1MT3A

Crystal structure of the tricorn interacting factor selenomethionine-f1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mt3A00
4ZXFA 4MYDA 1EVQA 1XKLA 3AINA 3C87A 4UFPA 5DNUA 1FSSA 2V9ZA 5ALHA 1XROA 4DMKA 1DQYA 2GZRA 3BJRA 4J0CA 4KE7A 1CUGA 3JYHA 2GBIA 3SK0A 2OAGA 3MGAA 6YASA 3WYNA 1LLFA 5LP1A 5CT4A 5CRIA 3E3AA 2XUPA 1TAHA 4UUQA 1EDEA 1YASA 3H2IA 2VT7A 2HU5A 2WUEA 1MO2A 4CIAA 1WPXA 1EDBA 4H18A 3UUEA 2VSQA 3N0TA 4QDTA 4EB0A 4AZ0A 1QONA 5A62A 1CUYA 4X6UA 4C88A 2VJDA 2XQGA 4I3FA 2PPLA 4BDSA 1CPYA 2WG2A 3FCYA 5FV4A 1J06A 4H7FA 1ISPA 3GUUA 4DMCA 5A71A 4FLFA 5SYMA 4G8BA 3D0KA 4PV7A 3H2HA 5AO9A 2CJPA 2BCEA 1YAJA 4EBBA 4FNMA 4P93A 2OCIA 5JARA 1L7AA 3V1MA 4H7KA 4V2IA 5T4FA 1KU6A 1ZJ4A 3STTA 4Y7DA 1QJ4A 2QRUA 2HA2A 1BCRA 3DQZA 3AILA 2QKYA 4X94A 3M82A 4KAFA 3RARA 3AIOA 1KU0A 4M0MA 5HK8A 2WUGA 3D3NA 4HRXA 2VQ6A 3G0BA 4FHZA 1ZD5A 4QWMA 5JAHA 5CURA 5JAPA 4KE9A 4O08A 1CV2A 3O9MA 1XFDA 1DWOA 2HL6A 3B3QA 3ZV7A 2HU8A 3GELA 4X00A 1MNQA 1FFCA 4U2FA 2OG1A 3EQ8A 1XRNA 2DQYA 2WIGA 5DNWA 5AK6A 5EI5A 4B7ZA 1ZI6A 1ZGBA 3STWA 1NU8A 4PNZA 2RONA 3QPAA 3HZOA 1XZIA 4AMYA 4QLOA 1F0NA 4QZVA 3WK9A 2XE4A 1UOOA 2O7VA 4J0GA 5LZ8A 5HFAA 5I7UA 1LPSA 4U2DA 2WHRA 2VATA 5AJHA 1XLUA 3PFCA 1CUZA 1JI3A 3EQ9A 4JEIA 2PU5A 4G4IA 3MUNA 1QGED 3HYSA 1LZLA 1CQWA 2QUBA 3IUQA 2WFMA 3WWCA 3H2KA 2Z3ZA 4N5HX 2B20A 1QTIA 4B83A 2OQIA 5DTIA 3WJ2A 5H3HA 3FYTA 5C8ZA 4IH4A 4C01A 1MJ5A 2O2IA 2H9YA 4E11A 3G02A 1SC9A 1YS2X 5AKGA 1TCBA 2I78A 2XLBA 4BP9A 3UUFA 2DFPA 5CXUA 3WIBA 4U2EA 5K3FB 5HF6A 3G0GA 1CUUA 4B6GA 4BCDA 2PBLA 3KDAA 1EK2A 2WQZA 3WMRA 1MN6A 1XZDA 5D3ZA 2CEKA 4NVRA 2BKLA 2IX9A 1ZI9A 2C0QA 3V1KA 5AKEA 2QS9A 4QDUA 1DTEA 1VE6A 2RHTA 4YX9A 1ODCA 2VEOA 4BAUA 1ZI8A 2YH2A 4C4YA 4PW0A 5ALTA 5HKAA 4OB6A 3AIMA 2X8BA 1E3QA 4MEBA 3FAKA 3G7NA 4IH1A 3I2KA 1THTA 2OCLA 1J1IA 4FMPA 1BRTA 5DLPA 5ALNA 1BROA 4WJLA 5EGNA 2BUCA 3DL7A 1T2NA 4GWLA 3WLAA 4P92A 4BBZA 5K3AA 4AZ3A 1CUCA 1N1MA 1ETHA 4F0JA 1XZFA 1QFMA 4MQMA 3PUHA 5IH7A 3VXKA 2XUKA 5ALVA 3T52A 2JGIA 3WKBA 1G42A 4FLEA 4QDZA 1LPAB 3D2BA 5E4TA 5ISMA 4C4XA 2WG0A 2C5GA 3M83A 2JEYA 1USWA 1MX1A 5CXXA 2WJ6A 5EIEA 3L1HA 1QIJA 2VF2A 1QIFA 4LXGA 4DNFA 5HF8A 2QM0A 2XQJA 3DCNA 1L7QA 1SCQA 4BYMA 4W1PA 3IUMA 4DGQA 1CUHA 4ZGBA 3GZJA 4PQEA 1AZWA 5IVIA 1EB8A 1TCCA 4DIUA 2XDWA 5ALOA 4GECA 4OPMA 3IB3A 1ZD2P 2PSJA 1MAHA 1G66A 3FVRA 2ZYSA 3N2ZB 3PFBA 1IUPA 5EHNA 3VKFA 1CUVA 1XQYA 1IMJA 3C45A 3ICVA 5ALJA 1YR2A 2ZYIA 4X3CA 5JADA 5JYCA 1XZGA 1N5MA 2G5TA 3WYDA 4NMWA 4RNCA 1K4YA 1BN6A 2IIVA 3HXKA 2XUJA 5D3KA 4HAIA 3STXA 2VJAA 5T4HA 2Q0XA 1LPOA 3BDVA 2EDCA 1LPPA 5AM0A 4LYEA 4K6HA 1M33A 5JD6A 4NS4A 4XX1A 2WKWA 4HXGA 4JUIA 2HU7A 4L3WA 4Q82A 3DKRA 1CR6A 2R11A 4UBKA 1LZKA 3AUKA 3W9UA 2DHDA 1QE3A 2BAGA 1XKTA 5ALWA 1B41A 2J4FA 1BS9A 4Q3OA 5C8XA 2JGFA 4PSUA 1F0PA 4JNCA 4AXBA 1VLQA 3OM8A 5JANA 4CG2A 4PO3X 4TVKA 2XUHA 4ARBA 3WWOA 4XJVA 4JYMA 3I6YA 4WFIA 1GPNA 3STYA 3D4LA 2K2QB 4HZGA 1GQSA 2XUIA 2HFKA 4YK7A 2HM7A 3B12A 4RGYA 3KSRA 1AC5A 3WK8A 2VAVA 3HSSA 5KWJA 2C0PA 4MWSA 1EB9A 4IQ4A 4FBMA 2E3JA 1JMYA 5AP9A 1BEEA 2C7BA 4U2GA 1MAAA 3CCCA 2HIHA 1FFDA 4UBNA 5JATA 5D7BA 2BGRA 2XMDA 2D5LA 2WU4A 5DYYA 3OTQA 2XMBA 5ALRA 3I1YA 1A8UA 4D9JA 2OAEA 2Y2UA 2WJ3A 2WSLA 4EY6A 4QWWA 2Z3WA 3WIOA 1S8OA 3BE8A 1CUWA 3RKSA 2YYSA 1L7RA 3W9BA 5FP0A 5ALDA 3I2HA 2ZYRA 5CW2A 4H7DA 3P2MA 2PUHA 3MVEA 5CH5A 4AX4A 5HZGA 3ESCA 4Q34A 2ZJ7A 4G5XA 4X6XA 3AZOA 2HRRA 1CUFA 5KBYA 5I8PA 1ZOIA 4FNGA 2Y1KA 1OILA 3R3UA 1C7JA 1QIDA 5EIHA 2WTMA 4EZIA 1TKRA 4BAGA 3GBSA 2FX5A 4GBGA 4B81A 1XRPA 2HADA 4ZRDA 3U1TA 1GXSA 3VJKA 3W06A 2XUAA 1XRQA 5ALFA 1QO7A 4GEGA 5FRDA 3Q8WA 2RHWA 3C5VA 1R4ZA 1R1DA 3FLAA 4L0CA 5FLKA 1YCDA 4HTAA 4EA6A 1FFAA 1Y7HA 4F60A 2WIDA 3G9ZA 1CUJA 1CLEA 2H7CA 4J7AA 3NUZA 3WL7A 1SFRA 1F6WA 2ZJFA 3ZLVA 2WU3A 3A6ZA 1UOQA 5JALA 3S8YA 3O95A 2PVSA 1VA5A 4X90A 5DYTA 3DJYA 4BB0A 3BWXA 2ECFA 3L1IA 2XQIA 1DT5A 4M0FA 4UPDA 1AX9A 4UHHA 2BUAA 4C6HA 2RIPA 2HFJA 3O4GA 2GYVA 3F67A 1JKMA 1ODSA 3IUNA 1CUEA 5KWIA 7YASA 4ROTA 4GDMA 1AQLA 1E8NA 5ALQA 1K63A 1XRMA 1VOTA 4BCBA 1CUIA 4ZREA 3BXPA 3G9UA 5AH0A 1YAHA 2JGEA 3HACA 4LIPD 5FOQA 3OPMA 1GGVA 1NU6A 1W75A 1EA5A 4UHEA 1XZAA 1UKAA 3PF8A 3V48A 2CZQA 4PF1A 4H7IA 3RM3A 1PV1A 4UBOA 2Z8XA 4BE4A 4N8SA 3NGMA 1U8EA 2C58A 2AXEA 5AICA 1H2YA 4JYPA 3CXUA 2WTNA 4J0KA 1K6EA 1QIHA 2NW6A 5AIBA 5AOAA 2AJ8A 1O6GA 4CIBA 2JGMA 4Q3LA 2J3QA 5DWDA 1EXWA 2V96A 1YS1X 3OOSA 3DOIA 2FJ0A 1YA8A 1DWPA 5JZSA 1G5FA 2HA6A 4ZI5A 1VZ2A 1QFSA 5LKAA 2JGKA 2VJCA 1P0MA 4RE5A 4LYDA 3WWEA 3DL4A 4KRYA 4PSDA 5ALLA 1CFJA 1U2EA 3PI6A 1IZ7A 3H1AA 3ANTA 5JZBA 4Y2YA 4MWTA 2BJHA 4Y2PA 5EFZA 3ESAA 5E4YA 3BIWA 3IDAA 4G9GA 2BFNA 3FSGD 2GBFA 1GPLA 4BRSA 2FJPA 5AKKA 3QVMA 3G0DA 1X2EA 3ICWA 1WHTA 4AMZA 4DMFA 4G8DA 3PICA 2YXPX 1ZJ5A 4HXFB 4EY8A 2QMQA 2XMGA 1E8DA 1WHSA 3TEJA 5AM2A 1EINA 3D7RA 5AI9A 1AGYA 3EBLA 3JW8A 2WG1A 1VA4A 2ZVDA 2Y6VA 4K6KA 1X2BA 3E0XA 3EQ7A 4W63A 1GKLA 1H22A 1JJFA 3IUJA 2IITA 3WI7A 5K5EA 3C8DA 5ESRA 2DHCA 2UZ0A 1DINA 2HA5A 4LKOA 4DYHA 1UXOA 3QBJA 2XLCA 5LZ2A 1MT3A 1QOZA 1IZ8A 4CFSA 2DSNA 1LBTA 1XZCA 4BC0A 4Y2QA 4INZA 1XLWA 3WWPA 2EEPA 3WKCA 3WKEA 4Y2UA 4RPCA 2XMQA 3FBWA 1QIIA 1UT6A 1ZD3A 2XUGA 3YASA 3NWOA 5AHXA 4UFNA 4WFJA 2XMZA 5T4BA 3H0CA 1WB4A 3EF3A 3C6ZA 2ZJ6A 3G0CA 1GKKA 3WJ1A 4EHBA 3C6YA 4LXIA 2B9VA 4L9AA 4QDOA 3G9TA 1GT6A 5AKJA 5AKYA 3ZLTA 5HQ3B 5HFNA 1Q84A 4J03A 3NOXA 5AIAA 1OCEA 4UHDA 2BUBA 5A2GA 3F96A 2PL5A 4BCCA 2XUOA 3WL6A 3U0VA 4BVJA 1NX9A 2QJRA 3VISA 2OXEA 5AI5A 3H19A 4X97A 5C7YA 4AN0A 1FJ2A 4CCWA 3K9BA 4G1FA 3A2NA 1CQZA 3DYIA 4GXNA 1E8MA 1GZ7A 3FYUA 3HC7A 2OGSA 5BWCA 1KEZA 3WK4A 4OUKX 1A8QA 1YA4A 1JFRA 2OPHA 3AIKA 3R3YA 1XRRA 1UK9A 1CRLA 2XT0A 5JD4A 3HLKA 1VZ3A 1WOMA 4ZV9A 3H18A 3O0DA 4AO7A 3GA7A 5LIPA 2XMCA 4RE6A 5DJ5A 1X70A 4FKBA 2VT6A 5K3FA 5LKRA 2OLEA 2XMSA 4X91A 3LLCA 1QO9A 3KWFA 3V1NA 4YPVA 1XQXA 4MJ3A 4FBLA 4BRZA 1JU3A 1VXOA 1JJBA 5CT6A 5HQ3A 1O6FA 1BU8A 3R3XA 3STVA 1MTZA 1LGYA 1ZICA 1VE7A 2XI4A 3GROA 2C5FA 2PSHA 4DMHA 1EHYA 4IO0A 5AOBA 5FXMA 4B84A 3H2JA 5HK9A 1J07A 4OYYA 2PSEA 5AM5A 3CCBA 4QDXA 4MYSA 4G9EA 2AJDA 2RGUA 1LPMA 4U2CA 1DU4A 3AJAA 4P08A 2QUAA 1P0IA 1IVYA 2FUKA 4DNOA 3L1JA 3A2MA 3O4HA 1EI9A 5AM4A 4LHEA 3O4IA 1W76A 4H0CA 1GQRA 5A6VA 4J0IA 1TK3A 5FDFA 1W52X 2DCMA 2WLSA 1AURA 1VKHA 1RWQA 2XUDA 4QEKA 2CUTA 3OURA 1UFOA 5FPPA 2WILA 1YB7A 5AKXA 1Q83A 5DYWA 5ALKA 3KOOA 3ZLUA 5HKBA 5AKZA 1DX6A 2W22A 2RAUA 4TPKA 3VJLA 2V98A 5LZ4A 5ALYA 4BTVA 2WM2A 4K5QA 2YASA 3WZLA 3A70A 4G8CA 3BIXA 4YASA 3I2IA 3ANSA 5KREA 3Q0TA 3WK7A 1H2WA 1CUAA 1QIEA 5FKJA 2JGJA 5T4EA 2Z5GA 2HDWA 4OB8A 1JMKC 2X5XA 4QLAA 4AB1A 4KR0A 4A16A 1D07A 1ODTC 1XZHA 5HF9A 4CCYA 1BN7A 2QT9A 4OSEA 3H17A 3C8HA 4G4JA 3HJUA 2QJWA 4UHBA 3R41A 1FFBA 3V1LA 2ZSHA 2BGNA 5K3BA 4BDTA 3QH4A 3H04A 4OYLA 1PJAA 4F21A 5CT5A 1XZMA 1QLWA 2QR5A 3I2FA 1DQZA 5AI6A 3M81A 1MX5A 4ARAA 4A5SA 5AM3A 1HPLA 1UK7A 1H2XA 1SCIA 2B61A 2ZYHA 1ZD4A 4QNNA 3DD5A 3H1BA 3BL8A 2HA3A 1BCSA 4X71A 1R88A 1EH5A 1MU0A 5K3DA 3QPCA 4C4ZA 3S2ZA 3IBTA 1RYYA 1YB6A 1A88A 3HI4A 4AN1A 5CTAA 4BTLA 3PF9A 3SX4A 2GBCA 2WIJA 5J3JA 3WL8A 3PUIA 3R40A 4Q05A 3W05A 1XRLA 4W1RA 5BOVA 4Q1VA 3F9CA 2PSFA 4UHCA 3X3HA 4A23A 2XB6A 1WCYA 2VA9A 5SYNA 3PE6A 4W9RA 3LIIA 1U65A 4N8DA 4EY4A 1ZIXA 2B4KA 2Y6UA 4DTCA 5LLSA 2WJ4A 4Y2SA 3IURA 5EIAA 4M0EA 3AFIA 4W1QA 2CKMA 4C87A 1CUSA 3HEAA 4KE8A 2CMFA 2AJBA 3D5EA 2QXUA 4UBMA 1VXRA 2ACEA 1BEZA 2W6CX 3I28A 4X92A 5F4ZA 4FOLA 4FTWA 3C6XA 4DSZA 5CT9A 4Y2VA 4L72A 3WK6A 4WFKA 3DLTA 2AJCA 1N8SA 2VTVA 1DT3A 4FFWA 1JJIA 4TGLA 1UK6A 4WDQA 4EY7A 4GW3A 2HA7A 3W2TA 2P8SA 4PSCA 1A7UA 1I6WA 1TQHA 2CBGA 2R8BA 2G63A 1F8UA 3IIIA 5EHXA 2AJLI 3T4UA 3B5EA 1A8SA 4HS9A 4H35A 1Y37A 5K3CA 1EK1A 3WQHA 2VAXA 3WKAA 4DLNA 1UWCA 2QZPA 3ESBA 4GLBA 4UBIA 5ALEA 4N5IX 2XMRA 3WKDA 3WA7A 5IVKA 1XZKA 3AZPA 3DOHA 3RK4A 3CN7A 3KWJA 2G4LA 4X6YA 4OB7A 4XIIA 3ZI7A 3VVMA 5JASA 1CIJA 2WUFA 3ESDA 3DDUA 3QPDA 2JEZA 1C4XA 5K3EA 4BZZA 4KRXA 4GI1A 3G8YA 4FWBA 3C70A 1DWQA 1PFQA 3DKKA 5IKXA 3MUOA 4N8EA 1LBSA 3TRDA 5JZ9A 3LS2A 4Y2JA 1SOMA 1E66A 3H2GA 3D2AA 1CVLA 3R3ZA 4H7JA 4ITVA 1UKCA 3QMVA 5E2IA 4H77A 2OQVA 2GYUA 4B80A 2GBGA 4E15A 4UFOA 4OU5A 4NZZA 2C4HA 4EY5A 4Y9SA 3WA6A 2O7RA 4B9EA 3FWHA 5C8VA 4WY5A 1MNAA 2PKYX 2D0DA 3FVTA 1UOPA 2XUFA 4FDMA 4KAJA 4BC1A 1LPNA 5ALPA 3K6KA 1TRHA 3R0VA 2DQZA 4OD0A 2XUQA 2H7XA 1JU4A 2H7YA 4K6GA 3VVLA 1XQVA 3FNBA 2EDAA 4B0OA 4WDRA 2PSDA 2DHEA 3FYUB 5AK5A 4J0DA 2OGZA 5ALZA 2OCGA 2WUDA 4Q3KA 5JAUA 1C7IA 2QOEA 4ETWA 3JWEA 3O9VA 4MEAA 1K5PA 1W4LA 2WHQA 2I03A 4DNQA 5LYYA 2I3DA 4B82A 4W1SA 5ALUA 4ZV7A 4Y2RA 5BWBA 5E4JA 4K2AA 2GYWA 2WFLA 5ALGA 5A7GA 4E46A 1CEXA 4KJXA 4F5ZA 3E4DA 4I4CA 2QTBA 2RI6A 4BAZA 1T4MA 4HXEB 5AI0A 1WPRA 3I6MA 4X95A 5ALIA 3LIPA 1HDEA 3F98A 4IH9A 3QM1A 1E5TA 3BJMA 4FFVA 4CG3A 3IVMA 2GZSA 2LIPA 4WCVA 3HRHA 4H7EA 1H23A 2ONCA 4KE6A 3DYVA 4X85A 3CN9A 2QVBA 1EX9A 4I19A 3FYUC 5AK3A 1XZLA 5C81A 2WIFA 5BV7A 2DR0A 3LCRA 3FOBA 4BVLA 1G4HA 2JIDA 3VDXA 1ORVA 4XVCA 1EDDA 4FLMA 3WWDA 3DEAA 3FLEA 4BP8A 3F8SA 4MQLA 1Y7IA 3HABA 3D2CA 3I2GA 1P0QA 4E14A 3V9AA 5EHQA 1DX4A 4QE3A 3GFFA 3IA2A 2G5PA 5IVHA 1ORWA 5ALMA 4J0HA 5JIBA 4H7HA 1K8QA 3VJMA 3F97A 4QA9A 5DTJA 1UZAA 1R9MA 1RP1A 4BVKA 2Y2VA 2WHPB 1LNSA 5DNVA 2X76A 4OCZA 4MXDA 1U4NA 1ZGCA 3IULA 1IUNA 1CUXA 1HQDA 1HLGA 1YSCA 2QXTA 3EIOA 5LZ5A 5YASA 3FLBA 1MX9A 4DM7A 2J3DA 2J4CA 3R3WA 1XQWA 2Z8ZA 5AM1A 2O2GA 5AK4A 1WM1A 4B0PA 3FSGA 4Z49A 5CH8A 5LZ7A 4B9AA 1VJ5A 2PX6A 1QIKA 4X93A 3UMJA 4AQDA 4CG1A 5ALXA 2ORYA 3QITA 2ACKA 2JGLA 4JH0A 3QMWA 5AKLA 2JBWA 3WL5A 5CH3A 2HA0A 3ILSA 4ZWNA 2PM8A 3ED1A 5I9IA 2ZSIA 1HL7A 1B6GA 5A7HA 2O2HA 1IUOA 4CCYB 3O4JA 5JAOA 2OGTA 2VJBA 1Z68A 4KYVA 4UBJA 1UKBA 2HHAA 3DNMA 4Y2TA 4KACA 3I6ZA 1AMNA 1HKHA 4AO8A 3ZPXA 1UK8A 1AUOA 5AI4A 1SCKA 2WFZA 2WHPA 5AKIA 4UBLA 1HBJA 3AZQA 2OCKA 1OXMA 3K2IA 3A2LA 2H1IA 4BATA 2CB9A 4UHFA 5FPQA 1CUBA 5EHZA 2XQFA 4J3JA 2PUJA 4Y2XA 1QIGA 3SC2A 4OU4A 3QMMA 1WB6A 3M3DA 4HVTA 1GPKA 2XQKA 4U2BA 1JT2A 5LZ9A 4LXHA 2WFLB 5AOCA 4GHWA 3BF8A 2ES4A 1J2EA 4XWGA 5CBKA 4S0XA 5JD5A 1XZJA 1H2ZA 4X7BA 3BDIA 1W6RA 2JF0A 1TIBA 4WY8A 5CMLA 1Q0RA 1WB5A 3C6BA 4DNPA 4B85A 4BZWA 1ACLA 1AKNA 3G0IA 4IHAA 3LP5A 1N5RA 4HRYA 5AI8A 1P0PA 3G9XA 3D59A 2HA4A 5HF5A 1XZEA 3I1IA 4J0JA 3QYJA 4CI9A 3PDCA 4KAAA 3WZMA 3OC0A 5HCUA 1BE0A 2I3ZA 2WIKA 2PU7A 3QZUA 3FCXA 3RLIA 2ROQA 4KEAA 4EUSA 3I2JA 3BF7A 1FFEA 5ALSA 2HRQA 3W04A 1QZ3A 1XLVA 3TJMA 4C89A 1MPXA 3DS8A 3SWWA 3E1GA 1ZIYA 1R50A 1QTRA 4BE9A 5IVDA 3KXPA 3C5WP 1QIMA 1TCAA 3KD2A 3WK5A 1E89A 4P9NA 4G4GA 1ACJA 2V97A 5CT8A 1R9NA 3STUA 1W1IA 4DSAA 1R3DA 3C43A 5A7FA 3OG9A 5FUMA 5AKHA 1XZBA 1THGA 5D6OA 1EVEA 4AO6A 1Q0ZA 3ZWQA 3TGLA 3R3VA 1LPBB 1CUDA
chains in the Genus database with same CATH superfamily
3QE0A 2XADA 3JWIA 5DFAA 4XE5A 1PT6A 1Z4NA 3TBHA 3CC8A 4HNQA 1PJBA 4E22A 1EVQA 5ANRB 4EG0A 2CNKA 3AIIA 1Q0TA 1XJ0A 1FXWF 5HTOA 3C87A 1KAHA 4UFPA 1TYAE 3M89A 3DMPA 3M6WA 1MW8X 1YFKA 3OLWA 2GBLA 4I4TF 5TMEA 3GJQA 4BVEA 5ALHA 4CM8A 4J6FA 5B1YA 4IFEA 1BAPA 3BBLA 3NAQA 4BMCA 1DBSA 2GI4A 2OP0A 2P68A 3ZZTA 2G1JA 4M1EA 3WLNA 4MI3A 2OAGA 1VFPA 1AG9A 2XRFA 4XQCA 4YALA 3RK1A 4N40A 3WYNA 4KGDA 1FA9A 5JEEA 3FYHA 4J49A 1VLJA 1IVNA 1C9NA 2X2FA 3INYA 5E6SA 4B35A 4HNAA 1GLNA 2AT1A 5J2TF 5HQJA 1W93A 4UUQA 4FXPA 1YASA 3EISA 4OI2A 2XPCA 4F2GA 4OXRA 3PQFA 3UQZA 1FSPA 1FS6A 2P2YA 2HU5A 2WUEA 3H84A 4KFCA 1XA3A 1QBGA 1JHVA 1DIRA 1PUXA 1NE2A 4KC0A 1MO2A 1SC6A 2OBXA 4O6VA 5TJ9A 5BR4A 1IXYA 4C29A 1EDBA 2V65A 4EPWA 4U0KA 3RUAA 3HDJA 3ZYZA 1WNTA 2B7LA 1AGXA 1E0DA 4IJUA 2X4GA 3UUEA 3AF2A 4JB8A 4YRCA 3H2YA 4D02A 1TD1A 1O2DA 2BMEA 2CCKA 1WLYA 4GLLA 5KYXB 1ZLYA 4NLLA 2QP9X 3FTFA 1QONA 1P72A 4IDAA 4AY3A 3MYYA 1GN9A 1FW6A 4X6UA 2A6PA 4C88A 1E1MA 1KVQA 3IMCA 5GJBA 4IQFA 1HYQA 4BBAA 2ZE6A 1I4WA 4G24A 1NVEA 4Y7CA 4BDSA 2WG2A 3FCYA 2FX3A 4FYHA 4MTCA 4RLQA 1L5MA 3RUHA 1QYXA 4IAOA 3K70D 4K6OA 2WZBA 1LQUA 4KG7A 4TYQA 5AD1A 3F6SA 1Z5NA 3DW1X 2FMIA 4I1IA 3DZCA 5A71A 3KP1A 3QGMA 3ENQA 1YK1A 5AOVA 3WIVA 2Q4RA 1TCUA 1VLVA 1ND5A 2Q0QA 1EP1B 2CJPA 4JI8B 1PJTA 1RM3A 3UBMA 3KKOA 5HSGA 3TF5A 1U6IA 4JUBA 4FZ3A 4WH0A 3NXKA 5IARA 1Y8QB 1Z2DA 3W8RA 4RPGA 3LF1A 2VHTA 2BR4A 1AKTA 1I4LD 3M34A 4WXPA 4V2IA 2HWWA 4OLFA 5LQRA 1I5OA 2AVDA 3LP6A 1P19A 2JJYA 5FWAA 2H2HA 4QXQA 3EA0A 5KOJB 2HC9A 2F90A 2H4JA 3M5CA 5LJIA 3GMTA 3MGGA 4YYEA 3JWJA 1DFHA 4O59O 3COSA 3VPHA 2V3CC 2VKTA 4FC6A 1G4AE 4PCUA 7REQB 2XBMA 4B5KA 4KAFA 4MPPA 1J8YF 3CEMA 4ALMA 4Q6WA 1SC4A 2CW5A 2IU3A 2P0YA 3FJ1A 4M0MA 4MWBA 1SMKA 3TTVA 1JVSA 4EKIA 1SCUA 2WUGA 4M0PA 2NU6B 3KV1A 2FPXA 2PY6A 2GFHA 3GLHB 3EN0A 3ONWA 5TQJA 3UB2A 4PAQA 4BEVA 4F72A 1PR1A 1Z12A 5I7AA 5EXTA 5CA1A 5GIOE 3JXEA 3DFIA 2AR7A 4EG8A 5CURA 2CMDA 1YE8A 4RPHA 1TGVA 2B1JA 3NTXA 4LJ8A 2Q2OA 3L0PA 1C8KA 3CLKA 3B3QA 5BRAA 5BV8A 2DPHA 3U3RA 1KC3A 4QTZA 3GELA 3H6KA 2B4YA 2C78A 2PSSA 2MDTA 4O2LA 3W8FA 4U2FA 3T34A 1Q92A 4E5NA 1XRNA 2F17A 3M6AA 1OYYA 2NAPA 5E1OA 5FR1A 3HNRA 3CWCA 1EUZA 5DLQC 2R1TB 3DLBA 3MWFA 4TWBA 3AVQA 2FXIA 5EI5A 1IG0A 1X3LA 3VR4D 4B7ZA 3CPHA 3V4OA 1ZGBA 3G8DA 4TXJA 1E1DA 2CJFA 3U61B 3STWA 1E2DA 3K8QA 2D2EA 1VG9B 1HT1E 2RONA 1M1YE 3QPAA 5E6SB 5FWYB 5K03A 1P18A 5TQ0B 5JXIA 3HZOA 2CK3D 3AXSA 5D1NA 4RY2A 1KYQA 3N1UA 4W7IA 1JJ7A 3OIVA 2O3TA 2OV2A 1QZUA 4MGIR 2OCXA 5DWQA 1KAGA 5CR9A 1GTRA 1JT9A 2RGBA 2P6NA 1C50A 2Z3VA 4KH1A 5ILGA 4BLOA 5JV5A 3ZJUA 3OP4A 2YWCA 3AU9A 1JLMA 1RRGA 3AL2A 5EXXA 4EKEA 4MITA 4ER5A 3UG6A 1RJFA 2X86A 1IEWA 4AX8A 2PZMA 1WXWA 3EZ9A 5DCUA 3RC3A 1Z5VA 3VZBA 4AWXA 5KSZA 4DEXA 2WHRA 4JBIA 4MV7A 4IIJF 4N0MA 4XWKA 1IBKB 1CQXA 1MIHA 5AJHA 1XLUA 2NSDA 3PFCA 5KYYA 4Q7KA 2QVXX 1RXEA 4WA7A 4NE9A 4JEIA 4R1OA 5JS6A 2RCYA 3RRMA 4RL6A 3JZFA 2AZTA 4G4IA 1EK6A 2A9RA 2ZUUA 1R27A 3MUNA 4TLAA 4K9OA 3T1YB 1L7EA 1XCMA 4O0LA 1SHUX 3H3XA 4KBGA 5JHHB 1LZLA 1CQWA 3W8DA 3WO0A 3FDXA 4W7HA 1JLLB 3EXEB 5D2CA 5HIJA 4FI3F 1KGSA 4RPLA 2NNWB 1EG2A 2W0MA 4TLBA 3EDRA 3BIFA 2A1UA 1KI3A 2QE7D 5E7IA 3X0DA 5C8ZA 2D06A 5IDVA 1ND6A 3IKVA 3LUJA 5I8WA 5E6RB 3THXB 4HH3C 3RFTA 2FPMA 2Z58A 3HU2A 1VLMA 2V0NA 4ANFA 1PGNA 4OKSA 4CMEC 3JR7A 3PI7A 3L9WA 1NN1A 3NHRA 4MV9A 1R5JA 1YXMA 4BZPA 5BR8B 4ACBA 3GGCA 1CZUA 4P0PB 5C1PA 1MJ5A 1JEAA 1DO0A 4XD7D 1NQWA 1W49A 2P27A 3K8OE 5IAKA 2XGMA 4WKNA 1BW9B 1ECGA 1U02A 4KBFA 1IRIA 5EHIA 4UMFA 2DAPA 4GYKA 3RYCA 5AVOA 3IDZA 3NIDB 5FL7A 1VCHA 1X6VA 2UVDA 3U26A 5CXQA 1IC6A 4L1KA 3WRYC 3ZDDA 4PPQA 4C5BA 2SCUA 1GL7A 1X1QA 4EJ2A 1GKUB 4F4FA 4ZI7F 2CN1A 3GB9A 4GPTA 4OHPA 3UJPA 2B2XA 1TCBA 4N18A 2X9VA 1JEYB 1ESEA 3OZUA 3PNLA 3IKMB 3UUFA 2IBMA 3JQ7A 4N0EA 3TPZA 2HQRA 3KUKA 5K3FB 1I5RA 3WIBA 1VMIA 1XWIA 4OGLA 2AJTA 3L8MA 1M74A 1S9DA 1X19A 3ZCPA 4BIIA 2WOOA 1N7IA 3AHEA 2C2WA 1HDIA 2BFCA 2V6JA 4E5DA 3U7HB 4TM8A 2CEKA 4NNPA 4NVRA 2FPIA 1PQYA 5AJUA 5JG7A 2C1ZA 4S1TA 2B6NA 1ZI9A 2IX9A 4N7BA 1G6HA 2GQ0A 2PGAA 4O8CA 5IJ9A 4MK4A 1D2EA 1V1MB 2BEUB 3EIUA 3RVDA 2WVHA 3COWA 1VE6A 3BH7A 3BMNA 3TNJA 1PEKE 4CMJA 1KK1A 4DZTA 1JLKA 2UYOA 3EXHB 1JR3E 3PPIA 5JEDA 1GZUA 1QTNA 5FNVF 1YB4A 4YX9A 1ODCA 1D9ZA 3AHCA 3NI2A 1VI2A 4XA8A 1V2HE 4P3PA 2VRCA 2WE7A 4BAUA 4Q47A 1T6NA 2R751 1Q1NA 5F35A 5GGYA 4JS0A 5ALTA 3AV0B 5CG1A 1DAFA 2DFVA 3I9KA 1GPWB 3A1EA 4WBNF 1CP2A 2R86A 4EFNA 3CY6A 3ISTA 3L6UA 1PN3A 3I1FA 2OKGA 4L5BA 5JUWA 5D6NA 1IJBA 4XM2A 4FMPA 1J1IA 4N82A 1NT2A 1TVMA 3G7SA 1BRTA 4A1FA 1L8XA 3AVWA 2VRWA 2EJWA 4G0NA 5C1DA 4OFZA 3U4HA 2IXEA 2O0JA 4DIOA 2CFOA 1LF0A 2FY8A 4XSVA 4D8XA 2FPGB 3CBQA 3C7CB 4MRVA 2W8ZA 5FTNA 4CUJA 2Z04A 4ZV4A 4CF6A 2A59A 2BLNA 2H4YA 3WLAA 2GPYA 3T7JA 1U0NA 1W85A 3ITNA 3KQVA 1GAJA 4EO4A 5JCPA 1WZIA 3HJFA 1XLTA 2AV6A 4HO1X 1GEEA 1MZVA 1ETHA 2C2OA 4BKMA 2PBZA 1NMZA 4YP6A 2GWHA 4NHOA 5IH7A 2PRZA 5C0OE 3T41A 1J22A 1IWOA 3HKCB 4XUGB 5FLXA 3NVKI 1O6CA 4GPZA 1FFHA 1EQ2A 2AXPA 2EFEB 3QTTA 3CWQA 4P4LA 3G5TA 2VJLA 1HT2E 2C9MA 5CNIA 1EXNA 4EO7A 1BDJA 2XNKA 2P79A 4JMPA 1J21A 1YIOA 3DP7A 2WTEA 2ZSBA 5BSGA 1LPAB 2CVOA 3D2BA 1M83A 4C4XA 4QT0A 1K27A 3GAZA 3EZYA 4DIMA 1ZL2A 1I3LA 3GK3A 3NBZC 3A14A 2ACWA 4GNRA 4HQOA 4KFTA 3AESB 3JRXA 3JZDA 4GLOA 3M83A 4OK6A 1CYEA 3T3OA 5CYFA 1U98A 1USWA 1WMFA 3MYRA 4AZWA 5HZKA 4TZ6A 2WJ6A 2Q49A 3VR4H 1QIJA 2UZ4A 1TB4A 1VKJA 3QBDA 1QIFA 1ZNXA 3L02A 3NM4A 4LXGA 4UOEA 2QM0A 3EVNA 5I3ZA 3DUFB 2XQJA 3EFOA 3H5VA 4GXQA 2Q3EA 3DFKA 2YV2A 3AYXB 4M1KA 4ER6A 4KPUB 3LBNA 4AZVA 2Y99A 3D6AA 3TKYA 1U0BB 2JK1A 2AMFA 3GP3A 1JX6A 1ZOSA 1OH6A 5KSYA 3G1TA 3ROMA 3LDAA 2F1JA 2HLHA 3U7QB 3UK1A 1Y7TA 3MLEA 3IUMA 1EDZA 1IQRA 4HI0E 3ZVKA 3SE0A 5EJEA 3COJA 3E2IA 1THZA 1U11A 5K8IA 2QR2A 4HMPA 3KSAC 4ALNA 1T25A 1KIMA 4MWOA 4F9EA 4UW9A 4HGPA 4PQEA 3JVUA 4MDEA 2I0FA 4RENA 4TS1A 4P7GA 2QDXA 3NC0C 1W4RA 5EJ8A 1AUPA 4L76A 1EB8A 2G5CA 1GAWA 3K1AB 8AT1A 2VHEA 4B6SA 2KMLA 2FV8A 1XB2A 4D4MA 2Z9CA 2YL2A 3D8TA 1JHMA 3JYOA 4I5FA 5C52B 1VE5A 7ADHA 4GECA 1G3RA 3IB3A 4NSNA 3ZEIA 5KU1A 5LR6A 3R6TA 3OA2A 2NQ2C 2WB2A 1MIOB 2CVPA 1MAHA 3F4LA 3GRZA 3JASA 3L8ZA 4N6GA 1Z28A 3N2ZB 3O0TA 4TWRA 4PRYA 2AOUB 2P69A 1WCWA 2Q6IA 3TOXA 4ZVQA 3WP1B 1GNTA 2R4TA 1NOIA 3R2JA 3BFJA 3PSAA 1UPBA 1CUVA 1XQYA 1M2FA 4IQGA 4ZVRA 2Y1CA 3C45A 3RREA 4CFZA 3NHUA 5LMZA 4RY9A 3AF4A 3NEYA 2X8WA 1DG1G 4TQAA 1S02A 1C9YA 4QNMA 3CVXA 3DDNA 4V0ME 4S1PA 4YRTA 4XQGA 1N5MA 4M8SA 1DSSG 1K98A 1QM5A 2GTIA 3IUSA 1PYDA 1XCGB 1U9YA 4PC3A 2X0FA 4LFAB 1G16A 4GKAA 2VHXA 1T9ZA 1JHRA 2PT9A 4PAGA 3H97A 3IQXA 1FU8A 2HI0A 3MAAC 1Z2CA 3IDOA 4OMUA 4ZJYA 1L5QA 1P60A 2XUJA 5H0IA 4JY7A 4YAJA 4HAIA 2FPUA 4BUCA 3WQQA 1E2JA 1LW7A 4DFDA 2IOQA 3C6MA 1LPPA 1N0HA 1VYUA 1FUYB 2PR2A 3C8ZA 3F7NA 4HH4A 5CGQB 2E89A 2WWHA 3U1VA 5B30A 1T2VA 3IMFA 2IZ7A 3JQCA 2XCRB 3GJ4A 2VHVA 2NU8B 4NS4A 1JR6A 2WKWA 3F1LA 3ZLJA 1NSTA 1SBTA 2HK6A 3QELB 2C9YA 4JUIA 4LHVA 3G6KA 3AEQA 4TSKA 2C07A 5ERYA 3L4SO 2GPAA 2IRWA 5EE0A 4ZU1X 1RCTE 3FXAA 4B4WA 4RTLA 3KC2A 4PNHA 1EXDA 1X38A 2REXB 4OK3A 3K9GA 4BJHB 1YOBA 2BI4A 4URHA 1XXHE 1FFSA 5DEIA 4JVMA 4NU5A 1NVVR 3VKHA 4I36A 3W5VA 3R7DA 3W9UA 3OPYA 1DC5A 2DHDA 2ZE8A 3GRKA 1P3DA 4P32A 1SUBA 1QE3A 4KFUA 1QV7A 2BH9A 2PIAA 2P11A 4GUAA 3OT5A 1XKTA 4RLFA 2Y9PB 2ODTX 2ZB2A 1PQUA 2R7MA 2GD0A 4U6NA 4XDGA 1QAMA 2J4FA 2AW5A 1BXKA 1ZQ1A 2ZKIA 4MMZB 1W36C 4PSUA 3CVVA 3QE3A 1NRWA 1DXHA 4WACA 4W6ZA 4RQUA 4R1TA 1A9TA 1F8GA 4JNCA 3VOSA 3TVYA 1RI5A 4JK3A 4QAJA 1J49A 1JB1A 3FUXA 4HSGA 5JANA 4CWAA 4EUEA 1Z7YA 2XUHA 4WWHA 1PUIA 4ARBA 3VBCA 1D09A 2O2JA 4ER0A 1X9GA 4PIMA 3I6YA 4W5WA 1EGVB 4C4SA 4MWZA 3D4LA 2ZSEA 4GAEA 4XEHA 1KKUA 3A4MA 2XUIA 3EFEA 3RUCA 1K7CA 3JU3A 1B16A 1QVRA 3JYQA 4RGYA 2EBWA 4S2UA 4A73A 1AC5A 4RTJA 1M1NA 1SXJD 3EXHC 1KHHA 3ND7A 4FK8A 4MRMB 2C0PA 3DMTC 5I4BA 5KWJA 4JAVC 3VNSA 2XB8A 3FNGA 1N2CE 5LMUB 4MWSA 3L6DA 4TV9F 4LNHA 4FB4A 3FB1A 3S2EA 4XM1A 4EB3A 2C7BA 4P1ZA 3B6ZA 4O4JB 1IM8A 3SHTA 2R3SA 4CN9A 3V4LA 1J0BA 5LUAA 3LX4A 3JCZA 4D41A 1COWA 1FFDA 4ZD6A 2EJVA 2V7GA 4BFZA 4NABA 5D7BA 3WMGA 1Z33A 4BGDA 5JATA 4QUGA 3L7LA 4FNOA 3U4CA 2BGRA 4QBFA 2MTBA 3K0FB 3NANA 5REQA 2XSZA 1M6HA 1E7QA 3LCUA 4I2NA 1S2GA 4YMSA 2V9CA 3EW9A 2XMBA 4QC2A 3ZIAA 4B48A 2VPWA 3PQ3A 5ALRA 1NJ5A 3ESYA 4X8MA 3DBLA 3MXTA 4IIUA 2PBRA 4V1CB 5C4IA 2OAEA 1RQRA 1TUIA 4FW9A 3ZK8A 2MT9A 1M8KA 1ONBA 2Q9CA 4AFNA 2WSLA 3II6X 2IGTA 1UEXC 3HZRA 5BV2P 4CIWA 2WAAA 2IV2X 2GRAA 2I3AA 3ZU6A 3K1YA 4YCCA 5GZ3A 5JJCA 4ETMA 4F9FA 1I2BA 3W5IA 3CF6R 1BMDA 2P3QA 2XVXA 3P20A 3TNDA 1QX4A 2BGWA 2YYSA 4C6TA 1NNUA 2JIOA 2HF2A 3GX1A 1AZLA 3A32A 1WE2A 4TTJA 2UUCB 1Q1BA 1M6VB 2EZ4A 2JIPA 3AR5A 2Z1NA 5ALDA 1IEQA 1K92A 2VSXA 2IPLA 2WTAA 2Z09A 3DZDA 4GZLA 3HL4A 4QYWA 3RVLA 4B09A 4E7OA 1NZFA 2X58A 3FROA 5CW2A 5AR1A 3ZR4B 2JC3A 5I3CA 1M5RA 5FO1A 3EXG2 4D92A 3BTUA 5JROA 1BVUA 4MCHA 3PCXA 4DCPA 1A76A 5I9SA 1D8AA 3W6OA 3L18A 2PUHA 3HEMA 1G9TA 5HZGA 4KYUA 3COPA 4Q34A 2ZJ7A 3LQKA 4CHGA 1NVDA 4YJDA 4YAWA 2F3RA 5DGTA 5KBYA 4YMIA 1E92A 1GNQA 3NIWA 1TYEB 3PQ6A 3BWCA 4KO2S 2R6AA 2VDPB 3B60A 1OILA 2I1QA 2GNPA 1KY4A 1A50B 4NF2A 4Y18A 1DIAA 4RFVA 1C7JA 1QIDA 2P4EA 3D6TB 1AY0A 2GCEA 3HCNA 4NU8X 2AN9A 4R31A 4RVOA 5EIHA 4C04A 4GL2A 1NF2A 3V8RA 1MP0A 3BGDA 4REQB 4M36A 4IIJB 1D1QA 2WTMA 4RH1A 5DGDA 3UMYA 1PT9A 2Q8QA 5LQSA 2YNMC 4QHSA 4WBXC 3HO1A 4CBVA 1XTJA 1KQGA 2HXYA 1Q7RA 4QRDA 3VU9A 4QGHA 3DLHA 3N0RA 2FDRA 4UKDA 3IT3A 3PNKA 4HDKA 5DCYA 3VNAA 1ZMOA 1OD6A 4HAXA 1XDGA 3VJKA 1W30A 4V0KA 1AVTA 4I5DA 3G2IA 1WAMA 2GN4A 1UIMA 2NLOA 5FRDA 3ROEA 4D0GA 3O4FA 3LA6A 3THYB 3A6KA 5G0TA 3C5VA 1R4ZA 3D1LA 4P4NA 1JSZA 3IX7A 4NDNE 3FLAA 1X8LA 3VI3B 1SXHA 4V0RA 2QMEA 2VNKA 1Z88A 2VCHA 4C6TB 1KP2A 3PJDA 1LS6A 4BFSA 1N5LA 1LK5A 1QSGA 2DQKA 1L6IA 1RLMA 5IULC 3KR1A 4B3HA 2BKUA 1RXCA 4I5EA 4PHFA 4LV5B 1GZ3A 2EATA 2CL5A 3QEKA 2P4UA 3NHZA 5GZ1A 3IEPA 1L5KA 2G9ZA 3D0RA 3FKSA 3A31A 3G9ZA 1ECBA 5KYVA 4A10A 2IYTA 1NKVA 2V7XA 3O93A 1F4PA 4JOBA 4KDFA 1JIUA 1CLEA 4LAFA 2GSDA 2YBDA 3VAAA 3GEBA 4BO0A 5K7SA 4K9QA 3QUBA 5L45A 3TZKA 1O1YA 3MB8A 2Q8NA 4GP6A 4K46A 1SKMA 1SA0B 2JIMA 1OLOA 3G82C 3RRZA 3UWKA 1GNSA 2Q2QA 3GZ4A 3LYHA 4P53A 3A6JA 5FBHA 1KEUA 4P54A 5KWVA 2N42A 5TF4A 5EZYB 3L8FA 4V39A 1AF4A 2Q9UA 1UAYA 4I81A 1T8PA 4PX3A 1F0YA 2PVSA 2W2LA 1VA5A 2UAGA 2ECKA 4RY0A 4DCCA 4YRKA 2RJ3A 3OQIB 4AYTA 4ZI3A 4ZHQF 5IDQA 3QKTA 3FTQA 4KTVE 2QI9F 3M6UA 1PJSA 2ONZA 3HYRA 1BZYA 4QNRA 5TQ2A 5JSFA 1OX5A 1RZRD 3ZOKA 4RKRA 1YDHA 1Z2PX 4YGYA 4LCJA 4V1CI 4E4TA 1II8A 3H1TA 3LHSA 1SHKA 1MAUA 1Z3CA 3L7OA 4M0FA 1M2EA 4UPDA 1AX9A 3UJ9A 2EKLA 3K1JA 4UHHA 4IJVA 5CCXA 4YAIA 1VBKA 1ONPA 3LPNA 1PG0A 2HQ1A 3FF1A 5FWNA 2RIPA 3CF4A 2HFJA 4LX0A 3L46A 2ASVA 1H3FA 2W2NA 3BG5A 3RC9A 5ED0A 3U7IA 2AD1A 1KBZA 1SXQA 2ZP1A 4RZ2A 5HK9A 4QYIB 3U7GA 3HVKA 1JDTA 4FXOA 4ZU3A 5F5XA 3L41A 4DHWA 1DV2A 4RKYA 4PLPA 5EIBD 1HTTA 4DR6B 7YASA 3AVXA 3Q72A 1G17A 2RGNC 1FIUA 3I52A 3GLFE 1ONNA 2AKYA 4GICA 4ROTA 4BV3A 1KORA 5KNCH 3KSUA 4GDMA 1LF5A 1ORHA 2C1XA 2A5JA 3HY3A 5JISA 1Z73A 4DVJA 3PD1A 4K8RB 1K63A 2BP7B 4FFBA 2AC7A 4Q5IA 1XRMA 1PVOA 2WWTA 3FMOB 3FRIA 4KV9A 3QKUA 5IG2A 1KZYC 2W70A 4DDKA 4WNCA 5IXYA 1W5SA 4BPBA 1H3EA 5A9SB 1UIRA 3BXPA 3IPLA 5JWHA 3ZY5A 5BQ3A 1UJBA 3FNQA 3HXOA 4GRIA 1DQRA 3HACA 1AKVA 4G0OA 4J1TC 1UBNA 2KS6A 2YJZA 4JWTA 3LBYA 5FOQA 2GYYA 2EP5A 4E7PA 3M4YA 1IIBA 1KI1A 4LDQA 3B9QA 1GO2A 2PH3A 1A2OA 4H27A 4RJKA 3SKYA 3C6KA 5L95A 1GA4A 3PPVA 1IN7A 3R6LA 2PDAA 5JMTA 4MKHA 1G5HA 1G7CA 4KQEA 5A3SA 3T15A 1A27A 5KWSA 2UUBB 3BTOA 1UXJA 4QTUB 4UM9D 4CGZA 4G1MB 2C94A 1S5PA 3RSOA 4PYIA 5CD9A 3NT4A 5J5VA 3L7NA 4C30A 1KTIA 3AF5A 2PRYA 2HEGA 4RZXA 5FLYA 2AXNA 4N8SA 5GV8A 2DPGA 5IH3A 3SIXA 3ZDFA 4R71A 3GQBA 4X1KA 5B3LA 4K0KB 3NTLA 1WZ2A 1A8HA 1HO3A 4JA2A 4R51A 5AICA 3TNLA 2HGZA 3E9NA 5H9WA 2HY7A 3CXUA 3IPRA 9ABPA 2EBUA 2ZRPA 3VV3A 5BN3B 1M1NB 1XAIA 2TECE 3IR6A 1XYYA 1G60A 4MHOA 3FHLA 1P1RA 1QLHA 3OMXA 1DAIA 3T5MA 1KEEA 1KMQA 4AJJA 3PLAE 2RAFA 4R0NA 4BMDA 3ZU3A 5IC5A 4N4AA 4F7WA 1AHNA 5AOAA 2F3SA 1OJ7A 4I4NA 4IRXA 2ZUTA 3UMFA 1PX2A 3X43A 4XUCA 2VQFB 4GU5A 8ATCA 1A4RA 1TK2A 2GA9A 2QYSA 1UPCA 3CF4G 4X5OA 2WWRA 2XT6A 5IHXA 3F9IA 4A8JA 2FR1A 2J3QA 3L0CA 1MVNA 2RAVA 4MNTA 3ZWXA 1TZ2A 1V26A 1XDSA 2JIBA 3H4IA 2Z2KA 3KZOA 3P2OA 3QXGA 4IKPA 3SXPA 3DOIA 3EEYA 3WAJA 3DEIA 2R8EA 2KM1A 4WZ6A 1QQAA 1MAVA 4MS1B 3DONA 1OT5A 1YRBA 4HL6A 4P22A 3U3XA 4YUVA 3F1KA 1G5FA 4MJ7A 4U7HA 4WUTA 3RJ9A 4GZMA 1K75A 2DEUA 4NTZA 3QE4A 1QG4A 2QJOA 4NESA 3ZXIA 1S96A 2DGDA 4PGAA 5J2TB 2JGKA 2F4VB 4YJFB 5E9WA 2LW7A 2YOGA 5C1BA 2CB0A 3KJEA 3UKDA 1RABA 4BNDB 4R9SA 3WGYA 1V1JA 1POXA 2RK4A 1UZNA 4KRYA 5FA5A 3K0SA 2O5RA 3ZK7A 2XYRA 4CKCA 1U2EA 2BFMA 2YMLA 3HCAA 2PVCA 2DR2A 1VLZA 2OD7A 2JH8A 3TKLA 1FX0A 1PWHA 2HF8A 4H4EA 2VDRB 4HX5A 5C8YA 3B48A 3HR7A 2YQ4A 3P9CA 1A71A 2ZJBA 3FSEA 2M9MA 4N5DA 5ECGC 4D9CA 1XD2B 1K6MA 2FZ4A 3WRXC 4JNKA 4HN2A 3G5MA 3OZFA 2FCRA 3SOPA 4MAFA 4JJ6A 4FFLA 1YOVB 1JTEA 2X0IA 5COBA 5E4YA 3TL3A 3VKUA 5M2QA 2V8OA 5J5CA 1R10A 2IKSA 3DT6A 4F6LA 1I1QB 3S1AB 5HIAA 3RAFC 4MDHA 2V6FA 2GBFA 5TPWA 1GPLA 4G26A 3O26A 4V0MA 2ZAMA 1J0CA 1L7XA 5C8YB 4WGFA 3VAYA 1XDDA 1CD5A 3ICWA 3OICA 5A2QA 1IK6A 1WHTA 5IJAA 4AMZA 3CO5A 4DA6A 4DMFA 2BDUA 2YXPX 1N34B 1ZJ5A 1CZHA 2Y93A 3NTQA 3CLUD 1Q6YA 4ZARA 4DIDA 1E7MA 1SKBA 1ZU4A 1FVHA 4D97A 3TAUA 2B8EA 1N6HA 4L02A 1QYIA 2E87A 2IXTA 3EVBA 1P8AA 4MKRA 3SHFA 1E6KA 2M1XA 1BXZA 5DT2A 3ZDXB 5CA0B 5MHTA 4FU0A 1DIHA 5ICCA 5C18A 3QVTA 1QKKA 3OO0A 2C97A 1GYQA 2FXVA 2Y0EA 1BGWA 3D7RA 2WG1A 3F6EX 3JW8A 3R5SA 3ORYA 3M5DA 4OF4A 4BB9A 4PPNA 1D7AA 4X9XA 2ZVDA 3LVQE 1F2VA 4EG6A 1U7HA 4DKJA 1P4HA 1HLFA 4P7JA 4X44A 3L6EA 1VSQA 1H0KA 1F9AA 5ESDA 2R2GA 2JHFA 3VZPA 3WOHA 4P5PA 1XCBA 1RWOA 3TQOA 2ZM6B 1OMOA 3ABRB 5IAGA 2I7CA 4S1OA 5EZYF 1JJFA 2DBVO 1WEHA 3EIFA 2RJNA 1AA9A 3CNOA 1XMSA 5ELXA 4TMYA 1DINA 1K97A 4Q24A 2HA5A 3K5IA 2NSLA 4PZEA 4DYHA 2AOTB 2DFKB 5J4LA 4MP8A 1DADA 5ELMA 1QOZA 4WN9B 3ZGYA 5KTKA 1DE0A 1E0AA 3D2LA 2J41A 1NVAA 4R9RA 1Z75A 2W9XA 4W5HA 3ZOZA 4N3AA 4G5GA 5EZSA 2O50A 2QAGB 3GDOA 5L7WA 3JSXA 5BMOA 1OASA 3B38A 1XZCA 2ZBRA 4ZQFA 2A33A 2R68A 4BC0A 1TJ4A 2I6GA 4CFYA 2PLRA 5TMBA 5KWEA 5EJIA 1P77A 3MBKA 2Z4TA 4G3XA 1MPTA 3SP1A 4AXXA 2F1RA 3MJRA 3X1MA 3Q12A 3CZRA 1CIVA 16PKA 2C9DA 4GS5A 4RDHA 4DNXA 1AB5A 3OJEA 4QUEA 4FYWA 3UICA 3WKEA 1SHTX 4Y2UA 4RPCA 1I0ZA 3WTCA 4JL8A 2YBEA 1EWVA 4EVRA 2RCNA 1BX1A 2VPQA 1J8MF 1KDZA 1UMCB 2CD9A 2H06A 1CR1A 2AG8A 5JRJA 3PNOA 2XUGA 3YASA 1SU8A 3QNWA 1UF9A 3TL2A 5JY1A 3OMLA 2FSIA 3CNEA 4B6EA 1EPUA 3FMVA 2EQ5A 4BGVA 5AHXA 2NXJA 1N57A 2D59A 2YV3A 3Q1KA 3ANNA 4MZXA 5ULLA 4CZ2A 3AM5A 4WW0A 3SBDA 5HG0A 4R1PA 2OO5A 3PT9A 2VUHB 1QHIA 1WB4A 4JLWA 3UWSA 4XIJA 3GZTB 4Z7QB 3R3SA 5I5EA 1Z15A 3KQNA 3QFCA 3S5JA 3K0KA 1AO3A 2WY2D 3ILHA 4IDCA 1QR2A 3JZIA 1SCUB 2O8FA 2G28A 2JGDB 5B37A 5KUTA 1ZRMA 4XIGS 4LXIA 4QBHA 1C3EA 4L9AA 4QXOA 2YHSA 3LSYA 2XYVA 1E1QD 4R3UC 5CDFA 3BC1A 1C3JA 4M53A 4NHEA 1GT6A 3BFKA 4KH0A 5AKJA 1KDYA 3BB1A 3MMPA 3T95A 5AKYA 2BFDB 3ENWA 1YKFA 1E2NA 3K9FC 2G9QA 4OKIA 5AIAA 4HTFB 2WQ6A 1VHLA 3QUSA 5I7SA 1B00A 4A15A 1R0KA 4IVNA 1NRIA 4UHDA 2C9BA 5IFLA 2F9FA 1S7CA 3TCNA 3UWPA 5T57A 5ADVA 3NHLA 4H4CA 3SSOA 3HZHA 3QFRA 1Z2NX 3AY3A 3NDRA 1VDMA 3K30A 4R1QA 5AHKA 5A2GA 1WDLA 3F96A 1G8HA 1TLTA 4C20A 5K8UA 5JI2E 3RSQA 5L3QA 3EIHA 4W5QA 2OM6A 1JIIA 1R16A 3ADDA 1HV8A 3OT4A 4KXWA 1NBHA 2OV1A 2HUPA 4MYHA 4QVGA 5AI5A 1MJGA 1ZCBA 3DTYA 3H19A 2A9KA 3THSA 3VPSA 5ECWA 3IQGX 2BFAA 1KFCB 3R77A 1FFGA 1JKIA 2UYHA 1NV9A 5BW5A 2I9PA 3UEOA 4AYXA 4TLMB 2KHZA 4AN0A 4YRLA 4NJEB 4FEYA 4HVLA 1WF6A 1D3AA 4QXAA 3RIHA 3K9BA 1YR8A 2WI8A 1DDIA 4G1FA 2WYOA 2YXBA 3L7BA 4X64B 4BFLA 2GM4A 1F5SA 1D6MA 5AVVA 1GD1O 3WDLA 2H59A 3D4NA 1JEQB 3VR2A 2KI5A 1W36D 1PHRA 1B73A 1L4YA 1IONA 2P67A 3N3BC 3A9CA 1KEZA 2YWBA 2NZYA 4MUKA 3ZY6A 2ISSD 2VPZA 3DTVD 3WK4A 3KPJA 1A8QA 1LLQA 1FP1D 4G89A 3WE7A 4QELA 1H0RA 2PN1A 4OSOA 1GNLA 3ZJ5A 1RMQA 3KEMA 2G1AA 1DRWA 2R25B 5KCMA 2BVNA 2IU6A 5TR9A 3HVHA 1TVCA 4WKCA 3KZXA 3EQZA 1F38A 1CRLA 1T34A 2FOXA 3O83A 5HRUA 5G0WA 1W4AA 5DLYA 2WPDD 1O95D 3I09A 5IYZA 3AH8A 5DN9A 4UCXA 1YQDA 4ZV9A 2VDVE 4UVEA 1XJ5A 2EHJA 2FR0A 3GA7A 2Z2IA 2C3PA 2ZSKA 4LOHA 2XMCA 4R8SA 1XCJA 3G2QA 7MDHA 3UH0A 2C7QA 1D0VA 2EIHA 3I8XA 4PCAA 4BYGA 4FKBA 4A7PA 1W2HA 2WD7B 4AUNA 1G8AA 3FTPA 3RBVA 1D7OA 2DBQA 2BISA 2QTMA 3CLUC 1FCJA 5K3FA 4M88A 1QGZA 3FHTA 1G59A 2OP1A 4Q00A 5CJ2A 4HUTA 4TTIA 3LI2A 3GRAA 3U62A 4CN8A 3K0BA 5DXFA 5TS2A 4HPXB 3VR5H 3LC2O 5TT0A 4CF4A 1CY2A 1KFKB 2EC5A 1JNXX 1U8FO 4IHKA 3EDOA 3PEYA 2VHZA 3AYZB 1WZCA 2LUOA 2I67A 1A69A 3HI6A 1ZXBA 1C8LA 3OBBA 1JPVA 2C7RA 2XXAA 1JU3A 2O8DA 1SIUA 5CT6A 5BNTA 1F8YA 1E1KA 1OIVA 3STVA 4RXUA 3C2QA 3EVTA 1LGYA 3DAYA 3DB2A 4Q6BA 1E3MA 2JH3A 3W0LB 2R87A 4BN5A 2PSHA 3O4RA 4MVJA 5L4SA 4D56A 3T1HB 1EHYA 3Q3VA 1X42A 4B44A 1AK2A 5D7NA 2J6CA 1NVFA 3H2JA 5E6RA 1J07A 1M67A 2WYUA 1XHFA 3I73A 3IO5A 3LQ2A 4YUZA 2B4QA 5B58T 5AM5A 4DV4B 4FILA 4JVLA 3UO8B 1OV6A 1Z47A 1RYEA 4V3BA 1C4KA 2OYSA 4D8UA 1A98A 2W7TA 4KGXA 4RYLA 1TKAA 4B34A 3A9RA 2O06A 2QRJA 2RGUA 4PSAA 4ZO9A 3G3EA 4GNKA 3W34A 2SHKA 3T3GA 3QKRA 3KQYA 2QX8A 4DS3A 4EATA 1DXQA 1X39A 2NVUA 3KHSA 3NW9A 3R5JA 5KTSA 1EUQA 3EG5A 4KPYA 3OVMA 4XLZA 3SLKA 2X0DA 1GCGA 5A9SA 4LJ9A 3SPXA 1CRWG 2ZRNA 4DNOA 3L1JA 3HDVA 1E4EA 4MKFA 4N49A 4YP9A 4D81A 2A0XA 2W48A 1PDVA 2FVYA 4LNUB 4MVJF 1XCOA 1I3CA 5MN5A 4I6GA 5CAEA 4XIFA 4MS4B 4FBGA 1ODLA 3OLVA 5AM4A 4L5AA 5AXDA 3FF4A 1R9JA 4CR7A 2AK3A 2QYHA 4AY2A 3RANA 1W4CA 2PV7A 1KGDA 1TK3A 2LD4A 1MRNA 2O20A 2ZBVA 2BEUA 4KQ9A 4PLYA 4H3KB 4QXPA 5EMLA 5FDFA 5KYTA 1WQ1R 3OQ6A 3NBYC 5AHWA 2YHIA 3MRVA 2HJVA 4ND5A 2IS2A 1S89A 1VKHA 4YRQA 4KFRA 5L53A 1X0VA 2R5NA 5DULA 4K05A 4DG9A 4F1WA 3UOAB 1R5OA 1E79A 2CUTA 1FFWA 2YDYA 2WILA 4LNUA 2G82A 4H3HB 4G0UA 1AGNA 1FUIA 2RMKA 3HBFA 4QECA 4KI7A 2RGDA 3WBJA 3IR5A 3P9NA 4AS1A 4PYJA 3TG2A 5IBPA 3OQBA 1Q83A 3TCKA 2ZG6A 4PBSA 2Q3MA 4YJ3B 4ZP1A 3KZMA 3T94A 5T6BA 5DYWA 3QJYA 1WBBA 1QB8A 4NZPA 4YRJA 1Z2EA 3R0ZA 3SFTA 4JFRA 2Z08A 1II8B 2NPOA 1O08A 1JJAA 4RY8A 4PG8A 3NHMA 4RAQA 3TI7A 2RB5A 2WNHA 4PFKA 4XQ9A 2QVYX 5B2EA 5EJ5A 5HHTA 3M6IA 3NJ4A 2AGVA 3UXHA 5TVKA 4DQDA 5HS6A 2PGOA 1A4UA 1H1TA 1X1SA 3ML1A 4FEAA 1XZQA 3V6MA 2ZJZA 2A86A 2CL6X 2WM2A 3ROTA 4BTVA 2GAOA 1MJFA 4HN9A 2YASA 3WZLA 1F14A 1HDXA 3A70A 3GLFA 1C29B 3OPYB 2R7KA 2V7UA 1ZH4A 2HN9A 5BW8A 3T1OA 1LA2A 5EA2A 2WVAA 4PRZA 3IP3A 3V2GA 2ATEA 3AQ4A 3H9JA 4K9PA 4OHOA 1J8FA 1KPGA 3A05A 4D0RA 2ZS8A 4LGMA 4LMBA 2HQSA 1XGKA 2OFWA 3PEEA 5KREA 2AKAB 2QU7A 2FUNB 4RKWA 5TXGA 3OC6A 2XNDD 4CHTA 1CUAA 3GCWA 3P52A 2OGUA 3VGPA 3ET4A 1YZUA 2WHEA 2X5XA 4KXFB 4QLAA 4XCXA 5F77A 4DYDA 2P5YA 4EA9A 4AB1A 2HDNB 2BHRA 2VVTA 5AJVB 2MYUA 1D07A 4RJ2A 5E4FA 3ZZ0A 4MULA 3O3NB 1RPJA 3C85A 3LK7A 5IXSA 1DBWA 1EYZA 2JS7A 1TFRA 2WKQA 1HE1C 1XNRB 3DDSA 5K0NA 1I3MA 1RWPA 2WAYA 2EKZA 3ZV6A 3Q9SA 3PHGA 4TYPA 4DRXA 1OH7A 1YE3A 2J4DA 4X8HA 3HJUA 5DHPA 5ENDA 1PYOA 2MYTA 3UAVA 4PZLA 3HVRA 4PTYA 1O3YA 3O4VA 4HXYA 3NJRA 2WP0A 3KSDO 2O3JA 3HY4A 1FFBA 1PJQA 2JCXA 3HH8A 3OCUA 3R41A 2ZSHA 4R1LA 2C88A 2ZR7A 4ISCA 2G71A 3QEJA 2YMQA 4IW3B 3ZHXA 4KPFC 4O3FA 3TE7A 5EE1A 3PVSA 2P6PA 3VTAA 2VPIA 3DV0A 3BILA 1OFIA 1TVKB 4R05A 3AJDA 3W5JA 2ZTUA 5EPOA 1Z0ZA 1URPA 1SNYA 5DX0A 2Y1OA 2GKSA 4KCGA 1U8UA 1XZMA 3IE1A 4LTMA 3DWGA 3KQPA 1CY4A 2FN9A 2FN3A 2OFPA 3BHNA 1Z62A 3PNVA 4B4OA 3QHQA 2YKGA 1EGMB 2WE8A 2IEZA 3JQFA 3E22A 3UYKA 3IOYA 4WPGA 1TW3A 3PC8C 4LDAA 3BL6A 4TTPA 3ASUA 4F2WA 4JZKA 1MXHA 1ZLXA 2BV3A 3OJCA 1WXQA 1YC2A 3ASYA 3DD5A 1BX0A 1S0UA 1EIZA 2YX1A 3H1BA 1FLVA 3BL8A 3I9JA 2FAXA 2N75A 3LV8A 2G09A 3NBUA 2Q3JA 3JATB 1SKAA 2OCBA 4QO7A 4G25A 4QSMA 1N8KA 1KOFA 2LDBA 1X7HA 4JKYA 3RAEC 1FXWA 2O2XA 4PFQA 4KL8S 1U8ZA 2B69A 2P75A 3A11A 1IAVA 1ULAA 2HO4A 4HMQA 3S2ZA 3U9TA 1BG6A 4ALIA 3IBTA 1OX6A 2HTFA 3AR2A 1T9AA 1RYYA 3C3WA 4ZQBA 5LBIA 2QUIA 2VS1A 1QQBA 1ZNYA 3KJQA 2OZKA 2VN8A 2Z5LA 4E5KA 1JG1A 2JATA 2X7XA 3O7WA 4HBZA 4IHJB 4ZTUB 3A0UA 3CNNA 4BO2A 1JKJA 3GRVA 4MQEA 2E37A 1J25A 1OREA 4LY6A 3K31A 4CM3A 4UARA 5JBQA 5GPBA 3RVBA 5KQGA 2IHUA 1QWSA 3QPVA 2VUTA 3UV3A 2CXUA 4ZKEA 3CWZA 3SQMA 1F4LA 3QSGA 3LC0A 1I2DA 2HAEA 5B4TA 4NYIQ 1OROA 3IPCA 421PA 4DIBA 4GVLA 1XRLA 3N39C 3RFXA 1WUTA 4EA8A 4C2AA 4PXYA 1H6BA 1V1RB 3RGGA 4UHCA 1I7SB 4A23A 3BBPA 4ERNA 1SVIA 4NECA 1NP6A 5KNBA 3OSUA 3BGOS 3SNKA 1W581 3LIIA 4BNMA 3A3NA 1JDNA 3U44B 2PCLA 5EWLB 3AG5A 1SG0A 3UZUA 3C3MA 2H31A 3VR0A 4BVFA 1YZVA 1HETA 1T5DX 1YACA 2KLHA 2WD7A 4NICA 4EENA 4M0EA 3D7KA 2CKMA 2RKWA 1OE0A 4BUZA 3C48A 3V80A 2ZIZA 1I3KA 2VP2A 5CDUA 1ZO8A 5P8WA 2FB9A 3W5BA 1GZVA 3PXAA 4G0XA 4DA7A 2SBTA 2QX6A 3KDPA 4MTLA 4OHRA 3NYWA 4UBMA 3VNQA 3MQ2A 2TMGA 4C2BA 3VTZA 4KQHA 1SG9A 5EE5B 2WKPA 5MGBA 1W4ZA 3QEAZ 1CSEE 3I28A 3OJLA 5IASA 4CUKA 3IBCA 5JAZA 2FPGA 1DKRA 1YJ5A 4R3WA 4JASB 3NT2A 3C6XA 1IRXA 4BO3A 2DRIA 5DV9A 1N7GA 4D5GA 2ERCA 5H3CA 4L72A 4W9MC 1U94A 4B3FX 4WFKA 1KBQA 1O94C 1NOKA 3GLSA 3D0QA 4HD8A 1RM5A 2AJCA 2QL6A 2VTVA 1DT3A 3AHIA 4P4GA 1KVUA 1NW5A 4LF8B 5KNCA 3QVXA 3AFHA 5KMGB 4JJ8A 4DL9A 2C31A 4IL5A 3H6HA 3JS5A 1HYHA 2CLEB 2C57A 1HG0A 2R6ZA 3RAPR 3DDHA 4CI0B 4EPRA 1NUTA 1P2FA 3GMSA 2XOKD 4YDRA 5KVAA 5AESA 2VTDA 3TSAA 1OOEA 1JAHA 2R1VB 3ST7A 1T36A 3L7CA 1G5IA 2J6BA 5AHOA 5L51A 1NMXA 4MGKR 4H31A 3BM5A 3IP1A 2GA8A 3GWZA 4OQYA 5DX1A 5KJ1A 3CPJB 1OVGA 1FMCA 3ONEA 4WZAE 1SQGA 1L1FA 5LA6F 1BVHA 1GOTA 4IEFB 4MB0A 4XAQA 5BSVA 1HR0B 1F8UA 4AJEA 4ZIRA 5IJWA 4M0KA 4TRNA 1CHNA 3FCUB 4JBYA 2AFHA 4LMAA 3T4UA 3AEKA 1QVZA 2MJLA 3KT6A 4ID9A 2NQ8A 4KQKA 3U3JA 1O94A 1UZMA 1A8SA 3T6KA 4CYMA 4HS9A 3GY0A 4H35A 1IN6A 5EQDA 3I76A 3ISJA 4BNXA 1WCIA 3RSSA 3WQHA 2QP3A 3HB5X 5PGMA 1PS8A 4AZTA 3ZCRA 4NAVA 4AC9A 2QZPA 4GI3A 4FI3C 4UMDA 4UBIA 2HMSA 4YR9A 2UYCA 1EQUA 1NBMA 2I4LA 2PUGA 4W5OA 2JI6A 4LZJA 1F1JA 1XPJA 4N5IX 4ZAWA 5AQ1A 5LYJF 2PWZA 3U1BA 2Y1GA 5EPEA 3LUFA 1RYFA 1Z6XA 2WU1A 3CEAA 1B43A 4BQOA 1E3WB 2JKZA 4FCWA 4F3KA 4ZICA 1ZUD1 5IVKA 3CN7A 4K3UA 3Q5DA 1USKA 1UBJS 3BWYA 3LNCA 5ARCA 5F78A 2ZBGA 3CT6A 1Z34A 2R6GA 3DAOA 5F33A 4EG7A 1RE0A 1ZIPA 4OB7A 1GUDA 1PVDA 4CL8A 4YCMA 3BS4A 3J81k 2FN7A 5DK4A 3VVMA 3A6PC 5JASA 2V5UA 4Q1AA 2OXTA 5I7EA 4I8DA 4F6CA 3RADC 2AZXA 1N9ZA 3TZEA 4CMIA 2ILTA 4M89A 3QPDA 1T91A 5FOTA 5GZ6A 4J1TA 3KTOA 3EMKA 3VI4B 1E1LA 4AY4A 1G98A 1LSJA 3C97A 1VLHA 2E5FA 2YS7A 3ZN2A 1JKJB 4MQEB 4YJHB 3ZW9A 4FWBA 4EX6A 4G5SA 1Y6FA 1EQAA 5IKOA 3H4TA 3VKWA 3JWHA 3C70A 8LDHA 2DBRA 1MW9X 1PFQA 4LPKA 2NG1A 3FHJA 3MA0A 3MUOA 4U3JA 4HCJA 5AJYA 4JODA 1V43A 2QG4A 4U7GA 5JZ9A 2AOWA 3H99A 4HWKA 2I3BA 3LS2A 3OFSA 4B32A 1N5KA 2AWOA 4Y2JA 1ECCA 2JBAB 1QYDA 1WMEA 3T9BA 1ID1A 5JCJA 4W9RA 3OLXA 3PRHA 2AN3A 2D3TA 3CJRA 1MCZA 3D2AA 2QW0X 3MJHA 1CVLA 5HUJA 1KDRA 3QFTA 3W3AD 5EXPA 3Q8LA 2J48A 3AOEC 5JYBA 1SPXA 1SOUA 2QX9A 4FWTA 1E4YA 4R5MA 3SAJA 4JBNA 2EJUA 1RYZA 2DUNA 3QMVA 2VAWA 5E2IA 4KQJA 2D2XA 3HJGA 4RQTA 5GV7A 3VYRB 3OHSX 2AEMA 2PGLA 2WSIA 3KQUA 4P3XA 5DYNA 3IA7A 2G4CA 4B80A 4NV3A 3Q15C 1ORRA 2DBZA 2ST1A 4I1RA 4TSFD 4JZYA 1TZCA 1FS4A 2RG1A 4QASA 1QDEA 2IYSA 2ZPAA 4RA6B 4CM4B 1MD9A 3DOJA 1L5HB 3IFSA 4UU7A 2NO0A 3RASA 5F2OA 3CB2A 4YAFA 1REQA 4YR7A 4CLOA 4DIKA 5KQSA 1PWEA 5EKDA 1PWZA 3OLYA 4RF5A 5FYQA 3W2FA 1IQUA 2HV9A 1VI5A 2O7RA 2PQ6A 4TV9A 4UCQA 1ZOLA 2J9YB 3OQMA 1NHWA 1JLHA 2YICA 3ITEA 5CB0A 2Q29A 3U7EB 1I36A 3B3AA 4B73A 5FOWA 4OI0A 1IM5A 4KO4S 1KYWA 3NONA 1YS9A 2I76A 2PTGA 2AZMA 2PKYX 2E6UX 1VIYA 2NIPA 2AFIE 3BUSA 4GZ3A 4RFLA 1PP4A 1IHOA 3LVFO 3FVTA 5CLLA 1PDOA 1Q1QA 5K0LA 1N3IA 4DQKA 3U16A 1TT7A 5HRAA 4JYZA 1UODA 4Z4IA 4JUFA 2BEVB 1G9SA 2B35A 4C7XA 1Y4AE 3EGEA 2P4SA 1V2GA 3KYCB 2J6HA 4GUDA 5BN4A 3H9CA 4Q93A 1NR7A 4DC1A 2D5BA 3OY2A 2JI8A 1FP6A 2JLQA 4XJSA 1PR5A 3LUCA 3PFIA 4Q1FA 4YJGA 4CRWB 1RR6A 4D4JA 3EPKA 3SR0A 5LVAA 4GDFA 3ZWAA 4RIEA 3RS4A 3VVLA 1XQVA 3DEZA 1YTLA 1OIWA 2VJMB 1H4QA 5K6TA 1M0EA 4WDRA 2PSDA 4PIPA 3ZXYA 2L0XA 2P3OA 1NNEA 3V7UA 4WNYA 2CUNA 4J0DA 4YJ3F 2GN9A 4TN5A 2B2CA 5ALZA 3ZQ6A 1EVJA 5FHQA 2OBNA 1HLDA 2GEKA 2OCGA 5HDQA 2CE7A 4BKPA 4D26A 1RLIA 3DE4X 4Q3KA 4GVPA 5F2NA 3R44A 4D80A 4LJ5A 1GGKA 1VMAA 3QVVA 2ZB3A 1PL8A 4KLZA 3D3KA 3I0ZA 1Y3AA 1FMJA 1I13A 1PT5A 2ERXA 3ASVA 4L73A 2C5SA 4TXHA 4DNQA 2V55B 1J5XA 3UB4A 3QX3A 1O87A 3LMKA 1OFUX 1DFIA 2IOFK 4AKIA 5ALUA 1F20A 1P9WA 2TMYA 3RYFA 2PX2A 1DKLA 2ZBDA 2P9BA 1QRAA 1VSTA 1OUMA 3GLUA 1P2GA 1QVVA 2ZJ4A 5AHRA 3MSXA 2QYOA 2Y1LA 2B5VA 4C3OB 5KOJA 1ULSA 3W7VA 1T2DA 3BHJA 2QENA 3RNOA 1CEXA 1CLUA 1MFPA 4F5ZA 4B4VA 4DDWA 2Q5EA 3HNOA 3L4KA 2OC9A 3U2QA 4CQMB 5BPFA 3R9XB 3LHFA 2BFBB 3M9XA 1LVUA 1VIDA 2QTBA 1JQJC 3SDZA 4Y8VA 3D6VA 1VSVA 3UA4A 1EEHA 4BAZA 1NC3A 5DNDA 3R4VA 4HAZA 3I6MA 4DLLA 5CG2A 1RLOA 2OORC 2JAPA 5ALIA 2X7HA 1EFCA 1QKIA 3E2PA 1CBUA 4D4LA 3OFND 5A5EA 2X19A 4F04A 1V7QA 5DGHA 1PS0A 1NLFA 4I1SA 4NENB 1U2DC 2IWHA 3PQ7A 1Y81A 1WQ3A 4QJ4A 3EGXA 1UBLS 1T8TA 3T4EA 5EVJA 4H16A 3BK7A 3BJMA 2FG5A 2BP7A 3FD8A 4CTNA 5MDHA 4DUYB 1NVMB 1DKUA 2CFSA 2UVPB 3IVMA 4WMLA 3WNQA 5ICMA 5J58A 1PG2A 2MSKA 4GGMX 2BDEA 4IO1A 4JMLA 2R6HA 1NKSA 4XI9A 3VMMA 3CZAA 4DJTA 1CJKC 3T4PA 4OXXA 2IF0A 3FBGA 3L8CA 5DHQA 2H52A 5BSHA 1MB4A 1Y89A 4IJMA 5KI6A 1RXSA 4OYHA 5EMJA 4BEJA 2E1PA 1RJGA 4KE6A 4JI2B 4KX3A 2VJYA 4KQFA 2H63A 1H4VB 2DOKA 3D4BA 4W5NA 1V16B 4DVGA 1ORTA 3CN9A 3OM1A 2JZOA 1FS5A 1P1IA 4I19A 4J0EA 3ZYCA 4YMVA 2OG2A 2JCVA 1DOZA 2QRNA 2CMGA 3DMFA 4BRWA 1XZLA 2H0AA 3GIWA 3PNBA 2J07A 3ZE2B 4DWOA 2WIFA 2MYNA 2DR0A 3L0DA 5B1HA 1XVLA 5GY7A 2CE2X 3LCRA 4AJPA 2ILVA 4BVLA 2AG1A 2CY0A 3HB4X 1VI6A 3TLZA 4MPTA 3U19A 2A8YA 2W5UA 2XEDA 2CZCA 1B7GO 5IXJA 1J7JA 1G7RA 1Y98A 3X1ZA 5LQUA 1HZZC 1LV7A 2ZDGA 5K6AA 2XGSA 3T5PA 3R20A 1AKQA 2WQ7A 2WJIA 3IAFA 3QOXA 4QU5A 2H07A 1MZPA 5J2UB 4RD3A 2P1ZA 3UK7A 1VRWA 4AKTA 3ZG6A 3OT1A 3BJIC 4ASUD 3V7NA 4UUOA 4DXAA 3RG2A 2PUBA 1DAOA 4U6SA 3UHJA 2D1QA 1Y7IA 3GDGA 2XVAA 3IBYA 3OIWA 3PDHA 2FZ5A 4URFA 3L3BA 4JI3B 5CPBA 4M6WA 1ZN7A 3WOVA 2G4VA 1YZNA 3ZU5A 4KUGA 4E14A 4L6AA 3ZHSA 4WZZA 4F84A 4CTJA 4ENUA 1SELA 3GFOA 4FGJA 3W3AH 1XJWA 1O95C 1TUGA 2CLIB 4LE2A 2OMKA 5HGXA 1R4MA 1H2HA 1PFVA 3G9QA 2JAOA 3CVWA 5IVHA 1BQ4A 4OHVA 3LL7A 3R8CA 1M6EX 2H8KA 4EFDA 4PZDA 3KPUA 4G0WA 3T3MB 1KIAA 4EGSA 3VDQA 2FZWA 3OT1B 4H7HA 3LCVB 4QG3A 5JYDA 2KX7A 1GV1A 5JH7F 2XRYA 1Y7LA 3L8DA 1C3OA 1Y3FE 3MTEA 3L4BC 5K2OA 1RP1A 3QG1A 3QKWA 3WHIA 5TQ0A 1GN8A 3ZUGA 4BVKA 2FA9A 3ILXA 4Y98A 4C4TA 4JLSA 4CLXA 3WBFA 2NPIA 4RA9B 3USZA 4BLVA 1FTQA 1UJCA 4NCAA 3AVTA 1JGTA 2EXXA 3BOSA 3RTDA 3KZNA 5F9FA 1WXFA 3U9LA 3PEWA 2FMTA 1FX1A 3HJHA 1ZGCA 3OCCA 1V6AA 3IULA 3PK0A 4UM5A 1IUNA 5EFOA 1FNDA 2PZKA 2CUZA 4HH0A 2P41A 2QXTA 5LZ5A 4C3VA 2VEDA 4KTTE 4KNYA 2YRXA 2ZWPA 5KX5F 1Q7GA 3L04A 1FP7A 2B4TO 1VL0A 5HEKA 5KNBD 1IULA 4GMFA 1MENA 2J4CA 2OV3A 2YINC 3GCDA 3UAYA 4KQGA 1AKRA 4K6FA 4OXKA 5DNYB 2LIVA 1Z7GA 3NV7A 3CINA 1M10A 5AK4A 3X1DA 4BLRA 3FSGA 5FOSA 1EG7A 1C2YA 5FOUA 5LZ7A 3VYTB 4B9AA 3IP9A 1VJ5A 3ECAA 5JZVA 1X7YB 1MV8A 2PX6A 1QYCA 4RV5A 4CEHB 5K3SA 1P9NA 4Y3UA 4GFDA 2QVCA 4Y1GA 4KXMA 3PFKA 4YC7A 1UWVA 4ND8A 1GADO 3NG1A 2ORED 2UUOA 1KI2A 5JT1A 1VKZA 3EWSA 3M1YA 1D2CA 3B1FA 4JUAA 1J39A 1R0BA 4L4YA 1CF2O 2VZEA 5DLDA 3SSAA 4BMOB 1A9XA 5KKCA 3WL5A 2HW8A 4FMCB 1JWLA 5CH3A 1PEAA 4X1IA 2V9PA 4I9NA 4KIFA 5IJ0B 3L0ZA 5BQXA 2PM8A 2VF8A 4IKEA 2Q4DA 2EOAA 4PQGA 4RVHA 3U3KA 5I9IA 2OZVA 3KLMX 1BXRB 3HTXA 2G9VA 3O1IC 2VBIA 1KJ8A 2JAHA 2XY4A 2ZTLA 1QHFA 2OHOA 3DHEA 1NQVA 1GNRA 2UU9B 2XH8A 2QPTA 4M8NE 4ZTBA 2E2WA 3IQZA 4OLHA 4O2AB 5ED4A 5F7ZA 1IK4A 5BXYA 2JGNA 2HHAA 1MABB 4KACA 3I6ZA 4Y2TA 1CY1A 4NZYA 3UHPA 1KI9A 2J6IA 1PE0A 1AMNA 1GY8A 1RXUA 4FX2A 1QH8A 1DG3A 2P1DA 2UXCB 1K3FA 3AUFA 4ZQIA 4GPEA 1KYZA 1T15A 2WRZA 4X1IB 1P29A 1N1GA 2J59A 3CV3A 5AI4A 1GPUA 2WFZA 4HAOA 5AKIA 2XCOA 3LWNA 4RK4A 3WGIA 1ZMTA 5G0UA 1E6LA 3VR5A 2JA1A 3WMEA 3V00A 1KA9H 3CLVA 3JTMA 1HE5A 3KOXA 4OATA 4NIMA 1NMQA 1I80A 4E30A 3MINA 1GV0A 4CT4B 1WW8A 2H1IA 2VPPA 5BT8A 1P73A 4LW8A 3TOVA 3UGTA 2D4AA 2V1UA 1K9SA 1ENPA 1E77A 1KIFA 1QLJA 1P33A 2XQFA 2VKQA 2PEZA 3BAZA 3UH1A 1KZGB 3DTNA 1G8FA 4GM4A 1L5VA 2PUJA 4PICA 4AL4A 1XQ9A 3U5TA 1QIGA 3SC2A 1Y1LA 2YW2A 4OU4A 2PKRA 4MPDA 4HVTA 3DJFA 4WXEA 4CQMD 1GZ4A 1S3GA 3NDJA 5HQTA 5LQMA 5LZ9A 2CF5A 3DF7A 3FVQA 4LDNA 4UCWA 1ZS9A 2WLTA 2XW6A 1PX0A 5AOCA 3HA2A 4HUQB 1N77A 3KXDA 2FMHA 5EEHA 1WEKA 2EU8A 1RFLA 2NTYC 5TRTA 2ES4A 5EWJA 3A06A 1J2EA 2IHYA 2W6JA 2P2DA 4W5RA 4ZTZB 2PTHA 1OFGA 2HSJA 2GCGA 4JUDX 2RAPA 1T2UA 1PSDA 4MUIA 1AN9A 1GLVA 4WVFA 1GTZA 5F7XA 2C2MA 5TQVA 4JIMA 4PANA 1JXQA 1XZNA 2V5VA 3RS2A 4ZXPA 4D3YA 2YQZA 4J4HA 1MMFB 4P4TA 4YDHB 1AK1A 3QK7A 3WVNA 2VT3A 1N2ZA 2JHGA 1HFKA 1Q0RA 1PKXA 1IN8A 5CMLA 3PRJA 3C6BA 1JLRA 3QOFA 4MQFA 3OPVA 4G4SO 2D1SA 2MCFA 3IIEA 4NH0A 3RIMA 4BZWA 3INTA 1C5KA 1PKEA 1U1DA 5IM4A 3G0IA 3LP5A 4OP1A 2XB2A 1KI8A 1T6YA 4Y1RA 1VL5A 1BA3A 4M99A 4BO5A 1TC2A 1X8JA 3QOWA 4F3RA 1KETA 1TJ3A 2QAJA 1YJCA 1G38A 5KQRA 4C0QC 3G8AA 4GT1A 5CM8B 4ZYWA 1V8FA 1PJRA 1Z0KA 3NALA 4NCKA 1BS2A 3ENVA 3GG2A 1AZSC 4TWZA 2POQX 3WRWA 3HJCA 1HE2A 2E4UA 3K32A 1G41A 1H4TA 2XWPA 1S3SA 2QI9C 5I45A 2ZBQA 4DILA 1CR2A 4PRKA 3RFUA 3UB3A 3KAKA 5IT4A 3WGKA 4P82A 5B36A 1IPEA 4C3ZA 4QYMA 3PDCA 3ZE6A 2GK7A 4C2UA 1U4OA 3HXQA 3JYLA 2Z8YM 1C0PA 1JU9A 1YBHA 3VSAA 2NPFA 1O03A 4MVXA 3CVYA 3GI1A 3ROXA 3ZTTA 5FUQA 4C07A 3W9YA 4E1VA 2UZ3A 3RF6A 2AMYA 1KK2A 4X24A 2JLSA 4GGPA 3DV9A 1P17A 3E9ZA 4AS3A 5E9AA 4EUSA 2R0QC 3PWZA 3PHHA 1KK0A 4CKZA 3TAXA 1C9JA 3FTCA 1TEHA 2KSQA 2W2XA 4MPRA 4YTEA 1BA2A 2ID4A 1RZ3A 3CH5A 5KNDH 1ZM9A 4LC1A 1CRPA 3BF7A 4ABYA 4D3SA 2P6RA 5ALSA 4N12A 2HRQA 1Q15A 1TUEA 4TL9A 4L28A 1K0FA 3RBZA 2PKWA 5IUNC 1DRVA 5FLEX 2C3OA 3TLGB 1B0AA 1M0WA 4PS1A 2EYUA 4WNIA 1T26A 5BSRA 1LQTA 3RV4A 1Q0HA 3TJMA 3SWWA 2CV1A 2C95A 2JFXA 3AEYA 3U7FB 3A2KA 3PFGA 4G9BA 2HU2A 4Q03A<