2FMFA

Crystal structure of chey in complex with chez 200-214 solved from a f432 crystal grown in hepes (ph 7.5)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fmfA00
1MIHA 1PEAA 2PE5A 3H75A 1JWLA 4OTZA 1ABEA 4RDCA 1APBA 5EWMB 1NXSA 1XWWA 3H5OA 4MS3A 4N0PA 4W5OA 3KLNA 2CD7A 2E4ZA 4XFKA 1HEYA 3DGFC 1NXPA 3HS3A 4YV7A 5I4CA 1NY5A 3ILHA 3OLVA 3FFTA 2H3HA 5CNKA 5IBQA 2FTKE 1USGA 3KG2A 4E7OA 4L4UA 4IGAA 5JNWA 2IYNA 1JL3A 5CNIA 3OQOA 1C4WA 2JBAA 4RY8A 4RSMA 4LDZA 2FEKA 1E6KA 3URMA 1YS7A 4DN6A 1DRKA 1KRXA 3EQ2A 1URPA 3OLYA 1RZRD 3UK0A 1RPJA 3H5LA 4MLDA 3VNBA 4KFCA 1DBQA 1JYEA 1U2PA 3HCWA 3DLHA 3CLKA 3F7NA 5TPZA 1EWVA 3NHZA 4Q6WA 2CHEA 3KTOA 3QLVC 4RK5A 4O1IA 3QLVA 2IPMA 5F64A 3M9XA 3EODA 1A2OA 3GT7A 4KQCA 4MS1A 4W5RA 4XLTA 2VYCA 1PNRA 3CNBA 1S8NA 3QX9A 3CU5A 3KYJB 2E4YA 3ROTA 4KPYA 4RWEA 4TMYA 5EWMA 2PL9A 1JFSA 4G0YA 3O2JA 1MB3A 3OM0A 4EVQA 2FSPA 4GNRA 3QEMB 5KQLA 4G0PA 4YS6A 3RVSA 5T7BA 2E4WA 2MYPA 4MPTA 2YHBA 3H1EA 2HQOA 3NHMA 2YHAA 1ZVVA 1LBIA 3OM1A 3O2SB 4IILA 3Q7SA 1ZGGA 1JBEA 1K66A 4EVSA 5FWXB 4Z4IA 4NV3A 3OLWA 1CYEA 1SXGA 1U2QA 1Z25A 1JFTA 1TJYA 4LRQA 2CWDA 1QP0A 2H0AA 2IPAB 3FMVA 1SRRA 4OBBA 5PNTA 4QYMA 1SD5A 2P9HA 1PNTA 2OQRA 4LX8A 4JB0A 2I6FA 4KQ9A 4YR7A 1QQBA 4EYGA 2QR3A 4KK4A 2WJWA 3I42A 4IRXA 5DCLA 4F06A 2IKSA 3LUKA 1A04A 3CG4A 3L49A 1Y1LA 3BREA 1U0SY 4F12A 3H5WA 3FDFA 1W25A 1XHFA 3GA5A 5EWLA 1DJMA 5JS2A 3N0WA 3EAFA 4MYRA 1DC8A 3K4HA 4Z99A 3O1JC 3QEMA 2FMFA 4RXUA 5HSGA 4EYOA 5DKFA 1TMYA 1B00A 1JF8A 1DBWA 4FB4A 3KJXA 3SAJA 1U04A 5BRAA 3G85A 5D2CA 3E3MA 3HDGA 3I09A 2WWVD 1A0OA 4Z4EA 1USKA 3HDVA 1JLKA 2PUBA 2LPMA 1DCFA 2E4VA 3DGEC 2HSGA 2VK2A 1YS6A 1NXXA 4QPJC 5EWJB 1WETA 3A10A 5KWSA 5TQ2B 1P2FA 4MRMB 4RK1A 3K9CA 4MR9B 3IPAA 4MR7A 6CHYA 2PUGA 3CG0A 3OO0A 4YO7A 3A0UA 3H1FA 2MYUA 4XARA 2FEPA 1R8JA 2F8SA 2HJ9A 3SNKA 2L18A 3LUGA 4ETNA 4PEVA 3C3MA 3O1HB 4JAVC 4OG2A 4FE4A 4PE5B 3BRQA 2FN9A 4TN5A 5DLEA 5JNRA 4NCBA 1LJUA 3DBIA 4WUTA 3N0RA 5KC9A 3N8IA 3A3KA 4O1HA 2FMIA 3H1GA 4KVFA 1JDNA 5HKOA 2LBPA 3KSMA 2FMHA 2NT3A 4ETMA 2JB9A 5TQ0B 2QXYA 3D02A 3EQZA 5CNJA 4ZPJA 3RVOA 1NATA 1Z15A 2FN8A 4Y9TA 5IC5A 4WZZA 1PHRA 4KREA 1E6MA 2ID9A 1DZ3A 5KC8A 3LUAA 3O74A 3O2QB 3OLZA 4G86A 1FFWA 2QU7A 5FBKA 3JS5A 3SM9A 1CHNA 3SY8A 2BGGA 5GOTA 3LUJA 4CBVA 4KV7A 1YMUA 1IIBA 1EHCA 5DGCA 4MS4A 2WB4A 3CFYA 1YIOA 5EWJA 4RY0A 5CNMA 1TVMA 5BR1A 1ZH4A 1Z2DA 2QV0A 4WXMA 2QW1A 4KNYA 4MR9A 5IUJC 2LP4Y 3HZHA 5IULC 1E2BA 4EYKA 3HM9A 4TLLB 2ZWMA 1YK1A 3HEBA 4Q6BA 3QELA 3JTEA 2JVJA 1UDRA 3LUHA 3OMXA 2NUBA 1PUXA 3GWGA 1M2FA 8ABPA 5FWYA 2E4UA 4RXMA 4GPAA 2FLWA 2FLKA 4ZYLA 1DCMA 3C97A 5HQJA 4H3HB 2B4AA 3TMYA 1L5YA 3F6PA 3JY6A 3ROFA 4F8JA 3NNNA 2IPNA 4OATA 5TQ0A 2PUCA 3DLBA 4KRFA 1NXTA 1NXVA 4QICA 2GWRA 5IX8A 2GI4A 3Q9SA 3B2NA 5TQJA 2IPLA 3IP7A 1LBHA 2MYNA 3JPYA 4LE1A 4D6YA 3CKMA 5GQSA 4S05A 3RQIA 2R47A 4WXEA 1CEYA 3IPCA 4G0MA 1TM2A 4NICA 1JHZA 3QK7A 4HNQA 1P8AA 2FW0A 3H5TA 1DBPA 1AB5A 1GCAA 1M5UA 4W5QA 3UKJA 3CZCA 3UUGA 2OENG 4TLMB 4UHJA 5TPWB 1QO0A 4JB2A 3TD9A 1Z26A 3O21A 4QYWA 2FEWB 5ABPA 1U8TA 1E6LA 3KHTA 2R4QA 2RJNA 3QEKA 2LIVA 4MR8B 4LE0A 1PEYA 1ZGZA 4MQFB 1JH9A 2WMYA 2A9PA 5IUNC 2VUHB 4D6XA 2FQYA 1RNLA 2PAFA 3HV2A 4G0OA 5JNVA 3GL9A 1QP4A 3GV0A 3RVKA 5KQMA 4IF4A 1D2AA 1QKKA 1ZDMA 1DP4A 2O20A 4YWHA 2GKGA 2NZVG 3T6KA 4E7PA 4XASA 5CHYA 1SXHA 4DADA 2ID7A 2FMKA 1MAVA 1D1QA 1GUDA 3EGCA 1YMVA 1TLFA 2HQRA 3C3KA 4P98A 3KS9A 4Z4FA 1KGSA 1GCGA 1EAYA 2GX6A 3H6HA 3H6GA 3OMWA 3P9YA 3LUDA 3IP6A 3N75A 1J56A 2PMCA 3N53A 2PUFA 4Z9AA 1BAPA 3C6QA 3JPWA 4RXTA 3HSYA 2E4XA 3GBVA 5FWXA 3RVLA 3R0JA 5IEJA 2NT4A 1FFSA 3LOPA 1BDHA 3GBPA 3H5VA 1P6UA 1KMIY 1YK0A 5KI6A 5BQ3A 4S04A 4MQEB 4ETIA 4Z4CA 2V0NA 5E3JA 1DG9A 1L5ZA 1Z13A 2DRIA 3N0XA 3Q7TA 3VNAA 4DQDA 4N47A 4RK6A 2X7XA 2AYXA 4MR8A 1BA2A 5JNUA 3FFXA 5ED4A 1QPZA 3D8UA 1VKRA 1Z16A 1DCKA 2LUOA 3MA0A 1RXIA 3E61A 1D5WA 1NTRA 2JBAB 4RK7A 3A0RB 4PYRA 3MF4A 4JOQA 2FQXA 3CHYA 1ISRA 2PLNA 4EY3A 3LUCA 5KQPA 1FFGA 3T95A 3L6UA 3BBLA 3QX8A 4WWHA 2RJOA 5C5CA 3GYBA 2L19A 4RY9A 3RH0A 4G97A 4LZLA 2QVGA 3CRNA 3LFTA 2NZUG 1NXWA 4YLEA 1ZY2A 1Z12A 3Q15C 3QLUC 1ZN2A 1VPWA 3H5IA 3MIZA 3QLUA 2L17A 4OLAA 4XAQA 2MYTA 3NBMA 4P1ZA 3EULA 3OQNA 4W5TA 4ML3A 2A9QA 5FBHA 2PUEA 4RK0A 2HPHA 3KCNA 1QMPA 1FQWA 1W9HA 3LTEA 4YP9A 3SQNA 1M5TA 4NCAA 4F11A 4MAAA 1DC7A 3SG0A 4N76A 1MVOA 5TQ2A 4MRMA 5T3YA 4IMIB 3Q7RA 1AB6A 1I3CA 4MQEA 3NNDA 4EVRA 2PJUA 2M98A 3MQ4A 2RGYA 2QVCA 4Z4GA 4JA2A 3HUUA 5IUKC 4G0XA 2WY2D 4RKRA 3N6VA 1H9CA 1RZRA 2WJAA 5TPZD 2FQWA 3FGZA 3RVMA 3I5AA 4RV5A 3CZ5A 1JDPA 4UHKA 2W42A 4YRZA 2MSKA 4MLCA 5IEBA 3JVIA 4JP1A 3OLXA 4G0QA 3T38A 1ZHHA 2FKAA 4Z0NA 3G1WA 3RVPA 4N0QA 3KKEA 3LKBA 3GRCA 4KZKA 4EUKA 3I45A 2A9OA 1OXKB 2PKXA 3IDOA 1DRJA 3QLTA 2XDYA 3RVJA 1ISSA 3HO1A 1ZESA 2TMYA 3TB6A 2MSLA 3RVRA 4OLBA 5EWLB 2PUAA 2AYZA 5JNSA 1BDJA 2JCGA 1Z2EA 1ZITA 4Q7EA 3MYYA 4IMJB 5HM6A 3O1IC 2R25B 2ZAYA 4O5AA 4WT7A 3F6CA 3NNSA 1Z18A 2IOYA 1QO0D 4RKQA 3HVRA 3DZDA 4LE2A 1D4ZA 1JYFA 2HQBA 2M1ZA 4JASB 5B3JC 1YTUA 4YGXB 5KQGA 3IP9A 5B3JA 1XHEA 3KYIB 1ZAYA 1GLGA 2QSJA 4G0ZA 5DTEA 3O75A 4MGEA 1D1PA 1EWKA 3TX6A 4EYQA 1KRWA 2JVKA 3EDCA 3EJWA 3RVQA 5JS1A 1VLZA 1Z17A 1F4VA 4MR7B 3W9SA 1M2EA 2PUDA 2J48A 1FSPA 2JK1A 4W5NA 4Z4HA 4L85A 1QNLA 4KK3A 1MB0A 3T8YA 4ZMSA 2JVIA 4H60A 5C5EA 3BILA 5TE9A 2KYRA 3TO5A 2WRZA 2FVYA 2R48A 1YVUA 2RDMA 2B1JA 1OXBB 3HUTA 1VRVA 2L2QA 1RXEA 4D74A 3FFWA 3LUFA 4H3KB 1LJLA 4MS3B 1EFAA 4ZMRA 2GBPA 3MMNA 3HJFA 4HNSA 1EWTA 2PL1A 5TPWA 1F51E 4KMRA 9ABPA 4EGSA 3OO1A 3KLOA 3M9WA 4RK4A 1JFVA 1BVHA 4PICA 1ZH2A 1USIA 1P6QA 4Z9BA 1T34A 4YCSA 2JRLA 3LMKA 2N9UA 4MQFA 3M6MD 3Q41A 4B09A 1C0EA 2QZJA 1ABFA 3LKVA 4LDAA 4N03A 4XXHA 5JNTA 1BDIA 1SXIA 3ILYA 3CTPA 4PZ0A 3MM4A 4MS4B 4HNRA 2VUIB 2F8TA 1LK0A 4RU1A 4RZSA 5BRJA 4NQRA 4HYEA 3HXMA 1K68A 2MSWA 4M88A 2FXIA 2A9RA 4FE7A 3C3WA 1JX6A 3JVDA 7ABPA 3OQMA 3F73A 3CS3A 2Q5CA 4F3TA 4ZJPA 3IP5A 3QELB 4RS3A 3S99A 1QQAA 2IDMA 1QP7A 4N41A 4MS1B 2CHFA 3HK2A 3BRSA 6ABPA 5FWYB 1NXOA 3RVNA 2P4UA 1GUBA
chains in the Genus database with same CATH superfamily
1PJCA 4M1YA 4F45A 1PEAA 4ER5A 4OTZA 4QAJA 4EKDA 2AJCA 3NANA 3H5OA 1J23A 4BBPA 1V96A 3PQCA 4NMXB 4ERNA 2I5PO 3IH5A 3AUUA 2HSWA 1I13A 2JD2A 1U3TA 3W2EA 1Z2NX 2OYCA 3KJFA 3TZQA 5I4CA 2VL7A 5IT0A 3WFZA 1JHOA 1PGOA 5CNKA 2WT8A 1DFIA 3KG2A 2XCTB 1IU9A 2ZQZA 2C99A 3QU7A 1O94D 2R79A 5JNWA 3KYCA 4FLMA 4P5EA 1CIVA 1GNRA 3OEWA 4K9QA 5LP6C 2WK1A 4BZXA 4ROTA 4LWPA 4PGHA 2W6JA 4PHFA 1ZUD1 1CSEE 4C0WA 3W3AA 3NYIA 2PRYA 4P81A 1IMOA 5ALQA 1V2GA 2XODA 3H5LA 3EDYA 4Y0NA 4J2TA 3TI9A 3V1LA 4AJKA 1ZS9A 3S28A 1ZFNA 3ZI0A 3DMYA 5IT9A 4AF6A 1WZNA 1HC7A 4ZI5A 2VLIA 2A7QA 4QXAA 1JR3A 2ZJ4A 1R5BA 5K4GA 4L4XA 1HDRA 1R10A 5HCNA 2N0SA 1E62A 2IPMA 2P9JA 1LFDB 3OZGA 2WG2A 3D81A 3BGSA 2C5FA 3LRXA 2C3MA 4EK9A 2XH8A 3AWIA 5ICFA 2BZGA 2ZIAA 2CE7A 2HBQA 4OMCA 4G5QA 1QPBA 5ENZA 5IP5A 1PJ2A 3WGNA 5JCJD 4ZZIA 1CQIB 5HK9A 1JZTA 5K4HA 4QXPA 3NG1A 2P0AA 3KYJB 3DC7A 3GT0A 4U9HS 4IIEA 1E77A 4LOAA 5FA6A 5IJZA 3CNHA 4G8CA 1H3NA 1NX9A 1OPRA 3VR4H 2V54A 4ZJYA 3DDSA 4TTJA 2FR8C 3CM0A 3FDJA 5FO1A 4CIVA 2I6XA 3CVXA 4AWXA 3GVPA 3F7MA 1HFJA 5MDHA 3RQSA 4BVHA 1CV2A 1R4AA 3L93A 5F51A 5D51S 4GLLA 5KU1A 3GFOA 4UOQA 2OOSA 1PLKA 4HEA1 4IDOA 2YXBA 2B20A 1CG6A 1UKVY 4O6VA 1FMLA 4O4JB 2QZSA 2H4YA 3EDMA 3NVAA 1RAHA 3JQCA 3P2YA 3PYLA 1TUEA 4B82A 4F1KA 4FBLA 4R31A 5ERGB 2AHOA 4LMRA 5FFMA 4BBZA 1LS6A 4FMCF 2ZIUB 4QQRA 2WMNB 3R3XA 5DASA 3IEVA 1SXGA 1RBMA 4Y1RB 2JFUA 3K15A 5ENDA 3WMRA 3ADKA 3MT8A 2AOXA 3AR4A 4ZT6A 4IO1A 2ZBDA 3VPBA 4ENPA 4L76A 3W3AH 4TROA 1G8GA 5HIKA 1SZDA 4S1WA 1WTAA 1VKJA 2GSWA 3KV3O 1OT5A 1TMOA 2XD4A 3KYDA 1G60A 4AUNA 4EB0A 3UXEA 1JZSA 4JJAA 4KK4A 4ODIA 5EERA 3VVBA 4YRJA 5AKGA 1H85A 3GR6A 3FTDA 1I4LD 4HX9A 3L7IA 3BL8A 3UJDA 1JN0A 3CLRC 2Q5OA 1D3AA 3Q3GE 3OHMA 3OIGA 4WOCA 1WQ4A 5DBFA 1BO6A 5LUBA 2AXEA 1FCJA 3K4HA 2UYGA 1RFLA 1SAYA 1U8EA 3NT5A 2WTNA 2XNKA 3PR1A 5CCXA 3I1YA 4LW8A 1XD2B 1PR6A 2AT1A 3OM8A 4BAUA 4QPDA 3K3PA 3EOZA 5DKFA 4J0FA 4L9WA 3GLGA 2Y1FA 3C3DA 3RFTA 1U0JA 1KAGA 3M5CA 4K40A 4EG3A 3DOCA 4AZVA 5C31A 2D6FA 4PFQA 1QIMA 4RGBA 1E3IA 5A05A 4F2PA 3RAEC 4OYHA 5FLEX 2YXEA 3C74A 1JLKA 2BDUA 2LPMA 2IC5A 3HB4X 5I3CA 1R7RA 2W22A 3VO2A 3P4YA 1U3FA 5FA5A 1WKBA 2ZM6B 2G9QA 1JPJA 3JATB 3ZDZB 2JKZA 1O6FA 1KK3A 3CLTC 4P7JA 1KFEB 2HSZA 3MMSA 3A0UA 4FMBB 3TPCA 2DH5A 4MGYR 1F0PA 2B0CA 4IBOA 2YV1A 3A3OA 3BIFA 2I03A 1LDBA 2QTGA 5JV5A 4ZYWA 4ETNA 5L51A 3ENVA 4TN5A 4HZUB 4QRHA 2B1RA 4IUCS 1ZAKA 3Q88A 3WYDA 2V7BA 1XE3A 3LC1O 2YS6A 1MUUA 5AJHA 4NBUA 2IHKA 1K6MA 1FBTA 1UM9B 3EEBA 5I7AA 5FLXA 1EVQA 1SUPA 4FS8A 3CH7A 4N7MA 5HTOA 4UDYX 3DL2A 3R4VA 1KETA 3K9GA 1Y5MA 3JARA 1TVKA 3ABSB 1OFTA 4FR5A 2I4NA 4MPPA 3ZWWA 1UBLS 2E37A 5LDDC 5CYFA 3HI4A 3ZGVA 2OL4A 4OV6B 3VVMA 1XJ0A 1I6KA 4DC1A 2JC3A 1VHLA 2E55A 3OPQA 3JYPA 2IXAA 1EVYA 1YZYA 5IJXA 3R5JA 3MPOA 3WKBA 4UFPA 2K5UA 5GOTA 2SKDA 3IQFA 5ER6A 4GBJA 1M2NA 4RHYA 1IIBA 3H7AA 3QVUA 5HJEA 1RHUA 5FTNA 4EI2A 4YPOA 3DQZA 2V8BA 2YDYA 5JQGA 5KCMA 1NGSA 5G1PA 1EFDN 3E4DA 3N2IA 3FYCA 1QRRA 2C8KA 4IJ6A 4GUDA 5JHHB 3P19A 1AO3A 4ND3A 1PJZA 4YV2A 1ISIA 1XCMA 5KTKA 1F5SA 2EQAA 5F33A 3HEBA 4MEBA 4GM1A 2BSQA 2CCJA 2NUBA 4DV2B 2D2FA 4MW0A 4LFAB 1ZWKA 2C83A 1TAGA 2XUQA 3BIJA 3HVUA 1IM8A 3PC3A 3U7QA 5DK4A 3MIIA 3RBZA 1YFLA 1AF4A 1OAKA 4B83A 4RX1A 3WWDA 7MHTA 3VPHA 1PEKE 3EY9A 3GUYA 3VH4A 2JL1A 3VKUA 5ADHA 5CK4A 4NEGA 2PUCA 3SHVA 2WAOA 5C34B 5GINE 3E5RA 4DJDC 3STTA 2C00A 2IQIA 5JSHA 2JCSA 2MYNA 4HF7A 5T8KA 1M8JA 5C3UA 4QG7A 4GXNA 4N6NA 2G36A 2NSLA 4ZARA 1WB5A 4UAGA 3RCBA 2CSXA 5IYZA 3GA0A 2ZU0C 1JHZA 4M49A 3FWHA 4RAQA 2F3UA 4UAUA 4Q9IA 5B4VA 2X2FA 1G2PA 1POXA 2I33A 4TMTA 4YP7A 2OBYA 3DP7A 4PNZA 4BX0A 1BOFA 2QLJA 1YULA 1OWNA 1J39A 1D6MA 1IEVA 3O92A 4AJ1A 5HZHA 2VJMA 3ZD9A 1EG7A 1QO0A 1SUSA 1E20A 2EBWA 3L8ZA 1T0UA 3PL1A 1E0AA 2K6GA 3F78A 4A7PA 1JGTA 3G5UA 3HACA 1WVMA 1QB8A 1K97A 2ZCVA 5B58T 2CEAA 2HDOA 1XPOA 3LHDA 2YV3A 3RRJA 1TU0A 3PD0A 2Y68A 1I7PA 1O5TA 1WD5A 2PGOA 1HH4A 3T1TA 3WKCA 2CMDA 4NIMA 4DY4A 2QJOA 5DZSA 4A2QA 1Y4DE 2GPNA 3DTYA 4LC0A 3Q10A 3H2SA 2VPXA 3U48A 2P9YA 3A70A 1D2AA 2NU8B 4P34A 2XMBA 2OP0A 4EMUA 2QQ5A 1N6RA 2GN8A 4QDOA 1PYGA 1SXHA 3N8HA 3P4XA 2W2LA 3AFNA 3W2FA 1SN7A 2RI1A 3YASA 1ZM4A 2HQRA 5KPJA 1YO6A 3D3JA 4EG1A 1YZKA 2FW6A 2GX6A 1EAYA 1BWPA 3PNMA 4O4LA 1BMTA 4HYYA 4BV2A 2HWUA 3H1BA 2BI4A 1VI2A 2I1QA 4UZEA 3MTDA 4RVGA 1YGPA 2M6SA 5CLIA 4H1UA 3K9QO 1BGXT 4PLGA 4YYEA 2EF0A 4CM6A 5EXDA 4B8YA 1FFSA 5EP2A 4QULA 4YAOA 1NU6A 3HBLA 2QR2A 3QUBA 1ONBA 3HKEA 1W0KA 2Z0MA 1I5EA 1MAAA 3L6CA 5K9ZA 5IVKA 4RQTA 1R0YA 4L0MA 3K72B 1JFFA 1ULTA 3IEIA 3FROA 3NTVA 1XZHA 4DHWA 1MEEA 4H7FA 1UBRS 3MA0A 5ECGC 5EY5B 2BSAA 1WEKA 3RBVA 4RK7A 1NVVR 5FUYA 3EC7A 4DW8A 4BL5A 2VAPA 4NFYA 4TSKA 2XRZA 1CZLA 4MIKA 3AFIA 3GOHA 3HJGA 4WK0B 4PPGA 3RROA 3L6UA 2W90A 5HIIA 3R44A 3WLAA 5ADVA 4RY9A 3GELA 1NLUA 1E3LA 1HTBA 3DWIA 4IQ8A 4UBIA 2DF8A 4QTTB 1O3YA 2EZTA 2PUVA 2XUPA 3LF2A 1ZN2A 1NW6A 3NOXA 1LU9A 4J6EA 4QGBA 1DFHA 5C1IA 3WNVA 3P32A 1A5AB 3Q9UA 3K5IA 2YBEA 2GZ1A 3T3PB 3UWKA 5FRDA 4LXUA 4D02A 2WJ6A 3PNLA 4MQMA 2FZLA 1PJBA 3UTCA 3D6VA 5FBHA 4PC1A 1SXJC 2CVOA 3H9EO 3TRJA 4J8PA 5LOVA 3KCNA 1TD9A 1JKJB 2O6LA 4FFRA 1P45A 1U8FO 2QKYA 4Q3AA 1THMA 1CR1A 3KEQA 4KHZA 1BGVA 2FPKA 1Z36A 2G77B 3DT9A 4RJIA 3SJZA 4RPHA 4V0RA 1IN8A 2JJQA 2ZSDA 4JEMA 5JDCA 4DCPA 3HKCA 1JEDA 4MRMA 5KJEA 4D0LB 4N5LA 5COAA 1RMYA 4U3JB 3AVUA 1JJ7A 1GPMA 1ZO8A 1U0RA 2A67A 2PJUA 1YJXA 2WFMA 3GB9A 3HGMA 1ZL2A 1M75A 5AXAA 3RFUA 3KSAC 1P2DA 1OMOA 1ZISA 3GUCA 2NYVA 2PBLA 2YX1A 4UBNA 4X90A 3KOWA 2VHWA 3GROA 3AEQA 3ZH9B 4FHGA 4DKJA 5JD3A 1B6RA 1GNQA 2IPOA 2ZIWB 4OXNA 3VR0A 1S2DA 5IKEA 5A3VA 1I6WA 5IEBA 3DOUA 4O2BF 5FHQA 1FTWA 1Y33E 1UAGA 1EM8A 2H3EA 2HT6A 3ZCXA 1IWBB 3I9V6 1YCGA 5P21A 4C6TB 2J3DA 3RBXA 3ZE2B 5EYPB 1XTVA 1ZHHA 1WPGA 1SOVA 1Y4SA 2X8LA 3DDWA 4Z0NA 5L3SB 1BVUA 1IXRC 1ODFA 2OV2A 3FPLA 4I50B 3HBNA 5B7NA 3FJYA 4RL4A 3H0EA 2ZSAA 1MEOA 2FRXA 1P3Y1 4ZAZA 4BJ1A 4ROSA 4NCIA 4YASA 1F8YA 4CODB 2DQSA 3KD2A 3NGMA 4RPCA 1VSUA 4NHEA 3GLFE 3LBIA 4GKVA 3QXHA 4EHBA 5EKXA 5A3RA 3RS8A 3T9FA 5LMZA 1I0ZA 2SHKA 4QFCA 4CE6A 4D0NA 5KNDD 2OA0A 2BEWB 3AIMA 5AW7A 2ANBA 1EXDA 1G4AE 1K88A 4X6XA 3GCXA 4FLFA 3WKDA 2JGAA 1FNNA 3GNSA 1NPYA 2F3TA 1X74A 2C58A 3DAGA 2RHJA 5AUOB 4EARA 5CA0F 4TUYF 3CW9A 4X85A 2Y1GA 3ZGNA 3WC4A 2AN5A 2Q6TA 3COWA 1TZ2A 2B4TO 1TW2A 2VCYA 3H84A 3K4PA 5TB5A 4RKQA 4BZWA 2RGDA 3L1HA 4JL8A 1O8CA 4NMMA 3TVYA 5F7XA 3WGIA 3OZCA 4LE2A 5DTIA 5CFQA 4UPVA 4EG6A 1Z5PA 3WHPA 3UT5B 1P39A 3WRXC 1Y81A 3CRW1 3N07A 2P5TB 2X14A 4PSVA 3G6WA 3GFTA 4CTOA 3L1JA 1LPMA 1JAYA 1GITA 5AFSA 2X6TA 2ZPUA 3T0FA 1KRWA 1C2YA 3JYQA 1V11A 1G5RA 1I9GA 3UUFA 4YMTA 1Z17A 1T13A 4HXFB 5CDFA 1J9ZA 4BE9A 4BQEA 3MFYA 1UJMA 4ANFA 1TVCA 5K0ZA 4Z7QB 3ABOB 3LC2O 4FINA 2GEJA 4K46A 1MV5A 3R7DA 1TPZA 5CW1A 3VOAA 1EUDB 1BSVA 1EX7A 1TAQA 3K0HA 3R6LA 5D5PA 2WHYA 3SC6A 2GEVA 1EIZA 4BE7B 3T7CA 2OR3A 1CB7A 3B1FA 3DBRB 5JH7A 4C20A 4HN2A 1ODKA 1KYXA 3LUFA 1ZH6A 2CJWB 3VPXA 4BS9A 3FZGA 1BHSA 3ZWXA 4JU9A 3ZHBA 1NQOA 5BWBA 1EWTA 2OESA 5LKAA 1MOZA 1TCAA 5KS2A 3P0JA 1PL0A 3DLAA 4IX9A 4RVHA 5AKEA 7YASA 4W5TA 3E0XA 4DYDA 3OEHA 1B3BA 3HBFA 2Q2VA 2CBZA 2G17A 2ZCUA 3O3NB 4ICIA 1EBBA 3DZBA 3X1WA 3Q41A 4DLKA 1D7OA 4LDAA 4UXHA 2PKQP 1BDIA 3RK1A 5JZMA 3NM4A 4KN6A 3IUMA 3D3KA 2Q3HA 4L4RA 4HNRA 3LCVB 1H2XA 3AIKA 3TEJA 1SHZA 3PPYA 2W7TA 1WZCA 3EPLA 2VDNB 1R6DA 1XIVA 4G8JA 3KVRA 4RU1A 1DC5A 1WSDA 1CUUA 3QQ5A 3AFMA 4WA7A 4L27A 3O84A 4MZDA 3I28A 4ENQA 3KP1A 4GSYA 4MYTA 2UYHA 2CVHA 5BSKA 5J43A 1RM5A 2Q46A 3LCUA 3CEJA 1KYTA 1OBHA 3HZOA 3S99A 4TTIA 1QQ7A 1UJ5A 4TL8A 3RFFA 1MH9A 3AL0C 1L4BA 4OHYA 1QH8B 2WNIA 3CH6A 3I2YX 3NIWA 1A98A 2CNKA 4FJ1A 3LCCA 3EF1A 1KE1A 4OI0A 4G5HA 1W5SA 3IVGA 1NXSA 3V5NA 2LTAA 5IF3A 4E2YA 3HCDA 5DH9A 5HE8A 3SJAA 2EL7A 3F3SA 5THQA 2VSOA 3LLMA 4D4JA 5DDIP 1VECA 4N5MA 3C3EA 4I1YA 4D5GA 3UB2A 2B4QA 1FUYB 1L7VC 4RPGA 1ZM2A 4ZDJA 4OK3A 4BRZA 4KI7A 2BHLA 2VATA 5ELXA 4WJKB 5M2QA 1Q1BA 1E6EA 2X58A 1N5MA 3JZFA 3VHQA 5JJ5A 5FOXA 3CEPB 1YS2X 3U3XA 2COKA 2ZRMA 2SCUB 1N6NA 3BWEA 3DCYA 2R6DA 2D06A 1G41A 4JUFA 1Z7GA 2WUGA 4HRXA 3TLAA 3S1SA 1DRWA 2P2CA 3VTFA 1JYEA 4WZBA 4I4CA 4EW1A 2OQIA 1YIDA 2I2XB 3OZ7A 2NXJA 2P2SA 2YQ4A 3NKFA 4F1JA 4NECA 1QHYA 1KI6A 3QLVC 3EAGA 3KDAA 5E8RA 5DBHX 2Y0CA 4P92A 3GEGA 3NFRA 1UPCA 1U1CA 3SBDA 4DNPA 3LVQE 1Y7IA 2F8LA 2YKGA 2V3VA 1AHIA 2ILTA 4J03A 1VSBA 3A9VA 1JE0A 2FCAA 2VP6A 5FV7A 3IUEA 4KQIA 1WP9A 2VYCA 2B99A 4XLTA 5KYVA 3GLFA 2ZJ0A 1XD9A 1Y7HA 4WDRA 1BA3A 3C7CB 4EJFA 1N6KA 4Y7CA 3PBKA 1TIBA 5EWMA 4DLWA 1D6JA 1MO5A 2DSNA 5LQSA 5AW6A 3NUZA 3PVZA 2FSGA 2AFHA 3UK7A 4HXEB 4CUKA 1I0LA 3PSAA 4MJLA 5IT5A 4RJTA 5LDHA 2ZAMA 3PC7A 4EKEA 1KU6A 3FRJA 4QXMA 1HE8B 4FFBB 3WB2A 1VJRA 1O89A 2I4OA 3OQHA 2Z6QA 4ZYXA 1JI0A 1E3SA 3WWYA 1K0UA 3G9TA 4XIGS 1LBIA 4UUAA 1PFKA 3AJEA 5E9WA 5AHRA 1RM0A 1Z5GA 2OOKA 4MQLA 3OUTA 4M76B 1EJ2A 3QBEA 2XITA 4LGMA 2BDTA 2DR2A 1U2QA 4JJFA 3RYHB 3RYFB 4PQGA 4I9FA 2QUBA 5EE9A 2O2EA 3VSEA 2HIHA 3AU9A 2FEMA 5DNWA 1KI8A 1QGAA 1UZNA 3A6PC 3O4IA 4O33A 1SRRA 3AIIA 3LHFA 4DA7A 5E4YA 4GQIA 5IHXA 1DCTA 2YY5A 2J3KA 2X0FA 4E4YA 1GNSA 1XNJA 4QVKA 2BKXA 3M9LA 3IHWA 2JGNA 1YQGA 5JSYA 3VO8A 4D3ZA 3TGLA 2JHFA 4JEIA 3DAFA 1JJIA 1FVOA 1WBJB 1WXHA 2YRXA 4OKIA 3LUKA 4TXLA 3WADA 3ZCSA 2Q6VA 1N2OA 3R3VA 3EA0A 2BZ1A 3BREA 2XBLA 1ZN9A 5ECWA 4X6UA 4D8WA 2PSSA 5LSAA 5ALNA 4UTRA 1NLYA 1DJMA 3H11B 4M1OA 4HFRA 4EWLA 3WMWA 2PUTA 1DPGA 1KVUA 3IDSA 2X8WA 3L46A 4HY3A 4TQUS 3FJOA 5H4GA 1YFJA 1QE3A 4HNUA 4JVOA 5FL3A 4D97A 3V4RA 2OORC 3LY9A 4NKRA 3QXGA 4MDYA 5BOSB 5EHQA 1UKBA 2NAFA 3R5FA 3PGJA 3QKTA 1S2NA 1M74A 3EXHB 3ZWVA 4LJ8A 2VPWA 4IGFA 2B4KA 4TRMA 2GNPA 1GGVA 4MROA 3B1JA 2JFBA 3PWKA 4CNQA 2AC2A 1OB2A 3OFNA 1E32A 1T9BA 3LY7A 4MA5A 4OA8A 5K2MA 3IT0A 2H2DA 1IWPB 1ZX1A 1Z6TA 3A10A 3CX3A 2FRDA 5EXPA 5GWXA 5TF0A 3SBXA 3NMUF 1XLVA 3ROKA 1GR1A 3G0HA 1LH0A 3IPAA 4URVR 4Y6GB 1XQ9A 4P3OA 5HEKA 1E79A 1JDSA 1UZMA 5ALEA 2W2KA 1JKIA 4JKOA 3SSMA 2H1SA 2WVAA 3AFHA 3LC0A 4HL6A 3FRHA 5A5EA 1Q7BA 1T36A 2ZI9A 1W6RA 1RYBA 2H1OA 3HJBA 2XI4A 4HUQA 3A3KA 2IS1A 1E3WB 1T5OA 2FMIA 2RGUA 3LWDA 5CJ2A 5HCUA 2ENUA 2HNKA 2RFLA 4GI1A 1WUTA 1ZJ4A 4Q03A 1J5PA 3U60B 4ISBA 1B23P 1N2CB 1YF3A 2PD6A 2IXGA 2ZDQA 3TKLA 5CNJA 1GM5A 3CW8X 3EWIA 1M6NA 4RQAA 3V3TA 4JI0B 1JILA 5KAPA 4CKBB 1OT3A 3K1AB 5JUWA 2XYGA 4FHFA 4JC8A 4OXXA 4KFTA 2B3DA 2DT8A 2VYNA 3VZRA 4UEWA 2BGGA 5A4MS 1FFWA 3K8OE 3SGLA 3EXEB 1HURA 4ZT3A 5BUZA 4QDKA 5HQ3A 4D9IA 3DFZA 3ZR4B 1A1SA 1L7OA 4GP6A 2O14A 4KWEA 5EFOA 1SO8A 2VT7A 4C4XA 5C9ZA 2Q28A 1K8RA 2ZANA 3B1WA 4R2WA 3LA6A 1C3EA 4WQMA 5J23A 3O8QA 3RS4A 2GPJA 3FKQA 1ZZEA 2XYHA 2JIZD 4LMBA 3UMJA 3TLGA 3DVLA 1J2RA 5BO5A 4U8GA 4ENVA 3KNZA 5K3SA 3UV7A 4AJ4A 2IBSA 4BKQA 1AKNA 4U6SA 1W49A 3HV0A 4ENSA 4Y2VA 1CP3A 1OHHA 5D6OA 3ROMA 1EXVA 4CPDA 4MLZA 1SBCA 3OKCA 2GR9A 3SSAA 2OHHA 2WSSA 2XR1A 4UHHA 4WA8A 2R44A 1OIXA 1PK7A 2IL1A 3EZYA 3VJMA 4DUGA 4X65B 3JWEA 2XQKA 1W88A 2ADMA 2O5EA 4V02A 4DMMA 3FVRA 3UW1A 2AHRA 5JPDA 3I9NA 3NZEA 4L2IB 5E1OA 4XM1A 3FNFA 2UUOA 1MHTA 2KS6A 3I2IA 2OPBA 3BC1A 3FD8A 4BLWA 4FOOA 5IX8A 5HOEA 4LWOA 3BWDD 1FMJA 1UINA 3IP7A 4YHBA 1QH0A 3IUJA 4A91A 5FOVA 2UKDA 2FR0A 2C96A 3RS9A 2J9FB 1QNFA 1UK9A 1DEKA 2YIJA 1Z7BA 3D3NA 3D0KA 3GGOA 1A9TA 1DAHA 3OIWA 3QTTA 1TM2A 1DELA 3G0GA 4HDKA 4M9QA 2H5LA 4MV0A 1MC8A 2JHAA 5H8WA 4US2R 2TMGA 2XQIA 2HLHA 3VOTA 4CM1A 4DEYA 1PD0A 3VMMA 4QGSA 1GCAA 1RHMA 4EB6B 3DVSX 3HDTA 2QXTA 4FMCB 2WJZB 4PBTA 2FEAA 3LXRA 4YC7A 4TLMB 1PFQA 4HB0A 4NV1A 4Y2UA 1DDOA 2PRJA 2O2DA 2PO7A 4HNVA 1DX9A 2LIPA 4NYIQ 1XALA 3GLHB 5HJ5A 4BPRA 3OCVA 4P5DA 4A8HA 2GCGA 1QGZA 3PEYA 4BGVA 1KGDA 3EQ8A 3FTQA 5EKTA 2AC4A 3NIBA 2QNRA 3VMFA 1AIPA 1YBMA 2BHRA 1OLSA 2WJPA 2ZBEA 3P9RA 1T1IA 4MUMA 4EJSC 3AR9A 1XJQA 2YWXA 2FQ1A 1I01A 4MMXB 3DV9A 5ALTA 4EHFA 1WAMA 2PJRA 1T4CB 3B2QA 4D3XA 4YWHA 2B1GA 3K2BA 4HG2A 3DYIA 3SQWA 1GRNA 2C7RA 3F9IA 1W59A 4AFNA 2IOQA 3PQ5A 1N8KA 1MXHA 4I3GA 4MYUA 1TLFA 2CNWA 1E94E 2YQZA 4J4HA 4RD3A 4RKYA 2RE8A 3KQKA 3P9YA 5IJ9B 1G7CA 2HQSA 3ZKAA 3MQ2A 4X8HA 3CXUA 5I4IA 3DMHA 3AJ9A 2W93A 3OHSX 2CFTA 3NQ41 5BSTA 2JI6A 3H18A 2V7QA 2F48A 2NZWA 4U2EA 1O9GA 2WIKA 4F84A 2O5CA 3F5SA 5B3KA 4AROA 3VTZA 5JASA 1FVXA 1CJSA 2PMDA 4N3NA 4C3OB 5M7EA 3M4XA 4RAOA 5KI6A 2C98A 4M37A 4RVOA 4V2UA 5CLGA 1YL7A 3SJCA 1L5ZA 2X9QA 2ZWIA 1C14A 3N0XA 4JY7A 4C2BA 3CNEA 4CG3A 3TG8A 1HE1C 4FWIB 2NUPA 4CLXA 3U09A 1BS2A 3TYXA 3DMFA 1S9DA 3A4TA 1TAUA 3AR7A 3I9FA 4RTSA 2B7BA 1X15A 1YRQA 2QN2A 1Z62A 3DKIA 1LW6E 3GCWA 1J0AA 4FNGA 3L07A 4DE5A 2DERA 3TQTA 1T1SA 1JQ5A 1FP4B 4EY3A 1H3EA 4EO7A 4KMSA 1Z0ZA 3AF6A 2DJ5A 2WYIA 2Q41A 2VEOA 5L4NA 4D0GA 2NVUA 3H2HA 4YRQA 1M67A 2UUBB 2E85A 3SXUA 4V1CI 1XNHA 4DNFA 4B3CA 4K05A 2PFSA 1XKLA 1ZY2A 3P9ZA 1RU3A 4FZVA 1JDTA 1P4GA 1GHTA 3VYRB 1P4JA 3BORA 2OQ2A 3H5IA 2P65A 2FEOA 3MLBA 2JLUA 4ZOCA 4N6OA 2FHPA 4GQBA 3OKFA 5B57C 2P2LA 3IIKA 4AKTA 1CRPA 3AINA 3GFGA 3KJGA 4DYHA 2QTLA 1R4MB 2A9QA 2W6QA 3BE6A 5FV4A 4PZAA 3VOBA 5D3QA 4LZOA 2P1DA 1FX1A 1QMPA 2HCTA 3BM5A 1QC5A 2I3ZA 1GKKA 5EJ5A 4NCAA 1BDMA 3K2EA 3RANA 1V1JA 4F11A 4ESEA 1N34B 2IYRA 1JDVA 2A4MA 4MWDA 4MI3A 5HF5A 2EYUA 3V8QA 2I54A 4HGPA 1RI3A 1CNMA 2V1XA 3Q7RA 4MQEA 3X2FA 4AMYA 3QV2A 3GRPA 2ZULA 2O2XA 1THTA 1Q95A 2M98A 1U0BB 1Y82A 4MW2A 2XWSA 4GVPA 4JA2A 4JH0A 1PJAA 1W93A 2OBBA 3ZY2A 4EUFA 1OFGA 5ENVA 1Z4IA 3WDMA 5LFAA 2Q8NA 3GJXC 3EZFA 4HI0E 4NI5A 5IM4A 1L7EA 3VR5D 1C0LA 4P4TA 2BVNA 2CF5A 3LK6A 1YCFA 1F2VA 4LCBA 4FGSA 3H19A 3CNOA 2PS9A 1P4SA 3ILXA 5CRIA 4FK8A 5AJYA 1H6BA 1EH5A 2P27A 4TVKA 1G7TA 4RYDA 1A96A 2G1PA 1F20A 3IOCA 3NX4A 1JSZA 4M7PA 4MPRA 5BRNA 4S35A 3RVPA 1MG0A 2JARA 2I99A 3NUGA 4YCJA 2FZ4A 3V7YA 4AZWA 4BKPA 5LIPA 5FUWA 2Y1OA 3UMYA 1K4KA 2AOUB 4NDZA 1KNXA 3G49A 3HM2A 2FPRA 3N2KB 4K3VA 5CMLA 2GZ3A 4K6CA 5ERYA 4BIIA 4MUNA 1KP9A 4Z5XA 5AIBA 1EVJA 2XKBA 3F3MA 3JVEA 3NRJA 4YAWA 2GESA 1NKTA 2WHPA 2QL6A 3NTUA 4BUZA 5AOAA 3RB8A 4DQLA 3I34X 3UAVA 1SUFA 2CMGA 2V9CA 4CDGA 4PG5A 4UTOA 1NZJA 4EUHA 1OV4A 1UJNA 1U0NA 2XAUA 2NVOA 1QTQA 1BC5A 3PR2B 4MVYA 1AKVA 4BN4A 2QUZA 2GJ4A 4R05A 1Q0PA 3M5DA 2DX7A 2AFIE 2C8VA 4JX8A 2ZSKA 4PGFA 3BIOA 4F6RA 1NJFA 4TMKA 2IOYA 1GT91 1QO0D 3Q9NA 4PYKA 4UOZA 3EW7A 4ZCIA 2ECFA 2YV2A 5D3ZA 3TQRA 3DPUA 1G66A 1X9IA 1R6BX 4OBWA 2YFQA 3EH1A 5EC8A 4QVGA 1YASA 3TEFA 3REQB 3I53A 3C5HA 1GV1A 4G0ZA 4PAQA 3D8NA 3COPA 1YQUA 2OZPA 2Y71A 4JQOA 1AV6A 2O4UX 3JQ9C 3P2EA 4JB3A 3AHCA 2ZBRA 3D7LA 2EC5A 1RLJA 3EQ9A 1Z47A 3CLRD 1RCFA 4PZEA 1MB0A 3KHUA 2R7MA 2XJ9A 3KWMA 4PVCA 2JFGA 3A27A 4KTVE 3JWHA 4D1YA 4D99A 1HXHA 2W2LD 2XZTA 3QPWA 1QV9A 1YVUA 2H2HA 4JUAA 3D1JA 5DGDA 4A8PA 3K6SA 1NMQA 5AKIA 2AF4C 2QVXX 2FDXA 1F9AA 4MNTA 4O4HA 3IAM1 4MKFA 3QJYA 3U81A 1JS1X 1UK8A 4HNSA 4Q21A 4ZQGA 5E6UB 3S40A 1OXUA 1ZD9A 3VX3A 1HOTA 4FIDA 4MWBA 5KYUB 4U7DA 1RI5A 2FP4A 4W8GA 5A4DA 1VG1A 5LQKA 1LNZA 2YOFA 1MRNA 1U9IA 3IA2A 2GYVA 4PICA 3UFXB 4NU6A 2J4CA 5HA5A 1T34A 2CFRA 1AKMA 4KWTA 2IEDA 1LLDA 1XB2A 2BTQB 4XXHA 3I1JA 3UCEA 1VG9B 4KRXA 3WO1A 4A4DA 2IEZA 3CLTD 3L6RA 2VAXA 3H9QA 2VSNA 2PKWA 1UMCA 5DYYA 4B3IA 4PO1A 5FUXA 5EXSA 3D0QA 4II7A 1FTSA 4QEZA 3R7WA 4Z1OA 1OLUB 2AN4A 4G5RA 1WSAA 1X1SA 3ECCA 4B0PA 1OV6A 1QCCA 2DBVO 3FCSB 2XCQA 5KNBH 5LQCA 1EX1A 1U1GA 2AMLA 2C2YA 1EUCB 1QZUA 4KDCA 3NYWA 4QU8A 3R3JA 4F3TA 1T8TA 4AX4A 1X1QA 1RJFA 5KREA 2E5LB 3E03A 3F2VA 1SCJA 1IH8A 4JLKA 4CV1A 3D7NA 3JQ8A 3PFNA 5EHIA 4EFMA 4EG4A 1NXOA 1TTPB 4L08A 5AHOA 3RVNA 3V7UA 5BNIA 1VL8A 1GUBA 4LI0A 4CETA 1RWQA 5JBIA 1X7DA 2PX8A 3OECA 3U7GA 1LDNA 4AZ0B 1TA4A 1LI5A 1HDYA 1N1DA 1YDFA 2ORVA 4YLYA 1VCMA 3PP8A 4B81A 5HJ7A 3VSDA 2ISQA 5H7XA 3EYWA 2CCKA 4UCFA 1NY5A 2GRAA 2LV8A 4H6VA 3CZ4A 1T9AA 2QM3A 5BMVA 3PGXA 4I9NA 1SPBS 2XDQA 4I4LA 3UHOA 5C2JB 3BMNA 3F49S 2WQ6A 1Q6ZA 4BX3A 1EP9A 2JBAA 2FEKA 1H8EA 2PT7A 1QVAA 1XDWA 2G4CA 3F6SA 3KR2A 4BMDA 2DUMA 3S6JA 4XSHA 5TY0A 4C03A 4YJFA 4C4YA 4DA6A 5FF9A 4RQUA 4MLDA 4O2BB 2YMPA 1M6WA 1U2PA 1H42A 3Q0IA 4J16C 4R69A 4ZVTA 5T4BA 3ZDXB 4ECEA 4EY5A 2XCSB 2CF6A 3UPDA 5CCEA 1XXHE 3UA4A 3WAGA 1NP3A 1UMBB 3G89A 3WJAA 2HU8A 4O1IA 3OPMA 5KWEA 3K70B 1JDUA 5FULA 3ZW7A 1I2CA 3LC7O 4IDHA 2H11A 3BF7A 3TAXA 2O8DB 5CHEA 1P0IA 1BCSA 2QENA 1AKRA 3U3OA 1QDUA 1CUWA 1I10A 2CFCA 4M89A 4QBFA 5G4KA 4EJ6A 1E64A 2BSXA 2CHUA 2VDVE 3EE6A 1KP3A 3JYOA 4JZKA 2PX3A 4DR6B 4AYXA 1CDDA 4WNCA 1XL0A 4LBWA 1YRYE 4E32A 3PC8C 4K1XA 2V7WA 1YOVA 2WPDA 4EX7A 3RC8A 3OA0A 1HG1A 1LWOA 1L8QA 2Q07A 2V5VA 1JEOA 2VF5X 1JHUA 3JQQA 2PMBA 3MSXA 4IWXA 5CA0B 1P18A 3UWPA 1I2DA 2PQMA 1ENOA 4TMXA 5DYWA 2AFIA 1R0ZA 2H5JA 2AOTA 1J8YF 1OWLA 4AJ9A 4RKWA 1SXQA 1UBMS 1I7DA 1TUIA 5IW8A 1Q14A 1ZK0A 3SYNA 2QL5A 3U4IA 4DL9A 3RADC 1NVVQ 2B9VA 4X1OA 1A7UA 1E1LA 5T3UA 3MRVA 2H29A 4NULA 3E22B 5DSXA 1C3XA 2I9KA 2IYXA 2X5OA 1HDCA 3GAZA 3JQRA 2XX3A 3H2JA 4M3NA 3ESBA 4OKSA 4GX5A 1MFZA 4I1VA 1SY7A 1CD5A 1Z25A 4XUGB 3D8RA 1JQKA 1NJ8A 3I6ZA 1FYDA 1Q12A 2CLIB 3DXYA 1Y7TA 3Q98A 1KQPA 1T2AA 2X5XA 5CLQA 3ELBA 4JROA 4B46A 3LAWA 2IXFA 1ISPA 1KL7A 3GC6A 1R9GA 2YJNA 3NRBA 4II3A 1FFXB 3AR6A 3DZCA 3C3BA 4JLMA 1QQBA 1D2HA 3KPYA 2CXHA 4PQFA 4TTTS 4Y2YA 1QHEA 5CU7A 4ZVPA 3MB8A 4OMFG 2I6SA 2OUIA 1ZHFA 4Q3EA 3W79A 2H7YA 3CG4A 5A6SB 3ZHRA 1Y1LA 1TJPB 1Z6AA 1I4TD 2C7PA 1Y8ZA 1QFXA 5DYGA 1VHTA 2R6JA 2ONZA 4I46A 4RHTA 2CGEA 3R74A 4WGGA 2JLVA 2X77A 1ZEMA 1RW4A 2INGX 3IP3A 3K5HA 4FCVA 1MJGA 1CUHA 1J4AA 2AG0A 3FCXA 4HUTA 1YJ5A 3SIWA 5A9SA 3IT1A 4IDPA 4NEQA 4Q01A 4JGGA 5G3ZA 4CQMB 2GARA 2P1RA 1OPXA 4PYOA 5TJHA 2OTCA 4ARCA 4C06A 2ZJ8A 3A31A 3WDSA 1X2EA 4TLAA 4PZCA 3DAPA 4MIOA 3HU1A 3KPUA 3SHFA 1QGUB 3OEHD 2PD4A 3VJKA 1USKA 3PWSA 4XWWA 3DGEC 2Q1UA 2HHHB 2HSGA 5EWJB 4KCGA 2GEUA 2Q3BA 2IXDA 3L8EA 1P2FA 3O91A 1V2HE 4OJMX 3RSLA 2CDRA 1WBDA 1XRSB 4B6JA 1ZNQO 5BT9A 1SUBA 2FN7A 1V35A 2OBXA 3CIOA 3HU3A 1PZGA 5BYBA 3W6OA 5K6AC 1NNEA 2XECA 1GN9A 2WYOA 2PZJA 3SNKA 2L18A 1B4DA 2A8YA 3SC2A 1YBFA 5J58A 3QOYA 2FN9A 2V4UA 1RMTA 5TT1A 4KXWA 3PEFA 4QZVA 4CLHA 2ZKIA 3O94A 4QJ3A 3K0CC 1RIIA 3O8BA 1RWMA 4PPFA 4YI3A 5JEEA 1SA0B 1Y7LA 1R00A 2QI9F 3FSRA 2Q5EA 4ZI7A 5I7VA 3O4GA 2HDNB 3IJEB 4FDLA 4NV0A 2G6TA 1KKLA 2ZYWX 5FUMA 1Y4AE 1II8A 3I37X 3KKMA 1P2GA 3UVEA 4ND5A 1FFEA 1MP0A 4EABA 1CF2O 4ARAA 2GM5A 4RA9A 5DI3A 2AZMA 1E1QD 2VN8A 3C5VA 4R0VA 4JI2B 1JR2A 1NMEA 2DPLA 2PXCA 2ST1A 3NTQA 5FBKA 4Y6SA 1JLHA 5FNVA 4P4SA 2IUSA 3DT6A 3OE7A 1N2IA 4MX8A 4XQEA 4ZVUA 2PGJA 5KVSA 2ZIXA 5AKYA 3U4HA 2X8AA 2CEKA 1P1FA 4PR0A 1YIOA 1Z56C 4PYIA 3VR1A 3O3CA 4D4GA 2OZLB 4DR1B 3G0CA 4KNYA 4J2OA 2X86A 4HEA6 2FJ0A 1J25A 3HZHA 3OEED 5DHTA 4PC6A 1ULBA 4RM3A 5TSDA 1XXHA 4TLLB 3ZLJA 3FHTA 5C32A 3OQBA 4WXPA 5EMMA 1YZQA 1IEQA 1WUIS 2R1ZA 2MCFA 2NSHA 2Y3IA 1PV4A 1QTNA 4QIHA 5CM8B 3LXXA 1CIJA 4PFSA 3DZHA 4LOIA 5EQDA 4JFRA 4PCVA 5AVZA 5CBKA 1S8AA 2FFJA 1LSJA 3WL8A 4F9FA 2KBFA 5FWYA 3W6UA 4HDOB 3CWQA 3TECE 4E2ZA 3PXDA 3Q8WA 3CH5A 2W2MA 3D31A 3FNQA 3UH0A 5C7LO 3VAZA 4I08A 2QN9A 2R62A 4RH1A 1M7GA 1SCUB 4CV0A 2QZZA 1L5YA 4LJLA 3WMFA 4F8JA 1UOQA 1U2TA 2EERA 3ACDA 1YFZA 3BWYA 4H27A 3ACBA 4DC9A 3W05A 1H4QA 1OC2A 2V9ZA 1KEZA 4G2TA 1E9FA 4EG8A 1EVIA 3JPYA 1CKEA 1P29A 1SVWA 2IUEA 2KI5A 3LW8A 5E6SA 1GGMA 1B43A 2GOYA 2H1WA 2QM7A 3RQIA 3IE1A 1O9HA 4H4CA 2X40A 2XHZA 7ADHA 3VKHA 1P8AA 5MFPA 3HCBA 2HPZA 3ZDFA 3CB4A 2VNJA 5CBPB 1L4YA 1E2JA 2GJSA 3D0OA 3ZV4A 5L53A 3SKVA 1L5HB 1XO1A 5DU2A 1THGA 4ZCPA 5LUAA 1N0WA 2GK3A 4N39A 2ABWA 3C1AA 4MW4A 3S2UA 3T7IA 1RKUA 2ZRIA 1ZSYA 2E87A 2QMUA 2VTBB 1R50A 3W7VA 1C8KA 2QUIA 2UZ4A 3Q1LA 4DGSA 1Z5ZA 2Z1DA 2YIDA 2RHTA 2YW9A 4N7RA 5KYGA 4G1FA 2W2XA 4AF8A 1JEEA 4QSHA 2CZGA 4CMIB 3C3CA 3GL9A 4L9SA 3WWPA 1Y48E 4W7SA 2FWAA 4Z4QA 5IZ4A 3GRAA 5I9LA 5EE0A 4DCVA 3EA5A 4JLJA 1T15A 5KTOA 1B73A 4RYLA 4LTMA 5JI2E 1NURA 1TIPA 2RBGA 4FGJA 2BM0A 1JR4A 2WI8A 3UH1A 3CUUA 1IBCA 2NTJA 2WHXA 1E1MA 3SVZA 4BTLA 2C4NA 4DIBA 5CFZA 2DLCX 1MQ8B 2XF8A 1TADA 3C6QA 4O4JA 1BXGB 1YE5A 2Z5GA 1YA8A 4LY6A 4RXTA 1YE3A 4XWYA 4HLCA 4M8KA 4X7BA 4UW9A 2X0EA 3CONA 3VDNB 2IDZA 3RU7A 1PJ3A 2I7XA 4P7KA 2MR6A 3V4FA 4S04A 1LS1A 3CYFA 3F4LA 2HZBA 5IEJA 4WASA 5DYIA 1TLTA 1KHTA 1KRHA 2FW8A 2H16A 2V4ZA 5K45A 2NYAA 1KYVA 1BA2A 1NC3A 5JNUA 3D8UA 3I72A 4RFSB 1AKYA 2VQDA 3E61A 5EPUA 2D5CA 1P2TA 5LLTA 4PYRA 3KD3A 1RLIA 1WBBA 2PUWA 3U3DA 4LRSB 2VZ0A 1LQ2A 5T5QA 2Q49A 3L0SA 1UAYA 1ESCA 1X77A 2I62A 3JQDA 2C1ZA 2ACEA 3BFXA 5CX1B 1QAMA 3OJCA 2B35A 4F2HA 3TOCA 3CTMA 4NDNE 4AAYA 4B3XA 3W9BA 2RK6A 3P8ZA 4QQ8A 1V9LA 2V9PA 5F3DA 3ENWA 3MUNA 4E09A 3GDOA 3RTEA 3ONNA 1XD2A 1EM6A 1O4VA 1KS9A 3K7EA 4I36A 1XVVA 4HLQB 4FYPA 1HEIA 2B98A 4CWAA 1Z45A 5CGZA 5MN6A 2FSVA 1AT1A 3I6QA 4Y30A 4KSYA 3L18A 5LQUA 1AZSC 2X2PA 4YJ2F 2IV7A 3A9CA 4ND8A 1W9HA 2V6FA 1MEJA 5HTKA 3L7MA 2Y77A 3SXJA 2PV7A 1YZNA 4ZJZA 2ZVDA 5SY4A 3NDBB 2P11A 3MN1A 2C4HA 5T3YA 3C0KA 3PRJA 3JATA 4JHXA 4UU0A 3H1TA 3V7FA 2W5UA 4HWRA 2KBEA 4M0LA 2RB4A 3RJZA 5JAIA 2QTCA 4KWIA 2PDAA 4DREA 2VKTA 1USUA 2X0DA 4MGHA 1KXJA 3OZVA 3SU8A 3WFJA 4DCMA 2FQWA 4UFNA 5EPEA 4YCNA 3S1AA 5GZ1A 3O8NA 1LV7A 4B45A 4X84A 5ESDA 3DFUA 4Z7NB 3ZWOA 1WLSA 2ZTVA 4I55F 1DUIA 5EOVA 1ZK4A 1TM4E 1UM9A 5TS2A 1SNYA 3BFKA 2I34A 3AM4A 4LXTA 4A1FA 1HNWB 3ZK9A 1TF2A 1J2YA 2OPHA 1TYZA 1MTOA 1DAEA 3MCAA 1V8BA 2YZ2A 1TGYA 4W5HA 4JLUA 5BORA 3ZNQA 3E58A 3THWA 1MC1A 5DVZA 1XTIA 1C7RA 3JWGA 3MGKA 4PONA 1XQXA 2Q9UA 3I45A 5EP4A 5T8KC 4GSKA 4DFDA 2VHXA 2YHUA 1O6ZA 3TKYA 4YUYA 3TUZC 4KLNA 2VP4A 3ULKA 5HXAA 2HHJA 2JZNA 2P7IA 2Z58A 4XPIB 2MSLA 1NN3A 2R9VA 3UZUA 3RLFA 5JT1A 5GIOE 3QUTA 1EWQA 4OI2A 1NUQA 3F74A 4YT2A 1PEDA 4GFDA 3S8EA 4C76A 1QQ6A 3QXSA 5JARA 1KQ3A 4MJ3A 2AQ8A 2PLWA 5HM6A 4K9RA 4Q4HB 4XVHA 4NE7A 4BMVA 3H87A 4DUZB 4EH1A 4EKNB 3U26A 1YRBA 2BOVA 3ZD8A 4FB5A 1DTSA 1W29A 3HU2A 1Q7RA 1U8ZA 1X7XB 2B8JA 1JU3A 2HPAA 3AM3A 3MRXA 4AS1A 1D4ZA 2QLFA 4N0DA 3GJYA 4GR5A 3UHPA 2QE7A 4FCTA 4AECA 1G0NA 3VH3A 3ZDEA 2HLDA 2WVJA 2BMWA 4PBRA 2FW7A 3SF0A 2OHVA 3R9IA 3V2UA 2QMOA 5DTEA 4FSXA 1LLQA 1VL2A 3IERA 4L8FA 4EYQA 1LPAB 2BY4A 2JVKA 5BN3B 1VLZA 4DRXB 2ZJ3A 5CT6A 2O3QA 1TAHA 3HWX1 4MR7B 4B71A 4IO0A 4I99A 4XRGA 2B25A 1W30A 3CNNA 1WMEA 4FGKA 3WGTA 3BDVA 2DWCA 1CTQA 3C24A 3U4MA 2Z57A 1CY0A 1AV7A 3BILA 4PLPA 2YXNA 4IEFB 5DNCA 2CDNA 2OMKA 3BWVA 4KPEC 1ZR4A 4YA6A 4KR7A 2RDMA 3RC1A 3NHBA 2VSYA 4J1SA 5JSUA 3W5VA 4I66A 5A1TA 2Q4DA 4WJLA 3MJVA 1QSGA 3ZLUA 1LJLA 2LXNA 1NVWQ 1NNUA 4UU7A 1U3GA 3T5AA 1S5PA 3FDZA 1HE5A 1VPDA 1Z33A 2ZSEA 3CW2A 3PICA 1RCUA 4EDHA 4O29A 4OHMA 2C07A 3KLOA 1Y1RA 1C7JA 2Y92A 4PLHA 5LQRA 2EW2A 1EK6A 4Q02A 2AFRA 4GKKB 2P5UA 2B0JA 4URXR 1WR8A 4BNDA 4NDAA 4OUDB 3CVUA 2PL5A 3AETA 4KO1S 2BJWA 1T2FA 4BLSA 1PJQA 4Q19A 2N3ZA 1E2IA 1UDWA 1U99A 1KY4A 4PZ0A 5JS7A 3ONWA 1T5DX 1TUGA 2TMKA 3DZIA 4R5MA 4B3GA 2ERCA 2O7SA 1R18A 2J30A 2QZPA 3C6XA 1TDJA 1ZGBA 2PU7A 3BFVA 3B6MA 2IELA 4RE6A 4Q4AB 5HCIA 1U0HC 4CI0B 4R9UC 3K5WA 4R98A 2P75A 3R1IA 1X39A 2BMJA 2V65A 1GWNA 4QA9A 3QOXA 1F2UA 4C2AA 3WISA 4Q24A 2ONCA 4HGOA 3IUBA 4Y9RA 5DW3A 1QHNA 1GFSA 3IBSA 1D2GA 3LCJA 3TNJA 1M8FA 1U7XA 3KQQA 3STXA 3TE6A 1OCEA 2ZJAA 1PR0A 2GEDA 1F2TB 1GNVA 4DLTA 4N0PA 1LBSA 1IY2A 3I5YA 1E3QA 5JCOA 5DGXA 3GLQA 1J00A 2X5KO 2C0PA 1MX1A 3D3EA 4HDSA 1KEEA 5DMXA 1U2DA 2YV5A 3N0TA 3AEXA 4GOND 4QC2A 5C7IO 2RGNC 1RKBA 2LCQA 2V6GA 1U2ZA 1YZUA 1SRQA 4U63A 2C2HA 1E2NA 3OTWA 4CQLB 2ZE7A 4R4JA 3L0YA 1Z63A 2X8JB 5EGNA 3ROPA 2BHNA 4D42A 4IG9A 2OV3A 5KMGB 1EFRD 3RHSA 4RTKA 2DWPA 1TYBE 1SG0A 2V97A 3MS2A 3P97A 3ZGYA 3WYBA 1C7FA 3B89A 1SM4A 1Q16A 2EJUA 1QJCA 1XUOA 1FS4A 3TIGA 4XOIA 1KDRA 1I2AA 2B7LA 1DBQA 1R8QA 3GJ4A 3P9KA 3ZHYA 3E9RA 2WDZA 3ITNA 5EUCA 3I6YA 3NHZA 4LPSA 2CHEA 3KTOA 2HNAA 3HPQA 3D1VA 1YRHA 3CINA 1AGRA 3WE7A 1N5IA 2YHIB 4FDUA 4LOJA 3R7BA 1NKSA 5EMJA 5BQPA 4CLRA 3GFFA 3NORA 3F6RA 1AY0A 2YJ6A 4HAZA 4HFNA 3D1LA 1PNRA 3BKWA 1ZC3A 1OTXA 1XZQA 4M0FA 5EG5A 1JKJA 2YVLA 3KEMA 1P7CA 2RGWA 4U9IS 3AJRA 1ZWLA 3O2JA 3QFCA 4KAAA 5THKA 1MMFB 2CKDA 2POCA 4HWTA 3EQ7A 3RBAA 1CULC 4OFBA 1W5EA 4U3JA 3W2GA 5HMMA 9ATCA 1CHDA 2C77A 3B51X 5L4LA 1BEZA 2I8LA 4YJ3A 2FFAA 1NAHA 4JV5B 1XWIA 2VNHA 4NYMQ 5ALGA 4DM3A 1BE6A 3IURA 1VMAA 1EGVB 1H0SA 5F4BA 4C21A 2D74A 3QUQA 3T7RA 5B3AA 1CK4A 5IZCA 4KUHA 5JSZB 1WABA 3S8YA 1Y98A 1FXWA 3M89A 3H1PA 1MABA 2IGTA 2Y1XA 2XKAA 3RODA 4AZ3B 1IUKA 1LBTA 3BK2A 1A8IA 2CUKA 2TYSB 1Z3IX 1TGVA 2ODNA 2EARA 1NNSA 1QB7A 3IJRA 2PVPA 3EG5A 3CVJA 4QTUB 1VHQA 3EGOA 7MDHA 2CVPA 3AJAA 3EUEA 2G40A 4MQ4A 3WS7A 2FEXA 2BT4A 1LTKA 3KOYA 2P35A 3OJEA 4M9RA 2SKCA 1IUPA 3ISTA 1K6JA 2YVAA 3ZLVA 3NTRA 2ALJA 4JVMA 2C9YA 3ESAA 4J0QA 1KMCA 3VZDA 4F86A 3FHJA 4J1NA 1LZKA 4TX1A 4LNUA 5CM9C 4CM3A 2NACA 4UNIA 1Y42X 1IN5A 4DJFC 4CQJA 4IQGA 1BX3A 3G9QA 4EJ0A 4JX9A 1NUSA 4Z51A 2ZOSA 1B26A 2BEWA 3A9WA 2BFDB 3A4YA 4FC7A 1N5DA 2YZ7A 2VZ9A 5DK6A 1G6Q1 1XF9A 3E15A 2B82A 2FWPA 2WM8A 3IEUA 1MX5A 4J0IA 1P91A 2ZIFA 3GT3A 3RHZA 1UPAA 1FYVA 2DTEA 3BMQB 3H9BA 5H83A 4HNTA 1A3CA 1IHUA 5MF6A 5EN4A 1J2EA 2A84A 4QXQA 5KTPA 3RC3A 2ZRQA 3UO8B 1U02A 3H5NA 3M2PA 3ND5A 4MVJE 5D7BA 3GP5A 4ZGWA 1S01A 4F8EA 3F5MA 3MSCA 4ZYUA 3A4IA 4C4RA 4NLLA 2XCLA 5BN5A 1I8TA 1ZCFA 1TM5E 3KKKA 3DS8A 2E4VA 2EGUA 4L4ZA 2VK2A 4GXRA 4V1CA 1X1AA 2HY7A 1WETA 4TTAA 2DWUA 4DQUA 1U98A 3C6YA 4MR9B 4TSFA 4WCFB 2CHVA 1GPAA 2YOGA 2WT4A 1ID8A 1I33A 4BBJA 1G8YA 2DQZA 4CVNA 3SJBA 3CGWA 4IP0A 1QFMA 4FCWA 4Q4CA 5BQOA 4WK6A 1WPQA 1KI7A 1Y4UA 2MOKA 3MVEA 3OZBA 4JOCA 4YT4A 3AF4A 3DBIA 2ARKA 1CC1S 1W44A 1OVMA 3D6AA 3DBRA 3DMTA 4NFSA 1NSYA 4F9EA 5CB6A 1GFZA 4EB3A 2YWJA 4FDAA 3AQ4A 4X95A 2CJWA 2GPSA 3B82A 3OT1B 4G4SP 5AICA 5BSUA 1BWQA 3NC4A 3OFVA 3VJLA 3CURA 4RCYA 5CX4A 5JO0A 2PQ0A 1P7VA 2CMHA 2VWHA 2IYQA 3OE4A 4IH9A 4KRGA 2XCRB 4TQ9A 5DPMA 3PTLA 1W581 2D2IA 3CX7A 5AESA 1N6HA 2X5NA 3QTBA 3JQBA 4Y9TA 1XDSA 2WYHA 3AG6A 1IHDA 1E2HA 2O0HA 1S1MA 3NDJA 4GS5A 4LV5B 2X5JO 4G86A 4UHBA 3EXHC 3JV7A 3AP1A 1ULHA 3D7MA 2HR1A 3L0BA 4B5KA 2E1PA 1QM5A 2GN6A 3SQOA 1VL1A 1EHCA 4CM9D 4UMDA 3TQCA 3QKUA 1FFYA 2PWZA 5BN4A 4E14A 4GOJA 4PN7A 1WUJS 4Y2TA 3KSDO 5JXJA 4RY0A 1XZJA 1UEIA 1R0CA 2JHPA 4J07A 1Z2DA 4WOKA 5E1BA 3TQFA 4ALMA 1Y1SA 1JMYA 3IKLA 1NVDA 5L3QB 4FR2A 4O0MA 5TEWA 3C43A 3F6BX 3G2JA 2HWYA 4L8WB 1EP3B 2HYDA 1SQ0A 4HDQB 4AG3A 1Z6GA 2O2HA 1NAIA 1RAFA 3KTFA 4RANA 4DDWA 3ZVLA 3H9GA 3LUHA 3AHFA 4GC5A 2X1VA 3AU8A 3GX1A 1JQDA 4HD8A 2MTBA 2OFWA 2C3PA 1GDHA 3C87A 1ZM7A 1UWLA 1RJDA 3EVNA 3TGPA 4IYJA 4KVZA 4E21A 1EFVA 2H08A 3LGSA 5JWRA 2O06A 2AWNA 1N2CE 3L92A 2C9DA 4ZQBA 3F6PA 4OATA 5BY2A 1CR2A 3RK0A 1BQ3A 2FUG1 3GGJA 3KHKA 2HJVA 1BQ4A 5AK0A 1XTSA 4ZOLA 5DTQA 1QX3A 2JJYA 4FPXA 4KXLA 4DSTA 4EZEA 5AIAA 3JTMA 1JVBA 1WG8A 3E2MA 3JAKA 2FPPA 5FB3A 1K7FB 4V0NA 1JA1A 3FPAA 3KL4A 2OG1A 3NEAA 1B74A 1OOEA 5E3HA 3TCKA 2ECOA 4WFQA 3V33A 5IDYA 5TMPA 4A73A 2GVNA 1VCOA 4J0DA 3UKJA 4LVUA 4EHNA 1CUXA 5BWNA 2V59A 3H65A 2WJYA 1I5OA 5FAKA 1T3HA 3WGKA 3KXKA 3SC4A 3F8TA 1TMKA 4ER3A 4HYQA 1LDYA 4NMHA 4KZPA 5LD2B 1LPSA 1L5OA 1UPFA 3QEKA 2XZDA 2R6GA 4MUKA 3J81k 1L8OA 1KOFA 4YREA 3U3MA 4RZHA 3GLKA 5HX7A 5FWAA 4GL2A 4BMZA 2ID8A 3ZZMA 3MJCA 3COVA 3QPBA 3DUFA 3GV0A 3V1YA 4BLOA 3RVKA 1GQRA 1XP5A 2PVCA 2C7VA 2Y1DA 1QKKA 4ZDWA 2GKGA 4D25A 2YYZA 5DX8A 4M0UA 3O7MA 4PSUA 2GAJA 4HVLA 2FAXA 1D1QA 3VSBA 4IVPA 1IK4A 4MCAA 1JEQB 4BNVA 2CLDX 4IIJA 4KUEA 1T2VA 1E9VA 3VSCA 3SZRA 4EKYA 1PLLA 4YAGA 1TEVA 1BMFD 1LGYA 1RRGA 3IIJA 1JQ3A 1DJQA 3GUZA 3N75A 1CR0A 1I2MA 1ZNXA 4JIMA 4MYCA 1VCNA 3GW8A 3WR5A 1X1TA 3DCJA 3MTJA 4CT5A 3T52A 1NN5A 2YICA 4JI7B 5EKUA 1OZFA 5J3JA 1C29B 1NYTA 2C61A 4OQXA 3L0DA 4RS4A 4ZCTA 1MZPA 2YCBA 4Z86A 4ZV7A 4GOXA 3H5VA 1P6UA 1YGYA 4OJKA 4M0PA 3QWHA 4FFWA 4G1MB 3BX1A 3F3YA 2Q7DA 4CDNA 3GLHE 2QAGB 1CQJB 2OXEA 3U17A 2QP3A 4LHWA 4YAIA 3KJNA 4ISCA 1RQRA 5ED4A 1EP1B 1R88A 2D62A 1VKRA 1Z16A 2W58A 4DV3B 3QPUA 3PJDA 2DFPA 1W5TA 3R0ZA 1X8XA 3ZIUA 4MA0A 3PZRA 4U5XA 2ZE6A 3C6ZA 3CHYA 1YHZA 3F1KA 2QW8A 5KQPA 4ZPXA 1VKOA 2YR0A 4HS4A 3BXZA 4IF6A 1HSZA 1PYDA 5TS3A 4AJ2A 1FDIA 4H17A 3GYBA 4BGEA 2ZT8A 4DMGA 4GW3A 3OPYI 3ICWA 1OI2A 3H11A 1U7PA 4OX9B 1KA9H 4ZVNA 3BFPA 2ZJ1A 4P32A 1JLLB 3ZXUB 2PKEA 4O2AF 3HY6A 2PKQO 3TLXA 2ZJBA 5LXTF 4IDEA 3JVUA 1ORDA 2CZQA 1B8VA 2ZYVX 5BOSA 1G5HA 4CLOB 5JY1A 2PUEA 2WTUA 2AK2A 4M36A 4HPXB 3VNVA 4U1RA 2DYKA 3PJEA 2PYDA 3USCS 5DLDA 5AXBA 1K4MA 1SVNA 1JMVA 4MITA 1INLA 4XLZA 4ZCRA 4YAEA 5B6PA 1OSNA 2A33A 1I3CA 4MULA 3QWIA 1VM6A 5SYMA 3GG2A 4G5GA 4YIKA 5FTMA 4BRSA 3OICA 1LXCA 2QVCA 3QFTA 4X61A 2B7CA 2ZJ5A 3TQQA 4DANA 1ZUNB 1QVWA 4R2JA 1WCWA 1UDBA 3Q6NA 1J07A 1GL6A 2J41A 1RZUA 1K7SN 2DY0A 3ANXA 3G79A 3MBIA 5LWQA 4OHKA 3BT7A 3KQSA 3K1ZA 3WLJA 1RMQA 1XLTA 1JZQA 3TL6A 2HU7A 1E9DA 4TKZA 4RETA 4LF5B 3C41J 4NH4A 2AG5A 3GGDA 4P58A 1SKBA 3MWEA 3JQFC 4MUEA 2Q1XA 5CAEB 3U5ZB 1G3MA 1O95D 5B1YA 3LT2A 3K1AA 1DAMA 2I0FA 3RC7A 4REQA 3UJNA 3ZCPA 1VXOA 4NZYA 5EHXA 5IRCD 4N7JA 4XWGA 5HIJA 3LHSA 4URZR 3EXEA 4MUBA 4DZTA 4HQOA 1B8PA 3G5TA 4QUEA 2HMTA 1SG6A 2TMYA 3EXAA 4QUIA 4ZVVA 1OWPA 2OQVA 1FSFA 2V7EA 3H0KA 3KZXA 2Q1YA 4CMHA 3IO3A 3OI7A 1UK6A 3TAHA 4KQEA 3RGGA 3EPKA 3TTTA 2H1LA 2DT5A 1XYVA 1E6CA 1MC4A 1ACMA 2WJJA 4H7KA 3M7IA 4Q7EA 2OWEA 3KRTA 5A7HA 3AI7A 1J06A 3N3BC 1ZCZA 1IB6A 2PZFA 3PR3A 5J47A 1K4YA 2COEA 3JWPA 4L51A 2DHDA 1XA4A 3KSRA 5GPBA 2AKAB 4D9JA 1ZM3A 2AXPA 4HVAA 2MSEB 4IRMA 1CUEA 3ND9A 3OTGA 5DM1A 1EE2A 2QNIA 5K3CA 1BEEA 3N6RA 2GETA 2QZ9A 3KJEA 1N9GA 1TT7A 3ZCVA 4XSGA 3TFWA 2YWEA 2I6GA 1L5MA 4GT1A 4PAOA 4MO9A 4MI9A 5JAZA 4FZJA 2EVWX 1EWRA 4JMPA 5J2UF 1Y6ZA 5HF9A 1R6TA 4M98A 4C6RA 5B7PA 5DT9A 1YR3A 5HE9A 3KETA 5BR7A 2OHFA 3DMNA 4OQYA 5L6MB 1UMKA 5G0WA 1YQWA 2Z2KA 1TJ3A 3MD0A 2ZR0A 2OLJA 3ZHXA 5KWIA 4CIYA 3CBGA 3C8MA 3UJ6A 4EZIA 4GVXA 1L1EA 4A6PA 2ZSBA 1IQRA 2GHQA 2QMYA 2Z2YA 3HR4A 3MLAA 3ZWKA 5LMCA 4IIFA 3AL2A 5KUTA 3HXQA 4EB6A 4YIHA 2DC1A 4C2TA 2YYYA 1O97D 4Q1AA 1XRMA 2O7NA 2DM6A 3JD3A 3R3ZA 1ZUHA 4V0KA 2HKIA 1GPKA 2VJLA 2NG1A 1BFDA 4K9NA 1CZUA 1DJOA 1K2VN 3OZEA 1Y8QB 3W78A 2DEUA 3WXMA 2HA6A 3B9BA 4WBXC 4YRPA 2Q4RA 1ZK2A 1ZKDA 2Y0PA 1RHQA 3BWXA 1EWYA 4WY5A 4IXMA 4LJKA 3HKDA 4TKUB 2YXDA 2FF5A 4XB6B 2BFPA 3IHTA 4LQCA 2VDKB 3DFIA 1VMDA 4YBRA 1EX6A 3OX3A 1KIAA 4FFPA 4WACA 5AJVB 3A14A 4N03A 1E18A 4OSPA 4BAZA 4D9HA 5JNTA 3ILYA 1G3UA 3I76A 1OX4A 3DEFA 2IXEA 4GE3A 3WJ1A 1DU4A 5TF4A 3S2SA 1QMGA 4J9VA 5ALXA 1VGVA 3OTQA 4U6NA 3WP0A 4R1LA 2W6MA 3TRIA 1T3ZA 3WLIA 4IDDA 5JADA 3OZUA 5IAOA 3UBTA 5ALKA 2FJUA 2BCJQ 3EZGA 1NOKA 2DPMA 1K7YA 2Q8QA 2WOOA 4WBNA 2BELA 2VRWA 1J9GA 2WQ7A 1FJXA 3CRZA 4ZRMA 3R77A 4QUKA 3M49A 3PVSA 5D5QA 3SFVA 5JANA 1L5VA 5H81A 4MWOA 2VSQA 3LT4A 2GZDA 1IMJA 2AVDA 1Y6JA 1I4DD 5J9FA 1JP7A 3VC7A 2VPTA 4YJ2B 1WULS 2ZBQA 2P9TA 2NU7B 3H75A 4D9KA 3CN9A 1RC0A 4ZAGA 4DWVA 2BISA 3VZSA 2V5UA 4C01A 1HDEA 1W73A 5JECA 4BFWA 4LIPD 1VPTA 1W1IA 1YUNA 2BDEA 3PC6A 1QYDA 5K20A 4M1TA 5IDWA 3ZDRA 3U4QB 1EUQA 4NZOA 4ZEXA 4BXOB 1JHAA 3OQOA 1W36B 3WRWA 3PE4A 1C4WA 4MI6A 5CXSA 3JVVA 4YRTA 3WGOA 1Y34E 4XX0B 4EY6A 4LXGA 4BNWA 2O1EA 4DHEA 4DN6A 3IQIX 1FP4A 3SIXA 4RTJA 1DGQA 3ZU5A 1EB9A 1M2KA 2PIDA 2ZB4A 2ZVPX 2OAQ1 1OAOC 3I04A 1UWCA 4I55B 5D3MA 1E3EA 1KIFA 3S0JA 4C14A 4P38A 4KFCA 2G7MC 4C30A 3CLKA 4K6GA 4ZQIA 1ULUA 3G5AA 4MWTA 4W9MC 4ZODA 1Y9EA 2RHCA 1KEUA 1WXXA 3GPCA 1G3RA 1A9YA 4Q15A 3VJRA 3DEYX 3EODA 3LYAA 3JALB 3EG9A 4MYDA 1U8UA 2WZQA 4LFBB 2H0RA 2VXCA 5AVSA 4KQCA 1XRNA 2I8AA 3Q8XB 1R4MA 3WDKA 3DP9A 3H2KA 3L0CA 4B7XA 2JD0A 3FRIA 2ZVQX 5AWFC 4DWJA 4YQYA 2J1LA 1PJLA 3L7LA 4RGYA 3ZY3A 2EBFX 1BX0A 1DQYA 4MZXA 4F7WA 5BUSA 3L6OO 5IT4A 1QHXA 3SIPA 3KUCA 3E3AA 3VR6A 1N3YA 1D03A 1LUAA 3EZ2A 2GLTA 3HA3A 4RIGA 4Q48A 3WZMA 4DXHA 4B4DA 1JPUA 2HQOA 1N8NA 2ZVJA 3IQHX 1XDGA 1YJ8A 4GNKA 1IOWA 3IAM6 7REQA 1LVHA 2HEIA 3HA5A 4P22A 1UDAA 3BJRA 3NBYC 2R1TB 4L9AA 3WK5A 5LZ8A 1I36A 2VP3A 5BXQC 4PRZA 4EVSA 3WB1A 5COQA 2AW3A 1IZZA 4QM6A 2BUAA 3OWHA 1V1MB 1W6UA 2NSYA 2C5GA 3UB3A 4E46A 5CFRA 1JFTA 3GWZA 4PO9A 2QE7D 3CVYA 1VBNA 3BH6A 4WN9B 1ABBA 3L6DA 2EDCA 3GK3A 5M5BA 2C2BA 4WCDA 9MHTA 4LRYA 2A58A 2H0AA 2OK7A 2P69A 1L4GA 2HA2A 3C1UA 4U7HA 3SMQA 1W75A 4MCHA 4IAOA 2D2EA 2OQRA 5E7MA 1H2HA 3DLCA 3VSAA 5ADUS 3DMGA 4Q9AA 5LL6P 4Q0MA 4TPKA 1SQGA 2OHXA 3DTVB 3GVHA 3QU4A 2HH9A 4HGYA 1PQYA 2WDPA 4BP1A 1CE8B 1L5WA 3KJHA 4JT4A 5DCLA 3ELDA 4R8LA 4BVEA 4D57A 4IIBA 3RHFA 3O82A 1VI5A 3V42A 3FYTA 1V48A 1SUEA 5JOQA 2WHRA 1X1DA 3JQGB 1CS0B 4UU1A 4F4DA 1FB5A 3DXFA 3A11A 2O3JA 1NYRA 2H4ZA 5A3SA 1V3VA 2VJBA 1AQIA 2FMFA 3GPLA 1GTL1 2YNMC 3EVTA 4Y2PA 3WGGA 5HSGA 2M6KA 4UM5A 4PGAA 1RLUA 3V6MA 1T9HA 1JF8A 4GOLD 4KSCA 3NBQA 4AP5A 1M6VB 4UHCA 3M70A 2IH5A 1R0RE 3V9AA 1HMYA 2QN8A 3F4BA 4YAKA 3PNVA 2XSZD 4G0WA 3GYGA 4JR2A 2O2GA 1QKJA 4YCAA 3I61A 3ETJA 2OP1A 3REQA 4V38A 3WP1B 2REXB 3WO0A 3QTLA 2BH2A 1ZONA 3OY2A 1JHPA 2X2EA 4RK1A 4D9CA 3C98A 3BB3A 5EP3A 2P67A 2QNBA 2CFSA 5ELLA 3S7ZA 4BFUA 1JJBA 1QYRA 2B8NA 2WD7B 2CD9A 4A0QA 1X8LA 1S0UA 1WV1A 3DPSA 2I76A 2ATCA 3VTKA 2GCIA 3P1JA 4AXXA 5REQB 3BYZA 1JUDA 4PE5B 1ZNYA 4L57A 1Q0HA 3K9NA 4GM0A 3NAMA 4KNWA 1ZP6A 3MGCA 4GWKA 3DMRA 1DRUA 2A5YB 4YT5A 1NT2A 2RARA 2O23A 4AYTA 2WILA 2J3MA 2BCGY 2WUWE 2YXLA 1JDJA 3D2BA 2QVBA 3N8IA 4HSEA 5F2KA 1FFHA 3T61A 1XZGA 4ARSA 5I8PA 2BW0A 2EKQA 2QY6A 2R1UA 2ZUCA 3DE7X 2DSTA 3A1EA 1QCDA 1X7HA 4GGMX 2HB6A 2WQZA 4NZ9A 1T8RA 2WM9B 2F9FA 3U9LA 3UEOA 2DTDA 2PRIA 3K9BA 4IHQA 4UOEA 2ID9A 5DYNA 1XZMA 3TRHA 4TYPA 2M6LA 3FWYA 1NQXA 1AN0A 4MQBA 3W5CA 2IHYA 3X1ZA 3ZHOA 1XV5A 1N5JA 4NCKA 3SMVA 2EIHA 2DQYA 1CUFA 2ANCA 4NHOA 3QITA 1NF2A 3WAJA 2OG2A 1AN9A 1L5LA 5AM0A 4CT4B 4FDMA 4GMHA 1EKXA 1LC3A 1BX1A 1JDBB 1T2DA 2QV0A 3NWPA 5BR1A 2DETA 2Z30A 3TTXA 1QO9A 5CT4A 1E5DA 1GPH1 1H2FA 1RRMA 2BM8A 3W06A 4YXFA 2IZ7A 3KE8A 3KQHA 3MCTA 2DPGA 5CTAA 3EQ6A 3TOZA 4A8JB 1MOPA 3Q7PA 2WM3A 3PSHA 3HY3A 5CDSA 3AB8A 4V39A 2FLKA 1U7WA 3T15A 2Z6UA 1YBHA 4QREA 4AZ0A 2PX6A 4HWGA 1WMAA 1UANA 1XVIA 1GIAA 1HT1E 4EGAA 3UGKA 1DAPA 4OFZA 4TMFA 4IICA 3EXIB 1FDTA 3BTUA 2JEZA 3BA6A 1H23A 2H4WA 1GYRA 2FVXA 2FKNA 4MWEA 3LYHA 2GTHA 4NPAA 5CA1A 1BTOA 2OT3B 1XEAA 1ZMXA 2VDOB 1P73A 3IEXA 1SK8A 4B3SB 3WSWA 3WYAA 3RUIA 3MELA 3CR7A 3ZPXA 3ESDA 2GAFA 4CCSA 5KYWB 3MTAA 1X1EA 4M86A 3SS8A 4X8OA 1HNNA 2PM8A 4BYMA 4CF4A 4EUEA 3OQJA 3FOZA 1DAFA 1O5IA 3AR3A 4KBFA 5I9MA 3ADDA 2W2NA 2VXOA 2ZSFA 3E1KA 3EZLA 5K99A 2QBYB 3U7RA 3QI2A 4RJLA 5GM1A 1VJ1A 4CM7A 2PX4A 5H16A 6YASA 3QW2A 3SZMA 1NU8A 1UMBA 1WUYA 2R4QA 4MR8B 4ZVOA 4XVCA 4RO0A 3PNKA 1K8QA 5TVGA 3EBLA 1JNXX 1L7DA 4MQFB 1X1BA 1ZGZA 2AN9A 2I4MA 3JRXA 4URUR 1H2YA 2O8DA 4PQYA 3HXLA 4D9GA 2DE0X 2PGNA 2X8BA 1L8LA 1ZK1A 3KKQA 1EVKA 3JQEA 4RFLA 4UU8A 4MEJA 3TTSA 2WKQA 2GBFA 4MYHA 1XPRA 4N48A 2FSSA 2CJXA 2WYVA 2PMFA 1B3RA 1XCGB 2ILVA 3FKJA 5FL7A 4INAA 3EGCA 3NDPA 5CA0A 1SU7A 1OROA 3IUPA 4TUYA 1RXC