1DKRA

Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
298
Chain Sequence
NLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRMNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
publication title Structural basis for the function of Bacillus subtilis phosphoribosyl-pyrophosphate synthetase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 97
structure length 298
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dkrA02
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dkrA01
3MJDA 1I5EA 2AEEA 1XZ8A 3LRTA 4QYIA 1BD3A 1OPRA 1QB8A 1HGXA 3M3HA 1IBSA 1ECFA 4X45A 1I14A 2PRZA 3H83A 4P3KA 1CJBA 4M0KA 1W30A 5KAMA 1R3UA 1QCDA 1ECBA 3LPNA 1AO0A 1ECCA 1QB7A 2JKYA 1MZVA 4JLSA 4P82A 5BRNA 3GGJA 5HKLA 1PZMA 2C4KA 1XTTA 3OHPA 1BD4A 4Z1OA 2XBUA 1UPFA 1GRVA 4LZNA 4RAQA 5KAPA 2H06A 3DAHA 3G6WA 1G2QA 3MBIA 1ZN8A 2VFAA 1BZYA 1A3CA 4P81A 5E38A 4ZFNA 4RQBA 1HMPA 1NULA 4RHYA 1DKUA 1A96A 4WN3A 2FXVA 2WNSA 1ECJA 4PAWA 4RHXA 1STOA 1I0IA 1XZNA 2E55A 4FYMA 1FSGA 4X44A 3OZFA 1A98A 1D6NA 1OROA 1U9YA 1P17A 4M0PA 4QYIB 1VCHA 1QK5A 3DEZA 3HVUA 5BSKA 2H08A 4WMLA 1QK4A 3ACBA 4RAOA 5BQPA 5JV5A 1DKRA 1U9ZA 1UFRA 1VSTA 4KN6A 4RHTA 1L1RA 4RANA 1I13A 1L1QA 1GPH1 3KB8A 4RV4A 1QK3A 2EHJA 1A4XA 3GEPA 5BQOA 5JSQA 4LYYA 4RADA 2H07A 1VDMA 2DY0A 1WD5A 1JLRA 1G2PA 4MB6A 1G9TA 4OHCA 4F8EA 1TC2A 1ZN7A 1P18A 2HCRA 3NAGA 5EUCA 1OREA 2JBHA 4IJQA 4P80A 3GGCA 1QCCA 4RQAA 1XTUA 4TWBA 4JITA 2JI4A 1V9SA 1ZN9A 1P19A 1A97A 1JLSA 4RHUA 4LZOA 3EFHA 1Z7GA 1TC1A 3N2LA 4LYGA 1I0LA 4P84A 4S2UA 4P86A 1O57A 3O7MA 4QRIA 1XTVA 5IPFA 5ESXA 1LH0A 1P4AA 2PS1A 1G9SA 1Y0BA 5IAOA 1J7JA 2PRYA 3DMPA 3QW4B 2P1ZA 4P83A 4RABA 3ACCA 1NONA 1DBRA 2YZKA 2JKZA 3OZGA 5HIAA 4M0UA 5K51A 4PFQA 4RACA 2IGBA 5ESWA 1A95A 2GEBA 4LZAA 3ACDA 3S5JA 1O5OA 1DQPA 1UPUA 1ECGA 1DQNA 1YFZA
chains in the Genus database with same CATH superfamily
4WSOA 4LHZA 2BGWA 2QTAA 1B2LA 4H1TA 3HFJA 4TYNA 3KAJA 3BGOS 5CMLA 1JHVA 3PHJA 2FNAA 4C78A 2WP0A 1N2ZA 4FLMA 2RAUA 1UXGA 4HQ0A 4KL8S 1HYEA 1UJ6A 4J29A 2QYSA 5HPYB 3WYCA 3WNZA 3PQ8A 4MV7A 4LF4B 1JA1A 1W4BA 1L5FA 3PPIA 2OGSA 4FHZA 4MVJE 4UHHA 2O2EA 5EJFA 5JY1A 1JQ3A 2HRBA 3LQYA 4QJBA 1RMYA 2FI1A 1FC0A 2P9ZA 3CU5A 4QYTA 5D3MA 3FD8A 4EKIA 2VYVD 4V2IA 4AXBA 3OA0A 3PQ2A 2ZJ1A 3GNTA 5JXGA 3HA2A 4KWEA 1A2OA 4RAQA 1IOZA 4OGGA 4U1RA 3H11A 4EYQA 5CB4F 3UMYA 3EIUA 1MHPA 3NV7A 1W8DA 4DLBA 2J0EA 2ECPA 1N2SA 4ZYUA 16PKA 4XIYA 4XB2A 3ZJ4A 2BZSA 2H54A 5DOVA 2JJ1D 1Y4SA 3FXAA 1UBTS 2JGDB 3ZCXA 1AQYA 2PNFA 4PVDA 1L4BA 1QRAA 1JVNA 2P4QA 3K96A 1XLTA 1DAHA 2OCDA 3A6HA 4I1VA 3BQNB 2J6CA 2O48X 1VC2A 1WDTA 3FWHA 3MCUA 2CCGA 1LBEA 2P5YA 3UHFA 4YH1A 5B3KA 4YY3B 1RJGA 1D3AA 4HXYA 1JXAA 4OAOA 4CIDA 4EI9A 2P7HA 5FPSA 1L6RA 2B2CA 1R27A 1CYDA 2FZLA 3FVRA 1Z28A 5ALFA 1YZVA 2KPOA 3A3YA 1XN4A 2FPXA 1BS9A 4BQFA 4CQMB 3TZHA 4B9AA 4R01A 3LOQA 4MR9A 4HWGA 4IZOA 5IW8A 3P9XA 5C37A 2XA9A 4J90A 5SICE 5C1OA 1R5NA 4G4GA 2DY0A 3VR5D 3GFSA 1EGAA 4F8EA 4N76A 1IQ0A 5ESRA 2Q4TA 1WB4A 5ARDA 1IG0A 1UBUS 4NFSA 5HMMA 4E4YA 4BUZA 3LC0A 1DU4A 3NTQA 1VKZA 3A6EA 2XMDA 4FMDF 4N41A 1WF3A 3NG1A 2RH9B 3G3EA 4MS3B 1UBHS 4YRTA 3C5EA 4C0XA 3GNLA 1TQ8A 2B8NA 3PCTA 4PNHA 3WLIA 5M29A 1EK2A 1JP7A 2YWDA 3MGBA 2HWKA 3F73A 1F9AA 1CZKA 2DOKA 3CPEA 3X1YA 5HKBA 1EEXB 3D6UA 1EE2A 2QJWA 1W9HA 4NBVA 5B57C 1N2IA 3QFHA 1H22A 1N6PA 4GF5A 1LSJA 1TU4A 2C9MA 4JU9A 1AUVA 4KQ9A 4ARBA 4F21A 4FK8A 4Z1MD 3K9FC 1R6TA 2KB0A 2HN9A 2ZJ8A 3FAKA 2R1UA 4M0MA 4YAWA 1YZGA 1G38A 1CQJA 2L19A 5KTMA 2O0KA 4JYZA 2GNPA 2J9XB 5DNUA 4U7GA 1QPGA 3HUTA 5EJ4A 3RADC 4B3HA 3BX1A 3L8YA 1NQUA 1LJ8A 1CIJA 4DR1B 4MYHA 4Z9BA 1ZUWA 2X7HA 2B5OA 3L7YA 2OM2A 3L8MA 4BAGA 3AY7A 3B3AA 1ZM3A 3T5AA 3OZDA 4CM5A 2A33A 2O2CA 4IHJB 3F47A 5DLYA 3DD1A 4EPWA 2CLLB 2HJWA 4X8MA 3O21A 1DQPA 3WNQA 5DYNA 3GIDA 5BOVA 3FKSA 4UTOA 4INPA 2O3SA 5JNRA 1Z63A 3CFYA 1ZD5A 2C2KA 3OCUA 1EDBA 2XBLA 4GOMD 3WNDA 3RWBA 3R8XA 3R74A 3EJWA 4DIBA 1NUTA 4G81A 4P1ZA 1LVGA 1PGNA 1S01A 1Y6RA 5T5QA 4ER5A 4M0KA 3U9SA 1NQAO 4NAVA 3VR6H 3IQXA 3HVKA 4LXTA 1QB7A 2C5SA 2EWWA 3KKOA 3PA8A 2YWEA 4GQBA 3T7SA 2V1UA 4XD7A 4QTUB 4KQXA 4RGYA 3NXSA 5C0OE 3RFUA 2VYCA 5C51B 1MT0A 1NXOA 3IIMA 4YJHB 3HJAA 4OB6A 3GLRA 3RC8A 3WK9A 1J20A 1S3GA 2GZRA 1Y8ZA 4KR6A 2WD7B 3D7LA 3DCNA 4Z86A 1BS2A 3O3OB 4Y6RA 4IG9A 4ZTBA 2JAUA 5K6RA 2O4UX 2XDQB 2VKQA 2GO1A 4TGLA 3H5RA 5HG0A 4AF7A 2W42A 1YDGA 3DZGA 1PJTA 1L5RA 1JLHA 3VU9B 5AD1A 1E2HA 1Z06A 4NK4A 2VJYA 2I91A 2BTOA 3KS9A 3DYIA 1IC6A 3O8LA 3WO1A 4KAXA 2HHAA 3HLKA 2E55A 3OX3A 1PZFA 2MIIA 5GZ6A 1W4LA 1RHMA 3QEMA 1AV7A 3N0WA 5KNCA 1D8AA 1VL6A 2F1JA 3WGGA 2FR8A 5FJJA 4EP1A 2EAUA 4WACA 2HIMA 1OZGA 3W5UA 2VJMB 4PC7A 5AW8A 2VDNB 4WECA 5COAA 1V3VA 2MDTA 5FKJA 3NTXA 3UMMA 1ZGHA 2H5LA 1WXIA 2B20A 4C7OA 4EHHA 3TLZA 1B0UA 3GFBA 4IDGA 3ZXUB 4AYWA 3AIIA 3ROGA 3MJTA 3KBOA 2HCBA 2FHPA 1ORHA 1XZJA 2E6UX 5LD2B 2D1RA 2XOKA 2Y1DA 1FMCA 4C03A 2PQ0A 2NSYA 5FFFA 4GQIA 2Y4NA 4W9NA 2D6FA 1UXOA 2VWHA 3K94A 1OY1A 1Z0FA 4FIZA 1RBMA 4MMYB 1XEWY 2G9VA 3KV3O 3GLGB 1G2PA 2OE2A 4WLOA 3V2GA 1EDOA 4DDKA 4A2QA 2FCRA 2P2YA 1DEAA 2ZIAA 4XCXA 3E1GA 1TVMA 4UAUA 1YZLA 4G1EB 2H7XA 3M4JA 1Z25A 5JOQA 2BR3A 3AJ8A 1SK8A 4CYMA 5EGNA 3TTVA 4JUAA 1S7GA 3CUUA 4LMBA 2ZYDA 3E22B 1N9ZA 4RWEA 4O4JA 2JJQA 3FWYA 4TVKA 5K3FA 1L8XA 3X1MA 3OJ0A 4H9GA 1R4MB 5DTIA 1ELOA 4DQDA 3DM5A 4B32A 3EXIA 1WDWB 1XZFA 5LZ7A 4EA9A 1Y6GA 3H2HA 1EAMA 2R8YA 2XECA 2Y1CA 3CYFA 1K3UB 3ESDA 3GEHA 4DR4B 4BDSA 3AY0A 1NXPA 4UAGA 1E4EB 1FOEB 4ATNA 1XU9A 5A3QA 1YR6A 3H9JA 3K92A 2HPZA 3FCXA 3UWOA 4IIHA 1D6JA 2O7SA 2P1ZA 4OQMA 3KL4A 4D46A 4EVRA 5AW3A 1VPEA 4PICA 3ROPA 1ZESA 5KNCD 1GA6A 1VA5A 4AAYA 1JYFA 2HD4A 4RSGA 1NDUA 1TM4E 4YAOA 3KWJA 3AP1A 5AW7A 2DLCX 3MAJA 3VJMA 5KQGA 1G8FA 4MW4A 2ZAOA 3DLCA 1U0HC 3ICOA 3S1LA 1QYCA 5IFKA 1D7AA 4AG3A 4C06A 1XU4A 1DTWA 2HL6A 2WM9B 3WADA 4DKXA 1Z5WA 4I55B 4GL4A 3JZFA 4YLYA 5A5DA 3I1FA 3IMGA 1IBSA 2G04A 3I9NA 4JR0A 3ZUGA 1MIOB 3QF7A 4TL6A 5KTKA 1TJNA 2KM1A 2Z3WA 4BLWA 4BQQA 4Z0HO 4YRBA 4RF5A 1A2KC 3PLRA 4K87A 1T2DA 1YASA 3ABQB 4KQGA 4U7TB 4Y6OA 3H86A 3U4CA 4ZVPA 5E6RA 4KIUA 5AI4A 3FYTA 3MOGA 2GCNA 4M99A 4N5LA 3PUJA 2Q6KA 1ZPDA 4IJMA 3RC9A 1GRVA 2Z57A 1OAAA 1Q12A 2NVWA 1Z4JA 1TX4B 3H5NA 4NE2A 1N2OA 2FSSA 4YDHB 2GCOA 1PR1A 3L7DA 3FBWA 4Q82A 4KE7A 3FDIA 1VIAA 4CM4B 5IT9A 1P33A 3VSBA 5BV8A 1E6EA 1J8MF 3UC5A 6ABPA 4CEIA 4CKCB 5AM3A 4J0IA 4RVOA 3VSEA 4CU5A 1EE9A 1COWA 2PKQP 5LQMA 3DV9A 2FUG6 1JFTA 1MB4A 3CVVA 1SQ5A 1RYEA 1OBVA 3VR2D 1HTWA 4IUBS 4E08A 1K63A 3OZ7A 4ZQGA 1UXHA 1XDGA 2IHKA 4V0QA 1JHQA 2RB4A 4ICIA 1WMFA 2ZTLA 1VLMA 1GZHB 2FPMA 3AHJA 3NRJA 2JF0A 1I1NA 1XB2A 1Y42X 3GJ4A 4MHOA 1M54A 1YCFA 2BZ0A 2QRZA 2YIMA 1W19A 2VPZA 4UUBA 4QRHA 5I7SA 3ETJA 4BEVA 4CIBA 4WJLA 3B12A 2QOEA 4IFEA 2H9YA 1C7ZA 2IYLD 4A26A 1OYYA 4RHTA 3VDQA 2AOXA 3AHIA 3RU2A 3IT2A 3V8EA 3H1PA 3OT5A 5D3MB 2XB9A 3KJFA 4JIGA 5EZYF 4ZZ0A 4OK6A 5K6AA 3ED5A 3RUEA 3QY0A 1NWCA 2PL3A 2Z1NA 4B7UA 3H11B 5HUQA 4YHHB 3TUIC 1WETA 1I2BA 2J9FA 3OZVA 2DR3A 2ZYWX 1GRCA 2A0UA 2BHSA 3FYHA 1ZUHA 3N74A 4FFDA 3FYUA 1U6JA 3SEAA 4EW6A 5JXJA 1F17A 4UU7A 3MINA 3RK4A 1I2MA 2NAPA 8ABPA 1NSYA 5F1KA 5CIQA 3KQQA 3B36A 2JKVA 4HAYA 3FOCA 3SZOA 3QE2A 4QUJA 2BTEA 4YLGA 1LPPA 1Z7GA 4DWWA 1QOZA 2CFSA 4HEJA 1Z6YA 1DNPA 1WTCA 2DCMA 2A9KA 4UCQA 4P54A 2QORA 3DKRA 3AL2A 4WKOA 3G59A 2LGJA 4J4BA 3IUMA 3U80A 3OOHA 1Y0BA 2Q21A 3HCWA 3U1TA 1SY7A 5A71A 4IH1A 2XXAB 4RH0A 4UEOA 3DMPA 1GL7A 3A6PC 4I9HA 5KVVA 1F4VA 4AZ3A 4F7WA 4BEBA 2WTMA 4QPNA 3T4EA 1ZK2A 3WRVA 3KWFA 2EJUA 4FNMA 1OB5A 3EQ6A 4H0NA 3SKVA 1JLLA 2Z9CA 3EXG2 2FF7A 4MR9B 4OMCA 3CLKA 2QRVA 4LZAA 1J2UA 2BPOA 3ADOA 4H7KA 3PZBA 2XXJA 3FPBA 2ICAA 3GJ3A 3ZWCA 3NJRA 2CEAA 3FVQA 2P9TA 5JCPA 5CDFE 2JIPA 4EY5A 2ONJA 3F1LA 1IIRA 1MO3A 2BV3A 4GQAA 4EPRA 1I3KA 4OSEA 1GT6A 2Q1UA 2Z5FA 4GP6A 1QUFA 5EGSA 3TLYA 5TT0A 4PNEA 5HHTA 2VKTA 3QXXA 3RRFA 3CBQA 3U61B 1P8AA 1L1FA 2GZSA 1IK4A 3AKCA 3B70A 4FMCF 1GNPA 3WYFA 1JE0A 2BAGA 5BYKA 4B40A 3ZE8A 1OMOA 3T3DA 4KK4A 3IEIA 1IM2A 4ZEXA 2ZWAA 1XTTA 2I8CA 3U81A 1Z3IX 3AVXA 3TPFA 4B45A 1OSNA 1XNRB 1W6UA 3C16C 2Y27A 1CQJB 1KEUA 5KKCA 4R9SA 4Z4IA 2QK4A 2Z5GA 4GLFA 4HB4A 3CKYA 5EQFA 2IPLA 2X8LA 3ZGYA 1MP0A 4J0GA 1E1YA 2PQ6A 4L5IA 4DA8A 4W9MC 2OBLA 4CW7A 1CX9B 4NJMB 6Q21A 2G40A 2ODNA 4IINA 1B1AA 5FHQA 2ILVA 4BU1A 2MR6A 1A9SA 1HLFA 3L0YA 3OP1A 3QKUA 4LXQA 3D2LA 4UEQA 5EMNA 1F8YA 3ESYA 1BSVA 5H59A 3K0CA 4WLFA 4YK7A 2IU0A 4FOSA 3N5KA 1ZH8A 4LSMA 1PEYA 5LP1A 2MMCA 2JD0A 3WHPA 5HVNA 4IOLA 4O3MA 3WWZA 3EPJA 2BSAA 2V5UA 3KOMA 2HNBA 3TTUA 4EMSA 3F46A 3MCZA 4LZPA 3ZI7A 5BWOA 5FWNA 2AHRA 4PLZA 3GAMA 3JD4A 1SOVA 3IULA 3TCNA 3AF1A 4QYWA 1R0BA 4KU4A 3WK6A 2C84A 4KIGA 2VJPA 3HP7A 1RT9A 1Q50A 5ENDA 2P9BA 5LLSA 1AKEA 4HQ6A 4QPPA 4MROA 2JGMA 4I9NA 2FUG1 4RFSA 4J7AA 4OV6B 1KRWA 3FCOA 4PZYA 1OT3A 3PCRB 4Q12A 5AFSA 4FBGA 2WDZA 2CMDA 5J1TB 3UFXA 3KBBA 3BH7A 2COUA 1WZIA 2QZJA 1DBQA 1E5LA 3RUCA 3EPKA 2VI5A 1DX4A 3B1XA 4RF3A 1NMQA 1QKJA 2VUHB 3D4IA 3IGFA 1NOJA 1C9YA 2EHDA 1R0RE 3GCWA 3OZAA 1S2OA 2ZR7A 3F3SA 4FLFA 4JB0A 3HCNA 4JT4A 4MVYA 4PC1A 4DSTA 1RYNA 1UEJA 2QP3A 3NBAA 1QTIA 4WERA 4P08A 5HQJA 1GGVA 5LQJA 1T5IA 3CKKA 2PNJA 4A23A 3HDHA 2R96A 1HL3A 3ISVA 3KTFA 3QVSA 5HKAA 4QUHA 3ZDZB 4OGLA 2ZSBA 3BWDD 3JSXA 2PRYA 4DYHA 2DFVA 2Z58A 1J2RA 4C7OB 1Z7WA 3OZIA 4N65A 3ZJVA 1Y9EA 3W6UA 2Z83A 4KNWA 2YR0A 1LWNA 4DSZA 3OC0A 1TM7E 1RI2A 2CMHA 5HTOA 3GCXA 2W2LD 3K9GA 2Y0DA 3IX7A 2B21A 4DM4A 3AUSA 1AKTA 5AVTA 1GFWA 1HDRA 1H42A 2ST1A 5ALXA 2VOJA 1GRNA 3CF6R 1JPJA 3QXGA 1ULAA 3INRA 3WOVA 4MRAA 3IE1A 3DMYA 4QGHA 1O0BA 3PRJA 2HPAA 3WC4A 5LSAA 1T0IA 4OHMA 4FKZA 4QNNA 1EX7A 4CQNA 4DVGA 4GXTA 3L5KA 4EABA 3T61A 1DLIA 1F8XA 4O4JB 5K3FB 1UL1X 1W0KD 2JZNA 4V2UA 4JDUA 4ALMA 2BR5A 1E3QA 3IEKA 3IV6A 3O4IA 5E1DA 1OAOA 3TLGA 3QIVA 1KOJA 2I4MA 2CDBA 4PV7A 3WS7A 3G0BA 1T9GS 1ZSVA 2F3TA 2IHYA 1GKLA 2P27A 1GU0A 1MVOA 3AY3A 4JQYA 4MINA 3HYCA 4O2AF 1N7JA 3RU3A 5A5EA 1MRSA 2IH5A 3J81A 2IHTA 1GNSA 3AX6A 1VE9A 2PJUA 4RKYA 2GN6A 2WKRA 3GUYA 3LUDA 4BYMA 4YYZA 1RE1A 2BIFA 1GZVA 2FHSA 2YZGA 3S8YA 3ELWA 3AF0A 4QHTA 3QOXA 1X77A 2BUAA 2D2FA 3J81k 4B80A 1R9NA 2EQBA 5CLGA 2VTBA 2IFTA 2EL7A 2YFHA 3QLJA 4PYQA 1P1IA 3IP5A 3TSCA 3ZV5A 1WSBA 3JR7A 3ZIAD 3OEEA 3W5JA 3D64A 4KXLA 1PT6A 1KXZA 5CA1F 5LLDA 1E6UA 4L9AA 3WJAA 1C80A 4DF3A 5AVOA 4Q4CA 2B99A 4LSWA 1SHKA 3R44A 5LUBA 2XVXA 1QMPA 4B8ZA 1DTWB 2J4CA 1R5JA 3TZCA 1O95A 3WL7A 4RVHA 2PXHA 1NAHA 2QUHA 2UYYA 4JLAA 3LLUA 1L5GB 5CJJA 4B3RB 2CXHA 4EFMA 4F9GA 3AEXA 2VXOA 3P0JA 1L1RA 1OQAA 4HYQA 2YRFA 5E6RB 1F12A 3KEGA 2ZB4A 1WXFA 2PIDA 3B2NA 5CTJA 3DJYA 5BQOA 3U3RA 3OY2A 2V6MA 1J5XA 3CUKA 4FP9A 5CFQA 5IANA 1KQGA 2NMVA 1FDTA 1IY8A 1RRVA 1HG1A 4U9HS 4KH0A 1YBFA 1ZN7A 4F72A 3E70C 5KWEA 5J4HA 3EJ6A 3U5ZB 2QQGA 4RTNA 2WPNA 4RCZA 3DV0A 2ISQA 3LDUA 3QUTA 3S7TA 4C7MA 5B36A 1KZYC 3G0CA 1PWHA 2GKGA 4YBZA 1BU8A 3IAUA 4CEIB 4IXTA 4AJJA 3PC7A 3QITA 1XA0A 4HAWA 4INZA 5JSUA 4W5TA 2XSZD 1CB7A 4CN8A 1A97A 5HQ3A 4KUGA 3MUEA 3QWBA 3R0VA 3CSUA 1IVSA 4J0EA 4BN5A 3L8DA 4UPDA 5B3JA 4X20A 1U3TA 4JB2A 4R1MA 2JFUA 2COKA 2JB9A 4DGSA 4K2HA 4S1WA 4KV9A 1OBCA 1SIOA 5BW8A 2RBGA 3TMAA 3WXBA 2BLNA 1YL5A 3ZBTA 4Z7JA 1NVTA 1NKTA 2JRCA 1M72A 2G06A 3OEED 5ITVA 4KYVA 3FKQA 3FTCA 3W5DA 4UNRA 1E0KA 4MW1A 1D1SA 1X1EA 2HF8A 5C1PA 3UVEA 4IGKA 1BMFA 1XDWA 1QLHA 4BWVA 4UCFA 2W6OA 4Z8XA 3BKWA 4DMRA 2F3RA 3Q15C 4LDZA 1G6HA 4LUCA 1GTZA 2E5LB 3TDNA 3CISA 3RTGA 1F06A 2PUHA 3BMNA 3NM5A 2JLBA 2OQ2A 3Q8MA 2EP7A 3AF5A 2NYRA 1E1MA 4U3JA 2AEEA 2JI7A 2J9FB 4GDFA 5KOJA 1CUZA 4PZEA 4WY5A 3FYUB 1EFLA 1U7TA 1B26A 2F3PA 4L3OA 2CNWA 2WWYA 1CUXA 2JFFA 3MINB 5FDFA 3KR1A 1U4NA 2HJSA 3QE3A 1JIQA 4DV0B 1OTHA 4QODA 1XMIA 3L8CA 2QGFA 2IUFA 2XMGA 4KN9S 1OIVA 4AJKA 4CLHA 3I5AA 1OFVA 2A5LA 2ZSUA 3JSAA 4FKBA 1KEWA 4PN7A 5BRNA 5B37A 3NONA 2H4JA 2RG1A 4DJAA 3FM9A 1GYQA 1EYZA 2IHZA 3K1AA 4TWIA 4ZAGA 1UK8A 2FWJA 1RLUA 2GZAA 2RFLA 4UTXA 2NV0A 4IDEA 3NDBB 3E3NA 4N47A 4C5CA 3BFKA 3R09A 3CF4G 3DVSX 4BNKA 2XE8A 1E6WA 1QANA 1VYUA 1CW2B 1S1CA 2X0RA 4L2IA 1Y8RA 2FSGA 3B6JA 4Q7EA 4AZ3B 4ARUA 5CCEA 3ICEA 4LC9A 1UDCA 1VL2A 2R87A 1K7YA 4MWSA 4IAOA 4G4JA 1MPXA 2VJBA 4II7A 2VQFB 3WLMA 3RT1A 1JLLB 2O8NA 2H65A 4PLCA 1H0HA 1DAFA 1MX3A 2QRVB 2VPPA 3GRZA 3R8CA 3AUXA 4JLWA 1OPXA 3U2QA 3U6KA 3LKVA 1NQVA 1IQUA 4OBWA 1P0MA 3SWWA 3AK4A 2HK9A 2EJVA 3EWNA 3WL5A 4WUTA 4DAEA 4PR0A 1VBNA 3MWGA 2HQ1A 4ZO4A 1Z0AA 1ZMBA 4AF8A 2GK7A 2QLJA 2O1XA 5EQDA 1WE2A 3AJRA 2PSFA 4ISCA 4LRQA 2WDPA 4QHYA 3ZZ1A 3C70A 4C30A 1P5FA 1VIVA 3Q8WA 1J0DA 1V45E 4L74A 5C7YA 1ATZA 2QZZA 1VJTA 1SA0B 5D5QA 1DAEA 3T5TA 2I80A 3VKUA 3O3MB 1HYGA 4E5SA 2A59A 4ETMA 5K0GA 2O5EA 1V8OA 4FNGA 2OBMA 5EKTA 1QFSA 5K4HA 5KQPA 2WZBA 3IAFA 4ZQCB 2AFIE 2X8BA 1HDXA 4HEQA 2KX7A 1PEDA 5HIKA 3DCIA 3C5VA 3IDQA 1T24A 1YNSA 2JANA 4MDFA 2AFHA 1UBGA 2VXCA 1NPDA 4R8LA 1SUSA 1LK7A 5B30A 5JRZA 3B82A 5K05A 2GBLA 4RE5A 1IUOA 5DGIA 1SMKA 4UE2A 2Z08A 1ABBA 2IXBA 4RX1A 1P7VA 1PJRA 2RGNC 3DZBA 5IDWA 3PPWA 3QPCA 3AC0A 3DBIA 1PAUA 5DISB 3SD7A 2C5LA 2FUCA 2UXDB 4JEHA 1WCYA 1QDUA 2EZ9A 1W29A 2AOUB 3MUNA 2V4MA 3IO5A 2QTLA 3WZLA 2D2XA 5A1TA 4RVCA 1TYEB 4CUKA 2IGTA 3ZDBA 1RZUA 1HQDA 5DSTA 3JZAA 4YJ2A 2GPYA 3AV3A 1FNCA 1CB0A 1J1IA 1M1NA 2JCXA 5IBRA 1GUDA 3UC9A 2Y77A 1VKJA 2QVZX 2WTNA 2Y68A 2VZ9A 2FMIA 1EHCA 3KLNA 3RJMA 1DCMA 2A88A 1XZGA 3AETB 3LX5A 2JFXA 3WGJA 3OJOA 4EG3A 4F3CA 1TMGE 4J4TA 1E9BA 3G7UA 5JO9A 5LQNA 1PT7A 4QPDA 4RFSB 4BZWA 1I5EA 1JPUA 1T1JA 1TZCA 4AS1A 2LPMA 2BN4A 2YVQA 3B6ZA 3SFZA 4TZTA 3HACA 3UFXB 2RK3A 3KQTA 4WVFA 1KYIA 5AVUA 1SBIA 2CUNA 2G1JA 2GFQA 1BHO1 4URUR 1WMSA 2P6MA 2CFRA 1UQRA 2I1QA 2WHXA 3W8EA 1VJGA 1S9HA 4MQUA 3E7FA 1CRQA 5JD4A 5C34B 1XAJA 3VOTA 4Y9UA 4NJEB 4R31A 4NMWA 2QQ5A 4W9RA 1U2EA 1U7XA 1TMOA 4AT1A 3AKEA 3OZXA 5P21A 1VLHA 3TUZC 3DDWA 4Z0NA 4B3SB 1VBMA 1M10A 3EGXA 4RQBA 3K70C 3H65A 3DDCA 2X0IA 4FOLA 3RSQA 6CHYA 4ND4A 3VR4A 1XCMA 4QDUA 2QRLA 5AH0A 2PKXA 4F56A 2FWRA 3QG1A 2D5BA 4II2A 1S7CA 2F55A 1W4CA 3IQEA 1JHZA 4TWAA 1ZCZA 1W1IA 4FWTA 4B82A 4D8XA 3MFYA 4EZEA 2GBPA 1KK2A 2OBFA 4C0AC 2GN4A 4RZXA 1OROA 2JIOA 1EG2A 4NEHB 3SF8A 3UJ7A 1KC3A 4M76B 1SUEA 2ERXA 3GG9A 4JHXA 1MR3F 4HFRA 2G0TA 3JWGA 3L4JA 1JG3A 4H31A 4KR2A 2YS7A 4PYNA 3GJTA 5AKEA 1EFAA 3Q7TA 1VSTA 2B94A 3JVIA 4B8YA 4L95C 2Q99A 3TLGB 5IULC 2I29A 3FMFA 3K9QO 3KEFA 1JQBA 1QK3A 2DWOA 3S2FA 4EPXA 3FDFA 2WT4A 1EFCA 1OE0A 4HLNA 4D4KA 3T3OA 2IPAB 2C03A 3RAJA 1ZWLA 2X9LA 2WF5A 5BY2A 3W5BA 2PUTA 3B7PA 2C7VA 2ZLBA 3B8EA 3OJXA 3PR1A 4GE3A 4TUYF 3KD2A 1VPWA 2P79A 3FZQA 1JQJC 5L3SA 5GIOE 3E3MA 3F97A 1C7JA 2Y9PB 3QI2A 5EPUA 4HVAA 4LE2A 4TVOA 3CR8A 4FW8A 4G1BA 5ICFA 4D9BA 2VTBB 1I01A 1T8UA 2VF7A 1E9EA 1WZNA 4KQ1A 5IKOA 4R1UA 1RP7A 2FWPA 2H6EA 2YY5A 5TQVA 3WLLA 5K20A 3AP2A 3F2VA 1VHTA 1X8KA 4ZTUB 1OV6A 3E9MA 2QTNA 3CN9A 3UXHA 2CNBA 3IMKA 3CF4A 3FDXA 1E2IA 1SB9A 4ILKA 1PZXA 3U4HA 2H3HA 3LJKA 3PFNA 4XR4A 4A92A 3W06A 3WQSB 3W34A 1O6GA 3AWIA 3HRIA 3NT4A 3AZOA 1FFBA 4NS4A 4UVGA 3ZE0B 1XJQA 2B78A 3GUUA 1MQAA 4IIDA 3R0ZA 1J8VA 5EA2A 3JAKA 1YQGA 1ACMA 2DB3A 1CZHA 2PR7A 3R9KA 2WFLB 2AIRA 1SKYB 1XAHA 1V25A 4GZ6A 5HUJA 3TLCA 1CBUA 2QM0A 3HUUA 3M5CA 1LSUA 4URXR 4GUDA 1XPUA 2TMGA 3HN6A 1KOGA 3LQFA 5A9TA 4EDFA 1LFDB 2WTAA 3ZV3A 1OI4A 1JHMA 3KJXA 2OCLA 2I6GA 1N78A 4F60A 3VDXA 1GL6A 1IPFA 2Y1GA 4MAFA 2ZUVA 2QLMA 3DV0B 3OPNA 3UAGA 4FHDA 1EM6A 1RKVA 3U3XA 2PYZA 2VZ8A 3D1JA 3BXOA 4RS4A 1XQXA 3I01M 3G8BA 4JVOA 3FLEA 5DYIA 3WICA 4RMIA 5HQ3B 1BDIA 3DE5X 1BMQA 4YJ2F 5ALUA 1I4OA 3QLUA 1EQUA 2R8RA 3F6CA 3KU1A 1YFKA 1S6YA 4X20B 1Q1GA 1T8TA 3C3JA 3WLTA 5JCOC 1AUPA 3DL4A 3C74A 2ZK7A 1NJ6A 2RGWA 4NG5A 1E3EA 4FE4A 2K4MA 2ANCA 1TO6A 4HD8A 1R0LA 1RKBA 4NBRA 3DMGA 5DASA 5KINB 1GO2A 1L7QA 3QBVA 1KJNA 3M6UA 2DLDA 1JEDA 4INAA 4TRMA 1U63A 1H8EA 2FMFA 3HSSA 2VTKA 1H2YA 3OY7A 3QPBA 1IN4A 3V32A 4XX0A 5ALEA 2OORA 3SP1A 1V8PA 2OPBA 3U4DA 3UZUA 3ZQ4A 3ZBQA 5BW5A 5I3CA 5C7OO 4BWYA 4IJVA 2CB9A 4NV1A 4OVKA 5FL7A 5WRFA 4H3HB 5EIOA 2EYQA 3G5MA 1OXMA 1A98A 4U3JB 4KO8A 3TFWA 4F2WA 4JX9A 3KTDA 2V65A 2DVMA 4KIJA 3ZC3A 4LK3A 5KC8A 5LZ2A 2AI3A 2Q28A 4Y2PA 3GRVA 4HRXA 3RC1A 1PU2A 1MC5A 2EF0A 4G0MA 1Y4UA 4IW3B 2VF5X 2ZWVA 5AIAA 4C4TA 3LXUX 3NBKA 4Q1FA 2VYFA 1C1XB 5GJBA 1LGYA 2FGJA 2ZB3A 1GOTA 4MVJM 5SY6A 4CTMA 3COZA 3GAFA 4MRNA 5A03A 1YCGA 3SIPA 3TIGA 3RRMA 1T1EA 3FNBA 3W3AA 3GVPA 1R6VA 3EVTA 3TZKA 4EGFA 4RDIA 5B1IA 1XX6A 1X0VA 1LC0A 2NXJA 3K1AB 3PNPA 4AK9A 1DXHA 1LNSA 4NPCA 4FFWA 2X4GA 4Q3DA 2GBGA 1FP7A 3QJYA 4LHVA 3V34A 2ZJ7A 1IY9A 3M9LA 1IXRC 4MKRA 3WRXA 4BMSA 5BN3B 3S68A 4C05A 3E82A 2C97A 1F48A 1VP3A 1PJ8A 4L2IB 1Y8RB 5BPFA 1W75A 3G9ZA 3L1JA 3WX0A 3ZG6A 5KEIA 1XTUA 3LV8A 1Z75A 2POCA 3BT7A 5KWVA 2ZQYA 2CK3D 1PYOA 5M2QA 1FYFA 4RELA 2CLOB 3KPUA 8GPBA 3AZPA 4TT3D 2A9QA 1NF9A 3G8AA 3T41A 1W49A 4GYKA 4ZYWA 1RVV1 2QN1A 1ZHFA 1U1EA 2XA1A 1K9VF 1T3GA 1HKHA 2BE9A 2I7VA 3QSYA 3G2MA 1G64A 1WQ1R 3EGOA 2AOVA 4HLDA 4ZDIA 2ONKA 2BYTA 1EZ1A 4R2KA 3W78A 1VKHA 3C3CA 1Z15A 1Q92A 2LDBA 4RLFA 3OTOB 2F3UA 3IQGX 3PFGA 1H2HA 2J33A 1PFWA 1VG1A 1ESNA 1EP1B 3PUHA 4JL5A 2AN1A 3KOZA 3MHPA 9ATCA 5HKKD 2PN1A 4BYGA 2OG1A 3DONA 3H18A 4HJXA 4JP1A 4LZLA 1A2BA 2G4LA 2Z98A 3IP9A 3KOXA 3N2KA 3R3XA 4DQ0A 5A4KA 3ZD8A 5ICEA 3BHIA 1RCUA 1INLA 2H2FA 2IA5A 2Z2JA 5GONF 3IPCA 3KQUA 1TK2A 4GO1A 1S4MA 2FVYA 2NQTA 3NNDA 4ZEVA 1G2OA 4BOYA 2DJIA 4RK7A 1I7NA 4UQLA 4I9UA 5ALSA 5JTTA 1IVYA 3W7VA 4EMBA 2MWMA 2W6ID 3VTZA 1PL6A 3MTQA 3ZZ0A 4C4ZA 1KAQA 3F6YA 5F98A 1ESDA 2G09A 3HBAA 1VXOA 1FP1D 3MS2A 1NN5A 4P32A 1V1JA 3T0FA 4RL4A 4KQ6A 3L1UA 4FR5A 4AS2A 3GDWA 3DAOA 4G56A 5J2TF 2P2SA 4FONA 2RI1A 3RSZA 2GTHA 5K2OA 3R3SA 1M2OA 5EEHA 1VKRA 4MUGA 1O5IA 1PJ4A 1LA2A 2QUIA 3ICPA 4HH0A 4IF6A 4KN8A 4LBYA 3OOYA 4R2JA 3DOIA 1G5HA 4R81A 4ZC8A 3I5XA 1A9ZA 4OY3A 2WSYB 1H9BA 2IOQA 4G5SA 2XNDA 4GOJA 1BZYA 4KH1A 5AOAA 3UK2A 3OZTA 1T26A 2O5RA 3GC6A 3EVDA 4J1TC 1T0HB 4M49A 2OPHA 1Y6ZA 5KNBA 2B4YA 1GNTA 3GAAA 1E94E 1YC2A 3U56A 2J4FA 1TOAA 2ATIA 3KHTA 3WQBA 2WMDA 3AGPA 3BF8A 3CT6A 3T5PA 4C08A 1FLVA 1F60A 1GARA 1PJ3A 4A73A 3IOEA 1P7CA 1KQ3A 3JRWA 4QU8A 3GJZA 5DI9A 2ZTSA 1Q7TA 4W8GA 3TEJA 1I4DD 4K9DA 4AKSA 4WBNA 3H6HA 1U7OA 4NG4A 3F7TA 1KO5A 1NSTA 2A30A 2YN2A 4JP2A 3ACBA 4KVAA 4PFKA 2GFHA 1QGED 2YFYA 3ZJTA 5KNDD 1DOZA 1U9ZA 3PHIA 1CP2A 2XMPA 4CM7A 1AQUA 2A57A 3B7GA 4M8NE 3RARA 5E7MA 2JI6A 4NULA 1PYGA 2VR1A 3ETEA 4L76A 4A6PA 3HJHA 4CLXA 1V7PC 4ND8A 4E09A 1YTUA 1M6YA 1GKUB 1RC8A 4J4HA 1KNQA 1DG3A 2AL7A 2Z3VA 2IOYA 3F5QA 4UXJA 4CI9A 3Q11A 3T0IA 4LVUA 2NZUG 3NLLA 4YONB 3UBMA 3EGXB 1YR7A 3GGPA 1W6RA 4DC0A 2JIQA 5AM4A 1G6KA 2I7TA 3DBVO 3HEAA 3MRXA 1EFHA 4Q9NA 2O14A 1QYRA 3CNEA 1EQAA 1M67A 1K27A 3HB9A 1LRKA 4PO8A 1H66A 4NCIA 3GROA 3UXEA 2XNDD 3IUQA 3K9WA 3S44A 3QX3A 3ERCA 2FQ1A 4M7RA 1G5IA 3BAZA 2AXEA 2X2FA 3JQ6A 3SF8B 4UBNA 3B6KA 3OF3A 3I23A 4TRNA 1ETUA 5BQXA 1WXGA 2ZAIA 2RHOA 1HZZC 3ROEA 2PVPA 6REQA 1A9QA 2XNJA 2WJJA 3RCBA 2IC5A 1K8XB 1BAPA 1VE3A 2XE7A 2IWRA 1AQJA 1KMHA 4YALA 5LB4A 1F2TA 3IV7A 4EL5A 2Q49A 1H4SA 5TEVA 1U9CA 3QVVA 2LE0A 5DTMA 1JS1X 4XQEA 4YRGA 3QZUA 1LDNA 3A4LA 4KR9A 2NG1A 5KYXA 2WMYA 4I1OA 2CGEA 1DUVG 4RK6A 1FFYA 4WZAE 4UNPA 4NBTA 3AM1A 1KPIA 4RQUA 2Y0CA 1PS0A 3DO5A 2HMSA 5L3SB 2H2HA 4R1NA 3P9NA 2QD1A 5FNVB 4D0GA 4Q37A 3RTBA 1Q0TA 1WU7A 1XJ5A 5DXJA 1JLMA 4ZXFA 2ZRDA 4P4UA 1QRDA 3UGTA 3WB0A 2XDAA 3K9NA 4A0SA 2TS1A 3EA0A 3KJHA 2UZAA 2YRXA 3GT4A 4RVFA 1WOYA 5CT5A 1N75A 1NXQA 5H3CA 5EXPA 4XXHA 4QU9A 4F3KA 4JQZA 4OPMA 3MK31 1V9CA 1V6CA 4ZT3A 5F7OA 2FQQA 4JVNA 1QP7A 3ZDFA 2J5BA 2Y66A 4D8YA 4ONEA 1YKSA 2RGRA 2WP8J 2IBSA 5K0TA 4OJQA 3AKYA 5LP6A 1JRLA 1UPBA 1R10A 3K16A 2JI8A 1AE1A 1XVVA 1OZFA 3A2LA 4FIDA 1LB1B 4H35A 1XMOB 1JG1A 2ATEA 3JAKB 3NI2A 2QNIA 1PBNA 2RKOA 3E23A 4GBJA 2IYAA 5DYYA 3MBOA 3P94A 1FNSA 3NVDA 4MA0A 3V7FA 1SIWA 5ITSA 4URFA 5FBRB 3G9UA 3E2IA 2AZTA 5HZKA 2IQIA 2EL9A 3GLGE 1LZLA 3OZFA 4EGQA 3NBUA 1XQYA 3L1VA 4R1SA 1LBHA 1D4AA 2OD2A 4G01B 4GOKA 3FCEA 4MRPA 1KAHA 3SLKA 2SKCA 2HEIA 5CLLA 2YXPX 3NHFA 4MYDA 3FPGA 4Z3DA 4MUMA 2BR4A 3DLHA 3NKVA 1ABEA 2V1XA 3HVRA 4CR6A 1M8GA 3I8XA 4L72A 1DTEA 2G1UA 5AHXA 1OBFO 3DM9B 4JKYA 2D5LA 4C4PA 4ISBA 2ZTHA 1WA5A 4FGKA 4OOEA 1E6KA 3CH6A 4KB5A 1QR2A 3L0PA 3IPXA 3HKCA 2XCSB 1M6NA 2GYWA 3CW2A 2C5BA 4DZRA 2QG9A 3GEBA 5BWLA 3SMQA 4YN3A 3RYCA 4EHKA 4NESA 2P2NA 4UE3S 4D3ZA 3BGWA 3OA2A 2G0NA 2DFNA 2IXEA 5KX5B 4AU1A 5L7TA 1Y98A 1ENPA 4XX0B 5F1YA 3PEEA 5ES3A 1X87A 3JQCA 4YLEA 1G7RA 3FTQA 2ZUEA 3SLRA 1OXUA 1Y9AA 5JD3A 1F5NA 1Y1LA 3A14A 3G9XA 5DHFA 3ML1A 3ZW9A 5DM60 5AW1A 3D7NA 1QWSA 1CQIA 1QO0A 2X4DA 1DG9A 4DV6B 1EVEA 4EUKA 5ANRB 4B5KA 1DKPA 1XQ6A 2OHGA 1RZRD 3PQFA 4MPTA 1YF3A 4AP9A 2JAWA 3Q3EA 4X00A 1C41A 4HWRA 3DOCA 5ITZA 2V98A 4RACA 1Q7GA 3HU5A 2XUHA 3CSSA 5SZJA 3RTEA 1AD2A 1BN6A 1CUDA 1J4AA 2IP4A 1DT3A 1N0HA 3TLAA 3OFND 2EFJA 4GR9A 2Q2NA 5K0CA 1P4GA 2VIIA 2YIVX 3OEHA 1YIOA 3KLMX 1Z4KA 2CUKA 2RH4A 4HK4A 4KMSA 1O5TA 4IQ0A 1ZK0A 3A1EA 2UUOA 3CURA 4X1YA 4ALNA 2HMWA 4PQEA 5CM8B 2FEWB 4HRVA 2IKQA 4AF6A 3D6NB 1BH6A 3MJEA 1OAKA 5IC5A 5K01A 2H1VA 1NUAA 2VAMA 4G4IA 4DBVO 2JG3A 2FG7C 5AVJA 3DTTA 5HKLA 2Q4BA 5K4GA 3PIIA 1A50B 4BY9E 5F9HA 4Q5IA 1CUCA 1CUYA 2YC4C 3VKVA 4GLLA 4D0RA 1CUEA 4EB8A 1OBHA 1PX2A 2WEKA 5FYQA 3F3KA 3A2MA 4BNVA 4TVSA 2P9HA 4TN5A 4W6ZA 1PVOA 3JQGA 5K3OA 4XGKA 5DNYB 2PUCA 3ZGVA 3O2NA 4YMLA 3RAFC 1GPYA 2Z6VA 1IONA 3EH1A 1JIJA 4QOHA 4OA5A 1L6IA 3EARA 4WOCA 4XEHA 3CMCO 3CB2A 3FTFA 2FLVA 1QO0D 3JZDA 1WAMA 3MTEA 1UBMS 3OE4A 5EWLA 3I1IA 4G89A 1QHGA 3JQFC 3QLVC 4HUQB 3GLTA 3H1GA 3I30X 3VAZA 2XITA 3FUXA 3ADPA 1T4GA 1QIFA 3IHLA 4LAFA 1PRYA 3EGWA 4OKIA 1TQ6A 3N2ZB 3SX0A 4M7WA 2YWHA 3LVBA 4GX1A 4IJUA 4TS1A 3SC6A 2ID8A 3EVCA 3ZHTA 3OFVA 4JC0A 3HWSA 4CHTA 4DYVA 3IP1A 3ZWKA 2J45A 2AZ4A 4DV1B 3QU2A 2UXBB 1FMJA 5DB4A 3Q8KA 2YMMA 1GA4A 2JFGA 1P9RA 2XCIA 1S2GA 4DNQA 3ON5A 2Q4EA 1MQ8B 3OECA 4KCGA 3PBKA 5GZ1A 4IFIA 5JMPA 1I7LA 2QD5A 3F98A 3SBOA 2ODAA 3WIBA 5EJ9A 1KEZA 4HSGA 1RAEA 3CUSA 4FFOA 3T52A 1GRRA 2HSEA 1YXMA 5COQA 3PE3A 2C54A 2ETVA 5DX1A 1XZIA 4XJVA 3WKEA 1YBMA 3UUFA 4BRWA 4UNQA 1TD9A 3PQ3A 3PQCA 1PR2A 3DYBA 4LDAA 1TJYA 1NHWA 5UKDA 1Y5IA 3PT5A 5EEGA 2ZBFA 3VO9A 4D45A 1PTJC 2ZYRA 2QMQA 3AUYA 1OX5A 4ZQFA 4CFYA 1JAZA 4UBJA 2XCQA 4H0CA 2A3RA 2DSNA 2OOKA 4EHFA 2ZREA 4PG8A 3KCQA 4L15A 2DHRA 4XWGA 3RV3A 3F6BX 1KDRA 1P31A 3HPRA 1JWBB 4WBSA 3KFVA 2P3QA 1RACA 3KAQA 5A2QA 4KYIB 3UM9A 4WBNB 3STVA 3F78A 4HGOA 7MDHA 1P2GA 1S2NA 2X5NA 3P4YA 3KPWA 4YJKA 4PSKA 5AOVA 4TS4A 5FIUA 1MTZA 2I6UA 4E21A 3MBKA 2D3WA 3OZGA 4PIPA 5C4IA 3A3PA 4ENVA 2WU3A 1BWPA 1JSXA 1R6UA 2WUGA 5H8WA 1R6DA 4NNOA 1E1NA 4JGIA 5E7QA 3RVSA 1WB6A 3G9QA 1GCAA 1KU6A 1V2HE 4XWYA 1FSSA 1M7BA 4ND8B 4C2AA 5FWYA 1P6QA 1ZOSA 1JT2A 3B60A 5JFTA 2E2WA 4EX7A 3SNKA 1KGSA 2DQZA 2O7NA 4MKFA 2HQOA 3LYUA 2VYNA 4G25A 4AJOA 5GTDA 2ENUA 3KCNA 3IR6A 1BNCA 3QVGA 5B2EA 3A1UA 2Q1WA 3V2HA 5TGDA 1OASA 2DG2A 4GU5A 1LCIA 3BIOA 4PWYA 1L4MA 3I5MA 3FRHA 4UJ3A 1PD0A 3PUYA 4ZT4A 1FXSA 1WBJB 1MNAA 5KSZA 1P5ZB 3KQLA 4EIWA 2HREA 1NVMB 2Q6OA 1DOHA 5IBPA 2GXAA 1X7XA 1OFGA 2P6NA 2V4UA 3EDCA 3QXSA 1HTBA 2C8KA 1CPYA 2E85A 2XGMA 5AOBA 1CYEA 2FW9A 3MQ4A 3QQ5A 1KO4A 4CMCA 3FIJA 1XDBA 2A0WA 3G8CA 3N6RA 3A9VA 3IC5A 1UBFA 5BMVF 5KUTA 1MV8A 2QY6A 1SXHA 2VDKB 3KE8A 3PXUA 5T4BA 4UAVA 2R6HA 1KMHB 2WJGA 1PW7A 1F2TB 5FUWA 4UNNA 1IK6A 3EF3A 3TZEA 1X8LA 2DPHA 1NLFA 4EUNA 3TXYA 3GMIA 2PZGA 3RS4A 4FR0A 1PJLA 5DU2A 2A9PA 4INOA 1FYVA 2PGNA 2WWWA 1IAVA 2HU5A 4G3XA 5KYXB 3GEIA 1YQTA 4HN2A 1K66A 1NXWA 1XFDA 2FPLA 4YP5A 3GEMA 5D3ZA 3RUFA 4DAOA 5LU9A 4AUKA 1PP4A 3ZXXA 4K40A 2NU7B 4ZAFA 3VU0A 5K0FA 1E77A 1XEXA 1P77A 3T06B 4D92A 4DEVA 3DT6A 3W6OA 4ND7A 2AC2A 4B4DA 3FROA 3B3GA 1KVTA 4ZKDA 1FNNA 2QR2A 4BKUA 3FWNA 3WMEA 4J0FA 3HU2A 4Q3AA 1B6TA 4GVLA 1QOQB 1UMBB 4GNRA 3RSFA 1WY5A 4B1FA 1I2DA 3CT4A 1UZLA 3C8DA 1W76A 2EJTA 2Z2YA 4N7BA 4UTZA 2AUMA 8ADHA 2CDAA 3OX2A 4R3WA 3DPIA 3S8MA 2BGIA 3V6LA 4AVYA 1DUSA 3ZD9A 4GXRA 2WWVD 3UUGA 1J70A 5LP6B 2H7VA 4NE7A 5JSKA 4K9RA 1A5TA 1URPA 1XAGA 2YWXA 3QPDA 4AB1A 2CNDA 1TZBA 1U1IA 3ITDA 2QRJA 2ZRLA 2YV4A 3GP5A 1C2TA 2GJ4A 3WGNA 3CIFA 3P32A 4BLOA 4EG8A 2HT6A 1G3UA 4Q9JA 1UKCA 3BCHA 1ZD8A 3FZNA 2FDXA 3AR8A 2NUTA 5ICCA 1RR6A 1GDTA 1QS0A 1ZL2A 3D5EA 4WOBA 1T13A 3OO0A 4RDXA 1OGJA 4NXMB 1J7JA 1C3LA 5LUAA 1XLWA 4HNQA 3QW4B 3KT8A 4GEGA 3SR4A 3SSOA 3TRKA 1Z35A 1MC1A 2HBRA 1B8UA 2JKZA 4FZRA 2GPBA 1Z88A 2JBAA 4RD6A 4YJ3F 4G41A 4YB8A 2IY7A 1N2CA 1RAIA 3N0RA 1QFXA 1DJNA 4BATA 1P4HA 3ASYA 4CKYA 1GG5A 1L5WA 1ZBDA 2NPOA 4RDHA 4RIGA 5BNIA 3IHKA 2J09A 3REQA 5TIIA 1JHDA 1Z5NA 1DLJA 2VXBA 2XCLA 1DBSA 3TE7A 4EF4A 2AQKA 3AVOA 1GTRA 3HKCB 5CP8A 1Q14A 2G28A 4YRAA 3NVKI 4LHYA 4MW6A 1ZAKA 4CDMA 4UFNA 3RYCB 1B73A 1IJEA 2VQ6A 5KYTA 1I9GA 2WVHA 2YOHA 3L92A 3NOQA 3D4NA 3NX4A 1EFRD 4JROA 2OQVA 2AFVA 3BA1A 3E81A 4O4HA 3H5WA 4QATA 2WQ6A 1VTKA 3QYFA 1JFRA 1KK3A 3RREA 4UEWA 3IUPA 1IM8A 4MV4A 2ZUWA 1QFZA 1CKEA 1TT7A 4HEA6 4M53A 1CEXA 1NVXQ 1R2QA 2GB4A 4OREX 3LUFA 1UQUA 1FQWA 1U0NA 2VS1A 2YJNA 3QRWA 4EAQA 5HW0A 1HR0B 1AGPA 3JYOA 5EJMA 2I4NA 4HGYA 3TSYA 5U4XA 4D82A 3ONVA 1NE7A 4CL8A 3J7AC 3B6EA 2JIMA 3AF2A 4L27A 4TV8F 1HDIA 1PLJA 1RXIA 3C3WA 3EGIA 3GJXC 1G3RA 3HLTA 3R76A 3WLJA 4MTLA 5T6BA 4YQYA 3IHTA 4OSPA 5FRDA 5B64A 1P5HA 4H1UA 2B8JA 3RS7A 5KO2A 2C92A 5IJ0A 1O4WA 3OCVA 4UE6A 4JI4B 4N6GA 4O2BF 4MQ5A 1RPNA 3P7MA 3THOA 4EJSA 4ESEA 4DSOA 5KHAA 4KGDA 3PNYA 4DQVA 3GLVA 3T7DA 1X1SA 2JGKA 2QZ4A 4N6OA 4N7JA 2HO4A 4M0PA 1F7VA 1ZIXA 1JILA 4PE5B 1N6OA 2HCFA 1SCBA 3DZKA 4Y7DA 4X1YB 3I2FA 1ULSA 2QA5A 4QJ4A 2PE5A 1XZEA 2W71A 3RFXA 1JYSA 4M8LA 3ST7A 2IH4A 2HIAA 4Y3UA 2IHVA 4M9RA 1JDVA 3V4SA 3RIGA 3RC3A 3VHLB 1T3HA 1P0QA 3IXLA 3D7MA 3KPYA 1YI8A 3QM1A 4NZOA 4D9MA 3NBZC 3CC8A 1K1EA 3MEQA 4GH5A 4JSTA 5FV4A 1XPJA 1MX5A 1D9XA 1XN1A 1P29A 3QLTA 1IUNA 3L7KA 4Q1AA 4TZ0A 2O8FB 2OXEA 4UCWA 5A6SA 2QTTA 4LJ4A 4RJLA 1DO8A 1XQ1A 1BEEA 2BEVB 3QF4A 2X9QA 1P61B 4EY6A 2Y6UA 1C29B 5JECA 2VHJA 4BLPA 4UU1A 1HT1E 2R5NA 3IOMA 3F96A 3JQGB 3MVEA 1GADO 4E31A 4BO0A 3NEAA 1UJ4A 4IQ4A 1BCSA 1E2PA 3MCVA 1KORA 3NTUA 3FSGD 3DMDA 3H2BA 4JU8A 3UG6A 9GPBA 5FHRA 2RGBA 5JSZB 3LRXA 4KXUA 3VZDA 2J87A 3N2LA 4YI3A 4Z9YA 3KSMA 1FFSA 2YQ5A 3H16A 3ZIDA 2FEMA 2BKEA 4HLUA 1DAOA 1DRVA 4IQFA 3B48A 1Q84A 2I3BA 2QTBA 4X1KA 1KDOA 3AVUA 1GPAA 1XRPA 3MAGA 5JYCA 4UARA 4KQKA 4F85A 3DTVD 3TVYA 2CVOA 2Z09A 1VCMA 1L3IA 2Q9AA 3THRA 4XQCA 1XLVA 4YECA 2JJ2D 3HV0A 2C2YA 4JJAA 2VHXA 4M6WA 4CIVA 4DIFA 1DXQA 4U7JA 3P0FA 1QKKA 1JX6A 2PBLA 2ZBUA 3HJCA 2BT4A 1NC1A 2HU2A 4MAAA 4EY3A 1U2QA 5JNLA 4LVOA 2P2GA 1BFDA 3LW8A 2AN4A 4NHOA 4L4ZA 2J9ZB 4A8PA 1GZ5A 1CP3A 2YOGA 3BZBA 1YJBA 4IMPA 2OXTA 2VHVA 5AKLA 4YXWD 1RQ7A 3E4DA 4NNPA 4BS9A 3BS4A 2C8VA 2OZEA 2WKQA 2HJVA 1SCKA 1CE8A 1I14A 2Q5FA 1KJIA 2PCJA 2XIQA 3FWPA 3LT0A 3RE1A 4ZOCA 1XTIA 4ZI2A 2Z4RA 3SGLA 2B4RO 1R6BX 3N7UA 4L8VA 4D0SA 2UVQA 2GEKA 4YAJA 4EHDA 1NU6A 1VSUA 1XVAA 2V7WA 1KTIA 2YXEA 1Y5MA 2VZEA 1F1BA 1J24A 3MRSA 4Y9TA 4BBPA 2FSIA 3MN1A 4ALJA 3I2JA 2DUMA 2B34A 4E32A 4C1BA 3AESA 4CNBA 5I9IA 5JC1A 3PUZA 4EYGA 1C2YA 1H93A 2JIZA 2VFAA 1QLWA 4JJIA 1QV6A 5AKGA 2ECOA 1WCIA 4ERXA 3L5OA 3R40A 1UM8A 2G5TA 4WLEA 2GX6A 1DBWA 1ZCAA 2W2MA 3C4VA 4N54A 4LS3A 5COBA 4ADSG 2KBFA 4C4RA 1LPNA 3CLRC 4UEJA 4D1YA 2ZCVA 5JCXA 5KZMB 1JWAB 3GR6A 1R50A 4PPQA 4V0SA 4U8GA 3OJCA 4X1IA 5DO9A 2WMOB 1KFKB 3CNHA 1FTSA 5FWYB 5HDBB 2J8ZA 1NZJA 2A3NA 3R0QA 1U7PA 5BYJA 3K73O 5IZCA 2V5VA 3PJDA 4K9LA 4C6RA 3CEJA 3HWWA 2HM7A 4GR4A 4UMEA 4EB6A 4HEA1 5IKPA 5KYVA 2C9BA 1FU8A 5CH8A 3FPSA 4U2BA 3NFYA 3QVGB 1Y3HA 4Y2HA 2XWPA 1ZL0A 3O8OB 5L8VA 5IASA 2OBNA 2BCGY 5T4HA 1BG6A 4XVRA 4UDOA 3Q98A 5I4BA 1LDGA 2Q3JA 2XWJI 1X7YA 3BJEA 1GU7A 4WRRA 2P5SA 3X1WA 2FVXA 2WIDA 5GY7A 1X7XB 1IATA 4FGWA 2FFJA 3PX7A 3PVSA 5L3RA 4FX5A 2I2XB 5D86A 5BWBA 2PWBA 4M0EA 1A8UA 1O97C 1U31A 3C1AA 2B98A 2WF7A 2I9KA 3LHIA 3ADDA 4K9QA 2I2AA 1K7FB 3BFXA 3DLPX 3KOYA 1YZ3A 2IZ5A 4RJJA 4H15A 5EKDA 4OSOA 4YGYA 1AKMA 4RPGA 1V96A 5P8WA 4BUCA 4D96A 2R0QC 3G79A 1F20A 4U2EA 3VH4A 1GAXA 4LY9A 4BJHB 1U65A 4G0YA 2D5CA 5JARA 1VMEA 1CSEE 3D3KA 4Q39A 5TMDA 4PGAA 1P6UA 2VDLB 1KSFX 2BC9A 3G0IA 4OYYA 3EIWA 4F6LA 5L7WA 1ZJ4A 2FZKA 3IP6A 3AU8A 4HWTA 2VNHA 2C9DA 4W1RA 4DMKA 2OP0A 3GOQA 3MSXA 1QHSA 3NUQA 1BGVA 3D8NA 1MLDA 3SXUA 1C9DB 3G2PA 3D5TA 1TF7A 1F8GA 1ISRA 3OCJA 3JQ9C 5B6IA 1GZ7A 1OBOA 3DKKA 3BIJA 2W90A 3O74A 3N8NA 1Y3BE 5DEOA 3QYJA 1NP3A 5CIYA 1Y9JA 3BIFA 4JJFA 1O58A 4TXHA 4GI1A 1YA8A 5SZIA 1D6SA 2BM1A 3N2YA 2RAVA 3H1BA 3PTZA 3NIDB 3Q3JB 4PGMA 3X1JA 2W98A 2YL2A 2HSJA 5DX0A 3EC2A 5K1ZA 4BX2A 1PEAA 5J1SB 2BZ1A 3USES 3CM0A 3FBTA 2ZSKA 4RK4A 4B85A 2CW5A 2DHDA 4L9WA 3OESA 4NZMA 1FP6A 5DCWA 1UP7A 5CAEA 4KMMA 2XUQA 1N25A 2OLKA 3N87A 2HA6A 2ORVA 2EERA 3R0IA 1QRSA 1YQQA 3DDSA 1TAHA 1Z4OA 1VI2A 4N7RA 2ZOSA 3IVXA 5H9VA 4LXYA 1CY4A 3TB4A 3E7XA 4F2DA 3T35A 4U5QA 2H31A 5IYZA 3HPQA 3DG9A 4R5MA 4V3CA 5SY4A 4OLAA 2NUTB 3JTMA 4WAUA 2D13A 2YUIA 1QS0B 1G20B 2PMKA 2PPLA 3GFTA 2BGKA 3M4YA 5DBGA 5DP1A 4E94A 5CA0B 4DMFA 4RKWA 2WTEA 3TQHA 5EJ6A 2FOLA 1SEPA 4JT8A 4PW0A 4UM9B 4QFBA 2OCKA 1LQUA 2UKDA 5E4TA 3TR6A 4AM8A 3WAJA 4TM7A 1TO2E 5DHRA 3L0CA 5GJCA 1MORA 4DT1A 2O06A 5MHTA 4BVHA 1MGPA 2JBAB 3BD6A 4I46A 2W8BA 4AMYA 5GVRA 4S2EA 1N2CB 1CUHA 2VH1A 1SAYA 4F0JA 4X3CA 4ZYXA 1WUIS 1SHJA 4HWOA 3IS3A 5ILGA 4IO0A 2LDXA 5L40A 3REQB 3CVOA 1JLKA 4ZCTA 2R8XA 4C9BA 5JFGA 3U60B 3PNQA 2QL7A 3GRAA 3ZGXA 2I22A 2KI5A 4L5JA 4XDHA 2XMQA 1ILWA 3I2GA 2ZJYA 3PU6A 3FPLA 3ZDYB 1K5GA 1YBVA 4RMNA 1T8SA 4U63A 5KVAA 2ZANA 3ZXSA 3GQVA 3QEAZ 4KBYA 1BW9A 3D7RA 4O4HB 1MN6A 2ODPA 4XYBA 4XI9A 1JHOA 1ONPA 1OIWA 2O2JA 4BLVA 1ACLA 3H5OA 3KQOA 1M8FA 1ZIDA 1ZQ1A 1WSWA 2FZGA 2JIRA 4JLPA 5DBFA 4FYHA 2SNIE 3ZVRA 3MYRA 1VLQA 4EO4A 2OV6A 3UGJA 4H77A 4AJIA 1QBKC 2WFMA 3SVTA 4F2HA 2NUBA 2ON6A 3MTIA 3NHZA 4HGNA 4DCCA 4FFVA 2O3TA 5LIPA 2FMHA 3U3JA 4FGZA 4BO9A 1V8DA 2PDAA 2C9YA 2R8ZA 5BSEA 2CJWB 4KPEC 4AY5A 2QYHA 4FHCA 4AIRA 4B3DA 3OPVA 1CQZA 1PL0A 1TQDA 1U5BA 5TC4A 4BFZA 2DYKA 3E2PA 2YKGA 1KEKA 1GTVA 4Q1BA 5JNWA 1SKYE 5JYEA 1DO2A 5AJZA 4K03A 4OFBA 4H6XA 4PRZA 4EJSB 1IEQA 3F7OA 4NRDA 1U7ZA 4NEGA 4BTEA 1XZLA 3L4BC 1CUWA 4QFDA 1ZZGA 3C3BA 4YCLA 4KR0A 3K15A 1JIXA 1TXGA 1IJBA 3QX8A 4L16A 3UEOA 1FNBA 1QZUA 1J0XO 4K6GA 4KP7A 1UUFA 3WB9A 5HJEA 3C8UA 4HRYA 1O77A 4I5IA 2BKUA 1I4WA 3U4MA 5DTEA 3BFPA 3GLIA 5HK9A 4MDHA 3JQBA 2BRUA 3EVZA 3BIWA 3KSUA 1A95A 1XMXA 4FHGA 4LOLA 4WI1A 3VYUB 4C0BA 1TE2A 3SK0A 1O8BA 2CHQA 5TEWA 4RPKA 3PWKA 5ENVA 2C7RA 3ORFA 5B1HA 1QIKA 2FPGA 3D6JA 3DFIA 4P7JA 5H3LA 4CJXA 5A6SB 5CBPA 3D3EA 3MJDA 3R3ZA 2OC9A 3QF4B 4Q1DA 1KRHA 3FE2A 3EGEA 4P92A 4LYFA 4P7FA 3HNRA 5BR4A 1Y1QA 4WHMA 2XEDA 3HL4A 4PYJA 3D9QX 3PC6A 1QF9A 3QBDA 1PD1A 1UOQA 2WHRA 4B6RA 4MVJG 2C31A 3GJRA 4PZPA 4QEZA 4FWIB 4WLNA 1U0OC 2NX2A 3NASA 4N3GA 2R6DA 2O6LA 1HBJA 4YYEA 4ZVTA 3DT8A 3UCEA 4PPGA 2W6PA 4CFSA 4F1JA 3AF4A 4ENWA 4X1KB 4Y9DA 1E0JA 2VNIA 2O8CA 3DMTA 1UC5B 1FQJA 4CF5A 5FUBA 1FFHA 4B2IA 4M36A 2H1LA 1QIEA 4JMLA 2ZULA 4MLZA 1C8LA 1U1FA 4F2GA 4M6WB 1U11A 4QDJA 4R16A 1NMXA 3MGAA 2QIPA 5CUQA 4BMPB 2OD9A 1SG0A 4N3BA 2AI1A 4W8OA 3H04A 3H8JA 2ZYGA 1GT91 3BHMA 2ID9A 3ER9A 1TU0A 4NYMQ 3ZIUA 5F33A 2QVCA 1H1DA 2WSLA 1UMDA 5B1YA 1Z47A 1I3LA 1SCQA 4ETNA 1EP2B 4OJTA 3UJBA 2IYVA 1XYYA 2OD7A 4OI4A 3TIXB 1O1YA 3LP8A 3JYLA 3UO8B 2PIAA 2YC2C 3JASA 5KYKA 1KHTA 3U7GA 1GTSA 2QV0A 3SYRA 4AZVA 3PVZA 4L8FA 2XNKA 2HJ9A 3UB3A 1C4XA 1AXEA 5LOVA 1TKAA 2PLFA 5EJ8A 4M4SA 4KITB 3ZVKA 4B3IA 4QDTA 4HQOA 1O0CA 2O2DA 4MQLA 1KYQA 4JT2A 3T9DA 3DOHA 3IPYA 2O1SA 2XQIA 4B3FX 1BMTA 2FN7A 3DGEC 4YT5A 5C9ZA 1O4VA 1M8JA 1HA3A 3AESB 4L02A 4TSFA 4ZI5A 1XCLA 4E70A 5CDHA 1JGTA 2OV2A 3RS8A 2OHIA 2VZLA 5JWRA 1J22A 2AD1A 4GP9A 4HADA 4NDNE 1W2GA 2V3VA 1ZG3A 3LXXA 2RGEA 3BZUA 1SCIA 2Y3IA 3E0QA 4X3PA 1T9HA 1JIIA 5F78A 3IH5A 3U3DA 1SPXA 4NL4H 2ZJOA 2XTAA 2ESRA 2P9QA 3R3YA 3PX3A 1MG5A 4LZOA 4MYRA 4ZGWA 1JMVA 4ZODA 4CQJA 2VQSA 2OXIA 2W2KA 5TPZA 4DDHA 3C87A 2BWJA 1NJ1A 4RY8A 2GNOA 2BM0A 4BEWA 1WX1A 3LGSA 4ITVA 1LS6A 3M6FA 1KY3A 3F3MA 5AK4A 2H1RA 2FWNA 3KT3A 4UHFA 1NXVA 4EB6B 3AHDA 4DQKA 2OO7A 5T3YA 4J49A 2MSKA 4RQTA 4BV2A 3HKDA 1OLSA 1IY0A 1H9AA 2I2WA 2J46A 5DHTA 3MLAA 3OIUA 3DLAA 1WXWA 1ZUD1 4EFNA 2QPLA 5K0BA 1IY2A 3QMMA 1X7YB 1IXKA 4JB3A 1V3TA 3L0DA 1ZNYA 4BX3A 4H7FA 5MGNA 1DV1A 4PXAA 4HBZA 4D8TA 1L3BA 3FTEA 3LECA 5BQPA 3P2OA 1GU1A 1GNQA 1SN7A 2E49A 1ID8A 4YP9A 4B46A 3KSDO 4L75A 1NFRA 3ZHQA 4D4MA 3LS2A 5JAOA 3B5JA 4Y0NA 1VIMA 3ZEAA 1V41E 2IP2A 1P74A 2ACVA 2ZIEA 3V8QA 1E89A 1NDQA 4R84A 5AW5A 3OQIB 2XAAA 4X5OA 3A2NA 1LW7A 1R0YA 2PU5A 6AT1A 1GTMA 4Z7NB 1Z4LA 3DOJA 2Q2VA 2H1CA 3CUTA 2CHFA 1JXQA 2CE2X 1VYHA 4WGGA 1CZLA 5DGXA 1TIBA 4QXRA 3LUJA 4NZYA 4RFVA 5JG7A 5FOTA 1GCOA 2QN9A 1RWPA 3AM5A 2YX1A 1ZUNA 3NRCA 3RVKA 4EQZA 1ENYA 2DR0A 4TKUA 4DLKA 4D0LB 4DRXA 2E4AA 1W1UA 4KJZA 3VV3A 3W9YA 5ICMA 5IG2A 4U7HA 3I01A 5IC6A 2NTVA 2YV2A 3GMSA 3BWCA 5ARCA 5B4TA 1YVPA 1FMTA 2CLCX 2NSHA 5KS2A 2IYSA 2YNMC 3VPGA 5A0VA 1IMJA 4DHWA 2IS1A 2WZCA 1XTZA 2G72A 3NM4A 4F91B 1I6KA 2QRUA 2R6GA 3IESA 3T12A 4BBJA 1T2FA 1VJ0A 3VAAA 5B5SA 1FSGA 1PVVA 1TA4A 5EXEA 2IZ6A 1YZHA 3ROTA 3TOZA 5JS6A 1HH4A 2VNJA 1D9ZA 4LMAA 2KLBA 1RNLA 3C6QA 1AKVA 4DMCA 1OR8A 1SVIA 1L4KA 2PTGA 5CAEB 4UULA 4C1NA 3E9RA 1KO8A 2PCLA 1MOQA 1NP6A 3A6FA 2YHIA 4LC1A 4XYGA 4MRSA 5EVCA 4YX9A 1Z8NA 4M1WA 2GF2A 3DKPA 1QDEA 1HT0A 3ZCVA 2GPSA 5A06A 2VHWA 5KVCA 1HPLA 2FG6C 4RUKA 5IYZB 4BCBA 5EHNA 4TMYA 3STTA 1YL6A 4IIYA 1WB5A 3HBFA 1L5HB 1H5NA 2W2OA 5K0NA 3UWSA 3L01A 3QEOA 1XWIA 2MSDB 3EK2A 3M70A 4JXKA 3LPMA 3EC1A 4JOCA 4LKRA 1NKVA 1CDZA 4O1IA 1UPAA 1TYAE 1YRBA 5I5GA 4JI1B 4EECA 2BJHA 4MVJA 4X3OA 1Y8AA 1Z37A 4DILA 3MTGA 4DT1B 1AJEA 3UF0A 1FCJA 4JUBA 3OZEA 3AP3A 2P4UA 5HR5A 1DRWA 1U8CB 2GOYA 3FCSB 2GM3A 2ZU0C 3EDMA 4KK3A 4OYLA 2HRQA 3KHUA 5FAKA 1MB9A 4Q15A 2ZJZA 5ALQA 3RS3A 2QX8A 4HJRA 2WYHA 2IXTA 5JPCA 3KX2A 3GFRA 2ZSHA 5JNVA 4RTJA 3URMA 3JYPA 1XF9A 1HLGA 2DHQA 2H16A 4Z4GA 1DG1G 1I1HA 2C5FA 4KN5A 4HYTA 3W4IA 3G82C 4KXWA 1F0PA 2FWAA 4MWBA 4HAVA 3RBXA 2Q2QA 2REXB 5JFOA 5TS2A 4HBGA 1BW9B 3DP9A 2W2XA 2RONA 4MUEA 3EEOA 2DSTA 5J4VA 3QE9Y 1GP2A 1K5PA 2H2WA 4IDQA 5FNZA 5B2FA 1SXQA 4Q7MB 3AUJB 3GMDA 3GO4A 2WFAA 1SZPA 3EDRA 4P58A 1T91A 3RS0A 1EVIA 3L84A 3DL7A 3GA5A 3NHPA 4H27A 4S24A 3T1TA 1GD1O 2DY1A 4MR8A 5AJHA 4D9KA 3ZXYA 3B2EA 4B87A 4GSYA 1QHEA 2MSWA 4LRWA 1L9XA 4FGJA 1GFSA 1ODKA 1SU6A 2HHHB 1EFPA 1E66A 1K0FA 1L8QA 3IP7A 1U5BB 2H51A 3CQ9A 1F3OA 1X38A 1YB2A 3MLBA 1V48A 3TVDA 3AV0B 1U9IC 1H2WA 1CEEA 5KNDH 1Q16A 4QDKA 3AVWA 1A88A 2P75A 2WOJA 1M2VA 2SCUA 3VX3A 1SCAA 3ANLA 4RSRA 2BFWA 3L7BA 3FUUA 4US0R 1XKTA 3UT0A 5C1DA 2HLDA 5T41A 2Z6AA 2IX9A 4GMHA 2C42A 2DKOA 4FHEA 2ASEA 3HM2A 1U94A 2CVHA 1RLIA 4Q6WA 2O7QA 3NFRA 4M55A 4XM1A 3V4ZA 1Z62A 5JD6A 1KFBB 1ODCA 4N18A 3NHSA 3G2NA 5K03A 3GLIB 1YU6A 3C3EA 3N6XA 2ZRBA 4EGCB 4Z6KA 3RIMA 3TECE 5IS2A 1JHYA 1U0FA 2GZ1A 2DCUA 1U0SY 1VSVA 2O54A 3EB9A 5CB0A 2X7XA 2AHOA 3IJEB 3K0KA 4W7SA 4D5EA 1GQQA 4TRRA 5CBPB 2NVUA 2WM8A 3AI7A 3IXMA 3SHWA 4J16A 2BVNA 3TH5A 5EC8A 4RYDA 1Z45A 2I7CA 3C7KA 4I8IA 2B5WA 3TNYA 2P77A 4I1PA 2CXNA 4Y1RA 1MOPA 4YUZA 3JARA 3W7BA 2QP4A 3GRRA 3AQ4A 4J91A 4S0XA 2E1RA 4FXOA 3GH1A 2IU6A 3PXEA 1KIFA 2V7VA 3MWEA 3EXHA 3QWAA 4FJ1A 2Z5VA 4B31A 2C88A 1QWOA 1SD5A 4EYKA 4OHUA 4Z51A 1CY0A 3PFHA 3Q3HA 1SHTX 4IZ6A 2X0FA 1BXRA 1LLFA 4K3VA 1MD9A 3ZE9A 4BLUA 4XOIA 4HR7A 4QJ3A 2IZOA 5K8UA 2OLEA 5SZKB 2OGTA 2O8CB 3ETHA 1KTVA 4P22A 2YFQA 4PYMA 5MGBA 1RPZA 1NNUA 1AGYA 1WXDA 1F7UA 2F48A 2PEYA 4JQSA 4DLTA 2WM3A 5CDYA 2DTDA 4IHAA 3TTTA 2ECKA 2J5XA 2JFNA 1EJBA 3OEYA 3I42A 5E3IA 3WKDA 1T8WA 2UYQA 2VSNA 3NKFA 5EIBC 4LF8B 2CYBA 2MYPA 4ZYVA 3DZDA 1XEWX 3X2EA 4AO6A 5D1NA 2JS7A 3PUKA 1UMDB 2V5AA 5K8JB 3TIIA 1EG7A 1MO6A 4P3OA 3ABSB 5ESXA 1SUWA 5JVDA 3D0RA 5A2GA 4UUAA 3JASB 1FFGA 3RB8A 4IFTA 1P0PA 2GZDA 2ZT6A 1TCUA 3W5HA 5ELXA 1JR4A 4WK4B 3WMFA 5LOVB 1Z2CA 3CEAA 3GUVA 1JIUA 2YNMD 3DHEA 3LX8A 1WU8A 4TKVA 1UT5A 2BFCB 5HJ2A 2E4ZA 3OM1A 3NEYA 3S2YA 4LTNA 1UAAA 1MO5A 1N3IA 3GRUA 3R24A 4LJ5A 2E89A 1PW5A 1QTQA 4QTXA 5JJ5A 3B1KA 2IZ0A 1DKQA 1Z0IA 1YZFA 3F5SA 3O8BA 4R7TA 3QMPA 1HGXA 4AKTA 1V5EA 2H5EA 4A0FA 4EVQA 4HVCA 4PHCA 3OF5A 5AI0A 1JFVA 2B69A 1JN0A 1LQ2A 1D0IA 2V8BA 1DZIA 2QMUA 2IYEA 3AFMA 3MGKA 4H16A 4O4LB 3DDNA 2ZPTX 1N2BA 2PRIA 2YN4A 3IAS1 3JYNA 5EE3A 1F0KA 2GLXA 3O2SB 4ZV7A 2W2KB 5EIHA 2EIXA 2V7PA 1Q1BA 2FRDA 3VR4D 4YTEA 1FMLA 1T6YA 4GSLA 5LQRA 4OFXA 4Q05A 5EERA 1RIIA 1UPFA 4ON9A 3U3KA 3PUWA 4M8IA 2CC2A 1M7HA 3OWOA 1AMOA 1L7RA 2JFBA 1WCWA 3HLYA 5ECDA 4O63O 1JI0A 1RDFA 4RF2A 4GC5A 3WP0A 3CPSA 4GM0A 4WKCA 4EY7A 2ZATA 3HKDB 4MQEA 4MO2A 3IAAA 4HRAA 1QVAA 2NSLA 5H3HA 2OHFA 4Q3OA 4CL3A 1EPUA 2E82A 3UHAA 4BQNA 5I4CA 1C9NA 1PWYE 4QPCA 4Y30A 3RC7A 4ZHQA 5JQWA 2Z6UA 3EPPA 4IP0A 3M4XA 1XTJA 1X15A 2QROA 3NP9A 1HNXB 5DNDA 1RQGA 1KZ6A 1QG6A 1T2UA 2QN7A 3IILA 3C7TA 3CUVA 1U2PA 2I1WA 1QGZA 1V95A 1X1TA 2PRKA 2QT1A 2YJZA 3NGXA 4RXMA 4EFDA 1N2EA 3ZU4A 3T3EA 4DG5A 2H4XA 3LOUA 4TWRA 3TRHA 4DNPA 2I3GA 1R1DA 2H9IA 1NVUQ 2QRHA 4CKEA 4NMLA 5JCJD 2IYRA 3DE6X 3MLEA 4XGRA 4L4UA 2FKNA 2W37A 3GQBA 4LJ6A 5LA6F 3PWSA 3VFDA 3WGYA 4FMPA 3SSNA 1Y3FE 1A77A 3K0HA 4C88A 2YASA 3H05A 4B4KA 1KE2A 2PWYA 2AXQA 2YZ2A 4M60A 4K0KB 2EJWA 4CMAA 5A05A 1FFEA 2YXLA 1L7EA 2YW9A 1UWVA 3LPCA 3UAXA 1PQYA 3VRHA 3ZV6A 4CM3A 4DJDC 4EHBA 3HHEA 3KYIB 2I2FA 1RJ9A 4A2CA 3QVTA 5D3QA 3ZCSA 4E7PA 1Q21A 1ZUNB 3ODPA 2IYPA 2WJWA 2QE7D 2XRZA 4TKUB 3LL4A 2AB0A 4LBWA 2IIQA 4N8DA 4RY2A 2AWOA 1SIBE 1XR3A 1HE5A 2VWPA 3GZTB 4N01A 3UIEA 2BH9A 4C7XA 4D4LA 3V1TC 4OQ4A 1V5IA 1E3MA 2C7BA 3ZK7A 2EFYA 2JI4A 2Q5JA 1JJIA 1W46A 1RXWA 2ODBA 5KVSA 1NATA 3E9NA 1GPKA 2V7QA 3GLFA 1M34E 1NT4A 3KFLA 2C2ZA 1ODTC 1LI7A 2EBFX 2W2PA 3CPHA 1O57A 1LEHA 1JH8A 2GNAA 4G8CA 3RH0A 5KDDA 2GO7A 4NYIR 2KE5A 4WADA 1YJQA 4ALIA 4F93B 1QIHA 2D1QA 5DT9A 3CH5A 4PFJA 3CPJB 2CUTA 3K8YA 4N0QA 5BYAA 3SVLA 1B00A 1UODA 2OA0A 2C5EA 2B4QA 4ENTA 3M3DA 1NFFA 4DA6A 5AESA 5IK2D 3WLKX 5EIFA 2YHIB 3BE4A 3AO0B 1XRJA 3ANTA 3R20A 4NZ9A 1DIOB 1ID1A 2GILA 3LC2O 1Q44A 4XCVA 4LI3X 1TECE 3ZZUA 1HFWA 1XYGA 3FYSA 3T15A 1HT2E 2CJXA 3N5CA 1CLUA 4M1QA 4N5HX 4UTPA 1TZJA 4HHEA 4F11A 2YICA 2GCPA 1KJJA 1NW8A 2V7TA 3CLHA 4YPFA 3LCRA 2MYUA 2IYNA 2X1VA 4DM3A 3CCCA 4EL0A 1N5KA 2J3IA 1WWKA 1YR8A 2YFKA 3ZTTA 3KKQA 1N4DA 4WFIA 1IN6A 2QTVB 3KUUA 2QZSA 4IHKA 3RVOA 3SM3A 4UOZA 3VNUA 1JSZA 2WIGA 4TXMA 5IXJA 4AQ7A 2G5CA 4Q4LA 2JA1A 2HU8A 1JHXA 4HFNA 2C61A 1HRDA 3UK6A 5AVRA 1AA6A 4XA8A 2X4IA 4Y1GA 2DWPA 1MXHA 4FINA 4Y2QA 4B84A 3EDYA 3REOA 1YR1A 4JFAA 5EHZA 2VJQA 2A4MA 1FFWA 4JBWA 4RKRA 5K3DA 2X0EA 1R66A 1VPLA 1WZUA 1SUPA 1UC9A 3O92A 2B0JA 4MRRA 1AZSC 5E6UA 1RABA 5BSRA 3OUZA 4RTPA 1RTTA 2A5DA 4PPNA 1ZJWA 4R6WA 4EI2A 4HH4A 1W5FA 1BWRA 2WU1A 8LDHA 3KQVA 3F4BA 2Q2OA 5EIBD 1G60A 1WB9A 2VJCA 5JROA 1L0BA 1WUJS 4KOAA 3OC6A 2C3OA 3INYA 3KKMA 1RYDA 4XX1A 4RY9A 4F3NA 1D6NA 2J3KA 4MR8B 1TCVA 1MA0A 5DMHA 3OLVA 2X5KO 3BWYA 1MAUA 3T34A 1YRLA 1Z6QA 2A1TS 1AKQA 4JODA 5K0JA 1TLTA 3RYHA 2P4EA 3WYGA 2JI9A 2R1TA 2ECQA 2QJRA 3SM9A 4C0LA 1EFPB 1F0NA 4WNAA 3FRJA 3CNLA 3ZHVA 5CFLA 3U5TA 1YJCA 4OOFA 4M37A 1BJKA 1X39A 3CG0A 1JJ7A 2AZXA 3WMXA 4MTCA 1T5BA 4A8JC 4JXZA 3ITKA 4N0EA 1TGYA 4UOQA 3TG8A 4KLCA 5ADWA 1J99A 2L18A 4CM1A 2WFZA 3HMKA 1FTGA 3ZU6A 5KOYA 1M2VB 1Y7TA 3O8NA 1RP1A 5BW6B 2SCUB 4RS3A 4BO2A 4EOGA 1JU4A 4QFCA 3UKOA 4OQYA 1R5OA 3T7RA 1MF7A 5JI2E 4QT0A 4XW2A 1I1OA 4R1OA 1EUZA 4XOUA 4DUPA 1BROA 2HDWA 5DRTA 1QH8A 2C5GA 4ZHQF 3TTWA 2FUEA 1Y81A 3UGKA 5D84A 1LC3A 4ABYA 2KWIA 4DUGA 1DP4A 5C81A 2FF5A 4DSNA 5IWAB 5JE8A 3JV7A 2BONA 1PNVA 1BQ3A 1TK3A 2TSYB 1L4EA 3GJ6A 5FORA 1DX9A 4LPSA 2O19A 1DQYA 2R00C 4L73A 2Y1KA 1QG2A 4C5BA 5FPYA 3CX3A 2OZLA 4BRUA 4G63A 5CPBA 2NVUB 4N49A 2ZSAA 1GLVA 3MELA 3PNVA 1S5PA 2WHPA 4BFWA 5LJLA 4V0ME 5DW0A 4J7UA 4ZD6A 5ALYA 1JG4A 4RTSA 2JZCA 2KQUA 1LRLA 5CHYA 1CR1A 1TYZA 2NOAA 2FA9A 2J30A 1ZNXA 4LEIA 4E5MA 1EWQA 3RRNA 1RAHA 2DLNA 3JARB 4NFYA 5FBQB 2C77A 4XZ3A 4B6FA 3D0QA 2UU9B 5B7QA 2XNCA 5EHQA 2VHCA 3IUJA 3EEFA 4HMPA 3MWEB 1BRTA 2DAPA 1NV9A 1D5WA 2OV8A 2R62A 3EXHB 4KAJA 2AN3A 4MJ3A 3BGVA 4JELA 3BWBA 4KPFC 1BXRB 3KOWA 5TF4A 2NO6A 2OCXA 2H1OA 1XZ8A 2CBXA 1RRKA 3PFWO 2HQSA 5GV8A 3AEYA 1OPRA 2BGLA 4J07A 5IEBA 1EJ6A 4RHFA 5AHRA 2JGAA 2YHSA 3OJLA 3G5UA 4GPAA 3BA6A 1Q3TA 3LCVB 2QGZA 2YJGA 1FIUA 2BHNA 1CJBA 2YVAA 1X94A 3M5DA 3HBLA 1KYYA 3PC3A 3HVIA 4IDOA 3SHTA 2C1EA 3NHMA 1ZGGA 2MINA 4I50F 4PXSA 5B7GA 2H17A 4WIAA 2CJYA 1V2GA 2DU8A 3TTSA 2QUBA 1KFEB 1OV4A 4FDUA 3I8OA 3O90A 2A1IA 2XV1A 1A5BB 3GXOA 4QWMA 2WWTA 1EBFA 3CBGA 1M2GA 5JVDB 5GGYA 4AYXA 4CMHA 4O2LA 4CLEA 1NYTA 1Q2XA 1D03A 1Z4IA 1W87A 4B76A 4BBZA 4CCAA 2A9OA 4LGYA 4CFZA 4TL7A 1W36B 1RW4A 2JH8A 3K70B 5F2EA 3X2FA 4TKVB 1HE8B 1Y5LA 3E3AA 2WF9A 4ZC1A 4Z9AA 3MERA 3ITEA 1E6MA 4XFDA 1C9MA 4PHFA 2C4TA 3I6ZA 4PONA 5ER9A 5T67A 2C2MA 3EQ9A 4TX1A 4I3HA 4IIJA 5E7JA 4OH1A 4WXRA 3RU7A 1CDEA 4KHPB 2ZE6A 4R05A 3T1NA 5IJ0B 1DKNA 1QGDA 2XD9A 3UOAB 1MA3A 1M2EA 2DE0X 4V0LA 3NHUA