1MT3A

Crystal structure of the tricorn interacting factor selenomethionine-f1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mt3A00
4AZ3A 1W6RA 4J7AA 2JGMA 2GZRA 4Y2UA 5E2IA 1S8OA 2VAVA 3R3UA 4BE4A 1GXSA 2WHQA 2V96A 5LZ4A 4Z49A 4ZV9A 4AN1A 3DL4A 3C6XA 4INZA 4Y2JA 4ZWNA 1LPMA 1H2XA 4DNQA 1PFQA 2ONCA 4IQ4A 4U2EA 2CKMA 3I2JA 4Y2QA 3FSGA 4KRYA 1SCIA 1R50A 1MX5A 2GZSA 2Z3WA 3G7NA 3D59A 2XLCA 2O7VA 2HRQA 4BAZA 3V1NA 5A7HA 1ZD4A 4N8SA 1E89A 1MX9A 3X3HA 4W1SA 1DX6A 1BRTA 5AIBA 5HFNA 1L7AA 3ESBA 2PM8A 3O4JA 5AKYA 2WFZA 3D7RA 4UPDA 2QUBA 1F8UA 1HBJA 4Y9SA 1U8EA 2J3QA 4WFIA 2JGEA 4DSAA 1QO9A 1RYYA 5DNUA 1MTZA 2CUTA 4KEAA 2GBFA 3STWA 5HKBA 1X2EA 2ROQA 4BCCA 1BCRA 2BGNA 2AJ8A 4UBKA 5CRIA 3C5WP 3F96A 1XZCA 1CUUA 2WFLA 3GELA 1WM1A 3DCNA 1VE7A 1CUEA 4BC1A 1CUVA 2HL6A 4BVKA 1J07A 1ODSA 3A6ZA 1VOTA 2OXEA 2CJPA 4TGLA 4H7EA 3CXUA 3PI6A 4X93A 3PF8A 3WWOA 4EY8A 3QITA 2XUDA 4KE6A 1L7QA 4E46A 1XLVA 3A70A 3N2ZB 4BBZA 3JYHA 1T2NA 5JIBA 2W22A 5AP9A 4G8CA 1EDBA 1VJ5A 3VISA 3T52A 2BAGA 2HU7A 2WJ6A 1CQZA 1ZI6A 2DFPA 5AHXA 1ZGCA 1EVQA 5JD4A 3KSRA 2RONA 1KEZA 3CCBA 4QDTA 1JKMA 3WK6A 2PUJA 2BUAA 4EY4A 3QM1A 3NOXA 5ALJA 5HF9A 2JF0A 5AICA 3O95A 1U2EA 1LPSA 1GZ7A 1XLUA 3ZI7A 3G0DA 2VATA 3LS2A 5DYYA 2Y2VA 1E8DA 5LZ2A 4HXEB 1EI9A 1R1DA 3AZOA 2ACKA 1GKLA 3AZQA 3VDXA 3LLCA 3STTA 2Z5GA 1D07A 3OC0A 3I2FA 3FBWA 2XUPA 1F6WA 1O6FA 5IVHA 1ZICA 4Q34A 2G5PA 2PSHA 4H18A 4Q3OA 3H0CA 4H7JA 3GFFA 5KREA 2XMBA 4C4ZA 1XZBA 3H2HA 4EY6A 3C5VA 5T4EA 2WIFA 2Y6VA 2H7XA 4BTLA 1ORWA 5HQ3A 2GBCA 1A88A 1VA4A 3QMMA 4DYHA 3D4LA 1FFBA 1FFAA 4BATA 2NW6A 2XUIA 3QMVA 4B85A 1VE6A 3UUEA 4MYDA 3G0CA 1OCEA 2WG0A 3B3QA 5ALFA 5FXMA 4AMZA 4LKOA 5HQ3B 3HI4A 1HL7A 1LLFA 5SYNA 1XRLA 3ED1A 3HC7A 3H19A 5LZ7A 4BC0A 2CBGA 2BFNA 2H1IA 3FYUA 2I78A 2XE4A 5AKKA 4OPMA 1C4XA 1XLWA 5CBKA 3WZMA 3F97A 3E1GA 3DYVA 4UHHA 3C6YA 3V1MA 3M3DA 3WK8A 1EVEA 1W76A 4AZ0A 4H0CA 5D6OA 3V1KA 1BN7A 2XMQA 5EIHA 1LBTA 3RK4A 3HACA 4UUQA 4C88A 4Y2YA 1YSCA 5F4ZA 3DL7A 4RNCA 1ETHA 2OGZA 4RPCA 4FMPA 3IVMA 3H2JA 2PKYX 1P0QA 3GZJA 2I03A 2XUFA 2XUOA 4PF1A 3D2CA 3FWHA 5DTIA 2DHDA 5ALSA 1R3DA 4DMCA 2RHWA 4C6HA 4J0KA 1KU6A 1YCDA 3R3ZA 3KWJA 5CT4A 1UOOA 2VT7A 4B83A 4BAGA 1XZKA 1JMYA 1HPLA 4OD0A 3WL8A 2H9YA 2DR0A 3STVA 3HLKA 2HA2A 1IUOA 1R4ZA 1QIKA 3G9ZA 2XQFA 4CIBA 4AN0A 1BCSA 4CCYA 4WDQA 1E66A 3I2GA 1XZHA 1AX9A 3QPDA 4G4JA 5EHQA 3WK7A 2HIHA 2ZYRA 1IZ7A 2ZJ7A 4XVCA 1EB8A 4MWTA 3WL6A 5AI6A 3ZLTA 2OPHA 2VJAA 4KAJA 3ANSA 3HJUA 2HA7A 5AJHA 4OYLA 2PPLA 4KRXA 3ZLVA 4CCYB 4WJLA 3TEJA 2O7RA 2FJ0A 3DDUA 4HRYA 2PX6A 2QXTA 1WOMA 1C7IA 5AI4A 1VXOA 4OYYA 1Z68A 5AKGA 3HXKA 4NVRA 2O2HA 4BE9A 4FFVA 4X7BA 4TPKA 4QWMA 4EZIA 3WYNA 5D7BA 4AO8A 5AKXA 1YA8A 1XKTA 4BCBA 1W1IA 2XMGA 3STYA 1XQWA 2E3JA 1AQLA 1ZI9A 5ALTA 3SWWA 3E4DA 3D5EA 4MJ3A 5DNWA 1QGED 3FOBA 1UT6A 4JH0A 1EXWA 3FLAA 3KXPA 1YASA 5AM5A 3G0IA 5CT9A 4OUKX 5HFAA 4CIAA 4Q82A 5FOQA 1F0NA 1UXOA 4GI1A 5EHXA 3V1LA 1WCYA 1CRLA 5AK3A 3WA7A 2OCLA 3GROA 5CXUA 4U2FA 1DU4A 2IITA 5LKAA 4U2CA 3G9UA 2B9VA 4KAAA 2OGTA 1FFEA 5LIPA 3WYDA 1A8SA 5SYMA 2QZPA 4WFJA 2XUJA 1NU6A 1ODCA 5FRDA 1U65A 2XT0A 4BVJA 5LP1A 4FKBA 4MWSA 4AO6A 2WILA 2QOEA 3FSGD 3IB3A 3LCRA 5C7YA 1IUNA 5AKEA 4G8DA 3HSSA 1J2EA 3WK4A 2QKYA 3L1JA 4WCVA 4DIUA 1ACLA 4YPVA 1QIJA 2JBWA 4GECA 5T4BA 1CUFA 1JU3A 5K3FA 4UHCA 3EF3A 5AKIA 1NU8A 5I8PA 1ZJ5A 4J0GA 4PSUA 4E14A 1FFCA 1XROA 2QTBA 1H2YA 4HRXA 4RGYA 4UBMA 4JYPA 5E4YA 3V48A 3I1IA 2HRRA 2JGFA 4UFPA 3I2KA 1LZKA 5A71A 5AM0A 1GQRA 4D9JA 5JATA 1T4MA 1IVYA 3AJAA 2WSLA 5K3EA 4O08A 4K6KA 4HS9A 3L1HA 5LYYA 4J3JA 4QWWA 2AXEA 1DWOA 5ALIA 4Y7DA 1BN6A 5HCUA 2VJCA 4L9AA 2PSFA 3STXA 3QH4A 4LIPD 1DWQA 4LXGA 5FPPA 2Y1KA 3M81A 2OQIA 5JAPA 4P08A 4IH9A 1JJIA 3ICWA 3C8DA 1WPXA 3PF9A 2WUGA 2AJCA 5IVKA 3C43A 4B80A 1CUDA 3ESDA 5IKXA 4N8DA 1L7RA 1Q83A 3VXKA 3FYUC 1THTA 4BDSA 2WIKA 2GYUA 3H04A 2PBLA 3MVEA 1UOPA 1FJ2A 2XMRA 1XZEA 4I3FA 4WY5A 5AOBA 4G1FA 4LHEA 4ZRDA 5JANA 1CEXA 3FVTA 4H7HA 4MQMA 2R8BA 1TKRA 2VTVA 4F60A 3LIPA 1XFDA 1AURA 2WUDA 4QDXA 4P93A 1VLQA 2WFMA 2IIVA 2X76A 4HXGA 5DWDA 4MXDA 4QDUA 4UBJA 2OCIA 4OU5A 3PE6A 2PUHA 5C8ZA 3IUQA 1R9MA 5DJ5A 5ALVA 3V9AA 1XKLA 3WI7A 2WJ4A 1H23A 5ALGA 3R41A 2WKWA 1YB7A 2VF2A 1HQDA 1MAAA 3FLBA 2O2GA 4X00A 4EY5A 3W9UA 1OXMA 4X95A 3ANTA 4ZXFA 1XZIA 3G9TA 4FLEA 3C70A 2FUKA 2WG2A 4KYVA 2ES4A 4ROTA 1GGVA 4LXIA 4OB6A 4X6YA 1YAHA 3W9BA 2QM0A 2XQIA 5C8VA 4OU4A 4C87A 2WU4A 1E3QA 2WUEA 5JASA 5ALKA 2GYVA 3O9VA 3BIWA 3DQZA 4IH1A 1XRMA 1ZJ4A 1P0MA 5ALQA 4OCZA 3WA6A 3E3AA 4DGQA 1DX4A 1CLEA 4ZI5A 3DYIA 3ILSA 3ICVA 2V98A 1N1MA 4X3CA 4NMWA 2ZYHA 3WKBA 4BCDA 2WHPA 1VKHA 1MN6A 4FNMA 1EX9A 2HU8A 4LXHA 1UK7A 1W52X 5IVIA 3DOHA 1F0PA 4XWGA 5JZ9A 2K2QB 4FFWA 2BUCA 3B12A 2WHPB 4AO7A 4PNZA 1XZGA 3BE8A 4RE5A 1B6GA 3GA7A 3FVRA 2QJWA 1JFRA 1BE0A 3PFCA 4B9EA 3CN9A 1CVLA 1CUAA 5A2GA 1SOMA 3R3YA 3P2MA 1CUXA 1XZJA 3EQ8A 2VSQA 5AM3A 3R40A 1BU8A 3U0VA 2YASA 1WHSA 3B5EA 5K3AA 4UBLA 4WY8A 2RAUA 1G4HA 3PUIA 4K6HA 2HA6A 5FLKA 5AKHA 2OG1A 2Z8XA 3VJLA 1USWA 3FYTA 5KBYA 2H7YA 3YASA 3PICA 3S2ZA 4ITVA 3H18A 5CTAA 1CFJA 4H7IA 3M82A 2XUKA 1MU0A 2FJPA 4F0JA 1QLWA 1CPYA 2J4FA 2PSJA 1PJAA 2I3DA 1CIJA 1MNQA 2PU5A 1EK2A 1LPNA 3O4IA 4FBMA 3BDVA 4KJXA 2XUAA 1O6GA 4OB8A 4BZZA 1X70A 4X90A 2H7CA 1QIFA 5DTJA 4UFOA 5CT5A 5DYWA 3MGAA 2WG1A 5BOVA 1CUIA 4K2AA 3MUNA 4U2GA 5FUMA 2ZYSA 2RHTA 2ZVDA 3OM8A 4M0EA 2BCEA 4GHWA 2C0PA 3LIIA 3L1IA 2V9ZA 5JYCA 2JGLA 5ALDA 4HXFB 4ARBA 1UKCA 4Q3KA 4PV7A 1B41A 2WJ3A 2JGKA 1LPOA 2XUQA 5CT6A 5BWCA 4DM7A 4BRSA 1FSSA 2ECFA 3WLAA 4KE8A 1TQHA 2EDAA 1DINA 2ZSIA 5CH3A 4G8BA 4I4CA 1QIEA 1AC5A 1VXRA 1Y37A 1EA5A 2ORYA 5JD6A 3DLTA 1P0IA 2VT6A 1Y7HA 1QOZA 2XUGA 3HEAA 2QS9A 3I2HA 5AK6A 3W05A 2DHEA 3AIOA 3STUA 4F5ZA 4QNNA 1QE3A 4B81A 3M83A 1CUGA 4ZREA 2GBGA 5KWIA 2JGIA 5ALNA 4BYMA 1YS2X 4M0FA 5ALXA 1GPNA 3BJRA 2C4HA 5D3KA 5FV4A 5AOAA 5K3BA 2DQZA 3F8SA 3RKSA 2X8BA 3JWEA 4G4IA 3QPAA 4Y2VA 1QIGA 5EFZA 1UK9A 4G9GA 2HM7A 1LPBB 1XZFA 5DLPA 5CH8A 1Y7IA 2PVSA 1ZOIA 4UHEA 3I6MA 4Y2RA 1JT2A 1ZIYA 5HK9A 4M0MA 5CW2A 4PW0A 2WUFA 4KAFA 1QTIA 3ESCA 1TAHA 4OSEA 2GBIA 2WQZA 1GPLA 4J0CA 2RIPA 1A7UA 1CUZA 1VZ3A 4B0OA 5K5EA 1CUWA 1K4YA 3HZOA 1PV1A 5AKLA 5CXXA 1BEEA 4IH4A 1EINA 4A5SA 2CB9A 2UZ0A 4PSDA 5FPQA 3BIXA 4W1RA 3BWXA 1A8UA 5JARA 2HHAA 3NUZA 1BEZA 1TCAA 3O9MA 2CMFA 5C8XA 4X6XA 1ZI8A 3C45A 1DQYA 2OAGA 4IO0A 4W1PA 3D2AA 5LZ9A 3FNBA 2JGJA 4C4YA 4B0PA 2ZJ6A 4ETWA 1UWCA 5A7GA 3I6ZA 5ALYA 4N8EA 2XQGA 4FOLA 1AUOA 5LZ5A 1CUJA 1SCKA 5FP0A 1N5MA 3C8HA 3RLIA 5EIAA 2XQKA 4GLBA 4HTAA 3IA2A 3OPMA 4DLNA 1Q0ZA 5AM1A 3BJMA 1ZD3A 1QFSA 4LYEA 2WTNA 1E8NA 5ALLA 3Q8WA 1H22A 4CCWA 3H2IA 3WKEA 4YX9A 2PSDA 4F21A 4UFNA 2W6CX 2WU3A 2XDWA 3R3VA 4JNCA 4H7FA 3HABA 4HZGA 4DNPA 1JI3A 4C4XA 4B6GA 4B7ZA 3AUKA 1BS9A 5AK4A 1QTRA 2VJBA 3C6ZA 4UBIA 1GQSA 4ZV7A 4CFSA 4Y2SA 2HA4A 4P92A 3WMRA 4GW3A 2YYSA 2LIPA 3TGLA 3W04A 4LYDA 1P0PA 3W2TA 1MT3A 1MAHA 2WLSA 3FLEA 2WM2A 3FCXA 5ALOA 3TJMA 3WZLA 3NWOA 3U1TA 2VAXA 4PQEA 3WWCA 3C87A 5AI5A 5BV7A 2C58A 2QUAA 1J1IA 1LNSA 2Y6UA 1E5TA 1CUHA 2B61A 2Q0XA 5EGNA 4G4GA 4B82A 3CN7A 4PO3X 2ACEA 2DSNA 4XJVA 5ALUA 3SX4A 4JEIA 5AK5A 1LBSA 2YH2A 4YASA 1XZLA 2D0DA 2PL5A 4AXBA 4CG3A 3DKRA 5ALWA 3AILA 2RGUA 3DD5A 5A7FA 3WKDA 5AKJA 4UHDA 3VJMA 2V97A 2WIJA 1ISPA 5K3DA 3O0DA 3RM3A 1X2BA 2J3DA 4X92A 3WJ1A 3VVMA 2QMQA 3IUMA 1HDEA 2QJRA 5AKZA 4QLOA 1CUBA 2EDCA 4QZVA 4P9NA 2HFKA 1OILA 4FLMA 1UOQA 5ALMA 3DOIA 1UFOA 4UHBA 3E0XA 3EIOA 1QIMA 3IBTA 5JZBA 3ZWQA 2ZJFA 3I1YA 2J4CA 2C0QA 5KWJA 1LPPA 4X94A 6YASA 4W9RA 2C7BA 1WB4A 4FWBA 4L0CA 3PFBA 2XUHA 1IUPA 3QBJA 3KWFA 4X71A 1HKHA 4DTCA 2Y2UA 4HVTA 4FTWA 4G5XA 5LLSA 3R3WA 1QZ3A 4EB0A 5YASA 1UKAA 1ODTC 3JW8A 3H1AA 4BVLA 1TIBA 1MO2A 2HFJA 2QT9A 1IZ8A 3H2KA 4AX4A 5H3HA 1QO7A 1EB9A 2QR5A 3K6KA 1CUYA 5AO9A 3UMJA 5ALHA 3K9BA 3EBLA 3AIMA 3CCCA 5IVDA 1M33A 2CEKA 2GYWA 1XQYA 3KDAA 4K6GA 5C81A 4YK7A 5IH7A 3F98A 2B20A 2JEZA 1MX1A 1XRPA 4NZZA 3AFIA 1NX9A 2VJDA 2HA5A 3T4UA 1G66A 5K3CA 4Y2TA 4I19A 1K8QA 3Q0TA 2WFLB 2D5LA 4G9EA 2Z3ZA 4WDRA 3IULA 1EK1A 2C5GA 4AQDA 1YS1X 2HA3A 1ZGBA 4H77A 3OOSA 2DQYA 2XMZA 2G4LA 4U2DA 5HKAA 4EA6A 4J03A 1TCCA 3VKFA 5EI5A 5BWBA 4S0XA 1DQZA 1MPXA 1CUCA 3ESAA 4N5IX 4U2BA 1DT3A 3QVMA 1Q0RA 1K6EA 1A8QA 2PU7A 1YA4A 3NGMA 4QE3A 4H7KA 4MQLA 2B4KA 1ZD2P 4FLFA 2WTMA 1RP1A 4UBNA 1THGA 3BXPA 1DT5A 1GPKA 2XMSA 2HDWA 4BZWA 3QMWA 1J06A 3OURA 4DMHA 3WKCA 4PSCA 2HU5A 3O4GA 5T4FA 4EHBA 4AB1A 5DNVA 2VEOA 3AZPA 4A23A 3N0TA 1EH5A 1Q84A 3UUFA 3H2GA 3F9CA 4ARAA 5EIEA 4AMYA 3S8YA 2JEYA 3QYJA 1DTEA 4MYSA 2QXUA 1JMKC 5DYTA 3G02A 2XLBA 2OGSA 3SK0A 3PDCA 1CQWA 1AMNA 2VQ6A 1N5RA 1XRQA 2X5XA 4B84A 3BF7A 5HK8A 1YAJA 1TK3A 3WWPA 5ALPA 3IUJA 1XZDA 1TRHA 3C6BA 1QONA 3WIOA 4XX1A 1ZD5A 2BKLA 3IDAA 4N5HX 1QIDA 3TRDA 4DNFA 2AJDA 4E11A 4J0DA 1CV2A 5AM4A 1XRNA 2R11A 4H35A 4CG1A 5CT8A 4L72A 3QZUA 4V2IA 5LZ8A 1LPAB 3VVLA 3K2IA 1XRRA 3BL8A 1JJFA 3I2IA 1XZAA 3KOOA 2ZSHA 5D3ZA 3BDIA 2OAEA 2FX5A 1EHYA 5CMLA 4Q3LA 3A2LA 5JALA 4X6UA 3RARA 5JD5A 1UZAA 5J3JA 4J0IA 3FYUB 1WB5A 5CURA 3DS8A 3R3XA 4Y2XA 4C89A 4W1QA 4OB7A 3A2NA 4B9AA 1MNAA 3IIIA 3DEAA 5JAUA 1R9NA 1K63A 2OLEA 5AI8A 3FAKA 1AKNA 3G9XA 5T4HA 5CH5A 3W06A 3A2MA 5AI9A 4BP8A 1I6WA 4BB0A 2OCKA 3VJKA 3G0BA 5ISMA 2EEPA 5AI0A 5A6VA 4BTVA 4QDOA 4JYMA 4UHFA 3WWEA 2G5TA 1ORVA 4CI9A 2P8SA 4XIIA 4BP9A 5JAOA 2I3ZA 3H1BA 5ALEA 3WWDA 1K5PA 1EDDA 7YASA 2G63A 4K5QA 1EDEA 3WQHA 4J0JA 2ZYIA 2CZQA 5EHZA 4E15A 4Q05A 2XMCA 4QEKA 3AINA 3OG9A 2BUBA 1R88A 2IX9A 4X91A 3HYSA 1GT6A 1SFRA 1XZMA 4FHZA 4C01A 3KD2A 4GDMA 5EHNA 4NS4A 1LZLA 4QDZA 4DMKA 5ESRA 2HADA 3OTQA 4QLAA 4EUSA 1U4NA 2QVBA 1UK6A 5FKJA 3ZV7A 2RI6A 3PUHA 1KU0A 1AGYA 5E4JA 2WIDA 1JJBA 1CR6A 3ZLUA 4BRZA 1H2WA 4DSZA 1VA5A 1DWPA 4HAIA 2XQJA 3D0KA 3GBSA 2DHCA 5AOCA 4DMFA 1VZ2A 3F67A 4GEGA 1XQVA 5ALZA 3WK5A 3LP5A 1YR2A 2VA9A 1UK8A 2OCGA 2XI4A 4EBBA 1H2ZA 2HA0A 2XB6A 4Y2PA 3BF8A 1WPRA 5ALRA 3G0GA 1QFMA 5HZGA 1G42A 1HLGA 1TCBA 4W63A 4A16A 3EQ9A 5JZSA 2DCMA 2O2IA 5A62A 3WJ2A 1FFDA 4JUIA 5AH0A 3EQ7A 1XQXA 4MEAA 4QA9A 1CUSA 3DNMA 3DKKA 2Z8ZA 4Q1VA 5I7UA 3I28A 5I9IA 2OQVA 1W75A 3MUOA 4J0HA 1UKBA 3D2BA 4GBGA 4IHAA 3R0VA 5HF8A 3H17A 1AZWA 1WHTA 2XMDA 5JADA 2PSEA 3DJYA 2WHRA 4BDTA 1IMJA 1LGYA 3GUUA 3I6YA 5AM2A 4DNOA 2YXPX 4RE6A 3ZPXA 1QJ4A 2AJLI 1GKKA 4CG2A 1ZIXA 4KACA 2C5FA 3WK9A 2JIDA 3IUNA 1QIIA 1RWQA 1MJ5A 4TVKA 4GXNA 5LKRA 1E8MA 4ZGBA 1ACJA 4UBOA 2BGRA 3WIBA 3WL7A 2BJHA 1WB6A 2AJBA 5FDFA 1QIHA 4FBLA 1BROA 3D3NA 2WIGA 4L3WA 1C7JA 3WL5A 5K3FB 4GWLA 3IURA 5HF6A 1SC9A 4KR0A 1SCQA 3WKAA 3G8YA 4FNGA 2QRUA 1YB6A 1JU4A 3O4HA 4WFKA 3HRHA 3FCYA 1G5FA 3AIKA 1W4LA 4KE9A 4X97A 3SC2A 5E4TA 1N8SA 4EY7A 4FDMA 4KE7A 3QPCA 4BAUA 5HF5A 4X85A 4H7DA 5JAHA 4MEBA 5AIAA
chains in the Genus database with same CATH superfamily
1Z0ZA 2O14A 1K8XB 1M5UA 2IE0A 3N6RA 4QPDA 4CU2A 3HK2A 3C3EA 5EWLA 1AKUA 4AP9A 1IVNA 2GZRA 1QB7A 4PZEA 4UUPA 1BMDA 1UWKA 4KLAA 4Y2UA 5DM2A 3A14A 1KYTA 3IQEA 4MKGA 1KEKA 1GRQA 4RAQA 2C00A 2B6HA 1YZUA 1FNBA 3BMXA 2PX0A 1KDPA 1AKVA 1I33A 4DCVA 1X74A 3OCVA 4ADSG 4LCEA 1LK0A 1YGYA 1ZVQA 1DXHA 3GFOA 4RD0A 3RVSA 4AN1A 2G0NA 4LZWA 1J0XO 5KNBH 5ICGA 2IHZA 1Q22A 4BMZA 1LPMA 5D5QA 2XKKA 5JDIA 4S2UA 2BM1A 4EFMA 2IEAA 5COAA 1WQ1R 4U2EA 1W2HA 2CKMA 2BTQA 3I2JA 4Y2QA 1VG9B 3GQBB 5K09A 1SCIA 2VJQA 2PUBA 5J63A 2X5OA 3PKZA 1G3RA 1GEGA 1LU9A 1WMAA 1I0IA 2GK3A 1HDYA 3QWIA 4DRXB 4CN9A 2RGEA 2W6JD 2CHQA 2ZB2A 1JIQA 1AUQA 2BMEA 2GN8A 2JFQA 2VYFA 3D59A 1JHYA 3JATA 5LXTF 3B89A 3KQSA 3PZRA 3HR8A 3I9NA 1Y7LA 1CTQA 3BB4A 3GNSA 4KPUB 4D96A 4Q6WA 1U3DA 4MV3A 2BDUA 2G1KA 1ZD4A 2IZ1A 1M6WA 1Q1ZA 1U1GA 1VYVA 2HSJA 3KYCA 1ISIA 2FMXA 3MUEA 1R12A 2YY6A 1KZ4A 1ZITA 4W1SA 3OE7D 4FOPA 5F77A 1E77A 2ZAIA 4GUAA 4MZDA 1RQ7A 3CS3A 3DCIA 4KQ9A 4MW6A 4RJLA 3ZEAA 5EKXA 1L4LA 1L2TA 1QS0A 4RS3A 4H17A 3HB4X 3BWEA 3FNHA 3MWKA 3O4JA 4UCFA 3VHXA 1XIVA 5AKYA 3ADDA 4M1MA 3Q8XB 2FWJA 3H5RA 3E6AA 4JVMA 3UJAA 4WA8A 4DWOA 2C2WA 2VNKA 3NPMA 4ZQBA 3SXUB 2AK2A 4UPDA 4CKWA 4LZNA 4M86A 3LOPA 1NRWA 3IIEA 3O1HB 4DV0B 1RAIA 3JU3A 3WC4A 4RVUA 4FYXA 2O8CB 3OIYA 4V0OA 2PGXA 3QX8A 1P5JA 2FN4A 1E7YA 3Q9LA 4L16A 2DU8A 4RV4A 1SVIA 3TX6A 4AQYB 2YWHA 2XPCA 3QE9Y 1IAVA 3LVFO 3M5PA 5EYPA 5J4LA 4PX3A 1L5FA 4BLUA 1CVIA 4FX2A 1DXQA 2AXPA 3K0CA 4WVFA 4HEA1 4DSAA 2F59A 4JK3A 2BHSA 1Y0BA 4RV9A 2IU6A 5KYYA 5IZ4A 3ZGVA 1KP3A 4DMMA 1E0KA 2QAGA 5DNUA 3BSFA 3OQ6A 1J70A 4JUDX 4ND6A 3KZVA 4WZ6A 3CZAA 3GRYA 3QI7A 2QRKA 3S2YA 2WM3A 2Y0DA 2QJOA 2VUHB 2W70A 1J0EA 1H5QA 1KH2A 1T25A 2CUTA 3W2FA 2Q50A 3STWA 4AROA 3OEED 5IKMA 4G65A 4PAWA 1PNVA 1NNI1 4K3UA 4BCCA 2V6FA 3N5KA 3G5UA 3ZWKA 3OT1B 1JALA 1M2EA 2Q41A 2JEOA 3NLLA 2BGNA 4I7EA 4KXUA 5AVJA 3TRFA 3DBRB 2OHVA 1FLAA 2RB4A 3KSUA 3AEQB 3PJDA 4PYLA 3ISVA 2P6OA 3QIAA 5JQWA 5CFRA 1IJBA 3QXHA 5BNFA 1GLNA 1I94B 2ZR0A 3TJZA 1W36C 3DVSX 3DCNA 3P97A 3K72B 1VE7A 4L4UA 4BC1A 4ZTZB 2FSUA 4OQQA 1Y8QB 1CUVA 1N5IA 4FQ5A 2HL6A 4F4JA 2XOXA 1ODSA 4I4IA 3GI1A 1J9ZA 3LUDA 3K4QA 4O4LF 3UT6A 4WKPA 1K6MA 1SQFA 1U9IA 3BJEA 3RUCA 3TEMA 4BECA 4D2IA 4XIYA 5GM2A 1PJQA 4II7A 4E94A 2WDPA 3DWFA 5G41A 4EPRA 2FFAA 2NPOA 4K2HA 3ERCA 2OBFA 4EVSA 4P83A 2E87A 3A6FA 4CCAA 4YR7A 3PNBA 3A3KA 4F2DA 5JCXA 5L6LB 1FQOA 3VMMA 2OBBA 1GEEA 1U11A 4B3BA 3REGA 1U1FA 5PNTA 5KNBD 3FPFA 2F48A 3TIGA 5K8JB 1NWCA 3JYHA 4CKYA 2RK6A 3Q5GA 4DCTA 3Q5DA 3S5UA 3U7RA 1Q0QA 1YRQA 3GL9A 3IUEA 2W22A 3B5JA 2R66A 4G8CA 4BKQA 4CDMA 3Q98A 2GXUA 3H05A 1PDWA 3S3TA 2DGDA 3NNSA 1T2VA 1VJ5A 2R86A 3WYGA 4OA5A 1ZM7A 5E95A 3PJGA 5LD2B 2E0IA 2BAGA 2H1SA 4I1VA 4MCAA 1W5FA 2PVPA 5EWMB 3KETA 1FEZA 3NO4A 3VPFA 1CQZA 1QAMA 2O7SA 4KVFA 4URYR 1BYUA 4EVQA 4R41A 4URFA 4BNHA 2CVOA 3BWMA 4XVHA 1EVQA 2QT0A 4G5RA 2GN1A 3I62A 1SK8A 2FPIB 5JD4A 2FA9A 2QHXA 1R6VA 3KSRA 2RONA 3TCNA 2DOKA 4MRAA 2ZSEA 4W5NA 4KR7A 2WT9A 4IXDA 2WSBA 1G18A 1JDVA 4OHWA 4RD3A 1Y5LA 3GVHA 3VU9A 2O8EA 2JH8A 4L5IA 3CO5A 2DC1A 4MP6A 4NOLA 5DF1A 4YV1A 3CCBA 4NIMA 3U6BA 1JXAA 2Z04A 2Q6KA 1FP6A 4D82A 3GHYA 2I9KA 4OXIA 1ENPA 3CF6R 4UTRA 5H16A 2BZSA 3NOXA 3ZHVA 5ALJA 5B55A 2JF0A 4DWVA 5AICA 5JFTA 4M54A 4P4UA 3THSA 1MHTA 1L7EA 3T4XA 1TAGA 1ADJA 3DLPX 3QFFA 2B3TA 4HX5A 1WG8A 3AI3A 4JUAA 1AQJA 1T4DA 3NOQA 3M6MD 3NVMB 2XTZA 1CY1A 2PXAA 4WW0A 1LDYA 2IYOA 1GA1A 4HDSA 2QVZX 2R47A 4M9ZA 3SDZA 3RAEC 2VATA 2GKSA 4HDMB 4QFMA 3TJRA 4CEHB 4HXEB 3FBGA 3MS4A 3MB5A 3DF7A 4EYGA 1EI9A 3UENA 2GWRA 3E5NA 4OX9B 1HC7A 2FPWA 2PNJA 4TTJA 3H8SA 2ACKA 4EKGA 1GKLA 2ZETA 4YDHB 1B3RA 4CQLB 4N5NA 2FPPB 4RU1A 3LLCA 1PJ8A 1WCIB 2HMVA 4ZVPA 1POXA 4BMSA 3I2FA 4ZKDA 3FBWA 6NULA 3MMZA 4K9SA 1F6WA 4J90A 4DCNA 4P82A 2F9FA 5MFZA 3LYLA 1Z5GA 1JAZA 2G5PA 1T4GA 2PSHA 1LK7A 2IIPA 3VNSA 4RDXA 1SQSA 2WM8A 1A4UA 2J33A 4YY3B 4QL3A 2B37A 3VQTA 3HL0A 4A8JC 1QVZA 4MGZR 3U4CA 2CJWA 1SOUA 3SBDA 3TTWA 5KNCA 4AQ7A 4XYBA 4XAQA 1WUTA 1X38A 2DH5A 4JB0A 1BU5A 3I4FA 2BI8A 4D4HA 1GSHA 5KYWB 5IDVA 2H57A 1FTSA 5IJAA 4YGXB 5H81A 2H7XA 1ULHA 4B74A 4BTLA 4HAWA 3O5AA 5KYGA 1A88A 4TUYA 2FE4A 4RK1A 4X66B 2X4GA 3O2JA 2WKQA 3KYDB 1FFBA 2BFMA 1R4AA 1IWBB 3O4RA 4X0EA 3VJRA 2VPYA 1P1IA 3FF4A 3IRVA 2WYWA 3PXBA 5AHOA 4ZT4A 1IMOA 3QMVA 4O2AA 1UPBA 4L3VA 3BWYA 3DZ8A 4XCQA 4IFEA 1PE0A 1SA0A 2P2GA 2WAAA 1NVWQ 1JIJA 2KHZA 2QSJA 3BE4A 3EGOA 4FE4A 4Q7MB 5DNDA 3UANA 2FWNA 2WY2D 3EIUA 4ZYUA 3BXEA 3RVPA 4YT8A 5L7WA 3G0CA 1LRLA 5E6SA 3GR6A 4ZO8A 2AR7A 2VQSA 3B3QA 5ALFA 4CIXA 2OSBA 4RJKA 3DBLB 2X0DA 4AMZA 1M34A 3JZIA 1HL7A 4LXTA 3LRXA 5CGZA 1LLFA 4EYOA 1FTWA 5SYNA 2DT5A 4WKGA 4IIFA 2IZ6A 1J1UA 3H19A 4UAUA 2JCSA 1F48A 1EUCB 1TK2A 2F8MA 4J6EA 4KLZA 4C04A 5B12A 4FHDA 2AFHB 4JC5A 4UNIA 2Q1WA 2H1IA 2HJVA 2Z2KA 3N1UA 2WBLC 4R7GA 1N4AA 2YX1A 4IG9A 1RRCA 1TQ8A 2CDBA 2FF5A 2I65A 3CIFA 4PHHA 4RF4A 4EI9A 1F7UA 2XE4A 3CVOA 3AUUA 4IINA 5IJZA 5FCDA 2PTGA 3UM9A 1AXEA 1C4XA 1QUFA 4HDOB 4BNNA 3VRHA 3WZMA 1U2QA 3JQ7B 5ILGA 3R3JA 3BFJA 2A1TS 5JAZA 3TLEA 3WZ2A 1VCNA 1RZRA 3K9FC 4AKHA 1ZCJA 3ZW7A 1TC1A 4UHHA 1ARZA 1NBMA 2E85A 1FUIA 4E5KA 4RESA 1O9GA 4DM4A 4H0CA 3PDIB 4UU0A 3V1KA 3KALA 5I9MA 2GS9A 2XMQA 1LBTA 5REQB 1P60A 4IL5A 5EESA 5UKDA 1JHOA 2O3SA 3GEIA 5C4GB 3V4ZA 4DZRA 4JXJA 4RXUA 5FNVF 3O9ZA 3RK4A 1ITZA 4O59O 3HACA 1ZNQO 3CMCO 1UBEA 2VDJA 2I71A 3NEPX 2EKLA 3LQQA 1O95C 2F4NA 4X7PA 3FXAA 4MUMA 5CD1A 1NONA 4LCJA 3RFCA 2QUJA 4B3SB 3DE6X 4FEAA 1ORIA 1ETHA 2ZRQA 4RNCA 2IBMA 3R7WA 5TEVA 3T5AA 5JNUA 1YQTA 1JG4A 2ARKA 2ETVA 4QBTA 2ODQA 3G8DA 2FUEA 4B76A 2PKYX 1P0QA 3TTXA 4XRGA 1RP7A 1V8ZA 1ESDA 4DY6A 5FTLA 4BTEA 3PNPA 1WUHS 3SHTA 4BGVA 4EKYA 1JQAA 2V7BA 1V7CA 4HYTA 4WXEA 3D2CA 2D1SA 4WN9A 5DTIA 4UNRA 2DHDA 3BYZA 4DMCA 2RHWA 3PRJA 1IJEA 3LKZA 3R3ZA 5IT0A 3LPMA 1N8NA 3P9KA 1GITA 5TVGA 1TM3E 3CNEA 4YDQA 4ZRMA 1YU6A 2DQ4A 5TXGA 4BMOB 2JHAA 5LU9A 4WNIA 5T64A 2CFTA 4X65B 4A0QA 2IYEA 3LUJA 4A8TA 1GL7A 5CT4A 2PGOA 2W0MA 5IUNC 4EB6A 3UJPA 2C8KA 3TXYA 2Y4OA 1QOQB 2WYVA 5B1SA 4E33A 4M76B 3IP8A 1QF9A 2NZUG 3WNVA 2AMYA 1ZOOA 1HPLA 1TYCA 1ZCBA 2H1LA 1OWPA 1X1EA 1NVAA 1E63A 2H9YA 2HZBA 1ZXXA 2WD9A 1TAQA 2YMMA 3IT3A 4NV3A 4Q1BA 4X1YB 4XX0A 1HOTA 2HA2A 4E2XA 4KNYA 3INGA 4JA2A 4A4DA 4IVNA 2WSSA 1EX6A 3NRJA 4EQZA 1O97C 2Q4EA 5DCYA 1M74A 4ZZ0A 5HUQA 4MHTA 1IZZA 4ROSA 1W35A 4RTLA 1K0FA 2C96A 1YRLA 1QG2A 2AHOA 1Z22A 1NXWA 5CJ2A 5T57A 1L1FA 4F06A 2QIOA 1E66A 4TYNA 3HSYA 4HR7A 3HU5A 3B9PA 3QPDA 3KHSA 1QV6A 3UB3A 3CEPB 2XXAA 3MMPA 4XVCA 3IILA 1EB8A 4E30A 2WUVA 2NU6B 1QP7A 1OTHA 1ZA2A 3I4CA 2IPNA 2UZ1A 5CVUA 1KXJA 5DEIA 1JT9A 2V65A 3W3AH 1Z88A 3GPCA 4B34A 2OPHA 1XMQB 3NGLA 1OH6A 4ZO9A 4ER5A 3KELA 2PWZA 3E22A 5BVGA 1D03A 3ANSA 5ITWA 2J3JA 4LE0A 4MIOA 4Z6KA 2C42A 5E6RB 2QMUA 3NBAA 5E1OA 1JKJB 1YQXA 5JZOA 1PFVA 1BCSB 1EWYA 1O0SA 3IP1A 1ZMXA 4Q16A 5AJHA 2REQA 2C9DA 3RI3A 3S40A 1HTWA 3WWYA 3TEJA 3PEVA 2O7RA 3CR8A 2J6BA 4BJ3A 1CF2O 1L4NA 4HEHA 4EVIA 3KJEA 2AV6A 5LQMA 4ZOEA 5DW0A 5F7JA 3WP0A 3E48A 1CIPA 1WOMA 1NQTA 5AI4A 2F64A 1Z68A 1M2VA 1GNLA 2Z56A 5FUWA 3ZI4A 5TNXA 2P2LA 5K0FA 2WSIA 1A7KA 2GPBA 3REFA 5KSOA 3HXKA 4NVRA 5C8YF 2RBGA 4NBKA 3SQNA 4W7HA 2NQ2C 3PDUA 5C1OA 5JYEA 1N32B 2HNBA 2NUPB 3VDRA 5GGXA 4QWMA 2XCQA 4RPIA 3W6ZA 1NJGA 3WBKA 4EZIA 2HK6A 4RMHA 3WYNA 2FZLA 3GLIA 4FJ1A 2DVMA 5D7BA 1N75A 1Q1NA 2QL5A 4J07A 3K6JA 3LSYA 1E92A 2VBGA 3MFQA 5BN5B 4BCBA 1J8DA 3C3AA 1GYRA 3G23A 4YP5A 5EFOA 3STYA 4ZIRA 2B2CA 2EIHA 3FRIA 1NRXA 4XCVA 2NWQA 3RCBA 2QJTA 4B8ZA 3ORHA 3FRHA 2ZBRA 3AB7A 4DGSA 4L7QA 4NENB 3WOHA 4CEJA 3PXEA 5JI3E 3BAFA 4R51A 5LC1A 3FOBA 5L6MB 1YDGA 2UXDB 4BO8A 4KR2A 2JZNA 1KR2A 2XRFA 3IAUA 3M0EA 3P4UA 4RMIA 1ZINA 4QUHA 4PYOA 4LRQA 3U13A 3HS3A 4AUEA 5JQGA 3OF5A 1SKYE 2HV9A 5GOTA 4UW9A 1V3UA 3A6PC 3W1EA 1ONPA 4CKBB 5CDYA 5JU6A 1NZJA 2O7QA 1TJ3A 3JARA 2JD1A 5HFAA 4DLRA 3R6GA 4F97A 4CIAA 2JAOA 3TD9A 2JFNA 4EHIA 1F0NA 1WXFA 5E7MA 1XF9A 4EHJA 5LQJA 1T3HA 2YWCA 4FGKA 1CRLA 4I9HA 1U0JA 4LE1A 5AK3A 1L4KA 1AGXA 3IQDB 2WTXA 4OBWA 2V55B 3BL6A 1YUBA 2WP8J 1IN5A 1C9NA 3F7MA 4IWNA 5D1NA 4EG7A 1EFHA 2IITA 3C97A 3P0JA 2B92A 3RJZA 1OKKA 5HR5A 1BGVA 1YJAA 4U2CA 5JS6A 5JV5A 4P0QB 1WVGA 1XTZA 4EJ6A 1SG9A 1NF3A 2BI7A 1GTVA 2IZZA 4KXVA 4ALIA 2YMQA 4J2HA 4RVGA 2IV3A 1UKYA 3RW9A 1Z47A 3B5IA 4P3PA 3DZIA 3VTKA 1BDMA 4LBWA 1KY4A 4YIHA 5KSWB 2XUJA 1ODCA 1TT5B 3IOYA 3N8NA 3W2IA 5JSZA 2F6RA 1ZW6A 2XV1A 3OPNA 3TKYA 4WCFB 1JQBA 1LB1B 1Z2NX 4BEBA 3U56A 4L4YA 3AUJB 5JT1A 1E59A 7MDHA 2O19A 1M7BA 3EDYA 2ZUVA 1TADA 4N47A 1SUDA 1UEIA 1JR3A 4MWSA 4Z1MD 3O8OB 1UP4A 3EY9A 5SZJA 4CFYA 4J9VA 4C7MA 4IS2A 1NVGA 4DLAA 1NI5A 2PZLA 5DIFA 1KTVA 2GRJA 1USKA 3TCXB 3LE8A 4OXYA 3ZJYA 3PPIA 2WILA 3IJPA 5BSGA 1GAXA 4R7ZA 3I05A 9LDTA 3IPYA 4FHGA 2YICA 3FSGD 3IB3A 1VIVA 4FN4A 2G4VA 1WZEA 3LCRA 5C7YA 1WQ4A 3H4IA 8OHMA 3LX4A 3X1KA 5TMBA 3WIEA 1FP4B 1N6NA 2JBAA 3ILXA 3QFRA 4M60A 5D00A 3W3AD 4DUZB 5D51S 4C05A 5HDBB 1ISGA 1T34A 4G41A 2QKYA 3L1JA 4QO7A 3OIFA 1H2AS 2Q5QA 1T8RA 2M1XA 3OCYA 3SZRA 4DXDA 1Q77A 2Q3EA 2LP4Y 1QIJA 2GEUA 1FFXB 1UFQA 2EARA 2JBWA 3H7IA 4NBUA 4N6OA 4BMPB 1MIHA 1MENA 3PHLA 1IPFA 3OA2A 3RVQA 1WF3A 4UHCA 4MWOA 2W8BB 5EE3A 1SC1A 4RJTA 3E70C 3IA7A 3AUXA 1NNEA 1MH9A 5BP7A 1J9EA 3KQLA 1ONNA 4PLVA 4E14A 3Q1LA 1AA9A 1KY3A 1VMAA 1A50B 2K6GA 1XJCA 3EXFA 4TWIA 3E9ZA 4EUNA 1XROA 2KYRA 5E9AA 2PBZA 1PG2A 1PZNA 4ZN6A 5F3WB 2TRSB 2YHUA 2RHCA 4UBMA 3N74A 1H5NA 1I1OA 1GQOA 3A58B 1MD9A 5JNLA 4JI3B 5E0OA 3J81k 5D87A 4DW8A 2HLHA 2FW0A 1AGPA 1V11B 3IELA 5AW4A 4Q3EA 2CLKB 4K7JA 3S7TA 3SE7A 1S3GA 4IS3A 4UFPA 2HDOA 3I2KA 2XE6A 3D31A 4F5YA 3DUFB 4IWYA 4D9JA 1QNFA 2DH6A 5F35A 1R0KA 1NVVR 1OWMA 3VH1A 3UF0A 1WMBA 3IQIX 4OXRA 2QEQA 3LTEA 4ZPJA 3G8BA 5A5FA 3CM0A 2WSLA 1QDEA 1XZ8A 1IQ0A 1NM5C 1KKLA 1O03A 2JFOA 2EWWA 4UC0A 5DHFA 5E7IA 2B69A 1DCFA 2BEUA 2R87A 3OMXA 1P9RA 1XFAA 1Q7BA 1V4NA 1XPUA 5CA0A 1VIAA 3FGPA 4LNUB 4KRFA 1QXSA 3DBOB 3AF1A 4EHKA 2E4WA 3LBIA 4J3JA 5EJGA 2QZ4A 2NTYC 1D6MA 3P2JA 2I62A 4PHGA 4CU5A 4OQZA 1LEHA 1YCHA 2YZMA 1OX4B 3KUKA 2CBXA 1O7JA 4RH3A 4MGHA 4HSEA 4BX0A 1AHIA 2ZIAA 4CQNA 2ZPTX 1RRPA 2YTZA 3GRAA 2CDNA 2ZIZA 2CXTA 5J5CA 4EGAA 5C37A 2PSFA 4DR1B 2I9PA 2O59A 4JLBA 3STXA 2ANCA 4B73A 1DOHA 1M6NA 1XSEA 3JPYA 1OWLA 1N5DA 2GSDA 2B83A 3ECCA 4WKBA 4O63O 5JH7F 5FPPA 3F0TA 2A5FA 5H83A 3D0QA 4C5AA 3DXYA 1PV2A 1W34A 1C9EA 2AN3A 3CTPA 4M9RA 1ECGA 1SG6A 1Z0FA 4MX8A 4PLZA 3ZY6A 2WAOA 1S8AA 4Z5XA 5JAPA 3BZUA 4F04A 3LBHA 3NASA 2WJWA 2QR2A 3HEBA 2ZIGA 1WPXA 3RTEA 3ITKA 5AXDA 1HOXA 2HWWA 1O0BA 2C5HA 3C43A 3O8DA 2OP0A 4AWBA 1KRWA 1IPHA 3O91A 3CPEA 2YNMD 5C53B 2AZ4A 3WV5A 4N8DA 5LXTB 3N0WA 2FQWA 1FSFA 2XTJA 5C18A 4G0OA 3UJ6A 2QU8A 3D8BA 3VXKA 1THTA 3LXUX 3WMWA 1V5FA 2YCBA 2GYUA 3EFOB 1G20B 1N7JA 4ND3A 3TAHA 2Z2JA 3S2UA 1X7DA 1Y63A 3BB3A 3MVEA 4QHTA 4WOPA 3RVOA 1RU3A 2EW1A 3U4MA 2XT6A 4C6RA 1O6BA 4CRWB 5BNIA 5AVSA 4WY5A 1G5IA 5AOBA 4G1FA 5FBVB 3QVXA 1SBHA 4MW5A 4WJZA 4ZRDA 4JYBA 5JANA 3FVTA 4PFJA 4WNAA 4TWRA 2I33A 4X84A 4D0LB 4PAQA 4CKEA 4GRIA 5C4MA 2GWHA 3L0SA 4QXAA 4GVXA 4FJ0A 3SS9X 2PEZA 3NH9A 3X1YA 4ETIA 4E3WA 4M9QA 1V7PC 4S1TA 1PL6A 4R8MA 3TL2A 4AY4A 3LDAA 4HEQA 3ZW8A 4CL3A 1GRVA 2ZZNA 4O4JA 4RF2A 4DHEA 4D43A 2RK3A 2BGLA 3C1AA 2A59A 1NMXA 4P93A 4QDXA 5KTPA 2FWIA 3G49A 4FZ3A 2JZCA 1AZLA 1CFZA 3L8HA 4JLMA 2NACA 1R6DA 2GEKA 1EUDA 4MXDA 2GHIA 3EJWA 4WIAA 5KOHA 3COPA 2YXLA 4PQGA 3GZNB 1NXQA 3ABOB 3KJQA 5DRYA 2H3EA 2VAMA 1CETA 5A3RA 1SC4A 2DQKA 3AV0B 2LW7A 5HZHA 3QA3E 3NM4A 4NU0A 2P7IA 4JBLA 4WD3A 1B76A 2ZRMA 2OBNA 3CB4A 4IMPA 4KQ6A 3EAQA 3MXTA 2JLUA 3N8DA 4BJHB 4DV3B 2OBMA 1QFXA 3H4VA 4LRTB 1UJNA 4ABTA 3UAZA 1R9MA 3VGJA 2I66A 2VTBA 3GLUA 1TA4A 5T6BA 5ALVA 1T3TA 1XKLA 1AK1A 4C6TA 2QX7A 3RRYA 2IT1A 1H8EA 4BATA 1PEYA 2BEVA 4HGOA 1Z6TA 1VL1A 4BN4A 3FUVA 3K0HA 1B26A 3MILA 5H9WA 4U7DA 1AA6A 3AW8A 3BIOA 1D2HA 3HFGA 3MBOA 4P2BA 2IODA 4ZC1A 5KHOC 1HQDA 1P7VA 3IP7A 3BGDA 2IPXA 3A06A 5IM5A 4FQ8A 5K2OA 1L4FA 5DLDA 4N5MA 2W00A 4X95A 3W9UA 5EP3A 4KQ2A 3ANTA 2YWGA 3ETJA 4H16A 3ACCA 4BEJA 1IN1A 1E3JA 1U7PA 2ZXFA 3VM6A 3GNQA 1IXSB 2ZI5A 1OLSA 4OKSA 2X9LA 2WJPA 3GUZA 5HJEA 1X7WB 4RQUA 4EA8A 1CJBA 3I9V6 4L6CA 4JUCA 2Z6VA 4DB4A 1XMJA 3H5IA 1KVTA 4ROTA 2O0HA 5SYAA 1XAGA 2C83A 5HBRA 4O4LB 4XWKA 4J76A 2DFVA 2EG9A 4KWCA 2J9YB 3OZIA 3W9SA 3AR2A 1E1LA 3QX9A 2QM0A 2XQIA 5C8VA 5HGXA 2V59A 4K6OA 1IBCA 4C87A 2WU4A 2ZKIA 3G8AA 3GLIE 1T35A 2WUEA 1J0AA 1K8YB 4YP6A 2Q0QA 1XDZA 5IWCA 3BIWA 2Y76A 2RAPA 1ZJ4A 2YMPA 4N0QA 1P0MA 2O9JA 5BUSA 2P9BA 3EZFA 3AHHA 4OCZA 3ZDQA 5LIRA 1F4PA 4KQ1A 3W5JA 3K5WA 1N8TA 3L0OA 2VQDA 1HDZA 4V03A 3QVJA 3ZNPA 1GV1A 1X9GA 3ILVA 4RHFA 5AJXA 4EIWA 4DGQA 1DX4A 1T13A 4J0FA 3DYIA 3CX8A 3ICVA 3DZDA 2M9MA 3OPYA 4YN3A 3TUIC 4EUFA 2V98A 5IT4A 5L3QA 3SE0A 1ZM2A 5DGDA 3UHJA 3PL1A 3U61B 1W49A 2AZTA 2W6JA 1VIDA 4K9QA 3MTAA 4I9NA 4NYIR 2ZYHA 3WKBA 3CH7A 3OWXA 2IF2A 3BCUA 2BTOA 5F51A 3K9HA 3WLHA 1DJPA 1MW9X 3FTNA 2H92A 1CHDA 7MHTA 1HNNA 2P9JA 1JHAA 2HMWA 1PJ2A 3NG1A 4ENUA 2EQAA 4Q00A 3K6RA 1FP7A 5EUBA 1HUQA 1OGYA 1EX9A 3LCUA 4MS4A 2HU8A 1QG6A 3QK7A 4YT2A 4AP5A 1ABBA 2UVPA 1U9CA 4KW7A 1GA4A 3KKLA 1W52X 3WLIA 1OLUB 1UDWA 3DAPA 2ZT8A 4L6AA 1F0PA 3MWEB 4AVYA 6Q21A 4P5PA 4XWGA 5JZ9A 3KJNA 2YV3A 1TMKA 3CISA 1EZ1A 2CK3D 3FWNA 2D2FA 4RTRA 1GNSA 4ZJUA 1DADA 2NVUB 3BMCB 3MBIA 1C4KA 7GPBA 1A5ZA 2FR8A 4I1IA 5EXEA 4MDFA 2DKNA 1HQKA 3GA7A 3SSOA 4HWTA 3THWB 4UCQA 1JFRA 1C8KA 3ONVA 1NZDA 3DXZA 3LGSA 5SZHB 1C7FA 1H4SA 1PIWA 2DJIA 2EKQA 3M89A 4HMQA 1LXCA 3CN9A 2DKFA 3SHWA 1JHPA 1CY8A 4Y98A 4L4ZA 4GWGA 1IXKA 3NEYA 3MJVA 3WTCA 1J5EB 4LFCB 1NDQA 1AN9A 2CNDA 1RHUA 1VB3A 3BZBA 1O5TA 3KOZA 3R3YA 4G81A 2OC9A 3UOWA 4I50F 1JW9B 2FFQA 1A5TA 1VHWA 1XZJA 2E89A 3N58A 1RYNA 4MA4A 4DCSA 4QHYA 1JSCA 4YYZA 1M2OB 2VC2B 2FUG1 3NHFA 4C76A 5A9RA 2VPIA 3AHEA 5ER9A 1J90A 3VNQA 4AG6A 5KC9A 1NNSA 4DZTA 1M1ZA 1WUKS 2A4MA 2C7VA 2C97A 1JR3E 3TDKA 3R40A 5HSGA 3AETB 1SEVA 5ICEA 4MGKR 3CX4A 3OCWA 5E3IA 2JLYA 1Y33E 2APJA 1N2GA 2YASA 2QENA 3VFDA 5K3AA 3ZE8A 3L4BA 1BAPA 2P5YA 3O2SB 4K6HA 2A0KA 5FLKA 1E3EA 3Q15C 5AKHA 5F1OA 3VU8A 2OM6A 5JBQA 3OEEA 2V7XA 1E3TA 3UT0A 3FYTA 1D1PA 1WD5A 3D7MA 1OOEA 3QLUA 3YASA 2DTDA 3H99A 3Q0IA 8MHTA 3FTPA 2H16A 3H18A 2O8VA 4RHXA 4G36A 2Z30A 5KYKA 1V2HE 2FHPA 4L7VA 3WXBA 5I4CA 1J8MF 3M82A 4YQZA 2CW5A 4I1YA 3TRJA 3ULKA 1P77A 1MU0A 3OP4A 1B00A 2EERA 1WV1A 2IHVA 2R6GA 1B4DA 4I66A 5IC5A 4F0JA 2HV8A 2HSEA 3JALA 2XQVA 2ZRPA 4BNGA 1L8AA 2AUMA 3R9XA 3FDFA 1OV6A 1F9AA 1FDRA 1L1QA 3OJFA 4XQEA 1U7TA 2I3DA 3DDZX 1F8FA 5DGIA 2V4ZA 4RK4A 1OLXA 1XBTA 2HHJA 4FGLA 3ZVRA 1P61B 4FS3A 1FX0A 1LPNA 2ZUTA 3A7EA 4FBMA 1R4MB 2W90A 4EJMA 3BDVA 3S1AB 2D5BA 2JJQA 1QHHB 5EE9A 2CVPA 3ZV4A 2JIZD 1O6GA 3KWMA 4D99A 3FOCA 3D6AA 5EKUA 4PY2A 4CKCB 5LYJF 5JVDA 3NU1A 2ZRLA 5IXSA 1G3UA 4X90A 1BKDR 3U7QB 2LGJA 2L42A 3W6UA 3ROQA 1A76A 1B16A 2WZDA 2CHGA 1W85B 3G89A 3NNDA 1VHQA 3PNQA 1K7XB 4QXMA 5D01A 3LF2A 4OG2A 3NUQA 2HT6A 1T9DA 1H2FA 2YJ5A 3ZDRA 4RW0A 4QT4A 4DWJA 3M6XA 4QLBA 4L9RA 4AFNA 2IKQA 1L9KA 2QQEA 1EFDN 1PW7A 1Z2CA 4LY9A 3L43A 1MIOA 3LUHA 4L9SA 1W48A 5SY9A 2YJ4A 3BFXA 4DLZA 1YQWA 3WX0A 2ZRAA 3Q6IA 2G8LA 2VDMB 4L6IA 4X54A 1QYXA 3RT1A 1BE1A 1ZUWA 4M0EA 5ADWA 1XCJA 4DDUA 2A5DA 5F21A 1MO4A 1VYUA 2BR5A 4TTVA 4DA9A 3L1IA 2WYIA 1XEAA 3C14C 4EI7A 2DBYA 1TVMA 3Q6NA 4XLTA 1G8YA 1GAQA 3JS5A 4OJTA 4PV7A 3RSHA 4INPA 4E0BA 1LV7A 1CDDA 3DKVA 4O3FA 4YMWA 1KZ7B 3GUYA 5FADA 5FNVB 4ZI3A 5JRJA 2IS6A 4C7JA 4R81A 1IJFA 1W4AA 2CLMB 2VBFA 2OQRA 5EJ4A 2IIBA 1C30B 1OPRA 3ITDA 1JJAA 1PK9A 4U7GA 4TYWA 4OREX 3WOVA 2ZRNA 3FTDA 4X8LA 1W47A 2C9OA 1E1YA 3L8CA 2NV2B 3T9EA 5BWCA 1X7XB 2P9HA 3TMAA 4C7XA 1G7TA 2W7TA 2YVQA 5L8VA 5H68A 3RHFA 1DWUA 3QW2A 3V4PB 3VH3A 1ZLYA 2BSXA 2IXEA 2GBLA 1L5HA 5CH3A 1CE8B 5DH9A 3Q12A 2GAJA 1QIEA 3VSDA 1QHXA 3FFAA 4GDFA 3M6UA 3H2ZA 3GX1A 5EQTA 1B7GO 5EJIA 3DLTA 2ZRJA 5EZSA 3HWX1 1IEVA 4DT1B 5G0UA 4P5EA 1J0DA 2GPNA 3D7SA 4GLJA 3RUPA 13PKA 1SVNA 4DC9A 4C03A 3IJEB 3CWCA 2R4QA 1WABA 4PPNA 4GIBA 5U4XA 2IDZA 3ZKAA 3ZUPA 3EDMA 4U0KA 3OPVA 3HEAA 3VI3B 4CZ2A 1EQAA 2X77A 4MWEA 2C1XA 4WK4B 5JBIA 1E62A 1Q74A 3RT7A 3U09A 3WB9A 3DEYX 2GVZC 3FYDA 3AIOA 7YASA 1MDBA 1GGKA 1GLGA 3OETA 5BWOA 3M8KA 1CR2A 1JNYA 3MS7A 2PMDA 4IUDS 4V38A 4C20A 1SXHA 1KH3A 1CUGA 1N6LA 2BZGA 3BWVA 2C61A 4KR9A 4ZQCB 2HCRA 3U4QA 1YBVA 2NU9B 2X0IA 3WE7A 4BUCA 1A77A 2A4KA 4HAUA 4TL8A 4GO1A 4JOCA 1UP6A 4H7PA 4O4HA 2Z58A 1XEXB 4OF4A 3ELYA 1P2VA 2R8YA 4M0FA 1GZ5A 2G72A 2AN5A 3JQAB 1D8TA 1C7QA 1AUXA 1UIMA 2WABA 3FE2A 4NRDA 4KG7A 4KSBA 2C4HA 3TPCA 5KB3A 5D3KA 3O3CA 1DKNA 1ZMRA 3GIDA 4AKSA 4IIXA 3U3OA 3GLHA 1JDJA 4FFLA 4UU7A 4JGGA 1ICIA 4MYCA 1UFKA 2DT8A 3TPZA 4YRBA 2R1VB 4ZAGA 3IMFA 2JKZA 1QIGA 3WQBA 4DV6B 4D0NA 2HM7A 1E1MA 3HGQA 3EMBA 4MI6A 4UHJA 2ZU6A 3UAWA 4AU1A 4G4SP 1SIWA 4JQCA 2PVSA 3H5NA 4UHEA 3HB9A 3K05A 1TM5E 1E2EA 2WWIA 3EH1A 3FNFA 3I6MA 2PX4A 3QKSB 2WU8A 3RO7A 4M0MA 4OMFG 2PJUA 1K8RA 4NCJA 4PW0A 3RUEA 1U0NA 3IESA 3CLRC 1JU9A 4KVAA 4OFWA 3GA5A 4WLUA 3C1OA 1YKSA 2D59A 4G5GA 1X7YA 2VF4X 1TAHA 2FOXA 1JQKA 3ESCA 3G5TA 4HLDA 4OSEA 4Q4HA 5CYFA 5F76A 5BMVF 2FDCA 1V35A 3ISJA 3KV3O 4REQA 5C8YB 2A9RA 1GO2A 1VGVA 3QKRA 2DBQA 2FF7A 3BIFA 1IONA 1XPJA 3E15A 3NFRA 5L3VA 1T1IA 1RS0A 1ZH4A 4QBHA 2HXYA 2JANA 4WECA 3SFVA 2YRFA 1VG1A 5JO9A 1OU4A 3U2QA 3ZXUB 3R0ZA 2DWCA 1E1RD 4KFCA 1QP8A 2OLKA 5IBRA 3EXEB 4QFCA 5CXXA 2X7HA 3IDOA 2QTMA 3JY6A 3MINA 4JI1B 4C2UA 1R8JA 5CLQA 4DLYA 2OO5C 2Z9DA 5IKEA 3B6JA 1LC3A 1G6OA 2WM9B 1BQEA 3EEBA 2UZ0A 3FPAA 3ZQ6A 4A5SA 5DISB 1JTFA 3QI2A 1B0ZA 2RGDA 2ZUWA 1HV8A 1CLUA 1RLJA 3AG6A 1C8LA 3AH8A 4KQXA 4F46A 3OPQA 2UUBB 4B4WA 4M3NA 4W1RA 3EODA 1E79D 3OICA 1PQPA 1XCGB 3W0LB 5GM1A 3F6SA 3ZWNA 4RTSA 3DOEA 2RJ3A 1L1EA 2D2EA 1Q0PA 2HHAA 2RGAA 1EUYA 4I9UA 4ZCQA 4CV1A 3CJQA 3LVRE 1R5JA 4FYKA 1JS1X 2ONYA 2FW6A 2WRZA 3E0QA 1D4ZA 3HBLA 4HL6A 4N82A 3RSLA 3U3KA 4D42A 5BPFA 1PLKA 4MR8B 1UL1X 2CUZA 3AW9A 3B1XA 4PYKA 4MYHA 4YMSA 5CIQA 4ZAXA 3NHRA 3L02A 5F9FA 2ZQYA 4RL4A 1UJ5A 5C31A 5FH9A 1SHTX 4NQRA 4F56A 5C8XA 1ADGA 3A4MA 4I6GA 3UMMA 1ZVMA 3GU3A 1JAIA 3HBNA 2OCBA 4YRLA 2Q7OE 3VMFA 2E4AA 2Y05A 3HDJA 4FILA 1GFZA 5BSMA 3CYFA 4DLLA 1YS4A 3A05A 3WJ7A 4W1PA 3D2AA 1Y1KE 3BRWA 3QU4A 4FDLA 4GZLA 5P21A 5CDHA 5L51A 2GM4A 3GARA 1COWD 3OLWA 5IG2A 2GM3A 3VNBA 5K03A 5BNZA 2ZPUA 4ETWA 1PGQA 1UWCA 5DHPA 4ZAVA 4QOHA 3SJCA 4MP8A 1NKSA 4E5SA 1L5VA 1ZHFA 2W4QA 2XWSA 5ALYA 5L3ZA 4B2YA 4L2IB 1N78A 1PX2A 3THXB 1DKUA 1FVXA 1PDVA 1Y5NA 4P22A 5B53A 3T99A 2A3NA 2XQGA 3N53A 4KIWA 2DULA 3RRMA 3RSOA 3HG7A 4FOLA 2PS0A 4ZZ1A 2IU3A 4PXAA 5FP0A 1N5MA 1YKFA 2IBTA 4LTMA 1G8JA 3MQ4A 3RLIA 3SJAA 3GAZA 5EIAA 3L7CA 2QVYX 5F3RA 3KR0A 3O03A 3OUUA 4HTAA 3I6QA 3OPMA 4DLNA 5JG7A 4M53A 1AUVA 1L6IA 3LKVA 4LTNA 3WV4A 2QRVA 2NUAA 3PT5A 4LI3X 4ARZB 4KVZA 3UH0A 4QGBA 4M8KA 1ZD3A 2OV4A 3NJRA 2HF7A 1UR5A 4RLHA 4XJTA 3WLLA 4GI2A 1ZESA 3F6BX 2FWMX 3IB6A 3IP9A 2CVHA 2JJ2A 3P2OA 1L4HA 2OCPA 1H22A 5ALLA 1XTUA 5EOVA 3S6JA 3W8DA 3D6VA 4CCWA 2CL7X 3H2IA 2ZT6A 4L8GA 3HWRA 4HZUB 2AN4A 5KTMA 4B6OA 1NLFA 2R00C 3WKEA 2A67A 4W5RA 1YD7A 1XCMA 4YAKA 3M4NA 5DYIA 1QK5A 4YX9A 2PSDA 1BMTA 2BMVA 4KTVE 4U4AA 5HCNA 3SEFA 1XA3A 2HXSA 3T12A 1A9QA 3BTUA 1GGEA 3RIYA 5D7NA 4UFNA 3U40A 721PA 3AP2A 4FFDA 3GP5A 4LZJA 4OJKA 2PRZA 4CMBA 3RF7A 1JQ3A 5FLXA 2AX4A 4W6ZA 4NDZA 1WCXA 4PFKA 3SEZA 4I1UA 1RQRA 2X6RA 3WMFA 3U4IA 2CF6A 3IQFA 2VDUE 1S0UA 1XAIA 2AFIA 2EL7A 3PE4A 4M87A 4B4DA 4B7ZA 1ZN2A 2BPOA 2RDMA 3AUKA 1R3UA 2EBWA 2YQ5A 4HH1A 4ALJA 1W1WA 1TZ2A 2RKBA 1HI9A 3OCCA 2KI5A 1PI3A 2HMYB 2ZYTX 1JFFB 2Q6IA 4TQUS 5KNDH 2DFKB 1MA0A 2ZIFA 5CB0A 4PAGA 4XPZA 2GKOA 5CK4A 5IWAB 4UBIA 1M1YA 2KE5A 3GLGE 4FZVA 2IYPA 4EATA 4DLXA 4TKUA 1NGSA 3WMRA 5A0VA 1QSGA 4KL8S 2YWJA 3MJ4A 2R6HA 3Q72A 4Q19A 2H4FA 1Y3FE 1NNLA 3RT9A 3QLUC 4KN6A 2LIPA 2ZJ4A 3Q3IA 4R1TA 4RKYA 1U5BB 3V33A 2QG6A 4JBHA 1M1NB 3S2SA 4NPHA 2FMUA 3C6MA 1YCFA 3CZ4A 2X15A 4GC5A 3BL5A 5FNZA 4PYIA 2QLJA 3IMCA 3SJBA 1K7YA 4V3BA 3KT0A 1MAHA 1IOVA 2A94A 2WLSA 2D8MA 1MJNA 4ZA2A 4F3YA 1NSFA 4LF8B 1B43A 5KYTA 3L04A 1YZGA 4X24A 1LD3A 3TJMA 4G1UC 4EPVA 5ESDA 3AHJA 1KEPA 4W8GA 4D25A 4Q47A 3NWOA 2CJXA 2VAXA 3U4DA 2ZR7A 4F8EA 3WWCA 1QMPA 2YUIA 3WISA 4LJ5A 5JH7B 5IH3A 3AEKA 1J25A 2QNIA 4ZI7F 3PNYA 1M76A 2IHNA 2Y6UA 2GR9A 1KZHA 2A0XA 1CUHA 2BGMA 3K5PA 4QELA 2B61A 2R8EA 3ETCA 2CVZA 1SN7A 3AR5A 1F3LA 1HYHA 1XK7A 4M9UA 1DIGA 1GL3A 5EGNA 4JGIA 1FMJA 3RDPA 4D9EA 1PT8A 4PO3X 5KYUA 4CLOA 1RI4A 2DR2A 3TI9A 4DLPA 1KEUA 2ACEA 5ALUA 3SX4A 5GJVC 4DIDA 5FI3A 2FV8A 3EZXA 5JTUA 3HYTA 3O8QB 2YH2A 1GU7A 3FZYA 1PFUA 4GNRA 1FQWA 1LBIA 4HADA 4YJ2F 5C80A 3L8MA 3QEBZ 1X42A 4WXHA 1U2RA 2WNSA 2D0DA 3MJRA 4BASA 5I47A 4RPGA 4GG1A 3DKRA 5DCUA 3BORA 4JBNA 2NZWA 2ZIXA 5ALWA 2J3LA 1I36A 4PZUA 1DI0A 1AKWA 4CCSA 1TD9A 4QJ3A 1E2PA 5CEEA 2IHYA 3V6LA 3G2LA 3MWDA 1UWVA 4QGHA 3WBBA 3VJMA 2BGUA 4QD3A 2WDZA 2WIJA 5CX1B 1F8YA 1K7EB 4J7UA 1MZVA 3AYXB 4KK3A 2AB0A 5K3DA 1SB9A 1C9DB 3WVNA 4UTPA 3HGTA 4E7PA 3OZSA 1PLLA 5TGDA 1LK5A 2NZYA 5KNLA 4X92A 1UKVY 1ESEA 2YVUA 1XB2A 1QGDA 1Z0SA 4B5KA 4QSMA 1K6XA 2FVXA 4MITA 2PFGA 4EW6A 2JFGA 2YJ3A 1P0FA 3X0DA 1ZH8A 1A7JA 5DP1A 4YXWA 1CEYA 4PX5A 1V2GA 2G1UA 1HQYE 4GMFA 2EDCA 4TM7A 2ZJYA 1GWNA 1HSZA 3AUTA 3FVWA 2XGMA 3JVVA 3K20A 3PGXA 2RJOA 4O25A 4EGFA 1MABB 1YB5A 1MJGA 3VV3A 3BGOS 3KUXA 2WVJA 4HNGA 2FZ5A 1L5OA 3SZOA 4CHTA 3QSYA 1A97A 1UFOA 3P0EA 5L40A 1XCBA 3DF9A 3AF3A 1CQIB 1WMDA 4OMCA 3BCHA 4MVYA 1MFPA 3CZPA 5BQOA 2P41A 2HHCA 1TEVA 1VLVA 3OX2A 1RJFA 2J4CA 1X87A 1DBIA 1MJGM 4HY3A 2JZOA 4JHXA 5DT9A 4TRMA 4Z51A 1FUYB 4GICA 1LPPA 1Z9BA 4C7VA 4L78A 4S35A 1WDKA 4X94A 1KQOA 1DFIA 3LW7A 4MB2A 4L8FA 1XYGA 2W2KB 3TD6A 1PJBA 4GL4A 4L0CA 2WLTA 4A6PA 1O6CA 3CUVA 3BFVA 4ZMBA 3GFVA 1SZJG 2RG1A 1WW3A 1YACA 1IUPA 2RGGA 2W6ID 2GX6A 3OVMA 3B6EA 4L5YA 4P3YA 2D00A 2JW5A 3D6JA 4RXTA 2E4ZA 4X71A 2DFNA 3P19A 3CGGA 3EHDA 4H31A 2PJZA 3WGKA 5LLSA 2HQBA 5CVCA 4WRRA 3R3WA 4WOBA 1Y98A 3LY8A 5E0KB 3FMOB 2OO3A 5IAGA 2PH3A 4XE5A 1KMCA 1I6MA 3JW8A 3V1YA 1YVDA 1E2DA 1TIBA 2HFJA 2B1IA 2JFBA 3KU1A 4XJXA 3W5IA 5ABPA 3H2KA 1VPEA 4OY3A 3TTSA 3UC9A 3IVAA 4DQXA 1E2QA 1EB9A 3Q7EA 3OE4A 3SFTA 1OXXK 3D43A 2PS1A 2VHQA 3NVAA 2IS2A 2PLFA 2RHRA 3GYGA 4EUEA 1MLDA 2ZTHA 1QC5B 3LO5A 3P9RA 1MB4A 2VUTA 1CUYA 1ONOA 2GFIA 1OV4A 1WXHA 4IIYA 5AO9A 4BY9E 1FTQA 2B8EA 3K9BA 4HN4B 4XSHA 3EBLA 4GKJB 1J8FA 2P6MA 5ES3A 2O1EA 2I7CA 1YH3A 4YJFA 4KWTA 4PLPA 4DC0A 5CAEA 1V8FA 3FB4A 4YK7A 1RZUA 3E2MA 2B20A 3A9CA 2ZYAA 2Q3FA 2QM3A 1CVRA 3B3GA 3LUPA 5HS6A 4D9NA 4KITB 5GINE 1D4OA 1HT1E 2OHIA 4K9RA 1RXUA 4PGGA 2VHEA 3ETLA 2HJGA 2RGWA 5K0SA 4QEDA 4RD2A 4Q21A 3SNHA 3PSHA 1LDNA 2VJDA 3EGWA 2Q2VA 5MFPA 1OU0A 2YDXA 5L9AA 4I19A 4PCAA 1RLMA 2AR9A 1PN3A 3ZIAD 4N5DA 1E96A 4M98A 5IDQA 3H5WA 2POQX 1UM8A 2HCBA 2D5LA 2Q2OA 3QE4A 5LBUA 3HO6A 4G9EA 1PT5A 3WY9A 2NO4A 2XCTB 3FTCA 3KVNA 1H66A 1U4SA 2CCJA 1YQDA 1EK1A 2REOA 3IULA 3JASB 1ZCFA 1YDMA 2VYVD 2WJZB 3WLFA 4AQDA 4H77A 3I5AA 3EEFA 3AEZA 2DQYA 3MLAA 5CLIA 4WVLA 1U0GA 3GLVA 4XH9B 2H2IA 3WADA 4AJEA 1TCCA 2Q4TA 4TN5A 4ZOQI 4TMVA 5EI5A 4TTTS 4CGYA 5BWBA 4B3XA 1MPXA 2Q3HA 3NP9A 1CUCA 2CLFB 2DPHA 1Z5OA 4KMSA 4LDNA 4MW9A 4RA6B 1Z26A 4N5IX 4U2BA 4UVIA 3WAJA 1DT3A 2WUWE 2GKGA 3KUCA 5F3DA 3QYFA 3QV1A 1K6EA 5TQ2B 2IX3A 1A8QA 5AVUA 3A3PA 2P68A 1U7ZA 4L5CA 2GESA 3N8HA 3TIXB 5I7AA 3G2KA 2PZEA 2AVDA 4L5JA 4ZP1A 1V5WA 1HT2E 1TUGA 3KKOA 4H7KA 4MQLA 3TTUA 2WK1A 1CEQA 1F6DA 2VHVA 3GT0A 4I50B 2MYPA 1Z0AA 5CA1F 2X0EA 1YVPA 2CLCX 1Y8RA 2HCTA 1FDTA 1TIPA 1H1DA 2ZE6A 2QQ0A 1RP1A 2W2LD 3EPLA 4N18A 3VPXA 2E4UA 1JZTA 1DT5A 4C2TA 4F4IA 1QRSA 1J06A 3LBNA 2IELA 2PGIA 3I3SR 2W6OA 5ARDA 2WWVD 1RXYA 5IUJC 1BHQ1 1N6PA 4ZU1X 2LRHA 2EBHX 3O4GA 5JCZA 3P0FA 4NX2A 2O1SA 4Q1CA 1CJVC 4CE6A 4PM4A 3RNLA 1XJ5A 3DMYA 3GGOA 1XNHA 3QF4A 3E7WA 3N0TA 4KR6A 2AA3A 1RRGA 2ATEA 1EH5A 2Q1XA 1SQ0A 3GFGA 3GO4A 3N2GA 3VSCA 4J0EA 1BX1A 5BN4B 4C7KA 1JZSA 3G3EA 3KC2A 4HD8A 1WDMA 3P2KA 1IK4A 4E5DA 3L4KA 2JEYA 2JATA 3NHWA 2ON6A 3I73A 3KKQA 2X8JA 5ER6A 2AC4A 3GRFA 1ZZGA 4B79A 1P4GA 4QQFA 1N9KA 1N2HA 3SK0A 4YCDA 3KQUA 1CQWA 2IHJA 3ETGA 5U1PA 1AMNA 3UQZA 2VQ6A 3U16A 1RI1A 1N5RA 1LX7A 4B84A 3FYCA 3FKJA 4HLNA 1Q57A 3C5HA 3BF7A 3SN6A 4BV9A 2Q3LA 4AS3A 2PZMA 3E03A 2UU9B 1GN9A 1EFVA 2WJYA 3WWPA 3T3OA 4XUGB 2IF0A 1DJNA 2R3SA 4NZMA 5GOZA 4D8XA 5KU7A 5HIMA 1EG7A 2J1LA 2HK9A 3KFLA 3JD1A 2RH5A 3FCCA 1TRHA 5SV2A 5LYJB 4JYCA 2VF5X 5DRTA 3PQ8A 1EM8B 1D3AA 1YZFA 2XODA 3K0BA 4PQYA 2J5XA 5CM2Z 1M1YE 2AKYA 5DDIP 4D41A 4XUDA 5AD1A 2SKDA 3EULA 1QONA 3S29A 3PGKA 5BT9A 4QYIB 3CRRA 1VRCA 1XXHA 2JKYA 1CRWG 1I7PA 3N05A 4Z7QB 4XX1A 3SQXA 1QX4A 4IIGA 1SKUA 1RYDA 3DVLA 4CL0A 4CT5A 2XWPA 1AY0A 1GG5A 3EUFA 3I23A 5DT2A 3VH4A 1W1UA 2X6TA 1N25A 4U7HA 4M8LA 1X0XA 1Y48E 2QE7D 2PGNA 3QUTA 1STOA 4E11A 3ZYZA 1HG1A 5A3JA 4KLCA 4R1LA 3F4KA 4BNDB 1Q3KA 1FW8A 1XRNA 2R11A 3TNLA 4ND2A 1MC5A 4KO8A 2NT3A 4H35A 4N9WA 2X8LA 1FIUA 2M6KA 3SVTA 1E1CA 5C9ZA 3EDOA 1LW6E 2H2GA 4DSUA 1GAEO 3SU8A 3LY9A 4V2IA 4EYKA 1LPAB 1UBCA 4WK2B 3JTEA 5HIKA 5HOQA 4BB5A 1H2HA 1V25A 3K5IA 1KDTA 1P1BA 1RWWA 3KIPA 5K51A 3K2IA 2B1RA 5CM8B 4FKMA 4R9UC 1ODFA 2POCA 1YRWA 2XWJI 2ID4A 3LNCA 4TUYF 4NATA 4F5EA 3I2IA 1QUEA 4PG8A 4XIFA 1VC2A 1G8FA 2CK3A 3CWQA 2OESA 2RHGB 1LVUA 3EF0A 2JHCA 3KOOA 3PWZA 1Z45A 4WI1A 3PNKA 3TKLA 3ON5A 5G40A 3OCZA 1DC4A 1A9XB 4LWPA 3T3EA 4O2AF 2PZJA 2C4WA 2V03A 4AJJA 1GCOA 4KXQA 4HFNA 4AYXA 3HV0A 3V32A 1H4VB 5HQTA 4YJHA 5C1PA 3N87A 4EH1A 4JIGA 2ERXA 2OB1A 4ER7A 4RVNA 2QE6A 1JI0A 1R6UA 5CMLA 4KH1A 5IDWA 1YBMA 2VDKB 1RM0A 1LA2A 3U62A 1QR6A 3ASYA 3RARA 2FMFA 2C7GA 4JVLA 5C5DA 2PE5A 4J0IA 2IU0A 2WD8A 1C29B 1BIFA 5JXHA 2P9ZA 2ZRGA 3U4HA 1UZUA 4V1CI 3FYUB 1VL6A 4RUKA 5CURA 5C3UA 3MJTA 4UTZA 1E2JA 2LE0A 5J5AA 3ZX5A 4Y2XA 1QO0D 3P4XA 1W9HA 4OB7A 1XTPA 2AQ8A 2XYPA 4A8PA 1FMTA 3I34X 3BK2A 3DEAA 3LUGA 4HC4A 2QZ9A 4X3OA 4JBWA 5EXTA 4YUXA 2XOKA 2D06A 3SF8A 2GN2A 2XOEA 2YHAA 1P2SA 3FAKA 3I1JA 3W9YA 2AXQA 4DZZA 3UAXA 4MUFA 4FDTA 4P33A 2XKBA 3K71B 3HFJA 5T4HA 1XEFA 2AYYA 3IAS6 3ROPA 3HP1A 3AONB 3WGUA 2BSQA 1A69A 5MDHA 4DAOA 4IZ6A 2RKOA 4D81A 3GUVA 4BP8A 4LHSA 4GXQA 5F73A 2J9FA 2PFSA 2W6ZA 1WV0A 3VJKA 3PPXA 4B3IA 2DBRA 4P4SA 5CNKA 3IT0A 1ZH0A 2VDPB 1QNLA 1SUAA 2DPMA 2ISSD 5F5LA 1JBQA 4FYWA 4YRRA 5B2EA 5BURA 4JP3A 4MPJA 1IOLA 1QU3A 2P9EA 3OJ0A 4GM4A 4KH0A 1RCTE 1GOTA 2ACWA 4KWEA 4Q9HA 3G2QA 1W2WB 4XWOA 4IVRA 4O1MA 2EP8A 2ZM5A 4QJ5A 4HDRA 1RBZA 1H3FA 1Z5WA 2WMYA 1RR6A 3KVVA 3U7HB 4D44A 1UXIA 2O2SA 2QROA 4OQNA 2GJ8A 3ESXA 2IY8A 3GVXA 4S12A 3W5BA 1JEQA 2ZU0C 4HGNA 3K9GA 1ZK3A 3KTAB 1W30A 2WF7A 2YMLA 3GA0A 5ALEA 1HYBA 4JR2A 3RTCA 2QN3A 1QZXA 2PBRA 1VE9A 2AI3A 2CNLA 3FIJA 3HDGA 3L6RA 3O31A 4XVQA 3T7TA 4QGSA 3JQ9A 3NM5A 4JQSA 5J9FA 2ZXUA 3BH7A 4QATA 1G2OA 2PS3A 4JXZA 3AHFA 1I7SB 2CVQA 4U02A 2ZYIA 4IMIB 2Z0MA 4NCHA 2JD0A 3WHPA 3ORRA 1RYMA 3CY6A 5EHZA 4Q05A 2H4HA 3RS8A 1M8PA 4GGOA 4UXIA 3TYXA 4NCAA 5BMVB 3WLTA 4YT4A 1WZIA 4X91A 4YV0A 3R75A 3ZHTA 4QBKA 4WZBA 4DMLA 4TXNA 1AQUA 4DDVA 1XZMA 4K9NA 2JFFA 2W83A 3AEUB 4C3OB 1CJTC 2O8BB 3JYQA 1ZS9A 3BH6A 3LD9A 1NOIA 2HIGA 1LZLA 4IUBS 2ZBDA 4QDZA 3DHYA 2O2EA 4B6QA 3VKUA 2XVAA 5DVZA 1Z06A 2FFHA 3VA7A 3IHKA 4QTZA 4DMKA 2HADA 1IXZA 1EU1A 2DPYA 1I5EA 3PLRA 3QLJA 1GNVA 3SZMA 2P3QA 3BAZA 1EG2A 4MV9A 2YL2A 1LTKA 5B7GA 3A1NA 1NYLA 4MR7B 4URHA 1DEOA 1V9LA 4DLUA 1UAYA 2ESRA 2BBTA 2FR1A 4GLFA 4RIHA 4KPYA 2YOHA 3F4BA 5DOVA 3NAMA 1PNOA 2LNDA 4TLAA 2G5GX 1UKZA 3HKBB 4CTKA 3A37A 4Q3NA 4MR9B 4ZEVA 5B7NA 4XFKA 2EW2A 2YZ2A 4LA4A 3KR1A 1KSHA 4FSXA 5SY6A 1LI5A 3SR4A 3W2GA 4BRZA 2BJWA 3B48A 3KQKA 1H2WA 1FU8A 1SCUB 3DMRA 2ZI4A 1ENOA 2O23A 2V0NA 2XQJA 1HZZA 3NUGA 1QAQA 5BSTA 4HNAA 2XBLA 2R1TB 4PHCA 3PQ7A 2FSVA 2RCYA 4B4KA 2FG5A 1KYZA 1VZ2A 2PYZA 3P32A 2F55A 1GPUA 1JXOA 5BR4A 1GRCA 3PRHA 1LFAA 3R6DA 1UK8A 3NIFB 3ZZUA 5CCXA 2OCGA 4RZ2A 1KKMA 3MJCA 3ONNA 5LA6A 2XI4A 1CY0A 5TS2A 2CSUA 3VAYA 4PRZA 2QRLA 2XB6A 2RI0A 2Y71A 3DULA 4NR0A 3ABZA 1WPRA 3W6OA 4ITRC 4Z0TA 5LJLA 3PJRA 3DO8A 2OHHA 4GH5A 3OEYA 4QUEA 4D6YA 3T5GA 4I5IA 1GTJ1 1KERA 1TCBA 3E58A 5DB4A 5GMOA 4A16A 5JZSA 3SIXA 3PUYA 1TDJA 3U60B 1GUAA 3IP5A 1V16A 2P5SA 4ZEXA 1ZYUA 3Q0EA 5K8CA 3CZ9A 4K03A 1DQPA 5I5GA 4QA9A 1CUSA 3ENVA 1XZNA 1PS9A 3L4JA 2RGRA 1CZKA 1T6ZA 2VSOA 3MELA 4IOJA 3TLGB 2TMYA 1JAHA 3TI7A 3DKKA 1LLDA 4DDKA 1L4EA 3IMKA 1NIPA 3ZWAA 4FFMA 3VTZA 4BKMA 5FV7A 1A2OA 3EXHC 5FHQA 3WGVA 3JVEA 3W8FA 3AOEC 3F7OA 2PT7A 2W2MA 2OQVA 3A6DA 3RYIB 3MUOA 5I48A 2NVOA 1UKBA 3KLOA 4XM0A 5B4VA 5K0EA 5EKSA 8ADHA 4LECA 1R10A 1L5ZA 4FI3C 4R84A 3E18A 1EGHA 1LBHA 1UUFA 4JD5A 1S2MA 1T8WA 5ADVA 2UV8A 5BV8A 4K8OA 4RVFA 3MGGA 4CNBA 3THRA 3DJYA 3ELWA 3ME5A 2C29D 3OOWA 3PC4A 5BSEA 3DO5A 5AJWA 3RTBA 3C3CA 4ND8B 3U26A 4BDTA 1PGPA 3ONEA 4L3OA 3T54A 3V4FA 3JYOA 3ZHCA 1KI3A 4BRUA 5DM60 1TZMA 1T0BA 2Z5VA 5A9SB 5MF6A 3P9QA 2I2AA 4FUQA 4F2PA 2XNKA 1B6TA 1TLLA 1CKEA 1PFKA 2AZXA 4MICA 1J56A 2CGEA 4FJ2A 3QUBA 1HX7A 4MUHA 2PA0A 1VMEA 3BREA 4RE6A 4QQKA 3PK0A 4JP5A 4KXWA 1GYQA 3RVKA 3TMKA 4DREA 4YUYA 5DLQC 3L06A 3GG2A 1QBGA 3WJAA 4A3SA 3A3NA 3KNZA 3QE0A 2NU7B 3GZTB 3SC4A 3V8RA 1AZTA 5AXAA 2P6NA 4CG2A 3CVUA 4QOJA 4QSHA 421PA 1QHSA 3KSDO 1ZIXA 5IF9A 3SEAA 2C5FA 2JIDA 2PUCA 5C3MA 3R24A 5E8JA 3QY0A 1Q0TA 1GPWB 1BG6A 6LDHA 2I87A 3G1TA 5H82A 5TGTA 4M1TA 2OOSA 3DTTA 3TO5A 3ZG6A 1C3LA 4FDUA 1XMSA 3DSRA 4GXNA 4H4EA 4P7FA 3R77A 4QFDA 4FEGA 2OCAA 1V3QE 2ZJ5A 3OIVA 2FN8A 4KQGA 2OD9A 4ESHA 5HRAA 2KBFA 1YR9A 3QJYA 4X63A 4JU9A 5DWVA 3ANXA 4ZVMA 3U6KA 1DUSA 3CLKA 3U39A 4UBOA 1PK8A 3V8NA 3CKKA 2HPZA 3GRPA 4AP6A 1VPWA 1O58A 3K32A 1A9YA 4EKEA 1QRTA 3WL7A 3TIIA 1UBFA 1M54A 1WB6A 2AJBA 4HQLA 5IAAA 4N7MA 1LI4A 4X1KB 4B17A 2HMTA 1K3UB 2C2BA 4HWPA 4RJIA 3IR7A 4FBLA 2AOTB 1XXHE 3V2IA 5ETJA 4BQEA 4UULA 1E1QD 2FW9A 3UUGA 4F1WA 3MJSA 3EUEA 3DEJA 3PA8A 5LSAA 4LOLA 4UOQA 2VQFB 3AOGA 3KOUA 4Q9NA