1MT3A

Crystal structure of the tricorn interacting factor selenomethionine-f1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mt3A00
2PKYX 4EY7A 1OCEA 2V9ZA 2AJDA 4AO6A 1TQHA 3D2BA 2PX6A 1VXRA 2VF2A 1J1IA 1CIJA 5CT5A 3C6ZA 2CBGA 2EEPA 5YASA 5ALFA 1VE6A 2RGUA 1EINA 4OB6A 4UHDA 4ARAA 1MAHA 5AKHA 1EDBA 2AXEA 3V9AA 3PFCA 5ALMA 4PF1A 2H9YA 1XROA 1DWOA 1LZLA 3L1HA 2WUGA 4G8CA 4JUIA 4C4ZA 4UPDA 1Y37A 3WKCA 4PQEA 5AIBA 1P0PA 2DFPA 4U2CA 4C89A 3O95A 4JH0A 5ALEA 5JASA 2XMQA 5D3KA 1JMYA 5JYCA 1X2EA 5JIBA 3ESCA 4PV7A 1BU8A 3G0BA 5IVDA 2O2HA 2VSQA 2OXEA 4E14A 1VA4A 3QITA 1SCIA 5CT6A 2ZJ6A 5AKGA 5DNVA 1XLUA 1QIEA 3DL4A 3WWEA 4C4XA 2XQGA 4OPMA 6YASA 4HAIA 4HZGA 5CURA 1W4LA 2FUKA 4DNPA 1U4NA 4ZV9A 3CCBA 5HF8A 5A2GA 4K5QA 4JEIA 4DSAA 3C5VA 2ZJ7A 3ED1A 1QO7A 4X91A 3QPAA 3R0VA 5ALOA 3SK0A 2GYWA 2PSEA 1I6WA 2PU5A 4HVTA 2WFLA 1ZI9A 5EIEA 2OG1A 4FOLA 3VJMA 1XZKA 3MUNA 4B0OA 4DLNA 4OSEA 1P0MA 3F96A 3GBSA 3KSRA 2Z8XA 3I28A 4G4GA 4UBKA 1IUNA 4X6YA 1Q84A 3BJMA 4BC1A 1DQYA 1FFBA 2GYUA 5T4BA 2G63A 3DQZA 4QE3A 5LZ4A 3A2NA 4BVJA 4AZ3A 3WZMA 1WM1A 5ALUA 4X95A 3ZWQA 4FLEA 4FNMA 1X2BA 1WB6A 4OU4A 1E3QA 1YA8A 1UOQA 4KE9A 4XX1A 5KBYA 1UOPA 1K4YA 1F6WA 2VJBA 5FV4A 3C6YA 2IITA 1VA5A 4Q3LA 3AILA 2XMGA 4MJ3A 1GPKA 4TVKA 3ZLVA 1CUHA 5KWIA 4J7AA 3PICA 4X92A 4M0FA 2ROQA 4DIUA 3GELA 2Y6UA 4KAAA 2RHWA 3FYTA 3IUNA 2XLBA 1EVEA 4EHBA 1QGED 3QVMA 2OLEA 4EUSA 4GBGA 3F97A 1GT6A 3WKBA 3H0CA 5AI6A 1BCSA 3VXKA 2QR5A 4NMWA 2H1IA 1SFRA 1YA4A 5K3CA 2WTMA 3P2MA 2OCLA 2BUAA 2HA6A 4X00A 4QDTA 4WFIA 4MYDA 4X97A 2GBGA 5CRIA 2OPHA 4PNZA 2B9VA 2QM0A 4I3FA 2ONCA 4BRZA 1JMKC 1USWA 1CEXA 3WK4A 4KE6A 1ZD4A 1WB5A 1WB4A 2C7BA 4FDMA 3UMJA 4UHEA 1CFJA 4ROTA 3ZV7A 4XVCA 4OU5A 4H7JA 1QONA 2HA2A 2HRQA 3PFBA 4GECA 4RPCA 3FSGD 4ZREA 2AJ8A 1HQDA 1ZD3A 1G42A 4WDRA 1W76A 1E89A 1CUYA 1QLWA 1XZDA 4WFJA 3C8DA 2I3ZA 4N8SA 4B80A 4LIPD 2Q0XA 2V98A 2ZVDA 4OB8A 2JBWA 4F0JA 4L9AA 5E4TA 4ZXFA 3V48A 3HYSA 4KE8A 1DU4A 1FFEA 5JD6A 5FDFA 5LP1A 2XQFA 2VJCA 4XIIA 4Q3KA 2PSDA 1BCRA 2QXTA 2WU4A 3DJYA 5EHXA 5IKXA 5SYNA 1EB8A 2NW6A 1ORWA 4BVLA 1LPSA 1ZOIA 1RWQA 4XWGA 1R50A 2VQ6A 2C5GA 2BCEA 3S2ZA 1LBTA 4Y2YA 3WQHA 2OAEA 4FWBA 5A7HA 4AN0A 5AM0A 2BAGA 4A16A 5ALSA 3DCNA 5JADA 3I6YA 3DYIA 1XZJA 4BB0A 2XUGA 1GXSA 2JEYA 5LLSA 3L1IA 1XQYA 2R11A 3NGMA 3STVA 3G9XA 1XRMA 3BXPA 1S8OA 1VE7A 4FFVA 4J0CA 5AKYA 5AKEA 4BE9A 5BV7A 5JAOA 4U2BA 3IURA 3EQ9A 3U0VA 1ETHA 5ALWA 1G66A 2HU8A 1EDDA 4QWWA 1K8QA 4UBLA 2VA9A 4B82A 2Z3WA 4NZZA 5AI5A 4GWLA 4MWTA 3BWXA 2WU3A 4DMFA 3UUEA 4I4CA 4H7HA 4AXBA 2OGSA 1W6RA 1ZD2P 2AJCA 2P8SA 5ALRA 1AUOA 1CUBA 2J4CA 4WCVA 4H7DA 3G9ZA 5DTJA 3HABA 4D9JA 5HF6A 4Q3OA 2GZRA 3W2TA 1JU3A 4KAFA 3N0TA 3VISA 2AJLI 3OM8A 3W9BA 2XQKA 1N8SA 5CMLA 1XRPA 1DTEA 2DQZA 4N8EA 2XUHA 3O4GA 2ES4A 3QYJA 4X3CA 3HRHA 1LPPA 3TEJA 4BP9A 5EGNA 2VT7A 4MQLA 5KREA 3DS8A 4ZRDA 3BF8A 4BVKA 5CT8A 1HBJA 3BIWA 1C7JA 2QOEA 4UBJA 4G5XA 3STWA 5DNWA 3WK6A 2HA4A 4B85A 5JZBA 5DLPA 3WL5A 4EY8A 3R3XA 4N5IX 3VVMA 5A7GA 4ZI5A 3OG9A 1N1MA 4H77A 5HF5A 4QDXA 4Y2VA 5ALKA 3V1LA 5JATA 4W1SA 1R1DA 3NWOA 5C7YA 3K9BA 3FLAA 3B3QA 1KU6A 3FYUC 4CCYA 2XUKA 2CB9A 5H3HA 2WUDA 4LXGA 4HTAA 3WIBA 4U2GA 3LP5A 4BATA 1KU0A 1YCDA 3AIMA 1BE0A 4YASA 5D6OA 1DX6A 3CCCA 3O9VA 4OB7A 3GA7A 3GZJA 1OXMA 1YAHA 2BFNA 5JAHA 4UHBA 1YS1X 3PDCA 4G4IA 3VKFA 4UHHA 4DMKA 1R3DA 3HC7A 4C88A 5C8XA 3FAKA 3FCXA 5EI5A 3IB3A 4C87A 1PV1A 2RIPA 2WILA 1CUZA 4K6HA 1QIFA 3EBLA 1CUCA 3BIXA 1K63A 2WM2A 4KJXA 2W6CX 1CQZA 5CH5A 4X94A 1CUSA 5J3JA 2ZYSA 4INZA 2PSFA 4BDTA 3I2IA 2B61A 1A88A 5LKAA 2QJRA 2JGJA 4AX4A 2I78A 3TGLA 1T4MA 4BBZA 3GUUA 2O7VA 1EXWA 4C6HA 1XRQA 5EHNA 1XLVA 3WWPA 1CUAA 2PSHA 3QMWA 5T4FA 1LPMA 1HPLA 1MNAA 1AX9A 1UWCA 1BS9A 4IH9A 4O08A 4PSDA 3SC2A 1TIBA 5DTIA 1XLWA 5A6VA 5DYYA 1CUXA 4KRYA 5ALZA 1EHYA 1THTA 4U2DA 2XT0A 5A62A 3LS2A 3D4LA 4FTWA 4IO0A 2OCKA 2OGTA 1WOMA 5AM4A 1XRRA 1HL7A 3QBJA 4KYVA 1W75A 5AK3A 1IUPA 3ZLTA 1XKTA 1XQVA 3I6ZA 3BDIA 1LPAB 5E4YA 1A8UA 1GQSA 3LIIA 1LLFA 3ZLUA 4WDQA 4L3WA 5AKIA 5EIHA 2GZSA 4Y2TA 5FLKA 4F60A 3H2IA 1YSCA 1ODSA 5IVHA 3OURA 4J3JA 1CR6A 7YASA 3TJMA 4H18A 1N5RA 2JIDA 1GPLA 5I8PA 1UKCA 4Y7DA 1DWPA 5ALLA 4GDMA 4CG1A 4AO8A 3W04A 3A2LA 3RLIA 3LCRA 4HRXA 3ESDA 3WYNA 3BDVA 3M3DA 4BYMA 2UZ0A 1F0NA 1MTZA 4L0CA 2WUEA 2JGEA 2C0QA 5ALQA 4UHFA 3H2JA 1AMNA 4P93A 3HEAA 3I1YA 5HQ3A 1EH5A 1P0IA 2ZYHA 1E8MA 1XZBA 4AB1A 3PUHA 3EQ7A 3AJAA 1FFCA 3W9UA 3UUFA 4QLOA 2CKMA 1SCQA 1Q0ZA 4NVRA 1ORVA 4UBOA 1EDEA 3WK5A 2CMFA 2WIFA 3C6XA 2XUIA 4KRXA 5HKAA 3WJ1A 2YASA 2BGRA 4CCWA 3DOIA 4E46A 2WLSA 1L7AA 3G8YA 3O4JA 2CUTA 4GEGA 1U65A 2WIGA 3F98A 4IH4A 1ZD5A 1EB9A 2PUJA 3HACA 3I2JA 2HHAA 5CH3A 4ZGBA 3NUZA 2VTVA 3HLKA 2XLCA 3WL8A 3IA2A 1AKNA 1ODTC 2R8BA 5JALA 2G5TA 2JGLA 3H04A 5AM5A 3FWHA 3C43A 4F5ZA 4N8DA 4ZWNA 3WKDA 2BUBA 1AURA 4YPVA 5EHZA 5CXXA 2WTNA 1VJ5A 1DT5A 1RP1A 4Q82A 1CVLA 2WIJA 4FKBA 4HXEB 3VVLA 5JAPA 1W1IA 5LKRA 1AGYA 1AZWA 5K3FB 4MYSA 2FX5A 1L7QA 4M0EA 4UBIA 5KWJA 2VAVA 1YB6A 1UK7A 3RARA 4K2AA 1WHSA 1YB7A 5JD5A 1IVYA 3R3VA 2V97A 1UK6A 1EX9A 5AK4A 4Y2JA 3SX4A 5K3EA 3WKEA 4Q1VA 2OGZA 1H2XA 2VEOA 5T4EA 3G9TA 4LYEA 3QPCA 1UT6A 4TGLA 3E4DA 4DNOA 4LYDA 1VZ2A 2DQYA 2HA5A 1CUJA 5ALVA 3H2KA 3WL6A 4X7BA 1TK3A 3R3UA 1MNQA 2B20A 2PU7A 3OTQA 2QZPA 2DSNA 1Y7IA 2ZSIA 5HCUA 1EK2A 3IIIA 5AKXA 1HKHA 1QZ3A 4B0PA 2GBIA 3M82A 1TRHA 1LZKA 3WK7A 5DJ5A 4B7ZA 4YX9A 3BF7A 4MEAA 1LBSA 1HLGA 4Z49A 4BE4A 3T52A 3D0KA 1D07A 2WFLB 3STXA 2C4HA 2XDWA 2OAGA 4GLBA 5AKKA 2DHCA 1IZ7A 2BUCA 4EA6A 3H17A 1PFQA 5FUMA 4P9NA 1E66A 2PM8A 1UK9A 2I03A 5AP9A 3E0XA 2O2GA 5E2IA 3K2IA 1BN6A 1VOTA 1FFDA 5C8VA 1BROA 4BAUA 5IVIA 1DQZA 2QJWA 3IVMA 4MXDA 4G9GA 1O6GA 4CG2A 2QS9A 5K3DA 3ANSA 5AI4A 3R3ZA 3H2HA 4QA9A 1PJAA 3RKSA 4AN1A 3ZI7A 4QLAA 1LNSA 4GI1A 1JT2A 1RYYA 1C7IA 3A70A 4BCCA 1MT3A 2C0PA 2OCIA 3STUA 2DHDA 2QXUA 2XUOA 3FLBA 4K6GA 2GYVA 3DNMA 3M83A 3F8SA 2DCMA 2OQIA 5HF9A 3HXKA 4AQDA 3A6ZA 4QDUA 3I2GA 4AO7A 1L7RA 4BAGA 1QE3A 3R3YA 1R9MA 5AOBA 2O2IA 1VLQA 1MPXA 2WIKA 4FHZA 2H7YA 3WYDA 5FRDA 2RI6A 1ZICA 4RE5A 2HA7A 2ACKA 5D3ZA 4G4JA 2JGFA 1H2WA 5A7FA 3GROA 4Q05A 4QWMA 4W1RA 4EY6A 3IUJA 3FSGA 1X70A 5AK6A 3T4UA 4Q34A 3C5WP 1LPNA 1NX9A 2WG0A 1MX9A 3K6KA 4BTVA 2HA0A 3IULA 3LLCA 5JZSA 3SWWA 4ARBA 1IMJA 1QIKA 4BC0A 2WHPA 3I2KA 4IH1A 5HKBA 4X71A 4Y2XA 3CXUA 4Y2SA 5LIPA 1UXOA 3OOSA 2HRRA 2JGMA 1P0QA 1CRLA 4WY5A 2D0DA 1ZGCA 4IHAA 1DWQA 4X90A 2WFMA 5AOCA 2XMSA 1THGA 1H22A 3W06A 1ZI8A 3W05A 5LYYA 4PO3X 2CJPA 4H7IA 5AOAA 4GW3A 4OYYA 2XMCA 1H23A 4AMZA 1QFSA 2PL5A 2HFJA 3AZOA 1CUUA 2ZJFA 1R9NA 3FYUA 1UKAA 1H2YA 3V1KA 3STYA 2WHRA 2JEZA 3WWCA 3M81A 4B81A 1QIGA 3B12A 1XZLA 5AK5A 2WJ6A 3DLTA 5ALYA 1T2NA 4DNQA 1JI3A 1R88A 2HU5A 1XZHA 3FNBA 1ZGBA 4CI9A 3ICWA 2HA3A 5C8ZA 3KWJA 5AKZA 3IUMA 1CUEA 4N5HX 2PSJA 4J0DA 2I3DA 1TCAA 2CEKA 4HXFB 1JJFA 3HI4A 4FMPA 3PF9A 1ZI6A 3O4IA 5IVKA 4BZWA 5HK9A 3O0DA 1NU6A 4PSCA 2J4FA 3AINA 1FFAA 2WJ4A 4MQMA 4E11A 4LXIA 3PI6A 1DX4A 2XUJA 1GKKA 1QFMA 1MJ5A 2Z3ZA 1WCYA 3B5EA 2VAXA 5IH7A 1LGYA 2WKWA 3KWFA 2DR0A 3HJUA 3L1JA 3QH4A 1AC5A 5AHXA 1U8EA 1ZIXA 3G0IA 5AM1A 3R41A 4L72A 2D5LA 5T4HA 1MX5A 3FVRA 4W1QA 3A2MA 4LXHA 1CUGA 2HIHA 4BCBA 2CZQA 5JANA 4MEBA 2Y6VA 3C6BA 3F9CA 1YS2X 1XZMA 2YH2A 3QZUA 1LPOA 2XUFA 2WJ3A 3PE6A 1UFOA 4QDZA 5FOQA 3MVEA 1OILA 4LKOA 2JGKA 2JF0A 2WSLA 3EF3A 2B4KA 3NOXA 1G5FA 2FJ0A 5AICA 3O9MA 3STTA 1QOZA 3FOBA 2OQVA 2HM7A 3OC0A 4DMHA 2OCGA 1CV2A 4WY8A 2J3DA 5CT9A 3D5EA 4H0CA 1M33A 5ALHA 1MAAA 1JU4A 5ALTA 1QJ4A 2DHEA 4EY5A 4OD0A 2XB6A 4KR0A 1BRTA 3H1AA 1XZEA 2C5FA 4NS4A 1TCCA 4DNFA 2YXPX 4UFNA 1DT3A 2HU7A 5AM2A 3N2ZB 1CUVA 3AZQA 3AZPA 5ISMA 3IBTA 3I1IA 3IUQA 1CUIA 3FBWA 2VATA 3DD5A 5HZGA 1ZJ5A 3QM1A 5AH0A 5CH8A 1QIHA 1XZAA 2X5XA 3ESBA 1XKLA 4G9EA 5FXMA 3ICVA 5I9IA 4FBLA 4CFSA 3G9UA 1XFDA 2XMZA 2QT9A 5AJHA 3I2FA 1ACJA 5LZ7A 4B84A 2WG2A 3Q0TA 5EHQA 3WWOA 3WMRA 2WG1A 3DDUA 1B6GA 4IQ4A 5CTAA 1LPBB 2ZYRA 4QEKA 3H18A 1BEEA 5A71A 1WPXA 3KOOA 1CPYA 2XI4A 5CT4A 1YASA 1CUDA 5ALDA 2AJBA 4H7EA 4JYPA 5ALJA 2WHQA 4UUQA 1IUOA 2ORYA 2X76A 4J0HA 4S0XA 1ZJ4A 2FJPA 3C45A 3OPMA 5AKJA 4UHCA 1UOOA 1R4ZA 1JJIA 4UFOA 3CN7A 1QTIA 2BJHA 2XMDA 4PW0A 4BTLA 1QIMA 4OUKX 3WWDA 3LIPA 3AFIA 1H2ZA 3BJRA 4KAJA 5F4ZA 2Z5GA 3PUIA 3GFFA 3U1TA 2IIVA 3O4HA 4BCDA 3AIKA 4OYLA 4AMYA 5CXUA 3D3NA 3G0DA 1XZCA 2X8BA 2XQIA 1F8UA 5HQ3B 2VJAA 2WFZA 3DOHA 5BWBA 1MU0A 4XJVA 1J07A 2PPLA 2Z8ZA 4B83A 3VJKA 2RAUA 4KEAA 3WI7A 2QUBA 1QTRA 4G8DA 4JYMA 3WKAA 4X6XA 5AKLA 3C70A 1YR2A 4FLMA 1Q0RA 3YASA 1VKHA 2ECFA 3G02A 5LZ2A 3QMMA 2XE4A 1UKBA 1C4XA 5C81A 1XRNA 1XZGA 4DM7A 2ZYIA 4EY4A 1GGVA 3C8HA 2BKLA 4EZIA 5LZ8A 5LZ9A 1CUFA 4G8BA 1Z68A 4W1PA 3IDAA 5FP0A 2RONA 3D2CA 1DINA 4QNNA 1AQLA 1ACLA 1NU8A 2HL6A 3E3AA 4BP8A 3Q8WA 2XUQA 1J06A 4CG3A 3DL7A 2XMRA 4Y2QA 1JFRA 5JD4A 4J0JA 2V96A 3ILSA 4DMCA 2G4LA 2WUFA 4TPKA 5DWDA 4FBMA 2PVSA 5HK8A 3PF8A 5AI8A 4DSZA 1QIDA 3FVTA 4YK7A 5CW2A 4W63A 5I7UA 3RK4A 3DYVA 2J3QA 4EB0A 1ODCA 2HADA 4J0KA 4E15A 3HSSA 3D2AA 3RM3A 4FLFA 1ZIYA 3I6MA 4K6KA 3V1MA 1A8QA 5AM3A 4C01A 4J0GA 3BL8A 4P08A 1CQWA 5JAUA 2EDCA 4H7FA 1GKLA 1TAHA 2GBCA 3TRDA 2XUDA 3S8YA 4ZV7A 4JNCA 5AIAA 3G7NA 4UFPA 3KXPA 1E5TA 4KE7A 4WJLA 4GXNA 3DEAA 2XUAA 1GZ7A 1VXOA 3V1NA 1IZ8A 5SYMA 3AIOA 1K6EA 3I2HA 1SOMA 1WHTA 5ALPA 2E3JA 4WFKA 2O7RA 2EDAA 5LZ5A 1XRLA 5ALNA 3VJLA 1A8SA 4BAZA 5K3BA 4AZ0A 2GBFA 3VDXA 5ALGA 1GPNA 4X85A 5DNUA 1JKMA 1GQRA 4PSUA 1MO2A 1G4HA 1SCKA 1HDEA 4CCYB 2PBLA 2XUPA 5BWCA 4Y2RA 3JYHA 2QKYA 4X6UA 4CIAA 2QUAA 4M0MA 4X93A 5FPPA 4C4YA 3JW8A 2H7XA 1FSSA 4QZVA 5HFNA 2C58A 1VZ3A 3FCYA 5CBKA 5E4JA 1K5PA 4B9AA 3G0CA 2LIPA 3D7RA 3HZOA 5JZ9A 4H35A 5K3FA 1TCBA 3WIOA 4QDOA 5K5EA 1MX1A 2PUHA 5AI9A 4LHEA 5DYTA 4V2IA 1QIIA 4RGYA 1Y7HA 2WIDA 4HS9A 1XQWA 3G0GA 1WPRA 3E1GA 2H7CA 2W22A 2YYSA 1YAJA 3ZPXA 3EIOA 5DYWA 3CN9A 3EQ8A 1JJBA 2ACEA 2VJDA 3WA6A 4OCZA 5BOVA 1A7UA 1UK8A 4P92A 2QMQA 2HDWA 5ESRA 2WHPB 2VT6A 2JGIA 5K3AA 3MUOA 4HXGA 3R3WA 2RHTA 3H1BA 2G5PA 4RE6A 1QIJA 4BZZA 4GHWA 4CIBA 1UZAA 1W52X 3BE8A 4U2FA 1QO9A 4RNCA 3WJ2A 3DKRA 2WQZA 1XZIA 3WK8A 4FNGA 5FKJA 1EI9A 4H7KA 2ZSHA 4B9EA 2Y1KA 4G1FA 4U2EA 1EK1A 5AI0A 4J0IA 3KDAA 1BEZA 3F67A 2Y2VA 2BGNA 1TKRA 1CLEA 3X3HA 5ALIA 4DYHA 4ITVA 4ETWA 1B41A 3QPDA 1CUWA 3H2GA 3WLAA 4UBMA 1E8DA 1SC9A 4KACA 1N5MA 1EVQA 3D59A 4Y2PA 2IX9A 3C87A 3FYUB 3QMVA 4FFWA 2K2QB 4Y9SA 3JWEA 3WK9A 3WZLA 1J2EA 4EBBA 3H19A 5JARA 4Y2UA 5HFAA 2QVBA 4MWSA 4DTCA 5EFZA 3FLEA 4B6GA 1XQXA 2XQJA 3ESAA 3AUKA 4BRSA 3WA7A 4A5SA 1F0PA 4BDSA 4J03A 2XMBA 4W9RA 4HRYA 1E8NA 3R40A 1Q83A 1KEZA 4DGQA 4A23A 5EIAA 5ALXA 1EA5A 1O6FA 4I19A 2QTBA 1BN7A 3KD2A 2Y2UA 3WL7A 1XZFA 1MN6A 4F21A 5AO9A 2QRUA 1ISPA 1U2EA 3DKKA 3MGAA 4UBNA 5FPQA 1FJ2A 3ANTA 2HFKA 5D7BA
chains in the Genus database with same CATH superfamily
1EFHA 3MCVA 3NNNA 1OCEA 2J85A 2QNIA 3OIDA 1IEQA 3PUYA 1ZCJA 4RA9B 2AJDA 5C7OO 2V0GA 6PFKA 2BT4A 4K86A 4DWOA 3F6EX 4DA6A 3PGVA 5D5QA 3DCJA 2JH3A 2PX6A 5DNAA 5MFPA 2HQOA 3IERA 4TT8A 5IASA 1KR5A 4JSTA 3C6ZA 5CT5A 4BQPA 3CS3A 2EEPA 5YASA 2Y1WA 4ZYVA 1PL8A 1PW5A 3D3KA 3O8QA 1JHYA 1EINA 2GT1A 2YNMA 3GT3A 3N0VA 4BFZA 3ENZA 4EJSC 1MAHA 3U4MA 3RDPA 3O4FA 4IHKA 5DBHX 3NW9A 4D26A 2YINC 3QVOA 3WLLA 2ADOA 2AXEA 2ZTLA 4JJ8A 4XYGA 2OBLA 3V9AA 3PFCA 5KTPA 2WQ6A 1BCSB 1SU4A 5ALMA 2X42A 2B0JA 3JAWB 3C3KA 3LQRA 1GDTA 2EBFX 1LZLA 3FDZB 4O8CA 3KNZA 5FO0A 2CEAA 1SBYA 1RXCA 2VK1A 3GO4A 4G8CA 4AYXA 4DQDA 3SQWA 3MHTA 4WA7A 4UPDA 3PHCA 3WLMA 1YB4A 4PQEA 3I5AA 4F3CA 1KK3A 3NHZA 2IS1A 4O4LB 1SBTA 3K0FA 4OLFA 4C89A 3O74A 2ZB7A 3CEJA 1AGXA 4RFVA 5T6BA 4NBUA 1J0AA 2AYYA 5ALEA 1K3FA 3OETA 5JASA 2XMQA 3CLSC 3QU4A 4D9CA 5BOSB 1JMYA 1Y8ZA 1WBDA 4I50A 1R0LA 1ULZA 4EB3A 3C4JA 1OF1A 3MBOA 4RDIA 4CTOA 3QVJA 3D8SA 4J9UE 4TYWA 2AFRA 2WABA 4PV7A 2P4UA 1X92A 2PXXA 2ADFA 2O2HA 1KJNA 4Q02A 4E0BA 4WKBA 4EEXA 1A5AB 2VSQA 2OXEA 4KN8A 4PHGA 2IHNA 3IRUA 1DDIA 3QITA 3P71T 3QHQA 4I1UA 3F4BA 4KGZA 4EF6A 3KOYA 3ZNQA 2I1QA 1DV1A 3I8OA 3OPYA 1OTYA 1QIEA 3IJRA 5FI1B 2DFNA 3DL4A 4R1PA 3SGLA 3UXHA 3QBDA 4K3UA 2IL1A 2E4XA 1JPJA 4S2EA 3KUUA 3CTPA 2NP6A 2POCA 2QQ0A 2QUHA 2WSYB 4DNPA 2X6QA 1XCBA 2OCPA 4UKDA 4ALKA 1U4NA 2BRUA 3KWLA 2JFXA 3KPWA 3DVAA 4G5QA 2IWHA 3OZTA 3THXA 1OXKB 3MMXA 1K75A 3GJRA 4KREA 3LKDA 3HKDA 3QU7A 1LSSA 4CIDA 3PP8A 4LDPA 4TXHA 2EIHA 3H13A 1TLFA 1YQUA 2ZJ7A 3E9MA 1O2DA 2ZTMA 4X91A 3LY5A 4OGFA 1GGNA 1MKYA 5ALOA 2VAPA 2EG9A 4FHCA 2ZE8A 5KDLA 3GFOA 3W77A 4D8TA 2GZ1A 4A03A 3I4LA 2V6BA 5ARDA 1KAEA 3W1VA 3UHPA 2JGRA 2ZQ5A 1U2DA 2QVCA 5CR9A 1Y9ZA 1FXUA 3EVNA 3VBCA 4D43A 4PSVA 1GO2A 1OQAA 3KE9A 2LRHA 5B2ZA 121PA 2R8EA 1MZPA 1OLXB 1QDUA 1J7KA 2YBDA 2ZBPA 2I1WA 1J22A 3TKAA 1JHVA 1E1RD 3RRZA 4V0SA 4ARUA 5EIEA 4DF3A 1YJ8A 3AVWA 2EARA 1G5PA 1RQPA 1QP7A 3VJMA 4K88A 2W7TA 3MUNA 4HNQA 5DRTA 3ADCA 1KDRA 5COBA 1FDWA 3TZ6A 1C2YA 5L6LB 1R0BA 1P0MA 3QKUA 4J0QA 2G9UA 5EZ5A 4JBIA 3RUCA 3SHOA 3IKJA 4DDKA 3R0JA 1AKQA 4EPXA 3RV3A 4YCNA 4DA4A 2G83A 3EYAA 4LF4B 1Z6AA 2NQ2C 2BI8A 2PMBA 2GEJA 3P9PA 4FYXA 4RLFA 1Y4AE 3TWOA 4AIRA 5CXQA 4X6YA 2A3RA 3BJMA 2W71A 3P27A 3M70A 2GPBA 4I9GA 1OAKA 4IV8A 1WVIA 1DQYA 1QYDA 1RYNA 2AN4A 1VHLA 1VYHA 4TTSA 4KGVA 1FFBA 1D2CA 2NVUB 1OX6A 1P2UA 2Z08A 4HNAA 1U94A 3TVDA 2G63A 4WXHA 3DQZA 3O3MB 5K2MA 3AY7A 1OX5A 4LYJA 4Y6LA 3SP1A 4XYEA 3WLTA 1I1HA 4IHQA 3I61A 4HLQB 2PZAA 4FZ5A 1IY2A 4HV4A 5ITZA 3PC8A 1XDZA 2GM9A 3BT7A 5ALUA 5BXQC 3TZBA 2CLSA 4FSHA 4JBLA 4OFXA 5A4MS 1P1CA 1RQLA 3JQ8B 3RASA 3RAFC 3KG2A 3HYNA 3OU7A 4G5FA 1J0DA 4Q4AB 1E3QA 3A27A 1UOQA 4KE9A 4AJ9A 4CQNA 3I01A 3M6VA 2V3VA 3PRYA 3VNBA 3WFIA 5KBYA 3VJRA 5FO1A 2PBFA 4MRPA 3NFYA 1YHNA 2CF6A 5KINB 4RSMA 1OIXA 1QQ5A 4YUAA 1WD5A 3LWBA 5BR4A 1V5IA 1Z5VA 2FLKA 1F6WA 4TKUA 3U0BA 4FGWA 2EQ5A 3NG1A 4OHRA 3ZWMA 4B71A 4PPNA 1NVXQ 5LA6B 3T7KA 4A3SA 1A1VA 2B83A 4Y3UA 1H69A 4MX8A 2FDCA 5BQFA 1ZN8A 3ISVA 4FFOA 3ZLVA 1CUHA 5IYZB 4TSFA 3CNQS 4RF3A 2BCJQ 5FAKA 2ID4A 2FW9A 4FMCB 2P9JA 2YFKA 2MSCB 1SA0B 2OC9A 2RAPA 2Q7DA 3PICA 5LBIA 4G36A 3SHFA 3I72A 1WUYA 1PWZA 3AUXA 5CB4B 5IK2D 4OAPA 4AQ7A 4BMOB 2YHIA 4OA5A 2GZHA 3FFBA 4OJKA 3O8DA 3O93A 3H5RA 2I22A 1F2TB 2RHWA 3LOUA 1QCYA 3QE3A 4KAAA 4UNPA 2CGEA 2VUIB 3DE6X 4DW8A 1XJQA 5LJLA 4AD8A 1UPXA 2XLBA 1H66A 3IQIX 1EVEA 4HRAA 4HAWA 3L0PA 5JYEA 5KS2A 3NHUA 3AEQA 1DE0A 1QK5A 3D6MA 3F5MA 1VLHA 3IV7A 1PJBA 4QPDA 4U63A 4E03A 1P72A 4LJLA 2HOQA 1PT5A 3F97A 2EU8A 2WD8A 3E9QA 4GOMD 2WD7B 4FFLA 5H81A 3WKBA 3JYLA 4DQXA 4PCVA 3SYNA 5K0FA 1UQTA 4WCFA 1BCSA 2HDNB 3ZGVA 5KNCH 4GKJB 3KELA 4W5JA 4NMWA 3K0HA 4MUFA 2QWXA 2Y4OA 4K2HA 1L0BA 4OI0A 3AHIA 3ZGNA 4BLOA 3P9KA 3CBGA 1SU7A 2R7AA 5F51A 2OCLA 1MO6A 3U62A 4BB6A 3IEVA 2PUGA 3EEQA 3IBCA 3K96A 4I7EA 2QMEA 1HTWA 2D3WA 3QHPA 2L69A 4JT9A 5JMPA 4KR7A 3DBIA 1RKBA 3WOHA 4XDZA 1N77A 2VZLA 2O3TA 3I9KA 3UCFA 4KQIA 2YHAA 1BYUA 1RTTA 1CY1A 4PX2A 4ZI2A 3NJRA 2OE2A 1RRFA 2ECQA 2PGNA 3AXTA 1RABA 2LBPA 1C81A 4FYJA 3WK4A 4JBGA 5GPBA 1RHMA 5IZCA 1FSZA 2ERCA 4PR0A 3AESB 1WB4A 4Q7EA 4XWTA 3NPAA 4FDMA 3OM9A 3ROFA 4UHEA 2Q8NA 1CFJA 1F60A 3PXCX 4MYUA 3B2EA 1XG5A 3QV2A 4PY2A 1Z7EA 3ZD7A 2NOAA 2V7QD 1SXJE 2OBYA 3DDWA 3G3EA 3PC7A 5FYDA 1QVWA 2ODAA 4YUYA 3UAWA 1BDIA 2BLLA 1GV0A 4G37A 4GQAA 3DB1A 4EA8A 5ANRB 4NCNA 3KQWA 5IMSA 1CZLA 2HJRA 4MGKR 3CUWA 4Q21A 4RPCA 1N0VC 4RD1A 4CPDA 2ZOSA 1OWPA 4PAMA 1MJHA 1G7TA 2NO7A 3B78A 1Q1AA 1T3ZA 1QLWA 4M9XA 5BMVB 1Y3CE 4REOA 3RFVA 4FGSA 4IVNA 3BAFA 4EMUA 2I6UA 2LD4A 4Q37A 5LOVF 1XGKA 2UUOA 4IIXA 3VPAA 1Q3HA 3K1AA 2IDZA 3KLNA 3OEYA 4LIPD 1QO0D 2Q0XA 4I8DA 5E1BA 4JVSB 4CV0A 3CKYA 4OB8A 2W0SA 2WJZB 3SMVA 3CH6A 1N2ZA 2FNAA 1E6KA 3HGTA 5GONF 4OLJA 4G6ZA 4ZXFA 1COZA 2Q5JA 3USZA 2H1CA 2JLQA 1E9EA 3EFOA 1FFEA 3EBPA 2GRAA 3PC4A 3WLRA 4BO6A 4BNKA 2PS0A 2C9CA 2DFKB 2QXYA 3UOAB 5K20A 4XIIA 3J81k 3CNBA 1IVSA 2PSDA 4KGXA 2PZLA 2J3LA 3AKEA 4JMLA 4JR2A 1AJEA 1WHTB 4CN8A 2QXTA 1RC8A 1T2FA 1N2GA 3QENA 3DJYA 1ZVKA 2FF5A 4N9QA 4UCQA 3ZZ0A 4EHDA 1RFGE 2EBUA 1L4KA 1RLIA 2VHUA 3PQ4A 3ED5A 3TBFA 4HFJA 2VVTA 4I2VA 4R8LA 3HP4A 4ZCSA 4BZQA 5F2OA 2IIBA 4BVLA 2A4KA 4MICA 3KB8A 1EZ4A 4JLNA 2X1HA 3ELDA 3CUUA 1ZH8A 1OFGA 3K1TA 3D8TA 4ZCQA 1ZC4A 1DC4A 2XZTA 2I5PO 2RHMA 1JDTA 4NYIR 1TFUA 2L0XA 2D06A 4WOBA 4YONB 2J08A 3SR4A 1PJQA 4LJYA 5BRJA 5CYPA 2OBMA 3NIDB 3D2LA 4KL8S 3DLAA 2WSMA 4KXQA 3WQHA 1RTKA 4FWBA 2GCEA 4RYDA 1E2PA 3MSXA 4WESA 3HU2A 1R4NA 2BEJA 1NOJA 1W4ZA 2R97A 1O8CA 3K0EA 4MJXA 4KGDA 3OT1A 1GTMA 1FK8A 5LMZA 1Z0SA 1R9JA 4M98A 3I1FA 4K9PA 3I6YA 4X5OA 1U0FA 1XJCA 4X3OA 4QGSA 2B8TA 1XZJA 2TMGA 3H5TA 1IPFA 1JEQB 3BD9A 3N8IA 4HKTA 3AGQA 2IYXA 3CC8A 1IZZA 2JEYA 3L1IA 3KQOA 4JUCA 5LLSA 1OY1A 3UVEA 5BN1A 2VPZA 2XXAA 4P3YA 4C78A 4YUXA 2YWFA 1XT6A 2RH9B 4JJKA 4FEEA 3E84A 5K51A 4WLNA 2VCHA 4L5CA 1XPOA 2V9CA 4KHPB 5AKYA 3PJRA 3VR1A 5K03A 3DLBA 1KZ6A 3T4XA 5K0BA 3LY8A 1BKYA 5KQMA 3CX4A 1SQ6A 3IURA 4MV0A 4P0PB 3EVEA 3U0VA 4P84A 3V4ZA 1C29B 1RRGA 4DLYA 3LBHA 3LUDA 4GAEA 3BFPA 4L75A 4D4GA 4YT8A 1JBEA 1GDDA 1TKBA 1YI1A 4NNOA 5BV1A 1T43A 3LYLA 4I3GA 1D04A 1GFIA 2HU8A 1IH8A 1CP3A 4GFDA 4FW8A 4WGFA 2OESA 1K8QA 3L7MA 4UBLA 2XKAA 1DELA 4LJ7A 1NM5C 1M1XB 1X0VA 1A8PA 2R60A 4R84A 1PNRA 4QJ4A 3QBTA 4JLPA 4K9LA 2X0NA 4PLWA 1G18A 3T1NA 2UYYA 1B42A 1ZA2A 1YFJA 1I5RA 1Z8FA 3BWXA 3JQQA 4IQ0A 4P7GA 3C3EA 4YJDA 1H93A 4TRJA 3Q4GA 4HLUC 3UUEA 4P3OA 2CVHA 4I4CA 4AXBA 3G5AA 4ARZA 3CZ4A 3ZG6A 3FJ1A 2PVPA 5AJWA 1P6QA 2OGSA 3CZCA 1C7QA 4HGYA 2CZCA 3NKLA 1JZQA 4LHXA 1ND6A 2RGEA 2CXUA 5ALRA 1N9KA 4BO9A 2HT1A 5K7SA 3RADC 2G9NA 3RVSA 1VI6A 3KUXA 4RQBA 2OXIA 3GLFE 1CUBA 2J1LA 4XTCS 3W2GA 3GLFB 4QQ8A 1GCAA 4B6QA 1QM5A 1Z6QA 2X3FA 4BJ5A 3QEBZ 1OPXA 1TEXA 1PZXA 3C6KA 5HF6A 4Q3OA 2LPMA 4P1ZA 1L7NA 3H5LA 4UARA 3RIMA 2IHBA 4MI9A 3W9BA 1Z75A 4DEVA 4R7ZA 4EYQA 4S1OA 2XQKA 1IY9A 2CFSA 1MCZA 2A9JA 1H8ED 1KOLA 1IEWA 3L3BA 1RM0A 5H9VA 1I0LA 2JRCA 4XIJA 1CY6A 1QGDA 2VO1A 1JEOA 1YIAA 1XRPA 3A4IA 2DQZA 4HQLA 2W6ID 4PHFA 3O4GA 1V1MA 2X3YA 4R9SA 4RAQA 4U6QA 1TTHA 2RKOA 2V74B 4LE2A 3EOZA 4UUNA 3W3AD 1LPPA 1PFGA 1QOPB 4HC4A 4ZQCB 3SSAA 5FCDA 1W49A 5TARA 2E82A 1EEXB 2GBLA 2W6QA 3AFGA 1JE1A 5KREA 3L4JA 4Z4CA 3GBVA 4PCAA 1NI3A 3PHGA 4L5IA 5AMXA 4JQSA 4HUQB 3Q9NA 4IHJF 4ZRDA 5H0IA 3E82A 1DEAA 3I76A 1CHDA 4BVKA 1KXZA 1Y5MA 1E3JA 3LK6A 4MK4A 1C8BA 2XYQA 1KOGA 4E5VA 3RTCA 2FRXA 4XX0A 1NQVA 1Y80A 4UBJA 2QOEA 3GRPA 1IUKA 2FPIB 1Z25A 2GAFA 2QD4A 3MRSA 3PHJA 5L53A 4FEYA 5I9TA 4DWVA 2GRJA 5FYQA 4EL0A 4WNIA 2PGAA 2A5LA 2G0NA 3B2QA 3IC5A 5H3CA 3UFBA 4MV6A 3IIMA 3CVXA 3VNVA 2J31A 2HA4A 3MFYA 4B85A 2Y0PA 4M6WB 2L18A 4A82A 1Y9AA 4KLNA 3IQZA 1IU9A 2Q6LA 3I3SR 2AUTA 4FC7A 1P17A 4UZEA 4P81A 1C1DA 5KKAA 1AV7A 5C8YA 2ASEA 3P9IA 4N5IX 5EIBC 4ZI5A 2F1RA 3OG9A 5HF5A 4H77A 1H3NA 3AKDA 2J7PA 3AF5A 3DE1X 4GRAA 4RKQA 4RXTA 3DE7X 4BV8A 3NWOA 4GRDA 1T9AA 3FLAA 1DRWA 1ZOLA 4YRRA 1KR2A 3IUBA 1T6ZA 1GLGA 1LTKA 1B8VA 3P8ZA 3W5SA 4K6FA 1KSJA 3MWDA 1JXAA 4S35A 3RVLA 1KU6A 2QRQA 5CDUA 3O8CA 4TLLB 2IHZA 4PPYA 2XUKA 4YAGA 3RYFB 3W3AH 1QFXA 3LQ2A 1P31A 3M1YA 1IN5A 4U2GA 2W5UA 4QICA 3AHGA 3LP5A 1V16A 7REQA 3CNOA 3PEUA 4QUBA 3FDIA 3HZHA 4JOBA 1ZLXA 4NQRA 4OBXA 4F11A 4OP2A 3I53A 1DLJA 2L82A 4B76A 4RACA 3LD9A 4AS2A 1PJ4A 4HDNA 1YBHA 3JQ7A 3ZX4A 3EWAA 1PWXA 1YS4A 4HGRA 3I9V6 5E3HA 4HQKA 2OK8A 4W9NA 2BFNA 1FNMA 1U7XA 3EMBA 3WBBA 5KVCA 3Q0IA 1RPZA 2BFDA 2IOFA 4JOSA 4G4IA 2WHYA 1YQEA 3H1PA 3VKFA 5F3WB 2DERA 3SX0A 2WKQA 1V8OA 4L50A 4YP0A 2ZVPX 3FPBA 1NVUQ 4IO1A 3FCXA 1YC2A 3IB3A 5EI5A 3FNEA 4PG7A 3MJHA 3SJCA 5TEWA 4C87A 3IJEB 3CF6R 3G68A 4MCHA 2XSZD 1MEEA 2C82A 4PTLA 5HKOA 2WHEA 3ORYA 1Z2PX 2XA9A 3GPBA 2O1SA 2RIPA 2WILA 1X7GA 1G4UR 4HDRB 1KZGB 3EBLA 3TINA 3BIXA 5DHTA 3T7RA 5AJXA 5IJAA 1UM8A 4DUPA 3FA2A 1GG2A 2IEYA 4HNSA 4NZOA 4O4JA 4CEJA 3RS9A 5L4LA 3AK4A 5FUWA 4WK0B 1A4UA 3SJAA 4ENRA 5GZ1A 3PFGA 4O33A 1V4NA 2W6CX 2WWXA 4L6CA 3L8GA 1JLLA 2ZTSA 1TVMA 2A8YA 1Z5ZA 1XZNA 1ZMBA 3BKXA 3WHPA 4NYJR 4DIKA 5K8JB 1TAGA 3VDNB 4BDTA 2B61A 1FUUA 4RD3A 1ESCA 4JGGA 4DR1B 1EUQA 3T41A 3GA0A 3UBTA 1IPHA 1IM2A 1E5LA 2XTZA 4M9QA 1S0UA 4AKHA 4C7VA 2HMSA 3VGPA 1RJGA 2E49A 1DFHA 5DHUA 4JOCA 4ZODA 1V4VA 1KPIA 1WZUA 1DJPA 1TUGA 1SKAA 3ZHXA 3QBEA 1NXTA 2JK1A 4XWAA 4BVGA 1BXRB 2MU1A 2G04A 1M83A 5FUXA 4RIIA 2GN2A 3W3ZB 1KFJB 3MWLA 1J0EA 2O7VA 1BX3A 4YJGA 1VCHA 3OFSA 4OJQA 3WWYA 3RSQA 4A6XA 1EXWA 2W0MA 3LKBA 4M8KA 1GUYA 3R0XA 2FCRA 2CL5A 2AHOA 3MJ4A 4RHYA 5EHNA 1XLVA 4OJTA 2I1VB 5GMOA 1EK0A 4F3YA 2DY0A 1VPEA 2IC5A 4C3VA 3P2YA 4ZT2A 2BEVA 4I6EA 4F1JA 3M3PA 5KNBD 1HNXB 2ETXA 4OJMX 3JARB 1LPMA 3W0LB 1MNAA 4YVFA 2YN2A 1II0A 3H0KA 4TTVA 2NAFA 5JECA 4YV1A 1CS0B 3PNMA 3ZHBA 2P7IA 3OP1A 1IM8A 4I1OA 1GFSA 2UYGA 2ZULA 3H4TA 3TUIC 2OR3A 1JJ7A 1OBFO 1KORA 3CKKA 1WF3A 5A6VA 5KMGB 2HMTA 3PDIB 4QEZA 5HM8A 5DH9A 1FLAA 3L92A 1HFEL 4KO1S 2AMLA 3B6JA 1Z6XA 4KWTA 1PLLA 1THTA 5A62A 3DJFA 4XPZA 5BYKA 2PMWB 1LFDB 3QUBA 4NHEA 4A0FA 2IU6A 3SVZA 4FTWA 4BS9A 1JA9A 1EEHA 2VA8A 4RHUA 2NV0A 1HYEA 2JBHA 2LZ0A 1EM8B 2OZLB 4M7PA 4QX6A 1XXHA 4BIIA 1KA9H 3OX4A 4JI4B 4WN3A 4F7DA 4KNYA 3IESA 1W59A 3WLEA 2OQ2A 3V9PA 5CJJA 3UJDA 4U5QA 1VIVA 2NZVG 3GRYA 3OF5A 5DWVA 1CJSA 2GXQA 3GNQA 1M2JA 1WOMA 1MQ9A 1HZJA 4PFQA 1I2DA 3FYCA 3WS7A 1QLJA 1HL7A 1SHZA 1U8AA 1JPUA 3HDVA 4B4DA 3QBJA 4G26A 3WXMA 5G0VA 3O03A 1NUAA 2ZIFA 3BQNB 4RDXA 4H3HB 3LPCA 4Q9LA 5LD2C 1H1LA 1XQVA 2O20A 2VWPA 3CUYA 3OKFA 1MJNA 4JL5A 3MWEA 5F21A 1WHSB 3PI7A 3B1WA 5FFMA 1GQSA 5I47A 3TW8B 2ZDHA 3CPSA 5H3LA 3ZBQA 1R8SA 2B69A 3D7SA 3WSVA 4BO1A 5IT9A 2I6QA 4MVXA 2Y1LA 1AKMA 5D6NA 1XALA 1BCRB 1QG4A 2BHLA 3LX6A 4MWEA 3O3CA 1IIBA 3PQEA 5JWRA 4Y2TA 1M2VB 1BXZA 1P3DA 2QRZA 3A9VA 4AZVA 3ICPA 2FF7A 5FLKA 3TZQA 1X1BA 1EGAA 3GQBB 2XWPA 3VC7A 3W1EA 5CEJA 3H2IA 1TF5A 3CGGA 1ODSA 2QTWB 3FUWA 4FUQA 4JWTA 4Z51A 3WFJA 1D1TA 3HJBA 5L3QB 3KAQA 4Y8VA 2AD5A 2HWXA 1NXVA 1ONOA 4KHZA 2BFFA 3QF4A 4KPFC 1R6VA 3RVNA 3BA6A 3SHWA 5JNLA 2JIDA 3EQ6A 3KM0A 4LY6A 4OL9A 2PJUA 3MRXA 4Q9NA 4BP1A 3TL2A 3C5EA 3UC5A 1P1BA 1TVEA 3QFHA 1DWPA 4JC8A 4PSKA 3I9OA 2Q45A 1J2JA 3ELUA 2WWFA 1RLMA 3A1CA 4IINA 1G291 4NYJQ 4UU8A 1JAZA 1IOZA 3LOQA 5B4VA 3BCHA 1NPDA 3BXOA 5JDIC 3W04A 5F5XA 1QRDA 1O0SA 1FFWA 1WR8A 2B8NA 2X14A 1OGYA 3DBHA 3EFEA 3AC0A 3B52X 4HRXA 2II6A 4BTEA 3UGJA 2BDEA 1Y5LA 1D6NA 1SU6A 4R7GA 2HMYB 4F45A 4DCTA 5AXCA 4XM2A 3ZHZA 1ZQ9A 3EAQA 3GCDA 3VOTA 3QEJA 3A58B 4RIGA 3AR9A 2VWHA 2AN9A 2ZRPA 5A04A 3REGA 2LUOA 3MB8A 4M46A 2NTYC 5L9AA 2WVGA 4P53A 2HQ1A 2FEWB 3FH0A 3TXAA 4IIVA 2GCOB 1FTSA 3FRHA 1EH5A 1P0IA 2R87A 1G8KA 2ZYHA 1E8MA 4OHZA 4OHFA 1IOVA 3ZDDA 1RADA 1FFCA 5I7OA 2IFTA 4I81A 2PT6A 2E5FA 4IFIA 4O4IF 3HCCA 1YNSA 4CTNA 1VLVA 2OFOA 2WWTA 3LWDA 4WLOA 3ZNOA 4EG3A 3UUFA 4R98A 4QLOA 3WDLA 2X8WA 2HQSA 3GEHA 4O25A 4CR8A 5JDCC 3M6MD 4PC6A 1FDOA 1Q50A 1NQTA 4IKOA 3M33A 5IC4A 3RH0A 3RKRA 3WY9A 3PL5A 1XD2B 2VCYA 3SQLA 1NULA 2DM6A 4IWXA 1JQLB 2ZGVA 1BXRA 1EDEA 1MXFA 4PCUA 4F4CA 3WK5A 2Y8EA 3NHFA 4WLFA 1Q12A 3IXQA 3LFTA 2O2XA 2CWDA 4Z2AA 2DSTA 4QU8A 4H1VA 2G4CA 4A6EA 4ENUA 3U6KA 2LCFA 5LCXA 1XMQB 2X9QA 3IT0A 1OFIA 2IXFA 2FX2A 2XUIA 2ZZKA 1WMFA 4HAVA 4I0WB 4PAQA 2NV6A 2P8JA 2P6PA 4GS5A 1FP6A 3FB4A 1WTCA 2V03A 1XQ6A 5HKAA 3Q3GE 4BWGA 4DDWA 4DLWA 3VVCA 5EIXA 3DWIA 4IIJF 1E99A 3BSWA 3I37X 5TPWB 1WLSA 5CU7A 4BKOA 5KC9A 3DOIA 2QLBA 3DNFA 3JD2A 1XFAA 2DH5A 3R5KA 1C8VB 2BM0A 4GOOD 3L0OA 1XWIA 4FIDA 5H70A 2G07A 4JLBA 4PHHA 4R2JA 1FXSA 1G6HA 3W5AA 2YFQA 1XNRB 2QU7A 3DCYA 1UC5B 1WNFA 1EB9A 4UM8B 3WNBA 2GO7A 1JLHA 4JYBA 3NUZA 3DKVA 2ECPA 2VTVA 3PXAA 1XN4A 2XLCA 4MEJA 4RGQA 1GADO 3SDSA 4A6DA 1M76A 2Y9MB 3HDQA 4YAFA 3TOZA 4I8XA 3U9TA 4E4RA 4L4UA 5TMPA 3A3OA 3M6IA 1E1KA 1AKNA 1K7XB 2R8BA 3R77A 1PLKA 4Z4IA 2Q50A 3EVFA 4N3BA 1RHQA 5DW0A 3A6GA 3ZCSA 3EODA 4KQMA 1U7PA 1WP4A 3C43A 4F5ZA 3U7QA 4ZHQB 1FQOA 2IIPA 3A1TA 3FZGA 1Z33A 4YCBA 2FMIA 1ZUIA 2IUSA 1O6BA 4XJXA 3FPEA 3SEQA 2IWRA 1Q77A 1K6IA 5IAKA 2XCIA 1AURA 4YPVA 3DZKA 5EP2A 4XI9A 4CLHA 5EHZA 1VG9B 3ETDA 4ZKDA 2WTNA 4U7DA 4Q82A 1CVLA 1DG1G 1Y8RA 1GQOA 3OTWA 3JS5A 4QUKA 4NJMB 4COOA 1DQPA 2A1UA 2Q9CA 3NANA 2P27A 2X0FA 1DFIA 4LSWA 1CWUA 4JGIA 2PS3A 2QLFA 5LQNA 2D1FA 4RX1A 3G13A 3SBEA 5LWHA 2HF7A 3IDQA 5JAPA 1G17A 5LKRA 4KFSA 3V00A 3ZOZA 1NBAA 1AZWA 5TC4A 2ATCA 1DAHA 3TO5A 3DMDA 4H2DA 5K3FB 4NH4A 3PFIA 1Y9JA 4LNUB 4YDRA 3AI2A 1KL7A 2WRZA 1C9JA 1TJPB 3W8DA 1JT9A 4UNQA 1KC3A 5TRTA 1FB5A 4PZEA 1ADBA 2DMRA 4RXMA 5TNXA 2G8NA 1BE6A 1WXFA 1YB7A 4IJ6A 3A6LA 2AG6A 3R6DA 3IE2A 4L4YA 1IVYA 4XR4A 3TUZC 1TO6A 3SAJA 3AKYA 2YFYA 1RIIA 4ZO7A 1QU3A 2V97A 3C16C 5KCZA 1PW7A 3LQFA 1S2OA 4HY3A 1NP7A 1T5DX 4QFDA 1Y4SA 1E9CA 3JZFA 2Q62A 3KJGA 2YOGA 3Q11A 4RKWA 5IBCA 1R74A 2G88A 1ADCA 3WO0A 2EHJA 5T4EA 3UXMA 1Z2DA 3S2SA 1WG8A 2QBYB 2E21A 3DHYA 2FKNA 3KCNA 3QPCA 3BB1A 3VDRA 4BBJA 4E2FA 2FU5C 5KB3A 4DNOA 3I5MA 2O1EA 3GD5A 2EEZA 4LYDA 1VZ2A 1Z7GA 1A2KC 1SKUA 1Z5PA 2HA5A 1N2CE 2E6KA 2H9IA 3CW2A 4Q4AA 4DKXA 3S8EA 3MSCA 3K4PA 4HGZA 5B7GA 1W6UA 4A0SA 4BECA 4F4UA 2BRUC 3UQZA 1TK3A 2OYSA 1OFVA 2QTFA 3I39X 4WKGA 1Y5NA 3HB9A 3KQTA 3E53A 1MIOB 3NT2A 3P52A 4OYRA 1E61A 2UDPA 4JL8A 1KJ9A 2B20A 2VHXA 2YWEA 1PP4A 3ANYB 4TRMA 3EEYA 3WGLA 3KYCA 1E1DA 1TAQA 2WF8A 3ILHA 1VL5A 4XWOA 1KPHA 4XD2A 1SBQA 2X5KO 1HKHA 1O0CA 2WZCA 3N6XA 4DUGD 2HD4A 4ZJYA 1A4RA 2OCDA 4XD7A 1RLOA 3BHMA 1VB3A 1E5QA 3FDXA 3PGLA 2SECE 1OVMA 5ULLA 3KKKA 1IZYA 4TL9A 1NPYA 3PHHA 5DJ5A 4B7ZA 5ADUS 1RWMA 3K94A 3HO8A 1GSIA 3NVDA 4CM1A 1YGYA 5T8KC 5TQ2B 3RT7A 1DPGA 2FQWA 2PANA 3G89A 4L8GA 1HLGA 1XN1A 5REQA 2RHRA 1ZXBA 3TLGA 3RVRA 3GZNB 3T52A 3LW7A 4JJZA 4W5OA 3HQ4O 2NT4A 3BREA 1UMDB 2F3TA 2O48X 2CLDX 2IOQA 1YZLA 2C4HA 3SZOA 1U0BB 2B5WA 2GZ2A 5G2OA 4QG7A 3GEMA 1HE5A 2QROA 5DX1A 3FWKA 1L4NA 3H17A 1TPZA 5JQGA 1W0JA 1MP0A 1K7EB 3OLQA 4DILA 1FUIA 4PNHA 3C3YA 4V38A 1NW5A 4C03A 4GLJA 4ENSA 3MAJA 3I09A 5BNWA 1PR5A 1YR6A 3FOFC 3NNSA 5E7JA 2C9BA 4G97A 2PM8A 4L57A 4I4TF 5KQPA 4YWHA 3R7WA 2MJLA 3LCCA 2I03A 3E0XA 4MV3A 1FSFA 5LXTA 2C7VA 2OMKA 1UAYA 3K8ZA 1WPQA 4JBYA 1E64A 1UEXC 2C3OA 3K2IA 2M6KA 1HEUA 3TLGB 4BNNA 4MRMA 4MLDA 1N7IA 2G0TA 4R9NA 4Z8YA 3KETA 2BFEA 3G8BA 3DVAB 2CNWA 4OFZA 2FUG1 3KVVA 2H5JA 5IVIA 1E9VA 4G9BA 4CT4B 1DQZA 4TX1A 2QJWA 3IVMA 4JLVA 4KO4S 4MXDA 3RVMA 1F7UA 3ZLJA 4LJAA 1ZJ6A 1O6GA 3AR8A 3I9FA 1B2RA 4G8JA 1U2GA 4NPHA 4RYLA 3HA2A 2QS9A 3I30X 3ILVA 3NIFB 1QR2A 3OKCA 2DXIA 5KPJA 1SOVA 1W96A 4MMZB 3WJ7A 3SYMA 1YH3A 4O0MA 1U0HC 4AAYA 2LWIA 5B2EA 4QJ3A 2DBQA 4RVSA 4XSVA 2Z4RA 2UZ4A 1HX7A 3BGOS 3T1VA 5MDHA 2X5JO 3EGCA 4ACBA 3FNGA 4D8YA 4QU9A 2AOTA 1UJBA 2SHKA 3TB6A 2O50A 2OFPA 1E7QA 3T3EA 5ES4B 3LCMA 4AS3A 4C4PA 1GVHA 1DBPA 1T5BA 3ZU4A 2IKQA 3TNYA 5A1TA 3KJHA 1VPVA 4GUDA 4UJ3A 4KDEA 5FV7A 2FQXA 2BELA 2GXUA 2X2OA 3F8WA 2PUFA 4PC3A 4P4NA 4LI0A 2GX6A 3RS2A 3VPFA 2J9XB 1DHRA 2V6MA 5A05A 5C0OE 1ZSVA 3M83A 1X7YA 1AK2A 1WW3A 1UC9A 2V8BA 4YMVA 4RENA 4OK5A 1GPJA 2WVHA 3R7NA 4EJFA 1X77A 3K3PA 3F8SA 1JIQA 3N2EA 4MQEB 4O4JB 4I6GA 1QG0A 2FR8A 3WNZA 1WMEA 4CODB 4UM7A 2BWJA 1A9PA 3QXSA 4QDKA 2DFVA 2IK8A 4R2LA 1DDGA 4NFHA 4AU1A 4ENVA 5I9BA 1N0IA 4WCFC 1L6IA 4G56A 4PS1A 4QDUA 1IBCA 3GZNA 1IC6A 2Q29A 3TE7A 8ABPA 2AUMA 2PA3A 3VNQA 2X4IA 4LXUA 3V80A 5FORA 4D4MA 3AU8A 3IFSA 1QE3A 4WLVA 2CLKB 3CZ5A 4DSUA 2GXAA 1HFKA 3L7OA 3R3YA 3LO8A 3L0SA 2D7JA 2GM4A 4YGXB 2WIKA 4PHCA 5FAXA 2A1IA 3S2UA 2R6GA 5IZ4A 4WZ6A 1VQ1A 1G8PA 1GLNA 4YAEA 1I10A 4WUVA 3RS5A 3HVJA 3T5MA 5KEIA 3P2KA 3KEFA 5EE0A 4NSNA 3WYDA 3UANA 2XWQA 4MAFA 2RI6A 5J9FA 1JDUA 4QUEA 2Q9AA 1N5KA 3OA2A 4G4JA 3ENKA 4UTXA 1B43A 3NTOA 1J90A 4JL6A 3GROA 2EFEB 4J1SA 5KJFA 3LQ4A 1YS6A 1I4OA 1JXMA 1T1EA 1F6DA 3FUVA 3IUJA 4EY6A 5HX7A 1QYRA 1UWLA 3FSGA 5AK6A 3RABA 2HMVA 3U3XA 2CFTA 4ZV4A 1ABEA 3KTOA 2P9BA 2HSZA 3CNLA 4BPRA 2R9VA 3K8YA 5DOZA 4AULA 4ETNA 4LVCA 4TL8A 4XQ9A 3WLQA 3K6KA 4QQNA 1KEEB 4BTVA 4F91B 1E6EA 4UM9B 3OT4A 4FVTA 3B51X 4RPKA 5JCJA 4DG8A 3OJXA 3IUYA 3VZCA 1IMJA 4ARBA 2Q1TA 3GJ0A 1QIKA 3QXGA 5JR3A 2BKEA 4BJHB 3DDHA 4LXYA 3THWA 5C8YB 3ANLA 2O5EA 1Z3CA 4MCJA 4UMFA 2C4MA 3UJ3X 1TM1E 5HKBA 4EPTA 1Y42X 3CLSD 4EG4A 2P4HX 2XB8A 3CXUA 2ZJBA 4HBZA 1RVDA 5EL0A 5BW6B 2B36A 3JASA 3WAGA 3LQYA 4BMXA 2EHDA 5MGNA 4JA2A 4MW6A 4U2KA 2JGMA 3HYRA 4B2LA 1P0QA 3JQCA 4HADA 4F72A 5KNDH 4ZYYA 1IBMB 3T7DA 3E3MA 1PUXA 1ZGCA 3MQ2A 4HQ0A 2EJVA 4IHAA 4KYIB 4PCLA 4PR3A 1DWQA 3USES 4X90A 3K35A 4HZUB 1NQOA 4KCGA 1S9HA 1TX4B 3OVMA 1C1XA 4DPMA 4EG7A 2XMSA 3D81A 2GASA 2VWQA 3VU8A 3ESZA 4EHKA 3IXMA 3EDCA 3G79A 4FFDA 3L07A 4D0RA 4J1NA 5EZ6B 4RO0A 3OZIA 1ESEA 1BMFD 3HZRA 4QAQA 4DC1A 4QBTA 4YJ3A 5TF4A 2A5DA 4D8UA 3HJTA 1QS0A 4DJ5X 1QZZA 3ZY5A 1VDZA 1KAGA 1QAOA 1QFSA 4MR7B 2HFJA 5JAMA 1CUUA 3NHWA 4ZEVA 1WL8A 1KMHB 1R9NA 2WWIA 2XVXA 1GGEA 1XDWA 4Q7KA 4B7CA 2B9EA 1GZ6A 1EXVA 2G76A 1QLHA 2OZEA 3ENWA 3GEBA 3GV0A 1DOZA 3SC6A 2AZMA 3ZDQA 1XOIA 2XIQA 3QLJA 4NE9A 2DCUA 1JFFB 1KJQA 1V9LA 3H0EA 1KK0A 3JZDA 4J16A 3STYA 3NDJA 3OUTA 1R3UA 2FFAA 1Y1SA 3BB3A 4BKPA 2JLUA 1QYVA 3K2BA 1KAQA 2SKCA 3UKJA 1TGYA 3WE7A 1N9GA 2CXNA 4H60A 3G82C 4RMGA 1WE2A 1KYTA 1OT3A 1ZINA 1JLRA 4KXXA 1WMSA 2JAXA 3KKMA 1JQDA 1CERA 4GPZA 3BOSA 1AQIA 4XSGA 1PZFA 2J0QA 2FJUA 4AJNA 4XSHA 5ICFA 1ULSA 5DDIP 1H9CA 2DPMA 3L40A 4B8WA 1Q22A 2PCJA 3FNBA 1G3QA 4MRVA 5DK6A 1C80A 4CW7A 2IH2A 4ZOLF 5G4LA 3R5TA 1YR8A 3NC4A 2CXTA 1X0XA 2ASVA 4EKNB 3ICWA 1BKSB 2A4MA 4QGGA 5C8ZA 4D4HA 3V7NA 4XYMA 5CK4A 2O8VA 3IUMA 3EDMA 3BE6A 1DAGA 2V5UA 4QASA 3SHTA 3FUTA 1SKYE 1TCAA 3JQ8A 2CEKA 4ZC8A 3V3KA 4LYHA 1F38A 2ZRDA 1G9SA 4JEHA 4Y1FA 4CEHA 2BR5A 4FFRA 1V3TA 3TLJA 3IPAA 3HI4A 2F62A 4UAJA 3ZWDA 4BN0A 4EX6A 4D0LB 4EHIA 3DC7A 3ER9A 1APBA 4YBZA 4C21A 2NVUA 3N3AC 4LOHA 1L5RA 2LNDA 4ZOAA 3T1YB 2P6MA 3Q7EA 2REOA 1ESDA 5D5HA 1E0DA 3GYGA 2F1HA 2J4FA 2UVQA 4MS1B 3WBFA 3ZIDA 1M1ZA 1H8HD 1VKNA 2DUUA 2Y1CA 3D6FA 2WJ4A 2FEXA 3IKLA 4MQMA 1SD2A 2Y68A 3GJTA 4Q4LA 2AC2A 3MYYA 4HLUA 4L5JA 4IYJA 5C8DA 1P91A 4WACA 4IGAA 3RHZA 1DAFA 1Q74A 4N7RA 4R9VA 1J00A 2XYVA 4TLCA 3GPLA 1NNEA 2Z6UA 1A95A 4CJXA 5AK0A 3TR5A 2PE5A 2ORIA 1HYQA 2DWUA 1W5AA 2EKZA 1P3Y1 1VKJA 1GSAA 3FIJA 4GRIA 3L1JA 2JJYA 4Y9UA 1U3DA 1UWKA 3K72B 3ZDXB 1YCGA 4TZ0A 5IC6A 3DOOA 4LC1A 5JSFA 1I80A 3G0IA 1EJ6A 3MN1A 2OV4A 1V11A 3QVWA 1YB2A 4I46A 3UHAA 3GUHA 2ERYA 5HIKA 4L72A 1NF9A 3CSUA 5LXTB 3QPUA 2BONA 3TNJA 1OJLA 1V8PA 1YKFA 2C31A 3D6TB 4NBNA 4KPEC 2JHFA 1H2AS 3BPSA 1DKMA 1L8AA 3PNPA 1QHYA 1SCBA 1DO8A 3L93A 3ASYA 3FYSA 1ID1A 2R8RA 1JLKA 2ZR9A 2K87A 3B2NA 1Y6RA 2FPLA 1KQ3A 2WUWE 1W94A 2YJTD 2YZ7A 1OFHA 3Q85A 4GNRA 4N7MA 1KDYA 2PWZA 5JANA 4U7PB 5DHRA 3TAUA 1K5DA 3RJ5A 2X4GA 1QE5A 1P9NA 2IJGX 4JVOA 4NX2A 4Q5IA 2IEZA 4QXAA 3WIVA 2GN6A 3F9CA 3HY4A 5TB5A 1XZMA 1RQGA 5DEIA 3B6MA 2QZZA 2ZI4A 1ZVJA 2ZRCA 5HJ5A 1PV4A 3FPSA 3QZUA 1LPOA 2A5FA 2WP0A 4V24A 1IIRA 2EFHB 5G4KB 3CLTD 3EZ2A 1E2HA 3AI7A 1Z4MA 4NIMA 3ZVRA 3MVEA 1KJIA 4LMRA 4FBGA 3WGNA 3ZXSA 4ND8A 1T6XA 1U3VA 6ADHA 3VV3A 2WSLA 2B4KA 2NLOA 4OHVA 1NXXA 5FHRA 3PNOA 4BNLA 2EJBA 4NE2A 3SN6A 2FJ0A 1JNXX 1TUEA 1QOZA 1HE4A 3A3YA 2BHRA 1MG0A 5FTNA 2XBMA 1AKVA 3HN7A 2HM7A 3OZAA 1K9VF 4PVDA 2VJLA 4QTXA 3S5JA 2YWCA 2BPOA 3E5NA 2ZRAA 1A9QA 1M33A 2OHFA 3QOFA 1NJ6A 4PYNA 3QMPA 5IJ0B 1M2WA 3HDHA 1N2CB 5CFOA 5ALTA 3QIVA 2CLCX 3G6WA 4PLPA 4CT0A 4MUKA 3DEJA 1GCGA 4EY5A 2DLDA 2SBTA 4QUAA 3TQCA 5ITWA 1S2MA 4X44A 1L5FA 4DEXA 1USGA 3OZDA 4O4LA 2VNKA 1DEHA 5A3SA 1RKXA 2C5FA 3NTQA 4YMTA 1E0JA 4F12A 1TCCA 2H6EA 3F47A 4LOKA 3GRCA 4DNFA 4Q3DA 5JCZA 4UFNA 1A7JA 1FQWA 5A02A 1XNGA 3OEHD 3C6MA 3LPAA 1PX2A 3NBKA 5CLJA 4INJA 3E2MA 4IV5A 2ZSEA 5FR2A 3GW8A 3IMFA 4FR5A 3TLAA 1IFXA 3CVYA 2NU7A 5JFGA 5BVGB 4ZP1A 1E2EA 3LC2O 4RAOA 3VTKA 1D2RA 3R23A 2IZ0A 1W5EA 3KEQA 3L79A 2QUZA 3MT8A 4HAOA 1RQRA 2IXBA 4HQ6A 1JVNA 2EBHX 4RTRA 3ZDBA 3U7FB 4OXQA 3S1AA 1YDMA 2PAAA 4PG4A 1AXEA 2PLRA 3GUCA 1XZAA 2Q5LA 2QJOA 1DQSA 4XB1A 5GONB 4DIFA 2D3TA 2XRZA 1VLZA 3RU9A 1F1JA 3FKJA 3T99A 2JRLA 4CF6A 2C8JA 2D00A 2IYWA 2XRMA 3HBLA 3ZY2A 4BMPB 3FBGA 1L1QA 1V25A 4AJPA 3BC1A 1P62B 1R8QA 3HCEA 2WD7A 3KJFA 3OZGA 4GX2A 1V3QE 5DX0A 5TVGA 3V8NA 5K3OA 1O89A 3H5AA 1EE9A 1OI7A 1ZSYA 2CSUA 2X7XA 3A0RB 4HQRA 4KXWA 2GM5A 3ROGA 2R48A 2RGAA 1JIJA 3I2FA 5DT9A 5F33A 1ACJA 5EJ9A 1OIWA 2XGMA 1WDWB 2F2TA 4A0HA 1U28C 3KSBC 4LGMA 2E55A 2O2CA 3O4VA 3PVSA 3SIWA 3WWOA 3NUGA 3H8JA 1DMSA 1SUFA 4C1NA 1U90A 2WOJA 1W1WA 1G63A 2NPOA 3DDUA 1FXWF 4MGYR 2RAFA 4IQ4A 4ZJPA 4Y2GA 2V1XA 1CSEE 1GY8A 4HK4A 5CTAA 5J1TB 2G72A 2M9MA 2ZYRA 3A9TA 4QEKA 1XXHB 1DHTA 2PZGA 3IP6A 4DB4A 8MHTA 1ZN2A 1FIUA 3IIEA 3IPXA 1IHYA 2GARA 4BGDA 2XWBF 2NPIA 2ORVA 4NF2A 5HBRA 4Z1MD 4UREA 3DUWA 4L85A 3CZQA 4PPFA 2QW1A 3HR7A 5ALJA 5CD1A 2WHQA 3OIGA 1TK9A 1PSWA 2VBFA 3GDWA 3L49A 3LDHA 4M0PA 1KDZA 5JFTA 4L3VA 2YYYA 4V3BA 1OZ0A 1YIOA 2X76A 4J0HA 2ZRQA 4TTJA 4CTJA 1IK4A 4TQGA 5EXPA 1LI7A 5EJ2A 3UCXA 3BMCA 1XP5A 4IXNA 1N0WA 4ALMA 3GLTA 3C45A 3OPMA 4P8RA 5LMUB 2GF0A 1UR5A 5JVDF 4J4HA 1XMXA 1ZA1A 1Y3HA 1O97C 4UCXA 1F9EA 2YCLA 2VHEA 1T5OA 2PX2A 3ZQJA 4JKIA 1SULA 3D3WA 3FSJX 2X2FA 3PBKA 1JJIA 2JAOA 4HN9A 1ENYA 1WZIA 1JLMA 3BWYA 1NVDA 3BFXA 3HFSA 1IL0A 4MROA 1K98A 4G0MA 3GG2A 1YACA 2LV8A 4X6LA 1H5UA 4I4IA 2NUAA 4BLUA 3MYRA 5BSEA 4INOA 2RJOA 1EVKA 2GEFA 2RAVA 3UMSA 1QIMA 4XM0A 4ZFNA 3MWJA 1TTQB 2Q6KA 1CRZA 4NZPA 4QULA 1DTWA 1U5BB 3FOCA 4LZLA 4OUKX 2P3OA 1U8ZA 2X5NA 3E8XA 5HS6A 2C59A 2JH9A 3F71A 3AFIA 3KIPA 1X1DA 3P32A 3H4IA 2TMDA 2XA1A 5CDSA 2O8BA 3VO2A 3BJRA 4I55F 3WL3A 1OU0A 2OSBA 2HJSA 3I83A 2CVZA 3PUIA 3TTSA 4DDHA 5CBPA 2EKLA 1GFWA 4OEHA 3U1TA 1B4DA 1HSZA 1YS7A 2FSIA 2IIVA 2XOKD 1TO2E 3O4HA 4L4XA 4OREX 4YR9A 4ZCTA 1SR8A 3S2FA 1T2CA 1UWVA 2FE1A 1JBKA 4OOEA 4P6VF 4YRGA 2R6JA 6GPBA 4BLQA 1OH6A 4KLRA 1ZZGA 1QORA 1VCOA 2HPHA 3IAEA 5EZYB 4DCVA 1Q7TA 2QTHA 3G0DA 3FZNA 4OHKA 3GLFA 3GLGB 2OWDA 2X8BA 4WT7A 2OFFA 4KNWA 2GCOA 4IIUA 4NV3A 3S70A 4YAIA 5G0UA 3DOHA 4XJVA 3AW8A 1J07A 3EIWA 3BXFA 1K3UB 3R8XA 2JPDA 4U6NA 2QMYA 2OM2A 3G49A 3MJTA 5GOZA 3UT5A 4JYZA 4MV8A 2KE5A 4PZLA 3Q2OA 4R2WA 1Z35A 2F67A 2RAUA 3TGWA 5DNCA 1BAPA 2ZBGA 4HL6A 4TLMB 3AR5A 3OI7A 5E2BA 3UH1A 1MO3A 4UPEA 1YQGA 2P9ZA 2FDXA 2HLDA 2EZ8A 4L08A 5F98A 1TMYA 4ZPXA 1NT2A 4K9RA 1EX1A 4YYEA 4M4SA 4NBWA 5E7QA 2JFGA 4D9MA 3HCNA 1B1CA 2NGRA 5HZKA 5L6MB 3HHPA 2CHFA 3GT4A 5DFAA 1G2QA 1Q0RA 1I4WA 4XVQA 3YASA 3B89A 1OC2A 1Y1QA 1ST2A 1YRHA 1K86A 3G02A 4Y18A 3TK1A 4E07A 1IDN1 2RGNA 3BRCA 1KARA 1O95A 1QSGA 4Z2YA 5TMBA 3DFIA 3FKQA 3EC1A 3FWZA 1JYSA 2VC2B 3ASUA 4RZUA 5DM70 4XEUA 3T3GA 3M2PA 4K0RA 1X8JA 4Y1GA 3Q15C 3GJ6A 3RRMA 1VHQA 2ZYIA 2W9XA 3RVDA 3VQTA 1X74A 3UB2A 1B76A 3EVCA 4EZIA 1TVKB 3GDFA 3B7WA 2ZBVA 3RFCA 2HHCA 1NJ1A 3MWDB 5C7IO 1XCLA 2YZMA 1TM7E 2KW5A 4B40A 2JJMA 2ZBQA 4HCJA 2FH5B 3X1KA 3BSSA 2Q1SA 4YXFA 3R1IA 2H2GA 4OKNA 2CL0X 1FFXA 3D0OA 3D2CA 1DINA 1ZITA 1AQLA 2VP2A 3KKLA 4W5HA 2HTEA 3D5QA 1H0KA 1UAGA 4D0GA 1C8LA 1RKUA 4Y0NA 2A92A 3CEPB 1EBFA 1Y1LA 2J3EA 4IOMA 4B7XA 4K7JA 1Q0LA 3COYA 3JASB 4OIFA 4NBVA 2RI1A 3O0TA 2FZ4A 1ZNYA 4NK4A 3WLHA 4Q6WA 1U98A 1LTQA 2BEWA 1OLSA 1L3CA 2HBRA 2QTVA 4KXUA 3SJ7A 1T4GA 3L7JA 3ROZA 2CBXA 1U02A 3CX3A 1M34B 2RHDA 1ATZA 2HNAA 1W0KA 4ZQBA 5FLXA 2VSNA 4MRRA 4DMCA 4TPKA 2VYVA 4FBMA 4PLYA 2C4UA 5F4BA 3KQLA 2OZLA 4G67A 1XC7A 4Y7CA 3V6MA 2AT1A 1BQ3A 3CCFA 3HCBA 5A4JA 1DBSA 2CHEA 4DSZA 1NWHA 3SS9X 3UF0A 3IMEA 3AF0A 4C7OA 2VJYA 1UMKA 2GD2A 1ELOA 2B37A 4D8VA 1B0PA 2GFIA 3T35A 3IJPA 4JX9A 4F5DA 1AS3A 3Q9UA 1KHHA 3QF7A 4HDKB 1H6BA 4TWZA 5EHGA 4AL4A 3QU9A 1RWVA 4WN9A 4DHEA 3PSHA 2ENUA 2Z2JA 1QG6A 4J0KA 2YVLA 1Z4PX 3HSSA 4BEWA 1SCUA 4UVGA 4C6TA 3HUUA 4RNDB 3D2AA 4EHJA 1I7PA 2FMHA 2VRCD 2PS9A 4IJVA 2BGJA 1MJGM 4QUDA 5E9WA 4A8HA 1TPYA 3CE9A 3I6MA 4O5AA 4AP5A 1MZVA 3LHSA 3OBBA 1E3MA 1W5SA 1IAQA 4K6KA 3V1MA 1QGAA 4WL0A 2PMFA 2HCRA 1HZZA 2H2HA 2CHGA 4QNRA 1UKEA 4X61A 4B33A 1HURA 2XOEA 1SUIA 4MQ4A 3B8HA 5FA8A 1SHTX 4K9OA 1GDHA 4PN7A 1LC0A 1WUIS 2WTAA 4NI5A 1ECBA 2C84A 4OATA 5G40A 2GAAA 4TYQA 2CDCA 1S2IA 4BV9A 4YRKA 5A1JA 4XOIA 1G5RA 1KK1A 1UPCA 1D3AA 2FZWA 1VJ0A 2D13A 2Q4RA 3DLHA 4H7FA 1GKLA 1Z8HA 3NYRA 3JYOA 1E96A 1V7ZA 1YFZA 3SF8A 4OP1A 4DWWA 3Q8KA 1WSDA 2VUUA 1F12A 1IZ0A 3E0QA 3E9ZA 1WKBA 2GEUA 4GNKA 1C4WA 4MGZR 4IJWA 5TGDA 4ZCLA 4AJHA 3ESYA 5ARCA 1KI6B 4ZV7A 3UG6A 4D4IA 4R31A 5AIAA 2ATIA 2UKDA 5FL7D 3OQOA 3MIZA 1LLUA 1AXRA 1E5TA 1RCTE 1T5IA 2RB5A 3G23A 4U9UA 5CFPA 3KU1A 2YXBA 4L8VA 2GEKA 1V48A 5EVJA 1L1EA 1RHKA 2HK6A 2XNDD 3AB8A 1RAIA 4AM8A 4BE7B 1FX1A 2VWGA 2DPLA 3DEAA 1XEWY 1QQBA 1GZ7A 3ROMA 3SQXA 1X6VA 1XPRA 3A37A 2A7QA 3C3PA 4WTOA 4ZVUA 5AVKA 3H3XA 1LB1B 1J42A 1Z17A 4FQ5A 1U1DA 3Q7IA 2IE0A 3V33A 2JJ2A 1IZ8A 1Z07A 4UUMA 5ERXA 3K70B 1A5BB 4LDJA 5EWLA 5K8LA 4JASB 4HDRA 5SZJA 2PBRA 1PUJA 1YQWA 3ZE2B 4I4TB 4Z4EA 4CCYA 1WHTA 2O8FA 3PPVA 1TYZA 3PXXA 1L4HA 4UAGA 4ND3A 3C3CA 5DN6D 2BZGA 3JPWA 4WFKA 4EKDA 1MQAA 1JSZA 1OWLA 3TTYA 5JMOA 4EI7A 2JCGA 3E5MA 2MCFA 3GIDA 1VSVA 4FQ7A 2OENG 2XTJA 4CUZA 3EISA 1UBCA 3LOPA 1CQXA 1U7ZA 2IXGA 2ZCUA 1A8SA 3OJCA 1U7WA 4ZVMA 3EPRA 2I2XB 4AZ0A 2GBFA 2G77B 4WH0A 4ZN6A 2DBZA 3DO5A 4MW9A 5ALGA 3ZGYA 1OV6A 4TXLA 5DT2A 3L4SO 3DZJA 2R6ZA 4X85A 1WLYA 2R25B 1SH7A 1JKMA 1EUYA 3NALA 1GQRA 2HYDA 2YY7A 5B3KA 3VNRA 3ZV6A 3WP0A 2WM9B 4OQQA 5AJUA 3B9RA 2LIVA 5DSXA 4KMMA 1SCKA 4XVHA 1L8XA 3T3HA 3FMFA 3NHAA 1KWGA 2BFMA 5EAIA 2PGOA 4EG1A 3E7XA 1Z4OA 4MHTA 4Y9TA 3UMRA 4XUEA 1U9JA 2Q1YA 1PFUA 1NMYA 2Z2ZA 3SYKA 3QE4A 3I6IA 4X6UA 4CIAA 2UYHA 1USVA 3RC7A 1E4EA 3SZGA 5BQOA 4IEIA 4OAQA 1JEDA 3BGDA 3JW8A 3TCNA 2W93A 5HZHA 4QLBA 4ATNA 3QHAA 4XGRA 5HFNA 1DUIA 4RLQA 5CBKA 5E4JA 1DQRA 4B9AA 1T9CA 1GYQA 2B30A 2GDJA 5CCBA 3CEAA 1CJBA 2H48A 3IQWA 3GLSA 4MW2A 1PKXA 3MPOA 4E13A 5KNBH 2LIPA 3M49A 1PL0A 1T35A 4L5YA 3S99A 2I7XA 2OCBA 4B17A 3GQVA 1G8GA 5CDFE 1FA9A 1ZK4A 5BV2P 5JZ9A 4FDUA 2WTEA 4RPIA 2EFYA 1KI2A 1RPAA 2CDRA 5JXIA 2VPWA 3A28A 1ZL0A 3LBNA 4M9UA 4QDOA 3F1KA 4A2WA 1MG5A 3ZYZA 4AZSA 2JB9A 4K6OA 4MQFA 4KIGA 5AI9A 5DI3A 2WYUA 5K0GA 5I3CA 3DUFA 2EOAA 3H5VA 4V2IA 5FPYA 3H8WA 1C50A 4LVUA 3C74A 4S1PA 3HH8A 1QZXA 3GN2A 3MINB 1PHPA 5E0KB 3E1GA 5IW8A 4F6RB 2C00A 5F52A 1QH1A 3ADOA 1CTQA 2F4VB 2IS6A 4MAAA 1P45A 2W22A 1YAJA 2WVAA 4QOSA 3Q1LA 4KO2S 2OPBA 1G8HA 1DCKA 3GJSA 3I0MA 1GRNA 4NY1A 1LQTA 4RK4A 3ZPXA 3ZK7A 1H4VB 3LUJA 3ZTTA 2JFHA 3LDUA 4WQMA 2ZJOA 5DYWA 4PAGA 4N47A 2J5XA 3WGYA 4TKVA 3B85A 1ZFNA 2RHLA 3EVAA 3LC1O 4UW9A 4F71A 4ZO9A 3RS3A 2Q27A 2I91A 5E6RB 4MTLA 1H2RS 4C4RA 3LUKA 2P9FA 3ZWBA 3COJA 3BE4A 2DLCX 2W83A 2QBYA 3VH3A 2VBCA 1Y4DE 1WU8A 1L7MA 1ECPA 1NG1A 2EP8A 2ORWA 2X0JA 2ZAIA 3KVOA 4MHSA 2AW3A 2JDIA 3R2JA 5FD8A 3OE1A 3KQUA 3BRWD 1F8YA 1P0CA 3CVVA 1MUUA 2QMQA 3EA4A 2ODWA 2X0EA 5IT0A 2B4TO 2FPPA 2P5YA 5JMWA 2GFHA 1P5ZB 5A4IS 1DBQA 4J76A 1ZAYA 3VR4D 4QARA 2OV1A 3MUOA 2FB9A 1ICIA 4K28A 1W1UA 1Y63A 1Z4QA 2R84A 3MBIA 2JFVA 4NCAA 3IL2A 1K27A 1LI4A 3DV2A 3RNOA 1BD4A 5EG5A 2RHTA 3PB3A 4RIHA 1CVIA 1V71A 1UBLS 3CPHA 3DVSX 3H1BA 2GOYA 3UBMA 2O05A 4WVLA 3BMQA 3MOGA 4BZZA 4F1WA 3PNVA 5JS6A 1NR5A 2QA5A 3IE0A 4X1IB 1K6XA 1DMRA 2HWUA 4U7JA 3BE8A 4CDRA 2H4HA 2WT4A 3ZWNA 1NF3A 3MRTA 3H6KA 1QHGA 2B92A 1IAVA 1BHJA 1X1TA 2R4UA 4IMJB 3NBZC 2OXTA 2YWBA 3G1UA 5TQVA 3W4IA 1YOBA 1YI0A 2IY8A 3BSYA 3JQAB 4X7MA 4Z54A 1U7TA 1QBGA 3HU1A 4IDGA 5HCIA 5JNTA 2A1UB 1YZ3A 3OESA 3HKCB 3WK8A 3DO8A 3HXMA 3D1JA 1CY2A 1QANA 2VXOA 4AKSA 4X66B 2BL4A 1UBNA 2H11A 2W2PA 3IKMB 1JBQA 5DP1A 3J81A 4QOEA 3MTDA 3WBJA 1G3UA 4WOJA 2YQZA 1G38A 3ZWWA 1EI9A 4JC4A 1YFKA 2HT6A 2W2LD 5BW4A 1VHDA 2GAJA 4ZEXA 1JSXA 1K0UA 2APJA 2JKZA 1F2TA 1BD3A 1CEQA 4IV0A 1U7HA 2BMAA 3FMPB 2Y1KA 4QD3A 3GA5A 4G1FA 3UEOA 2NZ2A 4EFLA 1BHQ1 1DJNA 1U0GA 2C97A 1JDNA 4LQCA 1F48A 1UJNA 3H1FA 4JJIA 4RGVA 1RR6A 5CITA 3WMXA 4RPJA 2ZUWA 3LSYA 5AI0A 4IWYA 5BSMA 3UM9A 5M5BA 1BG6A 3KDAA 1CVRA 3KZOA 4J0IA 3H05A 3PWZA 1I5EA 3W34A 3DMTC 5F3RA 4OLBA 1NJ2A 5IDWA 2RGXA 5GTDA 1CG6A 5TQ0B 3BYZA 1CLEA 4CM9A 3HXOA 5F2EA 2Q4TA 4TN5A 1I01A 3QEMB 3RG2A 1GUDA 4JXXA 3F6PA 5TXGA 3T54A 3X3HA 5ALIA 4CKBA 3T3OA 4PNPA 3AERB 1TMGE 2HXYA 1MHTA 1BXGA 1YV9A 4ETWA 3SEAA 4G0VA 3ZDRA 2ZG6A 2PJRA 3WLAA 2I33A 3VH4A 3A6FA 1E8DA 4MPPA 4Q9KA 3Q3HA 5KQLA 1FNNA 1JPVA 2HHLA 3O73A 4IIYA 4KACA 3ZW8A 1DKOA 1L5WA 3ZDFA 2C94A 1ZRHA 1GFZA 2VSXA 4YQFA 5CVTA 5FOWA 1WEHA 8GPBA 4YCAA 1OXUA 3DEHA 3HYTA 4ZRMA 3U7GA 1GL7A 2IX9A 2QLLA 3C87A 3O83A 3VZDA 4D4KA 2XGOA 3GAZA 4QPNA 1KYIA 2YWGA 4YPOA 1CZUA 1ZK0A 2K2QB 5JPCA 3JWEA 4ZYZA 1DKRA 4CGYA 4MV1A 3SDZA 4ZPJA 4ECAA 3K6SA 4DPLA 2PPVA 4NC9A 2WAMA 4GQBA 3GLGE 2QVBA 4MWSA 2DUMA 4Q4JB 5CHYA 3P26A 3LT1A 1XD2A 4DTCA 5AVSA 5LWQA 5DPMA 4H17A 3FTQA 1ISIA 2J3IA 5EFZA 2TECE 4PYQA 2XQJA 3NRBA 1IEVA 1WV0A 3JR7A 3VU3A 3ZQUA 1ZK1A 4BRSA 3BL5A 1SXHA 1B3RA 4NJOA 5I8PA 3AR4A 3QXCA 1A7KA 4P31A 3SKYA 1ZVVA 2DY1A 4H3SA 3BTSA 1NAHA 2XMBA 4AK9A 3HJNA 2Z2IA 4YIHA 2WT9A 2J9YB 1PF7E 1E8NA 4PZZA 5DXAA<