2BFNA

The crystal structure of the complex of the haloalkane dehalogenase linb with the product of dehalogenation reaction 1,2-dichloropropane.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
294
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HALOGENALKANE DEHALOGENASE
publication title Weak Activity of Haloalkane Dehalogenase Linb with 1,2,3-Trichloropropane Revealed by X-Ray Crystallography and Microcalorimetry
pubmed doi rcsb
total genus 109
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfnA00
4PF1A 2VAVA 1UT6A 4L3WA 1CFJA 5LZ5A 5T4FA 5KWIA 4UFOA 1JT2A 5C7YA 2ZJ7A 3G0CA 2XMZA 4Y2QA 1E5TA 4P93A 3WA7A 2H7CA 3EQ7A 5EHQA 1CLEA 2I03A 2PBLA 5AM4A 5DYWA 4AMYA 1YAJA 4QDXA 3H2KA 4QLOA 5AI4A 1XZBA 4M0FA 3VDXA 3ED1A 1YR2A 2ORYA 3F8SA 4W63A 2RAUA 1WHSA 5AKIA 2JGMA 3P2MA 4BAZA 1T2NA 3W06A 1FSSA 3WKEA 4TPKA 3G0BA 3C6XA 1CR6A 3IUMA 2DHCA 5HFNA 1IMJA 2RHTA 1H2ZA 2UZ0A 4KJXA 3V1MA 1IUNA 5AKHA 2E3JA 5DLPA 5D6OA 1DX6A 3ICWA 4KE6A 3O9MA 3V1NA 5YASA 5K3BA 1UKBA 4UHCA 4DNPA 1AMNA 3WA6A 2C5FA 4IHAA 3BXPA 4X6UA 4OCZA 5A7HA 1QFMA 4H77A 1XQXA 4CIBA 2HU5A 3EQ9A 4G5XA 2V96A 2OCGA 3TJMA 5JANA 2ECFA 5AM3A 4QWWA 4OB8A 3FVRA 4G9EA 5ALJA 1O6FA 1E3QA 4J0DA 4KRXA 3VJLA 5JAUA 3F96A 5JD6A 5ALWA 1NX9A 3WIBA 1ZGCA 3PF8A 3C6ZA 3G9TA 3A6ZA 4E46A 2PX6A 1QIJA 3I2HA 1GQRA 3JYHA 2AXEA 1RYYA 1AQLA 2BJHA 2CKMA 3D0KA 1F0NA 1AX9A 4HRYA 5AKLA 2CMFA 2JEZA 4U2FA 4H18A 4INZA 4DLNA 5ALUA 1LGYA 4N5HX 1XZLA 2WILA 2VTVA 3HYSA 4UHHA 2PPLA 3RLIA 1K8QA 3VVMA 3HABA 2OGZA 2RHWA 2W6CX 3IULA 1ZJ5A 4WFKA 1CUZA 5CXUA 3SWWA 3G9XA 3I2JA 3IUQA 1P0QA 2OGSA 3VVLA 1DINA 1CUGA 2WIJA 4XVCA 2ZYRA 3WWDA 2HA7A 3OTQA 1G5FA 1N1MA 3VXKA 1QTRA 3R40A 4GDMA 1P0PA 1IZ7A 3W9BA 3DYVA 2PSDA 2QT9A 2HFJA 4J03A 2XUJA 1U4NA 3WKDA 1VZ3A 4BCBA 3GFFA 2WSLA 4NMWA 4QDOA 3R3WA 5HCUA 4AN1A 1Y37A 2DHEA 3A2NA 4ITVA 1WPXA 3WWCA 4BVKA 3VJMA 4X93A 3HXKA 2GBCA 4H35A 4IO0A 5CT5A 4LHEA 2ROQA 3ESCA 2OCLA 5AK6A 4BC0A 3RKSA 3DYIA 1LPMA 4BTLA 1VJ5A 5EHZA 2WHPA 2WG2A 5ALHA 3UUFA 1QIMA 3PE6A 3AJAA 5AKXA 2X76A 3V1KA 3AUKA 4QWMA 4X92A 1P0MA 3E1GA 2IITA 5ALVA 4AMZA 1WOMA 1MAHA 3DL7A 3GBSA 2BGRA 1YASA 2Y2VA 2AJDA 1JU4A 2PSEA 1CUAA 1VA5A 2WUEA 2OQVA 2WHRA 2OLEA 4FKBA 2W22A 1EX9A 1QIDA 4NZZA 1XRPA 1CQWA 5DYTA 3G02A 1MNAA 3DLTA 3CCCA 1CUSA 3FYUB 5AP9A 1K63A 3N0TA 4XJVA 5CH5A 2XE4A 4AN0A 1QIHA 1PV1A 3W04A 5AJHA 1R9NA 4CG2A 2Z5GA 1HQDA 4N8DA 5JAPA 4Y2PA 2QJWA 1LPSA 2JGFA 3IVMA 4J0GA 3H1AA 1XRLA 3FLAA 5EIEA 1SCKA 2QVBA 3WZLA 1G4HA 3N2ZB 3SX4A 3PI6A 5FOQA 3FOBA 4EA6A 1Y7HA 3DNMA 5CT6A 4J0HA 1WB6A 3WL8A 4A5SA 2RI6A 2V9ZA 1VLQA 3D4LA 1GKLA 4HVTA 1C4XA 2ZYHA 5AKZA 1XZDA 1QO7A 1BEZA 5HZGA 5IVKA 4H7DA 2DCMA 1LPPA 2XUQA 2RGUA 1C7IA 5E4JA 3BF7A 3O0DA 1DU4A 1L7RA 4WY8A 3IURA 4H7JA 5LKRA 2XI4A 4I3FA 3M82A 4EHBA 1W1IA 4CFSA 1OCEA 1QIEA 1L7QA 3DOIA 4ZRDA 4C01A 1ISPA 2WG1A 1G66A 1UWCA 4KR0A 3CN9A 1QOZA 3ESDA 4Q82A 3WWOA 5AHXA 1CUFA 5AM5A 4Z49A 4OYYA 2X5XA 5K3AA 2PUHA 1X70A 1QJ4A 2GZRA 2HA5A 4J3JA 3ZLTA 5AM0A 3ZI7A 4HS9A 1XKLA 4DSAA 3WK8A 4FFWA 1ZD4A 1MU0A 3FLBA 4HXGA 1CUUA 1UKAA 5FUMA 1UK7A 4GEGA 4CI9A 1MN6A 4C87A 4PQEA 3AINA 2WIKA 4UBMA 2VJBA 3MVEA 5ALMA 5ALFA 4MYSA 3KOOA 2P8SA 2AJ8A 4KEAA 1A8SA 1B41A 1GT6A 2H1IA 4GBGA 1EHYA 1JMYA 3PDCA 3C5WP 2WG0A 4BP9A 5LZ7A 5D3ZA 3FSGA 5ALSA 1T4MA 3O4JA 2Z8XA 1TK3A 3I2GA 3D2CA 5AK4A 1HKHA 5EIAA 3I28A 3ZLUA 4X71A 1CRLA 1UFOA 5ALKA 2YH2A 2J4CA 4UBOA 5ISMA 5HF8A 4BVJA 3KXPA 2ZJFA 4KACA 4MYDA 3O4GA 2G63A 3AZOA 4FNGA 3PICA 2OG1A 2IIVA 1YA4A 2XMCA 5T4EA 1JFRA 2VJAA 1CUXA 1VA4A 4E14A 1QIGA 4S0XA 3CCBA 1Y7IA 2BUBA 4KRYA 3H1BA 2V97A 5LLSA 1XQVA 1XZFA 1M33A 5C81A 3R3YA 4CCYB 3OC0A 2QXUA 4X95A 5AI0A 1EINA 4UFNA 4AQDA 2JGLA 4B81A 4FLMA 3FYUA 4X6XA 2C0PA 1AUOA 3IBTA 1H2WA 1BCRA 3D2BA 1WHTA 1R88A 3GUUA 1MAAA 2WTMA 1CUWA 2XMQA 1VKHA 4C88A 3HLKA 4DMCA 5ESRA 1EB8A 4HXEB 4F21A 3L1IA 4PV7A 2QKYA 5HKBA 4UBIA 4HTAA 4NS4A 3WK5A 3BDVA 5KREA 4QA9A 1ZICA 2ES4A 4B80A 3UMJA 1LNSA 3H2IA 3WQHA 4DYHA 2G4LA 1XZEA 2O2GA 5DTIA 1EI9A 3W2TA 4MXDA 1W76A 1JMKC 5JALA 1K6EA 3IUJA 2PUJA 2I3ZA 3NGMA 3C6YA 4G8DA 2PSHA 4A16A 1AGYA 3K2IA 1A88A 1S8OA 3QMWA 1CUIA 1F6WA 4FOLA 3DKRA 4F0JA 5ALLA 3ZLVA 2ZSIA 2B61A 3MGAA 4OSEA 1ZIXA 5FPQA 5K3FB 1SFRA 5FKJA 1GPKA 5SYNA 5FLKA 3BE8A 1ZI9A 2H7YA 3G7NA 1UK6A 5CRIA 1EK1A 3FNBA 4KE7A 5DTJA 1XQWA 5ALEA 2J3QA 4U2EA 4BAUA 2OGTA 4QDTA 2HL6A 4Y2TA 5EHNA 1HLGA 3WI7A 2QTBA 2JGEA 2XUFA 4YPVA 2JIDA 3WKAA 2WJ3A 2HU7A 3EBLA 4I19A 3C5VA 1OILA 3H04A 2QMQA 4FBMA 2V98A 1QZ3A 3M3DA 1BN7A 3OURA 1CIJA 3WKBA 4UHDA 3STXA 4IH9A 2VT6A 5EI5A 3ZWQA 4OPMA 4Y2XA 4UBLA 2GYWA 3PUIA 5LZ4A 2GZSA 2WU4A 1XRRA 5E4YA 2O2HA 1YA8A 1ACLA 2HU8A 4DMKA 5EHXA 2XUPA 1XLWA 4BRSA 1EXWA 5EFZA 2GYVA 1IUPA 3ZPXA 2B9VA 3UUEA 4Y9SA 4B7ZA 4CG3A 3W9UA 3QBJA 1MO2A 2VF2A 4UBNA 1QTIA 4DNOA 1ZI8A 3BJRA 1I6WA 2VAXA 3G0DA 4Y2JA 4G1FA 5EGNA 2ZVDA 4UHBA 3H18A 3VJKA 1JKMA 5JARA 5HFAA 2FX5A 4G8CA 3GROA 1XZAA 5K5EA 4GXNA 1A8QA 1FFAA 4UUQA 4FDMA 3DJYA 5J3JA 2HA0A 3E4DA 2QJRA 1JI3A 2DQZA 4CCYA 4QEKA 1UK8A 5AKYA 2BCEA 1EDBA 1TIBA 2WTNA 1FJ2A 3DKKA 3V9AA 5AOAA 2XB6A 3F98A 4AO8A 1ORVA 1CUYA 1YB7A 1AURA 4X6YA 2XUHA 3FLEA 1QIIA 4Q05A 1R9MA 3ZV7A 2JGKA 1TCBA 4H7IA 4L0CA 3QPAA 2EDAA 3NOXA 4FLFA 1EDEA 2C4HA 4LXIA 4Q3OA 2I78A 4TVKA 2PL5A 3WK6A 3AIMA 4KAFA 4W1QA 2R8BA 4RNCA 4AZ0A 2QM0A 1Q0ZA 4J7AA 2Q0XA 1RWQA 2J4FA 4GHWA 1DT3A 2DHDA 2WFZA 3JWEA 3WIOA 2BFNA 1QGED 2D5LA 1E8DA 3LLCA 1CUEA 4WDRA 1U65A 4J0JA 2QZPA 3O95A 3FCYA 5BWBA 3BL8A 3L1JA 2QXTA 4C89A 1N8SA 4YASA 3U0VA 1W6RA 2GBIA 4B85A 3G9ZA 1LBSA 2Z8ZA 1JJFA 2HIHA 3I6YA 1DX4A 4KE9A 4AX4A 1XRQA 5K3FA 4PNZA 3FSGD 1N5RA 5AH0A 3KDAA 4MWTA 3WWEA 1FFDA 5CXXA 1Q84A 4ZXFA 4ARBA 3H17A 5A7GA 4Y2UA 4WDQA 4EBBA 3DDUA 4WFIA 1HL7A 2QOEA 4BBZA 4UHEA 5A6VA 2JGJA 1K5PA 4KAAA 4BZWA 2WUFA 1IUOA 2OQIA 3E3AA 2ZYIA 3BWXA 1E89A 1X2EA 1ACJA 5JAHA 3PF9A 4FWBA 2WJ6A 1ZD3A 3QM1A 1QONA 1LPBB 2DSNA 4UBKA 5JAOA 1TAHA 5CT9A 1EA5A 2XMSA 3WMRA 4X7BA 5CTAA 2RIPA 3BIXA 3D2AA 5CMLA 5DWDA 3FVTA 5LZ2A 3M81A 3NWOA 3DD5A 3I1YA 2OXEA 2ONCA 3HI4A 5LZ9A 1DQZA 1TRHA 4C4ZA 5A62A 4W1PA 4H7KA 4PSCA 1LZKA 3ANTA 4XX1A 3FAKA 1AZWA 3E0XA 4OU5A 5FP0A 1EDDA 4RE5A 3D5EA 1GXSA 5AIAA 3KWJA 5IH7A 3DQZA 2HA6A 2HM7A 3HZOA 4E15A 3D3NA 1MT3A 1F0PA 3WK4A 4G4JA 2JEYA 3C87A 3CXUA 3Q0TA 5CURA 5FV4A 1EVQA 3STYA 3ESAA 4N5IX 4B82A 5AOBA 4EY6A 3HEAA 1OXMA 4BB0A 4GWLA 4QNNA 4U2GA 4W1RA 1J07A 4B84A 4UHFA 2VJDA 1XKTA 4BE9A 3K9BA 4E11A 4B0OA 5DJ5A 1R1DA 1MX1A 5SYMA 5IVDA 4J0IA 5JZSA 3SC2A 3LIPA 1MX9A 5LIPA 1EVEA 3Q8WA 4HZGA 2QS9A 5FDFA 3I6ZA 1CUJA 2AJLI 3VKFA 2QUAA 1BROA 5HK8A 5T4HA 1XROA 3I6MA 1VXOA 5FXMA 4B9EA 5A7FA 4ZWNA 2EEPA 4DSZA 2R11A 5E2IA 1L7AA 4PSDA 2RONA 3WK7A 3F97A 3V1LA 3AILA 3WKCA 5D7BA 5ALRA 4ROTA 5ALOA 5AKEA 2WFLB 1ZGBA 4OUKX 3HACA 2CB9A 2C58A 4BZZA 1BU8A 4BC1A 4DMHA 4EY7A 4H7FA 2HRRA 4K6HA 1QIKA 1VXRA 3PFCA 1BS9A 5DNWA 4QZVA 4N8SA 4J0CA 1JJBA 1QIFA 4X85A 2XMBA 3AFIA 1AC5A 3S8YA 1ORWA 1R4ZA 4RGYA 3OM8A 3I2FA 4Y2YA 1W75A 4N8EA 3QPCA 5E4TA 1MPXA 3ANSA 4MQMA 3R0VA 5DNUA 1N5MA 1DTEA 1NU6A 3R41A 3KSRA 2HRQA 2OCKA 4ZV9A 3T52A 4B83A 4GECA 1HDEA 7YASA 4F5ZA 3TEJA 1ZOIA 1IVYA 5JASA 2XUAA 1KU0A 1YSCA 5AI6A 2WU3A 5BWCA 2XUOA 4UFPA 1R50A 5ALQA 5ALPA 4OD0A 3MUOA 3C45A 3FWHA 4ZREA 3A70A 5BOVA 1USWA 4P9NA 3H2JA 2YASA 2HA2A 1ODCA 4BRZA 4G9GA 1KEZA 4EY4A 5JD4A 1PFQA 1QO9A 4EUSA 4Q34A 1UOPA 1R3DA 3M83A 2DFPA 1UZAA 3WJ2A 4GLBA 4DGQA 3C8HA 3LCRA 1DT5A 3WYDA 3OG9A 1MJ5A 2C5GA 1ODSA 5DNVA 2J3DA 5JIBA 2D0DA 3TGLA 1BCSA 5AK3A 4Y2SA 1TCAA 2Y6VA 3G9UA 2H7XA 4EY5A 5LYYA 4C4XA 5HF6A 1XRMA 3ILSA 2WFMA 1CQZA 4WFJA 3ICVA 2XQKA 3STWA 1A7UA 1F8UA 2OAEA 3PUHA 4XWGA 5CH3A 4G4GA 1FFEA 1JU3A 5KWJA 5JD5A 4DNQA 2YXPX 2OAGA 2BGNA 4C4YA 1HPLA 3BF8A 3RARA 3G8YA 3IA2A 4C6HA 4BATA 5H3HA 3ESBA 1CV2A 2WHPB 2XUDA 3HSSA 4IQ4A 2Y6UA 2QUBA 4MEAA 5AO9A 1YB6A 3TRDA 1VE6A 3FYUC 3H2GA 2VA9A 4FFVA 1XLUA 1GGVA 4HAIA 3U1TA 2WKWA 4HXFB 3F9CA 2WFLA 4YK7A 4U2BA 4HRXA 4BP8A 5AKGA 1VE7A 2O2IA 5JZBA 2QR5A 1DQYA 3O4HA 2WIDA 4KE8A 2DR0A 1WB5A 3DEAA 5CT4A 4V2IA 6YASA 1C7JA 2QRUA 4P92A 5DYYA 4JYMA 1LZLA 3KD2A 4BAGA 5JATA 3PFBA 1CUHA 3WZMA 2HHAA 1MTZA 4JYPA 2B20A 3STUA 2EDCA 1UKCA 4FMPA 4B0PA 4QE3A 4DTCA 2LIPA 3GELA 4X94A 5AOCA 4X3CA 2XMGA 2C7BA 4UBJA 3B12A 2C0QA 2Y2UA 2VJCA 4W9RA 4WJLA 4CCWA 4G8BA 5IVHA 2NW6A 3R3UA 3RK4A 4MJ3A 4BVLA 1DWPA 2JBWA 2Y1KA 1THGA 2HADA 4ETWA 3B3QA 4GW3A 5ALXA 5K3DA 3D7RA 3QITA 2AJCA 1LPAB 1XRNA 3A2MA 3C43A 5AI8A 4CG1A 2CBGA 4OU4A 3JW8A 2WJ4A 4PW0A 2XQGA 4DNFA 4K6GA 1H2XA 1LLFA 2PM8A 4OYLA 2PU5A 2WUGA 3QMVA 1EH5A 1ZIYA 1YCDA 4JNCA 5AM1A 2BUAA 2K2QB 2ZYSA 4RE6A 1TKRA 5ALTA 1CUVA 2WIFA 4BYMA 2XQFA 2XQIA 4FBLA 4JH0A 1X2BA 1XZJA 4Y7DA 1QFSA 1IZ8A 4D9JA 1XZKA 3KWFA 4DMFA 4L9AA 3QMMA 1FFBA 2PSFA 4Y2RA 4H7EA 1GPNA 3IB3A 1CVLA 4LXGA 1J06A 5AKKA 1Z68A 1TQHA 4DM7A 2Z3WA 2G5PA 3QYJA 4TGLA 1J2EA 2IX9A 4IH4A 5I7UA 4UPDA 4KAJA 1TCCA 1PJAA 1H22A 2CEKA 2GBGA 5CT8A 1BE0A 1G42A 4M0MA 4X90A 4X91A 3HJUA 3O4IA 2PSJA 1Q83A 4Q3KA 2ZSHA 4BCCA 5EIHA 2Z3ZA 2BAGA 1A8UA 4Q3LA 5HQ3B 3FYTA 4RPCA 2XT0A 1D07A 4B9AA 5AI9A 4AO7A 1RP1A 2BUCA 1JJIA 5ALNA 5ALGA 1AKNA 1XZIA 5I9IA 4B6GA 5JZ9A 1SCIA 5HF9A 3WLAA 3AIKA 3C70A 1SC9A 4H0CA 5KBYA 2BKLA 2XUIA 1BRTA 2WUDA 3AZPA 2XUGA 4OB6A 2O7VA 4LYEA 4BE4A 3D59A 5HKAA 1HBJA 2DQYA 1UOQA 2FJPA 1W52X 1XZMA 3EQ8A 3C6BA 3QPDA 3DCNA 4K6KA 4QLAA 4YX9A 4Q1VA 3V48A 3LS2A 1E8NA 2VATA 2GBFA 1UXOA 3MUNA 5D3KA 1FFCA 4H7HA 5ALZA 3STVA 2XLCA 4I4CA 4ZI5A 4PSUA 3BDIA 1H2YA 1DWOA 4W1SA 5C8VA 5A71A 1UOOA 2GYUA 3IUNA 4FHZA 5C8XA 2CZQA 1XQYA 4JUIA 4F60A 3O9VA 2ACEA 2OPHA 3EF3A 3IDAA 1ZJ4A 4PO3X 4O08A 3T4UA 3WWPA 3DS8A 1BN6A 5HF5A 3STTA 4AO6A 1YS1X 2X8BA 1B6GA 2CJPA 4JEIA 4IH1A 1O6GA 2XQJA 4L72A 4EZIA 2I3DA 2XMRA 3IIIA 4EB0A 5LZ8A 1MNQA 5F4ZA 4KYVA 3YASA 4MWSA 4LXHA 3WL6A 1ODTC 1CEXA 5AM2A 3WK9A 1CUDA 3B5EA 5ALYA 1SCQA 1U2EA 1QLWA 3WYNA 2XMDA 5AKJA 2JF0A 2WLSA 5K3EA 2VEOA 1SOMA 3NUZA 3QZUA 1LPNA 1NU8A 3QH4A 3A2LA 1E66A 2AJBA 1THTA 2O7RA 3AIOA 3G0IA 3K6KA 5LKAA 1VOTA 3R3VA 3RM3A 3BIWA 3F67A 5ALIA 1GKKA 4GI1A 3R3ZA 1DWQA 3OPMA 5K3CA 1P0IA 4K5QA 4X00A 3HRHA 3LP5A 2WQZA 5CW2A 1CPYA 3BJMA 1K4YA 3WL7A 2FUKA 5AK5A 4K2AA 5CH8A 2VT7A 2ZJ6A 2HFKA 5AICA 5JYCA 2PVSA 2WM2A 2WIGA 4QDUA 2CUTA 1GQSA 1MX5A 2YYSA 3SK0A 5LP1A 4BDTA 1GPLA 3CN7A 5BV7A 4EY8A 5I8PA 4U2CA 3DOHA 2ACKA 2XDWA 1U8EA 1ZD2P 1WCYA 1CUCA 4WY5A 1VZ2A 2PU7A 4LYDA 3VISA 4CIAA 2OCIA 3X3HA 4OB7A 5HK9A 1XZCA 5ALDA 3DL4A 2XLBA 4AZ3A 1KU6A 4BDSA 1XZHA 5AIBA 3H0CA 4ZGBA 2JGIA 4J0KA 5HQ3A 2HA4A 4AB1A 3WL5A 1QE3A 1CUBA 4QDZA 1GZ7A 1WPRA 1BEEA 4M0EA 2HDWA 5AI5A 2VQ6A 5T4BA 3GA7A 1W4LA 3W05A 5C8ZA 4LKOA 2G5TA 5FPPA 1ZI6A 4ARAA 2B4KA 3I2IA 1E8MA 5FRDA 4MQLA 1UK9A 2PKYX 3I2KA 1YS2X 4AXBA 3H2HA 1LPOA 1Q0RA 1ETHA 1EK2A 3AZQA 4XIIA 3OOSA 4BCDA 4U2DA 5IKXA 4ZV7A 3I1IA 1EB9A 5A2GA 4FLEA 1XLVA 4MEBA 4FNMA 3WJ1A 3QVMA 4A23A 4DIUA 3FCXA 4BTVA 3S2ZA 4NVRA 1WB4A 2XUKA 1LBTA 1J1IA 1YAHA 4LIPD 2FJ0A 5IVIA 2VSQA 3HC7A 3FBWA 2WHQA 5CBKA 4G4IA 2HA3A 3H19A 3G0GA 3EIOA 4X97A 4WCVA 4P08A 1H23A 2H9YA 4FTWA 1XFDA 3LIIA 3GZJA 3L1HA 3R3XA 3C8DA 5JADA 4Y2VA 1WM1A 1XZGA 1ZD5A
chains in the Genus database with same CATH superfamily
4MCJA 1M8JA 4PF1A 3BWCA 3U0BA 4UU8A 3E3NA 4KNWA 1U0LA 4G09A 2DX7A 4L3WA 1H93A 1OX4B 3WLNA 5BVHA 2CY0A 2F4NA 1VPLA 2ZREA 4OHZA 5LZ5A 4FR2A 4KMMA 3BK7A 1OGIA 3VSCA 1M1XB 3AP1A 3AP3A 5F5LA 4N18A 4MMZB 3I72A 4EJMA 3SHWA 2O3SA 4I14A 3IJEB 4F5EA 1F7UA 1L3IA 2YY5A 3DZ8A 2PKWA 4D43A 4YQYA 3VZRA 3W2IA 4DMUB 4R16A 2XGOA 3BSSA 5EP1A 1IPFA 4BIMA 3JAKB 1Z15A 1Z5OA 4P93A 3CT4A 2YC2C 3EW7A 4N01A 1PS8A 2YVAA 1ZKDA 2FSIA 1JIXA 5INTA 4MHTA 1JDUA 4Q18A 4MV5A 2XNSA 5JBQA 2O0HA 4ZODA 2G9VA 4GMDA 5C37A 2PBLA 4CT4B 3F5DA 3BTSA 4ILKA 1YQUA 2IBTA 4P31A 2RHOA 2FPUA 4C1BA 1YV9A 4CF4A 2OR3A 3FZQA 1XTTA 1LEHA 4TMTA 1U5BB 3N05A 2POCA 2C3OA 3IT0A 2OGWA 3VDXA 4EW1A 2Q45A 3U19A 1X8LA 1HYEA 4WVLA 1I01A 3OEWA 3SMVA 1YR2A 3ZBQA 1R10A 2GVNA 1T4CA 2ORYA 3E70C 2J7PA 3EXHA 4RY2A 1J7KA 4LZPA 2QNBA 4M9SA 4W63A 3DUWA 4H3KB 3V7NA 1N0UA 4KVAA 1F8GA 1IM2A 1HO3A 2Y05A 3FDZA 3S1SA 2B7CA 5FTLA 5DLYA 4KBYA 1GARA 1F7VA 5TT1A 3DEHA 1DNPA 2F90A 3GGPA 4MRNA 4E5MA 1IQ0A 4CM1A 1H8HD 1POWA 1P5HA 3PBKA 4J2OA 4IMPA 2DTEA 1G3IA 4R2IA 1XEXB 2EF0A 3C6XA 1CR6A 3IUMA 2EKDA 4YYZA 1SXPA 1VG9B 3Q9NA 5HFNA 3HXTA 2G70A 4ZT7A 3MCWA 1LDMA 3CLTD 1IMJA 1MKYA 2IYWA 2UZ0A 2X7HA 3QTBA 1BD4A 1CR2A 4KJXA 1JBEA 4OGKA 1WUIS 3GJYA 2V55B 3IJ5A 1K3TA 1I2BA 4HQ0A 1BMTA 5AKHA 5K8IA 1XMJA 4IDAA 1NMSA 4RESA 1Z6AA 2TMDA 4HDNA 1ZDMA 1BIFA 1DI0A 1GUZA 2Q2QA 1N2BA 1NQUA 2FFJA 3PXCX 2REXB 3PT9A 4UDNA 1TOAA 3T3IA 1F48A 3JQFA 3DEFA 5FEMA 3MELA 4NCXA 5E1BA 4KE6A 1MVNA 3QV2A 2FW0A 4JUFA 3O9MA 4YRJA 3SJZA 3ZHVA 4JL8A 3OP1A 1Z2NX 3ST7A 1CY8A 3RHZA 3RTCA 4BNDB 4TTTS 1WTAA 1FSGA 3GQBB 4UHCA 3EF1A 1OXSC 2Y99A 3WA6A 4IFTA 4IHAA 4BNIA 4QEDA 1LDBA 3OF3A 2Z9CA 4X1IB 5EKXA 2QNIA 3KOYA 3VDNB 1QDUA 1EUDA 4GOJA 1TO1E 3WIUA 3ZCSA 3CF4G 4HB2A 2ORWA 2Q1TA 2GXSA 1VLHA 3D6NB 1XQXA 4G1BA 4CIBA 1FMJA 3NUQA 2HNAA 4S1TA 1OFTA 4KXXA 2RG1A 2OORA 4E31A 5CBPB 2H06A 4FM9A 1XTZA 2A4KA 4AD8A 3BRCA 3O2SB 4G5XA 1CJSA 2NU6A 4MQFB 4R01A 3DBRB 1C2YA 5THXA 3PWKA 4BNFA 3ETGA 3ME5A 1G9TA 4CF3A 3G8DA 3B82A 2J5BA 1DAPA 2BEUA 2QD1A 1E20A 1YDFA 2IPLA 4G9EA 2C88A 4JCCA 2WF6A 4D2IA 4L16A 3GA0A 1M1YB 4MLZA 3WGOA 1P5RA 1J2JA 2BH9A 4XD7D 1OJLA 4B3HA 4BN5A 5IKPA 3QHAA 1E9VA 2W6IA 3JX9A 2RFLA 1JQKA 4CF7A 3L8EA 4V0NA 3RS9A 1Y1PA 1I7DA 4UUOA 3ZY2A 2V6MA 3CLRC 3EGWA 1URPA 1MRSA 3GRUA 4HEA1 1A4RA 3LXRA 3MJ4A 4LK3A 1N1EA 1CY1A 3RJMA 2XYRA 5JH7B 2F00A 1KYTA 3RWBA 2MHCA 2ACWA 1E2DA 3KSMA 3PF8A 1L0BA 3C6ZA 2VT2A 3BJIC 1K9VF 2Q1UA 1DAIA 1B73A 1Y7LA 2BZ1A 4ND3A 4OI1A 3T6KA 2Q5QA 1C8LA 1CULC 2N75A 2RGBA 2VCYA 3N59A 4JVSB 4W8HA 4DA0A 1ADBA 1NBIA 2GF0A 3IX7A 3GRPA 3UV7A 3HJCA 2RSLA 3H1PA 4FGSA 1WZCA 2ZATA 2BJVA 1JILA 2BI4A 2O8DB 1GNPA 1U0FA 5IT9A 4N12A 3LVRE 4TS4A 3ZJ4A 3CWCA 1ZWLA 3M4ZA 5H83A 3RWOA 2CKMA 4GXTA 1CNMA 4KUEA 4R0VA 1JQ3A 4J75A 1SKMA 3I9NA 1TA4A 2OUKA 3S2SA 1I2DA 5HE9A 3KB8A 5BY2A 3NHFA 2GWHA 4PVDA 1ZAYA 2VWHA 3V7WA 2H1WA 3S2YA 2LCFA 3BH0A 3BAZA 3VPDA 4H18A 1FW8A 1L9KA 1QS0B 3Q2IA 4DLNA 5LIRA 1KXJA 3Q9UA 3RRBA 2BFWA 5K8JB 4PSKA 2ENWA 1E3LA 5ALUA 4DT1B 2DECA 4X3PA 2EHJA 1LGYA 2HBYA 3OPNA 4MGZR 2QI9C 2JFUA 3ETDA 1NMXA 4O4JA 4YQZA 1AKYA 1FMLA 3ZWOA 5H4GA 4F2WA 3GAZA 4PZUA 4X65B 3GLIA 1ZK2A 2GD1O 2I1WA 2HSWA 3EHDA 3WP0A 1I3MA 1NMYA 1W2GA 3DR5A 4A0QA 2ZANA 4LOLA 5DHUA 3V97A 3B52X 1OASA 3M33A 4UHHA 1XYVA 5K99A 4GZLA 3VVMA 2GJSA 3PC4A 4I3HA 1ZD8A 3HABA 4F93B 1DC5A 1F4LA 1G3RA 1HXHA 1UQRA 2RCNA 4G84A 3CUTA 5EZ5A 5JV5A 1LX7A 1RXWA 4RLHA 2PG3A 2DBYA 4XIJA 2VSYA 1Y63A 1ZZGA 5FEUA 1RI2A 2JNWA 3IULA 3ZWKA 5IBCA 3PS9A 1Z6TA 1E69A 1GZVA 5JDCC 4FEYA 4GRAA 5GIOE 4WFKA 1CUZA 2VOJA 4BO6A 5JFOA 2RB4A 1NI5A 2KHZA 2QRLA 4G37A 4O2BA 4WEOA 3JATA 2GLTA 4W5NA 2OGSA 2EYUA 3E61A 4IIDA 1Y9JA 4O2RA 4YUYA 3OIFA 5B2ZA 4HNQA 1EP1B 2IUTA 1AY0A 1RZ3A 2B8NA 3TOZA 4MKIA 1MIOA 4MCAA 3GRKA 4OMCA 1ODLA 4D4GA 1JDJA 2J48A 1CUGA 2WIJA 5JH7F 2XE7A 5TIIA 2HJ9A 4F71A 4YIKA 1VGVA 1BGVA 2Q6IA 2ATXA 1N1MA 3AFOA 1HZJA 1NQ5A 3AR6A 1QTRA 3I5AA 4DVJA 1CB7A 1WOYA 2ACVA 3KQTA 4GDMA 1XD9A 3KHUA 3MJDA 1Q7CA 3OQIA 1Y8RA 1PU2A 16PKA 5JI3E 3B13B 4MLCA 3PLAE 1P0FA 4S0ZA 2I6FA 2WBLC 4MW1A 3A6HA 3K0SA 5L40A 2HFJA 2PKQO 3H86A 2ATCA 2FMUA 3KVOA 3PE4A 4J03A 2OQRA 1S89A 5A5GA 3SZLA 1IN7A 3DONA 3EX7C 5G1PA 1VZ3A 3IBSA 4BCBA 3GFFA 1OVGA 5DO9A 3LUFA 2OESA 3AUTA 3VPAA 4DLKA 1U04A 1LTQA 1GGEA 4IDCA 3N2EA 4PPGA 2UZ1A 4UU0A 5J43A 2DHQA 3OICA 1ZMBA 4CNQA 4ITVA 3KPUA 5KDOA 3DFKA 2PMDA 2XAUA 4GGOA 1WPXA 4W6QA 4IVPA 5EG5A 3TBHA 5CFPA 3AR2A 3IP6A 3ELBA 3C6QA 3OJFA 4X93A 3SZRA 3BOSA 1Z4LA 1VE1A 2J5KA 4EPYA 1FXWF 1KAOA 2E18A 1HI9A 1FZQA 2GBCA 4I8IA 2P6UA 1CR4A 1FP7A 2R1VB 4IO0A 4J7XA 4C0WA 4B3JA 3VC3A 2XKBA 1DDIA 3ZNNA 2UZ3A 5L3QA 4M46A 4LMPA 3ESCA 2XOXA 2OCLA 3ZHQA 1HDZA 1S0UA 4BC0A 5K8VA 4TLCA 2AOUA 2LKDA 3FHTA 4LJAA 4TZ0A 2DFVA 4NBRA 1LPMA 4E03A 1VJ5A 1M0TA 1J9ZA 1S9HA 1SHUX 4Z0TA 3CGWA 2ZXFA 3PE6A 4NJMA 4WN3A 4GOOD 5AQEA 4IG9A 2PAFA 4Q7JB 3F6EX 3HA5A 4WCFB 3V6MA 1S02A 3BIJA 1JSCA 4TN5A 3WGYA 1KFEB 1Y81A 4J0FA 3QENA 4E33A 2XVXA 1ZUIA 3HJRA 3W5SA 2I66A 2PXHA 1EVJA 2WJPA 3ZOKA 4DANA 4CV0A 1RIIA 2YTZA 2CHQA 3KZMA 4OFZA 2CJWA 3D4BA 5ALVA 3UYKA 3GCZA 2BGRA 1YASA 3OWXA 4EO7A 3LK6A 1YS7A 1JU4A 3V32A 4GQIA 3CA8A 2Y3IA 1YL6A 4X41A 4LN1A 5E7IA 3H2SA 1P5ZB 3O8QA 1TM5E 4JCOA 5DK4A 4YACA 1CQJA 5TGZA 1CWUA 3UMSA 5KYGA 4GM0A 2EVWX 1Q6YA 4BV9A 5DNDA 2C92A 4HQNA 3HR4A 4A26A 2RGXA 3OKCA 4LGVA 3KWMA 5DYTA 1QVRA 5KS2A 2QSZA 3DBLA 1ATZA 2WOOA 4B2YA 4D79A 3IL2A 2ZIXB 3AHHA 4JROA 1T5TA 4XWKA 2ZBPA 1U4SA 4YQFA 4NFYA 1SOUA 3KZXA 1CRZA 3EUWA 1KERA 4DCPA 1ZK0A 4ZALA 2IWHA 2O48X 3ETHA 2H11A 3JD1A 5A4JA 1UWLA 4NKRA 1IPHA 4Q02A 3V1YA 1FEZA 1PV1A 1JF8A 3DO8A 2D2FA 4Y6GB 2YHUA 2VXOA 4CG2A 1TPYA 2P65A 1Z0JA 1BJKA 2MYNA 4RHFA 5JAPA 2FFHA 4I66A 1XXHE 2DUUA 4FJ1A 2HXSA 3IVMA 4C4PA 3P5SA 3TTVA 4IL5A 1G8HA 3ZJVA 1NQTA 3NHSA 5CB6A 1FTSA 4ZU1X 4UMFA 2V65A 1MO4A 3U4GA 4C7KA 3PRJA 1XEWX 1T6NA 2C4WA 4K9KA 4WLFA 2IWRA 1VPVA 4DRXB 5KYTA 4QODA 5DASA 2IW3A 2RKWA 2GAOA 3JSAA 4KV9A 4M53A 4AKSA 3K0AA 2O14A 1HDGO 4ZRMA 3IO3A 3OD1A 5HZHA 4RPKA 2W8BB 4MK4A 3UFXB 4YRAA 4HB3A 1OU4A 2VHJA 4R31A 2HO5A 5D5PA 3VZPA 3BMCA 1VLQA 3SGLA 4A2WA 4BNMA 4YV7A 3JU3A 5JBIA 3MRVA 4FGZA 1NFFA 3U1VA 2G77B 3ZCUA 4P7GA 3KV3O 4MDFA 3CO5A 4OKIA 1UC8A 2H3EA 3CMCO 1FLAA 3RBVA 3T7SA 1KJZA 3IAUA 4REQB 1UP7A 2I5PO 4F5DA 2H8KA 2HTFA 3KEGA 1A5ZA 4OF4A 3WGUA 4CUKA 2EJTA 1EK6A 1FDTA 1MB3A 4H7DA 1Z63A 2EKZA 2BIFA 2DYKA 4YUZA 3CZRA 3KBBA 2D0IA 1G8MA 1ZY2A 3HBMA 5AD1A 2IH2A 4IDPA 1CJCA 1ZH4A 4IJKA 2FPIA 2OO5A 4XDHA 1EDOA 5C3UA 2VJQA 4DS3A 4D8TA 5JSQA 3O0DA 5CB0A 1L7RA 4WY8A 2OILA 1SQFA 1JU9A 4FMCF 2J85A 2XOKD 2EX0A 3WLOA 5A4KA 1Y33E 3GJ8A 2QT0A 4ZQIA 3V8BA 4EHBA 1M6WA 1WBDA 2QRJA 1SVKA 1JECA 1OCEA 2BHSA 1AMNA 2AD1A 1E4YA 3GMDA 3ROFA 2FG5A 2PRSA 3TZLA 3PQ2A 4C01A 2BMFA 4FWTA 2G67A 3PK0A 5B3JA 2D7DA 1SB8A 4RC9A 3LBNA 1G66A 1TUBA 2JRCA 3CN9A 4BMCA 5I5EA 3L6CA 5KNCD 1H8EA 3OPYA 4FC7A 5AM5A 1PK9A 2PYZA 2QTVB 1RJWA 3GBPA 4HLUA 4OYYA 4K8OA 4KWEA 4ECEA 2D00A 1N6IA 3Q7RA 1GRQA 4XWOA 1X70A 3BFKA 3RAJA 1E3WB 1DJMA 4ESEA 3I83A 1XRSB 1AB5A 1I5EA 3H9EO 2HA5A 4MW9A 4QPCA 1RD4A 4PZ9A 5E6RA 4NDAA 3PD7A 4KPYA 1XKLA 2YJZA 1H2RS 2VHXA 3JWJA 3EAQA 4DMLA 4DSAA 2PV0A 4KHPB 4FGLA 2I7CA 4XXHA 3FLBA 1E2EA 4K6CA 1W5TA 1XDUA 3OFSA 1A9TA 3HLYA 3NHYA 5F52A 1Z6YA 1KEWA 2XDQB 1PS0A 4WVFA 1X7XB 1G60A 5FV7A 4G2TA 4GEGA 2VJYA 4RZQA 3UW3A 1UWKA 2PUEA 1Z2DA 3JZFA 2F62A 3IKTA 1VL1A 3G2OA 4CI9A 4H6VA 3TPZA 2I4RA 4JIGA 4C87A 4X0EA 1ZBQA 3GJQA 2W48A 4LOAA 2Q9AA 1W9MA 3QPWA 1L5OA 1VMIA 4TZ6A 1RYNA 1AUPA 2CSXA 1L4EA 3VU9A 2CSUA 3UMFA 3KUXA 4XM1A 2WHEA 2O5VA 4UBMA 1MJGA 4H3VA 4QT4A 3KYCA 3OCUA 4DQXA 3DBHB 1A72A 3TI7A 2UAGA 3MTGA 2BMVA 4IV8A 1VIAA 1O4VA 1QGUA 4LGCA 3VC2A 4E2WA 4K3UA 5DM60 1A4XA 3DLIA 1FP1D 5BSWA 4QM6A 3OQJA 2A1UA 4FGWA 4RFSA 1L4YA 1IXZA 4K6FA 2VH2A 1Y3CE 3K0FB 2RGDA 4RA6A 3X1XA 4PZCA 2ZI5A 4CODB 1ZCJA 3BE4A 5EWJA 4PHTA 4B34A 1KZYC 4IS3A 2W6MA 1Q17A 1XAHA 5ALSA 1K88A 1XCGB 1VE9A 3VNAA 3QRWA 4BQNA 5KHAA 2Z8XA 1Z6XA 1M8FA 4HWSA 4BNLA 1IXSB 1VKNA 3K6SA 4YMTA 1HKHA 4CTOA 2I7VA 4HY3A 1DXQA 4LHZA 4ZJPA 1FYEA 2GM9A 5KJ6A 3T1OA 2JAUA 4LXXA 4X71A 4KBFA 2OB2A 1UFOA 3E15A 1A77A 1SNYA 1T9HA 4DMGA 1ZISA 1C1XA 1PTKA 4RAQA 4MVJD 2X15A 2AK2A 3F4LA 3IEPA 2KI5A 3Q7TA 5SZJA 3HCPA 2J6BA 1VYTA 3C3PA 2V7VA 3D6UA 3SHOA 3O4GA 5FQNA 2Z9DA 5I9BA 3AZOA 3RYTC 4PZLA 2VHCA 5EYPA 5L9AA 1IH8A 3JQ8B 2IIVA 2LPMA 3IESA 4C2UA 2P4HX 2I2BA 1BJRE 1KPHA 1ADFA 2XMCA 3K5WA 4DADA 1GZ3A 1KRHA 2ORIA 2XDAA 3U56A 4C78A 2QF7A 3QQPA 2P41A 5FWXB 1FXSA 1K97A 4K1LA 4P35A 3R20A 3I32A 4E14A 1UXGA 4FWIB 2YOGA 1W0KD 4GSLA 4MB6A 3O84A 4S0XA 3CCBA 1Y7IA 2BUBA 2EFGA 1PZMA 2ZIWB 4F12A 2V7UA 3CURA 4D9EA 1YO6A 4QAJA 1XR3A 2CUZA 5EESA 1O6BA 2WA1A 3M6XA 4MPRA 5KINB 4GOKA 4PX2A 4O2AA 4HGQA 3GXBA 4TTVA 1Y42X 1C4WA 3H83A 4V3BA 1T8PA 3R3YA 3IT1A 1PVOA 4JELA 3CPEA 4CCYB 3OC0A 2QXUA 1G20B 2JZNA 3NANA 4H4CA 4JJ7A 2VSFA 4X95A 5AI0A 5IH3A 3TR5A 2QM8A 2NYAA 5BYBA 1LF5A 5B6JA 3OZSA 1EINA 4IIJB 4QL3A 3C5HA 5CA0A 3WYCA 4AQDA 1ZU5A 4FLMA 4I1OA 1ZC3A 2FETA 1W4AA 3FYUA 3OEYA 5JNRA 2CHVA 3Q3GE 5B1YA 1N36B 1PT6A 2C0PA 4X6XA 3IBTA 3EEIA 3RU3A 2QD5A 5B58T 2BR4A 1IUKA 4E30A 5ABPA 3IQIX 1OH7A 1RRPA 2KQUA 2YXBA 4Q03A 3SX0A 4DQ0A 5KVAA 3VTAA 2QVXX 1R88A 4CM8B 4Q0MA 3HO1A 4WXRA 3EE6A 1ISHA 3GUUA 5ECGC 3MMZA 1MAAA 2HXGA 3VNRA 3R23A 4FMBB 1I7QB 1PQPA 1CJKC 1ZIPA 4Q4DA 4AN4A 2HK6A 4UE3S 3W5HA 3V4VB 1QHHA 5CK4A 4QUDA 3I3OA 4CVNA 3P9CA 4BFLA 4MR9A 4DV1B 5F5NA 5L45A 3LNCA 1D7OA 3K16A 1I7SB 1PI3A 1Y82A 4F21A 1PGQA 2JCBA 2ZQZA 4G5SA 4PV7A 2QKYA 2HDHA 1LH0A 2GPJA 3WLMA 4ZP1A 3OECA 4B73A 1T6YA 1KC1A 3AJ8A 4C29A 1IJFA 1ZNZA 1YTUA 3AUXA 3EBOA 1JI0A 1JIJA 1A04A 2I2CA 1U1CA 2JHAA 2IYQA 4CR8A 1SXJA 3H16A 1ZICA 1Z08A 2JLQA 3KEOA 3W4JA 4H1WA 1JKFA 2QAGC 2WVJA 2HH9A 3KQQA 2OC4A 3K70D 5JAQA 3PXXA 4N5NA 5ED0A 4DYHA 4DQKA 3L6DA 2EFYA 5HUQA 2GXAA 2O3JA 1X7ZA 2Q4TA 3NDJA 3W2HA 1XZEA 4JEHA 4KPGA 5H70A 1RLUA 2MU1A 4ACBA 3I5UA 4OFWA 5FWYB 3B53X 2J30A 3C3CA 3LZ6A 1JMKC 5D01A 3ZVRA 3GLVA 2PZLA 1K6EA 3QLUA 5JALA 4H2DA 4HUQB 2PUJA 3RVLA 3WDKA 2I3ZA 3NGMA 4M98A 2H0AA 4PG7A 4HQ6A 4R1TA 3SXPA 4R81A 3I04A 1XZ8A 3GT4A 3BWBA 3PUJA 4PCUA 1YJBA 5JVDB 2C04A 1DO8A 3H4TA 3AKEA 2VRCA 1YBVA 2EWMA 3MWFA 4U9UA 2H63A 4QOIA 4F0JA 2F17A 2QX9A 5K0BA 2ZSIA 5CB4B 1Z4MA 3AXTA 3KEMA 1EUCB 4GRIA 3ROZA 3VR3A 5BMVB 3KYDA 1PL7A 4WIAA 5F3DA 4HQRA 4ZA2A 4BO3A 1M2GA 3B85A 4KB5A 3DB1A 3TZQA 3A26A 3VM6A 1IEWA 2RHJA 3MGAA 1XF9A 4QU8A 2UUBB 5K3FB 1SFRA 2NX2A 1R6DA 4J4BA 1C9JA 2ADFA 3TIVA 4I99A 1J5EB 1WCWA 4QJ3A 5KNCH 1XK7A 3CUWA 1N2XA 3K9WA 3R9KA 2WW8A 3T9BA 2X6RA 1TA0A 4TWBA 1R4MA 2ZAGA 5AYVA 3VUEA 2ZBUA 3G13A 2ZM6B 1E3EA 7MHTA 4FOTA 4IDGA 3PXBA 2AXPA 2YY7A 2F7SA 1OPXA 2DUJA 3X2FA 3MT0A 4FCVA 1EK1A 3CF6R 4G4SO 2CVHA 4G36A 1SEPA 5TQVA 1E4OA 5HM6A 2XGGA 4S04A 1XQWA 1TVKA 3RSZA 1KMMA 1U0SY 3IE2A 1T4BA 4KXMA 4L8LA 1KEKA 1CJVC 1WEHA 1IY2A 1U8UA 1NM5A 3N6RA 3P94A 3WNVA 2PRKA 3F5FA 5EHNA 1GG2A 3FG9A 2D4HA 4MRMA 2W4IA 3WI7A 1X38A 2AYXA 4YJ2B 1Z6PA 4B6PA 4YPVA 1GPMA 1GUDA 3QOFA 5EPEA 5JO9A 1FS4A 3TBFA 1AA6A 1TMOA 5EJMA 4JU8A 5F1YA 3VSDA 2ZWAA 2HF7A 2QPTA 4LF5B 3BTVA 3NDRA 2NV0A 3LK7A 1PEKE 3GJXC 2E49A 2V7EA 3C74A 1E98A 4CUZA 1O5TA 4I4IA 2D6FA 4US0R 1B0AA 5ES4B 2C3YA 5IKMA 1K7XB 1QKIA 1XWFA 3T7RA 1WZIA 3AMVA 3M3DA 2H1CA 2AE1A 1M2JA 4F3CA 1P6QA 4OIMA 3ROGA 5AVZA 3D9QX 1FLVA 3OURA 1NPYA 3Q98A 1A0OA 3WKBA 2WVAA 3TUIC 3ETCA 1VE3A 3LVFO 2VT6A 1IJKA 4O0MA 2GOYA 4B8WA 3ZD8A 4MS1A 5ECDA 1BWRA 1JAHA 1OFIA 2GRAA 3N0WA 4CRWB 4OPMA 3JQ9C 4Y2XA 1ZX1A 3IQXA 4KCGA 1BKSB 1D4FA 2EIXA 2Z2IA 2P8JA 4U02A 2YFKA 1Z7GA 4MPTA 4GGMX 4K03A 1N2CA 3H6GA 2AF3C 3PYLA 2PGDA 5CB4F 2O2HA 3R75A 5BMVF 5KTKA 1Z0ZA 3U7FB 4UMVA 3U4HA 4BNVA 1NYTA 3BD6A 5CCDA 3CW9A 4CKYA 2XUPA 2H3HA 4RPGA 5E0OA 1XLWA 3TIFA 3W9YA 3WIVA 3FPEA 1UEJA 5LMUB 4D4MA 1O1YA 1W34A 1C81A 5EKSA 3ZPXA 1L7EA 4M21A 1RI3A 2XITA 1N2ZA 2XT6A 3IUPA 3UUEA 4NU6A 4AG3A 5EJ6A 1PQ4A 1II9A 4MVJH 4CG3A 1L3CA 3QBJA 3ESYA 3OBIA 1MO2A 5G4LA 3X1MA 3ZK9A 9MHTA 4QUEA 4RVGA 1VBNA 2YV4A 2YV2A 4Y2JA 4G1FA 1RQGA 4PYLA 5IG2A 4G5FA 4UHBA 4KIUA 2YJ6A 1P77A 4J1QA 2YMLA 1NVEA 3ZWNA 2MINB 3OPYI 3ID6C 3NYQA 3FVVA 3DMDA 3C3JA 3KYJB 1P61B 4ZYLA 2FX5A 2K6GA 4G6ZA 1QH8B 3GROA 1N5IA 2UZIR 3HB7A 4G8CA 4WX2B 4ZZ2A 5BSUA 3ZLBA 1G55A 1U1GA 2HPZA 5EXTA 2DGDA 5DOZA 4UTVA 2Y1XA 1KF0A 3IP7A 4I50B 2JLVA 2FQ1A 4E88A 5DSZA 3Q10A 2Q2WA 3I9LA 2C4UA 1X1EA 1JN0A 1U1DA 4UCXA 4EL5A 1GUYA 4FJ0A 3RTBA 1TMKA 4N0MA 1M0EA 4DY4A 2QJRA 4O4IF 5CYFA 4BZPA 4DNXA 4L02A 4YP0A 1N6LA 3AR9A 5FL3A 2Y71A 3CRRA 1R15A 2H4YA 3EFOB 2HB6A 3PHCA 5I7HA 2FH5B 1GPDG 1W29A 4QBFA 5FD8A 1TIBA 4G5OA 4MP3A 4R68A 3V00A 4EB8A 1QTNA 2O8NA 1SCBA 1EFDN 1FJ2A 2A0KA 3DKKA 3GPCA 1IY8A 3HCBA 1T8YA 3V7UA 4DLZA 3ADOA 1CQIA 1IWPB 2PZEA 2WWTA 3FJ1A 1UQUA 3SC2B 3SDZA 2KB0A 2C59A 1SD2A 3SIPA 2HIAA 1N2HA 1Q15A 2X8JA 1FVOA 4LGMA 2YMPA 1MV5A 2COUA 2X4DA 4C2AA 1FRFS 3L4BC 3ZD6A 3GAMA 3FAZA 4EARA 5J58A 1NVMB 3F98A 4FE7A 1CUYA 1H42A 2A7XA 2XUHA 3LBIA 4JJ4A 2J3KA 1U6JA 2V5AA 3NHWA 1S6YA 1UBCA 3TIXB 3B1FA 3DE2X 5C8DA 1QIIA 5IAEA 2Z1DA 4C7VA 1DFIA 1BHSA 3ZV7A 5HUJA 1RT9A 4YALA 2JGKA 3ESXA 2CMKA 2VJKA 1UMBA 2QD3A 2ZRDA 3SZMA 5DNCA 1C8BA 1M83A 3RS4A 3GPDG 3QPAA 1OFVA 3TSAA 2QAJA 3K1YA 3NOXA 3OQ1A 1D2CA 3AKYA 3KV1A 2B82A 2D2EA 1RC1A 3HJHA 2CLLB 4CTNA 1LU9A 4Y1GA 3RV3A 3Q8MA 4TVKA 1SC3A 4YI5A 5LCXA 2EZTA 4AZ0A 4W1QA 2R8BA 3DMTA 3IOCA 4LC0A 2QM0A 1Q0ZA 3JAWB 1OH5A 1YMUA 4J7AA 3PDJA 2XRZA 3B6KA 4LQ4A 3ZBPA 2C99A 4QPDA 3UKOA 1KO4A 1OX4A 2QZJA 1NP3A 4RGVA 1B8PA 3W7VA 4I2VA 2Q4DA 3OD5A 4LJ9A 2J4FA 3INTA 3KR2A 3G0OA 4ND8A 4UUNA 5LD2C 1HEYA 4GHWA 3EXFA 2DHDA 5DVZA 1OD6A 2WFZA 1DMRA 2OZKA 3JWEA 5MHTA 1US8B 3EHEA 4IO1A 2A3NA 1RXCA 1QGED 1OSNA 2E6UX 2IHVA 3L0IB 4I50F 1KDZA 2ZE5A 1EPUA 1MEJA 1MJHA 1QC5A 1R66A 4F2DA 5HSGA 3FKSD 2VPIA 4OREX 3BH7A 3JAKA 4WDRA 3A25A 1TVMA 3IAEA 1U65A 4KGZA 4ZKEA 2O07A 4DQDA 1DTSA 2QZPA 1XKXA 3O95A 3PX2A 4DZRA 1ND6A 3WL4A 4TLMB 1I6KA 3AUFA 1EJ2A 2OFOA 2RK3A 3FCYA 1DRUA 3P9KA 3ILVA 5FHQA 4BPBA 2VAPA 3U6BA 4L9SA 4ALJA 4B2LA 3QU2A 2PFKA 1XV5A 3IUEA 1B8VA 3R4CA 4WN9B 5BWBA 3ZHOA 5AW7A 1UWVA 3BL8A 1P73A 4UM8B 2FHSA 3L1JA 4EG0A 2QXTA 5HHTA 2DEUA 1I33A 3FF1A 2HMTA 3GGOA 5G40A 2WZQA 2W2PA 1H0SA 1RWVA 4W5RA 3HDJA 1CY4A 4Q9JA 3FNGA 5BW5A 2QIPA 5LR6A 3FSGD 4K8RB 5FJJA 1OZHA 4DDMA 1CDEA 3QY9A 2W6JA 3WV5A 1W7AA 3AM3A 2QWXA 5A0VA 1F2UB 3QE0A 3CUSA 1X94A 3QHPA 2C8JA 5K8LA 2NOAA 1IBLB 1E2BA 1OH8A 1EWYA 1TYAE 1XEXA 2D54A 4X8OA 3CX3A 3GH1A 1MJFA 3MJSA 3NCTA 2ZIEA 3VZDA 4Y2UA 1QCZA 3MM4A 3SFZA 5K6TA 4P2BA 2WAYA 2Q5HA 2QOEA 1T5OA 3MBOA 1BZYA 3CFYA 4BO1A 2OKGA 4UTOA 4PY2A 1KOFA 2OFXA 3PEYA 2B3TA 4PFSA 3M6FA 3ZGNA 4BQSA 2JGJA 2BRUA 2UVPB 5KOYA 3MB8A 2QYOA 1V9SA 3AEXA 3QBDA 1CS0A 3EXEA 1X9HA 5M29A 4BZWA 1FBNA 1CZOA 3DGFC 2RGEA 2WUFA 5HIJA 2IA5A 4IIUA 4AECA 5KYKA 3SJCA 1PJCA 1B1CA 4ZCSA 2JJ8A 1EZZA 1AK2A 1V43A 1V26A 2Y1WA 3BWXA 1E89A 5DPMA 2OMKA 1C9YA 3GQBA 4BNDA 4ZK6A 3RDPA 4HNHA 1VSTA 1Z5NA 5JAHA 2VUUA 2ZEJA 3PUKA 1X1QA 4HFNA 1MA3A 3CRMA 4K6MA 4JBHA 4EHJA 3WRXC 5J47A 1FK8A 2CLEB 3MBIA 4Y30A 3EPHA 4MR7B 3AUUA 1LPBB 4Q3CA 4WECA 5T67A 1T2CA 2XMSA 2QGFA 3TVYA 5CD9A 1QR2A 2J0VA 2O2ZA 5HZMA 4YCNA 1NONA 3V4RA 4FILA 2NNLD 4MQFA 3FVTA 4HWGA 4EPVA 3DNPA 2ZW9A 4TL6A 4RBNA 4Y6PA 3NWOA 3MJFA 1GAQA 3A31A 3I1YA 1UM8A 3QKIA 4YXFA 5J4VA 2ZU6A 3QKWA 2P9JA 5ED4A 4WKCA 1KZ6A 4FHDA 3ZHYA 2O0KA 5B7GA 1NQAO 4Q9DA 1VHJA 4IWYA 2P69A 4NBUA 4Q16A 2XXJA 1P9NA 1TRHA 4FFDA 1T9GS 1F1JA 1SQ5A 3ASYA 4HYEA 1M0WA 4KMOA 3RG2A 1KZ4A 3OMLA 4C4RA 2XSZA 1B7GO 1U3TA 2RH9B 3N86A 5DHQA 4TVOA 1WUTA 3TNJA 3NBXX 4K3VA 4OU5A 2L17A 4NNJA 3SSNA 4RPHA 1N3YA 3DPSA 3B8HA 4E5KA 5KMGB 4B1FA 1VHLA 1JHZA 4CGZA 1M5UA 2WD9A 3OEEA 3NNSA 3ZJ5A 4N5MA 2WD7B 2YYYA 4QBIA 2O8DA 2FGKA 1QCYA 5AIAA 1OAOA 2CDNA 5ITWA 5CFMA 3GRRA 3I9V1 5FI1B 3O3NB 5E1DA 3DQZA 3W77A 3L04A 3PXDA 4PS0A 3IVRA 1OGJA 2HM7A 2J6IA 3HZOA 1NT2A 4IW3B 4KR7A 3ZK8A 4JC4A 4I9FA 3PPWA 3REQA 2C97A 1F0PA 3GB9A 3KOXA 4G4JA 4B2IA 4JI8B 2B34A 3AHJA 5HOQA 3E7XA 3CXUA 3PX3A 4ZDKA 1F4PA 4IUCS 1KI8A 2AR7A 1TW2A 2J6CA 1DJOA 3FHJA 3WYGA 3KS9A 2AFRA 4RD6A 3CINA 2CK3A 1GT91 2IHZA 1FBTA 3WADA 5AOBA 3GCXA 3U7HB 4CZ2A 1QOPB 4TYPA 3LZCA 4KXNA 1OXMA 1ZJYA 3TD2A 4CEJA 1UJCA 5JSKA 2DHRA 2VXBA 2IBSA 3OJ0A 1J07A 1EGHA 1SRRA 1E5LA 4XCVA 1A9OA 2I0FA 4TMFA 3I6BA 2AHOA 2JKYA 2LD4A 2QHXA 1GZ5A 1XKTA 2A9VA 2O4UX 2PVCA 2E55A 3KXLA 1QHYA 4PTYA 3GP5A 1O57A 4B0OA 1D2GA 3D8RA 1AMUA 5JSZA 3FUCA 4C3VA 1O95D 1R1DA 1MX1A 2BKEA 3UNXA 2B69A 2ZU0C 4JWKA 2VHYA 5D85A 1KS9A 3VX4A 5JZSA 4RKEA 3LIPA 3DZJA 1MX9A 1QF7A 5TB5A 4WOBA 3UMBA 2ODNA 2ZBFA 3RJ5A 3TLBA 3P19A 3ZDXB 4KQHA 4M60A 4C4OA 5DK6A 2QGZA 2AJLI 5FIUA 5G02A 1C7FA 8ATCA 2HYIC 3NVKI 2HHHB 4DSUA 1JKIA 3PT5A 3TD9A 2TMGA 1XDBA 2HKIA 2YNMA 1XJQA 3FFAA 5HK8A 3RH0A 5T4HA 4BX3A 1WETA 4D9NA 1YVRA 1A4IA 4PCAA 2B7LA 3LY9A 4QATA 5B55A 4N49A 2BFEB 1M2VA 2KSQA 1UPTA 3OU2A 5IPFA 5GIPE 1GPBA 4MPDA 4IPTA 4YAEA 4RJLA 5KOHB 2IHBA 5FBZA 2VJMB 4CM3A 1MQ9A 4NU0A 3E1SA 2A14A 2R11A 5E2IA 4GOND 3ROKA 3GCWA 4TXLA 4D3SA 1D03A 4EOGA 3ORRA 3L79A 2W6NA 3C4QA 3F97A 3RF6A 4CKBB 1GUBA 2WSSA 2FUG1 2FWMX 4LV6A 4P3PA 4MVJI 2AFVA 2ZJBA 3DGEC 4ROTA 4HH1A 4BECA 4DIEA 1W0JA 2LBPA 4FGJA 5K2OA 4F4HA 4A10A 4D4KA 2GUGA 4L0DA 1P7YA 4FUTA 4L7VA 1QB7A 1QOQB 2NUTA 1YI8A 5AKEA 2O23A 2VRWA 1LK5A 5L3RA 5TQ2B 4A0SA 1UC9A 3ZWCA 2FQQA 4DA9A 3LUCA 1U11A 1QMGA 1C0LA 1ZGBA 2XECA 1AGRA 4FYMA 4OUKX 3HYTA 2AC4A 1BVUA 4WGFA 3OHPA 3B51X 4G5HA 1WR8A 4BNYA 4DA4A 4L57A 1YFLA 2BKVA 2BGIA 4NPAA 5BSRA 4QLBA 2R5FA 5F78A 3QVSA 3AV0B 4EY7A 4DGSA 2J4DA 2WYVA 2A9JA 4AYXA 4G0WA 4WBXC 2N3ZA 5JFGA 1U8CB 4UM9D 1HE3A 4K6HA 3EEQA 2RH5A 4Z9FA 2EWWA 3MMXA 1Y8ZA 3R7WB 1K68A 2EEZA 2REQB 4MR8B 5DNWA 3D8TA 1K3FA 2R1VA 3OTGA 1OOEA 2HO4A 2X22A 4J0CA 3TL3A 1Q1NA 3DDSA 1T0BA 4D44A 5FNVB 4ZO4A 4OGGA 3WRYA 4X85A 1U8YA 1RYEA 2HIMA 2I7TA 3BWEA 3FPAA 1P1FA 3IPRA 3NKVA 4JQSA 2AYZA 2ZQYA 4REMA 4KR6A 4K40A 4GUDA 3O93A 1OC2A 1UBSB 1SKYB 2CXPA 2XMBA 3EG5A 4AVYA 4X61A 3RUAA 1H85A 3Q7IA 1O97C 3UCXA 1C0PA 3W0LB 4YMGA 2HLPA 3U5ZB 1QAOA 1R4ZA 3E9NA 5AFSA 2AOXA 2D0OB 4RGYA 4RLQA 1JLLB 3AEYA 4G63A 2ZAIA 1OV6A 4WCFA 3M5DA 3VPHA 3QVXA 4Y2YA 3KKMA 1EJ6A 1RCUA 5K4AA 4U7PB 4AK9A 1MC4A 2WTUA 3ANSA 5TMEA 2AEMA 4P6VF 3BICA 4PLYA 5DNUA 1N5MA 3RCBA 1DTEA 1MB4A 4MV7A 1YU6A 5CPBA 2BMEA 4OXNA 1EQAA 4P3OA 3NDBB 4KO2S 1SCAA 4K6OA 2B35A 1OBVA 5JXGA 2WWXA 1WNFA 5J2TA 1G9XA 3DV0B 4Q9KA 2BZ0A 1GTG1 5FCDA 2UYYA 2Q6KA 1Z7YA 3LGAA 2VF4X 5KEIA 1JEDA 1NW7A 1RLIA 4DPLA 3DMPA 5KDLA 1DQNA 1H3NA 2YMMA 3CIOA 4MDHA 2XCSB 5JASA 1ANKA 3CYFA 1XTSA 1JT9A 4OQDA 4PZPA 1PTJA 4S1NA 2WU3A 1V1MB 3RYHA 3VR5D 1NVFA 2ZIXA 5TQ0B 2CWWA 2BI8A 5FTWA 1R50A 2NPOA 3U9SA 1W4CA 2WNHA 1JEQB 3EY4A 4I46A 3ZCXA 1SC6A 4IUDS 4AUMA 5HGXA 2VK4A 1CY7A 2ZUDA 4G3XA 4NYMR 5J1SB 4DG9A 1MGPA 1G5RA 2KW5A 4XARA 3O4FA 3A70A 4E2ZA 1HLFA 1QAMA 1XCLA 2PDAA 5LBIA 7ABPA 1SA0B 4XYEA 3ZIAA 3GHHA 2YASA 3FYDA 1DIHA 5ARDA 2HA2A 4ZVUA 1ODCA 1Z45A 2B25A 2EFJA 5JPIA 2WB2A 2NTJA 1AHNA 5DISB 3HY6A 1QYXA 1E1MA 2B37A 3DFUA 4XAQA 1ULUA 3UWSA 4DRXA 5JD4A 1E1RD 5G41A 1SG6A 4TYYA 3NATA 1QVVA 1Q74A 4EUSA 1I5RA 4JEMA 5FNVF 1UINA 5CX4A 3FSEA 5FUBA 3V4SA 3ZEIA 2FK7A 5CHEA 3K70B 1SXJE 2W8BA 3BWYA 1M5TA 3G2KA 3CEPB 4M55A 7GPBA 4RTJA 4DGQA 3ISJA 2AN3A 3RLFA 4LBVA 1MF7A 2O2JA 1UEXC 2HWUA 1PJRA 1MJ5A 5BQPA 4R3WA 3JAMA 3N70A 1YZNA 1ND5A 2AFHB 4KLNA 3ZXUB 4C4TA 2JB9A 4OSPA 4E5VA 2YIDA 5DNVA 1N3BA 5T41A 4YV1A 4COKA 3DLBA 3G23A 4F9TA 2Q9CA 4RQBA 2V1XA 4REQA 3QX9A 5GWXA 3TQHA 4LJRA 2NLOA 3D0RA 4ETIA 1GEGA 1RJFA 1R64A 4XTRA 1IIRA 2C2GA 3JZMA 4YV0A 3KAKA 2V9PA 2Y6VA 3BJEA 3NHRA 3K53A 5J2UB 4ENSA 5KYNA 1SU6A 2YBDA 3RF7A 4EB6A 2ZCVA 2C5LA 2UV8A 3H4VA 4LJKA 5FOQA 5REQB 2WJHA 4QDKA 1D4OA 4B6RA 3UHPA 4BFTA 2PGIA 2WRZA 4D74A 1FTGA 1W59A 4OBEA 3H5TA 3QKUA 2DERA 2BKUA 1NE7A 3FDXA 4WV3A 5B3LA 4LWQA 4PX5A 4TL8A 3EDQA 5CU7A 2QJFA 4BU0A 3C3MA 3N2GA 5KTSA 2EFCB 1L5RA 3S1AB 1KY5A 3JQAD 2JD2A 3GUVA 3I05A 2XQKA 3NYIA 1R0XA 5E2AA 3STWA 2AA3A 3BRWA 3E9DA 3PZBA 9ATCA 3EYWA 3QVWA 3R0ZA 2NPIA 4RVSA 5CIWA 1A7UA 1UPAA 1P2SA 1FCJA 3NMUF 5F9MA 4IILA 1HC7A 1R18A 1SCNE 3PUHA 5K03A 1DL5A 4HGPA 4CN8A 4AY2A 1BVRA 5FO1A 1FFEA 5DBHX 1B8OA 1VBFA 4AMGA 5U4XA 1QBGA 3HM2A 1YZFA 1OPRA 3H84A 1Z5GA 3KC2A 2FKNA 4RSMA 3OUTA 5MGNA 3RYCA 3EH2A 1MOPA 3CVOA 2VJNA 1D2RA 3QU7A 4RK0A 3SOZA 3H13A 3LOUA 3NVAA 4LJ8A 4OI0A 2C2KA 2I6GA 1EFRA 3RARA 1GQQA 1Y0BA 2H17A 3IA2A 3NXKA 1GADO 4NICA 4C6HA 3QWAA 1E0SA 1YB5A 2GN8A 3AR4A 2EBWA 3FBGA 3N6XA 4TTSA 4K9QA 3OE4A 5EPOA 1NW5A 3A2KA 3MOGA 2FVYA 4HSGA 1AF7A 1VECA 4KV7A 3CNLA 5H3HA 2PZBA 4UNPA 5DYIA 1UFVA 2XIJA 2WHPB 2XDQA 5HFJA 3LFTA 1GNVA 1TEZA 1X7XA 5D51S 3ZGVA 1RPAA 5BV1A 4F4CA 2WPDD 3MSXA 3HSSA 3SVZA 2XWPA 1KDVA 4CR6A 1E1NA 5DN6A 3M6MD 3DOEA 1DBVO 4WZZA 2Z2ZA 4IMRA 3X0DA 2AQKA 5IF3A 1PE0A 3UJBA 1PRYA 2OD9A 3WOVA 4F6LA 3VPGA 5TGTA 3X1KA 2XZTA 3HTXA 3H2GA 1YQWA 1T2FA 1KOJA 4Q24A 1E79D 3NFRA 1DLJA 3L7AA 5BXQC 3QIVA 2MOKA 4IGEA 1OYOA 1IK4A 1F9AA 2CZGA 2RB5A 1XLUA 4FFVA 1GV0A 1GGVA 1T9CA 1ZINA 2FMXA 3D6VA 3HYRA 3JVVA 3LY5A 4HC4A 4KXQA 1DSSG 1OWPA 3I9MA 5J2UF 1JLSA 2SKEA 3H3FA 3NT4A 2BFDB 5AW8A 3M4JA 3GLUA 1YFZA 3ZBUA 1XAGA 5EKTA 3ZGLA 3F9CA 3EC1A 3K0FA 1MD9A 2PX5A 2WFLA 3JCZA 4YK7A 5EGSA 1NMQA 4J1NA 1OXKB 4KNVA 4ZQBA 1AN9A 4FEAA 3RUCA 4F4JA 3MCVA 3EXIA 5DTEA 3WLRA 4X63A 1S3GA 1TUGA 2VP5A 4LY0A 4WWHA 1IEXA 4JN6B 3RUEA 2FPPA 1SWWA 3UJ8A 2ZUEA 4Y6RA 2I87A 1N2CE 2DU8A 2D2XA 3QLJA 4JLPA 3O4HA 2CXRA 2WIDA 1JDNA 1BXGB 2Q8PA 1TAUA 1UBFA 2AH5A 2QLNA 3DA8A 3D31A 3D1VA 4HFRA 3KHTA 3M1IA 4JLSA 3GVCA 5KYVA 2G0TA 2WB4A 2RHMA 5TF4A 5BUSA 3N0VA 1Y34E 2JZOA 2QRUA 2R97A 1U98A 2X1VA 4P92A 2BLNA 1IWOA 1V11B 2DUNA 2IE8A 1U9YA 1ARZA 1I3NA 2P0AA 4CMAA 1T1SA 5JATA 4YA6A 3B9BA 5TSDA 1EKXA 1E9AA 3QKTA 4JUCA 4AULA 4P34A 2AV6A 2CNKA 3HM9A 2QD2A 3FPHA 3KLOA 1XL0A 3WZMA 4YFVA 1OY1A 4C6SA 3N8DA 5DP1A 3WMXA 1D5CA 4JYPA 3STUA 3MWEA 3WISA 4DQVA 2GCIA 2OK8A 1UKCA 3FMFA 4AJNA 4TWAA 2H1RA 1NOIA 3JQ8A 4P8RA 5ANRB 1CYEA 3A3PA 3CNNA 5EZSA 1FX0B 2G5GX 2NVUB 4B0PA 2EP5A 4EQ6B 2Q3CA 3GELA 4R1SA 2WZCA 4X94A 3GT3A 5IBRA 4YT2A 1V8BA 4LDJA 5K6RA 1IN1A 2RBKA 1N9GB 1C7QA 2Z1NA 3CPHA 5FWXA 4CN9A 1UDBA 1NP6A 4JXJA 2C7BA 1LQ2A 3UWKA 1VCMA 4K9OA 3C3WA 4UBJA 3OQNA 4NG5A 5FFFA 4Y8VA 1NASA 4PRZA 2FMTA 5D84A 2Y0CA 2FZ5A 1DFGA 1OLSB 4CCWA 3G79A 4L2IB 3W4KA 4D8VA 4G8BA 1SBTA 5IVHA 2JH3A 5JS6A 2OHXA 1GL7A 2O2XA 3KZ1E 3UOGA 1ADCA 1G1AA 3HZRA 4BVLA 1RXVA 4FQ5A 3RVOA 1CETA 2JBWA 4OI4A 5IXYA 1RC8A 1THGA 1JKJA 1COZA 1X7GA 2C7VA 3PFKA 3KR0A 4KGVA 3RUIA 1CY0A 4N7MA 3R7DA 1PO7A 5ALXA 3ROPA 2H4HA 5K3DA 3OOEA 1L5FA 1HDRA 2E4UA 2AJCA 3QITA 4MWBA 1D1TA 2X23A 3A4LA 3HKCB 4WXYB 4AS3A 5AI8A 4EHDA 5IT0A 4JBLA 4JAVC 1ITZA 1AS3A 1CS4C 3GX1A 2GAIA 2YIMA 4INOA 1O96B 4PSAA 2AKAB 1JB1A 2X7JA 2AOTA 3O8OA 3VR5H 3G2JA 1I1OA 1DXYA 2B4RO 3RIGA 1MXHA 2KBFA 2H2GA 4C2BA 4ENVA 1DTWA 3G9QA 4PTZA 3NM5A 4XDYA 2XQGA 1P8JA 3LWBA 4K6GA 4BNZA 2G17A 1JYEA 3KDSE 4LI0A 3QMVA 4EJ0A 3K92A 3CG0A 4JNCA 3ZJTA 5AM1A 4D97A 3HRKA 2K2QB 2ZYSA 5LU8A 2ZITA 2OXFA 4A8HA 5ALTA 1SBNE 4OYHA 3LYHA 1GTRA 2XQIA 1I9GA 5JYEA 2Y1CA 5A3VA 4BJ6A 4CMEA 1P2BA 1Z18A 5KNBA 1IXRC 1E9FA 2GVZC 4DIFA 5FA5A 1E62A 1DV2A 2O5CA 1OZ0A 2C4NA 3DWIA 3UA3A 7MDHA 3KTOA 3X1DA 5IABA 3W7AA 3F71A 3U3JA 1BEUB 1PR6A 1R6UA 3DYBA 3EJWA 2ZUCA 3FI0A 1V4VA 2O8EB 2Z1MA 4KDRA 1PR3A 1FFBA 4MEJA 3KUDA 1RAAA 4BVBA 1OXXK 3V8RA 1CVLA 2VJOA 3OCCA 3QELA 4LXGA 1KDRA 5C46F 1G7RA 2OD2A 3A9WA 3GF4A 3PVZA 4M22A 2RJ3A 4ENQA 3D4PA 2GAAA 1GTVA 2Q0SA 3GCGA 5AESA 4CU5A 1VSVA 4UQOA 4NV1A 1BX3A 4F45A 2OZEA 3I76A 1RMQA 4E1BA 4TGLA 4L0QA 3KJHA 4HUQA 1J2EA 3OT5A 5AW1A 4M7WA 1TTQB 5I7UA 1V8PA 5AJWA 1WIWA 5FH9A 4JP8A 3IDOA 3HH8A 3OCWA 1ZVKA 3P9XA 1TFRA 1TCCA 3AETB 4I5GA 4NBSA 1J0CA 3BCUA 3VHQA 4YJGA 1X6VA 5DW3A 4FCCA 4YTEA 1NWHA 1YHZA 1AHPA 3CZMA 1MAUA 3RNLA 4FN5A 3PL5A 2JAOA 2HPAA 1ONOA 1DCFA 1BJTA 4M0MA 3IT2A 4E12A 5EERA 2YVLA 2Q5EA 5DMXA 5G0TA 5LQDA 1EUCA 5ENDA 1QK5A 2CLCX 4HHEA 5BMVA 3HJUA 4GIBA 5EZQA 4DV0B 3IV6A 4IAOA 4QJ4A 1G38A 4HH3C 1T3HA 3HFSA 4RQTA 4Y2HA 2FMKA 3UJDA 3UMYA 1H8HA 3TQCA 1XX6A 2CFCA 4BN4A 4W5OA 1VG1A 4E5NA 1ZA2A 2WJAA 4PZYA 1QNLA 1A8UA 1N6HA 4KUHA 5JSUA 3B1YA 5HQ3B 4MGYR 1L5HA 1H6DA 2Z0MA 4B9AA 1VJ0A 1W4BA 2BUCA 3IPXA 1X42A 1JJIA 5I4KA 4DLTA 2IY8A 1D1SA 2PJDA 2Z3VA 4URVR 1KETA 5EJAA 4DREA 2B6NA 3DQQA 5KJCA 1QCCA 4B8ZA 2YHAA 4N5DA 4KI0A 4PQFA 4C76A 4EG4A 1L1EA 4CMGA 3TX2A 2ADOA 3C70A 3P45A 4HGRA 3TB4A 5KBYA 2B5VA 3PHLA 2CYAA 1MW8X 3UH0A 1I4WA 1ZH6A 1YHNA 1HDCA 1BRTA 3LECA 2CLIB 2WUDA 3HBLA 2YY6A 3OEHD 5G0SA 3DT6A 4WZAB 2IS1A 1E1CB 4F11A 2H07A 2OPBA 2XHEA 1VJ1A 1U2SA 2AC2A 3MILA 5HKAA 2X13A 1DKNA 2HZBA 1HOXA 4KOAA 3RRZA 1Z8NA 4BB6A 1Q7RA 2GPNA 3AI3A 3JVIA 1CERA 4O4IA 5THKA 4BMDA 2DQYA 1J22A 2ALJA 3VTKA 1SIBE 1NF3A 3UK6A 2BTEA 3L0SA 2FDCA 1ZXLA 2QZ9A 2VKTA 1PBTA 3GD7A 4X1YB 1TGYA 3RIYA 4EZBA 5K01A 4QLAA 4EENA 4D02A 3Q3EA 4YX9A 3QE9Y 4BMOB 3PXAA 3BSYA 1YS9A 4TWZA 1ZQ9A 4J91A 1YOBA 2XBUA 3U4QA 1YRHA 2VPPA 3DE0X 1M6EX 1EFTA 2BGKA 3L77A 4L22A 5FT9A 3HXMA 4XVHA 1A9RA 1BE8A 1UXOA 1X9IA 2GBFA 2LR0A 3MUNA 2BHTA 3UJ9A 3VO8A 5SZKB 4F6RB 5ALZA 2I3BA 3NG1A 1M2OA 2XLCA 4DNPA 1CY6A 1EWQA 1ZM3A 2ZR8A 4ZI5A 2VP2A 1M1YE 4G0UA 2OVFA 1U2DC 5M04A 2VYND 4P58A 4XPZA 2JLXA 4H59A 1BDJA 2Y77A 2VXYA 2ZRHA 5DF1A 3ZH2A 3AH8A 1M34A 1T3ZA 4GXQA 2ZDHA 2QTCA 4OQYA 3FCSB 5EHIA 3R3SA 4KN6A 4ZVKA 1UOOA 5KQLA 2C9YA 3Q87B 3IXMA 2GZAA 2CV0A 1P1HA 1F4VA 5C8XA 3II6X 2AZDA 1TA9A 4JXXA 4LRXA 3V42A 2XVZA 3KOZA 2WWHA 1Z0UA 5LOVB 2WAOA 3O9VA 4R1PA 5A9TA 3CVYA 1ORRA 2EW2A 2OBNA 3B1KA 5BOSB 1YZTA 3TGPA 5HOEA 4C5CA 2W7TA 1MA0A 1VGRA 3AHIA 3TLAA 4O08A 1KQ3A 2DM6A 1ZLXA 3ABOB 3IVGA 4QOEA 1G21B 5HF5A 1FUIA 3STTA 5FFMA 5A03A 3EPLA 1QU2A 1YS1X 5AXBA 4CDRA 5KKCA 3W5DA 2X8BA 5IEBA 2QB5A 4EUFA 3NIWA 4N40A 1ORIA 4JEIA 3IKVA 4QQRA 3COVA 4QU0A 2F1OA 4IH1A 5LYJA 5C1DA 1ZM9A 4DR2B 3BT7A 4II3A 3TLJA 2WJVA 4V0MA 5IUNC 2AJTA 1KPGA 1AOXA 1U90A 4RTNA 1JVSA 2YJGA 4JR0A 5HQTA 3W8NA 3NQ41 2EX4A 2OV2A 1O9BA 2ISCA 2VZ0A 3P4UA 4I36A 5ER9A 5F1KA 4I50A 1ECLA 3ZZ1A 5K4GA 1N2EA 1J90A 1K5GA 5C1BA 1DUSA 3HNRA 1Z5VA 4BO5A 1HNNA 3GRVA 4XASA 3I3SR 2A0YA 4F56A 1WABA 4TLAA 4GE3A 2ZE7A 3RIMA 4MWSA 3FGNA 1DJLA 4LXHA 3GJ5A 2R6AA 1Y8QB 5CD1A 2R68A 3EJ6A 4B43A 1CEXA 3ANLA 4B75A 1Z82A 2WKQA 3WK9A 4CM7A 4ENRA 2H1FA 4BWYA 5IXJA 2X6TA 1KOGA 5DRYA 1RHQA 3KL2A 3NB0A 1R00A 2FEXA 1PGJA 2NSLA 3B5EA 4GG1A 4AY3A 1U2EA 4EL0A 1A96A 2EFHB 1E6CA 2OBXA 4UASA 2CDRA 3NVDA 3R0QA 1Y3BE 5CLHA 3FPBA 2Q8QA 4CJXA 2FRDC 3HA7A 3HJFA 1D8AA 2VDRB 3CLTC 4O8CA 1RZUA 2SKCA 1JDBB 2HSDA 3KQYA 4E4RA 2QLFA 3PR3A 3BRQA 3NUZA 1X86B 4JI7B 3T94A 1VHDA 2NADA 4BN0A 1Z5ZA 3WYEA 4N7BA 2W71A 3A2LA 5E6UA 1USKA 5HIAA 3KLMX 3ZEAA 3PUXA 2AJBA 2B8JA 4RZ3A 2O7RA 1MAVA 2H1VA 2F3QA 3OTHA 5HBGA 3G0IA 3PNPA 3H9JA 4LZOA 3T3GA 2V03A 3RM3A 1EE9A 1JHYA 1UIRA 2VDPB 3LP8A 2HC9A 5CG2A 2H1OA 3PJGA 1M0SA 1OAAA 4GI1A 5DHFA 1YKSA 3B6IA 4EWLA 1ZQ1A 1VBKA 3FPSA 2CL7X 2FX3A 1GO2A 2JARA 2JJ2D 1C1DB 4K5QA 5IDWA 3NM4A 4K87A 2PS3A 3DWEX 2ZRIA 4OX9B 1Q0LA 4QUBA 1FRNA 1NXPA 3HRHA 3K20A 1BSVA 3MTJA 3PENA 4PGMA 3OZVA 4MQ5A 1QPGA 4EKNB 4PQYA 2X40A 1JRLA 2C20A 1VMKA 1IVSA 3PQCA 3KJNA 3QYFA 1QFYA 4K2AA 5IBPA 6CHYA 1DP4A 1QVAA 1KK0A 2GCEA 3B2EA 3AOEC 2XEDA 3FPCA 3VUFA 1XCMA 4EW6A 5EQFA 3NTUA 1FQJA 3X2SA 4WMLA 1ML3A 4HZUB 1W8DA 4GKBA 1P9LA 1U7OA 3FMPB 4QDUA 4UU1A 3B1XA 3UAVA 1ENYA 2BONA 4NZOA 1MX5A 4Q4JB 2BZGA 2G7MC 5HGJA 2CHGA 3I09A 4F4FA 5LP1A 4Q3BA 4BDTA 3O38A 3CS3A 4X1OA 2VQDA 1U5CA 2Q6VA 4XUGB 3AHGA 3SQOA 3EASA 2HIGA 1BFUA 4UM9B 2C3MA 1LBEA 3VOSA 2TSYB 1PJ8A 3EUFA 1EFAA 4JZKA 4EAQA 1HGXA 3KTAB 3TIGA 3E9RA 1J97A 3FIUA 4KJZA 4EHLA 1PSDA 2ZPTX 5J4YA 3ADPA 2CLMB 3SM9A 4J1SA 3U1BA 3NJRA 1E1DA 1FNCA 4CKZA 3OOYA 1Q12A 2Q2OA 4IXMA 3BL6A 2FPKA 2NZ2A 4OHPA 2Q4EA 1NBMA 1O89A 1MH9A 1WCYA 2CF6A 2PGOA 3RD5A 3UATA 4D9KA 4B3SB 4EECA 4N82A 2C9CA 1XC7A 1QAQA 2C9DA 4WY5A 2FWBA 2PU7A 4UTZA 2XA1A 3RVDA 3M9LA 3VISA 1PFGA 1FFHA 1CU1A 3D1JA 3IQZA 1Z07A 4LRUA 3X3HA 5HK9A 5ALDA 1U9ZA 2LCQA 1PZXA 1RE0A 4LYFA 1O0BA 5JDIC 3DL4A 1R4NA 3K35A 4RMGA 4AROA 4NXNB 2XNJA 1E3SA 2JFVA 4R84A 1IRXA 3N3BC 4S1PA 4BDSA 2PGAA 1XZHA 4GPIB 5AUPB 1AF4A 5AIBA 4MUIA 1F2UA 2W37A 3E7DA 4WKPA 3CEJA 3FNIA 3QEKA 4HKTA 3DAPA 1XTVA 1IM8A 3QLTA 5FUYA 2BHLA 2G4CA 4L74A 3NALA 5DGIA 1GFSA 2GD0A 4JB8A 1BEEA 3NHAA 4A91A 3J81k 2JLYA 3V8NA 4Z0NA 3DJFA 2JAWA 1B6SA 4HMPA 4KKVA 4GSKA 5TJ9A 3RHFA 1GRRA 521PA 4RTPA 2XNKA 3LO8A 4RZSA 1NDUA 2CCKA 3O7WA 4NH0A 4P53A 5E6SB 3NAMA 3TK1A 1L1FA 3TLGB 1F8YA 1F3LA 2G5TA 4N41A 4ZD6A 4NXMB 5DX0A 4UUAA 5LDDC 2J9YB 1RXUA 4ZVOA 3T5AA 2BEWB 4LVCA 1TYEB 1E8MA 5FRDA 1JFVA 5IAAA 1OLUB 4MQLA 5LQMA 2AYYA 2QTNA 3O4RA 1DARA 1O87A 3VU8A 1ADJA 3GMTA 3H2HA 4HH4A 2P68A 2GPBA 3E05A 3OFND 3NJ8A 3ZW9A 4IFBA 1EK2A 4NFSA 4EM6A 2CJYA 4LCEA 5DLEA 2I8AA 4XPIA 1U2TA 4BCDA 2XMPA 1DKRA 4U2DA 1J70A 3I1IA 4P3NA 3G0HA 2PZMA 4MR7A 1XVUA 1PUIA 4LYGA 1M66A 3UAXA 4MEBA 2VP6A 7ADHA 5P8WA 5JAIA 2H1SA 2J9ZB 5AJXA 3WXBA 2AC7A 4P36A 1KZ1A 2XYGA 1A5AB 2G9UA 4X84A 4DIUA 1ULHA 3NEJA 2DOKA 2OO7A 1DAKA 3ADKA 3PPYA 3L0OA 4HAVA 2PMEA 2JCXA 5BURA 2DPYA 3ETLA 3DFFA 3RGGA 1GR0A 1NF2A 5A05A 3LD9A 4QYSA 3KK0A 3M1AA 3WICA 3FYSA 1XN4A 1DKOA 1E2HA 1NNI1 3LQKA 2CD7A 4FK8A 3RFUA 4DILA 5ADHA 3UGQA 1P81A 1KWKA 3PQ8A 4QBKA 4V39A 5IMSA 3QKSB 5T6BA 1ZPDA 2IHYA 3A6FA 2VSQA 3HC7A 3OLQA 3OZEA 3OBBA 3UJNA 3LOPA 2O3UA 5CBKA 2Z2KA 1UJ4A 1JPNA 1W0CA 2ZSDA 1L7XA 1OI7A 2R4QA 2XOEA 5EN4A 2HA3A 3WBBA 5DBGA 3H19A 5U1PA 1IZ9A 5BRAA 3R8FA 1EJ0A 1I51A 1T1GA 1OA0A 1T6BY 1H23A 4MKHA 3ZCVA 3T5PA 3V3KA 3AJEA 3TI9A 1KK3A 2WD7A 3OMWA 4WJKB 4IHJF 4AX8A 4P5DA 5JY6A 3LIIA 3A7DA 3GZJA 4P1ZA 1DCTA 4BGEA 3C8DA 1T5SA 3ROQA 3ADBA 4OHBA 2ISQA 4NDNE 2QAIA 4YFYA 1LTHR 2VBGA