1BKYA

Vaccinia methyltransferase vp39 complexed with m1cyt and s-adenosylhomocysteine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Mrna processing
total genus 97
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1bkyA00
1NV9A 1RI4A 3KQVA 2YXEA 4CKCA 2F8LA 4CWAA 4OA5A 3DR5A 2Y1XA 2ZVJA 5DWQA 1ZQ9A 3CKKA 2ZZNA 2JHAA 3CCFA 4PNEA 2IBTA 2WA1A 3UFBA 2BR4A 3NWBA 3WSTA 2GB4A 2CMGA 4DCGA 3ER8A 3NDIA 2XVAA 2ORED 1G38A 4HGZA 4PYOA 2PX8A 3ME5A 1WXWA 2Z6UA 2PJDA 3KHKA 2O07A 3BGIA 4AUKA 2DULA 1JQ3A 1JR4A 4XUEA 5C1IA 4YV0A 1YFLA 5EG5A 4F85A 3G5TA 3DXYA 5F2KA 3RODA 2FYTA 3UZUA 4PIPA 3LGAA 4BP1A 2GLUA 2ZIFA 3Q87B 2ZWVA 5DTQA 3NW9A 3NVKI 3LX6A 5E9WA 3D2LA 5BXYA 3EEOA 1ORHA 3FTDA 3R6TA 4QQKA 3BWBA 3GU3A 1WG8A 3X0DA 1QYRA 2ERCA 1SG9A 3KU1A 2AOWA 2FHPA 2P1DA 3CGGA 1EIZA 5CIYA 4Z2YA 4E30A 3ELDA 1JTFA 3HNRA 3K0BA 2JHPA 2YX1A 4GOOD 3KPUA 3PT9A 1G60A 1XCJA 4DKJA 1R74A 4OQEA 2BR5A 1KYZA 5GWXA 2B2CA 5HIJA 3LPMA 3TRKA 1R00A 1M6YA 4ER5A 1RI2A 3U81A 1IXKA 4YUZA 1JG3A 1VIDA 4BLWA 4CKEA 2P8JA 2XYRA 1NT2A 4DZRA 5DX0A 3OE4A 4UOEA 2I62A 3JWJA 4AZWA 2IIPA 1X1AA 2GPYA 5HILA 5CVEA 5F2OA 4E2YA 3DMFA 3I9FA 1L3IA 4RTPA 1X1BA 2XYVA 3FPGA 2P35A 1X1CA 4ER7A 4E2WA 1Q0SA 3TKAA 3BGVA 4MIKA 1JTEA 3B5IA 3DTNA 2OO3A 3KQYA 4P7GA 3LCCA 3R9XB 5E9JA 4RTQA 3E23A 3HA5A 4WXHA 4E2XA 1RJEA 1BOOA 4M7RA 5D1HA 5FTWA 9MHTA 4DMGA 1RJGA 3B7PA 3T7RA 2AVNA 1XTPA 3AXTA 3GO4A 3HVIA 3MGGA 4PINA 2PX5A 4EKIA 4RTJA 1KPHA 3FPFA 3GCZA 5DM1A 3VYWA 2V74B 1MJFA 3CVOA 1UWVA 2PXCA 2H11A 2OZVA 1SKMA 3CJRA 1YFJA 4BY9E 1ZKDA 2OYRA 4E70A 4QDKA 1ZGJA 3KQWA 4HH4A 1AQIA 4DM3A 1KHHA 3AY0A 2FPOA 2ONZA 2ZFUA 1I9GA 3KQSA 5EMLA 5FUBA 2BM9A 3OCJA 4LG1A 2IH4A 1D2CA 1RJFA 3P8ZA 1KYWA 1NW7A 2QM3A 2UYOA 4RTMA 2NP6A 5DLYA 5DSTA 5K0FA 1P1BA 3SVZA 5K03A 1JQDA 1WZNA 2E5WA 3EMBA 4P7FA 5BP7A 5KVAA 1DCTA 3FYCA 2O0LA 3KR9A 1EJ0A 2N47A 1SQGA 5EMJA 1WY7A 3OU2A 3KPYA 3A27A 2IH5A 1FP1D 3C6MA 1NE2A 3HA3A 1YZ3A 5K0NA 2YQZA 5K0LA 2JJQA 3HM2A 5EZQA 4EK9A 3EVAA 2OPBA 5JUWA 2ZIGA 3PS9A 3PX3A 2AOVA 4RTOA 3E8SA 5EMMA 3THSA 2PKWA 1YB2A 3PX2A 1I4WA 4FR0A 2IBSA 2QRVB 4YMHA 1XDZA 3UJ6A 4HTFA 2I7CA 5CVDA 4EMSA 3T0IA 5F2NA 2CKDA 4C04A 2Z6QA 3P9NA 2FRXA 3FPEA 4YV1A 3HCCA 3B3JA 4RV9A 3IHTA 3ELYA 2AOXA 3EPPA 5EEHA 2P7IA 5DPMA 2OB1A 2HNKA 4CKBA 1NBIA 3FPHA 3EVEA 5EMKA 1SQFA 5DT2A 4KIFA 3P9CA 3M6VA 1VPTA 5HIMA 5LSAA 3LHDA 3JWHA 1HMYA 5KQSA 5GM1A 3NDJA 3AWIA 5FA8A 3GRZA 3A25A 3SX0A 4R6WA 3A26A 3R24A 2H1RA 4BLUA 3EMDA 5JR3A 5CM2Z 3UJ8A 3HVJA 3EEYA 10MHA 3P2KA 4C07A 3EGVA 3O7WA 5LQAA 2V7EA 2AR0A 3ELWA 3SSNA 4QPNA 5IH3A 3VC2A 1WS6A 5ICCA 2AVDA 5K0BA 4FT2A 4GUAA 1NKVA 3TM5A 4CTJA 2NXCA 5CCBA 2B9EA 2O05A 3HCAA 3FUVA 4MTLA 2GH1A 3GRVA 4FS8A 3M33A 4GC5A 4GQBA 5ERGB 4YUXA 1XVAA 5LQRA 4HTFB 2VDWA 4PWYA 4RTSA 4HC4A 3HTXA 3ANXA 5HIKA 2UYHA 4KWCA 1DL5A 2BM8A 2IDKA 4QVKA 3DH0A 2EG5A 4ISCA 2PT6A 5E2AA 1SVUA 5KYGA 3LBYA 2HWKA 3UJDA 2NYUA 1PJZA 2B3TA 4B17A 2I6GA 2AZTA 4MQ4A 2P3LA 4KDRA 1EG2A 3RIEA 3V8VA 2A14A 2PWYA 2ZZKA 4XCXA 4RTKA 3JWIA 2LD4A 5FQOA 3REOA 2IPXA 4R05A 3UJ9A 3EGEA 1L3BA 2B78A 3BKXA 3FRIA 4YUWA 2IGTA 2Z6AA 4X63A 1V39A 1M6EX 3OU6A 1IY9A 5T64A 4BLVA 3KQMA 3NWEA 4U7TB 4IWNA 4E32A 4FSDA 3LKZA 1AF7A 2PBFA 3PLAE 1F38A 1JG4A 4PYKA 4GEKA 3C0KA 2PT9A 4EQZA 2OB2A 1EAMA 1VL5A 4XUCA 4Y30A 5EIWA 3ELUA 3RW9A 2PSSA 1NV8A 3EGIA 3LBFA 5CVVA 2PY6A 3UBTA 3MAGA 2C7OA 2P3OA 2Y1WA 3F4KA 2KW5A 4FSXA 1JSZA 4OA8A 3SXJA 5DM4A 5K0JA 4RVGA 5E1BA 1XCLA 3DP7A 4GBED 3EVDA 3UA4A 4QDJA 4R8RA 2PLWA 4X61A 4DCMA 1BC5A 3EVFA 5DXJA 2ESRA 4G56A 2G71A 5DRTA 3LCVB 4HG2A 3KKZA 5HEKA 1HNNA 2HTEA 2ZBPA 3SSOA 2IH2A 1FP2A 2AOUB 3A7EA 4GOLD 1D2HA 1P39A 5EC8A 4CTKA 5M5BA 2ONYA 3M6XA 1O9HA 1VP9A 3TQSA 4AX8A 3GRYA 3GJYA 3NVMB 2QRVA 2IDJA 5FHQA 3MQ2A 4DQ0A 2ZSUA 3JWGA 4EKGA 2YR0A 1T43A 2JHCA 2HV9A 1UIRA 3ERCA 3BT7A 2OY0A 1FPQA 5DTRA 2PX2A 3S68A 3I5UA 4ER6A 5K8VA 2UYCA 3VC1A 2VP3A 3LKDA 3C6KA 1NW5A 3P71T 1N7IA 2OKCA 1RI5A 2DPMA 2ZWAA 4X60A 3OFKA 5FULA 4C06A 3EVBA 3A7DA 3G2PA 4PYQA 4RVHA 3GRRA 3I58A 5DTMA 2G72A 2VDVE 2ZIEA 1ZHFA 5LQKA 5EHGA 3T7TA 4F84A 1X19A 3KR2A 2AN3A 5LQJA 3C3YA 3A4TA 4MWZA 4PYMA 2B25A 3LDGA 5ICEA 2EJTA 4FT4A 1EQAA 4AZVA 2NXJA 1SUIA 4O29A 3GXOA 1M0EA 4P7KA 2GA9A 4FGZA 4OQDA 3QV2A 1U2ZA 3KQTA 4AZSA 4E31A 4YV2A 3IYLW 3CJQA 4K6MA 2PWPA 1R18A 3HCBA 3TFWA 2P41A 1IM8A 5EVJA 5DX1A 4R6XA 2NXEA 1TW2A 1BHJA 1INLA 5ICFA 1FJXA 4KDCA 5G02A 5GIPE 5CD1A 1TW3A 3FZGA 4X41A 4PONA 2G1PA 3PFGA 1XJ5A 5U4XA 3NMUF 1XXLA 3FUWA 4P58A 2PV0A 2CL5A 3G89A 2NP7A 3TPZA 4F86A 4M36A 4HSGA 4RX1A 1SUSA 2C7RA 4LWOA 1KR5A 2VDUE 5LQUA 5CVJA 2C7QA 4HGYA 1N7JA 3GWZA 4NECA 5E1DA 3SMQA 2R3SA 3TKYA 3DLIA 5E1OA 1Z3CA 1JG2A 1FBNA 3K6RA 4E2ZA 2AOTB 4E33A 5LQNA 1O54A 4GF5A 5EKXA 1JG1A 1TPYA 4PCAA 5T6BA 1AQJA 5E1MA 5DXAA 5KS2A 1X1DA 5EPEA 4FP9A 5P8WA 2Q41A 2BR3A 3KQOA 4IV8A 4YUVA 3GDHA 3LDFA 5K01A 2P40A 2AN5A 2VZ9A 1KPGA 5MHTA 3G8BA 3ID6C 3KQQA 3M70A 4OBXA 1EJ6A 3P97A 1P91A 2UYQA 1UFKA 1VQ1A 3C3PA 4KW7A 4PCLA 4GC9A 5FWAA 3UJBA 5K0CA 2ZBRA 2WK1A 3B3GA 4RWZA 3GNLA 4QQNA 4RVFA 3THRA 4PIMA 2GAFA 4ATNA 3OZRA 4OBWA 5C9ZA 2YUIA 5DRYA 5LR6A 4C05A 3UJ7A 5CCXA 3BWMA 4C03A 1D2GA 3TR6A 3FUXA 3G88A 4ER0A 5D1NA 2ZBQA 4ER3A 2JH9A 4M37A 1Q0TA 1G55A 3E05A 1KP9A 1VLMA 5EQJB 1Y8CA 1R8YA 2ZTHA 2AOUA 3FPJA 3NTVA 3BGDA 2ZULA 3OFJA 5IKMA 4A6DA 4MHTA 3SR4A 2YTZA 3FTFA 3M6WA 5EGSA 1RJDA 3EVZA 5CUQA 3BUSA 2JG3A 5K0GA 4GOND 4PYNA 2PXAA 5EIFA 2ZZMA 1B42A 5EEGA 5ICGA 4QTUB 2XVMA 2QYOA 3HCDA 4KVZA 1ZG3A 2IFTA 3SSMA 2ADMA 3BKWA 3DUWA 2QY6A 3HCEA 4PYLA 3MHTA 2O57A 3OZSA 3TMAA 3L8DA 1KPIA 1P1CA 4KIGA 4RSRA 1DUSA 1RI1A 3KPWA 1AV6A 3OPNA 3EVGA 3BWCA 1KIAA 3PB3A 3R3HA 4LECA 5GOZA 3OE5A 5FWDA 3CBGA 2FK8A 3OZTA 3H2BA 2I9KA 3TM4A 4PGGA 2G70A 5EOVA 1NW6A 4FZVA 3UJCA 4DF3A 3FYDA 2YXDA 1YUBA 3MB5A 3OU7A 5DSXA 5FHRA 1VE3A 4EVIA 4A6EA 3ER9A 2JH8A 4ZTBA 5HZMA 5DX8A 3BXOA 5K05A 3BZBA 3AXSA 4C4AA 4RYLA 3FRHA 1G8SA 2NNWB 3AJDA 3LDUA 1N2XA 4X1OA 1G6Q1 3GRUA 3DULA 3O4FA 4C08A 4M38A 3Q7EA 3MCTA 4RVDA 4PYJA 1R6AA 3HA7A 4IKPA 1QAQA 3MERA 3R0QA 4RTRA 2OBFA 1ZGAA 2ZCJA 7MHTA 2GS9A 3IV6A 2H00A 1F3LA 3MTEA 3M6UA 3B89A 4R8SA 1XDUA 3UWPA 2XBMA 2FK7A 2BZGA 4Y2HA 3CJTA 3SM3A 3UA3A 5BW5A 3VSEA 2BH2A 3QOXA 3P2EA 5B1SA 3LCUA 2AOTA 8MHTA 1G8AA 1L1EA 3DMHA 5GP1A 1I1NA 2EJUA 5FADA 3I53A 3KR0A 2VS1A 2EFJA 3G2OA 3HCFA 3KR1A 3CC8A 3G2MA 1NBHA 3HVHA 3GGDA 5E8JA 1NW3A 1NW8A 3I64A 5HFJA 3BWYA 4L7VA 4JXJA 3UJAA 4POOA 3FTEA 4QVGA 3V97A 2AS0A 1YF3A 4P7JA 5KQRA 3FUUA 4XUDA 5BW4A 4BP3A 1L9KA 2C7PA 3G8AA 3M4XA 2YXLA 5K0EA 1QAMA 1O9GA 4KRGA 2O06A 3SGLA 1R8XA 2WA2A 5HOQA 5GM2A 2ZW9A 1KXZA 1RI3A 2PGXA 2YVLA 3DOUA 5FQNA 2EX4A 4YUYA 3KQPA 4H0NA 2HMYB 3DMGA 3KPVA 3PTAA 4CXMA 1YZHA 4WVLA 3FUTA 3QOWA 3LSTA 3LECA 1H1DA 4RTLA 2PX4A 4GOMD 4IV0A 4OX9Y 5T67A 5EHIA 5EKUA 3TLJA 4LWPA 4PYIA 4V0RA 4AZTA 1JQEA 1VP3A 1BKYA 5GIOE 4PGHA 2G8NA 5C0OE 2NXNA 4QTTB 3HVKA 3DLCA 2ZLBA 3IEIA 1OR8A 1PRYA 1VBFA 3DXXA 2P7HA 3P9IA 3PFHA 4RTNA 4DA4A 4QPPA 2CWWA 3LL7A 5GINE 3DXZA 2CMHA 3E7PA 3O31A 2PVCA 2K4MA 2QE6A 3B3FA 2UZ4A 1QANA 3P9KA 3G2QA 3KPJA 2R6ZA 2FCAA 5E8RA 2OXTA 5H02A 5FA5A 2P3QA 1WXXA 3P2IA 4HRAA 2AN4A 1ORIA 2PXXA 3GIWA 3HP7A 4U7PB 5DM2A 5E2BA 3PVCA 3MCZA 2XYQA 5E9QA 5EZSA 1JSXA 3NJRA 5FCDA 5CVUA 5DM0A 5HIIA 3T7SA 4V0QA 5LQCA 3G7UA 1QZZA 3ORHA 5K09A 3TOSA 1XDSA 1L3CA 1QAOA 3FTCA 3G5LA 3HEMA 1MHTA 2HR1A 3EVCA 2IP2A 4YMGA 3MTIA
chains in the Genus database with same CATH superfamily
1YACA 2BT4A 2W48A 4QFBA 1PZNA 1PJ4A 2Y1XA 3T61A 3ZKWB 3ANLA 3ZX5A 2OUKA 3BJEA 2Q49A 4OOEA 5FNVA 5TEVA 2DHQA 2HLDD 2GZ1A 4F3RA 1FFDA 2NSDA 1AUPA 1E2DA 5L4LA 2JI4A 4XPZA 2OXIA 3LTEA 1JU4A 4GKKB 3ZDQA 2I8AA 1YFLA 2H4FA 2GPTA 4D9BA 2YVQA 5ITSA 4KPUB 4LZLA 2CDBA 4RJJA 2X9NA 1RXUA 1YBFA 3OQOA 5J2UF 1DIOB 4BBPA 3IEPA 4OJMX 3QX3A 3C3MA 3HH8A 1T34A 3B12A 4TV9F 1Z26A 4C4TA 3HBJA 1AHPA 1U99A 3U4QA 3U5ZB 1O9BA 3ED5A 3FNRA 3FMOB 3GLUA 1CRLA 3O1JC 4FR5A 3SHVA 3TSYA 1QLHA 2I9PA 5CB8A 3ZDBA 1J9ZA 3G23A 3TZHA 4XIJA 1TJPB 2G8LA 2SKCA 4I3HA 5EIBC 4RSHA 3ESZA 1PS9A 4D8XA 4Z54A 2XZOA 3H11A 4QPDA 2CVFA 4UBNA 4Q05A 5KSPA 3L7BA 1K7FB 4MQLA 1R0KA 2O3RA 3LC0A 4TV8B 3TTWA 2QRJA 3SYLA 3V1UA 4AL4A 3BXXA 3STWA 4PANA 1N0HA 2HEGA 3MTDA 3RSFA 5KO2A 4DAOA 1B8VA 2QMYA 4B4DA 1HZJA 2OR3A 1ZIYA 2XOEA 1U3WA 1CV2A 2OTCA 3HHPA 3KFXA 4D8TA 1HDGO 2YMQA 2B6HA 5CFZA 4Z3DA 5K6AA 3NM4A 4EUHA 5HUJA 5F2OA 5LLTA 1N6NA 1P18A 1L3IA 1NVEA 2EKBA 2JC3A 4M49A 1FFSA 3BRWD 1XLUA 1NP6A 1PT8A 2C5EA 4WZ6A 5D3ZA 3TX2A 1YNSA 1Q15A 1LVUA 2NZJA 2PV7A 3RHFA 3L40A 1RRPA 1JSRA 2Y1KA 4NBLA 5SZIA 4RTQA 4KNYA 4S1WA 1R27A 2QG4A 2XMGA 2FW7A 1GKIA 2Y67A 3NX4A 4JMLA 5FO1A 4OGKA 4DMGA 4E5NA 1W75A 3RO7A 3TUZC 5I9NA 4JUFA 2E4VA 4G5GA 5JHGB 3A1DA 1UWVA 3QUTA 4NDAA 3IKVA 4YPFA 4C7BA 2CGEA 4YRFA 1UKZA 1VXOA 2Z58A 3EWIA 1O6CA 3AHIA 2ZUUA 3HYLA 3U1VA 1B26A 1TXGA 2H1OA 3WJ1A 4A8JC 4G41A 1JB1A 1Y9ZA 2JAHA 4I50A 5IM4F 5J4YA 2Z98A 1X14A 2UUPA 3E9ZA 4KPFC 4K05A 1NNLA 1PT5A 1W49A 3D2BA 2A57A 2GSDA 3IJRA 3OCJA 4FDLA 3D64A 4R5HA 3NWJA 3VVBA 1I7SB 2GRJA 4AG3A 3GNSA 4KQJA 1X15A 4X5OA 3SVZA 1KJ9A 3DZ8A 1E66A 1HK7A 2JI9A 3HY6A 5K03A 1QDEA 5BVGA 2NT4A 2IYUA 3FTQA 1DC5A 2JLBA 3F1KA 2WHXA 3NONA 4JK3A 2E5LB 3KPYA 2IH5A 1LJLA 4CL8A 2Y76A 3HJTA 5A0FA 1JT9A 3PDWA 3RVSA 3AL2A 4KI7A 4DB2A 1RMTA 2CFCA 2IUYA 2R96A 2PZEA 2QUIA 1LRLA 1ND6A 4EM6A 2EZ4A 1G3QA 3K1AA 4PPFA 5TB5A 4C6TA 3IV7A 5KYKA 2ZE6A 1EDBA 1QK4A 2AOVA 4JBHA 2KJQA 4U39A 3UAYA 1Y9DA 4XKJA 1QGOA 2ST1A 4YMHA 4BMSA 1QE0A 1K6EA 4KLCA 3S40A 3USES 1ZUIA 4B6EA 1YR8A 3AP3A 3IEVA 3L43A 3TXYA 1PWZA 1I3LA 1LQUA 3JD2A 3HXQA 1QE5A 3B3JA 5FUMA 3HN7A 1ODFA 3D6JA 3GFSA 3UG6A 4FQ7A 4KR6A 3ABSB 1W4RA 2C04A 2HDOA 2QD5A 1F2TB 3C3AA 2ZXEA 2HCJB 3OIUA 2XE7A 1BMQA 2R1TB 4JI0B 3R6LA 3IPCA 5DK6A 2P5YA 3PC3A 3U37A 2YWGA 4JP3A 1FRVA 2C61A 4QREA 3A26A 1U02A 3FE2A 3IV9A 3U3MA 3CUVA 3KOZA 3SICE 3R3SA 1UC4B 4WBNA 1RAFA 1VDZA 3D6HA 5T5QA 5KREA 2M1ZA 2Q6TA 4QUGA 3GPLA 1C4XA 5L6MB 1OFUX 3ELWA 3CUEF 4B3IA 1FLAA 4XDHA 1J5PA 5I7HA 1XAIA 3K9LA 1E1QD 1N25A 2R7KA 4HDRA 4LI0A 4ZO9A 3FUVA 3TMYA 4YUXA 4N82A 2WSIA 1TAUA 4HSEA 3TEFA 1MZPA 1T1GA 4MR7A 1ZGGA 4OFWA 4YAIA 1A82A 3BXGA 2GWRA 2V45A 1DS6A 4ISCA 5AWFC 5ADWA 5HRCA 1VGRA 2WYUA 4U7WA 4B4KA 3O1LA 4IYJA 1CFZA 1RP7A 2QA5A 4HDCA 4RQUA 2HWKA 4GBMA 1BQEA 2Q99A 2NU6A 4YJHA 5FBHA 1IZ0A 3BDIA 4X94A 3OE7A 3C3DA 1NTRA 9ABPA 5EJAA 4RIHA 2P3LA 3PYXA 4KDRA 4LHXA 3RIEA 1M34A 4IJKA 1ISMA 3D7NA 3TOVA 4EGAA 3FIUA 1KH2A 1T5BA 1MQ8B 2NUPB 3KOMA 4DIKA 4DNQA 4EDFA 4UCWA 5LZ4A 4PGAA 1DWQA 4LFCB 3SE0A 2P4UA 2JAXA 4CM4A 3RYFB 4UBOA 4A23A 5B7GA 1SPXA 1QRDA 1Z88A 4IVNA 4Y8VA 1P4SA 2ZT8A 4D45A 5H7XA 2QE7D 1HH4A 1PNQA 1Y3AA 3RYHA 2YVUA 3BCRA 5DGCA 1FDSA 2VTEA 1GYPA 4AKTA 5A9SB 1A8QA 2JGEA 1T2DA 3I6YA 3LVRE 3ELUA 4Y30A 4WA8A 2GZHA 3CRW1 3LUGA 1BHSA 2FGJA 2WJYA 1SBNE 1V8OA 2JLXA 3I28A 1LLUA 5CEEA 2FMHA 4FSXA 4L95C 1PLJA 3BK2A 2BCEA 3UA4A 1WVMA 2X0DA 1X7XA 1SFRA 1DIHA 4BFSA 1GTZA 4LBYA 3QMMA 4IEIA 4PQRA 4Y2GA 3SSOA 2C2BA 1XRSB 2J67A 4WFKA 4H7DA 2BBSA 3V8PA 3L41A 3WJ7A 1U7ZA 2HMWA 1YRHA 4GBJA 1F12A 1GG2A 4I4CA 1ZISA 4NPCA 1WF6A 2JA2A 3HCWA 4FXPA 3R9WA 4OGGA 1VL2A 2Y2UA 1BCSB 5AT1A 3DL0A 2CV0A 1AK9A 1CUDA 2FPPA 5C5DA 1IATA 5KSOA 1GSHA 3CLVA 4HDQB 3ZBPA 1ZFNA 1UPBA 1B2LA 1ISRA 2EIXA 4KH0A 4PFKA 4P3NA 1YAHA 4HPXB 1QBGA 1ZCAA 4I2NA 1NUTA 2H9YA 4DG8A 1GT91 3OFKA 2FPSA 1DBWA 4ZEVA 2QVGA 2YYSA 2JFZA 1M66A 2I4NA 3PDIB 5HJ5A 2J1LA 4O2LA 1DBIA 3I9KA 4YB8A 5KYNA 3KHUA 2GAJA 3GOQA 4DA6A 2Z2KA 4F6RA 5SYNA 5CG2A 2WG2A 1HDXA 5JPIA 4BO1A 1DEAA 1EINA 8ADHA 2WFLA 1MTZA 4FGZA 4B3CA 2XDQA 1ADFA 4W6QA 1CNMA 3T3NA 2I1QA 4P93A 4DREA 1I6WA 1P6QA 3SBOA 4JROA 4MQ6A 3CUKA 3NEAA 3FYSA 3S1AB 2WSBA 4EHHA 3UXEA 4BV8A 2WD7B 4IHJA 3UHAA 3COPA 2F17A 1EK6A 2HZ7A 3UN1A 4IQFA 1GZ3A 1LPMA 1W0KD 3IVMA 1UC9A 3A4IA 5KYTA 1IB6A 5AKYA 3WQQA 1I4DD 1UP4A 2PSHA 2C5LA 1PT9A 1VGVA 1WV1A 2E6UX 2VPPA 2XZTA 2PV0A 1D6SA 4IIVA 4L8LA 1P2FA 2XHZA 4LISA 1UC5B 4DSNA 2OHGA 4AN4A 2BY4A 2DP4E 2GBIA 3TIFA 1H66A 5EIOA 1QUEA 3O0TA 2DPLA 3LZCA 3X1WA 3GLTA 5E1DA 1LS1A 4UJ5A 5HCIA 4CN9A 1O95D 1BQ4A 1WZCA 4OOFA 3BD9A 3ZZ1A 4IS3A 3V4FA 2PRIA 1JG6A 2OILA 3SC4A 2GARA 2E1PA 1XZEA 1L5HA 2EZTA 1KS2A 2V4ZA 2HKIA 1AKWA 1L6RA 2QD2A 3HJAA 1NLZA 5MHTA 4JL5A 1EX7A 3H9JA 3IODA 2IXBA 1FC0A 1HKHA 2VUTA 2HSDA 2C4HA 2PL9A 3B1YA 5FV7A 5SY9A 3P97A 1XCBA 4F11A 4L4UA 4ZVVA 4ZDIA 3BSWA 2HJSA 2Z30A 3OM1A 1VE6A 3W6NA 2H5IA 4Q3BA 2PUCA 3JXEA 1FFAA 4JR1A 2YICA 4NBWA 4Q15A 4R7TA 1VB3A 2CXXA 4RLQA 2QXYA 4B5KA 4D56A 3A58B 3IRUA 4JL6A 3RWOA 2IA5A 1II8B 4A3SA 1NI5A 2FR0A 2JI6A 4JZKA 1P8JA 4B7ZA 4DCPA 3LRTA 2NM0A 1E9VA 1XL1A 4B3MB 1W5FA 2F67A 2JH9A 3PFNA 5FBKA 1KZ4A 2WNSA 4HP8A 5TLSA 5KAPA 2IW3A 4HXFB 3PEFA 3PVZA 5IKMA 4UUBA 5BQ5A 3VPHA 4AZ0A 5MGBA 1NL3A 1OLUA 3TSAA 3BQ9A 1N32B 2DUNA 1EVKA 2ZRQA 3O95A 4PGFA 4BEWA 1FP4A 3DAFA 3NOQA 3TG2A 1W36B 2WIAA 2UVPB 1IVYA 1Y3CE 2J87A 5PNTA 3LO5A 1ZA1A 1QONA 2WUWE 4KVZA 5KCZA 3GJZA 2BZ0A 2ZSDA 4KR0A 1U7DA 3LX5A 5AVVA 4JXZA 1TA0A 1IHYA 2IOFA 3HCEA 4YRZA 5BSRA 1VRVA 5KTNA 3K6SA 4J16C 1E1CB 2VZ8A 4MLDA 2CHVA 4FYIA 3MVEA 4WLVA 3NB0A 4CCAA 3D8SA 4LYYA 1WXQA 4BRUA 4LZWA 4BBJA 4ENWA 1ARZA 3H2BA 3IMKA 4MV6A 1TVKA 1EM8B 1T1IA 3WFIA 1O57A 2VL7A 1ATIA 1OWNA 3COWA 3NFRA 1W581 3BRCA 3H65A 4PXSA 1II0A 3BJZA 5C8ZA 2VSYA 3NT5A 4MWSA 5D3MA 1DAMA 4E5KA 2QYSA 3GMSA 4NS1A 4F60A 4AY2A 2DQSA 2I6TA 3GLVA 4MIOA 3AGQA 3TL2A 1VDMA 2BGKA 3FRHA 2GA8A 5HIAA 1N2GA 2VK4A 1PD1A 3FOZA 4H7KA 4KGZA 1SUPA 3M1AA 3PGA1 2FUCA 1TKBA 1U3CA 1VE7A 3EG9A 4EIWA 3HA7A 1L5ZA 4UM5A 2FN4A 1B23P 3NBKA 1R0YA 4K9MA 2CHEA 5HQJA 5ADHA 5DYTA 5FD8A 3OAAA 4FYMA 3F0TA 4KIWA 2GAAA 2O7VA 1P5HA 1K97A 2YWJA 2BBOA 4J76A 3ITNA 4KXLA 4N0QA 1C7JA 3A0UA 4PO9A 5JJBA 1T9CA 3O7MA 2BH2A 3HJFA 1N6OA 4WINA 4Z4CA 3Q1KA 2ZITA 4KO2S 4D98A 5A4DA 4YR7A 1X80A 1XGKA 5JAUA 3CH4B 3KXDA 5DB4A 1DLIA 4N5HX 4G81A 4XQCA 5DISB 5KSWB 4L28A 4LZAA 5IKEA 4GL4A 4UUOA 1NNEA 1NKSA 2FF5A 5IAOA 4R9UC 5KQRA 2H0AA 4FHEA 2WUVA 2XECA 4GWGA 5D7BA 5E7JA 3I2FA 4KZKA 3HHEA 3ITEA 5L40A 13PKA 2GX6A 4REOA 5D5HA 3KT3A 4L6AA 1U2GA 4UCXA 1BWQA 4XD7D 2PU7A 1DJPA 2FB9A 3VZRA 1KH1A 4FCTA 1Y7HA 4MVXA 1G63A 4NYJR 2F00A 4M60A 4H0NA 3ZDYB 5KC8A 3FUTA 1EFLA 3EDCA 3ROKA 5CH8A 1R7RA 3LFUA 3VPSA 3VR3A 4CMCA 3BK1A 4OX9Y 5CLLA 1SCDA 2V6GA 5BSKA 1T5DX 1QB7A 2O2YA 1HGXA 3F8TA 5GONB 2EJVA 3BIXA 3PTLA 3VTZA 1OZAA 3ZYZA 2E5FA 2JB9A 3EWAA 3RVNA 3V8NA 4OHUA 3F9IA 1WHTA 4JLVA 4YRCA 2EWVA 3ITDA 1L8XA 4KXQA 4Y2TA 1GRNA 1NUUA 2HAEA 1Q19A 4P8RA 5C53B 2XPCA 3QH4A 1UC8A 1NJSA 1XZQA 1XMIA 5FOUA 5T6MA 1TM5E 1UKYA 2BTOA 2JIOA 1E18A 3CRQA 1UBNA 3NPAA 3FPLA 3CWZA 3J7TA 4FC6A 3QUSA 1SC4A 2EW1A 2RKBA 2WKRA 1PN3A 1N5LA 2JEOA 5BOSB 2QM0A 1FVXA 2AT1A 5EWJA 2HU8A 3DCYA 1OAOC 5E2BA 4AP9A 3NRJA 4IDDA 3NJRA 4DFDA 3OF5A 5AOVA 1G3RA 1XK7A 1BIFA 2N9UA 4ESEA 4NZZA 6PFKA 4H59A 3ZWPA 3AFIA 3VNBA 1BEUB 3G5LA 2ZUBA 3CS3A 2ET6A 2IP2A 2MCFA 1ESMA 2QIPA 1Z6XA 3MTIA 2G1KA 4YCAA 3KQVA 3Q88A 2QUAA 2WF7A 5AUNB 3EOBI 2XGOA 3UK0A 3R5XA 5DWQA 3W8NA 4D82A 5C7YA 1BN7A 3GELA 3NQ41 3T5MA 3NIDB 4HNSA 4QJ5A 4R69A 2V97A 3TQFA 4BU0A 1ZI6A 2NGRA 1J97A 3UUWA 2A3RA 1TUGA 1R5JA 2VLBA 2UUOA 2MINA 3NALA 3QKUA 4FFSA 1D2AA 3D59A 3X2EA 4IQ0A 1XT6A 2QROA 1LFDB 2Z6UA 2B1QA 4BLSA 2VRWA 2IV2X 2CXQA 3TBKA 3ND9A 1XXHE 4QUHA 3MT9A 1MB4A 2WF5A 1WMDA 5FTJA 3ZH2A 4Z0PA 3GGPA 3EULA 1G8FA 5CLIA 2EEZA 1Q21A 1YVDA 4D0NA 4OKIA 4Q0MA 5E9WA 2X1MA 1XJWA 4D9EA 1T6XA 1G291 1ZM2A 4HZUA 9LDTA 3DO6A 3ROFA 3QU7A 4JB3A 1H6DA 5J40A 1HO3A 3VR6H 2V5UA 1XQWA 4XZ3A 1CETA 3V8MA 2CKMA 1E2EA 2R9VA 1UDWA 5EJ7A 2BLLA 1U7WA 1LPBB 3RTGA 4GDFA 3TIGA 5AVRA 1FVOA 1ZOIA 2ZBDA 3R7LA 4GYJA 4DKJA 1ZD3A 5E7IA 2HHJA 3QKIA 4RHFA 1BDBA 1NY5A 2HCFA 3BD7A 3ECSA 1XKQA 2LDXA 3D2CA 3LPMA 4KCGA 3ZGLA 4AKEA 1W1IA 1BDJA 1SC6A 4CKEA 5AKIA 3GEHA 4L73A 3PXXA 2J09A 2VSNA 3IRVA 3OE4A 5F33A 1X1AA 1AZSC 1WIWA 2W6ID 3GMDA 3I9V1 4MIEA 4QGFA 1WMAA 2OPHA 4E2YA 3I9FA 1M67A 3KZ1E 3FPGA 2AKAB 2WMYA 2XNDD 3NYQA 4M9UA 4QXPA 3QWBA 1XMJA 1IH8A 4RZ3A 4ZOLB 3PP8A 3ZHVA 2O20A 4HPJB 3M3PA 2X2FA 5CXXA 3RS3A 4QSHA 3S8MA 2XNCA 3PICA 4N1AA 1YE3A 2B4KA 1E1RA 3VAAA 4E2XA 3BE5A 1ECLA 1KAOA 2B2NA 3KT0A 2AH5A 3M5CA 3B7PA 3T7RA 5E6UB 1EFVB 4HLDA 1MJHA 1P0IA 4JNKA 4P4UA 1G0NA 5F9MA 2Z2JA 4U1RA 3NLLA 1J39A 1I5OA 1R0ZA 2XEXA 3C98A 3KDSE 4CRWB 1ORWA 1BFUA 3HFGA 4PQFA 1QGUA 2O9JA 1YFJA 3U3DA 2OD9A 1Z2OX 2H7CA 2QQFA 3RIMA 3PJFA 1ZKDA 4CF7A 5I7UA 5BMVF 1S4MA 1QP8A 2D00A 3KP1A 1RHQA 4OV6B 3AFOA 4X66B 1Y5RA 2WF8A 2E21A 1BX1A 2H85A 4FE7A 3ZHOA 2QN2A 3A05A 3EH1A 3K1JA 3H2ZA 4MVYA 1YS6A 3DMDA 5DGHA 4E5YA 2RHMA 5L3ZA 1MIHA 2JIZA 3O1IC 3WRYA 4RELA 3BFKA 4PLYA 4CR8A 1TCAA 3MJEA 5K3BA 3URMA 3FGPA 3LBHA 1CE8B 2HJGA 2QVXX 4ZO8A 4XRRA 3L8HA 3D6FA 3V4SA 2Q6LA 4JOBA 4D3ZA 5B2FA 1L4YA 3OLWA 4EFLA 4X7MA 3VU9A 1BU5A 2QVZX 1GPBA 3I1JA 3H6HA 4B09A 3ZQ4A 2VTVA 2FPGB 2XBLA 4R2LA 4EK9A 4F2PA 3EAGA 3P19A 1L7DA 4XOIA 3E7DA 4C87A 4RVSA 3DBOB 1ULAA 3EFEA 1Z5PA 2AEEA 2C99A 3DBLA 1YCDA 1Z2DA 4OYRA 3QMPA 3T12A 4EMSA 3P27A 1Y8QB 2JFUA 3JTMA 2Z6QA 1NYRA 2A9VA 1I2DA 4URXR 2AFIB 4QNRA 1XZDA 3L77A 1V1MA 2FR8A 5KMGB 2QNBA 5CITA 1K6JA 1FYXA 2QT0A 1A5AB 5KVCA 3OBIA 4RNCA 5BN4B 3GP3A 1KVRA 4CKBA 3VX4A 5K8CA 3WSWA 1JE1A 3TQRA 1DT3A 3SF8A 1VPTA 3T0FA 5A04A 1QV7A 1ORTA 2O2GA 3D8UA 3JWHA 3G1WA 3KS9A 4KPGA 2VF7A 2FU5C 3FZNA 5DV9A 4ZZ2A 1CR1A 5TMBA 1D7OA 3WWPA 3JR7A 5ENVA 3ZE2B 5JJIA 4NZOA 2XCUA 4QO8A 2X4LA 2ZT5A 5A7GA 3ICOA 4BTVA 2PANA 3H8VA 3HRHA 3B8HA 4KNVA 1ZUD1 4XJTA 1RHMA 4Z8YA 1K4KA 1RRFA 1JEEA 1ISJA 2KS6A 1DARA 2CB9A 4C3ZA 1NFRA 4AS2A 4ZI2A 4AQYB 4OLJA 4RGBA 3I3SR 5ICCA 5EIAA 5K0BA 4EYEA 3OEHA 2ZRIA 4GUAA 3VNQA 1NKVA 4JQYA 2G88A 3O93A 3B20A 5IJZA 1O8BA 1E2UA 2YIVX 3WQRA 1D2NA 3RT7A 1Z38A 4GC5A 1PR3A 3DDCA 1H5QA 2P9HA 3B13B 4HWOA 4WVFA 5ERGB 1NPYA 2HYIC 1PG5A 4WLNA 3MQFA 1F51E 3NR2A 3STTA 5E2AA 1JDZA 3DQQA 3I5AA 5KQLA 5JYEA 2IEIA 1W47A 2R44A 1B0AA 1JU3A 2FFRA 3U6BA 1L5WA 2QTLA 4NBKA 1RDFA 5HSGA 5GVSA 1RIIA 4E7PA 4RULA 4D97A 3TECE 3E58A 3OSUA 3QQPA 4R05A 3EGEA 3BEOA 1T4CB 2E4XA 2F48A 2QR3A 3Q2KA 5DVZA 2HT1A 1WHSB 2V9CA 2GR9A 4BLVA 1WW3A 3MWEB 3NWEA 3D3NA 3O4GA 2BFEA 2VJBA 4RA9B 3CX4A 3I2JA 4N0EA 3RD5A 4M8SA 1F38A 5TF4A 2HW8A 3T5TA 3WQBA 5F3DA 2O6LA 4J0IA 4BFWA 3NHJA 5AHWA 4DJDC 4DIBA 3LP8A 3OX4A 2WYHA 4N7JA 2PSSA 1DAFA 1NV8A 4TKLA 1M1NA 1YH3A 4ZJUA 3Q7SA 3DBIA 5TT1A 5EJMA 2NPFA 5EJEA 1GU7A 1KVSA 1OXTA 2DJ5A 3B6EA 4JOCA 5E1BA 1BZYA 3X2SA 4XM1A 5JYDA 4DCMA 1K4MA 5JQGA 3I9OA 4WERA 1JLMA 4FFPA 1MLDA 4BP9A 1TK3A 2GRUA 4HG2A 1EFDN 4TTJA 5JCOC 2HTEA 4Y6SA 5TR9A 5I01A 2K87A 2NADA 4IL5A 3LZ6A 4HLQB 4PLCA 5FAXA 1J2EA 1NVVQ 2N1BA 3FGZA 3K1ZA 5E0OA 5JECA 1GTSA 5CGZA 1XB2A 4KK4A 3NHSA 4BASA 2A5JA 2XE8A 3FNQA 3DJYA 3P5BA 3SZUA 5AI8A 1KEZA 2OXRA 2OZLB 3GVHA 4XOUA 3CUTA 4W1SA 2PSJA 2WU4A 3K20A 1FXWF 2HU2A 1NHWA 2PR7A 2BGUA 4I81A 3EPJA 4EEXA 4C2BA 4ETMA 4ZYYA 1FMFA 2B9VA 1G8JA 4BNUA 4TGLA 1NG1A 3JSXA 5IZ4A 4BVJA 4OK5A 1FZTA 4EGFA 4OYHA 2ZYUX 3LHKA 1WVIA 3Q5GA 2AZMA 3LPNA 4F4FA 1DG3A 3H2IA 4LV5B 2WPDD 1GLVA 3F8WA 4L4SA 3ZWQA 2ILTA 4BOYA 5K6TA 1NVWQ 5A3QA 1GARA 1G41A 1TVCA 3EYWA 3WGUA 1LK7A 2ATXA 3A8TA 4BRZA 1NP3A 4V0LA 1CUFA 5AW7A 1QQ7A 3OQVA 2R8XA 1FYVA 2Q9CA 1SAYA 2X2EA 3HABA 4JLJA 4O29A 4BWGA 4CHTA 1M0EA 1WD5A 1E9SA 2CVOA 2XR1A 1KP2A 3N6VA 1F8YA 1LWOA 4KXUA 4Y7DA 3UH1A 4EAAA 5I48A 2DPYA 1CIVA 4ICIA 1IM8A 5DX1A 2KHZA 1XKLA 1TW2A 4G63A 2CCGA 5DN9A 1P62B 1PL0A 3W34A 1QZ3A 1XMSA 5CDGA 3NTQA 2PZBA 4J6FA 3NS7A 3E03A 3IDZA 2XB9A 3FIJA 1Z0SA 3QLVC 4QRIA 5DH9A 1SQSA 4X3CA 3AF1A 3ANYB 3IHLA 3FUWA 1I13A 3ZWBA 1ODKA 2H2IA 2P9QA 3MPUA 4R8LA 1E7RA 2OXEA 1XFDA 5M3BA 2B2XA 4M36A 4PVDA 4B1FA 2FSVC 3U3KA 5FUXA 4ZVUA 3U4DA 3O91A 2OENG 4J49A 3WJAA 3SMQA 1D1TA 3V4ZA 4DTIA 4J2TA 1UXJA 1E3WA 1JG2A 2PN1A 2HBZA 1ZUNA 1U9ZA 3PXEA 3SQLA 3D4LA 3OPYB 2CNDA 2ZROA 1ICIA 2FRDC 4GLJA 1N2HA 3VPGA 4QEZA 3RUHA 5JROA 4LOKA 1W73A 5EWLB 4UAGA 3LYAA 3TLGA 3G2IA 1O4WA 3ORQA 3PPYA 3S5JA 5DLEA 2XWJI 3HBAA 4MWGA 3MUNA 3E9DA 1GV0A 2C2OA 3A70A 3TLYA 3UJBA 2ZUTA 1Q1BA 4F91B 2N75A 1TC2A 2GBLA 6YASA 1B8OA 2WWTA 4J3FA 4F3NA 3THRA 3HP4A 4ATNA 3EH2A 4MIYA 1ONPA 3W78A 2VF4X 3OEYA 1Q11A 2Z43A 4GI7A 1IG0A 3JQGA 4C05A 3ZK8A 4CMHA 1TM2A 1ZIXA 2GJKA 5D1NA 4CDNA 1OIVA 1KP9A 1PFKA 2ZRJA 4B5LA 3GFOA 2FR1A 2IQ5A 4GXQA 4OLFA 3VPCA 1KDTA 3FPJA 3OFJA 3NTUA 4NK5A 5AR1A 3ILXA 4A6DA 3A1NA 4ACBA 3UPTA 1SCUB 3LC7O 4QDZA 3UV3A 2JG3A 3T35A 2CF6A 1WOYA 2ZB3A 1UF9A 3GXBA 5G0SA 2YZMA 4EJ0A 3OQIB 4YLYA 4ZCRA 5ECYA 3O3OB 1SZPA 5HXAA 4A6XA 4DLTA 2A5YB 3F5DA 4M1MA 4O2BA 1RZRD 1ZINA 1A96A 4LNUB 1JF8A 4ABTA 3VZBA 3TVTA 4QPCA 1U2EA 2XMDA 2DY0A 1IPEA 3DM9B 2GYVA 1OQAA 3OE5A 2YOFA 2KBFA 2AKEA 1EP3B 2FK8A 3TSWA 1XL0A 4NOMA 1BJRE 1PWYE 2Y9PB 4PGGA 2VHTA 3MT7A 1EB8A 1MP0A 1V95A 1W85A 3FYDA 5D84A 2QSJA 5JMPA 3AI1A 3FPSA 4HL6A 2NVUB 4RANA 7ABPA 1JA9A 4DN6A 1PGOA 1JI0A 1QHYA 5J43A 1ZJYA 4GSKA 3OCXA 4MVJF 5HZMA 1WRBA 3DBRB 4QG7A 4CLOB 4V24A 2GBPA 4L57A 1NC3A 5K2OA 2RHRA 1FE8A 3IURA 5ECWA 2VP9A 2WD9A 3TCNA 3K8YA 1U7TA 4HBGA 3PGXA 4QUJA 1Z74A 3C4QA 4JDPA 3R0QA 4FDVA 2X9LA 1WUTA 2N1MA 4KMRA 3K15A 1T36B 2ZDGA 3KDAA 4M99A 3B9RA 3RI3A 2VTBA 3LWZA 4GU5A 4JBXA 4YECA 4MQEA 1DZIA 1QMGA 2R60A 3KDPA 2QPTA 4XM2A 1ENYA 4BO2A 4YAGA 5IU6A 5E2IA 2WKWA 2DM6A 1GOTA 2L17A 5INTA 4LPKA 3PKIA 1K89A 5BSWA 2A2ZA 4JSTA 3SIRA 1L1EA 1Y8RB 2XSZA 3E22A 4TKUB 5NULA 4BC0A 3AM1A 4TVBA 4RIEA 4Q6WA 3HCFA 2B4YA 3CC8A 2EVWX 1FTSA 3AERB 2TMGA 5A3JA 3U7RA 2K7ZA 2K5UA 3ZV4A 4B81A 4QG3A 1VHJA 1N3BA 4ZDKA 3GEIA 2WM2A 1JQJC 1JIIA 4IQ8A 3U7QB 4IGFA 2C7PA 3OO1A 1AM4D 1FTNA 3EXEB 3PTZA 2KSQA 2AZXA 1DC4A 3F7MA 2XIQA 2H2FA 1RNLA 1CP2A 3LIIA 2Z3WA 4Q7KA 4EG6A 1GDHA 5IASA 3EHEA 1KAGA 2G9QA 2XD9A 2NX2A 4RHTA 5B55A 3LHIA 4J1NA 4UMEA 5FQNA 4KRFA 3RKRA 1Z4LA 2MMGA 2Z08A 4MUKA 4YJ3A 3ZE6A 4BGEA 4C3OB 5FBVB 3H2HA 5K51A 3SZOA 3QOWA 2F64A 3QIVA 4HRYA 4QLBA 2OHHA 1KQFA 1C1DB 4A6PA 3LY9A 1LKZA 2P4QA 4OI0A 5EHIA 3PQDA 4BQNA 3P26A 4AZTA 4ZN6A 5JLJA 3LUFA 1GUDA 5GIOE 4HN4B 3LYHA 4WLUA 2HY7A 5CXQA 3QEBZ 2HWXA 5KYWB 5HKAA 1PRYA 1VBFA 5DFAA 4GPD1 3T1NA 3QJGA 4M1QA 3D31A 2BI8A 3MMSA 2QORA 3G49A 3CBQA 1R4ZA 1Z56C 5BY2A 3WNQA 2G4CA 2JDID 4JT8A 4R3WA 2QLTA 5KOHA 4EJ2A 2HTFA 1WULS 1FA9A 4BFUA 2FCAA 1IOLA 3GEPA 1XCMA 3PEUA 4M7PA 4Q1EA 2Q50A 3Q3CA 4PFJA 1XRJA 4U2CA 5AHXA 1TU0A 4ZKEA 4R2HA 1QVWA 4O4JA 5FUWA 2JJMA 2GM9A 3EEBA 3I72A 3MCZA 4EI2A 1MQ9A 1XDGA 4MKZA 1BYUA 4Y18A 5DM0A 5IP5A 3A6LA 1ZVMA 3AK4A 4ZPXA 2EJCA 5DHUA 4BQEA 1FNNA 2PHZA 2Y1EA 3WIBA 2QLFA 3NYRA 2HJ9A 1KY5A 3AUJB 4IX1A 3HPRA 4PSDA 2WWYA 2EF1A 2JASA 1FUIA 3HUEA 1YR2A 4ZRNA 5EE5B 4R1SA 1P73A 1AF4A 1RAIA 1B6SA 3E1KA 3H8SA 3Q0IA 1M8FA 1U2TA 3ZWCA 2XX3A 1YR6A 4AU1A 3RHZA 4HAVA 3K0FA 1C7QA 1LPOA 5DBFA 2FQXA 1IEWA 2JAWA 3E2MA 5HM6A 3WLFA 1YQTA 1HEYA 4I08A 4O4IF 4TS4A 1Y1RA 2C29D 2HRBA 3R4CA 4XR4A 5H59A 4BRWA 2I2BA 4LGVA 4RHCA 5HUHA 3BMNA 1YZLA 1WXWA 3NHBA 2D5AA 1ZXBA 1DAEA 1HQYE 3QVSA 3JY6A 2QN3A 2B3DA 3L0CA 4TS1A 5JBIA 1WB5A 4EHLA 1ZRHA 3RODA 4BKPA 3A9TA 4DC9A 1SR8A 3O2SB 3DD5A 5DTQA 1KR2A 2CLEB 4JJGA 4UVEA 1WDWB 1OT5A 3UT0A 4BMPB 1ORHA 4EX7A 4ZVQA 4UUPA 5CA0B 2QTWB 3JQ6A 2AOWA 2FHPA 5LA6F 1TT5A 4Z49A 2IYRA 2VK1A 1RQGA 3SS8A 3ELDA 1QFXA 3LQQA 1B76A 2QK4A 3QEMA 3QKRA 3QKSB 2O7SA 2NUTA 4YCCA 3LMKA 5AO9A 2B2CA 1E1KA 3NBMA 3IH5A 1QIKA 3OM8A 4OQMA 3QFRA 3ZY6A 4DR6B 1CUZA 2O8FB 4I4TF 2LVBA 3LVQE 1KOGA 1HRKA 2XUQA 3L0OA 5EIBD 2IF2A 1K5PA 4ML3A 5GJVC 4D92A 2QD4A 2G6BA 2XYRA 4QYWA 1NT2A 4ENQA 3AUXA 1JWBB 5KTRA 2QN9A 1AO3A 1M0WA 3WGMA 2RIPA 2AQHA 1CX9B 3DQZA 4M6WA 2VZ0A 2NO4A 2P0EA 5ILQA 5ED4A 3D8RA 2HXGA 2BRUA 1RXIA 2VJPA 4LGMA 1R4MB 4M0EA 1ISGA 4MV0A 1X1CA 2R87A 4P81A 4XFKA 5AXDA 4M83A 4RF3A 5K0TA 3DHWC 1EWYA 5CDUA 1QP0A 3WYBA 1W36C 2GLXA 3DLBA 3E23A 3WWEA 1Q0LA 3V3KA 5F98A 2XXJA 1CLUA 1R9NA 5BSUA 1X1TA 1REQB 2AVNA 3IKMB 4GBGA 2FPMA 3ZI7A 5KVSA 4EKIA 5A3VA 1HE1C 1IBSA 3O8OB 1DRJA 1QTIA 3AFNA 2FY8A 4TZTA 3CVOA 2JFPA 1STOA 1PVDA 1P8AA 2ZYHA 3EZ2A 1C8LA 1SG6A 4DPKA 3VDRA 4GW3A 1LPNA 3EEQA 2ZVDA 1OBVA 1PG2A 3H4TA 3UK7A 2X0KA 1T91A 1IOVA 4GPTA 1CY8A 1GZVA 2QAIA 4PAMA 3A1UA 3T7CA 4PLZA 2QI9C 4JJEA 3RAEC 1Z29A 1Q3HA 3LPDA 1SVLA 3B53X 1R8QA 4G0UA 1XP8A 3HXPA 3BL5A 4BNGA 2O8NA 3ZV7A 4KGVA 5BWOA 1YOVA 3ADOA 1LBQA 2A9PA 1FNSA 2WZCA 3BCHA 4WZZA 1I4EB 3KOXA 1KO7A 1YZ3A 2G1JA 4JMPA 5KVQA 3UUFA 4MAMA 5IG2A 5KHOC 4UXIA 5ARDA 2JARA 1YHZA 2XWPA 5JALA 4FGJA 1YQGA 2FEXA 3NTLA 3PX2A 4YDRA 3UUGA 2SKEA 1XZPA 1PZHA 1QHHA 2D7CA 3VV2A 1E4EA 3DOCA 4P1ZA 4AKSA 5B1EA 1TM1E 4CGYA 1XZMA 1DKPA 3EN0A 4UVIA 5B7NA 4C7OB 1CJVC 4FI3C 1NBMD 2JIPA 4LKOA 5ALVA 4BGVA 2HU7A 4IM7A 3W6PA 4YV1A 3UH0A 4YLGA 1NG9A 5CW2A 3VR5H 4B6QA 5TS3A 2CL7X 2HNKA 4N6NA 3WK8A 4KFUA 5JRZA 2EEPA 3KB1A 5EMKA 1SQFA 5FBLB 5DM60 1ULTA 3JD4A 1GR1A 1GRQA 2Q3LA 3EDOA 5DNDA 3OQ6A 4QXMA 3I01A 2Z0MA 2QXTA 3DKPA 2KQUA 3IX7A 3R24A 5CFMA 1FFHA 4RY0A 3MFYA 4P5PA 3V46A 4D74A 3L0PA 2J32A 2O8EB 3EEYA 4GMKA 4YXFA 4J0QA 2IUEA 2BF7A 3P2KA 4CV0A 4PG6A 3UC5A 3SR0A 4PX5A 1DI0A 1UANA 4EMUA 3IE1A 5TVKA 1IUKA 5I4IA 1X3SA 1VKZA 5E6SB 2NZ8A 4MQFB 4RPJA 4FT2A 4KR2A 4KR3A 5CMLA 2C4WA 1S96A 1W46A 3TM5A 4CKZA 1IC6A 1N0VC 4WESA 1JR3D 3D8TA 3NWOA 2JD0A 3BN3A 1D4OA 5LQRA 1QH1B 3FOBA 3B5JA 4O2AF 2I3GA 2GK6A 3WIUA 2IF0A 2F1RA 1TYBE 1ETHA 1ZK0A 4ZP1A 1RE0A 1RKVA 2BKUA 2WHYA 4GX2A 1H85A 2BJWA 3R9XA 1P1FA 4B17A 2IOFK 1NF3A 4LW8A 3FUCA 1XZCA 2BONA 4MX8A 4R1LA 2JHFA 3SP1A 3G5AA 1RQPA 4UEWA 2D5LA 4LYGA 1RMYA 2CXUA 3OQ1A 4J8PA 3JWIA 1G20E 3AILA 2Y1FA 3IVAA 3PQ2A 4DLUA 3SKYA 3T38A 3KWJA 4HRXA 4ZQFA 4Z9XA 2B78A 3FG9A 4X63A 2L82A 5AIAA 2CW5A 3DFKA 3KQMA 4DDUA 2PXHA 2HF8A 2VQ6A 4LJAA 3T54A 1T8RA 1P1IA 1KHTA 2W0MA 3OO0A 5JD6A 4PYKA 1CF2O 5A0TA 4ZK2A 1T35A 3FLBA 1NDHA 1XDBA 3K96A 5LQDA 1EUCB 3K30A 1RKUA 3TPCA 2PKXA 4EMBA 3WMRA 1ZH8A 2VJYA 4LZZA 3NAQA 1UZUA 3WYDA 1Q7CA 4GAEA 1LTQA 3PPVA 2F3QA 1GD1O 1L8OA 3P9RA 4Z9AA 3SXJA 3JALB 3CLHA 4EGQA 2VBCA 1ZD8A 4RW0A 4RVGA 2OMEA 4TXJA 3OZWA 2JAQA 2J3KA 2C1XA 2ISCA 3EVFA 4UHCA 4YFYA 3SHQA 3TLMA 1CRQA 4JCCA 2R97A 4LCJA 3F6BX 2YYAA 1HNNA 1KI6A 3BVPA 2P2SA 3ISVA 4H3VA 4EJ6A 2HB6A 1GZSA 3RTEA 3QRWA 4GKBA 1XALA 4AX8A 1GQRA 2WJJA 2C54A 4Y9RA 5HS6A 1NUPA 1E1YA 4W7IA 2I2XB 4EW6A 5C8YF 4D4KA 3ASYA 4HQ6A 1XZJA 2XMZA 2JLWA 2J08A 3X1DA 1FP7A 1Q0HA 1WMEA 1Q5PA 2J07A 3KAPA 4WASA 4Y1RA 3KYCA 3KETA 1N36B 3QSGA 3VZDA 4JJ4A 3VC1A 3BA6A 4DSOA 2CHQA 2J3HA 2RHWA 3PR1A 1AKEA 3ZV3A 3WBBA 1I01A 4GZLA 4IMPA 2WWHA 1JHAA 1RI5A 2Q2VA 3NGLA 5G3YA 2ZWAA 3JYNA 2H16A 4X60A 3R0VA 4C78A 4HO1X 4FFWA 4JODA 4R1TA 3UKOA 5KNBD 5A5DA 1DIRA 3FVRA 5DTMA 5H1YA 2ZIEA 4IJWA 4LDZA 3FB1A 1J5XA 2C8VA 4NXNB 4WMLA 3V6LA 3RYTC 4BCDA 4G0MA 3LDGA 3MUOA 3LWBA 3UMRA 5DCYA 2ZR7A 4TT8A 1FK8A 2Z8ZA 2I33A 3N05A 1X0XA 3QNMA 4QD3A 5DGTA 1YK1A 4EKYA 4XLZA 3H5TA 5H3CA 4CFYA 1T3LA 2P41A 4TUYA 1B93A 1E3JA 3BTOA 3B7GA 1DADA 4L5YA 5EVJA 2B94A 3P9PA 3SQOA 1INLA 4PLTA 1U90A 1L0BA 2ZTLA 3ENQA 1E7YA 5FX2A 3TL3A 3KD3A 1YD7A 1Y37A 3IT1A 3QLUC 3FM9A 5IVKA 2I3AA 4MR8A 4PW0A 2ONKA 3VPFA 1UJBA 3KKEA 2R00A 2NNLD 5EXPA 2XYHA 4MK4A 3JQAD 4XB6B 4E09A 2CNWA 1ID1A 4BLQA 4HDKB 1WXDA 1Q1GA 1CUEA 4L74A 1JR6A 3G0OA 1FQWA 2NTYC 4R1UA 4CLHA 1C14A 1Z39A 3ESQA 1EFTA 1P19A 2C3UA 2OESA 3F67A 1KVQA 3DBHA 3GUVA 3KZKA 2D2VA 2C2GA 1DC3A 1HL3A 2WUFA 3TYXA 2RKWA 1SUCA 2IHYA 3A2LA 4EKGA 3D1VA 2YNMA 5CXUA 3AVUA 3NBQA 2CDRA 5CAEB 1NVGA 3WTBA 5EFOA 3KFVA 2PUDA 4KWEA 2FPIA 1Z4IA 3MWJA 2C2HA 4ZCQA 1YQQA 4RCVA 4MV3A 4PAWA 3DAPA 2F62A 2GHQA 1GG9A 4F2GA 4OP2A 5B1IA 2YWDA 1KPGA 5LKAA 3FDZB 1K5GA 1WBJB 3ID6C 4EQ6B 3L4EA 1QHEA 1CY6A 1UFKA 2C2KA 4IXMA 1EHIA 1FUKA 2QMEA 3HKDB 2ZBRA 3QVXA 2CXTA 1YUNA 2DE0X 4HEHA 1OGJA 1IUOA 3WL3A 2ZI4A 4NV3A 4HAWA 4RPCA 1C9MA 3QQ5A 1WMFA 3DFMA 3S2IA 2JVIA 5KDLA 1WA5A 4NEHB 5TQ0B 5KHLB 5CCXA 3C6YA 1X42A 2W71A 3FUXA 3TR6A 4JVNA 5I7EA 1EK5A 1D09A 3CSUA 2IUSA 4RKYA 4RZSA 5LOVA 2RGRA 2QJFA 2XUFA 1IJFA 2YCBA 1A9XB 1WPRA 4TQAA 2QTFA 1HTBA 4LGCA 1S8OA 3CONA 2UZIR 4LX8A 2QTRA 1U94A 5C5EA 5M34A 3AUTA 3SR4A 1P7WA 1A4XA 1NXXA 2MSDB 5GMOA 1APBA 4MMXB 2VP0A 4TRRA 2JBAA 3A1TA 1QVAA 5TRTA 4K6KA 4PN3A 3QXCA 3ZK9A 5JSZB 3KRTA 1C81A 3FI0A 2XVMA 5JFOA 4IDOA 2ENUA 1F06A 1YC5A 1XVTA 4RGVA 2Y1GA 3MW8A 2PKYX 2Z1MA 2FPLA 1AUVA 1Q74A 1N9ZA 2X76A 5IARA 1IIRA 1HYEA 1AUQA 1SXJE 4LDNA 3V1TC 3QW2A 3WQSB 3TMAA 2JCVA 2Y71A 2I55A 1GQSA 4DUGD 2P6RA 4PNPA 1JBQA 2CLMB 4HDOB 4LECA 3ROMA 4Q24A 4FKZA 4EHIA 4WCFA 4XWYA 5B64A 5TIIA 1WCYA 2QQ5A 2R8OA 3GF4A 4NABA 3ZNQA 4AIRA 1QO0A 3AI2A 2NLOA 3LVFO 2QVYX 4MVJD 3ZZNA 4U2DA 3HI4A 3TNYA 3MB5A 3VBCA 2QPLA 2CC2A 2VH2A 4R1QA 4WJLA 3ML1A 1P7VA 2JH8A 2QTVA 3SJUA 2CVHA 4I55A 1MB9A 5TPZD 4CMIA 4B43A 1YA8A 5BR8B 2HGSA 3DBVO 5AJTA 2HJRA 2COEA 3IO5A 4L51A 4HQRA 3EPKA 1CUXA 2J45A 4DSTA 2MR5A 3AJ8A 2CNLA 2B0JA 2H9IA 2XBUA 1K8XB 3BFVA 5EQDA 4EHJA 2Z2ZA 4D3FA 1OTYA 1RQ7A 4OHPA 4EG1A 1SBHA 2CJXA 4OBEA 3L8EA 2E3JA 2X0FA 4IKPA 3I05A 3HGQA 2DYKA 4O3FA 6REQB 1QAQA 2B61A 1TZBA 2RJNA 4RE5A 4Y2VA 3GVIA 5LB2A 4OLHA 1PEKE 1VTKA 2NPOA 2VJQA 3OEEA 3OQMA 2A5GA 4ZDJA 3WVNA 1FDWA 4TYQA 5SY4A 4BNFA 4LK3A 4EA9A 4M0PA 4PM4A 3OKPA 4AWBA 3ETNA 4NMXB 1D1SA 2ZWPA 4CEIA 1UXHA 3QOXA 2PA3A 4BNYA 3OTQA 5H16A 1QRUA 3W8EA 5JXIA 3KR0A 3M1LA 4ZT6A 2KBEA 3KR1A 5KJ1A 4KU4A 1XSEA 1RXEA 1VYHA 4U3JA 1VCOA 1G7SA 4QYSA 3GGDA 4R8MA 3RF6A 1W0JD 3ER6A 5G0UA 3TIVA 3UJCA 1WSBA 1NW8A 3H11B 1T8TA 3ADPA 4KIJA 3ZBQA 4RJTA 2VJNA 1N92A 1I30A 1I3KA 1CUVA 3TI9A 4LTDA 2JCYA 3G8AA 1NXPA 4IVRA 1O9GA 1XEXA 4DVGA 1R8XA 3RSLA 3AO0B 4G89A 3WL4A 1M6HA 3SFZA 4RETA 2AG5A 4C29A 2JCBA 4ETIA 1XRPA 2WU0A 4BUCA 5EJGA 2JANA 1Z13A 1DJLA 4JJ6A 5KBYA 3PWKA 5HM8A 3X43A 3WSVA 5L53A 1AS0A 2O8VA 2R7NA 3QJYA 1R6UA 4LWPA 4DEYA 1W7AA 2CL0X 3DZDA 4QDXA 4BYGA 3ED1A 4ZA2A 2R6AA 5ALYA 2IEGA 3PFBA 1H4QA 3H84A 2ISQA 1X13A 1ZKMA 4ZO6A 1ZCBA 4BAZA 3GLFE 1KJIA 4HH3C 3RKUA 2P7HA 4AO7A 1GJRA 2JAOA 4YALA 4H1HA 4QFDA 3NV7A 3WB0A 5GINE 1U63A 1GHTA 4FGLA 4C4YA 4C4XA 2XF2A 1VXRA 3P9KA 3H05A 1KI7A 2C8KA 2PUWA 2X0RA 2DBVO 1QK3A 1X1EA 3LQ4A 4RDCA 1KQOA 4UQPA 4YY3B 1LS6A 3PQEA 1IG3A 3C48A 3IAXA 4UNPA 3CNHA 4R1PA 4JI1B 4BFTA 1ZVVA 4OHYA 3PD0A 4JI7B 3EIUA 3E3NA 5EJ9A 1E79A 1RRGA 3BXPA 4ID9A 4YQZA 4E6PA 1UBOS 3UJPA 2J9FA 1L4UA 4GMXA 5M2QA 4PX9A 1WABA 3B78A 5AI4A 5FYQA 5BVGB 2PVPA 3HQ4O 2ZS7A 2YJNA 4G07A 5LXTF 1HE3A 1TQ2A 3G8CA 1JAHA 1V6CA 3QVWA 3S29A 1KZ7B 5BR4A 4AMYA 3ROPA 3VOAA 1Y6ZA 3DOOA 1M54A 1N5KA 3CCFA 5EXDA 4PNEA 4I8IA 3IBSA 1Q0UA 3K1AB 4NEQA 5JSHA 3IPRA 3NWBA 3WSTA 2Q5HA 1EXDA 4OB8A 1CYDA 2DR0A 3ZWNA 4JJZA 1UJ6A 2Z5LA 3VH1A 4R2MA 5SYAA 5BV2P 4ROTA 4BE9A 5FWXA 2ZJ6A 2D0OB 1XQ9A 3LZDA 3Q9LA 2O1EA 2PLFA 1JQ3A 2QGNA 3JVIA 1O1YA 5C1IA 3C3JA 1N2JA 3L05A 1YHYA 1A04A 4PU0A 1M2FA 2FN8A 2GXSA 2IPNA 4J1TC 1EUYA 1B3BA 4KQWA 4PX2A 1J7KA 2POQX 3RQIA 1FCJA 1PR6A 2G63A 2ZWVA 2H9AA 2QKYA 2QW0X 2P4EA 3FH0A 4IXWA 2XAUA 4O4HA 1MVOA 2HXYA 5ARCA 1L7OA 3ZXUB 2JIQA 1Z34A 1UMCB 3KU1A 1YFZA 2P1DA 1ZM9A 3RAJA 3KG2A 3HL0A 3I83A 3T1VA 2WSSD 4E30A 3EPRA 3WZMA 1FTGA 3PNVA 4KSCA 4TL7A 3STUA 1BHO1 1PJQA 3T3MB 1X87A 1IM2A 3Q9UA 1N1GA 5EZYF 2DETA 1XCJA 4IFTA 1GPYA 1BHQ1 1XTSA 5D51S 3CZMA 1W88A 4M0KA 1R00A 1T26A 3ROEA 5LYJA 3ZY5A 2IXEA 2DJIA 3AR7A 5EP2A 3SYRA 1XZBA 2P8JA 1Z16A 2ECQA 5HGJA 5FPHA 4H6WA 4DCOA 1K8ZB 5AOCA 4KSYA 4HDRB 4E13A 5KUTA 1VJ1A 1YJCA 4K9LA 1GQFA 1NUHA 1AGXA 2QRKA 4YCLA 2WIGA 2O8BB 2P35A 1A72A 2Z57A 4HGPA 4A0RA 4MIKA 3SDBA 4WLOA 1IN7A 2VRBA 2WV9A 3KQYA 3RFVA 3WYNA 2BV3A 1NFQA 4PZDA 5E9JA 1GTJ1 1GCAA 4X7BA 2G9RA 2J3DA 2ODQA 1RJEA 2NSYA 1WOMA 1AD2A 3B85A 4M7RA 3HNPA 3CU5A 1JVBA 5ENZA 1ML4A 3A3OA 3CINA 1I5RA 1OJLA 2ZRCA 4WK4B 5EMHA 5KX5B 5HNKA 4ZCSA 1NQUA 5AM0A 1HLFA 5DM1A 2GKSA 1IHOA 3U31A 1LF5A 4ZVLA 4OU4A 1MJFA 4EP1A 5EJ4A 4DYHA 3BILA 3R9KA 4DMCA 2PIAA 3VDXA 3GEBA 2P75A 3BAFA 1N6KA 3QXXA 4XR9A 1CR4A 4HH4A 3M4ZA 2WAAA 1YIOA 4LJ6A 1QH8A 5EKTA 1Z4JA 5FTNA 2HO4A 4D57A 3N2ZB 2BM9A 3AUSA 4LXUA 3V1YA 2IH4A 1P72A 2GF0A 4ENPA 1M8PA 2ZR0A 3MAAC 3DMTA 3QVGA 3QVMA 5H80A 3ZGOA 1K6IA 4V1CB 5KJ6A 1P1BA 4A10A 2PX0A 2GTIA 3EMBA 3FYUC 1SCIA 3IP5A 4GECA 3GRPA 4KXFB 4L22A 4J16A 5B37A 4IVPA 4JA2A 3O2JA 1O6GA 2C07A 3OU2A 4DCUA 3DO8A 4IQGA 4JIMA 4MHOA 1Y7PA 5ALOA 3MILA 1RQXA 1X7XB 1FP1D 2RG1A 3IAEA 1VKRA 1H69A 1TMGE 4U7FA 5IYZA 5EZQA 1Z37A 2VBIA 3T9FA 3W5UA 3PX3A 2JFNA 3E8SA 1YZTA 2VP6A 4MUHA 4YJ2F 2XMBA 4PFSA 2SHKA 1XDZA 4D6PA 1BAPA 3FOEC 4G01B 3WYCA 2JZCA 2FPPB 1UMDA 1VPEA 1Z5VA 2Y4OA 4GPZA 2ZJBA 4MLZA 4PVCA 5C5IA 3HCCA 4MLCA 5IK2D 3HPQA 1V7CA 4IX9A 4X71A 3ZLJA 1ONNA 4HAYA 5EEHA 4OQQA 3F4BA 5DPMA 6LDHA 3H8JA 1JQAA 4IIUA 3AETA 2Y77A 4GOKA 3FMIA 5A4FS 3H6KA 5DHQA 3DOJA 1E8MA 4RH1A 4BUZA 1YZGA 1E6UA 4ND1A 3ENNA 5GM1A 4GOJA 4F6RB 5IF9A 3L0YA 1ZLXA 1OXUA 1LV7A 4R6WA 3HDHA 3EA0A 3GLHA 5C18A 5CDFE 5SV2A 1PHPA 5CIWA 1UJ5A 2I03A 3DLAA 2H4HA 4FQ8A 4IICA 3S5UA 4DIUA 5F7JA 1OBOA 3OQPA 5CM2Z 4N0DA 4JUCA 1ZITA 4ZIRB 4HX2A 4N18A 2XDQB 1K6XA 5HJ2A 4A92A 2CNBA 2I0FA 1R4AA 1KO8A 2CMDA 2PVSA 4UMDA 3ZHQA 2BMEA 2QBYB 1KP3A 4LMAA 1Z9BA 3E2IA 1U2PA 4IHJB 4ZV4A 1QH9A 3OTOB 2JH3A 3IBFA 1S7GA 1M1YE 2V7QD 3AOEC 3X1MA 1DELA 3EYAA 2XGSA 3PI7A 5L7YA 2ZYVX 4KWCA 2PJRA 1ZH4A 1GAQA 2QRPA 3BQNB 2I8CA 4ENTA 1T2FA 1BXGA 2P9TA 3E8MA 3LBYA 3UV7A 1US8A 2NYUA 4WOPA 4YBZA 1MUUA 1ZRNA 2AZTA 4MQ4A 4PLPA 3NAGA 4DLVA 3MJFA 3BH6A 2M6SA 4WRRA 5DMHA 4RD6A 1G2PA 4J4HA 2HQOA 5I9LA 1LRJA 3QFSA 5A1TA 4KEAA 1CULC 2EWMA 1GXSA 3ZWAA 2GAOA 2B1JA 2IGTA 2DWOA 2NZWA 2QG6A 4GI2A 4Y6PA 4YQYA 1EYZA 2KI5A 5EYPB 2DAPA 3IT0A 4IWNA 4OM8A 5B30A 4IPTA 1RC0A 3B7WA 4ZI7F 4WDRA 1JE0A 3RC7A 4FCWA 4Z0NA 3DDOA 5CVCA 4W1QA 3WLIA 3H3JA 4DG5A 3VPXA 1VPVA 1N8TA 5ABPA 1Z2AA 3RW9A 2AG0A 3R40A 1PD0A 3LQFA 1C9DB 2H3EA 3G68A 1JSZA 5H4HA 3V1LA 4K2HA 1KO1A 4AJIA 721PA 1ZWKA 3HDTA 4ZT4A 1ZW6A 2CUTA 4ARAA 1U0HC 4R71A 4F9EA 4G56A 2BKEA 2IV3A 2ROQA 1PV2A 1PQYA 3HYSA 3KOOA 1KK2A 4C0JA 2WVJA 1ORVA 4C7MA 5AVTA 5IKXA 3A6PC 3E70C 5M5BA 5EC8A 4DDHA 3OA2A 3OHSX 5EAIA 3HXLA 1XJQA 1OLUB 4KAXA 1FDRA 5HFAA 3RNLA 1EWKA 3SS9X 4BNDB 2PMBA 1OXXK 1Z5GA 1PIWA 2NTNA 3DZGA 4M8LA 4OHFA 1FMJA 5EINA 2R6CA 4AYWA 3VI4B 3LHSA 2DFPA 2PR2A 1XQXA 3LLUA 3GNTA 3G82C 3UWOA 1NI4A 4QTYA 1C8VB 1PR0A 1YC2A 5LMNB 4NDZA 2ZWOA 1KOFA 1L7PA 1UEXC 1ZVQA 2OKCA 2NZ2A 1J21A 2DPMA 2OZPA 2PL5A 2RK6A 4DBLE 4QDOA 4C06A 4KGXA 4NAUA 4ZJYA 2FEWB 7GPBA 3QU2A 4FONA 2G72A 3M6LA 1FJGB 2A4KA 3Q12A 2WP0A 1QLWA 1TVKB 3CX6A 3Q3VA 4Z0HO 2R2GA 2PMKA 4F72A 1O97D 1PJSA 4OXQA 1QPGA 2ZGVA 3L8CA 3MINA 4NP6A 4LZOA 2VNJA 4TSRA 3WV4A 1J8FA 1QIGA 5BWMA 1W44A 3BJIC 2AMLA 4O02B 4TL8A 5A9TA 5JZSA 1UAGA 1BHJA 2J31A 4QRHA 3Q3HA 3VSBA 1PJBA 4I6EA 3RVDA 1ELOA 1RIFA 1CQJA 5G02A 3OZUA 3JYPA 3L6EA 4QXAA 4X41A 4X54A 3VR5A 1BJKA 1XD9A 2YRFA 4FCCA 3SU8A 3PFGA 1Y6FA 2IYYA 1VHTA 4G23A 3NC0C 2ZE7A 5G0VA 4ALKA 1G5RA 2B4RO 4OPMA 2FXIA 1JDBB 2V6FA 3ABOB 1G42A 3J80A 1M1YA 1IK4A 4TX1A 4RX1A 1QRSA 1LSSA 4TMFA 3UXMA 4J94A 1GQOA 2VR1A 1JEYA 1TK2A 3A2KA 3DWIA 4L78A 2ODWA 1XZKA 4PGMA 4UZSA 2GYWA 1A4IA 3O26A 3U80A 3IBYA 1X80B 5FWNA 1L5RA 1OFVA 1VJDA 1Q3TA 4JC4A 4X20A 3RSGA 2EGUA 1TGVA 4LF6B 3FOAA 4I4NA 2VPZA 2R4TA 4DDWA 2XCOA 1MEOA 1CCWA 1CTQA 1N8KA 2W2KA 1ENOA 3I2KA 4RWEA 4M21A 1G5PA 1KTVA 5B57C 5KDDA 3NOVA 4TZ0A 1PFYA 1T2VA 2AN5A 1G6OA 1SZJG 4X1IB 4MWEA 6GPBA 5IXSA 2LBPA 5J58A 2Q2NA 1MO2A 5AKKA 3RU7A 3W90A 3P4XA 4I99A 2GM4A 4XJVA 2C2YA 4DR3B 1OFIA 5CT5A 1H2FA 2QSYA 2WQ6A 3S81A 4NBNA 1E20A 1M10A 2RGNC 3EAQA 1TCVA 1JHZA 2W83A 4QUEA 4UHDA 2V8BA 3LIPA 4MCHA 3A9VA 3HR4A 5C80A 2E89A 4QQFA 2IYTA 5BV1A 4LYJA 4Y0NA 2B8NA 5U4QA 1BXRA 1OX4A 4G86A 2PPVA 1SURA 4KL8S 1POWA 4NAVA 2WTMA 4EO9A 2IYEA 1WAMA 3GT7A 4UBLA 4LNAA 3BUSA 4BNIA 3MELA 4D02A 1WHTB 4CQMB 2A0KA 4IFIA 1N2SA 2B4QA 4ODIA 1H8EA 3OOJA 3A4NA 3NTOA 3BIWA 4QTUB 3UWDA 3AR4A 5AK6A 3VU0A 4UTZA 4BO3A 4MUIA 2Y0DA 4Q3CA 1KZ6A 1G8MA 1QE3A 4MS4A 4PHCA 2OCKA 5DTIA 2OQIA 1TRKA 3HDYA 3IP7A 1EFKA 2NAFA 2X1VA 4YP6A 1QRTA 1P1CA 5TQ2B 1I0ZA 2VCHA 1RI1A 4I5GA 5A62A 1E58A 5K9ZA 4UCFA 3V9PA 5FWDA 4UJ3A 3PQ7A 4PZLA 3EHDA 5EOVA 5KTTA 3EGWA 1I2BA 3UOGA 4PHFA 3C7DB 4CF4A 3S28A 5AK4A 1W96A 2ACVA 2VQFB 3CE6A 3ZDEA 3BXOA 2XKKA 3WY9A 4KN9S 3R0ZA 2QSZA 1CQPA 3GY0A 3T7AA 2A58A 4CEJB 1WXFA 2HA5A 4I1UA 3AJDA 4CEHB 3LDUA 3ZDCA 3G1TA 3VRHA 5FYDA 3ZYCA 2CD7A 3DOFA 2H17A 3I4CA 2V1XA 4CM6A 5TV2A 1A7AA 4N9QA 3FXAA 3SX2A 1C50A 5LP6C 2IV7A 1V7ZA 4DWVA 2I1VB 3JVVA 2EW2A 3HU1A 3MTEA 3U16A 2SBTA 3DM5A 3R6DA 1XDUA 4XGQA 2XBMA 1VCMA 2C00A 5JCXA 4Y2HA 5C7OO 4KI0A 4NIMA 5KJCA 4Y2SA 3PXCX 2C9MA 2XHEA 5IWCA 1P2UA 1P9WA 2J5QA 2UKDA 1GPNA 3BHNA 1RQRA 2H92A 1SOVA 1QKJA 2ZB7A 3I53A 3TB6A 2PQ6A 4F3YA 1NBHA 1VOTA 4HD8A 4LKRA 3RJ9A 3LUCA 4YMVA 4GFDA 5JMWA 2BH9A 1HG1A 4PNHA 5KTSA 1T24A 3K4QA 5T4HA 3G0BA 3LBNA 2C7GA 3P1JA 3W0LB 5IWAB 2D0DA 3UGTA 5M04A 2WA2A 3SIXA 4DLZA 3VDMA 1UMKA 5SICE 1R0RE 2FRVA 2B4TO 2HQSA 4OJYA 1GPUA 3GC6A 3KB6A 1SVNA 4G09A 1WZEA 1YZHA 1CDOA 4I1YA 4ZZ1A 2UUBB 2Q1XA 2D1RA 2GNOA 2HHHB 3UT5A 2JGAA 2BFCA 4WJZA 5FFFA 4R2KA 4TOIA 4A03A 3TLJA 2VYFA 2QRLA 4XYMA 4QRDA 3STYA 3ZKWA 1PZFA 5BW6B 1W4ZA 1PTJC 5AW8A 3F5MA 2AWOA 3QUAA 5JEEA 1FFXA 3DV9A 4B6SA 4DJEC 1QX4A 3RT9A 2DPXA 2UYYA 1NXWA 4H0CA 3I1IA 3L7JA 4ZRDA 4K7JA 3R4VA 4JDUA 4NK4A 4QPPA 4OHBA 4K6CA 1NI3A 3T5BA 2K4MA 3E5RA 2EFDB 5MN6A 4QPJC 4YMUA 3I23A 4KPUA 3KPJA 4YH1A 4I3GA 3TNJA 2A35A 1YJ5A 2I8LA 2RDMA 1WXXA 1OBHA 4MYDA 4MS3B 2PZ8A 4GYKA 3R7BA 4HLUC 5TGDA 4XARA 4NSNA 4IGIA 1JSXA 1U5CA 3GUHA 2YN4A 1VLHA 3UGQA 4RKWA 4BMVA 1AZLA 3DC2A 5JDIC 4D46A 3KKKA 5K3FB 4EAQA 4H7JA 1RWWA 3VYUB 3OT1A 1QAOA 3AM4A 4LRQA 4WZBE 2B5VA 2FFQA 2P62A 1AA6A 3QG5A 3SS7X 3HR7A 4TV8A 3GV0A 3WK6A 4L76A 5IAAA 4PC2A 3ZW7A 5MN5A 2PS3A 5BN3B 2VF8A 1H2HA 2WJGA 3VU9B 1SVMA 3HYRA 2PUEA 5CB4B 4KRXA 5ELMA 2C9OA 5D3KA 1LVGA 4BO8A 2YHBA 1IUPA 2CMGA 4DQXA 3C39A 5BNFA 4G5HA 3T5PA 2HN9A 2PLAA 1HSZA 5C3UA 4ACAA 1AHIA 1EFAA 1RPNA 4UUMA 4UU7A 2BCGY 2AMVA 2AR7A 2X40A 3TBFA 1BGVA 5GQSA 1SGWA 2GN1A 4KXWA 2MOKA 4J91A 3VVLA 1U11A 1AK1A 1W94A 2VO1A 3PHHA 3ZY2A 4I5EA 1GWNA 4L8WB 1QG4A 1U0NA 1IWPB 2O52A 3RUCA 1XXHB 4Q1AA 5AXAA 2C58A 2RH9B 4UM9B 3D2LA 1R66A 2GT1A 3I6MA 3NVKI 1PJ8A 2OT3B 1NX6A 3K4HA 4L08A 2OCXA 1JDTA 1ODCA 2CDCA 5I9MA 1Q1AA 1Z68A 5GZ3A 4G9BA 2CLFB 1Q1QA 3MD9A 2D06A 4KQKA 5IFLA 4Z2YA 1JTFA 4PS1A 2OBMA 3HNRA 2MSEB 4U2BA 2MJLA 3K73O 1V9LA 4G4GA 3EZYA 4YRRA 1UPUA 1OZ0A 4BVGA 3LUDA 4CMEC 1PGQA 3G5MA 2GEDA 4CKCB 1E0JA 1I7LA 1WUIS 3FBGA 3HMKA 4P4GA 3IR5A 3M3DA 4YUZA 1K66A 1JIKA 1MENA 4JHLA 4L4XA 5BUSA 4N5NA 3CB2A 3B9BA 4QOGA 4BJ5A 5HYVA 4DW8A 5IW8A 3NHKA 4HUJA 1Z18A 2CVPA 2IIPA 2QNIA 4C4OA 5JADA 2FKNA 1BOFA 2O2IA 3QA3E 4GNKA 2HUNA 4HNRA 4YXWD 4BO6A 4V38A 1H3FA 3IMGA 3Q7RA 2QRGA 2FOIA 1EVQA 4UM7A 3TKAA 4X9XA 4P7GA 4FLMA 3I92A 1AIPA 1XU4A 4OUKX 1TRHA 4HYEA 3RSHA 5B3JC 1X9IA 4HDNB 1YQXA 5FL7A 2XGGA 2GEJA 2JZNA 1HG0A 4MA0A 1YE5A 3QXSA 3RS5A 4V3CA 3AF5A 4MOWA 4MUXA 3FNGA 4EMTA 1H5NA 3GJ8A 4PICA 2ZI5A 5IT0A 1ETUA 4QQ8A 2BGJA 2IY7A 1IXSB 1W36D 1U7PA 2BZ1A 2HF9A 3GRAA 4YJFA 5FBRB 3B6IA 3EFHA 1DX4A 2JFQA 2H5EA 3L49A 4R7GA 5HCNA 1JEOA 4FC7A 3DE4X 3FVVA 3P0HA 1EGVB 3A36A 6CHYA 3LY8A 5I4CA 1QHGA 3LPAA 2GCGA 3R5HA 2PEZA 1IBMB 2GM5A 3E61A 4P53A 1KI9A 4CM1A 1ACJA 2OLKA 4BMDA 1P75A 1MJ5A 3IVRA 2ONCA 4TL9A 4WA7A 1AMOA 2R1TA 3I2HA 3WLTA 1JVSA 1K88A 3L18A 4TL6A 5J9FA 2VHYA 3HP1A 4RF2A 3WMXA 5DLYA 2EBUA 4C88A 2EDCA 2C4MA 1OASA 5IX8A 4Q3DA 1ZC3A 4H60A 2JBWA 1X8KA 1AKRA 2ZPAA 2N47A 3CZ5A 3OM9A 3MIZA 3LUKA 3M89A 3N3BC 4JEUA 1XVUA 3TTYA 3AVTA 1YB4A 1B74A 3C4JA 3BE6A 3N8IA 4L75A 5JQGB 5IKOA 4OI1A 3RR2A 3EXG2 3EPLA 2JIDA 4N3GA 2WY2D 3M1YA 4JNCA 2QTGA 2WIDA 3G85A 5ALLA 4N8DA 2VAVA 4FHCA 5I7WA 4WACA 1BW9B 3TCXB 3LCRA 1Y1SA 1YJXA 5BYBA 1E96A 1SHJA 1QGZA 2F3TA 4XDYA 1LI4A 4X8MA 5CB6A 5TT0A 3HB1A 4EHKA 2VRNA 1OAAA 2XD4A 1L7VC 5E95A 4MVJI 3TOZA 5LL6P 4MYTA 4GMDA 1HR0B 4B4UA 3I09A 2WG1A 2FSHA 2Q3EA 2AI3A 2AJCA 2H1HA 2YHSA 1YKSA 3DW3X 3E8XA 5IDXA 1G18A 2QUBA 4KIFA 2BIFA 4TMTA 1N0UA 2HHLA 4NQRA 4A4DA 3NP9A 4F4JA 2PUTA 3DC7A 2NUPA 3A25A 2J0SA 2AFHE 1A9RA 2QVBA 2F43A 4RLHA 1M2HA 3VYRB 1HYGA 3BD8A 4MV4A 4DQLA 3N2LA 4INAA 4CF3A 3BXFA 3B3AA 3OIVA 3ZHXA 3PPIA 3KKNA 4P36A 3P0EA 4C4PA 3F7NA 2QGZA 4C07A 2NYVA 4EUNA 5K6AC 3F2VA 4DG9A 2UZ0A 1C41A 3EA5A 1OU0A 2QHXA 5A9SA 1RTTA 4BCCA 1YJAA 2UXCB 4HT3B 3HLKA 2NXCA 1OHHD 4QWWA 1MD9A 1E0DA 2XF8A 1ZN7A 3JZIA 1RCFA 4DCTA 3S4YA 1PLKA 1RFLA 1F14A 1TK9A 3LCJA 2VTDA 4MPDA 2FAXA 4QBTA 5F2EA 5GGYA 5FXMA 5JANA 2IZOA 3NJ8A 3PGMA 3QU5A 2LV8A 4KYVA 2EG5A 2QP9X 1EMDA 5M7EA 4RZ2A 1IAVA 3K0CA 3GFRA 3HLTA 4G0OA 2AL7A 1XU7A 2B3TA 3B1ZA 3N2EA 1S02A 1E2KA 3I6QA 3DZFA 1LJ8A 5F1PA 5J4VA 4DS3A 1ZH6A 2PUJA 2H3HA 3K9FC 1HL7A 2UUCB 1E3WB 4Z86A 1W2GA 1JN0A 2WU1A 3EEIA 3E4DA 1XV5A 2XUPA 3ORSA 3TZBA 3KYJB 4LJ7A 4MROA 2HSGA 1L3BA 1Z8NA 3FRIA 4R5MA 3U7EB