1XZCA 3R1IA 4IIFA 2CV2A 1Z0UA 4HAWA 4AQ7A 2ORVA 1KAGA 3CHYA 3UPTA 4EIWA 1O97D 4YN3A 2RHDA 1G2PA 3WLNA 1P1JA 2BE9A 1HL3A 2EWMA 1HYEA 3G2MA 4UUPA 2GEFA 1T9HA 2DG2A 3VR2D 4BX0A 4X97A 5LB2A 2H11A 4EK9A 4V03A 1JFFA 1F5SA 1QIHA 3OE1A 2FZLA 2YMLA 3RU9A 3UKJA 4X8HA 4RTKA 3DT9A 1KI7A 2W2XA 4TYPA 5E0KB 5ED0A 4GZ5A 4QOJA 2V97A 5T64A 3TZEA 4N0MA 7ABPA 3B1WA 4CM8B 3CVVA 2WHPA 3GEIA 3NHMA 5BR4A 1X1SA 1XRRA 3W9SA 4JJ4A 4K88A 1XPJA 4ZOEA 1UBRS 4V3BA 3GH1A 1Z38A 4I3HA 3TRFA 4DCOA 3TPFA 1TADA 4NDNE 5AT1A 1MJGM 1VDMA 1YFKA 3GLKA 3IAFA 3KXIA 3RHZA 1NT2A 1DCMA 3GHHA 4L95C 2B1RA 3JVUA 4NF2A 2XUAA 4LHXA 2R44A 2VPYA 2ZRKA 3CEMA 2JLVA 1KQNA 5KKNB 1DJNA 5LPNA 4R1MA 2WICA 5I9NA 2R97A 4FD3A 5BMVF 4CF6A 2WLSA 5L95A 4TLDA 3TUJC 3ROQA 1XO1A 4JZKA 3SLKA 1JT9A 1QWOA 1U8XX 3RVMA 3I42A 4PYMA 3VH2A 4JI8B 2IEYA 3VNAA 5K8CA 3MERA 2TMYA 2ZR8A 1L0BA 2QU7A 5DXAA 4POOA 2BSQA 1N32B 3OLQA 2CYBA 3DZCA 4M1KA 4TV9A 2PR2A 1ZOPA 2WHPB 3T7JA 3M1IA 1A2BA 2ZI7A 4Y2UA 3DD1A 4RVDA 5K8TA 2BN4A 1RRPA 1H0KA 3DCYA 3EZ2A 3KYJB 4YNBA 4WNAB 4BB0A 5EZ5A 3M9XA 4RF3A 4UBNA 1RJ9B 1Z22A 3PC2A 3RYCA 4MVJA 3SYMA 4E32A 2HXGA 4TV8A 1JEQB 1L7VC 3VZRA 4ALNA 4TKVB 3THOA 1PK8A 3D2BA 1N5IA 4JJKA 3A6DA 4RTPA 3D2LA 1LVUA 3MK31 8GPBA 1R6XA 2IP4A 4X8OA 4YRIA 5AM0A 2VYCA 4BNHA 2Z2YA 3FX2A 4G36A 4HNQA 1RI1A 1IM2A 1CFZA 5H8WA 3TM4A 1ZD1A 2NUPA 2G9NA 4L85A 3JCZA 4H3VA 4L9SA 1BW9A 1S8FA 4FE3A 3STXA 1E1CA 1R6AA 1BO6A 1A4UA 1WCWA 2WNSA 1H4VB 1JWBB 3A6FA 3HY4A 1CV2A 1JJFA 4HX2A 5CLJA 1ZGCA 1YRYE 2LCQA 5KYGA 3H5NA 1BJTA 1SUEA 3KAPA 1B8VA 1XYYA 4FOTA 5CT5A 2GAFA 3W5AA 4KR6A 3KUCA 5AFSA 5KTPA 1CU1A 1Z0JA 2B8JA 4URXR 5M5BA 2Y0EA 5I7OA 2K2WA 3NBUA 1FX1A 3UUFA 3AY3A 4DLNA 4ECEA 2A30A 1OLXB 2IOFK 5DP2A 1EP1B 1CUDA 1X39A 4OGGA 4PGHA 2HM7A 3WP0A 1SXPA 3K9NA 4Q4AA 1M9NA 2FPGB 5DNEA 4LF5B 2B30A 5FQNA 2O8DB 1MRSA 2WJ4A 4M0UA 3FMPB 1EVQA 1Y1TA 4CF5A 5TSDA 4L5BA 2BFCB 2PJUA 2WT4A 2VDRB 1U3CA 3DXFA 1WPRA 3CNQS 4NCHA 3GU3A 5FIUA 1UQUA 2O2CA 5F98A 2VPXA 1V37A 1RZRA 1XOIA 3WQSB 2AG0A 1CC1S 4TQ9A 4YDQA 1DOHA 1PR1A 2J9FA 1CR6A 1TM7E 1AC5A 2X76A 4FONA 4XFKA 3JQGB 1E3MA 3UMVA 5L45A 3MC1A 3EMVA 1ADBA 1KOFA 2AMLA 4FWBA 3V33A 4E30A 4ZCTA 4CEJB 3M6VA 5B12A 4F38A 3EQ7A 5ICEA 1YBHA 3FWZA 1FFHA 2OSVA 2ARKA 4RDCA 2VI5A 4M6WB 4ACAA 3UW3A 1HFJA 1NNI1 3AERB 4DB2A 1QLJA 4BLPA 1IPEA 2HBRA 1KETA 3NKVA 3QUTA 3CPEA 1E32A 3CLSD 4TZTA 3SKYA 3WGOA 1GNLA 2JFUA 4KO8A 3VI4B 1UAYA 5ESRA 4Z1OA 4AIRA 3QEOA 3WYNA 4DWOA 3V8EA 4DYVA 3IYLW 1Z6XA 1UXHA 3MRXA 4KP7A 4OHCA 4QASA 5DTIA 3KBBA 4MCAA 2HI0A 4PX5A 2PUCA 5G53C 2CLSA 1GU1A 3LXXA 1F5NA 4HLNA 2LD4A 3V1LA 1JEQA 3K8OE 1E94E 3DR5A 1AQIA 1EZZA 4ZXFA 1K0FA 1VB5A 3FTNA 1EG7A 2N0SA 3ISVA 5AKLA 4CF4A 2GJ8A 3AO0B 4I50B 4TXMA 3EARA 3O3OB 3RADC 5C80A 4LFBB 3RTGA 4JNCA 4DYHA 1G18A 4XUDA 3E48A 4M9UA 5IBPA 2Q3HA 1CUCA 5LB4A 4QVKA 3EH1A 3HVKA 4B4UA 3NHSA 4F56A 1BU5A 4H7PA 4MCJA 2A0UA 2W8ZA 3HU1A 3OOJA 1LS6A 3CSUA 2JJ8A 3IE0A 4ZODA 4EVRA 4G8JA 1Z8FA 4B6EA 3WC4A 1P2FA 2OA0A 2I3BA 3SVLA 5JTUA 4PRYA 2HK8A 4BMVA 3GEMA 1XF9A 5CK4A 3ZU3A 4DF3A 4B0OA 3HUEA 3S81A 2PLWA 3OWOA 4MW2A 1EESA 2YVKA 2FCRA 5DTQA 4BTLA 2MYUA 3DQZA 3QNWA 4MK4A 3EVFA 4X93A 2CWWA 1JH9A 3RJZA 4L74A 4RSMA 2IYAA 1U9IC 1NVBA 3BRWD 4RD6A 2ZULA 3ICWA 3BJEA 4DIOA 3PCRB 3ANYB 3JVIA 1EGMB 3R4CA 1Y1SA 2OXEA 2I8AA 3IURA 4L8YA 2G9RA 2MSKA 2HV9A 3DGFC 1PJTA 4ZI2A 3JZFA 1HR0B 3LP5A 3M5DA 1E6LA 2ECQA 1VA5A 3AJAA 3PE6A 3TTVA 3KU1A 3LDGA 4C7MA 3QX7A 1ARZA 4ENSA 5IK2A 3VKFA 2ZU6A 2I71A 2Q5LA 1SG9A 4PXYA 4XSVA 5CPBA 2AUTA 3G5UA 3JZDA 3GFSA 4YRRA 1ADYA 1J0XO 1FSZA 4R2XA 3SEZA 2B83A 1TM5E 1UMCB 1U7WA 3BE6A 3OPXA 1BXRB 3G1UA 4YAIA 2Y66A 4BE4A 3PDIA 4ZIRA 4I50F 4A2WA 5F5NA 4BCCA 1DTSA 4V02A 4HI0E 2OZEA 4ZAYA 4EI2A 2O2GA 1NUPA 1FFBA 1KWGA 2PQ6A 1FTSA 1XTSA 4BEJA 421PA 1NVGA 3MTJA 1K6EA 1UXGA 4FE4A 2P9FA 3HZZA 1X7WB 2IEBA 1OT3A 1YI1A 2ZJ1A 4IQFA 4QBIA 5DT2A 5JZSA 3QVUA 4EG6A 4FOLA 3U9TA 1I0LA 1AKRA 3KB6A 3LW7A 3CLRD 5JWHA 2FWAA 4KV9A 3CPSA 4YP6A 4EO9A 1Q83A 1Z75A 1NXPA 3KUKA 1QP8A 1RQNA 2B1JA 5IANA 2XDWA 5G40A 4QECA 1Y9AA 1F0KA 2OYSA 2Z8YM 1V5IA 4XVHA 3C6XA 3CONA 5L6LB 1F7VA 2PX6A 2Q50A 1GZ6A 2QWXA 3KIPA 3LCCA 2OBFA 3GJRA 4LY9A 4OM8A 1X86B 4DMCA 2PVCA 4DYDA 1L5SA 1N0WA 1L4GA 1QB7A 1N5KA 2PO7A 3HVHA 4G1EB 5H0IA 4D7AA 1X38A 3OEEA 4WN9A 1ZVQA 2X3UA 1G98A 1WZ2A 1E9BA 1RJGA 3C3CA 5CB4F 2P2LA 3C74A 5AVRA 3U6KA 4WESA 1GN8A 2I65A 5CT9A 2ZYUX 3TW4A 3AHDA 2CVHA 2X2PA 5GZ6A 3VNSA 4G8BA 4BRSA 1ZR4A 2W6PA 3I3SR 4OJQA 4C87A 1Y6RA 2OGSA 1W48A 5CFLA 3JQQA 3P8ZA 5K2MA 2X0DA 2X0FA 4UREA 2PWPA 4B45A 3B6KA 3STYA 4DJ5X 2GEUA 2LR0A 2ORIA 1YL7A 1RXUA 1RHRA 2RC5A 3DDZX 3A11A 4QDJA 4WLNA 3TQCA 4JXZA 1SUIA 2GETA 1A76A 1JKJA 1TJYA 4PIPA 2XF2A 2CL6X 2XD4A 2HWXA 2XZDA 2V5VA 3IIMA 3MJCA 3N6VA 1HYGA 2X6QA 3RYFB 3NNSA 3SX0A 4AD8A 3LBHA 3EPPA 1CRQA 1BE6A 1C9JA 2BC9A 3BFJA 1O6BA 2BEUA 2GZDA 3D6VA 3UEOA 1Y3HA 3DH0A 1A71A 2J3DA 3L0CA 1TT7A 1RAGA 3EH2A 5B4TA 1NLYA 4FYPA 2YV2A 3C45A 4MGIR 3DW3X 1HQYE 3AM3A 4G5XA 3I9V6 3OZSA 5E8RA 3V3KA 2OAGA 3G5LA 4DARA 5JJCA 1V8DA 3KQKA 5BW8A 1PU2A 4RWZA 1JIKA 2RGBA 3GPCA 1QF7A 1Z12A 2JBWA 4WCFC 2WAMA 3JYQA 4RQBA 1WW8A 3UCEA 1NE2A 4PLWA 2RHRA 1CERA 5HW0A 1NI4A 4IO1A 4BNFA 1YR9A 4YUAA 2C2GA 3ENVA 3KXLA 5FBRB 3PLNA 4W5QA 3QELA 1A9RA 4TL9A 1NBAA 1GLNA 1NMEA 1U2DA 2VDJA 3QKSB 4IWXA 4RGYA 3V6MA 1YS1X 4C9BA 4W5NA 2B20A 4OXNA 2VTKA 3VU3A 4D92A 4O6VA 1PL7A 3KTOA 1F8YA 1PS0A 2WJZB 2VO1A 3KT8A 2JCBA 2WMOB 4F3NA 3CU5A 4RFSB 4AI6A 1WP4A 2G7ZA 1Z2OX 2WM8A 1K5GA 3M8KA 4NP6A 3AT1A 4E08A 2JJMA 4G1FA 2WF9A 4TTQA 4NMWA 1PS8A 4UZEA 1QCDA 4YIHA 4GWLA 3A6JA 3DPUA 3MAJA 4O4IF 2Q2QA 5HILA 2YN2A 5KJCA 2OBNA 3MB8A 4K3UA 4WZBE 3FDFA 3G13A 3KKZA 2H1OA 4JXJA 3SQWA 1JKFA 2PYDA 1U2GC 3OLYA 4O2AF 3VBEA 1E99A 3RYTC 3TIVA 4LKOA 2JRLA 4MEBA 3X1ZA 3H3XA 2QD3A 1K27A 4P0PB 2P9HA 1Y8AA 3DO8A 3FPSA 1YDHA 3J7TA 4ALLA 1T6NA 4EG4A 1DL5A 2ZTSA 1JSRA 2UAGA 4XFJA 3NC4A 2EU8A 3TJRA 3FN4A 1E4EA 2PGLA 4UATA 3VPCA 4YHHB 4IDBA 3HDHA 1E3JA 1IOVA 4L5CA 1T24A 3N2LA 1PFUA 1B0ZA 4RQTA 3PB3A 1N6IA 1TYZA 1PWHA 2QK4A 1N2EA 2HK7A 3Q15C 1B0PA 1LPSA 3LM8A 1EHCA 1K8ZB 5JBNA 4BQNA 3BF7A 1AGNA 4KACA 1Y42X 2O3TA 1XRLA 4PX9A 5KKAA 3RAFC 1FIUA 3RS0A 4BC1A 4D8WA 2QW1A 1WL8A 5J4HA 2ZZKA 3K1TA 3M49A 4G8DA 4M99A 5EIBC 4YGXB 1BS2A 1JHYA 3X3HA 5ICGA 3QFFA 2G40A 4Y2YA 1MJHA 4JEMA 4FSHA 1S8OA 2CXHA 3PI7A 4UUAA 3QLVC 3TWOA 4HNAB 3X1MA 4HXYA 2ZIEA 4OHFA 4Q9AA 4DTCA 1SWWA 3A9RA 2ZI9A 3WGJA 1JKXA 1HETA 4IQGA 4NOJA 3FWNA 4Q9IA 1RM0A 2NZXA 3ZGXA 3FR7A 2B36A 2OBMA 4WLEA 2WZCA 3AVOA 4FDMA 4H6PA 3LBFA 3FTFA 1T0HB 4B82A 2GYWA 3HCRA 1XEAA 1OU4A 3QUBA 3OG9A 4M98A 5JQGF 4W5TA 2EJTA 1D2GA 2Q5HA 4OY3A 5JSFA 5JPDA 2OUKA 3JD1A 1W1WA 2BHRA 4G5FA 2NQ8A 4QGBA 1X1AA 4W7HA 3X2EA 4DV5B 4JY7A 1MJFA 2F2TA 3TEJA 4GPBA 3ZKAA 5KC9A 4EKIA 2DF8A 3QVTA 2Y1GA 2ORYA 1ZA2A 3GYGA 4B43A 3QQ5A 1N6HA 3MJRA 3NGLA 2GBIA 1BE1A 2X58A 4CNBA 5F78A 1I7SB 3NT5A 1T5IA 2H2GA 2HJSA 2LGJA 3DEKA 3O9VA 3AUSA 1QBGA 4PC2A 4FCCA 4YMLA 3J81A 4ZU6X 1FX0A 1G16A 2CNKA 4R68A 4PN7A 1T5DX 1YGPA 1XT6A 2BEUB 4GBMA 3OFSA 4ZZIA 4XJSA 1SD5A 1EFPB 3OX1A 2HSWA 3AU8A 1KRWA 1H0SA 4V1CI 2WQ6A 4BYGA 2OG1A 3KYCA 4BV8A 5I4IA 2ZUEA 1CF9A 1SVWA 3DMTA 1DS6A 3JRWA 1X1RA 1AJEA 4ZAXA 1JU4A 2XNDA 4RVCA 3E61A 4C4XA 2ATXA 2C9DA 3GAFA 1DEXA 1D9XA 2RH9B 2VJMB 3PNMA 4JMPA 4MQLA 4PWYA 4ZAVA 4C4TA 1NP7A 3WVNA 1GNRA 2X8AA 5C5EA 1PX2A 1O94C 1GKYA 1XDZA 5JZMA 2JGIA 3ZJVA 1ZR2A 5HDQA 3QKSA 4IHAA 5J3JA 4HEA1 1OFHA 1MHPA 3TDNA 1EX1A 4DRXB 1G8MA 1HX7A 2CXTA 3ONEA 5IJWA 1MPTA 2PH3A 5ENDA 3P71T 3OF5A 4N76A 2DFVA 3ESDA 3R0ZA 1SQGA 3KX2A 1GSIA 2QXTA 4V1CB 4JP5A 1C1XB 1C4OA 1DIOB 4CN8A 4DSNA 2DFKB 4A0HA 4RCVA 1GU7A 3SHFA 4UEJA 1N34B 3GRZA 4L8FA 2JIZD 2DR2A 3I83A 3FZNA 1FA9A 4JELA 4EITA 4NCIA 2J0UB 2VHCA 5LQNA 3ULKA 2W6OA 3S28A 2GPAA 4GZ3A 2X1HA 1GZ3A 2DHEA 3KDSE 3LCRA 3R3VA 4F8EA 4H7DA 4OMDA 4Q12A 4ADSG 1HLFA 2XPCA 3EZYA 4FMCB 4B6RA 1KH1A 4J0EA 1TVEA 1S4QA 4G09A 3PWZA 4HKTA 4LCBA 4LNHA 2XDAA 1B76A 5CW1A 2JCXA 3RC7A 4X20A 2HH9A 3PEWA 5U9CA 3QWHA 3BCRA 4YASA 5LP6F 2MSEB 2GILA 3GEDA 3TQFA 4JI0B 3B9QA 5HOEA 4TKUA 1KL7A 1ZCFA 2AD1A 2OM2A 1G7TA 4ZI3A 4JOSA 3ID6C 3JR7A 1NAIA 1WTCA 1KY5A 3GLSA 2I3ZA 5BQPA 4RV5A 1Z4MA 2E4VA 3KQPA 5AXDA 5K3BA 1TUIA 4HGYA 2FTKE 5JV5A 5LNK6 3H7IA 4D9HA 2J45A 2E4ZA 5AKZA 3OCJA 3KB2A 1C4KA 3CJTA 3KQYA 4MVYA 1PD0A 1HQDA 4UEOA 4HC4A 4H77A 3ZVMA 3VPHA 2ESRA 4O25A 4PU0A 1GR0A 3WLJA 1YT5A 1IMOA 5H4GA 1QSGA 2WZQA 3O9MA 4ZKDA 3GLHB 2FP4A 1VTKA 2CUZA 1JQBA 3AHIA 3AI3A 3Q3GE 6YASA 4NU5A 4UBMA 4NMMA 5F7JA 1L7OA 1M2OA 3W04A 4M83A 3NVKI 3K0BA 3EFEA 3LO8A 3E23A 1ACJA 2IUFA 4GX5A 4DWWA 2XQKA 1U1DA 1N5LA 2JIRA 4M9ZA 2YQ5A 1MR3F 4D8XA 4DLZA 1AD2A 3ODPA 4ZRDA 3UT5B 1R6VA 2UYQA 4WE3A 3VNVA 2IZ5A 2PSDA 3FFTA 4QDUA 5JSKA 2UUAB 3TF5A 1QM5A 3DZHA 1AKWA 3NHYA 4OGFA 3TE7A 2UXDB 1JHAA 1X92A 5DN6A 2VPIA 3D7NA 3I6MA 3S29A 3AX6A 2W42A 1QIJA 4ZV7A 2IYEA 1ZU5A 3KQWA 4C0JA 1B6GA 4ZC1A 5B3JC 4F2HA 2HDHA 1UJ6A 1GGKA 4I9FA 1YJCA 1WMEA 3OQBA 1XNGA 1YFLA 3WIDA 1OBFO 3TLJA 2PZKA 1AK9A 2QVLA 2ZE8A 4C20A 5J2UF 3HXQA 3FFWA 5I9LA 2IYZA 5BURA 3QX3A 2RGDA 1WSWA 3EEYA 5CB4B 3F74A 3A9UA 1H2FA 2XQGA 3SF8B 3WHLA 3HFGA 2YFQA 2GBFA 2HO4A 2WF8A 2P7HA 4RABA 3SICE 3BMCB 1P2VA 4RPLA 2W8BB 4YRNA 4QU5A 5FTNA 3UC5A 4XQGA 5P21A 5C46F 3SIPA 1KIMA 4HEHA 3ESXA 1YUNA 2ZYTX 2HF2A 4MS3B 2RBEA 1DAHA 5EQJB 3EEIA 3RC8A 2NVWA 2ERXA 3LPAA 1O03A 3GCGA 4QDZA 3EIEA 3MGKA 4R51A 5CPFA 1L3BA 5JJ5A 2O8EA 1U2GA 4NPAA 4EEKA 2Q9UA 4G5HA 3WL5A 3TJZA 3LUCA 2QLNA 3CZCA 3ZI4A 3GQVA 4QQ8A 2BGJA 2X40A 5EE1A 3UA3A 2BDTA 4NESA 1TM2A 1UPTA 4G24A 4N3BA 2C84A 4UXHA 4YQEA 2I4OA 2B94A 4WRRA 4CE6A 3ND5A 4K9RA 2UUCB 4TUYF 5GJVC 2BGKA 2WTMA 2G6TA 1L5MA 2C2ZA 2RGUA 4OSEA 1M83A 4U6NA 1Y5IA 1ZBDA 1VLVA 2QR5A 1CS0B 4HYYA 1L4KA 4X8MA 1J9ZA 2R6HA 2HCBA 3DMTC 3S8YA 1NYQA 1EVZA 1JSZA 2Y0DA 3KFVA 4KHZA 2YNMA 3QMMA 2IU0A 4C7VA 2P2YA 1Q7CA 1NW5A 2HFJA 1WCXA 1OPRA 3P5BA 5TMDA 2Q5EA 2CLEB 5JAQA 2WOOA 3NIBA 5JH7B 4LOJA 2O05A 2QRVB 4GPZA 5HZMA 2C1ZA 2OEPA 2RKOA 1IHDA 5AJZA 1L1RA 1DBIA 3HU3A 5A04A 2IS4A 2CJPA 1F20A 1FP1D 1NZFA 2PFGA 2YWDA 3L7LA 3WWYA 4B3BA 5HTOA 3D7MA 3IHLA 1UBGA 4GM0A 4ZCMA 4F92B 2ZE7A 3G7SA 4EJ0A 1OTHA 4HMOA 2IEGA 3KDAA 3NXKA 1SHLA 4MWOA 2EGGA 5IC5A 4OAOA 1IULA 3L8GA 5ALMA 1UODA 3NV9A 4ND3A 4HNUA 3T1QA 1R9MA 1XWWA 2IYXA 3B20A 1ENOA 1UM9A 4O4LA 3DC7A 2RK6A 5B58T 1H65A 5JS8A 4MQEB 2WYHA 4DABA 2PL9A 1FE8A 1JR3E 1NU6A 1I4EB 1TEHA 1U94A 2RK3A 3BHIA 1IUPA 1MTZA 1CPYA 3IO3A 5G0SA 1X80A 2HCJB 5J5AA 4KR9A 4BZPA 1ZH2A 2OWDA 1F8GA 2EFYA 2PY6A 2Z4TA 3IAUA 3F5QA 4OFWA 5SZJA 3RSQA 3K1JA 2WWXA 1MC8A 2HT6A 4M76B 4UE6A 4C6SA 1AUXA 1ZAKA 3IEVA 1GRCA 4HQKA 2CHVA 5E6RA 5F2KA 5JCOA 1E1DA 3H6KA 5BRNA 4B31A 2XUOA 1OZHA 5KOIA 3EVNA 1TKRA 4G89A 2OGWA 2N42A 1EX9A 4U2EA 4IF4A 2BHSA 1PG0A 2FYTA 4FP9A 2FEWB 4L51A 1RXWA 4L3OA 1KSHA 5DTJA 1VSBA 1Z08A 3O83A 4BMOB 1RYZA 3E1SA 3NM5A 5L4NA 4JKYA 4AP9A 2C77A 5GY7A 1KZGB 4MV9A 4DA6A 1IDOA 1R0YA 1WB4A 4MEAA 2UXBB 4BCBA 1DG3A 4GPD1 5CU7A 1ZOLA 3UXMA 1AF4A 3RTCA 2VK1A 1GQYA 3G1WA 3HBJA 4EG5A 1Y1QA 5J2TF 5B1IA 2DWUA 1CZKA 4YACA 4FZ3A 1BROA 4FI3C 1E7MA 1P2UA 1EFTA 1YR8A 1UP6A 1XEFA 3AH8A 3EDRA 3EEFA 1ODTC 3NC0C 3Q6NA 2RK4A 3RVSA 3CY6A 2O2YA 4IZ6A 4HNHA 2NZVG 4PC7A 1UH5A 2VDKB 3O4RA 5GGYA 3E2IA 2VCHA 4ZOBA 5TT0A 3WGMA 1FQOA 5CFZA 1V47A 2C5BA 4UZSA 5CJ2A 1N2CA 1IFXA 1RJ9A 4PNPA 4A2QA 2ZBGA 4ARAA 1IIRA 1Z2AA 2OZLB 1KSJA 3FNHA 2VKQA 4R54A 4UASA 4CMKA 4UQLA 2B4QA 2BBSA 2P7IA 1EFVA 1VE6A 2G0TA 1G4HA 3WKAA 1RKBA 2MSCB 4H31A 3PC4A 3D1JA 1O94A 3D5TA 3RC1A 4E70A 1JG1A 2HIMA 1F4LA 4WCFB 1V4VA 4ABTA 1FQKA 4QXQA 1L8QA 2GMWA 3DUFB 3PRJA 4GICA 4ZYWA 3GLGA 1U7ZA 4WLVA 2OZKA 3CVJA 3EXFB 4ZJYA 4TYNA 3FDZB 2Z6UA 5AM3A 2ZUUA 2JZCA 3JQAA 3I64A 2NO9A 2OWEA 4RKEA 2IWRA 4DZTA 1KGSA 1Y89A 1HPLA 5DX0A 1MBZA 1A98A 4DV1B 1OU0A 2A58A 2OBXA 2ID7A 3U3XA 3U56A 2LPMA 2HADA 4H7IA 5D7BA 4QNMA 2HU5A 3CJRA 1JQKA 4W9RA 2P9QA 4TXLA 2X14A 5ARBA 2IDJA 3AYZB 4IEEA 1LBTA 1NW7A 2EP8A 3RJ9A 1NLMA 4PSCA 1ODLA 2J32A 4BQEA 2EP5A 4L27A 2ZIAA 5DOZA 4EQ6A 3OOEA 3OP4A 3KAQA 2PMKA 2VK8A 1L1FA 1CUEA 4QQFA 1YMUA 2P0AA 3MCZA 4DNOA 3HJFA 1MX3A 3ZY6A 3ZWWA 4ER5A 1VXRA 4I8XA 4BKPA 2VXYA 1E9AA 5THQA 1JPVA 1P39A 4OKSA 3V7YA 3IKTA 1YKGA 1D2EA 1NW8A 2G1JA 2IOHA 3A6EA 5JRJA 1AE1A 4MWCA 1V4NA 1NNSA 2OLEA 4FD2A 3UN1A 4KO3S 4DLTA 1OAOA 1R0RE 3OQIA 5K01A 4AQYB 5JALA 3COZA 4RDIA 2YOHA 5CFRA 4CM7A 2YJNA 1ILEA 1TC2A 3K0AA 1YFZA 3AOGA 1NF9A 3A27A 3DM9B 4PS0A 3IIIA 2AZXA 4F2WA 2B7CA 3T1YB 1DXQA 3EXEB 1T5LA 3F97A 4KE9A 5C1IA 3SZOA 4JLVA 5I7WA 2ZSFA 2QTMA 3P9PA 4DLLA 5T67A 4N5MA 5JT1A 3LU1A 5C52B 3QBVA 3TLYA 4C4OA 1GA1A 3FI0A 5FLYA 1QE0A 3VNQA 3WG9A 4Q3EA 1Y6FA 4J9VA 3VYWA 1QK4A 4P0TA 5DCUA 3OIGA 3KJEA 4R05A 3GGGA 5BN4A 2B0CA 4E4TA 3GJ5A 3WISA 3WX0A 4Y9SA 5TMEA 5CLHA 3T9FA 1R6UA 1RXEA 5DX8A 3DE0X 3Q87B 4RMNA 4D5GA 4BNIA 3K0KA 1Q22A 4ZI7F 3P4UA 3JQAB 2IFTA 4RXUA 5L4LA 5HKAA 1GTRA 3LCVB 2XSZD 1JR6A 3M4ZA 2I1WA 1DOAA 4QQRA 1PR5A 4X61A 1PIWA 1R4NA 3QPWA 4UAVA 5BMVB 4CF7A 2VT2A 1I4LD 3B1VA 4KPUB 1TF5A 2R8RA 3QE0A 3ESBA 4QFCA 4NK4A 1XVLA 4YUXA 4EHHA 2GAAA 3QVKA 4MVJM 2C9ZA 4P3NA 1HDZA 1KIFA 3AVUA 3WLPA 3A1VA 3R76A 4HDRA 2PUDA 3QFRA 5I01A 5JZBA 3ZZUA 3VJMA 4JJIA 3PPXA 3D0OA 3C7CB 4RCYA 4JU9A 3RB8A 1KI6B 3V80A 1NFQA 2I99A 2VHTA 3EXIB 3R6LA 4HGOA 1ZDMA 3Q3HA 1CDOA 4OQ4A 3TOVA 4BO6A 2YHAA 4TLMB 3HA7A 5F1PA 3REQA 3AB7A 3HR4A 4W63A 4BZZA 1D5CA 4EFDA 1NZJA 1HGXA 3JWIA 1MNAA 3OEWA 5DYWA 3F5SA 1DKQA 3HZHA 4V0ME 5AVWA 2XOKA 3LVRE 4EJSC 2JA1A 1MIOA 2LUOA 4FMBB 4MYCA 3D6NB 4LJ5A 3Q5GA 4Y8VA 4IKOA 1G8PA 4R9SA 4AUNA 1WXFA 1Z62A 2JEOA 4HAZA 4M9SA 2CNNA 3PXAA 4GYWA 3EPLA 3BKWA 4X85A 5JCXA 2ACVA 2Q2VA 3MXTA 3L92A 1LRKA 4MKIA 1IXSB 5EP1A 3R7NA 1AA6A 3ZGZA 2HHAA 4ZCIA 1E79D 4H6VA 4NIMA 2BGNA 3ZVNA 3ITEA 1RKUA 4FWTA 1JLRA 1UDWA 1WLSA 3JQBA 5CGQB 1S3IA 2P3LA 1XJWA 3ABOB 3WIVA 1XRMA 1T0UA 3C6KA 3EC7A 3KUUA 3ORSA 2HR1A 4C3OB 3PGLA 1X7WA 4LHVA 1OYWA 2VDOB 4J4HA 1UAGA 1Q1AA 4EG3A 4O4IB 1Q0HA 1AUVA 1UANA 1T8YA 1RQ2A 1WMDA 5KOJB 5KWEA 5A4AA 3SBEA 2GYYA 5E4FA 1JEYB 3ZW9A 5AHRA 1NXOA 3MLEA 5HIAA 5K05A 5FNVA 2I80A 4J07A 5AJHA 1S4MA 3QU4A 4Z9YA 5K1ZA 1ECFA 2H1VA 4MVXA 4TTPA 1OB2A 1Y9ZA 3TVTA 1K7FB 4GLJA 1M5RA 1SKUA 4L9RA 3I9V1 2QPTA 2L19A 1DAFA 5EERA 2YC4C 3KZVA 2Z9DA 5FBLB 4EY3A 4OQQA 2QZ9A 3WGZA 4Q7KA 4FNAA 4ZVUA 2AZDA 2PRSA 4HDNA 4IRMA 1W59A 3DAPA 4IZIA 4NV3A 1YAHA 1ZJ5A 4WBXC 5DMHA 5BSKA 3IEMA 1TEZA 2FH5B 3R2JA 2O5CA 2X5JO 4ZDKA 3KUDA 5LOVF 4RLFA 3OCYA 1FQJA 3FWHA 3IT2A 4MRRA 3OZDA 1ZITA 3ET4A 4M0DA 4YECA 2JIZA 3T3MB 4ETMA 3U7GA 1YNOA 3FZYA 4RFSA 3HDGA 3WLAA 1GR1A 4Q47A 2BLNA 4JBNA 4JCCA 3QVVA 1VCOA 5IZ4A 1P6QA 3AQ4A 4YQYA 1TYCA 3R0JA 1BDHA 3B53X 1C41A 2WVHA 3Q8WA 2E7ZA 4PO9A 3DWEX 1DC7A 5CH5A 1A5BB 4REMA 1ZQ1A 4WBNA 5BPFA 1UDCA 1QE5A 2ADOA 3P45A 2XMPA 3ZHXA 5I7AA 2HLPA 3TLGA 1QAMA 1XQVA 3AUAA 4KFCA 2CGEA 4ZCLA 4ETNA 1E77A 1HE5A 2PMCA 3EIOA 2DT5A 2V9CA 1UKEA 4OB6A 4A82A 1YQUA 2JAOA 4QDTA 3RLIA 4BP9A 4D8VA 4LF9B 2DQKA 1M8GA 2VZ0A 1ZKMA 3HCPA 3OUTA 1GT91 2VSXA 3PHJA 4DIFA 3NAZA 1LC3A 3T1HB 3QF4A 4YPVA 1U0HC 4PZCA 2UXCB 1QF9A 4URWR 2QVBA 1FNBA 3HZOA 3TPCA 3KSAC 3RUCA 5HJ7A 4JI7B 1Z25A 4EVIA 1P0MA 4Y9UA 5F21A 2DBQA 3NDRA 3I2KA 1YDMA 1E3EA 4XX1A 4RPCA 3KQMA 5TF4A 3R7WA 3PI6A 2ZRHA 4M55A 4OP2A 3TSCA 4HWRA 3D7SA 2O57A 1E1QA 1US8A 1CR2A 1U5CA 1X7XA 4AJEA 2LKDA 4RZSA 4BHTA 3J7AC 1H8HD 4HLDA 1Z7WA 4N5IX 3I01A 5DB4A 3HA5A 4DLXA 2Q5IA 3P19A 3P2YA 1GKIA 1THMA 4CQLA 4GKKB 3P0FA 1JBKA 1H0RA 1GPYA 2EFDB 4R9NA 4RD1A 1E2BA 1WX1A 4GPIB 2C92A 2Q4EA 4QX6A 2FEAA 3A4YA 3QKRB 1YL5A 3R5HA 4YFVA 3KPJA 3ZIAD 4RHUA 3M83A 1N7JA 3GDWA 3U4MA 3Q7SA 1V8OA 2A5FA 4DV7B 1K5PA 3K6RA 4DR6B 1CY7A 1VQ1A 1GPDG 2IOFA 2WWRA 3FYCA 4N03A 1TQDA 1DWQA 4I66A 3VO2A 2IXFA 1WV1A 3N8HA 2P5UA 4AJPA 1DBPA 2FN7A 1E6CA 1MDBA 2FGKA 2ZOSA 5BYBA 2A1TR 3KKKA 2JAPA 2IYQA 5TS3A 2OC4A 1RBMA 4CETA 1RWKA 4CN9A 3BZWA 1YVUA 4ZA2A 3RS9A 1Y7PA 1TYEB 2WWWA 2GOYA 5ALUA 1BEEA 3TD9A 3VH1A 3CSDA 1JHXA 1OFUX 3V8VA 1P3DA 2ZRBA 4IJKA 2X8LA 1CZLA 4QYIA 3PIRA 3NHLA 2AR9A 4PS1A 1ZOSA 2DWOA 2QP3A 5AICA 4Y7DA 2R65A 1IVYA 2IH5A 1E1YA 1XCOA 4KRFA 1USKA 1W44A 4CMCA 3ER8A 4M0PA 1MZVA 3ND9A 1BDMA 2JPDA 2R8OA 3AV3A 3CPJB 1P75A 3PLAE 2C82A 2NT4A 1KI9A 3GB9A 1NPYA 2ZIVB 4JA0A 1K8XB 4LRXA 4Q4DA 5HRCA 3UWOA 1GUBA 4MGYR 4P4LA 2AJDA 3O2JA 4HAIA 2WTBA 5IAGA 3UV7A 1K2VN 1RFLA 4WJKB 1PDVA 2ZUDA 3QKWA 4I6JA 3BHNA 5FPQA 3V1NA 4K6GA 1IEVA 2GKSA 1R5BA 2XMDA 4TYQA 1U0EA 3WMFA 2QRKA 2VQFB 2C59A 5CDHA 2DWCA 1FF9A 1G2IA 1XP5A 4U6QA 4X95A 2EKPA 3AONB 3LNTA 2CUKA 2PYZA 3I9KA 4W1RA 3THYB 3BREA 2IYRA 2VAVA 3LC1O 2BRUC 3HNRA 1QIMA 4LWOA 3JWHA 2QNBA 3H65A 3R41A 1QCYA 5ELLA 1NV8A 3HJCA 2VPTA 4TL8A 5F5LA 4BN0A 4B3RB 1Y9EA 3FCEA 1US8B 1VG1A 2P2SA 4LVOA 3V4SA 3VR3D 2PJZA 1M0EA 1VFPA 1DAEA 1EGVB 1SQ0A 4YO8A 4F3YA 1A77A 1R88A 3DDCA 2IIQA 2ZB2A 3G17A 4DWVA 4EJ6A 1SK8A 1EWVA 4JI6B 2PSFA 1ODSA 1UFRA 2H51A 3WTBA 5IKMA 2I91A 1JGTA 2H06A 4EF5A 3HS3A 2H2FA 2GPYA 3MCTA 3PGA1 5CDSA 1QZXA 2BJWA 1NXSA 2ZJ3A 2E4UA 5CB8A 2CZCA 4IDEA 1E61A 4Z4IA 4N18A 4KWCA 3KLNA 1AX9A 3UH0A 4BKMA 1ZH4A 3E9EA 2H7VA 1VKZA 3M3HA 4TTIA 2BFPA 2VSOA 3N2IA 4HGZA 2A0YA 2LIVA 4JVNA 3A26A 1JAHA 4I4NA 1P9LA 3I4FA 5FI3A 4JC5A 5LZ8A 3AVVA 4C4SA 3NLLA 4NOLA 1PO7A 4G97A 3PPVA 5FUYA 2XOKD 4AJ4A 3QJ5A 5I48A 2FPXA 5FX2A 2ZSEA 2PS9A 3Q0EA 1PTJA 2G5GX 3ZTWA 4YI5A 1JLLA 3GFFA 4RTMA 3UM9A 2BR3A 1J42A 1KBZA 4YUWA 2QTAA 1P17A 1CUHA 1WSBA 1ZEMA 3BQNB 1G64A 1ZRMA 3ILHA 3GN2A 3NW9A 2CVPA 1NUUA 1T5HX 721PA 4RNDB 1B8NA 4QHSA 2HPZA 4GMXA 4J76A 1JHQA 1K98A 5JOQA 4WEOA 2MSDB 4ZHQF 2W7TA 3UF0A 1J20A 2VT3A 2XVZA 3INTA 3IQGX 4IXDA 1SKBA 4XX0A 4R1LA 5C8ZA 4NFLA 4TTRA 1AH2A 3KQOA 3K7EA 4RORA 1G1AA 1RCFA 2FU5C 3Q3CA 1ZH6A 2WPDA 4I1OA 3T4EA 4AYTA 5A9RA 4QG3A 4LOHA 1KEPA 5BVGA 1GCOA 1N2ZA 1NBMA 3CZ9A 1RWPA 3WLEA 4BMYA 3U7FB 4GP7A 5FWNA 3AF1A 1H8EA 4D8UA 1NN3A 1XU7A 2BFCA 3T3IA 1YU6A 4I2VA 4ZOCA 4LY6A 3A06A 3VPDA 2Y9MB 4NLLA 5BRJA 1T0IA 2XUDA 1LTKA 2NO4A 1CIVA 2ZRCA 3IMGA 4YV2A 3TNDA 5TXGA 2CXQA 5B2FA 4KPYA 2HU2A 1UK7A 4XE5A 5U1PA 3VDMA 4EBFA 3BHMA 3CUKA 2PUBA 3GLTA 1P9NA 2B37A 2YDYA 3NRJA 1GKKA 4JA2A 3A3NA 3H18A 3BH7A 3P9XA 1BMDA 4A6DA 5DNUA 4J43A 4U3JA 5C8YF 4DT1B 4W8GA 5LZ5A 3OFND 3UUGA 1HL7A 3BZUA 3DE5X 4F96A 2R8YA 3HB4X 1JP7A 3QOYA 4GXQA 4IQ0A 3JPWA 4NYMQ 4QKQA 5K0CA 4EP1A 1WHTB 2D0PB 1PDOA 2QD1A 4V38A 4N47A 3FZGA 3L7OA 2X19A 3QENA 3L77A 5AK3A 3UFXB 4EQZA 1J5PA 1T29A 3VOSA 3FCCA 3F8WA 4X1OA 4RHXA 1FLNA 1N2CB 4JEUA 1E89A 2WIFA 2XMSA 1Q1EA 1YHZA 1J8VA 1JFRA 1V1MA 1QZ3A 4EHFA 4DGQA 3BD8A 3KKEA 2OB1A 2ABWA 8OHMA 3R9XB 2FRDC 3KUXA 2PCJA 4B83A 3CVUA 3WY9A 5E8JA 3OZXA 5DEIA 1NR7A 5JMPA 5CA1F 2QVGA 4RKQA 4DLKA 3EQ6A 3KT0A 3L6CA 2AJ8A 5FYQA 1PYOA 2AZMA 2I4MA 4OL9A 3IH5A 2IJGX 4H3HB 1ZM4A 2G63A 4IYRA 5GOTA 1E5TA 1EK5A 3K1ZA 1NAHA 2WUDA 3EMDA 3KEGA 1ZL0A 4TGLA 5FOUA 4XOUA 3FNQA 3F3KA 2JANA 1R5NA 4M1EA 1X0VA 2GHIA 2J5QA 3MWFA 5ULLA 4DS3A 3TM5A 5LD2B 1VIYA 1K8QA 1P2DA 4N12A 3MOIA 4E12A 2A9JA 5FPKA 1T8UA 2G9ZA 1PVVA 2XGGA 4AS1A 5ENVA 3NBZC 4GPAA 4PRKA 1YDWA 3UAOA 3SVTA 5LQSA 3AERA 2I2BA 1XYGA 2PSEA 1GARA 5EZSA 3ZLTA 2Q3MA 2DPHA 3E3NA 3JRXA 2DFPA 2ZUWA 3GBSA 2JI8A 1EFHA 3FCUB 3UW1A 3JXEA 3W2TA 1BE8A 2IF2A 2ISSD 1V9LA 2OXRA 4XLLA 4I5FA 4HAYA 4PLVA 3MW8A 1MB2A 4OI2A 1O9GA 1U0BB 2XUFA 4BATA 3PRYA 4ND7A 2KS6A 1UC9A 1QR2A 4IXWA 2F64A 1VECA 4XGIA 5KMGA 3ADCA 3VR3A 1XRJA 1V8FA 3OBBA 3QW4B 5ETJA 3QIAA 4V0LA 2IP1A 4LDZA 2XYVA 5LVAA 4EJFA 5HVNA 2Z6QA 4YMWA 4PONA 3QWFA 4FT4A 4QBTA 1GL3A 1IBKB 2VH1A 3DP7A 4DCJA 3ZDRA 1Q11A 1JRLA 1VLZA 4R41A 4N54A 1N5MA 4RJJA 5FPSA 2O3UA 4HRYA 3P0EA 2F1RA 4GLBA 1OGIA 3TW8A 4Q7LA 1AS2A 5DYGA 1OROA 3EHEA 5D85A 4XQ0A 5B7QA 5ESDA 4YYEA 3V34A 3CKLA 3Q9SA 1G7CA 2XWJI 3R3YA 4M87A 1SRQA 1E69A 2HMYB 3WLKX 1O0BA 4CCYB 1I36A 2NOAA 4JQYA 221PA 4RZQA 3RYCB 4U7TB 1Z33A 1P19A 2HF8A 3TGLA 4NYJQ 2J3HA 1USGA 5TGTA 3CNBA 1YIOA 4Q15A 4ZRNA 2NTEA 1XVUA 1MTOA 4Q03A 2QZ4A 4Y18A 2P9BA 2PQ0A 4JJFA 5DM2A 1GFSA 4H35A 3JQRA 5EJAA 2QPAA 3UYKA 1JPNA 1XMPA 3JQ9C 2O2HA 4RH1A 5ARDA 4BL5A 2PX2A 1N2GA 1ODCA 5L7WA 3U2QA 4D0RA 3P0JA 5JBQA 2FMFA 1BC5A 5HGXA 1KRHA 5FOWA 2O19A 2QUIA 5ER9A 2ST1A 2VJKA 4QLBA 4QATA 3W5DA 3BA1A 4BKQA 2GXQA 2I6UA 3FOEC 1AGXA 2Y1WA 1BGWA 4UHDA 2V59A 3CR8A 5TY0A 3QHQA 4UXIA 4C06A 1H6BA 5F23A 4WESB 2OCDA 1GV0A 5I9TA 5FBQB 3RSHA 1F38A 4Y2SA 5CIYA 3RYHA 5AIAA 5LSAA 2R87A 1CS4C 2VDUE 5E2IA 5T6BA 1UBUS 2V7QA 1M8JA 3A8TA 4WOPA 4ND6A 5AWFC 4KAFA 3TZHA 1XA0A 1Z28A 4BB5A 3N53A 2JGMA 2YKGA 1I1HA 1NX9A 1TVMA 2VWGA 1A8QA 1YBVA 1YRQA 4HQNA 2O3JA 4UTXA 2VSFA 1FDUA 3K2EA 1Q3HA 3NWPA 4BBPA 3DQPA 1FFWA 5DNCA 1UK9A 2O0HA 2XWSA 3R24A 1ZC3A 3BB1A 3NDJA 2AFHA 3RREA 4PHGA 4F4IA 2IBSA 2BRUA 2EQBA 1QIGA 4HN2A 4KN6A 3ABIA 1RYFA 1XMXA 3NANA 2AK2A 4M1ZA 1ZMTA 2TECE 7AT1A 3RKRA 1U80A 1GKUB 1ZCAA 3PPYA 2BUBA 1MW8X 2W6JA 2GFIA 1RVDA 1VHDA 3TOXA 1K4YA 2VFAA 4M7OA 5JHHB 4QBKA 2HIHA 5KO2A 3FFXA 2V9PA 2GZ2A 2GNPA 5HFAA 4RH3A 1OYYA 4CR6A 1A4RA 3KJNA 2OCGA 3RASA 2QRQA 2A9OA 4WDRA 1RDFA 4FFSA 1NLZA 4IY1A 1G5RA 2ZJ2A 4RJKA 3X44A 4V0QA 3C48A 3SBXA 4G26A 4ZMBA 1ZOOA 1U3UA 4EGSA 3QU2A 2B99A 1OFVA 1V25A 1KH2A 2A5GA 2Q49A 1ZNQO 2ZI6A 5HWSA 2OK7A 1MCZA 3CNOA 3D0QA 1AKMA 1E6KA 4Q66C 1NN0A 2C7BA 2QMQA 2RMKA 4CEIA 5K3AA 1BHSA 4J3JA 4TTAA 1D07A 1ZW6A 1USIA 2PBZA 1WPXA 1PNVA 1ZU4A 2GVZC 4B9EA 3DJYA 1NHWA 3GCXA 3LQFA 1D04A 1QVRA 3DP9A 5FOXA 4QLAA 1YB1A 5HIKA 4G1BA 2BGMA 2C5HA 2MSLA 2W48A 3PXEA 3ODGA 4F2PA 2PCLA 3LY5A 5FWYA 1CQJA 4MYHA 1YC2A 3REQB 3WNCA 3NTUA 4DNFA 1BHQ1 1PJLA 4I0WB 5CBPA 3HVRA 1XKTA 3FBGA 4XLTA 2R3SA 3F49S 3PT5A 1DAPA 2BCGY 4M36A 3RBXA 3IHKA 1XELA 5K4GA 2C29D 5TQ0B 4TT3D 2GJSA 4C08A 4AZTA 5HNKA 1YRLA 4I46A 1FRNA 4DZZA 4D3FA 4V2IA 1MN6A 1NP6A 5BP7A 2O2EA 3ZDQA 4CEIB 2HK9A 2J3IA 4M8IA 2NNLD 2ZBUA 1MRZA 1S3FA 3FE2A 3OZBA 3M6XA 5A6SA 1MX9A 1UDBA 1UBEA 2XOXA 3EGXA 3MWLA 3F9CA 3QKUA 4KQWA 3W34A 3OKCA 4MUMA 4YMTA 4YR7A 5ABPA 4D9GA 2VDWA 2I3GA 4LWQA 3WDKA 4BWVA 5FH9A 1E2EA 2B3DA 1JXMA 2ZVDA 2FLWA 4QXAA 4LFAB 2FG5A 2MYPA 2JCVA 3EXG1 3BGSA 3HBFA 2I03A 1KQFA 1PV2A 4R84A 1A3CA 2CZGA 4NBSA 1WD7A 1MNQA 3S1LA 4V39A 2IHYA 4WACA 3B51X 1P6XA 3N8GA 4UPVA 5D5QA 3AFNA 4PANA 3O8CA 4LDJA 1G5HA 2NN3C 1HE8B 1Z6GA 521PA 2WWTA 3VDNB 1MJGA 4URYR 5EZ6B 1XZLA 1FTQA 1NLUA 5BVHB 3KFXA 3R6DA 1DQYA 4UARA 4DA0A 4IUCS 5CHYA 1T3TA 3P0HA 4K9LA 4ERNA 4EW1A 3VVMA 5DYTA 2ZRJA 5EIWA 4MB2A 2C7PA 3Q5DA 1NWHA 2YJ5A 3FYUC 3WIUA 4E5YA 3OJEA 2O52A 5TR9A 4BQQA 3IAAA 2AV6A 5CX1A 3ZXYA 4XFDA 2Q6LA 4YV7A 5I8PA 1UBSB 3ELYA 4RANA 2PJRA 4YJ2A 1I2BA 3TBKA 2ZAOA 1GTMA 1JIIA 1NE7A 2X13A 1RLJA 4A6PA 3ZWQA 1XN4A 2J85A 3CGWA 2I7TA 5EINA 1R8JA 2V7XA 1RRVA 2DRIA 3A2MA 3D3JA 4G25A 2WSSD 2XQFA 1AK2A 1ZIOA 3BTVA 2Z3VA 4LC9A 3WL4A 5C51B 2MINB 3IT3A 4RHTA 1PFKA 1C7ZA 3UH1A 3WBBA 2IY7A 2AFVA 2JGEA 5DLDA 1HT1E 2X23A 2AFRA 2R8ZA 1E4OA 3OCUA 4KQ2A 3FHLA 1B73A 2YWJA 1XAIA 4FGWA 4DEYA 2HQOA 3R7DA 1AO0A 3LZ6A 3D54D 3OY7A 1L7BA 1V6AA 3PRKE 4G5GA 1P9RA 4WCVA 5BN5B 3RTAA 4AICA 4EHAA 2ZTHA 1Q16A 1GO2A 1F0NA 1YR7A 2C4TA 3MMXA 3C7AA 3DL7A 4XPIA 1YI0A 3OT1B 4M1QA 1DTEA 4JOCA 5BYJA 3SXUA 1VPEA 2JBAB 3T4UA 3UWSA 4PYIA 4CIYA 1BKDR 3TLGB 1Q7RA 4DDHA 1NN5A 3EZGA 3HEMA 4AS3A 4DRZA 4B76A 3L9WA 3AR5A 2YIMA 1EFDN 2JF0A 4QPCA 3TYXA 3GLIE 2WSIA 4N5HX 3DBLB 3VO9A 3MYYA 1U3VA 4AJLA 2QX8A 2X1MA 3UAGA 4F84A 3D1VA 5B1HA 3BGDA 1MXFA 4PXSA 1C7EA 1PBTA 2FSPA 4FDLA 1K7EB 4YBZA 5EQTA 1DT3A 3GNQA 2I8LA 3A3OA 3HY6A 4K05A 4KXQA 4TLBA 4U00A 5TJ9A 2J7KA 3HUFA 3T12A 2J9ZB 1F14A 4EHIA 3FYDA 5B3JA 4HLUA 1LV8A 2AJCA 1IB6A 4I1IA 4YB8A 1JIVA 1Z7YA 2ZT7A 1YA4A 5M04A 4HQLA 3S7TA 4EYQA 3WL6A 5A9TA 3R7WB 4DVGA 3AXTA 3GUVA 4DR7B 1TUBB 2UV8A 1J8DA 5BQOA 2EG5A 3RRJA 1N8TA 1H3NA 4JOQA 1O3YA 2Q6IA 2XRFA 1QG4A 3QXJA 3B6MA 2H16A 1YBAA 1BN6A 3WE7A 1VL0A 4LWZA 1QHIA 2HA5A 1N2CE 2KE5A 5A9SB 4O0LA 5J47A 5DFAA 1QIDA 2RJOA 4QSMA 3TCKA 4LF4B 1TU0A 4GU5A 3RJMA 1MQSA 1SOUA 1XVVA 4EKYA 4DCSA 3MQ4A 4FZ5A 1EX7A 1DRKA 4Q39A 4RK4A 4X6YA 5LXTA 1YB6A 1NI4B 1TI7A 2IV3A 1QU2A 1N1MA 3G7UA 3W3ZB 4YJFB 2FMTA 3EK2A 2V0GA 2IUEA 2G08A 4TWZA 3MT8A 5CMLA 1ZI9A 2Q27A 3CEAA 1XJ0A 1NR1A 2MINA 3JAWB 3FNRA 4KYTA 2ZTVA 3VTKA 4QYSA 5JSUA 5BR8B 3Q8LA 1VLMA 2WY2D 1CQWA 5A6SB 1XYVA 2EX0A 2O5RA 3P9RA 4DCUA 5IDXA 1PNRA 3EFHA 1RM3A 1S1CA 1CVIA 2JGNA 5FEMA 4G0UA 3SC6A 3FHTA 4BZXA 3D8BA 5KYXB 2G83A 3B5IA 5DWQA 2H57A 2PG3A 3KQSA 2FW7A 3KT3A 4OKIA 1ZLXA 4JITA 5KREA 1KZ4A 2XLBA 4DJTA 4AUMA 3M4JA 4GOOD 4NBVA 1U6IA 2RGRA 4KLCA 2W6ID 1YVEI 1HI9A 3REFA 2JH3A 2O06A 2JD2A