1MT3A

Crystal structure of the tricorn interacting factor selenomethionine-f1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mt3A00
3LP5A 1YR2A 2WUDA 3OURA 1UT6A 3D59A 4UHEA 5AKYA 2PU7A 4WFIA 3I1YA 2CZQA 5JALA 1UZAA 4HXEB 2WUEA 2CBGA 3HYSA 3EQ8A 4H0CA 4QLAA 5FOQA 4V2IA 5AI0A 1TRHA 3VJMA 2WQZA 5CURA 5A7GA 5C81A 3O4IA 3P2MA 3SK0A 4UHBA 5AI8A 2RI6A 2OAGA 5D3KA 1RP1A 4G8BA 3WJ2A 5C8ZA 4X6XA 1DINA 5A6VA 3BIWA 4IHAA 1LZLA 2QZPA 4INZA 3WWOA 1FFDA 1QO7A 5A71A 3G02A 3UMJA 5LYYA 2WJ6A 2ES4A 1ODCA 3AILA 3L1IA 1ETHA 4FLMA 4OSEA 3WI7A 4M0FA 5ALGA 4H7JA 2PUHA 2BJHA 4Y2XA 1DT5A 3H17A 4Z49A 2HIHA 5KWJA 4G4JA 5CT4A 5ALKA 3BDIA 4N8EA 4QE3A 3WL5A 4F21A 1IMJA 2PVSA 4BATA 4Q34A 2WILA 3AZOA 1LBSA 1W6RA 1HPLA 1K4YA 2JF0A 4HAIA 1IUNA 4DNQA 3FYUC 1C4XA 1TQHA 1E8MA 2H7XA 4LKOA 4MYDA 2X76A 5JAUA 1IZ7A 2DCMA 3I6ZA 2CEKA 3R3XA 1YAJA 3DL4A 1I6WA 2DSNA 3AJAA 1E8DA 2HU8A 3H1BA 1ZGCA 3BF8A 5JATA 2VJBA 2HHAA 3HI4A 3QPDA 3WIOA 1XQYA 3LCRA 5EGNA 3R0VA 5FUMA 2WU3A 4BBZA 3OM8A 2QXTA 3BE8A 4B84A 1BU8A 2I3DA 1FSSA 1UKBA 5CBKA 4C88A 4CFSA 3IDAA 2DQYA 2EEPA 2J4FA 1YA4A 1DQYA 1QIGA 5HFAA 1DWQA 2B9VA 1UKCA 1W76A 3IUQA 4MYSA 4B7ZA 1QIIA 4LHEA 3F96A 2FX5A 3G0CA 4HZGA 1C7IA 4BC0A 4BVKA 1YB6A 3R3UA 2HRQA 1U4NA 1L7RA 4FNGA 3AZPA 2XUGA 3C8DA 2ZJFA 3JW8A 4HRXA 5CXUA 3OPMA 2QT9A 2H9YA 4ITVA 4OPMA 4FLEA 2QJRA 1W75A 2O2HA 3KWJA 4MWTA 1GZ7A 5CRIA 1L7AA 1GPLA 5LKAA 1LPNA 1Y37A 2C7BA 4BTVA 4FNMA 3VISA 1BE0A 4CIBA 2Z5GA 1J06A 4B83A 4KAAA 1R4ZA 5HF8A 1WPXA 2W6CX 3ZLVA 3DS8A 3DKRA 5AK6A 2Z3ZA 1CQWA 3GFFA 3RLIA 4KEAA 4X90A 4EB0A 1EB8A 4QLOA 5ALHA 2QJWA 4X6UA 3BF7A 3U0VA 2HDWA 3C6BA 5AKIA 5IVIA 2QXUA 1K5PA 4N8SA 3KXPA 4DMFA 4BAZA 4FLFA 4PW0A 1UXOA 4FWBA 1XRLA 1GQRA 1YASA 1MU0A 1H2XA 5DNVA 1YS1X 1GKLA 4WDRA 2I78A 4WY5A 4ZV9A 2WUGA 5EIHA 4JH0A 4DM7A 2ECFA 3WK7A 5ESRA 2BCEA 1CUCA 3WZLA 1E3QA 1JU4A 5ALIA 3C87A 4C4XA 4U2FA 1GGVA 3QYJA 4D9JA 2CJPA 4J0CA 2B61A 3FYUB 4QA9A 1AURA 1YCDA 1YS2X 6YASA 4RPCA 3B12A 1O6FA 1HBJA 4Y2YA 3G9XA 5AM5A 4UFNA 4JNCA 1THTA 3PUIA 3I2KA 2AJBA 4TVKA 1BCRA 1THGA 3PF8A 3Q8WA 3CCCA 1ISPA 3I1IA 4LXGA 1EX9A 5EHXA 1IVYA 5K5EA 3I28A 5AK5A 1XZGA 5DNWA 2XQGA 2AJLI 4ZXFA 1CRLA 3O9MA 3R3VA 1G5FA 4Y2TA 1QE3A 3M81A 4EHBA 1BEEA 4JYMA 5ALDA 1QIHA 1MNAA 5CXXA 3D2CA 4XJVA 1BEZA 5AICA 2JGKA 1DU4A 3IBTA 2BKLA 4OB8A 1Y7IA 1F0PA 4UFOA 3WWEA 4KACA 3G0IA 3N0TA 1MTZA 3Q0TA 1EI9A 1H22A 5FPQA 2XUOA 3LIIA 4KE9A 2C58A 1EH5A 2OQIA 2WIJA 3JWEA 2QM0A 4RE6A 3KWFA 3AZQA 1WHTA 1VE7A 4DLNA 3V1LA 1YSCA 2JIDA 4G9EA 3EIOA 4EUSA 3C5WP 2CB9A 2HA4A 2Q0XA 5AK3A 1A8SA 1B6GA 2BUCA 2H7YA 3VVLA 4BE4A 5JAOA 5AM0A 5HKBA 2H1IA 3I2JA 4CCYB 3V48A 4H77A 1W52X 2XMZA 5LIPA 1AQLA 3W06A 4BE9A 3GA7A 4CG1A 4MJ3A 5K3FB 3G8YA 3YASA 5LLSA 3STTA 3WKCA 2PPLA 4BVLA 3MVEA 3WL8A 5HQ3B 2XQIA 2PSJA 3BL8A 1DT3A 5LZ4A 5E2IA 4BZZA 4DNPA 5JAHA 1CUDA 3L1JA 1WPRA 4F5ZA 1P0PA 2HL6A 4H7IA 4MQMA 5FRDA 2C4HA 1T2NA 2JEYA 4PSCA 4DSZA 4X94A 4F60A 3QMWA 1JFRA 5A62A 2OG1A 4BCDA 3O4GA 3C43A 4Y2RA 4IQ4A 4BCCA 3O95A 4K6HA 2DHCA 3D3NA 2HA3A 2GBIA 2XUPA 2XB6A 3R40A 4LXHA 2PM8A 5EI5A 5DNUA 4X85A 3HJUA 5AKXA 1FFEA 1YA8A 4BDSA 4Q3LA 5K3AA 4ZRDA 3GZJA 3H2KA 2XT0A 3OTQA 3WA7A 5LZ2A 3VJLA 1F0NA 4QNNA 2PBLA 3D4LA 3IUMA 3A2NA 3WWPA 5JANA 3WK6A 3DYIA 2PU5A 1VKHA 4X7BA 3GBSA 1CUZA 5CT9A 3W2TA 3KSRA 3VXKA 5AM3A 1RWQA 3WQHA 1MAHA 4FBLA 4BRSA 4AN1A 2B20A 1VA5A 4U2BA 1MX9A 3H2GA 2VTVA 2AJCA 4I4CA 1QIJA 4W1SA 2XUQA 5CH8A 2ACKA 3ICWA 1RYYA 3B5EA 3W9BA 1E8NA 1XZFA 5SYMA 2XMQA 5D7BA 1XLVA 1L7QA 3VDXA 4P9NA 4NZZA 4FFVA 5JASA 2GBFA 4YX9A 5C8VA 3O0DA 4L3WA 4RNCA 4HXFB 4XIIA 3D2BA 4Q3KA 3WK4A 4E46A 3FAKA 4GWLA 1MT3A 4AN0A 4G9GA 5LZ8A 2PX6A 4J0DA 2GZSA 5AIAA 5T4BA 1LNSA 4IH4A 1CIJA 1Q83A 1JMYA 3RK4A 1AC5A 1XZBA 5EHQA 3E4DA 4H7KA 1VLQA 4EZIA 4PO3X 4G4IA 5K3FA 1CUEA 2QVBA 3R3ZA 4AQDA 2QOEA 1VE6A 2WFMA 1HL7A 3EBLA 5ALWA 4DNOA 1FFCA 3DLTA 2J3DA 1G42A 1R3DA 3SX4A 5JD5A 1MPXA 3QVMA 4OU5A 1ZJ4A 4L72A 2HA7A 1R9NA 5HK8A 2PKYX 2ROQA 1J07A 4EA6A 3ZPXA 1CUGA 2XQKA 3C6YA 5LKRA 5EFZA 1UK7A 3D7RA 2BFNA 3F9CA 4AB1A 2OXEA 1XZEA 3WKAA 4WCVA 4ZV7A 2VF2A 2BAGA 2VATA 1B41A 3LIPA 2JBWA 3GUUA 3WK9A 2O7RA 3QMMA 4QEKA 1EXWA 5DLPA 1CR6A 1E66A 1ZIXA 4F0JA 4QDXA 4H7FA 4J0JA 1MNQA 3V1MA 3O4HA 2DHDA 2Y6VA 3HEAA 5FXMA 4HRYA 5K3CA 2RGUA 5AOBA 2ZVDA 3DOIA 2QS9A 4H7DA 1ORVA 3IA2A 1PV1A 2ZYRA 4X93A 3TGLA 3ANSA 4B6GA 3EQ9A 3QPAA 1SCIA 5LP1A 4PNZA 4B9EA 3BJMA 2WHPB 1MX5A 2C0PA 3D2AA 1BS9A 5HFNA 3TEJA 4BZWA 4CCYA 3UUEA 4ARAA 5CW2A 1WHSA 4KAJA 3A70A 4B80A 1QO9A 1QIEA 3QPCA 3HABA 1MAAA 1R50A 3CCBA 1VXOA 3E0XA 3WK8A 2QKYA 4Q1VA 3W9UA 1JU3A 1ACJA 1XZHA 5ALJA 1CFJA 4OU4A 3BXPA 3ESDA 1QLWA 2OQVA 1ZI6A 1GXSA 3IB3A 3WMRA 2R11A 3G7NA 1O6GA 4BDTA 1BROA 4KRYA 1JKMA 2QTBA 4AZ0A 1ZD3A 2JGFA 1H23A 2VJCA 4UBNA 4KAFA 1DX4A 1P0QA 3OG9A 4KRXA 3G0DA 2HU7A 4NVRA 4UUQA 3BIXA 2I3ZA 5AOCA 1CUAA 5AIBA 1SC9A 2XMGA 2XUKA 5JZBA 1ODSA 1UOOA 1A8UA 3I6MA 5CTAA 3HRHA 2OGZA 2CUTA 4Y2SA 3FLBA 1A8QA 1UK6A 3FWHA 1QOZA 4ZWNA 3NOXA 5AKGA 4B85A 4EY7A 2Y2VA 4BYMA 1G4HA 1HLGA 1A88A 1Z68A 1ORWA 2WUFA 5I9IA 5ISMA 3W04A 1CUSA 4UBMA 4J3JA 3DOHA 4LYEA 1CVLA 4DMHA 1QIKA 3FCXA 4J0KA 1SCQA 1AKNA 2GYWA 3CXUA 2DHEA 2HRRA 4WDQA 1IUPA 5ALSA 5LZ9A 4GHWA 1PFQA 3AIMA 1SFRA 1OILA 3G9ZA 3A2LA 1XZMA 5AOAA 4CG2A 1USWA 1LPSA 3QM1A 1ZI9A 3GROA 4MEBA 3ESBA 1M33A 5EHZA 3DDUA 5JIBA 4BB0A 2HFJA 1CUIA 1TCBA 4MEAA 2CKMA 4UBIA 4JUIA 1XROA 1E5TA 1WB6A 4X97A 2VEOA 1PJAA 5CT8A 2WKWA 1JJFA 3M82A 1TCCA 2EDAA 2GYVA 3F67A 2V98A 3FOBA 1ZI8A 4HS9A 3BJRA 3C8HA 1OCEA 2Y1KA 1TK3A 1UK8A 1XZLA 2RHWA 1JT2A 3TJMA 4J7AA 4OD0A 4HVTA 3WA6A 3G0BA 2WFLA 2VQ6A 4N5IX 1N8SA 2DFPA 4GBGA 2AXEA 2ONCA 3AINA 4H7HA 5E4TA 5SYNA 5IKXA 4QDZA 5HF6A 4ZREA 1JJBA 2G5PA 4EY6A 2FUKA 4RE5A 3ZLUA 1H2YA 3D5EA 1QIMA 5DJ5A 3WKBA 1D07A 1CUBA 1QTIA 1W1IA 4U2GA 4AMZA 2VAXA 3H0CA 1YAHA 5EIAA 2WTMA 4X95A 1XRQA 3H1AA 1XRPA 1XZCA 2JGMA 5A7FA 1QIFA 5AI6A 1YB7A 2CMFA 3H19A 4DIUA 2WG2A 1IZ8A 2GYUA 1XRRA 5ALEA 4YPVA 3FYTA 5T4HA 4KE6A 3FBWA 3WKEA 1X2EA 5JZ9A 1TAHA 4OB6A 5CH5A 4BRZA 3CN9A 3WLAA 1CUYA 4PQEA 1C7JA 1QONA 2WIKA 2IX9A 3FSGA 4LYDA 2XLBA 5HCUA 1Q84A 1LPMA 4K2AA 3R3WA 2D5LA 5FP0A 2XMRA 4AMYA 4ETWA 4K6KA 4BP9A 1KU0A 2LIPA 3S2ZA 2IIVA 3M83A 3E3AA 1NU8A 4L0CA 1U65A 2OPHA 5JYCA 2Y6UA 3WL6A 3QBJA 3STWA 2PSHA 4N5HX 2HA6A 2X8BA 3GELA 4MWSA 4JYPA 2WJ3A 2WSLA 2ZYIA 1R88A 4W9RA 4N8DA 1DWOA 1EVQA 4Q82A 4XX1A 2XE4A 1FFAA 4YASA 2ZSIA 2PL5A 5H3HA 4DNFA 1A7UA 4Y9SA 5I8PA 1AMNA 4PF1A 5AO9A 2HA0A 1LBTA 4MXDA 4X6YA 5HZGA 1XRMA 1R9MA 5AJHA 3LLCA 3NGMA 5A2GA 3FYUA 2PSEA 2HU5A 3A2MA 5ALUA 1SOMA 3X3HA 3A6ZA 3L1HA 4B81A 4I3FA 3IIIA 3VVMA 2GBGA 3DEAA 2QUBA 1AZWA 2GBCA 5DWDA 5JD6A 2PUJA 2FJPA 4PSDA 2GZRA 3V1NA 1UOPA 1EVEA 4W1RA 4OB7A 1GT6A 1CPYA 3R41A 4BAGA 1ODTC 4U2EA 5BV7A 3DJYA 4Y2PA 5ALFA 2Y2UA 2AJDA 3RARA 2R8BA 3ILSA 4QDTA 2WU4A 3WKDA 2XUHA 2WG0A 1UFOA 3FSGD 2RAUA 4B82A 4C6HA 1H2WA 2WFLB 5E4YA 5ALLA 2JGLA 4OUKX 1XQWA 2ZJ6A 1G66A 3DYVA 5ALQA 1MJ5A 2G63A 5D6OA 1LLFA 3DKKA 1BCSA 2VJAA 4BP8A 3NUZA 4UBKA 3AIOA 1AGYA 2G5TA 1EA5A 2ZYSA 1QJ4A 3I2GA 4G8DA 5ALOA 1CUWA 1EHYA 3FLAA 3PFBA 1XLUA 2XUIA 4UFPA 5DTJA 1P0MA 2J3QA 1GPNA 4DTCA 3CN7A 3S8YA 4AZ3A 4B0PA 4UPDA 4Y2VA 4FFWA 4M0MA 2O2GA 3M3DA 4QWMA 4S0XA 2Z8ZA 2V96A 1VXRA 1ZICA 4DMCA 5IVDA 1ZD2P 5FDFA 4GDMA 1TCAA 1XRNA 1DX6A 1MN6A 3IUNA 1CUHA 3PDCA 3H2HA 4OCZA 1WOMA 1WM1A 2V97A 3STVA 4FBMA 5K3EA 3QITA 2ORYA 3HXKA 3VKFA 2P8SA 1JMKC 1EB9A 4UBLA 1CV2A 5AH0A 2ZJ7A 3HC7A 1BN6A 3I2HA 2OGSA 5BWCA 2XLCA 2OCIA 5KWIA 1QIDA 1IUOA 4UHFA 4FOLA 1GQSA 3HZOA 3RM3A 5HF9A 3K2IA 4GXNA 1ZD5A 2IITA 4WFJA 2JGEA 5E4JA 1VZ2A 2XUDA 3TRDA 1K8QA 2QUAA 1E89A 4G8CA 4XVCA 4AO8A 5AKEA 3WWDA 1CUJA 5HQ3A 4QDUA 3OC0A 1DQZA 3ANTA 5AK4A 1XZAA 2OCKA 1AUOA 2D0DA 4KE7A 1HKHA 3DL7A 4PV7A 2WIDA 3T52A 1QGED 3F98A 3AIKA 5DYWA 1VA4A 4UBOA 3MUNA 2VJDA 3FVTA 4GW3A 4X91A 2V9ZA 3QZUA 1CUVA 1CQZA 3EF3A 5BOVA 4X00A 1K63A 2VAVA 3AFIA 4A5SA 3WL7A 4X71A 2Z8XA 3PUHA 3STYA 4IH1A 1U8EA 1JI3A 1UKAA 3HLKA 1N5MA 4ZGBA 5JD4A 1N1MA 3WWCA 4DYHA 4Y7DA 4J0GA 1XQXA 3ZWQA 2QRUA 4U2CA 5KREA 3VJKA 1SCKA 3H2JA 2OAEA 5ALNA 3H18A 5EIEA 1N5RA 2HFKA 4G4GA 3ZI7A 4CCWA 3PFCA 2WFZA 3C5VA 5IH7A 3HSSA 4GECA 1CUXA 4QWWA 3I6YA 3D0KA 4AO7A 2XMDA 1QFMA 4ROTA 5AI5A 3MUOA 5YASA 1UK9A 3KD2A 1JJIA 1LPAB 5C7YA 4Y2JA 4C87A 4IH9A 1XZDA 5ALXA 5BWBA 3FCYA 2NW6A 3PICA 4LXIA 3ZV7A 2G4LA 3R3YA 1ACLA 3G9TA 2VT7A 2I03A 2BGRA 5ALRA 5D3ZA 1EK2A 2OLEA 4NS4A 4MQLA 1K6EA 4Y2QA 2C5FA 4BAUA 4DMKA 1VOTA 2WJ4A 3T4UA 2EDCA 1KU6A 4KR0A 4K6GA 4EBBA 1R1DA 1NX9A 1LPBB 4J0IA 3B3QA 2C0QA 3W05A 5AM4A 2X5XA 5ALMA 5AHXA 4UBJA 2UZ0A 2HM7A 2ACEA 1EDDA 4B9AA 3O4JA 4BCBA 1U2EA 5JZSA 2WIGA 2BUAA 5T4FA 3I2FA 3C45A 2H7CA 2XMSA 4W1QA 3FNBA 1X70A 1ZIYA 4EY5A 4FMPA 5AKZA 5ALVA 1WCYA 1MO2A 1BRTA 3UUFA 3HACA 4E11A 5F4ZA 5FPPA 4CIAA 2J4CA 3H2IA 4OYLA 4DGQA 5AKHA 4HXGA 5ALPA 5CT6A 3K6KA 3AUKA 5ALZA 3JYHA 1DTEA 2WTNA 4WJLA 4E14A 1ZGBA 1TKRA 5IVHA 3MGAA 5CH3A 2WHQA 4QDOA 1AX9A 2JGJA 2YASA 1GPKA 2ZYHA 1XFDA 1FFBA 5LZ5A 1XKLA 3F97A 2K2QB 2XQJA 4LIPD 4CG3A 4J0HA 4WY8A 5DYYA 1J1IA 4FTWA 4GEGA 4RGYA 1LPOA 1XKTA 2O7VA 3WYNA 4H7EA 2W22A 1DWPA 2DQZA 2QMQA 1Q0ZA 1F8UA 1MX1A 7YASA 4KYVA 5AP9A 4ARBA 4P93A 1EINA 5AI9A 4K5QA 1HQDA 1Q0RA 5HKAA 2XUFA 5AI4A 4WFKA 3PF9A 3IVMA 2WLSA 3QMVA 5CT5A 5HF5A 1ZOIA 3E1GA 4KJXA 1WB5A 4Q3OA 2Z3WA 3KDAA 4M0EA 4BC1A 1TIBA 2XDWA 2HA5A 5JARA 3STXA 1HDEA 5CMLA 1CEXA 3EQ7A 4G5XA 5AM2A 4GI1A 1QFSA 4H18A 4A16A 4KE8A 5HK9A 3OOSA 1CLEA 1XLWA 4X3CA 2YXPX 2RHTA 1FJ2A 2RIPA 3FVRA 1W4LA 4GLBA 5AM1A 2OCLA 2ZSHA 3G0GA 4OYYA 3WIBA 3QH4A 1GKKA 1LZKA 1S8OA 4P08A 4C4YA 3DD5A 1QZ3A 1ZD4A 2PSDA 2RONA 1WB4A 4DSAA 5JAPA 1XQVA 2XMCA 5AKKA 3ESCA 1X2BA 2FJ0A 3SWWA 3C6ZA 4C4ZA 2PSFA 3NWOA 4QZVA 1LPPA 1KEZA 2WHPA 3FLEA 2AJ8A 2XQFA 4E15A 5AKLA 4AXBA 4X92A 2DR0A 2C5GA 4FHZA 3RKSA 4BVJA 2WM2A 5C8XA 2WIFA 4AO6A 5T4EA 2VSQA 4UHHA 4IO0A 4P92A 3WZMA 1EDBA 5I7UA 1CUFA 4B0OA 5K3BA 4W1PA 2OGTA 1XZJA 3ED1A 5ALTA 2VA9A 3LS2A 3I2IA 4H35A 1VJ5A 4PSUA 4I19A 3PI6A 5JADA 4ZI5A 2OCGA 1UOQA 4FKBA 2BGNA 4C01A 4JEIA 1XZIA 3SC2A 2HADA 2JEZA 4Q05A 3V1KA 3WYDA 5KBYA 5ALYA 2XMBA 4W63A 2WHRA 5FV4A 4NMWA 1OXMA 2YYSA 5DYTA 2JGIA 3BWXA 2WG1A 5IVKA 5AKJA 2HA2A 4EY8A 4J03A 5FLKA 3PE6A 5EHNA 3ICVA 2XUJA 1NU6A 1CUUA 4HTAA 5FKJA 2O2IA 1EK1A 3IURA 4A23A 1XZKA 3C6XA 1H2ZA 3IUJA 3ZLTA 3DCNA 4TPKA 2E3JA 5DTIA 1ZJ5A 2VT6A 4U2DA 3IULA 3G9UA 3WK5A 4EY4A 2YH2A 4G1FA 3C70A 3BDVA 3ESAA 4YK7A 5A7HA 2XUAA 1QTRA 1P0IA 4UHDA 4C89A 1LGYA 4FDMA 3DQZA 4AX4A 4CI9A 1Y7HA 4Y2UA 2B4KA 4O08A 5LZ7A 4XWGA 3KOOA 3O9VA 3N2ZB 3K9BA 1T4MA 1UWCA 2BUBA 1BN7A 3WJ1A 3F8SA 1J2EA 4TGLA 3U1TA 3STUA 4L9AA 1VZ3A 3H04A 5J3JA 2XI4A 3V9AA 3DNMA 2QR5A 4UHCA 5K3DA 1F6WA 4BTLA 1EDEA
chains in the Genus database with same CATH superfamily
4RK7A 3UFXA 1HEYA 4HQ0A 5CVDA 5FWYB 4CKZA 2DPGA 4W99A 4H31A 4QUKA 2YW9A 1YBHA 1B26A 4XYMA 3UPTA 4B3RB 3JQFA 4BO0A 1WV0A 2GF2A 1V9CA 3IV6A 4M8LA 3B1WA 1V3UA 2QRHA 4X1YA 2IXTA 3KVNA 5CDTA 2QQGA 3BFVA 1DAKA 3LHIA 1BAPA 1RI2A 3T1TA 3X1XA 3BJZA 2QPLA 3GZ4A 1GIAA 1NBOA 2XNKA 3FFXA 2WUEA 5MN6A 3KQMA 3MCWA 3EZLA 2IU6A 2BN4A 2FN9A 4HMQA 4HWOA 4E32A 3OKPA 3LI2A 1UJ6A 2WF8A 3HDHA 1KI4A 4H0CA 4W6ZA 3BVPA 3FG9A 1JECA 3X1KA 5L53A 3VJMA 1HA3A 1ZJ6A 2WQZA 5A7GA 4XFKA 1QS0A 1E9FA 4FGSA 3CC8A 3SMQA 5TMDA 2MJLA 2NSLA 1N6PA 3IE0A 1KOFA 3SK0A 4KLZA 1QBGA 1RXCA 2QVZX 2XJ4A 3GLTA 4M8SA 4TUYB 3ZHQA 4RTQA 2WMYA 2R7KA 5GZ1A 4C2AA 2B4RO 2EFJA 3PR1A 4OIMA 2OAQ1 1BE6A 2XTAA 4KBGA 3WP0A 4DCTA 4C0BA 3TTWA 5CA0A 4F84A 1C80A 1ZNZA 5F2OA 5I3CA 1V3QE 3KQNA 3LT1A 5D2CA 1QOPB 4LRSB 2VDVE 1QWOA 4RPHA 4HWSA 5K4HA 1W19A 3AF1A 3GT0A 5C8ZA 4Z3OA 5D3MA 1Z2EA 5A6VA 1PSZA 5M7EA 1XPRA 5B4VA 1QC5B 4QRHA 1U4OA 2QROA 1X14A 4UCWA 1VYHA 1XYGA 3V7NA 3WWOA 2QTRA 3G02A 4N39A 1O6CA 3WNVA 1XEWX 1M1ZA 3Q9NA 5LYYA 1XJWA 3E4CA 4YJGB 5KOHB 5CVUA 2ES4A 1QRDA 2YQZA 3VOBA 4D8YA 3HG7A 1WB9A 4KK3A 4DFDA 3DC7A 4JDUA 1XK6A 4UU7A 2Y0DA 2VNKA 1L7NA 2ZSUA 1GQQA 1OAOA 3G7SA 2JC3A 4OSEA 5REQA 1ZJYA 3D0RA 3WI7A 1K0UA 3THYB 2DF8A 4H7JA 2PL1A 5DXJA 2CCKA 3SF8A 1OZGA 2BJHA 3BTOA 4E5SA 4KQMA 2HIHA 5C8YB 3NHLA 1UPCA 4S0ZA 3WOHA 1WZ2A 3T3OA 2HLDA 1FQOA 4FFNA 4G5OA 3IV7A 4ZU6X 3WLQA 5DRTA 3BDIA 5KWEA 1FJXA 3O2QB 4L75A 2Q62A 2ZQZA 3MGGA 4OP1A 3F7MA 1K7EB 4NAVA 2D8MA 2Z2IA 4KP7A 3ZWKA 2NYVA 2PVSA 4YDSA 3JQQA 4UPEA 2CVQA 4YR7A 1O97D 3NHKA 4WBNA 1U1CA 1X7WB 1LBSA 4LOAA 4FGLA 1K4YA 3X1WA 8GPBA 5DULA 4HAIA 3DNFA 4QEDA 1C4XA 1TQHA 2LWIA 4XGNA 4DOMA 2AG0A 3RRNA 2BFWA 2V4UA 1SUEA 1TEHA 6GPBA 1ZCAA 5IC4A 1H42A 3DPUA 3QQPA 4JCCA 1UMCA 1IZ7A 3GUVA 4N7MA 4UZEA 3R9XB 1HORA 5F2KA 1PL8A 1Y81A 4I8DA 1T35A 4KQEA 2B0JA 3MWFA 4IILA 4MROA 4D41A 1DEHA 1GPBA 2Z5LA 3UO8B 1MP0A 3IQDB 5KKAA 3UJ3X 1NR5A 3UK1A 4J2OA 3F78A 2X0DA 4I9NA 1E8DA 1TZJA 2JAOA 3R7LA 2HU8A 3GGDA 1GGJA 4MVCA 2BJWA 2IUYA 3B89A 4R6WA 4RK5A 4YLEA 1ZGCA 3BF8A 5DM0A 1BC5A 4M53A 4AMVA 5JATA 4MAMA 3SBEA 3A6PC 4E4YA 2PUWA 4AY5A 1A9XA 4WN9A 3GT7A 3HI4A 3ZHSA 2B2CA 4BLVA 5B4UA 1TZMA 2JJ2A 5AXCA 2OBLA 3QPDA 5HFJA 1PUXA 3WIOA 1JEYB 3OKAA 1WP4A 2RHOA 3QU2A 2IS4A 3R0VA 3QXJA 2BI7A 4ZDWA 1UUFA 2XE6A 3OETA 1P1CA 4KWHA 4ZO4A 2QX9A 1SKMA 2WPNA 2EEZA 4BBZA 3ZE6A 5A4FS 1WAMA 2OFFA 2Q3LA 1C1HA 3K92A 4G07A 3UMRA 2JLSA 1SXJA 2A0WA 4EW6A 2WINI 1U8UA 3WFZA 1MIOA 4QKQA 1YA6A 4FUTA 5T3YA 3WHPA 1R0XA 4AJNA 4P3KA 1FSSA 3HEMA 3W8EA 3TEFA 2K2WA 4IUDS 5ARBA 2ZRNA 3N74A 1QQTA 2YVLA 1YFZA 2LNDA 4C88A 5JSZA 3D1LA 5C34B 4EENA 2C7VA 2AOUA 2NU8A 3BAZA 3DYBA 1W96A 1FFYA 5K8IA 2EQBA 3LLVA 2GXQA 5E7JA 1YA4A 4LOLA 4JKYA 5HFAA 2QMYA 1BWQA 3VZDA 4AQYB 1Y9DA 2EBFX 4I5GA 1PYOA 1V95A 2G77B 3CNHA 5FV4A 4V0OA 3MJEA 1UKCA 1W76A 2LTAA 4C0LA 5JQWA 3IUQA 4Q47A 3KQQA 4B7ZA 1QIIA 4AJHA 4LJRA 1J9ZA 1PWZA 1XLTA 4LHEA 4D3YA 4J3FA 1A9PA 1Q3TA 2YUIA 3IOMA 4V03A 5EPUA 4BEJA 2X58A 3OJCA 1CP2A 1FF9A 2DFTA 2ZRAA 1EYZA 3JV7A 1L5FA 3SS8A 1Y3CE 4XEUA 3EWSA 4DDTA 3WNQA 4EB6A 1QX4A 3R3UA 1RMQA 2Q1YA 1U4NA 4RPIA 5EZQA 3ZHOA 4XJSA 5KDLA 5KOIA 5KKNB 3ZGOA 3T4XA 3A58B 4RESA 1BCRB 4H08A 3F49S 2Q1UA 2ZS7A 4WK0B 4R1MA 4BNHA 2ZAMA 2OVFA 1YB5A 1MQAA 4P0TA 3AKEA 2ZJFA 3H5TA 1H0KA 3T5CA 4I5FA 1P5FA 2GCIA 1B73A 1GVHA 4ITVA 3LT2A 2Y67A 4L07A 1HYQA 3L8EA 3L7YA 3TH5A 2EX4A 4OPMA 3HUFA 1MO3A 3Q40A 2QJRA 2G40A 2B83A 4GXQA 4TSFA 2R1ZA 3D6JA 3W1EA 3U7EB 4DJFC 2JB9A 1WKVA 4M1QA 1Z5OA 3NTVA 4QBTA 1GZ7A 1K06A 1HG1A 2RHDA 1P5RA 1VIMA 3U49A 3D4PA 1L7AA 2C2OA 1CQIA 1U9IA 4C2TA 4C7OA 1LPNA 3EFEA 4OA5A 2X5NA 1LUAA 2ET6A 2C7BA 2Q8QA 1UZNA 3ZCRA 1NYTA 3MTGA 1D8AA 1SVMA 2D0OB 5KAMA 1DXYA 1G20E 1VP9A 5ERXA 1T2FA 3JQ8B 4KGDA 4LZPA 3TCKA 5HF8A 4B83A 4ZCMA 1XJ0A 4E6PA 3L7CA 3KYBA 3B6IA 3AR5A 3ABIA 4QO8A 4C07A 5DM2A 2WAYA 4IVNA 4MARA 4X8LA 1TIKA 2EZ8A 1THZA 2FZ4A 2OZLB 5AK6A 3GRPA 1UBCA 1OGYA 2W6MA 1TT5B 1YE8A 3GFFA 2VBIA 5FEMA 5CA0B 1Y8ZA 5JNUA 4KEAA 1IDOA 2J6IA 1EAMA 2MMCA 3DM5A 4MWDA 4X90A 4HSGA 4XIGS 5J2UB 2ZRLA 2CUZA 4NPAA 4S1VA 5ALHA 5JCXA 2PHZA 4X6UA 4CT5A 5CB6A 3EIQA 3PIIA 4HFMA 2P6RA 4LJ5A 4OHVA 2GK3A 2HDWA 1HDZA 4YYZA 5KC9A 2BGTA 1X7ZA 5ADUS 5TPZA 3UHAA 3O21A 3DAPA 1ZEMA 2H9AA 5PNTA 3UGTA 3KXPA 4JITA 2XAAA 3MTDA 1P74A 2X8JA 4IEEA 1SVLA 3X2SA 1UXOA 3K71B 4JP2A 1J0XO 3REQB 4R2XA 4R69A 1B0AA 1XRLA 5J43A 4YRNA 3DBRB 1MU0A 4I50F 1XU7A 1XMQB 4OAQA 3U4CA 1OV4A 4N4AA 1O94A 2LUOA 2MOKA 3DZCA 2HK9A 3LY8A 2I78A 4WDRA 2OO5A 3N7UA 3PEYA 5G0VA 2W2LA 3LOPA 4HRVA 1GM5A 1PDVA 4MB6A 3QKRA 1HYEA 2WZQA 3C3YA 2JS7A 1K4KA 2IXDA 3QKRB 4OP2A 4WKNA 2FZEA 1QV9A 4CQNA 1LDMA 3HKBA 4KO3S 1N6RA 2YINC 4YA6A 3WZLA 5FORA 2VXBA 4EK9A 4LF9B 2POQX 1P5HA 5ALIA 4PPQA 2P9HA 2Z1DA 3CONA 4WBNB 5AW5A 1IBKB 2CCGA 4C4XA 3E03A 2WHYA 1LB1B 3QYJA 4URFA 1NUQA 1Y8QB 4QATA 3HJNA 4UU0A 4UUPA 2CJPA 4J0CA 3PX7A 2GJSA 2B61A 3BSWA 4LEIA 5IEJA 2P9YA 5CFQA 1U5BB 3HRKA 1QRAA 2WA2A 2WTXA 3CUEF 3KYJB 2Y4NA 5ILOA 2X2EA 4JLWA 4AJKA 4F4DA 2O8DB 2H5EA 4CRWB 2FFQA 6YASA 4RPCA 1UKZA 1JTVA 2ZW9A 3BGSA 3U39A 1S02A 1XB2A 1M0SA 1R5NA 2BI8A 1X7DA 1HBJA 3KVYA 3VPSA 5CM9C 4CKEB 3MINA 5AM5A 3OUZA 4HL6A 5LLTA 3T1QA 5CDFA 4BRWA 4UFNA 1UXIA 5E6RB 5JBIA 3PUIA 4RSMA 3AFOA 3PCXA 1Y3FE 2XB8A 1BKDR 2GJKA 4OGKA 3NRBA 4NYJR 4Q3NA 5GQSA 4D5GA 2YOFA 2FFRA 5A4MS 1R6BX 1A9XB 2H4HA 1RZVA 3EMBA 2VPTA 4RWEA 1SWVA 4B3BA 3UMYA 4PBTA 1IBRA 2EG9A 4QUBA 4XUGB 1MEOA 4NCXA 2PYZA 1ISPA 2EC5A 3Q6MA 4LXGA 1K3TA 1SAYA 1PCXA 3S2ZA 1I10A 4LF4B 3BXOA 1N4AA 4BNDB 1VP3A 4J2TA 3AQ4A 5D85A 2I87A 2ILTA 4WLVA 3CVUA 5C5IA 1SD2A 1XZGA 4MDEA 1MZPA 3B6MA 3GN1A 4TTRA 3AWDA 5I9MA 2WW8A 1XJ5A 3EC1A 2N75A 4ZXFA 3W8RA 3AVYA 3AEQA 3SZRA 1G5FA 1UDCA 3B8EA 2F3UA 4BLSA 3OI7A 2EFEB 3BCUA 5GVRA 3L4JA 1AUPA 5ALDA 4KOEC 3TSYA 1VB5A 1ADGA 3D2CA 4KQ9A 2BMWA 1C1DA 3H3XA 2VWHA 1NXQA 5CYPA 5AICA 2ORWA 3IBTA 3OZEA 1QG6A 1XXHB 4X1IA 4F2HA 2X4GA 4OB8A 5A4KA 1X8LA 2IOQA 1OY1A 2EIXA 4UUAA 5H83A 4AQ7A 3QKSB 3BXEA 3PFGA 4H0FA 2B37A 5ILQA 2IY7A 4E30A 2F90A 1AUQA 3D3EA 1MTZA 4JXKA 1WKCA 3MCTA 2XCTB 2ONKA 1EI9A 3L8CA 3MQFA 2ZBUA 2FEXA 4HCJA 4L6CA 1IY8A 1F2DA 1PDOA 4UAGA 4ZU3A 2YV5A 3SDBA 4ETMA 2XUOA 4QOIA 2FF5A 3OH8A 1QR2A 2OQIA 1SBYA 2WIJA 3RTBA 4D8UA 1TJ3A 2XUZA 3OUTA 3ID6C 1GO2A 1SMKA 3AZQA 2C4WA 3IDFA 1MO4A 3T3DA 4FZ5A 4GUAA 3TOXA 4DAOA 3THOA 3R8XA 2GJAA 3UK2A 2JGDB 2VPZA 1IXZA 4YQFA 5KWVA 1UDWA 1YSCA 2PMBA 2J7PA 2DSTA 4EUSA 5IU6A 3B7PA 3I53A 3QWAA 2CB9A 2HA4A 2IYEA 2Q0XA 4XD7D 4V39A 1A8SA 1B6GA 4DVGA 4DC1A 1RIIA 3C6MA 3VVLA 3EAGA 2DR2A 3PCTA 3GDHA 3I83A 1LRJA 3B5IA 3OPYB 3RVKA 3E2IA 4Q00A 1G3QA 5EKXA 1OC4A 2DBYA 4OQEA 3E5RA 2H57A 4ZV4A 1FFSA 1OFIA 1NE2A 4YCBA 4BQQA 1YZTA 1UEXC 2ZROA 4XGIA 1GWNA 3LSYA 2XMZA 3ZW9A 2J59A 4C78A 1V6SA 1AQLA 1V7CA 1JDNA 4UMVA 1MDBA 3AB3A 3ENVA 1Q0PA 2J3JA 4HAYA 5G2OA 2R8XA 3UATA 3DLPX 3AEUA 5DT2A 4DA4A 2JJ8A 1E3IA 1QF9A 4CG1A 3ERCA 3E15A 3OSZA 5K3FB 3WDLA 2PQMA 3A28A 3G8YA 3L0PA 5B3JC 5LLSA 3J80A 3STTA 2P0YA 3Q5GA 1COZA 1FNNA 3Q7EA 4IYJA 3WKCA 4CR8A 5L95A 2X0KA 1JHZA 4KIUA 4BVLA 4C3UA 4V0MA 3VFDA 4YJKA 1GG9A 3RT1A 4ENPA 2DY1A 2IPMA 5DZSA 3WL8A 1CJMA 2GTHA 4CMIB 2XQIA 3OLYA 5J4KA 5ELXA 1G9XA 4KIJA 3G2NA 1JJAA 1PQYA 1UAYA 3UWOA 1WXGA 2WWGA 2JBHA 1GLGA 3G1WA 3KQWA 3Q3IA 1KARA 3COYA 4IHKA 5BNTA 1DT3A 1BG6A 1RXIA 4O2BF 1D4FA 4S1NA 5CP8A 5T5QA 5E2IA 5DISB 1RRCA 4XXHA 1VJDA 5BQXA 5E8JA 3TCNA 3V7WA 3BILA 1H1TA 3ACBA 3T1YB 3AVOA 3EZ7A 1Z82A 3IOEA 2MWMA 3DTVB 4FIZA 5JAHA 4I55F 1CR2A 2EKPA 4HYEA 5A9SA 1KQFA 1XL0A 3G2IA 3HWX1 1P0PA 2OBXA 3ZDFA 1O8BA 1TJ4A 1OC2A 3BSSA 3ND5A 1NATA 4RGVA 4MQMA 1Z2PX 1TCVA 2JGDA 5FRDA 3T0FA 3MSCA 4LBVA 4CGYA 2ZS9A 3KKKA 1VLZA 2JEYA 1COWD 3JD2A 4XJTA 1AVTA 1XTSA 2XX3A 3LC7O 2VAPA 4DSZA 1ECFA 1QUEA 1ZN2A 3PHLA 4RYLA 1RHMA 3DFKA 5EMHA 3VVBA 4C4SA 2NU7A 4MA5A 5JWHA 3BL5A 3I72A 3ZZNA 1JFRA 4F60A 4TS4A 2OG1A 2Z57A 1ZL0A 2FMHA 2ZK7A 2VP3A 1E2JA 3IXMA 2XCQA 4FDUA 4MWCA 2FQWA 3VA7A 2AWNA 3OZWA 4F4IA 3AHDA 2E5FA 3C43A 1SO8A 4IQ4A 4BNNA 4BCCA 3ADCA 1O6ZA 2ZYDA 5HXAA 1T6XA 5CD1A 3O95A 4B6JA 4OGFA 3LUHA 4MUXA 2DKFA 2Z9DA 1P91A 5IYZA 4PTZA 2YBDA 2XUPA 3NAMA 1SUSA 2O7NA 3ZGXA 3R40A 1M10A 4RX1A 3ZE8A 4GIBA 1WSAA 2VKQA 5IP5A 2WPDD 3WQSB 3VSAA 4MIKA 5DNUA 4UNRA 5TMPA 1JEQA 1J8VA 4O3MA 4EY3A 1FFEA 2BI4A 2BFDB 2LRHA 5I7AA 3M3PA 1AUVA 1WUHS 4OAPA 3VPGA 1JWLA 4DRYA 1ARZA 2HK8A 4CM4A 3D8RA 4NARA 2PV7A 3UJ8A 4A10A 2HNAA 2R1TB 3QI7A 4PWZA 1IJKA 2O06A 1TADA 3EXEA 3GZJA 4PYJA 4NX2A 3OTQA 1UL1X 3IOCA 4RQAA 5TV2A 4FK8A 4M9XA 5F7OA 4YJGA 4QNNA 4TZ6A 1FTNA 1AKWA 3PWTA 1DBPA 2WIBA 1I4WA 3A2NA 4I4TB 3PDWA 5DBIA 3WWPA 4F9TA 5BRJA 5JANA 1DIBA 4AUEA 1Q0TA 1Y8RB 1XHEA 1Y3BE 2VJOA 3GBSA 1NSTA 2I7DA 3CH4B 3NANA 3SSMA 3TLMA 1ZLYA 1JAIA 1OFUX 1RLJA 2AW5A 3KSRA 3VXKA 1SEVA 1TF2A 2HK7A 3IXQA 4IGEA 3T9EA 4CTJA 5H7XA 4D26A 4IRXA 4JDPA 3EDCA 3WQHA 2O8CA 3KQSA 3T5AA 2E4YA 1M83A 2LR0A 4GVLA 1US8A 4OKNA 2AN9A 4FDTA 5SY4A 1TF5A 4AN1A 3KKOA 1JUDA 2E37A 2UXCB 2CDCA 2M2IA 4U2BA 4YFVA 4D9IA 3TGPA 3ONDA 1I4TD 2AJCA 5FADA 5HE9A 1ZHHA 2I6SA 2HK6A 2PL9A 2Q5FA 3LHFA 4EGSA 2EL9A 4IDOA 2PKCA 5IXJA 3U3XA 1VRWA 4LXYA 1ZH0A 2EGHA 5KYGA 2HF8A 2J3HA 4NSNA 4EEZA 4KQGA 1G9SA 2VHZA 3ICWA 4JLOA 1YDEA 1UZLA 1NMYA 4FHDA 4RKFA 2CDNA 5K8TA 1RYYA 2ZWMA 5T64A 1MW8X 2ZDHA 2UYYA 3AY6A 2NX2A 3AR9A 3DPIA 3LQQA 2HMAA 2E87A 3T9BA 2G9RA 4MGIR 4KQKA 3U7RA 7ADHA 1CRPA 5KTPA 1E8NA 4J49A 1X7HA 3BJIC 4PVDA 4RXMA 4RLSA 3DE0X 4R2KA 1SGWA 5F3RA 4MJ7A 4ZOLA 4UM8B 2XMQA 2WNSA 2JH9A 3V4OA 1XDSA 2QP4A 3TDKA 1P8JA 1LWNA 1Z8HA 3COWA 5HDQA 4BOYA 3RVOA 2W0SA 5FLXA 1IWOA 3RUAA 1P3DA 2JZOA 1ECPA 4LVCA 4MRMA 4P9NA 5JDCC 1MVOA 4EABA 1IHOA 4AP9A 1G6HA 1GG2A 4FFVA 1KXJA 1XWIA 3NBUA 1OZ0A 1Y33E 4KXNA 4WY2A 1JG1A 3EHEA 4E2FA 4YX9A 3O0DA 4L3WA 4E3ZA 3G82C 2X15A 4LDAA 3AHIA 3R76A 3MT8A 2LXNA 4ON9A 3D2BA 3ROEA 4E21A 3OLVA 1WUTA 1MT0A 1ZC4A 3WK4A 5EPOA 3D02A 1XTJA 4QOJA 3C3KA 3RC3A 3PFKA 3TRFA 2C5BA 2AMLA 2VYVD 4RO0A 4JUCA 3HVKA 4BRUA 3L0OA 3JQBC 3PDIB 1SPBS 1U5AA 1C8LA 5C1BA 3B2EA 3K0EA 3TECE 1KZYC 3CW8X 4EDFA 1Q7EA 2QRMA 3C1AA 4GSYA 4CNBA 3DMNA 3RFFA 1A7KA 2BFEB 5LZ8A 4E70A 1AZLA 4M54A 1Z4LA 2GZSA 1PGPA 3CURA 4R8LA 3JQBA 2GAOA 2D59A 2JCVA 4IH4A 3MMPA 5SZKB 1COWA 3QWHA 2EF1A 1JMYA 1SD5A 5IANA 1UJ4A 3I6BA 1E9BA 4IJMA 5HCIA 3UMFA 2JLAA 2XCLA 3K7EA 1SEPA 2JFPA 2AD5A 2DPXA 4QVKA 1FDUA 4C0KA 4J8PA 3QWFA 3E4DA 3P2EA 1EWRA 3M4YA 4KYIB 3W6OA 4F8EA 4I46A 2JLWA 2W2XA 3G2HA 1SRQA 1TL7C 3NYQA 4H7KA 4IGIA 4N0EA 4V3CA 3VC7A 1N0UA 2NO1A 2A14A 2E2WA 4EZIA 3OZFA 1NT4A 2ZYWX 3GN2A 3KVRA 2O1EA 4MNTA 4PO3X 4RMHA 3ENQA 5K3FA 1LQUA 4FBGA 3DP9A 5FOWA 3AJ8A 4FDLA 2AG6A 4DVJA 4ME6A 4JC5A 1U0GA 1A71A 2GPYA 1IN1A 4YV7A 2MYNA 5KEIA 1FFCA 4BUZA 2O3RA 1OTXA 3O4RA 2OD7A 2TSYB 3DBLA 5DLDA 4D0SA 2B7LA 1CULC 4LRUA 5JD5A 2RGNC 4O4HB 3EW7A 4CI0B 2E4XA 3N3AC 4M7WA 2I6FA 1MO5A 3B2NA 1I2ZA 4L72A 4IG4A 5B36A 1HRKA 1A9SA 1TVCA 4QIHA 1L4NA 1J07A 1N3IA 1RHQA 2AV6A 2KMLA 1CUGA 2IYOA 2ROQA 1SVOA 3H86A 3PRHA 2PZBA 4B6FA 3P19A 1YQUA 1DAHA 1Z6TA 1OLXB 3OFNA 3PWZA 3QE2A 3EAQA 1QWSA 5K9ZA 3I73A 1K8RA 2AEEA 2EZUA 3FMPB 1VSBA 1YZVA 3GLSA 4IFIA 4TV9B 2ZB3A 1J49A 3S5UA 5BWLA 2V6BA 4CLHA 4ZV7A 1WQ4A 4XUEA 3VR5H 4L6AA 4R40A 2IP1A 2O6LA 1L3BA 3U7IA 3VX3A 1B41A 2V6MA 3ANMA 4BVBA 4HAWA 4QFCA 4WLUA 1YNSA 3T38A 3VRHA 2H48A 3TNJA 2HXSA 1O5TA 3C39A 5DOVA 3CO5A 2AFHE 3TLBA 1EXWA 2HWYA 5DLPA 4NK4A 4EJFA 2Q29A 3B3AA 3BTUA 1R4NB 3QKSA 4KZKA 2NXCA 1PFKA 2HLDD 3C24A 1ZD1A 2A30A 1VYTA 1QHHA 3GCXA 3HEAA 4ANFA 3ZJTA 3LC1O 5EIBD 1Z63A 5LQJA 1NKSA 4N0PA 2CMDA 4HRYA 1ECLA 2RGUA 1Y4ZA 5LFAA 2JLZA 5KDDA 2P9BA 2DC1A 2JRCA 2VCHA 2DPHA 1LLUA 3NJ4A 5IKEA 3P5BA 4FQ7A 2F4VB 1EG7A 4H7DA 1KEVA 4EMTA 1QK5A 2EX0A 1B2LA 4DQLA 1HDGO 1BW9B 1X1DA 3JVVA 1L3CA 2FR0A 1XAIA 4X60A 3EQ9A 1JHVA 3OCZA 2O5CA 1GQYA 4PNZA 4MS3B 4E4RA 5HS6A 5F3WB 2OXFA 2X9VA 3CZ5A 1MX5A 3RVDA 4D81A 2X1MA 4YMSA 1GZVA 5JBNA 2OHHA 3TL3A 1RAGA 1BS9A 3FN4A 1PI3A 3TEJA 2NUTA 3F6EX 3WRXA 3W4IA 3BZBA 1Q6ZA 1TFRA 3DR5A 3NV9A 2WT8A 1BSVA 2P2YA 5ENVA 4OHRA 3RS5A 1R37A 3HVHA 4EQ6B 3UOAB 4ARAA 1LCIA 3HGTA 4O59O 1UZUA 5CW2A 3SQLA 3L04A 4YAOA 5BN4A 3I3SR 5IPFA 2AC4A 4FI3F 3W77A 1VLMA 2WHEA 3UK6A 5K6RA 2FCAA 2X7JA 1UBHS 1RCTE 5CK4A 3K53A 3VAYA 4ZYLA 1XOIA 2J0SA 1JZQA 4N03A 1YBAA 3JYOA 1TT7A 4OA8A 3UA4A 1U3CA 3CCBA 5IJ0A 1GKIA 3H0KA 2X4LA 1M2VB 2J7KA 5G4KB 3KTAA 3HN7A 3LVFO 4XH9B 2CXOA 1AMUA 4AMGA 4KBFA 1CDEA 1MVLA 3K9LA 1E1LA 4YO8A 2CXTA 4JBGA 3ZGZA 1MZVA 3W2IA 2Y76A 1ABFA 1I9GA 1MENA 1Z08A 3DHEA 2G28A 4RMIA 3G2PA 3UM9A 4F3KA 2WD8A 2Y68A 3KT8A 3VSDA 4NZYA 4N5DA 4AAYA 3DZDA 5EIWA 1AN9A 1YVRA 2X0IA 2GTPA 1RFLA 1DTWB 1MH1A 5AW6A 3L8ZA 4F8JA 5IBRA 4GKAA 4IFTA 2OQVA 1E1QD 1GXSA 5I4IA 2D1QA 2O07A 3WMRA 4B3GA 6LDHA 1KKLA 3W6UA 1R2QA 3UXMA 4UEQA 3QLVA 4S12A 2Q9UA 2IXAA 4IQ8A 2I66A 2VDWA 3R6DA 3NS7A 1T3ZA 4BDTA 1F2UB 2PZEA 4QNRA 4BBJA 3WL4A 3Q7IA 1RJEA 2DLDA 3LQ2A 2HYDA 4CE6A 3T9FA 4E5VA 5IDXA 1ES9A 1DWUA 3QU4A 2JGFA 1T5SA 1PQUA 4E1AA 4CMKA 1JIVA 1LK0A 1BKSB 3HR8A 3V1YA 1T43A 4YAUA 3DCJA 5DGHA 4RJLA 1DX4A 5EOVA 4JY7A 5I7EA 4KWCA 1DGQA 4Q7EA 1OTYA 1RQXA 1RWOA 3QLUA 4UXHA 3KQUA 2X3UA 2JHPA 1XTIA 4IRMA 2C2WA 5EYPB 4ASUA 1IDN1 3CX3A 1Q22A 4GGOA 5B12A 3BIXA 2FN3A 2GFIA 5MN5A 3P2OA 2H4YA 3WMGA 4DUGA 3H9EO 1YCHA 2CLEB 4KG7A 1RKUA 3P9ZA 3I9FA 1RRVA 4ND2A 5IMSA 1NVMB 4N5NA 1SQ5A 3L1VA 4L5CA 5JZBA 3EIWA 1SUBA 2DX7A 3B20A 3FSJX 1JXQA 2PH1A 3TIFA 3TZLA 1W2WB 4GX0A 5D84A 2CUTA 2HJRA 4HDQB 1ZU5A 1L7MA 1LV8A 2JW5A 2Y27A 3FWHA 4TYMA 3TTTA 4WGFA 5AKGA 1EX1A 5I9SA 2IC5A 2QW8A 1E1YA 2QAGA 3FSRA 4UTOA 1UPXA 1KJ8A 1SCUA 1NA5A 2PBFA 4MW2A 4LYJA 5JTTA 4DJJA 3GEBA 4Q4JA 1A88A 3ZBQA 1U63A 1FTSA 3MWEA 4C1BA 2OWDA 2ZSEA 2GNOA 4K9SA 5ETJA 2P6PA 1UWKA 2CD7A 3K5IA 3A6KA 1NBHA 1TKAA 4JL6A 1KRHA 2V7VA 5F7ZA 3O31A 3GGPA 2AEMA 3TW8A 2A8YA 3EISA 4JL8A 5L45A 4MYCA 5JVDB 4PTLA 2Q0SA 2QPTA 3ES9A 4HUJA 4LJ8A 4WAUA 4CM7A 5E6RA 2NTJA 2X9NA 3OMWA 3NT5A 4FSHA 4ER0A 2LDBA 2RH4A 1SCQA 1AKNA 3B7GA 3KYIB 3KYDA 3CZ4A 2WB2A 4U7WA 4X1OA 2HEIA 2PKRA 2E6UX 2ZJYA 1CXZA 4FE7A 4I1SA 4PZUA 4TN5A 4Y0AA 4YAWA 4C7VA 4UARA 2GZ2A 2XBUA 2CXPA 3Q41A 1XUOA 4X24A 3T7IA 4BLOA 4Y1GA 2QN3A 2VZ0A 5E7QA 1IUPA 4D9HA 5F1YA 2GDZA 1EMDA 3GGSA 1RXSA 3JQFC 1SCBA 2P5YA 4LE2A 2C5SA 3QPWA 3H6GA 3DMYA 1A3CA 3HSYA 3WTBA 3AR6A 4O1HA 4WZ6A 1KGDA 1XZMA 3A4VA 1KS9A 2P6MA 2Q3CA 3IILA 3RS2A 4CG2A 2GKOA 3KYCA 2A57A 2W2OA 4LCEA 5CM2Z 5FX2A 3NTRA 5KVVA 1C3EA 1NF3A 4WEOA 3ONVA 3OTOB 1Y6FA 5EESA 2ZDGA 2BTQA 2AE2A 3GRAA 2VBFA 1AD2A 3GROA 4I2NA 3ESBA 4O4LA 5EHZA 3BRQA 5HQTA 2NTEA 2QLLA 1V9LA 2QD4A 3IHWA 1CUIA 2PWBA 3TIVA 4MEAA 1EM8A 3ZVKA 5FBVB 1TA0A 2E0IA 1Q19A 3DMGA 4OL9A 4YDQA 2CKMA 1MOQA 1SXPA 4ALKA 3T3MB 2E4AA 4YHBA 2ZE6A 1E0KA 3PVCA 2C77A 5ARCA 3IAUA 2E85A 1W85A 1U0JA 4MWBA 1XPOA 3ULKA 4NAUA 1QQ7A 4Z5XA 1LF0A 3GT4A 2DUUA 3AI2A 3FOBA 3NBZC 1JHAA 4A8JC 2ZM6B 2C3OA 3ADDA 1PSWA 3C1UA 3HYCA 2IEDA 4KRGA 5FFMA 5LDDC 3DGEC 3QHPA 2H5LA 1Y6ZA 4QJIA 3BJRA 4W7IA 4Q9JA 2JFWA 1HSZA 1LTHR 1KMMA 3QG1A 2H1LA 3TTXA 1OKKA 3IAFA 5AQEA 4MDYA 4KH0A 1EGHA 3JQAA 2E7ZA 5FL3A 5BV0A 1DAGA 2R6ZA 3I52A 3V2GA 1T8UA 1U2PA 3HB5X 1KFJB 4V3BA 4LC9A 1T0BA 2WKQA 1XZLA 3EEQA 3O92A 4JB0A 4JLDA 4U39A 3ZQKA 4BMNA 2J3IA 5K51A 3HE3A 3FTCA 3PUWA 4UQOA 5JVDF 1N2JA 4X7RA 2R5WA 1WXWA 3ILXA 5GWXA 3WA6A 4DA9A 3GLFA 3G0BA 4BN4A 3QXCA 3ET5A 3BXZA 4AECA 1K92A 2I6QA 4CPDA 4JA2A 4LYGA 5JFGA 4D0LB 4D43A 5BSEA 4R1NA 1KE2A 3V80A 5LMNB 1K08A 1JFTA 4H7HA 1VGRA 5JMWA 3HDJA 4QQNA 2XKAA 5E4TA 1EZ4A 3MS2A 2Q4DA 1STOA 3ON5A 4JJ4A 1H3EA 5L3QA 4QDZA 3CV3A 4IIXA 1F38A 3H1TA 4JB8A 4MCHA 4ID9A 4LHSA 4XWAA 1Y4DE 3U4IA 3PXUA 1GLNA 4BNIA 2YY5A 2W4QA 3AQIA 2WM9B 4KMSA 5GJVC 4EHHA 4Q6BA 3KT0A 5F7JA 1EM8B 1NVAA 2G5PA 4N7BA 4DR1B 2YWDA 1XD8A 1ZM7A 3NJ8A 5EE0A 3E70C 3M4JA 4KV9A 1EU1A 1DIAA 2YHIA 3FZQA 1QIMA 4RCYA 1FRZA 5B2ZA 1NP7A 1OT5A 3K1TA 1CUBA 3QNWA 4L0QA 4JQZA 1QTIA 2F62A 5CFZA 5LQCA 1CDOA 5CBPB 1VIAA 3RBXA 5BY2A 1Z0DA 2IZ7A 4L27A 1JG6A 1XRQA 5KTNA 1GCOA 1Z22A 1VPDA 2Y1OA 4K6CA 1XRPA 4DR5B 3HTXA 3EBOA 5AI6A 1WIWA 2X40A 3ZGLA 2PBRA 3RHSA 4UQPA 5HOEA 4MQEA 3GX1A 1KDTA 1YB7A 3DKVA 2HX1A 3H19A 4PGMA 3SZGA 2UKDA 3HGQA 2QRQA 3HPRA 3B38A 1IZ8A 4J1TA 3QVVA 4RD4A 3RVNA 1U0SY 2BWJA 4OGGA 4YPVA 3IR7A 4FNOA 2QT1A 4XAQA 1SXJE 2VRCD 4YHHB 1ABEA 2OFOA 2H5JA 2G83A 1NR1A 1YU9A 5L7WA 4CMEC 3LM8A 4IDNA 1M54A 4JI0B 1Z8DA 3OPQA 4D6PA 4OUDA 2JI7A 1BXZA 3DQPA 3M9WA 4EJSA 4NCBA 1PD1A 4KGXA 5BR8B 3WDMA 2B78A 3F90A 4C3ZA 1C7JA 1D8TA 1DDOA 1DEKA 2C3UA 2VBGA 3BXFA 3FSGA 1A0OA 1T4GA 5JJCA 1V96A 3TL2A 1OREA 1GZ5A 3TLZA 4S04A 1I7SB 3JYNA 3QEJA 4WXYB 1HDYA 3IALA 2IQIA 3P0HA 4H4DA 5EVCA 4RVUA 2JFOA 5HCUA 5J4VA 1M74A 4JLUA 4ZT5A 4S05A 2G80A 3G2QA 3KR1A 1Z0SA 3EVTA 2ZUBA 4HQRA 4R1QA 3RIXA 5FP0A 4ZVPA 3AV3A 2P2SA 1O2DA 2PUGA 5L3SA 2CXQA 4CCSA 2B8WA 1YZNA 5T41A 2XMRA 1YRWA 3V7FA 4MUMA 4AMYA 4ETWA 5DNDA 5EHGA 4PHGA 5G4LA 4UJ3A 1GR1A 2FPWA 5BOSB 5JHHB 3BZWA 1SIOA 5HKOA 2KYRA 1U65A 4OHUA 3HVIA 2XF8A 4G56A 4OSOA 3QBJA 3K2EA 3T61A 5KJFA 1NG9A 2C7OA 1JPVA 3R4CA 4MINA 1VFPA 2G4CA 4OREX 4JLPA 6ABPA 1ML4A 2PSHA 1V2GA 4G0NA 1IG0A 4PR3A 4R2HA 2O54A 2ODNA 2V03A 4N5HX 3V34A 4K9PA 4RIGA 2WWHA 3DFZA 4MW6A 3RTEA 2BRUA 1WZUA 2ZYIA 3JAKB 3DOFA 4FX5A 1R88A 3AUTA 4DPLA 2EKDA 5K8CA 3VH4A 4V0RA 1W4AA 2MSWA 3I4FA 2F64A 1DWOA 1O7JA 4Q82A 1PNVA 3EIHA 4EI7A 4YALA 4F6LA 2Z5VA 2IIQA 5IK2A 2I6GA 2B5OA 2FEPA 1CB7A 3FUUA 1FFAA 3IKJA 4RF4A 4FB4A 1XZ8A 4TKLA 4A6DA 2P9EA 1Z5UA 4PF1A 5FUYA 1FYEA 1SUIA 2GM9A 5AO9A 3PGLA 5CDHA 1D0VA 1ZHOA 4Z53A 3N05A 1S5PA 5CA0F 2C4UA 4JBXA 4BPRA 2VH2A 1DKUA 3DMHA 4PLHA 4HN2A 4ZRNA 3SI7A 1IHXA 3AF5A 3LCCA 4EDHA 2VNIA 2GVZC 4X6YA 1KRXA 1TVMA 3UUGA 1U90A 5HZGA 1Y89A 3ZHVA 3GVHA 1A9OA 3F7NA 3RYHA 4DTIA 3EWAA 4YNBA 5K6TA 2X41A 5I48A 3LLCA 3QNUA 3AYZB 5A6SB 2I4OA 3HCCA 4L15A 4H1WA 2PSEA 3VUFA 3E9RA 3X3HA 5ALUA 1SOMA 2ZWPA 2Y1DA 4LC1A 3A6ZA 1K6JA 3L1HA 1XTZA 1KDVA 4PC2A 1MRSA 1YUMA 1Q5PA 2X9GA 4MV6A 2G08A 4F86A 1VKRA 2VJNA 1E6UA 1XDBA 3EYWA 5G0TA 5JEEA 3KPUA 1AKYA 4DA6A 2BM0A 4IXMA 3BCSA 3ZKWA 4NH4A 5JPDA 1G8JA 4H0NA 4KO4S 4V1CI 3N7TA 3H6HA 3BORA 2ZJ1A 1EKXA 4PZYA 421PA 1T4CB 5BQFA 2XE7A 4TS3A 2DQSA 2Z5FA 2AR9A 4HAUA 4OATA 3UENA 3HUDA 2PT6A 3S2SA 5DWDA 4NBUA 4WXRA 1PLJA 2WP8J 1GPAA 4F4JA 1OX4B 1ZW1A 2B3DA 4GLLA 1YJCA 5FUXA 3V1NA 5KSPA 2VP4A 2VTEA 2WICA 4W1RA 1DC7A 1KH2A 3LE8A 4IXTA 4XLTA 1GT6A 1CPYA 2RK4A 1K5HA 4HK4A 1LK7A 4U2EA 3M6UA 1MG5A 5H02A 4S2EA 5BV7A 3HJRA 2EHJA 3IAHA 3WGYA 1M72A 4B3TB 3HHEA 3EEYA 5B6IA 5LP6B 1NLMA 3PQEA 3M6WA 4DJTA 4DLTA 3R75A 1TJ5A 4YPFA 2CW5A 3ZK9A 5KU1A 3ONWA 1WX1A 2VAMA 1N78A 4BHTA 1Y9ZA 5FIUA 3WMEA 5JCPA 3T7DA 1ZUIA 1VC2A 1E6WA 2Q9CA 2ZU0C 4WH0A 2HMVA 2R4QA 3LMKA 1JN0A 1TDJA 3H8VA 4A26A 2MT9A 2CK3A 1G16A 1HH4A 4BEBA 2QX6A 5TT0A 3VV3A 2GGSA 1VIVA 1CU1A 2RAUA 4C6HA 5EXTA 3O3CA 1TOAA 5ALLA 2GFQA 2IHKA 2V58A 3N2YA 1G66A 1SC4A 3BWVA 3GP5A 4WCFB 4XI9A 5GONA 1EFDN 3RADC 1FU4A 5C52B 3ISJA 1MJ5A 4HQFA 1N6OA 1NZDA 2EFCB 5AVWA 1ZR4A 1RZRA 4PPGA 1AT1A 1AQIA 4HDNA 3K35A 5AJXA 1Z2DA 2Q8PA 4JT8A 3PGXA 5D6OA 3PQ2A 1ULTA 1QVAA 3KETA 5L4NA 2AOTB 1LLFA 1N0VC 4KOAA 2QQFA 2YFYA 4PS1A 2PMEA 1Y3AA 3I9NA 3AH8A 1POWA 3ZIUA 1FVOA 3H5WA 3BREA 1AXRA 1V16A 2PJDA 3AF2A 1VDMA 4MITA 2QJFA 1P7CA 5G1OA 1P2GA 3NUZA 4UBKA 2VOJA 3FCEA 3S1SA 1IFXA 2BVNA 1Y5LA 3KB6A 4I5DA 2IYRA 1F6BA 3H8WA 4FMCB 4DCJA 2C88A 2FPPA 2ZRMA 2F2TA 5EWLB 4KN9S 4CMEA 1S3FA 3LF2A 4J7XA 1ODFA 3SQMA 3F6CA 2V0CA 3NDPA 4Q16A 3T5PA 5J23A 5KNBA 3QJYA 4CL0A 1GPNA 4K6OA 5E2AA 1JV2B 2H1OA 2YCLA 3L6CA 1LU9A 3S8YA 4ZTZB 2O3JA 1Z83A 1Z35A 1BXGB 1ZMBA 2AX4A 3K8YA 2X19A 4FUQA 4B0PA 2WV9A 4BLRA 1RRGA 4DG8A 2FR8A 5KNDD 1N7HA 2VSXA 2F3SA 1TPYA 1U9CA 4MKRA 3U3JA 3GEDA 4Y2VA 1N2CA 5THQA 1K7XB 2Q1WA 5TGZA 5IRCD 4PIMA 4NEHB 4ZDIA 4ESVA 1KEPA 3KPVA 1P1HA 2JJQA 3KTFA 1Z33A 3HWRA 1GTG1 3PHHA 5D1HA 3SP1A 4B3XA 2EKLA 4V24A 4EELA 5K8LA 3AERB 2C59A 1GGNA 2GILA 3M3DA 5B2FA 4QWMA 1KOLA 4QOEA 4YQZA 4HDRA 2AC7A 4C4AA 3LECA 3V8QA 4RY0A 2Y3IA 1R0LA 5LBUA 4HMPA 2EJVA 3L93A 4S0XA 3ZCPA 3H1GA 5C51B 1XXHA 4KV7A 2F1JA 3GR6A 3RT9A 3TRKA 1YGPA 1D2EA 3GEPA 2P9JA 3T7KA 4UC0A 3R0JA 4ZVRA 3GZTB 2UV8A 2DE0X 4NMHA 2AF3C 2O3TA 4ZK2A 2HNBA 4DMCA 1M6HA 1FJHA 3GNQA 2RKBA 1RTKA 3L5OA 2C1EA 2YJ6A 4ZVTA 1TTQB 1N6NA 1H0RA 3UJ7A 4GW3A 2IEGA 2LE0A 4J07A 4RHFA 2ZIXA 3AT1A 4WT7A 5FBLB 2VT2A 1XAGA 2CJYA 2X4DA 4Z4HA 2GZMA 4HD8A 4KTVE 1RYEA 3IUNA 3PT5A 5TB5A 2IPXA 1YR9A 4PGFA 1JEAA 1ZBDA 3LAWA 4M87A 4UNPA 3RDPA 1A7AA 4Q6WA 1QAQA 3TCXB 1E5DA 3ESQA 2HY7A 2V97A 5DHSA 5FQNA 1JX6A 4FBMA 4NPHA 1C41A 1PQPA 2FPGA 3QITA 3HXKA 3FOEC 3VKFA 2P8SA 3VSEA 1CV2A 2ZB7A 2I34A 3QVWA 5AH0A 4DIEA 4CGZA 5GY7A 1XN1A 4OHOA 3O91A 4AZTA 3FR7A 2J1LA 3Q3VA 3OFJA 2OUKA 4M6WA 1LV7A 3LA8A 1CS0B 3TZEA 4FOLA 4KO1S 4LSGA 4AJOA 4CTOA 3OAAA 4ZJUA 3WQRA 3A9WA 1N3LA 1QHGA 3LV8A 3HZOA 3TQHA 2Q5CA 4LY6A 3TZCA 3WISA 1H4SA 4AKGA 5HF9A 2QBYA 4DREA 3K2IA 1EE9A 4XDGA 1JR6A 3UHPA 1MXFA 3AU8A 4UE2A 2XUDA 1VJ0A 1D0SA 3EN0A 5DNEA 5F4BA 4DCUA 1HXHA 3DJFA 2WYWA 3M1YA 4RBNA 4EM6A 3GJ8A 1Y5NA 2C7RA 3OQIA 3S2YA 3W2HA 1D03A 3NHYA 3NHSA 3B60A 3ZWNA 2OBYA 1PVDA 2NGRA 4UUMA 4MYRA 1E89A 1NVGA 1TO2E 4OAOA 2H6EA 2I9PA 1EJBA 1LBHA 3ICPA 4YP0A 4C6TA 4IPTA 4B2IA 1OI3A 1I0LA 3E7PA 3PC8C 2QMOA 1L5QA 3ZIDA 3KKMA 3Q1KA 2NTYC 5AKEA 4CM6A 4DN6A 5B7PA 4RKRA 2CNBA 4FOOA 2O8EA 5FPHA 4EHDA 1GZ4A 1S7GA 1XZAA 3TMAA 4UEWA 3Q7PA 4MJXA 3WJAA 1Y3HA 1DPGA 1D7AA 2YIMA 2OUIA 1BDHA 2Z2JA 2X0NA 2HRZA 3RIYA 3KUXA 2GDJA 3LNTA 4XGKA 4B47A 3BRCA 1XU9A 2QTGA 3KQVA 3O8NA 2GKGA 3EZYA 3JQ7B 4Q4LA 2Q7DA 3PZBA 1LI5A 1UT5A 2ZZKA 1Z6YA 5CLIA 4MR9A 3TJZA 5CA1F 5HKKD 4BXOB 5E2BA 1YHYA 1GAJA 1RYNA 3CPHA 2I4LA 2DY0A 2WDPA 2R87A 3DXZA 3I5XA 4KHZA 4UDOA 4MB2A 3FVTA 3DW1X 1KPHA 3QUQA 3RREA 1BNCA 3QZUA 1SHKA 2FEOA 4LN1A 3A26A 2WB4A 4ZVUA 1Y8CA 1Z9BA 2RIRA 3QLEA 4YLGA 5C7IO 5DM70 3TMYA 1CQZA 1P2TA 3IB6A 3EF3A 1YKGA 4IDBA 3EB9A 4Y9RA 2O5EA 3PNSA 4BQRA 2AUMA 3ZVNA 2A0YA 1KYWA 2PY6A 1K63A 4X00A 2NU8B 3ZXYA 4JI1B 2W6QA 3AFIA 1DRWA 2VF7A 3VPHA 1KOGA 4MUGA 5JS7A 2LIVA 3P26A 4KQXA 3BH7A 1AB5A 1HDCA 4UKDA 1F20A 1RTTA 3K0FB 1ISJA 3KXLA 1U8EA 3TDMA 1JI3A 2PK3A 2IYXA 1CE8B 1AA6A 5EL0A 2QN9A 1P29A 3AFNA 3EGOA 2JBAA 4LJSA 4HG2A 4ZQCB 1K8ZB 2I6XA 3FWZA 1SBQA 1E69A 1T1RA 4K3VA 2CUKA 3RJTA 1RZUA 4RVFA 4IOMA 1DJLA 1HT0A 3OZRA 3TQOA 1R10A 3E1KA 5JNRA 3BULA 5JC8A 2RSLA 4BNJA 1I30A 2OAEA 5ALNA 3NUGA 3OU2A 4WLOA 4YRQA 3U5TA 2SKDA 3WIVA 2EJBA 4GH5A 3PGJA 1N5RA 4LZAA 3TKAA 3E9YA 5BW6B 4BECA 5KSYA 1V8ZA 4DIOA 5C46F 3CT6A 2OKCA 5ELLA 1ZUWA 1PNQA 4BGEA 1XLTC 4EHIA 3FTQA 2VWPA 3NXKA 3RUHA 3A0UA 1NN3A 2IUFA 4AP5A 5IH7A 4GECA 2ONYA 5ECGC 3KK0A 4J16A 2WR8A 4XYLA 2DT5A 4QWWA 3I6YA 4WW0A 1OIWA 5JY6A 3TRHA 1DAEA 3D0KA 5FOTA 1PK9A 2RGYA 4WOJA 4AO7A 2XMDA 2I9KA 2IHYA 4ETNA 5AVVA 4WECA 4BMXA 1OAKA 1QFMA 5AI5A 4EMUA 1E0AA 3E6AA 1A2QA 5KYXB 1H4QA 4B3JA 2HT1A 2JAHA 4Z4FA 4E13A 2C03A 5YASA 2ODQA 1UK9A 3LSTA 4TLAA 1I8TA 2QYSA 3BBLA 3UWKA 4RY9A 1OFTA 4CQMA 3ZNQA 2EJWA 2NVWA 4Z7JA 1NOJA 1U81A 5G02A 4Z4IA 1ZSVA 5BWBA 3CIOA 1OPXA 4OHZA 4IY1A 1UKVY 4KUHA 2NW6A 3PICA 3S8EA 2RAFA 3ISTA 3WLSA 4R1PA 4CKCA 2G4LA 2UVPB 3GFBA 3NHWA 2F8TA 1XSEA 3R3YA 2E48A 1NW9B 4BQIA 3G9TA 1BX0A 3G5UA 4E2YA 3RVBA 1E9RA 2L0XA 2KB0A 1K88A 3MERA 3AUXA 1AMOA 2VDQB 2QRVB 1X80B 1YS7A 1QLHA 5ALRA 2W83A 2IEAA 4DPKA 2HSWA 4KPUB 5FI5A 3CVXA 2AMJA 5D3ZA 3AM5A 3IS3A 1T6ZA 3DT8A 3KOZA 4I08A 5C0OE 3A7DA 3TUJC 4D9FA 1K6EA 4EL5A 1CYEA 2XKBA 2PN1A 1P1JA 1RCFA 2W9XA 4BAUA 5LD2C 1ZK3A 3WDKA 1YU6A 3U9LA 2H1SA 1VI6A 2J0UB 1PR3A 2AI1A 5A4IS 5LQKA 2VP6A 3LF1A 3FTFA 1V0JA 3HGMA 5FO0A 1U02A 1WR8A 2VDMB 3E2PA 3T4UA 4R0MA 2IH5A 2EDCA 1GYRA 3TBKA 1E9VA 1SCUB 2KS6A 2QTLA 4IOJA 4EBBA 2I71A 5JECA 1LPBB 1KXZA 2YXBA 4I6JA 3B3QA 1YJ5A 2AYXA 4ND8A 4MZXA 5IKPA 4QELA 5IFLA 5AM4A 2RARA 4CLOA 1GNLA 3CJTA 5DHTA 5FJJA 1XVAA 2GBPA 3PUVA 3A11A 1E1RD 2FOXA 5LP6A 1YCGA 3IP5A 4MJLA 4WFQA 2Q3JA 4NCHA 2UZ0A 4U0JA 4Y30A 3WXBA 1V2HE 2O50A 4P58A 1NSFA 1XYYA 4RD1A 4OFXA 4D99A 4HZUA 1J00A 4WUTA 3SC2B 2W37A 3KBBA 4ZIRA 4MTLA 1UIMA 2ZRQA 3ECCA 1QP8A 4QPPA 2BUAA 5FPTA 4D7AA 1AHHA 2OCYC 1Y4SA 4QXAA 4R1UA 3C1TA 4CQJA 1Y1TA 3F6RA 3TXAA 3C45A 1T0PA 3TLGA 3ZWBA 1PJ3A 1L7PA 5J5CA 5LDGA 3LWBA 5HM6A 3FNBA 4EY5A 1A1VA 1G8HA 4HWPA 5KQSA 3PQ5A 1QS0B 1SQSA 2VRBA 2ZWIA 3CWZA 4GBMA 5DBFA 1KYZA 1NVFA 1ND6A 3U3KA 2Z08A 4EO7A 4UM9D 2ZJBA 1BRTA 3MJTA 2JHAA 4WPGA 3ZJYA 5F98A 4TKZA 1PUIA 1LH0A 3C3MA 2P91A 2YV1A 3ITEA 3RVQA 2W8BB 4F3NA 2IH4A 3EAFA 3JRNA 3ZXSA 4RS4A 4WXEA 5CD9A 3TW0A 3VU9A 3KLOA 3GPCA 2DFVA 3QFHA 5AXDA 1L4HA 1NUPA 3ZJ5A 3WYGA 3H2IA 5IDQA 1E4OA 1AUXA 1QV7A 4TTVA 3PQDA 2WQ7A 4ZPXA 3ABOB 2O0HA 3N2LA 5CT6A 2VFAA 3BD9A 3EFHA 1G8GA 1Z34A 3T7AA 4AYWA 5J1SB 1OFGA 5CBPA 3VPBA 1NI5A 4L0MA 1OAAA 1U3GA 2PEZA 4GC5A 3BE6A 5AJVB 5FOUA 2G71A 2PS3A 4X64B 1M0EA 5IVHA 2YYAA 4Y9DA 4F71A 2A9VA 2OO7A 2EWMA 1F8YA 2PZGA 3LW7A 2ZAYA 4QDOA 5TF4A 2Z2KA 2C97A 4IWXA 2NPFA 3RD5A 1JDUA 1FZTA 2EV9A 2ZSFA 1GPKA 4JKOA 4BE7B 3THYA 2HTEA 3GEHA 1M8FA 4L85A 4KCGA 1FFBA 4NZPA 5LZ5A 3ETHA 1U11A 1NFRA 5KNCA 1WMDA 3WWZA 2IIPA 4A8TA 4Q19A 3IKTA 1CEYA 4MVXA 3ZHUA 4BN0A 1BJTA 4LIPD 5KDOA 2HSGA 4HDOB 4LBZA 5DYYA 1EFVA 4L9RA 3MRVA 4FTWA 4YS6A 3EXG1 2FFBA 3A3OA 3D8HA 1NVXQ 1YJAA 3E5MA 3LVQE 4KN8A 4EI9A 5F23A 3BUSA 1V8BA 5E95A 3L7MA 3AERA 2VHEA 4OUDB 4QUEA 3O83A 1LPOA 2B1RA 2O7VA 3PENA 1W4BA 2W22A 4O2AF 4RGYA 2PGOA 3HFSA 5MFPA 5E4FA 2IF2A 1WJGA 4P7KA 1A9ZA 1PEYA 1SC6A 2KQUA 2DQZA 2P8JA 4FM9A 2AEJA 1V8OA 3K5HA 4DANA 4OH7A 3I64A 2ZQYA 3NVAA 1Q0ZA 3VR4D 4ARZA 3U7GA 3FKSA 3L7DA 1RAAA 5DBOA 2QIPA 1B3BA 1E98A 3U7QA 4YPOA 3RO7A 1Y1KE 4P93A 4XWYA 4HYQA 4CEHB 3FUTA 2XOEA 3E9ZA 1NVKA 3DDOA 1I1HA 2QTHA 4L1KA 5T7BA 1VJRA 5JDIC 4EB3A 2MIIA 1E1CA 2ZBDA 3L6UA 2UXBB 5KYUA 4JN6B 5KVQA 5KNCH 1VBKA 2FZVA 3GMSA 3PF9A 5JE8A 4P1ZA 2OQ2A 1TUBA 5DHRA 4Q02A 3EHDA 1IN8A 1SVWA 1XTQA 1SOWA 5HF5A 4L78A 5BR1A 5TEWA 3E1GA 3GO4A 3NUQA 2WSIA 3PRKE 2QQEA 4IL5A 1DBRA 4HQKA 1QYDA 2HJHA 4E12A 4NNJA 3TLJA 1GNSA 4G23A 4GOKA 4JBHA 5A04A 1MFZA 2YN4A 1U1IA 3AL3A 3ADKA 2PZFA 4BLTA 1E3WB 2XDWA 3JYPA 5CFPA 2JAPA 4I1IA 3MIIA 1RQLA 3PKZA 1PP4A 2HA5A 1GU0A 4D02A 4LDRA 4CM1A 1A8HA 4M0LA 2Q3HA 2X1LA 5CMLA 1CEXA 2F00A 3EQ7A 3WGVA 4G5XA 1P2FA 2QLJA 3L0SA 4US0R 3PC8A 1YB2A 4IRUB 3WB1A 5JWOA 4WOBA 5AM2A 4A6EA 2WWYA 4NR0A 2PS9A 3KZCA 4EHKA 4FCCA 3C5EA 3JS5A 5AVKA 3EA0A 2GF0A 5LB2A 1Q21A 4KITB 4QPCA 5DNYB 4P38A 4NMLA 2XOXA 4PXAA 4Z0HO 1TAUA 3H84A 1L5KA 2OK7A 2P2NA 2UZIR 1NUAA 3DV0A 1QP4A 2IOFA 2Y66A 3DO5A 4KVZA 2RIPA 4Y6SA 3BYZA 1DAMA 1KI9A 3N76A 3CRVA 2OCLA 4Q4HB 2CEAA 2QJOA 2ZSHA 3R3SA 3MT7A 4F3YA 1A4XA 2YR0A 221PA 2BFFA 2P79A 3HNOA 1S8AA 1UANA 2Q6IA 2IODA 3QH4A 1GKKA 3V7UA 3K30A 1LWOA 4P4SB 1LZKA 1E5QA 1S8OA 3GLUA 1W1WA 3DAYA 3MC1A 3ESYA 4C4YA 4OF4A 5DU2A 4WLEA 4A0RA 2PX2A 2QXYA 3GEMA 4WE3A 2ZJ4A 4JYZA 1CZRA 4HLDA 4FWTA 3OTGA 5DHUA 4TUYF 5F3DA 1TEVA 4J3NA 2RONA 4ECEA 4OJNA 2NTNA 4G01B 3W5CA 1LBEA 1LVUA 4P81A 3MQ2A 5JAPA 1T4BA 2IS1A 2EQ5A 2XDQA 3LUBA 2P4HX 4ZCSA 1G2OA 4CT4B 4ZMBA 1RLOA 3AVXA 2MSCB 2VJLA 2JFFA 2VRWA 3GUYA 3HVJA 4G5GA 1KZHA 3HM9A 5H8WA 3C7DB 4G1CA 4PNEA 1FPMA 4QZVA 4MRSA 3IOYA 4JOQA 4HEHA 5J40A 3SDZA 4JIMA 4B0OA 2D2XA 3LQ1A 3TLXA 3V8EA 1FXWA 4RABA 4EG7A 4H1UA 1Q2UA 3W6NA 4DA7A 3R74A 3IAS1 2X86A 4G97A 1KNXA 4HYTA 1QGAA 3HA7A 2F3TA 2COKA 3FLEA 3C85A 3I42A 4P5EA 4LV6A 2W43A 1N9GB 1ZU4A 1NRIA 1U3UA 5AKLA 4AXBA 2N0SA 1BYUA 3G13A 2DWUA 2IPNA 2NSYA 3FPAA 2JIZD 4FS8A 5GONF 2NNWB 3BQNB 4RVSA 4DC0A 2R84A 4FHZA 2IBSA 5EINA 2XPCA 3EOZA 4RTLA 1K0FA 1WU7A 2ZDQA 5DYIA 1W36C 2GN2A 1F9AA 3DE3X 3FYCA 4RV5A 3GRRA 4XD2A 3CF4G 3ZN2A 1GCAA 1HZJA 3SX0A 1W4CA 1XAHA 3ZVLA 5BT9A 4EVSA 3K70B 3O8OA 1Z0AA 2HPHA 3NFRA 2Y4OA 5E7MA 1M1YE 2Z4SA 2AMFA 3UT0A 4KWIA 5KYKA 1Q20A 4K9DA 4YT2A 1T2EA 1IZZA 3E27A 3WZMA 5C8YF 1CLUA 3VTAA 1Y4UA 2EW1A 3TOVA 2PAAA 5THXA 1ZAYA 2Y1EA 3GPDG 3B1KA 4KQIA 5KB3A 2ZRJA 4W1PA 2TS1A 2W2TA 4KXVA 3S2GA 3I62A 1N1DA 4QHTA 2GNPA 3VAZA 4S2UA 3ZX5A 5ALTA 4ENQA 2Y93A 4WESB 6ADHA 3A4LA 3WHLA 3UK0A 3ZH9B 3G6WA 2REXB 4PIVA 2RDMA 3I2IA 1VJ5A 4PSUA 4RK1A 3RAFC 4QX6A 2OBNA 2BR4A 2L2QA 1PKXA 4YBZA 2WEKA 1KNQA 5J2TB 4IUBS 2FEMA 5CTJA 3WYEA 4DY6A 2IVFA 1NV9A 5DEOA 1NRXA 3IKMB 4IIBA 1OI4A 3AXSA 4G63A 4J7UA 4ED9A 4UNQA 4C01A 1XTVA 4JEIA 4MAFA 4PYRA 3LOUA 1W5SA 3EVAA 3QBVA 1E2GA 4MEJA 1EP3B 1V4NA 5JHGB 5G0UA 2FQYA 3DSRA 1C30A 1XO1A 2HADA 3CB2A 3D2LA 3S0JA 2VQEB 2BBSA 3V1KA 5KBYA 4YP5A 3B1JA 4KPFC 3GLQA 3IUYA 2XE8A 3GFPA 1FY2A 3EVBA 4TMTA 2ORED 3D6FA 1J0CA 1OXMA 4YGXB 4O29A 3REQA 4WA8A 5DYTA 2PUTA 2JGIA 2P3OA 3SC3A 3UGQA 5ENZA 1VL0A 2GWHA 2H2HA 5GVSA 3KZOA 5IVKA 2G1AA 4EY8A 2BP7B 4QJBA 4ARCA 4J03A 4CTNA 1WUYA 3EXHB 1V47A 5KHLB 3Q9UA 4CM5A 3PE6A 4CZ2A 4IJQA 4KFSA 3PV0A 1IOLA 2XUJA 3ZCQA 3DMDA 4FQ5A 2HXGA 1Q74A 4UHKA 3LXXA 4NU6A 2PSSA 3AONB 1CUUA 2JIZA 4HNAA 5FKJA 2O2IA 3LDGA 2HMYB 1I2MA 3OE7A 1SUPA 4BO4A 2VDNB 4CU2A 1XZKA 4MH0R 4MLPA 3C6XA 1JVSA 3F3KA 1KZ7B 1RW4A 4Q39A 2XCRB 3PB3A 4IHJB 5D00A 1Z16A 1F9EA 4ZI2A 1SOUA 2E3JA 1XTBA 1ZJ5A 2X8WA 1LD3A 2ZPUA 4P7FA 4KXXA 4U2DA 4V0ME 1NX6A 2G09A 1W73A 1N5KA 4PN3A 1PL7A 4LY0A 5TJHA 1WQ1R 1IN5A 3ELUA 5TPZD 4KI0A 2HQBA 4EY4A 5DM1A 3ZC3A 1M2NA 2WTUA 1Y7LA 5EJEA 5IAOA 1X38A 4G1FA 3SKYA 2Q50A 3TQSA 3LL7A 3ZZTA 1AK9A 2DULA 2CHUA 1SRRA 7GPBA 3DXYA 3ESAA 3I6IA 1WPQA 3GY0A 4EO9A 5LJIA 2AOTA 1ENYA 2XUAA 2XKJE 3QTLA 1V35A 3KJXA 4K8OA 3RRBA 3GUHA 4RDIA 3L77A 1LGYA 5EAIA 1Z2OX 2QUHA 1I7DA 2PVPA 1ULSA 3ZZMA 4IJ6A 4LW8A 4YDHB 4DCGA 2AK3A 1BVUA 1NBAA 4MO9A 4CJXA 4YXWD 4HZUB 3DQZA 3BRWD 5TGTA 3OTWA 4A0GA 4GPBA 4AX4A 2AFIB 5LP6F 3A1DA 3F73A 4Y2UA 4XWTA 3ILYA 5HMLA 2IV3A 1ZA1A 1TD1A 1Z4QA 2B4KA 3RAJA 3W0LB 3OESA 1LSUA 1EX6A 1YMQA 2NUPA 2I2XB 2YFQA 3UANA 4C0AC 3IDSA 4E2XA 1WLYA 2JEOA 1RQNA 1VHTA 1SIUA 2YVQA 4NK5A 4TN1A 4XWGA 3EFOA 4ZCPA<