1MT3A

Crystal structure of the tricorn interacting factor selenomethionine-f1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mt3A00
1U65A 3C6BA 3I1YA 3IUJA 5EIAA 2JGJA 2ACEA 2OAGA 5DNUA 3BIWA 3F96A 3LLCA 4ITVA 2VT6A 4DTCA 3F67A 4UBIA 5HFNA 2HHAA 5KWIA 2BUAA 3FLAA 3QZUA 2CZQA 1H23A 1BCRA 3D2CA 1DX4A 4JNCA 5CT8A 2GBGA 3N2ZB 4ZRDA 4IH4A 3V48A 2XUKA 4KYVA 5CURA 2VSQA 2WG0A 3VISA 5DJ5A 4YASA 4ETWA 2ZJ6A 1FFEA 2VJBA 1RWQA 3MVEA 3FYUC 1VA4A 1CIJA 1EX9A 2PX6A 2QUBA 4RGYA 2HU8A 3BF8A 5ALWA 2AJLI 1HL7A 1XZFA 1O6FA 1EK2A 3WZMA 5JD5A 3H2KA 5ALQA 2ZYHA 4BDSA 1THTA 5AICA 4KE6A 2PSHA 1SCIA 5ALUA 3ZWQA 2IX9A 3D5EA 1BE0A 1W4LA 3G8YA 4BCDA 5DLPA 4BTVA 1CUFA 1QLWA 2OQVA 4P92A 4INZA 4KAFA 4C01A 2J4CA 1H2XA 4E11A 2VAXA 4XWGA 3N0TA 1CUIA 5HKBA 4UBNA 5EHQA 3VJKA 3WLAA 3O4JA 3QPAA 5A7FA 3FYUB 4N8SA 3H0CA 1QE3A 4JUIA 3RKSA 2XDWA 3ANSA 1EI9A 2JGMA 5ALEA 1QTIA 4PSUA 4P93A 2BGRA 4RPCA 1LZLA 2XUOA 4B84A 1UKBA 5K3EA 2PSEA 1FFCA 3C43A 1H2ZA 4RE6A 1MNQA 1EA5A 2X8BA 1XZIA 4MEBA 3C5WP 5EFZA 3QBJA 3I2GA 1EINA 2HA5A 1VZ2A 2YASA 3I28A 4FNGA 1DTEA 5K3DA 5C8ZA 3K2IA 2XI4A 3BJRA 2Y6UA 2RI6A 1AX9A 1Q83A 3V9AA 3V1MA 2XUHA 3FWHA 5CXUA 2R8BA 1UOPA 3PFCA 2WHPA 3DYVA 4F60A 3WK6A 5EGNA 4IH1A 4HAIA 4LIPD 4G8CA 1ZJ5A 3LIIA 4G8DA 2HM7A 1XZBA 1QIEA 3O4HA 4AN0A 5CMLA 5ALNA 5HQ3A 5FPQA 1XLVA 3LCRA 1R1DA 4U2BA 1JMKC 3V1KA 5I9IA 2DSNA 1LPPA 3KSRA 1U4NA 3K6KA 2PUJA 4B81A 4AO7A 1YAJA 4BVJA 3BIXA 4X71A 3HRHA 2G63A 2VJDA 4ZV7A 2YYSA 3WI7A 3EQ7A 1WHSA 1N8SA 5AOAA 5KBYA 3HLKA 5C7YA 1XZHA 4BP9A 2DCMA 1VXRA 4TGLA 1UFOA 1XFDA 2QVBA 1QIDA 3PUHA 2H1IA 2WLSA 2PKYX 2XMGA 1BRTA 4KRYA 5AOCA 2CUTA 1XLUA 1ZI6A 1WOMA 2V9ZA 5JD6A 3DL4A 2GZRA 3I6MA 5HF6A 4WY5A 3H18A 1D07A 2XMQA 3PICA 1GKLA 5AJHA 2G4LA 4X6YA 4W1QA 4E46A 3G9UA 1NU8A 3I2JA 3ZV7A 3FYTA 4OSEA 5CW2A 1EDDA 4Y2TA 4PW0A 2YH2A 3PUIA 4OB7A 4J0KA 5DTJA 3FVTA 4HRYA 1A88A 4LHEA 3D59A 2B4KA 2WTNA 4W63A 3WWOA 3DYIA 2PVSA 1YA4A 1I6WA 1QFSA 4UFOA 5JANA 3VJMA 2XB6A 2CEKA 4N5IX 3WA6A 3WQHA 5E4YA 3MUNA 5AOBA 2XE4A 1XZAA 1MN6A 4A5SA 4BP8A 2ZSIA 4AXBA 3HC7A 5LKRA 4ARBA 1G4HA 3HEAA 5DWDA 4ROTA 1MX1A 2G5PA 3C70A 2IITA 2FJ0A 3M81A 2WIGA 3A6ZA 5JZ9A 3JW8A 5HF8A 3ZLTA 3FSGD 3QM1A 5ALSA 4H77A 3ED1A 3PDCA 4CI9A 5A7HA 3WIOA 5AIBA 5CH3A 5A2GA 3WA7A 3VDXA 2JEYA 1BN6A 2QJRA 4EY4A 1EH5A 2BCEA 2GYWA 1H2WA 1E5TA 2V98A 1DINA 3C45A 2WJ3A 4LYEA 5ALYA 2D0DA 2ZSHA 5ESRA 1C7JA 2DFPA 5HFAA 5C8XA 5ALJA 3KD2A 5ALLA 4B9EA 4E15A 1CLEA 1P0PA 3FAKA 1XRRA 6YASA 3UMJA 4H18A 3I2FA 1MNAA 1XZMA 2Z3WA 5EIEA 2WG1A 3FSGA 3SX4A 5I7UA 5E4JA 3WKCA 1QO9A 2XUDA 3SWWA 2JGLA 2OCGA 4LKOA 1XZLA 4QDTA 4AMZA 4FOLA 1F0NA 4LXHA 1CPYA 4CG2A 3G0GA 5LYYA 4QA9A 2EDCA 1GPNA 4Y2YA 4DYHA 2WIKA 5AK4A 4QEKA 1CUSA 1CUWA 4G4JA 4AZ0A 3KDAA 5F4ZA 3PF8A 1BCSA 4EZIA 4UHDA 2QXTA 1DT5A 4QE3A 4FHZA 5AI0A 4C4YA 1WB4A 3A2MA 4H7HA 2Z5GA 2ZVDA 4P9NA 3CCCA 1CQWA 1QIHA 3G0IA 1AGYA 5D6OA 4X91A 3DOHA 4Y2JA 2VQ6A 1ZI9A 2OG1A 3QITA 1C7IA 5AH0A 5K3AA 1WCYA 3D2BA 3WK8A 2WUGA 1LNSA 3E1GA 2GYVA 5HCUA 2BAGA 2XUGA 1G5FA 2Y2UA 2IIVA 3PI6A 4RNCA 3FCYA 4AQDA 5FLKA 4IO0A 2BUBA 4EBBA 4U2GA 1CUYA 1ZD5A 1VOTA 2WU3A 5IKXA 5ALXA 5LIPA 4U2CA 1CQZA 3O4IA 4M0MA 3WKDA 1PV1A 4KR0A 5CTAA 4WFKA 1QFMA 1BEEA 1O6GA 2XQIA 1IUOA 4KACA 3T52A 1UT6A 3DKRA 4BYMA 3C8HA 4U2FA 2H7XA 3I2KA 4UFNA 4B0OA 5ALGA 2RHWA 1E8NA 3RK4A 4BRZA 1MU0A 2JF0A 5AK3A 5ALRA 2WG2A 3S2ZA 1H22A 2W22A 5YASA 3AZOA 4OU4A 2O2IA 5ALIA 5HF9A 3ZLUA 5CH8A 5LZ7A 1LPOA 1CVLA 4LYDA 1PJAA 1CUCA 4ZREA 1QIFA 4FMPA 3VJLA 3STWA 2QJWA 3DOIA 2DHCA 5T4BA 2EDAA 3O4GA 4ZWNA 2WIJA 4UBLA 4GBGA 1QIMA 4ZXFA 5T4FA 4MQLA 4OU5A 2HA0A 3WIBA 5JALA 2H7YA 4DMFA 1CUUA 1HBJA 3E3AA 1M33A 3KXPA 5LP1A 5ALPA 2GBIA 4FBLA 2XMCA 5ALKA 5C8VA 1G66A 2OQIA 4ZI5A 4X93A 5ALTA 3WKAA 2WUFA 1QONA 3ICVA 2WIDA 1F8UA 4EY6A 3A2LA 3OM8A 4WCVA 4C4ZA 4UHHA 4XX1A 3DEAA 5T4EA 1YASA 4E14A 1XQWA 2VATA 1GGVA 5FRDA 4EY8A 5K3CA 5JZBA 4DNPA 2WU4A 3IA2A 2DQYA 3BDIA 3ANTA 1QTRA 3IBTA 4TVKA 3OOSA 2XQJA 4BATA 3WJ1A 3G0CA 1DWOA 3D3NA 1VE6A 1MPXA 3EQ9A 4Q3OA 3G0DA 4DIUA 1QO7A 4Q3LA 1MT3A 2I03A 5ALVA 2E3JA 5K3FB 1JJBA 1G42A 5AIAA 2B20A 4Y2SA 4UPDA 1YB7A 4GWLA 2O2GA 1UKAA 4XJVA 3M83A 4MWTA 2RIPA 1T4MA 1XRLA 1ZD2P 3I6YA 4BZWA 1JJFA 2AJ8A 1JFRA 5LZ5A 3V1LA 1J1IA 2XMBA 2HA7A 3HXKA 3H2IA 3JWEA 1TQHA 5JADA 4DSZA 4HTAA 1J06A 1NU6A 1K6EA 3KOOA 5AKKA 3WJ2A 2DQZA 3W9UA 4LXGA 2ES4A 2DHDA 3RARA 2BUCA 1HPLA 1KU0A 3F8SA 3I1IA 3QVMA 4W9RA 1UK8A 3H1BA 3G0BA 4UHEA 4DNQA 5HK9A 3BL8A 2XUJA 3W04A 3IURA 3LS2A 3WL8A 3ICWA 2BFNA 2NW6A 4UFPA 2Y2VA 1XZKA 4O08A 1QIIA 3OC0A 5CBKA 2VJAA 3WL7A 2Z8ZA 2VA9A 2GZSA 4KAAA 1XROA 3CN7A 1XKTA 1JJIA 4MEAA 4M0EA 4U2DA 4J0HA 2JBWA 1ZGCA 2PSDA 4D9JA 3OTQA 5DYWA 4ARAA 4TPKA 3WMRA 3VKFA 1CUGA 5DNVA 1VLQA 1LBTA 1E8MA 5IVKA 5ALMA 3C6XA 1XRPA 3BWXA 3O95A 2K2QB 3G9ZA 2WQZA 4OPMA 4BE4A 1XRNA 3CXUA 2XUAA 4BAZA 4Y2RA 4X94A 1UWCA 4F5ZA 4K6HA 3TRDA 4G4IA 3GBSA 1K8QA 3EIOA 4Y2XA 1XRMA 4G4GA 4AO8A 1VJ5A 4FBMA 1RP1A 4H7KA 4J3JA 1B41A 2ORYA 2VJCA 4FKBA 1GQSA 4FFVA 2XQFA 3STYA 4C88A 1E89A 2O7VA 5A71A 4G5XA 1MX5A 3GZJA 4KEAA 1ODSA 1AC5A 1YSCA 3QYJA 3AILA 4B6GA 3R3VA 5AI6A 3IDAA 4WJLA 1SOMA 3AIMA 1HKHA 4WDQA 2OXEA 3O0DA 2XT0A 1L7QA 4I3FA 2ZYSA 5EI5A 5AKIA 4Q1VA 4B80A 4CIAA 5EHNA 2WFMA 1WPRA 3ZI7A 2OCLA 4B82A 1AQLA 4LXIA 3D0KA 3AIOA 4IHAA 3R3WA 1YB6A 4PO3X 4UHCA 1TAHA 2JIDA 3WWPA 5AM3A 4K6GA 5EIHA 3VXKA 2C4HA 2XUPA 1R4ZA 1AURA 3QPDA 4X00A 3DDUA 4WDRA 4AB1A 3F98A 4DM7A 1EVQA 1JI3A 2VTVA 3WZLA 5JAPA 5CXXA 1ODCA 1EB9A 3QPCA 4K6KA 2ZYIA 4QDZA 1J07A 5AM1A 5HZGA 2PM8A 2JGFA 4KE9A 4CCYA 5FPPA 1ODTC 3GUUA 3HJUA 4UHBA 3IUNA 4YPVA 1SCQA 2WTMA 1OILA 1E8DA 2QMQA 3WWEA 2PL5A 4MXDA 3AZQA 3B3QA 5AI4A 4J7AA 5ISMA 2AJBA 2HRQA 2WJ4A 3W2TA 1QIKA 5IVIA 4C89A 1GT6A 5AI8A 1XKLA 2HFKA 5CT4A 1ZOIA 4F21A 1XRQA 1GQRA 1MAAA 1WB5A 4AZ3A 4BAUA 1SC9A 1YA8A 2OGZA 1Y7HA 2PUHA 5EHXA 2V97A 2XLBA 1CFJA 5IH7A 3ZLVA 1GKKA 2C0QA 2OLEA 3QMMA 2O2HA 1A8SA 1DWPA 4OCZA 5AHXA 1P0MA 3GA7A 1CUEA 4OD0A 4JYPA 3WYDA 5CH5A 4IQ4A 1T2NA 1E3QA 3AZPA 3C6YA 4BCCA 2XUFA 3WK7A 1FJ2A 4Y2PA 1CEXA 2FX5A 2X5XA 1IMJA 1P0QA 2HA6A 2W6CX 5FUMA 2PU7A 4NVRA 5JARA 4B85A 3H17A 3C8DA 4NZZA 1ZJ4A 3QMVA 1ZD4A 4XVCA 4YX9A 3BF7A 3R3XA 4DLNA 1W76A 2XMDA 4QWMA 1A8QA 1NX9A 2JGKA 1YS2X 2HU5A 2P8SA 1CUJA 1E66A 1QJ4A 2WHRA 4OB8A 3EF3A 2QTBA 1XZCA 5JAOA 3DNMA 2I78A 1LPSA 5LZ8A 5HKAA 2XLCA 2HFJA 4HS9A 1A8UA 3H1AA 4QDUA 4MYSA 5FOQA 1ACJA 3C87A 4DSAA 4BAGA 5A62A 3QMWA 3S8YA 1Q84A 1ZIXA 2C5FA 1L7AA 4HVTA 3FNBA 3ILSA 2OCKA 4EY7A 4GECA 4FNMA 1WHTA 5BOVA 1MTZA 5AI9A 3PE6A 1KEZA 4W1SA 5C81A 1W75A 1VE7A 1R9MA 4Y9SA 5ALZA 1QOZA 5AKJA 1UKCA 1CUZA 4H7IA 5HK8A 3R41A 2WFLB 2CMFA 3OG9A 3M82A 1W6RA 5AM2A 5LZ9A 4BB0A 1ISPA 5AK6A 2QOEA 2Z3ZA 4V2IA 1JMYA 3GROA 2HRRA 2WIFA 3CN9A 1JT2A 2C7BA 5JAHA 2GYUA 5AKLA 1UZAA 5D3ZA 4CIBA 4ZV9A 2PPLA 3MUOA 5D7BA 2CB9A 1X70A 1XQXA 2EEPA 4I19A 1XZDA 3LIPA 4FLFA 4Q05A 4UUQA 3B12A 2QUAA 3E0XA 4G1FA 4DMCA 1R88A 4DMKA 3T4UA 4GHWA 1K4YA 4H7EA 2HL6A 1GZ7A 4K2AA 1XLWA 2V96A 3WK9A 1AMNA 4WY8A 1IVYA 2HA4A 1ORWA 4QWWA 5K5EA 4DNOA 4QDXA 3W06A 3GELA 1B6GA 2HIHA 2OGSA 4UBOA 3ZPXA 2XUIA 5DYYA 1X2BA 1UOOA 1YR2A 4Y2VA 4FFWA 4J0CA 3HSSA 5CT9A 4BCBA 4BZZA 4DGQA 1MO2A 1MAHA 1R9NA 5DYTA 1PFQA 4X95A 5A7GA 1XQVA 5LZ2A 1FFAA 5AKYA 4FWBA 2OGTA 2OPHA 5SYNA 1XZJA 4MQMA 5BV7A 3W05A 4CFSA 5FKJA 2XUQA 5IVDA 2Z8XA 1CRLA 1CR6A 4HZGA 4BTLA 2DHEA 5AI5A 3OURA 1ACLA 2QT9A 4X85A 3DS8A 4W1RA 4QNNA 3FVRA 1AKNA 3HYSA 4WFJA 3BJMA 5JAUA 2GBCA 4M0FA 1DT3A 3LP5A 1HQDA 1VXOA 3BE8A 1LPNA 1EDBA 3RM3A 3Q0TA 4H7DA 1RYYA 5AK5A 3YASA 3IB3A 4HXFB 1BS9A 4BDTA 3H19A 1MX9A 3DD5A 3C5VA 4DMHA 4L0CA 2HU7A 1AUOA 4MWSA 4BVLA 1JU4A 1Y37A 3OPMA 1LPAB 1OCEA 4C4XA 4A16A 4UBMA 4PNZA 3AUKA 3F9CA 1F6WA 1N1MA 5K3FA 3G7NA 3STUA 3VVLA 5J3JA 5FV4A 4G9GA 5A6VA 1XZEA 5DTIA 1AZWA 3AJAA 5E4TA 2JGIA 4HXEB 4BBZA 2QZPA 4GDMA 2QR5A 3FCXA 4Q34A 1EVEA 5LLSA 2WUEA 5AKXA 5JYCA 5ALFA 4H7JA 3SC2A 4OYYA 5LZ4A 4J0DA 4QLAA 3FYUA 1GPLA 3H2GA 4H7FA 4C6HA 2I3ZA 3R3UA 4GLBA 1ZD3A 3L1IA 5AM0A 3KWJA 3IUMA 4FLEA 4BC1A 4XIIA 4X92A 4A23A 1UOQA 1N5RA 1EDEA 2PU5A 2WHPB 5JZSA 4EUSA 3DQZA 4GXNA 1QGED 3KWFA 4FLMA 4HRXA 2B61A 2J4FA 3FLBA 1CUXA 3IVMA 1HLGA 1ZIYA 2QRUA 4EY5A 4X90A 4G8BA 2XQKA 3D4LA 2X76A 2XMZA 4K5QA 3STXA 3WYNA 5AKZA 1C4XA 5HQ3B 2O7RA 2OCIA 4PSDA 4KJXA 1DQYA 1THGA 1DWQA 5BWCA 3I2IA 2ONCA 4BVKA 3NOXA 3K9BA 5AP9A 1FSSA 1DX6A 5JASA 3G9XA 1Q0RA 1LGYA 3TJMA 1EB8A 1IZ7A 2C5GA 3D2AA 1EHYA 3G9TA 4F0JA 2UZ0A 1UK7A 2QXUA 1TCCA 3NUZA 1FFBA 3R3YA 3FLEA 1YCDA 4CCWA 4N8EA 5ALOA 2ROQA 1LZKA 1J2EA 1Z68A 1TK3A 3MGAA 5AO9A 1QZ3A 4X7BA 4PV7A 3L1HA 4BC0A 1ETHA 1QIGA 1HDEA 3AIKA 3HI4A 2B9VA 4Q3KA 2R11A 4P08A 3AFIA 4PF1A 3F97A 2CBGA 1CV2A 2WFZA 4OB6A 4B0PA 4QDOA 4KE8A 4N8DA 2WILA 4UHFA 4DNFA 2WUDA 2D5LA 3W9BA 3A2NA 5HF5A 2ECFA 2JGEA 1MJ5A 1YS1X 1EXWA 1LBSA 1KU6A 3O9MA 3WL6A 3R40A 2RAUA 3L1JA 3WK4A 4X6UA 5JATA 3WKEA 4J0GA 4Q82A 5AKEA 2RHTA 5CT6A 1GXSA 2XMRA 1WPXA 2VAVA 3ESBA 1TIBA 1A7UA 2Q0XA 4Y2QA 3IUQA 1CUBA 3IULA 4ZGBA 4GEGA 4B83A 5SYMA 5E2IA 1F0PA 2BGNA 3FOBA 4CG1A 5CRIA 4CCYB 1L7RA 1IUPA 5AKHA 3NGMA 1ORVA 4AX4A 3PFBA 3EBLA 1ZICA 3ESCA 3FBWA 1VZ3A 2WKWA 4J0IA 3JYHA 1LPMA 1CUHA 5CT5A 1EK1A 2FJPA 2C0PA 4JH0A 1JKMA 3WKBA 2G5TA 3STTA 2VEOA 2Y1KA 4JEIA 5I8PA 1R3DA 2AXEA 1DQZA 4S0XA 3DLTA 4PQEA 1Y7IA 4U2EA 2CJPA 3C6ZA 4RE5A 1TRHA 1GPKA 3A70A 2HDWA 4B7ZA 1BN7A 3WWCA 4C87A 1CUDA 3HACA 5JIBA 1UK9A 2PSFA 2XQGA 1YAHA 3EQ8A 2JEZA 4L72A 3NWOA 2HADA 4JYMA 4OUKX 5LKAA 4NS4A 3UUFA 1SFRA 3E4DA 1R50A 1U2EA 2ZJFA 1S8OA 4AMYA 5JD4A 2J3DA 1IZ8A 3WL5A 5IVHA 3R0VA 1TCAA 3B5EA 4BE9A 5AM4A 1W52X 2RGUA 4MJ3A 3TGLA 4IH9A 2QS9A 4YK7A 4EHBA 4EA6A 3IIIA 2QKYA 3UUEA 3H2JA 3DL7A 3Q8WA 5T4HA 2WJ6A 3VVMA 4PSCA 5ALDA 2WSLA 2Y6VA 1XQYA 4KRXA 3CCBA 4Z49A 4J0JA 3GFFA 5FDFA 4FDMA 3P2MA 3O9VA 4H0CA 2WM2A 2VT7A 3DKKA 3G02A 4QZVA 3BDVA 2DR0A 1BROA 5ALHA 7YASA 4W1PA 4B9AA 3HABA 4HXGA 4WFIA 3SK0A 3WK5A 1FFDA 2HA2A 1DU4A 2C58A 4KAJA 3I2HA 2ZJ7A 5AM5A 1UXOA 5BWBA 1Q0ZA 1XZGA 2WHQA 3RLIA 2BKLA 3ESDA 1TCBA 1JU3A 4Y7DA 2QM0A 1X2EA 1USWA 1WB6A 4BRSA 1ZGBA 1VKHA 1BU8A 1BEZA 4AO6A 2H7CA 4GW3A 4X97A 1CUAA 2J3QA 4X3CA 4QLOA 5FP0A 4J03A 1H2YA 4N5HX 1QIJA 4FTWA 1N5MA 4NMWA 3I6ZA 2RONA 2XMSA 1LPBB 2CKMA 2H9YA 1IUNA 4OYLA 4UBKA 1K5PA 1LLFA 3DCNA 1WM1A 4I4CA 2YXPX 5K3BA 4EB0A 4KE7A 2ACKA 2WFLA 4GI1A 3AINA 1OXMA 2BJHA 3QH4A 2AJDA 2FUKA 3BXPA 2OAEA 4G9EA 5KWJA 3WWDA 1TKRA 2VF2A 3H2HA 5DNWA 2LIPA 2PBLA 3U1TA 1ZI8A 3STVA 3ESAA 5D3KA 4CG3A 3R3ZA 3PF9A 1CUVA 4UBJA 3M3DA 1SCKA 4AN1A 5KREA 1K63A 1W1IA 3U0VA 3D7RA 3X3HA 3DJYA 3TEJA 1P0IA 2HA3A 2PSJA 4L9AA 4Y2UA 1VA5A 1U8EA 5H3HA 3H04A 2AJCA 2I3DA 5AKGA 4H35A 4X6XA 2ZYRA 4L3WA 3HZOA 1UK6A 5EHZA 3V1NA 5FXMA 2GBFA 4MYDA
chains in the Genus database with same CATH superfamily
3B1ZA 2FP4B 2EAUA 3LLVA 3NR2A 3WE7A 3Q72A 1ZQ9A 5AVVA 1GPUA 1OX4B 2Q4BA 3L01A 3BXGA 3GFBA 2ZBUA 1P18A 4L22A 2W2NA 3MAAC 2GAFA 2JIPA 4HAWA 4Q4HB 4UAJA 1Q16A 3HZRA 2AI3A 3U13A 1YZYA 4XCVA 5DNUA 3BIWA 1WSAA 4E6PA 5TB5A 2QRLA 2HI0A 3CNQS 3H13A 4KVFA 3RTDA 2QXYA 2VT6A 2FJUA 2FF5A 5LNK1 1N0HA 3CRNA 3B6ZA 3HFJA 1Q1EA 3EFOA 4B2IA 1B3BA 4D9HA 4KR6A 1NVBA 4OOEA 2IY7A 4D3SA 4U39A 5B2FA 2HHAA 2YDXA 1OLSB 2IEBA 5JC1A 4ZODA 4IIJF 1SD2A 4RMJA 4TTPA 4O4JB 3VPBA 4X8LA 1WCWA 2W70A 5AVJA 1SK8A 2QG4A 5JW6A 4G81A 3D2CA 1DRUA 1RS0A 4HH4A 4F9TA 3O8DA 1E2PA 2QN9A 4B5LA 2VOJA 3AFMA 4CEHA 2O0JA 3Q9UA 1WXHA 4P34A 4OO3A 4E5NA 4INOA 3MJEA 1C7QA 1GZ5A 1QKKA 3OPNA 4P7GA 1Q6YA 1YS9A 4UD2A 2J9RA 1K92A 2JHPA 1E3LA 5CURA 4KPUA 4IKOA 3ZZUA 1KZ6A 1YT5A 2IK8A 4YASA 2FWNA 1R9JA 2ZJ6A 3LECA 2VJBA 3DB1A 2ENWA 3F78A 5EZQA 3ZZ1A 4NNOA 4HX5A 2EZUA 4G4SP 3EGDA 3MVEA 3B7PA 2DBQA 2JNWA 3NI2A 2IPNA 1JVSA 3ZLBA 3I04M 9LDBA 1PFGA 2ZAOA 4HZUB 1ZGJA 1DXYA 3C3AA 3FYUC 2O5CA 3PPYA 4KQFA 2J0EA 3IT2A 4PZLA 4RS3A 1GTMA 2DQSA 1CIJA 4L6IA 1EX9A 3TQFA 4V39A 2GYYA 2HJGA 1M2EA 1C0IA 2VWHA 5EJAA 2VP0A 1COWD 3VKUA 2DF8A 3DCYA 2OV6A 1OT3A 2C29D 4DMUB 1HL7A 5I7VA 3H9BA 5KSZA 1W5TA 3FPJA 3QFFA 3CZMA 3VFDA 3FOAA 2B5OA 1DC8A 3B9QA 3AR2A 3BMNA 4MDHA 4OQ4A 1ZH0A 3BXEA 4IOMA 5CYFA 1GG9A 1WEKA 2ISCA 4DDMA 4UOEA 4RKFA 5CM9C 3ZU3A 2O48X 3V8PA 2WABA 1XL1A 1XMQB 4XPZA 5DGCA 1RAFA 1I14A 3MJCA 2V3WA 3SDSA 3P9XA 5IT0A 1R27A 2E0IA 2ZYHA 5HUJA 1ZHOA 4ER3A 4DJEC 3FFXA 2HQOA 4LX8A 4DHWA 5J4LA 1CF9A 2D3TA 3K05A 1HQKA 2J3IA 1XTBA 1R0YA 5DSXA 3GYBA 3Q87B 4FFMA 4W8HA 2GD1O 1O58A 4QULA 2JLCA 5HIIA 3V8MA 4RVOA 4E30A 3G8DA 3FTEA 4OXKA 4ZVUA 3DBLB 4BMZA 4G0YA 1FTQA 2JS7A 4IV8A 4FZRA 4REOA 3ZWQA 5I7WA 4R8SA 1XEWX 1YDMA 3AEQA 2YV1A 2VK2A 3Q0EA 4KYTA 3I64A 2CUZA 1E94E 2GJAA 1SGWA 4DGSA 4YMLA 1BVHA 1BE0A 3X1KA 1W4LA 3G8YA 4G3XA 4RDHA 3IHKA 1U0TA 4E07A 4RSMA 1J5XA 1MXFA 1YZTA 4XB1A 3DXFA 3QVWA 5C1PA 721PA 4BTVA 2OQVA 2PKCA 2Q27A 1GN8A 3DCJA 4BIMA 1Q1ZA 2C97A 4MV7A 1FFGA 3ZDRA 5FTLA 1N25A 3RYIA 2ZZNA 3ZGOA 2FNAA 1SBNE 1TVKB 2CK3D 4UVDA 1H1LB 1PQWA 1E3IA 3EW7A 1OH8A 4HNSA 3RSOA 3SAJA 2ERYA 2J4CA 5FR2A 2YHBA 3DMRA 4QAQA 1KR2A 4JKIA 5DNAA 1X13A 2BRUA 4UUNA 4BQIA 1WV0A 1NR5A 2V7GA 4E11A 4YY3B 3CZQA 3C0KA 3I2YX 5HKBA 3F4BA 3RC1A 3CB2A 4IIJB 3FPEA 4OM7A 1FLDA 4KQ9A 2VYCA 3BD9A 2R87A 3T7RA 3U5TA 5IC4A 4JUIA 5LQUA 2FMUA 1JKFA 1JDPA 4CU5A 3AC0A 3LW7A 4BO6A 1M34E 1TJNA 2XDWA 4G84A 2ONZA 4M9SA 3URKA 1G5TA 3A6GA 3ZX5A 5C4MA 3QKIA 5KOHB 1FOEB 2JGMA 3BILA 1IY1A 2F3SA 5ALEA 1ZU4A 3G1UA 1QTIA 4NABA 4PSUA 4ZI7F 3B7WA 2BGRA 1NW5A 1M1ZA 4UARA 1A95A 2HPZA 1V35A 1LFAA 3PJGA 1B93A 3NU1A 4ZDIA 4D9BA 3V7NA 4NE2A 5EMKA 3GO4A 3FJOA 1T6BY 5A04A 5H9VA 2PSEA 4EJ2A 4O0LA 1N7GA 1O96B 3K0EA 1WPGA 3FUVA 3QV2A 5PNTA 3ZJ5A 2J5QA 4JWTA 2X8BA 4TTVA 5KINB 4LZPA 3JQ7B 5KAMA 4MEBA 3S2IA 3OCCA 5TRTA 3L8YA 3Q9SA 1A8HA 3Q8LA 1JEDA 4JJ7A 4C1NA 4OI0A 1HE1C 2F62A 1ZNWA 4ZVRA 4C4SA 4K0KB 2J7PD 2V4MA 3KZNA 3WLSA 2D62A 3ZXYA 1MJFA 3QYAA 2APJA 4A82A 1DELA 2ONKA 1DTEA 4NMMA 2I33A 1ESNA 4HMPA 5TQ2B 4HYTA 3W2GA 1DKPA 1O4WA 1RYBA 1X7ZB 2XI4A 1HDGO 4WVFA 3BJRA 3OQPA 2H1RA 4HKTA 4WNAA 5JUWA 4YXWD 2RI6A 3EZGA 1E1CA 4NFHA 1EKXA 2GD0A 4NPCA 3VPGA 2QMHA 1AX9A 2KW5A 3L49A 3O2JA 1W36D 2ODTX 2XB4A 4EPYA 3CRZA 1MX3A 3O7WA 4LI0A 1J2UA 4R1MA 1M83A 1L5RA 4C2UA 4AKIA 2HQRA 4BZPA 3ECCA 1WDLA 2CVFA 2PXCA 3NAQA 3V1MA 1J00A 3DVSX 2Z6QA 3PTZA 1KEEB 3BREA 1SBHA 3NHFA 4P4GA 3FWHA 4J90A 3INTA 4BRUA 2VUTA 3FD8A 2VO1A 2WICA 4L07A 4CLXA 4CQMD 5CXUA 2JJ2D 5JJKA 1ZEMA 3FNRA 1HL3A 1ULZA 1U31A 2W93A 1PJ4A 2VCHA 3G17A 3UWOA 3WP1B 1DOHA 1X80A 3DYVA 3PA8A 1ULHA 4TMYA 1AU9A 1EJ6A 2Q3DA 4DCJA 1FFXB 2NZUG 4NBLA 4EUFA 4IH1A 3SNHA 1RVV1 1TLFA 3DQQA 1U2QA 2L18A 4G8CA 3X1MA 1ZJ5A 3NVKI 4G8DA 2RHBA 4DKXA 1NKVA 2YIJA 2GTPA 4CM9A 1XA3A 3NOOA 1E1NA 2PK3A 1RQGA 1W0JA 4DVGA 4PO1A 2Y67A 4AN0A 3IQZA 1JDJA 4NNPA 2MINA 2E1PA 1K66A 3NORA 1EVIA 1Z2AA 1U8FO 1PNVA 2DWUA 1XLVA 1ZDMA 2E4UA 3CEMA 3HCBA 3O4VA 5FPQA 3T3GA 5JVDF 1GPWB 1DPFA 5B1YA 4FDVA 4DCGA 2V6MA 2ZYGA 5D1HA 1E6UA 4O2BA 1TC1A 4P7BA 1IWOA 5D3QA 2OHOA 4LTMA 4PX5A 4CLEA 5G1NA 1S7CA 3R5JA 4N47A 3FMVA 5B30A 2C1ZA 3K6KA 3KYDB 2XBMA 2I2DA 4B81A 3VU8A 4EKDA 1Q7CA 1E2DA 1RQNA 4JLAA 4JJZA 2ZBFA 3HV0A 4UQLA 5HKOA 5I9MA 5CCXA 1G5IA 3R5XA 5BN3B 2CUKA 5KPDA 3KLNA 1OWNA 2YYSA 2I6FA 4ZALA 1GEEA 3EQ7A 3GJTA 2UXBB 1TAUA 5SY9A 2NU6A 3KV1A 1Y98A 1CNFA 5JT1A 5AOAA 1U80A 5K0ZA 4A26A 2J33A 5LYJA 1ISJA 4Y9RA 1LVUA 3QE2A 4YAEA 4YRPA 1WV1A 2X0KA 3UK2A 4BP9A 3ZV3A 1EE1A 1T1SA 1HUQA 1J99A 2GBLC 2GK3A 2W37A 2DMRA 5G1PA 1BGWA 2O8FA 1YR8A 3WLQA 4JI2B 3HS3A 1XNRB 4AN4A 1XFDA 3BYZA 3PYLA 1BMQA 3HO8A 3DMFA 1QIDA 2OQ2A 3DTNA 1N4DA 4QNMA 4HYYA 4IZOA 2ODEA 2R7LA 2IUYA 1NJFA 1QH0A 3D2LA 1BRTA 1N8NA 3DLPX 5DLDA 3QG5A 4KRYA 4LOAA 3VSAA 3CE9A 3S0JA 1VYVA 1GG5A 5ADVA 1XLUA 1N32B 4M9RA 3VTFA 3NFRA 1M8KA 3QUBA 4OGWA 4FEGA 5K2MA 1ZI6A 4MQ6A 3GXOA 3PQ7A 2H06A 2V9ZA 1EA7A 4TVSA 1TCVA 4IBOA 4D56A 5BWMA 3MJRA 3PNKA 1Q20A 1XX6A 1IQUA 2O2XA 4GYJA 4MVJF 4UDOA 5AJYA 2H92A 3DC7A 1QORA 2XOEA 4ZVQA 2HUPA 3IQHX 4KFRA 1P6UA 4CKZA 3PHCA 2NU8B 2EWMA 5HF6A 4UVEA 3TW6A 1D07A 2XMQA 3PICA 4LS3A 3PGVA 4XDZA 2WYOA 1E1MA 1LDGA 1M6VB 3IPYA 3U49A 4KPEC 1AGRA 2WE8A 3G9UA 4HFNA 4NZOA 1JFSA 4FWIB 4JBXA 2XXAB 4H59A 4CYMA 4BNUA 3GARA 2L0XA 3CX6A 4UE2A 1YUNA 3VZPA 2XAUA 3TQQA 1T5LA 2AN1A 1XL0A 4Y2TA 2OKCA 4PW0A 1U0FA 2YH2A 5EJIA 5FV7A 3LYAA 4GMGA 2WT8A 2ETVA 3IT3A 4HVLA 4Q9AA 5DBGA 1BNCA 1JQBA 3KLBA 4NULA 3TLBA 4ROSA 5JVDB 5AR1A 3FVTA 3EY9A 4NF2A 1M8PA 3Q6IA 4X60A 3QFHA 1E5QA 1PT7A 5FQNA 4GQBA 5TQJA 3E18A 4P3OA 1CFZA 2Q9AA 3ZD8A 2B8TA 3I83A 1QHSA 3DG9A 3IH5A 3TAUA 3UJPA 3VRHA 4HNUA 3EAFA 1KNQA 2BCJQ 1JHXA 3A27A 4EMBA 5EMHA 3J7TA 4W8OA 2GM4A 3VZSA 2RGBA 4FD3A 4LHEA 4ZYZA 5EZYA 2JAOA 2ZRBA 2Q3MA 2B4KA 4W63A 3OZTA 3ILYA 4RTNA 4FFBB 2XGJA 1TX4B 3SKVA 3N2YA 2C54A 2EKBA 1NV8A 2XXBA 2ZLBA 3NV7A 4RU1A 1Z6PA 3AJEA 5CYOA 1I30A 5DB4A 4NCKA 4XGKA 4RVUA 4RD2A 1I6WA 2ONJA 4UFOA 5I4BA 1W46A 5JANA 1J09A 3BB4A 3GH3A 4D4KA 1ZD8A 3IUSA 2CEKA 3ORRA 3BBLA 3WA6A 1EWTA 4BNDA 2X3YA 2ICAA 1EWQA 5AOBA 3SHQA 2QTAA 3G2JA 2PT5A 3K5WA 3MJ4A 3OX4A 4MVWA 1Q0UA 1SKMA 1TXGA 5CJ2A 4BP8A 1MZPA 3P26A 4WNYA 3U62A 1DB3A 2VIIA 1PU2A 3KKLA 4MR9A 3IIJA 1MHTA 1AQUA 2OHVA 1XCGB 3HC7A 4ABYA 1W29A 2IYQA 3RV4A 3HEAA 2WSIA 3QXJA 4M37A 4IMPA 5IHPA 3QU2A 3MLEA 3GP5A 1ZYUA 3V55A 1GFIA 4MCJA 5CCBA 1GKUB 3DP7A 5KTKA 5C1BA 1CLUA 1UEIA 2HDOA 4XSGA 4RENA 2X4LA 3DOCA 3O91A 5ESXA 1SUPA 3FXAA 1FYVA 4Z54A 1MQ9A 3RADC 5K6AA 1KQOA 2EG9A 4EQ6B 3PZBA 4V0QA 2GK4A 4NICA 1A98A 2Q5IA 4PHHA 4E5PA 2FOIA 1W0KD 1Z4JA 4H77A 4Q3CA 3ED1A 3N07A 5INTA 2C77A 3PDCA 5IXYA 4FHFA 4R2IA 1E62A 5A7HA 1TM2A 2FEAA 5J2UA 1P1CA 3W78A 1U0BB 5CH3A 3B38A 2P27A 2JEYA 1G20A 1BN6A 2QJRA 2QN6A 1L5LA 2QRMA 5HIKA 2PYDA 2C95A 2F9FA 2GILA 3CNHA 3OKFA 3K15A 1GZ3A 1QX3A 1QG6A 4TWZA 2K7FA 2WB2A 10MHA 3JR7A 1AKEA 4D0NA 4EJ0A 3R09A 3ZY6A 4WCFB 1GZ6A 3GI1A 5KYXB 1GSOA 5HZKA 3FZEA 3OIUA 1RJWA 2AI2A 4HLCA 2D0DA 2QX4A 2V6JA 4IINA 2ZSHA 4YV1A 2GAIA 2WT4A 5CVDA 4O2AA 1DJMA 1FDRA 3A6LA 2ORIA 3DVRX 4ZO4A 2WTXA 1QGZA 5ESRA 4LOLA 4E5MA 5HFAA 4D5GA 5C8XA 2V8BA 3SSOA 4AD8A 1RBMA 3D4IA 5ALJA 2HQSA 3X0DA 3C3WA 1M8GA 4ZI3A 3ZQKA 1PFKA 5DEIA 4E15A 1V1JA 3LUDA 3FAKA 6YASA 1FNCA 3BMOB 4QOEA 4H18A 4XARA 2QV7A 1F3OA 2BEUA 2ZI4A 3TGPA 3FR7A 1MNAA 3E9QA 2WT9A 5GM1A 2X8LA 2V59A 4G1CA 3UWDA 1XZMA 2QLJA 2CXNA 3NDPA 3ZNNA 2WG1A 4M4SA 4EPXA 5ENDA 1PGOA 1QPGA 2FSIA 1A71A 3FSGA 5HP4A 3MBIA 4LK2A 3JWPA 3IXLA 4WNIA 3PFGA 5I7UA 5IT4A 2M32A 4R31A 1I2CA 1V11B 1E2MA 4QO8A 5EIBD 1LK7A 5JO0A 1QYVA 1PV2A 2HH9A 3KVOA 3VNRA 1IATA 2VVTA 1H0HA 1PW7A 3GQBA 4OI4A 4LKOA 1E99A 1QQ6A 4GF5A 1B15A 4ND5A 4YRLA 2MCFA 1T4CB 1XJ0A 1J42A 3CO5A 4RFVA 1TE2A 7REQB 5L3QA 2C8KA 2CDCA 4CG2A 5LYYA 1NMZA 5AQ1A 3SI7A 1NF2A 2JD0A 4AIIA 1GUDA 3NHLA 4II3A 3PRKE 4BV2A 1CP3A 4Y2YA 1F8XA 2VZEA 2QIPA 1UF9A 5D86A 5DHUA 2IU4A 4YRZA 5JQWA 3HDJA 2J9XB 1UZUA 2VUIB 2P62A 3OPQA 4C29A 2V3CC 4M36A 5DNDA 4JJ4A 4CEIB 4KQEA 2ZBRA 4QXPA 5F4ZA 4X65B 3QX7A 3CV3A 5FOXA 4ZTUB 3FCUB 3I8XA 4P83A 5CLHA 1C9KA 4F38A 5EEHA 4BMOB 2QXTA 2EYQA 4C43A 1C8VB 3OESA 4QUGA 5I45A 4LOHA 3TEFA 3ENKA 3G59A 4S2UA 5EXEA 2WWIA 2J5KA 4Q6WA 1D0SA 3A6FA 3OWOA 2FPSA 4JR1A 1G8HA 2GI4A 4PWZA 5JXIA 3I9V6 3A2MA 3WRWA 4XVRA 1AY0A 4RDCA 4H7HA 2Z5GA 3PXUA 3IQEA 2YY7A 2P6RA 4L9SA 4LGVA 1RLUA 2AI1A 2G88A 1UMDA 5B3KA 3G0IA 3X44A 1KYQA 1DARA 1UIRA 3JQGA 4X91A 5CDHA 4EX6A 4ND1A 4CPDA 4DLUA 2POCA 3HB1A 3GLHE 3I4CA 4L6AA 5AH0A 3S2UA 4EJSC 3TVYA 4IWNA 2YQ4A 2OHIA 2P69A 1ORDA 3FTQA 1Y0BA 1ZCJA 2BKAA 3OZ7A 3QI2A 3WK8A 2GKSA 2PL1A 2ZWAA 1FRFS 4ZEXA 3B60A 1SCBA 2D59A 3C5CA 2KBFA 1W1UA 2JFGA 4KUHA 4NYMQ 1MXHA 3ZVNA 1CVRA 2BAGA 2V45A 4LHWA 2X14A 5IEJA 3FM9A 3MS4A 5FFFA 2IIVA 5GGYA 2NUAA 1FUIA 1KFKB 5IVPA 3VOSA 1VE5A 5LXTA 4ZRNA 3FPBA 4MAMA 2C84A 3OVMA 3QKTA 4MGIR 1L0BA 3R7SA 5EE5B 1OHHD 1RQRA 1EE9A 4V2UA 2WW8A 4RD1A 2ZI6A 2ZAMA 4ZQHA 4EARA 1IJKA 1ZEJA 3ES9A 4AZTA 3GRKA 4I0WB 4Y1GA 2G1KA 2JCGA 3U4QB 4NQRA 1G2IA 5AVSA 3VQTA 1OD6A 2SKEA 3FB4A 3IHTA 2DTXA 2BMDA 2VDOB 2VDNB 5FLYA 1Z0UA 5EQDA 5BSUA 5TJ9A 4JI4B 1F7UA 3NDRA 4G5OA 1COZA 4L7VA 3V4SA 2WU3A 2C42A 2OHFA 4XLLA 1O5OA 5ALXA 1OC2A 1NV9A 1TZKA 5EKUA 2OXTA 5LIPA 5IKXA 3N0VA 4JT8A 4V0LA 2P1RA 4Z0PA 5EOVA 4M0MA 1SBCA 1PV1A 3LWDA 1RQXA 1Z18A 3FW1A 5CTAA 1TKCA 4HX9A 4TL8A 2EERA 1YMVA 4QJBA 5G40A 3T95A 2JJ8A 1QFMA 4CDMA 1SVSA 1T8SA 3REQA 3P19A 4E1BA 2HLHA 1BEEA 4G1BA 3FNGA 1KE1A 4F6CA 4LF6B 1VJGA 1Y82A 4XIGS 2CV2A 1O6GA 3PFKA 4TT3D 4ZTZB 2EFEB 4BOYA 3DLHA 4YXFA 4ZVMA 3OOJA 3SQWA 4OQNA 2J5RA 2BGJA 2DSTA 1VMKA 1XPJA 3DKRA 3ZKWA 4EB3A 1VL2A 2J4DA 3BICA 3C8HA 5HM6A 2YOGA 1V39A 2H7XA 4DSTA 1WRBA 5HTKA 3RSQA 3S7TA 4DE5A 3GQVA 3MF4A 1XDWA 5FTJA 2X0FA 5BP7A 2VQFB 1DL5A 3R8FA 1E8NA 4DADA 5FBHA 2HTEA 3RJ5A 3RK4A 2GM9A 3RRNA 4BS9A 1MU0A 2ACVA 3S2ZA 4HLQB 1G5PA 3T1HB 2W22A 3AZOA 4OU4A 5SZJA 2O2IA 2A0UA 1J5EB 4OTZA 1G7SA 5DPMA 4S04A 1QYXA 5DCYA 2BZ0A 1DDIA 1ODFA 1LPOA 1Z39A 1RVDA 1O9GA 4JDUA 2B6HA 3ZS9A 1GPJA 2HK8A 1CVLA 1RKXA 1PJAA 1YE5A 3KPYA 1CUCA 3H9UA 4XCQA 3BHNA 3GLVA 3EB9A 4HWSA 4ZO9A 3ZCSA 2DJ5A 3HMKA 4TZKA 2UDPA 2WIBA 2O7SA 4W4TA 4D6PA 3F5QA 3IKMB 2PJZA 1QIFA 2HF8A 4EOGA 1PSWA 1BDHA 2JJYA 3KOZA 4FOSA 1JFTA 2Q7OE 3PGLA 4LJ9A 3STWA 2QJWA 3W7BA 1EFCA 4ILKA 4JBLA 1CG6A 2R8XA 3WGLA 1GYRA 2H4WA 3UANA 4J2HA 4C4RA 4YYEA 5D85A 3ENNA 1DHRA 2MSCB 3UV7A 3PRJA 1VKZA 3MCUA 4TKLA 3WO0A 2FZVA 2NXEA 3KHKA 1FZQA 1JZSA 4UBLA 3ZE0B 1N0IA 3ZIDA 1QIMA 4QXQA 1GNRA 5EA2A 3QJYA 5T4FA 4FQ7A 1SEPA 2AVDA 2C4MA 4MQLA 5D1NA 7ABPA 2JLYA 2IYOA 2NVOA 2O54A 1UZMA 4N5LA 1O8CA 4RHUA 3ZDFA 2VNSA 1RXEA 3HCCA 3M1IA 5BSRA 3RUDA 3B3GA 4RVHA 1ZM3A 1VPEA 2H7YA 2YS7A 2OFPA 2X22A 4BV3A 3A06A 1MQ8B 2RHHA 4MMYB 4TMWA 1HBJA 1BS2A 2WQ6A 2FP4A 2NSHA 3U3DA 4DEXA 3COYA 2BRUC 3H8VA 2AOXA 4FBLA 4UCXA 5DN6D 2NP7A 1IQ0A 4J4BA 2NU7B 1OX4A 4LOIA 5JEDA 1ADFA 1G66A 2OQIA 4PSAA 2QTVB 4Q4HA 1Z4KA 3MMXA 2JFQA 3BQNB 5KTTA 4NU0A 1F9AA 1F0YA 3H8WA 3ITNA 3ICVA 1KJWA 1MB0A 2P6PA 1GPBA 2WIDA 3C74A 2I4LA 2X6RA 4EY6A 1MUUA 4BGEA 2FFAA 3WYEA 3AVXA 3W2EA 1POWA 3HEMA 2OV2A 3KOWA 4M9CA 2E9SA 4TLBA 4ILEA 3EISA 5FUWA 4ENSA 1V7PC 1D4ZA 4KOAA 1GN9A 5U4XA 4IIBA 2Y0PA 4U0JA 5IBQA 4AMUA 1GGVA 2X13A 3HDQA 4O4JA 1DC3A 2B83A 2Q6IA 3MRVA 3NBZC 4IUCS 3DO8A 5JZBA 3OD1A 2RJNA 3DJFA 2WU4A 3IA2A 3K70C 3ZIAD 1FS6A 3UJ6A 3ANTA 3CHYA 4TVKA 3KZVA 1H1TA 4MZXA 3OOSA 3I0ZA 3T7KA 2R48A 3ZHZA 3G0CA 4I50F 1FFSA 1Q0LA 5F1OA 1DWOA 3FG9A 2QD5A 3NHKA 2EP7A 4ZPXA 2GHTA 2JL1A 4DV6B 1XTJA 2ERCA 3OEYA 2H4HA 1OAOA 4PR3A 4DJAA 1XI2A 3BAFA 3EIUA 4D9IA 4ABTA 2QA5A 5JSZB 4UHJA 2XEDA 5FOWA 4D9KA 2X40A 4HZUA 1XYYA 3AQIA 4X8OA 1UBSB 2AOTB 2E4XA 2ZR7A 3NH9A 4U3JB 4O59O 4FXPA 5EG5A 1CIVA 4M9QA 1OX6A 4PRKA 4XLZA 3N3BC 3IV7A 2I4NA 5K3FB 3NOVA 3RH0A 3KAKA 1XGKA 4G86A 2QGFA 1NOIA 1BWRA 1TD9A 5FOUA 5BT8A 3QHAA 5CAEB 1CU1A 1T3TA 2IHVA 2WF6A 3OIYA 3HXOA 1GPDG 1NVXQ 1Y89A 2JVJA 1O77A 3Q7EA 1UXJA 3O8NA 3WMXA 3T0IA 2JIOA 2A57A 4KGDA 2IU0A 1MV5A 2VUHB 3GA0A 4BZWA 3F8TA 1ODKA 2B2XA 4LRYA 4UOZA 8GPBA 2PV0A 4N6GA 1DI0A 2WSMA 2YRWA 1S2MA 3IR6A 2VPXA 1EWYA 1Z07A 1QM5A 2V7UA 2JRLA 4OHXA 2C3OA 1PFWA 1P62B 5LZ5A 3V1LA 1IM5A 1E4YA 1TKAA 3BXXA 2J0SA 3SE7A 1J1IA 2K87A 3EC1A 2XMBA 3GX1A 4GLJA 2GNPA 4IXNA 4X5OA 4TVOA 3RANA 4OG2A 1SUSA 3TW8B 3VPXA 1FIUA 3SC2B 5DNCA 2X9NA 4BLUA 5K0BA 2P6NA 4Z4IA 3TTWA 4M2LA 1MG0A 3JWEA 2PZBA 2FLVA 1PBNA 3A4NA 2W2OA 5JADA 4DSZA 2JA1A 2ZYVX 2O2SA 1LTQA 4D4MA 1K6EA 3CEHA 3E61A 3ND5A 3NTUA 4RH0A 2NO5A 1URPA 3DM9B 3LLMA 4L50A 4QVGA 2YKGA 1WD7A 5KWEA 3MWGA 3QU4A 4Z0TA 5K2OA 1SC6A 5EMNA 3T3NA 4LXGA 3Q3IA 3RARA 4DWOA 3CLRD 2BUCA 5IJXA 2VJQA 2QR2A 4I5DA 2X5NA 5DCLA 1KU0A 1YZFA 5IW8A 1XJWA 3RASA 1TVKA 3OEHD 2PKEA 1H1LA 1UK8A 1PGNA 4WHMA 3F74A 5CIQA 5TGZA 2V65A 2CHFA 4BGUA 1LK0A 2EX4A 1JTEA 4Z9XA 4DR7B 3V2HA 1S1CA 2TSYB 4CM9D 3AOEA 3OZEA 4M1WA 4Y9UA 1K88A 4MVJM 4WKPA 1G3MA 2RK4A 3VSBA 4DNQA 3NIDB 5BSMA 1XTRA 4IIJA 3SICE 3HUFA 4EVIA 5HK9A 3LOUA 5DM70 5A0VA 1TGYA 2G5GX 3IURA 1QYRA 3LS2A 4BO9A 1UDAA 3WL8A 4B4UA 3G8BA 1L5YA 3EFEA 2VJLA 3K5IA 2BFNA 3DPUA 3O92A 3D81A 1WMEA 4HB2A 4NJOA 3O8CA 3GLGB 1Y9AA 1BHQ1 3IBCA 2O6LA 3HHPA 4RV4A 1E7MA 5KOHA 4I50B 2VJOA 1OWMA 2Y2VA 4AJ9A 4EW3A 2CHQA 3VYRB 1P33A 5CD9A 3N3AC 4JXJA 1SUCA 2CNWD 3CX3A 5KB3A 2VPTA 3NVMB 4FYYA 3KB6A 4UQPA 3KXLA 3ZG6A 2AEFA 1JR6A 2VJAA 3WTBA 3EG5A 4BO3A 2AN4A 4PZYA 5TPZA 4FDLA 2HSDA 1FE8A 2R65A 5KJ1A 3L05A 4GD3Q 1IDOA 2GZSA 4IGEA 4U8HA 3CN7A 4UVGA 1XKTA 3VH2A 2HIMA 4DWVA 1O96A 3EYWA 3GH1A 4KSYA 4BQRA 2RAFA 2FFBA 1FJXA 2NM0A 2V5AA 3WAKA 1XT6A 2JBWA 1JDZA 2YV4A 5ELXA 4UMFA 3JQ7A 4ZOCA 5B36A 4XLTA 3GHYA 1PEDA 1EE2A 2H6EA 3QLUA 3WMRA 5CP8A 1GUFA 1R66A 1L4UA 4HN2A 4URFA 5TQ2A 1SCUB 2C5EA 4HY3A 4GXRA 2XIQA 2C3UA 3OQNA 1X7ZA 5ALMA 3AM4A 5BW6B 2HW8A 4QYXA 1QRDA 2ZUWA 1N6LA 2V9CA 2G9ZA 3QEOA 1YF3A 3QKRB 4N48A 1SG6A 5KNDH 1Z5VA 3HVJA 4KJZA 1JR3D 2RHOA 2AV6A 2ZE7A 1HDZA 4L76A 4QEZA 3EPPA 2XUAA 2HAEA 1YZQA 3VVBA 3SHFA 1JDNA 3D1LA 4BATA 4K6HA 1KEEA 3TKLA 4WD3A 2QQ5A 1JHRA 4R2WA 1K75A 5JSYA 1NNSA 1LBHA 3KKQA 4G4IA 4IGIA 2W43A 4PLZA 2AZTA 5CU7A 5EKDA 3SEQA 4RLFA 4X1KB 4K88A 1T9DA 3RSLA 1VJ5A 3TEMA 1AQJA 5DV9A 1IBMB 3TN7A 1F2DA 1M0TA 4NFSA 1E0DA 2V4UA 3GRZA 1SQGA 1FFXA 2G40A 4RHTA 5LPNA 4H7KA 2RI1A 3ZZTA 1VMIA 4KNYA 1Z8FA 3AK4A 2I6SA 1Z7WA 3E3LA 4C0LA 4FFVA 2XQFA 1WUKS 2PO7A 3SHOA 3STYA 4C88A 1QUFA 3GMSA 3NWBA 1CY2A 3NX4A 1Z2CA 1ZK2A 1FVHA 1JLHA 1VBKA 1NN5A 1JBQA 3GZJA 1NE7A 2X4IA 1QHGA 1WUTA 1ODSA 2G83A 2Z43A 1NJ1A 1TYDE 2DU8A 2FX2A 4V0NA 5IZ4A 4LJRA 2P7HA 1LUAA 2F64A 2ZIFA 5HOEA 3KUXA 4V0MA 4EW2A 1CD5A 1V71A 1UKYA 2P9JA 3K0KA 3QYJA 4R6WA 3WL3A 3ZR4B 3R3VA 4B6GA 5F7OA 4LKRA 3KYDA 5ES4B 4YUXA 2WA2A 3IJRA 1G16A 3LT5A 1YA6A 1ZUNA 3NUGA 1WXDA 2A35A 4P4LA 1P6QA 2CFTA 1RZRA 2W00A 3GZNB 3P4YA 4XIJA 4EBFA 3EMDA 5CCEA 3JALB 2DZDA 1GXSB 1YXMA 1AK1A 5BN3A 2FVXA 2Z6AA 3DWIA 1M2KA 3FSJX 3I8OA 4U7HA 4NMHA 3A11A 4FDTA 5C31A 5AKIA 3DOJA 5I47A 2O2CA 4FOPA 3I9LA 2VQSA 2B98A 2B2CA 5SY6A 1UDWA 2C9YA 1V37A 4OBXA 3ZBPA 1YBVA 1AS3A 1E3WB 4PONA 3TZCA 3JWHA 4V38A 1ECJA 1WPRA 5KU1A 2BGIA 5ERGB 1T0IA 3ON5A 4LJ4A 3TXXA 4EKIA 4D9GA 3UWSA 5K6AC 1BQ3A 5JNVA 4Q01A 2XDQB 3HPQA 5D8DA 5HRCA 4L1KA 1IJFA 3CRRA 4RPIA 2Z1MA 3JZIA 3ESYA 3Q41A 3NM6B 3SC3A 3F49S 1V8PA 4INJA 1D2MA 1E32A 3KETA 1G8JA 1Y6FA 1JSXA 4DW8A 1W47A 2JIDA 3H1FA 2JPDA 4K6GA 5H7XA 2X2FA 4Q9JA 3VXKA 4K6MA 4M46A 3OLWA 1CZKA 4DY4A 2X58A 5L8VA 5JSUA 4TZ0A 1RYMA 3MWLA 1PHRA 4B8ZA 1SUEA 1N5DA 1AN0A 1HV8A 4TL6A 4TMVA 2X0EA 3RQSA 3TLKA 4IIHA 3WNDA 3NRCA 4RF2A 4JV5B 1J2JA 3MCVA 4UD6A 3F98A 4JMPA 2NU8A 4HGPA 1EQAA 4K9LA 5IN5A 2OV3A 3IR5A 5M34A 1GKYA 1REQA 4M0DA 4LA4A 3B6MA 4R71A 2QZSA 5CXXA 4RWZA 5P21A 5BMOA 1SR8A 4AKHA 1ICEA 1EB9A 4EJ6A 1BGVA 1M6VA 1G18A 3N2KB 4K6KA 4LDAA 3BSFA 4CE6A 1G17A 3BXZA 4P3XA 5JAIA 2VA8A 2LNDA 3LHFA 3ZHUA 4E70A 1J07A 4FQ8A 2PM8A 3PD1A 3EEIA 4KE9A 3KR1A 5EWMB 1G8MA 4MRMB 1AUXA 3R8CA 4K9MA 1NPDA 2ID7A 2WVJA 1EEHA 3BJIC 4DDHA 1KJQA 2NO7A 3C7KA 1SCQA 5E9JA 1GA1A 3F6EX 4KIWA 2GEVA 1L7BA 5D84A 5JVDA 1DKNA 1ZHHA 3O03A 4WNCA 5BPHA 5EZ5A 2ZK7A 1TT7A 3ZWVA 2GR9A 5T6BA 3CCFA 1OYWA 2QYSA 4A91A 4DRXA 4BFWA 1UMKA 2P40A 3A7DA 4MXDA 5FWYB 5IBRA 5A3SA 3AZQA 5CG1A 2WAAA 3Q85A 3NOQA 2EFDB 4J7AA 3ECAA 4W5NA 4R3WA 1BJTA 4YMUA 2R84A 4XGNA 1J20A 3DHNA 3AW8A 3N1UA 3AJ9A 5T3YA 5AI8A 1OKKA 4FFBA 5KNBD 5CT4A 4LZZA 1N36B 1LSUA 4HUJA 3VR4D 3WB9A 1C30B 4C0KA 5H02A 3P0EA 3QEKA 2H4JA 4LPSA 4MI9A 3DM5A 1TZCA 1U8CB 2DHQA 2E4WA 3CF2A 3KAQA 2MR5A 2O2ZA 4MIEA 3FYCA 4N7BA 1I32A 3FROA 3DO5A 2EC5A 1Z47A 1KC3A 1XZQA 1E5DA 2ISSD 1CJCA 2OGZA 1VSBA 2PUHA 5LMZA 1EFVB 3UXMA 2W71A 3OZBA 3T7SA 2O1WA 4WKOA 1E20A 1S8NA 2ZP1A 3IJPA 5HQJA 1QYDA 3KXKA 4Z86A 3VAYA 3LUCA 4EL0A 5J4YA 3DTYA 1PNOA 3OZCA 2HK7A 2OLEA 4G5SA 3GOQA 1NULA 1SIOA 3JYNA 4CG0A 3MLBA 2O2HA 1EM6A 1F4VA 1PLLA 2H2GA 3RRMA 3FUCA 4Q1BA 1RAEA 1P0MA 2ZUEA 3DTVD 1QNFA 4YP9A 5FBWB 4QD3A 1QVWA 1YRYE 1MC8A 1SG0A 3SYNA 2KE5A 2H07A 3SQXA 3QVVA 5CH5A 3H9EO 3AB3A 3SS7X 2IC5A 4UMVA 2IXAA 4URUR 1N7JA 4EI9A 1E3QA 4EQ6A 4MVJA 3M4YA 1T3ZA 4ZQIA 2FFHA 5BW5A 4OXQA 5ITZB 3CLUC 4EY3A 3L1UA 1KXZA 4PCVA 2XXJA 3FMPB 3MCAA 4N3CA 2V55B 1FJ2A 1QANA 3BCRA 3LKZA 3W3AA 3CNLA 3CC8A 1JLSA 4J75A 1T3HA 2A88A 2WMDA 3I5AA 1B8OA 1HT3A 1C9JA 2J6IA 5E2BA 5IC5A 2HA6A 4AZVA 1Z08A 1VM6A 3EGVA 4WZBE 3A26A 5FUMA 3F47A 1FL9A 3PKJA 4B79A 3OI7A 5BVGB 5JARA 2JAUA 2CVPA 2ZB8A 3C8DA 5BRAA 1I1NA 5JXHA 4BJ3A 2XVZA 3CLTD 4WCFA 1CETA 1ZSVA 4I4LA 1HMPA 4WI1A 5HZHA 5KYXA 2YJ3A 4DLNA 4QWMA 2O5EA 5KKNB 3M5PA 1X0VA 3TIIA 3QWAA 3RVQA 3WGVA 4Z7NB 1I7DA 2GH1A 3EVNA 3OCJA 4M87A 1O94C 1NYRA 5G02A 1NUPA 3VGJA 4GPD1 2IW3A 2A5FA 3DDNA 1YS2X 5EJMA 3VO8A 2ZYWX 1DRWA 2CLDX 4CG1A 4LECA 1USIA 2BHSA 1X7XB 4UVIA 3BMOA 2YXDA 3EMVA 4YLGA 2AG6A 1QOPB 4R9SA 2QTBA 1XZCA 3WNVA 3CNNA 2B21A 1R5OA 4ALMA 3N0XA 2CYBA 4ZAZA 2Y9PB 4LF5B 1Q3TA 2W2KB 2I78A 3GCXA 5IFKA 4TYMA 5DCUA 2YRXA 4D97A 5LR6A 3IUYA 4H2DA 3CLHA 5BPFA 1GNLA 4IGAA 4TM7A 4HS9A 5NLLA 2IBTA 2I9KA 4AUEA 4JJEA 4YJGB 2OB2A 2RJOA 4YJFB 5A1JA 5H9WA 4O3MA 2C2GA 4ETIA 1V11A 4DSAA 5C1DA 3WLRA 5FA5A 1W5AA 1NLFA 1T0PA 2PRIA 4E4RA 5IFLA 3ULKA 4ZANA 5KTPA 2JCVA 1MAVA 2G9VA 3QA9A 5I7SA 1VLVA 3B2NA 4OI1A 4RTPA 3PJRA 3TD9A 4BFUA 4KUGA 1T4CA 1EESA 3QMWA 5EJ7A 3QHPA 4IGKA 2C7OA 1ZAKA 1Q84A 1ZIXA 2C5FA 2J30A 2XJ9A 3NEJA 3ZNPA 4E6EA 1KOFA 2YIMA 2ZAYA 1V6SA 2ZS9A 1X38A 2AW5A 2OCKA 2OGUA 3ILSA 5K1ZA 4DC0A 1NVWQ 3D3JA 1WXXA 3KEOA 3MGCA 4IJ5A 5AI9A 2EHJA 3PE6A 2W90A 4E4YA 2ONYA 4ZP1A 3QXGA 1NNI1 1WP4A 1ARZA 2H52A 3DE7X 4N41A 3H4VA 3HBAA 1W2HA 1LD3A 1YQXA 2BLLA 4JP2A 4FB4A 4CEIA 4H1WA 4MB6A 1R9MA 1JQEA 4GWGA 5K4HA 1NM5A 1UUFA 4BEWA 3TQRA 4UTNA 1G0OA 2X41A 3KLPX 3MGKA 4J4TA 2XRYA 4YDRA 3VNQA 4BXOB 2C2OA 1FNSA 4MB0A 5HKLA 5HK8A 3R41A 4OHYA 2H18A 2ZT6A 2AMFA 2NV2B 1KAEA 2NO1A 3E9YA 3GAFA 2A84A 3JSAA 2CMFA 5GWXA 4QJ3A 3OG9A 4LRUA 1DX9A 4JQOA 4AI6A 1PZMA 4MQ4A 5DYNA 1CY1A 1RLTA 1XU4A 4IG4A 2PZGA 4OYRA 1GTZA 1LRJA 2FMFA 3ZX4A 1G2PA 5F3WB 3NYQA 1ISPA 2REXB 4QFMA 4TTRA 3OFVA 5AK6A 2Z3ZA 4CQLB 1C41A 1UBNA 4WKNA 3VH3A 3GG2A 1R18A 1JQ3A 3I6BA 3JD1A 1Z25A 5BXYA 3A25A 5IUKC 3GROA 4W5QA 2HRRA 1A72A 1XEXB 2V5VA 4DQLA 5AKLA 5DT2A 1KORA 1QMPA 4HGQA 1HE3A 1V4NA 4H6VA 1KRWA 4V02A 2X1MA 3FA2A 5E3HA 1LVGA 5GVRA 4E2FA 3L5KA 2GCGA 2PPLA 3TDMA 1XAJA 1THMA 5FI3A 2BYTA 1P5FA 5SZHB 2A1TS 2CB9A 3H5LA 3KL2A 2IYSA 4JLUA 1LX7A 2RH8A 3ZH2A 3GFSA 2WZBA 4UNSA 3WBJA 2QNRA 3KO8A 2Z8YM 4FLFA 4N0MA 4E2ZA 1T1RA 2OYSA 4ND8A 3U4QA 4KXQA 1VPWA 3OE7D 1QX4A 1XCPA 2PJDA 5JG7A 2VNAA 4D4JA 3R77A 4OGLA 2ET6A 1DEAA 3WHIA 1Z3CA 2PIAA 3GT0A 3QY0A 3ZGVA 3LO8A 3JQ9A 1Q7BA 4M9UA 4H7EA 2FW7A 3CF4A 1ND6A 2C59A 4NV0A 4RHFA 1YDFA 4XSHA 2IHBA 1JE0A 2JI7A 1J39A 2PX3A 3BL5A 4DV2B 4PCLA 4J1QA 4NCJA 4BB9A 4DY6A 3LC0A 3IL2A 3UG6A 3PYMA 4Z4GA 2O4UX 2JJ1D 3EJ6A 1N7HA 4N3AA 1E9EA 2HWKA 2I67A 1DNPA 1VP3A 2IXDA 1IONA 1JG2A 1VPTA 2CUNA 2HK6A 2GK6A 3E9RA 4WY8A 3WG9A 3SS9X 3QE9Y 1OAOC 5DBHX 5K5EA 3AONB 1U2GA 4DV0B 4DNOA 4LZWA 4QDXA 3CZPA 3FHTA 4UCFA 2MR6A 2WPDA 3GELA 1FCJA 1V0JA 2Y1GA 3E9MA 3LCVB 4GSYA 1TGVA 5JE8A 1C4WA 4ID9A 4FZ3A 2BZGA 4UBOA 3GEDA 3EEYA 3SHVA 3AHEA 1PK8A 2XUIA 4JIGA 1M0WA 5EPOA 2C00A 4ZGWA 1XMJA 4B3GA 2HLNA 1XCOA 4WACA 1HZJA 2I8CA 4M53A 4G36A 4TXNA 5GONF 4JSTA 5T57A 5BYKA 1QU3A 1RRKA 3HJNA 1WF3A 4J0CA 2BBOA 4XASA 2XYPA 4RANA 1JIQA 4BMVA 5A4JA 1SXJD 1WZNA 1NP7A 1YONA 2AG8A 3HCWA 4C0BA 4JK3A 2XZTA 2SKDA 3H11B 5F23A 3HSSA 1XCMA 4FS3A 4R5HA 1F8YA 5G0WA 4RF4A 1VYUA 4Z1OA 2C4VA 3WL4A 4BCBA 1H4SA 4CUZA 1UOEA 4C7OB 1Q5PA 1MO2A 2F1HA 3VOAA 5CIWA 4YLEA 4HT3B 3LP8A 3MTBA 3O8OB 2ZPUA 4CW7A 3FZGA 1FMTA 2I6TA 1EFHA 3IXMA 3WGTA 2H2IA 1DEOA 1CEQA 3NHRA 1OREA 4KODA 1D6NA 3U3ZA 1EVJA 4DM3A 1LH0A 3F7OA 2RC5A 3P71T 3V7UA 3VZRA 2DGDA 4D2IA 2CMDA 2DX7A 2XKAA 2K7ZA 3FF4A 5D87A 4ZYLA 4IRMA 2OGTA 4IUDS 1QCYA 2VP3A 3INYA 4ZDWA 3AH8A 2OPHA 2R6ZA 3TXYA 2Y93A 1J0XO 2YC4C 2YBDA 4MW5A 3V8BA 2N46A 1L5FA 2QG9A 3D4OA 4P4NA 3JVIA 3L1VA 1VCOA 2XGSA 3PC8C 2C2WA 4MKXA 1P2FA 4K9SA 3BPSA 2A4MA 2O4CA 2J6BA 3LHKA 4JJFA 3W05A 1D2AA 1KYWA 2QL9A 4CFSA 4RJIA 3RYTC 3HCAA 5FKJA 5CLFA 3FDFA 4Z3OA 4DIFA 5BNIA 3BSSA 9MHTA 3UPUA 2QMEA 3L07A 5BUCA 4DV5B 4OQMA 2NAPA 2UVDA 1CR6A 5C18A 3O3OB 1XVTA 1W25A 3KIPA 2NU7A 1T1GA 3IVRA 5LQNA 2QTVA 4JA0A 4NC9A 2R7MA 4L4XA 2QT9A 4ZMBA 4B6JA 2W6PA 4HQ6A 1WULS 3MTAA 4EUNA 1JSRA 4QYIB 4IV5A 2IE0A 3Q7SA 3FVRA 3PS9A 4BAZA 1KEVA 3BH0A 3BJMA 4ZJUA 1KMHB 4KQWA 4MVJP 3ZWKA 1P60A 5JAUA 4MJLA 1GRQA 4Y2HA 3GFGA 5IJ9B 4XQGA 2UYGA 3FPKA 3MFYA 3RM3A 4ZVOA 5LIRA 3K2EA 2E55A 3DUWA 3HWSA 1PR4A 4ER6A 1F7VA 3ZJVA 2HLPA 1V5GA 3O26A 3IB3A 4PFJA 2DY1A 4TLLB 2FFQA 4HXFB 4YWHA 2C1XA 2JASA 4GKJB 2YWRA 3O83A 5DNYB 2AMYA 5BWOA 3KXDA 4OQFA 4BDTA 3T3OA 2AEMA 4NBUA 2UYHA 3QLUC 2IOFA 1QHFA 5KYUB 4YCDA 1SY7A 2CJXA 1YHYA 5BV2P 5T67A 1KIAA 2GN9A 3L02A 5JSZA 4MUAA 2GXQA 2G67A 4KQIA 4LK3A 5JAQA 4BNYA 1AQNA 2Q9UA 2PFSA 2AOTA 2Y0EA 4UBMA 2W42A 3JVUA 1BDIA 3AUKA 1PJSA 3Q15C 4HQFA 2GPAA 1C3OB 3PNOA 4C5BA 1N1MA 1UBMS 2DP4E 1A7KA 2Z2YA 5EVCA 5K3FA 1PD1A 2ZXFA 1Q77A 1PSZA 4WFQA 2QNIA 2EBFX 5FV4A 3W2IA 5CAEA 3U26A 1TMOA 3P2YA 1FMFA 1I5RA 3G85A 3WMFA 1Z0SA 1SUWA 2PGIA 2ZRFA 3AJAA 5E4TA 2NVBA 4B6RA 2V7EA 3KEGA 4MHOA 1BH2A 1GAQA 1CY4A 2Y76A 4YUAA 5HRUA 5EL0A 2J5BA 4YRRA 5KZMB 2AD5A 4A27A 2QZPA 4EHFA 4XOUA 1G98A 1YCHA 1P5HA 3GJZA 3MS7A 4MB2A 2GCNA 4RH3A 4B3SB 1IOZA 1WW2A 2PPVA 1AS0A 1VG8A 4GQAA 3SOZA 1JVNA 1KP9A 3ZWOA 4LXQA 4GYYA 1NHGA 3JD3A 1E1QD 4YH1A 3VPDA 3TW8A 2QUHA 3SBDA 3DW3X 2YBEA 3SC2A 5K8CA 2GZ3A 1XMSA 1FX0A 1Z26A 2B2NA 4WEQA 1OBVA 2PE5A 2Q5LA 1V96A 4PM4A 4OX9Y 1AB6A 2D00A 1GPLA 2ZRPA 3H2GA 1IB0A 1K7SN 4ZU3A 2E89A 4H7FA 1BE1A 3C7AA 2QD4A 4C6HA 4W9MC 2R0QC 1ECBA 4IOJA 5K99A 2C83A 1TYAE 1N5OX 1KJNA 3F9RA 1ZD3A 2XBLA 3H75A 4O29A 3T54A 2IVZA 4MV8A 5DYIA 3TTTA 5CA0B 4ZT5A 3SZ3A 1KTIA 4HYQA 2BE7A 1EX1A 2CL6X 2FY8A 3D8NA 2P11A 1TRKA 3IP7A 2VWGA 4XIIA 3UCXA 4M83A 4A23A 1I6MA 5FBLB 3V8NA 4OK5A 1TDJA 3KYIB 5JZSA 2ZE8A 5IMSA 3DQZA 3CF6R 1ZZGA 5IAKA 2QTNA 2X7HA 4BKPA 2CXOA 1F20A 1C3EA 4AZSA 2XWQA 3B3FA 3MM4A 1IXSB 1I01A 1FPQA 1S2DA 4BMPB 2V3VA 1T1IA 2CJYA 5TS3A 2PGOA 2C1EA 4D3FA 3AVVA 2W2LD 1F9EA 1KBOA 2X8WA 5IDVA 3T0FA 3NP7A 1JBEA 1TQ4A 4MRNA 2PQ2A 3V97A 1FDOA 3LMKA 4FFLA 3ZGLA 2A7XA 3GLGA 1VMEA 2C8VA 3H1GA 4GMXA 4PXSA 4EKGA 3STXA 2DWCA 4K5QA 3JQFA 1KAQA 3NHJA 4I50A 5AKZA 1JTFA 1RQPA 3BRWA 4NWIA 5KOYA 4CUJA 5SY4A 3I9NA 1TQ8A 4B3CA 4QGFA 3QUAA 4PAWA 3PZRA 4D3DA 1SIWA 2I80A 3MJTA 3L0CA 2IUEA 3BXHA 3JASB 4QYWA 1RHUA 4TKZA 3OEWA 1E69A 1ZD9A 2Z8YA 4RBNA 1HNZB 4PZCA 1HRDA 3WQSB 4ZC8A 1IYZA 3D3KA 3ETJA 2QYTA 3NEPX 1TYBE 4KBYA 1IZ7A 3D2AA 5E8RA 1UBCA 4KU4A 2P0YA 4KLRA 5IG2A 3DBVO 1EHYA 2OCDA 1WHSB 2IHKA 1WDTA 2WSSA 3G9TA 1O95A 1X42A 2BHLA 2F1RA 3M70A 2UUBB 4EELA 1U7DA 3VU1A 1TCCA 1ZNYA 5KNCA 4AECA 1SCUA 4F4CA 1T6XA 1WWKA 3F7MA 2VPPA 3K72B 3F73A 2QP3A 4Z0HO 4CWAA 1F3LA 1J2EA 2IXTA 1W7AA 2FGKA 1XELA 3QKRA 3GAZA 4LE2A 1P3JA 3NDBB 2QLFA 3KWLA 4GE3A 1Y4ZA 5G0VA 1XNHA 1DWUA 1OXTA 1V6CA 1IRIA 1CJMA 1WTCA 4DEVA 4B2YA 4HLDA 4P2GA 2CL5A 1ETHA 3ZH9B 5JNSA 2B9VA 3N39C 2F3UA 4FOOA 1MHPA 3OEEA 4WA8A 1PG2A 1DTSA 1PR3A 1DV1A 4X1KA 5D00A 2R11A 3T5TA 3DV2A 3SQNA 2QF7A 4DLLA 2CBGA 1CV2A 2WFZA 1RJ9B 5LP6B 1YQDA 2AZMA 3QXHA 3PENA 4G01B 4OB6A 3KKKA 2DY0A 4IZIA 3SX2A 4YVFA 3WS7A 5IT9A 1L7PA 4KE8A 2Y3IA 4FYKA 2KM1A 4WK2B 4N82A 5U9CA 4LJAA 3OWHA 3ZN2A 1T15A 2AN3A 3K4PA 4UE3S 5BSGA 4DSNA 2LPMA 3EXFB 3DSRA 2JEOA 3NWEA 3W9BA 2NP6A 1M34B 4I1IA 3A2NA 3K2BA 3NG1A 3ZY3A 3LZDA 2ECFA 1EYZA 1JA1A 5HS6A 4C0HA 1EU1A 2JGEA 1MJ5A 2QPTA 5CA1F 3KUDA 2AUNA 1DQRA 1YS1X 3LC1O 1P7PA 4M54A 4DAOA 1KU6A 1G8PA 3FDZB 3NPAA 2MWMA 2IKSA 4FW8A 5T8KA 3UHFA 3PGXA 3R40A 3BQ9A 3L1JA 1X1RA 2BL4A 1G9XA 1IG3A 1NXTA 1W85B 1WW8A 2CDBA 2HJSA 1X14A 3QU5A 4KNVA 4X6UA 3WK4A 1N6RA 3WKEA 4L0MA 1GV1A 1HOTA 2ZSDA 2GN4A 3E5MA 3LQ4A 3GEGA 3GZNA 4QOJA 3WYAA 3L7JA 5HKKD 2ZJ1A 3JALA 1GXSA 3IEMA 4Q7JB 4C3VA 1GSHA 3FRJA 3QWHA 4ZAVA 5E3JA 1WPXA 1BJRE 3ESBA 5FA6A 1RSZA 3UV6A 2L42A 2AMVA 3L04A 2AYZA 1U98A 1A7UA 1WCIB 3H1PA 4RTQA 2Q0XA 5IC6A 3W1VA 1Z5ZA 1E3WA 1KSFX 3A6JA 1CUBA 3KQSA 4L15A 3C41J 5AJUA 2YR0A 3D43A 4ZGBA 3KPJA 2XY4A 4GEGA 1NOJA 2BGUA 3HFRA 4LEIA 1TA9A 4PLPA 5SYMA 4B83A 3TFOA 1E2FA 1OLXB 3PRHA 2A67A 5K51A 4Z3KA 3QGMA 2G8LA 2DFKB 4MGKR 3RO7A 1XDZA 3GXBA 3T5DA 2XDQA 2XNHA 4JBGA 4QOHA 4EHKA 5CHEA 4CCYB 4A0HA 5LSAA 1T5TA 2Q07A 3VBCA 3VR2A 4EZBA 5AKHA 3NGMA 1ULAA 1OWPA 4QFCA 2ZIXB 3AF4A 2E6KA 1XALA 4GPAA 3FBWA 3GF4A 4Q3DA 3D8BA 4E4TA 1Y63A 3HYLA 4H4DA 3T5PA 4BLTA 1C7FA 3THOA 1X8XA 1D2GA 1CUHA 2XRFA 4OJNA 1EK1A 1RXUA 3OLVA 4QDJA 4EGAA 1VHDA 4PVCA 4DHEA 2YXLA 1LSOA 1W96A 3IDQA 4WCFC 3PITA 2ILTA 1Q95A 4JIMA 3VR5A 2OFXA 3CTMA 4FE4A 4AP5A 1ZGAA 2MSKA 1NDHA 2Y1KA 4DCTA 5IM4F 1XAHA 1N6PA 1NVKA 1NXOA 5GJBA 1D2EA 1MBZA 2PGJA 1QR2A 1K6XA 3H5VA 3VZCA 1DQZA 1II9A 3Q0IA 3Q3JB 1ESCA 2PMWB 4IW3B 3TJZA 1O2DA 3N2KA 4MCAA 3GV0A 1CWUA 5EESA 2ZI9A 1Y7IA 3DEYX 2HC9A 2CJPA 3DC2A 3U40A 1H5QA 1CB0A 3W6OA 5AK0A 4XSVA 2I3BA 1ILEA 3C3EA 1KZ7B 2IOQA 5EXSA 4OXYA 5EWMA 2HF2A 1PGJA 2HDWA 4DDVA 1MO5A 1RYHA 3OPVA 4MRMA 2IS4A 1R4MB 4CVNA 3ORQA 4B7ZA 1EVKA 2I34A 2V1XA 1BN7A 3OZRA 1Z06A 3PDIB 1HE5A 1I6KA 2XKBA 4MMXB 5JIBA 4JL8A 4R05A 5HZMA 1XVUA 2CKDA 4Y3UA 1N5JA 3M2TA 3RRBA 2EWVA 4LJSA 5CA1B 3W6PA 1GRRA 3D5TA 5K8UA 1Y6ZA 2Q6LA 3EQ8A 1R6DA 2JGRA 1D8TA 2HCBA 1GG2A 1FA9A 2WC1A 3IX7A 3PHGA 2R6JA 2YYZA 5FWYA 1ODIA 2F00A 2D2VA 2QY6A 3U1VA 4WKGA 1XPRA 2HEGA 4HAYA 4NI5A 3S55A 4UPEA 3PWSA 3AV3A 3B52X 1UBFA 3E9EA 4LC9A 1E1KA 2IPAB 3PQ6A 5P8WA 3GMTA 3AR3A 1QH1B 2ODPA 3CURA 4X54A 4CTOA 5BQPA 1LI4A 1DBSA 5JCPA 4FC7A 1EHCA 1KZYC 4RK4A 1LDNA 1M2OB 1NLZA 1ZC4A 1QP7A 3MJFA 2G71A 3D7SA 2WD7B 4NS4A 2YINC 3HG7A 3UUFA 1SFRA 1W87A 3T15A 3ACBA 1C30A 3EVCA 4UEWA 1CP2A 4P0QB 4OBEA 1JALA 3HU1A 1N6NA 2NXJA 3MJSA 2VLIA 1EFDN 3P2JA 1AS2A 3L8MA 5AYVA 2YHSA 4NHEA 2J3DA 3UAOA 3WLNA 1IZ8A 4GBMA 4DLZA 3ND6A 4NU6A 3JWGA 1NM5C 1T9HA 4NBSA 4KHZA 3WL5A 3ND9A 4P80A 2AX4A 4S35A 3LP6A 4EG8A 4JXXA 1TCAA 3ZQUA 3E3MA 1UXIA 3DDOA 3TW0A 2RGUA 3TUZC 1EFVA 2JFXA 1V41E 4C0WA 3Q5EA 1AUQA 1XMPA 1SCDA 4P7JA 1I4OA 2HQ1A 2DECA 2BI4A 4YK7A 2HMUA 1GWNA 1TTQB 3IIIA 3LSTA 4AK9A 3QPWA 3L4JA 3PGA1 1TT5B 3UMVA 3F0TA 1HE8B 1KVTA 4KFTA 5EINA 3ZC3A 3R24A 7MHTA 2HJVA 1OZAA 1Y7LA 3Q8WA 1P3Y1 5DWQA 4MA0A 2G1JA 4P54A 2I99A 3VVMA 3ASZA 4BNMA 5ALDA 2WHEA 2DCUA 3L0PA 1B42A 3GJSA 4C3OB 2JFZA 3ILHA 1OOEA 3C5EA 4MLDA 3OF5A 3U7GA 4J0JA 1N33B 1JLRA 1QR6A 3E3NA 1A5AB 2X5KO 2LDBA 5ITZA 3K0SA 5TMBA 1I7SB 2R8ZA 3TOCA 2Q5FA 4MW9A 4DIDA 1G4UR 4EGJA 2WM2A 3DKKA 1QDUA 4WJKB 3CTPA 4BWYA 4K9NA 3H8JA 3D7LA 2MSWA 4NMXB 4PXAA 4BP3A 5LVAA 5E7JA 2FK7A 1H0KA 4CFYA 2C9DA 3DV0B 3SHTA 1F8FA 4QXAA 5F12A 3ZU6A 3BDVA 1SXIA 1LLUA 4BNIA 5BVGA 5FULA 1N5KA 3WLTA 4A8JB 1PLJA 3WXBA 4EGCB 1XVVA 3R3SA 3A36A 4C7KA 5EJEA 4NPAA 1FUUA 5F7XA 2RJ3A 3B82A 2JANA 5BNFA 4EI7A 3AI7A 2BWJA 3L8ZA 3EE6A 4NE7A 2ZRLA 4CN8A 3W4JA 1O1YA 1TVEA 3VU0A 1PK7A 2C9MA 3BFPA 4O0MA 1Z0JA 4NJMB 1TJPB 3WRVA 5EXPA 4K9OA 3UJDA 5KVQA 1ZM7A 2XCUA 1X9GA 3I73A 1X7XA 1FFDA 2OZKA 1JA0A 3GEHA 4B3DA 4EFLA 1P1IA 1PNRA 2ZEJA 3NNSA 1QFZA 2DJIA 1J2RA 4LDQA 4BASA 4DQ0A 3DOOA 3BRQA 4LGMA 4YEDA 5KYVA 1UXOA 2W2KA 1UPFA 2A7QA 3L7BA 1Q0ZA 2GN6A 2RD2A 2WHQA 4IKEA 4WE3A 2BKLA 5IULC 1U2GC 3GWZA 3K70B 5EE0A 5G3ZA 4UXHA 4YJGA 4YJFA 4EECA 1FYFA 1WB6A 3QUSA 1FMJA 1DZIA 4XWKA 3DMYA 1U8TA 1BEZA 2H3HA 1RLJA 3NM4A 1QHIA 2H57A 3HZHA 4G5QA 2D4HA 5A4IS 3NANA 3OPYI 3ZI0A 2FK8A 2VUUA 2B5VA 1AA9A 4FW9A 1X77A 1VIVA 2J3QA 2FWBA 2Z0MA 1BFUA 2IEZA 3V8EA 1RXCA 1L7MA 1H2YA 4LXXA 4RD3A 4ZZ3A 3F6PA 5FEUA 4ZEWA 2E5FA 2XNDA 4BO2A 2D54A 4N0PA 3OQVA 4JI6B 4L02A 1U0OC 5JS6A 3GLIB 1GIAA 3LQQA 4RY2A 3WGNA 3F6RA 3RE1A 1SBTA 4MR8B 3V4RA 4R4JA 2FOLA 4HAOA 1Q6ZA 2VI5A 2VJKA 1IUNA 1Z4OA 2I6QA 1IZ9A 1J0DA 1ECLA 1YJ5A 2I2WA 3BFKA 2D2EA 3FNQA 3VPAA 3U6BA 4DRYA 3PE3A 4ZAGA 2IIQA 4UBKA 5C34B 4PVDA 4BXOA 2P3OA 1M1NB 1O9BA 2WPDD 3DCNA 1U0GA 3BFJA 3N2NA 2DFVA 3UAWA 3KQNA 1KBZA 1JP7A 2CBZA 4A6DA 4RXUA 5AW6A 2UUPA 3O9ZA 4D80A 1Z0DA 3FDIA 3DT8A 4HPJB 4DLSA 1B74A 4F2HA 1E92A 2ZU6A 3TAXA 5JJ5A 4GPEA 1EUYA 1XJCA 1H65A 3EGEA 3KELA 3KKNA 4FE7A 4OJQA 3PRYA 5A5EA 5MFPA 1H8HD 1XU9A 2FUKA 3G88A 3KBOA 4WY2A 4CQLA 1NUQA 1VECA 1XHLA 2ECQA 4TM8A 4YAJA 1ESEA 3HP7A 1JR4A 4TRMA 3BXPA 5J1TB 2V54A 5FFMA 3SM9A 4GRAA 1N6KA 4HLNA 1EX7A 1AXRA 3GRRA 4FNOA 4PLGA 5ESDA 3V6MA 1I8TA 2X5JO 4EWLA 1GTG1 5ICGA 1XEXA 2E18A 3LDUA 4W5RA 4JBYA 1AQIA 2ZTSA 3H2HA 3W5VA 2CT8A 3BN3A 5REQB 2CDAA 2LIPA 1DKQA 1UJ4A 3TMYA 5H82A 2GCIA 2PBLA 3U09A 4IQFA 3GPDG 7AT1A 5HOQA 3GRFA 3ESAA 5DTRA 4RKQA 2E7ZA 2CFIA 5FYQA 5IANA 1ID1A 1UC5B 2BE9A 1P0CA 1DOZA 1YB4A 3KR0A 1T26A 3U7EB 5GOTA 4ZEOA 1W2GA 2QRGA