2FMFA

Crystal structure of chey in complex with chez 200-214 solved from a f432 crystal grown in hepes (ph 7.5)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Crystal Structures of Beryllium Fluoride-free and Beryllium Fluoride-bound CheY in Complex with the Conserved C-terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation.
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 45
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2006-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fmfA00
4LZLA 4D6XA 3CRNA 4RWEA 4B09A 1QMPA 1OXKB 4S05A 1QO0D 1SD5A 2XDYA 3A3KA 1M5UA 3CZCA 1EAYA 2LUOA 2FQXA 1A2OA 3H5IA 3UUGA 1JBEA 4Q6WA 5KC8A 2FMHA 3GA5A 2QW1A 4M88A 4MRMB 2PUFA 5IUNC 1PNTA 3QLTA 1K66A 1ZH2A 3JPWA 1DG9A 4KPYA 1PEAA 3BRQA 3A0UA 4HYEA 2DRIA 5FWXB 4KMRA 4W5OA 3HS3A 1BAPA 4G0ZA 3T8YA 1EWTA 4JB0A 4LE1A 2NZVG 3H5LA 4DADA 4Z4EA 4EYGA 2PMCA 3LOPA 3OQOA 3LUCA 1F4VA 5FWYB 1ZESA 2IOYA 1TJYA 1J56A 2E4YA 3GV0A 1IIBA 4RK1A 4WXMA 3OQNA 1JFTA 3QLVA 1U2PA 6ABPA 3OLWA 4YLEA 3KYIB 4XXHA 4YCSA 1EWKA 3A0RB 5CHYA 2A9PA 4YP9A 4Z4FA 2FSPA 4JA2A 1M2EA 5IEBA 4RK0A 3VNBA 2RDMA 4ETMA 1Z26A 3GT7A 4ZPJA 3KS9A 5CNJA 2MYNA 2PL9A 4F11A 1JF8A 3C97A 3CG0A 4RV5A 4KVFA 2HPHA 4KV7A 3ROTA 1RPJA 4EYOA 3LUKA 4QYMA 1Z2EA 4G0XA 5EWLA 4YR7A 2VUHB 5IUJC 1RZRD 4W5NA 4KQCA 3N0WA 3T6KA 3D02A 1USGA 4QICA 1HEYA 4DQDA 3QLUA 4RDCA 2R4QA 3CNBA 1AB5A 3H75A 4NCBA 1U8TA 4G97A 5KC9A 1QQAA 2NT3A 3H5WA 4MYRA 1Z12A 2O20A 3CHYA 4RY8A 4Z99A 4IILA 4Z9AA 3H5OA 3S99A 4MS3B 3JY6A 4P98A 4Z9BA 3EQ2A 2JBAB 5TQJA 3EJWA 4MQEA 5TQ0B 5D2CA 4W5QA 3EGCA 3C3MA 2PUAA 1JYFA 1NXSA 1CEYA 3IP5A 3FDFA 3O1IC 3QEMB 2RGYA 2ZWMA 3LUFA 1WETA 2MYTA 2GX6A 1B00A 5JNUA 3HJFA 3EQZA 4MLDA 1ZDMA 3KYJB 1JFSA 3RVKA 4KNYA 1GCAA 4MR8A 1SRRA 4FE4A 1USIA 2QZJA 3MA0A 4N47A 4MS4A 1Z17A 4PICA 1ZAYA 1MB3A 4TLLB 3HSYA 4D74A 1M2FA 2AYXA 3IP7A 2TMYA 3N6VA 1PHRA 2R25B 1JHZA 2MSKA 3EAFA 1VRVA 4ML3A 5DTEA 1XHEA 3RH0A 3UKJA 5BR1A 6CHYA 5IEJA 1NY5A 1RXEA 3N75A 5FBKA 3P9YA 5EWJB 3CS3A 4HNSA 3MQ4A 4UHKA 1U04A 3KCNA 3LTEA 5EWMB 1H9CA 1A0OA 2FVYA 4JP1A 3JVIA 3HO1A 4MPTA 5IULC 5JNRA 3KHTA 4MQFA 2BGGA 2FMKA 2MYUA 4N0QA 2IPLA 3O2QB 4RZSA 3NNDA 1PEYA 4EYQA 3NNSA 3HM9A 1APBA 1DZ3A 4TLMB 5TPWA 1GLGA 1BDIA 3L6UA 4OTZA 1ABFA 3KLOA 5DLEA 1PNRA 2E4UA 2QSJA 4XASA 5ABPA 3JS5A 2PUDA 4YRZA 1D1QA 1JFVA 3KSMA 3I09A 2W42A 5TQ2B 3KG2A 3LUAA 3QK7A 4ZMSA 2PUBA 3BILA 1GUDA 2IYNA 1Z16A 2FKAA 4ZYLA 3DGEC 2E4WA 1L5YA 4MR9B 2M1ZA 1Z2DA 5C5CA 2FMFA 4MLCA 2FEPA 3SQNA 4OG2A 1A04A 5HKOA 3OLXA 4Z4HA 3QLVC 4L85A 3CFYA 2MYPA 1SXGA 3LKBA 4RY0A 3OMXA 4G86A 1EHCA 2CHEA 3D8UA 1E2BA 2WRZA 5CNIA 2QU7A 4MR7B 2OENG 1UDRA 2IPNA 2JVKA 3FGZA 4P1ZA 1DCFA 1DC8A 1MB0A 2R47A 3H6HA 2FXIA 5GOTA 2ZAYA 2LPMA 4N0PA 4YWHA 3T38A 3N0XA 1T34A 1Z18A 4WWHA 1E6MA 2GWRA 2VYCA 2WB4A 3OLZA 5DKFA 3Q7RA 3FFXA 1LBIA 1Z13A 1DP4A 1JDNA 2PL1A 5I4CA 2RJOA 3RVLA 1GCGA 3OM1A 5JNSA 3URMA 1NXOA 3F7NA 1D5WA 2FTKE 3H1GA 3ILHA 4LDZA 5HM6A 3T95A 2X7XA 3C6QA 4PEVA 1VLZA 1C4WA 2N9UA 3HZHA 2L18A 1TM2A 2QV0A 4IRXA 4QPJC 4IF4A 4JB2A 3LUJA 3B2NA 2FN8A 1ZVVA 1Y1LA 3RQIA 3GBPA 5FBHA 1BDJA 3A10A 1P6QA 1P6UA 1ZGZA 2IDMA 3FFWA 4ETNA 4KZKA 1DBPA 3RVSA 1MVOA 2QXYA 3TD9A 3K4HA 4O1IA 2FEKA 4RK5A 4TMYA 4EGSA 3I5AA 3DLBA 1KGSA 5EWLB 3CG4A 1JWLA 3KJXA 4OBBA 3QX9A 3OMWA 1E6LA 2JRLA 2PLNA 4MAAA 3F6PA 4Q7EA 4EVSA 7ABPA 5HSGA 2PUGA 1AB6A 2R48A 3C3KA 4OLBA 4KQ9A 4N76A 1LBHA 3C3WA 5PNTA 1F51E 1D1PA 2HQOA 4E7PA 3M9XA 1JYEA 5HQJA 3RVNA 2QR3A 1NTRA 1DRJA 1DCMA 2QVCA 3IP6A 4JAVC 3Q41A 3DLHA 1FSPA 1ISRA 4G0MA 5JNVA 4UHJA 2JB9A 1QQBA 2CD7A 3JPYA 4N03A 3Q9SA 2VUIB 4IMJB 4MQEB 1JX6A 2A9RA 3FMVA 5KQGA 5B3JA 4EVQA 8ABPA 1KRWA 1NXXA 3OM0A 1S8NA 1M5TA 3GL9A 3N53A 4MS1A 2JBAA 5IUKC 3MYYA 1U0SY 1ISSA 2PKXA 3OLVA 4ZJPA 2HJ9A 2PE5A 4MR8B 2IPAB 4MS4B 3OO1A 3SNKA 2A9QA 3RVRA 4RXMA 3QELA 1DCKA 3QEKA 3LUHA 4PZ0A 1Z15A 1YVUA 5KQMA 1YK0A 4S04A 4HNQA 3H1FA 4W5RA 5KWSA 1QP4A 3Q7TA 2P4UA 3IPAA 4EUKA 1JH9A 5DGCA 1Z25A 3DBIA 3H1EA 3EODA 5T7BA 1QKKA 2JVIA 1EFAA 2B1JA 2F8SA 4KFCA 2WWVD 4E7OA 2RJNA 3QX8A 4MQFB 4JOQA 3HK2A 4F12A 4WZZA 4KRFA 5ED4A 2B4AA 2V0NA 4WT7A 3H5TA 3HV2A 1NATA 2IPMA 3TX6A 5BRJA 2JVJA 4FE7A 3LUDA 1K68A 5BRAA 4Z4GA 1ZH4A 1YS7A 4H3HB 3HDGA 4GPAA 2VK2A 1TVMA 4LE2A 2IKSA 2MSWA 3HEBA 1ZHHA 3JTEA 2LP4Y 2WJAA 3NBMA 4NQRA 3GYBA 4NV3A 4Z0NA 2NUBA 4EY3A 4Y9TA 1DBQA 3O75A 5TQ2A 1FQWA 2CHFA 4Z4CA 3E61A 5JS1A 2LIVA 2FN9A 3N0RA 4KK4A 2YHBA 1TLFA 4RXTA 2E4ZA 3CLKA 3ILYA 3N8IA 3RVPA 3H5VA 1P2FA 1DBWA 3CU5A 1RNLA 1D2AA 1MAVA 2L19A 2I6FA 2FLWA 1YMUA 3NNNA 3OQMA 2LBPA 2FEWB 4Q6BA 1W9HA 1ZGGA 5CNKA 3TO5A 3QLUC 2GI4A 1OXBB 3L49A 3K9CA 4L4UA 4MRMA 4G0OA 1ZN2A 3R0JA 4RK7A 2FQWA 5CNMA 3SG0A 2NZUG 1U2QA 5C5EA 2ID7A 5FWXA 3H6GA 1SXHA 3O2JA 2L17A 5JS2A 4LRQA 1CHNA 3TB6A 5IX8A 4NCAA 4W5TA 1W25A 4RXUA 5TPZA 9ABPA 5KQLA 3CKMA 1BDHA 3RVQA 3GWGA 1NXWA 2L2QA 2WJWA 5FWYA 4ZMRA 1QO0A 1VKRA 5GQSA 2HQRA 3Q15C 1KMIY 1P8AA 2JK1A 3MIZA 3BRSA 5B3JC 3TMYA 3O1HB 4G0QA 1QP7A 3W9SA 3ROFA 4F8JA 5F64A 1QNLA 4RKRA 3SM9A 2HQBA 5BQ3A 2YHAA 1D4ZA 1QP0A 3UK0A 2WMYA 3KKEA 1DRKA 3M6MD 3O74A 5E3JA 1CYEA 2OQRA 3JVDA 1PUXA 3MMNA 1ZY2A 3E3MA 2E4XA 1I3CA 4H3KB 3I45A 1RXIA 2H3HA 3HVRA 3EULA 1YK1A 3OLYA 3BREA 4H60A 3GBVA 5DCLA 3DGFC 3RVOA 5JNTA 2JCGA 1BA2A 3F73A 4RY9A 3IPCA 4MS3A 3NHMA 4RSMA 1ZITA 3HDVA 3MF4A 4WUTA 1C0EA 4XFKA 4YGXB 5TQ0A 3EDCA 2HSGA 4G0YA 1GUBA 3IDOA 1EWVA 4PYRA 3QEMA 4MS1B 3HXMA 2H0AA 1RZRA 1NXTA 1FFGA 1XWWA 1SXIA 2GBPA 4IGAA 4EVRA 4D6YA 1NXPA 3IP9A 3MM4A 2FQYA 4JASB 4PE5B 4LX8A 3QELB 3SY8A 3HUUA 3I42A 2WY2D 4RKQA 4LDAA 4O1HA 4Z4IA 1VPWA 2PJUA 4IMIB 4ETIA 2P9HA 2ID9A 4FB4A 5KI6A 3O1JC 4HNRA 3GRCA 1JDPA 4RS3A 2A9OA 5EWJA 3O21A 2NT4A 1FFSA 3CZ5A 2KYRA 4GNRA 2QVGA 1XHFA 1YMVA 2PAFA 4MR7A 3VNAA 4YV7A 1MIHA 4N41A 5EWMA 1YS6A 3HCWA 4XLTA 4F06A 3RVJA 1DJMA 1LJLA 1R8JA 5TPWB 2FLKA 4MGEA 1JLKA 1NXVA 5TE9A 3BBLA 1URPA 4OLAA 4RK6A 3SAJA 4KK3A 1LJUA 4EYKA 5KQPA 4O5AA 1FFWA 3OO0A 4RK4A 4YO7A 1KRXA 3RVMA 1DC7A 1YIOA 1QPZA 4LE0A 3KLNA 4YS6A 1TMYA 3Q7SA 4OATA 4XAQA 5IC5A 5T3YA 3G1WA 2AYZA 1E6KA 3HUTA 4NICA 2GKGA 4CBVA 4G0PA 1JL3A 3LUGA 4WXEA 4XARA 2PUEA 2F8TA 2PUCA 3O2SB 1YTUA 3FFTA 2E4VA 4RU1A 1LK0A 1ABEA 3CTPA 4MR9A 4DN6A 3M9WA 1BVHA 5IBQA 2Q5CA 2FMIA 2J48A 2M98A 3LKVA 4TN5A 3G85A 1L5ZA 2FW0A 3KTOA 4QYWA 3F6CA 2CWDA 3LFTA 3DZDA 3LMKA 3NHZA 5TPZD 5JNWA 4KREA 4F3TA 1USKA 2MSLA
chains in the Genus database with same CATH superfamily
2WK1A 3T5BA 3I1YA 2EL7A 3KIPA 1UXIA 3HJNA 4B79A 4S05A 3K72B 1EWQA 2P2GA 4J0KA 4FYVA 4P0PB 2QZSA 3CZCA 3RUAA 3L0ZA 1RYMA 3C1UA 3GMSA 1NKVA 4LMPA 2ZYHA 2Z43A 3Q0TA 5F76A 1AGYA 1TYBE 1RQXA 1ZZGA 4WK2B 4PFKA 5HQTA 2QSYA 2Y9MB 4JJZA 1ATZA 4BMZA 3LH5A 1GCOA 3WWOA 1MAUA 3RS5A 1U5BA 1U6KA 1M0SA 3DLIA 2Z5GA 4RLQA 4M3NA 4FCWA 4QOEA 1JYSA 4FJ0A 2Q6LA 2OBLA 4HAVA 4EYGA 3A6LA 4X7BA 3DXYA 3A4NA 3L9XA 1J56A 1G8JA 3UJPA 2YL2A 3O7MA 4WXMA 3RK1A 3OQNA 3VUFA 1UPCA 3TBHA 9GPBA 1QTIA 2YMMA 5ECWA 2G5PA 2AHRA 1BMFD 1FJGB 2ZYUX 3A6DA 4LCJA 2EC5A 4R9UC 2YFHA 2B4KA 1HFWA 1VB5A 1W5TA 2NV2B 3D2CA 1P7PA 3I1JA 3ILXA 3GT7A 4OY3A 4E88A 5LQKA 1G2QA 2RCNA 3UA4A 1JSLA 2OBMA 1UJ5A 3WXMA 3RF6A 5EHXA 4PZDA 3CG0A 2C8LA 2VTEA 3BGVA 2HD4A 3CH4B 4DBZA 3E7WA 1G4UR 1M10A 4FM9A 3KAQA 4R1NA 4ZOAA 1IZ8A 2I7TA 2ZWAA 3FCAA 1XKQA 4MMXB 1R9JA 3VDXA 5G02A 2XMCA 1I7LA 5BNFA 3KSAC 1ZNZA 3ASZA 8LDHA 1X7YA 1L2TA 3L93A 4LS3A 3W5DA 2Y0DA 1KZYC 1M66A 4MV8A 2FUG6 5DGXA 1EJ0A 5CVCA 3QLUA 4CFZA 1GDHA 1SBHA 3AFMA 3SS9X 3F98A 2GNOA 1M2VB 1UK6A 4OU4A 1WOYA 5EVJA 2CLFB 4UBMA 4BNKA 2NTYC 4ZV9A 2XMRA 3ZGLA 3STXA 3HBFA 3PTLA 2EFCB 1CP2A 1CQIA 1LS1A 3N8KA 2X77A 3B9RA 4QZVA 1CE8A 4HOYA 3JY6A 2DPGA 3R6WA 1QAOA 4EX7A 2UYHA 2QL5A 5K3FB 4A8JA 3CRRA 3VR2A 5TQJA 3UK1A 1DKNA 3L0PA 3VNQA 4DV2B 4NU5A 3RVDA 2C2ZA 1TKAA 4TSKA 3AVVA 1IXKA 2XVXA 2DT8A 3FDXA 4QBIA 5GONA 2GX6A 5A4IS 5DBOA 2GM5A 3KM0A 1L5VA 2YVQA 4UCXA 4W6ZA 1G6Q1 3EQZA 2BFEA 1JI0A 1MFPA 5BQFA 3O31A 1ZDMA 3R3HA 5CDYA 3FMPB 4AB1A 2IT1A 3VI3B 1BTOA 4D9MA 3RCBA 1V8DA 1JJFA 2AMJA 1JR4A 1PQUA 3GJ8A 4OAOA 1JSZA 4XQ0A 1NAIA 5CLHA 1QTRA 5ES3A 8GPBA 3H5NA 1X3SA 4H9GA 4M1SA 4FSXA 4JJ6A 2ODAA 3ANTA 4KYIB 2FUNB 1DMRA 3EEQA 3MUEA 1UXGA 3CWCA 4HWKA 4M0EA 2BGRA 4RSRA 2BOVA 3VTAA 1ULUA 3QXXA 4GVPA 1JRLA 4XEUA 5BW6B 3VBCA 4BEBA 1XCJA 1Y5RA 3PQCA 1WUHS 4RDHA 1O94D 1IG0A 1KC3A 2B2NA 5JE8A 1L5WA 1J99A 1YRWA 5HZGA 4NFSA 4QAJA 3FWNA 1NDHA 1YQDA 3CS3A 2AR9A 4GL4A 3CVJA 4Y30A 3R3JA 2GN2A 1GRVA 2X86A 2NX2A 3AB3A 1J9EA 4M22A 4BZZA 1ZO8A 3R0IA 2IZ5A 3SR0A 4C4OA 4N48A 5JBQA 4HLUA 2EGUA 5JWOA 1M2GA 3FUWA 3VC7A 1G64A 3QJGA 2CF6A 3AC0A 1HNZB 1OZAA 4RTPA 4HX9A 1HEUA 4TLMB 3S2ZA 3MWGA 5AUPB 1ABFA 1X80A 4ZZ2A 2HNKA 1WPRA 5LJLA 3KD3A 1MBZA 4IOLA 1AKEA 1S1MA 4K86A 4QU0A 5C3MA 5GZ3A 1S89A 1E6EA 1U80A 1R6BX 5AW5A 2QLFA 2WIDA 5DYYA 1G0NA 1VFPA 3WRYA 1YQXA 4MVXA 5FLYA 4BFSA 2ZPAA 2VP2A 2Q2VA 1R0SA 2IUEA 4M37A 4KQ2A 2ZUVA 3DGEC 3UJ9A 4ZEWA 2IBTA 1TUBB 3QLJA 3G0BA 4M9ZA 3MT9A 3NYRA 3AOGA 4OB7A 4WCFA 2VT7A 2VZ0A 4I8IA 4ZICA 3N70A 2D0PB 5K0NA 1MA3A 3F6SA 1RLMA 4P4GA 2CXPA 2IW3A 2YIDA 4IUCS 4RD6A 3U31A 1GGNA 3RI3A 1HLGA 1SJ9A 2CXSA 3D6MA 1GGMA 1KTIA 2VI5A 5JAQA 2QU7A 3DAYA 5HRCA 2H2WA 1TJNA 3CBQA 4ZO8A 1E2JA 2IPNA 4LHWA 2BFDB 2C9DA 3OE4A 1ENZA 1Z45A 4MB6A 2O1SA 4N0DA 4XASA 2OGTA 5GOTA 3GLFE 1R3DA 2A57A 2QXTA 1NW9B 4WUVA 4E32A 2CFIA 1JG6A 2C4MA 1L4EA 2CUTA 3NT5A 1ZK0A 2VYCA 1P7WA 3OLZA 4OJTA 5FI0B 4CXMA 3HYSA 4FXPA 4HWSA 4HMQA 1T43A 3V8NA 3CCCA 1UJBA 3UFXA 2WAAA 3UNXA 3AM1A 5L3SA 1ZINA 2E6UX 1XZLA 2DUUA 2K7ZA 3OM1A 4UASA 1OV4A 4XX0B 3I01A 3ZLJA 3OKFA 4YAFA 2FEXA 1IPEA 1QE5A 2D1FA 4NRDA 3EDYA 3UHFA 1KMHA 2FB9A 1EP2B 5LMNB 2HIGA 1E64A 1BQ4A 2J0EA 3BMCA 3EMVA 3IOCA 1VLZA 2J0UB 1OPRA 3OE7A 4KWCA 3S3TA 3SKXA 4D8VA 4IZ6A 1VCOA 3CCBA 3AIMA 3OIUA 2YJNA 4YECA 3SR3A 1BU5A 1S2OA 1SIWA 2FN8A 1QHXA 3AR9A 1OZFA 2P2ZA 4KO4S 4MVJA 3GBPA 4B7XA 2GETA 2H5LA 3K0BA 4AUMA 4CW7A 3C3EA 3LOUA 4M8KA 4JWKA 4YB8A 3UW3A 2IS2A 4HDNA 3H11A 1LDEA 1SK8A 4RDIA 1ZHOA 5AXCA 2JLAA 3ZCRA 2W2VA 4EG4A 3NEJA 2BCEA 5HJ2A 1UKBA 1O4WA 2YHIA 4DNOA 4FFVA 1KIAA 3JR3A 4MAAA 4DC0A 1Y82A 1W35A 1WCWA 1PGQA 1TGYA 2JJ2A 2X8AA 1O0SA 3AP2A 4LJ4A 4QL3A 3MTJA 4KQ9A 3V1KA 1O03A 4J9VA 1JW9B 1JDVA 1ORRA 5FTKA 4CUKA 2RE8A 3T9CA 4D99A 4UUBA 2DUMA 3IP6A 1KS9A 3NR2A 4LFCB 4RTNA 3DMDA 2ZYVX 2IEGA 2VJAA 2BGMA 3DE4X 1U1EA 3VH1A 3ROQA 4YREA 3OJOA 5FNVB 1COWD 3FKJA 3I0ZA 4MVWA 1E2LA 2PT9A 4CR8A 1JX6A 1W88B 2ACVA 1QDUA 5ITZA 5KYYA 4D4LA 3LCMA 3SD7A 1PAUA 3HY3A 2IRWA 3ABSB 1RAHA 2GKSA 3GGDA 3MYYA 2W6ID 4KXYA 3ZXSA 5JCZA 5JD4A 1KY5A 2HJ9A 3FSGD 1GFZA 3EX7C 3GARA 4JJ8A 4MS4B 4BNDB 3C14C 3KDPA 3JZIA 1COWA 1J0AA 5ELMA 5KJFA 1MOSA 2H11A 1WDMA 2CV2A 4L5IA 3RS9A 1KYWA 1PWYE 1KEEA 1XMVA 3DC2A 2H1VA 4Q3LA 2M6KA 1QQTA 4PLZA 1PLJA 3GLIB 3OHMA 3IPAA 1OD6A 2NG1A 2OZLA 1GQYA 3KZ1E 2CCKA 4MV4A 4DCUA 4EKDA 2P0AA 5F77A 3OP1A 3C45A 5K0GA 2FP3A 4UMVA 3IQFA 2W4MA 3QGMA 1SOWA 2H5JA 4JBLA 2NVWA 2JI4A 4NK5A 4EKGA 5KNCH 1R5JA 1PR5A 2EZTA 2RJNA 4H7FA 3ZDRA 1BWQA 1IOLA 1YOBA 1Z2PX 2L69A 4HJXA 4RFSB 4BGDA 2C2XA 2IPMA 1GSAA 1NFRA 5BV1A 3DTTA 3NH9A 3BL5A 4PAOA 4A92A 4INOA 3FKQA 1D6JA 3CH6A 3HU2A 1ZH4A 4BMCA 4K88A 5AUNB 1VDZA 2BGUA 3P52A 1W5BA 3VNSA 3QVUA 4D3DA 1EIWA 2Q7OE 1GPBA 4TUYA 1J90A 1E1CA 1TVMA 4G81A 1G2OA 1JSRA 3B3GA 2DFVA 3AG5A 4JFAA 4TN1A 2FMXA 3F1LA 5KAMA 3JTEA 3VSAA 4GI2A 5CB4A 4DMCA 2ZYAA 1L1RA 3OH8A 1NMXA 2BELA 2QE7D 3LBHA 5CP8A 1W93A 2QF7A 3F3KA 1JQJC 1GAQA 4ZO7A 1EA7A 4YAEA 4FD2A 7MDHA 4RULA 5F33A 2XVYA 1RHJA 2QTGA 1JHMA 4M21A 3DW1X 2GJKA 5REQB 4PX3A 5TIIA 2HLDA 3EFOB 1N7HA 1SKQA 1CB0A 4IVQA 4N5NA 4NS1A 4Q3BA 5LQAA 3AJRA 1WRBA 2P62A 2V4ZA 2RG1A 4MHTA 4DMFA 2QU8A 3H1PA 3PFBA 4ARBA 3H5VA 4WZAA 3LDGA 3T5TA 1G4AE 3CU5A 4MB0A 2IS4A 2V7XA 1KZ4A 4IXTA 1E61A 2VBIA 3SVLA 3HACA 2GSDA 4GM0A 1QTQA 3OIYA 3E53A 4BVGA 1M2KA 4EHNA 4W7SA 3H2SA 221PA 4QUHA 3HMQA 3HRKA 3E5RA 4N01A 2LDBA 4G0OA 1CJMA 2W6JD 4ZOEA 4K9DA 1TMKA 2CDRA 3QF4B 2Z9BA 3W06A 5K03A 2DVMA 2Q41A 3RIMA 4ZI7A 2CZGA 4YCAA 1ENPA 1RZ3A 4FFLA 5EP2A 3QWHA 2AXQA 2WF9A 5CJJA 5LPNA 1V6CA 2H1LA 2X2OA 1W8IA 1GZSA 2R1UA 3FOFC 2WC1A 4V0KA 1VTKA 4YJKA 2OAGA 3TEFA 3BWCA 4Y2UA 3GJTA 2P1ZA 4M0LA 4K26A 2L82A 3GNSA 1OASA 3ZE6A 3PFFA 2BONA 3OURA 3Q5GA 3HGMA 1KIMA 5KNDD 1A98A 3SOPA 4BUJA 2X3UA 1N2CB 5K4GA 2DJIA 4HP8A 4P53A 5HUHA 3E15A 4ND8B 4I1OA 4P5DA 4RQAA 2PVPA 2H9AA 3OUZA 4MCHA 1U3FA 5HS6A 4IUDS 1QP0A 5EKUA 4IGFA 2ZOSA 3LXXA 1BE8A 4RH3A 2LTAA 3M3PA 3RT9A 4AUKA 2ZXEA 4R4JA 1E0KA 2D5BA 3GRYA 1WF3A 1EE1A 2XE7A 2P27A 5EIBC 1X42A 1G7RA 1RXIA 2IJGX 2ROQA 1U0RA 2R6FA 3ELDA 3AHIA 5JFGA 1G42A 2EJVA 4K8RB 4OHYA 2X0RA 3D1LA 3DAOA 3RUHA 4AF8A 4AWBA 2NZJA 3PIIA 1KPIA 3HNPA 4BS9A 4L5CA 4Z7OB 5DNWA 4AN1A 3I32A 5L9AA 4DIBA 2J0QA 1SCBA 5CLLA 5H7XA 3HDVA 4AG5A 4DJDC 1K27A 3WFIA 1P31A 1GNTA 3M6AA 3OU6A 5JD3A 3VVCA 1GA1A 5B6PA 5EUCA 4R83A 1R12A 3BJRA 5ALHA 2IV3A 3UMSA 1QIDA 2IDZA 4U8GA 1XWWA 3LO5A 5DM1A 4IV5A 3LXMA 1B6TA 1NP7A 4I5IA 5EQJB 2Q3FA 3GMDA 4D1YA 5EIAA 3S0JA 2XY4A 4MYUA 4FHCA 1PRYA 3BDIA 3AGPA 1P5ZB 2Z4SA 3KZNA 4JASB 5ETJA 1T9CA 3RSLA 1KYXA 4X5OA 5F12A 5HGJA 3SY8A 4N0EA 2B21A 1JPVA 1BMTA 1QWSA 2AQIA 4TTAA 1SY7A 3IP1A 5JSFA 3ZKWB 3HJCA 7REQA 4OQDA 4U3JB 1DIBA 1XCGB 3HTXA 3WY9A 2QRPA 1SU6A 1WPQA 2O57A 1JMYA 1LTHR 4R2IA 4CCYB 2I3AA 5SYNA 1QBGA 3EVDA 4MTCA 4CM1A 5IYZB 1GRNA 2XQIA 4NVRA 2M6RA 3ZE7A 1CJUC 4R9VA 4A2PA 2O19A 1L5LA 4GSLA 3KXDA 1X1SA 2DQZA 2GAAA 3IMEA 4UVEA 1Z5OA 1MIHA 3E7DA 3MILA 4HGPA 3INRA 5AKJA 2J9FB 2PLWA 1RHUA 5TX7A 1VHDA 2WYOA 1SURA 2VXOA 5K0LA 2JHFA 1B6RA 3LBIA 1JLKA 1HDEA 1NOJA 2I2BA 2GD0A 1BMQA 1U2TA 4B7CA 3SBOA 4NYJR 3IEIA 3LG2A 3U3RA 3QUSA 4QLAA 4HN9A 4CHGA 2CDCA 3ABOB 5ALEA 1TDJA 1ZUWA 1KA9H 3QKRB 1U7UA 3EOZA 1FMTA 1XDBA 4FU0A 4BLOA 4Q12A 4S2EA 3CPEA 2HA6A 3AU8A 1QZXA 2VJBA 2RK3A 3L6RA 4NICA 3P9QA 7YASA 3ELBA 4WXEA 4XI9A 4Y7CA 4E11A 2EX1A 4H7DA 3V3KA 3O91A 3O2SB 4CM4A 4JI8B 1UJNA 1GU7A 2GFHA 5K4AA 2GYWA 1DRWA 3AIOA 4FTWA 5T41A 4X24A 4B0OA 4WESB 1FFXB 5JZOA 2Y3IA 1XNQB 2HBYA 3CLRC 5JG7A 3BGSA 3I9JA 4FHGA 2I8AA 4WCFB 2I29A 3NKFA 5ALKA 4RBNA 4PX2A 3W1WA 3OQBA 5ALPA 4FDLA 3HGQA 4MUKA 3MS4A 2MSLA 4CF7A 3RUIA 3K3PA 2PANA 3BJEA 4LNUA 3L8HA 4RJTA 1MX5A 1W34A 3AHEA 5A1TA 5IJ9A 3KAPA 1KRHA 3FDZB 1IJEA 3R40A 5B6JA 1P1KA 4D0GA 2JBHA 1YXMA 3QPWA 3GGOA 3T7IA 5G1OA 3H5IA 4J0QA 1PR4A 3KTAB 4Q6WA 3WRXA 4Q1BA 1TTQB 1Z5UA 3COSA 3H2BA 3RS7A 1PVVA 4EEXA 5AW4A 3L0SA 3QLTA 4MWEA 2XGMA 1BOOA 2BJVA 2EWVA 2R5NA 5D01A 2CYCA 3TPZA 1L5SA 2XT0A 4GXQA 4NU6A 2P3OA 3P9IA 2CVZA 3B6MA 1BAPA 3CWQA 3RWBA 4RPCA 3DR5A 2C1XA 3UHOA 5JWRA 5B4UA 5K6AC 3ADPA 4HNTA 3MTDA 1YU6A 3TKAA 5HTKA 3W6OA 3MT0A 5CT5A 1DE0A 1GV1A 3TX2A 3O73A 4KYTA 8ADHA 4NJOA 5AVWA 1Y3IA 1ZVKA 4A8TA 4QYSA 4Z51A 5IMBA 4Q4JB 2FJUA 5LBTA 3CH7A 2CVPA 3WJ1A 1T6NA 4MUYA 2W2XA 2ZT7A 3DE2X 4YP9A 3MOSA 1XRSB 1R0XA 1TAHA 3P4YA 3VRHA 2IDJA 2XCQA 3AB7A 4O4LB 2HLNA 5KWEA 1BSVA 1LSOA 1I3KA 3FNRA 3LLMA 4QT4A 4P31A 1W4CA 4PG7A 3L7OA 4M8IA 4ABYA 3D3EA 4QVIA 4QPDA 4KN9S 1KEUA 3KT6A 4FS8A 2V6BA 3OZUA 4ZXPA 3U7HB 4JODA 1COZA 4L16A 3GLFB 2WVGA 1HZZA 1X0VA 3OZIA 1U5AA 2QTRA 1XLTC 3DYVA 4N4AA 2WUVA 3X1DA 1SG9A 2ZU0C 5KSPA 1K7SN 4DQDA 4FNMA 3DVAA 2R4QA 2E3JA 4IW3B 4OXQA 1PI3A 3V8BA 6YASA 1ZI9A 3KJFA 2RGNC 1IIRA 4GC9A 4TV8B 2J7PD 4MQ4A 3A1NA 5JARA 4IILA 1DNPA 1JTVA 2DHCA 4QYIA 3ZLTA 3A1CA 3OZCA 1ZOLA 2CKMA 2Z57A 3D8SA 3U1VA 1CYDA 1Q7TA 1XEFA 2JBAB 3BB4A 4ZN6A 4DR3B 3KR1A 4GG1A 4CM8A 1E5TA 5EZSA 2R1ZA 2RGYA 3HKDB 1VJ0A 4LYFA 1THTA 2OCBA 3K2IA 4JUAA 1FFBA 4TQ9A 4E12A 2P7IA 2Y6VA 4PO1A 4AYWA 3GO4A 5J4VA 2WFLA 3JASA 3ZHYA 2NXCA 1K4MA 2E82A 1WDLA 2N1BA 2QT0A 2ZR0A 3Q2KA 3DZ8A 1C9MA 5B7QA 3AI2A 3CO5A 1DV1A 4KWHA 5DM4A 4DZTA 1JTEA 1PTJA 1SELA 2ACEA 1SVIA 2HV9A 3KJIA 1Q12A 2TMYA 4XW2A 4BX2A 1PHRA 1LVHA 4RIGA 4URWR 4XWWA 1W19A 4WVFA 2R6AA 1T2CA 1E3SA 2BMEA 4AJHA 3UK7A 1TRKA 1VJGA 4B3RB 1DWOA 2W2KB 4B71A 2DU8A 5JSZA 2ZRPA 2XB2A 3GHYA 4DY6A 3AUXA 1UOEA 3G2JA 3PENA 4YHBA 3GJ4A 1N3YA 3V2GA 2DETA 1XCPA 4BAGA 2FMKA 5K8CA 1R4NA 1HTWA 1EJ6A 3EZYA 1I33A 3RTGA 4PYKA 2J9XB 4Q7EA 1OC4A 1PEYA 2V98A 5TPWA 3A1FA 3LC0A 1BDIA 3SC4A 4BPRA 1ZD4A 2VT6A 1Y9JA 1M73E 1OYYA 2FR1A 1EVZA 3MLBA 3VHQA 2QV7A 5A2QA 1N5KA 4A26A 3NV9A 1E32A 1E2MA 2EKZA 2GAJA 2H07A 4MITA 5C7OO 2VF8A 3G82C 1VLMA 1Y6RA 3NVMB 2E4WA 1M6YA 4R51A 3TI9A 2M1ZA 2IOFA 1GT6A 1RRGA 5CTJA 1D0VA 3ZWBA 1POXA 4OOEA 1B43A 3RC8A 2FG6C 1L8XA 3CEJA 3HDQA 2Y9PB 1Z07A 3I0MA 4F8EA 1GZHB 1ZMRA 3H16A 2MYPA 2BFNA 1OX6A 3LKBA 4LK3A 4G86A 1ZRNA 4EI2A 3IUYA 4L8FA 3KZCA 1C1XA 4Q3EA 5A7GA 2UVPB 3T7RA 1GUAA 3MWJA 3TAXA 1ILEA 1P4GA 4X54A 3VH4A 4YT2A 5C9ZA 2C7RA 1FSFA 1ZN7A 3QWBA 4HEA1 1JALA 1WV1A 1YR3A 4RPIA 3UTDA 4A91A 2JVKA 4NNJA 1DCFA 2B1IA 4F91B 5AI8A 5EKDA 4NHOA 4GZMA 3ZXUB 3AR4A 2Y1FA 3N0XA 1T34A 2WD7B 4ARSA 4B3SB 2GRAA 3PNBA 2V5AA 5DKFA 2WF5A 1HX7A 3F46A 1DTWB 3LP8A 4S35A 5FWAA 1ZJYA 3AP1A 3KOOA 3EGEA 2C5BA 1PT6A 1ZJZA 5CT4A 3ZDEA 4XVHA 3W6ZA 4AYXA 3N7UA 1RXWA 1XXHA 3AF2A 4LMAA 3BAFA 2Q4OA 4Q39A 1A88A 1AKYA 2I8CA 4FZRA 4GMDA 5LWHA 2CHQA 4DVGA 5BVHB 1EDZA 1V6SA 1CZOA 1V26A 2PPLA 3UPTA 3K9BA 1RAIA 1WBJB 3Q4GA 4RD1A 5E7JA 1IHUA 2IIVA 1ZVVA 1P7YA 1RJ9B 4C0XA 5GTDA 2HCBA 4UEJA 1P6QA 2XV1A 3ECAA 3G2QA 2CXTA 4DDKA 3V1LA 3E9ZA 1ICIA 4AO7A 1HKHA 4RETA 1I0ZA 4V0ME 1BWSA 1JB1A 4HB0A 2FRVA 3K4HA 2FPGB 3GDFA 1VPDA 4D02A 2JGKA 4F5YA 2QW8A 1OLXA 2K87A 4IRMA 1RWQA 4A2QA 3EZLA 4UE6A 2WG1A 4Y6OA 2PUGA 3VA7A 1J0BA 2V7EA 4PONA 4PLPA 3X1XA 1XNHA 3Q0IA 2C9OA 1XMQB 2G08A 1DI0A 1U8YA 2AOTB 2FSIA 3BZUA 1ZD8A 4RH0A 3USZA 3C4QA 2PMEA 2ZI3A 1G8KA 4EP1A 3KUCA 3D3JA 3H8VA 4JAVC 2BD0A 2X0EA 1DKOA 4IXNA 3M5WA 4IDFA 1QGOA 4L75A 3EPJA 1YJCA 2EQ5A 3BBPA 4ZTBA 3IUEA 5A3RA 3WSWA 1G38A 3PC6A 4ZT7A 4C4AA 2O2ZA 1Q0UA 3OECA 4L2IA 4XB1A 1UMDB 3NGLA 4HNHA 5B53A 4B8YA 3CRQA 1T9BA 2QP9X 1ESEA 3JYNA 2VYNA 1PLLA 5KQGA 1J9ZA 1RYNA 5C1BA 1C0IA 1XRNA 4EVQA 5JZBA 2FQ1A 4R6XA 4MS1A 4RPKA 4O4IF 1J97A 1HSZA 3P27A 4GHWA 4ZJPA 2P2LA 5HMLA 4FLFA 2VPYA 4ZOBA 1AXGA 1PG0A 4DV0B 4PWYA 1JDSA 5FUBA 4HUTA 5KOHA 2PFSA 1E2FA 3I39X 4YXWD 1TOAA 4PZZA 1ZCJA 5U9CA 1QIFA 4G26A 3K70C 2NSJA 4DIUA 1UOPA 3PXDA 1O9HA 1V7CA 1VRWA 3LUHA 3THRA 2XCIA 3D7KA 3ELYA 4Q02A 1B76A 1P61B 2I4NA 5GPBA 3K6RA 4WCFC 1L4UA 4MDEA 2W43A 4XKJA 2CGEA 4DB4A 1SCIA 3P9ZA 1Y5IA 3AK4A 1JPUA 5CGQB 4AKIA 4Z53A 4GQAA 2PS1A 3O8BA 3WDSA 1MZPA 3WOHA 3SHTA 2W2LA 1GPAA 2XRMA 2ZJAA 3HVKA 5BYBA 4B7AA 4WLOA 3WRVA 4EUNA 4NXMB 1NFQA 1VE7A 2PRIA 1DG3A 4KVGA 4MCAA 1J9GA 2NXNA 1SU7A 2V6FA 2Q1SA 4UDYX 2SCUA 3S2IA 1XN4A 3OHSX 3BIWA 4YFVA 3TX6A 1A5BB 3F9RA 1M8PA 2B6HA 4QDXA 2H2FA 1HY3A 3LGXA 3TLZA 1PHPA 2H63A 2IXAA 4GICA 1NN3A 2X1VA 1DZIA 4XLLA 4F93B 2ZS9A 3VKUA 3ZE9A 4F3CA 4D4JA 2BI8A 4ENQA 4YMTA 1CDOA 4U2GA 1IN5A 3KYDA 1SXQA 4OLJA 2UYCA 4TXNA 3KR2A 3SIRA 1IY9A 1SULA 1VZ3A 3LC1O 1GNQA 1U9ZA 2Q1WA 2O2YA 3LQRA 1Z8DA 4V39A 3EPPA 2Y05A 3ZJ5A 4F0JA 1ID8A 2EX0A 4FGLA 2PXHA 4HQLA 2CHFA 2QD5A 3CLHA 3GJ3A 5TGDA 2PX4A 3RC9A 2LIVA 1XLVA 4RHUA 4RTQA 4KC0A 5CYOA 2CYAA 4NESA 5JLAA 1I1HA 1MIOA 4ESEA 5A5VA 4RO0A 1GPNA 2GNPA 4RYLA 4HPXB 4GMGA 3TTVA 2GB4A 2G1JA 3DDUA 2OD7A 4ASUA 4LV8B 2ARKA 2R6ZA 4RABA 4X45A 4KSYA 3EXHB 2FWPA 4CMCA 4ESOA 5E0KB 4YJFA 2IHBA 3BL8A 4HVCA 3K9CA 5LR6A 4CV1A 2QN6A 2NO9A 2VT3A 4LQ4A 4MRMA 1NBMA 2AZ4A 1E7RA 4M83A 5LLDA 5INTA 2LZ0A 2PMBA 2V3VA 1G20A 4Z4QA 4AROA 3FZGA 4Y9RA 5FOSA 2I1VB 3NM6B 1CHNA 3VBEA 4X64B 3TB6A 2Q0QA 5IX8A 2JW5A 1S2IA 1W25A 4KYVA 1XTSA 1R0KA 5LIRA 3CKMA 1TYAE 2GEDA 2AI2A 5KYKA 1N78A 3AY0A 1C0LA 3EUFA 3IB6A 3HVHA 4X66B 1ZD9A 2ZJ0A 4HATA 1UKZA 4YIHA 5HKLA 2WA2A 3HNRA 2B20A 2B83A 2YJ4A 4WE3A 4YMWA 3BCUA 3ZE2B 4QJ4A 1W2GA 1U7OA 1GGFA 4IR7A 1AV7A 2OM6A 4PTYA 4WKOA 4CNBA 4D9FA 5C8ZA 3ZHOA 3C3DA 2BFWA 3VVBA 3CXUA 1DUVG 4DLKA 4LHXA 4F8JA 2DWUA 4ZCPA 4COOA 1Z74A 1PJQA 1LDYA 5KJ1A 1GWNA 4Y1RB 2PSHA 1E1DA 5BWBA 1KZ6A 5BN4B 1RPAA 4A1FA 5F5NA 1BHJA 1D8AA 4IINA 4Q0MA 3RTDA 2B30A 2EARA 3AILA 4TMKA 5SZKB 1ACLA 4BMYA 4YROA 2Y2VA 3QYPA 2TRSB 3KWMA 2B3TA 3QH4A 3LQ2A 2HDNB 3LU1A 4IDCA 1T9HA 2W6MA 4AK9A 2OHVA 3VPGA 3HLKA 4BNGA 2GM4A 4R0VA 3BWMA 1OI4A 3KSDO 2ZTVA 1WVGA 4H60A 1Z2CA 2MIIA 2PVSA 1GL3A 2P9ZA 3GA7A 4K0KB 3UATA 4Y6RA 4LRSB 1WQ1R 1EK5A 1EGVB 4O2BA 4XGKA 3W5SA 4WN9A 4DSAA 1O54A 16PKA 1S01A 4IVNA 2HCRA 3ZHSA 4JUCA 3A6KA 2DBZA 1ODKA 3OUTA 4HYQA 1WUYA 3BIOA 3IT2A 3PNQA 3RJTA 3IELA 1EGHA 1KTVA 4DPLA 1Z3CA 1JJVA 2HHCA 2GZHA 4U2BA 3WE7A 3MXTA 1LVUA 1LLCA 2YX1A 1T2VA 3NC0C 2B5VA 4PO9A 3A3OA 1P7CA 3ANSA 1JILA 1H3FA 4XOUA 2V9ZA 5G0VA 3O8NA 4IQGA 4XQGA 4CETA 4CG2A 1Q1EA 3E1SA 2XYRA 4Z2AA 4I4TA 2ZIGA 3QELB 3I42A 3R7WA 2WY2D 4BRZA 1MB2A 1OX5A 3DM9B 4A0GA 3IDAA 4RUKA 1DO0A 3AB8A 2E0IA 4ETIA 1CY1A 1SHTX 2GZRA 2X42A 2JGJA 1YB7A 1LF5A 4K28A 4XFJA 4RA6A 1UFOA 3OPNA 1AUVA 1RKBA 4LJ5A 3C2QA 5ALZA 3VPHA 1YE3A 4YCNA 2R2GA 2H1FA 3LVQE 4EW1A 1FLAA 3RKRA 2UDPA 4EG5A 4RS3A 1Z8FA 1U3VA 4E09A 2WYVA 3CZ5A 5ARDA 5ILQA 2Q2WA 4GRDA 3UAWA 4BB9A 1CJSA 2QR2A 2XIJA 3DE6X 3COWA 4XLTA 2P9QA 1MVNA 1DKPA 3BEDA 3EAQA 3G7NA 4ZDWA 2HJSA 3VPBA 1CPYA 3UMRA 5IASA 3OFSA 1XF9A 5FR2A 3X2FA 1JEEA 1UPTA 4RVOA 1RYZA 2I8LA 1PZNA 3LWBA 4B8WA 1LPNA 2AQHA 4MRAA 5L3QA 5LOVF 2OXCA 2NTVA 2B8JA 3GYGA 3D81A 5HJEA 2RD2A 1Y9EA 4P4UA 3I5XA 4KHPB 1CW2B 3HWWA 1YQQA 4UARA 2ZSJA 3EE6A 4IDHA 4ECEA 5TJHA 2AFHE 1YS4A 4PYOA 3RSOA 2V3CC 3ZDBA 1YTUA 1T2DA 2NSHA 1GTMA 5KKAA 4Y9DA 1WXHA 4ZFNA 1VE3A 2YUIA 3JQ7B 1T8WA 4URXR 3C7DB 1KJJA 2I34A 3GQBA 1ZONA 3M9WA 4MW2A 5HF8A 9LDTA 1RWXA 3QKTA 1V1JA 4Y2GA 4CF6A 1YGPA 4QTTB 1Y8RA 2FSSA 4FWIB 3LKVA 4N6OA 4DG8A 3G85A 4UTRA 3PUIA 3DTYA 1IXYA 1DX4A 2QL7A 3FSRA 3NHSA 2R00A 1W2HA 4JLSA 3OE1A 1WSAA 3W9YA 4F4UA 1F48A 4LXGA 2GZMA 3FKSD 5HE9A 2GBCA 1QMPA 2HHJA 2X19A 3AM5A 1Y1TA 4KRGA 4W99A 1NI4A 3DO6A 4DLXA 3FUCA 4G2TA 3ZX5A 4QDOA 4D9NA 1VMEA 5A4KA 4EAQA 1HR0B 5A0TA 1YZLA 3FDJA 1XU9A 1G16A 4E21A 3WKEA 1A2OA 3UUGA 1S7CA 2D3WA 2WFAA 1IBSA 1J20A 4C7OB 4BFUA 3UWPA 3OIVA 2O6LA 5F2NA 3FBGA 4MWGA 5LD2B 1WUTA 2VF7A 4MB2A 2XCRB 5E2BA 1EUQA 1IQPA 4WEQA 5EIXA 3E9DA 5AJTA 4DA8A 3FR7A 4PCVA 4DANA 1E7SA 4J0DA 3ORYA 1BCRA 1EWTA 4EQ6A 2JZCA 2OV1A 1NT4A 3H5LA 1J5EB 4Z49A 1M76A 4ZQEA 1GRCA 3IDSA 2FPPB 1P2DA 1AS2A 4J8PA 4KH1A 4ZD6A 1Q2UA 2MSEB 3H2YA 5ALJA 3TLXA 5FA6A 3NGMA 4BX3A 1WQ4A 3EGXB 1RTKA 3FPBA 4DT1A 4K6CA 4BO6A 3NT4A 2AE1A 3MGCA 4OGGA 3P2MA 4K9MA 4LHYA 4UREA 2G71A 3IOMA 4KN6A 5BNTA 3KS9A 1EX1A 1E59A 2B6NA 3C97A 1FIUA 1IUKA 4QOHA 1U7ZA 4JL5A 4MJLA 5K8IA 1U0NA 3UHJA 1XEXB 1RRCA 1JBQA 1AO3A 2CW5A 2HRCA 2YY7A 3L7IA 3OD5A 1UR5A 4MA0A 4U7GA 3RYIA 3U7QA 2ENWA 4NONA 1EAMA 4ER7A 2FP4A 1VP9A 1T5LA 1VOTA 1Z5ZA 3ZV6A 4LTNA 4F96A 1PR9A 2QN2A 1HYGA 1MXHA 2Q07A 2I80A 1EBFA 1KJYA 5DF1A 4EI8A 3A31A 3WISA 3ZLVA 3NUZA 3E9RA 2G17A 1C4XA 2J4DA 2VSYA 4P0TA 4OU5A 3DE7X 2J08A 3C6YA 2O20A 2E1RA 2AFVA 2HMUA 2HADA 4B73A 5BV0A 3S99A 1Q0LA 3M4ZA 2C2GA 4E5SA 1E3WA 4JLVA 1GG2A 3NDIA 4RLHA 4TKVA 4MQEA 2J59A 5K0TA 2C4HA 1JFLA 3FI9A 3VPXA 5DX1A 4CTKA 3C3BA 3WGQA 3O1IC 4AQYB 1A50B 3JQGB 3EPLA 2HLPA 1SCKA 2Q2QA 1Q0PA 5EG5A 3WWDA 1DQRA 1FNBA 1PZMA 3NJRA 3KQYA 1U8EA 1TEHA 4XDZA 1J8YF 1VHLA 3HWX1 1DXYA 3ENKA 1F2TA 1XTVA 2C8JA 5FQNA 4DRXB 1TFUA 1T5BA 2QZJA 1CRZA 4N47A 5AKGA 4BCCA 4AUNA 4BIIA 1FUUA 2BEKA 4G25A 4D74A 5IDXA 2AYXA 2ZBVA 3HP7A 2IBSA 3NONA 3GMTA 4FW9A 1I01A 1ZH8A 4ZYWA 1YS9A 4P3NA 3TD6A 1XHEA 3EAGA 3LK7A 4JC5A 3MS7A 1QJ4A 4O0LA 1V7QA 2G80A 1PGPA 4I1VA 1RAGA 2AG6A 4O2AB 1HQCA 4MRNA 2H16A 1U4SA 3G8BA 5AJZA 3PRKE 5AIBA 1U3GA 4MXDA 2YS6A 4IS3A 2LGJA 4NFLA 1YV9A 2WU0A 4JSYA 1ENYA 4BE7B 2GPAA 4N18A 2HCTA 5D3MA 2OM2A 5CUQA 4Q48A 2O9JA 3TCXB 4ARZB 3FNGA 1QUFA 2P6UA 4RZSA 4EGCB 4BWGA 4CR7A 4ND3A 1K92A 2BHRA 1UMBA 5FA8A 4CM9D 1U8ZA 2Q3HA 4YUXA 1W30A 4ZOQI 2ZS7A 3EISA 4AVYA 3ZY4A 4L1KA 3UB3A 2OQ2A 2C2OA 2XF8A 3IDQA 1A97A 1M7BA 3HY6A 5ERYA 2GMWA 2D62A 4J16A 4ITRC 4PLHA 4H1UA 3W8DA 2QKYA 3LLSA 5CB0A 3OX2A 5EJIA 1FRZA 1M6VA 7ADHA 4BYGA 2DPLA 1D2HA 2JHPA 2BFCA 1YKGA 1NWCA 1V16B 4PIMA 2ZR7A 1VI5A 2ZT8A 3B5IA 3PCRB 1SC3A 4MR9B 1U2DA 2QRLA 4DAOA 1R0WA 2GF2A 3CX7A 4G89A 4DLUA 1F9EA 1LPPA 2XEDA 4RIFA 4EZIA 3TECE 5KNBH 2A30A 3DXXA 2B92A 1YC2A 2AN1A 1YA8A 4V03A 2CCJA 2PZMA 1BXRB 1US8A 3V9PA 1ZQ9A 2OBYA 4TKLA 4A0RA 4BNXA 5JAIA 1M33A 2WRZA 1NG9A 2WU3A 1ZCFA 5CNIA 1YR7A 1L7EA 3IUSA 4DLTA 5HKAA 2PR7A 2QUBA 4PV7A 4JITA 3DBRB 2R8YA 1BZYA 3FZQA 1H3EA 4MHSA 4P1ZA 3DMTC 1ZD2P 3O4HA 1IEVA 4ZAZA 1OH7A 2EG9A 2VPXA 2ZAYA 4PQGA 3UJCA 4KTVE 3O4FA 1RRVA 4LMRA 4WWHA 1DC6A 1LX6A 3QXCA 4DQVA 5HFAA 1K98A 4DMRA 1IH8A 4AY6A 2O06A 3RSFA 3Q3IA 4OAQA 1WXQA 5B64A 4GD3Q 2ZVPX 4BC0A 1ND5A 2J9YB 2PQ6A 4ILEA 1KQNA 2VQEB 3CEHA 3K96A 4QDTA 1KWKA 3MW8A 4IGKA 4OHFA 5HM6A 5ALTA 1ETHA 2Q4EA 2PUJA 4FBGA 1TM2A 2H2IA 2KQUA 3DKKA 3EW7A 1G21B 1N2GA 3KPYA 3OPXA 4N3AA 4UBKA 1E9FA 3PDHA 1ULBA 5FBHA 1BDJA 4NENB 3R3UA 2J8ZA 2ZPUA 3ZD6A 4KAXA 5JO0A 2R7NA 1V4VA 4TQAA 3FUVA 4BWYA 3THWB 2AXEA 4CKBA 2JFFA 1FU8A 3FLEA 4GSKA 5E6UA 1RXVA 1U7HA 1WMFA 2HK9A 5JALA 4BQEA 3QSYA 1PTJC 3QX9A 3DF9A 4FGKA 3ETNA 2G67A 1Z7EA 4PS0A 4RENA 1EDBA 5CA1B 5HM8A 3KEQA 5IDYA 3AYXB 3GUHA 3NAGA 1F4LA 2ZCUA 3DOIA 3K09C 4MNTA 1KK0A 2ZR9A 2ZRDA 2PRYA 4F6LA 1NTRA 2C5SA 3BCRA 2QTVB 1EMDA 3Q41A 1Z88A 3IPXA 3KZMA 4KV9A 4R98A 5DHUA 5IJAA 1JHQA 5AJXA 1ISRA 1RC8A 1AMOA 4GO1A 4FJ2A 4PRKA 2E5FA 1C29B 3P0FA 2D5CA 4RJLA 1QQBA 1SGWA 2QMHA 4HUQA 4X92A 5FPYA 1VIDA 2WSBA 3AV3A 2PT6A 2I1WA 4GBMA 4OLFA 1SBNE 2I2DA 5B3JA 1PNOA 4IMRA 2XA2A 2ZSFA 1XG5A 1MO3A 3CRMA 1QLWA 4C5AA 1C7EA 1JFRA 2YQ4A 4ZEVA 1OKKA 1ISSA 2C07A 2ONJA 3JWPA 1LNSA 3T9BA 3NH6A 3I9V1 2ZIXA 1SU4A 4YCCA 2GYUA 1OFTA 2F9MA 3NVAA 3RU2A 5MHTA 3E0QA 5T4FA 2OE2A 2Z9CA 3FBWA 2CLCX 3C7AA 1UKVY 1Y7PA 1DCKA 1QZUA 4GGPA 1P4HA 4DSNA 1E8NA 4S24A 4PFSA 4CLOA 5KSYA 1AA6A 5K8VA 1FFHA 1MQAA 1ZNXA 4OUKX 4R1MA 5AQEA 2I0FA 3UAOA 4RCYA 3OFND 4YJGB 3T7DA 1JLMA 4OXNA 4R2JA 1YFJA 5JPIA 5FL7A 4PZ9A 4Z54A 4NBVA 2A78A 4PYIA 4CMBA 2FAXA 3WL3A 4TVBA 2GK7A 4ALMA 3ZI4A 3GPCA 4JEIA 2BDTA 2EFYA 1QCDA 1JQEA 3H42B 1N33B 4EYSA 3RAEC 4B40A 2H2GA 1DIHA 4OQYA 3K5HA 3IQXA 3PQ7A 3WKDA 5DLYA 1LTQA 4W7HA 3TW8B 5LMUB 5H8WA 1K5PA 4KMOA 1NN0A 5CITA 3DPUA 5CIWA 5DXAA 4TSFA 1XMSA 3OFVA 3PXXA 4TKMA 2Z5VA 3A58B 1F0YA 2HO4A 4UTXA 2QAIA 2CWWA 3TOCA 1TC2A 1LBTA 1F3LA 1U3WA 2V7GA 1G3MA 3PNYA 1RJEA 3HB0A 4LV6A 2P9JA 4QC2A 2GAOA 1VI2A 2GUWA 2C58A 3GT3A 4RJIA 2ZREA 1KEKA 1JS1X 3HEBA 3SXUB 4BEWA 3GEGA 4JX9A 2XBUA 2B7LA 3U4HA 1XL1A 1G8HA 3NLLA 5HFNA 4WBNB 3LPLA 2QRUA 3HI4A 2B99A 2G28A 4JK3A 3V1YA 2G04A 3HXTA 3QBTA 4A03A 2VDQB 3HCCA 3ECSA 3BC1A 4E4TA 4ND1A 4LVCA 1FPMA 1WXGA 1AN9A 1QWOA 2CD9A 2G76A 2FOIA 2O14A 1W46A 3Q40A 4NKRA 4ZAFA 3WI7A 3DOUA 2E4ZA 1MCZA 4N5LA 3G9TA 4EHAA 5CDSA 3I0NA 3WLFA 1O7JA 3WAGA 3I4CA 2G5CA 1SIOA 3BE8A 521PA 3OQMA 1MT0A 2C82A 3F0TA 4IIXA 1NLUA 4YRFA 1UQTA 2H8KA 3TZCA 4UD2A 2SKEA 4A9AA 4QBTA 1E89A 2C5HA 3NPAA 4LJ6A 4DM3A 1KYIA 4RGQA 1KKUA 4C3VA 5IT9A 1DEHA 4LY9A 3ADDA 3HVIA 2D3TA 4NEQA 5TMDA 3QWAA 4PCUA 1IOZA 4OO3A 3AEZA 1Z7GA 4PXSA 4HKTA 4U63A 5LLSA 4LF4B 1KMNA 2FQWA 3GLHA 3OOHA 4UM9D 5CXXA 3RHSA 3L4BA 2C4WA 4GZLA 4Q3CA 4QFDA 3O2JA 3P4UA 4JI2B 4FBMA 2J5QA 1IVYA 2WQ6A 1OBVA 3SJZA 5C81A 2XDQA 2YV1A 4TXHA 5DOZA 5A3SA 1EK1A 3ZD9A 4R31A 3R1IA 2BLNA 1VE1A 4J0FA 3EHEA 2WJYA 1QGZA 3W6PA 1H85A 2JIZA 2WF7A 4FYWA 2UUAB 4MPJA 3GJZA 4ZCLA 3OZVA 2OAQ1 1JKMA 4YJ2B 1RQNA 1DL5A 3SIPA 4CDNA 1QO7A 4EDHA 2C0CA 2BEUA 2QT1A 1R88A 3BGOS 2F6RA 4PGAA 3ESQA 4OI1A 3H0EA 1CETA 1JIKA 4BN4A 2XOEA 3V4FA 2RAVA 4EJ2A 4AZSA 1C1YA 4GEKA 3KDAA 2FFRA 2WF6A 3EVTA 3LC7O 4UM9B 5BWOA 5JZMA 4BMPB 2D00A 1PZGA 5BSMA 3WK8A 4E51A 1UFQA 2CL5A 2VHTA 2ZBFA 3LWZA 4ZU6X 5KTMA 3JVDA 1XZHA 4EB8A 4NABA 4CCSA 2WM3A 3CNOA 4MVJE 3E2MA 4N5HX 4FT2A 3EQ6A 1G5FA 4UMDA 3CIOA 5H83A 2H3HA 4IIHA 1WF6A 4Q1DA 3GBVA 2IEAA 4ER3A 1N0WA 3LRPA 2WWTA 3PIRA 1JP7A 2XXAB 3TSYA 1M5RA 2GASA 3QFTA 1V41E 4PPQA 4HDMB 1P0QA 1KZHA 5LQNA 4C14A 5A05A 4PGFA 5LOVA 1V11A 1HDRA 4MH0R 3U3XA 1UDAA 4MWCA 3RHTA 2IQ5A 3OTOB 3LPMA 1JDZA 2ZUFA 1MG5A 2OV8A 2BY4A 2ZUBA 1N6PA 2GBLC 2OQIA 1NR5A 1U9IA 4JB8A 4BIMA 2B4TO 4MCJA 5HJ7A 1W0KD 1ZIPA 1H6AA 2EW2A 4DMKA 4NC9A 3PXAA 4IIYA 2H7CA 3F3MA 3T12A 3A1DA 3B53X 1H94A 3I04M 2PH5A 5AP9A 2ZJ7A 3PXCX 4KUEA 1AQUA 1JT9A 2JASA 2UZAA 1R6VA 2NV0A 1LXCA 4XRRA 4DR1B 5H81A 3W9BA 1CQPA 4L6IA 1XKXA 3FY4A 5FO0A 4FB4A 1RKQA 3C5WP 1WW3A 1DO8A 1E1QA 4H6PA 1IZZA 3QE3A 2OXEA 3SK0A 4CIVA 1TZMA 1OZGA 3O21A 2PZFA 1FFSA 1OTYA 3LHIA 1T8RA 3Q2OA 4X6LA 5IZCC 1IOVA 1KU0A 3EC1A 1LH0A 1Z5VA 4FQ7A 3I28A 2V0CA 1ZJ6A 3BF7A 3EXHC 3M4NA 4K1XA 1OWPA 1YZKA 3WAJA 4PN7A 4XM2A 4CKEB 3IJ5A 2ZBDA 1YFZA 1H6DA 2QJTA 2DKNA 3LYLA 2RJ3A 4URZR 1HG0A 1YACA 3WRWA 3K0AA 1DC7A 5MDHA 2IZ1A 3UMGA 3QE0A 2R79A 3W5HA 2BSQA 2WWHA 1X7HA 4OJNA 1IHPA 3ITDA 3WX0A 1WSWA 5DCUA 2D5AA 2CJFA 2WILA 2R2AA 2YZNA 3UJ8A 2DLNA 4C4SA 4HGYA 3UMMA 2D7DA 4NV0A 2IYOA 2CFCA 2J3LA 4Q1EA 4BRWA 1NQOA 4ZT4A 3Q85A 2X0JA 4J3NA 3R7AA 3CWZA 4C2UA 2BZ1A 5TNXA 4WK0B 5IAKA 2ZJ2A 5EHGA 5J9FA 2J6BA 2VDRB 2PD6A 4KXQA 5E6SA 4NBNA 3SMQA 1AG9A 1TT7A 3KT8A 4WY8A 3GFFA 4Q4AB 1PYGA 2O8EA 2QUZA 4IIEA 5F1YA 2DWCA 3LW7A 4J6EA 4ZANA 2HSEA 2VJDA 1VHJA 3L1IA 3KK0A 2PSDA 1DWUA 2IYZA 5SZIA 1DXOA 2I3GA 4IFIA 4IKEA 3TYXA 1D6MA 3WWCA 1M5UA 4EATA 1SA0A 1WCYA 2OYSA 3LLVA 2JAQA 2PLFA 3DO8A 4WGFA 3PA8A 3R3VA 3T4XA 3SYTA 1CX9B 2OL4A 2QGZA 2OFOA 4G8BA 4BLRA 3BUSA 4MUEA 3IKTA 4R2XA 4QHSA 4QGGA 4WZAE 1XB2A 3UGTA 3RO7A 3FTCA 4HNAA 4XSVA 3WGIA 1SCAA 3MUNA 3AEYA 9MHTA 1XWIA 3RFFA 5L4SA 4L07A 4U39A 3VHLB 3OQOA 1GTRA 3MHTA 4TTJA 5FWYB 3WFZA 2WVJA 1TYEB 2BEVA 4KTTE 1WCXA 1RQ7A 2PH7A 3THYB 1O6BA 2GDZA 4ZAXA 1NV8A 3OTGA 1PT9A 3D5TA 2GCOA 2GPYA 2M1XA 1CY2A 1DBRA 2RK4A 1ZA1A 3PZRA 1QAQA 3MN1A 1PUJA 4QDUA 4AJLA 3GVHA 5DW0A 3WB9A 1EP3B 4R5HA 1KF0A 3QMMA 6ADHA 3A9VA 4H15A 1XQWA 3E27A 3OQIB 1Q5PA 3N76A 4AZ3B 2JFQA 3IAS6 3U1BA 2XQGA 4XUGB 3N9IA 3MLAA 4NCHA 4DV6B 4BNFA 3NHKA 4L0DA 1TTHA 1ECBA 1NW3A 2GTHA 2VDVE 3JV7A 4G5HA 1LD3A 4BCDA 1Z0DA 3UKDA 3KKNA 2F3QA 3TG8A 2HFJA 4JUBA 1O57A 4KQCA 4RQTA 3L0IB 3WZ2A 3F78A 5KTPA 1YJ8A 2O3JA 3SEZA 3K8QA 1OZHA 4XD7A 2G9ZA 5HILA 1W4LA 1U8FO 2Z2JA 5TGZA 3UAVA 3WGKA 1GPH1 2O8FB 2NT3A 1A7UA 3L7BA 4YRGA 1T35A 5K01A 2PXCA 1Q15A 2QNBA 3UIEA 3N8HA 2RBEA 2QX8A 3OJFA 3JALA 4O1MA 2NO0A 5TT1A 5KKNB 4PSVA 1T2EA 3BZBA 4OQMA 4UBLA 2WSSD 3PUKA 4G5GA 4JJAA 4BJ6A 4RVHA 5KREA 3C8DA 3R2JA 3L07A 2HRBA 3HJBA 3DLAA 5F21A 4V0NA 4AURA 4RJJA 5ALDA 4BNNA 4BQIA 2OVBA 1EDDA 1Y9ZA 4Q9HA 5GVRA 3QE9Y 4DABA 4INAA 1GQQA 1JFSA 1T9ZA 1SRRA 4OYYA 1USIA 3KJHA 3ZZMA 4A6PA 2RHCA 5KKCA 1GM5A 3CZ4A 5KBYA 1I5OA 3VZSA 5AVKA 1PJ3A 3KVVA 3EA0A 4L8YA 5F1KA 3SGLA 3ND8A 1DJNA 1LZKA 2VDOB 2ZATA 3IP7A 5GOZA 2P91A 3L8GA 4LXQA 2AN4A 1E69A 2MCFA 5C32A 3BWVA 1SRQA 3WL8A 3RT7A 2Z04A 1RXEA 1HYEA 2A0FA 3C5EA 5FX2A 5EWJB 4B6PA 1GTZA 5C8YF 5CXUA 5EP4A 3TG2A 2DXIA 4ZOLF 5HZMA 2XUPA 1QLHA 3EFBA 1YB1A 2DOKA 1G2PA 1YU9A 4UBNA 5C1IA 2JDID 3MRSA 4G5OA 4TL6A 3RHFA 3Q6IA 1F06A 3MOIA 5HF5A 3NTVA 5JXHA 4UC0A 3HO1A 1WM1A 2VDLB 4OB8A 3RTEA 2JJ1A 1NJGA 3VPDA 2KW5A 2FGKA 2NW6A 2ZRQA 1XK6A 3NNDA 4EYQA 5AVQA 2H5IA 5LD2C 1JDBB 1JQ5A 4G84A 4YK7A 3TW0A 1E1NA 1E1CB 1FYWA 2JI8A 5B2ZA 4CODB 1V9CA 2HSWA 1YQGA 2PSEA 1L7DA 4KE8A 4O0MA 4L9AA 5DLEA 3W2HA 3X2SA 3B60A 3QBJA 3RYFA 2IHJA 1A5AB 1C14A 3A04A 4FDAA 4YRZA 2KSQA 1JU3A 2JAPA 1JV2B 4L8GA 3R41A 4G9GA 2JAXA 1XD2A 3HB7A 1IHDA 1RXYA 2CBXA 2I71A 3DYIA 3KG2A 4I5GA 5ERXA 3X1YA 4AULA 3DLPX 3EXFA 3OJXA 4KDEA 1Q74A 2VJMB 2VSOA 2XQVA 3UZUA 4CYMA 4DXDA 1THGA 1JLLA 1S96A 2WAXA 3T3NA 4CEJA 2P0YA 4JLKA 1RJFA 3AVQA 3PFCA 4HS4A 5CVEA 2BI7A 3NWEA 1FYXA 3KJEA 2XYVA 4NE2A 2FZGA 4UTZA 3WLNA 3IURA 3GVPA 5A7HA 2P1RA 1IZ7A 2JIRA 4TKUA 5F1OA 1O2DA 4AF6A 4NOKA 4Q7MB 4M6WB 5H3LA 3FVVA 3TLCA 1XDZA 1L5KA 5HG0A 1LPBB 2W90A 2X4LA 1N5IA 4Q1VA 2HA3A 2YWHA 3BWEA 4YMUA 4ZCIA 5D3ZA 4Q05A 4QOSA 1MB0A 1RZUA 2PZKA 4XDGA 3TTWA 1Y4SA 4L73A 1QF6A 4OQQA 2MSCB 5J2UB 4IIJF 5T4HA 1GCUA 2GWRA 2FUG1 3MAGA 1XYVA 2AGVA 4AY2A 1BXKA 1LBIA 5K5EA 1TX4B 4OB6A 1TF2A 1IB6A 4B83A 4EPRA 5HHTA 1OFGA 2JGRA 1VP3A 3L92A 1X38A 3LLUA 3N2NA 2QR5A 1WWKA 3NTOA 4G65A 3VU1A 2A1UB 3WLQA 4CDRA 4CEHB 4ER0A 3KKOA 4G07A 4R1OA 1IBMB 5FPKA 3F7NA 1DG1G 3C1AA 4IUYA 2UZ0A 2FTKE 3MUOA 1DJOA 2WTBA 4CEIA 1BXGA 2VHYA 1V1MB 3C6QA 3E22A 4OK3A 5F5LA 1H2AS 3ZZUA 1IY0A 4IEEA 5J63A 4JB2A 1NA5A 4YWJA 1SIBE 1SQSA 3PQEA 4NZYA 1CB7A 3N8DA 1EM6A 1XTRA 4JVOA 4KQKA 2FWRA 2X2EA 1SC1A 1CF9A 2WKPA 2J32A 1CCWA 4L78A 4DCPA 2XDAA 1D3AA 3WLHA 1DBPA 2OILA 4DG9A 2J9ZB 4TV9F 3O84A 1D6SA 1O5IA 1UC4B 5CPFA 2FSVA 4Y18A 4DA0A 1J2TA 3S1SA 1X7WB 1A4XA 5FPHA 4RGBA 3DDOA 4RK5A 5A9SA 2H4WA 4EGSA 1R0BA 3I5AA 2D2EA 4DMUB 3UT5B 5DEIA 3CG4A 2ZVQX 1U1GA 4O4JB 1FFAA 1TT5A 1HDIA 2ZBUA 3FHJA 3GK3A 2RIPA 3I3OA 4DFDA 5HSGA 4OLBA 1EBBA 1C3JA 2VDPB 3WNZA 1M8FA 3ASVA 3M9XA 2C8KA 3INGA 5C8VA 4ZI3A 4ENPA 1JPJA 2I6TA 4DJ5X 1WOMA 1HLPA 2HRRA 2I6GA 2QVCA 4OCZA 4REMA 4UNSA 5E6RA 3TQTA 3UGQA 3Q72A 4MVYA 1MOPA 4F72A 3ETDA 1SH7A 4U00A 1JQKA 3W5AA 1USVA 4LHVA 1IEWA 3TLKA 2CD7A 4F6RA 3COZA 3K2QA 1BCSB 1QS0B 3Q9SA 4N03A 4DG5A 4IMJB 5JJBA 3WGOA 3MD9A 1MAWA 2RHLA 1E5VA 3IVMA 3N1UA 1R64A 4G5RA 2QDXA 4QULA 3B3FA 5LA6B 3T34A 3IOEA 2ADOA 1K8ZB 4QEKA 2QROA 5DLPA 3GX1A 1ZCAA 2AFIA 3IULA 1GN8A 4L5BA 4XWAA 1XFDA 3I04A 2IPAB 4L4RA 4EFNA 4FYYA 3W05A 5AVXA 3RVRA 3TZHA 4JYZA 4HH0A 3K30A 1RLTA 3P2JA 3T7TA 1VXOA 4Y9SA 4I55F 3EWSA 4FCVA 2WUDA 3BRWD 1U2DC 2CNDA 1RRPA 2B1GA 2WBLC 2QP3A 4CKCB 4AY4A 1ZD3A 1IN8A 2B8WA 2CFSA 2DX7A 2H65A 1ZJ5A 3E1KA 3UJDA 3W34A 4V1CA 1SQ6A 3AUJB 1DC3A 2ID8A 2ISQA 1N57A 1WCIB 3DZKA 3GUZA 4B2IA 4Z0PA 2O3QA 4YXFA 2UYGA 2OKCA 4MDHA 1EFAA 1ONSA 4KFSA 2XTAA 1B2RA 5EXEA 2XUQA 2PG3A 2CMHA 1X7GA 2FR0A 4HYYA 4MQFB 4RD0A 3ZWXA 2AEJA 2QLTA 4C6TB 3MJFA 2GUGA 2FWIA 5JDCC 3JQBA 1RR6A 2PDAA 1A9RA 4Q1FA 1TW3A 4DCJA 2YCBA 5TJ9A 2H52A 3LNCA 4O4HA 2FFHA 3IEKA 4CIBA 1RPZA 1L5HA 2PH1A 4RNDB 5BORA 4DIKA 1OXXK 4KQXA 4UNPA 4FJ1A 2KBFA 3ZLUA 5IK2D 1WAMA 3QA9A 4LC1A 3NXSA 4ZP1A 4IDBA 4OQ4A 2RH5A 4B4UA 1QDEA 3QHQA 3QWFA 4DC9A 3ND7A 3E5NA 1A72A 1U0LA 2XPCA 4JS0A 4NV3A 5BXQC 4FUTA 1MC1A 3WDLA 4EY3A 3AY7A 3NANA 3O75A 2Q3BA 2ZJOA 3RFTA 3TS1A 2G25A 3W0LB 3WOVA 2VRCD 5LDGA 1ZC3A 5HNKA 2ANCA 4PYNA 1E0JA 3GROA 3HCFA 4KDFA 5L8VA 4MJ3A 3BRCA 1FZTA 1MB4A 4TRRA 1QFSA 3PC8C 4YAWA 5FUQA 5D84A 3MZ0A 5KIAA 5I7UA 5BURA 4FNAA 3Q3CA 4B3TB 2NPIA 1QNFA 4Z9YA 4BO2A 1TU4A 3IILA 4YHHB 4C21A 3TLEA 2AXNA 3D2AA 2XMPA 5DLQC 3R23A 4E22A 4IDGA 1BQ3A 1S9DA 2CLHB 3HR4A 2XWPA 1WQ3A 2PKWA 3B51X 2LCIA 2DC1A 3QVGA 3FIUA 2CJWA 4KFTA 3GXOA 4PR0A 3B1XA 5G2OA 5IKOA 2BGKA 5LYJA 1Q21A 4BCBA 4U7TB 1XVIA 3PEVA 3W2GA 2APJA 2EGGA 4G6ZA 5BPFA 1I94B 1JMVA 1JFFA 6PFKA 3OZRA 1UODA 2GFIA 2N47A 9ABPA 3ZEAA 4F3YA 3GEDA 4LXIA 1BDHA 4XUEA 3TRHA 1YRBA 4DZRA 2XSZA 4US1R 4ZI2A 5K0BA 3A1UA 4OGWA 2H06A 2GVNA 3V8RA 2NWQA 4BLVA 3GLGA 4RD3A 3ZNNA 4BNZA 1ZD1A 5ALSA 4HPWA 4D26A 1DU4A 3CLSC 5B3JC 4CT4B 3HKCA 4Y2JA 3S2SA 1OIVA 5C7IO 2DY1A 4GOOD 4AN4A 4KOAA 1QNLA 4QPNA 3OZDA 2HQBA 2ZDQA 3GJSA 1XXHE 1O8BA 3H4VA 4U6QA 4YRBA 5JVDF 1QG4A 1C7RA 1DRKA 1TGVA 3BWXA 3UC5A 2X76A 5ITWA 4DXHA 3DVAB 3FYHA 4YRJA 4JI3B 1XHLA 2DKFA 5KVVA 1P7ZA 3HJAA 5J5VA 4N7RA 3UXMA 3AERA 1XRLA 4BB5A 1PGNA 2LKDA 3K16A 5J43A 3MQ2A 2R97A 1S3IA 2CNNA 1AK2A 3QKIA 3OLYA 3RB8A 1I2CA 5LQMA 4RIEA 2QAGA 1C7ZA 4PHCA 4P4SB 1DWQA 1K2WA 2XIQA 4RHCA 3GG9A 2IYYA 4J7AA 3B70A 1PFVA 2R6R1 4DW8A 5KNCD 3T1TA 1Y1KE 1RIFA 3ONVA 3QEOA 4Q4HA 1LGYA 4JU9A 4EFKA 3KVYA 3EOAI 4INJA 2H2HA 2K4MA 2IUYA 1MJHA 4MTLA 1GP2A 1UPFA 4Q4DA 4RM2A 5F1PA 5ICCA 4X1OA 2JKZA 1UWVA 2ZIEA 3P2KA 4LY3A 2HSGA 2OBNA 2Y67A 4XFDA 3KTFA 1R9GA 2ZBPA 4MRVA 4IYJA 1H2ZA 3KUXA 2HSJA 5KYUA 3DBHA 1N1MA 4NCXA 1B8OA 4JJIA 2D59A 2GARA 1V95A 1GSHA 4FN5A 1ODIA 3D8TA 2HDWA 2PEZA 4EFLA 4E4YA 2VBFA 4C0LA 5BV7A 2DCUA 2AUNA 3FWYA 1SR8A 2AQ8A 3DS8A 2QSUA 2YFYA 4URHA 3S8YA 3M83A 1SKMA 4D4IA 1I2MA 3WIBA 3PCTA 5ANRB 1VPLA 5HQ3B 3FETA 3HDJA 1LNZA 1TU3A 5KI6A 4EUEA 1QGAA 5I9IA 5COAA 4EELA 1I1NA 1N5JA 1QH1B 2P9YA 3HJRA 3U26A 4JBIA 3W2TA 2A9OA 3GN2A 2E37A 3OQ1A 3VSCA 5BNZA 1R4NB 1HV8A 2EF0A 1OFIA 5IAOA 4LNAA 2XUKA 5I48A 2HLHA 4D81A 4F06A 1QHHA 4N12A 2JFZA 4ZQHA 5TPWB 1K7FB 1NIPA 5JECA 1YL6A 5LMZA 2Q4DA 1KAEA 2YN2A 5AVVA 1G1AA 2BMVA 1HL3A 4P08A 4RK6A 3GFOA 4Z1MD 2JRCA 2P3QA 4Y0AA 1I6KA 2A9FA 3L77A 4KRXA 3IEVA 3RVMA 2UVDA 4EPVA 4TXLA 1BW9A 3BHIA 2ZSKA 2UYYA 2GLXA 1E1YA 1WB5A 4GOJA 1MV5A 4P4LA 1QFMA 1Z4MA 2V6MA 4W8GA 2Z2KA 3O8QA 1T4BA 4G67A 2F1OA 2WD8A 1NQXA 3LOQA 5T3YA 3F5SA 2ET6A 3WQBA 3WGLA 3PPWA 4EGJA 1QHNA 5J58A 5LIPA 2PUEA 3DZBA 2ZXFA 5JI2E 2AB0A 2C96A 3FFTA 1XVTA 4RM3A 3P2OA 3BS4A 4OI2A 4Q3KA 1JDUA 4IQ8A 4UULA 1GKKA 5E1BA 5KYTA 3N8NA 1GARA 3ZK7A 4X6UA 2XT9A 1AHNA 3RAGA 2ILVA 2RGAA 3PD7A 5L6LB 3W5VA 2FW0A 3NI2A 1QC5A 1DADA 3JW8A 4Z9FA 2CWDA 1FYFA 5IHPA 1E2PA 5AJVB 3GRAA 2JFPA 3ELWA 3HWSA 3IAEA 4YLYA 1ZM3A 3L02A 3EVFA 2IPXA 3JZFA 1X70A 3FROA 4PO3X 4ZRMA 1DKRA 1OTHA 4BVEA 4HDKA 1OXKB 2FF5A 3BSFA 1GNVA 3EZ9A 3MJDA 4KXMA 4NJEB 4ZVNA 3B48A 2QI9F 5I6DA 1P2GA 4FFRA 4AJ2A 3FG9A 4YAKA 2ECOA 3RT1A 3CUTA 1WULS 1GQFA 1VJDA 2C42A 2XMSA 2XVMA 1X8LA 5IW8A 1IWBB 4MUHA 3DZCA 1XJQA 4RHXA 3A9SA 5L40A 4UVGA 4C01A 3BMQB 1W36D 1BN7A 3L5OA 4MVJP 2XA1A 3A0UA 1HEIA 2O23A 2VF2A 2EJUA 4BTVA 2NAPA 1AS0A 3UA3A 1UUFA 3T8YA 3BORA 3LL7A 5KJEA 2P2CA 2WTMA 4CI0B 5BN3B 1VLLA 3WWEA 1JEQB 3IP3A 4RTKA 1RMYA 3PYXA 3PDCA 4FYXA 4PAMA 4HDCA 1UXJA 1ST2A 3ROEA 3VMMA 4M0KA 4HBGA 4W4TA 4J0HA 5CDFA 4RNCA 5SY6A 1YD7A 3R44A 5L4LA 5B3AA 1NBME 1HMYA 3M33A 5JC1A 1B14A 1OE0A 2DFDA 2YXBA 3IUBA 4YRPA 3DSRA 4TYPA 3RYCA 1U9IC 3B36A 2V7PA 2ES4A 3BPSA 3UV3A 4EJSA 4PNEA 4NZMA 1XA4A 4J7CA 5IEBA 1Y7IA 5EHIA 1NI3A 1W36B 4ZPXA 1AQ6A 2CZCA 721PA 1TNDA 3LCRA 2JCXA 3BCHA 1P74A 1YJXA 2AXPA 4I08A 1UBCA 3TEMA 4REQA 1XV5A 4G0XA 2GJAA 1GDDA 2QL9A 3DKVA 4KL8S 5LZ8A 3CEAA 1NNLA 1X7ZB 2GEBA 1ISFA 1YB5A 2YWGA 3NHLA 4ZOLA 1WB4A 3P2YA 4Z0TA 3MNFA 1MGOA 1I7DA 4NU0A 3NM4A 1CUDA 1Q7GA 3RC7A 1JHVA 1NUSA 2HWKA 4GOLD 3TVYA 5LP6F 3ICPA 3JAWA 1N2OA 2P78A 4NCBA 3ZBUA 1JHUA 1V8OA 1H66A 3AM4A 3ZHUA 4ZVMA 3L1HA 4Y6PA 3SM3A 3SVTA 1BO6A 1MOZA 3RUPA 3UMJA 5B12A 4AZ0B 1NUQA 4ZWNA 3M6LA 1OFUX 2Y4OA 3TNFA 2P5YA 4Z9BA 4FR5A 1HI9A 1F6DA 3U2QA 2Q6VA 1NU8A 3FNIA 3UHAA 5K2OA 4KLZA 3EGCA 2HF2A 4WDRA 1CEYA 3IP5A 3KELA 1D2GA 2PQ2A 1KO7A 3ZI7A 5JUWA 3ADBA 4F4IA 3PVZA 3DJFA 2I2AA 4DR4B 2CXXA 3G68A 4UXIA 3CKLA 4I5DA 1ZMOA 4MLDA 3JRXA 1N1DA 5JS6A 3I2YX 2WE7A 1I6WA 3KYJB 3W90A 3ZVKA 4ZOCA 4MR8A 2H1IA 3HMKA 3R77A 3ZCSA 3B7PA 2IZ0A 3VR3D 4U7WA 1IDN1 2AQKA 1O6ZA 2ZB8A 3D6NB 3TH5A 1ZAYA 4OUDA 3E9EA 2C3YA 1AZSC 2M6LA 5T67A 2ZI4A 3TOVA 1CY0A 2HOQA 3FCEA 1S6YA 4X1KB 1R0YA 4ML3A 4DYDA 1UXOA 4YMIA 1FJXA 3ZH9B 3O9ZA 3OQVA 4TVKA 4Y2VA 2IUFA 3ORQA 5HCIA 1NY5A 2YC4C 4ALLA 4D3ZA 4KXLA 4JLOA 4XYMA 1NTOA 2WQ7A 3H4MA 1ULZA 1S0UA 1AJEA 1WDWB 3RS2A 1J21A 2FPOA 2RI1A 5DGDA 3MYRA 1L5FA 3E3LA 1WD5A 3HPQA 3ZOZA 1RWMA 4X65B 1TEZA 4IIJA 5JZVA 3G2OA 3X1WA 3ZDXB 3WA6A 1YO6A 3FYCA 1CBUA 1GO2A 2MYUA 1GZ6A 4WRRA 4WCDA 2VIIA 5COBA 1ZGAA 1XCOA 1RCTE 3JQDA 3PEFA 1CR0A 1DZ3A 2EBHX 3JRWA 4DCOA 4LF9B 1B4DA 1C3OA 1KBZA 2OG1A 3IUQA 4TZKA 3ST7A 3TIFA 5I9NA 4GYWA 1JR2A 5ALGA 3H9BA 1EQUA 1YRYE 3AUUA 3PF9A 4MJXA 1YA6A 1QH9A 5CBKA 4UM8B 4TYWA 4PW0A 1R37A 4DEYA 5CVUA 3P7MA 5EMNA 4UU0A 3TIXB 4JP2A 3SFVA 5DRYA 2VP9A 1FYVA 1C7FA 1HLFA 2IYRA 3NTRA 5M34A 2Y92A 1RJDA 1WVMA 4TROA 5J2TA 1LS6A 1LPAB 2WM8A 3OEEA 2DYKA 1GXSB 3B9BA 3PPYA 5DFAA 3FAZA 4Q9AA 4PSDA 1OGIA 3RROA 1LQUA 1U2EA 2JC3A 1PR6A 5FTMA 3THXB 2F3PA 1JN0A 3A6HA 4OMUA 4BQQA 2W6CX 3AF1A 2XW6A 4YMSA 1IXSB 1V3VA 3HO6A 2QRVA 1TQ2A 3CR3C 3V1TC 4D98A 4LXXA 5A6SA 4NOJA 3WDKA 2I1QA 2R47A 2YXDA 2Z3WA 3WYNA 3AJDA 4YWHA 1M74A 1AGXA 2NZWA 1PDOA 1R0CA 4K9OA 4WNAB 1NVGA 1QLJA 3SJCA 3FFXA 1DAKA 1VIYA 5CX1A 4F2DA 1DP4A 4FVTA 2DH5A 2E48A 1JDNA 1DT3A 4C20A 3V8PA 3JATA 3SSNA 2Q6IA 4HEJA 3B3QA 4CQMA 4O63O 4DJAA 1CEEA 1P0PA 2HU2A 3GEBA 2JCBA 2WWXA 3BB1A 3EGDB 3F49S 4LCEA 5CYPA 3URMA 1YOVA 2IE0A 3OPVA 2IZOA 4O2LA 4EENA 3TF5A 3JQ8A 2WICA 4L27A 1G9TA 1XA3A 1XROA 4FXOA 3N0TA 4R68A 1T3TA 5FAXA 3R7FA 4C07A 2I99A 1N3BA 4P9NA 3IHTA 1U6JA 1AH2A 1Z6AA 2Y0CA 5EZ6B 2VATA 1KXZA 2O6HA 1NMSA 3LUJA 3R76A 3WSTA 1U7XA 1JZTA 1XZGA 5IBCA 2EL9A 3PUZA 2YZMA 3BK1A 4IBOA 4QO8A 4WKPA 4G0UA 4G4GA 2CNBA 4I55A 1HGXA 4K9RA 3DR3A 2G09A 1E77A 4AMGA 3QFHA 1YDFA 3TD9A 2GAIA 3ICVA 3ME5A 3OEHD 5FI3A 3G59A 3DLBA 2JI6A 3FTPA 1JR3E 1MENA 3DL4A 3N5CA 4KPFC 2W4QA 4U9UA 3ZZ0A 3VZRA 5IU6A 4FEEA 4FSDA 3X1MA 1VBNA 3SFZA 3QKSB 5T3UA 1RW4A 2XCOA 5I8ZA 4ZCRA 4LOHA 1JIXA 3UOWA 2HXYA 3GLQA 1DRJA 1KVTA 3ZK9A 4JMPA 3EXG1 1D2CA 1CU1A 1A7JA 5HFJA 1ZVQA 2DBQA 1F8UA 1XZPA 2HA5A 3BD6A 2DP4E 2IWHA 2DHRA 2FEAA 5C35A 4J75A 3VR6A 2NXJA 4YJ3F 4QYXA 3IGFA 4ZAYA 3NVKI 2QJOA 4JZKA 3NAZA 4X20A 1ZN8A 1KZGB 3ZGVA 4F45A 3NTQA 5K45A 1T6YA 2ZSUA 3PE6A 1ISIA 3Q7PA 4IZHA 4V02A 2WQZA 3QBDA 1C3XA 3W8EA 3GL9A 1KH1A 1U1CA 4M0MA 3D3WA 1JE1A 3M6FA 1ZGBA 3OKPA 2I9KA 4D43A 3UAZA 3RSCA 3JARB 3EGIA 5CFQA 3ZWNA 5EFZA 3SR4A 1IBRA 4GOKA 5DHAA 3VR5H 1NBHA 1Z35A 4WZBB 3KQTA 2H5EA 1KE