2FMFA

Crystal structure of chey in complex with chez 200-214 solved from a f432 crystal grown in hepes (ph 7.5)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fmfA00
2FMIA 3O1IC 4CBVA 4MS4A 9ABPA 7ABPA 4Q6BA 4ZMRA 4KQ9A 3LMKA 2E4VA 1DBWA 4RS3A 1DRJA 2R4QA 1ZY2A 3GV0A 5IC5A 3K4HA 2R47A 4EVSA 5F64A 5IX8A 3HS3A 4O1HA 4F12A 1RNLA 1YMUA 2FMFA 1XWWA 3CRNA 2BGGA 1A04A 4EGSA 3A3KA 2VUIB 5EWMA 2VYCA 1RZRD 4LX8A 2RJNA 4QPJC 3LUJA 3EDCA 3LUGA 4L85A 2QZJA 1TVMA 1BDJA 4NCBA 1QO0A 1BAPA 3IP7A 3QEKA 2J48A 2LBPA 3MYYA 1MB3A 4MR7A 2F8TA 5TQ2B 3O1JC 4JASB 1GUBA 3QX8A 3C6QA 4RK5A 1RXEA 4EYGA 4W5RA 5BRJA 1K66A 1M5UA 1GCGA 3I09A 3LUHA 1W25A 4RDCA 2HQOA 2FEWB 2FN8A 1GCAA 2PJUA 3H5WA 4RXMA 5CNKA 2N9UA 4JA2A 3JVIA 6CHYA 4Z4FA 4EUKA 1P2FA 4LDZA 2NZVG 3HXMA 4YWHA 4B09A 3VNAA 1EWKA 4RK4A 5FWYA 3HVRA 1JFTA 4YS6A 3P9YA 1DCMA 3UK0A 3OMXA 3HUUA 3ROFA 2PUBA 3F6PA 1D1PA 1JF8A 3T95A 2VK2A 4GPAA 2FKAA 3DLHA 2Q5CA 4KFCA 3HO1A 1Z2DA 1APBA 2E4UA 3DGFC 1S8NA 4TLLB 3GT7A 4FB4A 2FQWA 4W5NA 4W5OA 2R48A 3IP6A 3SAJA 4YR7A 1TLFA 4MGEA 2ID9A 3OM0A 5T3YA 5KWSA 2MYTA 4MR8A 3D8UA 2IKSA 4IMJB 1P6QA 1ABFA 5DKFA 2P9HA 3I42A 3QELA 2M1ZA 4Q6WA 2A9PA 3QLUC 4UHJA 1SXHA 1DJMA 3UKJA 1JWLA 3JPYA 4MS3A 5CNMA 4EYQA 1ZVVA 1CYEA 2QVCA 4KQCA 3W9SA 3FDFA 2JB9A 4KV7A 1TMYA 1JBEA 1YMVA 2KYRA 1YTUA 3H5LA 4MPTA 4IILA 3NHMA 3OLXA 1YS7A 4MQEA 1JH9A 2PUDA 5IULC 1ZESA 4M88A 4G97A 4Z9BA 4LRQA 2RJOA 3KKEA 1NXTA 4LE1A 1RZRA 4JB0A 1JYEA 4MR9A 3RVMA 1KMIY 5KQGA 1L5YA 1DBQA 1IIBA 2FXIA 2WY2D 3T6KA 5DGCA 1QQAA 3BREA 4IMIB 2QU7A 1GUDA 2FSPA 2A9OA 3OM1A 1DBPA 1ZITA 3RVNA 4ETMA 5JNSA 4W5TA 4WXEA 3LKVA 2QVGA 3D02A 2L2QA 5TE9A 3RVJA 1USKA 4ETNA 3A0RB 2FTKE 4RK0A 3SY8A 2AYXA 4RKRA 1QQBA 2ZAYA 1SXGA 3EAFA 4RSMA 5KQMA 1ZDMA 5CNJA 4E7OA 3GL9A 5HM6A 1VLZA 2HJ9A 3QLVC 3RVKA 5HSGA 4XAQA 4D6YA 2FVYA 2WMYA 4D6XA 5IUNC 4FE7A 3NNNA 4HNSA 5ED4A 2JK1A 2YHBA 3FFTA 3EQ2A 5EWLA 1ISRA 3JS5A 4XLTA 3ILYA 3RVSA 4OLBA 4XXHA 3FMVA 1NXWA 3Q41A 4G0XA 2JVKA 1T34A 4E7PA 2IPNA 4W5QA 1Z2EA 4DADA 2FLWA 3C3WA 4HNRA 4PYRA 3LUDA 1B00A 4QYWA 3BILA 4MQEB 3KSMA 4ML3A 3EULA 4N41A 2QV0A 3KCNA 1ZGZA 1URPA 4PE5B 1F4VA 3JTEA 3LUFA 3UUGA 5JNRA 5TQ0A 1U0SY 2OENG 4N47A 3RVQA 4KRFA 4KK4A 3BBLA 3CG0A 4YLEA 1H9CA 4MQFA 1NTRA 4N76A 4EVRA 1OXKB 4RK1A 1J56A 4ZPJA 1PNTA 3LUAA 5IEBA 5IUKC 5JNUA 4Z4IA 1YS6A 4O1IA 1ZGGA 4XARA 2PUAA 1RXIA 1U2QA 5CHYA 3O2SB 3QK7A 1JX6A 3MQ4A 2CWDA 3DLBA 5DCLA 1MIHA 4PICA 2QW1A 2JRLA 2WWVD 4JAVC 4F3TA 1QP0A 4F06A 5KC8A 4YCSA 4MLDA 4RY8A 2PUCA 3QEMA 2V0NA 1DZ3A 3SG0A 3E61A 5JS1A 4JOQA 5TPWB 3HDVA 3HDGA 3KTOA 1K68A 2A9RA 2B1JA 2FN9A 4P98A 1DP4A 3KJXA 5DTEA 3IDOA 2PKXA 3GRCA 4OG2A 2H0AA 4ZJPA 3ROTA 1Y1LA 3G1WA 2MYUA 5HQJA 4H3KB 2PAFA 2PE5A 2FEPA 4Z4EA 3HUTA 1JHZA 2TMYA 3C3MA 4JP1A 1JFVA 3LKBA 1VRVA 5GQSA 3H5TA 3IPCA 5KI6A 4MS4B 4RY0A 1PEAA 2NT4A 2PLNA 1P6UA 2LUOA 3LUCA 1PHRA 2LIVA 2LP4Y 2YHAA 4MS1A 1KRXA 4OLAA 3T8YA 5JNTA 2JCGA 3TMYA 5JNVA 4TMYA 1YK1A 1BVHA 2FQXA 1M2FA 1QPZA 5PNTA 1JLKA 2WJWA 3KHTA 2GX6A 5EWJA 4G0OA 5EWMB 1D1QA 4H3HB 4MQFB 5B3JA 4ZMSA 3GBPA 3DGEC 3TX6A 2M98A 3CZ5A 3HV2A 3MMNA 1Z12A 4JB2A 2QR3A 3Q7RA 2PUEA 2GBPA 3MM4A 4MR7B 4GNRA 3CHYA 3MA0A 1R8JA 4IF4A 4D74A 3G85A 3HJFA 1D4ZA 4ETIA 3M9WA 1QKKA 1Z13A 3O2QB 3N75A 4RK6A 4RU1A 1DCFA 3Q7TA 4OBBA 5FBHA 3E3MA 2QXYA 3A0UA 1BDIA 1Z18A 4DN6A 4N03A 1U8TA 1CHNA 1VKRA 3CU5A 3GA5A 4KVFA 4RY9A 3TO5A 1ISSA 3CKMA 1YK0A 4HYEA 3EODA 3GBVA 4YP9A 1KRWA 4S04A 5IUJC 4EYOA 5FWYB 5I4CA 1DC7A 2CHFA 3KS9A 2E4XA 1LK0A 3O1HB 2IPAB 5TPZD 1NATA 3H1EA 3L6UA 5IBQA 3RVPA 1EAYA 1FFSA 2FW0A 1U04A 4NV3A 3OQOA 1USIA 3IPAA 1YIOA 1NY5A 2WJAA 3GYBA 5HKOA 5FWXA 4MS1B 3BRSA 4RXUA 2MSWA 2E4WA 1EHCA 2RGYA 3DZDA 3LOPA 1NXSA 4WWHA 2JBAA 4MR8B 1XHEA 1UDRA 2FMHA 5FBKA 2B4AA 8ABPA 1NXXA 2L17A 2HSGA 3QELB 5TQ2A 3F7NA 5E3JA 1Z15A 3KYJB 4KK3A 4MS3B 1PUXA 3I45A 1Z16A 3CFYA 2A9QA 3OLVA 2LPMA 3C3KA 4G86A 1E2BA 3H75A 2HQBA 2I6FA 1PEYA 1QP4A 4RV5A 3OO0A 1D5WA 2P4UA 4MYRA 5BQ3A 1ABEA 1E6MA 1FFGA 3OQMA 4QYMA 1LBIA 4F11A 3A10A 2IOYA 2MSLA 4WT7A 3HM9A 1FSPA 2E4YA 1ZN2A 5ABPA 3FGZA 4RZSA 5KQPA 2WRZA 3N6VA 4WXMA 4MR9B 3SNKA 4IGAA 3JVDA 4LZLA 2HPHA 1C4WA 3M6MD 4G0ZA 5JS2A 3NNSA 1L5ZA 1HEYA 5TQJA 3K9CA 1NXVA 5IEJA 4G0PA 2CD7A 4MRMA 2H3HA 2ID7A 3OO1A 1A0OA 3O75A 2JVJA 4LE0A 3OQNA 2PMCA 2MSKA 1SD5A 4H60A 4Z4CA 3QLVA 5BRAA 3FFXA 1EWTA 1USGA 3H5OA 4KZKA 4RXTA 1Z26A 3ILHA 4O5AA 1LBHA 5FWXB 3N0WA 3O2JA 1SRRA 4Q7EA 2GI4A 3MIZA 2PUGA 3B2NA 4YRZA 4KMRA 4DQDA 3RVLA 3L49A 2OQRA 2VUHB 2JBAB 3HSYA 3IP9A 3KG2A 3H6HA 2RDMA 3R0JA 3O74A 4OATA 4UHKA 1AB5A 2GWRA 4Y9TA 2MYPA 2WB4A 5B3JC 5EWLB 4N0QA 3Q7SA 4G0QA 5TPZA 4P1ZA 3OLYA 2IPMA 1I3CA 1BDHA 3LFTA 1F51E 1RPJA 3CZCA 1FFWA 2L19A 4RK7A 3DBIA 4TLMB 3CNBA 1PNRA 3CS3A 1DG9A 5BR1A 1NXPA 3IP5A 3CG4A 1CEYA 3Q9SA 1JL3A 2HQRA 4YV7A 4L4UA 4RKQA 4PEVA 2IDMA 4Z0NA 1QP7A 3T38A 4YGXB 4TN5A 4MAAA 1XHFA 4S05A 3N0XA 5TQ0B 3HCWA 3SQNA 3VNBA 5T7BA 3RVOA 3F73A 3QLTA 2FLKA 2NT3A 3KYIB 2CHEA 4XASA 1ZHHA 3N53A 4KREA 1E6KA 4OTZA 3JPWA 5DLEA 3H5IA 3JY6A 1ZH2A 1MAVA 3H1FA 4MRMB 1DCKA 2L18A 3NBMA 4G0MA 1EWVA 1D2AA 5KQLA 6ABPA 1LJLA 1KGSA 4NQRA 1LJUA 5C5EA 4Z9AA 2FMKA 1E6LA 2PL9A 3C97A 4EYKA 3EJWA 3OLWA 3QEMB 1MVOA 3QX9A 1NXOA 1W9HA 1SXIA 4IRXA 1GLGA 3F6CA 3FFWA 1M2EA 4MLCA 2W42A 2NUBA 3CTPA 3KLNA 2E4ZA 3BRQA 3H5VA 3HK2A 3EGCA 3KLOA 5JNWA 1DC8A 3N8IA 1MB0A 3I5AA 4N0PA 4Z99A 2NZUG 3EQZA 3HZHA 4HNQA 5KC9A 3O21A 5CNIA 1QO0D 3TB6A 1QMPA 2PL1A 3OLZA 1JDNA 2AYZA 3M9XA 1OXBB 4NICA 4WUTA 2R25B 4Z4GA 4ZYLA 3URMA 5D2CA 1WETA 1DRKA 4LDAA 3TD9A 1YVUA 1C0EA 4FE4A 4WZZA 4XFKA 4NCAA 1JYFA 1P8AA 1Z17A 4EVQA 4YO7A 1JDPA 3OMWA 4LE2A 2DRIA 2IYNA 3RQIA 3CLKA 3QLUA 2PUFA 1A2OA 5EWJB 4RWEA 1FQWA 1ZH4A 3MF4A 2O20A 3H6GA 4KNYA 3RH0A 2FEKA 3NNDA 2GKGA 2IPLA 1M5TA 3Q15C 2ZWMA 4KPYA 2MYNA 5C5CA 4Z4HA 1QNLA 3LUKA 3N0RA 2XDYA 1BA2A 2F8SA 3RVRA 4G0YA 1U2PA 2X7XA 1EFAA 5TPWA 3S99A 2JVIA 1JFSA 1TJYA 5GOTA 3GWGA 3SM9A 1VPWA 4F8JA 1ZAYA 3H1GA 1Z25A 1TM2A 3NHZA 2FQYA 1AB6A 2QSJA 4EY3A 4PZ0A 3LTEA 4QICA 3HEBA
chains in the Genus database with same CATH superfamily
4CBVA 2F62A 2X2EA 3M5DA 3OC6A 4KQFA 2VA9A 3B3FA 3I28A 2H9AA 3O8OB 1SFRA 1NV8A 2QLFA 3IT3A 3QPDA 4KQ9A 4LBZA 4YJDA 1MC5A 2N42A 2OBLA 5CFRA 4J1SA 5BYBA 1U6IA 3K4HA 4FDVA 1PKEA 2X2FA 1YMUA 1NR5A 4DLBA 5HUJA 2OPBA 5LQRA 3FWPA 1V7QA 1K8XB 1CTQA 5BT9A 1KAEA 4UUQA 4LYFA 1H6CA 1L8XA 3EZGA 4HSEA 2VNKA 4OA8A 3SZLA 4F72A 4F1KA 3HGQA 4XIFA 1RZRD 3V4RA 4YRSA 1J7JA 3SSOA 4WJLA 3TQTA 5K8LA 1H05A 4C0AC 2BFFB 1TECE 3EYAA 4IX9A 3QEKA 1CS4C 1WR8A 2J48A 3H1AA 3QBDA 4C22A 4AI6A 1AN0A 1F2DA 2AN9A 4QDJA 2CNWA 3GT0A 2W5UA 1XVVA 4ZJYA 1P18A 4GS5A 3UBTA 4F3KA 3VNUA 3KEGA 3PC8A 1C7IA 4FGJA 4PF1A 2ZOSA 1U0JA 2H8KA 1AKNA 4HNHA 3EVNA 4C2AA 3IB3A 1JQJC 2GEUA 3LPAA 5CAEA 3D8NA 1NNI1 4FQ5A 2JLXA 1UMBA 1TUIA 1J9GA 1SC3A 3PXDA 3H4IA 5IN4A 3DDZX 3AHCA 2V7XA 3DPUA 4L5CA 1KO8A 3A2LA 2F1IA 4B09A 3BF7A 1MR3F 4FBMA 2VHQA 1EWKA 2P2YA 2UUBB 3R0IA 5A02A 4XWKA 2M1XA 1V4NA 2OAP1 5JSUA 2PLAA 4QREA 4JZYA 4WH0A 1QVRA 2W2PA 1NBOA 5EJMA 2BL4A 4BRUA 2QYTA 2D3TA 1FXWA 3K8YA 3W3AD 4MTLA 4C7VA 1W36B 5CBPB 1RD4A 4B6FA 3Q1KA 2YWGA 4XB2A 4JSRA 1UPTA 1WU7A 3A14A 4XUDA 5JALA 4RO0A 1TM4E 2HGZA 2C03A 3GT7A 4R2LA 3ZHXA 5BMVF 5LP1A 1FNMA 3SAJA 1A76A 1YDWA 4HZIA 1OLXB 2C82A 3DDUA 1EK1A 1CKEA 1RTKA 1U3UA 3ZX4A 4MR8A 4RPLA 1CUCA 5GZ3A 5K3BA 5JY1A 1XZPA 2WP8J 3K0HA 1SOVA 1UMCB 4TS1A 3WWOA 1IOWA 1G4UR 3LQRA 2J0QA 4LSGA 5B12A 1DBIA 2R68A 3FPCA 3X1KA 4OK3A 3H11B 1AUQA 3EPRA 1J5PA 1OJ7A 3KOYA 1Z3CA 4ALKA 2CYAA 3IEVA 1Q21A 4NESA 3LBYA 1U8UA 3OQVA 2BEWA 4MK4A 4UDXX 5EIAA 1JIQA 4DUYB 4I1PA 1U2GA 3OX3A 1DMSA 1SBCA 3DQPA 4B3CA 1E9SA 1HYBA 2CVFA 4FHZA 1S9DA 1RWBA 4JJ8A 4YDRA 3F9CA 3UJ7A 1G8HA 2ZYHA 1XAJA 4R2KA 2WM9B 4E2WA 4CIWA 1FY2A 4EEXA 1U8CB 3KB6A 4XX0A 2YWDA 4UTVA 4JN6B 2P6RA 2E6KA 4YJ3F 3VPFA 2H1WA 4HR7A 1P3DA 1M75A 2XJ9A 3L0DA 4HWPA 4YHBA 4ZALA 3RFUA 3VU1A 2Z8YM 2XZDA 4AN0A 2GTHA 3RHZA 4DJAA 1Q3HA 3C3AA 1GUDA 4P4NA 2V9PA 1YONA 1ZITA 1TVKA 1QIMA 1Z8FA 2XCUA 1DOAA 4BQNA 1N5DA 2ZJ4A 3LCVB 1V9CA 4WLOA 2JPDA 2IXTA 1GPKA 3W4IA 4I1RA 3ZCSA 5KNCA 4Q48A 5FTJA 3K9GA 5DM0A 2P8SA 2C9OA 4JDPA 1XNRB 4OCZA 3ZWYA 3DFMA 5DBGA 2VDNB 3UJDA 2BTEA 3WQSB 1X3LA 3PZRA 4TMTA 1X42A 1H4QA 4XAQA 3RI3A 1OYYA 1EB8A 2UAGA 3RSZA 1CRLA 4RW0A 4OXKA 3IB6A 3MGCA 4IXMA 3FFTA 5AK3A 4F97A 2OCYC 3QE3A 3KIPA 3G0BA 1CIJA 3A1VA 1UINA 2CLMB 3WL6A 2GJKA 4YCDA 2X4DA 3AZOA 4EQ6B 1PR3A 1RJ9B 1GN8A 1UL1X 4N18A 5IVHA 1NRXA 2XEDA 1NWHA 4MARA 2Q3LA 3QVGA 4CLDA 3LVRE 1HRKA 4N5DA 5HJ5A 4G0UA 3RRNA 1P0QA 1QG0A 1IBKB 3FAZA 5JAPA 4X8HA 4OKIA 4YMIA 1EP9A 2UUOA 5LP6F 1KY3A 1XSEA 1G41A 1W1WA 2HRQA 3D1JA 3L84A 3E5RA 4FJ0A 3VUEA 1JFRA 3VO9A 3E03A 1OCEA 3BILA 5JEEA 4BBPA 1C9JA 1YJXA 4ONEA 3WGYA 1YFZA 3GUHA 2QV0A 3HVUA 1Q15A 2OO5C 3C85A 3KUUA 3NKLA 4WEQA 5BV8A 1L6IA 3BZBA 1TMKA 4EGQA 5B6IA 1ILEA 3E23A 5DGXA 1OXKB 2GYVA 3FTPA 3IHLA 4B81A 1N8SA 1S3GA 4UZSA 4KYUA 2Y3IA 1YS6A 2H2WA 3K09C 1DX9A 2BRUC 4RA9B 4M46A 4MINA 3DL7A 1FQOA 4FFDA 3OX2A 2MMCA 2PIDA 4I5GA 4R6XA 3DLBA 1SZJG 3B9RA 1XE3A 1Z08A 2WMOB 3L7NA 3MJVA 1N8KA 3UT5B 3WLLA 3KWMA 1G7TA 3PCTA 2LTAA 3GLFE 1JHMA 3THOA 4A8JA 1DZ3A 1UBOS 1YS2X 3P4YA 5TEVA 2WTUA 4RGVA 4DFDA 4HOYA 3TF5A 4A6DA 5ARCA 3WV4A 3QJYA 1T0JB 3VVCA 2DSTA 3DO6A 1PBTA 3TB4A 4LOLA 2F43B 1V8OA 2DCUA 3TRHA 4RHCA 5IHPA 3BXXA 1KNQA 3NYRA 5ADHA 1O8BA 1OGIA 5ALOA 1F0PA 2H31A 5BO5A 5JS6A 3ZDCA 5HDBB 4Z4EA 4WJZA 2AVNA 2QE7D 1YBHA 1Z5WA 1KKMA 3LKBA 1AHNA 3QUSA 4ODIA 4KV9A 4P86A 3EXHA 1H2EA 2GXUA 2JW5A 2QSYA 1NVAA 3BFXA 3OSZA 4TRJA 2EQ5A 3WKCA 5ARBA 1A27A 3WHLA 3I9FA 4G4JA 3PJGA 4UUPA 1W52X 4LF6B 5HF8A 2CYBA 4D98A 3F6SA 4RDIA 1D0SA 3HCCA 3BL5A 1BMDA 2JLQA 4OP1A 4A4DA 1ZR4A 3ELDA 3P32A 3UAZA 2H9IA 2PX0A 1RKVA 4HKTA 1MA3A 3JR3A 1RXVA 2YWCA 4TYWA 3JXEA 3D7LA 1W35A 4H3HB 1XYYA 1K2VN 2HZBA 2P2CA 4HLNA 4MQFB 3WLPA 1S1MA 1AA6A 2A7XA 1K06A 2Q5EA 2IHJA 4PYKA 4D7AA 1FS6A 2XNSA 1SB9A 4JBLA 4JB2A 2VZ9A 3OECA 4XM0A 4B2LA 3A4YA 2JAUA 3A6LA 3Q88A 5K4AA 1YL7A 5K3DA 2J0EA 2R8RA 1VIVA 3KZVA 3QX7A 5AOCA 1DWPA 2CUTA 4DYDA 3RYCB 2AN1A 4EG5A 5J2TB 1M2KA 4RK6A 1QZZA 4ZVOA 3U44B 1U7DA 3N2KA 2GKSA 3NT4A 3BZWA 3M0EA 4WKGA 2FB9A 3UNXA 3VMMA 5IJAA 1K6XA 2JDIA 2PD6A 1KOLA 1JQBA 3ZCPA 4F2GA 2ANBA 4Q4CA 1QQ6A 1KPIA 1THZA 3GFSA 4DN6A 3DJYA 5DBEX 3WLKX 5KZMB 4H7KA 2R79A 4URYR 1E89A 1GZHB 1JLRA 3CU5A 2ZS9A 3GA5A 3L7KA 3DL2A 1Q1QA 2DWQA 4NP6A 3E2PA 1PI3A 4P3NA 2XF8A 1Y33E 2BSQA 5IT0A 2Y1XA 2I76A 5AXBA 2VT6A 2K2QB 3EEBA 1P8JA 3C3YA 3SYRA 4EB3A 1TK2A 2FN4A 2NNWB 4MUMA 1CK4A 2AC7A 1BXGA 1P17A 1E7QA 3EG9A 5LJIA 3CWQA 3WIEA 4OP2A 2VEOA 4IXWA 3L0ZA 3RKUA 4B3IA 1R0YA 2Y67A 3Q0EA 4L2IA 2OZKA 3FGNA 2HR1A 1ONNA 1USIA 3B70A 1A5AB 1RJGA 2BE9A 3BFVA 1RYHA 2M2IA 3BHJA 3VR6H 2F48A 2P2ZA 2FW6A 3PXCX 4C3VA 5IJ0A 3ER6A 1R88A 2EJCA 3U3RA 4ALLA 1AM4D 2H2AA 2O8EB 2FWAA 2IZ0A 2JBAA 4JOSA 3CJTA 2HUNA 3EXEB 2GPAA 5K20A 2QL5A 3D6AA 1ULBA 4C0WA 5AESA 4UMVA 4TZ6A 1SKQA 4GX2A 1K88A 2FWIA 5DNDA 1TGYA 1YKSA 3MYRA 4G9EA 3TFQA 5EOVA 1FNSA 2FMUA 4G86A 4M9SA 4IIDA 2O7VA 4QBHA 1BEEA 1KF0A 2VAMA 2JIQA 2AL7A 3AILA 3FUWA 3T5TA 3LT1A 3OFNA 1CDEA 3PFHA 1EHYA 1XD8A 1QK3A 1U1IA 2A5DA 3QF7A 4B6OA 1PL8A 1JMYA 1P73A 1ABEA 2PKCA 4RVOA 3CZ9A 4XPIB 3A10A 4DM7A 5HP4A 2JFOA 5EHIA 2HMTA 4RZSA 1XTKA 1V5IA 1CZRA 1PL6A 3DOIA 3AERB 1WXFA 2EKLA 2W2VA 2WAXA 2XA2A 3L4EA 3LDAA 4Q24A 4QBKA 1PJCA 2BMEA 3A6GA 3AY3A 4EPRA 2VSFA 2BLLA 5IJXA 1FCJA 1H2RS 4O25A 5L8VA 3ADDA 2Q4EA 3DSRA 1WD5A 1JA1A 3O83A 2N3ZA 4ND6A 9MHTA 4G0PA 1W0KA 5ALXA 2E87A 5DM2A 3ZIAA 4GMKA 2CCJA 4KW7A 4PXAA 3KT0A 2G76A 2IYXA 3OIGA 3WDKA 1NI4B 4KO2S 2XYVA 3ZD6A 2MSKA 1ENZA 1UBHS 3ZJTA 4ND1A 5EESA 1P1RA 4CKBA 1BCSB 5FULA 5J3JA 4C0XA 4B3TB 1D4AA 2JD2A 3EDRA 5HE9A 1L8LA 2C20A 4MRPA 5D84A 2R84A 1YKGA 3BD6A 1AHPA 4CIYA 3AF1A 4BVEA 1E3QA 1OIWA 2XUZA 4FMDF 3EW9A 3P9SA 4CL0A 3LP8A 2ZU6A 4NS1A 2DFTA 4PW0A 1NBAA 4A92A 3ACCA 4TVOA 1MIOA 1P62B 3OCXA 4WZBB 5J1TB 1Y1SA 1A9YA 1E1NA 1OFUX 1T9GR 1YBAA 1NBMD 1Y3FE 3EUFA 4MCHA 4W6QA 4J1QA 5D8DA 5FP0A 5IDVA 1X7GA 1Q0ZA 5LMNB 1HGXA 2GT1A 3U81A 4IGIA 3JWIA 1YUMA 2DLNA 1L7PA 2YMLA 2CLSA 1IDN1 1N4DA 2GJ9A 2C78A 4RKQA 3KHKA 4KKXB 1E62A 4PV7A 4LF8B 4BVJA 4JKYA 4J7CA 3W90A 1VCIA 3V4SA 2PVCA 2J3IA 1AS2A 1H6DA 4S05A 3P9CA 1E5DA 1P0FA 2ZZMA 2WJYA 1UFRA 4LNAA 2ASEA 2WJ3A 4HAXA 4PX9A 4JVSB 1HLGA 4MHTA 2C5EA 3F73A 2V8BA 7MHTA 1RWXA 5K0LA 3KYIB 4LQCA 5FQNA 3IBTA 1PWHA 1KETA 1KKLA 1E6KA 4RD4A 1KQGA 2YWXA 1LVHA 4HAIA 3TZHA 1J7KA 2L18A 4E03A 4E1BA 5I9NA 2AV6A 3H4VA 2WYWA 3HDYA 3SMVA 2AFIE 2Z8XA 3HNRA 4Q3NA 3GCXA 1K7XB 3HXQA 4EYKA 1BJRE 3ZEAA 5B3AA 3QEMB 3BSYA 4D8YA 2XUOA 5ICMA 2H57A 2AMJA 2XLCA 3LYAA 1QLWA 3I6ZA 5B1HA 1QC5A 4LF9B 4GR9A 4HCJA 4J0QA 1JEOA 1H22A 1LGYA 3C3DA 4KDRA 4MLCA 4OHBA 4UE3S 3HH8A 3I3SR 3A2KA 5KX5B 1KYXA 3BCHA 1ECBA 2V5VA 3IE2A 1AE1A 3CXRA 2WZCA 1SXJA 4FDAA 1Y4SA 4HEJA 4IH4A 4NECA 4C7KA 3G0DA 3M6AA 2NZUG 3EQZA 3REOA 4CG2A 1XEAA 3L92A 1R5OA 3UJHA 4XYLA 3W5DA 1OZHA 3LHSA 2A0XA 4IIJB 3E9RA 5F3RA 1KA9H 4CKWA 1R0CA 1U7HA 1PR0A 2ROQA 3VYUB 2UUAB 2CNWD 3D4IA 1E9DA 3D2AA 4DC9A 2YYSA 3JYNA 4OI1A 3UF0A 4FE4A 3O90A 1D0VA 1FW8A 4MHOA 1PZHA 2CLDX 2EJBA 2HBQA 4GSYA 2X41A 4EG8A 1BEUB 3H1BA 1P1CA 3C43A 2C3YA 5JZVA 4LE2A 3DF9A 3M6FA 2P0EA 3F7MA 1EJ0A 5DEIA 1RPZA 1WABA 2ZJZA 5DTMA 2AGVA 3DBHB 2VHVA 3TBKA 4WFQA 5EWJB 2HSZA 1OFVA 1J90A 2R1ZA 3KTFA 4ZVRA 1T10A 2G71A 4BLTA 2YX1A 5JW6A 4AKHA 4OMUA 3EYWA 3TUIC 2O19A 2WYIA 4P3PA 3KYDA 1E1CB 4L8LA 1EUDA 5DNUA 1WKBA 4O2AB 3NWJA 3FKQA 2CLOB 1GILA 1FTNA 2C2OA 3NBKA 1ECGA 4Y6OA 4ZT5A 3B38A 4QWMA 1U3FA 2ZJAA 3ZPXA 1R5JA 3PKJA 1TEVA 5AXCA 4C4RA 1E79A 3IKTA 4JIGA 2QQEA 1IE3A 3AJEA 4IUCS 2RBEA 4YJKA 4EB6A 4KXLA 2ISQA 3MJEA 3PCXA 4OFZA 2BFEB 1QANA 2BY4A 4R4JA 5JCPA 3QXSA 4NYIR 1H2BA 3LLSA 1Z25A 3K2BA 4PFQA 1IQRA 3O3NB 2IZ6A 4I4LA 4QGBA 1MAHA 1XXLA 2H2DA 1WSDA 5JAHA 4PO9A 2JLYA 1HFJA 3KUXA 2BMJA 3I04A 1DBRA 1COWA 2A9JA 5DH9A 5JU6A 2FPMA 3UFBA 2I7VA 5CX1A 2JGAA 2MMGA 3HB9A 1AV7A 3WL5A 3GLIA 8MHTA 2QD1A 5E1BA 3CF6R 3VTKA 4ARUA 3BGIA 1VIAA 2OG1A 2MSEB 2ZJ8A 2FY8A 5K51A 2JLZA 1Z62A 4S0ZA 1GQRA 3I32A 3WKEA 3K1YA 2COUA 2WV7A 1SY7A 3A4NA 1FP6A 1XD2A 3CJQA 3KKLA 3R8XA 4AU1A 1I7NA 2NZ2A 1A2KC 1GZ7A 1E4EB 1XZ8A 2IY9A 2PT6A 4HYTA 2C7VA 2I7XA 4G07A 1KHHA 2I4IA 2ZDGA 1VE6A 1VI5A 1FFHA 5GJBA 4PZPA 3GLGB 2QBYB 4OK5A 2R44A 1O3YA 1SUEA 1Z0JA 4L02A 3T5MA 1TYAE 1MB3A 4YQYA 2XTZA 1N6IA 1DKMA 1E3EA 5BRNA 5BUSA 1FJXA 4Q1CA 4AO6A 1MJGM 3VSEA 2FNAA 5DW0A 4YCJA 2JJ2A 2I9PA 3ZK9A 2VP5A 3B3AA 1AC5A 3IIJA 1RIFA 4NHEA 1ATZA 3JYLA 4GKKB 3M9LA 3T1TA 4R8LA 2N9UA 5KNCD 4MV7A 4RHTA 2H5JA 1ISJA 1F38A 2J1LA 3HN2A 5AWFC 3UKDA 4LMPA 1E3WB 6CHYA 4PO1A 1CF2O 1A95A 3I2GA 3GI1A 1CDOA 2O2JA 3ZE6A 2H5LA 1OYVA 1ZGBA 3R3WA 4N01A 5LUBA 4DWJA 5D00A 3KRTA 5LU9A 1SQSA 5CDYA 2HHJA 3A1FA 3OIUA 2HK7A 3NEPX 4G0WA 3DTTA 3OSUA 5A5DA 1X70A 3GR6A 2P9YA 4BHTA 1XCMA 2QZSA 4RSRA 1C1HA 4GX1A 2YDYA 2Q6KA 4IUBS 3SJUA 3GA0A 3GJYA 2I3ZA 2PMEA 3U3DA 3W7AA 2RSLA 2AF3C 3L8GA 4GPAA 1JBKA 3FIUA 2CT8A 3Q10A 1KBZA 3E6AA 4EBFA 1N7GA 5ICGA 1T8TA 1L7MA 2E4UA 2QOEA 3DGFC 3UG7A 1SM4A 2FUCA 1IWPB 4MGKR 4RHUA 3L4KA 1Z0UA 1W46A 3PRJA 2RONA 3HZZA 1NUQA 4W9NA 1V5EA 4XH9B 3RC1A 4AO7A 1SRQA 2A4MA 3VH1A 4AMUA 4YCMA 3V7YA 3SBEA 1QCZA 1WP9A 4WESA 3EEOA 3FSRA 3IUMA 1P29A 4HUQB 5CNMA 1GL6A 1PS9A 1QDLB 3MWYW 4WBSA 4ZN6A 3FDZA 3OZRA 2QV7A 2OD7A 4KXMA 2HRRA 1ZN8A 4KV7A 1EK0A 1CFZA 2J07A 3VKUA 3VR6D 1HETA 2I6TA 2OKCA 5LUAA 4EW2A 1YTUA 4JYAB 2QRGA 3IULA 4XD2A 2Q5OA 4F92B 3QBEA 1H9AA 1PEKE 1FDVA 2QRVA 3SX2A 1ODTC 1GPH1 2WVAA 3ENQA 3K96A 1VCOA 1NUPA 2W43A 3QFSA 5ALQA 1RHUA 3BDVA 4MR9A 1NMSA 2X0RA 2EG9A 3DH0A 3Q4GA 2JHFA 2JJYA 2Y27A 3VVMA 1Y82A 3JQ8B 1YRHA 5BOVA 1EGAA 3OKAA 4OYLA 5C18A 1HLPA 2GETA 2HPVA 4JGGA 1DWUA 2IBMA 1B41A 3HU5A 2NO9A 3R5KA 5HS6A 3RJ5A 3VDXA 5I7FA 1S9HA 3VPCA 3LQQA 4CIDA 4DBLC 4PLHA 1HK7A 1Z3IX 4A0QA 1XU7A 1Q3KA 4X3PA 3TIVA 1O96A 3QBTA 2VHCA 2F7SA 2ZIAA 1WQ1R 1OGYA 2A0UA 5C31A 1GRVA 2C99A 1YDMA 1QQBA 1DQZA 3VSAA 1ACMA 3R75A 3AKCA 1KO5A 4J1TA 1G5HA 2Q6IA 4QOJA 2OFPA 4WZAA 3WGVA 4IYJA 1DTEA 2E0IA 1SQFA 5AVKA 5A3SA 1NN3A 5C34B 3RVDA 3NNNA 4DMFA 3KZMA 1ONSA 4KIGA 1YB1A 5DWVA 5K3AA 1Y1KE 2PL5A 5L3ZA 4LDRA 4XIJA 4MPJA 1W1IA 1OC2A 1UWVA 2PZGA 3CX8A 2GM3A 1NZJA 4O8ZA 3ZZMA 4G09A 4FD2A 1PF7E 1I24A 3A1TA 4IEEA 1RAHA 2QLBA 3FB4A 4RVSA 4EARA 3ONFA 4OI4A 2WT8A 1TA9A 1M34E 3LUBA 4ZO8A 3AVYA 1GUYA 5CG2A 1EFRA 521PA 4GP6A 5ALGA 4MQEB 3M5CA 2YKGA 3DKPA 1PJSA 4NPCA 3BUSA 4RJJA 1ZVKA 2Q5FA 2QTFA 2V59A 2OLKA 3IBFA 3SF8A 2VJYA 3AHEA 2JNWA 1NVKA 2EGHA 2CDBA 2JDID 5L4NA 1QFYA 3ZS8A 5IZCA 1IEWA 1ZUNB 4BQSA 2J5XA 3DYBA 3BQNB 1QYXA 4DIMA 3RSHA 4OQPA 4UTZA 1MVNA 2K7ZA 1KSFX 2KM1A 2WYUA 3IVAA 5DHPA 5DSZA 3CCBA 4CLOA 4G67A 5GJWC 2W4IA 3E3AA 1K5HA 4HH0A 3KETA 3B9PA 3RLFA 1W4ZA 1YMQA 1FZQA 2NX2A 1G20B 4ALJA 4BP1A 2PHZA 1QP0A 4F3TA 1XMSA 4YMTA 3AEQA 3QPVA 3VR5A 4C4ZA 5F3WB 2QRZA 3ZJ4A 2WSYB 3LC2O 2JHCA 1YU6A 1DAPA 4TYQA 5DX0A 5TEWA 5JH7B 3UA3A 4G6ZA 4M8NE 2CEKA 1J42A 1NVUQ 3CPEA 3QKUA 5LXTF 3R09A 4H16A 3WYEA 3NYQA 3OD5A 3SQMA 1N2IA 1G6KA 1IPFA 1CQIA 5ALUA 3I4FA 4EFMA 5ICSA 2OV8A 2PAFA 3FRJA 3GRRA 1M1ZA 4DDKA 4K9DA 3ZQ4A 4QVIA 4HMPA 2IGTA 4EAQA 1DAGA 4F5YA 4XDYA 1E2PA 5JD6A 1C29B 4KRYA 1E1RA 4JEHA 4LYDA 3J81A 2QX7A 4TZ0A 3WTCA 4YB8A 1LSJA 1L0BA 3TL2A 2ZRGA 3U3OA 1HE3A 1LUAA 2VJPA 3OPNA 3OZDA 3SXPA 2EHDA 1R50A 3OFND 3EGXA 1NJ8A 5H7XA 2BI4A 4IIHA 2I33A 1ECLA 4WA7A 4TPKA 4CLEA 4H7PA 3U4MA 3K6JA 1YK1A 4B7UA 2E6UX 2GPWA 1I2MA 1SGWA 2HX1A 2LCFA 2QNIA 3FYUC 3K5IA 4N9QA 5DSTA 5EWMB 3VTZA 2HFKA 5CYGA 1NKVA 1UPFA 4Y18A 3RYTC 3LHIA 3P8ZA 2V5AA 3CUUA 3MMNA 4Y2SA 2ZCJA 2I2CA 4DIEA 3UGKA 3X1DA 4DJEC 1RSZA 2W71A 3DE5X 2Z6UA 3T7KA 4S35A 3CUSA 2AHOA 2REQB 1X74A 2AK3A 2DVMA 4O59O 3O2QB 3QMVA 3FOEC 1XXHE 4PRKA 1KZ7B 4G5FA 1NJSA 1BO6A 3ZZ1A 1W0KD 3ZIAD 3ZDDA 1SHZA 1KSJA 2FZ5A 2EGGA 2ZPAA 3MELA 4JVNA 3DDHA 5D51S 4Y0NA 4OQLA 2VJBA 5LLTA 1L4YA 1DDOA 3LS2A 4V0LA 5J9FA 2H00A 3O0DA 3JQ7B 4D8VA 1PD0A 2BSAA 5A9SB 2B5WA 1U99A 2FSGA 1KORA 3H9QA 1U8TA 2BEVB 1U3GA 1Y7TA 4N03A 5FI0B 1L7QA 4JVMA 2P6PA 5TNXA 3R8CA 4BBAA 4EY8A 1DL5A 5C5DA 1UXOA 2UVQA 4I6GA 1K1EA 2H4YA 2QRMA 4AP6A 1I6LA 2FK8A 3T7JA 3GBVA 5FO1A 5AKXA 5JMTA 3ND8A 1J1IA 4Y9RA 5CEJA 1QGAA 3WDLA 3WL8A 4BC0A 3BXPA 2X9GA 4DYHA 1IRIA 2EQAA 4IFIA 4B44A 1U8EA 3DUFB 5IBQA 6NULA 3TNYA 4C20A 4C6TB 4EMBA 5B64A 3ZK8A 1ESDA 3GYBA 1RKBA 3B6MA 4GZMA 4LMAA 5EIBC 4BO0A 3E9CA 1NBME 5JAQA 3ADOA 3QEAZ 1SBQA 3TRFA 1KZ1A 5K05A 1P4HA 3SHFA 4I9GA 1M1YA 3OOSA 1UJ6A 4WE3A 4M0CA 1FVFA 3HB7A 5EQJB 1EFVB 3VU9A 2VDQB 2W70A 1FDTA 4CEHB 2AOTB 1JHYA 4RD1A 4HY3A 4OQQA 4C5CA 1QAOA 2O3SA 2ZUBA 5IC6A 1U2EA 3GHHA 2ZI3A 4MUHA 4TV8F 3OZSA 5FAXA 2XYHA 3ACDA 3C7KA 4MV4A 4QD3A 4QPPA 4GBMA 2O3UA 4N0MA 4OKNA 2HMAA 1F14A 4XWGA 1SHLA 3FI9A 4NF2A 4ZO9A 1EEXB 1TYBE 4AN1A 4OJQA 4Y9UA 4MYDA 4KC0A 3WAKA 1AO3A 1E6MA 3OQMA 2L82A 2QTVA 1BX3A 3CF4A 3FXAA 1O6CA 2ZYUX 3G5UA 4PPFA 4AW9A 5K09A 3QX3A 2CVHA 1YBFA 4Q3KA 4ARZA 3ICVA 2XBLA 2CSUA 1K6IA 3UWDA 4B31A 3AVXA 3KKOA 4PYIA 3UAXA 4C3OB 3THWA 1ZM9A 2VUTA 3OA2A 1GA6A 2Q5LA 2CV0A 2O0KA 3SNHA 3IPRA 1PYDA 2IXAA 1ZJ4A 1PT6A 4U6SA 4D44A 4YNBA 1VE9A 1P2BA 3K0CA 2CXSA 3R6LA 2XGJA 3DFKA 3AKZA 3JAWB 5L9AA 1M6YA 2QYHA 2NUAA 1C1XA 1FMJA 2OO3A 3CW9A 2J0UA 3ZTWA 3WYDA 1WLSA 2ID8A 4BLQA 3E9YA 1ADGA 1UOOA 1TTTA 4FC7A 3FPJA 3OIDA 1N0UA 4CF6A 4Z4CA 2B1RA 4JWTA 4O63O 1SIBE 5L3RA 3HLTA 1WEHA 4IIJF 3FSGA 1PX2A 3RU3A 5BVGA 4CE6A 1IMJA 4OBEA 3PFWO 4RZ2A 1NX9A 2AFHA 1JIKA 2GI4A 4GWLA 4H7IA 5B1EA 4KMRA 4MUJA 3AM5A 3V3KA 4AJKA 3R76A 1NJ6A 1UFOA 2XDWA 1BMFA 3JARB 4WUVA 3CB2A 3HSYA 4BMDA 4DPLA 5BRAA 1ZK0A 1QRRA 4D26A 1KFKB 1P5ZB 2GWRA 3P97A 3VPGA 4DS3A 2G1KA 2MU1A 4BJ5A 1KI8A 2QN8A 2Q6LA 5DYNA 2FCRA 1PZXA 3KT6A 2XDQB 3N86A 4OQYA 4CMJA 4F3NA 5BSVA 2L19A 3EE6A 2HNAA 3P4XA 3AESB 4NI5A 1L5KA 2Z04A 1MAUA 4I4IA 4MLPA 1T3GA 3AYXB 4G5SA 2EFJA 4ZDWA 4CFYA 4PANA 4CMGA 3Q9SA 4YAUA 5YASA 1JL3A 3FUUA 3AEUB 3OKCA 4O2AF 4XB6B 3K70C 4EKEA 4RAQA 3OJEA 1X8JA 4IPTA 2ZIUB 2J6IA 4RX1A 4TN5A 3EVEA 4MAAA 3I01M 3KB1A 4QPNA 2FHSA 2Z1MA 1FLNA 3N0XA 1NVTA 3Q3JB 2BFWA 4WLUA 2DZDA 4C7BA 5IASA 1VDZA 3PTZA 5EKXA 3G1TA 3UUEA 3QEBZ 4BUJA 1KZ4A 4WCFC 4BUZA 5EXPA 3SEFA 3O4RA 1AF7A 2V7BA 3HACA 4G0MA 2LNDA 3B2QA 1Q17A 1COWD 1J24A 3CVVA 3L8EA 1SD2A 1XPJA 2IEGA 2OB1A 3WA6A 4LJRA 3L6RA 1CWUA 3TE6A 2OORC 2BZGA 3M33A 3EAGA 5LOVB 4UAGA 4M21A 3PT9A 3LGAA 1IK6A 1XEWY 2PQ2A 1C4XA 2OBBA 4FHCA 4NK5A 4WTOA 5K1ZA 4X65B 2ZRFA 4L72A 4C7MA 1NE7A 3H5VA 1OLSA 2ODEA 1XGKA 4KFSA 5KPDA 4OXIA 1LZLA 1XZMA 3WGNA 1AKVA 2WSLA 3DCJA 4BP3A 4FHGA 3PD1A 5EIWA 5FD8A 1BOOA 2QQ5A 4GGMX 4HZUA 5E9AA 1NYLA 1OXXK 2KWIA 2BR4A 2A84A 2BEJA 2Z2XA 3GGOA 4ZYLA 5HOEA 2WABA 3OJWA 4H6XA 4P4UA 3F5SA 4WKBA 5H68A 5K9ZA 1L4BA 1QRDA 1TMGE 1WZNA 1XQVA 2JJ2D 2NYVA 1NUAA 1KMHA 1U8XX 2UVPA 3D8SA 3GBSA 5A6SB 1VG0B 4DLXA 4FFRA 2O8CB 1F0YA 2IYNA 3FUTA 3SDBA 1L7OA 3VGPA 1CVRA 4L5BA 1I0ZA 1ZLXA 4EIWA 3GLHB 5T8KA 2HBZA 3NBUA 5CB0A 4KPGA 1SH7A 4QEDA 2PLWA 4TKMA 4EL0A 3H6GA 5JASA 1X1SA 4KNYA 1P45A 2DY0A 3KBOA 4GOND 2NACA 3PX3A 1IATA 4QFMA 2VDWA 3L1UA 3HY4A 2Z3WA 2JLRA 3C2QA 4UEQA 1RMTA 1PW5A 4PZCA 1FSSA 4RTJA 3I92A 4F3RA 4F45A 1U7TA 1QB8A 2OLJA 1OFIA 3K31A 4FFLA 5HTKA 2AXNA 4LZZA 3LH5A 5AOVA 3S81A 3HCBA 1C8BA 1E0SA 1YA8A 1T6NA 3PNBA 3CPHA 3SSAA 2JG3A 4BNDA 3K2IA 5TPWA 2OFOA 3CURA 1M5RA 2GDJA 3N39C 3PUJA 1TJYA 2XCIA 3AUUA 5AJXA 1AIPA 1T5SA 5IPFA 3BKWA 4UVEA 3FCSB 1KEEA 1XV5A 4KE9A 1P5RA 4X9XA 1TAQA 1CY8A 2OXEA 1NW4A 4ZIRB 4QUKA 3AFOA 4FGKA 2NU8B 2ZJ2A 1L5SA 1W9MA 1Y89A 1YL6A 2G17A 3ED5A 4K6HA 4WCFB 3KVNA 3U3ZA 5THQA 1EM6A 1DEHA 5F73A 5G2OA 1Z74A 2OGZA 1LPSA 1AKRA 3X2EA 3E81A 1GCOA 4YC7A 1NQWA 3G9XA 4ZEWA 1I2DA 3ZGLA 1OBOA 2L42A 1DRJA 3MLAA 5I7AA 4NY1A 4E5YA 1M8KA 4MEBA 3QPCA 4XGKA 3U39A 3WY9A 2EJVA 2YWFA 1IDOA 1S8OA 1B43A 2P5TB 2FSUA 2Z4SA 3SYNA 2HPZA 1FNCA 4AKEA 4AX4A 3AEXA 4QPCA 3A3KA 5KCMA 4KOEC 4OU4A 4TM7A 1X9HA 3LY7A 1VE3A 1O8CA 1F1JA 5KHOC 3TJRA 4LX8A 1FLDA 4G9BA 4M6WB 1NX6A 3EDCA 1UMDB 1BDJA 3ANXA 7AT1A 2PSJA 5JJIA 5F51A 1YCGA 4FWBA 3TTYA 1IQPA 4DCCA 3VAAA 3VAZA 5G02A 3WSTA 1E9BA 3KOZA 5TB5A 4CT5A 5LU8A 3DV0B 2EYQA 3JQGB 1CVIA 4CKEB 2AQHA 2NUTB 1GZDA 1GCGA 2JGDA 2HO4A 1IZ9A 2Z2YA 1B6TA 4GLFA 2CJXA 1RWOA 3QUBA 5HIJA 3UYLA 5BNWA 3K15A 4US2R 1HNNA 2YFQA 3CEHA 3KC2A 4EF5A 3BTSA 5DP2A 4DOMA 2EGUA 4BJ3A 3E27A 3SHWA 2J4FA 3C1OA 1O03A 2VSOA 4II3A 1E66A 4OV6B 4IWYA 3DVAA 5AKIA 4CEIB 4DR6B 2P2SA 3R6WA 1YULA 4QJ3A 1FPQA 4M0PA 1BXKA 3KOMA 3RIMA 2J6BA 2L69A 3EBOA 5D85A 1JFTA 3O31A 4JT2A 5CPFA 1N3YA 5D5QA 4PZ9A 1WY5A 2QRHA 4ZCQA 3O7WA 5IFKA 1Q0PA 5JSQA 2HJRA 2Y71A 2HU5A 2V0GA 1TAHA 3UFXA 5BWMA 2OOSA 2WOJA 2ZCUA 5AKEA 3KXLA 2W6MA 3RUDA 1APBA 2VXOA 3AM4A 4GT1A 5KYUB 1VC2A 4RFSB 4CKZA 2CV1A 3FTFA 3EEYA 3I39X 4FB4A 1W8DA 1W85A 2GOYA 3CBQA 1TIKA 3UGJA 1EFRD 5A4IS 1Z37A 3OJCA 4JL6A 1ND6A 3B8EA 4JLSA 3ND7A 4U8GA 1Z07A 3WXMA 5JADA 3ZVMA 2D8AA 4IMJB 1NJ5A 1P6QA 4BZQA 3RWBA 2XECA 4X91A 1I0IA 2NSJA 3O8DA 2XZLA 3OE5A 3EN0A 1DJMA 1SUAA 3EZ7A 2OQVA 3HYRA 3JPYA 3KWJA 4GPEA 4XOIA 4WBNF 2ZM5A 3DMNA 4YRFA 1Z5UA 3HO8A 3OHMA 4OJNA 4Y2PA 4INOA 4QOHA 4X20A 4INZA 2V8OA 3Q3VA 2Q3MA 2DMRA 4ZRNA 5DM70 2X7HA 4RVHA 3OTOB 3OCWA 1MH1A 3FHCB 1EMDA 1XDDA 4OLJA 4PGAA 2FZVA 2GF9A 2VSXA 1D03A 5KPJA 1JH9A 3D0RA 2DBRA 3TGLA 4LRQA 1R6AA 2P2DA 3CLSC 3NP7A 3A3YA 3TI7A 3VR5D 2EWWA 5AM5A 4J0EA 1V8PA 3RVMA 1N2CB 4NENB 1REQB 5TX7A 3BD9A 1GQ2A 3LD9A 1MHPA 5H70A 5TS3A 2H1OA 2ORVA 3KB8A 1K6JA 4GL2A 3B20A 2QU7A 1HQKA 5J63A 2G9RA 3SD7A 3U7RA 4WXEA 3D4PA 4NFYA 3CE6A 4P53A 5TE9A 4D0SA 2AOUB 3ZXXA 2AYXA 3ENZA 2QUKA 3K1AA 1T9AA 1FUIA 1GFZA 3GZJA 4GKJB 3EFOB 4Z53A 2AHRA 3OUUA 3STHA 4Z2YA 2AG0A 1H3NA 4EO7A 1E1RD 5A04A 3X43A 1QSGA 5HSGA 2PXCA 1C7ZA 1TVCA 2GK3A 5LDHA 1YZYA 2HL6A 4LCJA 2QJFA 2ZK7A 1UKEA 1O0SA 4ZODA 4F6RB 3GH3A 4OXRA 5FFMA 4GM4A 1FS4A 3I0ZA 4LGCA 4D92A 4B6JA 4POAA 1U8AA 3HFRA 4D8TA 1NU6A 1XTBA 3I9V6 3A25A 3K8OE 3ZWMA 2CXOA 5FYDA 2AXPA 4ZGGA 5KNDA 4OLBA 2BTOA 3OY2A 2HW8A 3H5RA 4M0KA 1ZXLA 2XAUA 4BNHA 5FFNA 1SJ9A 2GYUA 4XWYA 2XE4A 1KVTA 1RQ7A 1PYGA 3TSCA 2G3YA 5A1JA 2ZQZA 3WLNA 3D31A 3PCRB 2AZDA 4HFJA 5HG0A 4GPTA 1X7DA 5K0TA 4NG4A 4LBVA 4RCVA 1WULS 1GKKA 4G9GA 3CVYA 3HUEA 3A6EA 3SR0A 1E5QA 1K8YB 1KP2A 2WWXA 4MB0A 3TZCA 4LF7B 3HHPA 3EPJA 4BE9A 4PE5B 1S02A 4RM2A 1PVOA 3DWEX 1KI4A 1RQLA 3PHBE 1U0SY 3VDQA 1NE2A 1K63A 4EGJA 1ZIXA 4TZTA 4BQQA 1KPHA 3HR8A 2EZ9A 3AI2A 5HFAA 1A8HA 4ZPJA 2I7CA 3KXIA 3HKDB 5BR7A 4AJEA 1PQ4A 1ZGGA 3AJAA 5CHYA 1W5EA 2J5QA 4TX1A 2R65A 3UK7A 5K6AC 2IDKA 3MQ4A 5EGNA 2ZE7A 3M49A 3CEJA 2FFJA 2XUAA 4JT8A 3B1KA 4QDUA 2AWOA 1JVSA 3DR3A 2XIQA 3FTEA 5E7QA 3PA8A 3JD3A 3OZFA 2I2WA 3AOEC 3GP3A 3V55A 3D3WB 3ELUA 2BFCA 5LIPA 5JO0A 1V43A 5JS1A 3GARA 1J33A 4N3AA 3GFVA 3NEJA 5LA6B 1ZJYA 2OQIA 1TZMA 4XJVA 5FTLA 2B3DA 4R05A 4TWAA 3TDKA 4CGZA 2PKXA 1M83A 4TM8A 2GCEA 4MVJM 1JYSA 2AQKA 1G9XA 4FHDA 5JZ9A 2IYPA 4DWWA 4J75A 3WGGA 4PYQA 2JATA 2QG6A 5CLQA 1M7BA 2W6IA 3A2NA 1KJNA 2Q49A 4RMIA 2CVZA 3ZHUA 4TGLA 1M0TA 2I2FA 5EMNA 4LZNA 4BNFA 1G21B 2D54A 5J4KA 1HXHA 4M38A 5AVSA 1IWBB 4B35A 2FSSA 3NORA 2W6QA 4CQMB 5ENDA 5BOSB 3L46A 2P5SA 2DHCA 2YQ4A 1BN6A 3WWEA 5JNVA 1AD2A 4MVJF 5AM4A 2PX2A 3SVZA 4US0R 5T4FA 3FETA 3HU1A 3LF2A 3OFKA 3P0IA 4HH4A 4KE6A 3E7PA 3VHRA 1DOZA 3PVSA 1RRPA 4LOAA 1QS0A 2O2YA 1JALA 2HA5A 1KQOA 3O94A 1WSBA 1X87A 5L40A 4U7DA 2M98A 3WMFA 2AZXA 1JIUA 1Z12A 2V7TA 3MINB 1JG7A 2IVZA 3T7AA 1ZEJA 2JIRA 4PPGA 1Q95A 2PFKA 3NR2A 4IF4A 1A9XB 4GDFA 2WKRA 2HJVA 1D4ZA 2DEUA 4KRGA 4TUYA 3G3EA 3GRPA 3R8FA 4O4IF 4KDFA 3FDJA 2EW2A 2H2GA 3WK6A 3ICPA 4E4RA 4OU5A 3MHTA 4ZC1A 5FBQB 1NFRA 3QI7A 5C7YA 5KDDA 1RQ2A 3VXKA 1VRWA 5CG1A 1ZAKA 3IEUA 3HYCA 1Z18A 1PQWA 2VFAA 4NZZA 4GMXA 2G5CA 2AJTA 5JWHA 3TLBA 3U7EB 3M6WA 4DA8A 5SZKB 2RI1A 3BRCA 2OUIA 5EP3A 1ZM2A 3LM8A 2WNIA 3TRKA 4MQ4A 4PCVA 3EVGA 4UBNA 4F4DA 2Q0XA 5JVDF 1BMFD 3VPHA 5BSKA 4WHMA 4IVNA 3NGMA 3HWSA 2BEKA 2FEOA 3IQXA 5KYKA 1V8DA 3LNCA 4LHXA 1V4BA 4IBOA 1MKYA 1VG1A 4NS4A 1RM5A 4WGGA 1F48A 3UW3A 3YASA 2P78A 3KQHA 5TVGA 1AT1A 5TXGA 3VC3A 3ZIDA 1VJTA 4XDZA 3TBFA 4L76A 4A03A 2FW0A 5CA0B 2P0AA 2CLCX 1MQAA 2QSZA 1ORHA 2SKDA 5LDDC 2BR3A 1MB9A 3FYHA 2QD5A 3Q5GA 3P0HA 1TJNA 4RXUA 3AW9A 4B17A 1STOA 2ATIA 2JHAA 4IQ4A 1NFFA 3SICE 3A58B 1Y4DE 3TLZA 5JLAA 3USZA 3W1WA 4IL5A 1H4SA 1VB5A 1CFJA 1JE0A 3AVPA 1TT7A 1Z4OA 3DL0A 3KQYA 4IDDA 2CF5A 4U2GA 2IWHA 2F1HA 3AJRA 3TRIA 4D82A 1NQAO 1PLKA 2EBUA 5AD1A 3EHDA 1NUTA 4ZEOA 3TW8A 3GZ4A 1HDRA 1N5KA 1K7YA 1S8AA 1ZEMA 2HQ1A 2YXNA 4AJ1A 5BORA 2RC5A 1VE7A 3MLEA 4QARA 1PEYA 3QPBA 5SV2A 2V3WA 5CR9A 1K3FA 3L4BA 4YIHA 1D5WA 3O3CA 4MYRA 3C3PA 1CUZA 1KZYC 1LBIA 1Z29A 5C52B 1FJHA 1QG4A 1JKIA 2VJMB 1ZN2A 3FVVA 1Z38A 2QPTA 3PJEA 4H0FA 3FGZA 4UNPA 2PEYA 5MGNA 3D59A 2VA8A 5FL7D 1D0IA 1JLHA 4MPRA 4M89A 1Z0KA 2EG5A 3Q9LA 3IVCA 3M6XA 3ZCUA 1NVXQ 2G80A 2Q7XA 3ESXA 4IDPA 5EE3A 5KIAA 1G6Q1 1LS6A 2IS6A 3PR3A 3LP5A 2W2OA 4LC1A 4QRDA 2IP2A 5ALFA 1L5ZA 2AKAB 2QAGA 1G8FA 4LKRA 4CUJA 1XZQA 1DS6A 3S8YA 3UXMA 3A1SA 4LV6A 3K1TA 1Y4ZA 5DMXA 2O0MA 1HE1C 1N5OX 5LM3A 3ESQA 1RJWA 4HDNA 1ZNXA 2Z56A 2GPTA 1VLLA 3ILHA 3PPXA 1CQPA 5REQB 2ZSJA 3CGGA 4H0NA 4PVCA 5H3HA 2CXPA 1J49A 5TT1A 1GL7A 1N8TA 3N0WA 3QVMA 4G3XA 2D5LA 2PU7A 4MQ6A 4GXQA 3QYPA 2ISSD 4XR9A 4QSHA 5DCUA 1D04A 3RRXA 2VBIA 3TRJA 4PLPA 3O9MA 3UHFA 2GZAA 4ED9A 2FWNA 4EFKA 2ZTLA 3OU2A 4JODA 1G1AA 4HWRA 2BTQB 4OATA 1GU0A 3R3UA 621PA 2IXBA 2J9FA 1AS0A 1SA0A 2MYPA 4CCSA 2YIJA 4UCFA 4ZOLB 1ZGJA 3PUXA 3TOZA 5L6MB 4JBGA 1Z36A 2VIIA 5DRTA 3K0FB 1UJ4A 3N58A 3GP5A 3CZCA 4OMFG 1DQPA 1ZJZA 4WLVA 5BWOA 5I9LA 1HF3A 2EJUA 3B7PA 3CNBA 5F2EA 4AECA 2A35A 4B9AA 1K89A 3VDNB 1BS9A 1G7SA 1NY6A 2LCQA 3TW4A 4PC3A 2O8FA 5FLXA 4PEVA 3I5MA 3TLGA 1E4VA 2IDMA 1KDTA 4FFVA 5FEUA 1C9EA 3WGHA 3C6XA 4JLAA 2PSHA 2FW9A 4OUKX 3VKVA 1L5HA 3W2TA 1F2TB 1E3DA 1BHO1 4QOEA 4QE3A 4X61A 1JHAA 2HCRA 2X4IA 2NT3A 3X1XA 5BNTA 1ZHHA 4Y8VA 1E1QA 1R0XA 1JXQA 1DQRA 2C8LA 5UKDA 3QSGA 3P9NA 5ALDA 4P5PA 1ZNYA 4MW2A 4HAWA 3ESDA 4QGGA 1MZVA 5IABA 5KQLA 3ZGOA 3LXXA 1LJLA 2LKCA 1LJUA 4KGXA 5LZ8A 2FMKA 3H2BA 1QHHA 4X44A 1YJBA 3O92A 3TMAA 5JAMA 4QA9A 2VATA 4O2BB 4ZAZA 3GJRA 4ABTA 2HYIC 3OE4A 4WCVA 5IXYA 4KR9A 4OBWA 2B69A 4BIMA 1X80B 3UXHA 4UXIA 2G9VA 4DMCA 1XN1A 3RAFC 2XUPA 2R8OA 4K0KB 1RBZA 4DVGA 3O8LA 3N8IA 4DLYA 3RK4A 3NYIA 2VYVA 2C2WA 3IT1A 4E21A 3RV4A 4BGIA 5KTTA 2VQ6A 3V4OA 4GKVA 3SZGA 3Q3IA 2OBNA 4MMXB 2DFDA 3TVTA 4EO4A 4R0VA 4TXHA 3DAGA 1ZJJA 5DCYA 1F9EA 2LXNA 2Q27A 2VTEA 1XMOB 1YVUA 1JV2B 3TKYA 1WXWA 4EMUA 5FTMA 3E1GA 3H16A 3F6RA 3LYHA 4WDRA 4A2CA 2PU5A 5HGXA 1ZK2A 1FYEA 2P4SA 1KAQA 4YTEA 4Y6PA 2NTNA 4HVCA 1JDBB 3SDZA 1P7YA 3WKAA 5MN4A 4HNAA 4PSVA 1JDSA 2YASA 3HN6A 4BGDA 3E9NA 5HWSA 3GEPA 1ZUIA 2E89A 4X62B 5BNZA 1VI2A 3W8NA 4L08A 2YZ7A 1Y9JA 5KJFA 4UDNA 5JCOA 1UPXA 2FX5A 3LC0A 3DKVA 5C5CA 4WADA 3GPDG 4JUAA 2WIJA 2C9ZA 4AAYA 2R6GA 4S1VA 3HKCA 1MHTA 4DREA 3GJ4A 2HA7A 4R2MA 1C7EA 5IG2A 1O6ZA 3FJYA 4TMZA 3VKWA 2JEOA 3LPLA 3PRKE 5DLQC 4JBYA 2RGDA 4HDCA 1ZAYA 2CXTA 4V0MA 1KYYA 3LA6A 5BNFA 2JL1A 1TB4A 4MO9A 4GGPA 5K45A 4XJXA 4RVGA 4RTLA 1RMQA 2V1UA 1ZGHA 1NMZA 4EL5A 3LTEA 3KO8A 3KQQA 4JV5B 2XKJE 1HYEA 2V7GA 1QONA 4EY5A 1CUWA 1Q92A 3TFOA 1V3VA 3DP7A 3W4JA 1Y6QA 1DBWA 3QKIA 1VIYA 1OH6A 5BN1A 1KO7A 2WVGA 1E2UA 1O4WA 3NYWA 3QFHA 4WNAA 3ABZA 3B1FA 5AK6A 2BGUA 4NYIQ 2ONCA 3QZUA 2A92A 2GMWA 4V1CA 1QFXA 3JQ9A 4FZJA 2FPKA 4ENUA 5AW1A 2QP9X 2O50A 4TOIA 2C9YA 1VPLA 2F3TA 2IP4A 2PMDA 3NXKA 5JZMA 3UT6A 3ZD7A 1TUGA 1LBSA 2RJNA 3FUXA 2ZBGA 2QRLA 1VKJA 3IILA 2AR7A 1NJGA 3L8MA 1F2VA 3JYHA 4GWGA 1SUBA 2GZDA 2C5AA 4JYBA 4NSNA 4B73A 1YZGA 3KKZA 2PANA 4BO1A 3F97A 4B2PA 3O1JC 1Z9BA 2FW1A 1RWNA 4DMRA 1V6CA 3AUTA 4JY7A 1BQ3A 4FGSA 4QOFA 4EYGA 1ZU5A 5JI2E 3PE4A 5AW0A 2GUWA 1XUOA 4RMHA 2BFBB 3AF2A 2XRYA 3PNQA 4R51A 2XD4A 5EZ6B 2IUYA 3U7HB 3DHYA 1E0DA 1QQ7A 2NZYA 4FMBB 3UXYA 1ZO8A 2I4OA 3K94A 4ACAA 3RTCA 3NBYC 1UC4B 4D5EA 4GMDA 2PQ0A 1U5BA 3G2KA 4D8WA 4Q3EA 2QENA 4TL8A 1J5EB 2ODNA 3LL4A 2YWJA 4IQGA 3S7TA 4YV1A 5KWIA 1I3OA 1JAYA 3KD2A 1R27A 1KAHA 3GGCA 4GUAA 3H2SA 3OJOA 4HAYA 4MRAA 2VNAA 1EINA 3ZV4A 4FZ5A 4ER3A 2QG4A 3QVJA 3WB2A 4JI8B 2JCYA 2ZYVX 5KNDD 3ASZA 2B2XA 3TQRA 3U40A 5E6UA 4D0NA 4NZNA 4S0XA 5DGTA 4BVLA 3DLHA 4PSKA 4J9UE 1CUXA 3PX2A 2EFEB 1HZZC 2R85A 2P79A 3WIBA 2DR0A 3WGIA 1CP2A 5T4HA 1OY1A 4W5OA 1GGFA 4GXNA 4J1NA 4INPA 3WKDA 5EIEA 2EW1A 3GY0A 3MJSA 4KI7A 4E6EA 2ID9A 1ID1A 3DVQX 3GN1A 3NM5A 4RZHA 4UE2A 1MO2A 1UBNA 4ARCA 1YZKA 3K6RA 2MCFA 4CKXA 3QELA 2M1ZA 2IODA 1RXCA 1UODA 2P91A 1IXKA 2RGEA 1VMDA 4FIZA 4UHJA 4YJHA 1JWLA 2AIRA 2YVQA 5FA8A 1V7CA 4HRVA 2XLBA 5EUMA 3W4KA 2IDJA 3RQSA 4EYEA 1TUBA 1SOUA 4P81A 4XKJA 2QL9A 3P52A 3G13A 1HEIA 4M1TA 2P9GA 4Y6LA 2WB2A 3MJCA 1A5ZA 4XR4A 2JH9A 4RCYA 4Z9BA 3DOOA 2XMPA 5A71A 3SKXA 5JCJD 2XMQA 1E7YA 3C7TA 4ER5A 4ZV4A 5CIQA 3UH1A 2D5CA 4E12A 1FDOA 1H23A 4R8RA 2IV2X 5C8YA 2ZIFA 2IUTA 4RIFA 5IBCA 3HCNA 2YHIB 2QM7A 5ARDA 3U4QA 4HGZA 3KXPA 4BMZA 1IHUA 1MU0A 1M2OB 4YRJA 3HYSA 4W8OA 2WVJA 3RVJA 3U9SA 4BGUA 3L6BA 2R7KA 4RKRA 4WKOA 2ZRCA 4KXUA 4Y6GB 1HOXA 4WN9B 3V1YA 3N3BC 4X8OA 3ZNNA 5FO0A 3PUYA 4BB0A 1PEDA 2W6ID 4NAVA 1XEXA 1T9CA 1SZCA 1N5MA 3DE0X 4I9FA 2Q3DA 2WOOA 3AUAA 3NWEA 5L3QB 1J8FA 1VZ2A 3NDJA 3E5MA 3GJTA 3UO8B 5IUNC 3PC2A 1AHIA 4QUBA 1E96A 2Q5HA 2XI4A 1JDZA 1Y5MA 3U7FB 1L3BA 4Q3LA 1MO6A 2I2AA 3BGDA 3NUQA 4DBVO 1V3UA 2G4VA 2JJQA 5K2OA 1J6UA 2PD4A 2FR8C 4MVJI 1HG1A 3LE8A 2FPSA 5DX1A 1NXWA 3IQHX 4CDRA 3G9UA 3EH2A 1XEWX 1SBZA 3ET5A 3IBCA 1G17A 4X24A 3LW8A 3MGBA 3ORRA 4Y2HA 4W5QA 2E21A 4LVUA 4NU5A 1HSOA 1A9SA 3ON5A 2WINI 3VR0A 2VWPA 5CUQA 4BX0A 5AUOB 1IY0A 3RYHB 2CJWB 6YASA 1B26A 2E7ZA 1H9BA 3MT8A 4LRXA 3LLMA 1UEJA 2OHXA 2Q21A 1XP8A 1PZEA 4XGQA 4K88A 4I4TB 5FIUA 3QF4B 4FOSA 5HNKA 4TL9A 2EATA 4ZZ1A 1JSCA 1KY4A 1XJ5A 1FX0A 2Q0QA 5EHQA 4L7VA 3DMYA 1NTRA 1NPYA 4DRZA 1O54A 2FOXA 2BDEA 2I55A 4RORA 2Q7DA 4I9HA 5CCEA 5JNUA 3RW9A 4KX5A 4O1IA 3T4XA 1OB2A 2G77B 5BURA 3O7MA 3FVRA 2FOLA 2W2MA 4PGHA 2WHRA 3MSXA 2QN3A 3N3AC 5TV2A 3SX0A 2BFMA 1KAOA 3JAMA 3CMMA 1OJLA 2WJZB 1WBDA 1G7CA 3DBRA 1JQ3A 5TF4A 2JRCA 4U2DA 2WZBA 4ZEXA 1DO2A 3H8SA 4AKGA 2PJZA 1RE1A 5LMCA 1JHRA 2RG7A 3H05A 3L7BA 4GL4A 1C1DA 3W3ZB 2I54A 2GA8A 1W96A 1XKXA 2V0NA 3R0VA 1Z35A 4NPHA 4AY3A 2D7DA 2XITA 4MGZR 1SIUA 3Q7PA 1MX3A 1QU3A 2BJHA 1YE8A 4KIWA 2XODA 2D2FA 2I2XB 4EHBA 4MWCA 3U9LA 5FLEX 3SOZA 2A78A 3U1VA 5LJLA 5KEIA 1CR0A 4P98A 4QU8A 1DP4A 4DUGA 1FYFA 3EXG2 4F0JA 5F9HA 2M6SA 2H0AA 2ZT5A 4NJMA 4RJLA 1EQAA 4C2TA 2F3RA 2BM0A 3ZG6A 2FEPA 2DHEA 1EE1A 3ENVA 4JP1A 4CM6A 5JARA 4AYXA 4B4DA 3PPYA 3EAQA 2LCIA 3I4LA 4XCXA 3RADC 5TARA 1ZX1A 4IDCA 3OC0A 4QDTA 5JJCA 2UZIR 5LQMA 4WK6A 1IEVA 4CEJB 4MS1A 4CIAA 4XVRA 1W2WB 1V1RA 4NFHA 5JNTA 5A62A 2IYZA 2FPIB 3TMYA 5DHTA 3VISA 2QRNA 3QOWA 4KXQA 1OX4B 3R5FA 1N1GA 4A26A 1UBJS 1JLKA 1ZSYA 1TJ3A 4AJ2A 4TVBA 4UW9A 5IT4A 3GFTA 4YQEA 5B58T 1OXUA 4Z49A 5ALSA 1P19A 3BMQB 3IA7A 3LUPA 3VPSA 2NMVA 4GD3Q 2W58A 3M7IA 3N2GB 1SCKA 1S2NA 1P9OA 1E8NA 4NZ9A 2VQDA 3EOZA 2YIMA 4PIMA 4MNTA 3AI7A 4YFYA 1E8MA 1GA1A 4LXHA 2BOVA 4KTTE 2ZWPA 4DANA 4B0OA 2GBGA 4UHEA 1UKVY 3LX4A 1AKMA 4KWHA 2FMTA 1D7OA 1JJBA 2V58A 5J2UB 5K01A 1D07A 2JFWA 4KXYA 3OEHA 2DBQA 1R8YA 4B8ZA 2AJDA 1ZKMA 4BO9A 2OTCA 1ISSA 2HBYA 2O2GA 1SBTA 3GDGA 5I7SA 3FNIA 4PXYA 4R3NA 4YP9A 1D9XA 2MHCA 3N8GA 3STTA 3IPYA 2NSLA 5CBKA 5A9RA 2I6XA 3NRJA 3OOEA 1TKCA 3KQLA 4HTAA 2GZ3A 3AFNA 4R1MA 2F1OA 3GVIA 2ZRPA 1XDGA 1M74A 3IOEA 3PLAE 3ZI0A 3RVPA 5J4VA 1UBRS 3QU9A 4A0SA 1ORWA 3MMPA 4WV3A 5G1PA 2IOHA 3RC8A 3V46A 1I1HA 1RLUA 2MOKA 3COZA 1UJNA 2R8BA 4ZJUA 1AXEA 4FYJA 2Y1WA 1X0XA 5TSDA 4FILA 2V74B 1OA0A 2FZ4A 3A6JA 1EVQA 1FMTA 4IGFA 1MC8A 5E7JA 1FTYA 3EW7A 1L8OA 4Q9NA 1E6EA 2AFIB 2D2EA 3E22A 5DBOA 3UMFA 2QM8A 1OWPA 1Z15A 5IAAA 5E2IA 2VN8A 3IAS1 3QUCA 4ZI7B 1OIXA 4C0HA 3EVCA 2A9VA 1KFEB 1E1QD 4RQTA 1QP4A 4JP5A 4RV5A 2YYYA 4BBJA 2OBFA 5HRCA 2AG5A 3MTJA 4JKIA 2ZSUA 1FSPA 2XMCA 4UNQA 1VPVA 5FLYA 4UHBA 4TV9A 5SY6A 3H65A 1OBFO 1Q7EA 4ZHQB 4KH0A 4ENSA 5C0OE 2P40A 1TZCA 2IHVA 4ZQGA 4QJBA 4I55B 4BDSA 3ZTYA 1G18A 5AM0A 1HO3A 5LB4A 2VHUA 3VDMA 3L5OA 2F3QA 3TK1A 2BHLA 4EO9A 1PQPA 5DLPA 1YFLA 1LDGA 1Z6QA 2QGZA 2O8BA 3JVVA 1CNFA 2ZATA 4ZTBA 1VB3A 2C7QA 1QAMA 3N74A 1PTJC 4E5DA 2VYVD 1MGPA 1KS9A 1DFGA 1KK1A 1O7JA 4TLCA 4WVFA 2PGOA 5K8IA 1WL8A 1PZNA 1P3JA 2CUNA 1EWTA 1WMFA 2O4CA 1C14A 2WNSA 3B12A 2D5BA 3GQBB 4Y1RA 1JQAA 5DNEA 2A5YB 3C48A 4Q9AA 1AY0A 1OWLA 5EAIA 5FPQA 1KMQA 4J3NA 2A0FA 1GM5A 4WOCA 2XRZA 5ADWA 3EQ6A 3U26A 4BMVA 1IH8A 2PV7A 5KSZA 3H6HA 2O7SA 4F56A 4LCBA 3D43A 2XKAA 3GJ3A 3GZNA 3K4QA 2VQSA 3DWFA 5LNK1 1UXGA 3OLYA 1CJCA 3ABIA 4OSEA 3LFTA 4LQDA 1Y6ZA 2I78A 3BEOA 1E94E 1U9IA 2QORA 4UFOA 3G0GA 5CB4B 3CS3A 1Y34E 1RRMA 1LW6E 3THSA 1SXPA 1L5NA 5IDQA 4CN8A 3DD1A 4QTTB 4UCQA 1THTA 2R6HA 3ESZA 1LI7A 2WSBA 1JQLB 1OAOC 2YINC 3FOWA 3FNRA 3GJXC 4GW3A 3TI9A 3L04A 4OGKA 2IWRA 3A6FA 1KFJB 1KO1A 4YMWA 5KNBA 4C7JA 1FVXA 4KQIA 3B9QA 3BXHA 2H63A 1MCZA 2ZSIA 3CUWA 3LDFA 4HXYA 3QXGA 1N1DA 4G4GA 4FSHA 2LGJA 4HQRA 3RVOA 5KDOA 4RTPA 1YQEA 3EZFA 5D3MA 2CHEA 3OZBA 1P1BA 2I2DA 3N53A 3F5MA 4RVNA 4NG5A 4L78A 4PBSA 3O8NA 3VH3A 2GZHA 4CV0A 4TS9A 4D42A 5IT5A 3NJ4A 2P2NA 2ODTX 2J9GA 5LMUB 3P2MA 2WF8A 3RSOA 5HZHA 3M6IA 4BFCA 3R5SA 2WF9A 4M9QA 2XXBA 3A1DA 4YMGA 5F98A 1IM5A 2AYYA 4UAVA 1QYDA 3H9UA 3VX3A 2QX6A 2W83A 2WU1A 4D9BA 4DAEA 1Y8RB 4OY3A 5G4LA 5B3LA 2GZMA 1G98A 3O8CA 1G9TA 1I3LA 3ZJ5A 3QX9A 1DJNA 2J3MA 1YOVA 1NVGA 1SXIA 5LBIA 2NTJA 3CX6A 4IMRA 4L3WA 3B85A 2KX7A 1EDDA 4MUFA 2XXAA 5DWDA 3ZY6A 1T8UA 2XTMA 3D6JA 3KLOA 3V1NA 4AY6A 1QIKA 2CBGA 3TUJC 1AMUA 4YQFA 4XWOA 2A1UA 2IYOA 1W6RA 3DULA 4JC4A 1M2JA 3PFIA 5IJZA 2ZTUA 5HK9A 5B55A 2QRUA 3IJPA 4NEQA 2H65A 5BY2A 4Z4GA 2WFAA 3KM0A 2G0AA 1DRKA 3ROZA 1FF9A 2RHDA 4KDEA 1SKYE 4DT1A 2P9BA 4RVUA 3UQZA 5K0SA 1XMXA 3RSQA 4LYHA 2P6OA 2O3RA 3FYUA 3RC7A 5CITA 3UENA 4KNWA 5KINB 1IK4A 3ZLUA 2VXCA 2IS4A 3E35A 1UBKS 2JGRA 1GADO 4YJFB 1PSZA 2Q50A 5EZYB 3T7RA 5K3OA 2GAJA 1NNSA 2WM3A 1FQWA 2PWAA 4YK7A 3HC7A 3ZWBA 5JBQA 3U4GA 5DYYA 3WB1A 5KTYA 3CNLA 5DHFA 3RT9A 1USUA 1QFSA 4WXYB 5HJEA 4PLVA 4BVAA 1O1YA 2WG0A 5FORA 5GVSA 4EHDA 4BQOA 3MUEA 3W05A 1J97A 2CFSA 1LDYA 1C2TA 2JAHA 4XJTA 4M0LA 2Z98A 3T7EA 4GM1A 4BXOB 3CUYA 4PSAA 1GTRA 3COJA 1D4FA 1P75A 2GLXA 5I5GA 3PTAA 1RKQA 5IJ9A 2P4EA 2JHPA 1RCUA 1P0PA 4M4SA 2EKDA 2G4LA 2O6LA 1RYDA 5GOTA 4IFBA 4CHTA 4HC4A 3H6KA 3EWIA 4KWCA 1KEUA 4RLFA 5FPHA 4E32A 1NQXA 3NHZA 3U7IA 5SYNA 3NHKA 2BH2A 2VZEA 4URZR 3RFVA 3WOVA 1F7VA 2PX6A 5ALJA 3GUCA 3QVUA 2KE5A 5CIWA 3B1VA 5FBKA 3VYRB 4UBJA 3EUWA 1SC4A 4AMVA 4KQ6A 1KDVA 2AF4C 2CDNA 4IOKA 3NCHA 3CUVA 4RS3A 3NBZC 2OZLA 4HUJA 3H1PA 4LIPD 4CFZA 4I14A 1KMCA 1P7PA 4H08A 4O1HA 4EW6A 4ZMBA 3UMYA 4TTVA 2A58A 1GGKA 2WJ6A 4TYMA 4NPAA 4YCNA 1SIWA 4BO6A 1SU7A 2BISA 4QUIA 4LOKA 1IBLB 1YJCA 121PA 1UK6A 2C4UA 2AEFA 4TMFA 5HJ7A 1VSUA 3NAZA 2VPIA 3PFBA 4CLRA 3IQGX 2IEDA 4UCXA 1VBNA 4Y7CA 3SZMA 3FLBA 4XIIA 2FZGA 1T15A 4XIYA 1DTWB 1DUSA 1JDJA 1Y5RA 1D9ZA 2BM8A 3AWIA 3BG5A 4MR7A 5K0NA 4UULA 1D2NA 3DMGA 1US8B 5TQ2B 4D9EA 2FSVA 2C96A 3X2FA 4DR5B 5JQWA 3W04A 5KOYA 5JJKA 1JT2A 2IC5A 2VQFB 2E85A 3EHEA 1POXA 3QYFA 3H5WA 3WIOA 1VHTA 3UM9A 2AEEA 3DVLA 1K3TA 5CX4A 3DEFA 2GD6A 3TKAA 1MLDA 1PV1A 1SVLA 2ZWOA 3AJ8A 2DPGA 3I23A 4FIDA 4PIPA 3U4DA 4ADSG 5CCDA 1IM2A 2XYQA 2H06A 4RKEA 2NZVG 5B1IA 5K3SA 2AI1A 3U17A 4Q1EA 1FNNA 4ZQHA 2X1VA 5DM1A 5INTA 2BUBA 3DT6A 5EJ7A 1YXMA 1TCVA 2L0XA 4ZEVA 1P39A 5SY9A 1RC8A 2CL5A 1CDZA 1T13A 3F0TA 5KYYB 1L3IA 4M2LA 1T9KA 5COAA 2ECQA 1KHTA 1R10A 4RL6A 3JALB 3BGOS 3K8QA 1U3TA 1YC2A 3PHJA 4DLZA 4HRAA 5KUTA 1ADFA 3HNPA 1QGUB 2RKWA 4A5OA 1W59A 1C9YA 1SUDA 2R48A 3JWEA 4EKGA 4BAZA 3EF3A 3NMUF 3MQ2A 5LDGA 4WOKA 2VDJA 2G8LA 1UT5A 1OI4A 3COSA 2XIJA 3AONB 1WB5A 2RH4A 3E7FA 3ELWA 3B89A 5KJEA 3I8SA 4H4DA 2D0IA 3S44A 3MN1A 3I42A 5BW5A 3AK4A 1AQJA 1LA2A 1Q22A 1F2UB 1RYZA 2BFPA 2ZGVA 3TSYA 1T1RA 3HXPA 3H87A 2DULA 1U0OC 3C4QA 3MFYA 4HDSB 4ALMA 4B6GA 4C1NA 1GEEA 2XA1A 4ZC8A 2BGKA 4F4IA 5BMVA 4B46A 2BF4A 4NOLA 3ACBA 1WPRA 5A05A 1SCQA 1EJ2A 2O54A 1QPGA 1WCYA 4NCJA 3K8ZA 2MSCB 4X45A 1ZESA 5JYCA 1Y3AA 3H17A 1GPJA 3N05A 4C4XA 3DLCA 2VAWA 5ESXA 1YJQA 1I10A 2ALJA 4IQFA 4ROSA 4DNQA 2RGNC 4IDHA 4MW0A 2QJTA 4DF3A 3U80A 4LYGA 3LZ6A 3PGKA 5EEGA 2ZJOA 4AZ3A 3NC0C 1QQAA 1LSOA 1GU1A 3EQ9A 2QTGA 4C0BA 2F90A 1D2EA 2DP4E 5LIRA 4MA4A 1D2MA 2PT9A 3D64A 3IAFA 4LFAB 4DUGD 3C74A 3LKVA 4FGWA 2GS9A 3AG5A 4PNEA 1XZBA 1ZIDA 4KITB 1RBQA 2PWZA 2YOGA 2XUJA 3PFFA 4DPMA 3ZXIA 4YJ3A 1WV0A 4PNHA 4KR0A 3AL2A 2AMYA 4RSMA 2RBKA 4MW1A 4CMEA 1XNQB 1T25A 1I6WA 2SCUA 4DLAA 4FD3A 2WJPA 1W87A 1N5IA 1TYZA 3MRSA 3S2GA 2XUHA 4PX2A 4I9UA 2JK1A 3KCQA 4FJ2A 3CQ9A 4FKZA 1HSZA 1A1SA 2ZANA 1SKBA 1ORRA 3LW7A 4ID9A 4DSTA 3VJRA 2XE7A 5FOXA 5BSWA 1E2KA 3DC7A 4WRRA 4B48A 1R0RE 4XXHA 3FMVA 3PXAA 4MUNA 1T34A 1FDRA 3N2ZB 1MAAA 4H7DA 1V95A 3R6DA 3RUIA 3T7IA 1EUZA 2WJVA 1VYUA 2IE8A 2Z8YA 4MDYA 4DR2B 2PMBA 3IXQA 2FLWA 3BB1A 2W8BA 4H7HA 3RPEA 3AVQA 4J0CA 4EPTA 1BFUA 1M7GA 1X19A 4ZQEA 2XCQA 5K5EA 2XCRB 3PFKA 3O4JA 2H52A 1G3MA 2FWRA 3IERA 3NQ41 1XZNA 3ONNA 1QG6A 2E9SA 3RK0A 4H31A 4WD3A 5CEFA 4Q4JB 2NAFA 1D5CA 2J08A 2RAUA 3L8CA 3LDGA 2XWPA 2HDNB 4IY1A 4K6CA 3HYLA 4FI3C 1KJWA 3HABA 4PR0A 3ASYA 1HMPA 3PDCA 2PFGA 5EJ2A 1SVKA 2HA4A 4ISBA 1VPDA 5F2KA 4EVRA 3UJ6A 1DC5A 4IIUA 1E9EA 4B47A 4EY6A 1C7RA 3WRVA 2WD9A 4B3HA 3NW9A 5LP6A 1Q2UA 1RXIA 2Z95A 3G2NA 4DQUA 2BVNA 1TTHA 2BHRA 1M2HA 3IJEB 5HQ3A 2GD1O 1E2JA 3DOEA 2ZUTA 1F6DA 1N9GA 4AY5A 3TPFA 2CE7A 3WO0A 4Q01A 3ZLBA 1BD3A 2H07A 2G0TA 7YASA 2UZ0A 2WICA 4F06A 2A1TS 4QTUB 4RY8A 2B1GA 1EM8A 4BLPA 3HR4A 3R7FA 3C7AA 4YY3B 1T9ZA 1P7ZA 1R6VA 2H48A 4C1BA 2PKWA 4M86A 3TXAA 2EV9A 2EEPA 3CVJA 4XSGA 5CA1B 5D1HA 3CLTC 2FN9A 2DYKA 1TQHA 3OZGA 3PVZA 3U37A 2I0FA 3ENWA 2RI0A 5L7YA 3GP8A 1XKLA 1R5NA 3WNVA 2Q3CA 2VTBB 2AUMA 2G07A 3EVTA 5FHQA 3CMCO 1GEGA 3CCFA 4Q1BA 3SGLA 3CRZA 3STVA 3TOSA 2IL1A 1PJZA 2ZBQA 2W22A 3IPCA 1U2GC 4OQDA 3QVWA 3OPMA 5GONB 4ZEMA 2ZIEA 2NT4A 1VCMA 4QPZA 1P6UA 1VP3A 3H8VA 5AHXA 4ZI7F 4LTDA 4YECA 3UJ9A 2LP4Y 5T41A 2P6MA 4QU9A 1XO1A 1JR3A 4WY2A 1T6XA 2M6RA 2Z3VA 2Z8ZA 4Q9DA 4X7BA 3LRTA 3ZWAA 5LZ5A 4Y2GA 1BS2A 1YU9A 1JT9A 3KHTA 1W8IA 3MOIA 1XLTA 2WP0A 5B3JA 4AS2A 3A1WA 3LWBA 1JBQA 4ZOAA 2VQ3A 4FR5A 4ZHQF 1GL3A 5DNAA 3Q7RA 5B1SA 2GBPA 2WWHA 2A4KA 1SC6A 1Z0FA 2GAFA 1NIPA 1ZN9A 3G89A 4M1EA 3PUVA 1Q16A 3C4VA 1A77A 1ES9A 2VEDA 1WXIA 3BCSA 4AZ0A 4F84A 1EVIA 3OVMA 3KSBC 4YXWA 1GXSA 2ERYA 2J59A 4G8JA 4M1ZA 1MFPA 2YC4C 3C98A 4C0SA 5CAEB 4U63A 2N1BA 4J0GA 3TR5A 3X1YA 4DLVA 4UQLA 2B6HA 4EAAA 1UMBB 1T0BA 2X76A 4MV8A 5AW5A 1UEXC 2QX8A 1KYQA 2YXBA<