1MT3A

Crystal structure of the tricorn interacting factor selenomethionine-f1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
293
Chain Sequence
b'MDQECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline iminopeptidase
publication title Structures of the tricorn-interacting aminopeptidase F1 with different ligands explain its catalytic mechanism
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
total genus 99
structure length 293
sequence length 293
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2002-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1mt3A00
3DLTA 1F6WA 1THTA 5CXXA 4QDXA 3BDIA 1NU6A 4PQEA 1VXOA 4TPKA 3I6MA 3D7RA 2GYUA 1H2XA 2QM0A 2XUAA 1UK8A 2WM2A 1USWA 1XROA 3WJ1A 3WA7A 2ACEA 4BAZA 4OB8A 4Q05A 2VATA 4FLMA 2HA2A 2H7CA 3WA6A 3V1NA 3OM8A 1DX6A 3G0CA 3P2MA 4OU5A 4BBZA 3ICWA 5T4BA 1A8QA 5LYYA 1CPYA 3L1JA 3DD5A 2DFPA 2OCLA 5HQ3B 1EDBA 5AI6A 5DWDA 5FDFA 1CUVA 2GBCA 1DINA 5AK4A 5KBYA 3AZPA 3R41A 3C43A 3NUZA 2OG1A 1JI3A 2B61A 3V1KA 3C70A 4XVCA 3GROA 4BCDA 3WWCA 2VAVA 1ZD4A 1XFDA 4H7HA 3C8DA 4H35A 4X00A 4X90A 4F60A 4OCZA 1EVQA 4X3CA 1K5PA 4FHZA 3C6XA 4QE3A 5CXUA 4DIUA 3VISA 1YB7A 3EIOA 3RM3A 4A16A 3WKEA 4GDMA 4N8DA 1XZBA 1U8EA 2HA7A 4PV7A 1EHYA 1CUZA 2ZJ7A 4LHEA 2XMQA 4UBNA 4Y2VA 3N2ZB 1X2BA 2I3DA 1PV1A 5ALDA 4K6HA 5AOAA 5EHQA 4U2CA 1H23A 5E2IA 5E4YA 1XZIA 3FVTA 2PX6A 3BJRA 3GUUA 2RONA 4WDRA 4ZRDA 3FCYA 5AM1A 2O2HA 1HQDA 3PF9A 1LZKA 5J3JA 4DMFA 4J0IA 3NOXA 1DT3A 2V98A 1WB5A 3L1HA 2BJHA 1U2EA 4MYSA 2WHQA 3MGAA 4UHBA 4FBLA 2V9ZA 2WUGA 2QJWA 2XUGA 2O7RA 3VJKA 1LNSA 1RP1A 4NZZA 3H18A 3KD2A 4FOLA 2OQIA 3PFBA 3AIOA 2AXEA 4WFKA 1ACJA 1ZIXA 1ZJ5A 1YA4A 1XZDA 2HA6A 2O7VA 1Q0RA 4JYPA 1UXOA 2JGFA 3K2IA 5LZ2A 4DNOA 3V1MA 5ISMA 1F0NA 2I78A 5JAHA 2X5XA 1DQZA 4B9EA 2GBIA 4PO3X 4JH0A 4JNCA 4OU4A 1QE3A 1XZJA 5AKEA 1THGA 5AI0A 2GBGA 3UMJA 2RIPA 5ALKA 3RARA 2XUOA 5AM4A 1XLUA 5FRDA 1XRMA 1ZI6A 4J0HA 2WIJA 3QPCA 1SOMA 1UOOA 2QZPA 4RGYA 3BJMA 2XMCA 5ALLA 4DTCA 5FV4A 2WIKA 1ZI9A 1CUUA 1W52X 1IMJA 3QH4A 3MUNA 1OCEA 3A2MA 1CUBA 3DEAA 3H1BA 4CFSA 4C01A 2E3JA 4Y2XA 5A2GA 5ALOA 1MT3A 1JT2A 2FUKA 5CT4A 1N1MA 5FPQA 2Q0XA 3G0GA 2FJPA 2VAXA 3KWJA 3FLBA 3DKKA 2HA5A 2ZYSA 4H7FA 1G66A 2PKYX 1T4MA 5AKLA 1QTRA 3RK4A 1CRLA 4TGLA 5AOCA 2DSNA 3BL8A 3R3ZA 4U2GA 4WFIA 4IH1A 5JD4A 3STVA 3I2IA 1AURA 1Q0ZA 2G5TA 1LPAB 1VZ2A 3HABA 4W1PA 4F5ZA 4Y2JA 1UKAA 1E3QA 2V97A 2GZRA 5ALPA 5AKYA 1EVEA 4EHBA 4Y2TA 5A7FA 2DQZA 1AKNA 4X6XA 4Q3OA 5E4TA 2ROQA 3D4LA 3E4DA 1E89A 2YXPX 1WPRA 2AJ8A 5DNUA 1IUPA 4B6GA 1WHSA 2G5PA 3ANTA 5AKJA 2G4LA 5ALNA 3FCXA 3R3WA 3M81A 3WK7A 4PSDA 5C7YA 2H9YA 2HA3A 3QYJA 4PW0A 1R50A 2Y6VA 3FLEA 1NU8A 5FUMA 3D5EA 1XZFA 4UBLA 4BC0A 4BRSA 4MQMA 3I2JA 5FOQA 4BAUA 1EDEA 1GZ7A 2PSHA 3IA2A 2WU3A 5AM5A 1EDDA 4EB0A 3SWWA 4UFOA 5JIBA 5I9IA 1YS2X 4K2AA 1U4NA 5HF5A 1YAHA 4QZVA 2ZJFA 4YK7A 4C89A 1ISPA 1BCSA 2DCMA 1J2EA 3OURA 5LLSA 2AJBA 1ZD2P 3HYSA 3H17A 3H2JA 3I6YA 3WK4A 2R8BA 1LGYA 4W1SA 3QMMA 1UK6A 5JZBA 4C88A 3WZMA 3AIMA 4ARBA 1FFDA 4IO0A 4F21A 2XB6A 4OPMA 2ZSIA 3AZQA 4QLOA 5CT6A 4ZV9A 3DYVA 5HFNA 2WUEA 2K2QB 1UOQA 4P93A 3HSSA 3EQ8A 3V9AA 5CH8A 1A7UA 1IVYA 3GZJA 5ALWA 4DGQA 4N8EA 3H2KA 4KE7A 1P0QA 5AICA 2IITA 1VE7A 5JYCA 3WZLA 1FFAA 2GZSA 5EHZA 4QWMA 3BIXA 1FJ2A 2WFLA 2WFLB 2J3DA 4G4GA 4AZ0A 1XZEA 3R3XA 5AOBA 4DLNA 4H7KA 1LZLA 1XQWA 1LPMA 2DR0A 5LZ5A 4WDQA 3I2KA 3D2AA 1MU0A 3ICVA 2PSJA 4HS9A 3F67A 1XZHA 5BWBA 4OSEA 1VZ3A 1Z68A 2J4CA 5ALVA 1XZAA 1O6GA 1JU3A 3SX4A 3WK5A 1XLWA 3QPAA 2JGLA 5E4JA 4X93A 1CUXA 4LKOA 1DT5A 2J3QA 4P92A 2PM8A 4MWSA 2Y6UA 3GELA 3QITA 4N8SA 5CH5A 4IH9A 3W06A 1UK7A 1DQYA 1MX9A 4A5SA 3QZUA 1Y37A 2RI6A 2G63A 4EY8A 3AJAA 2C58A 2YYSA 1AX9A 4FLFA 1ZGBA 4W1QA 1RYYA 4AO7A 1L7AA 2XUQA 4AN0A 5ALQA 2ZYIA 3WYDA 4MQLA 2HHAA 1N5RA 3JYHA 2GBFA 5BOVA 3WKDA 4YASA 4G8DA 1CUSA 4MEAA 3AZOA 1FFCA 2QJRA 1J06A 4X92A 5IVHA 4BE4A 5FKJA 1O6FA 1I6WA 3SK0A 1CLEA 2HFKA 5CW2A 3O4JA 4LIPD 3D59A 2XQFA 4B0PA 3A70A 1AUOA 1QGED 1XRPA 4UBMA 2VJDA 1XRNA 4LYDA 3WMRA 4LXHA 1CUDA 2QRUA 5DYTA 1E8MA 2HM7A 3ESCA 3ESBA 3UUEA 2BUCA 5LZ4A 3HZOA 5K3AA 4AMYA 4KE8A 3AINA 2PSFA 4YPVA 1JJBA 3IB3A 5D6OA 3ED1A 5HKAA 4DSZA 2WIGA 1OILA 3GBSA 1K8QA 3RKSA 2WG0A 4J0JA 1ODTC 4G9GA 5CT5A 2D5LA 4LYEA 4KAJA 3W9BA 1XZKA 2XUPA 2CJPA 1LBTA 2OAEA 2WJ4A 1UKBA 4HRYA 4MYDA 2PU7A 3HXKA 4AZ3A 4FLEA 3ZLVA 4TVKA 4GW3A 2HADA 2BUAA 4H7EA 1IZ7A 3G8YA 5EIAA 2ONCA 2CZQA 6YASA 5JAUA 3WL6A 2DHEA 4W1RA 2FJ0A 5FLKA 5IVIA 4FDMA 1H2WA 3ESAA 3FLAA 3TEJA 3C6YA 1TRHA 5HQ3A 4J7AA 4INZA 1GPKA 3DL4A 4MJ3A 5YASA 4UFNA 1JMKC 3STXA 2GYWA 3W04A 3S8YA 4BATA 2QXTA 3EF3A 2WIDA 3O9MA 4K6GA 1CUGA 2OAGA 1W76A 1AGYA 4UHDA 4MEBA 4UFPA 4Y2RA 4FWBA 3R3VA 5A7HA 4L72A 5LP1A 1DU4A 1FFEA 4H7JA 5K3BA 1SCKA 2Y2VA 1GKLA 3LIPA 5F4ZA 3IULA 5FXMA 2QVBA 4H7DA 3G9TA 3UUFA 4UBKA 1VLQA 2XQJA 2XUIA 1MX5A 5LZ8A 1BN7A 3WQHA 1EB8A 4Q3LA 4UBIA 4WCVA 3AUKA 5C8XA 5ALIA 1QTIA 4K6KA 4MWTA 3G02A 4P9NA 1C7IA 2WG2A 3I28A 3WK9A 3CN9A 3STYA 2H1IA 5JD5A 1MN6A 2ZJ6A 4EBBA 1VKHA 5JADA 4G8BA 3WWOA 2HA0A 4WY5A 5I7UA 4J0GA 1QIFA 4X6YA 3A2LA 4GHWA 4BZWA 3F9CA 2AJLI 4NVRA 4OYLA 3VXKA 4HXGA 5D3ZA 1ETHA 2B4KA 2WILA 5JANA 3STWA 5AIBA 1EINA 3DL7A 2C5FA 1CUWA 4OB6A 2C0QA 4DNQA 4B81A 3CN7A 5ALZA 1Q84A 3WK8A 2DHCA 3FSGD 3O95A 4U2EA 2XLCA 2Y1KA 4BE9A 4KRYA 1QFSA 2P8SA 4EUSA 1W6RA 3IVMA 2VJBA 3NGMA 4FNMA 3O9VA 3L1IA 5AI9A 1HDEA 4KR0A 1TCAA 1XZGA 4J0KA 4BRZA 1T2NA 3BXPA 5KREA 1LPPA 4B9AA 4NMWA 1QFMA 2QR5A 3QMWA 5CH3A 3MVEA 3V48A 5ALFA 4M0EA 4X7BA 2W6CX 4GEGA 4C4ZA 2OCGA 1W4LA 4H18A 4Y2PA 3WKBA 1QLWA 2WTMA 2JEZA 2XQIA 4QEKA 1EXWA 2RHWA 1SC9A 4UBOA 4I3FA 1BE0A 3CCBA 5SYMA 1WOMA 1Y7HA 1VE6A 3VVMA 4B85A 5ALMA 4ARAA 5LIPA 3C45A 1CUYA 4W63A 4D9JA 2B20A 4XJVA 2WFMA 5AP9A 5AIAA 3DOIA 1ODCA 1CVLA 4QNNA 1XZCA 3LCRA 1VJ5A 2D0DA 1TAHA 5ALXA 1IUOA 2YASA 1JU4A 1DWPA 3GFFA 5C8VA 1JJIA 1P0PA 5LKAA 1UT6A 1EK1A 1F8UA 1YR2A 1GKKA 2WUFA 4Q3KA 1FFBA 3G0BA 1VA5A 1MJ5A 3B3QA 1A8UA 3U0VA 5JD6A 4GECA 4ZXFA 3PDCA 3ZLTA 3Q0TA 4S0XA 1JMYA 4BCCA 1J1IA 2BGRA 3LIIA 3KXPA 5AK6A 5HCUA 3DS8A 4Z49A 5AH0A 4OD0A 5CTAA 1ORWA 1QIJA 1ZI8A 1ZOIA 1BU8A 3O4HA 3VJLA 3OPMA 4QDTA 4E14A 4BVJA 4KEAA 4EA6A 1EK2A 3HI4A 4PNZA 4QLAA 4NS4A 1TIBA 3OG9A 1XRRA 4DNFA 4C87A 4B83A 3R0VA 2VQ6A 4FFWA 1HPLA 4B0OA 1LBSA 3LS2A 4BZZA 4X85A 4Y2YA 1BS9A 5C8ZA 4KACA 1CV2A 3WJ2A 4UPDA 4Y2UA 4A23A 3R40A 3STTA 2DQYA 4QDUA 1EH5A 2RGUA 2WIFA 5DNWA 3WI7A 4BP9A 4CG3A 4FFVA 5JASA 5JAPA 3DQZA 3NWOA 5AM0A 3OTQA 5ALEA 3DYIA 3QPDA 4BP8A 1BRTA 4Q82A 2ZSHA 3BIWA 3E0XA 1TKRA 1SFRA 5K3FA 5K3FB 3AIKA 5CMLA 1J07A 4J0CA 5A62A 4H0CA 1ZJ4A 2JBWA 3FYTA 4ROTA 4AX4A 1BCRA 4UHFA 3WKAA 4J03A 2UZ0A 1DWQA 3HC7A 4AO8A 1QIGA 1MAAA 2B9VA 4UUQA 4DMHA 1N8SA 2Z3ZA 1CQZA 5HF6A 5DYYA 4UHEA 3OC0A 3WWEA 4AXBA 4CG2A 4BTVA 3F98A 3DNMA 2HU5A 4M0FA 1GPNA 1UFOA 1CUHA 3IUMA 4U2FA 5AI5A 4OYYA 3DKRA 1CUEA 2XMDA 1QO7A 4H77A 2HL6A 3ZLUA 4BVLA 3R3YA 4B82A 5AK3A 2QS9A 4GWLA 3FSGA 3IDAA 5AK5A 5IVDA 1LPOA 4HXFB 2BGNA 1CR6A 4X6UA 2PPLA 2VJAA 2JGJA 1QIKA 1ZGCA 2VF2A 4G4IA 5LKRA 2JIDA 3QVMA 4FMPA 3HEAA 1CUCA 1MAHA 1PJAA 2C7BA 4WFJA 5AKGA 2XI4A 4FTWA 5AKZA 2HDWA 4DYHA 3BE8A 2WUDA 3BWXA 1TQHA 5ALSA 4B84A 1UZAA 2R11A 3KSRA 1XRLA 4Y2QA 1EA5A 1QIHA 4CIAA 4OB7A 2EEPA 2HRRA 3FAKA 1QIIA 1QIDA 3I2HA 3ZPXA 2QXUA 4BC1A 3T52A 2WLSA 1W75A 2WKWA 4WJLA 1MPXA 1VOTA 1H22A 2OCKA 5DLPA 5CRIA 4BDSA 1QIEA 1S8OA 2CB9A 1G42A 2QKYA 2OGTA 3PICA 3A6ZA 4WY8A 4BYMA 3W05A 5KWIA 4U2DA 3G9ZA 5K3CA 2LIPA 5DJ5A 5EIHA 2CEKA 3F8SA 1G5FA 1YS1X 3FBWA 3T4UA 4DMCA 2PBLA 4H7IA 2EDAA 3DCNA 3PUHA 3I2FA 3DOHA 1ORVA 2X8BA 3WWDA 5ALUA 2QT9A 3DDUA 1QZ3A 5JZ9A 5AM3A 4AO6A 3WWPA 1BEZA 1WCYA 1TCBA 2CMFA 1GT6A 3HLKA 4BDTA 1YCDA 3KWFA 5ALRA 2WJ3A 1AQLA 3IBTA 5JZSA 4L0CA 1L7RA 2H7XA 5CT9A 1KEZA 1BROA 3O4IA 2JF0A 1GPLA 3IIIA 5CT8A 2X76A 3LP5A 4QDZA 4ZGBA 4CI9A 2PSEA 2JGIA 2BCEA 4CCWA 1CFJA 2OGSA 4X94A 3EBLA 1X70A 4GXNA 5ALTA 3I2GA 2HIHA 4HZGA 3WL7A 1Q83A 1H2ZA 3CXUA 3IUNA 2WQZA 4PSCA 1FSSA 3GA7A 5HK9A 1AMNA 1K63A 1C4XA 2QTBA 1WHTA 1Y7IA 2RAUA 3WL8A 3W2TA 1CUAA 5EI5A 5IKXA 5HF8A 2W22A 3D3NA 4UBJA 1LPBB 4OUKX 5AKHA 1WPXA 2O2GA 1RWQA 1BEEA 2HA4A 1XQVA 5AKXA 1H2YA 5ALGA 3R3UA 5H3HA 1MTZA 5CURA 4I4CA 2PU5A 1F0PA 3QBJA 1YAJA 3B5EA 4KE6A 1EB9A 4ZI5A 2XUKA 1MNQA 4LXIA 5EHNA 2QMQA 3VVLA 1E8DA 5AI4A 3TJMA 5D7BA 3WKCA 4CCYA 3C5WP 1MO2A 4CCYB 4HXEB 3O4GA 2WTNA 3G7NA 1QONA 4KRXA 1HLGA 4PSUA 2NW6A 2XQKA 2VSQA 4DMKA 4GLBA 1JJFA 4AN1A 5HK8A 1ODSA 2AJDA 2VTVA 4W9RA 1AC5A 1P0MA 2QUBA 1GGVA 2VT7A 2GYVA 5T4HA 4ZV7A 3U1TA 5AHXA 2CBGA 2OLEA 5AKKA 3C6BA 2CUTA 4ITVA 5FPPA 2PVSA 2IX9A 2Z8XA 4GBGA 2IIVA 1R3DA 5D3KA 4AMZA 1QIMA 5JATA 5DTIA 2XUFA 1XZMA 3C87A 1GXSA 1ZD5A 1P0IA 4QA9A 5K3EA 5DYWA 5HFAA 3Q8WA 4HRXA 3ZV7A 3VDXA 2ACKA 4GI1A 1DX4A 1E66A 1B41A 4C6HA 4RE5A 3G0IA 4C4YA 4N5HX 1CEXA 3HACA 1QOZA 5CBKA 3H2GA 5SYNA 2JGMA 1R9NA 4K5QA 4E15A 3MUOA 3I1IA 3PUIA 4G9EA 1IZ8A 4X97A 4QWWA 4IH4A 4FBMA 4UHHA 4BVKA 3HJUA 2WHPA 4Y2SA 3IUQA 2WHPB 1VXRA 1UOPA 5EHXA 3C8HA 1WB4A 4KAAA 4KJXA 3E1GA 2VT6A 3PFCA 2BUBA 2OPHA 1E5TA 3FYUC 5A7GA 4DSAA 2AJCA 5ESRA 2OXEA 2VJCA 1QO9A 3TGLA 3KDAA 1SCQA 4G1FA 4RE6A 1CQWA 1PFQA 4AB1A 5ALHA 1MNAA 2QUAA 2H7YA 3M82A 1YA8A 4HTAA 4UHCA 4AQDA 2VA9A 1OXMA 3K6KA 1XRQA 5K5EA 3TRDA 3FWHA 2Z3WA 1LLFA 3BF7A 1IUNA 2HU8A 2XDWA 2I03A 4Y7DA 3FNBA 4JUIA 5K3DA 3ZWQA 3WIBA 2JGKA 3S2ZA 1A8SA 4B80A 2PL5A 1MX1A 2QOEA 2XMGA 5BWCA 1K4YA 4Y9SA 4E46A 4P08A 2BAGA 4KAFA 2XMBA 2XLBA 4BB0A 1R88A 4G8CA 5FP0A 2Y2UA 1ZIYA 1WB6A 2BKLA 4O08A 3YASA 4X71A 3DJYA 1JKMA 2XUHA 4XIIA 1EI9A 3D2BA 3W9UA 2XE4A 5C81A 1W1IA 4EY7A 2C5GA 3C6ZA 4J0DA 4L9AA 1R9MA 1WM1A 2JEYA 4V2IA 4BCBA 1YB6A 1LPNA 4E11A 2OQVA 3FVRA 1N5MA 5JALA 1DTEA 3IUJA 3ANSA 5IVKA 1TCCA 4HVTA 2XMRA 4KE9A 5T4EA 2WJ6A 3BF8A 2CKMA 2PSDA 2BFNA 3HRHA 4KYVA 2HFJA 5ALYA 3OOSA 3VKFA 2XUDA 5AI8A 1X2EA 4B7ZA 3WYNA 1XKTA 3QM1A 3FYUA 1E8NA 3FYUB 1HBJA 5HF9A 1GQSA 1XLVA 3ILSA 5IH7A 1HL7A 3C5VA 5DTJA 2ZYRA 3QMVA 1UWCA 3WL5A 5HZGA 3BDVA 5AO9A 4RNCA 2VEOA 5LZ9A 2XUJA 4F0JA 3A2NA 4JYMA 3N0TA 5JARA 3G0DA 3PF8A 1ZICA 4M0MA 1UKCA 3ZI7A 1ACLA 5A6VA 1HKHA 1UK9A 2RHTA 2HRQA 2WFZA 1KU6A 5HKBA 1D07A 3EQ9A 1GQRA 3SC2A 3JWEA 5A71A 5KWJA 1G4HA 4XX1A 1YASA 5EFZA 2XMZA 1TK3A 1XQXA 3H1AA 4CIBA 2HU7A 1CIJA 1A88A 4U2BA 1JFRA 4HAIA 1LPSA 2EDCA 2ZYHA 5AM2A 2Z5GA 4FKBA 4RPCA 1CUFA 1XQYA 1R4ZA 3D0KA 2PUHA 5DNVA 2I3ZA 1ZD3A 1YSCA 1R1DA 4IHAA 2WHRA 4FNGA 2O2IA 4BAGA 4ZREA 4IQ4A 4G5XA 3ESDA 4JEIA 2XQGA 4EY5A 4CG1A 2DHDA 1CUJA 1VA4A 3LLCA 1U65A 5ALJA 3WIOA 3G9XA 1CUIA 2WG1A 4L3WA 1L7QA 4XWGA 3AFIA 4Q1VA 4EY6A 2WSLA 2PUJA 1SCIA 2J4FA 4N5IX 3O0DA 1QJ4A 1NX9A 7YASA 5BV7A 3M3DA 5AJHA 1C7JA 3KOOA 1B6GA 4DM7A 4ETWA 3I6ZA 3RLIA 3V1LA 3K9BA 3PE6A 2FX5A 4X91A 5AKIA 4X95A 3PI6A 5LZ7A 3E3AA 3VJMA 2C0PA 4EY4A 2V96A 4EZIA 5EIEA 2ORYA 3M83A 1EX9A 1XKLA 5JAOA 3CCCA 3B12A 1K6EA 4MXDA 2C4HA 4ZWNA 3H04A 3EQ7A 2ECFA 4Q34A 4G4JA 4YX9A 2Z8ZA 2OGZA 5I8PA 3IURA 4PF1A 2YH2A 2OCIA 4BTLA 3WLAA 4J3JA 5EGNA 1M33A 3H19A 3I1YA 3X3HA 2XMSA 3WK6A 1DWOA 2ES4A 2WU4A 3H0CA 4I19A 1XZLA 2XT0A 3H2IA 1BN6A 3D2CA 4QDOA 3H2HA 1AZWA 3AILA 2JGEA 2ZVDA 3JW8A 3G9UA 5T4FA 4C4XA 3F97A 4DNPA 4LXGA 1KU0A 3FOBA 3STUA 3F96A
chains in the Genus database with same CATH superfamily
1I80A 3EDYA 5FUVA 3GPIA 4RIFA 4P86A 1M2JA 3KUCA 3NDJA 2MSNA 5LLDA 3ELYA 2AN1A 2QR3A 1VMIA 2R2GA 1KQNA 3QXSA 2BWJA 1RHKA 4YXWD 1EWYA 3T4XA 4DDKA 1FA9A 1U4OA 3CRMA 5HFJA 3P9CA 4NWIA 3V1UA 3T3IA 3UMMA 2FK8A 2L0XA 2PK3A 5A4KA 3UFXA 5CEJA 1BXGA 1UOEA 5KNBA 3EPHA 3UFXB 1PZHA 1BXGB 1R0LA 1Z4MA 2PLRA 1LSSA 4OHMA 4QBHA 5BSKA 2F8SA 1XLTA 1D5CA 5HM8A 3BD8A 4JLPA 1W85B 4IYJA 2LDXA 3WLQA 2GFIA 1CHDA 1I3LA 1ZVMA 1SU7A 2PT5A 5LMZA 2A9VA 4OB8A 3U56A 2BMAA 2GESA 3CLTC 3RSLA 3L4EA 4Q05A 3T61A 1E7YA 2BI4A 3F9RA 1XYGA 1LA2A 2OO5A 3GFQA 1O0CA 5T4BA 1TKBA 2G7ZA 4NJMA 2P6NA 4Q7MB 1EXVA 1L6IA 4NJMB 4FM9A 3DEIA 2DC1A 3TKLA 3R20A 3HB0A 5TDHA 1RRFA 3L1JA 4RETA 1ESCA 3CGWA 3QLUA 2NQ8A 4GI2A 4PZZA 4M99A 2NU6A 3PA8A 3NDPA 2NU6B 4GZ5A 5EKSA 3H13A 4O33A 3UK0A 1CRQA 1CUVA 4U9UA 5IT5A 1N0VC 1X42A 3FETA 2HHLA 3NUZA 3PUWA 3ZG6A 4D74A 4AD8A 4F1JA 1SAYA 3PC7A 3S2EA 2XPCA 1YS9A 2WTXA 2N47A 3BK1A 4HLDA 4KDCA 3UJ7A 4UC0A 4ZVPA 3C70A 2NSDA 1RP7A 3GROA 5JDIA 5B2ZA 4AJOA 4B3HA 3WWCA 4JWKA 4KXMA 1W1UA 1OX6A 4WOKA 4X9XA 3TBFA 1N6IA 4RKFA 2LRHA 2OEPA 3SHOA 1P9RA 2R2AA 2XDYA 3NHWA 2ZSEA 4H7HA 4HHEA 4R1PA 4UNSA 3FOEC 1RCFA 4GOXA 4H35A 3SC3A 3TQSA 3ZJ4A 2VXCA 3GVIA 4X90A 4F60A 2HK6A 5FO1A 3LVQE 4OCZA 2XTMA 1E58A 1I4WA 4OSPA 3JQCA 1UBRS 2ZREA 3BIFA 2HPAA 1A9SA 1MVLA 2OENG 2CFRA 2VCYA 2YIMA 3DWIA 4JHXA 4K28A 3VGPA 3C6XA 3JVIA 4E5PA 2IP2A 2Y1WA 3K9HA 3LBIA 1UZNA 2FEAA 5KCZA 4OJQA 2IX3A 3DBIA 1YB7A 2CL5A 5CHEA 2PJRA 4CR8A 2JIPA 1Y8RA 4CKEA 3CX8A 1Y8RB 4FHDA 4CKEB 4BASA 1XYYA 1B23P 4ZYXA 3QA9A 1WKBA 2FPKA 3BEDA 3SYRA 2VF7A 2J3MA 3HUTA 4QU9A 1CUZA 2JLSA 2BGWA 4MVJH 2WK1A 1ICEA 3EAFA 4PPQA 4UBNA 4Y2VA 4DLRA 3N2ZB 1ENPA 1X2BA 3PR2B 4MIYA 5TR9A 3GK3A 1KJIA 4WKPA 3ZJVA 3K0HA 4K6HA 1HYEA 4XDZA 1FVXA 2GCEA 2QUHA 5TS2A 3QWAA 4XWOA 1W87A 1QAQA 2JLZA 4A36A 1H23A 1IL0A 3GNLA 2PKEA 4FKZA 5E2IA 3DHEA 1HEUA 1KI1A 4X8OA 3FVTA 2EZ4A 3LK7A 4FZ3A 4FMDB 4EDHA 5I8WA 2WTUA 4EEZA 1T5DX 3PJGA 3TLKA 1X6VA 3SHVA 3AY0A 4WDRA 4PZAA 2X0IA 3RC8A 4AP6A 3D4BA 1JIVA 1T24A 3LJKA 3FCYA 4HAZA 1TZ2A 3IS3A 3L92A 1WDWB 2YVQA 3RBVA 4QJ5A 1XWFA 1CHNA 1D2HA 3P0IA 2BEJA 3PNYA 4WLOA 1NMSA 2A0FA 4JHLA 5EEHA 5K99A 1XMQB 1YRBA 2ID4A 2JI7A 5DN6D 1IUKA 1T36B 1PHRA 2PVPA 4D80A 3LXXA 5K8LA 3P9NA 1WB5A 4Q9HA 3LC7O 2UZ1B 4IEFB 3WO0A 5F7OA 2BJHA 1U2EA 4QGGA 3V46A 1CJSA 1S1CA 3VU9B 1G59A 4HAXA 4ZQHA 2O59A 4MYSA 4PYKA 2J7PD 3MGAA 4H2DA 4LV6A 4PAMA 5E7JA 4PLWA 4MSUA 4CTKA 2D5BA 3IDFA 3K35A 5KU1A 2G9VA 3LRTA 2CFOA 2GLUA 1WMFA 4UHBA 2C9MA 4PS1A 4EPTA 1SEVA 3PYMA 2ST1A 2GX6A 4FBLA 4WASA 2V9ZA 3N1UA 2WUGA 3H6GA 3MTJA 2O7RA 4LCBA 4W5RA 3WBKA 2G9QA 5FYQA 3HJRA 5L6LB 1KETA 4F45A 1B42A 3H18A 1JBEA 2GVDC 3KD2A 1UM9A 3C39A 4V0NA 3HXTA 3ZV6A 4B5KA 3PYLA 4E88A 1UM9B 1X1BA 3BA1A 3MAJA 1JXQA 3VRHA 1HT0A 2IF2A 3SEQA 2OFOA 3NHUA 5F7XA 1T3TA 4C5CA 2FP3A 3S44A 2A14A 4CLOA 4DR5B 2YBDA 3PNQA 1ZJ5A 1YA4A 2CL7X 5BO5A 1P4AA 2NO4A 4YMHA 3AXTA 4Q3DA 4Q7EA 2X5JO 4UCWA 4AZVA 3WGUA 2D6FA 4GR4A 4RPKA 2FCRA 1Q0RA 2GPJA 5HXAA 5MFPA 1O6CA 1UXOA 3FBGA 3L07A 3T9DA 4CKBA 4WD3A 1L7EA 2HK7A 1VYVA 4N1AA 5G0VA 5AVKA 1T9HA 4QXMA 1MCZA 4B9EA 4BRUA 5JVDF 1RM0A 3EDCA 1INLA 2EL7A 1FC0A 4Q24A 1KI3A 1Z3IX 1SBYA 4NXNB 3RF6A 4JH0A 4PGAA 2PGIA 4ISBA 4JB3A 4DIBA 5HZHA 1EHIA 1XZJA 2JIRA 2FYTA 4G2TA 1H4QA 4D9NA 3MJCA 3QNWA 1VHWA 2GBGA 3VZQA 4EH1A 3D6NB 4IGKA 4K0RA 4ALLA 4Y6OA 3G88A 4EJ6A 5C1BA 5JXIA 3IQXA 1OR8A 3HCNA 1JIUA 3RARA 4R84A 2YHIA 5JQWA 3THXB 2A35A 4NR0A 3MQ2A 2JKYA 2YHIB 4G1BA 4AIIA 1V3TA 4TXHA 1NP7A 5BNWA 5FRDA 3KQLA 3FPLA 2HXGA 4MK4A 3S55A 5CA1A 5CA1B 4HB3A 1Z13A 2WIJA 1QRUA 1U0OC 4J29A 2FEMA 4L76A 1PR9A 4KAXA 1P7PA 5TXGA 1SOMA 1YQQA 1UODA 1SVSA 3OHPA 3UAYA 3FDIA 2YMQA 4A15A 2QZPA 3BJMA 2XMCA 4OXYA 5ALLA 3K0CC 3O75A 3MS2A 1RC0A 1T35A 5D5HA 3W7BA 1NIPA 4DTCA 3E5HA 4F1WA 4DV1B 1QJCA 1ZI9A 2ZTSA 3D8BA 2OILA 2IZ5A 3O7MA 1W52X 3DOFA 5K9ZA 4NNJA 3ZCQA 1DO0A 4DNXA 3OLQA 3EF0A 1R15A 5PGMA 1OCEA 2UU9B 1CUBA 3DEAA 2CHGA 4CFSA 4ZOCA 3OEEA 5JSKA 1YS6A 1OOEA 3EOAI 2QROA 3NFYA 3RVKA 5JS6A 5K2OA 4PX9A 4QPNA 3KWMA 1YKSA 4B34A 1MT3A 1ESDA 1RADA 1XE3A 3N8DA 3ZXUB 3WDSA 1NI4A 3LC1O 3PJFA 3QLVA 2D5IA 3RADC 1JT2A 1LK0A 1NI4B 3KZKA 3UGQA 4HDAA 4KO1S 2FUKA 1DQRA 3RTCA 1WUJS 4UNNA 2F3PA 2EJVA 4F96A 1PJCA 2BKUA 4QO7A 2O48X 5FPQA 3REQA 4OV6B 1FEZA 4LE2A 4TMTA 3REQB 2X2PA 3KWJA 3HWWA 3MJDA 3HS3A 4KO8A 3FMGA 1N8KA 2WSIA 1MH1A 3FLBA 3KCNA 4XM2A 4A91A 2DQ4A 4FGSA 4L74A 2FZWA 4XEUA 2XYRA 4H7FA 2YJZA 1ZOLA 2BFBA 3P5SA 3I12A 1H2AS 1N78A 2BFBB 2D8MA 1ONNA 1OLUB 1EMDA 1F48A 1AS2A 3HEBA 3LQFA 3FYDA 3N87A 3ZV5A 5HTOA 5K7SA 2DSNA 4FT4A 5JD4A 3AR8A 4AJLA 3I9V6 4CGYA 1RAFA 4FYIA 3AGPA 5CYGA 5L40A 5FAXA 3QTBA 2PAAA 3IDQA 4K7JA 3I2IA 5LN1A 1KAQA 1M8GA 1WMBA 3GDHA 2PH1A 1NVDA 4F5ZA 5LD2C 3WLSA 3ZHZA 4RENA 3VPDA 1L8QA 4YRKA 5F21A 4HX9A 2V03A 1YK1A 1QHSA 3R1IA 4BGVA 4ZZ0A 5FTLA 4HDMA 4OI4A 2MR5A 4QECA 4BNFA 4N12A 4L0DA 2HXYA 4ZQGA 3TZKA 2YWXA 3COVA 4E0BA 1N2JA 2CF5A 4L27A 3RTGA 2HT1A 2QRPA 1U9JA 2IHKA 4KSBA 3UMRA 2HY7A 3DV0A 4DSTA 1WXDA 3P4YA 3E4DA 1IEWA 4E5SA 4XVQA 4R1MA 1VYUA 2YXPX 3KO8A 2KW5A 4H1UA 4N6GA 4RK5A 2ANCA 4R0NA 1KY4A 2NUAA 3FKSA 4ZGWA 3N6VA 1MEJA 1FXWA 3AG5A 4LJLA 5TGZA 2CD7A 4WZ6A 1SUAA 2IE8A 4QOGA 1ZVQA 5EVCA 2P9ZA 3ZE1B 4D79A 4FFPA 1ZCJA 1B8OA 1GZDA 2VBGA 4H3SA 1E4OA 1RJGA 4DWOA 4RKWA 1TT5A 5ALNA 4IOMA 1TT5B 4XARA 4TTTS 3WK7A 5AXAA 1H2EA 2ZPUA 4ZVQA 2I2FA 2GKOA 3LFUA 1KDPA 4S1WA 2P27A 2WP8J 3QYJA 4PW0A 3WLRA 1R50A 1U3TA 2R5WA 3KFLA 3NGXA 4INOA 4R8MA 2BLNA 3RWMB 1KJQA 1IOWA 1XZFA 2PO7A 3I5AA 1CRZA 1YZFA 1KSFX 2FA9A 1XV5A 3BWBA 2GF9A 4GX1A 4BRSA 2J85A 4PFJA 5KNDA 3UANA 2UXCB 2QZ9A 1GZ7A 5FEMA 2WU3A 3DE3X 2VWGA 2B5OA 5KSZA 3RBAA 2AZDA 3LQKA 2C2ZA 3O73A 1I7DA 3EEBA 3VX3A 4A0HA 1U4NA 3UMYA 1Z8FA 2IOFA 2V4MA 3C6KA 1TL7C 5FQOA 5HF5A 5ABPA 1GFWA 4TT3A 1FBTA 3VR4H 4EVSA 5C7LO 5U9CA 3UEOA 2CJWA 3TFQA 1M2EA 1P4JA 2CJWB 2H18A 4RH1A 4CMEC 2VTKA 3ZLJA 4LWPA 3UJAA 3VR3D 2DCMA 2Q29A 3HYSA 3LAWA 5C35A 2Z98A 3LYUA 4OJKA 5BXQC 3H8JA 1HK7A 5AW4A 3H2JA 1XPRA 3KT0A 4FXOA 3RWOA 3SZMA 1Z7GA 1VG0B 2YWBA 1YQXA 2ZI7A 4ZOQI 1B4DA 3HWRA 2QGNA 4GMXA 2X6RA 4JR2A 4OXNA 4EJ2A 1ZCBA 1ST2A 4OYHA 1ZGJA 2PZBA 4XXHA 2Q3BA 5I7OA 4MULA 2R8BA 3U7EB 3RYCA 1LGYA 3QMMA 1C8LA 1UK6A 5JZBA 4C88A 3W78A 4ARBA 4FR0A 2AYXA 3WIDA 4E2XA 2Z1MA 1BAPA 2XB6A 3EGVA 2VHQA 1IHPA 3AV0B 2HBQA 2P1RA 2ZWPA 3AZQA 4X7PA 5CT6A 2HF7A 3G3EA 4YS6A 4Z1MD 4R8LA 5KJEA 5I9LA 4ENRA 4BOYA 2PX2A 1PJQA 2WR8A 4BGUA 1QVVA 4ERNA 2B2CA 4G89A 2WYHA 1PNOA 2GQ0A 4WKGA 3R7FA 4EAQA 4JXZA 1G5QA 4V0SA 5HIMA 4OQEA 5CH8A 4BB5A 4MKXA 3GAMA 2PAFA 3MRTA 3E7PA 1ZRSA 3PQFA 5G0TA 3T1VA 2PBZA 1E3SA 1BCRB 3PB3A 3LT5A 4KLZA 4MUFA 1N6NA 1WBJB 2JL1A 4L75A 4AJIA 2Q6TA 2TSYB 3QTTA 1ZH6A 3A6EA 2P9CA 4C1BA 2OFPA 5JYCA 1N5IA 3A28A 4K9OA 3U7QA 2GZSA 3DEYX 3KXKA 4MWGA 2EX4A 5K6RA 1WWKA 3DHNA 3U7QB 3N2EA 1Z4IA 2NP7A 4FK8A 4RKEA 4B47A 1KH3A 1W581 1FJ2A 1P2TA 1GGJA 1VMDA 1A04A 2A9PA 2FMKA 1MQ9A 1TEXA 2IUEA 2PA3A 3LHFA 4MQEB 3T9AA 3ONFA 1TZCA 1QNLA 4GH5A 3WL3A 1XZEA 3LZCA 3HR7A 3TDMA 1RQ2A 1L4NA 2E18A 3PLNA 3R3SA 3W1WA 1DG3A 4H7KA 4MEJA 1PK9A 4TTJA 1M54A 1XCOA 1LPMA 3GF4A 2KLBA 1AG9A 2IS4A 4QNMA 1NYLA 5B6PA 1VG8A 1Z12A 2I4TA 3V8PA 2VRNA 2NZVG 4DB4A 1I6LA 1VSTA 1ID8A 1OZHA 1I0IA 2E5FA 1FUEA 1PDOA 1Z68A 2J4CA 4LCEA 3RAEC 2PKWA 1XZAA 1Y82A 5T3UA 4QFDA 1JU3A 1LQUA 5H1YA 1AS0A 1X1DA 3V5NA 1DWUA 2PNFA 1BX3A 5B58T 4F4JA 4RTSA 1XLWA 4YEDA 5IP5A 3UWPA 5E4JA 3WK5A 1WY5A 4URXR 2J67A 3B51X 3BFXA 2FE4A 4LKOA 1VCOA 4D82A 3PC8C 3PS9A 1IY0A 4FVTA 3PGMA 3ZNNA 4LBZA 1C9NA 2V74B 3MMPA 2DQSA 2JHPA 2IYVA 3A06A 1RTKA 5E1MA 4MP8A 1HMPA 2CXNA 5LXTB 1D4FA 1QGAA 1QZTA 3LX6A 3F6RA 4I5DA 4MIKA 3ZWWA 6Q21A 1W0JA 5JI2E 4IH9A 3PEWA 1U7PA 2IYNA 4A7PA 3B9PA 1AGRA 4X8MA 1DQYA 4LRXA 3W5SA 2R8RA 3N86A 3OH8A 1KZ7B 3QZUA 1Y37A 1VI6A 3KKOA 3KYBA 1FK8A 2PH5A 2G63A 4PYLA 5LL6P 3PNLA 2C61A 1COZA 2C58A 4EHFA 1E77A 4QU8A 4EG6A 4JQZA 2G1UA 5SY4A 3KD3A 1L5WA 3SHTA 3F6YA 2Y05A 2BJVA 4LOKA 1S7CA 3CZQA 5ITVA 2P75A 5JY1A 1J5EB 5ULLA 3TVDA 2NTEA 1B00A 4G4SP 2PX0A 4BBAA 1ML3A 1FQJA 2XUQA 3K5PA 1ZWKA 4GL4A 3RRNA 1ZZGA 3EH2A 4AN0A 4LF9B 1NVUQ 3K96A 3ZCSA 3EH1A 4HZIA 4MQLA 4W5TA 2GEUA 2YXDA 4X1OA 4HMPA 1M0TA 4OGGA 4W6ZA 1H3EA 2AYYA 2J6BA 1K7SN 2C3YA 1FTYA 2NU7A 3IQGX 4GQAA 1JHRA 4QTXA 3KSAC 3ZU5A 2NU7B 3K70B 2PNJA 4EW6A 2YZ7A 2D62A 4FNAA 3IBYA 3SJ7A 4Z4FA 1CUSA 4DY6A 5A6SA 3GZNB 1QRSA 5J2TA 5DIFA 3AZOA 2O7NA 5A6SB 3H42B 5KX5F 4N5DA 1TM7E 1XVTA 1Z5UA 3Q0EA 5JYDA 5J2TB 1T6ZA 3KL2A 2IS1A 4BFVA 3K1TA 4KQGA 4X92A 1K3TA 5IVHA 4YUAA 5G41A 3AR9A 5EZYA 5FKJA 3U5TA 2G07A 1O6FA 1TYZA 4JKIA 1R0XA 2O4UX 5EZYB 5H82A 3MFQA 4GM4A 3QVKA 1J97A 3PENA 5CW2A 4DLBA 5ICSA 2WWHA 3CTMA 4XH9B 2PZLA 2JIBA 2VS1A 5K0NA 3SYMA 3E9QA 1OT5A 5F77A 4KCGA 1A4XA 1EFCA 3BQNB 3VMFA 1IZ0A 3VZRA 4A8JB 4HLUA 4DILA 3H2YA 1X9IA 3CF6R 1KK3A 3RG8A 4CTJA 1ORDA 1VBMA 2Y8EA 4FMCF 3W2GA 1MFZA 3A70A 1G64A 4TL7A 1KXJA 3SI7A 3TZ6A 3TF5A 3W6OA 4W82A 4XX0A 3TIFA 4AG5A 1AHNA 2XAAA 1F4VA 3G2OA 4XX0B 1XRPA 3MSCA 4BNLA 3KQKA 4BGIA 3QELA 1SIUA 1RT9A 4KQ6A 2I65A 1OWMA 2XNDD 3QELB 4BO6A 1XRNA 3GJYA 4OJMX 3E7WA 3MSXA 2B34A 2M98A 2Z43A 4ZARA 3D1VA 1CUDA 2QRUA 3ZE0B 5DYTA 3ZDYB 1E8MA 3EASA 2DFVA 4RXUA 4QTYA 1I7QB 4UUAA 1HTTA 1OFHA 4Y1GA 1OV4A 1IK4A 1E79D 3C3BA 3NW9A 4J16A 4QQKA 1CTQA 4M1MA 4HAOA 4BWYA 1E2GA 5CBPA 2PUGA 2NGRA 5JQGA 5CBPB 4IGEA 4JLDA 3IXMA 3ABZA 5JQGB 1K5DA 1QH8A 3FZNA 5I5EA 3BM5A 4WX2B 5KNDH 1E0KA 1QH8B 4IS3A 1F51E 4RY9A 1MJGA 5EWMA 3GEIA 2X9VA 1BVHA 3HZOA 4TWJA 4MUKA 2CF6A 4XWTA 3HBJA 3WOHA 4DBZA 4PYJA 1IN1A 1E1QD 2QVLA 3AI3A 2P1DA 3AF0A 4LJ8A 4DADA 5CA0F 2VTBB 1UC8A 1YDEA 3O1JC 4JJFA 1C80A 1SVNA 2VHVA 5FWAA 2FZKA 2YRWA 1FDTA 2OXTA 5C8YB 1Q14A 2CNWA 5CVTA 1AXGA 4O4IA 1N3YA 2RGXA 4UTNA 1O3YA 4R68A 4PPGA 3GA5A 3UOAB 2FDCA 2AOUA 4KR6A 3BBPA 1OVMA 1ZK0A 2AOUB 2Q46A 3DH0A 3LGSA 5HKAA 2WIGA 3GBSA 3RKSA 4C0HA 4RK6A 2GH1A 5I7FA 1I7LA 1H94A 5KOIA 2WVJA 4LDRA 2VNSA 1GG8A 5G0UA 1HDRA 2XB4A 3E22A 2XUZA 3OY7A 4MOWA 2PIDA 3NANA 3E22B 2ALJA 1JHDA 4KAJA 3ZE8A 1P4RA 1GTMA 3WVNA 3HM9A 3R6WA 3CURA 2PXCA 3DDZX 4EM6A 1T8WA 4Q4CA 3KR1A 4MYDA 5JCJA 4AZ3A 5CCDA 1L5VA 3BXFA 3ZLVA 4AZ3B 4URWR 2JGAA 5A0TA 4CKZA 4Q4JA 3RFXA 3SNHA 2HADA 4FW8A 2JCXA 3X44A 4Q4JB 1KDVA 1NDQA 3OE1A 1V0JA 5E7MA 2G72A 3AUTA 1USIA 5EXDA 4LZJA 1W49A 1IZ7A 2PZ8A 4C08A 2W2QA 3NC4A 3RS3A 2GD2A 4MGIR 3KZ1E 1P1BA 1SUDA 3QXHA 1LSOA 1G8SA 5EIAA 2VDQB 3GH1A 3T3DA 4CKBB 3GRVA 4YIHA 1AB6A 3EY4A 1CDZA 3OWXA 4HAWA 3FOZA 1MO4A 5JAUA 1LH0A 1QC5A 4RMJA 1QC5B 1EFRA 3AG6A 4K9QA 1RJWA 3UJ8A 2FJ0A 4YAEA 4B1FA 1EM8A 3GDGA 3P5BA 1YE5A 3IOYA 1TPZA 5IVIA 1EM8B 2O6LA 3ZQJA 3BQ9A 1QOQB 1ZMBA 2FRVA 5GV7A 3CC8A 3TEJA 4XR9A 4ES6A 1R18A 5ITSA 1E9BA 2V5AA 3LPNA 1WVGA 2LBPA 4ZMBA 1SVUA 3PTAA 1E5LA 2K2WA 2RC5A 4HUQA 4I4LA 1X8XA 4HUQB 5YASA 1BO6A 3STXA 5IKMA 3M6WA 3EEOA 2Q6IA 3C48A 4HY3A 1DAIA 3SD7A 2WJIA 3R5KA 3S8YA 2XRMA 5BRAA 1WNTA 3ZZNA 1RJFA 3IKVA 3I58A 1CSEE 4K6GA 1U2SA 3QNMA 4JYCA 3QRWA 1YZHA 1UJ2A 2WF5A 5JSUA 5D87A 2CFIA 1Z16A 5J59A 3RT9A 1AGYA 1PT9A 4UHDA 3T41A 4S12A 4AS2A 1ZINA 1VKNA 3OPYI 4KUHA 4UFPA 5DU2A 1N2SA 2P4EA 5I6DA 3HFRA 4FX2A 1Y9ZA 1U1CA 1T9GR 1IJKA 4C22A 2ZRBA 4QASA 3JR3A 3D8SA 3FPAA 3L0YA 2A2ZA 4FIZA 2NU8A 3R7AA 2A3NA 4R2KA 3RWBA 3TXXA 4C4PA 1JSLA 2V55B 4JI6B 1SULA 4S1VA 4Y9UA 4WH0A 3OP4A 4XM1A 1Q6YA 1NJ8A 5F4ZA 1YIOA 3WSVA 3W5UA 2PS0A 4MTLA 3G9TA 4YA6A 2IW3A 3MINA 3FVVA 4MA0A 1R10A 3MINB 3ONEA 3CH4B 5A0VA 4MGYR 4EARA 1VB5A 5L7YA 5EJ8A 2W8BA 2H17A 4JXKA 4KH1A 3LXUX 2CNBA 3WQHA 2YFQA 1HSZA 3M8KA 2CLDX 1LSUA 4UBIA 2FWMX 4WCVA 3F74A 4YMSA 3O82A 4OI1A 4ZZ1A 5C8XA 1PR2A 4L4RA 1AGNA 5EUQB 1BS1A 3QV1A 3FPBA 5C1DA 2B99A 4FUTA 1GL6A 5CXSA 4J49A 1BEUB 2CVFA 3RHSA 5G0SA 5KHAA 2MSDB 3I64A 5I9SA 1QQ5A 2WD9A 2HAEA 1C7IA 1NOIA 1WMEA 2LV8A 5E4FA 4KMSA 1UDRA 2BMJA 2XGGA 1SBQA 3WK9A 3CN9A 2YWFA 3STYA 3VM6A 1B74A 5D00A 1C0EA 1QYDA 2CMHA 3FMPB 3DMGA 1YR1A 1AKVA 3I4CA 4J3NA 1R3UA 4OVKA 5EESA 1HDZA 4HDKA 4JSYA 4F6RA 1TYEB 3OCCA 3PQ7A 4G8BA 1UBMS 4HDKB 5EERA 5EYPA 4F6RB 1BQ4A 2GF0A 1ACMA 4JK3A 1GCUA 2C84A 1P7WA 3DEKA 1Q1GA 1CRPA 4UMVA 3T34A 1XTBA 2Y27A 3B7PA 4DCNA 1QIFA 3N8NA 4C3UA 5A9RA 3W5VA 4UUMA 3HNRA 2XSZA 4DV7B 2XBUA 1CZLA 2HZ7A 3OOEA 2D1QA 1K7XB 1Y3DE 3K7EA 2R85A 3E7DA 1Q7BA 3NAMA 2VUSA 1PGPA 3V33A 1Y9EA 1SWVA 5IANA 2G1AA 1VLZA 3DF9A 2EWVA 2QZ4A 1Q0TA 1EGVB 3RYFA 3FNGA 4DV3B 1IEQA 5D3ZA 3RYFB 2R6ZA 2WILA 3BAZA 3G89A 1JEJA 2WTAA 2Q1XA 2FSFA 5JANA 2HH9A 3PRYA 3SKYA 1UDCA 3PHIA 2ONJA 5AIBA 3A6GA 3P19A 2Y99A 2ZJ5A 2F3UA 4DNQA 4EG3A 3B1VA 4LXYA 1DBWA 4NZMA 3IJPA 3KPYA 3M1AA 5ALZA 1R0BA 4Z5XA 1L5ZA 1DO2A 3L8EA 1EK0A 2ZR0A 5L4LA 1LW6E 5IX8A 3PZBA 3C8MA 3KB8A 4UTVA 1RIIA 1P77A 2Y1KA 3Q72A 4BE9A 3E7XA 4MX8A 3VR5D 3FPKA 2ODTX 3O31A 4EUSA 5JCXA 4IJQA 1M0SA 1M8JA 4KMMA 1VPDA 5TQVA 3CRVA 2TMGA 3IVMA 2CLCX 2AQHA 2Y1GA 1Z08A 2ZM5A 3F2VA 4NYJQ 1XYVA 3O9VA 4YJ3F 4KXNA 3AC0A 5AI9A 4D4LA 3LFTA 1HDEA 1UBTS 1QGOA 2H31A 4H15A 1NMQA 4MV9A 3EUAA 5IM4A 1WCV1 1NMEA 1RRVA 4F46A 1MTOA 2ET6A 4C2TA 2B82A 2AOXA 1Z4PX 3GEGA 4YV1A 4Y18A 3OQPA 1OI4A 4O2AA 1XMPA 2CNLA 3QJYA 4BLVA 2MIIA 3RS5A 4O2AB 2IS6A 2M9MA 2Q3FA 2ZUEA 1T8YA 4OBWA 1PZXA 2L2QA 3GH3A 4QOEA 3V48A 4F3TA 2J3JA 1TVKA 3FNQA 4UDYX 3S0JA 5ALFA 1TVKB 3NAZA 5EZSA 3REGA 2XZLA 3HY3A 3K72B 2JAHA 3DHVA 3NKVA 4FI3C 4DA4A 4GDFA 2C97A 2EKZA 3FR7A 3KTFA 4GEGA 2R7NA 3RIMA 1JR3E 3VI3B 2GM9A 4LV5B 2IUUA 4ZN6A 5A03A 4ZCLA 2XEXA 3LKZA 4DLWA 3MD0A 4B6EA 2VKQA 4H18A 4UREA 4X8LA 2V65A 4ID9A 5BMOA 2O8DA 4HQ0A 5BYKA 3M6XA 3IEPA 2O8DB 4XTCS 1PFUA 2B1RA 4TL9A 4EYQA 1NJ2A 1MORA 4AYXA 1SMKA 9ABPA 3P97A 3PFNA 2I6GA 3HV2A 5SYMA 5FOTA 3RGWS 2AK3A 1Z15A 4MJ7A 1WOMA 3OIGA 4NULA 5AVJA 4DCVA 2NTYC 4CIWA 5E9WA 3ZY5A 4Z51A 2XCQA 4ARAA 3PXBA 3OZDA 1VL2A 5LYJA 3F46A 1JR4A 2I1WA 2FN3A 4W63A 2ZS8A 2ZB2A 1G21A 3TMYA 1NXOA 2EFHB 3AF1A 3CZCA 1RAGA 1G21B 3RBZA 3V4SA 2C4MA 3MPOA 1L3IA 2Q5HA 2VHTA 5KQGA 1JSRA 4D9JA 2IH2A 3BWMA 4HFNA 1X1TA 3F6PA 1XU4A 3RPEA 4GAEA 1XCBA 3PVSA 5KAMA 5AP9A 3DOIA 2E4YA 3GBPA 1HEYA 2ZBEA 4NHOA 3AFMA 2R3SA 5HQJA 1A0OA 4Q5IA 1HRKA 3PNMA 3SKXA 3LCRA 5F73A 3JQFA 3BA6A 2O4CA 3P0JA 1FVOA 3N75A 4I9NA 3D3EA 3L7CA 4O4JB 4L95C 1TKAA 1XB2A 4LSWA 3TI7A 3W7AA 4BKPA 2Z56A 3MLAA 3VTZA 4EUKA 3UHPA 4N7BA 1IUOA 1IWBB 5THQA 1ZQ1A 2HF2A 2YASA 2AFRA 2VA8A 1HEIA 3EXHA 4JU8A 3VHXA 3MZ0A 3GFFA 3VHXB 1RFLA 2HSDA 1H69A 3BKXA 4MV8A 5LKAA 4M1OA 1UC4B 3SQMA 1EK1A 1JFVA 1F8UA 2FWBA 2P2ZA 1DL5A 2FZGA 4WZZA 3UKJA 5C4MA 5KYNA 1QSGA 1VBKA 3CRQA 3FTNA 2J1LA 3FUCA 2OBLA 4D3SA 4F92B 1Z2DA 4C0AC 4ECEA 5J4VA 1G7SA 1DFGA 1DBQA 2ZUVA 4U5XA 4C7OB 5TPZD 2AHRA 3HL4A 4UTPA 3ZZMA 3LTNC 1KYZA 2BL4A 4IIHA 4RL4A 4FCVA 3T5AA 1SXJC 2G09A 3GJZA 1QHYA 2VPIA 3DLBA 1XEAA 2D3WA 2VDUE 3G0BA 4LWZA 3ZGOA 1KZ9A 3E8MA 3ICCA 5KSPA 1NUAA 3ADDA 5CX4A 3AHIA 1CKEA 3LWZA 3AI7A 2VDNB 1CVIA 3ROTA 5I5GA 4X20A 4OK6A 3EVTA 3PDCA 4X20B 2FQYA 4R54A 4C0WA 2X22A 1BW9A 1Q7RA 3PCRB 4ESVA 1BW9B 4R0VA 3UMVA 3A1WA 3ELDA 3AHDA 3NWPA 4BCCA 1NXSA 2P3QA 4LHVA 2L18A 3VBCA 1J1IA 1WY7A 2BGRA 1QX4A 221PA 3DKVA 1ZO8A 5EIWA 1BHO1 2SCUA 1CJUC 2Z9BA 3RU9A 5M29A 5LQJA 2YHBA 5FWDA 3ZJUA 2SCUB 3DS8A 2ZATA 2G1PA 4B3RB 5AH0A 4MYCA 4AXXA 3UAGA 3G85A 2ZRIA 1BU8A 1TFUA 4RH0A 5FOUA 2DXIA 2CSUA 3OPMA 3LYLA 4E14A 1T2DA 3Q9LA 1TYCA 2SICE 5KC8A 2EW1A 4N5NA 1KWGA 4KEAA 5FCDA 1B0PA 3D5TA 1EK2A 2ZBQA 3HI4A 4M46A 2OORC 1K89A 2AN9A 2F7SA 4GL2A 1TIBA 4LGVA 2VTEA 1JQBA 1MJNA 1XTTA 4WBSA 3UG6A 4BQIA 3TB6A 5B30A 4C87A 5JNVA 4R1TA 1NXWA 3CIOA 4JVNA 1MIHA 1DCFA 3FYCA 1OC4A 4E6EA 3QU7A 2PZEA 2CJYA 3DDWA 3A11A 1PN3A 1S2LA 3R0VA 2Q21A 2QMUA 4YNBA 1B15A 3QUSA 1CJMA 1L2TA 4LSMA 5CLJA 1ZMTA 2J9GA 1NTOA 3P9YA 1WLSA 2Q5IA 4BZZA 1WDKA 5K8UA 2QTZA 1C1HA 1I3CA 2PO5A 1DRWA 1N6PA 2A5YB 2X4IA 1A4RA 3MAGA 4DR1B 2C7GA 1BS9A 2BR3A 2Q1WA 3HJTA 4PLHA 1FS4A 2VFAA 3O92A 1Q12A 3KT3A 4EG8A 2QN7A 5DSTA 3L8YA 1NLFA 3WJ2A 3QVSA 3R40A 2VRWA 3STTA 1H6BA 1NUHA 2FLWA 2PBRA 3U4CA 2R1UA 1CXZA 2R1TA 4WKOA 3G59A 2PGXA 2FX2A 2R1TB 1G8MA 3EC2A 3BFPA 3OZ7A 5E8JA 1TKCA 4DGSA 1J56A 3OU2A 4TYMA 2WWYA 3KKLA 5DNWA 4KR3A 4BNNA 3RKUA 1NSFA 4YP5A 4RA9A 4JP1A 1N2XA 5H83A 2C83A 1Z5WA 4OAPA 5ARCA 5JBIA 4J4HA 2WDZA 5AFSA 5EIXA 5J2UA 2W42A 1IYZA 1N0UA 1Y1KE 5LOVA 1C0LA 5J2UB 1ZD8A 4BN4A 5LOVB 1UJNA 2BF7A 2NXCA 3NWOA 3RVNA 5KTOA 3EODA 4B3TB 2WSSA 3PLRA 5FTWA 1W29A 3JZIA 3EJ6A 4GYWA 2EATA 4WMLA 1XG5A 1ZK1A 1M6EX 4LOAA 1RI3A 1TTPB 4UDNA 3T5TA 4AVYA 3CMMA 5B3KA 5EAIA 1QF6A 3D6JA 5GVRA 2GN6A 2J0QA 1KKMA 2XD4A 4ZK2A 3BZUA 4Q00A 1U2RA 1RPNA 1NW9B 4LVCA 5FOXA 1VL1A 3E0XA 3P2JA 3VA7A 3HI6A 5ESXA 1CJCA 2ZJ2A 4UVHA 2WF6A 1KO5A 3D6UA 4EVIA 5EPOA 5DEOA 2AI3A 1V95A 2H2DA 2VVTA 1BGXT 5AJZA 4J0CA 1E9AA 1OFUA 3QE0A 4P34A 4PR3A 1MC5A 4Y0VA 1QP7A 3HZZA 3IXQA 1L1FA 3GRKA 2CE7A 2HJSA 4I9HA 4JBXA 4ZJPA 3C8ZA 4DHWA 4ZKEA 4C7OA 2WAYA 2JI6A 4NCHA 4AJ1A 2R65A 3HKCA 3WKAA 4Q9JA 4LX0A 1SK8A 2E6KA 3HKCB 2UZ0A 3IV7A 3OFVA 3GYGA 3HC7A 3BJEA 1NVTA 2VWHA 4QUEA 1KDZA 4YRCA 2JFVA 2VXBA 5K0JA 1K7EB 1RYBA 2HRDA 1EJBA 3WFJA 1DIHA 4DMHA 1U3CA 1FTWA 3NALA 4PE5B 4A0RA 4EO9A 4ENWA 1K66A 1R6DA 3ZCUA 5HF6A 1V16A 5SY6A 1XTKA 1BFDA 3LF1A 4DQUA 2G9UA 3HJFA 3FNIA 4GZ6A 1A77A 5IVKA 1NRWA 2DFDA 2ZBRA 1T4CA 3D7LA 3WMGA 2C4VA 1T4CB 1UBHS 1D6NA 3KCQA 4TQ9A 3RVRA 4FHEA 2HU5A 2IU0A 4RDXA 2I67A 2DCUA 1D0IA 4JL8A 4CE6A 2XH8A 4CEIA 5BT8A 4CMAA 4G1EB 3HA5A 5EP2A 2W6JD 3W3AD 4CEIB 2NAPA 4PXYA 1WETA 1TF2A 5BN5A 3HMQA 1K97A 2OO7A 4E2FA 3B9BA 5BN5B 1CUEA 3BUSA 3O1HB 2ECPA 5CLLA 4RTQA 1QO7A 1BRMA 2WD8A 2HL6A 2J0EA 3QMPA 1Z37A 5LQUA 1S6YA 3K4PA 3R3YA 1N1DA 4O59O 3DCJA 1P6QA 5IFKA 2QGZA 5I4BA 2QS9A 4LNUA 2IL1A 1JE0A 2X40A 4LNUB 4QHSA 5D3QA 1IM2A 2BHTA 2WPDD 1MA3A 1QQTA 3MT0A 1XQ6A 2IYQA 5IVDA 5KHLB 4HXFB 3OBBA 3LDAA 4DRYA 2A5LA 1L4KA 4PRKA 2XF2A 4HWSA 4IJMA 1OFGA 1U7HA 3L7NA 5DXAA 3F6SA 2JGJA 2VF2A 3EQ6A 4LQCA 4YJ2F 3TE6A 5K8VA 5LKRA 1JHVA 3EXIA 3LY9A 3MHTA 4R5HA 1E3TA 4ARCA 3EXIB 1A27A 3QVMA 4FMPA 1S02A 4CQMA 1EVIA 1ZN2A 2FPWA 1Q0HA 4C76A 1II8A 4PG4A 4W8GA 4CQMB 5I7EA 2A7QA 1II8B 3DR3A 2XCOA 3FPHA 2C7BA 1H4SA 1CY8A 1PT7A 2PR2A 4WCFC 1Z4QA 2WZQA 3IEVA 1NF8A 1R6UA 4LHSA 2HDWA 2VK1A 3LTEA 4BFXA 1KO4A 3O9ZA 2WUDA 1A9QA 3BWXA 1XJCA 3GAZA 2W98A 4ZPXA 5J5VA 3RYTC 3IEKA 5ALSA 4B84A 1T2EA 2OMEA 3WGMA 5BW6B 3BMOA 3URKA 5GAJA 3HL0A 1CERA 2HMUA 3OJXA 4JL6A 3WGYA 4B17A 2I34A 4OX9B 3QPWA 2RH8A 2CHEA 4AP9A 4WBNF 3DTYA 3BGIA 1OAKA 1QM5A 2IP4A 1VIVA 2ZZMA 4E6PA 4RK4A 1URPA 1XRLA 4URHA 1C9YA 2R00A 1CP3A 3LBYA 4M8SA 3OQMA 4QREA 5KPDA 2XWJI 1R0KA 3ZZTA 2HNAA 3P7MA 3BH0A 2I9PA 3PNKA 4IFEA 3P0HA 4MYTA 9ATCA 3RIHA 1TC1A 3FAKA 4Z3OA 3IE2A 4M49A 2KBFA 1QIDA 2ZRNA 3IPCA 2PWZA 1NA5A 1HDCA 2FUG6 2WLSA 5JPIA 1K06A 4Q6BA 4R2HA 4KB5A 4LRWA 3VPCA 1GUDA 2GBLA 2B1JA 1KTIA 4BDSA 3UB3A 5F9FA 1G3MA 1P7VA 3J81k 1FY2A 5F23A 1W5SA 2XCUA 4O02B 4ZO8A 2GN0A 3VSEA 4YIKA 4WY8A 2I76A 1HNNA 5IWAB 2JIOA 3ABOB 4HQFA 1AQJA 2IY7A 3W05A 1DJQA 1HC7A 4NPAA 3MEQA 5GM1A 4U2DA 4RWEA 2IWHA 1OYWA 2ZVPX 4LC9A 1C1XA 2Q50A 1D2MA 2Q5QA 4KQKA 4OJYA 2M32A 4PGGA 1RXYA 3GJ3A 2LIPA 1XJQA 3G5UA 3PGKA 3O3OB 4DKXA 3ZDQA 5HG0A 1N0WA 1UFRA 5TY0A 4EA8A 2AS0A 3AEXA 5TGDA 3EIXA 4ND8B 4UUPA 1MO5A 2N0SA 3ZVLA 2DERA 3SZ3A 3T4UA 3KOMA 2H08A 4DMCA 5AW6A 4IGAA 1T9DA 2FMFA 2PBLA 4H7IA 1PP4A 1K1EA 1SXHA 3PUHA 1VDMA 1JDVA 1E2IA 1PJRA 4EG0A 121PA 2X0KA 3MN1A 3WHIA 2R87A 1QGUA 2ZTMA 5IM5A 4B44A 1OLSB 2GZAA 3Q3JB 1QGUB 3QBVA 1P3Y1 3P2IA 1FTSA 2P2SA 5KOJA 1P9WA 3C0KA 1ORVA 2X8BA 3CJTA 3OZRA 4A2PA 5KOJB 2BBWA 3FUXA 4ZV4A 3F78A 2XECA 2BM1A 5JZ9A 1DRJA 1AUXA 3DNPA 3E9EA 2Q7DA 1NNLA 2RIRA 4IF4A 1RBZA 1WUTA 1FS6A 3VPBA 1GT6A 5IDXA 3TUJC 1HTBA 3HGTA 4BMSA 2OP0A 2BKVA 1KRHA 3A4TA 3RS9A 4HWTA 4D9KA 3N39C 1PJZA 4PEVA 3GFRA 4F97A 4FFSA 4FFNA 5F64A 3T6KA 2QSJA 3NIBA 1Z73A 3LOQA 1T6BY 3TQQA 2ZBUA 3CH5A 2J41A 4L5CA 1FYVA 2X2OA 4RW0A 3ITEA 3VPAA 3B1YA 1ZLYA 4R1NA 1CP2A 4UNRA 4DIKA 1B3BA 2QLJA 2WF7A 2ZBFA 3P2EA 4L0CA 1N4AA 5JZSA 1KEZA 2V7TA 3GZ4A 2YNMD 1Y7TA 3M4XA 3VR4A 5DSZA 5INTA 4CLHA 4DV4B 1GFSA 3WZ2A 1GPLA 3KE8A 4ITUA 4I1SA 4E3WA 1IQUA 1MZVA 1PE0A 3DMRA 4KV9A 3IAUA 5CPFA 1Q3HA 4UDOA 5A5VA 3W9SA 2WM3A 1AJEA 3MMNA 4YMIA 2LPMA 1IJFA 5B53A 4EQZA 2PSEA 2BCEA 1DDIA 2UZIR 3SEFA 2XDQA 4MW4A 4CCWA 2W2KA 2I4OA 2XDQB 1X70A 2JGDA 2QRKA 2ZTLA 3KYCA 2QG6A 1K2VN 1FP1D 2HIHA 2JGDB 5TVKA 3DCYA 3WLKX 1UKZA 1IJEA 1UF9A 2G0AA 2GPAA 3CWCA 2OESA 5ER6A 1UDXA 1M8KA 4PICA 1D0SA 1EWRA 3CGGA 1ADFA 1BOFA 3DC2A 2B9EA 3JQAD 4H7PA 1KVQA 1TA0A 1VJDA 2D2XA 3CXUA 3ILHA 3L77A 4L9RA 2P0YA 2O1SA 3U61B 5AR1A 3RG2A 4BO5A 3KKZA 3TNDA 5B37A 3GGPA 2R0QC 4A8HA 1VKZA 4Q01A 5SZJA 3D7KA 4WXMA 3RCBA 1SC3A 3RUAA 4OHYA 1A1SA 4HB0A 5ITZB 1YC2A 2ZIUB 1Y3IA 2H29A 2IIPA 3JPYA 1TI7A 3OOYA 2YDXA 2VBCA 1CUAA 3K0BA 1N2CE 4UTXA 3W2TA 4TUYA 3HXMA 1OBHA 4TUYB 3BK2A 4ZVLA 1NW3A 1L3CA 4CJXA 3S5UA 1JLLA 3D3NA 3PXEA 2H5IA 4J07A 4Q21A 1L8AA 3AJ8A 3BCRA 2DT5A 1CR0A 4UBJA 5E7QA 5FFMA 3VZCA 3BRWA 1PVDA 4QJ3A 2H4HA 1F8FA 2RHMA 3V3TA 4P4SB 4H1HA 3H84A 4GI7A 3AT1A 1BHJA 2ACVA 2BDUA 5DNAA 5CDSA 1NV9A 3GLKA 5DULA 3WISA 2BCJQ 4CU2A 4MVXA 3QKSA 5FUQA 3EG5A 3WGIA 1Q57A 3QKSB 1WULS 1QZZA 1RW4A 3I8OA 1PJSA 1GZ4A 1O5TA 1GD1O 4XLLA 2C9DA 3SHQA 4D6XA 1K8XB 1NI5A 4I8DA 4PGFA 3RB8A 2ZE6A 2ZUFA 4AMBA 5CVUA 4PSKA 1GAEO 3CO0S 1NT4A 3CRZA 5ALGA 4RD4A 2QE7A 1YB5A 3J80A 3NBFA 4PWZA 1E9RA 4UVDA 4EF5A 1YA6A 3OMXA 3RUCA 4IIXA 4BX8A 3WNVA 4RPLA 2HUPA 3SSNA 1B0AA 1EZ4A 1IEXA 2X5KO 4OQQA 3QX3A 4TT8A 1IWOA 3JSXA 1GP2A 3ISVA 4RHCA 5THXA 5FTJA 1MNQA 1T0UA 4LXIA 2QMQA 3EEQA 4EFNA 1I7SB 3QHAA 2G77B 1DG9A 1J22A 1SUSA 5D7BA 3WB0A 1P4GA 3NATA 5DWQA 3UV7A 4B4UA 4CW7A 5K0CA 4MA5A 5JJLA 1N6OA 2VSOA 2XTJA 4LQ4A 1T9CA 2PEYA 4RJ2A 5EUMA 5L51A 2VAMA 3M2PA 1PQPA 2WTNA 2Z1NA 2PLFA 4LZWA 4CLRA 4K3UA 1E1NA 4DS3A 4CLRB 5IAKA 1HLGA 4I8IA 4CEHA 1ORRA 2A5JA 3ES9A 3AF5A 4JSTA 4H1WA 1EVLA 1G55A 4CEHB 5B7NA 1FYWA 4G5OA 3V7UA 5CB4A 3UXHA 4ZMRA 1XEXA 2VQDA 5KWVA 1JXMA 2V7UA 2D1YA 2H00A 2VR1A 1XEXB 2XQKA 3PDHA 1FPQA 1YTLA 4GPAA 4RAQA 1KRWA 1VYTA 3TOSA 1R5OA 3MD9A 4GLBA 4EYGA 1J8QA 1XI2A 2EQAA 4NESA 2OV3A 4GNKA 1UFVA 4C20A 2RKOA 1ODSA 2VJNA 4AP5A 5C1OA 3D6HA 2WKRA 5T8KC 2AJDA 2YQ5A 3LCCA 4UTOA 4JYZA 1NKVA 1NC1A 1X80A 1YJ5A 4RY0A 1OZFA 1X80B 5FJIA 2FG6C 1V5EA 1YVUA 5ILOA 1P0MA 1GRVA 4JC8A 5H9VA 2R6DA 1QHEA 2N75A 2Z4SA 4J9UE 5E1BA 1GGVA 3KSUA 4J1TC 4L28A 5DCUA 3GXBA 1G19A 2VUHB 5T4HA 2O9JA 1RRCA 4LDQA 2C29D 1W44A 1K7YA 3PQCA 1J8YF 4CIYA 3KSDO 1J25A 2GEDA 1JYFA 3PNSA 3RODA 5D51S 5AVZA 5CYOA 5AKKA 1X9HA 1VCHA 3AHEA 4RQTA 4DDMA 5IFLA 3OJ0A 4EHHA 1AH2A 5LJIA 1JJ7A 1QB7A 2ZRAA 5FPPA 3BJIC 4FHCA 3RRZA 1A82A 2A58A 2ORIA 4IIDA 2AQ8A 3EVEA 5D85A 1I8TA 4GBGA 5IC4A 4TVOA 1R3DA 1T9AA 4MJXA 5UKDA 5IXSA 1LQTA 4YC7A 1SG0A 1BMFD 5D3KA 1I5RA 4G41A 5JCOC 4ZODA 1JZTA 2B1QA 1S1MA 3K1YA 2IDJA 3K2BA 4DVGA 5BWLA 3SR3A 2A57A 2AVDA 2VNJA 1ZD5A 1OH7A 3L8MA 1JLSA 1A9OA 2BHLA 2PRZA 4YMLA 2QP9X 5H02A 2RBGA 4RPJA 2ETVA 5K3EA 3GLQA 3VU1A 5DYWA 1FJGB 2XGJA 3I5MA 4LSZA 1V4NA 3A4VA 2VJYA 4JI7B 1ZS9A 3W6UA 4OQPA 1SB8A 3ZV7A 1TVEA 3PE3A 3VDXA 2YY7A 3P2KA 2IUYA 4CL8A 4DJDC 1DX4A 2YJ3A 3NIDB 4X7RA 1SKYB 2X4LA 4K86A 1EK5A 1S89A 2EF1A 1HGXA 2PRJA 2C2BA 1ABEA 1AHIA 2W6ID 3EUEA 4C6HA 4ZTZB 1HG1A 3G0IA 3Q9NA 1VI5A 1SY7A 4N5HX 3TTWA 5JXJA 3K16A 2JFOA 1KFJB 4O5AA 3FCCA 4D8TA 3HACA 4JB2A 3PQDA 1XMVA 4BZXA 1QOZA 4KXYA 1PR3A 4LZLA 4N9QA 1B8NA 2OWDA 3B82A 1THZA 4K9NA 1SQSA 4M9CA 1PUJA 2BFFA 2YRFA 2RSLA 3CZ5A 1L4MA 3HU2A 4MVJD 3GUVA 2BFFB 3G68A 4RIEA 1L7XA 3D5QA 4X97A 2FPIB 3TBKA 4XD7D 3R09A 3ON5A 2NO7A 2A5DA 3IUEA 2A9QA 3TD6A 1E3LA 3IEMA 3E8XA 5MN5A 4YJHA 1I4EB 3IJ5A 3NBMA 4YJHB 2Q5OA 3W2HA 3H4TA 2HXSA 3HN6A 2A9OA 3GDWA 1NY6A 1NX6A 3C6QA 3Q88A 2B3TA 1EFPB 3CCFA 4BNMA 5M5BA 2QBYB 1UOPA 3DWGA 1SUPA 1BWPA 1T9KA 3CKLA 1C8BA 1Q16A 3U4GA 1NG1A 4DWWA 5HR5A 1WXWA 3IR6A 3PD0A 1DKNA 1L7NA 3C8HA 1PR6A 3MOIA 4ALKA 3MA0A 4KAAA 4KJXA 2Q4RA 2QLBA 2FZLA 2AVNA 1LS1A 3CPHA 4MCAA 3GRYA 3PFCA 4RZQA 2BUBA 4FZVA 3EW9A 3TEMA 4E4TA 1UH5A 1E5TA 5F51A 5BNIA 5H70A 1K98A 5FR2A 1US8A 3KAJA 1G3RA 1US8B 2AJCA 1L5NA 5ESRA 2VJCA 4Q7JB 2ZCJA 4CBVA 3NHYA 4GLJA 2OECA 4OGFA 5FFNA 2R48A 4F2HA 2H06A 3TGLA 4KKVA 2CLHB 3Q3GE 4G1FA 4XVRA 4RE6A 2ZDHA 2NO1A 2X9GA 2Z5FA 4HBZA 4Q1BA 4CV1A 4BP3A 3JYNA 4CF5A 3MMZA 1D4AA 1RI5A 1WPQA 4MVJE 3UUWA 1E63A 2C5SA 4GPTA 3UUGA 2RK6A 5JSHA 5JSZA 1YBAA 3OLXA 4MGZR 4YRRA 5AK0A 4YXFA 2QUAA 3IAXA 1G16A 4YO8A 4ZEWA 3OZTA 7GPBA 2EFEB 1UADA 4RTRA 3CW8X 3PPWA 2J7KA 4LOLA 5KJCA 5BMVA 3RS7A 4A1OA 2VA9A 2C2YA 4KH0A 4MVYA 5BMVB 1OXMA 2AR7A 2V54A 2XYGA 1TGVA 4A6XA 3KTAB 4ZCRA 1IPFA 1JB9A 1L9XA 1F2VA 1XRQA 2FKAA 3TRDA 4NARA 1H9AA 2A59A 3G2KA 5LXTF 1YT5A 1KMQA 3HY6A 1U6KA 3BTSA 2IPLA 4FYMA 3F3KA 4IQ8A 1XMIA 4DUGD 1VMKA 2QRLA 1PNRA 1AD2A 4BKUA 1ZVVA 1IUNA 2HQBA 3M5PA 4KXWA 3TLMA 1X77A 4R7TA 1CS0B 1SUBA 1U0NA 2HU8A 1K7CA 1AXRA 3DFFA 2BHRA 5FPSA 3DEFA 4B75A 4IKOA 5IDVA 3AY7A 3UYKA 1NG9A 3SOPA 1D6SA 4CV3A 3FNBA 3P94A 1F0YA 1U7DA 1E96A 1QVWA 4JUIA 4OHWA 1GADO 3LA8A 2JGKA 1T2AA 3G2JA 4RESA 2ZSUA 4YRAA 2G6BA 2GHIA 3S2SA 1K0UA 3EGXA 3HDQA 3T7RA 1WQ4A 3QWIA 3ZE6A 5BR7A 3EGXB 3ZK8A 1A8SA 3CUVA 1MV5A 1Z2OX 2PL5A 3SDSA 3VJRA 3I05A 3ID6C 3QBTA 4LEIA 1E7QA 4LXXA 2Q6OA 4BNUA 5BWCA 2HB6A 4PBTA 3FSRA 4NPCA 4OI2A 2HT6A 2VZEA 1R0RE 2X6QA 3P2OA 4NH0A 4YXWA 5JTTA 1KVSA 1RBQA 1GU7A 1ZHHA 2V8BA 3JQBA 4RHTA 4I4NA 1ILEA 4K0KB 1COWD 4BQEA 1EYZA 1LK5A 5DW3A 5BSGA 1M2VA 2YOGA 4IIFA 4PC7A 5DHUA 5NULA 1M2VB 2BAGA 4FILA 5JLJA 2BM9A 1QB8A 3G0HA 2IEBA 3WGOA 2PGAA 4BB0A 4FFLA 5EJ7A 1R88A 4GP6A 2RHOA 2ODQA 1X8LA 2CXOA 4MITA 2R4QA 3DCIA 5FP0A 3CEPB 3H7IA 1PO7A 1UMKA 1WZEA 2EZTA 3ZNOA 1NQ5A 4FONA 3M7IA 3PEVA 4RIGA 4ZYLA 4I1YA 1M34A 2BKLA 4O08A 4QHYA 3YASA 3B1WA 1RM4A 5F5NA 1UWLA 1SB9A 4QTUB 3LU1A 4L78A 1MJFA 3NOVA 1ZM9A 3CM0A 4CMCA 1JKMA 3KQWA 4AJ4A 1NQWA 2FR0A 2Q2VA 5AW1A 4XIIA 2ZB7A 4XFJA 1VL0A 2CCJA 1NN0A 2Y1CA 3D2BA 2IEZA 3QOWA 2XE4A 2YVLA 2KX7A 3FKJA 4EY7A 4QM7A 4L9AA 3CLRC 2OA0A 3UATA 2RB4A 1KJZA 3LOPA 3WLFA 1LBEA 1SHTX 1FF9A 2JH8A 3H87A 2JG3A 2JEYA 3N0WA 4BCBA 1T13A 1YB6A 3KSMA 3L46A 1HTWA 2OQVA 4DV2B 4OOFA 1D7OA 5JRZA 3IHWA 4V2UA 5JFGA 3AIIA 1EQAA 1DTEA 2EGHA 1EGAA 3BHIA 2NT4A 3RROA 1GR0A 2XCRB 2AG1A 3NBXX 3QLEA 3CR8A 2GEJA 3VYUB 2FUNB 1LLUA 2PRSA 3CH7A 3BF8A 4DCJA 2BD0A 3OHSX 3OU7A 1Y34E 3L82B 2PSDA 1DMSA 1TM5E 2DQKA 4MUNA 3RRJA 4EGSA 2AB0A 1I1NA 3DKPA 3Q7SA 4YTEA 1XQ1A 1Q1EA 1A7JA 2ZJ3A 3ZGXA 4HDOB 5AI8A 1HE3A 1GZ5A 1H1DA 3DG9A 4GQBA 2JPDA 4QEDA 1O6BA 2PX5A 3S2YA 3ZV3A 4YRZA 1XKTA 3ZU3A 3D8TA 1X7WA 1OREA 5JAZA 1X7WB 4MW0A 1OROA 4HQLA 1V8ZA 1LDMA 3ILSA 5JE8A 5C8YF 3ND9A 1DAOA 4YI5A 4PPFA 3RIGA 1UXIA 4G5YA 3C5VA 4PCAA 2DTDA 4CU5A 2W6MA 1FP7A 1ZR2A 2O6HA 1UWCA 4B3MB 1GYRA 3NNSA 3DFZA 3SR0A 1C2TA 1MAUA 2QTFA 3RSGA 5C1IA 4G5GA 2M6SA 5DBFA 3ZDFA 1WXQA 2X8JA 4XI9A 3R3JA 1QKIA 1JFLA 2X8JB 5D84A 3ECSA 5DBOA 4TWAA 3ZCRA 4CDGA 4YBZA 4DA9A 4PYOA 5LZ9A 1KEKA 1YCFA 3INNA 2DULA 1F5NA 3DVAA 5BV8A 4BMYA 4PR0A 2HCBA 1RE0A 3DVAB 4DEYA 5GJBA 2BEVA 3ZE7A 2OV6A 3FWNA 1YBFA 3E53A 2I5PO 4F9EA 3AL0C 2BEVB 2DFNA 3EFBA 1OZAA 1B0ZA 4NYIR 3SS8A 3OLYA 4G0ZA 4B79A 1QCYA 3QVVA 4M0MA 4N39A 5ENDA 4TRMA 4WXYB 2CMDA 3ZI7A 2K4MA 5DWVA 4RACA 1I14A 1NR7A 1L4LA 1QZXA 4Q7QA 1KU6A 1T5TA 3CPJB 2XF8A 3OQVA 4KO4S 3W6PA 1VECA 3LL4A 4LYHA 2JIZD 2DH5A 4OMFG 3TZEA 5K01A 1RXIA 2WJZB 4JOQA 1ZOPA 2I8LA 4EBFA 4QNRA 1NT2A 2OYRA 1GQRA 2C95A 5G3ZA 3TFOA 4J1NA 1FFXA 5F3WB 1ADGA 2PTGA 3U9TA 4XX1A 1FFXB 1N25A 1SGWA 2GM5A 3DVRX 1MABA 1V47A 1IDOA 1MC8A 4YLEA 3UV6A 4LC0A 1U2GC 1MABB 1YASA 5L45A 4A8TA 4DCPA 1V39A 2H63A 4Z6KA 4LYGA 1P6UA 4R71A 4HFJA 5P21A 3AB7A 2WWIA 3KKEA 5DN6A 1T5BA 2EFCB 1X94A 2D0IA 3LP6A 2B78A 3X2FA 4V3CA 1NVXQ 2L82A 4A73A 4EVQA 4MO2A 4P35A 4AJ9A 3JWJA 4BMVA 3PD1A 3DM9B 1ZJ6A 4G9BA 5DMXA 4EKDA 4EOGA 4XJTA 1S2NA 5F4BA 3FX2A 2OLJA 2J7PA 1AZTA 3BB4A 3F1KA 5AJXA 3RRFA 2BFOA 3T7DA 1USVA 2EDCA 2ZYHA 1HE8B 3MLBA 4KGDA 4PC6A 2LE0A 4PLCA 3WMFA 2BKXA 1RQ7A 2OFWA 2Z5GA 3EWIA 3DWFA 3H86A 3MOGA 4PRZA 2LZ0A 4RPCA 2VH5R 1PYGA 4R31A 3N2KB 5TVGA 5KWSA 1J2UA 5J40A 4PGMA 4RQAA 5IABA 1R4ZA 3PGLA 5HDQA 4N3AA 4Z8XA 3HWX1 5DNVA 3ZBPA 2I3ZA 3A6DA 3RRBA 1I6MA 1W2WB 4KO3S 1DKPA 5EL0A 1A2OA 4KPFC 1OF1A 3FW1A 3CUUA 4D02A 2R6R1 1MB3A 4JDUA 3NT2A 4BO9A 1KPGA 3JWPA 2O3QA 2GNAA 4R51A 2W6QA 1B8VA 3A6KA 5JLAA 3DE7X 1A5ZA 3ACBA 2EG5A 1N36B 4FFBA 3ESDA 2WZDA 1NNUA 4MQ4A 3CRNA 3HB4X 3G17A 2XQGA 4Y7CA 2OV4A 3FA2A 3Q11A 1OX4B 4RTJA 3QVJA 1MHTA 1P1IA 1S5PA 3Q8MA 2GN1A 2HC9A 2RGYA 3ACDA 4CRWB 4G0YA 5ICFA 2OKCA 1RBMA 3MQ4A 3D7SA 1E6CA 1FU7A 2WG1A 1GAQA 4U9HS 4YRQA 4DJJA 3QLUC 2VHUA 1NRJB 2AKAB 3AFIA 3OWHA 1PCXA 1SG9A 1XVIA 2WSMA 1ICIA 3IPYA 4JKOA 4ZC1A 2D1RA 5COBA 1HE2A 5IASA 3LUGA 2DP4E 2F8LA 2XQVA 1W6UA 2BY4A 3QXGA 4NABA 4QYIB 3IALA 1KP9A 5JRJA 1ISJA 5THKA 1QBGA 1JFSA 1DXYA 2IXEA 1YL6A 3O0DA 4P0TA 4AJHA 4Q37A 4S2EA 1QOPB 4IICA 1GY8A 3DE6X 4L22A 1TJYA 3TPFA 2FSVA 1UC9A 4QBIA 4BO7A 1RAAA 2Y92A 3M3DA 5BV7A 4QG3A 2JNWA 4B6OA 3IHLA 4Z4EA 1SCUA 1SD1A 1FW6A 2ODWA 2QORA 2IZOA 2YZKA 1H8ED 3L0ZA 3ZHCA 1VIAA 5T6BA 2GZMA 2JZOA 3W90A 3ZKAA 5K2MA 3JPWA 2B4AA 1H5UA 2AN4A 1X1SA 2J59A 3I6ZA 3SSAA 4F56A 2ZQZA 3CH6A 3RLIA 3V1LA 2CZGA 3UNXA 1BWQA 5EXSA 4MW1A 4X91A 3A04A 2QIPA 2OD2A 1FDOA 3GJ4A 2XBLA 1IK6A 1JIKA 2OZEA 3N7UA 5GVSA 1RC1A 1VJ0A 1AF7A 5BV0A 3T7AA 4BFUA 5M04A 3B48A 3PE4A 3JATA 4K03A 5FOVA 3JATB 4IDCA 1QE5A 2CV0A 5ECDA 2A78A 3QEMA 2QTNA 3MCAA 4H3KB 3QEMB 3TDKA 1WUKS 1XKLA 5K3OA 2VDVE 3ORHA 3CCCA 4LFBB 3B12A 4MVJP 2DSTA 5F5XA 1GA4A 3CVVA 3L5KA 3TXAA 5DNEA 1TNDA 4NCIA 4YR9A 1CZOA 1K8YB 1VG1A 3GFTA 4LFAB 4GWKA 3VO9A 3QFFA 4EECA 4YX9A 1ORHA 3OPXA 2ZTUA 3Q7TA 4GEKA 4NE2A 4QUDA 4UZEA 2XGMA 3RS2A 2WA1A 3IDOA 3JQ9C 4KVAA 4AY4A 2NZUG 4TWBA 3WGHA 2QW8A 3CZPA 2XKBA 3QE2A 1IC6A 1PR5A 3UJ3X 3VSDA 3HFSA 2QA5A 4KZKA 1N5OX 4RCYA 4HGRA 1Q1AA 5FHQA 3KXLA