1BKYA

Vaccinia methyltransferase vp39 complexed with m1cyt and s-adenosylhomocysteine
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP39
publication title mRNA cap recognition: dominant role of enhanced stacking interactions between methylated bases and protein aromatic side chains.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Mrna processing
total genus 97
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1bkyA00
3ELWA 1BC5A 3PB3A 3LPMA 3RW9A 5K0FA 3KQPA 3UJ9A 1NW8A 4ER7A 3A7EA 2O05A 2EX4A 3OU6A 2QRVA 3I9FA 3DTNA 5EOVA 3KQWA 2IGTA 5DSTA 2B9EA 3K6RA 3AY0A 3OFJA 2IH5A 2VZ9A 4KWCA 10MHA 2XBMA 2ZWVA 1QYRA 3DMHA 3NTVA 4FZVA 1YFJA 3FZGA 3VYWA 2FK8A 2JH8A 1D2GA 3BWMA 1BKYA 4EKGA 2NXNA 2EFJA 1UFKA 5C9ZA 3MTEA 3NWEA 4QVGA 5DLYA 3RIEA 3HCAA 4AX8A 4XUCA 2OYRA 3GIWA 2E5WA 1NW6A 3KQTA 1IM8A 2Z6QA 9MHTA 1QAMA 1VLMA 1XCJA 2I9KA 3D2LA 1SQFA 4R8RA 3S68A 4G56A 1QAOA 2BM9A 5HIIA 5M5BA 1BHJA 1JG4A 2XYRA 2LD4A 1IY9A 3GRYA 2OBFA 2AOWA 2Y1XA 3ER9A 4M38A 5EKXA 1XJ5A 5KQRA 4MWZA 2CMHA 3MCTA 4PYLA 5HFJA 3PFHA 3PVCA 4PGHA 4WXHA 3GJYA 2PKWA 1WS6A 3LECA 1JG2A 3GDHA 5DSXA 1FPQA 4BLWA 4YUWA 4GBED 2JHPA 3NMUF 2V7EA 2YXDA 3GNLA 5CVVA 3BGDA 3OU2A 3LBYA 7MHTA 5FA8A 2IBTA 5DM2A 3DR5A 3BUSA 2AN3A 3UBTA 2HMYB 2HWKA 4C4AA 1I9GA 2ZBRA 3AXSA 4CKEA 3BGIA 4P7FA 4GF5A 5JUWA 4QTTB 4ER0A 2A14A 2ZTHA 4CXMA 5GP1A 4AZTA 1RI5A 2G70A 5MHTA 3UJAA 4RTKA 4HTFA 5FA5A 4PIMA 2ZIFA 3BWCA 2GB4A 1YFLA 3BT7A 3VC2A 3ME5A 4E31A 2BR4A 3HVJA 5EKUA 5CM2Z 3V8VA 1B42A 3G2OA 4GUAA 1JSXA 2ORED 3IHTA 5T67A 5E1MA 4DM3A 3FUVA 5LQNA 1NBHA 5K0NA 4V0RA 3G2QA 1NW7A 4IV8A 4PCLA 2VS1A 3NJRA 4RTNA 4LG1A 1N2XA 5EGSA 3OU7A 4OQDA 3P2EA 1AQJA 5BXYA 2HTEA 4YUZA 1TW2A 1I1NA 2IIPA 4DCMA 2AN5A 3CJTA 2B2CA 2ONZA 5LSAA 2PX2A 4H0NA 4GEKA 3JWHA 4U7PB 4AZVA 1R74A 2B3TA 2P1DA 2AOTA 4P7GA 4UOEA 4OBWA 2OB2A 2AR0A 3CBGA 1TW3A 2PXXA 3UJ7A 2ONYA 1JQ3A 3AXTA 3UA3A 1NV9A 3KQMA 4XCXA 5DRYA 3EPPA 2IFTA 2AOXA 2PY6A 3I58A 5FHQA 4HRAA 3M4XA 4RTQA 1I4WA 3F4KA 4PNEA 3BKWA 4L7VA 4R05A 3TM5A 5HEKA 3FPGA 4GC5A 1L3CA 1JSZA 2OKCA 1M6YA 1KHHA 3DH0A 4RTJA 3EVEA 3SSOA 1BOOA 3KQVA 3IEIA 2BR3A 3MQ2A 5K0BA 2ADMA 4PCAA 5CUQA 5DWQA 3CC8A 2KW5A 2R6ZA 4HTFB 5E9QA 3LHDA 4OBXA 3EVFA 3C6MA 4LECA 3KR0A 4RTLA 1RI1A 5E9WA 3SXJA 2UZ4A 5D1HA 3A7DA 4M37A 1UWVA 3FUUA 3B3GA 5T6BA 4ER3A 5LQKA 3GGDA 5GINE 2H00A 2AS0A 2I7CA 2P7IA 1FP2A 1NT2A 1RI4A 5FQNA 3CGGA 1AF7A 1Z3CA 3TQSA 3HCFA 5EIFA 3C0KA 5T64A 1UIRA 5CVDA 1EG2A 2PSSA 3FTFA 3SX0A 3TMAA 3EVZA 5FUBA 1MJFA 1P39A 1ORHA 2P41A 4M7RA 3REOA 2G1PA 3EGEA 3MGGA 4KRGA 4CWAA 1RJFA 2AOTB 1Y8CA 2OO3A 3CJRA 3EEYA 2YXLA 1XVAA 5FCDA 2EG5A 3E05A 3LCCA 3Q87B 2HNKA 4F85A 3HCEA 3HM2A 3FTEA 4RV9A 3UJDA 5EHGA 3R3HA 1KXZA 3KKZA 3M6VA 4F84A 2O0LA 4FS8A 1L1EA 1OR8A 3HTXA 2PWYA 5FADA 5C0OE 5ICCA 3JWGA 2IBSA 1P91A 3TKYA 3VC1A 4Z2YA 5K01A 1M0EA 2ZZNA 2IDJA 3B3FA 3FPEA 3PTAA 3G5LA 3C3PA 5EMMA 5E8RA 2VP3A 4FR0A 1JTEA 3TLJA 1ZHFA 3DLCA 4PYOA 2PLWA 3P97A 4RVFA 5FTWA 2P35A 3P71T 3M6XA 3HA5A 2PX4A 3I53A 4E2YA 3FUTA 4FSDA 2Q41A 3P9KA 3SGLA 3U81A 3UA4A 3FUXA 3GRUA 5F2NA 5LQUA 2NP6A 2JHCA 3M6WA 4LWPA 5K05A 4C07A 2AN4A 2PX5A 4FP9A 3PT9A 2H11A 2OXTA 5K0LA 3UJBA 5K8VA 4RTMA 3EMDA 2Z6UA 5EEGA 4QQNA 4HH4A 2PT6A 4BP1A 1INLA 5HZMA 5DM4A 4KIFA 3C6KA 3MCZA 3P9NA 3B7PA 4QTUB 4MIKA 4GOLD 4DCGA 3JWJA 2GS9A 4X63A 4E2ZA 3DLIA 4QDKA 1NV8A 2VDVE 4BP3A 2UYQA 5FWAA 2CL5A 5LQAA 3SSMA 3TR6A 4DF3A 1XCLA 2DPMA 2ZBQA 4OX9Y 3EVBA 2QRVB 5F2OA 1Q0TA 4EVIA 4RYLA 3ELYA 1VE3A 2BR5A 3TM4A 3OE4A 4FSXA 3VSEA 3CCFA 2B25A 1KIAA 1G6Q1 3AWIA 3NWBA 1U2ZA 4HGYA 2ERCA 3KU1A 1EIZA 4O29A 2YTZA 2GPYA 2AOVA 1NE2A 5G02A 3T7SA 4IV0A 2ZSUA 4OA5A 5ICEA 3GU3A 2PBFA 1G8SA 3Q7EA 4QPPA 2NXCA 4RTOA 3LBFA 5C1IA 4A6DA 3HVHA 5GM2A 3TKAA 4B17A 5LQRA 5KQSA 4U7TB 3NDJA 3SR4A 3HCCA 3B89A 2QM3A 2FCAA 4AUKA 5LR6A 2AZTA 3I64A 3KQQA 2ZIGA 3GCZA 5F2KA 3UFBA 5LQCA 2UYOA 2PJDA 5DM1A 4POOA 3LDFA 5LQJA 1F3LA 3A27A 2AOUA 4FT2A 3KPWA 2JJQA 3DULA 1R00A 4IWNA 3UJ8A 3RODA 3L8DA 4CTKA 3GRVA 4DA4A 2CKDA 1G55A 1RJDA 2P3QA 5JR3A 2NNWB 1DUSA 2G8NA 3G88A 5GM1A 1AQIA 1ZGAA 1QANA 3UJCA 2CWWA 2C7PA 3PX3A 2IP2A 3BWYA 2NP7A 1D2HA 1JQEA 4QPNA 4X61A 4ER6A 1SVUA 3MB5A 4P58A 3P9CA 3R24A 5K0GA 1T43A 3CVOA 4BY9E 3FUWA 2ZLBA 3KQOA 4PINA 1KP9A 5HOQA 1VP3A 3IYLW 4JXJA 4YMHA 3TFWA 1VP9A 3ANXA 3K0BA 3LKDA 2OZVA 2P8JA 4KDCA 3THRA 5CIYA 1RI2A 4E70A 1O54A 4XUEA 2P3LA 1SKMA 1P1CA 1JR4A 1YB2A 5EIWA 4CKBA 3OZSA 3DXZA 1DL5A 2YX1A 2JG3A 4EQZA 1M6EX 2I6GA 1G60A 1HNNA 2AVDA 2FRXA 3EVCA 3KPYA 5EZQA 1VL5A 3FPJA 1R8XA 3EGVA 2ZCJA 3R9XB 3SVZA 3EGIA 5E9JA 4CKCA 5EZSA 4PYQA 2BZGA 3MAGA 4GOND 1ZQ9A 2ZZKA 4RTPA 1NBIA 1XTPA 2OY0A 3LDUA 4RWZA 2HR1A 2BH2A 1NW5A 5DT2A 1R6AA 3HCBA 3EVAA 3O31A 3P9IA 1V39A 1NW3A 5EVJA 3G5TA 3MTIA 4X41A 4RSRA 1P1BA 4PYIA 1SG9A 3OZTA 4HC4A 3FYDA 1IXKA 1RJGA 5K09A 1L3IA 1VQ1A 3OZRA 2G72A 5EQJB 1KR5A 1X1CA 2GLUA 2WA1A 1H1DA 2P40A 2OB1A 4NECA 4PYMA 3BXOA 4Y2HA 1MHTA 3NDIA 3HP7A 1WY7A 3HVIA 1Q0SA 3QOWA 1JG1A 3QV2A 3DUWA 5E8JA 2YXEA 3IV6A 3B3JA 3M33A 3KPJA 4OA8A 3SSNA 3DP7A 1ZGJA 5HIMA 3UWPA 2AVNA 4KIGA 3FRIA 4GOOD 1L3BA 4IKPA 3A25A 3NW9A 4PGGA 1YZHA 4C04A 1KPHA 3KR9A 4M36A 1VBFA 5DXJA 5ERGB 4A6EA 2I62A 2ZW9A 4RVGA 3JWIA 3EMBA 3PLAE 2VDUE 2XVMA 3LX6A 2V74B 2JH9A 4PYNA 2NXJA 2PVCA 3THSA 3I5UA 4DZRA 1VIDA 5DPMA 2YR0A 2ESRA 3LDGA 2GA9A 2WK1A 2XYVA 3LGAA 1EQAA 3OCJA 5HIKA 5E1OA 4PIPA 2WA2A 1WZNA 1EJ0A 4YV0A 1L9KA 3TOSA 4RTRA 5HIJA 1D2CA 5EMLA 4QDJA 1FP1D 2CMGA 4MQ4A 4C05A 4LWOA 5CCXA 1FJXA 3NVKI 3LSTA 5BW4A 4BLVA 1G38A 5H02A 5IH3A 3HCDA 4KDRA 4HSGA 2YUIA 1EJ6A 5DRTA 2YQZA 4HG2A 3EVDA 4MHTA 5DX1A 1JTFA 2PWPA 2H1RA 4XUDA 4E30A 4K6MA 3DMGA 2P3OA 3DOUA 3ERCA 3ORHA 4GQBA 3G2PA 2JHAA 3FPHA 4YUVA 5EMKA 1SQGA 1QAQA 3HNRA 3EEOA 2IDKA 1RJEA 3M6UA 4X60A 1XDUA 1TPYA 4RVDA 2BM8A 3KQYA 4ZTBA 2K4MA 1PRYA 1N7JA 4EMSA 5U4XA 3E7PA 4E2XA 5DXAA 5DX8A 4ER5A 2ZFUA 4PYJA 3GRRA 1X1AA 3KHKA 2ZIEA 1QZZA 3CJQA 3BWBA 1YZ3A 1X19A 3BKXA 5D1NA 2GH1A 1JG3A 2PXCA 3HA3A 3ELUA 3PFGA 4R8SA 3FPFA 3FYCA 4RTSA 3ELDA 4YV2A 1SUSA 3ER8A 5FULA 4DMGA 1VPTA 5GIOE 3R0QA 8MHTA 3OE5A 2NXEA 1O9HA 1NKVA 1JQDA 2F8LA 1XDZA 2UYCA 2OPBA 2IH4A 3PS9A 4ISCA 4P7KA 1R8YA 4Y30A 3NVMB 3LCVB 3QOXA 3P2KA 4GC9A 3O7WA 4FT4A 2XYQA 1XXLA 3HA7A 5DTQA 2NYUA 5KVAA 4PWYA 2IPXA 2R3SA 3H2BA 4F86A 5CVUA 3T7TA 4C08A 3FRHA 3KPVA 4MTLA 4PYKA 2FYTA 5CVEA 4AZWA 2EJUA 5BW5A 4KW7A 4YV1A 3E23A 1ORIA 2FPOA 5EEHA 5BP7A 4BLUA 5ICGA 2N47A 5EHIA 4AZSA 2ZZMA 1N7IA 4GOMD 2O57A 2PX8A 2QE6A 1X1BA 4PONA 2PXAA 3OFKA 2IH2A 3CKKA 1X1DA 3ID6C 5HILA 5DM0A 5EC8A 2GAFA 4DQ0A 1SUIA 2C7OA 4P7JA 3KR2A 3C3YA 1FBNA 1ZG3A 3PX2A 2QYOA 1YF3A 3UJ6A 5CCBA 3MERA 5DTRA 3SMQA 5EMJA 3V97A 1XDSA 3GO4A 4DKJA 3TRKA 4ATNA 1HMYA 5FHRA 1YUBA 2FK7A 3DXYA 4YUYA 5FQOA 1G8AA 2UYHA 5GIPE 2HV9A 3G89A 5DX0A 2EJTA 3HVKA 1WG8A 1EAMA 3LL7A 5FWDA 3KQSA 5DTMA 4EK9A 3KR1A 5KYGA 2PGXA 2O06A 3A4TA 3P8ZA 3UZUA 2PT9A 5EPEA 4FGZA 1RI3A 5CVJA 1WXXA 4HGZA 3EVGA 5GOZA 1AV6A 1KPGA 5K03A 3GRZA 5E2AA 3G2MA 3DXXA 4RX1A 3G8BA 4E32A 3P2IA 3MHTA 3FTDA 3DMFA 3M70A 2VDWA 2P7HA 3GXOA 4V0QA 4CTJA 5K0EA 2ZBPA 1KYZA 4RVHA 2O07A 4X1OA 4C03A 1DCTA 3KPUA 5B1SA 5K0CA 3OPNA 5K0JA 5ICFA 5KS2A 3GWZA 2AOUB 4OQEA 3E8SA 1ZKDA 2PV0A 3R6TA 3SM3A 2ZWAA 4E33A 4R6WA 5CD1A 5E1BA 2B78A 2YVLA 3LCUA 5E1DA 3A26A 1KYWA 3O4FA 4EKIA 2C7RA 3HEMA 1WXWA 2Y1WA 2Z6AA 3LKZA 4WVLA 4KVZA 1F38A 3T7RA 4C06A 4QVKA 3TPZA 4YUXA 2FHPA 4YMGA 2QY6A 3AJDA 1R18A 3WSTA 3X0DA 1O9GA 3FTCA 1KPIA 4QQKA 5E2BA 4E2WA 2C7QA 3BZBA 5GWXA 2DULA 2G71A 3G8AA 5P8WA 3G7UA 5EG5A 3T0IA 2ZULA 5IKMA 3B5IA 2ZVJA 3BGVA 1PJZA 2XVAA 4R6XA
chains in the Genus database with same CATH superfamily
2IYZA 2BFBB 4LPKA 2AT1A 1FYXA 3TOVA 1ZNQO 2GBIA 2O2JA 2YWDA 2FW9A 1PUJA 2WWHA 3E5MA 4NEHB 5BY2A 1AKYA 1R4NA 2IGTA 4JNCA 5ISMA 4KWCA 1ZOOA 2IYRA 2ZWVA 3FPAA 4WBNF 6PFKA 2DR0A 4ZEXA 1MFZA 3O2NA 4DCPA 4URZR 1EFDN 2RIRA 2PZKA 4L5AA 1KSHA 1L5YA 3ANTA 1J90A 1AZTA 4XX0A 4ND6A 1RYDA 3IUEA 3N7AA 3BIWA 4G9GA 1KZGB 2ZTUA 4K9QA 4NP6A 4MUFA 2XGMA 4YJGA 2VF4X 5DMXA 2Q5CA 3LBNA 3ROXA 4OYYA 3SD7A 1E98A 2WKSA 3JASA 5AVTA 5D51S 3USES 1EDDA 1QH8B 3GPCA 4PLFA 4JEHA 4CIYA 1ZC4A 2AJBA 2W2LA 5JADA 1HUQA 1FDTA 3C45A 1RRKA 2DT8A 3CPSA 3N2GA 2XEXA 1TGYA 1CR4A 4FOLA 2IY9A 4UDNA 5DBFA 3PQDA 5L95A 1WZCA 4BO5A 1M7HA 2PCLA 1RWXA 3GRYA 4OH7A 1E9BA 3HI4A 3KT6A 1J8QA 2R00A 2BOVA 4M0LA 3WIDA 1JVSA 1W6RA 1LFAA 4JBLA 4G25A 2VHXA 1JG2A 1PW7A 5DFAA 4YIKA 5TEVA 3IALA 3VVBA 3ZTYA 3V9PA 5EFOA 3SQDA 1Z39A 4UPEA 1FPMA 4IEEA 3STYA 2EFEB 3CH6A 1C9YA 1CJUC 1FVHA 1QGAA 1SKYB 4WZAE 1I7PA 3PI7A 2VP4A 2DBQA 1WUTA 3BGIA 3U7FB 1Z22A 2YWEA 4D97A 1L4HA 1Z0UA 1RBQA 2ZUVA 4G65A 2XWQA 3NHJA 2RHDA 4JLMA 5EJ8A 1ZCZA 4MWBA 5IVKA 5I3ZA 4BPBA 2KYRA 3GJQA 3LT1A 1BQ4A 1DU4A 2XUHA 4R7ZA 1KMNA 1H2XA 1I1QB 3S7ZA 4RVCA 3B1FA 1JSXA 2ORED 2I2XB 4RE6A 3PUVA 4XTRA 3H1FA 1BNCA 4AY6A 3K70D 2YJGA 3O9MA 3NJRA 1RQNA 2AA3A 3O8QB 5EGSA 4NL4H 1RZUA 3ZWKA 4TTRA 1YVEI 3N2KB 2HCFA 4M3NA 4QKQA 4WZ6A 6ADHA 4OHWA 3JQ9C 1BFUA 2DH5A 2XTZA 3EPHA 2ONZA 3ESDA 2JH3A 4AWAA 4BGEA 4QM7A 3NH9A 5ALRA 1I5EA 5AK3A 4P7GA 2WM9B 1A2BA 3VTAA 3UV7A 3GDFA 3PDIA 2OB2A 2ECOA 2PD6A 4XM0A 5EJ6A 2AX4A 4YMIA 3FOBA 1FYVA 1WL8A 1IPEA 3F6YA 1K4KA 3O7MA 1S2DA 2C7GA 3WLTA 2R0QC 4O2BF 3TNLA 2GRJA 1S2GA 1T9GR 4R05A 5J1TB 3SFZA 1E58A 1U0RA 2CLOB 1XV5A 2B21A 3N58A 1M6YA 1XZJA 1YFZA 1NIPA 3A2NA 4ZQGA 5K0TA 3D31A 3WLLA 2G6TA 4NCJA 4BV2A 3UCEA 2FUKA 4HXYA 4ZT7A 1M74A 1QLHA 4JFRA 4RDXA 1CEYA 3M5WA 5KYXA 4U8GA 3DLAA 1WOMA 2ZS9A 2CFCA 3MXOA 5JE8A 3GG2A 2R6ZA 3F9RA 5H1YA 1FMFA 3RC8A 3V4VB 5BVHA 2ZSKA 1GL7A 1IBLB 4WLOA 3C7CB 2QVCA 1DXYA 2A9VA 2A88A 2J3KA 2GPBA 4HEA1 2PHZA 4HNSA 4JUBA 3P0EA 3SLGA 2BP7B 3ZD9A 1ZMRA 4V1CB 2GF9A 4YP0A 2XNKA 3CTMA 1OKKD 2H00A 2P7IA 2Q5EA 4OLJA 5DBOA 1PVDA 2CLKB 1C3OA 1W0JA 2C9MA 1GZUA 3C41J 4JEIA 2X8JA 5GMOA 3PXGA 1NJ2A 3DDOA 3II6X 3SDBA 3VSCA 1UIRA 5CVDA 3W3AA 4MW1A 1H22A 1JQKA 1UZMA 1IRIA 1NUAA 1GQYA 4V1CI 4HDNA 1E1CA 2OCLA 4KRGA 3W5DA 1WTAA 2BMEA 1P0QA 2J9FA 3CJRA 4O4JA 4WCVA 3V4ZA 4YTEA 4MI9A 3KVYA 2ET6A 4D0RA 3M4JA 4RGYA 4EG4A 3GCDA 2OAEA 3SPXA 1CUSA 5FPPA 3M1IA 1IEVA 2RG1A 1PNVA 1XMJA 1TVMA 2ABWA 1SR8A 1ZIDA 4KN5A 1WA5A 4LQCA 1POXA 1YXMA 1WO8A 4DW8A 3WBJA 1K3UB 2YRWA 2H2AA 3HFSA 1GPNA 1XN1A 1XX6A 3A31A 3B1JA 4PZZA 3WQBA 1E7YA 3AY6A 1QFJA 2VDLB 4TWBA 4WCFA 3T95A 2H0RA 2R5FA 2YOFA 4CLDA 4KAAA 2J6BA 5A9RA 1XZDA 3C3PA 4RHTA 4CLOB 1IQUA 1P5RA 2EQAA 2I78A 3K6JA 4L16A 5EXSA 3PQ5A 3P1JA 4Y2XA 4N12A 4JGGA 1FFAA 1NXQA 1Q0UA 2B4TO 2OV8A 1N8TA 2XKAA 4YROA 5C3MA 1Z4PX 1D03A 1L8LA 1TJYA 4GPIB 3R7WA 2PT5A 2ZJ6A 3JQ6A 5F2NA 5LQUA 3A1FA 5KNCD 4GRAA 3LPCA 5DDIP 4C07A 4Z5XA 2V7QA 2ZE5A 3KEQA 3U5ZB 4P53A 5HSGA 5BR1A 2OD2A 2FN3A 5ENZA 1NVXQ 2PJUA 3RB8A 1LRLA 1IMOA 2NUPB 1SKQA 4I9NA 5HZMA 2GN4A 1MVLA 2JCXA 1NQTA 1VOTA 2G80A 3MTJA 4W5TA 5EP2A 4E5PA 1PWZA 3AB7A 4DCGA 2PIDA 2EKLA 3C2QA 3C8ZA 4MINA 3D6MA 1S3SA 4R1TA 5D1HA 4TZKA 3VJMA 4B8ZA 4BNLA 4EUFA 4KRXA 4HDSB 5HCIA 5A9SB 4OX9Y 4F6RB 5I7HA 3QVGA 6CHYA 2BR5A 4PLWA 4LHYA 4NMLA 5LZ7A 4UD2A 4ALKA 3S4YA 3UHAA 4UVEA 1M1NB 3FDXA 2Y92A 4QYMA 2D0PB 3EARA 3LJKA 1ODTC 4RIGA 4CKWB 4YQFA 3D3EA 3IVMA 4D4MA 4CMCA 1LQ2A 2E4XA 2B5OA 2ZWPA 3MWYW 4CKYA 4Z1MA 1IVSA 5I3CA 4PLYA 1TM3E 3K1AB 4GNRA 1KR2A 4NJEB 4D25A 1ECGA 1ZK3A 2EZUA 3TKAA 1JYFA 3BN3A 3NT2A 4L4YA 1QQ7A 1VBMA 1W52X 1BXRB 1NY6A 3SR4A 4E03A 5KSYA 3I0MA 1YK0A 1PFYA 2GDJA 5G41A 4NCAA 2E6UX 2PRYA 4BVGA 2YDXA 4RGQA 3VR1A 2J4DA 2JLZA 4IWNA 2AOUA 1X7WA 4PIVA 2F43B 1A9XB 1OJ7A 3I1JA 2AYXA 4MKXA 2BWJA 3HADA 2HK9A 2NNWB 3WC4A 1U2PA 2OTCA 3IXMA 3ROFA 1RMTA 2HF2A 3PIRA 4B8WA 2GD6A 4GRIA 3G79A 5C35A 4P4NA 4EDFA 4PLVA 3GFQA 3IUSA 2IHYA 4X61A 4ARBA 3OURA 4P58A 4CLXA 5K0GA 1XKTA 4V02A 4BJ1A 3TEJA 1VP3A 5L4SA 1ISRA 2DPHA 2DU8A 1VP9A 2Q9BA 1W19A 3RYIB 3DDHA 1ZH6A 2VPIA 2P3LA 4TQAA 3BK7A 4TSRA 4ON9A 2ODTX 2ZRGA 4YP7A 4AROA 3KYCA 3PJRA 5EWLA 3PQ7A 1G291 4YWHA 1QIDA 1NM5A 2YX1A 3RRFA 1BMFA 2QU8A 1EUDA 1LY1A 1M6EX 2H63A 2I6GA 2WG1A 1FJHA 3BRWA 1T1IA 3KXKA 4KI0A 1USUA 1W9MA 2GARA 3T52A 1YOBA 3EFEA 5DLQC 1JMYA 1SMKA 4CKCA 4RZUA 4Z86A 1JP7A 4DM7A 4LZOA 2PVSA 1KFJB 1Z2AA 2I4RA 2VBFA 1ZO8A 1VKHA 1RQLA 3KLMX 3OWOA 5AUPB 1N32B 3EOAI 4G41A 4OJQA 1SG9A 3DCNA 3UAOA 2WDPA 4PPGA 1V1JA 5L3VA 1KR5A 4AVYA 2X0JA 2OB1A 4CE6A 2RGRA 3OQMA 5E8JA 5KC8A 4Q6BA 2BF4A 3HKEB 1UKYA 3G2IA 1D8TA 3KB2A 3MJDA 1NVKA 2VJKA 3NIBA 2FJPA 3FRIA 1TTPB 3OBBA 4D8YA 1XA3A 4PGGA 5HG0A 4AO7A 4RK4A 2F9LA 2M6SA 4M36A 5JDIA 2QSZA 2WSYB 1NMQA 3E4CA 5J2UB 1HYGA 4H35A 3ADDA 5AWFC 1RWVA 5JVDF 1UINA 3THSA 5KTNA 1ECCA 5DLPA 2C3OA 1XZHA 2ESRA 4X1KA 2GA9A 4KO3S 4BLPA 1X1SA 2V7GA 3OCJA 1T6YA 4CM6A 4ND3A 4UVHA 1U2GC 1SXQA 1OHHA 2ZSJA 2ZRIA 3GYGA 2J3DA 3CSDA 1SEVA 3HXTA 3JQPA 5ECWA 3D4BA 2AMYA 4G23A 3G8YA 2FPGB 3OZGA 5JECA 3WO0A 1JR2A 2CMGA 2Z3WA 3X1WA 4C05A 3WGKA 4MDHA 2QA5A 5EE1A 4LBZA 3JQAB 1QHNA 3L18A 3B7WA 1ZCJA 1V5FA 4HADA 1PJ3A 4OM8A 4XIFA 4Y6PA 5IT0A 4PZLA 1U2TA 3F6SA 4LMBA 4WFJA 4DV1B 3QV1A 2C96A 4BJ6A 3DOUA 3ERCA 4BEJA 2X2EA 3FPHA 1M34E 3FDIA 2Q27A 3HJTA 3LTEA 1W4BA 1GDDA 2MMGA 2Z5VA 4LJ5A 1ISSA 1ACJA 1W73A 3I72A 2R8XA 1Z0ZA 2DECA 16PKA 2AI3A 1PRYA 4EMSA 1KI1A 1OIVA 5HMMA 5IBRA 3QWIA 4E3WA 5KYTA 3NEPX 2PGOA 1F2UB 2YBDA 2ZWMA 1H1LB 4FCWA 5ALLA 5G40A 4CW7A 1DZIA 3ECSA 5I7SA 5D1NA 2CDCA 4Y2RA 2BGJA 5DBGA 1HSZA 1QJ4A 5AXCA 5THXA 3HRHA 4C0LA 3ZY6A 1CIVA 1LA2A 2YCBA 4LYGA 1SH7A 2NU7B 4OYRA 3SC4A 3CU5A 3ZU5A 2R62A 1Z8FA 1XZMA 1T4CA 4XKJA 1ECLA 1FDWA 2VTKA 2AKEA 1N4DA 1LNSA 1SZDA 2G4CA 3GBSA 2V5AA 4WE3A 3U1TA 3VM6A 3ZZTA 4AJJA 3VHRA 3NHZA 2XT6A 4LKOA 4R8KA 3W77A 1QVAA 3WK8A 3D1JA 1BX0A 2XYQA 3H1GA 2WLSA 3SBXA 1KO4A 1E9FA 1P6QA 1ZCAA 2X9NA 2QLTA 3AQIA 1I4EB 2BN4A 3M6LA 4Z0NA 4C78A 2ZS8A 3EYAA 4CCSA 3FCCA 4DIMA 3ZJUA 5GV8A 1AB5A 1RYEA 3GDGA 4DLVA 3STUA 3PUZA 5JNWA 2JGEA 4G9BA 3BD6A 3WK7A 2I8LA 3WLOA 5LOVF 2WU3A 4I3HA 5I4IA 1EB9A 3UMFA 2DUMA 1JZSA 4B6RA 4HDAA 1MB0A 1NVVR 4KYIB 1V4VA 1HE8B 3CT6A 3MCWA 4FU0A 4KQKA 1LLDA 4LNHA 4R69A 4CDMA 3HKCB 5CDGA 2Q9AA 4NX2A 2MTBA 4DCNA 4FXPA 4E5DA 5JSZB 2J0SA 2C8LA 2JRLA 4NNJA 1Y9AA 5CLHA 2GZ1A 2QN9A 5JS6A 4ZANA 2HGZA 1PLJA 4TMVA 3KR2A 3BIXA 4MJXA 1U7XA 2VKTA 3OJLA 2QYOA 2YV2A 1F1JA 1P0MA 2C4TA 3IT2A 1RE0A 4FZ3A 1L5HA 3HL4A 3SOZA 5BMVA 1SXJC 3I39X 5GJBA 4M9SA 4QGBA 1SA0B 3PKIA 1ONSA 3EA5A 4JEMA 3DXFA 2CB9A 3VKUA 1RWKA 3CN7A 1EBBA 5FL7D 1UJBA 3DE6X 4DG5A 4KWHA 4M0EA 4EX6A 3GN2A 1HKUA 1XVLA 2G7MC 3L7AA 4KQWA 3WJ7A 5CLLA 4D3FA 3JQBC 5K4GA 2ZUFA 5ALFA 4NDZA 5F7XA 4LRYA 2M32A 2OM6A 4IGKA 1WXXA 1Y81A 5LB4A 1T6NA 1MN6A 3I2GA 4TKZA 4C0XA 3QELA 3CY6A 4N7MA 5HNKA 1P19A 3NR2A 3RK4A 2V3CC 4EHBA 1HDOA 4TWAA 2ZBPA 3NT5A 4UUMA 3OCCA 3PNPA 3MLAA 1ZW6A 2XQKA 1NURA 3I28A 5BRAA 2QX7A 2VJAA 2Q0SA 4IHJF 3BMNB 4LQLA 5D6NA 4YRCA 3LW7A 3A26A 5KTPA 3P0JA 1E2IA 1ULSA 4DR1B 5HUHA 1KEKA 1IJEA 3N2IA 4L74A 3ZKWB 1QHIA 5KNBA 2FVYA 3PYLA 3AJ8A 3ZXYA 2VP0A 1DEOA 5JIBA 3UJNA 5I7UA 1KJWA 5BN5A 1FFEA 4UDYX 3TZHA 4IDOA 3FTCA 1JPNA 2FQXA 2GAIA 3RLFA 3FNHA 1E3IA 3QBJA 4E2WA 4B3BA 3FDJA 3UFXA 4DCOA 1ONBA 1E99A 3ZG6A 2OG1A 4CL0A 2IS6A 2EW1A 3MCUA 1RXIA 3OM1A 5HZGA 1F9EA 3DPIA 4QRDA 4CKBB 2OFWA 5K0FA 2RGEA 1H4VB 1MEJA 1MH1A 3E70C 4MV4A 4NU5A 4V38A 3KBBA 3VOSA 1QE0A 4AMZA 3BWEA 1RHMA 4YPOA 3DTNA 5JTUA 3KJFA 3ROPA 5HF9A 5EP1A 5K6TA 1BS9A 4V24A 2AFIE 3LLSA 1IVNA 1HNWB 3GLSA 4CEJB 1J8DA 3RFFA 4L6AA 2JH8A 4KO4S 3G7SA 2RHGB 4LC1A 1R0SA 2F6RA 2XMCA 4N03A 1DEKA 2B94A 2FEOA 2GK4A 2GBCA 1EK0A 1EFCA 2C2GA 1Z5ZA 3ZGZA 1QO0A 1V5IA 1G5TA 1A8IA 2IKQA 2QN8A 1S1CA 3E6AA 3PR2B 4E09A 2ZYUX 2QL6A 3A3YA 5CT4A 5AKGA 3CZAA 5J4YA 2XBUA 2V6FA 4M89A 4NIMA 2BM9A 2GXSA 5L4NA 1OAOA 3DV2A 1QRRA 3BGWA 4FFBB 3H19A 4FW8A 1E2GA 1Z0AA 1IY9A 2FNAA 4S1WA 3L7IA 2FB9A 2C42A 3V8MA 5JNSA 1WBDA 2VR1A 2EJCA 4MWZA 1HFWA 1OZHA 4KPYA 5B3KA 5JJCA 2QNBA 4OQNA 3VPHA 1U3DA 2QD5A 5EFZA 5L51A 3M89A 2W48A 2JHPA 1DAOA 1TZCA 4PO1A 4V0LA 2VP2A 4UUAA 2J41A 2ZROA 5AI9A 4WN3A 2OD9A 2YQ4A 1JDNA 3BGDA 4P2BA 4BFXA 1HDGO 1WZIA 3KJXA 3TINA 2IYSA 4YECA 3RSCA 4G01B 5ALYA 5AYVA 3GZTB 4AQYB 2O1XA 1CUFA 3ZUPA 1Y80A 3HXMA 3D2BA 1KGDA 3QW4B 3G9ZA 5GGYA 5AXBA 4CEHB 2CMFA 3C7TA 4ENRA 4UBNA 4ZRDA 4ZT5A 3OIYA 2B7LA 1N6IA 1Z83A 1ZWKA 3G1TA 4MVJG 2CXOA 5D84A 3HVJA 3DOCA 5ELLA 3I5MA 2H2DA 3MGKA 4EHIA 1FDRA 1XEWX 3RVNA 2UUCB 5J63A 4DAEA 4V0RA 3LOQA 1OLSB 4JUFA 2O5VA 3A6JA 4PPQA 1DJOA 5E9AA 4DBZA 5BYKA 4LG1A 1CUDA 2HA4A 4PBTA 1IN7A 2JGFA 2WT8A 4ZZ1A 2QUHA 5F9MA 1VMDA 2PM8A 3FNEA 3QM1A 5AOVA 4UEJA 5LSAA 3ZWWA 1Q14A 2BV3A 2I4LA 3DL0A 1KAMA 2P1DA 4FGUA 3E9ZA 2AOTA 1T2NA 2AFRA 3QQ5A 4RC9A 4JLKA 4YRAA 5L6LB 4C7OA 1TCAA 1O1YA 1YR1A 1PEDA 3NBMA 3DKIA 4LVCA 1F8YA 4UARA 5CK4A 5AW7A 1EUCB 2R48A 1BWPA 3CZRA 2Z58A 3C14C 1HOXA 4Y2GA 3UW3A 3RYFB 4IOMA 3PQEA 4BTEA 1OF1A 2IX9A 3IQWA 4RZIA 3GYBA 4N6OA 3ZDYB 4JVSB 1DRKA 2G0NA 4INZA 1FTWA 4YCAA 2QPLA 5CA0F 2CV1A 4RHYA 4W5HA 4U1RA 2D5CA 3RKSA 2QL7A 1YT5A 1RM4A 3PC2A 3SSOA 4AG6A 5KX5B 2JI8A 3IEIA 3EY4A 1LDNA 2BFDA 2ZSIA 3TIVA 2WWFA 2JLRA 4RULA 4IZ6A 5DJ5A 3UC5A 2ZTVA 1JDZA 2W8ZA 4NOJA 5D8DA 3LRTA 4HQ6A 1DSSG 4EUNA 3SQMA 3I6IA 2R8OA 1KQ3A 1SQ6A 3HHPA 1GL9B 3HWRA 3O8DA 1KAHA 5TE9A 5CEJA 2CNWA 1SC1A 2OHOA 1FNDA 3KJIA 3L7OA 2VHYA 5L7YA 4AJHA 2PTGA 4DJDC 4YRIA 4KITB 3OQNA 4G5XA 1APBA 3PNMA 1WBBA 2PSFA 5EJ2A 4PNZA 2XUZA 3OJCA 1RI4A 1ORVA 4ROTA 1KYXA 4IYRA 1CYDA 5AVJA 1TM7E 3GRFA 2AG6A 4LTDA 4N9QA 2YV4A 1JLLB 2BAGA 3C0KA 5D3QA 4OKSA 1CQXA 5KQGA 4IS3A 1I0LA 2IU6A 1H2RS 1NAIA 1TCCA 1Q0QA 2F59A 4MVJF 4OK5A 4OYLA 2FWIA 3GGJA 4KFSA 4CNBA 2YHAA 4ZYTA 1PT6A 3IRUA 3R6DA 2JJYA 1U8ZA 3ENQA 1W5BA 1VHJA 4UEQA 5HDQA 1UZLA 2A1TR 3H6KA 1KOFA 1NBEA 4DUGA 2XY4A 1QS0A 4G8DA 3NBFA 2HMTA 2QAGC 2I8AA 3W4KA 4FILA 1G59A 3VR4H 3G17A 1MEEA 5KB3A 5DNYB 1N2BA 1N6NA 1V48A 2DFPA 4HGQA 4HWTA 4QFCA 3RHSA 4DXDA 3RAFC 4IO1A 2G07A 1JEOA 2ACEA 2D0DA 2C58A 1Q7RA 1XZQA 1GNQA 3PE4A 4QQ8A 4TMFA 1F0NA 1P0IA 1A82A 3MSCA 4GPTA 3T9AA 5LD2B 5CX1A 5BSKA 1V9SA 3RJZA 3R5FA 2CXHA 4MA5A 4ZO7A 5REQA 3V34A 2CHEA 4XQEA 3RQSA 4X65B 2VYQA 1IB0A 3JD0A 3RT7A 3PSHA 3U6KA 5BSRA 4U7DA 2VP3A 4BATA 2XT9A 4Q4JB 5LOVA 3DLCA 4P4TA 3P97A 2WIFA 3OHPA 1W87A 2A9QA 4RKEA 1I7DA 1FFXA 3V3KA 2HLHA 3EBPA 1KBQA 2IHKA 4GGPA 5SV2A 4QUEA 2Q6VA 1ENPA 4G0OA 4GNKA 1F5SA 1VJ5A 4I4LA 5CCDA 4PZPA 3SGLA 2D5BA 2GO1A 3COYA 4GEGA 3M6WA 3VU0A 3M81A 4S05A 2XDQA 3C6BA 2X9VA 2PX5A 3WDKA 3EIEA 3CM0A 1E6KA 1HURA 4RTMA 4EGCB 5I9LA 4YQZA 4Y0AA 1LW7A 1XZLA 2WPDA 4JASB 4B40A 1EXVA 4P34A 3WNCA 3DTVB 1SUFA 4NZ9A 1EDEA 1YR3A 3U7EB 1BDBA 2XLCA 5LMCA 1DC3A 2H9AA 5CNMA 3O9VA 4LZAA 4U2FA 3TX2A 4DWVA 2UUOA 5JV5A 4L57A 2VEOA 5K99A 5LQAA 1RYHA 3A8TA 4DF3A 2JFUA 5C18A 4B3SB 2RH8A 5BOSB 2YYSA 4PRLA 4BMVA 5BN4B 1EVIA 1WX1A 2F1RA 3O4VA 1Z08A 4OHUA 3WGUA 4II7A 3SF0A 4X8MA 4Q4HB 2FSSA 1CUVA 1EGQA 1ST2A 1IJBA 1PJBA 4WEOA 2MMCA 4O29A 5MFPA 4I3FA 1OOEA 1TECE 3T7SA 1I6KA 4CLHA 1NW9B 2GF2A 5BURA 1F7VA 1NN3A 5A0TA 4AL4A 4XGNA 1X15A 4OA5A 1KAGA 1LPBB 4ZHQA 3WLRA 1L5KA 1JKFA 4ERXA 3J7TA 3LBFA 2Q5LA 4C2BA 3BB1A 5DASA 1B3RA 3PTZA 4ZAFA 1DBQA 5JXWA 5IJ0B 3F8WA 4B6FA 2BY4A 1D0IA 1DELA 4FNGA 4BGIA 5LQCA 1K9SA 4I5IA 4ARSA 3JARA 2FFQA 1WRBA 4WFIA 2M1ZA 1AIPA 4BC1A 1MO2A 2GKGA 3KPWA 2JJQA 3AR9A 3H8VA 2C20A 2CJYA 2VBCA 3R0XA 2DOKA 2P3QA 5EJEA 2CNKA 2ZG6A 1YZUA 4JVMA 4M9ZA 4RVOA 4YC7A 5IC4A 5J23A 4KR2A 5EINA 1E7QA 4KU4A 1Z0DA 2QN7A 4ND1A 1N5LA 4ZI2A 4QPNA 1N3YA 1I2AA 1GPJA 1RRMA 3OEWA 4XM2A 4V0OA 4PAQA 3GMSA 5CFRA 1JA9A 2WU1A 4F3KA 1OC4A 4WGFA 3DVAB 1DQYA 4B1FA 4DCVA 4EP1A 3GUZA 3G2HA 4KGXA 2P8JA 6LDHA 3A4IA 5KYYA 4GMXA 4E70A 1OZFA 3T7JA 4LXXA 2WQ6A 2G0AA 1HDXA 1Q0RA 1U3WA 5EIWA 5A06A 3J81k 2JKZA 1F2TA 4XVQA 4DT1A 1KKMA 4M1KA 2NADA 3AVQA 2YY6A 4GI3A 4LDNA 4XWGA 2AVDA 3RTDA 2EXXA 5EZQA 3ZNOA 1MJHA 1LLCA 1R8XA 2FW7A 4HYTA 1UBJS 4P8RA 1PJ2A 2GHIA 3FNBA 4XI9A 5B3AA 4NEQA 3X1KA 1XNHA 1BKDR 4IGFA 2O19A 3TAXA 2HJHA 1YRHA 3AR6A 2OAQ1 1JEDA 1QB8A 4M76B 1HE2A 3GEIA 1OZGA 2V7VA 3TZLA 4X41A 5AI0A 4J90A 4R7TA 3UY4A 4EO7A 2VI5A 3E9YA 4JQZA 3UATA 1RJGA 1YIAA 4DJEC 4BJ5A 2P8SA 5K8UA 5L8VA 2G72A 4B4KA 3RYCB 1Y1KE 4JCCA 1NYLA 1ORWA 4JXXA 1Z6PA 3HP7A 3HVIA 1II0A 1YJAA 4QYWA 1HYBA 5GOTA 5C8YB 4DLRA 5EPUA 2WF7A 3UWDA 1UMDA 1B8NA 5ECYA 1GG5A 2NSYA 3L49A 3O4HA 4H7HA 1YRWA 2Z2ZA 2HXGA 2B92A 2QN1A 3A25A 1URPA 4A8PA 4F2DA 2NZ2A 5C1BA 3UICA 3KIPA 3BXPA 3PEFA 1VBFA 2FHSA 3W5JA 3P52A 1A77A 1UP4A 2FSUA 5LLSA 3JWIA 3SE7A 4W99A 2ONCA 4TS9A 1DO8A 1EYZA 4ECEA 1GCGA 1UH5A 4JLWA 4GWLA 4R5HA 3E03A 3FWKA 1HLDA 3KZKA 5JXJA 2AEJA 3CWCA 2IELA 3TCKA 3TRIA 3DMTA 2XR1A 4PG4A 3EXHC 5ALQA 4M1OA 1OVGA 2P91A 1E5LA 3QPBA 2NT3A 1JAHA 1EAYA 2Z6VA 3TQFA 4BQFA 3D02A 1LXCA 1FSPA 2Y6UA 4YIHA 2A9JA 1KBZA 3E5NA 2QT0A 2VPYA 5FP0A 2X76A 1PGNA 4HSGA 2O1SA 5CBPB 4FR2A 3FWPA 1OBCA 2QGNA 4C0BA 5IT4A 2PWPA 1LTQA 3T3PB 1TD1A 1JKXA 2IU3A 1DWQA 2B5VA 5EMKA 2B30A 5ITWA 4OQLA 1MA3A 3VH4A 4KX3A 1WDLA 1TPYA 3S8EA 1O5TA 3MINA 3HYTA 4ARAA 1Z4QA 1ZK1A 4RFVA 4EF4A 3BFJA 3LNTA 1DX6A 5MN6A 3E7WA 4JJKA 2OP1A 5JARA 3SS9X 1QZZA 1C81A 3CJQA 4II3A 3BWBA 2ZP1A 3HDVA 1XEXB 4B9AA 2GAAA 4PHCA 4X20B 4M0CA 3AIOA 3E3NA 2HWXA 4GOJA 4FDVA 3ER8A 1NGSA 2OO5A 4DVJA 1CDZA 1ZAYA 3PHIA 1A9OA 1IWPB 2PGDA 3CZ9A 2BBWA 2G82A 3R0QA 3SBDA 4CFSA 2NXEA 4AXXA 3OVMA 3KT3A 2QW1A 1C8LA 3QYPA 3IIEA 1AB6A 2NVBA 5CR9A 1B14A 2IC5A 4ZVKA 1UT5A 1LBHA 2W22A 2HA5A 5LYJA 2I22A 2BKVA 2RHHA 2OGSA 5DI3A 3TEFA 5JNUA 3F3MA 4YXWA 1EUQA 2D6FA 2UXBB 4CQNA 1N78A 2CMKA 2H1FA 4QAJA 4ENTA 1T2DA 3LBIA 3CVWA 3BSFA 5DYYA 1GGVA 3Q0EA 3QBDA 1OU4A 1A1VA 4OOFA 4AN4A 4DE5A 3OLCX 4RV5A 1BS2A 5CH8A 2Q0HA 1T9BA 3C3MA 4WPGA 3RRNA 1PIWA 1PYOA 1KK2A 1SVOA 2A1UB 2H7VA 1Z2PX 4V0KA 5JCOA 4BO0A 2FYTA 4ZKDA 1N77A 1CF4A 3PUXA 2W90A 1DJLA 4RMJA 4XDZA 4YV1A 1G5PA 3ZWAA 1J2JA 2WMOB 4RENA 3ZWYA 3OFSA 3DE2X 2FKNA 4ZJZA 4FNMA 3NHSA 2O5EA 3IP5A 2EF1A 1EFRA 4EJ2A 3CZMA 3E1SA 1X1BA 2N3ZA 3TQQA 2W2NA 3UTDA 1VFPA 4J1SA 4G5RA 3HWWA 1A97A 3UPTA 4MW0A 3QXSA 4MDFA 3QG5A 1IYZA 1OX4B 2RFLA 3KWLA 1ZJ5A 2DFLA 3VR5A 4MVJA 2GNOA 4JKIA 2BFEA 3TW4A 3KOUA 1K68A 1OBOA 5SYMA 3W9SA 1KZ9A 4L6IA 1GSAA 2OHGA 3QIAA 4MP3A 4TL8A 2HPAA 2J9YB 1WDKA 3HV2A 4R5MA 3LPNA 3V48A 3KZNA 1PNTA 1PJSA 1YOVA 4W4TA 1FLDA 3NHLA 3OOYA 3GK3A 3QPDA 1QFYA 2W7TA 4TXHA 3V2GA 4ZIRB 1LRKA 3N28A 4H60A 2W2MA 3EZXA 3KG2A 4MW5A 4EG7A 5JASA 4ESEA 4QHSA 2FZCA 3GG9A 3KR1A 1VG0B 1D2RA 1JXMA 2BBSA 3WLFA 4GP6A 2PBLA 4ZVVA 3QXCA 4W8GA 1V3VA 4HVTA 1BCSA 4ZQFA 3W6OA 2BJHA 1SD1A 4TQ9A 4BHTA 3LXUX 3QEBZ 4IMJB 5LNK1 3W05A 1ESNA 2IYYA 4LUCA 5EKSA 1T4MA 5EXXA 1RYYA 4QHTA 3DYVA 3M6AA 1GZ5A 3IILA 1ZSNA 1W0CA 4O0MA 4OJNA 3SM9A 1GTRA 4C89A 3M70A 4KR7A 2SKDA 3ZXXA 1R64A 1RDFA 5TPZA 1T8WA 3RS8A 5KVCA 2RE8A 4URWR 2DHDA 2WM2A 2X7HA 4XD7A 5CJJA 1WU8A 5IHPA 2P9TA 5BORA 2GWHA 4J16A 2BRUA 2HLPA 2PUTA 3GUUA 4BZWA 3L0YA 1T9CA 4L8FA 3NKLA 5JALA 3NC4A 3B2QA 5CD1A 1T0BA 3VMMA 1AKMA 3V1MA 3RVLA 1PS8A 4WVLA 2PN1A 1S5PA 3E3MA 3WYCA 1GT6A 4CVNA 3HB4X 2D2EA 4FWTA 2CWDA 3CNEA 2WPNA 3X0DA 5J2UF 4X8LA 1K7YA 3HN2A 1KPIA 1LSUA 2PMDA 3HMKA 3NAQA 1J7KA 5EG5A 4HN4B 5HIAA 3ZE2B 5G3ZA 1U0JA 5TQ0A 2CLCX 1DC8A 2BD0A 3ESRA 5CPFA 1Q95A 2BFNA 1OXUA 1ZVJA 3M5PA 3NYWA 2QLBA 1NVAA 2PL1A 4KMRA 1Q7EA 1MOQA 1W6UA 2WUVA 2XD4A 3DHEA 3QF4A 4BX9A 4AS1A 3J7AC 5I01A 4S3MA 4L27A 1Q5PA 2GJ8A 2QQ5A 2SBTA 3HXOA 4ESVA 5BN1A 1QRTA 4XZ3A 3AHHA 1A9PA 4W5NA 5DLYA 1ARZA 2OUIA 3BERA 4K9NA 1L7MA 5FJJA 4PN7A 4JNKA 4TV8A 3IBCA 3K0AA 2ZT5A 3DGFC 1V3UA 3RC3A 3VR2A 2WUEA 3ZLBA 4BFCA 4MH0R 3U19A 2ZSBA 3AINA 3LV8A 2MSKA 3GPIA 4ZYXA 2JAQA 4Y1GA 1OYOA 4GVXA 4KN8A 2ZAYA 3HKDA 1Q17A 4ZK6A 1NXPA 3C8DA 2Y2UA 3PD1A 1XJWA 1MUUA 2GGSA 3OE1A 1SCAA 1G4UR 1JZQA 3JZFA 2VNHA 2Z5GA 3DM5A 2FFAA 3FGNA 3P5BA 3EDMA 3PYMA 4FVTA 5IUNC 3VYVA 3MCTA 5HFJA 1FJGB 1VBKA 3INNA 1SB9A 2ZM6B 2FMXA 2Q6KA 4Z4EA 2O3JA 5LU8A 1P7ZA 4DDWA 3FHLA 1NUPA 3FOEC 2V7EA 3L8FA 3ZH9B 1IEQA 1HTWA 4BNGA 5M29A 1B23P 1QKJA 4YAEA 5H82A 3TD2A 1HDCA 2HWKA 1PGOA 5HM8A 4UTOA 4EHNA 1YR7A 2BONA 1L4MA 1XALA 4AQ7A 1X9HA 4G5SA 4CXMA 2FEKA 5FWYB 1A95A 1IBSA 2EFYA 2HQ1A 2OHXA 3R3VA 4EB3A 1I4OA 2R86A 3IT1A 4UE6A 1N2EA 2ZJYA 1BQ3A 1PGPA 1UBCA 1B1AA 4PVCA 1D09A 2GB4A 3FF1A 4KWEA 2V6BA 1O58A 3WYDA 4EBBA 3R9XA 2XWJI 3KOXA 3WWOA 2EU8A 5EHNA 5BNIA 1B42A 1C1DA 1REQA 4V1CA 2CNOA 2P2YA 5FX2A 3VZBA 3OECA 1J0CA 1C29B 1WNFA 4ERNA 5TB5A 1XF1A 4R1UA 4KPEC 3N8GA 1RC0A 1JQBA 4QOGA 4O2AA 2HZ7A 3E9MA 3OU7A 4IGIA 4MI3A 1EA7A 2Z5FA 1JHXA 3H65A 3GLFA 5LZ4A 1UDCA 5DZSA 1AGNA 2BF7A 2PA0A 4YCSA 5F3DA 1G0OA 1QIHA 1RWBA 2XDYA 3LTNC 2IIPA 4IILA 3AM4A 4H0NA 4KN9S 4AZVA 4U7PB 4GXNA 4GPAA 1H5QA 4DR4B 1V26A 5JYDA 3VR5H 2G63A 4YRGA 1XEAA 5CMLA 1ZOPA 2EGHA 2HM7A 2FSGA 3AF6A 1I7QB 3AXTA 3B9BA 2WY2D 3RG2A 1EGAA 4EJSC 5I9IA 2C5FA 3TZKA 1KH1A 4B44A 2IZOA 2IGBA 4FJ1A 1BRTA 5J5AA 5CXUA 4YLEA 1RQXA 3F4KA 4D9EA 3TBFA 1DP4A 4LC0A 5CDFE 4R9SA 4Q9IA 2YVQA 2VDNB 3AEUA 2YC2C 4WESB 1UPAA 3DH0A 5GZ1A 1NG9A 1CUZA 1YDWA 5FO0A 2R6CA 5IANA 5GQSA 5FOSA 5CYFA 1SWVA 1U28A 3AGQA 3FX2A 3G49A 3JQ8B 1O95A 2R1VA 1HLPA 3H2JA 3CC8A 3C7KA 3P0RA 2HBQA 1OV4A 1Q2XA 2CXPA 3EIUA 3GJ3A 4LNUA 4KHPB 2DQ4A 3GGCA 1V1MA 1C3LA 1P8JA 2HA0A 2IIVA 1PR2A 2OXRA 3CT4A 3BBPA 3IDQA 3KZMA 3LWBA 3TCNA 5PNTA 1UWVA 3F74A 1DO0A 3D7LA 1QYDA 2AS0A 3IC5A 4JLUA 1CS4C 2P6NA 4P1ZA 2B69A 4DPLA 1CY0A 1U5BA 2QQ0A 3DMPA 4NULA 4UVGA 1OAAA 1A9YA 5H5JA 4QU0A 3DEJA 3L7DA 4GI1A 4ZTZB 1PT7A 1ADBA 1NXWA 1VJRA 2P69A 5ITSA 3LKVA 5FUBA 4B6OA 1W36B 2G1PA 2E5LB 4AXBA 2Z56A 1N5IA 3EGEA 4V0MA 4HDKA 3TLEA 1PQPA 5A1JA 3DV9A 3WGVA 1QQBA 4FONA 4PAWA 1QQTA 2UAGA 1SUEA 1GRVA 4QX6A 4ADSG 1MJGM 1NRJB 4Q66C 4D3YA 5C8ZA 1H2EA 1TUBB 4KXLA 2O0KA 5EWJA 2VIIA 2HNKA 2RHOA 4EMBA 1J20A 5JNRA 1I4TD 1FYEA 3PCXA 2IWRA 1Y4SA 2I2DA 3BREA 2P78A 3L8MA 3N07A 2TMYA 3UXMA 2NM0A 4LVUA 4TXLA 2HW8A 3M6VA 4MYHA 1AY0A 3SHTA 1M1NA 4UU8A 1V45E 1L1EA 3M0EA 4TSFA 1UPFA 5B2EA 1D6SA 3WBBA 5C0OE 1EB8A 2Z4TA 3O21A 2AFHA 4E5VA 2X3UA 3JVUA 3REFA 5KTKA 1Y42X 5JU6A 1HMPA 3AG5A 3MRXA 4KYUA 1YS9A 2QUAA 3K1AA 3LF1A 5DGCA 4JC4A 4BV9A 3RSOA 4GAEA 5LJIA 1P6UA 2O2CA 4PO9A 2ONKA 1BXRA 4XB2A 5LMNB 1HT1E 1NI4A 2VT3A 3BMQB 3KX2A 4W6QA 1FXWF 1MB9A 5JQWA 3MFYA 3S0JA 1ONPA 3GP3A 5TXGA 4EZIA 4GLLA 1U65A 1EE2A 1WQ4A 1IWOA 2QPOA 2TMKA 4HWKA 1N4AA 2JHCA 2WIAA 4TV9A 3WGQA 2XHZA 1A9XA 3WOVA 3V8BA 2XECA 1QLJA 4GI2A 1R7RA 4LW8A 2DEUA 2GRAA 2PRSA 1US8B 3ETJA 4KPGA 3ZDCA 3C48A 5ESXA 2DH6A 4MUJA 1CJSA 1E6WA 3QJ5A 3CONA 2FZ4A 1DJNA 2ZANA 3IJ5A 3LYAA 3PDUA 5AK4A 5ALGA 3VU9A 3WXMA 2R7NA 4B2LA 2ZR0A 5L7WA 2GS9A 1X13A 2PZLA 3Q85A 2VJYA 5I5EA 2FR1A 3ZDFA 1K5GA 3CSUA 1AK1A 1U7DA 2NV0A 1JMVA 1XCLA 2AUMA 1I80A 4MIYA 1YA4A 3THWB 1EIWA 4DG8A 1XTIA 3AR7A 3R44A 4CLRB 1NUQA 2KMLA 1UDBA 4RYLA 3ELYA 1W4AA 2JK1A 2O8NA 3FZEA 5IAGA 3LT5A 3F6CA 4C21A 1SAYA 3SZLA 2F3UA 2V8BA 2AOVA 4E13A 3G0BA 1HDRA 5CJPA 4OUDA 1YZKA 1Z5WA 5ITZA 2YFQA 2HSZA 1QTNA 2WBLC 3GFTA 1S02A 2JGIA 4JA2A 4QUHA 2RH4A 5JAQA 2HFJA 1AN9A 4BDTA 2IEZA 1N2GA 4OFBA 5KQSA 2W6MA 1LSSA 5MN4A 4B47A 1WCWA 5FI3A 1KQNA 4F04A 3VV3A 2YN4A 3PQFA 2AZTA 3T4XA 3L2OB 2CVPA 2J1LA 5AK5A 2APJA 1R3UA 5DM1A 4AW9A 3QHPA 3ZCSA 2V8OA 3HKEA 3A27A 1R00A 1B93A 2ZPTX 1C3XA 1DKUA 4P3OA 4KXMA 2CKDA 4TMKA 4RXMA 4UOQA 4CTKA 4UTRA 3OZIA 5FEMA 5JR3A 4DV4B 1BDIA 4Z53A 5CFOA 3L5KA 4MR7A 2OVFA 3KDPA 2QMOA 3IP8A 2OOKA 2HQBA 2Q1SA 4U7HA 5FAXA 1IZ0A 4ZREA 3LC7O 4KMOA 2VRNA 4MEBA 3OZVA 2EGGA 2OPHA 1XWWA 3T38A 3TG8A 3KCQA 1G9SA 3TZEA 3ZGVA 1BU8A 1QYCA 2HIHA 2HU5A 4H1VA 4PYRA 3KKPA 2QN6A 3B5JA 3VYRB 1FSGA 3WQSB 3IRVA 2Y1LA 4DDMA 2VAPA 5K8LA 3R6WA 1JR4A 3EF0A 5FOWA 2NT4A 4LJ7A 5EIEA 3OZSA 5KX5F 1NASA 2FPGA 3DAYA 5E0OA 1VPVA 3K7EA 2EWMA 4FC7A 3W8DA 1IXSB 2WJVA 3I4FA 3K32A 2WG2A 5LXTA 1Q1BA 4OAOA 3N8DA 1JX6A 1P0PA 5EZSA 4PYQA 2PUDA 3VH2A 3EIXA 1ZQ9A 4MYTA 5H0IA 4YACA 2ODNA 3B85A 2XCUA 3Q98A 4N5HX 1TUEA 3O0TA 3TECE 1RS0A 2ICAA 1XZNA 3PRJA 4W6ZA 1YQWA 1IBRA 3A0RB 1IXKA 1Z5NA 3FKQA 1RXUA 3H05A 4FCVA 4KTVE 5AMXA 4C9BA 2YIDA 4OQMA 4BBPA 1D6MA 1V7CA 4F1WA 3EXIB 3BHJA 1F2UA 3FVVA 1WY7A 1HWYA 4FFOA 1U8UA 3LP5A 2OFXA 3PD7A 2YXEA 2XA2A 3B53X 1VSBA 3JXEA 5CLQA 5I9NA 3MJ4A 3TW8A 1T35A 4I1RA 3UGJA 4KQ2A 1ZAKA 4KIGA 4C6SA 1L3BA 3VJRA 1QRDA 4RU1A 1VSQA 2VDQB 2NIPA 2P5YA 4MGIR 4MICA 1Q3HA 3VGJA 4CIWA 4FZRA 3K6SA 1MC5A 1Y7TA 2A59A 3HG7A 4KUEA 2JGJA 3QWFA 2OZLB 1N0WA 4OBBA 4I4TF 4D4JA 2CVZA 1XVTA 1PR1A 4WD3A 3RK0A 2ERYA 2FQQA 3GFVA 4UVIA 2XE6A 1XKQA 2HH9A 3NBAA 4UUBA 3ZGXA 5IK2D 1L9KA 1RIIA 3MWJA 2ZCUA 2LXNA 3C6QA 4TL6A 1NXOA 4LWOA 1FJXA 4TTAA 3NQ41 3QY0A 5KVVA 2WFAA 4L95C 4CUZA 1UADA 5L3QB 2VAMA 1JBKA 3C39A 4KE7A 3CW8X 3RS0A 1F12A 1ULTA 2FE4A 3B36A 3WBFA 3ZDDA 4XUDA 1CJKC 4IG4A 1V8BA 2ADFA 2JANA 2P3OA 4HQ0A 4JIGA 4K6MA 4N5DA 4PC7A 3VDNB 4EECA 1DTWA 1G41A 1NLYA 2VA8A 4QBKA 5E2IA 5KNLA 1WIWA 2C03A 3D7RA 3HSYA 4FJ2A 2VJMB 1R8JA 3E1KA 5FI5A 2II6A 4PYJA 1ZIYA 1GPKA 1QVZA 3I6ZA 1GGFA 1RAEA 2COKA 1YS2X 2YZGA 4M0FA 13PKA 4F56A 5FLXA 1BVYF 2H5LA 1TPZA 3ELUA 4K5QA 5TNXA 3U4DA 4DADA 1S8FA 5IDYA 2RK6A 1LS6A 1SUSA 2YH2A 1HDZA 1RT9A 2VOEA 1S89A 3AY3A 3H2ZA 1DADA 5I9BA 1VPTA 5CA1B 3IKTA 1YASA 4DC9A 3PJDA 3I6MA 2UYCA 2OPBA 4XH9B 3W8RA 1CY4A 1GFSA 2Q28A 4KK3A 3M2PA 3A2KA 3NOOA 3PGLA 3ZNNA 4HQLA 1KH3A 5I9SA 2PH1A 3WR5A 3P32A 2BBTA 1V16A 4BEBA 2PSJA 4BNJA 4OXYA 4HUQA 1ESCA 2JLUA 4D92A 1AQUA 2GXQA 3YASA 2OXCA 5JXGA 1LQUA 2JAWA 3H11B 4WGGA 1Z35A 3HCRA 4GBJA 1P1FA 3CUSA 3IDFA 2WIBA 3JAWB 5C53B 3H83A 3H2SA 4K6GA 1KS2A 3K09A 3WFJA 2D3TA 2I7DA 3ZWQA 1FNMA 4D8TA 1OQAA 4BV8A 1X70A 1P44A 2RHWA 1L5NA 2H1HA 3RVDA 3U60B 1PD1A 1PX2A 1RLJA 1TMOA 3L79A 1MX5A 2C78A 2ODPA 5HCNA 1PZHA 5A7FA 3NH6A 3K1TA 4OQFA 1V41E 5A02A 1EVKA 3HYRA 1T4DA 3MFQA 4LOIA 3PYXA 5K3CA 4M8SA 3KQUA 1XT6A 1E2MA 1DVRA 3B3AA 3KXLA 3ZKWA 1SK8A 2WMYA 4QNMA 3DW1X 2IUSA 2PKXA 2ZRMA 5SZHB 1YVUA 4Q9HA 4X00A 1G5IA 4GM1A 5JO9A 3VOAA 1RRVA 4H1TA 4ZXPA 4XEHA 1YF3A 1EZZA 4QC2A 3ZHXA 2C9ZA 3UTCA 4D43A 2WJHA 5CXQA 1K4YA 4MQLA 4JI8B 1N25A 1PJLA 2CY0A 1TQ8A 4BTLA 1YUBA 2FK7A 2YS6A 5FQOA 1GFIA 1V3QE 3IVCA 1N6OA 1IU9A 3G89A 1QFMA 4IJ6A 4IF4A 5FUXA 1NOIA 2QLLA 3R1IA 3UMRA 1ECFA 5KOJB 4EHKA 1JNXX 3EMVA 3L0BA 4FWBA 2E4UA 1CNEA 2QVYX 4MRAA 3JD2A 1P0CA 2E0IA 3R3JA 5CVJA 2Q1YA 2JA1A 1E4EB 3OEED 3A1SA 1FNSA 3VX4A 4BB9A 5GTDA 4R1SA 4OB6A 3HSKA 3UOGA 1ZGCA 3PXBA 4EI8A 3ASYA 1XYYA 3LP8A 1Y6GA 4O8ZA 3RJ5A 3EPKA 5KYUB 2INGX 2JFYA 2G3YA 2PRIA 3GWZA 2OCKA 4K0KB 1E18A 3RGGA 4OQEA 3H3XA 5EPOA 3PUWA 2GEDA 5EXPA 1LDBA 1OFHA 4RA6B 4DUYB 5DBIA 3AZOA 5C8YF 3EZ6A 2Y1WA 2BTEA 3T7KA 3MJSA 2XYGA 1GCOA 1PX0A 2ZRKA 1KWKA 5JZMA 3F90A 1AA6A 1JAYA 3THYA 4B3TB 1COWD 3K15A 2EZ4A 4JGIA 2BPOA 2H0AA 1N3IA 3E8XA 1ZK4A 2G71A 3D1LA 4LF5B 2M2IA 5C8DA 2HCBA 2DCMA 1YAJA 1RZ3A 4G1FA 4R2WA 3DEIA 4S24A 4D9MA 3AESA 1MDFA 3QVJA 1Z5UA 4Z4GA 5L4LA 4Q18A 4PX9A 4Z3OA 4JOSA 2HN9A 5DBHX 3HXQA 3TRFA 2HOQA 3V8RA 2ZRLA 3UJPA 3VHLB 4L0CA 1N0VC 5BV1A 1Y9JA 1Z0FA 3H1EA 4G0ZA 2O0MA 3STXA 2QMEA 2Y76A 2Y8EA 3QNWA 4MS3B 4UMFA 5BT9A 3T9BA 1LRJA 4Q7EA 4YAOA 4KH0A 5BUQA 3MTEA 2GMWA 1UWKA 2C83A 1Z4OA 1X3LA 2Q2WA 3AL0C 4NARA 1YJCA 2WZBA 2YW9A 1PJCA 2P9CA 2ST1A 2QRHA 3C3KA 4GVLA 1F8FA 2BUAA 2H5JA 2G5PA 3I23A 5F21A 3T0FA 2YN0A 3CINA 3JVEA 5CVCA 5KIAA 2RJNA 4LNAA 3OT4A 2WI8A 3L6DA 3NUZA 3VVCA 1W4CA 2WP8J 4OH1A 1ZH2A 1K1EA 3ICEA 4FI3F 3TRJA 3HRIA 2R00C 3KKOA 1XTRA 1TZJA 2J5KA 2CNDA 1XJ0A 2QQGA 1XZGA 2VK1A 4G1BA 4ID9A 1WHTB 2WFMA 5BW8A 3SQOA 1PG2A 3R5HA 3ET5A 5I5GA 4WXHA 4A2CA 4AF6A 4D0LB 5JD4A 3O2SB 1FPQA 2O3TA 2BEVB 2B83A 1C1YA 2A9PA 3OF5A 4AQDA 3DUFA 2WJZB 4CIVA 4FIZA 3SHVA 5JSHA 3EDCA 2IBTA 4PZ0A 4QU8A 1CNMA 1TTQB 1Z37A 3V4LA 2ZBRA 4UE2A 2Y1CA 5F5LA 3SN6A 1M1YB 2MYNA 3HCWA 2CT8A 4X45A 3ZOZA 4EJ6A 5GP1A 1M66A 2GZRA 1V96A 2R4QA 1W88B 4QARA 1N8KA 1OYVA 3HU5A 2QM8A 4XUGB 1IN4A 1L6IA 2R1TB 1K0UA 1E79D 1CB0A 4I6EA 4PIMA 1MXHA 3TQHA 3U4MA 2V59A 2HPHA 4B82A 2BKAA 4KSBA 2D1SA 3JR3A 2AN9A 4DCTA 1TVKB 3PJFA 2E18A 2NAFA 1BDHA 1CUUA 1WBJB 4P4SB 3V4PB 2LBPA 5KU7A 2GM9A 1J5PA 2WYWA 4ZZIA 3LHSA 4H15A 3U4CA 2I8CA 1PHRA 5JAIA 1RKQA 4ZCPA 1JLLA 3ANSA 3CLUC 4OTZA 5F1KA 2EX0A 4ZD6A 3I37X 3IHWA 1V6SA 3ZZMA 4CM5A 5CIWA 3RV3A 2PE5A 4XB1A 3HJAA 2B3TA 2DLDA 4D26A 3B6JA 1MG5A 4NQRA 3L7NA 3ELBA 4YYEA 2ZETA 5KYKA 1M76A 4I1PA 2AZ4A 2IXBA 1WDWB 1AQYA 1IUPA 4XR4A 1AGRA 2O1WA 3NJ8A 2H7CA 3BFVA 2XODA 3ZYZA 4I4TA 3M4XA 1YTLA 1OAKA 1N6LA 3GVPA 3PFCA 3QMPA 3QEKA 4S1PA 2PS3A 1D5CA 1BH2A 1HYQA 2E4VA 1VE6A 3AVPA 3DWIA 2P4UA 3DCJA 1RBZA 2XJ9A 3FMPB 4XSGA 3PIIA 4IIFA 3KT0A 4GKKB 1T1SA 2W6ID 5IWAB 1WMBA 1FMCA 3FNRA 1KERA 4GPD1 1HOTA 4QLOA 4WK4B 5A9TA 1R5BA 1LV8A 4CU2A 4RK0A 2FDRA 4YI5A 4DC1A 4ZDKA 3T3OA 1NRXA 4HTFB 1FY2A 3EJ6A 4G0UA 3C8UA 3W5SA 3PPYA 1LI4A 1DEAA 2ODAA 4GPBA 3GBPA 3H5OA 3EQ7A 3OCZA 1XYGA 2XNDD 3L77A 6Q21A 1IZ8A 4HNUA 1U90A 4JI1B 1VMKA 3NYRA 1NMSA 2RGNA 3R3UA 5K5EA 2J30A 2RI1A 4HNGA 4FMCB 3IQEA 5AHRA 2ILTA 3TUJC 1GR1A 1CR0A 3GHHA 3K8OE 3S8YA 2TS1A 4UNPA 1E3TA 5JPDA 4B3GA 3TFOA 4GECA 5HK8A 3C3CA 1CVRA 4L9SA 3QVVA 4L15A 2GYVA 1P9NA 3J80A 2IXGA 5AKJA 1S8OA 2C0QA 3QFFA 4HQKA 5AFSA 2VHTA 5FH9A 2XWSA 2P3SA 2YNMC 4EY4A 5BOSA 4PAGA 5BWNA 3IE1A 5G0VA 2PBRA 3PF8A 2DBZA 3A6EA 1MRSA 2ZYVX 3BXFA 3BZWA 3K9CA 2J3IA 1XA0A 2Y67A 3WQHA 1AZWA 5GZ3A 3ZK7A 2NO7A 2AC2A 2F1IA 3G0DA 4A6PA 5D85A 2YXPX 4XVHA 3ZGNA 2HGSA 1J70A 1OR8A 3E7DA 5F3RA 2N9UA 1USVA 1A8HA 1V8OA 5BSWA 3FOFC 1IM2A 3JWGA 5IDQA 3FSGD 1E1RA 4N18A 4IJMA 5FPSA 3RC9A 1M0EA 1VM6A 2P0AA 1H6CA 2OLEA 2QRMA 4K40A 1E2BA 4XYGA 4K9DA 3L02A 3TLBA 3T6KA 1O96A 4DXHA 1W7AA 1R5OA 3E7XA 2ZUBA 3TNYA 3R7SA 4KXUA 5IJ0A 1QQAA 1JU9A 3HPRA 4G5OA 4C0HA 4ZZ0A 1HDYA 2ZT8A 3VOBA 2A7QA 4LY9A 2EKBA 5AKLA 1E9SA 1XD9A 4DJJA 3KSMA 3GZNA 3IPCA 2Q41A 4ACBA 2ECFA 2W6CX 4ZVQA 5KJ1A 3TG2A 1Q57A 3A3NA 2DAPA 4MV9A 4WZBA 3V6LA 3PT9A 4B35A 2QXYA 1UFQA 3P9SA 4OHMA 4M1EA 1JEJA 3S2SA 5DHPA 1JEQB 3NFYA 4O4HA 1NDQA 2AJ8A 2VT7A 2WAYA 3B82A 3O6VA 1L8AA 4UBMA 4G81A 1JWLA 4KIFA 1SVLA 1D6NA 3C6KA 2IP1A 3U4AA 3GJRA 2X9QA 2C9BA 1GU1A 3DLIA 1L5QA 3HY6A 3NYIA 2Q9CA 3KKQA 2H59A 1F48A 4ZDIA 4X90A 1I9CA 1THGA 1NDHA 4JBYA 1AKRA 3WMWA 1KMCA 2DMRA 1U80A 4JI4B 3FOAA 1TT5B 3A9CA 4FHDA 1PR4A 2OVBA 4YRTA 5LBTA 4RJLA 3W7BA 4FQ8A 2R8RA 5FR1A 1FMTA 2X13A 3DS8A 2XYHA 4Z49A 4HGPA 4B9EA 4BAZA 3NTRA 1KVQA 3STTA 1JIIA 2YWCA 4ND7A 1P2UA 4OREX 4PN3A 1EX1A 1YI1A 3DT6A 1QDEA 1QBKC 4KLRA 5C5DA 5JZBA 3WGHA 4DL9A 1QO9A 1VLLA 4FX2A 1UIMA 2FWMX 5JC1A 5JMOA 4RPLA 4GOXA 5F52A 5DNWA 4KXQA 3EAGA 1MB3A 4B17A 4BTVA 4CMKA 5CU7A 2I3ZA 3K9FC 3F96A 1EXDA 1NJ8A 3RYCA 5AXDA 1GXSA 4FE4A 1UBTS 1ZVMA 2HSJA 1O6GA 1ATZA 1CZHA 4YQYA 2WYIA 3MWLA 3VDMA 1DUVG 3W9UA 2QVXX 2Q4RA 5D2CA 3K0SA 3QNMA 2V7BA 4CI9A 1NWCA 1XHLA 2P65A 4RW0A 5BR4A 1X92A 2H4WA 1N3BA 3KU4A 1VFNA 2WF6A 2G8NA 3G5MA 3T54A 4JKOA 3RTCA 3MOGA 3MWEA 1YE8A 2PWZA 2WJPA 3V80A 5C5EA 1VLJA 5K2OA 4LIPD 4AMBA 4B3DA 1SVUA 3QKSB 1OY1A 1QIFA 4YMUA 4I19A 4MWDA 4ZV9A 2WWRA 4GDFA 1MO6A 1CUXA 2ZLBA 3HR7A 1R4MA 4UMDA 4JH0A 5DOZA 4CV0A 4YPVA 1PS0A 1FOEB 2IYOA 4FD2A 5A5VA 3CKYA 2Q2OA 3FVRA 2OZVA 3KTAA 2PA3A 3TI7A 2LZ0A 2A0XA 3GFGA 1O54A 1Q1ZA 3ZQ4A 1SKMA 5C5IA 3QBEA 4MUHA 3OQOA 4KDFA 3FCUB 3U4IA 4E4YA 1DXOA 1NC1A 2HQRA 3EG9A 2FRXA 1HNNA 2B1JA 3LQKA 5LC1A 5TV2A 5C4MA 3PPVA 2UVQA 2ZCJA 2BEWA 1P31A 1DKMA 2YYYA 1WSAA 2IEBA 2WTXA 3PNVA 4M4SA 4QO7A 3W6UA 4F9EA 2IIBA 4GOND 1Z63A 2ZZKA 3ND9A 2GJSA 4EATA 5BVGB 4RTPA 1U9IA 4QUIA 2ZBDA 1TQ4A 3WGLA 3OMLA 5DT2A 4M1TA 3C3DA 4GL4A 4PG8A 1BHQ1 1YB7A 2OV2A 1E2PA 5JCZA 1VI2A 2BDUA 3KYIB 3EEFA 1P7WA 3AR4A 3FYDA 3ISJA 3OZTA 1Y3AA 4I5EA 1EPUA 3DBRB 4HAYA 4MW9A 4P84A 4W7SA 3RE1A 1H1DA 2VSQA 4NECA 3HI6A 3MD0A 4CQLA 4ETNA 2IEYA 4K28A 3IHLA 5C31A 3M33A 3FKSD 1W36C 1G8MA 2AHOA 1ZGJA 5HIMA 1XRRA 2AVNA 2ORYA 2OGUA 3OPYA 5JDIC 1LPPA 1T9GS 4GGOA 1KVUA 2QL5A 5ERGB 3RVMA 2WHXA 2XA1A 3ACBA 3ZBQA 3QEMB 1EXWA 1PZMA 4YMSA 4AS2A 3UMJA 3EMBA 3RREA 5DTJA 3LYHA 2QUIA 4IDFA 4BVJA 2SCUA 4DZRA 3QI7A 4YJ2B 4H31A 4U2GA 3ZD8A 4UAGA 3WFZA 4LF8B 2UXCB 1MR3F 4YCCA 1N5KA 1F4PA 4IZIA 2G9ZA 1D7AA 1N5DA 2JRCA 1XL1A 3IQGX 3JQRA 3PENA 5CB4B 2JFQA 4CMJA 3KQKA 1F5NA 4RVNA 4AT1A 4CCYA 3K2BA 3ST7A 2Z2JA 4KXVA 1XQ6A 3W0LB 1M0TA 4MWTA 2WM8A 2ZBEA 2AWOA 4MLCA 3WISA 5IH3A 2ZI4A 1Z88A 4DM4A 1IJFA 2KB0A 4M54A 4JUIA 3W9YA 4LZJA 4U2EA 3DSRA 4CG3A 2F3TA 3AW8A 3MIIA 1BROA 4FBLA 4WDRA 5ALVA 4EAQA 4Y9UA 3CUEF 4PQGA 3MZ0A 3TNFA 1K5PA 2QUJA 2XZDA 5IYZA 3CE6A 4U7FA 5AM0A 1Y37A 3L84A 1I24A 3ECCA 5JJBA 2Q4DA 2ZS7A 2QSJA 1W2HA 3M1AA 1AE1A 4WJKB 3L7BA 2HXSA 4GICA 4RM2A 4XAQA 3NJ4A 3U7IA 4ZTBA 2BSQA 3NHYA 4ZFNA 1D9ZA 2XVXA 2H54A 2BLLA 3SC6A 1OX4A 4AFNA 4BFUA 1SD2A 5B3LA 5H3LA 4OU4A 1NATA 1YQXA 3HJNA 2C61A 2CHUA 4WQMA 4BZPA 4YV2A 1X7GA 1BWRA 1QGUA 1WDTA 4IKOA 3PL1A 4AY3A 3PDHA 2W71A 4N4AA 1KZ6A 1TK2A 2CHFA 2C57A 2BMDA 3HO8A 2CLDX 2DLNA 4HEHA 1Q0PA 4ZIRA 2YWRA 4LV8B 5HQ3B 1J8YF 3KQHA 3VNBA 1WCIA 2GZ3A 2QJTA 3BL5A 2OG2A 4KVGA 4UMEA 1V43A 3PDCA 4FT4A 3WGGA 4MOWA 4CM9A 5J4VA 1K3TA 1J0BA 1XXLA 2C9DA 3AHGA 3OJEA 4L4ZA 1CF9A 1X8KA 1NVUQ 3FYUB 4L0DA 3QJGA 4R1MA 1DC4A 1OGYA 4HYYA 3ROZA 2Q8PA 1K6XA 3LLCA 1UFOA 4CR7A 4DMFA 3LUAA 3D2AA 1ZR2A 3COVA 4P80A 1OC2A 2R6DA 3DYIA 1U7OA 3EPRA 4YJKA 1ZC3A 4PLPA 1OBHA 1X1QA 4EYEA 4BLUA 4RMHA 4KQHA 5ICGA 3A4NA 5KNDD 3D5QA 4RKFA 1CEQA 2WE8A 3V4SA 4EJMA 3AP2A 5AM4A 3D3WA 4AU1A 1AHPA 3AVYA 4GR9A 2ZXUA 1G66A 4TQUS 3C5CA 4MMYB 5DM0A 2ZM5A 3EK2A 4MI6A 1G2IA 5I48A 1QHYA 3PXCX 1G6OA 1YJ5A 3KEMA 2QTHA 1FS6A 1UEJA 2FZVA 1XD2B 2PL3A 4LHZA 4Y7DA 3VFDA 4F9FA 5TIIA 3N2ZB 2JEZA 3PQ2A 4HD8A 5JISA 4HHEA 3U39A 4L7QA 1KEEB 1PDWA 2QYHA 4RO0A 4QOEA 2WIGA 1U94A 1DT5A 1ENYA 1Q19A 2JI9A 4YDSA 5LP6A 3H4VA 2NACA 3GEGA 3LL7A 4EW2A 3ASZA 1E3WB 3A9RA 2PL9A 1N2CB 1YK1A 4N49A 4CF6A 2FR0A 2QX9A 4Q47A 3OQIA 5CK5A 2NUTA 4E5MA 4LYEA 1PV2A 1R6VA 1XXHB 4YRDA 1AJEA 3O84A 2DTEA 1F3OA 2GYYA 3G8BA 1KFBB 3VSAA 1PEKE 3LY5A 1U7HA 1W4LA 4B85A 3LY9A 2HHHB 2VLIA 2VHUA 3M6MD 5B58T 4EA8A 2FUG6 1DAGA 4B6JA 3G8CA 3LCJA 1TO1E 3W3AH 3AM3A 3MUNA 1PUIA 4PQEA 5HWSA 4I5GA 3SLRA 4C6TA 4R6WA 3TSCA 1YJQA 4D4KA 3GLGA 3LCUA 3TOXA 1KKUA 1ZZGA 5E7QA 5J47A 3I2HA 3PP8A 1TL7C 1H66A 3W6NA 4M0PA 4TYNA 3WTBA 3BQNB 3DYBA 3RVPA 4FYMA 4GQIA 3TPZA 4BNUA 5B7QA 4IIJA 3UCFA 4NEGA 1JQAA 1ZD4A 2GN1A 2Z2YA 1T5IA 3BCRA 3GFPA 4K6HA 3IBFA 3IR7A 5DHUA 5P21A 1IN6A 1U31A 1DDIA 2B61A 4HLQB 4FHFA 5CT5A 1JIQA 4QXAA 4M6WA 4YRRA 5KWEA 2ZULA 3PPWA 1YDGA 1E5QA 2E37A 4U00A 4O1IA 1J2EA 5CGQB 3E1GA 1RE1A 3KOYA 2FI1A 3GLHB 1B0ZA 3KVNA 1QVVA 4RACA 4XYLA 3A10A 4S1NA 3DHNA 2CD9A 3K1ZA 1SVWA 1H0KA 4D5GA 1F4LA 5BUSA 1DAMA 2D7DA 1HA3A 5F1YA 1BOFA 4ITUA 4RPJA 3DDWA 1VKJA 3Q3GE 2NXNA 2V3VA 3CH7A 4Z0HO 5FOVA 3RBZA 3NWEA 4QVGA 3ORRA 1J06A 4IIEA 2BKXA 3PF9A 4DHEA 3F73A 1K2WA 3COZA 2I91A 5ALHA 5A5DA 2F90A 2Z8ZA 3HNOA 3O93A 4R81A 3KQTA 4FS3A 4ZOLA 5A3JA 1PGQA 3ZWVA 1EUZA 4WACA 5IFKA 3UGKA 2YV5A 2XB6A 4HDCA 1O8BA 1U8CB 2QZPA 4G56A 4IDNA 3ILHA 1QH0A 4F3RA 3Q1LA 4ZDJA 2JGKA 5ALMA 4QWWA 4IJUA 3CMCO 2RK4A 3H1PA 4RQTA 2B35A 2LD4A 3ER9A 4BAUA 1JYSA 1VSTA 3VU3A 3F71A 3DNMA 1ORTA 1QMGA 3G6WA 3W6ZA 4C22A 1OH8A 1JSCA 2QRLA 5CA1F 4P0PB 3NUGA 1WCYA 4PXYA 2I55A 2ZYHA 5DSXA 2D1FA 3U3ZA 1VHTA 1XLUA 3EDYA 4ECAA 2XMRA 4XEUA 1PI3A 1XMVA 3QTTA 4RY8A 3NMUF 5L3SA 1L4BA 4QM6A 1QX3A 1IH8A 4GE3A 3B51X 1UKVY 3ZLTA 1ZSVA 2HHJA 3NP9A 1ZI6A 1SZCA 4HLCA 3LBYA 1XQYA 1RSZA 3VBEA 2QN2A 4KSCA 4L5BA 2YOHA 4NBSA 2Q3EA 1H0HA 4P7FA 2IQIA 2R44A 4L9AA 4RIHA 1J23A 1K75A 3JQ8A 1P77A 1GNTA 1RI5A 3ICPA 1SU8A 2IE0A 1DBWA 5A6VA 2D00A 5EIBC 5K8JB 3ENVA 4RDIA 3G1UA 3GNQA 1M67A 3MWDB 2PWBA 3BWCA 4F4UA 1WPXA 2NSJA 2HZBA 4H4EA 3B78A 4NS1A 5A9SA 2RGDA 4D42A 1NYQA 2C4NA 2YJZA 3CVVA 4IXTA 3QKRA 2CHGA 3FUVA 4FDAA 1FTGA 3WHIA 3P9XA 4Z8XA 2X7XA 2WQZA 1X9IA 5DNEA 3STHA 4B0PA 4ZZ3A 1NP7A 4IJVA 2KSQA 3I05A 2WFLA 2QLNA 3WDSA 4U9HS 5TY0A 3JWPA 3DDNA 1IHOA 2Q99A 2DX7A 2I3AA 2I7TA 2XEDA 3CJTA 1PFVA 2GEFA 1C9EA 3LUHA 4R9NA 4U5XA 1C7EA 1LKZA 3GZ4A 3PXDA 2FPRA 3O38A 4DB4A 4N6NA 4BP8A 2Q07A 5CW1A 4Q3NA 1TUBA 3R23A 3JQ7B 1WPQA 1UXKA 1P3DA 4RPIA 4R8MA 2FP3A 3UA3A 1Z9BA 1Z4NA 4C4TA 2HK6A 1XRMA 3PA6A 3B52X 4OAQA 1J2YA 4Y2VA 3V9AA 5K3AA 3U4QB 3ABQB 4HRAA 2FVXA 1T9DA 4PC6A 1XVUA 2CMDA 3V6MA 1GPAA 2UUBB 3T1NA 3W5CA 1E94E 1P5HA 3RVOA 1LZKA 3VX3A 4YB8A 4ARZA 1F17A 1KTVA 3KUUA 3ND5A 2ZAMA 2I4OA 1FBTA 2XE4A 2B8EA 1R9JA 1XCBA 2VO1A 2YWBA 1N0IA 3K1JA 2QPTA 2VUIB 4MUGA 4GSLA 9ATCA 2B82A 4W9NA 3OQBA 1KI7A 5T3YA 1ZVVA 4OMFG 4LFCB 3EWIA 5FB3A 1EKXA 1W5EA 1GGKA 3P27A 2PO7A 1JFRA 3W7AA 1D6JA 1P6XA 3UMBA 1KQPA 1C8BA 1RM5A 1JIKA 1I2BA 4N5LA 2VRWA 3K35A 3CG0A 2J67A 2JBAA 4M0UA 3Q8WA 2BMFA 1RWOA 4XA8A 1FP2A 3FW1A 1R37A 4HNRA 4CV3A 4EG8A 1US8A 3AP3A 3FF4A 1VMAA 4RPHA 4DNQA 4MVJE 2ZRQA 1OTYA 2GDZA 2W98A 3UJ3X 1P39A 1LPAB 3VO2A 1DAFA 4BNMA 4XWKA 3IL2A 3MGGA 3ZY5A 1RJFA 1Y8AA 3AOGA 4AKEA 2G9UA 1OYWA 1EFUA 1R6UA 1LJUA 2FY8A 3RG8A 1ZITA 4IL5A 3AERA 4LGCA 5J2TB 2Q3DA 1JF8A 5DT9A 1EM8B 2EBUA 1LF0A 1UBUS 4DCJA 4P83A 1TB4A 3RSSA 4RV9A 3ZD7A 1N9KA 4XPZA 4F5EA 4MV5A 3G6KA 1YUNA 2J3EA 3QYFA 3R6GA 1YBAA 3RO7A 3ZDXB 1G3IA 2HA2A 3D8BA 3KNZA 4GLBA