1BKYA

Vaccinia methyltransferase vp39 complexed with m1cyt and s-adenosylhomocysteine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Mrna processing
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
total genus 97
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1bkyA00
5EVJA 3AWIA 3GU3A 3M6UA 1X1BA 3DXXA 3P2KA 5DRYA 4RTOA 1VBFA 2PJDA 1ZKDA 3DMHA 5E8JA 4ISCA 3I9FA 4FGZA 1SVUA 3HA7A 3M33A 4E2XA 1I4WA 1EG2A 4PYOA 2UYHA 3BWYA 2ZCJA 2DULA 1SG9A 4OA5A 1DCTA 3LBYA 2AN4A 2Z6AA 3K6RA 2OY0A 1DL5A 1Q0TA 2ZULA 1YB2A 3G89A 3T0IA 1L3CA 1DUSA 3SSMA 3ELUA 5P8WA 4YUVA 3EGVA 3SVZA 3EVZA 2YTZA 2QY6A 2HR1A 3B7PA 3DR5A 4IV0A 5HIMA 3UA4A 5E1DA 3A26A 2PXAA 3S68A 4OQEA 5E1BA 5K03A 3NVKI 5EMJA 3MB5A 3SR4A 4GOOD 5BXYA 5DT2A 5ICCA 5DM0A 3LCCA 5CCXA 2LD4A 4LWPA 4RTKA 5EQJB 2HV9A 4GQBA 3CJTA 4DCMA 1N7IA 3EVEA 5CIYA 2BR3A 2IFTA 3G2QA 1QZZA 5H02A 1FJXA 2P3OA 4RVGA 1EQAA 2N47A 2UYCA 3E23A 4DKJA 1O9GA 1RJDA 3GJYA 4XUDA 2P8JA 2EJTA 2JH9A 4R05A 4FT4A 1PRYA 3IEIA 1T43A 1VPTA 3FZGA 4PIMA 5EMLA 2ADMA 1NW5A 2G1PA 1RI5A 7MHTA 1XDSA 2OKCA 1YUBA 4X1OA 1P1BA 1AQJA 5EHGA 2Y1XA 2NXJA 2ZSUA 1XDZA 3QOWA 5CVVA 2ONYA 5DTRA 2PT9A 3SXJA 4LG1A 4GEKA 5EOVA 1P39A 4JXJA 4OBWA 3KPWA 3HCFA 5ICGA 2ZLBA 2IBSA 3O31A 4HC4A 3UJBA 3CBGA 3LGAA 3GIWA 1EAMA 4BLUA 4YV1A 3KR1A 4PCAA 3CKKA 5EC8A 3PLAE 2XYQA 2P7IA 3EVAA 2PT6A 1AQIA 3FPJA 2B2CA 4DM3A 1F38A 3B3JA 3R0QA 3A4TA 1G60A 3CVOA 1SUIA 3RW9A 3SSOA 5DTQA 1X1AA 5K09A 3SSNA 1XJ5A 3G8AA 5ICFA 1D2CA 4WVLA 5E2AA 3MHTA 1QAOA 1RJEA 1X1DA 1JQDA 3FYDA 2FYTA 3CJQA 3FUXA 3PFGA 1BHJA 1EJ6A 3LHDA 1WY7A 4RWZA 3GNLA 1XVAA 4RVDA 5ICEA 3HA5A 4CKCA 1VIDA 4MWZA 1JQ3A 2UZ4A 4CTKA 4HH4A 3FTCA 3MGGA 3NJRA 1BKYA 1NW6A 1I1NA 3GO4A 1KR5A 3HCEA 3FUTA 2NXEA 2PX2A 3MCTA 4YV2A 5LQRA 4KRGA 3OZRA 4Y30A 2BR5A 3R3HA 1YFJA 2BM8A 3NWBA 2NXNA 4YUWA 1F3LA 1NW3A 3EPPA 3FTDA 3LKDA 5JR3A 4E70A 3TMAA 2GH1A 4IKPA 5CVJA 3HVJA 3PX3A 2XYRA 4G56A 4XUEA 3KQOA 3NDIA 5DTMA 2VS1A 2ZVJA 5FA5A 5EEHA 4KWCA 1ZGJA 4QVKA 3BWCA 3EEYA 3RODA 2ORED 2NYUA 1YF3A 5CUQA 2IIPA 5EIWA 3P71T 5LQNA 3GDHA 2AOXA 3DLIA 3PB3A 3TFWA 4C04A 3NDJA 4HG2A 5GM1A 4HGZA 5LSAA 4PCLA 3M6WA 1JTEA 2JG3A 2PXXA 3LPMA 5EKUA 1JG4A 5LQAA 5GM2A 3DP7A 1G8AA 1WS6A 5DSTA 2VDUE 3HTXA 2FRXA 2IP2A 2HWKA 3ELYA 1NE2A 1SUSA 3TRKA 3FRIA 2ZFUA 3BT7A 1G6Q1 4QQNA 3Q87B 2I7CA 5FCDA 1G55A 4FSXA 3EVGA 3OPNA 3OCJA 4RTNA 1U2ZA 3VYWA 3B5IA 3JWHA 4YMHA 5K0NA 2PWPA 2R6ZA 5HIIA 1QAQA 1JG2A 2F8LA 3GRZA 4CWAA 3GRVA 1VE3A 2BR4A 2FK8A 4HRAA 5EIFA 3TPZA 4AZTA 5FHRA 2WK1A 3DMGA 3ANXA 4KVZA 3EMBA 4Z2YA 3OZSA 2OYRA 1VLMA 2G70A 2GAFA 3TOSA 4ER0A 2ZTHA 1KP9A 5GWXA 1MHTA 2FHPA 4QDJA 5EMMA 1B42A 2B9EA 3BZBA 5DWQA 5E9WA 1YFLA 5T67A 5K0LA 2H00A 4CKBA 3DMFA 4PGGA 1JR4A 2ZZKA 3G2PA 3PT9A 4GOLD 5DSXA 4E30A 5CVUA 2QM3A 1MJFA 5FWAA 5F2NA 3I58A 1FPQA 2XVMA 2ZBQA 3FPEA 2EX4A 4V0RA 5DM2A 3P9IA 5K0FA 3EMDA 3EVFA 3P2IA 3IHTA 3KR2A 3MCZA 3UBTA 4RTQA 3AXTA 5IKMA 3KQWA 4U7TB 3C6MA 5C0OE 5MHTA 4HGYA 5K0JA 4ER3A 1M6EX 1V39A 5EGSA 5FQNA 1VQ1A 2I6GA 3B3GA 4FP9A 4P58A 5FADA 2AOWA 3CJRA 3DXZA 4L7VA 2XVAA 2YUIA 3M70A 4FS8A 5F2OA 1KYZA 2CMHA 3TM4A 3F4KA 4RYLA 2B25A 3VSEA 4AZSA 4KDRA 1XXLA 3PS9A 3EVBA 4QDKA 3OZTA 3P9CA 4ZTBA 2PY6A 2EJUA 1NW7A 1VP3A 5KQSA 4GBED 2JH8A 2NP7A 2PWYA 3DLCA 3GCZA 4RV9A 4YV0A 1SQGA 4GOND 3A7DA 2IGTA 3DXYA 5KYGA 2XYVA 5G02A 3IYLW 2A14A 2IPXA 5E2BA 4EQZA 1R18A 2HNKA 2IDKA 5CVEA 5BW4A 3LCVB 4X61A 1R8YA 1QANA 4EVIA 1KIAA 4GC9A 3M6XA 5FTWA 1L3BA 5EZSA 5C1IA 4X60A 4RSRA 5T64A 2IH4A 2ZIFA 5CVDA 3TQSA 3BKWA 1HNNA 2AN3A 2AN5A 2G8NA 1XCLA 2Y1WA 4PYIA 3RIEA 5DXJA 3T7RA 3TM5A 3X0DA 5CD1A 3OFJA 3HVKA 3NW9A 2IBTA 4HTFA 4CKEA 3FTEA 2C7RA 1L3IA 2O06A 5LQJA 2ZZMA 3DTNA 3UJ6A 3HVIA 2ESRA 2P3QA 2VZ9A 4LWOA 2P35A 3TLJA 1FP2A 3AY0A 3BWMA 4E33A 3UA3A 2ZWVA 2P40A 1P1CA 2Q41A 3G5TA 3MERA 3HA3A 2ZBRA 1JQEA 1IY9A 1BOOA 4R8RA 3HNRA 2YR0A 4F86A 4DA4A 2O57A 4GOMD 3FUUA 3KPUA 4HSGA 3U81A 3LBFA 3UJ8A 1FP1D 1VL5A 5C9ZA 4CXMA 2ERCA 4P7KA 3KHKA 3LDUA 4DF3A 3PVCA 1O54A 1NBHA 1Z3CA 3NMUF 3IV6A 4PYMA 3R6TA 3G5LA 2O05A 2YQZA 3DOUA 3FPHA 3FPGA 1WZNA 3G2OA 2PSSA 5F2KA 3KR9A 4EKGA 2Z6UA 1KYWA 4K6MA 3BGVA 3A27A 2AVDA 3R24A 3MTIA 2AOUA 4E2YA 5EKXA 4E2WA 3ID6C 4GF5A 4QPPA 4X41A 3V97A 4EKIA 3O7WA 2NXCA 3CGGA 4PINA 1JTFA 1VP9A 3KQYA 3MAGA 3SGLA 1AV6A 1YZ3A 2FK7A 2OB2A 3E05A 1JSZA 3T7SA 2CKDA 2AZTA 3V8VA 3UJ7A 3UZUA 3NVMB 3ORHA 1ZG3A 3GWZA 2ZW9A 4E32A 5KVAA 3REOA 5GIOE 1RI4A 2UYOA 4OQDA 5K05A 5U4XA 1KPHA 3ER8A 1ORIA 3TKAA 3MTEA 3BGIA 1SQFA 1UFKA 5EPEA 5D1NA 5FULA 5DX0A 4C06A 1ZGAA 4OA8A 5HIKA 2PLWA 3LL7A 1WXWA 4RTMA 3PFHA 4A6EA 2UYQA 3LSTA 1PJZA 2PVCA 2ZBPA 4V0QA 1TW3A 3VC2A 1JG3A 2JHAA 5CM2Z 3G8BA 2YVLA 5EZQA 1HMYA 1KHHA 3E7PA 3FUVA 3OU6A 2ONZA 4BP3A 5LQKA 2K4MA 3HCBA 4PYLA 3VC1A 1ZHFA 4MTLA 1NBIA 1H1DA 2G72A 2QRVA 2VP3A 3P8ZA 4WXHA 4PYQA 1D2HA 1X19A 5K0CA 4QTUB 4O29A 3P9KA 4GC5A 4IV8A 4B17A 3EEOA 3PTAA 3HVHA 2PX8A 5E9QA 2PX4A 2JHPA 1JSXA 3GRRA 5LQCA 4P7GA 5FUBA 4OBXA 5DX1A 4BLWA 2C7QA 2Z6QA 3KPVA 4XUCA 4H0NA 2CWWA 4AUKA 3KQPA 3P2EA 5HEKA 3L8DA 5EEGA 4A6DA 1RI1A 2PKWA 1R6AA 2OPBA 1R74A 4MQ4A 5DM1A 3SM3A 3HCDA 3QV2A 2GS9A 1WG8A 4AZVA 4BLVA 3WSTA 3ER9A 1P91A 1NKVA 2ZIGA 2AVNA 2P1DA 4PYJA 5DPMA 2ZWAA 4KIFA 3KPYA 3KQMA 3HCAA 2VDVE 9MHTA 3O4FA 1N7JA 2BZGA 1NW8A 4RTLA 2OBFA 1YZHA 1I9GA 2OZVA 2V7EA 4R6XA 8MHTA 2GA9A 3A25A 2AOTA 2G71A 5B1SA 5K0BA 5DRTA 4FSDA 2HTEA 2EFJA 3B89A 5E9JA 4E31A 5K0EA 3KPJA 3ERCA 2XBMA 3ELDA 5FA8A 4RTRA 3I53A 3GRUA 3G88A 2OB1A 1XDUA 3DH0A 4C03A 4RTSA 1G8SA 4NECA 4QTTB 4EMSA 1RJGA 3JWJA 3R9XB 3OE5A 5M5BA 2IH2A 3QOXA 3TKYA 2NP6A 4XCXA 2JJQA 3ME5A 5DXAA 3A7EA 5KQRA 3BXOA 5K01A 3DUWA 1IM8A 2E5WA 1BC5A 3KKZA 5FHQA 1RJFA 3UFBA 2P7HA 1Y8CA 3CCFA 3HEMA 5DM4A 1NT2A 4HTFB 2GB4A 5T6BA 3UWPA 4QPNA 2IH5A 1Q0SA 3H2BA 3UJCA 5LR6A 1ZQ9A 4ER7A 2OXTA 3LECA 4C05A 5DX8A 3EGIA 4DMGA 5HFJA 2AR0A 1M6YA 4E2ZA 4AX8A 3EVCA 4ER5A 4OX9Y 3HCCA 3NTVA 2P3LA 1XCJA 2H1RA 3C6KA 3FYCA 3CC8A 1RI2A 3FRHA 2BH2A 3M6VA 5CCBA 3LX6A 3D2LA 2CMGA 3THSA 4QQKA 2PBFA 3TR6A 3KQTA 1JG1A 4M38A 1KXZA 2YXEA 1ORHA 3B3FA 3I64A 1KPIA 1UIRA 3JWIA 4U7PB 2GLUA 3SMQA 3GRYA 4CTJA 3Q7EA 4R6WA 5GOZA 1SKMA 3HP7A 4YUXA 2GPYA 3EVDA 2R3SA 5FQOA 5BP7A 5GINE 3LDFA 3E8SA 3UJ9A 3AXSA 1EJ0A 2HMYB 2V74B 4PYKA 5IH3A 3THRA 4MHTA 2QYOA 2AOUB 2NNWB 4C4AA 3UJDA 4M7RA 2YXLA 3C0KA 5D1HA 4F85A 4DCGA 5E1MA 4PNEA 2EG5A 3KU1A 3C3PA 4DZRA 1INLA 1X1CA 2P41A 5K0GA 3UJAA 2KW5A 4DQ0A 5E1OA 4M37A 3I5UA 3FPFA 3KQQA 2C7PA 1N2XA 2WA1A 3BUSA 3GGDA 4KIGA 4ER6A 2YXDA 4QVGA 5HZMA 1TPYA 4M36A 5K8VA 4YUZA 4ATNA 3BWBA 3G7UA 4X63A 4BP1A 3LKZA 1L9KA 1OR8A 2ZZNA 1EIZA 4PIPA 1IXKA 4UOEA 10MHA 3P9NA 5HOQA 1KPGA 3JWGA 3C3YA 2AS0A 2YX1A 4FT2A 1NV9A 4C07A 5DLYA 4PYNA 4F84A 2O0LA 4MIKA 1G38A 2I9KA 2I62A 1QYRA 1UWVA 2PXCA 1R00A 2QE6A 5HILA 3AJDA 4POOA 4YMGA 5LQUA 1NV8A 2B78A 2QRVB 4YUYA 1M0EA 2CL5A 5BW5A 2BM9A 1TW2A 2C7OA 2AOVA 4KW7A 4C08A 3PX2A 2PX5A 4RVHA 5HIJA 3OU2A 3EGEA 2PGXA 3LDGA 4R8SA 2WA2A 3BGDA 5EMKA 4IWNA 3KR0A 2OO3A 4LECA 5KS2A 1O9HA 2VDWA 3KQSA 5EG5A 2FCAA 3FTFA 4RVFA 3SX0A 3GXOA 3OU7A 1D2GA 3OE4A 4FR0A 4BY9E 3DULA 4RX1A 5ERGB 2PV0A 2ZIEA 1L1EA 3ELWA 1FBNA 4Y2HA 2B3TA 4AZWA 2DPMA 4P7FA 1WXXA 3HM2A 3KQVA 1XTPA 3P97A 1QAMA 3BKXA 4P7JA 5EHIA 5FWDA 2IDJA 5GIPE 4RTPA 2O07A 3K0BA 5GP1A 3LCUA 1RI3A 2JHCA 3MQ2A 3OFKA 3FUWA 2FPOA 4GUAA 4EK9A 4KDCA 3NWEA 2AOTB 2H11A 4PWYA 3G2MA 4RTJA 5JUWA 5E8RA 1R8XA 3M4XA 3T7TA 4FZVA 4PONA 4PGHA 1AF7A
chains in the Genus database with same CATH superfamily
4EL5A 1C0KA 2X2PA 2Q1TA 5JS2A 1RE1A 1U7PA 3FTPA 2QMZA 2YY6A 4L8FA 1F6DA 4QJ4A 2NU6A 3DMTC 2DULA 4AJEA 3NV9A 4KHZA 1HT3A 3BFKA 2JZOA 2P65A 3HDVA 8OHMA 3PUYA 2BC9A 1SVIA 4YUVA 4QGGA 3OTOB 2FJPA 2W0SA 3CKMA 1KZHA 3EDMA 3ZBTA 3GV0A 1OHHA 3QUAA 2Q21A 3TOZA 4MV3A 3WMFA 4JMLA 2HQBA 5KVQA 4QAQA 1QOQB 2IF0A 1N36B 1GAQA 1Q19A 5EAIA 1UBKS 4IMRA 1DIOB 3H8VA 1Y6QA 1TZJA 3DLTA 3UANA 2G0TA 2OFFA 4DCMA 3TWOA 3FI9A 4NCNA 4CMIB 4PWZA 3I76A 3Q98A 1FNCA 4UHKA 3F2VA 2QP3A 3AUTA 3CSDA 4B7UA 4BVGA 3AOGA 5AW4A 2J59A 3ENWA 1CVRA 5B7PA 4B6SA 3NUZA 3DPIA 2MMGA 3A6GA 2ZS8A 4DKJA 4CM3A 3OIDA 3GZNB 4NS4A 5IDWA 3I52A 1W4CA 1OV4A 2Z0MA 5I8ZA 4WX2B 4XD7D 1PRYA 2XTAA 3R0XA 1VPTA 2D5CA 2WFLB 1I3CA 1E6WA 2Q6KA 3VPDA 3WZLA 4E1BA 4F04A 3TTWA 5KVCA 1GADO 4L74A 1JUDA 1PV1A 2B6HA 1ZAYA 1E8DA 1AOXA 1CERA 3WK4A 5FB3A 3BA1A 3O8RA 3KZVA 4TZKA 1P5RA 3PRKE 4BWGA 3GRAA 1L4YA 1XA0A 2BMEA 1THTA 3RUPA 1S96A 4J3FA 3CKKA 1P9WA 4O4HF 1NJSA 2MSNA 4O02B 1S0UA 3H9GA 3GFGA 3QPDA 4GM4A 4Y8VA 1RXIA 1GLVA 2DQ4A 5H70A 4K0RA 2LKCA 3A4MA 4JEIA 4F3TA 3RW9A 2VJOA 1VE7A 4BO8A 2IXAA 3M89A 2YJ3A 1R50A 4BCCA 4AY5A 3UCEA 1SC9A 3G8AA 2VQSA 3O26A 2R79A 4F96A 3L77A 1CD5A 4PTLA 1LQ2A 1NXSA 821PA 1AU9A 3V1LA 1X7XB 2VF7A 1Z07A 5DWDA 4E4RA 5CA1F 2WJVA 2QL9A 5AW9A 2RGXA 1JHZA 3LXRA 3OAAD 4ES6A 2VTBB 3CLRC 4H3HB 3GO4A 4ISBA 1A9SA 1H1TA 4PSAA 1P44A 5DBOA 2PX2A 2VH2A 4IINA 2O6LA 4INZA 5GONF 3D3KA 1N2HA 1K4KA 2BR5A 1Q0QA 4OHMA 5L45A 2CXXA 1VIAA 3K53A 3GROA 3EPPA 1JRLA 2JD0A 2I4LA 4WRRA 3H1EA 2YFKA 1E3JA 1Y3IA 4GGMX 4K28A 4L7QA 4TN1A 5P8WA 5GTDA 4KPEC 4B34A 3QFCA 2HDHA 1C4WA 4KWCA 4ZVRA 4B2LA 2BGJA 2BAGA 2Z1DA 3SI7A 2QLBA 1HE3A 3FFAA 4YRJA 2COEA 4M1TA 3OZCA 1MLDA 2WD7A 4JL6A 4A0GA 2QTCA 1OXKB 2DUNA 3AUXA 3GDHA 3TX2A 4FINA 5KIAA 3R0JA 1DQPA 1II8A 4FN5A 4OOFA 1JDUA 2ZSKA 2VK8A 3GJ6A 5B3JC 3UHOA 4IEEA 5GJBA 5GM2A 4JQZA 4ABYA 2J67A 1QXSA 4P84A 4M0PA 4AJ9A 2C00A 1U28C 1D2NA 2VTEA 5F3DA 5JCOA 5BORA 3RUCA 4UTRA 1FYDA 3FWKA 3PCTA 3CPHA 4MQFA 3I2JA 4EFKA 2EKBA 3OFND 1IN8A 4NEGA 4GEGA 1XPJA 2XYHA 3DB2A 4N0DA 4MDEA 3GEHA 3WLSA 3I3SR 1N6KA 1TMOA 3OD1A 4MS3B 3PGMA 5ADUS 1RKQA 3GUCA 5KPJA 4PLFA 1JG7A 1EUCA 2IYVA 2J85A 1JT9A 4NZMA 4R3NA 4YAEA 5HUJA 1TT7A 4ZOBA 5AUQA 3TPZA 4EGCB 3GUUA 1GZ6A 4N5LA 4PGFA 3JD3A 3ANXA 1GTG1 1L5HB 3MJEA 1OFVA 4L2IB 3MUFA 1TD9A 3UUEA 4DREA 4CKBB 2BBOA 4ESEA 4DJ5X 2CXUA 4HDCA 1WPGA 5EMMA 1DLIA 1THGA 1NXVA 5TX7A 1UJ4A 4KNVA 5B3KA 2CFIA 5JHGB 5T67A 2VHCA 4BNYA 2PRSA 3IMCA 1YZVA 1I30A 3PE6A 2ZK7A 3PC4A 4QQ8A 3SC4A 3QHAA 1AGPA 3H11A 4PG6A 1B0ZA 1K2VN 4N0QA 4JBHA 1SO8A 1TU0A 2FWBA 4LJKA 2JGAA 3PC6A 4RVUA 1V26A 4CQMA 4BUCA 3UF0A 3DD5A 1E58A 2QT0A 4KIWA 1CF9A 4DHEA 3ZLTA 2FW9A 2W83A 4YY3B 3RKSA 5F3WB 2CN1A 2XSZA 5FQNA 3BHJA 1GNRA 5KWIA 1YIDA 1P9RA 1CJBA 1FP4B 1MHPA 2QGFA 1NRJB 1AV7A 2VYQA 4YT5A 5ADVA 3C8MA 3U6KA 4RHUA 2JFZA 2CLCX 1OQAA 5I3ZA 2OZKA 4DM4A 5CFNA 3P0IA 4GLFA 1C9KA 1LK5A 4QEZA 5BSMA 3EVBA 1D9ZA 4RS4A 3P9CA 1T0HB 4IGIA 5MN6A 1EB8A 2P5SA 3GX1A 1BRMA 4M9UA 4HQRA 3ZCPA 3IAM6 3WGNA 4YCNA 2BGLA 2X13A 4D56A 2OC4A 1E96A 4I7EA 2IGTA 3PHLA 3Q5EA 5KYGA 1T1GA 3NP9A 3CLSC 3LLMA 3T4UA 4CT0A 1F2TA 2VC2B 4LSMA 3O4VA 5I8WA 1ILEA 1Z4JA 1QIFA 4Q24A 4U3JB 4CRWB 3QVOA 2IYQA 4N1AA 1KIAA 4RA6B 4EY5A 1F4PA 4OQMA 4CQNA 2O6HA 1VRCA 4RSRA 4WL0A 2H3EA 3QY9A 4JXKA 3O90A 4HKTA 3MJSA 4QNRA 1E2IA 4EHLA 3ZJYA 5INTA 1YRQA 4MRMB 4CIYA 1BXGA 1JHYA 2HF9A 2HNBA 3RG8A 4H31A 4Z8XA 3LTEA 4XGRA 1A1VA 4O4LB 1A8UA 2ZUSA 1T4MA 3A6EA 4KE6A 1Y42X 2CNWA 4KPFC 5DBIA 1AIPA 1PX0A 4P4LA 1W88B 2G4CA 1V8OA 4PCUA 4F4CA 3IODA 1DB3A 2J9ZB 5YASA 2HA7A 2C77A 3TLJA 1HZJA 2PA3A 3O8CA 3ADDA 2XHZA 2IHBA 2ZWVA 2PLFA 3SJUA 5HF9A 3LP8A 3ZK9A 1F7UA 1X14A 2Q41A 4FZRA 4PCVA 5T4HA 4BYMA 2A9QA 4ETIA 4D5EA 1QFXA 2WUWE 2WR8A 1RYZA 3DHYA 5CB4F 1IY9A 1BOOA 2H1SA 1KI1A 1GSHA 2HA3A 5BN3B 4I1RA 1S1MA 2F1HA 4IDCA 4BU0A 5J43A 2DUWA 5GMOA 2PUEA 3A1EA 2JGIA 3T1TA 2OCXA 1Y6FA 1XJ0A 1QB8A 1VSTA 4KR7A 5GZ6A 3PVCA 4R5MA 3IRUA 5J4KA 2ZAMA 4LS3A 3C6XA 1V7CA 4JJAA 2VR1A 4M9CA 3DCJA 4NRDA 2RK6A 3DOUA 3FPHA 5EUMA 3F3YA 5DNAA 3WYNA 5F2KA 1A8IA 3TVDA 3PEWA 2J6HA 4RJLA 5JBQA 2BFEA 3ROKA 1C8LA 1H2YA 1I6KA 2AOUA 1L7BA 2VSXA 2ZR7A 3AU8A 3CWQA 4HNAB 4J16A 4O2BA 1OW3B 5DGCA 1N6RA 2A0YA 4QHTA 5FBHA 2BP7A 1E3DA 1F8UA 3TRFA 1KK2A 3A36A 4MWDA 2X76A 4MDYA 4DMHA 3OE1A 3ZWVA 1O57A 3E05A 4EHFA 4R0NA 2AW3A 2OYSA 2PAAA 4JYMA 4WWHA 1TLTA 2AZTA 3R7NA 1C4KA 2Z09A 3GYBA 3CVUA 1P4JA 1CUGA 3RUAA 1YNSA 2VT3A 3HB7A 3WLAA 5I7VA 3DFMA 1P1KA 3K1AB 2L82A 3FCUB 3OEYA 1BN7A 1K27A 3L1HA 1J0CA 3T06B 3DAYA 4OA8A 1SZCA 4UDOA 1U7OA 4O4JA 4V3CA 3DEAA 1EK1A 2C3MA 1X80A 3ZTTA 4E0BA 4KNWA 1NLFA 3GGPA 2FEPA 2XEDA 2NU8A 3PNQA 3H87A 3GY0A 3H3JA 1NXQA 3S2UA 4A23A 4LTNA 1MUUA 4DR5B 1T10A 1YS6A 4O2AB 2ATXA 5K4AA 4U2GA 5E6UB 2DX7A 4GI5A 4INOA 4X7PA 4NVRA 5A62A 1T3LA 4RM2A 5KJEA 1KEVA 1UOEA 3P9KA 1GYPA 4GC5A 4US1R 4B17A 5LJLA 4TLEA 4DV6B 1H3NA 5BT9A 2W2LD 3GA7A 1KFJB 1V95A 1FVHA 5CB8A 4OBXA 5BYJA 3UB2A 4ED9A 2E85A 4NOJA 2H48A 3AVQA 4H1WA 4ZGGA 1J0XO 1D4ZA 1MGPA 1BX0A 4IIJA 5EEGA 2RBKA 1R6AA 4EW2A 1TM5E 4B6FA 3HCDA 1E9DA 3EC1A 1AQYA 1K0UA 2V5VA 3OLVA 2ZIGA 4PYJA 1IQUA 1M2OB 3PNBA 1IU9A 1CULC 3G23A 4NCHA 2M6LA 5CTAA 4BNTA 1VLVA 3HUEA 1L7OA 4IVNA 4O4IF 4QLOA 5LOVB 2YVQA 2OZVA 3JALB 5JROA 3EPKA 5LP6B 4EB6B 4EYGA 2AOTA 2ZRFA 3KAKA 4MW1A 3RCBA 4N5NA 2V4ZA 3OEED 3TL3A 1FFEA 1W29A 4FSDA 2ZETA 3IQDB 1ZJ4A 4K81B 3PXAA 2Y6VA 4ID3A 3P2YA 4NH0A 2VJQA 1ULAA 1W73A 1Y48E 2R1TB 4UBMA 1W2WB 4X3PA 2GVNA 4J75A 4I6JA 5JAOA 3C1UA 1X77A 3O4RA 4PTYA 5CP8A 2FPMA 1BU5A 2XXBA 4FUTA 4IX9A 5FKJA 1NZJA 1BAPA 4DMCA 5JTUA 3I4LA 3B1WA 1P7WA 5F73A 2GAJA 1AMUA 5G53C 2NGRA 1YMUA 1Z0JA 4ZHQF 2JCSA 2FEAA 4I3FA 2Y1OA 2PLAA 4NBNA 2PA0A 3UAZA 5AHWA 4U9HS 2CLSA 1HY3A 2I3ZA 3CCFA 3QBDA 3P5BA 4B7AA 2GASA 3WP0A 2WWTA 2EERA 4FZJA 4BO2A 3ANMA 1COWA 2RGBA 4AD8A 4UM8B 3FIJA 3ZXSA 3N8HA 4JELA 2PS9A 2QUAA 1N9GB 3AJ9A 3P9ZA 1JP7A 1KJIA 2EQBA 3EVCA 3H9BA 3WSVA 3M4JA 2O2YA 5BXQC 1Z2CA 3X1JA 2R8BA 4TROA 4DMLA 2X9LA 4EKDA 2AMFA 3NOQA 3KVOA 4YDHB 1S01A 5DXFA 4BFTA 1JLLB 1BDBA 5C46F 4X8LA 2GDZA 3NDPA 3JX9A 3IPXA 5DHRA 5DYTA 1E98A 4KI7A 4PHHA 2AD1A 2W22A 1TXGA 1GM5A 1ZI8A 2ZYRA 4B1FA 2P91A 1DAPA 3CH6A 4K9LA 3W9SA 1SHZA 2C7BA 1WHTA 3L6DA 1H4TA 3HZOA 4UCXA 1A76A 2BOVA 3FOCA 4JB0A 5KYUA 3A9UA 4L15A 4OHRA 4YAOA 4F6RB 1WBJB 2XGGA 1Q7RA 4UTPA 3AO0B 3THRA 5IVIA 2QYOA 2G8LA 1YO6A 3TEFA 1PJ8A 4MYSA 2PL5A 4TMFA 2Q7DA 1P6UA 2AUNA 2PWBA 1GZDA 3K3PA 2B1JA 1RAEA 4OJKA 3WGGA 1Q1ZA 1XTSA 2P41A 1GTRA 121PA 1BGWA 3QVJA 4DSUA 3H0EA 3FPFA 3SOZA 4KIGA 1KAHA 2HWUA 4LYGA 1QH1B 1HBJA 4ER6A 1IVNA 2F43A 2O0KA 2IHTA 4JOCA 3G7UA 3HS3A 4HNTA 3O8BA 3OT5A 4RK1A 1XMPA 1WAMA 1FQKA 2MYNA 2QA5A 4NHEA 5JMOA 1SVNA 3RLFA 4UOEA 1P29A 5FDFA 4TV9F 2I4RA 3U37A 1SRQA 1W4ZA 2AJBA 3G82C 3NAZA 4XLZA 1NI4A 3DAHA 1LX7A 3WGVA 4YACA 1JXAA 1ZD2P 1ZW6A 4FFRA 3WMXA 5LMZA 3GG9A 3TGWA 1S2DA 1RTTA 3A3PA 4TWZA 1R00A 1PNOA 2FF7A 2BBSA 2G76A 1WE2A 3FW1A 1J7KA 2WUFA 5A7GA 5LQUA 2G83A 1XZEA 3C3XA 4OUDA 3WGHA 4V0LA 1OFIA 3LM8A 2A9KA 1HSZA 3MYRA 4GZ6A 1PT9A 2EZTA 2NN3C 4JHXA 1KYYA 1I2AA 1ZCJA 2GD0A 1W1WA 3EGEA 3FDZB 4AJIA 3LDGA 2WD8A 1E2FA 1HLPA 1KIFA 1RE0A 2YQ5A 3AV3A 4D81A 4TSRA 1OZAA 1OB5A 4BY9E 1O6BA 1HYQA 2JF0A 3DBRB 2ZXEA 1O96A 5HBRA 1N5KA 4GI3A 3KVNA 1KKUA 1U0GA 1WU7A 2GZAA 1ISSA 2YFYA 1FBNA 3C74A 3E8XA 3HBNA 4U2FA 4C5BA 5BV7A 3WV4A 2XCRB 1RJ9A 1TA4A 1QAMA 3GJ5A 4EFMA 3PQCA 4M7PA 1P77A 3LCUA 4G0OA 1VXRA 3ER6A 1VPVA 1U2TA 1AO0A 3ICPA 1QHSA 4NI5A 1EX1A 4IF6A 3TL6A 2GPJA 1P2DA 2AJLI 1QM5A 5CDFA 4OK3A 1TK3A 2V3CC 2OD7A 1PFGA 4FPXA 1K3UB 3RSOA 1JIIA 1V3QE 1HNWB 3AWIA 4C4XA 3K8ZA 4BO9A 4Q9NA 4DTIA 2ZYAA 4CKWB 4Y7CA 3K8OE 5M04A 2IYLD 2X77A 4FGLA 3SLKA 1FMFA 4COKA 1I4WA 1WSWA 4RDHA 4EPRA 1XRLA 2D4HA 4R8LA 2Z6AA 2VEOA 3GNTA 2F6RA 2OY0A 1DQRA 3PDHA 3SDBA 2Y2VA 4LOJA 2RI6A 4HR7A 4FZ5A 4MVYA 1C0EA 1HFEL 1CFJA 3ZCVA 1XE3A 1BMQA 4OBEA 5E1DA 3AZOA 3U09A 3SN6A 3LP5A 3JQQA 2QMOA 1QC5A 1WMFA 3WJ2A 5KVSA 4W8HA 2EYQA 5HG0A 4F11A 3VC7A 4KH1A 3U3DA 3W9UA 1BSVA 4TYMA 4L8LA 3DKRA 1WSAA 1DARA 1YQGA 3K9NA 2RCYA 2XWBF 3K2IA 4YJGA 3ROQA 4DC0A 4DNFA 1WUIS 1DC5A 4OFZA 2GCPA 1DAFA 3L06A 2WWWA 3TIXB 4IIHA 3ZH9B 5IX8A 3SZGA 3CXRA 1PGOA 3GZ4A 4DNPA 1W44A 2VBIA 4LYFA 4BCDA 2DG2A 4GYJA 1PP4A 1TMGE 3IEIA 1TFUA 4BQIA 2QXYA 2V96A 3FZGA 1XNHA 4EQ6B 1YJCA 2C29D 1NW5A 2GJ9A 2G1PA 4P7BA 4JI7B 4JUBA 2XDAA 1JWAB 4CLOB 4H27A 2ZSUA 4DE5A 1XHFA 3AJ8A 4JT2A 2O50A 2PT9A 1DKPA 4H1UA 4IOLA 4IHJA 4L07A 1F4LA 4IDEA 2Y71A 4OBWA 3HCFA 5HPYB 3O31A 3S5UA 4KKVA 2H4HA 5HZGA 1RS0A 1TLLA 1Y7HA 2RDMA 4CR8A 3ZLUA 3T94A 1M7BA 4OL0A 1E79D 3K35A 1EDEA 2OE2A 3R0QA 3JYNA 1B16A 1RRVA 1XU4A 4YXWD 1SUIA 1TA0A 1M1NA 2KS6A 3OG9A 8GPBA 2OLKA 4EKNB 5K09A 3F6PA 1S6YA 3IS3A 3CRVA 3QUTA 2H6EA 3V2GA 1SN7A 5AXCA 3EBLA 2CDAA 5CLQA 2CUKA 3S1AA 1DGQA 2C58A 4B3IA 3T3GA 1HDZA 2J31A 3V4LA 1U0TA 2XZDA 5LUAA 3GLFE 2QRZA 1MOSA 4RWZA 1DWQA 1RXEA 4CKCA 3W8NA 5F3RA 1E2UA 2H29A 4KX3A 1LBIA 3JQAA 5IH7A 4NU5A 1ACLA 4CJXA 5J40A 1R9MA 2VUHB 4QPDA 2HPHA 1KMMA 1XL0A 3R09A 3V7UA 4UTVA 5DGHA 1AUQA 4NENA 4RNDB 4JJZA 2IOQA 4P9NA 5KKAA 1UBJS 2CLOB 3OA0A 3EQ7A 3WA7A 4FYHA 3JS5A 4MIYA 4HGRA 4JQYA 3H42B 3I1JA 3JY6A 5KYKA 4XTCS 1OT5A 4ENPA 3U60B 2GZ1A 2G3YA 1FDVA 3H4VA 1H9BA 3I9NA 1AF4A 2FDRA 4DLUA 1KC1A 4P81A 4HWOA 3FLBA 5LYJA 2IIPA 3THXB 1QHXA 3HL4A 3C5EA 3ZE2B 1B26A 2FB9A 1PIWA 4LHZA 5FO1A 3TFWA 4XI9A 3NFRA 1RHQA 3G9ZA 5T6MA 4AX4A 5JC1A 1A9TA 2VHUA 3HRKA 2GPNA 1WQ3A 2PHZA 5D6NA 4V2UA 2ZI7A 3BTOA 4J0CA 2IWRA 1PG5A 1G8AA 2C4VA 2F9LA 1KH3A 2I80A 3ZIAD 3UY4A 1CJMA 4MS1A 2NV2B 3MT9A 5FORA 4MKIA 5NLLA 5TY0A 3WQQA 4ASUD 1L4LA 5A9RA 1KDVA 4BEVA 1SUSA 3FRIA 5LBTA 5C1OA 4EO9A 4XEUA 2ZJ2A 1I9CA 4R1NA 4ZOLB 1RZVA 5KHLB 5BVGB 1U4NA 3H7AA 5IAJA 2NSHA 4XXHA 4NSNA 4QYMA 3FTQA 5ALDA 3WL3A 1XSEA 2HSGA 3IDFA 1W49A 3GIDA 3N2NA 3VPXA 3BCRA 4JAVC 2Y99A 1T9DA 1WWKA 2F3RA 4O1HA 5EJGA 2WIJA 2ZUWA 4QGFA 4KVZA 4P36A 4KI0A 2Q0HA 1MX9A 2X3UA 1GKYA 1RAFA 1GZSA 2C20A 4HWRA 4UPVA 2CKMA 2QB5A 2W8BA 4WECA 2OA0A 1Y3AA 3RFVA 1T25A 1B76A 3FYSA 2P9TA 1E2QA 1KH2A 3IH5A 4MV1A 2XD9A 2AH5A 2NV6A 3SS9X 1I80A 1VB3A 5E6RB 2DQZA 4EHDA 1SUPA 1SUFA 3Q8WA 2DT8A 4R2WA 3D2AA 1L5LA 4UE6A 4U02A 1G41A 4TPKA 2EGUA 3Q7IA 4RSGA 1RMQA 4KLZA 4OUKX 4BQSA 1B4DA 5KNDA 2BGIA 3SQXA 1XKTA 3T1HB 1NATA 1EFHA 3ZXYA 5K1ZA 1KWKA 2R00A 4F92B 5DNEA 1OLUB 4U7TB 1JDBB 2FW8A 4FWBA 4KXNA 4UPEA 4HGYA 5FNVB 3VVCA 4ZZ0A 5KNBH 3T3MB 3MUOA 4XTRA 1VQ1A 3Q8LA 3B3GA 2SICE 1TF2A 1RXWA 3DXZA 4BQNA 4O08A 1UMKA 3OIGA 5F33A 3LPAA 3CR8A 5HDBB 3F4KA 5TT0A 4DSOA 5B12A 1PFKA 4E13A 4AU1A 4GPAA 1TMYA 3I0NA 1LQUA 4IJMA 1RQ7A 2C97A 3THYB 3MMZA 2VCYA 1NW7A 1V4BA 2A9OA 3A3NA 4B83A 2NP7A 4QWMA 2JAUA 1FW8A 1GA1A 4JXZA 5F5XA 4N01A 5G02A 5CFZA 5C8VA 1T8WA 4S0ZA 3LUGA 5E3IA 2P9HA 5T57A 1IXRC 1CUJA 2ZPUA 3RIYA 4GMKA 1JQ5A 1HNZB 3K6JA 3JVEA 4NDZA 1S9HA 1VIMA 4Y9SA 1N2CA 1NNUA 4RZIA 4XX0A 1RCFA 3SYTA 4C04A 2Y1WA 2R5FA 4IWXA 3A1VA 5DBEX 3K9QO 5JQGA 4WLNA 4HH3C 1B93A 5IVKA 1PK7A 2WTUA 5REQB 4HATA 1EXNA 4CUJA 1RYBA 4CKEA 2H52A 1Y4DE 4G23A 2OORC 5F52A 3ZJ4A 3VFDA 5IAAA 2II6A 3DTNA 3U3XA 4DGSA 4Q34A 2Y0PA 4KWTA 2BMDA 3DZCA 3F47A 4PHFA 5AXDA 1ADFA 2YIVX 1DQYA 4Q7EA 2Z8XA 1HM5A 2NW6A 2QJFA 3NC0C 3NPAA 4MUYA 2I33A 3VZQA 4NWIA 4E33A 4M0EA 3UPUA 2UVPB 1U3FA 2PD6A 1GPKA 2HREA 5D51S 3REQA 2B21A 4H1HA 3TDNA 3UGTA 2XKBA 3NUGA 4QUBA 1GKLA 1SUBA 2FGKA 2IK8A 2XYGA 1AKYA 2ZRPA 3AJAA 4IH4A 4XB2A 4AQYB 4HB4A 1GQSA 2UYYA 4D3ZA 5C9ZA 1T3GA 3WL4A 3NMUF 1EDBA 4ZZ2A 3DSRA 3K0CC 1W5AA 2YQZA 3JD0A 4MQ5A 1UP4A 1BJRE 2PU7A 1LTQA 4OQFA 2ZJFA 3OKCA 2OHIA 3AR6A 1UXJA 3ZGNA 2VDMB 2H9YA 2PNFA 3NAGA 4Y2RA 4GF5A 2NX2A 4QPPA 2XV1A 1BXRB 1CUAA 1VMAA 2FQXA 2A4KA 2KYRA 3CGGA 5DWVA 4D0GA 2ZYVX 4OGWA 4XWTA 3Q7SA 4KAAA 4KO2S 1YS9A 3PPYA 4ZYXA 5FOUA 2GEUA 4L78A 1WPRA 2R84A 6PFKA 3KALA 5FPKA 3F98A 3QUBA 5C1BA 3AV0B 3WS7A 2UYOA 3MWKA 4MVJA 2AJ8A 3E82A 1NM5A 3MTEA 5B6JA 2XMSA 5LU8A 1UFKA 1TM1E 1J09A 1QIDA 5HIKA 5DVZA 1B0PA 3NHYA 4LZZA 4CQLB 4KIJA 1YBFA 4MO9A 2VYVD 2ZBPA 3C3WA 3O3OB 1YJ5A 1D5WA 5CLGA 4ZAXA 4Q5IA 4TVBA 5IFLA 1LPBB 3ILVA 3LQ1A 1EP9A 1E9RA 1U3UA 5DNWA 2O2HA 3CLUC 4ZODA 5DHUA 1WB6A 5JI3E 5B6PA 3NT5A 2K4MA 1CXZA 1IHOA 3N87A 4EI7A 1DEOA 2D1QA 1Y8AA 1NPYA 4HNGA 3EEIA 3D1JA 1H1DA 3G79A 4IXDA 2QTWB 1T8YA 2XRMA 3IVXA 1EBBA 1E3EA 1F5SA 4UU0A 1USWA 1AHPA 4ZU3A 1EP1B 1JIJA 4JI2B 2EBHX 3QJYA 2M98A 5ALFA 2JHPA 4PLWA 1JNXX 2VHQA 1QK4A 5JNRA 3PYMA 3F1KA 2FE4A 5HR5A 1U63A 3JW8A 2Q3HA 3HPRA 5IP5A 2X0FA 3AF3A 5HF6A 3UAWA 3V1TC 7MDHA 4UU1A 3LHFA 1Y0BA 2NO6A 1LPPA 1FFBA 3OOSA 1N5OX 3RS5A 3AESA 3MLEA 4P53A 2A4MA 2YV4A 3LAWA 1NVWQ 3LCRA 4M1EA 4X1YB 2X8AA 3VJLA 5BRJA 4JI8B 1LFDB 1FFGA 1OC4A 3KPYA 4PU0A 2JC3A 1WTCA 5K9ZA 2IV7A 1DWUA 2JBHA 1PK9A 1W30A 1BD3A 1I9GA 1Q14A 2SCUB 5B1YA 4H7IA 3FTNA 1FRVA 3K0SA 1NRIA 1WSBA 2X0RA 3BJEA 2L42A 4WBXC 1XZ8A 3M6FA 1YKSA 3HUFA 4L5AA 5ESDA 1R7RA 2XWSA 1KEUA 1HQDA 3HDTA 1DBIA 3B13B 3GAAA 4UDNA 1Y1LA 5HE9A 4C01A 3KKPA 1U8FO 4A6XA 5JW6A 2IH2A 1LXCA 5WRFA 1AO3A 4NNPA 1CZOA 2D59A 2FWPA 3DFIA 4QE3A 4UKDA 5DBGA 2D1RA 2REQB 1FK8A 2CNLA 3HU3A 3JVUA 1M1XB 2GZMA 2P1ZA 3DONA 4YJKA 5IZ4A 5C81A 1NL3A 2WU1A 5L4NA 2E7ZA 5DI3A 5AM3A 2FPGB 2OL4A 4FEEA 4X6XA 1D2AA 1YNOA 4CBVA 4A15A 1GTMA 4EELA 4S2UA 4W5WA 1JVBA 1NY5A 3CZQA 3SIPA 1QBKC 4YS6A 1ZQ9A 1GU7A 4D9JA 1C4XA 4A0SA 1TUIA 4QDXA 1M8PA 4RL6A 2UAGA 2QU7A 4GMGA 1BWSA 2ECPA 5FAXA 1GG8A 4RZQA 2WM2A 3JRNA 1NIPA 3AUYA 2QZZA 3OJOA 2HRZA 1H4SA 3ZDCA 1NONA 3E0QA 2PKEA 2BRUC 5T8KC 5D5QA 1MJ5A 3BGSA 5HWSA 2CLDX 2HY7A 4WEOA 4E6PA 2BH2A 4TTSA 3S8MA 1T9AA 1C9YA 2DHDA 3GMTA 3UWDA 3ZQJA 4YCSA 4B43A 2V58A 2PSJA 3JAMA 4RENA 2I91A 2JHGA 4Y1EA 3M1IA 2I2FA 1V8BA 4DQLA 1NF2A 2Q4TA 4FC6A 5DW3A 4ZVPA 3W06A 4X7MA 4DANA 4QOFA 4BAZA 3GMDA 3HV2A 2C8JA 3Q7EA 4GBJA 4R6WA 4MPPA 4M54A 5CIQA 1G9SA 3H2YA 5AW8A 2G06A 2LP4Y 3EVDA 3IP1A 4FFVA 4KV9A 5F76A 5FQOA 3V8MA 1CEXA 1T5LA 2PKRA 2YFQA 3ABOB 3IOMA 3ONNA 4UEQA 2J3EA 4BJ6A 3S2EA 2C99A 5HRCA 5D1HA 1T1IA 4P83A 4AKSA 3TKLA 1H94A 2DUMA 5IKPA 1C8VB 1ZRMA 3OOHA 1WXGA 1U8XX 1INLA 4FCTA 4OL9A 1C4OA 2J30A 4AKHA 1K63A 1N1EA 1XKLA 2XA2A 4L75A 1WLYA 4RF3A 3PX7A 4ROSA 1KIMA 2PCLA 3FA2A 2PD4A 1JIVA 2ALJA 3BL6A 1J90A 2JAOA 3L49A 3PC3A 2ZT5A 3DCNA 3IIMA 4KMMA 3ZDRA 1X0VA 1ELOA 4GO1A 3SR3A 1UBHS 4BZWA 3BXGA 3R8FA 1EI9A 3AL0C 2PT5A 1SHLA 2P8SA 1GGMA 4U2KA 1OLXB 4F9GA 3IOYA 1G8PA 3QX9A 1YZLA 2RGUA 4LHSA 5KQGA 1ZYUA 4P54A 1TJ4A 4O2BF 5F4BA 3D3WA 2JCYA 1QV9A 1YB7A 2H4FA 3ITNA 3PJGA 1PVDA 5HILA 3TLXA 2YUTA 1DCKA 1NV8A 3RC1A 1N5RA 1NVEA 1V11A 2AI1A 1M0EA 3TVYA 1XAGA 4RD3A 2G4VA 2I67A 4IKEA 2ZRDA 3ZX4A 4C6TA 2DFVA 1SIBE 3OU2A 3R8XA 5KINB 1M0WA 2HHJA 3K09C 1RLOA 3RBZA 3RAEC 1X8XA 3KR0A 4LIPD 5AJWA 4DM7A 3DLBA 3R0ZA 3SR0A 4CEIA 4O4JF 3D3NA 5KOJA 1D2GA 3PQ2A 1I5EA 4IIVA 5L4LA 1L4BA 1JR2A 4MV5A 3DL7A 1GZVA 1UWKA 2E0IA 2EGGA 2FMTA 4AJHA 2RGYA 1UL1X 1VE9A 2QN3A 3FZYA 3OECA 4IGEA 1U2DC 3F5SA 2ZIWB 4MWOA 4RAOA 1HH4A 2F1OA 1C3OB 3D5TA 3H9UA 1F9AA 5H1YA 3L5KA 4UAUA 2FQQA 3H5LA 3D31A 4X7BA 1ISGA 5GP1A 3ESDA 4J7UA 3RUFA 1QGAA 3C4JA 1YU9A 3VKGA 4OG2A 2Y4OA 2F2TA 4XIGS 1J5EB 3TFOA 2VAWA 3I8OA 3A9WA 1F51E 4CEJB 3L8FA 3E2MA 5AXAA 3ZW8A 1SVUA 1ESDA 1EFRA 1L7EA 4IIJF 4MR7B 1EG2A 1B8NA 3ZY3A 5JXJA 1SH7A 2AZXA 1E89A 2R5NA 3BN3A 5KKNB 3QXHA 3DDOA 2V4MA 4MI3A 3PLNA 3NM6B 3K92A 4EW1A 4HWTA 3I9JA 3L7AA 3RS8A 1EXMA 3RYIB 1FYXA 1MB3A 3MT0A 4B6JA 1KWGA 4JU9A 2HR1A 4M7OA 1C81A 1B3RA 3M6IA 2IHKA 2WJWA 2Y9PB 3F3SA 1A9QA 5BWMA 5HUHA 2KQUA 2ZJ6A 3ZGYA 2D74A 1Q0UA 4CIAA 2F8TA 4PQGA 1UH5A 2LD4A 9ATCA 1M73E 5I45A 5EFZA 1KJYA 3A4VA 1I5RA 1F6WA 4UPDA 5A3RA 3ZIUA 3O8NA 1QG4A 1GPMA 3USCS 1GRQA 1P0PA 1MIHA 3RVKA 5AM4A 4WGFA 4WOBA 1FCJA 4BWYA 3GAMA 4ZD6A 2XUQA 3LL4A 3C8DA 4QFBA 1PDVA 4R01A 1GO2A 1ZA2A 4L0DA 1DZIA 1QCZA 2YN4A 4PGAA 4JWKA 4CM9D 4KBGA 2PUBA 3RRMA 4MPJA 3TBFA 2GN2A 2AZMA 3FJYA 1UBGA 3NGMA 4FONA 1AC5A 4X1OA 4DSAA 2FF5A 2Z4SA 3E9NA 4RDIA 3KE9A 4I9FA 1JZTA 4WY2A 1WDMA 5K3CA 3WTBA 4DYDA 4LG1A 4AZ0A 1SMKA 3AYZB 1Z38A 1F2VA 5ICGA 2ZLBA 5BVHA 3NIDB 2C5SA 1CUCA 1ZU4A 4D4JA 1XZHA 1NX6A 1N6PA 1EAMA 4IIYA 5DBFA 1LJLA 1OSNA 3KYBA 3WOVA 4HVLA 3QEBZ 4G5RA 3TQOA 4BNFA 5DHTA 1Z0KA 2P7IA 2PT6A 1ENPA 1R6DA 1DOHA 1ULUA 5D86A 3PPXA 2VATA 2ZI4A 1ESMA 3NTUA 1SVOA 2VUUA 5CB6A 3SSNA 2C88A 2ZYWX 3LBHA 1Y9EA 4FQ7A 4WVLA 3ZV3A 4TUYF 1X1DA 2C4MA 2FN7A 2PPVA 3QVSA 3U7JA 4LC9A 3GGGA 3FZNA 3NBZC 1CR2A 1U6IA 4RW0A 8ADHA 3S70A 3LWBA 1EJ6A 2CJWB 1ZSNA 2QD2A 4E5NA 2WAMA 2JFQA 4KGZA 1AKEA 1SIOA 1YS2X 3FNFA 3SDSA 3ZEIA 1M10A 1V5EA 4RH3A 4B45A 1YVEI 3NBUA 4GPZA 5D01A 4IYRA 3I05A 4P4GA 1UBUS 3FTDA 3RRBA 4UCWA 4QFMA 1FYFA 3CEJA 1XLVA 4FW8A 3CURA 1XD2A 2ORWA 3B2NA 4G0PA 1Q0HA 1UK7A 2GH1A 4KDEA 3R74A 3T5TA 2C42A 3BQ9A 4D92A 4BFZA 3SEZA 3BM5A 1T0PA 4QELA 4BFUA 2FX5A 5L3SB 1EGAA 1PNQA 2IZ1A 4KE8A 4O5OA 1QUFA 4YN3A 3I6ZA 1SCQA 1FDUA 4OU5A 3V4VB 3GA0A 4PAQA 1MO3A 2P9EA 2VUIB 1SCAA 3VXKA 3W8FA 3HKEA 5J4HA 3PD1A 3HH8A 3BDVA 1JG6A 4PG5A 4ODIA 1IK6A 4CM8A 2A86A 3DP7A 1DC4A 2Q3EA 2CW5A 4UBIA 5CA0A 4C22A 1TVEA 3ZJVA 1FSZA 4B3FX 3JAKB 1XXHA 4ZK2A 2A7XA 1TGYA 2QUHA 3NLLA 1NMEA 2GK7A 3CWCA 2JPDA 1BXKA 2YWEA 3DOOA 2XPCA 4JQSA 2COUA 3ZWXA 1XALA 4P3KA 5HJ7A 3OX1A 2GEJA 3AK4A 2QVBA 2G25A 2ZSDA 1OTHA 2E89A 3H65A 4NCIA 5JAQA 2P6RA 2XR1A 3EXFB 4Z0PA 1WMDA 1HZZA 2WMNB 1JL3A 2I2XB 2VA9A 4UVHA 3ZQKA 5C52B 3JQGA 3LC1O 3PQDA 1QGDA 2QNBA 1EVZA 4FN4A 2J4FA 2VF8A 1QORA 4LY6A 4LXYA 1VL8A 2BF7A 4I5IA 4OGKA 4QICA 1DNPA 4Y2XA 5IKOA 3BMNB 1B42A 5E9WA 4AF7A 2XD4A 3AQIA 1YFLA 1JWLA 3ML1A 3ZS9A 1T5DX 5IWAB 5DF1A 1WCIB 3E9CA 1GL9B 1USKA 1UXIA 1PJQA 3M5PA 1UFOA 4WT7A 5DYYA 3WBFA 1CW2B 1XVLA 4I5FA 3Q3EA 3UH1A 2RGAA 4Z1OA 4YREA 3EMDA 1LGYA 2FW6A 1CU1A 1U1IA 2NO5A 2QYTA 3KUUA 1NZFA 5IKMA 1OI4A 3DMRA 2PUTA 2QUJA 3LCMA 1CP2A 4ZYTA 3R9WA 1GRNA 4QQFA 3DC7A 4R2IA 1SQSA 4PY2A 5DISB 1PZEA 4Q3NA 2XNCA 2IYFA 4W5HA 3AGPA 1QLWA 1OBHA 3UWKA 1IFXA 3GP5A 4Z4FA 3TZBA 3COVA 2DGDA 3PS9A 4GOJA 4JFRA 1QRAA 2GZSA 3I28A 2DAPA 4JJ7A 4ZYVA 1VP3A 5KTPA 1YBMA 2JH8A 4QATA 3EXHC 2PWYA 3IAUA 5TMPA 3L18A 3JASB 1KAGA 4M60A 1RP7A 3GLKA 2QJWA 5HJ5A 4P86A 4HLCA 5E2BA 4X3OA 3BK1A 4L6CA 5D3KA 3TJRA 2K87A 3HJBA 3U4IA 4F1WA 3C8ZA 3EAFA 1DG1G 3TZEA 4F5DA 4JK3A 2P9FA 2BI7A 2YV5A 3L2OB 3NYQA 4GPEA 2VTKA 1CNFA 5FP0A 4I66A 3LXMA 4AMZA 2SKCA 4MI9A 1YK0A 3GPLA 4NMXB 3DZGA 2RK4A 5JLAA 3TM5A 4CIWA 2BN4A 3LPLA 1OX6A 2O8FB 1JSRA 2J45A 2QTZA 4DIFA 3OFJA 3OX4A 3RYHB 2GSWA 1OKKD 2I6TA 1EK5A 2YYZA 2GPBA 2Q45A 2RHDA 4G86A 2Y93A 1TEVA 2WE7A 2ESRA 1G0NA 2JJ1D 3CW2A 3EC7A 3NHUA 3BILA 3PGA1 3PL1A 1YAJA 4MGHA 3SPXA 1JFRA 4OMUA 1JI0A 4IHJF 4ZPXA 1PEYA 3AVOA 3WADA 5FF9A 4OX9B 5EWLA 1PLLA 4FFMA 3I9LA 1G21A 1FMJA 2ZRQA 4KXXA 5B3JA 1P5FA 2V97A 2P5YA 2ZYHA 3GUZA 4YRAA 5IT0A 2O57A 3LQYA 2Q8QA 3PGKA 5ENDA 4EGJA 5HKBA 1IK4A 5EKSA 1Q2XA 3OJWA 5JCXA 1CR4A 2AL7A 4G37A 1KQNA 2ZOSA 3CH7A 4KUHA 1JIUA 2NU9A 4XJVA 5J5AA 1NBHA 3IV6A 3CNEA 1NZDA 1FY2A 3GLSA 1T5BA 2CCKA 4RK4A 4IZ6A 9LDBA 1E2LA 4YFYA 3W1EA 3IALA 3GLIA 2ZUEA 3TD2A 1G3RA 1KYWA 4G3XA 1S5PA 2YVKA 1GPLA 3R24A 3GFRA 1EWKA 3N6RA 3QG5A 4HOYA 4K9RA 3TRIA 1GLGA 1UT8A 3MJRA 3IC5A 1PR1A 1XP8A 1EGMB 3C7DB 5LB2A 1UBOS 2O2JA 4LRUA 3UMSA 2DVMA 4ARAA 3BFJA 3V7NA 4PHCA 5H4GA 5L7WA 3OZDA 2SBTA 3UCXA 2FWJA 2P1RA 1L4NA 4MITA 4WXPA 3VR5H 2XDWA 1DT3A 2HMUA 3QPVA 4Q4JA 5M34A 4DR4B 1AGNA 5GIOE 1KJWA 1VCHA 1Y3BE 1S7CA 5HGJA 3SXUA 2JH3A 3ZCRA 2HXGA 5LYJF 2RHGB 3GZJA 1ZGAA 2F64A 3LL7A 3Q1KA 3PI7A 5IXJA 3VPCA 4TLBA 3YASA 1SCUB 4OAOA 3ZVKA 4CIVA 3HYCA 3NP7A 3F4BA 2IX3A 3DBHB 4ZAGA 2F3TA 1AGYA 3MJFA 2PMBA 4QOJA 6NULA 4TL8A 2PRYA 3VC1A 2YY5A 3HCBA 5BV2P 1IIBA 1PR4A 3FKQA 3L0OA 3RO7A 3K73O 3DEIA 4M8LA 2I2AA 2OK8A 1QCCA 2WKWA 2MR5A 1QGUA 3KD2A 3KIPA 4G0YA 5DDIP 3V4PB 5A2GA 8LDHA 1D2HA 1YGPA 1ACMA 1A50B 1ORTA 2FRDC 4INPA 2WHEA 3DAGA 1UZAA 4HL6A 1VSUA 4KN8A 4O29A 4YCAA 5K0SA 1N1MA 3MINB 3N05A 4Y6OA 1JSXA 1PUJA 5FI3A 3WGKA 3QEJA 2F48A 4IOJA 4GVLA 4CYMA 3GW8A 3W2TA 1FS4A 2YQ4A 3LGSA 4IXWA 2INGX 1QGED 3GRFA 2PD3A 1IEVA 4YRKA 3K70D 1AHIA 1U9ZA 3VI3B 4JUDX 4AZVA 3GHHA 1C0PA 3Q0EA 1QYCA 4EY8A 1OXSC 2P1DA 2ZRLA 2WM9B 4KIFA 2RJOA 3EMVA 1U9YA 1AA6A 3AI2A 1SNYA 3WTCA 1USVA 1LBEA 1NW8A 2HLDD 1RWOA 1JEEA 2W6JD 3Q6NA 3T8YA 4EHAA 2UZ1A 2OGTA 1EE2A 3FDIA 4W5TA 2W6PA 2EP8A 3M1YA 3PGJA 1NW9B 3GPCA 4NFSA 4ZRDA 1K7SN 2O7RA 3UOAB 4AP9A 2LNDA 1ZD8A 5JYDA 3B89A 1A1SA 2XBMA 2AN1A 1SK8A 1KI8A 1T1JA 1P7ZA 4DBVO 1OTXA 1Q12A 2KWIA 2YVUA 3ZZMA 5CEFA 3G88A 5CMLA 5IEJA 3KSRA 1U4SA 5CX1B 1KP2A 2FLWA 5I9BA 5T3YA 3IL2A 3KVRA 2YN2A 3BWXA 3SX2A 1RYDA 2BFNA 2JI6A 2V98A 3JWJA 1ZN7A 4YYZA 5M29A 1LJ8A 2IP1A 3UAXA 3VR4D 1GQOA 1MBZA 1IN6A 4K88A 3T4PA 3SEAA 2HDWA 4GE3A 1AN0A 2G1KA 2O8BA 4L72A 3KKZA 1AT1A 2BMJA 4U6QA 1D6SA 3QBEA 4WTOA 4A0FA 1Y8CA 1OF1A 4KXQA 2BEUB 1JQBA 2ID7A 2E21A 3H84A 2HCJB 3T1OA 5I9TA 3U62A 1Q0SA 3QVLA 1X1QA 4AL4A 4CETA 4BQOA 1W7AA 4Q4AB 2UUCB 2WM8A 1E1RA 1SKQA 1MJNA 3AR8A 4KPYA 2H31A 1QKJA 2AR0A 3AB7A 4V0OA 1J5PA 5EIBD 3T9FA 4YUAA 4YQZA 1QVVA 2DEUA 5KQPA 4V03A 1XRSB 2IGBA 1P5JA 3UK0A 5CCBA 4BBPA 5D7BA 1JBQA 5A3JA 3VI4B 3BCUA 3K31A 3LX6A 4L22A 3KEGA 3RGWS 1JXMA 3L7BA 1E2GA 1L6RA 1QZTA 1C1XB 1KXZA 3E2PA 4ZVVA 1CY4A 4LQDA 4BFVA 5JQGF 4LK3A 5AW0A 3ZOKA 4Q9LA 1IPFA 3OO0A 5MFPA 5GOZA 5CURA 3OHPA 1H65A 1QX4A 1SKUA 1XZQA 2DWUA 2OR3A 4W1SA 1WPQA 5BP7A 1ATZA 3SZRA 4M86A 3O0TA 1NR1A 1QHHA 5EPUA 1YVRA 2Q9BA 1KZ6A 2HJWA 4P82A 3JD2A 4C4AA 4EHJA 4ARCA 2VJYA 3TQTA 1DG9A 1C0IA 4JLUA 3OC6A 5A6SB 3PNVA 5EQFA 2PEZA 4BWFB 4Q39A 3HZZA 1FZTA 4JI3B 3CRW1 3IEVA 3CSSA 3GEEA 4RZSA 5G4KA 5MN4A 3IE0A 1E18A 1PL7A 2IIVA 5JG7A 3R40A 2UUAB 2GYYA 2MJLA 2XBUA 1DJNA 3TLBA 1AUOA 2WWYA 4QPJC 1EKXA 4IQ0A 3GPDG 3JZIA 5KDLA 2OFOA 2VYFA 2QV7A 1PU2A 2YJ6A 1SUAA 3ZD8A 3X1YA 5ED0A 1AUPA 3EX7C 4ZARA 4XJTA 3W5SA 1FDIA 1R4MB 3D1VA 3N6XA 4FYIA 4UEKA 2M6RA 4X6UA 3RJ5A 3TG8A 1IQ0A 1JHVA 2ZE6A 3JV7A 1JBEA 3NM5A 3Q3VA 1P18A 4P35A 4QO8A 4AMYA 4JOSA 2QPLA 4BAUA 2I9KA 2GBLC 2O7NA 5E6SB 3QNMA 1M2JA 4KYTA 1EIWA 4K5QA 3ABZA 3LVFO 4NYIR 1FDWA 2B36A 3AUJB 1DBWA 4G5SA 3MMPA 1RABA 4YUYA 4DR2B 2QI9C 3L0CA 3DOEA 4Z3DA 1TFRA 4QSMA 3SJCA 2B99A 3Q40A 3OTWA 4MCHA 3U4MA 5KTMA 3ZLBA 4KQ2A 2QUIA 4MVJF 1LW6E 2PGXA 3WYGA 4F2HA 1XTBA 3K72B 3SS7X 4JVOA 5C7YA 4C14A 1LDEA 3KLNA 4IFTA 2OFPA 2XE6A 2H85A 5AWFC 5IBPA 4LYYA 3KC2A 2XNDA 1BWQA 4P3XA 2QD4A 3N07A 1EFKA 2LCFA 2MYPA 5IK2D 1W59A 1JH8A 5JSUA 3PXXA 4TMVA 5KTNA 1DVRA 3JU3A 1YMQA 2QBYA 3KB1A 4ARIA 1CY6A 1SOWA 2HLNA 2CXSA 3GH3A 3TAUA 4PPGA 1CV2A 2GEDA 5KJ6A 3PEUA 3TQFA 4MQEB 1FNSA 1PUXA 4MAFA 1OREA 2BT4A 2O20A 2YMPA 3UENA 3VX3A 5B58C 2IPMA 3E7WA 3GUHA 3ZN2A 3LA8A 4CR6A 1DINA 3LT1A 2FPWA 5JUWA 3WLRA 4H18A 4UBJA 1EM8A 4HDRA 3DE7X 4EG4A 2Q2WA 4WLVA 1IG0A 2C3PA 1FNNA 4LISA 3WA6A 5KTKA 1PX2A 4ISCA 3UMVA 1QFMA 2C5BA 1Y5RA 2Q6LA 4B84A 2I66A 3WK7A 1QQAA 2UYHA 2O23A 3NGXA 5PGMA 3ZV6A 2VWPA 4OA5A 2P4UA 1DV2A 1DL5A 2W4QA 1XZKA 2VUTA 1SXJD 3PSHA 1CZRA 2Z4RA 3SSMA 3S0JA 4BJHB 4QOEA 1ZBDA 2WTAA 3OQIB 4FXOA 5FAKA 1JKMA 5F7ZA 3TNJA 4IV0A 2C2OA 1NQXA 1UINA 1VHDA 1U2GA 3U7EB 3ACCA 3O1HB 2WZQA 1Z47A 4LWQA 1VECA 1YRYE 4IHKA 3UC5A 2XQVA 5CM9C 5CFRA 2NPIA 4BKPA 1KO1A 5AVUA 1TA9A 4PZZA 4X64B 3IEUA 5ICCA 1C9DB 1JIXA 4NYJQ 4O4HB 1QIGA 4EA6A 1Y1TA 5GVSA 2N46A 1FU4A 1TLFA 3L8ZA 5BSEA 4GW3A 1TAGA 3MK31 3VPFA 5BSVA 3FYTA 2P3OA 5CH5A 5ES3A 2K2QB 3IKJA 2G7ZA 3EASA 5HCUA 1WV1A 1GHTA 2PGNA 1CWUA 4RQTA 2X1LA 1RC8A 2QXTA 1CS0A 3ABSB 4UMDA 3EIEA 3WLPA 5EMLA 1PKXA 2WE8A 3N8DA 3K70B 5CA1B 1TTTA 3KUKA 3QVGB 5L7TA 1ATIA 3A0RB 2JIZD 4L4XA 3CT4A 4D9FA 1SGWA 1WRBA 1Z4PX 4A8PA 1JPUA 2CMKA 3KZXA 3VO2A 4BGUA 1L4FA 1N3YA 3H5TA 4Z9BA 4IHQA 5EESA 3KR1A 5K7SA 4YP0A 5KSZA 2GAIA 4NPCA 3TB4A 1ZN2A 3C97A 4NZOA 4F5WA 3DOIA 2C59A 2NOAA 2DLCX 3PNPA 2P0EA 2D4AA 5DNVA 5JZMA 2IV2X 1MEEA 1AUVA 1RVDA 4FU0A 1U5AA 2BZ0A 3OZGA 4PQYA 1ZZEA 5CDYA 1D2CA 5E2AA 2G28A 2JIPA 2WJHA 1JQDA 1AXEA 1XMQB 2C4KA 1MIOA 2PGAA 4INAA 1BHJA 5DGIA 5ICEA 4C0WA 1SBYA 1PWHA 4Q1BA 4RVDA 5ALQA 3WJ1A 3ZDQA 1PVOA 1I0LA 2JAXA 2HLPA 2R11A 4DJTA 3TRHA 4NESA 4I1UA 5SYAA 1YS1X 2QOEA 1CIJA 2C2HA 3M9WA 1YFJA 2C8KA 2K5UA 3K05A 2NXNA 3DV0A 4A8JB 1G98A 2B61A 1CUSA 2FLVA 5AYVA 2AFVA 1EUDA 1N2JA 2PZEA 5DTMA 2CLLB 2J6CA 3HKBA 2VS1A 2LPMA 5HJEA 1ZGJA 2W6CX 3BWCA 2OV2A 4LFBB 2QF7A 2GOYA 3LGXA 4IZHA 2JCGA 3LUDA 2PUCA 4D8TA 1DBSA 1AUXA 3TLGB 3GLFB 3HB9A 1W4RA 3O2SB 1GY8A 1L4UA 3CLVA 1F60A 3QFRA 3WBBA 3W2EA 2CUTA 1YOVA 1ZJJA 3LCJA 4ZCIA 4F7DA 2GPSA 3AFHA 3M6WA 3WL7A 5AW3A 2VDJA 5CDFE 3EPHA 2X9VA 4XM0A 5IM5A 2FPSA 2NWQA 2QLMA 3KCQA 2COKA 1TGVA 2IVZA 3K9FC 2A2ZA 1E1DA 3QW2A 3IVRA 1YK1A 1WEKA 3LHSA 3SBXA 3WIEA 2NUAB 4EBBA 3HTXA 1PFQA 1BH2A 2VLBA 2AQHA 1MENA 2R2GA 3A10A 1U8UA 2QY9A 3GWGA 1A9ZA 4G4IA 3BT7A 3LUBA 2IXDA 3DHEA 3BRCA 2F62A 2HBRA 1G55A 3LY9A 1ODKA 2WZBA 4UJ5A 3DDWA 3U3MA 3EVGA 4MVCA 4ZJYA 2V6GA 3HG7A 1JPVA 4GLLA 5LYYA 4Z2AA 5JEEA 2W2NA 4OKSA 4BNIA 1VL1A 5K0NA 2CFCA 1U04A 2OZEA 3WL5A 1E6MA 4OTZA 1SD2A 3EG5A 4M6WB 1M2VB 5FL7D 2H2FA 4AZTA 1EFVB 3DMGA 2GM4A 1B73A 1XYGA 2O4CA 1ZAKA 3THWB 1LD3A 1SVMA 4XLTA 3VV2A 3R2JA 4S24A 1JB1A 2I7TA 4GMFA 2D5BA 4KYVA 1C7QA 2XGMA 4QUKA 1MHTA 2PCJA 1CDOA 4ABTA 4JUCA 4MEAA 2B9EA 3NB0A 4JI5B 3WISA 4I1VA 3PNSA 3UWMA 2J33A 3UK2A 1M6NA 4MWSA 1CIPA 3P9PA 2Q5CA 4HDKB 3HKCA 5BSTA 3JQ6A 4B7ZA 1A9RA 3AI7A 3X1WA 1PTKA 3LIPA 2OXCA 2ZYGA 5TXGA 3VZSA 3I42A 1YQUA 3U9TA 2V0GA 2BELA 1GKKA 4JUAA 3SS8A 3OFSA 5ALUA 1XYVA 4IXTA 4A1OA 2OBBA 5IN5A 1PDWA 3KFXA 1Z9BA 2X5NA 2GESA 1ZR4A 2Q2OA 2NNLD 4GZ3A 4DT1B 4RC9A 1O95D 1T4CA 2CMHA 4BS9A 3V80A 1QU2A 1YIOA 4XQCA 4HWSA 4OXIA 1WW3A 1YONA 2IUSA 3FSGD 3QUSA 4N18A 3CUTA 3C5WP 1YHZA 1FYWA 2V7WA 5TNXA 1H5UA 1KBQA 1M66A 4G1MB 5H83A 4JR2A 1FUIA 2HJ9A 3IYLW 1GOTA 5DH9A 1M75A 4CDMA 3QOYA 1L7PA 5AI0A 1HT0A 3F74A 3O2JA 3A6PC 3SC3A 5C8YA 1M34B 2Q1WA 4KMRA 5E4TA 4Z53A 4MHOA 2R751 3HLTA 5HA5A 4TYWA 2EHJA 1XB2A 1X7WB 3HWRA 3O4IA 4OJMX 2JIBA 4L4YA 4UTOA 4PG7A 3QK7A 4MP6A 4ITVA 1G5HA 1KERA 4NK4A 2X2FA 3VYTB 2OEPA 3EZNA 3K16A 1IEWA 4JT8A 4XVQA 2RBGA 3QF4B 4TYYA 4GX0A 4R2XA 4YGYA 4YI3A 5CB0A 4HTFA 2HWWA 5K2MA 1RIIA 5BSUA 5ALSA 4CUKA 5C1DA 1ULBA 5TPWA 3EGDA 1AY0A 3ZU4A 4DL9A 5IYZA 4IL5A 1PW5A 5KQMA 3SEFA 1YR6A 4KXFB 2HK8A 1XU9A 1UJNA 2DFKB 4DA7A 1PVVA 5IAOA 4N54A 1SXJB 4BJ1A 5CFPA 9LDTA 1NU8A 3PDIA 1V16A 1GGKA 1NGSA 2Y2UA 3TRDA 6LDHA 1SVSA 1M1UA 5EWMA 5ESWA 3LQ2A 1I2DA 3CPJB 4R69A 3SC6A 1KEWA 2I4TA 1YR1A 3LBFA 1LFAA 4UEJA 3GPBA 4R83A 1E1MA 4EI9A 1G8HA 2Q29A 2HRRA 3M5WA 5ARDA 4F3CA 1E5XA 1ESCA 1NYRA 2FWRA 4OI2A 3ZWQA 3OMWA 3EOAI 2RGDA 4EO4A 2ZJOA 3FE2A 4EKGA 5L6MB 4JBGA 3OPMA 1PV4A 4BO1A 1C3XA 3TXXA 2A78A 2YHIB 3A27A 4QM7A 1SKYE 3GBSA 5TC4A 4KE9A 1ACJA 1KO4A 5BUSA 1JDPA 1GKIA 2HN9A 4JJ8A 5LIRA 2IU6A 3BL5A 4NHOA 5HKLA 16PKA 4JIMA 3I92A 1ZNWA 2DCMA 1CRQA 2J7KA 1KH1A 1GT91 2DH5A 3RRZA 1UKVY 3VOBA 4GXQA 4JJ6A 1RWXA 4R2LA 5KYYA 4K87A 2WSIA 2HDNB 4PSDA 4HDQB 1SY7A 3R7AA 5KVAA 3FKSD 3V4OA 1R5BA 1OE0A 5DB4A 5K05A 5BUZA 1KGDA 5CXQA 1TYBE 3ORFA 5IFKA 1X7YA 5H68A 2ATVA 4HMOA 5EPEA 2IUFA 1ETUA 2N1MA 4N0PA 3M0EA 2G0NA 3WQHA 1U9IC 4YAGA 3EJWA 4A6EA 2VAMA 3I9KA 4GLJA 4NF2A 4S2EA 2CSXA 2PU5A 2PVCA 1Y81A 3QXSA 2NU7B 3G8YA 2XRFA 3ESYA 3OF2A 3UV7A 3FUVA 1OLSB 1PG0A 4HH0A 5G41A 5DV9A 3A70A 2JJMA 3KNZA 4YVFA 5CA0F 2XQIA 3C98A 3ESCA 4NMWA 4LDJA 1O9BA 1YHYA 4UZEA 1DG3A 1Q2UA 4O4IB 1E2NA 4IXNA 4BVKA 4DXAA 1WTAA 4PYQA 2WV9A 2HYIC 1Z0UA 1G3QA 4ZEVA 5DM60 5K0CA 1W0KD 4OQQA 4X0EA 3LT0A 2ZDGA 4M1WA 2P0AA 4M8IA 4RKQA 2FMFA 4FSHA 1HT1E 1RWPA 1DC8A 4HZUB 3TNLA 1EBFA 3VAYA 1R10A 4D9IA 5DX1A 4LRYA 4P3YA 2C4WA 3HXPA 4MNTA 5AM5A 4H0NA 2I2WA 1BHQ1 4QXRA 2GHTA 3VVBA 5I4KA 1K6EA 2B37A 1Z7BA 2DBVO 2I78A 2R60A 3QPWA 1FQJA 3C3BA 3ICQB 4QOHA 3DBOB 3QTTA 2ERYA 1Z75A 2P9BA 1TL7C 4YQFA 3O8OA 2NO0A 5AICA 5SYMA 1GAWA 1TADA 2ZWAA 3IIKA 2GJKA 4ZHQB 5IHXA 1KJ9A 1VJDA 1HRKA 2BZGA 4WXEA 3VGJA 3AQ4A 3D2CA 5C2JB 4CLEA 4AWXA 2FW0A 4QU9A 1E3MA 5DRTA 2HTEA 4FNGA 1UKZA 4D42A 5G0VA 4QU5A 2JCXA 3ERCA 2OBXA 1ZJYA 5AQ1A 2ZDQA 3ZDXB 3VNRA 2OORA 5LB4A 1KNQA 1UR5A 3RIXA 3CXUA 1U1DA 1C30B 1UKEA 4JLKA 2E37A 3O8LA 3R6GA 5CT8A 3FI0A 4K6CA 2DERA 1SHUX 3EUEA 3EZ2A 4Y0AA 3A3KA 3L0YA 3TKYA 5DGDA 3QLVC 4J0QA 2NP6A 1V2GA 5FTKA 1H2WA 3N70A 1P4SA 4KSCA 5KNCD 2XMBA 5K01A 5D7NA 3WWOA 4EZEA 2WPDA 3I6YA 3R9XA 1VJTA 1WMAA 3OIWA 1HDXA 1MAUA 1DRKA 3L07A 1IZ8A 4ZI5A 2RKOA 3WYBA 2GB4A 3MCVA 3NWOA 3GEPA 2YN0A 4GX2A 1QOZA 3V3KA 4MYRA 2HSEA 3CCCA 1L8AA 3MRSA 5ELMA 3ETHA 3DVAA 3NTXA 4NS1A 3KLMX 4XJXA 1CZUA 4ER7A 5GAJA 3GQBB 2OCLA 3K0CA 4RZXA 1D0SA 4D0LB 1JX6A 1HE2A 4IRXA 2PFSA 1BQ3A 2HSDA 1KJZA 3KBBA 2HAEA 4QD3A 4F4DA 2H1RA 1XHEA 3STYA 1WZ2A 2BZ1A 4RZHA 1TJ5A 4KLAA 2ANBA 3UGKA 7YASA 5IHPA 3WGOA 2PZJA 4RPJA 1R6UA 3FPCA 3KSMA 5TB5A 4C4ZA 2JA1A 1Z6XA 2WFZA 4QQKA 1CUBA 2XUPA 1XMIA 1JG1A 3ANTA 3MS2A 3OX2A 2OO7A 1FTWA 3CF4A 1LLFA 4JUFA 1AKMA 4TQGA 5EKTA 1T8RA 2RKWA 3CIFA 4CMEC 4TXHA 2P67A 4MVJE 1MRSA 1SKMA 3RC9A 4AXXA 1THMA 4BRUA 3N3BC 2R48A 2FDXA 3B48A 4PYKA 3UUWA 4QUEA 1D5CA 1U5BA 3DEYX 4TKUA 1T9BA 3BD8A 3U9SA 5KSYA 2A1TS 3T5DA 3TOVA 4QXAA 2Z43A 3FR8A 3MJDA 2RB4A 4OXQA 5CXSA 1UJ6A 4EFDA 5T7BA 1ZGCA 1V41E 1FFHA 3EQ9A 4NK5A 1KDOA 2OFXA 5CIWA 1ZSVA 3L4BC 3C3PA 4JB3A 4OFWA 4JSYA 4DZRA 4HB2A 3LOPA 1KYTA 5G0WA 4DXHA 5K0GA 2PVSA 2DHEA 1D4FA 4G41A 3J7AC 2ZT6A 3KQQA 1E1QD 1XVVA 2C7PA 1E1CA 3D7RA 3OT1A 5EGNA 3WLNA 1G3UA 5C5DA 4ZN6A 1EZ4A 4ACBA 4HV4A 3OKFA 7ABPA 2OESA 5D6OA 4I1IA 1XQVA 4EDHA 3GEDA 3IB6A 3D7LA 2B8JA 2J9FA 1O1YA 2C9ZA 3RIMA 1ONNA 3R7WB 2H9AA 2FPXA 2MSCB 1DX6A 1M76A 3P4YA 4OK5A 5FI1B 3QEAZ 1BJTA 1G38A 2CB9A 1XTVA 3SG0A 1Y6ZA 3BIJA 2MINA 2GJAA 3H9EO 3J7TA 1Z6GA 1NAIA 4XIJA 5ETJA 1MDBA 4B81A 4E88A 5AVVA 3K15A 4YDQA 2OHJA 4POOA 4XD2A 3ADKA 2FQ1A 4N6GA 1IDN1 5E4FA 1V6AA 3FPSA 5BW5A 1U1EA 3PF8A 1TYZA 1II9A 3PX2A 1NJ2A 2BDTA 2GXSA 2Z2XA 4FOTA 4XQEA 5HIJA 3S7TA 3DDZX 3OQMA 5B55A 2OCDA 3NHZA 1BX1A 3HZHA 1H0HA 3D4IA 1EFPB 3NETA 4PZDA 2FWMX 3T41A 5FI0B 4O3FA 1ZLYA 4XPIB 5HE8A 1H23A 4EO7A 3BWEA 4QYTA 2P30A 2YIDA 3RSSA 5I4IA 2XOXA 3QE4A 1L1EA 1QIHA 2DP4E 2QRLA 2ZIAA 3GCWA 3LJKA 3VOAA 4XFJA 3HM2A 2YIMA 4B79A 2HU8A 1Y4AE 1IM5A 4DR6B 1DJPA 4EVRA 2JLWA 3ZHXA 3BHNA 5DASA 3HU2A 4ZCPA 3MQ2A 2R4TA 2VZLA 2NVUB 4U0KA 1HL7A 2BFAA 2OVFA 2V1XA 4Z86A 4US2R 4RTJA 2FU5C 1MFPA 3BDAA 1LVHA 3C3CA 1V1MA 1ZWKA 2R8PA 1X7DA 5E7IA 4KXVA 4TZ6A 1E3WA 1WR8A 1JMYA 1Q6ZA 2FKNA 3ICCA 5E0OA 3LI2A 5FUYA 2VLIA 4EHIA 1PHPA 3CZMA 3OP1A 3ZH2A 2QSUA 2DUJA 3BWYA 4NEHB 1SG9A 1QO0A 3A2NA 3GN2A 3KCNA 4UMEA 4OATA 1IYZA 4YT2A 3IE1A 2RGNA 1PCXA 1G2QA 2VBGA 3K0HA 2FWAA 1J0DA 2JAPA 2BRUA 3E27A 5T8KA 4Q1AA 1E6EA 3IKTA 1YS7A 1NF8A 1XQ1A 5KSOA 3WLFA 1QG0A 2J09A 3KEMA 2VDKB 1FRQA 2DPYA 3C5VA 3DVSX 4FE7A 4IDNA 3MQFA 3VPBA 3NVKI 1VJ0A 5H3CA 3TQCA 2FUG6 3RHFA 2EJVA 1YCDA 3BFPA 4K9PA 4YT8A 4LNHA 1K98A 4U4AA 1UF9A 5FWYB 5K51A 4ENWA 1EVJA 4PVCA 3UT6A 1K6JA 1QZ3A 2I8CA 2E4YA 2AG5A 3M4NA 4LGCA 4NL4H 5K4HA 3NDRA 4QUHA 3ZKWB 1MA0A 2EFCB 1XRRA 3K5HA 3RFUA 3EF1A 2NTYC 4RADA 3IUSA 5C3UA 1P9NA 4Z4EA 4P4SA 3AMVA 3V1YA 3ZCTA 2PX6A 4F45A 1HLDA 4XUGB 1EVLA 1QGYA 1QRDA 3OTGA 1BOFA 2QORA 4GPD1 5KNBA 2IPLA 1PJBA 3L6OO 1YUBA 1KDPA 2HF2A 1EA5A 1AQJA 5AD1A 1XDZA 2YJGA 4EGAA 3VTFA 1QZUA 5C8XA 1Q1GA 1JDBC 1XCOA 2GHRA 4N9WA 4BMSA 4AYWA 1H42A 1FUUA 4PN7A 4C0QC 4R7ZA 4WK2B 4DMKA 1N0VC 3UOWA 3BWDD 3ZWKA 5EYPB 5LVAA 1NR7A 1LB1B 1WQ4A 2I4OA 4IFIA 4ICIA 3V4SA 1WDLA 1G5RA 1DC6A 4NARA 5KYVA 4IIGA 1X1AA 4B4KA 2CT8A 4ZZIA 2XTMA 1IATA 5ICFA 4H4DA 5LMUB 1DEKA 4JVMA 3QLUA 1BW9B 3LLVA 1KEEB 2ACKA 4OH1A 4PRLA 1A95A 1S02A 2NZUG 4KR2A 1GIAA 4CTMA 1AG9A 5CEJA 3D6UA 2F1RA 3PFKA 4LVOA 3ES9A 1NXWA 4JC0A 3STTA 2XZPA 1C9EA 1HGXA 3EXIB 1MPTA 3K09A 1UDXA 4YV2A 4KRGA 1PK8A 1UADA 4X7RA 2A9FA 1TB4A 1GITA 3OTIA 4ZMBA 2O2SA 3WJ7A 1NWCA 3UOGA 3K9CA 1NW3A 4CQMD 1V6SA 1WNTA 4X65B 3UQZA 1XDGA 5ELXA 2MHCA 1YGYA 1RQPA 2FSPA 1JBKA 5BSHA 3QLJA 4HI0E 4ZI7A 4E94A 2XSZD 3HCOA 3U7GA 4IDGA 5AHOA 1CY7A 4BO7A 1U2DA 4QHSA 2R47A 2BIFA 3WYCA 1VSVA 3I2YX 4JT4A 1H1LB 1PUIA 1NTRA 3HMKA 4PZEA 2AXQA 2UKDA 3BMQB 2XUZA 2YV2A 4HNSA 4NOKA 1AB5A 2H51A 4D46A 2SECE 3SQWA 1G6KA 3KS9A 1FRFS 3PGLA 2FFAA 1RQNA 1F3OA 5EKUA 4JBIA 4P2GA 1YT5A 3ZQ6A 4LBYA 4FEAA 4KB5A 5EXPA 4DBLE 2C5LA 2X0DA 2BGUA 2JFPA 3MTJA 4Q3LA 3JQBC 4XOUA 5LZ7A 3ZGVA 3AEUA 3AFOA 2IHYA 1OC2A 1NUSA 4XASA 3LC0A 3KV3O 5JDIA 1JA9A 3KT0A 2D1SA 4B4WA 3EQ2A 3W04A 4F5YA 2QRKA 4HNVA 2ASEA 2HMTA 3K0EA 3PITA 2CLHB 3Q8KA 4YJFB 1Q7GA 1YZFA 4I4NA 1GQYA 1XZLA 3GBVA 3QWBA 3TTVA 2LDXA 4U5QA 2J5KA 3DB1A 3DE6X 3PQ7A 5FHRA 4LF8B 1M54A 4I50A 2Q5FA 3D59A 2WFMA 5KDDA 4B2YA 3VHLB 1VHTA 1ZM2A 2OBMA 4YONB 1A5ZA 1Z8DA 4LF7B 2DBZA 2FHPA 2NU6B 3L41A 4HEJA 5FBQB 2CNBA 4UVGA 1TDJA 4PPFA 5EXDA 1OZ0A 4OSEA 1FPMA 3IPYA 5F12A 4NE7A 2H2HA 1M2NA 2HEGA 2YINC 1JR4A 4AYXA 4EZIA 2DF8A 2FMIA 3CU5A 1ZL2A 1OJLA 3ONDA 1UJBA 3D2BA 1F1JA 4A92A 3RROA 1IUNA 3ETGA 2C9MA 3H16A 2BFDA 2X0IA 2QR2A 4H3SA 4KUEA 3KR2A 2F3PA 3AXTA 2FPKA 3ODPA 3KQWA 1XOIA 3MEQA 4BEBA 1JILA 1HRDA 1N8NA 1L7AA 3RIGA 4BDTA 2ODWA 3F6EX 1ZUD1 2FW1A 5B3LA 4TXLA 4Z4QA 4BN5A 2ODEA 1YR7A 2F90A 4WEQA 2YUIA 2H1VA 2PGLA 4KFTA 3M4ZA 3T3OA 2NT4A 5F64A 2X0EA 2A1TR 2J0UA 1Y8ZA 2WNIA 5U9CA 2PMWB 1KR2A 2UXBB 1GTZA 1U8ZA 2Z5VA 3VKUA 1XD9A 3ZWCA 2BFMA 4V0KA 1GPNA 4HZGA