2BFNA

The crystal structure of the complex of the haloalkane dehalogenase linb with the product of dehalogenation reaction 1,2-dichloropropane.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
294
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HALOGENALKANE DEHALOGENASE
publication title Weak Activity of Haloalkane Dehalogenase Linb with 1,2,3-Trichloropropane Revealed by X-Ray Crystallography and Microcalorimetry
pubmed doi rcsb
molecule tags Hydrolase
total genus 109
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfnA00
1XFDA 3OC0A 1QO9A 1ODCA 1ZGBA 2X5XA 2XMZA 2CKMA 1ACJA 4GXNA 1THGA 4PW0A 4BP8A 2V9ZA 2Y6UA 2DFPA 4FLEA 6YASA 4G9GA 2OG1A 3R3WA 4BYMA 1LPOA 2ECFA 3D0KA 2WFZA 1U8EA 1VA4A 4DSZA 5ALUA 2GZSA 1XRRA 5AK4A 2VJAA 4YASA 1EXWA 4BTLA 3N2ZB 3AZPA 2O2IA 1K63A 2G4LA 4LXGA 1BEEA 2PSFA 4L0CA 1CVLA 5KREA 3D5EA 1XLVA 5LZ8A 5AOBA 2OCLA 4KAFA 4PSDA 1DX4A 2V98A 2QMQA 4K6KA 5K5EA 3STXA 5F4ZA 1MAHA 2JGFA 1DTEA 2XB6A 5K3BA 3H2JA 4OU5A 5HFAA 2O2GA 4KRYA 4CFSA 5K3FA 1VOTA 2ORYA 3CXUA 3WJ1A 1J07A 2HFKA 3WWCA 2HA3A 3LIPA 3KOOA 1LPMA 1XZEA 3WYNA 3LCRA 4EY8A 4GEGA 3RARA 1WPRA 1X2EA 4K6HA 2IITA 1CUCA 5JAUA 2HA4A 1QONA 1R50A 3FLAA 2O7RA 4Y2PA 4ZRDA 5JALA 1HL7A 1NU8A 2Z5GA 3BE8A 3F67A 1SCQA 3WL8A 1MNQA 5AM2A 1XROA 1IMJA 2WM2A 5AM4A 3WWEA 1CUUA 3C5WP 4C4ZA 1IZ7A 3G0BA 2JIDA 1XQWA 3IBTA 5ALXA 2XMBA 4J0KA 1YAHA 1YCDA 5HF8A 3I1YA 3JW8A 3DL4A 2WU3A 1N5RA 4AN1A 5DYWA 3QH4A 1K6EA 4GHWA 3W2TA 4KE8A 5HZGA 4C6HA 2QTBA 3BL8A 3C6ZA 2W6CX 4BC0A 5JATA 1AUOA 4C89A 3G0IA 3WKDA 4UBLA 4C4XA 1DINA 4U2BA 4BRZA 1TKRA 3CN9A 1IUPA 1JFRA 2WKWA 3L1JA 2WLSA 2AXEA 1LZLA 4GLBA 3FYUA 3QVMA 1F6WA 4D9JA 3H0CA 2D0DA 3QITA 4A23A 2RAUA 4Q05A 5JAPA 3C6BA 5T4FA 1QIKA 5LZ4A 3CCCA 1N8SA 4UHEA 2V97A 3WIOA 1CLEA 2RI6A 4B83A 5LYYA 1Q0RA 1OXMA 4H35A 5AO9A 3G7NA 1UKCA 3ZWQA 3H18A 1TAHA 2QJWA 1XZHA 3WK8A 4CCYB 1E8DA 2FJPA 2OCIA 4U2CA 4AMZA 3PFBA 3KD2A 1DWPA 1E8MA 1LZKA 3FLEA 1R9NA 3WL6A 3M82A 1P0MA 2WIFA 1XZDA 3C8HA 3K6KA 5LKRA 2JF0A 3ESAA 3HEAA 1GKLA 2XMCA 4K2AA 1YA4A 1XLUA 1ZD3A 3R3XA 4ZV7A 4FMPA 1CUSA 3QPAA 1TCAA 1MN6A 4OUKX 4TGLA 4RGYA 1I6WA 4I4CA 5AKLA 5BWBA 2ROQA 3FVRA 4QDZA 4MQLA 4MWSA 1ZIYA 1IUNA 1DU4A 2XUGA 4WDRA 1H2ZA 5AP9A 3GROA 4LYEA 1YR2A 5YASA 3G9TA 2GYWA 5DNVA 1VZ2A 1Q84A 1UK7A 4HRYA 2ZSIA 5JZBA 4FBMA 1MU0A 1XQVA 4EY4A 1HPLA 3O4IA 5BV7A 4AN0A 2GYVA 1W6RA 4JNCA 4QNNA 5HQ3B 1GT6A 1F0PA 2XQGA 2ZJ6A 4KR0A 5LKAA 4TVKA 1QGED 4B9AA 5AM3A 3V1LA 3DOHA 1PJAA 1CUVA 4RPCA 4Z49A 4ARBA 2IX9A 3B12A 1H2XA 1DWQA 5AI4A 3WYDA 4X90A 2ZYRA 5K3EA 2EDCA 2H7YA 1L7AA 4LYDA 2QUBA 1RWQA 4IQ4A 4XIIA 2ZJ7A 5CXXA 3KSRA 3IB3A 3PFCA 1W52X 3QMMA 4IHAA 3E0XA 4PSCA 3W9BA 1WCYA 1JJBA 1XZKA 4AB1A 2CUTA 3PF8A 4BCBA 3FYTA 5DLPA 1BROA 2XUDA 1GGVA 2BUCA 3GZJA 1VXRA 2GZRA 1CUIA 1GQSA 2B61A 5IH7A 4B0PA 1CUFA 5KWJA 3VVLA 4IH1A 1QZ3A 2E3JA 2Y6VA 1XLWA 4A5SA 5AKEA 1U4NA 4J0HA 2J3DA 3V48A 5JD5A 2PPLA 2UZ0A 3I6MA 4G5XA 3STWA 5J3JA 2VF2A 3STTA 1CUJA 2BGRA 1LPBB 5JD4A 3DOIA 5HF5A 1JMYA 5DNWA 5AIBA 4UBOA 3S2ZA 5EFZA 5IKXA 4DYHA 3HC7A 5ALJA 2PUHA 5HK9A 3ICWA 4LXHA 1H2YA 2G5TA 2QXTA 1GPKA 2HRRA 4OD0A 2J4FA 4JYPA 3TJMA 1H2WA 5AKIA 5ALLA 2WHQA 5A71A 1EH5A 3OG9A 4B82A 4BDTA 2XQJA 4QEKA 3H17A 5FLKA 2AJDA 2X8BA 3NOXA 4Q34A 1CV2A 3D2CA 4L3WA 5FOQA 3D3NA 5ALIA 1W4LA 3HI4A 3MUNA 2WFLB 4PF1A 4N5HX 1ORWA 3TGLA 4DTCA 5AKZA 4AO8A 3RK4A 3DDUA 2OCKA 2JGKA 4J0CA 4WY8A 3VJMA 4MWTA 3LP5A 3M3DA 1RYYA 3DYVA 5DTIA 1DT5A 3C87A 1LBTA 1UXOA 4ROTA 4F21A 2XMDA 1ZOIA 1XRLA 1YB6A 5AM0A 4Q82A 5E4YA 3VDXA 3ANSA 2WUDA 1VXOA 3WKEA 2WJ3A 5ALKA 2VATA 5AHXA 4BAUA 5CH5A 2OGTA 3WQHA 2DQZA 1A8SA 5JASA 3WI7A 5AH0A 4BC1A 1L7QA 5AI6A 1P0QA 3I6ZA 4J0DA 1IZ8A 1R4ZA 3E1GA 4B81A 2PSJA 3AJAA 4BAZA 4N8SA 2CEKA 3V1MA 3F98A 2QUAA 2B4KA 1J2EA 1FFBA 1MX1A 2HU7A 2J4CA 2WFMA 4FNGA 4IH4A 3IVMA 1ZIXA 3X3HA 5SYMA 1VJ5A 5CMLA 3TEJA 3I2IA 1AKNA 3A2LA 5EHNA 1XZFA 3MGAA 3WIBA 1R3DA 4ETWA 1BE0A 4BRSA 4H7DA 2XQFA 2ZSHA 1QTRA 4J0GA 2CJPA 3DL7A 4Y2JA 2EEPA 4H7HA 1U2EA 1CUYA 5AI8A 1AX9A 2WG1A 2ACEA 1JMKC 4X94A 4FHZA 4F60A 5ESRA 1U65A 2X76A 5K3DA 4AZ3A 2GBIA 1C7JA 5DYTA 1JI3A 3MUOA 2H7CA 4N5IX 4OCZA 5CTAA 3BIXA 4UFOA 5CXUA 4ZV9A 2ZYHA 2G5PA 2WG0A 4Q3KA 3I2GA 2OGSA 2Y2UA 3M81A 3H19A 4MQMA 1ACLA 3BJRA 2YYSA 1XQYA 5LP1A 2VAVA 4OB6A 2XUJA 1CUXA 4UBKA 1UOOA 4EY7A 3UUEA 1UK8A 2BGNA 1O6FA 1X70A 4LHEA 2K2QB 4MXDA 1EVQA 2BCEA 4DMFA 2C5GA 3DLTA 3QM1A 3I6YA 1CUAA 1E8NA 3WMRA 1GKKA 4B85A 3VVMA 3MVEA 4BZWA 1H22A 2XUFA 4X91A 1R9MA 3WK7A 4BB0A 2AJCA 2O7VA 5T4BA 2WUFA 1Q0ZA 5ALVA 3BXPA 1X2BA 3AUKA 2H9YA 4XX1A 3ZLUA 1O6GA 1ZD4A 2QT9A 4JEIA 3ZLVA 1F0NA 4E15A 4HRXA 1QTIA 1K4YA 1ZJ5A 1LPPA 1J06A 5CH8A 4E14A 2AJBA 4K5QA 5CRIA 5LIPA 1IVYA 5I7UA 2OQIA 4E11A 3OOSA 3C43A 3F8SA 4E46A 2XUPA 4L9AA 1TCBA 2ZVDA 5ALNA 5LZ2A 5AI9A 5HF6A 1YAJA 2O2HA 3FLBA 4Y9SA 3FVTA 3BF8A 5LZ5A 4UBJA 1W75A 4DNPA 2Y2VA 3AIMA 3B5EA 3A2MA 2HA0A 2BFNA 5JAHA 1FSSA 3D59A 4QDOA 5ALMA 1HLGA 3ICVA 1UOPA 4ZREA 1K5PA 2VA9A 4G4GA 3V9AA 4Y2XA 1UWCA 3D4LA 3B3QA 4BBZA 4YX9A 5EHXA 4DMCA 3G0DA 4GI1A 5IVKA 4FKBA 3ILSA 2C0QA 4QDTA 4ZWNA 2OXEA 3W06A 2PU5A 5AM1A 4DIUA 3G0GA 1EDDA 1QIEA 5A7FA 4C4YA 1AQLA 1ORVA 3WWOA 3LLCA 4KE6A 3H2GA 3G02A 4FLFA 4JUIA 4ARAA 1Y37A 3O9MA 4UHHA 5ALDA 5ALRA 2W22A 1EVEA 2OAGA 2XLBA 1UK6A 2ONCA 5EHQA 1L7RA 2WUEA 2YASA 2G63A 4JYMA 4DM7A 1ZJ4A 5D3KA 1YS2X 3I2KA 1MPXA 3R40A 5A6VA 2PSHA 1PV1A 1UK9A 3F96A 4CCYA 4H77A 5EIHA 5ALYA 3E4DA 4AXBA 2FUKA 2XT0A 3JWEA 3S8YA 2I78A 2HA2A 2VEOA 3VKFA 1S8OA 5BOVA 2H1IA 4XJVA 3OTQA 3IUJA 1UKBA 2DR0A 1TQHA 1VLQA 3AFIA 4W1RA 2JBWA 3IUNA 4WFIA 5CT8A 5AK6A 3H1AA 4EY5A 5DNUA 5AK5A 1CUBA 1KU6A 4G9EA 2QXUA 1USWA 5FXMA 3RKSA 3DEAA 4KACA 4UHFA 5A7GA 3D7RA 3EBLA 2CB9A 4UBNA 1SCIA 2WQZA 2R11A 3ED1A 5FKJA 4EHBA 4U2GA 2VJBA 4BAGA 5D3ZA 4BCCA 4KEAA 1BN6A 5BWCA 3SC2A 1VE6A 5E2IA 5JADA 4OSEA 4CG1A 3V1NA 1E5TA 1G66A 4F0JA 1YSCA 4V2IA 3QYJA 3A70A 4W1SA 5C81A 4Q3LA 5C8VA 3NUZA 3R41A 5JARA 1B6GA 1IUOA 4FOLA 1CPYA 4X6XA 3VJKA 1SFRA 4INZA 4YK7A 3OM8A 4H7KA 2OQVA 2GBFA 3D2AA 3I28A 1EK1A 4KE7A 4YPVA 3C70A 1CFJA 4G4IA 4UFNA 2ZYSA 2VTVA 1FFDA 4Y2YA 5AKXA 2XUAA 3SX4A 3OURA 3C5VA 1M33A 4UHCA 3O9VA 3U0VA 4CCWA 1KEZA 5AOCA 4H18A 5FRDA 4MYSA 2OPHA 1F8UA 3T52A 4H7IA 2WTNA 4DGQA 1ZI9A 4WJLA 1LPAB 4AQDA 1UOQA 4EY6A 4HXGA 4Y2VA 1EHYA 2QZPA 5DTJA 1CUHA 5ALHA 2AJLI 1UZAA 4PNZA 3R0VA 1QFSA 1CQZA 2QKYA 1N1MA 2WJ4A 2XMQA 2JEYA 3ZPXA 4KAJA 5AICA 4HVTA 3WKBA 1JU4A 4EUSA 4W1PA 3FNBA 3ZI7A 1E66A 4QWWA 1ODTC 1CUGA 4NS4A 5HF9A 1WPXA 5D6OA 4GBGA 2VSQA 2EDAA 4K6GA 2I03A 1TIBA 3O95A 3HXKA 4B6GA 2WIDA 4BVLA 3EQ9A 2WTMA 1Y7IA 1CIJA 5FP0A 4NZZA 3TRDA 4MJ3A 3WK9A 3EIOA 4CIBA 1OILA 4KAAA 1DX6A 3DJYA 3FOBA 2AJ8A 2PM8A 2XUKA 3DS8A 3ZLTA 5EGNA 5ALGA 2HIHA 1T4MA 2WHPB 1MO2A 1CR6A 3FCYA 2WJ6A 4X92A 5CT6A 5C8XA 4U2DA 1GPNA 2B9VA 4BDSA 3VXKA 4C01A 2WFLA 5FPQA 3AZQA 4JH0A 4KYVA 1P0IA 4Y2SA 1SOMA 4MEAA 4M0MA 2JGJA 4HXFB 2XQKA 3O4JA 1YA8A 5CT4A 4BP9A 2HU8A 3I1IA 2JEZA 4AO6A 4HXEB 5LZ7A 1VZ3A 1BS9A 2GBCA 3QZUA 1XZBA 3V1KA 4HS9A 3PUIA 4LKOA 3FWHA 3WL5A 4KE9A 2NW6A 1CEXA 4AZ0A 4X7BA 3WWDA 1ZI6A 1EX9A 3T4UA 5AKYA 2XLCA 2VJDA 1GXSA 2H7XA 3W9UA 1NX9A 3BDVA 4QLAA 3WLAA 1JKMA 2C7BA 1XZIA 2HA6A 3NWOA 4Y2UA 1BN7A 3QPCA 1QE3A 2PBLA 4W9RA 1AURA 5ALWA 5JZ9A 2J3QA 3LS2A 1MTZA 1XRQA 2C0PA 2DHDA 3KXPA 3BDIA 3UMJA 1QIHA 1BCRA 1TRHA 4WDQA 2R8BA 1QO7A 3UUFA 3PF9A 4HZGA 4UBIA 1H23A 2DHCA 4AX4A 3JYHA 3C8DA 2PKYX 5FV4A 3G9UA 1CUEA 3STYA 4IH9A 3HYSA 1DWOA 5JYCA 2HM7A 4X71A 1XRMA 5AIAA 4BE9A 3I2HA 4H7FA 5T4EA 4N8DA 1FFCA 2IIVA 2XUHA 1XZGA 5HKAA 1LBSA 3IIIA 1GQRA 4ITVA 1MNAA 4O08A 4WFKA 4B84A 2FX5A 3IULA 3KWJA 5FUMA 3DQZA 1LGYA 3YASA 1XZLA 1A8QA 4B7ZA 3BIWA 4FFVA 4RE6A 1WB6A 3R3YA 1LLFA 3WWPA 4W1QA 5LZ9A 1MAAA 4N8EA 1MX5A 4UFPA 1ZI8A 1QLWA 1YASA 4B0OA 1ETHA 3AINA 4G8DA 3R3UA 1T2NA 4I19A 3PUHA 4FWBA 1Y7HA 4RNCA 4WY5A 5K3FB 5AKGA 1WHSA 3ESCA 2QOEA 2WHRA 2XMGA 3IUQA 5IVIA 1A7UA 1HKHA 1VA5A 4GDMA 2WG2A 2QS9A 5DJ5A 4CIAA 4P9NA 4OB8A 4CG2A 1XRNA 5T4HA 1TK3A 4OB7A 1CQWA 3KWFA 4NMWA 4IO0A 3C45A 3FAKA 1FFAA 5AKJA 3DCNA 4DNOA 3O4GA 2BAGA 5A2GA 4BVKA 4FTWA 1YS1X 2WU4A 3WKAA 2HDWA 5JANA 2GYUA 4M0EA 2CMFA 3O0DA 4KJXA 3ANTA 2XUQA 5JD6A 5AM5A 1B41A 2HFJA 5EI5A 1JT2A 2HU5A 3PICA 4UPDA 4CI9A 4RE5A 3PDCA 2FJ0A 5LLSA 1YB7A 3HRHA 4DNQA 5JZSA 5AI0A 1XKTA 4XVCA 3HZOA 5KWIA 3EQ7A 4DNFA 1G4HA 3SWWA 1MX9A 3AZOA 1XZMA 5ALTA 3HABA 2CBGA 3HJUA 2GBGA 5DWDA 3A2NA 3WK6A 5CBKA 1J1IA 1WHTA 2OCGA 2RIPA 2XUOA 1RP1A 4Y2QA 2YXPX 4FBLA 2LIPA 7YASA 3FYUB 4ZI5A 2VAXA 1HQDA 1ZICA 3WZMA 5HKBA 1P0PA 1GPLA 1UKAA 2B20A 5KBYA 4GWLA 4OPMA 2HADA 3WZLA 4C87A 4UBMA 4QDUA 5ALSA 5K3AA 4X6UA 4OU4A 1XZCA 1UFOA 3RLIA 3BF7A 3DD5A 4NVRA 4X00A 3M83A 5K3CA 4PSUA 4EBBA 3GELA 1WOMA 4QWMA 4PO3X 3G9ZA 3D2BA 2Q0XA 4F5ZA 3HACA 3NGMA 4QA9A 2VQ6A 5CT9A 3CCBA 1SC9A 5AK3A 2QM0A 3W04A 1ZD5A 4BVJA 2DHEA 1EDBA 3QMWA 3STUA 3IA2A 5AKKA 2C5FA 2HRQA 3L1HA 4FFWA 1C7IA 4DSAA 3WA7A 2WSLA 4DLNA 1N5MA 3G8YA 3R3VA 4W63A 2VJCA 1QIIA 2PSDA 2DSNA 2XQIA 4B9EA 3BWXA 4KRXA 5FPPA 5A7HA 5H3HA 3QBJA 1G5FA 5E4TA 5AJHA 5D7BA 2BKLA 1EB8A 4Y2RA 3STVA 2HHAA 3H1BA 4MEBA 3H2KA 4Y7DA 3Q0TA 3C6YA 4G4JA 4H0CA 4QZVA 1E89A 2XI4A 4PV7A 1Z68A 4AO7A 2Z3WA 4QE3A 4P08A 2DCMA 1EK2A 4S0XA 2Y1KA 3QMVA 1EA5A 1ZGCA 3WJ2A 1LNSA 2OAEA 4HAIA 1QFMA 5A62A 5I8PA 4FDMA 4GECA 3EQ8A 2RONA 3K2IA 4FNMA 3WA6A 4BCDA 5CURA 5AI5A 5ISMA 5ALQA 3E3AA 3G9XA 3HLKA 1WB5A 3HSSA 1OCEA 1ISPA 3PI6A 3G0CA 1MJ5A 3IDAA 5HQ3A 2PU7A 3WK5A 3WL7A 1PFQA 1DT3A 1Q83A 2I3ZA 1JJFA 1A88A 4L72A 1QIFA 1VKHA 2V96A 1FFEA 2WUGA 5I9IA 2I3DA 1CRLA 5CW2A 2XUIA 2QR5A 3DKRA 2HA5A 1QIGA 1UT6A 5EHZA 1QIMA 3LIIA 4X93A 4QDXA 3VISA 1CUZA 3FSGA 3H2IA 4UUQA 5HCUA 4PQEA 1TCCA 3K9BA 4BTVA 4J3JA 1G42A 4EZIA 1AGYA 3R3ZA 3VJLA 4XWGA 3I2JA 4BZZA 2RHWA 2OGZA 1LPNA 3GBSA 1KU0A 4J03A 3FBWA 1DQZA 3WKCA 4I3FA 2D5LA 3GUUA 2CZQA 2RHTA 1XZAA 3EF3A 4DMHA 1EDEA 2ZYIA 1THTA 2XE4A 3GA7A 4OYYA 3ESDA 3AILA 1BRTA 3P2MA 1W76A 5HFNA 1GZ7A 3W05A 3U1TA 4X95A 2QVBA 1W1IA 1BU8A 5IVDA 4FLMA 4UHBA 4HTAA 3A6ZA 2PL5A 2JGLA 2WIJA 4B80A 2WILA 1XQXA 3C6XA 3BJMA 3FSGD 1A8UA 2XMSA 2P8SA 2YH2A 3I2FA 5ALOA 5AOAA 5AKHA 1SCKA 4P93A 3DYIA 1BCSA 3QPDA 1WM1A 5ALFA 1XZJA 2VT6A 4BATA 3AIKA 4U2EA 4WFJA 2PVSA 2HA7A 2JGIA 2WIGA 3OPMA 5ALZA 4X3CA 5C8ZA 2Z8ZA 2C58A 3KDAA 3FCXA 4OYLA 1XRPA 5SYNA 2ZJFA 4WCVA 4TPKA 4G8BA 2WHPA 4M0FA 1QIDA 3ZV7A 1FJ2A 1R88A 3IURA 2JGEA 2HL6A 4CG3A 3ESBA 3O4HA 2BJHA 3FYUC 4Q3OA 1XKLA 1D07A 1LPSA 2Z3ZA 2Z8XA 2RGUA 3CN7A 5CH3A 1EINA 4U2FA 4G8CA 1QIJA 4BE4A 2VT7A 2ACKA 4G1FA 5DYYA 4X97A 1WB4A 5JIBA 1R1DA 3N0TA 1QOZA 4GW3A 1EB9A 4LIPD 4H7JA 1CUDA 5EIEA 4UHDA 5E4JA 4MYDA 1K8QA 4ZXFA 4AMYA 5ALPA 3WK4A 5CT5A 1EI9A 3H2HA 1BEZA 2BUBA 2QJRA 2XDWA 3DNMA 1ZD2P 2ES4A 5ALEA 4Y2TA 5JAOA 1C4XA 1JU3A 5FDFA 4X85A 2JGMA 1E3QA 3PE6A 2PX6A 4J7AA 3IUMA 4J0IA 3GFFA 4EA6A 4A16A 4J0JA 1CUWA 2OLEA 2PSEA 4QLOA 1ODSA 2WIKA 5HK8A 3Q8WA 1MT3A 3SK0A 3L1IA 4Q1VA 4C88A 3RM3A 1JJIA 1QJ4A 2XMRA 3H04A 2C4HA 4LXIA 2PUJA 1AC5A 3DKKA 2BUAA 3AIOA 1AMNA 4DMKA 1HBJA 5EIAA 4ZGBA 5C7YA 1NU6A 5IVHA 1AZWA 2DQYA 4P92A 4EB0A 1HDEA 1VE7A 3F97A 3F9CA 1DQYA 4X6YA 2QRUA 4H7EA
chains in the Genus database with same CATH superfamily
5KOJA 2ZULA 1IJKA 3ABOB 2YIVX 2OV2A 3OWHA 3GJYA 1B16A 1ODCA 2X5XA 3FDFA 3PWTA 4JELA 5F1KA 2CKMA 3R4VA 5TC4A 5TGTA 4HDKB 4J3FA 3NR2A 4P0QB 4GXNA 2ILTA 4TSRA 1Y8RA 1TX4B 1T2UA 3TMYA 1VFPA 3U1BA 4FYPA 1E3MA 2R6JA 3IILA 4PW0A 2POCA 4ARVA 3RRJA 1Q5PA 1HDGO 1CVIA 2G1KA 1NVTA 3I23A 5DLEA 2DFPA 1V7ZA 6YASA 2BHSA 3OY2A 2IBSA 1EA7A 3QXSA 1N3BA 1ODJA 3PRYA 5DRTA 2YOFA 3L8HA 4HP8A 5T41A 2E0IA 3GW8A 1W4AA 3IBCA 3PC8C 3WO0A 1U28C 4A26A 1BO6A 3ENWA 2OTCA 4AJ2A 2IF0A 4FHDA 3JD0A 1SUDA 3SXJA 4BYMA 4C7VA 4F11A 2ECFA 5FI0B 1AUXA 3PNSA 1E1YA 1JLKA 1LBIA 4OQXA 1W19A 2WFZA 3W3AH 2QPOA 5C1DA 2WPDD 4MA5A 1MEJA 3MWLA 3VH3A 5AVWA 1P4HA 3MMXA 1EMDA 3GL9A 5FUVA 4ZI7A 4JI8B 1SOWA 1KQOA 2FWMX 1XV5A 2GZSA 1AQYA 2IP4A 2WVGA 2G28A 2AI2A 5EIOA 4IHKA 4L8YA 3T95A 5JHGB 2WQ6A 4XM1A 1IK6A 2Z9BA 4G0WA 1UBRS 3JQGB 4L5YA 1EXWA 2KLBA 4BTLA 4F2DA 3G5MA 1NBAA 4RGBA 3FDJA 2O2IA 2IHTA 4G67A 2QZZA 5A03A 3VHRA 4IV8A 1X14A 4JLAA 4M0CA 1TEVA 4U00A 1BEEA 2HHLA 1JSCA 2PSFA 3ANYB 3S7TA 4B3DA 5M2QA 1N6OA 3HU5A 1ODLA 3CX3A 5IUJC 3VMFA 5LZ8A 5E7QA 3UWMA 3U17A 3AJEA 2B6NA 3QOWA 3VPDA 2RGEA 4MCHA 5KQSA 1DX4A 4ZQGA 2QMQA 4KMRA 4AKIA 2OB1A 4KB5A 3STXA 4F5WA 2HDHA 4IVQA 1DDOA 4ON9A 3BSWA 2GI4A 4X44A 4TUYB 2BHLA 1SBYA 4BKMA 5M04A 1B42A 4V0ME 5C0OE 3SEAA 4CFSA 3GPLA 2GBPA 1PSZA 4TMXA 2QN1A 4Z86A 5K3FA 4DFDA 3SQWA 2NMVA 3BBLA 3UQZA 5I47A 2EKPA 2PZFA 5BQXA 1ZAYA 3VDQA 2D2EA 2B94A 3LW8A 4MULA 3GMSA 4JX9A 3TAHA 7MDHA 4D3ZA 3SG0A 2GEFA 4YRPA 1A77A 4NV0A 4YQFA 3VSDA 4FINA 3HCWA 2EGGA 2NTVA 3LKBA 2IYEA 3H9EO 3B38A 4I1YA 4Q12A 3UK2A 3Q7RA 1ZW6A 1IM2A 2YWBA 3EXEA 4GVPA 1X2EA 3RARA 1Y4UA 4K6HA 5JSUA 3TNYA 1M34E 3U60B 4TZ6A 3N75A 4G0YA 1KMQA 1UZUA 1CUCA 4HLUA 2GFQA 5CB4F 3CIFA 2HA4A 1AH2A 2EFDB 3RV3A 2FSPA 1RHMA 2GBLA 2NZYA 2JBAA 3FHOA 4MUYA 5CBPB 1EDZA 1AZTA 3E7WA 2O7RA 3OEHA 4R81A 4CF6A 2V7WA 1A7AA 4CQNA 1YMUA 5DHAA 1TA4A 3UMFA 2YVLA 2ZYVX 5F77A 1RJ9B 3GJ6A 4L27A 2DFLA 4CLHA 5JALA 2ZBFA 4CZ2A 1HL7A 1XIVA 2O2EA 2H6EA 2GVNA 3OMWA 5JWRA 1SCQA 2ODBA 1QFXA 4G37A 2M2IA 4LCJA 1NI3A 4WIAA 5AM2A 2FEXA 1S9HA 3PIDA 2PVCA 2O1EA 3A28A 3UGTA 4CL8A 1S0UA 4EUEA 4ZMRA 3N8IA 3CJTA 4V1CI 2H48A 4ZP1A 2RC6A 5GJBA 2BELA 3FOFC 3IP5A 3C5WP 3L84A 2JHGA 3A06A 1CJCA 3B89A 2VUTA 2J07A 4J0EA 3RGWS 2Z6UA 4JR0A 3L4BC 4FNOA 4O1IA 3WIDA 3PUYA 2FW8A 4L4RA 4AY2A 1F4LA 3M4ZA 4XCQA 4AJHA 3K9HA 4Q1CA 2QN6A 3NKFA 4W5WA 3HWRA 2HJHA 2YDYA 4KOEC 1W581 2OESA 1QBKC 3NBUA 2WU3A 1YDFA 2PUTA 2QX9A 2J48A 1JHUA 1KBZA 2CXRA 3H86A 3PPIA 4KI7A 4NICA 1DCMA 1P2FA 4OSOA 4CODB 4F9FA 4QJ3A 3QNUA 1NRXA 2GAIA 2NUTB 2W2PA 3EWNA 3ONDA 4AN1A 4CEJB 3Q11A 4JHLA 1OGJA 1P5ZB 2CXOA 3AVQA 1E69A 5ICMA 4R7ZA 3SOPA 1J8YF 3B36A 1OAOC 1DJNA 2GPNA 1SHJA 4NBWA 5F1YA 1Z28A 5TMEA 4GHWA 3RBXA 3CLSC 5CNKA 3WGZA 9LDTA 3SVLA 5I7AA 2QTBA 3GVCA 3C6ZA 2W6CX 3QOXA 2H1HA 1DIGA 3KTAB 3OUZA 3B82A 3S2EA 5JATA 5CYGA 4KXWA 3Q9SA 3I12A 4F4JA 3U3ZA 1G8PA 4Z53A 1PHRA 3CB2A 3SKXA 2HK7A 5A0VA 1P39A 1H2HA 5H16A 4JKIA 4TTQA 3BGSA 3TEFA 1Q11A 3F71A 4FNAA 4RANA 1GGHA 4G24A 4B34A 5BUZA 5CDFE 5IYZA 2GN2A 2AE1A 2NVBA 2LCFA 4IW3B 4K9OA 5EP1A 3CSUA 3D43A 3LBYA 4KPGA 4U2BA 5AUPB 1TKRA 5A5GA 3KPWA 2PUWA 2YIDA 1IUPA 1JFRA 1T3HA 1XQ6A 3CX8A 3EH2A 4WNYA 2PS3A 3TLAA 4HBGA 2Y76A 1KKMA 4GLBA 1Z29A 3P1JA 2FPOA 4J6FA 4UEWA 4MGHA 4FFPA 3NGLA 4A8HA 1XCBA 3AW9A 1LQ2A 1ISRA 4D9JA 3FTDA 3GCGA 5EHIA 1Q7TA 4KTVE 4J1QA 4URUR 3P0HA 1USKA 3R5KA 2IZ1A 3LCVB 3DZJA 4L5IA 2X0DA 2RAUA 4B8ZA 6ABPA 2V5AA 5T4FA 3FPFA 3CRMA 4GICA 2GEVA 4WCFB 4UCQA 3CCCA 1SXJC 1L4GA 3HU3A 1XG5A 1A3CA 1SQGA 2BJWA 2VH5R 2Z8YA 4KO1S 2IU0A 1VL6A 2C3MA 3F2IA 5THXA 1AKQA 5EXSA 3QXCA 4TQ9A 2BSXA 3WIVA 3D1LA 5LP6B 3FPEA 4WKBA 3VUEA 4JJ6A 5KNCH 2C8KA 5EWJA 1BWSA 1CLEA 3L0YA 3W90A 1YZ3A 1TM1E 1YOBA 2JHPA 2PBFA 1Q0RA 3HKCA 3H83A 3HU1A 3RIMA 1JDNA 1W36B 3P4XA 3MELA 4H35A 1JKXA 2B8NA 3IPRA 3ZNNA 3LZDA 1FU4A 3AO0B 3RJMA 5BN3A 4OO3A 4AYWA 1RFGE 1K08A 2H8GA 3EYWA 4JBYA 3ABSB 1Q1ZA 3DEFA 4AKSA 2IIBA 2Q99A 3MT9A 1IPFA 1XTBA 3GV0A 3MTEA 2FJPA 4IM7A 1G18A 1Q0UA 4U2CA 3UKJA 2H0RA 1L4HA 3K9FC 3KD2A 1N6KA 4MVJD 2E1PA 4CEHB 3QOYA 4CTKA 3VNSA 1GPBA 3BXEA 3NJRA 3WL6A 1W5TA 3M82A 1LDEA 1W94A 2WIFA 3KQYA 3DMDA 1NIPA 5KX5B 2JF0A 3OA2A 1UKZA 1RHUA 4LBVA 4Q4LA 2IBMA 4XDGA 3HFRA 2OV3A 3LPDA 4K2AA 2J7KA 4I9GA 3E0QA 4KQ1A 1BWQA 4MLCA 3LRXA 3R3XA 2BFMA 4ZV7A 1H4QA 3GVXA 3R0QA 4KR6A 3PFIA 3P19A 2WU8A 5IBPA 5JS7A 5EZ6B 2H1LA 1U02A 4N49A 3AOEC 1J2UA 1U2QA 1SPXA 2ONZA 1G4AE 4NYJQ 2Q3LA 3CIOA 1E1RA 4Q19A 1VBKA 2GLTA 4I8IA 4JBXA 4HEQA 1DO8A 1P4GA 1AMUA 1REQA 4TTRA 3A1EA 2Q0SA 4RGYA 4TGLA 4BLRA 1NM5A 4JLOA 1P62B 3FFTA 4BOYA 2GF0A 1M1NA 4MSUA 1SIUA 3FVRA 2NACA 4GVXA 5TMDA 3DGEC 5BWBA 2XAAA 3HB1A 4MQLA 4QFMA 4QBKA 2EP8A 1ZIYA 1YQUA 4NV1A 1M0TA 2XUGA 1IOZA 1H2ZA 4FHEA 4KQMA 1SC1A 4WXHA 5F1OA 4KZPA 1SVMA 3COVA 4ARZA 2NVUA 1JH9A 2Q3MA 3KQLA 2B9EA 2VPYA 1GGNA 1RPZA 4HB0A 2R6FA 4ZJYA 3GROA 5T5QA 1G21E 2DZDA 4N12A 3PENA 4PYQA 4WBSA 1XPJA 3NLLA 2QQFA 4JJ8A 4P82A 5CVJA 3TB6A 2VP9A 3V7UA 5B5SA 1Y8ZA 1NY5A 2BMFA 4H31A 4MRNA 3TZQA 2FSSA 4BGUA 5JZBA 5BV0A 5ECWA 1F4VA 4KX5A 1V5WA 4YDSA 4FCWA 2M9MA 1HPLA 1Y7LA 2CHVA 2V7QA 4HF7A 1C14A 3A1DA 1T3LA 1Z5NA 5BV7A 4B4VA 1X42A 2PD3A 2W00A 5CDSA 4JN6B 1UR5A 2XH8A 2GYVA 4AN0A 5B55A 4BP3A 5KTYA 4WW0A 1S2OA 4HAYA 3WLQA 2ORWA 1OUMA 3FFXA 4IJ6A 4FGWA 1T4CA 5HQ3B 2XQGA 1MAVA 2BFFA 4Z99A 2X1LA 1GZ3A 3ZWDA 3AF6A 5AM3A 2R0QC 4L4YA 5BMVB 3NPAA 2OP1A 3H16A 4RPCA 4Z49A 3PC8A 2P1DA 1ZUHA 2XCIA 3IQGX 1U28A 2IP2A 2YDXA 3DP9A 4NQZA 4LMAA 3V8RA 1MORA 4CCYA 1E4EA 1T2VA 3PQ4A 3D4PA 1CERA 2P2SA 3OX3A 3SZMA 4EYEA 4GMXA 2EZUA 4X90A 4C0LA 1IXYA 1XU7A 1FNNA 2X41A 4Z3KA 3KSZO 1QHEA 1L5MA 1KF0A 2JAXA 5BN5A 1L7AA 4HMQA 4F56A 3KQPA 1ZGZA 4LYDA 1YQTA 2GA8A 3ORHA 4Q7JB 2A86A 4I2VA 1BX1A 1NBMA 1RWQA 1XDGA 3AR6A 2CNDA 4IQ4A 4XIIA 1BWPA 1Y3AA 2OBNA 3A36A 5CXXA 4CIVA 1FNMA 7GPBA 5AJXA 5IK2A 2PT5A 5FWXA 2R8PA 3CUUA 2B4AA 3AHHA 1JWLA 3QIAA 3NBFA 3LOQA 3KYDB 2P2DA 3H75A 4TZKA 1W52X 2Y0BA 3HY4A 3NB0A 3RBAA 4B76A 3E0XA 2QPAA 3GGGA 3W9BA 4ZAGA 2EZ4A 4HTFA 1JJBA 4XWOA 5FWYA 2VJOA 3VTZA 1DTWA 5LQJA 3SBDA 3SICE 1XZKA 2GH1A 2CUTA 3HCEA 4K3UA 4AB1A 4C7OA 4GFDA 2P3QA 3PF8A 4CKBB 5DLPA 4OLBA 4XDHA 4DPMA 4A0HA 1SGWA 1YE8A 1S4QA 3BQNB 5BORA 3GAZA 3O5AA 3QF4A 4G1VA 1B73A 4Q4DA 4TLCA 1JHZA 2G4CA 1GQSA 5IH7A 4F45A 3WYAA 4MARA 1E3EA 3IH5A 5DHUA 1A4XA 4JOSA 2C5AA 1ESNA 2Z4SA 2ZSDA 5JAQA 3TIGA 2V6MA 1GUYA 3WOHA 4YAGA 1DKQA 2IPLA 3A9UA 5JCJA 1K6JA 4OHPA 4DIOA 1R27A 2YXEA 2XGJA 1NQAO 2R8ZA 4JD5A 5KOHA 2E4YA 1PJBA 1OBCA 5KVVA 3Q2IA 3P9KA 4HYYA 4FOOA 1EIZA 4ZOBA 5AUQA 1QQ7A 2E18A 2H57A 1JX6A 1UT5A 3ZDYB 1U4NA 3EE6A 1U7OA 2V9PA 5EXXA 1CZUA 3D2LA 1Q1NA 2VHUA 1L5FA 4MO2A 5EY5B 1DVRA 1TTQB 3DH0A 3PFNA 3UUWA 3AI7A 5BYBA 2FMFA 1U5AA 4CQMD 3JQ7B 3EDCA 4EHAA 4E5SA 4AI6A 3TNFA 1VKZA 2TMDA 5EWLB 4JLMA 1WMBA 1EKXA 2B35A 1N0IA 1SIOA 3L0IB 4ND4A 2O48X 1UODA 2CLSA 2P1RA 1QK5A 2H16A 2OV8A 1T1RA 4GX1A 2CWDA 2OQRA 4H6XA 3VHXA 1LD3A 1G63A 2O1SA 4GQIA 3U61B 1B8UA 1CUJA 2HTEA 4CGYA 2BGRA 3GZ4A 1LPBB 3EGIA 1KO7A 1MG0A 1OU0A 2BMJA 1PL0A 2RHCA 1YI8A 1Q2XA 5DN6D 1Z7EA 3EVFA 4LE2A 3L4BA 2ZRBA 4V0NA 3UC5A 4YUVA 3B3JA 3PGA1 3Q3GE 2VT2A 1XAJA 4YRCA 3ICWA 1Y6QA 1VKNA 1D09A 2OZEA 2WKPA 4FDTA 3KB1A 3RRZA 4Y6PA 3ENNA 2P2NA 4CLRB 4OK6A 4WASA 2GSWA 3EQZA 4DQVA 3Q7EA 3GB9A 3FKJA 5HKKA 2V7PA 4QICA 1GPKA 2WI8A 2HMTA 1Z4IA 2HRRA 2QE6A 3BICA 2VYQA 3OCCA 4IL5A 4KPEC 1AT1A 2YJNA 3I64A 4XCXA 2G0TA 1H2WA 1RI1A 2E87A 1P1BA 5AKIA 1JFFB 1YDMA 3BORA 2XNDD 4YJGB 3S2GA 1XAHA 4NLLA 1EH5A 1E60A 1WX1A 4U9IS 5FNVB 3SYLA 4PZLA 3ZBQA 5KB3A 5AXCA 1OYVA 4DDWA 4BDTA 2C88A 1KBQA 2C29D 2YZKA 1TADA 3FZQA 4B4DA 2HSGA 2ZSKA 1VPWA 3VV2A 2QM3A 1LBHA 3WBJA 5L7YA 3PJEA 1M1ZA 3ZY5A 4AUNA 3NOXA 1U8UA 1NLYA 3W79A 3K71B 4Q34A 3WLEA 2C04A 1M6VB 1OXKB 4L3WA 3GLKA 5FOQA 5KWEA 1B43A 2C97A 3L8FA 1K1EA 2IU6A 2I54A 1X7YA 3K2BA 4RWEA 1ZA2A 3PQ2A 3ZCVA 3HZHA 3ABQB 3MUNA 4P7KA 5LA6A 1IY8A 2H9AA 2YFHA 4PF1A 4LWZA 2I7CA 3OQMA 3THWA 4LWPA 2FETA 2IXBA 4N5HX 4JI4B 4XQGA 4LHZA 1T24A 1NPDA 3TGLA 1UC5B 1XNHA 5E6SB 2OGUA 2XOEA 2WQ7A 1YJ8A 3COPA 2R66A 1BG6A 4ZYYA 4WMLA 1SVUA 3FNFA 4AO8A 3C7TA 3N8DA 4GM4A 3PTZA 4TZTA 5AW2A 3T4EA 2OCKA 2RMKA 2JGDA 5BSFA 4QQNA 1XJQA 1MO5A 1PNVA 3N2KB 5H80A 1Q21A 3WISA 5GJVC 3TOCA 4EKYA 4OH1A 4PRLA 3M3HA 4YRLA 1DOHA 2D2FA 1VPDA 5GPBA 4F3CA 1SBIA 4JQOA 4BP1A 1M34B 3HKDB 3QKRA 1G60A 5JXGA 2Z95A 4XSHA 4MGZR 4BO7A 4HD8A 3FG9A 1K4MA 3KLOA 3BFVA 4CR6A 1RYYA 3Q7QA 3TRFA 1JEYA 1ELOA 1BMFA 3NPMA 3UY4A 1ZRHA 3HYTA 2P6MA 5DTIA 1H69A 2XA9A 5AUOB 3USCS 1E9CA 1YMVA 1RKUA 2QN2A 3AVYA 1W25A 1C4KA 3DMGA 4YMSA 5ILOA 1GRNA 1DL5A 5FUBA 2OZLA 3H5OA 3URMA 3E9MA 2O2JA 1PQYA 3TDMA 3AY3A 2QD1A 1BJKA 1XRLA 1UKEA 4TRNA 3LL4A 3O75A 4D0NA 1F2UA 1XYGA 2QPTA 2VNKA 3LC1O 1Z5VA 3ANSA 2I6XA 3OX2A 3AG6A 3W8NA 2BMVA 1IB0A 5EZYF 3GAMA 1VXOA 3B9BA 3C3JA 3WKEA 4XJSA 1JHDA 3TLYA 1V4NA 1Z12A 1ZMTA 1JWBB 2XQVA 2CV0A 5K4GA 2XZDA 3DE3X 2SCUB 4RV9A 1KGSA 4R1NA 2FP3A 4H27A 1CYEA 1C1XA 4P5EA 3HUTA 2PSSA 4DQDA 3WL3A 2GAAA 4JXKA 1PZEA 3WI7A 1W2GA 1XVVA 3B7WA 5AH0A 1ZXXA 1V45E 1W85A 3N0VA 4JHXA 1GDHA 5TQ2A 5JNTA 2MSNA 4LOJA 5KYXB 3X2EA 3EB9A 4GOOD 2P9TA 1ZM2A 4XYGA 5EPEA 5TJ9A 3RSOA 3ZGOA 4CUJA 5JPDA 5AI6A 3BD7A 3AOEA 1FEZA 1RQ2A 3N39C 3I05A 1ZH2A 4Y2GA 4F1JA 1QBGA 2XVMA 3WP1B 3VPBA 2NXEA 3A6JA 2BF7A 4Q21A 3G68A 1TZCA 3PXUA 1D1QA 1VBNA 2PKEA 3IV7A 2VUIB 2GUGA 3NCTA 4UPVA 4FK8A 3A3KA 2BTQB 4CW7A 3WGNA 3AJAA 4BAZA 2F8TA 1QVRA 3K5IA 1E3IA 4HBZA 2D1YA 4N8SA 2CEKA 4DM4A 3CH4B 1QANA 2BVNA 3F98A 3U13A 1C2YA 1JAYA 2PWPA 2IW1A 3T34A 2QX8A 2GXSA 3RW9A 1J2EA 3ET4A 1GITA 5KNBD 3I9NA 1SBCA 3A31A 3IUEA 3V4FA 4FNGA 1P3JA 4IH4A 1JPJA 3JZDA 3X3HA 4YMTA 3UAYA 3DT6A 4FXOA 4R5HA 3TEJA 4HWRA 4I1PA 4HRVA 1RLTA 4BWYA 1NXVA 5AJZA 3TTTA 1G2OA 4RTRA 1HDXA 2JLUA 4Z4EA 3B1VA 2WMDA 2JLYA 1VYVA 1CG6A 3ORRA 1XZFA 1A82A 1FDIA 1YOVB 4FPXA 1ZUNA 1Z75A 3T35A 4X8LA 4KGXA 3JAMA 5IJ9A 1JHMA 1R3DA 4J0FA 2HYDA 2IHYA 1BE0A 4M2LA 3NNNA 1RKBA 3ELUA 4KR9A 1KI8A 1U8TA 3ZUPA 4R2JA 4AAYA 4F3TA 1FSZA 3X0DA 2HX1A 3T0GA 5JDIC 3PNYA 3EN0A 2NN3C 4L8FA 1O08A 1E2KA 3SD7A 1IEVA 4LRYA 3ZDZB 3MRTA 1VLZA 5AI8A 2O14A 4QQ8A 4TQUS 1Y8RB 5CCDA 1FP2A 5JC1A 1PJSA 2JRCA 5IBRA 3QSYA 1YRAA 1HLPA 1R9GA 4P5DA 4IIUA 2J59A 1OJLA 3RLFA 5BUQA 5ESRA 3BCUA 3ZCSA 2PJUA 3JAKA 1G5QA 1U65A 4W82A 1EFUA 2NPOA 3OVMA 5K7SA 3QELA 4I6GA 2GBIA 2HXYA 1C7JA 3DO6A 1V1RA 1JI3A 3KQQA 4EFDA 1Q0HA 3V34A 1NDQA 4FGLA 1S3IA 4IVRA 2VCYA 2OC9A 4MCAA 4U7TB 4XJTA 4R0NA 3M7IA 3R75A 4OCZA 5IM4A 1ZVJA 3BIXA 4F2WA 1WQ4A 3N8HA 3F9RA 2DP4E 3CE6A 4RM3A 1U04A 3RJ9A 3UAGA 1C9YA 1RC8A 4OBEA 1PP4A 1WBJB 2WAYA 3D3JA 3NDPA 3OKAA 3QNMA 2ZTMA 2OM2A 1G7SA 3SQOA 2HWWA 4IRMA 4AURA 2CY0A 1I2AA 4BFZA 4CUZA 4WHMA 3D64A 3I2GA 2AZDA 2JFOA 1XI2A 4LTNA 5KYUA 3JWPA 4OGGA 4ZI7B 1TQ8A 2KSQA 1GV1A 1PWZA 1DX9A 3BJRA 3OQNA 4CLDA 4HGOA 4YRZA 5HHTA 5LP1A 4OB6A 4E5MA 3TRKA 2XUJA 3AL2A 4OEHA 1CUXA 2HREA 3K7EA 3E9CA 4QC2A 4DCSA 1WXIA 1SD1A 3MS4A 3QG1A 4X1KA 1UK8A 2ZAIA 3GLTA 2MT9A 2WVAA 1CZOA 3DTVD 1O6FA 3K9QO 1JYSA 4Q7MB 4E5UA 5J58A 5KVCA 4RVCA 4LYYA 3RRXA 5A04A 3NALA 1K68A 4LHEA 2K2QB 2GN0A 5KDDA 1A4IA 3C8MA 5LBTA 2C61A 2RH5A 4CI0B 5I9SA 4OYRA 2AR0A 3FUCA 2C78A 3OCXA 4PAGA 2ZREA 3LX8A 4QATA 1N2GA 1NNLA 4XCVA 5KINB 5CNJA 1CIVA 5HZMA 4MWBA 3M1IA 1C1DB 3QM1A 3FE2A 3RYFA 3I6YA 4NESA 2A1UB 2VP5A 5IAEA 2B99A 3D6AA 4HDSA 2YV2A 1EWKA 3BHMA 2X0EA 2JCVA 3ZZMA 1O6CA 1QE5A 4B6RA 4UJ5A 4C0BA 4IIVA 5DU2A 4UUAA 3S1LA 4EB6B 2WZDA 1N7HA 4GXTA 4ARCA 1PGQA 3PJGA 5CVDA 2DPGA 3TE7A 2RI1A 3ADOA 1BTOA 4S3MA 1YH3A 4CL2A 2CMDA 4HZUA 1TMOA 1JBQA 3ACCA 4MQ4A 4Y6SA 5BYJA 1G21B 2H1SA 3QK7A 1S01A 3OZIA 2QLNA 1VB3A 3EXEB 3GWGA 4PTZA 4BB0A 3B6JA 2WNHA 4NJMA 4HPJB 3GGDA 3KR2A 2O7VA 4KYTA 3IPLA 3NV9A 3VKWA 5L51A 3FPLA 2P9GA 1HSOA 3DEIA 1UINA 1VI6A 4MB0A 3EWSA 5E6RB 5B36A 3TF5A 4US2R 1EGMB 3WXMA 1CR0A 3FPBA 3W5CA 4FWTA 2B7CA 4J7XA 5ALVA 2H4FA 3IDOA 1SU4A 1JVNA 1TF5A 1I4EB 2H9YA 2P67A 3FUTA 3IQFA 1SCBA 3JQ8A 3KWLA 4XX1A 1T25A 2OFOA 1FP1D 10MHA 5TQ0B 2D6FA 1CDDA 4UDOA 3WGUA 4NOLA 2W2KA 1E2IA 3K4PA 4Q5IA 2ZB4A 3LL7A 4MDYA 1NUTA 2VNIA 3ZLVA 1F0NA 2WOOA 3N0XA 4KLZA 3FGOA 1P31A 3R77A 1C7RA 1X7ZA 3S3TA 3AM4A 1TIPA 3U3RA 5F5LA 3TH5A 4P6VF 2JS7A 4KREA 4XXHA 1W0KA 1R8YA 1XC7A 1ZJ5A 4JBWA 1GUFA 2IYXA 2NVWA 3DEZA 4POAA 3GMDA 5CRIA 4E14A 5LIPA 1TYDE 3BMQB 2ZB8A 3PJDA 3U7JA 4E08A 2WAMA 1POXA 4HDQB 3G0HA 2QWXA 2XODA 4AICA 4DPKA 4HUTA 1NVEA 4B6SA 4JDUA 4ZCTA 4Y18A 5ENZA 4I50B 4EYQA 1G1MA 3I0MA 5G0UA 2JCGA 4DEXA 4JJIA 5BW5A 1NATA 4MV5A 4ABYA 3QEAZ 3TXXA 4M8NE 2GUWA 2IU3A 4DA9A 3BFXA 3F8SA 2JAQA 4JLKA 3DUWA 4XM2A 3PUWA 4ZA2A 5GVRA 4F1KA 4KQJA 4KXXA 1Y1TA 3PQ8A 4TTAA 3T41A 3CC8A 3VNBA 3R0JA 3VU8A 3C7KA 3IE0A 3IP3A 1H93A 2QI9F 2PL3A 2WVHA 4D57A 1DEKA 1D2NA 2UVPB 4KIGA 5FCDA 2G5GX 4MS1A 2P9YA 3FCUB 3UMSA 4N5MA 2GXAA 1YKGA 2QORA 3BF8A 3HJTA 5JNLA 4YY3B 2E5FA 1EVJA 1MQSA 1T9BA 3BAFA 3MXOA 5J5CA 2A0FA 4YT5A 2CHFA 2EOAA 4E4YA 3ESRA 1GRVA 5IWAB 1TZ2A 5H02A 3B5EA 3UF0A 2GJAA 2L18A 3A04A 3DEYX 4GR4A 4BO0A 1Q92A 3B5JA 2XGGA 2QSYA 2FRXA 2Q4EA 4WCDA 1NVKA 1QOPB 2X8JB 1FSSA 3D4BA 3V4PB 5IYZB 3PGKA 3FMPB 3FZEA 3OFVA 2IXTA 2J6BA 5LQUA 3EEOA 1N33B 4B6JA 5JU6A 2NTNA 4RA6A 3V9AA 3GBVA 3DUFA 1M1YA 2N3ZA 5CIWA 3AEKA 3VU0A 1Z9BA 1K5HA 1C80A 1UWCA 2Q5IA 1KJQA 1PEDA 1Q3HA 4TL8A 4C7KA 1M1XB 5LQKA 1RM4A 4TV8A 3B3QA 1LSJA 5JOQA 2D8MA 5DN9A 3EGDA 5FX2A 2K5UA 4GI1A 1GVHA 1G5RA 2PQ2A 5E3JA 1O0CA 2LCQA 5EZ5A 1YFJA 1M9NA 2GRAA 2O0MA 2P9JA 1IJFA 2Q2WA 2WD7A 3C3EA 3ILSA 3ADCA 2JLXA 2V65A 1JDPA 1VHDA 5K0NA 5JECA 2PU5A 3TXAA 3OOHA 3W5HA 1EDDA 2BFOA 1N0UA 1H9BA 1U7PA 1NJ1A 4EFKA 5A7FA 3W5JA 4C4YA 1AQLA 2Z30A 3RFTA 4YRQA 2C3PA 1FBNA 1GKYA 2R6R1 3L3BA 3HM2A 3LLCA 3N28A 3H2GA 4MR7A 5AT1A 1M0EA 2C4KA 2ZYDA 1RRMA 3TSWA 5IW8A 1GQOA 1RE1A 1J39A 2X4IA 4NNPA 5H59A 3T4XA 4C1NA 5BN3B 1N5JA 1N92A 4UHHA 5ALDA 4RVSA 2IH5A 4MUIA 5FOSA 3WMEA 3QV1A 4DJDC 1JZSA 2PLRA 2XHEA 2X86A 3O31A 4MV0A 4AW9A 5GGYA 3UV6A 3LP6A 2AQHA 3AY6A 2GZ2A 4Q16A 4BNTA 3R7DA 1W87A 5KMGA 2AC7A 1UK6A 4X66B 2OY0A 5EHQA 2D54A 4FFLA 1P2VA 3ZGVA 5EXPA 2F62A 3PE3A 3VKHA 1GJRA 1KEUA 4EMBA 3IBGA 1T9GS 2OBBA 5TV2A 4AJ4A 1NUQA 2WV9A 3GDHA 4BU0A 3OJCA 5AYVA 2XVAA 3BZUA 5HKLA 1E3WA 1U3GA 4V2UA 2M1XA 1ZJ4A 2VQSA 1GNSA 1QAQA 1B1AA 5IBQA 1STOA 3VAYA 1HNXB 3LPAA 2YUIA 1C4WA 1MPXA 4UULA 3CR7A 3ET5A 2DR2A 5IN4A 4J1NA 5FOWA 4ZVTA 3QX8A 2CMGA 2R96A 4MR8B 4YMHA 2AC4A 3KKPA 2HSEA 3K05A 4BVGA 1XVIA 1PV1A 5KZMB 3FYHA 1QHHA 2CEAA 4JYZA 1FYEA 2W6PA 3AF4A 5C4IA 1SN7A 3AH8A 1AQIA 1IHDA 4CTNA 4DJAA 3GRUA 5ALYA 2QTHA 3QPBA 4JDPA 1YZHA 1M1NB 2APJA 4AXBA 3X1ZA 3AERA 2ZPTX 3Q8XB 3S8YA 4CNQA 3JWEA 2P3SA 4E5PA 2HHHB 1KH2A 2PXXA 2VEOA 3OEED 1Z4OA 3BTVA 1S8OA 3MJRA 1L8XA 4AG6A 2BJVA 2IZ6A 4MUAA 1O97D 3CNNA 1X7XB 1BQ4A 2I7DA 4R05A 4XJVA 1GL7A 5L3RA 3HTXA 2VWQA 4ARZB 3KEQA 4NZNA 2EZ8A 2D13A 3OZTA 4CKXA 2IYPA 1MX3A 1V3VA 4N65A 2JH9A 1J8VA 1TQHA 2QK4A 3C4QA 1MB9A 4LK2A 3V8NA 3VOTA 1CZRA 1VLQA 4EHDA 2AF3C 3O1JC 4Z4HA 4M0KA 4AKGA 3BS4A 3MRVA 5AVZA 3NGXA 2VDVE 1K7XB 1KL7A 3PDWA 4A5OA 2MSDB 1IAVA 4BN4A 2R6CA 3I62A 4GYKA 5JDIA 4NCNA 5TY0A 2P6OA 3JZAA 2OT3B 1E7YA 4D4LA 1ZKDA 1IM8A 4MKRA 1SOVA 1WWKA 4NMXB 5FXMA 4XLZA 4KACA 4PZEA 5D84A 1U1FA 3RTGA 4OLFA 2NSYA 1LXCA 3EBLA 3KQWA 2CB9A 1N57A 1RABA 2JHCA 2QRKA 1PEAA 3H65A 3KBBA 4RPJA 3TVTA 3NM4A 2XA2A 3ED1A 4TVOA 1QU3A 1U5BA 3CGGA 1PK8A 3FCOA 1WCIB 3UKOA 3PQ5A 5P21A 2OBMA 5FKJA 3GNTA 5KCZA 4U2GA 1YZGA 1E32A 3SBOA 3IBYA 3ZHRA 4BCCA 1Z5WA 1G9TA 3DPSA 3MF4A 4IJUA 4JP8A 3DMHA 3WLKX 5E2IA 3PJFA 4CG1A 5LWHA 3ZTTA 1E5TA 2XRFA 2JLWA 2PLFA 4N5DA 4XUEA 1YSCA 1CQXA 2EX0A 2IGTA 3WBKA 4EZEA 3A11A 3A70A 3PGJA 5BN5B 1X1SA 2XD4A 3G2IA 4BZXA 2FPIA 5DGHA 4JI5B 4L4UA 3ROZA 2D7DA 3G5AA 3IEPA 4RGQA 1BH6A 1W1WA 3LPNA 4XPIA 3KOXA 4YP7A 3H3XA 2WD8A 2EARA 1GGJA 4JQYA 5IC5A 4GLFA 2MSCB 3I39X 5FWXB 3OCJA 1B6GA 5JARA 4EGSA 4ILKA 3REFA 3A25A 1SFRA 4INZA 4E0BA 5LMCA 3K9GA 2AFIA 5AW0A 1I5RA 2BEWA 1MJFA 2FR1A 3OM8A 4H7KA 3JPYA 3PB3A 1DTWB 721PA 5SY6A 3I9JA 2ZRDA 3NAGA 4QUBA 2F3SA 5FHQA 1MH9A 3CS3A 3FJYA 3GJQA 4TWIA 1ZOPA 1PFUA 3QF4B 2H06A 2EQAA 4Q9NA 1KNXA 2CHQA 1LDMA 2E4ZA 2I1VB 3K2EA 1R18A 2FKNA 5CFNA 3GLFE 1EBUA 3BGWA 2H18A 1TA9A 1IN4A 1EWYA 2N9UA 2XUAA 1E2BA 3RT9A 1G59A 4OFWA 1H94A 1N1GA 4RLFA 1Y98A 1CZNA 4IUYA 4UHCA 3QE3A 3IMEA 4JLVA 2AKAB 4GAEA 1ZRMA 5K03A 2NUAA 4G4SP 3SN6A 3P9NA 4MWEA 1SZPA 3LKVA 1V8PA 4WTOA 1M8KA 4PGMA 4MYSA 3OMLA 1YQXA 4J7UA 2YJ4A 3FGPA 3QWFA 3GDWA 3HWWA 2WJZB 5IWCA 2CHGA 2I22A 4PC1A 4ZAWA 3TR0A 5IC4A 2CFRA 4TN1A 4OLAA 4MV9A 1HQYE 1PL8A 1UFRA 2DM6A 3G2OA 2Z2IA 3KPJA 2V1UA 1FMCA 1JQLB 4BIIA 4FONA 2RE8A 1MMFB 4Y2VA 1EHYA 4BVEA 1BFUA 2QL6A 3G85A 4FKZA 1U7WA 5I4BA 1CUHA 1QGAA 5ALHA 5D6NA 3BTOA 2DX7A 3KKQA 5CB4B 1YC2A 6REQB 4K9RA 5ENDA 3VH1A 1E0KA 5JSHA 4LG1A 4PNZA 3R0VA 5D51S 1PFVA 4NE7A 3K0CC 1CQZA 3PVCA 4ALJA 1HE3A 3VHXB 1VIAA 2YZ7A 1HYBA 4M9ZA 2HF7A 2WT8A 4UQOA 4L8GA 2XMQA 5DIZA 1BNCA 4P1ZA 2HQBA 3K6SA 2X6RA 5JUWA 4OMDA 4CDMA 4KAJA 3NJ8A 2CLLB 3WKBA 2QB5A 3EEBA 1IL0A 1G6HA 2CFCA 1CNMA 4C2AA 4KQXA 2B4TO 1YFZA 4MDEA 1E66A 1NN5A 2QT0A 3ENZA 2ILVA 3IQIX 4M9UA 5FYDA 1CUGA 2OOSA 3O83A 3RFCA 5HF9A 3SZRA 1L4KA 1FQOA 2C9MA 3BAZA 4C78A 2R8YA 3OTIA 1E79D 2BGTA 2CJYA 2PR2A 2QVXX 2O07A 1UXJA 2YZ2A 3HY6A 4ML3A 2C00A 3A1NA 5B37A 2I03A 1CF4A 3C7CB 2JASA 1V3QE 1O89A 1TIBA 1YJAA 3HXKA 4IKPA 5L9AA 3EZLA 3ROQA 2XB9A 4H3KB 2I71A 2JG3A 3STHA 4V02A 1AIPA 3T6KA 4DZZA 2VSNA 1SUAA 2WTMA 1KYVA 4ZOEA 3ECSA 2H08A 2FDXA 1CY1A 2IQ5A 1O96B 2GMWA 1Y5IA 1XE3A 3CNQS 3F7OA 3RS9A 1EFCA 3FR7A 4G1CA 4EELA 1Z8FA 1T0PA 3L1KA 5A5EA 1MRZA 1EYZA 2D4AA 2HLHA 3DJYA 3FOBA 3JTMA 3N3AC 4PE5B 5DSZA 2PM8A 1KQGA 2XUKA 4HKTA 1S2NA 4F9TA 2QHXA 1GSAA 1JDZA 3ZLTA 5KOYA 1WS6A 1ADFA 1IIBA 2Q62A 2Z2KA 4KUGA 3GRYA 3ZIUA 2LWIA 1SD2A 1ZGAA 2GWHA 3NNDA 3B9QA 3J80A 1C8LA 1R6BX 1NWHA 2AOVA 1XTVA 2YYAA 1PT9A 2QMEA 3BL6A 3L7CA 4BBPA 5BR1A 3THWB 2HWUA 3NCHA 3P0RA 2ATXA 5IC6A 1C0EA 3ZGZA 4LVCA 4YI5A 1B26A 2ZSJA 1KJJA 2DAPA 5ICGA 1P8AA 3ETHA 4EI8A 3I42A 4GDFA 5CT6A 4K40A 4DLZA 4TYYA 4KH0A 4G0MA 3OFSA 1SQ6A 2JGDB 3NVMB 1C1YA 5IJWA 5FLYA 4TROA 3P9SA 3EIEA 1KRHA 4MS4A 3FHLA 2HDNB 2G72A 1X74A 1IWPB 2VDKB 1OXVA 2PEYA 4MYCA 4BDSA 2ATVA 2Y9MB 3ZWPA 4ZVRA 4LVOA 1E1QD 3LYLA 1OLSA 1X7WA 2Z1MA 1JEYB 2WF5A 1L5ZA 2W43A 3AZQA 3RTEA 2X0KA 2B4YA 4I46A 2RHHA 4IFIA 5HTKA 2QVLA 3DZIA 2WNIA 1RIFA 2QRZA 1IJBA 4URWR 5AHKA 2P9QA 5DH9A 1VJCA 5IKPA 3ZD9A 1YA8A 2X0IA 3LHSA 2OHGA 3UAXA 2IZ0A 4LNAA 2CW5A 5ICSA 3I1IA 4G1MB 5HIJA 3ZK7A 5K0SA 5EE5B 1JI0A 4HXEB 3SE7A 1DS6A 1QPBA 4ZMSA 2IUTA 2XRYA 2H4WA 1IXZA 3DC2A 2QNRA 3QZUA 5TIIA 1XZBA 4V3CA 5EWMB 4A0SA 4ZTBA 3WLPA 1R0XA 2PRSA 4NAVA 3ZR4B 1CF2O 4E09A 5HJ7A 1DFGA 1EE9A 4EW2A 3JD3A 2FRVA 3NXKA 3UWDA 3KALA 1C30B 5K0EA 3UJCA 4MICA 4KG7A 1I24A 4V1CA 3AXTA 2NQ8A 1KSJA 1Z56C 1OLXA 1Z33A 2XCQA 1Z37A 3Q9NA 3UMGA 5I4CA 4YCMA 4M55A 5I4IA 1NVWQ 4XASA 2NW6A 2JFPA 4RF3A 5B7PA 5CK4A 4J4BA 5JT1A 2C2XA 1DC5A 2CXSA 3AWIA 3NC0C 4MUMA 4BLUA 4XB2A 3E8XA 5GADl 3L8GA 1JIKA 4G84A 4YJ3F 2AK3A 1EX9A 1WVGA 1EZ1A 1XVTA 5CLGA 3T4UA 1DRVA 1PD1A 4JBNA 4Z7QB 2YWJA 2ZI5A 2XE6A 3O91A 8LDHA 3AOGA 3KZKA 4TTTS 3U4HA 2WABA 2C7GA 5CDYA 3VNVA 4QOHA 3SSAA 7ADHA 4W7IA 1HF3A 4IGIA 4IILA 1XHLA 3W9UA 5DNDA 1O1YA 2YWRA 2ZVQX 3M5PA 4YC7A 3C14C 1AKMA 5C32A 3BMOB 1GZSA 2F3RA 4X5OA 2WTBA 2QLTA 2VP6A 2Z83A 2HA6A 3OHSX 5TVKA 2MIIA 3DAGA 4TV9F 2VWPA 3EDMA 5JO0A 2KBFA 3P5BA 3ZWKA 3OECA 3PRJA 2J5QA 4Z1OA 1MB4A 1L3CA 1BKDR 3LVQE 4HY3A 3QE0A 1OXTA 4HSGA 4I1OA 2HCRA 4DCNA 3FPJA 1M5UA 2WVJA 5TE9A 1JH8A 1MTZA 2YHIB 2CJFA 4UVDA 2IS6A 2Y68A 1X13A 1WQ3A 3GQBA 2A8YA 3A4MA 1D5WA 3CZPA 3HBMA 3R3HA 1I2DA 1ZEMA 2PHZA 4AY6A 5COBA 4GXRA 3R9WA 3OCYA 3CF4A 1C5KA 1D4FA 1CY4A 1DELA 2HAEA 3I30X 4DM3A 2DT5A 4NOJA 3AF3A 4L22A 3K0SA 1KYXA 1QO7A 4P36A 4P80A 3KRTA 1KAEA 1NVXQ 2ETXA 3JPWA 3PF9A 1DQSA 3PSAA 4HZGA 4UBIA 3ZCXA 1TNDA 3G79A 5D3QA 1P44A 3W5SA 4C5AA 4MGKR 4CIXA 5TLSA 2PKYX 1Z6ZA 2EKBA 3FN4A 1R8JA 1FFSA 1I2BA 4D3DA 1PEYA 4O3FA 1TLFA 2GKSA 2JA2A 2WMOB 2O5VA 1YZNA 3CVOA 1Z35A 2N0SA 1ZVVA 3FTFA 2NLOA 4F4DA 3STYA 1JYFA 1YDGA 4G1UC 1KVSA 3HYSA 3JAKB 1DWOA 1UDWA 2HM7A 4YO8A 3QELB 1LDGA 5EERA 2OZPA 5AIAA 4BE9A 2EFHB 4H4CA 3HVHA 3AWDA 1N2HA 3RE1A 3MFYA 3NYWA 4YMIA 621PA 4CHTA 5T4EA 3UJPA 1I5OA 4UASA 5HMLA 1PKEA 2GN9A 2XADA 2VZ9A 4FFBA 4N8DA 1L7DA 3N1UA 1N3IA 3M4NA 3ZI4A 1TLTA 4KPUB 5JG7A 2ESRA 3GUCA 1SC3A 3A1WA 3LW7A 5FL3A 2IYOA 2QY9A 2GF9A 1CY2A 1CTQA 3D8RA 1TD1A 3H99A 3I6IA 3TN7A 5K8TA 4NIMA 521PA 3HVUA 4XGQA 1D8TA 1BEUB 2LDBA 5B57C 3TPCA 2X3FA 4CMAA 4RKQA 1KI1A 3EZGA 1PNOA 2EQ5A 2WTXA 1JQAA 3NNSA 3PFHA 2FZEA 4M1MA 3SDBA 3W8EA 4DR6B 3OBIA 1LGYA 4ILEA 2PS1A 1YR3A 1IJEA 1NYRA 3OZWA 3BIWA 4FMDF 2AW5A 4J2HA 5AHRA 3VHLB 4FFVA 1VPTA 3OWOA 4JBHA 3T3PB 2GPAA 2OCAA 1TU3A 2YHUA 3UC9A 3F49S 5DCUA 3WWPA 1OIWA 3A8TA 3I1JA 5KQRA 4P54A 4N8EA 4U0JA 2R7LA 1MX5A 5LUBA 5CDHA 5HVNA 1GTG1 5EQFA 1MR3F 1X86B 3VNQA 2F59A 1D2EA 2D0IA 4I55F 2ZGVA 4C5CA 1E20A 3IXLA 3NWPA 4I4NA 2ZS7A 4MI1A 3PC2A 4XA8A 3AINA 3JSXA 5EIWA 4E33A 1KFJB 1WVIA 2J85A 4ZJZA 2HJSA 3L43A 5CAEB 4BUZA 5HGXA 5CFLA 1EFDN 2CBXA 3JYPA 1ID1A 2O8VA 1O54A 2LRHA 1A9OA 3LFTA 3PE4A 4NYJR 4LDQA 3VV3A 4HDSB 4I19A 3W4IA 5A9TA 3BK1A 3O3CA 4DSOA 1PG2A 3W6UA 3OJEA 2NQ2C 3DHVA 4LN1A 2QROA 3WV5A 1I14A 3BPSA 3T4PA 1WHSA 3EGCA 1KPGA 1XL1A 2QOEA 3IUQA 4NYIQ 4DA8A 1A96A 1NJ2A 3EUFA 1NKVA 4HNQA 4HZUB 2IFTA 4HYTA 1HQKA 2QS9A 1H4SA 4RV5A 5LMNB 2F1OA 3PDHA 1VGQA 1P1RA 3PC4A 3ML1A 1PNTA 4Q4JA 4NJMB 1U3FA 1G38A 2VL7A 4MWCA 3NIWA 2ZPAA 4N0QA 4CG2A 3ZXUB 1GPYA 5JSYA 3RANA 1QYCA 4QVIA 3HHEA 5T4HA 5FAXA 1XQ1A 1D03A 2BCJQ 1CQWA 2XYRA 3K0CA 1T4DA 5I9NA 4MRMB 5JCZA 4J90A 1BHQ1 1OFIA 3HCCA 4NMWA 3QHAA 4AIRA 2PMBA 3BWBA 4UEQA 3VGPA 2C5BA 3H2BA 3LRTA 2X15A 2DUMA 2W2KB 1FFAA 3KHUA 4P84A 3TSYA 5AKJA 3DMTC 3GEMA 3DCNA 4RKRA 4LJAA 4DWJA 2Q1WA 3O4GA 4CF5A 5JXJA 5EJGA 2RGAA 3WKAA 2WU4A 3B60A 2YTZA 3T7AA 3E53A 3K72B 5LC1A 5JANA 2ORIA 3KQSA 4Z5XA 2DFKB 3HZRA 2JIBA 2G0AA 2GYUA 4M0EA 3O8OB 3LBAA 4GMDA 4XD7D 4RJJA 5DK6A 4DCJA 5BYKA 1JPNA 3S2UA 3I52A 3QVOA 4JQSA 2B3TA 4K9LA 4RF5A 1A8HA 3S68A 3V1TC 3FMVA 3IOMA 3PUVA 2IYLD 3SIPA 1SQ0A 4H17A 1KZGB 1V26A 3L7KA 1F0YA 3P9RA 4UPDA 1K6MA 3ZY6A 3VAAA 1NVDA 1ZCJA 3QHQA 3BH6A 1QC5A 4MUXA 5DGTA 3W2GA 3IEIA 3RGGA 3FPAA 4G5YA 4H0NA 5KPJA 2CVQA 2GETA 3OZBA 1JXQA 3L2OB 3L07A 3CLKA 2HJ9A 5LLSA 3HRHA 3ZE9A 4L4XA 5CX1A 3IKTA 1JFSA 4OM7A 5JQGF 3TQOA 2Q6IA 1H9AA 2W2XA 3GBPA 5JZSA 2C1ZA 1XN1A 3BIJA 1JDBC 3W4JA 5K01A 1JV2B 2B34A 2ODQA 3VAZA 4XVCA 2DBRA 2H4JA 4MS1B 3HZOA 1K97A 5KWIA 4KQHA 3GLHA 4Z0HO 4XEHA 4GQBA 2C5EA 5HOEA 5IT4A 2XPCA 1OH5A 2L42A 1QQBA 1MX9A 4GGMX 1JHVA 3SJCA 3E8MA 1AHIA 2DHRA 3WMFA 2P7IA 4PXSA 1E2FA 1CRZA 2CBGA 1U6IA 3HJUA 3RVKA 4KODA 2OBXA 4DA0A 2O57A 3CO5A 1UPCA 3MERA 1IRXA 1XEWX 2HIAA 3ICCA 3SAJA 1OHHD 2JLVA 3GLFB 1IQUA 2FPWA 3A2NA 3P7MA 4QPCA 5FADA 4QYIB 4EVQA 1KOGA 1WHTA 3AETA 4R2XA 4RK1A 5EJFA 3V2IA 1Z15A 3TDNA 5FH9A 5F3WB 2AEEA 3ROKA 1EFKA 1ZGGA 4MK4A 3A9CA 2LIPA 4QOSA 2Y1XA 3DUFB 1YBMA 4NEQA 2DF8A 4QYXA 4YCAA 5A02A 4A82A 2VAXA 2I4OA 3C6MA 2RKBA 2QAGB 1QH1A 3RADC 5EYPA 1LCIA 4QBFA 2G17A 5FEUA 4RMGA 5KDOA 2YC2C 4RKWA 1YHZA 1E4VA 4L5CA 3E7PA 5B58C 2QD5A 4Q6BA 5AXAA 3T3DA 4JI7B 3TLGA 3CLRC 3UHJA 1P9OA 2D5AA 1VRCA 2M6RA 4W4TA 2QGFA 3U6KA 2J67A 4UOZA 2OL4A 4DQ0A 5JY6A 1URPA 2QN8A 5DASA 5EMKA 4AJJA 2QUKA 4OIFA 5T3UA 1QORA 4LDZA 4P31A 2IK8A 2AB0A 3WLLA 4CR7A 2QN3A 3R5JA 1Z39A 4NZPA 4DVJA 1C7FA 1VP3A 3GFSA 1I4LD 1C9MA 1T9AA 2UZ1A 4UE6A 1F1BA 5K3AA 4X6UA 4LSGA 3VR2D 4EP1A 1YZQA 3DKVA 1NV9A 2EFGA 1P9LA 1Z06A 4KNWA 1IBCA 3WYFA 4OU4A 1V11B 4OX9B 2H3EA 1OROA 1NA5A 4L7QA 3OZSA 4ENPA 2JW5A 2HMUA 3Q1LA 2NZXA 4JYCA 4CKZA 3U44B 3Q8LA 2DKOA 4R1PA 2E6UX 2XBLA 2C2KA 1IC6A 3ZJ5A 4NVRA 4X0EA 4X00A 4RSRA 4AJIA 3QVGA 1QQ5A 1XU9A 3EHEA 4IAOA 4MHOA 3ZU6A 4EBBA 3GXOA 1QOQB 1AS2A 2Z09A 3FOAA 2A9OA 4ND1A 5EJAA 4QWMA 5BRNA 5EZYB 1KDVA 4DV7B 3E70C 3L6EA 4JV5B 3NXSA 1KZ9A 3KKEA 3NYQA 4UAJA 3OF5A 4IZOA 7REQA 1KAHA 4DHWA 5ILQA 4PLGA 5H68A 1ULHA 4N0DA 4OQLA 3FB4A 1RBQA 3HB0A 2QEQA 4GC5A 4KVGA 3AIIA 3TTWA 3R9XA 1XTUA 3P4YA 2VP4A 3KJEA 1E3WB 2IW3A 5PNTA 2LKDA 4UDYX 4GUAA 5KYGA 3GOQA 1RPNA 1YZLA 1C0IA 3OZEA 5AK3A 5EZQA 3FIUA 1H5QA 4U8HA 3CUTA 3IEXA 4Q9KA 3BH0A 4PYIA 2K87A 3A7DA 1T8TA 4DJEC 3QMWA 3STUA 4JP1A 4EATA 4FHCA 3LV8A 3QFRA 4Z7OB 4ZD6A 1NVMB 3ZVLA 2E4VA 1JG1A 5TVGA 4FSXA 1QHHB 5JRDS 2HQ1A 5KKNB 4ME6A 5TQJA 3OO1A 3UATA 1EXVA 2OAQ1 3LVBA 5CVVA 1LKZA 1DB3A 2II6A 3FDZA 1ZVMA 3RG2A 5C4MA 4GG1A 1E18A 3AERB 4DBLE 4P98A 4DLNA 3BXXA 2G4VA 4C6TB 2VH2A 2CNNA 4D43A 2JCSA 3NHJA 3MT7A 3PUKA 4LZNA 4ZHSA 5B12A 4PYKA 2DSNA 3TWOA 3GP3A 5CJPA 2FW6A 2V6BA 4PTLA 4KRXA 1BGVA 2HLNA 2Q4OA 4DS3A 4HQ6A 1RRVA 3VR6H 4WKNA 1MW8X 4WLNA 4EENA 2GK3A 1TYEB 1NDUA 5E4TA 1TQ4A 2RDMA 1VLJA 3V33A 3NOQA 5G40A 4EPRA 1OI2A 1OREA 2ZKLA 3DT8A 3IOCA 4HQFA 4NPAA 4TT3A 4UNIA 1ZHFA 2ZSEA 3L05A 4MB6A 3L18A 4OVKA 1ECGA 1FTNA 1J8DA 3TX2A 4QRIA 2NT3A 3GF4A 1W96A 3WLJA 4LCBA 1C1HA 4IIXA 4NONA 4XGIA 3GCZA 2REQA 4OUDB 2A1IA 3MTJA 3Q5GA 1RJEA 3FUUA 1HDIA 4PHGA 4PO9A 1CXZA 1KAGA 4OA8A 4NXMB 3JWIA 3ODGA 1NQXA 3IAAA 4NAHA 1IE3A 2A88A 2BGUA 2XCLA 5SICE 1PKXA 1ESMA 1VG8A 1EK2A 4RTOA 4S0XA 1H8ED 2HEGA 2NT4A 2WWHA 1DQNA 3Q3VA 3ZIDA 4CYMA 2DBZA 2O9JA 2VSYA 1EQUA 3KT0A 1T8WA 4IIBA 1MAWA 4L2IB 5D2CA 1V47A 2NU7A 4C03A 4IG9A 4IDEA 1W36D 5A62A 5I8PA 1DIBA 1TW2A 3MS7A 4HLNA 3BH7A 4M8KA 1WSWA 4OGLA 3GA5A 4NNOA 1HT2E 1X1AA 5IDVA 4A03A 3FNHA 2QG4A 1EUCB 3EVTA 3JYNA 3Q6MA 4M38A 4QAJA 3RYHA 5JZVA 4GL2A 1CK4A 2VNSA 2ODTX 3A58B 4G0VA 4X1YB 3PEWA 4LSMA 1MVLA 4UD2A 3V2HA 1ATZA 4OLHA 2XWJI 3HSSA 4JP2A 4FEGA 4GEKA 4BJ6A 4UNRA 4H9GA 3SJBA 4Z4GA 3RAFC 3O26A 2X22A 3AKCA 2C5HA 2X2PA 4R5MA 2VJYA 3W9YA 4I9UA 3KZ1E 1HO3A 1JN0A 2J3MA 1ZNWA 3QA3E 4MUNA 2NTYC 3M6LA 2VWHA 4O4HA 4JOBA 1POWA 1TK9A 2I55A 4ZARA 5LQCA 2BEWB 5IP5A 2DQKA 1JA1A 4PYJA 4RFSA 2PZ8A 4YP1A 3KSBC 1HWYA 1K7YA 2O2XA 4IMPA 1KY2A 4FD2A 2I3ZA 3S99A 1E7WA 5IMBA 3W5IA 1A88A 1EX7A 1VKHA 2XSZD 3D8BA 2B25A 1J2TA 3QEMB 4QUEA 2PYIA 3X1DA 2EBUA 5CW2A 5U1PA 2XUIA 5TEVA 4ZAVA 3FOZA 2V74B 1UT6A 2ZB7A 2AI3A 2RAFA 3GOHA 3K1ZA 3CTMA 3JWGA 3M3PA 3QXJA 4I55A 4IHJA 4X93A 4ZYTA 5AFSA 1Y3CE 2IKQA 1TT5A 4MTCA 5JLAA 1ZJYA 1MAUA 1BMQA 3VISA 3KFXA 3P45A 4YR9A 1CS0A 3K32A 2PMCA 2J9FA 2WHXA 4GUDA 4O5AA 4R83A 4RK4A 4N9QA 1B00A 3GAFA 4ZI3A 4ZZIA 1DG3A 3QVWA 4Z9YA 1J25A 2D5BA 4DG9A 3CVWA 1Z2OX 1ZHOA 2DXIA 1ZH6A 2PFKA 1D7OA 5HWSA 2H5EA 3FW1A 3RH0A 1K7EB 1KHHA 2G6TA 2ZDHA 3P2OA 2W71A 5TF0A 4BZQA 4QXQA 4J3JA 1NN1A 5KYVA 1G42A 1VC2A 1C9KA 1F8YA 1Q3KA 4PX9A 3IODA 1N36B 4P0TA 1E92A 3RRNA 2VRWA 3LUGA 4P83A 1E9FA 1LX7A 3TQSA 1BZYA 4BZZA 2O3RA 1LPNA 4ZQFA 1RDFA 3DD1A 4CQLB 3DZHA 5I51A 3FWYA 3G7UA 1S3GA 3DMTA 1ECCA 3THXA 1DIAA 2PUVA 4RZ2A 1AZLA 1A50B 1G16A 1P4JA 4I3FA 3WKCA 1E0DA 1NT2A 1W5BA 2D5LA 2Z57A 4CM9D 4N40A 2A59A 1Q50A 4OFXA 2LNDA 1E4OA 5FWAA 5FFFA 2O0KA 3D6VA 4M22A 4BNDB 3CPHA 3G17A 3LPMA 5BNTA 4X84A 4B2LA 4QO8A 4HWKA 1AGRA 1T2AA 1G0OA 3M33A 4C6RA 1H5NA 2BMWA 4DMHA 4DSNA 7AT1A 4CXMA 3VM6A 5JJIA 1PFWA 2CDCA 3RHSA 3JQDA 3PEUA 5J40A 4OYYA 5HX7A 2P7HA 1PE0A 1RCTE 1IYZA 1I01A 1Q1BA 3KUKA 4YIHA 1YE5A 1W76A 2J3IA 4AVYA 3JRXA 2FUG6 1SXGA 2DGDA 4GP7A 4EGCB 3LLVA 2AOUA 1E1NA 2YV3A 4X95A 3Q6NA 3OLWA 3DG9A 5CK5A 2BT4A 3R7WA 1FC0A 5IVDA 5BSMA 1J7KA 3AF0A 1E2UA 4ZHQF 3K9LA 3DXYA 3W3AD 3M6FA 1AZSC 2PL5A 2ZRMA 2G9ZA 3A6ZA 2ODAA 4FJ2A 5T8KC 3ZYCA 1OFUA 4K9QA 1ISJA 4UTVA 2VLIA 4I66A 4MDHA 3S70A 1KK3A 1F0KA 1T6BY 1Z5UA 1Q19A 5J4YA 5J63A 2F9MA 4FCCA 1VP9A 3RC2A 2P8SA 3OPQA 1WUKS 3ROMA 3QVSA 3KU4A 1X8JA 2YH2A 4P5PA 3NH6A 3UJDA 4CCSA 3PPXA 4EO9A 3HG7A 2CMKA 1U9JA 2C2OA 1A9PA 4JWKA 4TQAA 4YCJA 1NVVQ 4R8RA 2C92A 1HRDA 2W6MA 4MW7A 4PZ9A 1YUNA 2O6LA 2ST1A 3GRRA 3LLUA 4PLVA 5EESA 4ZRMA 1RLOA 1XDUA 1VCHA 1R0BA 4RQTA 1K6XA 4O29A 4Q4AA 4YS6A 3KU1A 3NHMA 4LJ4A 1V8DA 1EJ2A 3DKPA 2VT6A 2WOJA 1E96A 3HLTA 5HXAA 5T57A 4HEA6 1J4AA 3AIKA 4RZHA 1ESEA 2CFIA 5CVTA 1FXSA 2AIRA 4R2KA 4TMTA 2J6IA 1YUMA 3AL0C 4P8RA 3SVZA 1E1CB 4RZ3A 3AY7A 2VYFA 2PVSA 1GADO 2Z98A 3E3NA 3OJXA 1QDLB 2F67A 2JGIA 1L9KA 2AMLA 2DSTA 1O94C 3CPEA 4MS4B 4JT9A 2RGRA 2IXDA 4HVAA 4AU1A 3D3QA 4D79A 4DB4A 1G55A 3V8EA 5ALZA 2JDIA 2Z8ZA 2C58A 1VDZA 3RG8A 3FCXA 5J4VA 1X77A 1Q0PA 1V4VA 4EB8A 4B2IA 5ITWA 3QGMA 3ANLA 3KG2A 3T12A 4LYJA 1C3EA 2P4HX 3E61A 2EP5A 3KB8A 3MBIA 4BNNA 4DDVA 1OB5A 1G2QA 4UVEA 4YPOA 4UTPA 2RBGA 1ZA1A 2CF5A 2WHPA 3T3HA 4RC9A 1HXHA 4HWSA 4BPBA 4W6QA 1XUOA 3O03A 4FFDA 3V55A 3ZV7A 3JQAB 1ONSA 1NJFA 2P27A 4IJVA 3RWBA 1FXWA 3HO6A 2HSWA 5EMNA 4CMKA 1Y5LA 1D0SA 4M9CA 5FEMA 1R16A 4BQFA 4DLYA 1OW3B 1OXSC 1S96A 2QR2A 3A9TA 4HEHA 2BGMA 3CZCA 1GU0A 1UPAA 2DPHA 4JBGA 4KLNA 4YP6A 4FIDA 5ICCA 2IS1A 5EQDA 3P27A 1E5LA 3VR5A 4CG3A 3FGZA 3DV9A 1O87A 3FYUC 5F64A 2W0MA 4HGRA 5K8JB 2PJDA 3MMSA 1M8PA 1PR3A 2BEJA 3O1IC 3AHFA 2Z3ZA 2CUKA 5DE3A 5E4FA 3JZIA 1XEWY 5CH3A 4GX5A 2XXBA 3KC2A 2FUG1 1U0NA 3HL4A 5J2UF 1QIJA 1OLXB 1TK2A 1SKYE 1RJGA 2NP7A 1MOPA 3IAFA 4AJPA 5KYKA 3RYCA 2ACKA 1V43A 5DYYA 5LOVA 3G1UA 4HNTA 5JSFA 4Z4FA 2IXEA 2O8DA 3ZE7A 2NTJA 2QP9X 3G2KA 1K98A 1EB9A 4ONEA 2FE4A 4OXXA 5DMXA 4ZDJA 4DANA 3LUPA 3GPIA 3HADA 4H7JA 2WD9A 1CUDA 4FZ3A 2F48A 5B1DA 3RSZA 2X5OA 5E4JA 4CEIA 2ZYGA 4FGJA 1TUEA 2NVOA 3EUEA 1GY8A 3E1KA 1OWNA 4MZDA 2JFZA 3COZA 2XGMA 3LWNA 3EDYA 4K1XA 3SHOA 4CMJA 4LK3A 5ALPA 1HZZC 4KVZA 4LQDA 2O7QA 3ETEA 3E3OA 3H2HA 5K8UA 2Q28A 4R8KA 4X9XA 4R1UA 5ALEA 1V9CA 1C3JA 4D99A 3ILXA 1TOAA 2OQ2A 2C9DA 4URFA 5KTKA 4EG6A 1NZFA 2ZQ5A 3FVWA 2EIHA 3HI6A 1A4UA 4UUNA 1JU3A 4LPKA 3WNZA 1U0EA 3CZ9A 1OVMA 2M6SA 3DDOA 1H6CA 3C1TA 4MVJP 4N6NA 3ST7A 3WWYA 4FYWA 4XH9B 3BFJA 5DHPA 5FBLB 3E7XA 3JAWB 4TLBA 2ZRJA 4LE0A 2DWPA 4YNBA 1U8ZA 3Q0IA 4O33A 3RJTA 2XAUA 4QDJA 4WWHA 4Y1EA 5JMWA 3GFFA 1G