1DKRA

Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
309
structure length
298
Chain Sequence
NLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRMNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYL PYROPHOSPHATE SYNTHETASE
publication title Structural basis for the function of Bacillus subtilis phosphoribosyl-pyrophosphate synthetase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 97
structure length 298
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.6.1: Ribose-phosphate diphosphokinase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13793 Pribosyltran_N N-terminal domain of ribose phosphate pyrophosphokinase
A PF14572 Pribosyl_synth Phosphoribosyl synthetase-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dkrA02
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1dkrA01
1HGXA 1A98A 2XBUA 1IBSA 3MBIA 1UPUA 3LRTA 4WN3A 1XTUA 1HMPA 1XTVA 4Z1OA 5BQOA 4RV4A 1MZVA 4LZOA 4TWBA 1G2QA 2WNSA 1QB7A 4PFQA 1TC2A 4IJQA 1L1QA 1ZN9A 1DQPA 1GPH1 2E55A 4RAQA 4M0PA 1DQNA 2HCRA 1BZYA 5EUCA 1W30A 2H08A 1JLRA 3DAHA 1I13A 3DMPA 1VSTA 1DKUA 3N2LA 4X45A 4P83A 5ESWA 3ACCA 2FXVA 2H07A 1BD3A 4PAWA 1DBRA 1QB8A 4LZAA 4P3KA 5K51A 2PS1A 4RHUA 1U9YA 1NULA 1NONA 2IGBA 3DEZA 1ECBA 5KAPA 1D6NA 4M0UA 1J7JA 3GGCA 1O57A 3HVUA 1P17A 3KB8A 3LPNA 4MB6A 2VFAA 4WMLA 1JLSA 1I5EA 1A97A 1Z7GA 4RABA 4P86A 1BD4A 1CJBA 1DKRA 1QK3A 4RHXA 4F8EA 1OPRA 3O7MA 4ZFNA 3OZFA 5ESXA 4QYIA 2AEEA 2H06A 1P18A 3OHPA 4RHTA 1ECJA 5IAOA 4LYYA 1I0LA 3QW4B 4JITA 1R3UA 4RHYA 1VDMA 4P80A 1GRVA 2JI4A 2GEBA 4QRIA 1LH0A 1UFRA 4KN6A 4RADA 5BQPA 1A3CA 1UPFA 1G2PA 3MJDA 1P19A 3NAGA 1G9SA 4RQAA 2YZKA 1U9ZA 4S2UA 1QCDA 1ZN8A 1ZN7A 5JSQA 5KAMA 4LZNA 4JLSA 4M0KA 4LYGA 1WD5A 1XZ8A 1XZNA 4P84A 4X44A 3GGJA 4RAOA 1STOA 1QK5A 1O5OA 4RACA 3H83A 3EFHA 4P81A 1A4XA 4FYMA 3ACDA 2PRZA 1V9SA 2DY0A 1PZMA 1ECGA 1XTTA 2C4KA 1I0IA 2P1ZA 4RANA 1VCHA 4P82A 1ECCA 3ACBA 5JV5A 2PRYA 1AO0A 1OROA 5BRNA 5IPFA 3M3HA 3GEPA 2EHJA 1FSGA 5HIAA 1L1RA 1QK4A 3OZGA 5E38A 2JKYA 1A95A 4OHCA 5BSKA 5HKLA 2JBHA 1G9TA 1TC1A 2JKZA 3S5JA 1I14A 1Y0BA 1ECFA 1A96A 3G6WA 1QCCA 1YFZA 4QYIB 4RQBA 1P4AA 1OREA
chains in the Genus database with same CATH superfamily
3C3DA 4ENSA 4L5AA 3W2TA 1J70A 5TSDA 3MN1A 2JHFA 1MOQA 4H3HB 3OTHA 3DF7A 2OGSA 4GI2A 1KO1A 1UF9A 2NZVG 1V7QA 4UTNA 2WJAA 1E2PA 1CHDA 4I4CA 1L7RA 1LK0A 2ZE8A 4DA6A 2O05A 3FMIA 4HR7A 4FEYA 4II2A 1Z5OA 2HIMA 2YIVX 4FN5A 3NEPX 4GWKA 4CQLA 3HKDB 3AQIA 4WLFA 4RM2A 4UHKA 1VE9A 5C52B 4MPDA 1N32B 1KY2A 3NG1A 1S3GA 1SC3A 3DMPA 4NENB 2MSCB 5BN3A 1BW9A 2FUG1 1OA0A 2C4NA 2UKDA 3HP7A 3LNCA 4N4AA 3I2HA 2PEZA 3LLMA 2A5GA 1HFJA 1KARA 1UJMA 2XA9A 4X7PA 1YKSA 2QU7A 2KSQA 4NZ9A 1VHWA 3DTVA 16PKA 3AC0A 1TKBA 1DIOB 1RHRA 3BF7A 3CUTA 3AHHA 3QSYA 2P2ZA 5L3SB 2ZBQA 2G9NA 3CBGA 1A5BB 1J7JA 3SHOA 1PJSA 2DQZA 2QLNA 1C9DB 5CPFA 4J0QA 5DKFA 2RGCA 4B84A 1WW2A 2OWEA 2I3GA 1JBQA 2ZYTX 1JMYA 3O75A 4IO0A 1P0FA 2HGZA 4OSOA 3UJHA 4I66A 1POXA 3KQOA 3L6RA 5CMLA 1GFIA 3E1SA 4HUTA 5L45A 2VF2A 2OKCA 4XB6B 3AVOA 2E5LB 3L8YA 2NYRA 3WGHA 5FFFA 1MAUA 3DEHA 4PLCA 3RT9A 1S02A 2P27A 3MAGA 1MA0A 4YCJA 1EUYA 4BPRA 5IASA 3R5FA 4NU8X 3L0YA 2DWCA 1NXWA 3M49A 4K8OA 2WR8A 3OQIB 3P2MA 4NJMB 5IAOA 1MT3A 3ZCTA 4OL0A 3N07A 4C7OB 2K5UA 2DR2A 3E22B 1CF2O 4M6WA 5FOWA 3GZ4A 1N1DA 1HYGA 1UWCA 4KBYA 3RK0A 4D56A 4EKIA 1ZINA 4DRXB 1YS6A 1MZPA 4EJ2A 2ZZMA 2RARA 4XYBA 2R8EA 3KJNA 2CV1A 3VR0A 1NLYA 1WU7A 1ESMA 3DBRB 1YO6A 2B82A 2VRCA 4UNIA 3T7EA 1CYEA 4DLZA 2FF7A 3H86A 1QRDA 4K9NA 4XR9A 5SYMA 4CMCA 2YJ6A 3KSZO 3CZAA 1KAOA 2X4GA 3MJ4A 1PLKA 1IJKA 4I99A 1FTNA 3HABA 1G17A 2AFHB 4ZEWA 2PZAA 4DR4B 3RLIA 4RDXA 1JVNA 1U0GA 1ESZA 2OO3A 4K9KA 3EISA 1NJFA 1SUDA 3DCIA 1NU6A 3RI3A 1GSOA 3H2GA 1W5TA 3GZTB 3QKUA 4BO6A 3QBJA 1ONSA 2VAPA 2FZLA 4O2BB 4F4JA 2GKOA 1M66A 3PQ6A 2BEUA 3E9EA 3CPSA 2ASVA 3K9HA 2E4WA 4F6RB 3DKPA 5AT1A 4RA6A 3KM0A 1K27A 1SOVA 1KVUA 4PW0A 3HP4A 4Q05A 4F46A 2Z2JA 3B1WA 4ENTA 4UMEA 1N33B 1I33A 2WA1A 3PUJA 4L4UA 2IU4A 3H11A 4EATA 2H1IA 1RIFA 1ZVJA 2C00A 2P67A 4XSVA 1R6BX 3ABSB 4PG4A 1CKEA 4LWQA 1X1RA 4QYIB 1Z82A 5EI5A 4Z1MA 4B33A 2R8RA 5F21A 3IVRA 2C3UA 1Y4AE 1N2HA 1GUAA 4FINA 4OLHA 1A98A 1RMTA 1ZUD1 3D5EA 4TKVB 3URMA 4R1PA 4DV0B 1N2BA 1UC8A 1JN0A 4TZKA 5F5XA 5J40A 2YJ3A 3W9YA 5JTTA 3GLVA 5FRDA 1DEAA 1JMVA 4OB6A 1FFBA 4RA9B 4E0BA 2W83A 1DLIA 1KXJA 3JD3A 1W34A 4MH0R 5JBNA 4KSCA 4ZXPA 1DFIA 1JG2A 1WDWB 1VBMA 2QT0A 2VBGA 4WJKB 5AVQA 3A4TA 2R60A 2CNOA 1ADGA 1PK9A 1VGQA 3SEAA 2I2FA 4L8GA 2X7XA 2GAOA 2ZJ5A 4IUDS 5B1IA 5KVAA 2WD8A 1Y3FE 3EDMA 3RVSA 4ALJA 2AX3A 2ZJFA 4HN9A 4C0QC 3R0ZA 4I1RA 3MT0A 4B3MB 1NNLA 1SB8A 4FD2A 4Q1CA 2XB6A 4CMIB 5HTOA 1TVKB 4OU5A 3O82A 1ZN2A 3CZ5A 3EEOA 1DUIA 1U9YA 1A8HA 1H5UA 3NJRA 3KVYA 3UWPA 1U3WA 1YIOA 5AM1A 4Q24A 2I1LA 4BFCA 1ZITA 1IBLB 3KAKA 3G5AA 1E5LA 4POAA 4X00A 1U1GA 3JAWA 1I4DD 2HTEA 4OFBA 4EJFA 5TXGA 4AM8A 2JA1A 3TN7A 4RW0A 5DASA 1NF8A 5T3YA 4XWWA 2C7QA 1A97A 4HWGA 4JSYA 4PZZA 4LF8B 3B6IA 1H65A 1OTXA 4IX9A 4O0LA 3PFBA 3SDSA 3KZXA 4F4CA 3OWOA 4HH4A 4AQDA 4CFZA 3QEBZ 2NTVA 3PQ4A 2UUAB 5EJ6A 4MB0A 2QTLA 1XU7A 3DAYA 1ZRSA 3DXYA 3BMNB 1M34A 5CD9A 4HNTA 2F62A 1T43A 1BXRA 2NSHA 4JLBA 1FPQA 1E0DA 1VMEA 4EB3A 3KAPA 2V7QD 2QSYA 2VHCA 3AU8A 2H6EA 3O1HB 4BAZA 2P9QA 3U7JA 2FKNA 3OBIA 2QMYA 4TTRA 2QQ5A 2RGNA 3EQ9A 2BEWA 5KYYA 1ZH6A 4RVSA 2VZLA 3GD7A 1AKMA 2H4XA 1MB4A 4RH3A 4UVIA 5CNJA 2ON6A 2WHQA 1I80A 5FV7A 2GN1A 2L0XA 1JQJC 4YCBA 4OB8A 2NNLD 5CXXA 1WY5A 4G67A 1OTHA 2AL7A 3WGZA 1XUOA 4QXRA 1SJ9A 4R2XA 4UMFA 1BKDR 4DARA 1QHIA 4RAOA 1UBRS 4HZUA 5A9SA 4YJ3B 2W2LA 3R0QA 1U02A 1XF9A 1E1LA 1P7CA 2ALJA 3C3XA 1E2KA 2DAPA 4RYDA 4UXJA 3M83A 4WLUA 3WZLA 1NP7A 1FSPA 1EGVB 1RYEA 1UBLS 2HO5A 1X3SA 1EGHA 2V65A 3HCAA 3PC8A 4LXIA 3D4BA 2J46A 3EXG1 5IDVA 2HQ1A 3ECAA 3HVJA 4DCGA 5BQ3A 4GE3A 3VZBA 2FPGA 2D2XA 1GSHA 3F6PA 4R0VA 3L77A 1R4AA 3GLFA 3BHNA 1J24A 4LYJA 3SC3A 5A0TA 1ZNQO 1NOJA 1IHXA 1OWLA 2R7AA 2W2MA 3B60A 2RSLA 4H08A 1XFAA 4JL5A 5AK0A 5F4BA 5DHFA 2FMHA 5DPMA 3EXFB 2JJ1A 2AUMA 2DFVA 2NTEA 4E2WA 2O0LA 4CTOA 4UXIA 2FRDC 2UZAA 4KLRA 3B3AA 1BHJA 1ZEMA 2NQ2C 4UPVA 1FYWA 1C9NA 4XPZA 4Z3DA 3DVLA 2OPBA 2P9ZA 5A5DA 4AYWA 3NYQA 3BL5A 4P9NA 1E3EA 5F3RA 3VKUA 3V1UA 1S2IA 4MVYA 2WAAA 4I8DA 3HACA 1D0SA 4KKVA 4NBWA 4QJ5A 1DJQA 2MU1A 3QY0A 4CT4B 2R1VB 4QXAA 3WLAA 3ZV5A 5KSYA 4U4AA 3M4ZA 5H80A 4ENQA 3L6DA 2O7NA 1U8CB 3PJEA 5DNEA 5LB4A 1VC2A 3B1XA 3VTKA 3KTAB 1M67A 3S3TA 1A50B 4ZQFA 5JH7A 2R7KA 4D3YA 1RJWA 1NAIA 2AFIE 4V24A 4YREA 1N25A 4OBEA 4ZYUA 4ZVOA 3THXB 1KL7A 2FWBA 1TJYA 3N2GA 3VQTA 2GEKA 4G0NA 2HSEA 2XOXA 2E4UA 2VSNA 4OQYA 4LOIA 4QGFA 4QL3A 4WEQA 5FO0A 2Y27A 1HNZB 1L7PA 1P5ZB 2QIOA 1S8FA 4EM6A 5AUOB 3G9QA 1E77A 1F2TA 1YS9A 4N01A 1L5LA 2DM6A 4QT4A 4R3WA 1NZFA 2WM8A 1AOXA 2XE6A 2N47A 3FR7A 3L1JA 4FZ5A 3CNEA 1U8AA 1PSZA 1E4YA 3DT6A 3GRCA 3HR7A 2XNHA 1UBSB 1N2ZA 1SH7A 2A3NA 2EZ9A 2FUCA 2BRUC 3SM3A 4EGFA 3OF3A 4LC1A 3ZWWA 3MRTA 1VPEA 2FK8A 2HIHA 3PWZA 1LGYA 5EIFA 3RVQA 4OJQA 1C7QA 4ME6A 1BHQ1 3ZE7A 3AL0C 1ADFA 1LDBA 1UWVA 1QP8A 5EJEA 5JMOA 2JGDA 3TWOA 4BPBA 1GZ4A 2V0CA 1XAJA 5AJZA 3OZTA 2GK3A 4CKZA 2QGNA 5DLDA 4PSCA 5JY6A 5EYPA 1FP1D 3DB2A 2J0UA 3I01A 1VHDA 3QI7A 4MVJI 1RQXA 3IBFA 3C74A 4EABA 1HDCA 3B6KA 4YJ2F 3TFWA 4N76A 1B3BA 2WHXA 3PBKA 5IN4A 1UODA 3UQZA 2K7FA 3FF4A 1SKMA 1EE2A 2ZYGA 1E32A 3C4QA 4PQGA 2OVFA 2VC2B 4NEGA 3TTSA 5JXWA 2O6HA 3PEFA 1ZSNA 4KPGA 3UUGA 1NVBA 3AJRA 2RH8A 2B6NA 3ETEA 1A8PA 1BFKA 2OQ2A 2ZYHA 4U9HS 1O58A 2XKAA 2Q27A 5JAQA 3BTUA 1QF7A 2NIPA 3GFSA 3NOOA 4DR7B 2K4MA 3NBKA 3VO8A 3FM9A 1UBUS 3HI6A 1V3UA 4KQXA 1CZRA 2NU6A 1UP6A 2XNKA 2Z2YA 5CH8A 2DETA 5ALLA 1M1YE 4ZCLA 1SOWA 2HMYB 4IHAA 5TT0A 3C6QA 3KJIA 2DCUA 4L95C 2R7MA 5AW9A 4O59O 5KKCA 3FTFA 3MG9A 1HC7A 1XVAA 2QW1A 4K8RB 3LY8A 4IFTA 5H59A 2FMUA 1EFPB 4OYHA 4IO1A 5K0FA 5C2JB 2Z8XA 3MS7A 2IVZA 3P9PA 4L0DA 5GIPE 4WEOA 3RSLA 1SCIA 3A3PA 4BRUA 4F97A 1E1YA 2VP6A 3IESA 4J2HA 1Z3CA 5DNUA 3OBBA 3HHPA 1NXVA 3N3AC 4GKVA 4K81B 3WX0A 3X44A 2J3IA 4OI1A 5EOVA 4CLXA 4RO0A 5EMNA 4B43A 1J25A 3EPHA 4Q19A 2IU3A 1XQXA 1OI7A 2IOFA 3AJ9A 5E6RA 2JZNA 3NBFA 4KI7A 4PYJA 1Y48E 4HZIA 3ZHRA 4B3GA 4V03A 5KQGA 4LVOA 5DDIP 3VKGA 1RI1A 2GCOB 2GHQA 3LQQA 4LKRA 1ZMOA 2JANA 3I2JA 1NKVA 4FCWA 1RPTA 2J30A 4PYMA 1FU7A 4H1WA 3Q15C 1UMDB 5FORA 1RCUA 4MDEA 5TT1A 3GV0A 4D3SA 2AZTA 2VHUA 1Y7IA 2VUSA 3NNNA 4MVWA 2XUKA 3A3NA 1JIQA 5YASA 4DZRA 1QP0A 3QLUC 4KWCA 2CD7A 4EHIA 5I51A 3FKSD 1JAXA 2BPOA 2FPLA 4IRMA 4PVCA 3SMVA 4MV4A 4TUYB 1PGNA 1C1DA 4L6CA 3WDKA 1A7AA 1G2OA 3PUXA 4LX0A 1W0JA 5EJ4A 5JR3A 4N18A 3UO8B 3TAUA 3DJYA 6PFKA 1MJ5A 1Z4QA 4HDSA 2W58A 5DI9A 2GEDA 2FPSA 3ROZA 1ZJ6A 3HUUA 5LN1A 1RADA 3HYSA 4MYCA 2FWRA 4EKEA 3KWFA 2X0IA 1NVFA 3MHPA 3R0IA 2VQSA 2WFLA 3T1VA 3VPDA 2HFJA 1B42A 2JW5A 2A67A 4QNNA 3FE2A 1FMCA 1VL5A 3V46A 4M98A 3LZ6A 1GTZA 3OD5A 3QGMA 4ITUA 4XVHA 4EF6A 1IHYA 1CR1A 1XZJA 2OILA 2X2FA 2PL3A 3BSSA 3OIFA 4PYQA 4X3OA 2FGKA 2GN4A 5JJKA 2QL6A 1JS1X 2AFRA 4EG3A 1C30A 4YROA 1EBFA 3TOSA 3U62A 4L3VA 1WP4A 4AXXA 4G41A 1NMEA 3NTRA 5AW4A 1TJ4A 1WV1A 1DXHA 2E4YA 3I5AA 3RKUA 3WRXC 2IS6A 3I0ZA 2AB0A 5BOSA 3E82A 3TJMA 3T34A 1U28C 1XRLA 5I7EA 3T5MA 1UM9B 4Q9NA 3QKSA 3NHMA 4OO3A 1PHRA 4LVUA 3GRVA 5F5NA 5IVPA 4FFSA 5ADHA 4Z4QA 5JU6A 1BDHA 1PQPA 3REQA 1ZBQA 2XXBA 3VISA 3Q3CA 4L5JA 4AJEA 1QRSA 3PXDA 2WP0A 3FROA 4R1LA 3QPWA 3TLGB 4ILKA 1YQXA 4M36A 3CS3A 2HSGA 3VYUB 2XWSA 3OFNA 4W5JA 4Y2HA 3LOPA 4LF7B 3RODA 1QF6A 4NNOA 4K03A 4JI6B 1A9TA 1J8VA 4MW9A 3W05A 4ARBA 4QVIA 2RAUA 5TY0A 3HNPA 1JW9B 3OTQA 5E9QA 1L5MA 1E3DA 2DHRA 5B1HA 4PXSA 3RYIB 1COWD 1PR9A 1ZMRA 3MWDB 5AQEA 5FWXA 4EYEA 3TMKA 2ZSJA 1FJXA 1Z0JA 4ARZB 2XXAB 3ZW9A 2MMCA 4BIIA 3WGNA 1H0KA 3VKVA 1MW9X 3WYFA 3OQBA 5HILA 5JMTA 4OKSA 1W0CA 4DMLA 3MTEA 2R5WA 3ANMA 3MS4A 821PA 2C4HA 1U7WA 1UXIA 2CHEA 2XV1A 3P0RA 4FDTA 1WUKS 4MQ4A 1O6ZA 2Y68A 3QFCA 4LJKA 2AXQA 5CVDA 5DSZA 1C3OB 1VJTA 3H19A 1OREA 4M9XA 3UJPA 5LQNA 2ECOA 2OBXA 2PG3A 2XBMA 2O19A 4NS4A 4GG1A 4OLAA 3ADCA 4JYCA 3GK3A 3C6MA 2MSNA 1RHMA 4NECA 3RHSA 4B9AA 5L6MB 4YC7A 3FHLA 1E3WB 1S01A 4A0RA 5A05A 4PY2A 4Y9UA 1EUDB 3V4VB 4BX8A 3NVKI 3ETHA 4YPOA 5E6SA 3B12A 3IVMA 4O0MA 5E6UB 3GLGB 3UFBA 3WI7A 2VQEB 2C42A 2O3JA 3QJ5A 3ZLBA 4EMTA 1AA9A 1C8VB 1N0VC 3SN6A 1DBWA 1T8YA 3NRCA 1KRXA 1B26A 1LSJA 2AS0A 2DUNA 3A6GA 4WZAB 5CVEA 2G1UA 3FYUA 4F45A 1SKUA 1YRAA 2J0EA 2PT5A 3B9PA 4L4ZA 1BNCA 2ZWAA 2E4XA 2XNCA 3GJ0A 2M9MA 3N28A 3PFIA 4DEXA 4GU5A 4GBGA 2BOVA 3N2KA 4U7DA 2PGIA 3P9KA 5KJCA 4GS5A 3Q41A 3AL3A 4LYEA 4JASB 3R7NA 3G8BA 3RNLA 4D9EA 2I99A 1DBSA 4C0JA 4Y6GB 1PEDA 2BFBA 5L4LA 3DJFA 3O4JA 1QC5A 3B6JA 3GJ5A 1OBVA 3FCAA 4HAYA 3ETLA 1R4NB 4ED9A 1U1IA 3E9ZA 3JYPA 4H4CA 4JJ8A 4J7AA 4LCJA 2A7XA 1V2GA 2ZIAA 4JYMA 4KMSA 5JEEA 2WIKA 4KIFA 1GADO 4C43A 1YR3A 3B1ZA 2BFPA 1U0BB 1QQ7A 3IP9A 4NF2A 3UXEA 8OHMA 3PEEA 2I7DA 4EFNA 4B71A 5DP2A 1KZYC 4NU5A 4M7RA 4CF3A 3QBTA 3QZUA 5LVAA 3ODGA 1Q7TA 1VYUA 4LE0A 2BHRA 3Q5EA 4OJKA 4V0SA 4DG5A 4JYZA 1CRZA 4R9RA 4LNHA 2MSDB 2ZAOA 1UJ4A 1PG5A 4HBGA 4NFLA 4F9TA 1DAIA 2I6TA 2IX9A 5BMOA 3ZIDA 3BWBA 4UUOA 5FPHA 4TL6A 2ABWA 2O52A 4HVAA 5DHRA 1Y1TA 4CLRA 5JSQA 3WIVA 1YZQA 2GQ0A 2RK4A 1LQTA 2WE7A 2O4CA 3D2LA 3G8CA 4OBBA 4BN5A 1C0KA 4KXVA 4MRMB 1HLDA 5CA1B 3LO8A 2QSZA 1JQDA 2R84A 1IZ8A 4D9JA 4ZYTA 1Z28A 1NM5C 2B8TA 3T3DA 1EAMA 3QUBA 2YC4C 2QAGB 4J03A 4U2KA 2VOJA 1G18A 3EH1A 4HDMA 1QE0A 3TLMA 3OQMA 1GDTA 1IEWA 2E5FA 3LCUA 2F3SA 4TWIA 5HKKD 3CLVA 1N5MA 2X1HA 2QD2A 4MUIA 4BB5A 5EXSA 2HLHA 4AMVA 1L4EA 3RYFA 2Q6TA 1TMGE 2QK4A 3R7FA 3T15A 1I5RA 2L69A 4J75A 4YJFB 3TSYA 1NATA 3NHBA 4IZOA 5EKSA 1R0KA 3SDZA 2CLKB 4G5HA 3ZCVA 1WDLA 2EHJA 2ZTLA 1V3TA 2L19A 4PBTA 1G42A 1QK4A 1TTPB 2VF4X 2BD0A 5AQ1A 4UE2A 5BSUA 3VC1A 3QPAA 3MTAA 1UMBA 2VNIA 1OFIA 1RWQA 3K5HA 2A9FA 4ITVA 3SJ7A 3UGKA 4JT2A 4DB4A 4IH4A 4B9EA 4FFRA 5ER9A 1XD2A 4AYXA 1MOPA 2XE7A 1SIBE 1YT5A 3SKXA 1KK1A 5BVHB 5GP1A 3KPYA 1LF5A 5F64A 4OIMA 1JTVA 5KTOA 4WD3A 3FN4A 2QYOA 2DFTA 4O4HA 3VBEA 1GQOA 1N6OA 3HGMA 4AAYA 3L49A 3KKZA 4M88A 1PL0A 3WO1A 2C2BA 3U7QA 3D5QA 3VMMA 3FRHA 1NIJA 3MFQA 2G0AA 1FP2A 1XQVA 3C6BA 2I67A 5EZSA 4DQLA 2QMZA 3R9XB 1D1PA 3PFWO 1NQVA 3QWIA 1T5IA 4I0WB 3TX2A 4HGZA 2QRUA 2BFEB 3EXEB 3I9V6 1R5BA 1SZJG 1RBMA 1VKHA 1SC4A 1WLSA 1XRJA 2JH3A 2Z04A 4OP3A 4HX5A 5DHTA 3H8WA 1NKTA 5AKZA 4A1FA 4HWOA 1XA0A 3UKDA 4WAUA 3D7KA 5EPOA 3N86A 5LYYA 2OHIA 1MC5A 1YZUA 2IYQA 3TS1A 5L7WA 2CJWB 3FI9A 3PA8A 1DXQA 2PUJA 4HLDA 2CXSA 5F3DA 3W8RA 4EOGA 2Q3LA 1BMFA 5ARDA 5ALRA 1JHPA 2BHNA 3OQ1A 3ZX5A 1AH2A 4EKNB 4CEIA 3MGCA 4I5DA 5AI0A 1S8NA 3TL3A 4MYHA 2GKGA 3TB6A 3UIEA 3K9GA 1K6JA 2X0RA 3GQBA 3HB9A 4H59A 1EDEA 2CLHB 3PXEA 3LPDA 9LDTA 1GUYA 3THRA 2WKWA 2AYZA 4TX1A 4Y7DA 4YV0A 5FFNA 2POQX 3U5TA 4DLNA 4IZIA 3WQQA 5K9ZA 4KE7A 1QGOA 5HRUA 2ZRKA 2BBWA 1L5NA 4BC0A 2JGEA 3R74A 3CUWA 4IKEA 4I1VA 1I1OA 4ZT6A 4CMHA 1SCUB 5EG5A 5I45A 1FDTA 3I01M 1GAQA 2R7LA 3GVXA 3P2EA 4P2GA 1CULC 3TNDA 1YJ8A 4NESA 2CHQA 4NMHA 1U4SA 2IEAA 3P0JA 5KNBA 3GFPA 4K3UA 1OVMA 2J4CA 1VHLA 1OF1A 1BU5A 2AZMA 1V8PA 4LYGA 2GYWA 2ENWA 2FVXA 3EFOB 3JTEA 4IWNA 4JVOA 3USES 2IS1A 4W5NA 5IS2A 4X1YB 3ASVA 3VOTA 4KO8A 4IUBS 5EWMB 4JQCA 4A15A 2O2HA 3ZKWA 4WZBB 1JX6A 3W79A 4OBWA 4YRCA 2A9JA 4LXHA 3NVAA 4L51A 3BXXA 4NBTA 2XUFA 4HAXA 2VTDA 1W4RA 3BSYA 3JQEA 4YRQA 3AVTA 2GPWA 4BP9A 1BXZA 2BFNA 4LYDA 4RPIA 1M2WA 5FUBA 5MFPA 2I0FA 1N6HA 4JJIA 1LDYA 1XZBA 1THMA 2X1MA 2X6RA 1E66A 1Z06A 2VDNB 2C5SA 2AWOA 5HUQA 4D8YA 3OAAA 1G8MA 3AUXA 2QX6A 1WUIS 1DG9A 1A95A 1QO0A 1ZW1A 3ES9A 2IYAA 4LEIA 5CIQA 4US2R 1QH1B 3GJQA 4FDVA 1U80A 3IUEA 2LXNA 4H1TA 4FC6A 2IYZA 2XY4A 4LWOA 4ZQEA 4N8DA 4WTOA 2OXFA 3WIDA 5KVCA 3VC2A 3HXLA 1WVIA 1TZBA 4MVJD 4LMPA 3QFTA 3WOVA 7REQA 1G8GA 4G86A 4NCIA 1PX2A 4WJZA 2QL9A 4WPGA 4YIKA 1FRFS 2Q8QA 3C7CB 4JIGA 4JVNA 3SS9X 2IXFA 2QQ0A 3A26A 4IFIA 4C7KA 4L8WB 2W6ZA 3AX6A 5ICFA 4JLDA 1WMAA 3VYRB 1BDJA 4J8PA 1CEEA 4ZJUA 1F0PA 3ORRA 5JALA 4Z4GA 1VE3A 4RZSA 5KO2A 2WPDD 4J76A 1FRZA 3S2YA 3VHLB 3IQZA 4JA0A 2TS1A 5AWFC 4Z9AA 5DCUA 5EUCA 1EFLA 3C4JA 3DE1X 4XIFA 1NU8A 3E7XA 4GL4A 4KQJA 3IPRA 4BNYA 4DFDA 1DRWA 4RS3A 1U0FA 4XX0A 4GVPA 1RFLA 3D4NA 3NTQA 4F6LA 2W37A 2G17A 1R1DA 2ZRDA 1YL6A 4QPNA 4UM9D 5JSUA 1UMCA 2WJ6A 4PPQA 1PR0A 4RK0A 4INAA 4EHBA 4NCAA 6Q21A 1WCXA 3WL8A 3TCNA 3B2EA 3QVLA 3KKLA 1X8XA 1THGA 3JQ9A 5EN4A 4YQFA 5JMWA 5H02A 1VP3A 4X1IB 3SS7X 1YZYA 3O4GA 4PCLA 3WGGA 3ZPXA 6ABPA 3K1ZA 2YWFA 2HHLA 1Z7WA 3K8ZA 4BQQA 4NE7A 3GPLA 1V25A 1Z4MA 1SCQA 2WA2A 1JT2A 4BMZA 2LPMA 1YMVA 3M81A 1XZLA 1GCOA 1W4LA 3H0KA 2ORED 3JQ7B 3R5KA 5TPZA 4BAUA 4YMUA 2FI1A 4RQUA 5AM5A 1SG6A 4REQA 4E13A 3ZVMA 1Y1QA 1J9EA 2FR1A 4A7PA 1XCOA 3CW8X 2JH8A 2XI4A 2FTKE 3KDPA 4PYNA 1Q2UA 3ADOA 5EUMA 4M76B 2A30A 5DWQA 3PXGA 4CR6A 2ZATA 3SKYA 2RGBA 3BWEA 4WFJA 1Z7EA 4EUFA 4MVJM 2EX0A 2AVNA 2AFIA 3VGPA 3WIUA 1KEZA 2NYVA 3LL7A 4AKGA 1VQ1A 4OMDA 4QA9A 4D02A 4C5CA 2E1RA 3E3MA 2X8AA 2IEBA 3PHJA 4GHWA 2LR0A 4OJNA 4BFVA 4LSZA 4AUNA 1ZN8A 3V8PA 2BLNA 5JNRA 1WXDA 4MA4A 3TQIA 4NCXA 2H63A 1H6BA 2W0SA 3K30A 1FNMA 3HCWA 3L0DA 1GKYA 1PFGA 1SXJB 2C9ZA 4JUDX 4S24A 5JS2A 3JVIA 4RJIA 2CYCA 1KBZA 3I6ZA 4IJWA 4LUCA 3CT4A 4NK5A 1OZFA 1OZ0A 2C7VA 1HETA 4CQLB 1N5JA 4FCCA 4Z8XA 3RT7A 1MC4A 4DADA 1N1GA 2C2OA 2AXEA 3FJOA 1PZEA 1N2GA 1X1TA 3KJQA 4Q3LA 3ZX4A 5BN3B 5IULC 1BW9B 2X7JA 3S2IA 3N8HA 2WG0A 3PR2B 3QVVA 4V1CA 2AG1A 3DTVB 3TR5A 1T8TA 4TM7A 2ZETA 2QX8A 1A2KC 4PLPA 5EMJA 4U5QA 4BLWA 2PRYA 3DCJA 1PZNA 3AY3A 4DMHA 2IXEA 4EB6A 1J39A 2CE2X 2Y8EA 3MB8A 3EW7A 4X93A 5AW5A 1K8YB 3RASA 5I3CA 3CUVA 3EVGA 3GGPA 1M7BA 5ELLA 4OHCA 2NVOA 3D7RA 4L1KA 1MO6A 3PGMA 1QUFA 1YR6A 4MQLA 2J3KA 1U6IA 3FB4A 4A0QA 5BUSA 3RAPR 4RVDA 5ECGC 1MBZA 3O26A 4QUAA 2NU8A 4ZGGA 2QN1A 3HEMA 3RWMB 4YR7A 5CLFA 4QDOA 1EX1A 1ZK3A 4KLZA 1TFRA 2ZSEA 3U48A 2B6HA 1PQWA 1QVVA 4B7AA 2OC4A 3A04A 4HEJA 1PZFA 2H0AA 3OKCA 3RREA 3WO0A 4L15A 4NBUA 1KQGA 2O7QA 4K1LA 3VYVA 4M6WB 2I8LA 2ZPUA 3QP9A 3GVPA 1RAEA 1FBNA 3W2HA 4BP1A 3UQYS 1HDIA 3BSWA 5BSRA 4D98A 1BSVA 2BJHA 3W3AD 5FWYA 1EZ4A 3O92A 2BTQA 3RU9A 1L1QA 3IP5A 2CMFA 3GLHA 4KMMA 4LVCA 2M6KA 3DOFA 4MWGA 4IIYA 4O3MA 1H3NA 2FF5A 2LCFA 2A78A 5DYIA 5EIAA 1IHDA 3U0BA 4OQPA 1Z5GA 2EZUA 1Z47A 3HO8A 2D1FA 4IJVA 2AWNA 2EQAA 4LY3A 1TKCA 2IIBA 1IY1A 3GCZA 3H9JA 5JVDA 5IJXA 3H9QA 2ZPTX 2ZAGA 2RBKA 1YH3A 3EHEA 3PUZA 3QPVA 4F6CA 5CW2A 1I8TA 2G4LA 2KM1A 1AO3A 4WCFA 1E64A 1GLGA 2OCIA 4JA2A 2Y1FA 4QNMA 4B0PA 4E6EA 2WTUA 1XPUA 4G09A 5FLYA 3P26A 2BEUB 3W5IA 3SC2A 1TZKA 1TD9A 2SECE 2PE5A 3IC5A 3KTDA 3D6HA 5I3ZA 4RA6B 3EUEA 1HDZA 4N9WA 4MYRA 1X8LA 1YI1A 1RQ2A 4HB2A 1X0VA 5FBKA 3HNOA 2IY7A 4MUBA 3MMZA 2QX4A 4B7ZA 1QG2A 2Y0CA 3H11B 5CYOA 3IUMA 2WINI 3UJ8A 4E7OA 5FTJA 4YRGA 1RWWA 2GVNA 2C2MA 4ZMBA 1C7FA 2DT5A 4UVEA 1SG0A 2QA5A 5E4TA 3ZHSA 3P9XA 1J42A 3NBXX 1E0SA 1T3GA 1CQPA 2OYSA 3OX2A 4H2DA 4NG4A 4WFQA 5BSHA 2VRNA 3PFGA 1G38A 1VGVA 1LBHA 2HREA 4XD7D 1LKZA 2R2AA 3MQFA 2NUPA 3BM5A 1LK7A 3LE8A 1DAEA 5K3SA 2AHRA 5FAXA 1XNJA 1Y8CA 1ZOIA 2Q4EA 1YRQA 2PCJA 2PH7A 4HLNA 5I01A 4I55A 5LZ5A 5AHXA 1M7HA 5DIZA 4XYLA 2FUEA 1PE0A 3LA8A 4MEBA 3Q7RA 3OJLA 4CDMA 3BFJA 3H83A 1GP2A 1ZA2A 2PH5A 2P3QA 1MIHA 2WOOA 2WYVA 3H4IA 4U2GA 3V7WA 1W36D 1BVUA 2HMTA 4PANA 3UF0A 2CV2A 1Z6QA 2XUQA 4LOLA 4ALNA 5C8ZA 4OB7A 2C2KA 1BGWA 2HRQA 2RB5A 1UEJA 1ZVMA 2ZIGA 3AJAA 3SLKA 2J0QA 2K6GA 4HB4A 5FT9A 3IRVA 4EIWA 5E9AA 1Z39A 5IX8A 1ZNWA 3KUCA 1G2IA 3NASA 3GB9A 4UMVA 4M3NA 4EAAA 1VIAA 3WKAA 1CS0A 1OXTA 3FI0A 2L42A 1OC4A 4QYXA 3T9AA 2O8EA 3GEPA 3JAWB 3DNPA 3RVJA 2VATA 4BXOA 3OZAA 4MV0A 4Q0MA 1IZ0A 2X6TA 3IT0A 3LP5A 3CO0S 1QPZA 1IQUA 2XQFA 5ENDA 5F76A 3D3NA 4DCPA 2QZZA 4YY3B 1C9KA 1SK9A 1SKYB 5F1KA 2I71A 3Q2IA 3MJEA 4ITRC 2VH5R 1VIYA 3EOAI 2GD2A 4QC2A 3G6WA 2YHIA 4XYEA 3UCFA 1XEAA 1M34B 4DY4A 3ADKA 1BXRB 3OJCA 3E0XA 1T6XA 2QVLA 5JJCA 1PL6A 4CMIA 1JIIA 4D45A 4X5OA 1GG2A 1DIHA 1LLDA 4NH0A 2Y1LA 1B8VA 1CC1S 2EP5A 2FRXA 2JLRA 1U0SY 2Q9CA 4FR0A 4EW6A 3C1AA 3GBPA 1F8UA 3VOAA 2BEWB 2H7YA 4JAVC 5CAEA 2YV1A 5KYYB 2FOLA 3SU8A 3GCXA 1R4ZA 3TG2A 2OQIA 2H9AA 1FFHA 3L0CA 1V9LA 5CTAA 2E55A 3BJIC 4KLCA 3RE1A 3F4LA 4CV2A 3AVUA 1T2NA 3OE1A 3FCSB 3GF4A 2J0SA 3ZTTA 1VTKA 1B4DA 1UM8A 2P9YA 3NGLA 4HZUB 4M9RA 5A9SB 1IDN1 2CVHA 2O7RA 1WETA 1E7MA 2DLDA 2DSTA 5IAKA 5B6JA 1QH9A 3H87A 4YUAA 2HA3A 3GRKA 3OZEA 3V1TC 3FDJA 2CBXA 3AEUA 1JQAA 2JFZA 4ILEA 4JLAA 1LXCA 2Z9DA 3A58B 4KQ1A 4Y6LA 4ZI2A 1IN5A 2FPGB 1EHCA 2NU7A 2Y05A 5KU7A 5GONA 3UBTA 2CSXA 4PV7A 1A0OA 3VYWA 3OLYA 5DGXA 1J8DA 1SWVA 3RIGA 2QZ4A 1TADA 3MILA 3ASUA 3RCBA 2X22A 1U98A 1TQ2A 2G5PA 1P7YA 3H9EO 3W2FA 2KYRA 2ZJYA 2LWIA 3B38A 3C5VA 3JAKA 3LC0A 1DLJA 3ONFA 5K0EA 3CYFA 3E9MA 4HAVA 1Z0FA 1IN7A 4MUAA 4BUCA 1HRKA 2RGWA 4KZPA 1E1MA 3ZHYA 4Q5IA 3BE5A 5IG2A 2ZS7A 3UHPA 4UHDA 3NIGB 1EFRD 3P52A 3QW4B 3MWJA 2N75A 4C3UA 3R5SA 4ZMSA 3U19A 2B20A 2X9GA 1GAWA 5F12A 4OQEA 2NP7A 1G8PA 2RJ3A 2VDMB 3PK0A 4QWMA 4HK4A 3ZWDA 4EPXA 5KDLA 3NHWA 1XNGA 2R2GA 2JGNA 4LZNA 5CT8A 1E9FA 3ZHCA 4C1BA 1SQSA 4X0EA 1P60A 1T2EA 2IOFK 2W8BA 4ARAA 5F7ZA 1H8HA 1VHJA 1P1RA 3AF2A 1NJGA 5JH7B 3KXKA 2VT2A 3FOEC 2P79A 2O06A 4UAGA 1U5AA 2QRJA 1ETUA 1PFVA 5DTRA 4D4GA 2I4LA 3ESQA 3N2GB 4LXYA 4X8HA 1TCUA 4D3DA 1E6UA 2BFOA 1PT8A 2XDQA 4DZTA 4CEJA 1J0DA 1EB9A 4GBJA 4NYIR 1CQJA 1F3LA 5AXBA 1F2TB 2R4TA 3CUYA 2IQIA 1C8BA 1RPAA 1D4OA 1T8RA 1TCVA 1GG8A 1NQ5A 2WIAA 4LOHA 4E3WA 2EJUA 2VUHB 5KSWB 4TWAA 1PG0A 1DJNA 1DTWB 2AG8A 2G63A 2PS3A 2DJIA 2FDCA 1JJVA 1P75A 2JGLA 2J8ZA 4DQVA 1TYBE 4ZOQI 5K3OA 2Z0MA 5KYVA 2V6GA 3BWMA 3LUCA 5LXTF 1YAHA 3FVRA 4H7PA 4S1TA 1Z5UA 1RRMA 2JGDB 4NMMA 4V3BA 4ESHA 2RE8A 4HFNA 4QJ4A 4TSRA 5EYPB 2DOKA 5DHPA 2J0UB 2G06A 2QLMA 2QJOA 3O3NB 4Q82A 5GPBA 1MFPA 2FEXA 3KPJA 4TLBA 2CWDA 3B3JA 4ZVNA 1Y8AA 2YY5A 5ITWA 1XEWY 2OO5C 3EGOA 5IVHA 2ACVA 2QXUA 3AI7A 4B6JA 3C45A 3LUFA 3GLTA 3Q7SA 3NBYC 4QLOA 1D7AA 1PGOA 2C9MA 2JD2A 1P5FA 3F74A 4X97A 4E7PA 1ZRHA 5DGTA 3HA7A 4FOSA 2PJRA 2C1XA 1DKUA 2JFGA 1FU4A 3P2YA 3ZK8A 5ABPA 1Q1GA 5JT1A 4OAPA 5BN4A 2A9KA 2FZEA 3HO6A 1DBRA 2FRVA 3CUUA 3ICOA 1NMXA 3I6BA 2I6SA 2P91A 2QMUA 4HS9A 4ND4A 1IB0A 3S70A 1PBNA 3UW3A 4WKPA 5KOYA 5FDFA 1JZSA 2NU6B 4N7JA 1BE1A 2YWGA 3IJRA 3T0IA 2P9BA 1DG1G 1LX7A 3ETJA 4FXPA 2H0RA 1N9KA 3EVZA 2EW1A 3ZE1B 1J33A 3O8OA 4FEAA 4I50B 4IZ6A 4QX6A 2ZKLA 3H65A 5BQFA 3AKYA 5ALOA 1Z63A 3DCNA 5J2TA 1DKRA 4BNUA 3H84A 2II6A 3LXRA 1GM5A 3LKBA 4DSNA 3BL6A 3PFFA 5KU1A 2FSIA 4MRNA 2HK6A 3TO5A 1S1CA 1Y8QA 3PL5A 2I55A 4RPKA 2P5TB 3R6LA 3N8NA 4LQDA 1WZIA 5C1OA 5C1DA 3ZW8A 2Z6VA 3D5TA 1YVUA 4TT3D 5JWHA 1QE5A 3A6FA 5TGZA 1HORA 4JI3B 1KDPA 2HA7A 1U3GA 4KXXA 3SS8A 1UZNA 1NR1A 3ZCQA 4YT2A 3B5IA 5E6RB 1T4GA 2HJRA 2QVZX 3FJ1A 2C54A 3NTOA 1PK8A 3PR1A 4HEA1 3SEQA 2QD1A 5LA6F 4AL4A 3GW8A 2GTPA 3KETA 1CF4A 2FU5C 3K2IA 2WSBA 4LF5B 1HNWB 4CUKA 4BE9A 3LRPA 4F06A 1ZI8A 2MSWA 4OLJA 1F9AA 5L3RA 1W6RA 1U7TA 5DBGA 4UBJA 5DNCA 2QT1A 3TVYA 1Z0KA 4XDGA 5KHOC 1OI2A 4P5PA 1W2WB 2H16A 2YS7A 4ETWA 1PNRA 3WDMA 4PGFA 1ECGA 3RSSA 4UU1A 2MSEB 5CFZA 1OYWA 3OECA 2XMGA 3VSCA 1NVAA 1QSGA 3DNMA 3TLEA 3EG9A 1C1DB 3QFRA 2RHLA 2YRXA 4FFVA 4R51A 1KHTA 4LK2A 4BASA 1PT9A 1NPYA 3S29A 1Z74A 4C9BA 1TW3A 3U49A 2W48A 1E4VA 4DHEA 1RRGA 3CG4A 1T8WA 3MT9A 4ZJZA 4HDSB 4LV8B 1EDBA 3KD2A 2AW3A 3TLBA 3KT6A 2H92A 4MKRA 2ZDQA 3GMTA 1AUVA 2Q1TA 5F9HA 4Y6PA 3OJWA 3EDCA 4EENA 5DK4A 1P7VA 2IBMA 1RRPA 2WFLB 3QKWA 2YV4A 1JSZA 1HTTA 2Y93A 1P2GA 2PH3A 4R40A 1KSHA 4EYQA 1NNEA 2YOFA 4JU8A 4FMDB 3SQDA 1FYEA 1MX3A 4FGKA 3H2KA 1RQRA 2EWMA 4U7GA 5L6LB 4X6XA 1C30B 4RWZA 3QXCA 1OH8A 1CY6A 1AC5A 2WB4A 4JVLA 5JWOA 1RKXA 1XKQA 2I76A 3T7IA 1PJ2A 1G2QA 5BR4A 1ML4A 5TRTA 1SGWA 4KTVE 5BOSB 1Z6ZA 2PZFA 1B1AA 1H4SA 1JR3A 1V8FA 5F1YA 2P11A 4LC9A 2GSWA 4UZEA 8ABPA 1BVRA 2EW2A 2ZEJA 3CX3A 3QKSB 4FZRA 2AQHA 3TLXA 1KDVA 4DNXA 5I7UA 3HVRA 4KMOA 3G7UA 2VPWA 3QLVA 1AXGA 4GMHA 4K87A 4MARA 5K3DA 5E4YA 3CJRA 1QJCA 3M6IA 3F96A 3AFGA 4HRVA 2P9GA 4Q1FA 3TTWA 1Q16A 1L7OA 1IOVA 3I9FA 1N0IA 3QV1A 1AB5A 5GWXA 2VRWA 2B94A 1NF3A 3CZ4A 3T12A 4CEHA 4XDZA 3L02A 3G79A 3CRW1 3QWFA 1N7HA 2IV7A 3HCCA 4MAMA 4WXPA 3MSCA 2VP0A 2DJ5A 4TS1A 1VJ1A 2OPHA 1XDBA 1WPRA 3T3EA 4R2IA 3UMVA 5CBPA 4G2TA 2QQFA 4G5OA 4TXNA 2DPYA 1ZWLA 2LZ0A 1RAAA 2PUTA 2X0EA 1N2IA 1G3MA 5CDFA 4GKKB 5IC6A 3SIRA 2AYYA 2VP4A 3ZIAA 1H94A 1AN9A 3U4DA 4GR9A 3S44A 5FWXB 1ZGBA 1U3DA 1J6UA 1B93A 1SEPA 2BGJA 3P0HA 4PYIA 1VECA 2ATVA 5F35A 3E1GA 2PIAA 4YPFA 4KR7A 5LUBA 4EECA 1XLTC 1P1KA 4UUNA 3UMBA 1I01A 4OHYA 4BO0A 3II6X 3UA3A 4Q6BA 3WB9A 4Z5XA 1OGJA 2G9UA 4X8OA 4M89A 5TEVA 2JGKA 5ES3A 1E9EA 3W34A 1RRKA 5K0SA 5CEFA 2Q5JA 1JEYA 4EUNA 4ZO8A 1L5ZA 3PS9A 1HA3A 1DC5A 2GT1A 5AKKA 4KSBA 3IPCA 3LKDA 3H5IA 2H5EA 3I61A 5E6SB 2YNMC 3DDWA 3CUSA 1ZFNA 3S40A 3T9EA 4KYVA 2P4QA 2PFKA 2WEKA 2Y0PA 1C0PA 5BYJA 1LWOA 4EAQA 3LO5A 2HOQA 1C4WA 1ZMTA 2JBAA 2JIZD 2OHGA 3FYUB 4IXNA 2IW3A 4LA4A 3BD9A 5AOCA 3UWDA 2I2AA 4F2HA 2N1BA 2Z2ZA 5IBQA 3SC6A 4PR3A 3RC8A 2P1ZA 2I8CA 3N2KB 1L4YA 4ZO9A 1A1SA 1XD8A 4IIVA 5LDGA 4DIUA 4EYKA 5BUQA 5JANA 2IYUA 4HWRA 3BIFA 2ZSAA 2CXPA 4JK3A 4GDFA 3CHYA 4R9VA 2JIOA 5B3KA 1EWKA 1E3QA 2MHCA 3BXFA 2H85A 1U7XA 1PTJC 3UG7A 5GINE 2BFBB 2EVWX 3DEYX 1ID8A 1QC5B 1ZL0A 3F6RA 4PGHA 4TTAA 5U4XA 1LBTA 2WBLC 3CLSD 3ZDYB 2GZ2A 2OCKA 4BNDA 1KF0A 3EVFA 2WWVD 4YTEA 4NABA 3NJ4A 4FM9A 1XMQB 2XB4A 1Z36A 4Q47A 2GM4A 5JE8A 5JC1A 3HJUA 1RHQA 4XRRA 4K26A 4B35A 3H42B 3JARA 5CH5A 1K6MA 5AJXA 3D81A 2BTOA 3LYLA 1EFKA 4QRDA 1JKXA 1SCNE 3TE6A 3C0KA 4EF4A 2P9HA 4PX3A 5JTUA 1GZVA 4RMGA 3HJTA 8ATCA 3FZGA 5ICMA 3HO1A 4I8IA 5FL7D 3C8DA 1ZUWA 4N39A 3ZVLA 5F23A 3ASYA 3KU1A 4DB2A 1NBWB 4UDNA 3PGVA 4WT7A 1IBCA 4U9IS 4CLRB 4YAEA 1KR5A 3KX2A 3D2CA 3SSAA 3TG8A 2ARKA 1Z7YA 3C87A 4A2PA 3WLRA 1OY1A 4F9EA 5A03A 2ZRGA 1G7CA 1H8HD 1JLRA 2IV2X 3V97A 3WIBA 2WF6A 2C78A 1QNLA 1TJ5A 3EIHA 4JGGA 1P5RA 2Z5LA 4MWTA 1O95C 4J0HA 2PGLA 2B3DA 4Q3DA 1ZJJA 2OQRA 4HDMB 3I62A 4K05A 2W8ZA 3HDYA 1G8HA 3IP6A 2HA0A 2J7PA 3DEZA 2QXTA 3R0VA 4Z51A 2Z56A 2P1DA 3RKRA 1Q22A 3GMIA 1O5TA 3RYFB 4HEHA 3UOAB 1WDTA 2C58A 3J7TA 1XZKA 1NUSA 4MHOA 1HE8B 3GP5A 2Y1CA 1YJ5A 1Z08A 3CNQS 3RQSA 2PEYA 4DLKA 4XW2A 2CBGA 1AKRA 1J8YF 1ZXXA 1AF4A 4GW3A 3F78A 1SD1A 4F8EA 1N5OX 3O7MA 4UCWA 3OZFA 1FTSA 5I9SA 2XECA 1E79A 2PS0A 1GUFA 2FPUA 5C1BA 2CLLB 5KOIA 1JQLB 2VJYA 3WLNA 3A36A 1UMBB 4RHTA 1Q20A 4BVFA 1VJDA 3S55A 2XVXA 5KC8A 1XJWA 2R68A 3K05A 2Q3EA 2QENA 4L50A 3I6QA 5EIHA 4WOJA 4DLWA 3RYCA 4OVKA 5BNZA 1XF1A 4F3RA 1XD2B 3FPAA 2ZCVA 2IGTA 4MWDA 1NR7A 1ZM3A 1T9DA 3ZV3A 1UFRA 1B7GO 3GAFA 4KN6A 4QXQA 4BLOA 3FFTA 3C6YA 1GRRA 4PAQA 2YXPX 4DWVA 3CV3A 3IIKA 4BLSA 4HQKA 5EY5B 3DMNA 3A6JA 3ENQA 1J23A 3U7QB 4GYJA 3ZNNA 2ZLBA 1R8SA 2F48A 4HPXB 3LCMA 3AH8A 3NHKA 2QX7A 1QIKA 3WV5A 4LG1A 4XWOA 2IODA 2V6MA 2C29D 2ODQA 3O8CA 3SVTA 4C07A 2I9KA 1IM2A 1RWVA 3KD3A 3TDMA 5IT5A 3GRRA 3UGTA 2Q1YA 2XVAA 3DV2A 3M6MD 1FX0A 1Z68A 4KBFA 2JZOA 3CLKA 4RLSA 1HTWA 3F3SA 5GJCA 3SY8A 1WMFA 1YKGA 3W7AA 3WOHA 5L7YA 2HY7A 1TO6A 4AO6A 1BXGA 2ZANA 3TM5A 2ZI4A 5LNK1 1P9NA 5IPFA 5CVUA 4ZVRA 3M5DA 2D0OB 3ENVA 3FUTA 4MQ6A 1F8FA 3N0VA 1WX1A 3IMCA 1V8DA 2GFQA 5JY1A 1X87A 1JFRA 5BNIA 4CEIB 4O1MA 2C97A 3FZQA 1IN1A 1HSOA 5AKEA 5H82A 3EZ9A 2AH5A 3GQBB 5JJ5A 2QTBA 3PRYA 5EJ2A 3DG9A 7MHTA 4D4HA 4IFBA 4GPEA 1AZTA 2EJBA 4CMEC 3QBDA 4R2JA 5KI6A 5IMSA 3B6MA 5AKGA 1CRQA 1RKQA 3L9XA 5EUBA 3FHJA 3WHPA 3KZCA 4OH7A 4Y1RA 4RSGA 1Z29A 1XMXA 4OXKA 4HG2A 1XGKA 4KR9A 2ZSDA 2Y1WA 2Q4TA 2PK3A 4YCCA 4CNBA 4I2VA 4TLAA 2P0AA 1FYVA 3GAZA 3T1QA 1WUYA 1X7ZA 5JSYA 4RVHA 3OTGA 4RGYA 1Q74A 1DC4A 1R0YA 3DV9A 4HYEA 5ALEA 4C4PA 4YV2A 3MB5A 4KV9A 1A2QA 3TEJA 2BY4A 3DFMA 4GZMA 2HL6A 1IZ9A 4LNAA 2LDXA 4Y2TA 3ZKWB 3Q1KA 3N59A 3NO4A 4QYMA 2QY6A 1E1QD 2HU5A 4IDFA 3V4SA 2YFYA 1L7VC 4JBWA 5FA6A 3ZY2A 5TMEA 2RGRA 3LW8A 2GZ1A 3A1CA 1TMOA 2JCGA 5IBCA 1LSOA 2B8JA 2NM0A 2IYLD 2VQ3A 3IP8A 5A0FA 4FMPA 4KUGA 4PIVA 3TMAA 3WK6A 2FUKA 2V6JA 2TMDA 2X0JA 4S35A 3VVLA 4AECA 1JI3A 5A7GA 4CN9A 5GZ3A 1M75A 5M3BA 2C4VA 2HPAA 3B5JA 2NPOA 3SG0A 2JFQA 4FKMA 1YZGA 4IH9A 4AZTA 1H2YA 1MG5A 3F3MA 5LMCA 4WCVA 3QE3A 4ZDJA 2O3RA 4JV5B 2RH5A 4EGJA 3ANTA 5IAJA 3AGPA 3N3BC 5LP6F 2B78A 3PKJA 1IK4A 1C1YA 1H6AA 3BYZA 4GI5A 5IN5A 4ZCSA 3RG2A 5JNWA 1XP8A 3LWDA 4U3JA 4ZVMA 1EA7A 2GEBA 2H18A 2OVBA 2AKYA 3PHHA 4MV9A 4FS8A 4Y7CA 3R09A 4GX0A 7REQB 2B1QA 4Q21A 4F3NA 2P0EA 4YP0A 4Y98A 4HC4A 1XELA 4BYGA 3Q7QA 3IAS6 4P3XA 3UGJA 5AVWA 3KYBA 3M6LA 3C14C 3DE7X 3LYAA 4IWYA 5FOVA 3EH2A 5DW3A 3ZWQA 4J29A 2QRNA 4RVNA 2FG5A 1FS4A 3HBJA 4IBOA 3JRWA 3K0BA 1SXIA 1U2EA 3H05A 3U0VA 4UNNA 4NYJQ 2VIIA 4KGXA 2ZR0A 1WXQA 1F6DA 2PLWA 1FSFA 3KUKA 3LTEA 4JC0A 1YL5A 4XX0B 3F90A 3LNTA 2CLIB 3A1NA 1UC5B 3RFCA 3UT6A 1UMCB 2Q6KA 2RONA 2IHKA 3PVSA 2OCLA 4Z2YA 5KWVA 5EXTA 4GGPA 4IIJB 4FFDA 1P3JA 3NRJA 3BJRA 2CDRA 1YVPA 2J07A 3HBFA 4OQQA 2VJMA 2NO6A 1PGJA 4XQEA 4LWPA 3UK7A 4A23A 2LRHA 5EWJA 1UCFA 1ST3A 1TMYA 3ZNQA 4YYEA 4OXNA 3GH3A 1HSZA 1Q57A 1WE2A 3O8RA 1QCCA 3A4VA 3V4FA 1G8AA 2NZXA 3KC2A 4L9WA 4CHTA 4DKXA 5K0JA 2OOKA 1B8UA 3AIMA 4LJ8A 4KIWA 1KK0A 5DNYB 3D6FA 4KDEA 1C29B 1AKYA 1LB1B 2XDAA 1GPNA 2DRIA 3H5NA 1R16A 5CLQA 2AFIB 4C4AA 4EW1A 3IX7A 3C1OA 2WFAA 5GQSA 3ISTA 3AM4A 3G49A 3L3BA 5JECA 2FOIA 4ARSA 2QTWB 3CNHA 3K0FA 3WGVA 5HP4A 1JRLA 1QGDA 2JFWA 1UFOA 1NW6A 2BF7A 4GI3A 1W75A 2Y0BA 5DLQC 3OQ6A 2PU5A 4X92A 4D26A 4HMPA 4I19A 2PA3A 1VSTA 3LUJA 4P4SA 2GD0A 3DR5A 1C3XA 1G55A 3BMXA 4GRIA 4KQCA 4QEZA 1WD7A 3OTOB 2QEQA 2JB9A 2ECQA 4X7RA 4JP1A 4YJ2A 4ZCIA 1XTQA 2JKVA 3JQFA 3N76A 2DE0X 1B0UA 1KZ7B 1QHGA 2OFXA 2VF8A 3G0GA 4JLJA 4OREX 4QQKA 2EXXA 1X80A 4TZ6A 4U2EA 2EKZA 3ZWBA 1NQTA 4IGKA 3KB8A 4YRIA 4V1CB 3C6ZA 1YQGA 1PEKE 1TNDA 5A3JA 4DV7B 2EGHA 3LUKA 4HQ6A 1IZYA 5G1PA 4AMGA 2YY7A 5K8VA 3ROPA 3VH3A 4EB6B 3BFPA 3EQ6A 4N8EA 5A5VA 4RF5A 3HUFA 3Q8LA 2ECFA 3JU3A 2JLUA 1AUOA 4P54A 1G291 1FA9A 1V7ZA 4BWVA 1P5JA 3LDGA 2QR3A 2DR0A 2QM8A 1PT7A 4IIGA 3SOZA 4EO4A 3D4OA 4PFSA 1NHWA 3SJUA 4W5RA 3BGWA 1A5SB 1I0LA 2NU8B 1YU6A 2E87A 4XX1A 2MYUA 3J80A 1KS2A 2Z1NA 4OMFG 2PMEA 3DL0A 1E2BA 2P78A 3F9RA 3PEWA 4JP3A 3RKSA 4HZGA 2WMNB 3F9IA 4FPXA 4LDJA 3WLMA 2DULA 4MUYA 2WILA 2GAJA 3C5HA 5ALXA 4KYIB 4YALA 2EG9A 1NX9A 2ADFA 3MRXA 3OLCX 5HCUA 3OJ0A 1UK6A 1U3UA 3VKWA 2IEGA 4IMRA 4BU1A 4YLYA 2R66A 2WF7A 1ST2A 2AKAB 3GP3A 2QUHA 5FWYB 3LW7A 4YCAA 5J59A 4UOQA 3TW8A 4BX0A 4PRLA 2JI6A 4BNWA 4IEFB 1IATA 1KMIY 1N3LA 3AOEA 3GLHB 4FIDA 3W90A 1TKAA 2HJSA 4JNKA 2WT8A 2HLDD 3KEQA 5F7JA 4XASA 1W9MA 2X0KA 2WJJA 5EIXA 5TMBA 4YFVA 2O7VA 3M89A 2QRVA 2SCUA 3NT4A 3QELA 2ERXA 3GVIA 4L0CA 1R64A 4JVMA 3HXMA 2OORC 2MIIA 1CNMA 1FYXA 3ILSA 5JVDB 5TNXA 4UD6A 2W4MA 4R5MA 1JLLA 2R79A 3IBTA 1E2FA 5HQTA 1B6SA 1DOAA 3UW1A 4WCFB 3ZUGA 4MGYR 3WXBA 1LNQA 3LUDA 4TS4A 2CFOA 4P08A 5TDHA 4DVJA 3DWGA 3HVKA 3SC2B 3U39A 1ILEA 3OPYI 1E8NA 2IXDA 1L8OA 1K63A 1QE3A 1PIWA 4MUKA 4A2QA 2AMVA 2HPZA 3I9LA 3WJ7A 1QYVA 4BRSA 1KI6A 1D4FA 5B7QA 3ED5A 1FP7A 3BJEA 1BO6A 2X8LA 1YVEI 4ZAZA 5FNZA 1MU0A 5CX4A 2BEVA 2ANCA 4YAOA 1F6BA 4NNPA 4RZXA 3ZEIA 1Q11A 3OUZA 4FNAA 2RHBA 4D9IA 1XTVA 5JD5A 1FVXA 1ABFA 3S5UA 2QORA 2EFCB 1DJPA 1CZKA 1JV2B 5CDTA 3O9VA 1XNRB 2FQXA 3CB2A 1BQ4A 1U9IA 2B7BA 2NUPB 4JBLA 4PG7A 1WQ3A 3G2JA 5CFQA 3GEBA 2O1XA 3QI2A 2NZYA 1QKIA 1EVZA 2JARA 3AKEA 1HK7A 4L4SA 4K9DA 4WY2A 4R31A 3DL4A 4I55B 3DOUA 2JJ2D 1RXWA 3H2IA 4UFNA 5CT9A 1A5AB 1AIPA 5KYUA 1EBUA 2PAAA 1MW8X 3E35A 5B36A 5FUXA 1NBOA 4HXGA 2OBLA 4LZAA 4YCNA 3ZW7A 1Z6YA 1G3UA 4BO3A 2COUA 3HSKA 4EYOA 3DDCA 1YCFA 4L8LA 4R1NA 1IG0A 4TLMB 5B1SA 4B3HA 3QG1A 1BE6A 4MQBA 1V8ZA 3U3OA 4K46A 2YFQA 4HUJA 1P33A 2VAWA 1N6LA 3K8QA 3E9QA 4LHXA 1CS0B 1YJBA 2P9TA 4B3XA 4EQZA 4DKJA 3IAEA 4JENA 1X9GA 2Q0HA 3P97A 4HMOA 4ZVKA 5GMOA 1B00A 5BO5A 3WAKA 4BXOB 2H1OA 1E2JA 4WK6A 3AVYA 4I6EA 1E0KA 4EY8A 4TXJA 2UVQA 2I3BA 1BYIA 3E53A 4N0PA 3R3JA 4WNYA 2XQKA 4BJ1A 2CVZA 2JF0A 4G1UC 1GL3A 3IOEA 1ECJA 3PNYA 4JJ6A 4JBGA 4ARUA 621PA 4HFRA 5JCPA 1T3TA 4HGYA 3DE0X 2X76A 5LBUA 2V5UA 1CUSA 2WJZB 2Y9MB 3L4BA 3PF8A 2GJ9A 2VA9A 3ODPA 4BHTA 1JG3A 4DJTA 4MIKA 5LOVF 2FMKA 1QCYA 4W8OA 3EZ2A 1BJTA 3CISA 1NN5A 1YWGO 2P5YA 3MMPA 3OE7D 1Z3IX 2CJFA 4IDCA 1UC4B 2P2GA 4DHWA 4TKZA 3IT2A 1SD5A 3BH7A 1MABA 2I22A 4OYYA 5CT4A 5CAEB 4FSDA 4AJ2A 1Z2EA 4HV4A 4B31A 1RCFA 2DHDA 3PNMA 3RU3A 3OO1A 4BLUA 4F96A 2GDZA 4JB8A 1TQDA 1E6WA 4DLVA 1LPBB 2IP2A 4FHEA 2O8DA 1S0UA 3D8BA 4EYGA 1FFSA 2J6CA 2QKYA 4DLBA 3EGVA 4KHPB 1IYZA 1XD9A 3L8CA 3FRIA 3UAGA 3K94A 3CWQA 3AW8A 1KNXA 1TF5A 1VRVA 4G0PA 4OK5A 1S2OA 2PTHA 4C30A 1E5TA 5FF9A 2AFVA 1VZ3A 2JD0A 3GUUA 2EBHX 4LY9A 5HDBB 4E5MA 1V16A 2VP5A 3MUEA 3AEUB 3RUAA 2FP4A 1QBGA 3BULA 2Q4DA 3L7DA 3K0EA 1FUUA 4DSAA 5BRNA 1L5YA 4Z7NB 2NU7B 1JXAA 5GONB 5EVJA 1TW2A 3QE0A 2FWJA 4HWPA 1KRWA 3FETA 4UDXX 1Y81A 4N0DA 4O4IF 5JCJA 1RJDA 2I3DA 2X0NA 2PD4A 4EPVA 5LR6A 3JAKB 4DILA 3PB3A 1NQUA 4FI3C 1H23A 1WJGA 2ZZNA 5JWRA 3QTBA 4CM1A 2H2WA 3AONB 2X86A 1MAHA 4P2BA 1I2CA 2ZYUX 4Y6SA 3ZHZA 5DU2A 1A2BA 3KR0A 2MYPA 1XXHA 4ESOA 3MWLA 4KU4A 4NK4A 4YMLA 2IXGA 2NZJA 1VHTA 5BV8A 4HLUA 2Y71A 2YKGA 3WLEA 5FUMA 4NATA 1GGNA 1P2TA 3H5AA 3PGA1 1NZDA 2ZT5A 1P77A 4X3PA 2BKUA 1C5KA 4JI5B 5HZGA 1G3QA 1D1SA 4WFKA 1T3LA 2XJ9A 1TYAE 4BVBA 1CY2A 2IZ5A 2JCXA 3EVEA 1ZGJA 1AJEA 2UUOA 2WI8A 1JQEA 1NZJA 1OMOA 2W8BB 5J1SB 1SBZA 1G19A 1UZMA 3LCJA 1Q7EA 1Y63A 4UPDA 3W6NA 2Z57A 3MD0A 3RGGA 4ZZ0A 1R6VA 1WUJS 1X1EA 3SX2A 2ZITA 4YRLA 1KHHA 5U9CA 5K7SA 5FNVF 4YAIA 1HE2A 2A9PA 1Y1SA 1DC3A 1N6IA 2CDCA 1H2FA 4M0UA 4Z53A 2XDQB 4CEJB 3WK8A 4OQ4A 3VUFA 4EEZA 1CQJB 3C48A 3RTGA 1DB3A 4QGBA 3AUUA 4WN9A 3RRXA 1M5TA 2ZROA 2ACWA 4G36A 4FQ5A 4RD0A 3K6SA 4AJ1A 1KDZA 2D1TA 4NPAA 3B7GA 3FY4A 2H1WA 1MQAA 1EINA 4F9FA 3R6TA 3VZPA 2W43A 4Q3KA 1J0EA 3S8EA 3G2QA 3QOWA 2DPXA 3OHPA 3KELA 2GASA 4J0IA 2QPOA 1R27A 3IAM6 3BCRA 4NL4H 3UY4A 2I2XB 3N6VA 5I7SA 4U2CA 3OOHA 1LLFA 3RS4A 4W5TA 1XI2A 3L1VA 4LGCA 3DE2X 3JZIA 4CF4A 3AI3A 5KYKA 1Y6GA 4CNQA 3ZDDA 2YWHA 1JDUA 2XB8A 3ZXIA 2HRZA 3TIIA 2BHLA 3V1NA 4DA9A 3WK4A 1GKKA 5HFAA 3X1YA 3SJAA 1Z13A 1DAMA 2B9VA 2R6DA 3RTAA 1WB9A 2OA0A 3GPCA 2QAGC 3DXZA 4PWYA 1GPUA 2ZSHA 3O8NA 2H5IA 5KDOA 3GFVA 2AI3A 5IWCA 4WLNA 3NB0A 3T9CA 2QRZA 4X7MA 1CUYA 3H13A 4MUMA 2RC6A 3QKIA 1ZYUA 4RKRA 1JDJA 2JC3A 4NH4A 1XG5A 1XTKA 2R751 3B1YA 1K3TA 3DZJA 1XTSA 5BN4B 4GKBA 3NORA 3W1WA 3ZG6A 1ZXLA 3NEAA 4HVTA 4XTRA 4YJKA 1GR1A 1TKRA 2J3LA 4NHOA 1KMMA 1E1DA 3VPHA 2L17A 2O8EB 3EHDA 3ZZTA 3FYSA 4GNKA 3LTNC 4D9BA 4QDXA 2WKSA 4YRKA 3O8OB 1L1RA 4W9NA 3OZGA 3U4CA 2VAMA 3PHBE 2ZE7A 1HE5A 3IAUA 4P92A 3G2IA 5J2TB 2A86A 4X8MA 4Y9SA 1RJEA 1ATZA 1ULSA 5CX1A 3ZCRA 2OGWA 2ZREA 4LWZA 5JSFA 3QXHA 1QRTA 4K9PA 4BO1A 1Y8QB 4JJ4A 4MYTA 1QZ3A 3COVA 3X1KA 4AMZA 1K3UB 3GU3A 1YZHA 5CCEA 4UULA 1CB7A 1D2CA 2Y9PB 5B3LA 1N77A 2EKDA 2EGGA 3OZDA 5HCIA 1WW3A 2H17A 3QVKA 1C7JA 2PZLA 4LBVA 4C08A 4QZVA 2G6TA 2PUWA 5FI0B 4M9UA 3THYA 4WECA 4EG7A 2V9ZA 3VAYA 3V7NA 2OB1A 1LVGA 4AZ3B 4JODA 4KXWA 1DQPA 2A0XA 4ERNA 3KKKA 3NHRA 5HS4A 1I4EB 2OXEA 1FFWA 1RPJA 5ISMA 4PZUA 4M8LA 3MJHA 4LHEA 3FUVA 1SBHA 1QAMA 4DV4B 2N46A 3AQ4A 5EHNA 3KHUA 2GLTA 1FEZA 4P3KA 3BZWA 4V0NA 4KREA 3N58A 2PMFA 2LTAA 2W71A 2D1SA 3T4PA 1VKNA 1AKTA 1FYDA 5GIOE 4URXR 5F52A 4IL5A 2Z2XA 1EK0A 3EG9B 1E3IA 4HYYA 1SHJA 2EQBA 4MJXA 4Q7LA 4MR8A 2W2PA 4R7TA 1AHHA 1MRNA 1GWNA 1WS6A 1DT3A 2IYPA 1PT6A 1CY4A 1GCIA 3EAQA 5FP0A 3UMCA 2E21A 5HTKA 1TO2E 2PL5A 2I9PA 4FGSA 1UQUA 4RF4A 2EZ8A 1YF3A 3IEMA 1C4OA 2PXCA 3UN1A 4Q01A 3CUEF 4A8JA 4UHBA 2YZ7A 1AKWA 3Q5DA 2CNBA 3WYNA 2R8OA 1V1MA 5MDHA 1LW6E 5K8CA 3FGZA 1E61A 1TA4A 2L18A 4LC0A 5T8KC 1VKZA 1ZQ9A 3SEZA 2J3EA 3CA8A 2JLCA 5DX0A 3RSZA 2GK4A 5IHXA 1GCGA 2E48A 1OAOC 2RD2A 1F3OA 1QWOA 4KACA 1VPWA 2TMYA 3DZ8A 4D9GA 1O6BA 2PM8A 2GWRA 1A27A 1G1MA 5JO9A 3AFNA 3FLMA 1JKIA 3ICQB 1AK1A 1XE3A 2B5VA 3OOWA 4WACA 3I9OA 2DFNA 2YZNA 4C0BA 4OX9B 4XZ3A 3U4MA 4QE3A 1CUWA 2X41A 3HA3A 2G4CA 1CUAA 3K31A 1Z6TA 1RYZA 4JQYA 1EZ1A 1DGQA 1ORWA 1D7OA 2DKOA 2IYSA 1OAKA 2QG4A 3PTZA 3V33A 5CR9A 4LDAA 5D51S 3T7KA 4PLGA 1A76A 1PHPA 2CKDA 3FOWA 3IQHX 3QM1A 3SK0A 5BXYA 3UNXA 2P3SA 4GMXA 4RVUA 5DTJA 1N57A 1WHSA 1I0IA 2AF3C 3FKJA 4OHRA 4J1TA 4CEHB 1P2FA 1SU4A 2GVZC 4G5QA 3M6VA 1I2DA 2IEDA 4H15A 1TIPA 1RJ9A 4GPTA 1EKXA 1JA9A 2OCBA 4FNMA 4UU7A 1ISSA 3JQBC 2G71A 5CBPB 5JISA 1W88B 4KJXA 3HY6A 1K8QA 1ZIXA 5FOXA 2WJIA 3D64A 1SQ5A 2BZ0A 2QVCA 3BB4A 3T5DA 4C05A 3L40A 4US1R 1GPLA 2UUBB 1DOZA 1EJ0A 2FSVA 4J7XA 1BROA 4ZANA 5B1DA 2Z6AA 3BGDA 3FOZA 2Q6LA 3ASZA 3EZFA 2GJSA 3NGXA 3OIDA 4E15A 3OTWA 1Q91A 1ZMBA 3LHDA 4GYYA 4ND1A 5KNCD 3U9TA 1A9XA 3GXOA 1EXVA 2AOXA 3G85A 5B57C 4MYDA 4KITB 3AERA 3TXAA 4PGGA 1KWGA 3GJXC 3LPCA 1U0NA 2H4HA 4HX9A 2CEAA 2VHQA 1T35A 1DKMA 3HPQA 1G6KA 1SRRA 3ICPA 3EDOA 2BKVA 4TTSA 2R00A 1W7AA 1JEYB 4OHPA 3UJDA 1CU1A 3KSRA 4EUSA 5EJ8A 5CD1A 2VYCA 5M29A 2AVDA 3IFSA 4PRZA 3N2ZB 2AC4A 4ZPXA 3DVSX 5ADUS 2GB4A 2PGJA 4AUEA 4G9BA 4REOA 5GVRA 4PPGA 3NBAA 1D2GA 3AVXA 4EW2A 4MQMA 4P83A 3UEOA 2UVDA 3VR6A 3UA4A 4WW0A 3TGWA 3ST7A 2BCJQ 3C8HA 4XGKA 1VJGA 1SM4A 2JBAB 3IQEA 3W6OA 1QOPB 1Z2NX 2I2CA 3GXBA 3NWPA 4KXLA 1WNFA 5DEOA 3FD8A 3RU2A 2POCA 5HGXA 5JZSA 2XADA 4D0LB 4ABTA 2IW1A 3VXKA 1PL7A 3QVXA 1LTKA 3K9CA 3E23A 4QWWA 2PDAA 5JQGA 4YRDA 2AX4A 5BQXA 4UOEA 5AM2A 1AXEA 2GN9A 2IE8A 1R6AA 3DBLA 3MWEA 3BDAA 1ISJA 2VYFA 2GAAA 3ZZ1A 4FDLA 3LXXA 4ID9A 3VH2A 2VEOA 2BE9A 5FEUA 1N1EA 3DAPA 3OFKA 2OGUA 3G7NA 4XQ0A 2AEEA 1SVMA 3I04M 4JCCA 2CXTA 1K08A 2CMHA 4KQ9A 4RK5A 4RSRA 4BNDB 4UTVA 1LS1A 4JOQA 1E9DA 4M1YA 3Q10A 2CNKA 1MH9A 1T9HA 2XNDA 4EX6A 4ND6A 2VG8A 3OFJA 4MIOA 4ARCA 1ORVA 1T4MA 2JNWA 3JARB 3LGSA 3RTEA 3SDBA 4YMVA 8GPBA 1AUPA 1IDOA 3EVNA 5C8XA 1Z7BA 4JHLA 1JHRA 4NFHA 3C98A 1D5WA 1GTJ1 2J6IA 3DEIA 3MCUA 2WTXA 1DX4A 4HD8A 2FKAA 2YWEA 3FGOA 5I5GA 1Z5PA 3UV3A 1JPUA 1T0IA 4PYKA 3WWOA 4DIKA 3RDPA 1SU6A 1NXQA 4GX1A 3LBHA 3LU1A 2PBZA 2R8ZA 3VJMA 1C3EA 4QPPA 1BJKA 2B36A 1QQAA 5AD1A 1T24A 2GBPA 4RACA 3ZBUA 1RHKA 4KLAA 5EHIA 1KAMA 3D8TA 1HNNA 2I65A 1YRHA 1DQRA 4TLDA 3E7DA 2JFVA 3LPLA 3BSFA 5EHGA 3WSWA 4BJ5A 4CQJA 1J20A 2C9DA 4QU8A 4RVOA 4LV5B 1LVUA 1F4VA 3OFSA 4P38A 2H1FA 2V7EA 3PLNA 4MKIA 3VKHA 3AF0A 1U1EA 4OHFA 3RABA 3V55A 3UG6A 2YJGA 1SN7A 5H4HA 2P4EA 1PKXA 3F5DA 2QBYA 2KLHA 3Q6NA 1B8NA 3NIFB 4K0RA 2INGX 5EKXA 3IB3A 3RGWS 4D9MA 1IVYA 2XJ4A 5D6NA 1R7RA 5JOQA 4XIGS 2J32A 2DFKB 2QMQA 4JBHA 3SSOA 3VZCA 1C4XA 1JE1A 3GMSA 3L5KA 3NGMA 4OM7A 2XUHA 2CFIA 2BMAA 4DLYA 1KH1A 1K7SN 1SNYA 1WNTA 2DBYA 4N47A 1KAHA 4AFNA 1EX6A 2W00A 4N0EA 1YNSA 1EE9A 2B5WA 2VI5A 3VZDA 4HS4A 4RD3A 1T8UA 1VZ2A 2GDJA 2GYYA 2WF8A 3H5VA 3LBYA 3QOFA 4R2LA 4TRRA 1D9ZA 3UT5A 5HIMA 3ZVKA 3RYCB 1O94A 2FVYA 4O2RA 5ALMA 5F3WB 1YOVA 4Y2YA 4TS3A 3TI9A 1YJAA 3KHSA 3TQOA 4BIMA 2XSZA 2O5CA 2IZ1A 4JI2B 3VR5D 4Q93A 4C4TA 3WNBA 4FONA 2ZIFA 1FJ2A 2Y1DA 2YJNA 1PFYA 3C1UA 4BLTA 5A5GA 3NMUF 1G66A 3NHZA 2WHYA 4DA0A 3TOXA 1XZMA 3IHKA 4B6OA 1W5SA 2JRCA 4MHTA 3X0DA 2P4SA 1X7YA 2X42A 1TECE 3AU9A 3NHSA 4ZCMA 3CNOA 3U31A 2C7PA 3FHTA 1JAHA 4ZCQA 2WD9A 4WY8A 3LPMA 3ZCSA 3DT8A 2WWFA 3KXLA 2DQKA 3RVKA 3UB2A 4RZQA 2AJBA 2W6ID 1DKPA 1KGSA 1WTAA 3EPLA 2PD6A 2JIMA 4RCVA 1KP9A 4LZPA 1FX0B 5JAOA 2ZJBA 4GC9A 1P4HA 3UJ7A 3NOXA 4TQ9A 1DJOA 3PIDA 4LGVA 3R0XA 4E5DA 3DP9A 4QPZA 2HHCA 1KO5A 4X90A 5DGIA 3EVBA 5DW0A 1KJJA 3E9YA 4WOKA 1J8QA 1W94A 1BXGB 1B16A 1FBTA 1IHPA 1ZD5A 2ADOA 4PAGA 4QOIA 2Q29A 3AP2A 4UJ5A 3RV4A 4KR6A 2ZQ5A 1WVGA 4G07A 3KO8A 2HLNA 3LSTA 3D0RA 2OHHA 2BFAA 4XUCA 1DQZA 1NBMA 3TXXA 2AOTA 1H2RS 4BZWA 2PGXA 2YVKA 1Y3HA 5BORA 4FX5A 3ZDCA 3SBEA 1YOBA 2Y67A 2H4YA 2V6FA 1TK9A 4NWIA 3T0GA 5AJHA 4N9QA 4JKOA 3CVOA 2XCLA 3U13A 2VSXA 2JHAA 1NAHA 4FKBA 5EE3A 1EI9A 3IAXA 4YT4A 5LM3A 4ZEXA 1M0WA 1WZ2A 4C4OA 4CFYA 2R47A 2GM5A 4MNTA 2NPFA 1QKKA 3BVPA 4JB3A 4PZLA 5JYDA 4BMDA 4CU2A 1JFLA 3CRQA 3OM9A 4Y1RB 1OFHA 3ZI4A 3KYDA 4QQRA 5LBTA 2OWDA 1EHYA 2CKMA 2DBRA 3ICVA 3V2UA 4UCXA 5G4LA 3LOUA 2VZEA 3WYDA 1BTOA 1X7ZB 2RKOA 3COZA 3IPXA 3OEHD 5LU9A 5IJWA 3I2YX 2IY9A 3E8SA 1F7UA 2VO1A 4BX9A 2REBA 1GGVA 2I91A 4N0MA 3G13A 1XPRA 3NBUA 1TRKA 4ZAGA 5C53B 4JLOA 1QP4A 1ND6A 1XZCA 2HZ7A 4CMAA 4E31A 4G24A 3ZEAA 3SFTA 4S04A 5JCXA 4QJIA 4UUBA 3ZHQA 3D43A 4B81A 1FOEB 5IK2A 5AVTA 2BZGA 2VTEA 2HW8A 1YAJA 1YVDA 2QN8A 2EATA 1O0BA 1FRVA 3NXSA 1FSGA 1PTKA 5HIAA 3JPWA 2WJVA 3VR3D 2HJ9A 4X9XA 3RRMA 1WUTA 4B32A 1G9TA 2YZ2A 4HDNA 3F8WA 1ANKA 5GJWC 4HN2A 1ECFA 3W7VA 3G0BA 2VHXA 5B64A 2VXYA 5JHGB 3GRPA 1AHIA 2NO0A 3BGOS 1X2EA 4XSGA 1S9HA 1T2UA 1EXWA 3QUCA 2PX2A 4Z3KA 1PVOA 3HU5A 4ZTUB 2G82A 1OE0A 1V6CA 3IKLA 4RSMA 2PIDA 5ITZB 5K03A 3LRTA 2HMVA 2LDBA 4C5BA 2RGNC 4JDPA 4X3CA 4KPUA 5AW0A 1HMPA 4WNAA 4W5QA 5I9LA 1IOZA 4U3JB 3H9GA 4E4RA 3BBPA 3H1FA 4MO2A 4DCVA 3PPXA 4HH1A 4CT5A 4RZUA 1K9SA 4X6YA 1SRQA 2NLOA 4B17A 1CUZA 1OWNA 1H6DA 4OFZA 1YONA 2BT4A 3QITA 4IS2A 1VG1A 3FVVA 4BFTA 4RTQA 1DBQA 1XNQB 4QASA 3JQCA 4RD6A 5C31A 1ZC3A 2ORWA 3U4HA 4EA9A 2J4DA 4JXXA 1Q0RA 3WE7A 1DU4A 3KVOA 4QD3A 1E1KA 2E18A 4ZODA 4M9CA 3ZH2A 3R6GA 4E5NA 1ZGHA 5CDHA 1YBFA 3PC8C 5ERXA 4GPIB 3QX9A 1PLLA 3BQ9A 4YQEA 4XFKA 4HF7A 2X15A 5E4JA 4K6KA 3SQLA 1RPNA 3DOCA 2XMBA 4C4XA 3KQHA 1NG9A 4IGEA 4AKSA 1DNPA 1Q0SA 5EEGA 3N0WA 3KEFA 1INLA 3WNVA 1VRCA 3QH4A 3JR3A 3T8YA 4AT1A 1T1RA 3DE3X 4GX5A 2C7RA 4L3OA 5EWJB 1UR5A 1MVNA 2NSLA 2BN4A 2CVQA 1O77A 3DDUA 3GLRA 3KL2A 2O2XA 3LOQA 4MRPA 3CU5A 4MRVA 1JIVA 2P41A 2UYQA 4DJEC 3S2SA 3K70B 2HPHA 1ZH8A 2HQBA 5CURA 4YMWA 2BZSA 1G3IA 2GNPA 3B78A 3NOQA 4B2PA 1JLKA 1X77A 1CR6A 3FNBA 2F7SA 3ILHA 3NP9A 4CL2A 3X2SA 5K45A 4YRTA 3FSGD 2FNAA 4LYAA 1H42A 2GBGA 1JF8A 4F85A 1YDFA 3K1JA 5FBWB 1GYRA 2HSJA 3RVDA 3Q8MA 5IAAA 5LXTA 1QU2A 1TK2A 3K0FB 4XIJA 3VSDA 4UAUA 4DA8A 2QIPA 4WLVA 3UM9A 1U1DA 1RYBA 4I81A 5JXIA 3A4YA 4RQTA 1EQAA 4NEHB 3LF1A 1ZD8A 2FN7A 1QO9A 1Z0UA 3CSUA 4LK3A 2HDNB 4KXFB 5K0NA 4M8KA 4GPAA 1IHUA 1QMGA 1WXWA 1RQPA 4P4SB 1HLFA 2O2JA 5CUQA 1UJBA 1JJIA 3GCDA 1XCLA 4YJ2B 2UDPA 1DO0A 1IEVA 3LQRA 4J3JA 3X2FA 5A3RA 5LMZA 1P73A 3IMFA 4XM1A 5CB6A 3PDIA 1X80B 1R5NA 4KDFA 1FP6A 4DV5B 5ETJA 3I8XA 1OV4A 3QSGA 4OK6A 4D43A 4GQBA 2JPDA 3VUEA 4UMDA 2ZUSA 3LFTA 5IH3A 3DFIA 2VWQA 3ONVA 5FBLB 1T1GA 1TDJA 3E4CA 4HADA 5B12A 2I7CA 1L6RA 4U7PB 3JCZA 2FPMA 1I2ZA 3L43A 3V8RA 1R00A 1WB4A 3DYVA 1E2EA 3UOWA 4C6HA 1YZNA 5BN1A 1JHOA 1C4KA 4BC1A 4F38A 4YCLA 1C81A 1R5JA 4J0GA 1N0HA 3W2IA 4Q7QA 3GA0A 2WWXA 2R48A 4WERA 4DC1A 3VKFA 4JN6B 3MMSA 3PYLA 4LY0A 1UAYA 3QYPA 2NU9A 3WL7A 4CKWA 5EL0A 4LAFA 4QEDA 5C80A 1UPXA 5AHRA 1YHYA 3MJVA 2HDOA 3V3TA 4D74A 5G0TA 2PCLA 4NCHA 3RS9A 4R1SA 3NC1C 5KOHA 5HZHA 2ZJ0A 3WR5A 3CKYA 3OPMA 4QOGA 2XVMA 2QVBA 5INTA 5LQJA 3UWOA 5ALKA 4IJQA 2W6PA 4FP9A 4RTKA 2I66A 3N6XA 4ZJPA 2IKSA 5ICEA 1NN3A 3LUBA 5CGZA 2XCSB 5C35A 1U9CA 1E2NA 1Q7CA 1JXOA 3EODA 3RBXA 5GY7A 3TW8B 5ITVA 5KNBH 1VCOA 4II3A 1L7MA 3KXIA 2JCVA 1UXJA 2ZQYA 5JYCA 2R5NA 3GRFA 1NI4A 3B53X 2BJVA 2OTCA 3O3OB 4UNPA 1YBAA 4FFBA 4LHYA 3EPJA 4TYWA 2CZCA 1G9XA 2BFMA 4H18A 2RIRA 4TTVA 5CIWA 5LA6A 4NU6A 3JR7A 3LWBA 3EB9A 3R3XA 1XRPA 2A0UA 2QRVB 3QELB 1RLMA 3SJCA 1JILA 3SKVA 7AT1A 3ZQ6A 2YX1A 4MX8A 4QBKA 2CFSA 1TEZA 4C4YA 1RZRA 1VCNA 4JKYA 1JLLB 1YS1X 4FR5A 1MP0A 5DN6A 5ECWA 3PTAA 1KEVA 3AJDA 5CT6A 1DSSG 3CH7A 1N4DA 1NFFA 5G4KA 2VDKB 4TYPA 2F1OA 4MPRA 3WL4A 3QLJA 1U0HC 1MJGA 3OCCA 2CLSA 5EHQA 4CRWB 1M33A 3PNVA 1M6HA 1AA6A 5DT9A 4YUZA 3FTEA 2BI8A 4NZOA 1KI3A 1Q1BA 2Q5OA 4CI0B 3DVAA 3C70A 1CCWA 1KI6B 2Q2OA 3EGIA 3A9SA 3G2LA