2BFNA

The crystal structure of the complex of the haloalkane dehalogenase linb with the product of dehalogenation reaction 1,2-dichloropropane.
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
294
Chain Sequence
LGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Weak Activity of Haloalkane Dehalogenase Linb with 1,2,3-Trichloropropane Revealed by X-Ray Crystallography and Microcalorimetry
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords HALOGENALKANE DEHALOGENASE
total genus 109
structure length 294
sequence length 294
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2004-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bfnA00
4J0CA 3WA7A 2OCLA 4G4IA 4BRSA 1PV1A 3ZV7A 5JIBA 5CT8A 1HLGA 5DLPA 3A2NA 4HAIA 3STXA 1QIGA 2JBWA 4INZA 1ZGBA 5ALUA 3D0KA 1BEZA 5AI5A 4X92A 2R11A 5HK8A 1T2NA 1CUUA 1UT6A 2C0QA 2R8BA 1VZ2A 1BCRA 3FCYA 4K6GA 2XQKA 1CUJA 2I03A 3QPDA 2XUPA 1YAJA 3G9ZA 4MJ3A 1IZ8A 3PF9A 1TCBA 1ZI8A 5FUMA 2PPLA 5CXXA 3WKDA 1EHYA 2WIKA 1Z68A 1G42A 4W1SA 2D5LA 2QM0A 2XB6A 3ZLVA 4QA9A 2QMQA 5C8VA 1Q0ZA 2QUBA 4GXNA 4N5HX 3H17A 5AK6A 1XZLA 5AM3A 1QIJA 4Q3KA 1ODSA 3VVMA 4WCVA 2DSNA 5JD4A 1C7IA 4Y2TA 1XQWA 2JEZA 5IH7A 1YR2A 3HXKA 4EY4A 1UZAA 4OUKX 2XUFA 5AKJA 5JAUA 3A2MA 4LIPD 5YASA 1CUAA 4OCZA 5AOBA 2V9ZA 4ZI5A 5KREA 1FFDA 4AXBA 4CI9A 2XDWA 3V1LA 4V2IA 1LPNA 1WPXA 1QJ4A 2RI6A 4EUSA 2I78A 3FNBA 3R41A 2WIJA 4X71A 1YCDA 1CUVA 3W04A 5CBKA 2XMGA 1ZI9A 2WUFA 3AIKA 4UBLA 4LHEA 1ACJA 4EY6A 2WFMA 4BVLA 3SC2A 4A16A 3WK9A 1AQLA 2VSQA 5ALXA 4UBNA 3DKRA 4Y2RA 3R3VA 4N8SA 3HABA 3H2JA 4B0PA 5DYWA 1LZKA 4JYMA 4BAZA 5LZ5A 1EX9A 5E4TA 4B84A 4LXGA 4RPCA 5AP9A 5ALVA 1P0MA 4Y2PA 4ZGBA 5CT4A 3QYJA 1MT3A 1X2EA 4HVTA 4MWTA 5DNVA 2OXEA 1CVLA 1D07A 1TRHA 4RE5A 2GBFA 1GKKA 4E46A 5AM0A 1VLQA 4LXIA 5DJ5A 3LLCA 2HHAA 4CG2A 1JJFA 1P0QA 2ZSIA 3KWJA 2WHPB 5A2GA 1GXSA 1TCCA 2LIPA 3PDCA 4MXDA 2J4CA 4W1RA 2HFKA 3PE6A 4DMFA 3WZLA 4DNFA 3H1AA 5ALIA 4QNNA 2OQVA 4B85A 3HACA 2HRRA 5I7UA 4Q05A 2WJ4A 4GECA 4M0FA 4OB6A 4QEKA 3ESDA 1QIDA 3Q8WA 2PM8A 4M0MA 4TVKA 1U2EA 1MU0A 3IB3A 2OCKA 2CUTA 3P2MA 3R3XA 3M81A 1UKAA 4X91A 3F9CA 4FNGA 5ALRA 3C5WP 1AGYA 3G0BA 1W4LA 1QE3A 3AINA 5BWCA 1XLWA 4J0GA 1CUDA 3OTQA 5CH5A 1WOMA 3T4UA 2Y2VA 2HA2A 4QDOA 1T4MA 2WU4A 3IVMA 2CB9A 1WCYA 4X93A 1SOMA 1BN7A 3D59A 2QOEA 1CR6A 1SCQA 3I1IA 1QZ3A 1XZGA 4C4XA 4P92A 4UBJA 1XZKA 2O2IA 1XLVA 4B80A 1R9MA 3YASA 2HDWA 4BZZA 1WB6A 4ZREA 1QLWA 3WA6A 2O2HA 2GBCA 1LPPA 3I28A 4G4GA 4MEAA 2YXPX 4IQ4A 1UOQA 3KDAA 3RM3A 3UUEA 4FHZA 2HM7A 2QVBA 3X3HA 2DCMA 5K3AA 4JEIA 2XE4A 1RYYA 4E11A 2XMQA 3G9XA 1CQWA 1XZBA 2JGIA 3VVLA 1IVYA 1A7UA 3IUNA 3GFFA 3LP5A 5AKLA 2VF2A 5A6VA 4J0HA 1XZEA 5AOCA 3H2IA 3NOXA 4XWGA 4C4YA 2DHDA 4AO8A 1CUXA 1ZICA 1LBTA 2WFLB 4Y2JA 4EZIA 3C8DA 1C4XA 1UOPA 2CEKA 4MWSA 4OSEA 4GWLA 3QITA 3STYA 2VJDA 2XQGA 2GYVA 4B82A 2XUDA 3BDIA 3QBJA 3AIOA 1R88A 2DQYA 5LZ8A 2XUJA 5AKZA 5FDFA 3RKSA 2WTNA 1ZJ5A 1KEZA 1BCSA 3C6YA 4G8BA 4YX9A 4UFPA 2OPHA 4FDMA 3F8SA 1O6GA 2H9YA 3M83A 4OYLA 1EDDA 5K3BA 3WWPA 4LKOA 1QO9A 3B3QA 1EVEA 5AO9A 1EB8A 3WYDA 4P9NA 2WSLA 3ANTA 4GI1A 5DWDA 3OM8A 2OCGA 2ONCA 4QDZA 1JJIA 1E89A 2ES4A 5C8ZA 4CCYB 3C6BA 4I19A 4OU5A 2W6CX 4G8DA 3EQ7A 1N5MA 1EVQA 1BEEA 3G02A 1XQXA 2AJBA 3MUOA 3OG9A 3SX4A 1XRLA 4L72A 1BU8A 1J06A 4C87A 4AN0A 2VA9A 1CQZA 4L0CA 3G9UA 3O9VA 3PUHA 4FBMA 2B4KA 3PFBA 5HF5A 1LBSA 3MVEA 3VJLA 1LNSA 4MQMA 5AK4A 5AM4A 4MYSA 4K6HA 2PSFA 2VJCA 3IIIA 2CZQA 3IUQA 2BUBA 3AIMA 5HK9A 1IUOA 4CG3A 1F6WA 2IX9A 5JZ9A 4UBKA 4QLAA 4NS4A 3PI6A 1SC9A 4QDTA 4HXEB 5AKKA 1YA8A 3V1NA 5EIHA 3KD2A 1W6RA 4DNOA 5AM1A 1HKHA 2JGJA 5IKXA 2VEOA 1N5RA 1MPXA 4CIAA 1HQDA 5FV4A 1JI3A 4A23A 4ROTA 1XZDA 2HFJA 3ED1A 3HLKA 1EB9A 4PSUA 2WG1A 3E0XA 2JGMA 5AI4A 2HA3A 1DWQA 5FRDA 1JT2A 1JKMA 1XZMA 5AOAA 4ARAA 1FFCA 3DCNA 2BFNA 3VKFA 5LZ9A 2W22A 2ORYA 3BJRA 3D2AA 4BDSA 4UHBA 4HRXA 2ZJ6A 3WL5A 3R3UA 1ACLA 4XX1A 3JW8A 5AKHA 4CFSA 4H35A 3WWDA 4G4JA 4Y2UA 3MGAA 1F0NA 1LPSA 1XZIA 3AUKA 5BWBA 2Z3ZA 5HKBA 1UKCA 1Y37A 1L7RA 5CMLA 3I6YA 1DX4A 5K3FB 1P0IA 5ALTA 3R0VA 1DTEA 4W63A 5F4ZA 2AJCA 4W1QA 1L7AA 3ESBA 4U2GA 2VT7A 4KRXA 3ZLTA 1ODTC 1WM1A 2OGZA 1EK2A 2Z8ZA 1THGA 5FP0A 1CUHA 4ZV7A 4UFOA 2YH2A 4AX4A 1H2XA 5JALA 3STWA 2O2GA 5FPPA 2ACKA 5JYCA 2QJRA 3PUIA 5AK5A 3WIBA 3E4DA 1EH5A 3EQ9A 2QR5A 4J7AA 3ICWA 1IZ7A 5DNWA 4L3WA 5A7HA 2WUDA 5T4EA 3C6ZA 4AO7A 4S0XA 1X70A 3ZI7A 4Q82A 5C81A 1CUGA 5EFZA 3QPAA 2FX5A 3GUUA 1FFEA 1MAHA 4FNMA 2ZYIA 1JU4A 3HRHA 3VDXA 5AJHA 2PSEA 2HA0A 3LCRA 4WFKA 1CUCA 2OGSA 1H23A 4OB8A 1UK6A 4KAFA 4LXHA 4I4CA 2XMDA 4C88A 3AZQA 5IVKA 1AZWA 5HF6A 5EIEA 4FTWA 2QS9A 4Y2SA 1QIHA 3G8YA 3AZPA 1XQYA 5EIAA 2Z5GA 1W52X 2XUHA 1AC5A 5LZ4A 1FSSA 4J03A 2PSDA 5LP1A 3QM1A 2QZPA 3GBSA 2Y2UA 1UK9A 1CV2A 1N8SA 1XRNA 5AKYA 3SK0A 1QGED 3B12A 1VXOA 4F5ZA 3FVTA 4RGYA 2JGKA 3MUNA 1FFBA 4FOLA 2X8BA 2OQIA 1K4YA 2AXEA 1UKBA 3O4HA 1UK7A 4W1PA 5D3ZA 5E4YA 4J0JA 4K2AA 5DTJA 3RARA 1RWQA 1ZI6A 4ETWA 4DMKA 2C4HA 4WFJA 1QIEA 3EIOA 2VT6A 2GZSA 4PQEA 4KRYA 4C89A 1LPAB 2YYSA 4PV7A 2Y6VA 4AZ3A 4X6YA 4LYEA 5ALZA 1BE0A 5AICA 3WWCA 5JZSA 4PW0A 4H0CA 5CTAA 1UFOA 4PSCA 3WKCA 1E5TA 5HQ3B 5T4FA 3C87A 4H77A 2ROQA 4PO3X 3C5VA 2WIGA 1LPBB 4DLNA 2QTBA 5ALEA 5LYYA 4KE6A 2WLSA 1AUOA 3G9TA 4U2FA 1QIMA 1YB6A 2XQJA 1YS1X 3BIWA 2Y1KA 3R3WA 5JZBA 4QWWA 3G0IA 5LKRA 3O95A 2XUGA 1MJ5A 4JYPA 2XUOA 4EY7A 3OURA 1AX9A 2CKMA 4BYMA 3RK4A 4B83A 3NUZA 3VISA 4G1FA 3BE8A 4G9EA 5CH3A 4C6HA 3G0DA 5JAPA 4M0EA 2XLBA 2C0PA 3PFCA 4NVRA 1DX6A 3W05A 1TKRA 2PUHA 2HU5A 4ZWNA 1R3DA 5HFNA 3AILA 5A7GA 4BATA 3PICA 4Q3LA 5FOQA 5BV7A 4WY8A 3C8HA 5AHXA 1R4ZA 1J2EA 5JASA 1GGVA 2BJHA 1ZD2P 4OD0A 4CCWA 2FJ0A 5AH0A 1OILA 2HRQA 4A5SA 1MX5A 3B5EA 4N8DA 3E1GA 4F21A 4UBOA 2HIHA 1CLEA 3KXPA 4B7ZA 4ARBA 5HF9A 1G5FA 1BN6A 3C43A 3GROA 4I3FA 1K8QA 3EQ8A 4MYDA 4BB0A 1DU4A 3R40A 1SCKA 3W2TA 1EA5A 1J1IA 4FFWA 3FLEA 1JMKC 5ALJA 4U2CA 3D2CA 1CUEA 1UK8A 3H2HA 1MX9A 5LKAA 4DYHA 3DL7A 5A71A 2C7BA 3TEJA 2EDCA 4BC0A 4FLFA 1TIBA 3QH4A 4NMWA 4GW3A 4C01A 5K3FA 2QRUA 2HL6A 5JAOA 1HBJA 1EINA 1IUPA 1FFAA 1WB5A 4J0IA 1JJBA 2IITA 3IDAA 5DNUA 1VOTA 4K6KA 3ESCA 3FSGD 4X90A 1QO7A 4OB7A 5FKJA 3GELA 4UUQA 2JGFA 1W76A 5JD5A 2AJ8A 3I2GA 5EHZA 1MAAA 5C8XA 5EHNA 1VKHA 2WHPA 3NGMA 2HA6A 3ZPXA 4BTLA 3FYUA 5CH8A 4UHDA 5DTIA 2CBGA 2JF0A 2WFZA 3ZLUA 4X7BA 3ESAA 2EEPA 5CT9A 2O7VA 2QXTA 3WIOA 2BUAA 1CUBA 3U1TA 1GZ7A 2AJDA 3BIXA 4H7FA 2PU7A 3CCCA 3KOOA 3S8YA 2HA4A 3DQZA 3WZMA 1DQYA 3C45A 3IURA 4BBZA 3I6MA 3KWFA 2OAGA 2QKYA 3FYUC 2PKYX 2NW6A 2WUGA 2ZSHA 4LYDA 2OLEA 4QZVA 1G4HA 5HFAA 3L1JA 2PL5A 3F96A 1UWCA 1TAHA 3DD5A 1MTZA 2PVSA 1AKNA 4UHFA 3SWWA 3FAKA 1ZJ4A 1MNAA 4DM7A 3G0GA 3AFIA 4AQDA 2GYUA 1G66A 5CRIA 1EI9A 5JARA 4C4ZA 4AN1A 3A70A 2PBLA 2ZYSA 2XMRA 4BDTA 1JMYA 3WL8A 1U65A 1GPKA 1ZD4A 1CPYA 1Q83A 5ALYA 4FFVA 4MQLA 4EY8A 4NZZA 2X76A 5IVDA 1PJAA 3V9AA 2VJBA 2J3DA 3WJ2A 3R3YA 2BGRA 2J3QA 4QDXA 2AJLI 4BCDA 1XLUA 2OG1A 2ACEA 3WWOA 3HYSA 5JANA 1MNQA 1E8NA 3N0TA 3CXUA 4GDMA 1LPMA 3WYNA 4KEAA 1EK1A 4FBLA 3E3AA 2QXUA 5E4JA 5LZ2A 2VJAA 4XIIA 5HQ3A 2FJPA 3PF8A 2OAEA 5K5EA 4DSZA 1XFDA 1EXWA 3M3DA 2D0DA 5CURA 1UXOA 5CW2A 5FLKA 4JUIA 3H19A 1LZLA 5E2IA 4W9RA 2PU5A 2E3JA 3D7RA 4KAAA 4BCCA 2WKWA 2WFLA 1XZHA 3H2KA 4U2BA 4KJXA 1CEXA 5ALKA 4HRYA 3DEAA 4Y2YA 2I3ZA 3I2JA 4IH1A 5JAHA 2Q0XA 1DINA 3IUMA 2BUCA 3VXKA 4BAGA 1E8MA 2BAGA 4FLEA 1BROA 2BGNA 4UFNA 4EY5A 3LIIA 5ALNA 4CIBA 3WKEA 1W75A 3I2KA 1U4NA 1KU0A 4ITVA 2OGTA 2VAXA 3WJ1A 1LGYA 5ALMA 1GPLA 4DSAA 1KU6A 1A8QA 1CUIA 3D4LA 3FLBA 1ZOIA 5ALHA 5HKAA 4GBGA 2QJWA 1E8DA 3FLAA 5D7BA 2H7CA 2RHTA 3H04A 2WU3A 2DHCA 3WL6A 2Y6UA 3IBTA 1THTA 2G5PA 1OCEA 1LPOA 3IULA 2XT0A 5K3EA 2XMSA 2DFPA 1I6WA 1E66A 5LLSA 5ALSA 3QVMA 1XRPA 1GQSA 3GA7A 2C5GA 2GZRA 3KSRA 3F97A 3WK7A 1N1MA 1P0PA 4AB1A 3M82A 1ZGCA 3I2IA 5AM5A 1XZJA 5HZGA 4Y2QA 4JH0A 1B41A 2WM2A 4N8EA 4UHEA 2JGLA 3BL8A 2QT9A 4OYYA 3F98A 3QMWA 3FSGA 3DOIA 1QFMA 2JEYA 1TK3A 3EF3A 1JFRA 3BF8A 4X00A 3C70A 2HADA 1CUYA 3CN7A 4AMZA 1VA5A 3C6XA 1HPLA 3BJMA 2EDAA 5AM2A 1QIIA 2ZJFA 5A62A 2ZJ7A 2GBIA 3QMMA 3FWHA 2XI4A 3DL4A 5JADA 4WY5A 3WL7A 1XRRA 3QZUA 5AI8A 4IO0A 3DYVA 5AKEA 4QWMA 4OPMA 4Q3OA 4J0KA 1YSCA 5KWIA 4GEGA 2WHQA 4BVJA 4EBBA 4YPVA 1QOZA 2BKLA 1Y7IA 1OXMA 5T4HA 5AIBA 5J3JA 2DHEA 4H7IA 1K63A 2Z3WA 3H18A 1F0PA 1QTIA 5IVHA 2X5XA 3K6KA 1CIJA 4WJLA 4H7HA 1SFRA 1DQZA 1H22A 5ESRA 2ECFA 2O7RA 4ZV9A 5LIPA 3TRDA 4DGQA 2H7YA 5ISMA 2ZYHA 5K3CA 2CJPA 2XQFA 4RE6A 1A88A 5C7YA 1VZ3A 1W1IA 1WB4A 1A8UA 1NU8A 1QIFA 4E14A 5D6OA 2WG2A 3TGLA 4WDRA 1USWA 4EA6A 1L7QA 3RLIA 2PSJA 3U0VA 2GYWA 4HTAA 3BXPA 1GKLA 3L1HA 2VTVA 4JNCA 5AI0A 2FUKA 4G9GA 1QIKA 4KE8A 3WLAA 1MX1A 4X97A 1UOOA 4ZXFA 3UMJA 2WTMA 3IA2A 3EBLA 3I2FA 4O08A 4BAUA 1HDEA 5FPQA 1WHTA 5EGNA 2DR0A 4HS9A 3DS8A 1QTRA 4P08A 2XQIA 1ZD3A 2PUJA 5ALWA 3FYTA 3DJYA 4WDQA 1XZFA 1NX9A 2XUIA 4J0DA 3O4GA 2RONA 3HI4A 3FVRA 4U2DA 1MN6A 1ORVA 1FJ2A 1LLFA 4F0JA 2PX6A 2VQ6A 2HA5A 4G8CA 3WMRA 4BCBA 5SYMA 1EDBA 2HA7A 1GT6A 1S8OA 1XZCA 2WIDA 2QUAA 3K9BA 1IMJA 3BWXA 1H2WA 4K5QA 4Y9SA 3JYHA 5AI6A 3DDUA 3FCXA 3G7NA 2BCEA 3G0CA 4X3CA 1WPRA 2V96A 4BP9A 1R50A 3WK8A 4XVCA 2XMCA 3BDVA 4PF1A 2HU8A 5HCUA 4FLMA 4PSDA 3R3ZA 4B9EA 2VATA 4H7JA 1WHSA 5AIAA 2JGEA 1RP1A 4UBIA 2G5TA 2YASA 4Y7DA 1CRLA 3LS2A 5CT5A 4P93A 3V1MA 1E3QA 4DNQA 1BRTA 4H7EA 2Z8XA 4ZRDA 3WKAA 2RHWA 7YASA 3DNMA 3NWOA 4J3JA 1VA4A 1K6EA 3IUJA 4Z49A 1H2YA 3CN9A 5BOVA 3ZWQA 3UUFA 5ALGA 4DNPA 1CUSA 1K5PA 5A7FA 2XMZA 3ANSA 5JD6A 1CFJA 3LIPA 4H7KA 3WK4A 1XROA 2G63A 5FXMA 2P8SA 2WUEA 2JIDA 1ISPA 4GHWA 1XKTA 4KAJA 1CUZA 4RNCA 4UHCA 3AJAA 1U8EA 4B81A 4U2EA 5DYYA 2C5FA 1YASA 1YS2X 4AZ0A 3I1YA 3QMVA 4GLBA 5I8PA 1TQHA 1DWOA 3DLTA 3N2ZB 4TPKA 4X95A 4Q34A 2B61A 3H1BA 2RAUA 4X94A 2OCIA 3HC7A 4CG1A 1ZIXA 3HZOA 3D2BA 3FYUB 3Q0TA 3STTA 4BP8A 4KR0A 2HU7A 1TCAA 2DQZA 1GQRA 4HZGA 4YASA 4QDUA 1C7JA 4Y2VA 5ALFA 1EDEA 2G4LA 2UZ0A 2WHRA 1ETHA 3WKBA 1YAHA 2K2QB 2PSHA 4L9AA 1R9NA 1PFQA 3A6ZA 4XJVA 4BZWA 5D3KA 4OU4A 3O9MA 5AKIA 2XUKA 3JWEA 3WI7A 2B20A 1NU6A 5ALQA 1XRMA 2V97A 1YB7A 2WJ3A 3HEAA 3H0CA 1XKLA 3QPCA 4H18A 4AMYA 1BS9A 4DTCA 1XRQA 3I6ZA 3V1KA 2WJ6A 4IH4A 4YK7A 4MEBA 1DT3A 1JU3A 3ILSA 1XQVA 1X2BA 1VJ5A 3BF7A 2WILA 4UHHA 3T52A 1Q84A 1IUNA 1GPNA 4DIUA 4Y2XA 1AMNA 3O4JA 4HXGA 2RGUA 4BRZA 5ALDA 4Q1VA 1Y7HA 3F67A 3WK6A 1QONA 4FWBA 3GZJA 4X85A 4QE3A 5T4BA 4F60A 4X6UA 2V98A 3OPMA 4H7DA 1VE7A 4CCYA 3OOSA 1M33A 4N5IX 5KBYA 3W06A 2RIPA 3HJUA 2H7XA 4IH9A 2IIVA 4DMCA 3I2HA 3STUA 3FBWA 1O6FA 5KWJA 2WG0A 1DWPA 4D9JA 5EHXA 3CCBA 5ALPA 2C58A 3WK5A 3O0DA 3V48A 2XLCA 6YASA 1ZIYA 4UPDA 4BC1A 4KE7A 4X6XA 3HSSA 3W9UA 1CUWA 1CUFA 5AI9A 3H2GA 3L1IA 4FKBA 3S2ZA 1ZD5A 4E15A 5SYNA 2ZYRA 1ODCA 5ALOA 1B6GA 5IVIA 3ICVA 4KE9A 1J07A 5EHQA 3D5EA 3W9BA 5AKGA 4BVKA 3VJKA 1XZAA 5DYTA 1YA4A 5I9IA 2XUQA 3O4IA 4EHBA 5H3HA 2WIFA 3A2LA 3DKKA 5LZ7A 1Q0RA 3FOBA 3DYIA 2CMFA 1QFSA 1DT5A 3DOHA 4AO6A 4B9AA 4WFIA 3K2IA 4QLOA 3VJMA 5AK3A 3D3NA 4DMHA 2B9VA 1VE6A 2ZVDA 3WQHA 4TGLA 1R1DA 4IHAA 4B0OA 1HL7A 5EI5A 4HXFB 2XUAA 3OC0A 2I3DA 1SCIA 4EB0A 4UBMA 4B6GA 2J4FA 5HF8A 4FMPA 5CT6A 1F8UA 1VXRA 3AZOA 1A8SA 1ORWA 4KACA 1AURA 5JATA 5ALLA 5K3DA 4G5XA 1MO2A 2VAVA 2XMBA 1H2ZA 2GBGA 4BTVA 4BE9A 3TJMA 2WQZA 4BE4A 4KYVA 3STVA 5CXUA 2H1IA 4PNZA 5AKXA 3WWEA
chains in the Genus database with same CATH superfamily
1NVXQ 4AZ3B 5A06A 3WRXA 1GPMA 1SQ5A 2H63A 4LSGA 3WGUA 5E7IA 2K2WA 3FR8A 9LDTA 2XQVA 4LTNA 4HPXB 1PV1A 1OVGA 3NC4A 5JIBA 3QEJA 1HLGA 2C7VA 3JZMA 3FJYA 2Y68A 4I1YA 5DLPA 2Q7OE 3T0GA 3K20A 2AG1A 2BFBA 3LA6A 1B3BA 2EEZA 4ZO6A 5F7JA 3ORYA 4DTIA 4YMGA 2BBSA 3E8SA 4LRYA 3F5QA 2RMKA 2ENUA 2FU5C 3AM4A 4KIFA 2GM4A 3R23A 2W6QA 2OZVA 3PQ5A 3OIVA 4P86A 4INZA 2OXCA 1ZGBA 4BJ1A 2C84A 3FKQA 5ALUA 3S70A 1MB0A 1WXFA 2YCLA 3LBHA 3R8CA 3BEOA 3IDZA 3HHEA 2R62A 4X92A 4L78A 5KSYA 1K8ZB 4A91A 5GJWC 3E2IA 1YA6A 1EXNA 4GMGA 4MJLA 3RVLA 5LMNB 3FYDA 2BFCA 1T34A 3QKRB 4JUFA 1EVJA 1U9JA 2FF7A 3TQCA 4LF6B 3AVXA 1BX3A 4O5OA 3E9EA 2FPOA 3JASA 1VZ2A 2FJUA 1Q0UA 5HMLA 3VYRB 3PNSA 4CGZA 1WUKS 1L0BA 1J09A 3ETEA 3HPQA 4CRWB 5DSTA 4XCQA 1GP2A 1R64A 3DFKA 3L8GA 3VZBA 2IXFA 4NJOA 3OX2A 4ZJUA 2XQKA 1COZA 4PANA 3K1JA 3W2FA 2I03A 2EWWA 1MDBA 2C5BA 2BBWA 1II0A 1OZ0A 2DT5A 2XUPA 4L08A 3LBIA 1IZ8A 4KOEC 4AF7A 3VUFA 3FPGA 1TCBA 1PDWA 1V8PA 1ZL2A 3K2QA 4LC9A 3GLHE 2ZI5A 5FUMA 2VYVD 4NP6A 4HLUC 4XR4A 3NBYC 3NDJA 4Y6PA 1L3CA 2GA9A 4QUDA 1EGMB 3BD6A 3ZXSA 4ENTA 1Z9BA 2QI9F 1EHYA 2OCDA 4PZDA 3VHXA 2JFGA 1W4ZA 4XARA 5EWLB 1MA0A 1QMGA 5BSGA 2G09A 5BNWA 5EKXA 4MCHA 2V45A 1MVNA 1OIWA 5F21A 3IMGA 1OX4A 2HRDA 2DETA 1S8NA 3PSHA 2NSLA 5IKEA 2XB6A 3ZLVA 3KJGA 1WBJB 2OZEA 3PNYA 4C14A 4V1CI 5C8VA 3FCAA 4XZ3A 121PA 1R9GA 4QELA 3AI3A 2HGSA 4OXNA 4UM5A 5FI1B 4C2UA 3BORA 1GSIA 1R0CA 4YMWA 1T5BA 1C2TA 4N5HX 2PBZA 2Z95A 3IR5A 5A3SA 4AJKA 5AM3A 1C1DA 5EJIA 1FMCA 3TD6A 1YS6A 4Q3KA 4I4TA 1FYVA 3UXYA 3X1WA 1LQ2A 3GPCA 4L4YA 2A8YA 2DSNA 4RFVA 4WCVA 3O8OB 5G4KA 4KG7A 4RMGA 5G4LA 4ZI7B 2R8EA 4J29A 1MO4A 4OQPA 5REQA 1UQRA 2JZCA 2P3OA 3KFLA 3VTAA 2EVWX 1OREA 1Q0PA 2Q0QA 3TLJA 3A0UA 3R7SA 2YJGA 3VHRA 3VNSA 1FOEB 3H4TA 4EI7A 1QVZA 1IK4A 2JEZA 4ZVQA 1VIVA 2Q3MA 4LVCA 1LDEA 3UAVA 3PQ6A 2HHCA 5AVVA 1ZCBA 2JBAB 2OWEA 3HXKA 4XYGA 1QGZA 4ETMA 1OXXK 1ZAYA 1VRWA 4EW2A 1H9CA 1UZAA 3TOZA 1HT2E 3CZMA 4B2YA 1RJGA 3J81A 3N2EA 3GJSA 3NWPA 1G2PA 4D26A 2Q5IA 3QEBZ 1DOHA 5JAUA 4E5MA 1T1SA 1MBZA 1R3UA 1P2UA 3KQPA 2FPKA 5G3ZA 3SR0A 5IASA 2FTKE 4ZTZB 3WLQA 4B3BA 4L5JA 4RTRA 2DPHA 1DJPA 2ZXFA 3MWDA 4M22A 4MO9A 3SICE 3T3MB 2IYYA 5JZVA 3ASYA 4KL8S 3HCDA 2W83A 4R3NA 3ZS8A 4QPDA 4L0QA 3EEIA 4TQUS 5AMXA 3UFXA 2QGFA 2KPOA 3ZDFA 3V1LA 3T3OA 4UXHA 1NHGA 2ZRMA 3HB5X 4OY3A 1WPXA 3D0OA 3IPRA 4A0HA 2VP3A 4B47A 4LFAB 1BD3A 4U6NA 4I5IA 3IXMA 5IAEA 1UMCB 3FNBA 3GT7A 1PJLA 3NW9A 3NYWA 4GR9A 5H81A 3K0SA 5HSGA 1BTOA 4GSKA 3BOSA 4M1KA 3HA2A 1KOFA 1CUVA 1XMIA 5K01A 3LP8A 4YJFA 4S04A 1K0UA 2R66A 5BO5A 2I34A 4YC7A 2XMGA 2IIPA 4PC7A 1JH8A 1JHUA 1VG1A 3H5AA 3N3AC 4UREA 2O19A 1GCAA 3EVEA 3TNJA 3TQOA 1X0XA 5AXBA 1DUIA 4WN9B 2PUTA 1D6SA 2CXOA 2P68A 1NQ5A 4KQMA 2LP4Y 3SC2A 1AQIA 2H2AA 3HDGA 4MMYB 1EWVA 3P9XA 1N6NA 2BTEA 4QYMA 3IP1A 2CF5A 4UBNA 2GI4A 2DR2A 1M2WA 1RQXA 3QWFA 3EVBA 2XOXA 3LVBA 4JHLA 1Q7TA 4D0GA 5A5GA 3R3VA 4YI3A 2JJ2D 3HB9A 2DMRA 4N8SA 1J0CA 5HM6A 1TZBA 2CXHA 1D7AA 2EWMA 4JT2A 1HE3A 1L7PA 1KJIA 2YINC 4RH0A 3UAZA 3VR5H 2QMYA 5DYWA 2FB9A 5JCJD 1ZH6A 5L7YA 3H1EA 1LSUA 1I9GA 2EF1A 1ECLA 2P27A 4BE7B 2ZCUA 5E4TA 5HTOA 4IPTA 3D6HA 3HN7A 2ZAOA 3FNQA 1DIGA 1JT9A 3OIYA 3I76A 4RPCA 4W8GA 2QTZA 5CT4A 4OO3A 1QMPA 4CKCB 2FOLA 1IQ0A 3QYJA 5LXTF 4JB2A 1OAKA 2X2OA 3NLLA 4MV6A 4JI2B 1X7ZA 3K96A 3LL7A 3CUUA 5D3MA 5CA1B 3WNDA 5I9MA 4NV1A 4JYZA 1FLDA 3R3HA 5H3CA 1FTWA 3PTLA 4GIBA 5AHOA 4YUWA 3N7AA 4QRDA 2OXEA 2BEVB 5BUSA 1CVLA 1S2MA 5TQ2B 3SZLA 3MWFA 1M74A 3EJ6A 1XZ8A 4DLYA 2GM9A 4QQNA 3R6LA 3B9BA 5BWNA 4UARA 3LPNA 1VLQA 1GTJ1 4LHSA 5KPJA 5DJ5A 5HQJA 4EUHA 1MV5A 1I2ZA 2PGOA 2YQ5A 1JJFA 3CH7A 4BKOA 5SYAA 3KWJA 3E15A 1RKVA 2OBNA 1JG7A 2P9YA 2UU9B 3KAJA 1DHRA 3NALA 4NNJA 5TNXA 1S3SA 3R9IA 4OREX 3RSLA 5DK4A 4E30A 1PWYE 3QFCA 3RIGA 3BEDA 1ST3A 3IC5A 1NVGA 3PDCA 1KAEA 1V8FA 2HFKA 1W0KA 2WTEA 1EYZA 1BYUA 3D3QA 2ATIA 2Y0EA 3PE6A 2DHRA 4JKIA 4EAQA 1L4YA 4DMFA 3SMQA 2CMGA 4KQWA 3QW2A 3EXHB 3LRPA 2YCBA 1FBNA 2PG3A 1MDFA 3KQQA 3FWZA 3H1AA 3W8NA 2EQBA 2ZJ8A 2YJZA 4JI8B 1LC3A 3G68A 3IH5A 2FYTA 3HACA 4LZPA 2HQ1A 5I7UA 4PE5B 1RTKA 1YO6A 3PQ8A 3AG5A 2H3EA 3ZXXA 4B7AA 2GTIA 4Y6QA 2E5WA 1E3DA 1HRDA 2YXLA 2IP1A 2OC9A 4BBPA 4EJ0A 1RT9A 1GCOA 4MQFB 2E5LB 3M3PA 4BMZA 4M0FA 3RAGA 2HZ7A 4AJNA 3NM4A 3IRUA 4GMDA 3GJQA 1M1XB 3NVMB 2F00A 4IMPA 1N8NA 5DBFA 1UINA 2PWPA 3W77A 4CM6A 1W87A 1GHTA 2BF4A 1HFWA 1CP3A 2HJRA 2R2AA 3D64A 2ZBDA 1U2EA 3OOWA 2CL0X 2E48A 3M81A 3LGXA 3R3XA 4PLGA 1ITZA 5C1OA 2XVMA 4PYOA 4X91A 2FWBA 3FWYA 5CBPA 2ZT7A 4Q7KA 4EMBA 5IJ0A 1JKJB 5SY4A 5M29A 3ND7A 4WNCA 1UDAA 4UZSA 1RWKA 2FKNA 1QF7A 2GJ9A 4KODA 3OT5A 2WV9A 5KOJB 5LNK6 3QTTA 2QX8A 4ZK6A 4RWZA 4XSVA 3H1FA 1W4LA 5B58T 2VP0A 4F85A 4RS4A 4BNGA 1ZESA 5CFMA 1ZKDA 1L5MA 4TS1A 1L5FA 3Q88A 5GVRA 1BGVA 2G36A 5I7EA 1FL9A 1BD4A 1Z25A 4BYGA 3JZAA 3WHKA 2DPYA 1JAHA 3TJZA 1E2MA 3KJFA 1F4PA 5FL7D 1XA3A 5J5VA 4PPNA 3NG1A 2HLDD 1NBOA 3FM9A 3TECE 2J41A 3CZQA 3JQ7B 1RWWA 3T5MA 5I01A 1O95C 3G5MA 1XNQB 1F14A 4C7VA 3LECA 3RANA 1DOAA 2QRMA 3UJ7A 2C2WA 2WYHA 4D44A 4D3YA 2HIAA 5BW4A 1RDFA 3T5CA 2R44A 2CV1A 5AVQA 4GWKA 4C06A 1SVMA 4UQPA 1OXSC 1JQBA 1BN7A 5EE1A 2WJIA 2IYZA 1U9ZA 5ECDA 1D2RA 1F12A 3ON5A 3EZFA 4K3VA 3IEMA 1QX3A 2CSUA 2XNKA 1XZGA 3IKMB 3PUXA 3RSHA 4B2PA 4L8YA 4TVSA 1GRQA 3RVBA 4RLQA 5IDXA 1E4YA 1Y9JA 5JNTA 4EFMA 3HRIA 3N8IA 3GJ5A 3DZGA 4E1BA 5HKLA 1H2AS 4AY5A 4ZGGA 1PEYA 3WHLA 4UNSA 2YOFA 5GADl 4XAQA 4HLCA 2C77A 4D9FA 1KEKA 5TGZA 3VRHA 3DEKA 3PP8A 1OVMA 3QKWA 4J0EA 1KORA 1R9MA 4B80A 1H2RS 1FVOA 2FMIA 4JENA 4PXAA 1S1MA 4DR3B 1SKQA 1W5BA 3O4FA 4DE5A 1BDMA 1L5QA 2ZQ5A 3ETNA 1WZUA 1DEXA 4LJ6A 2UZ1B 2L42A 3EBPA 3NHRA 4MW0A 3F8WA 4NECA 3HKEB 4R8LA 4XVUA 1W0KD 1SXGA 3GRVA 2H4HA 1LPPA 2JI8A 4EELA 4BP3A 4DREA 2J9YB 4TKUB 4E88A 1SXPA 3FIUA 2J9GA 3L41A 3V4SA 1O0SA 3MCUA 3R09A 3W6NA 4DSOA 4IQ4A 5BUCA 4MITA 3NJ8A 1M8JA 4PICA 2NPOA 3DPIA 3KDAA 4S2EA 2PGXA 4A92A 4FHZA 2REXB 3CRZA 3RU2A 5L53A 1QG6A 3L7YA 2BEJA 3QNMA 4U7FA 1GGHA 3HU5A 1Q6ZA 3NCTA 5EG5A 5K3AA 1JA9A 1UFRA 1HZZC 2REQB 1Z73A 2GAOA 2C5LA 3I30X 3REQB 1W4AA 2XMQA 3G9XA 2XKBA 3NDRA 4WXEA 2OSVA 2FA9A 2RHJA 5DCLA 1IVYA 1A7UA 3PHGA 4AJ2A 5KOHA 4DPMA 5JCOC 3NEAA 1L1RA 3OUUA 3FROA 3JD4A 3O5AA 4EHDA 1RVDA 4C78A 2VZLA 1G8HA 5I47A 2FFHA 1XMQB 4QT4A 3GEBA 4KBGA 5EPEA 2GRJA 2X0JA 2PZMA 3ONNA 1ZINA 3DM9B 3NOXA 1U7OA 2QBYB 2FZGA 2J5XA 4DCTA 1CZOA 1X13A 1IHPA 3HB0A 3PDHA 1GTG1 1TMOA 5CNJA 5CDFA 1QK3A 3VVCA 4DG5A 2OZLA 1AV6A 1A9QA 2V6GA 1O7JA 2AN3A 1B43A 3IP3A 4I9HA 3V4FA 4AJEA 1LBTA 1QORA 4EZIA 3BMCB 2HMAA 3C8DA 4HAXA 3E84A 4MR8B 2BMAA 1DAFA 2VP9A 3D3KA 2XA2A 1Z6GA 3IDFA 4TTJA 1M2VA 4BU0A 5DNCA 1KTIA 3OPYI 1U2RA 4Q7MB 5AVJA 1GTL1 1KVUA 2AX3A 2JH8A 3DCIA 3GJ4A 3QITA 5DTQA 4ZT7A 1QC5B 3DONA 5D51S 2HK9A 3QVSA 1GSAA 1RCFA 2YR0A 2CCJA 1IN6A 1VYHA 3QBJA 1F3OA 2IUFA 3I6BA 2PXHA 4LV8B 1YTLA 1XCLA 4L15A 4L9WA 4P80A 4PSVA 1OI7A 4N03A 1W2HA 4Q4AB 4RL4A 4BGUA 3GRUA 5AKZA 4JMLA 4GVPA 1Y7TA 4ZYVA 1RKUA 3FTCA 3W3AD 4EECA 3VU9A 3NPAA 2GCGA 2E21A 2GPSA 2MYPA 2O2EA 4M7OA 4WAUA 2O57A 5CFNA 1K88A 1R9JA 4I55B 1E94E 3C6YA 1Y9AA 2XGOA 2O0KA 1PL6A 5I8WA 4OIFA 4UFPA 4RTSA 5A5VA 3F8SA 1UBCA 1FB5A 2NZWA 3Q8XB 2Q1WA 1V4BA 3ZBPA 1FDIA 1QGUB 3G3EA 1VSUA 3K09C 4DFDA 2P6RA 1I3LA 4PTZA 3M83A 4OYLA 1J21A 2I7CA 3HUDA 3WFZA 3H6HA 1NVAA 2WZCA 3B3QA 4RVDA 4RKYA 4HGQA 1XF1A 2P5TB 5AXDA 4LDAA 4LSWA 2V8BA 1EB8A 3MWYW 3JTMA 4IGEA 3BFKA 1BFUA 1GDDA 4P9NA 1VIAA 1IN7A 2CJWA 3ZVKA 3AC0A 2PS0A 1CY4A 1ZN2A 3DDWA 3EQ6A 4GVXA 4NTZA 4RUKA 3H65A 4IVQA 4S1VA 5EP4A 5F5NA 3WOHA 5K8IA 4S3MA 2LD4A 5SY6A 3OTHA 4AQ7A 2XAUA 2GVZC 2P9CA 3TQQA 2DWQA 3EISA 1NOKA 1FS4A 3Q87B 5FTJA 2PFKA 3DMHA 1PR4A 2B9EA 4RF3A 3TZHA 2W7TA 1ML3A 5KMGB 1F1BA 3ZWBA 4CCYB 5FBVB 5IP5A 1O6ZA 5JG7A 3GRFA 3VU1A 4IV0A 4EENA 5EE3A 2VJPA 4NRDA 1DKOA 2I4OA 4FMBB 4WMLA 3CLRC 2UYHA 1MW9X 2WHEA 3DZBA 3G1TA 4A6XA 4EDFA 1H4VB 1EUQA 2A1TR 4C2BA 1A71A 1T25A 1EVQA 3U9SA 2VQDA 4FCCA 1EUCB 5G3YA 2WY2D 2RK4A 4CT4B 2G9UA 1BEEA 3AUJB 1XQXA 2A2ZA 2FETA 4MUEA 1TECE 4PIVA 2IH2A 3RQSA 3F9RA 3KLMX 3OG9A 4L02A 4AKEA 1X1CA 3CR7A 3PQDA 3QU9A 5TXGA 2H1HA 3BUSA 1UDRA 5LQAA 1NBHA 1C0EA 3INNA 1OF1A 3NT2A 4QHYA 2IS2A 3DZCA 2GKOA 3FFAA 3BMOB 1URPA 4K86A 4MP6A 1I33A 4PONA 3DC7A 2VHYA 4EQZA 4AY2A 3G9UA 3O9VA 4N6GA 4FBMA 1AVTA 3SSNA 2V74B 3UBMA 5AJYA 3GCGA 2CJFA 2C5EA 2HC9A 2F55A 3THXA 3L8FA 2H2IA 4KXXA 3C14C 4PG5A 4YRFA 5EWJA 3H9UA 1DFGA 1DIOB 2CY0A 5HE9A 1E3SA 1LBSA 3ENZA 2RGNA 3GO4A 3O0TA 1U2GC 4ND7A 4MQMA 5F7ZA 5AK4A 3VJLA 1U5BB 5CIYA 5AM4A 4GQIA 4ZXPA 4EEXA 4S12A 2Y9PB 1RCTE 2JKZA 1N9ZA 3CE6A 3DMGA 2QI9C 3GD7A 4MNTA 2OILA 1N6PA 1MIHA 4FU0A 2OO3A 2O52A 3ACDA 2V6BA 2CNLA 2BUBA 2IY9A 3AIMA 3ONEA 4CMKA 5I5EA 1KWGA 1EFVA 3DT6A 3TIXB 1NNUA 3OCJA 1L5GB 5CTJA 3P4XA 2MR5A 2P5YA 2PDAA 2DFDA 1DCMA 1FTNA 3D8RA 4XIJA 5FUWA 4JI7B 1QU3A 4QRIA 5K6AA 2CNDA 1V5GA 2KW5A 2A5GA 2R1TB 4QLAA 4URWR 1T9AA 3HMKA 3VPXA 4Q7QA 2IV7A 3A6FA 2B99A 2FEXA 4KITB 2QP9X 1NM5C 4US2R 5KTMA 3OZSA 3ZTWA 1PZMA 4IQGA 1JIXA 3ENWA 3N2IA 4RSMA 4PZ9A 5A9TA 1V48A 1MXFA 4XDGA 3MT9A 4GZ5A 3ESZA 4II2A 5CLIA 3RUAA 4Y1EA 4DJDC 3WYAA 3PC7A 3PCTA 4RA9A 1U0GA 1P9NA 1YA8A 3GN2A 4ALMA 3DTYA 1X1RA 1UPTA 3EVTA 4N3CA 1JEJA 4KN8A 3TQTA 3ZZ0A 4D9KA 5HS4A 4DNOA 4BBAA 1NLMA 2ZTVA 2JJ8A 1O94C 4J16C 4NS1A 3MXTA 4O4LF 1J8DA 4K9NA 4U0JA 3TG8A 5IKXA 1D1PA 4R9VA 3Q9UA 1O87A 2WF6A 1ZRHA 1N5RA 3DZIA 3KZNA 1GQQA 2OBMA 5E2BA 1VQ1A 4HLUA 1NONA 4JCOA 4RDIA 5BSUA 4YDSA 5K0NA 2G82A 4ROTA 1WXQA 1M34E 2G04A 1BFKA 3DEHA 4ZMRA 1IH8A 3TLKA 1TM5E 1YOVB 2YJTD 2W6JD 2RHBA 1HEYA 3ADKA 4R1SA 4WTOA 2B35A 4N5LA 1HYBA 2ZUWA 2XZTA 1DO0A 2C9BA 2JKYA 4RLFA 1OFGA 2QD4A 3V8MA 4XPIB 4EP1A 4Z8YA 2XWBF 1XAGA 4L9SA 1OHHD 1WA5A 2RGGA 4E33A 3S8EA 1GPDG 3GJ7A 5KDDA 1JEYB 2OCAA 3K4PA 2HA3A 3D6JA 3UJCA 2N3ZA 4P8RA 4B4VA 4L75A 4HQLA 5KC8A 5AVYA 2XBMA 4Y6LA 3LCJA 1JKMA 4L3VA 1S3IA 2NT4A 4WA8A 1JIVA 4DA9A 1SA0B 2HJ9A 4RPLA 2UZ4A 1I10A 1Z4MA 1FFCA 1A2BA 2R6HA 3DCNA 4JA2A 2BFNA 4CIWA 3G79A 1P2VA 5FUBA 3GVPA 1JG6A 4LDPA 4CWAA 4UHBA 3KQHA 3C7DB 1CY2A 2ZLBA 4HRXA 1VJ0A 1MQSA 4KOAA 2JCVA 2F1IA 5CX4A 1SOWA 3R3UA 3H6KA 4XX1A 4IY1A 3JW8A 3ZK9A 3D8BA 3ZHXA 2D1QA 5AKHA 2QIPA 1ICEA 5BSWA 1JKJA 4PAMA 2HLDA 4EUFA 3DLHA 3OWOA 3TW8A 4L27A 4BGDA 1Z7WA 1T2CA 4WLFA 3K1AB 1F0NA 1LPSA 4UTZA 2QV0A 3RW9A 4C03A 3MMPA 1H9BA 2Z3ZA 2FPWA 3HWX1 4RETA 5E8RA 1UKCA 2TMDA 4KXQA 2P78A 5E6SA 3VC7A 3I6YA 3JQAD 5K3FB 3W2HA 4BQQA 3E9RA 1L5KA 1U7ZA 3UK1A 1CY0A 3RTDA 2NT3A 4JSYA 1R66A 3CLUD 1NKSA 3QY9A 4W63A 5F4ZA 4C20A 1PR2A 4IQFA 4MAFA 4LRSB 4OYRA 3Q7SA 2JIOA 1HDIA 4Q7LA 3RKRA 1L7AA 2Y1DA 1WBBA 3LYHA 3HSYA 5DI3B 2WSSA 1B42A 3ZE9A 4P35A 3PHBE 2BWJA 1PK7A 4KXLA 1ZIDA 3OOEA 1MEOA 1MIOA 2Z8ZA 1OLSB 1THGA 2HKIA 4Z2AA 3ACCA 5EP3A 2ZUVA 2I8CA 2J85A 2I6GA 1BJKA 2J5KA 3K32A 2XT9A 1IN8A 3LQKA 3FDIA 1U6JA 2H06A 1V47A 4A3SA 3OZGA 2O2GA 4LGVA 4W8OA 5FPPA 2ZJZA 4JUCA 2V1XA 1XN4A 5H0IA 3W2IA 3J80A 5ICMA 4AJ1A 4G1MB 2WQ6A 1JJVA 2BL4A 4HNQA 4CV1A 3M7IA 2G4VA 1ELOA 4IIJF 1W1WA 4QJBA 1T8RA 2QTMA 1LFDB 2WWYA 5EJ9A 2Y1LA 3IHKA 4EX6A 5DLQC 3M6UA 3EPHA 3BRCA 4DVJA 3GEEA 4F7WA 3EGWA 5EZYA 3CB2A 2AW3A 2PRJA 3OM1A 2VRBA 1TYAE 1Q2XA 3E48A 4A9AA 1OBVA 1WCV1 3I92A 1B3RA 1PQWA 2W4MA 5T4EA 3RU9A 3VOAA 2B2NA 1QBGA 1IQRA 4GM4A 4NAVA 2DG2A 4QBHA 2PZJA 2FPIA 1KYQA 4B74A 2G8LA 4X7RA 3PNPA 2IV3A 5AOVA 4BFUA 5B64A 2ZIFA 1YQGA 1NYLA 4TTAA 1XI2A 3EODA 1IJFA 2QJOA 2WAAA 3ZI7A 2GJSA 5CVEA 3P9PA 4HYTA 1C80A 1C0IA 1H0HA 2A9VA 2JD0A 4URZR 3T06B 4PN7A 3E8MA 3UC5A 3UV6A 4RVSA 3JARB 5JDCA 1G8YA 1ADGA 1GAJA 3QPAA 2O2SA 3AXSA 1OV4A 1DAGA 2OXFA 4TLMB 3BSWA 1V6AA 1MAHA 4PYKA 1CX9B 4ND8B 2AN9A 4WZBA 4NENB 3DLBA 2PTGA 2DHQA 4UVGA 3HRHA 2GDJA 4IDQA 3X2SA 4B3HA 1N2BA 5K45A 3LI2A 5L51A 3A4VA 1AH2A 1HY3A 4S1NA 2AN5A 1DKPA 4DXHA 3BXHA 1CUCA 2XYRA 1SKYE 3KUCA 1YKSA 1PG5A 3T1YB 4E0BA 1N77A 4PWZA 3HVRA 1UK6A 1WZ2A 4I4CA 3THSA 3DW1X 1GPJA 3D8UA 4WINA 2FWMX 2X15A 1Q0TA 1TRKA 2FFBA 1ZK3A 3GW8A 3A4IA 4JA0A 4K6CA 1H5QA 1L8AA 2EP8A 5JAMA 1WW8A 2E6UX 4NFSA 5DM4A 5HF6A 3K70B 5EIEA 2VXBA 2ZB7A 3NDIA 4OXXA 4EO4A 4MI3A 1WMDA 4QG7A 4YH1A 1Y3CE 2O14A 3WDKA 3G8YA 4MI6A 3IUEA 2DFTA 1AQNA 2HIMA 2Q5EA 3LHFA 1JDTA 5SY9A 2HD4A 2IEGA 4MRAA 2ONYA 1W52X 4LAFA 5IBPA 1AC5A 1USKA 2XITA 1AKWA 1I2AA 5LLTA 5C5CA 2A0YA 2AN4A 1DAOA 3OOYA 4KFUA 3VO1A 3JRXA 2WMNB 1A4UA 4RQUA 5DHRA 3EG5A 3BTVA 2B8JA 3ZGNA 2F4VB 2W6NA 4UUPA 4Y1RB 2DU8A 2ZYVX 1TJ5A 3EC1A 1ICIA 2QZPA 2X6RA 1J56A 1V45E 3N6RA 4OXYA 4UMVA 5IBQA 5KSOA 4XWTA 2Y1GA 1QQTA 1XRNA 5D00A 3C1UA 5A9RA 3SK0A 1YL6A 4YMTA 1F2TB 4IICA 1Y1LA 4R7GA 4UTPA 5FTNA 1NYTA 1CEYA 1KMIY 2QD5A 4PVDA 4BUCA 2JGKA 3SDZA 1YU6A 3M6FA 3THYA 1WKVA 3CSUA 1RFGE 2VR1A 4QT0A 1H1TA 3ODPA 1XDSA 3NHPA 3ZS9A 3K6SB 3ZCXA 1NNEA 3RYFA 3L7CA 1EAYA 3FCOA 1RABA 1UK7A 1Z0IA 4ECAA 1E2JA 1OZGA 4ENQA 5LU8A 1UPCA 3ECCA 5U9CA 3DULA 2QM7A 1LDGA 2GLTA 3LAWA 3LLVA 4FIZA 4OFZA 4W1PA 4U1RA 3SLKA 4ABTA 1FPQA 1XXHB 3C4JA 2D8MA 2Y93A 4BN4A 3L4JA 3T5TA 2PUBA 2IHVA 5KINB 1NF9A 3GPDG 2VIIA 4ETWA 3HJCA 3WRXC 3BSYA 1YTUA 3CVXA 1XIVA 3NYRA 1Y42X 2C4HA 3QEOA 1ZJYA 4ZOLF 1PJBA 3UV3A 5K4GA 2COEA 1LJ8A 1TNDA 1YFZA 3N39C 1L9XA 5KMGA 2CLFB 4U39A 5JNRA 2AF4C 5LP6B 4C89A 4MS4B 5FTWA 4R0MA 1VKZA 1QS0B 5I7WA 2YYSA 5EHIA 4L85A 4LF5B 1B6TA 1RM3A 3TBHA 5MHTA 5GJBA 2Y4OA 3MK31 4AZ3A 5FA8A 2NTNA 1PU2A 4RNDB 3ZD9A 3ZY6A 1KNXA 2PGAA 5AICA 2XRMA 3Q2IA 1X80B 3LQFA 2HF7A 4LFCB 4TL7A 2BFFA 3WAKA 4FYJA 3BGIA 4RD4A 4TYPA 4A0RA 3H0KA 3NIBA 4NK5A 4F5EA 5CTAA 2NVWA 2E2WA 2G0AA 3KELA 1DHTA 4MW7A 2WWXA 4XCXA 5HQ3B 3UMCA 1GLNA 3RYIA 4U8GA 1YIAA 3TL3A 4EVQA 4LWPA 3C87A 1A77A 3CU5A 1QHHB 1CQJB 5KNDA 2SCUA 2AW5A 3MB8A 2ROQA 4PBRA 4JCCA 4J07A 2O1EA 1TAQA 2ATEA 3C3MA 3EW7A 3C5VA 3ELBA 3QPVA 4KP7A 1PZFA 1FUEA 1YB5A 3BD9A 4HG2A 4ZCMA 3IAXA 3RFVA 3WXMA 3CVUA 2PLWA 1H85A 1F6DA 4EKYA 4WBNF 3BK7A 3LWDA 2WLSA 1AUOA 1DKLA 4CHGA 1ZOLA 2IEAA 2OGUA 1RRGA 3KB1A 2EW1A 1PO7A 3QMPA 4BNIA 4F06A 3T5PA 4KKVA 2VNAA 2ZBRA 4DUYB 4U63A 3KQVA 1ZR4A 5ERGB 1JR3E 2XNDD 2EBHX 2ZSKA 3RIEA 2W6MA 4HNAA 4BQRA 5JZBA 4HH3C 1A8PA 3ZDCA 1PSDA 4L5AA 3KT8A 4JBXA 3PV0A 4BZXA 4F97A 5LKRA 3KOYA 4EPVA 3ZBUA 3PD0A 4WKBA 3HI6A 4R69A 4M7PA 4UMDA 3Q4GA 1CF4A 3EDMA 1EFVB 1Y4DE 3D7SA 5L4NA 3GLFB 3COSA 1R0ZA 1TW2A 1GNRA 3CUEF 4IXDA 2J9ZB 3EH1A 5DBHX 5ITVA 4D9MA 1Y3FE 5DIZA 4AMGA 4DV5B 4YEDA 1L3BA 3P0IA 3HCOA 4IZHA 4KK3A 4KLRA 4NBSA 1JEOA 3LE8A 4MKRA 2R48A 1VHDA 4M55A 1TUGA 4LY6A 3C74A 3AWDA 1T5HX 4ZU3A 1Y8QB 3BWYA 4HDRB 4MW9A 4UAUA 5THQA 2J0EA 3C3YA 2RK3A 3W5HA 2ESRA 2P9ZA 5LVAA 3GP8A 5JVDB 4AZSA 1RLMA 1W5EA 1C3LA 2ONZA 2LV8A 2VP2A 2A92A 3I23A 1U9YA 3AM3A 2NU6B 3COWA 3DZJA 3FPKA 4JLNA 1FJXA 1TKRA 2R84A 3AX6A 2W6ID 3FD8A 3P27A 2PUHA 4O2LA 5FBHA 3WP0A 1B0UA 4D9HA 4GYYA 2CCGA 2I71A 4JBNA 3EAQA 1U02A 3ENQA 1HLFA 3MHPA 4TS3A 3AI7A 3ZCTA 4Q3LA 2IU0A 5BV7A 3EIEA 5REQB 3HN2A 5ULLA 2Q5HA 3LHDA 1OXTA 1JQLB 1MX3A 1CHDA 3GVHA 4ER7A 1Y8ZA 1YU9A 1US8A 3BTOA 1T3TA 5JE8A 3QLJA 4MVJD 1N78A 5BQXA 4CCWA 4PRLA 4I0WB 5CFOA 2AF3C 3KVRA 3MGGA 1MRSA 4GOJA 5K4AA 3TX6A 2FWJA 1D5CA 4AC9A 3S29A 4IDDA 1P61B 2NP6A 3EIHA 4F21A 2EBUA 4UBOA 5IEJA 4YA6A 1VKRA 2FFJA 4LX8A 4OAQA 3FTQA 5A0FA 4X1IB 4RPIA 3THWB 1U1EA 4IIJB 4B7ZA 3BN3A 3QIAA 5LU9A 2PWAA 4ILEA 4Q6WA 2UZ1A 1RBYA 4PQGA 3RVJA 1M6WA 4IJKA 3EY4A 1X7WB 3TMKA 4I3FA 1GCIA 5THXA 4E3ZA 3AR8A 4TV9A 3AVUA 1KPHA 1WLYA 5LA6B 4FFWA 1MA3A 3LM8A 4EB6B 2GWRA 1E20A 5B37A 1ZISA 4KI0A 3EXEB 4UOQA 3U09A 2NMVA 1E1RD 1DQSA 2PVPA 4HMOA 1CB7A 3TKYA 1TJ4A 4U2CA 2NZ2A 2REQA 1EFHA 3H6GA 4G26A 3LKDA 4P84A 4YRQA 3G2PA 3ZY2A 4F5DA 4KWEA 5AW4A 1YCGA 1AHPA 1KZGB 2YY7A 2PKEA 3TEJA 1PLLA 1S8AA 4XM0A 4Z1MA 1L8LA 4BECA 1UQUA 4DUGA 4DY4A 2AKAB 2HNBA 3SQMA 3UC9A 1HYHA 4C04A 3PNKA 3UT0A 1YBFA 5C2JB 4Y9RA 1VIYA 4EB3A 2GEFA 1QHIA 2FEMA 1Y3BE 1XL1A 2VHQA 4Q3DA 4IYJA 4A8TA 1VCHA 5THKA 1MFPA 3UG7A 3TLMA 3L6BA 5CYFA 4I7EA 3WR5A 4AP5A 3DVSX 1IOVA 5HVNA 1C7RA 2WOJA 3A11A 4QAQA 4F4FA 3SZGA 5JAOA 3H9JA 2DWUA 3A9TA 4KFTA 3UW3A 3PITA 1KE1A 3U3OA 1EINA 1FFAA 2XTMA 3B1XA 3DG9A 3RVOA 3ZC3A 4N76A 1LS1A 1U0RA 1YRQA 2AMYA 4EDHA 4OI2A 5DXFA 5C8YF 3EFBA 5JJKA 3OI7A 4RH3A 1CNFA 3H99A 2XXAA 5JROA 3I0NA 4LG1A 4CKCA 4K6KA 1YL5A 1JG3A 2ISQA 5EZ5A 1GWNA 2UVPB 3I3SR 3FSGD 3I3OA 1FNBA 2NYAA 3D2LA 2IXEA 2UKDA 1AS2A 1SEPA 4GPZA 5DBGA 5I7RA 4AYWA 5IF3A 2WD7A 2I4IA 1QB8A 1HTTA 1IM2A 1XAHA 3UHJA 2ZOSA 1Z17A 3CH4B 16PKA 4OLJA 4Y67A 1Z83A 1P1RA 1Z18A 2UYQA 1IFXA 2WAXA 3GELA 5FKJA 5JI2E 3HBMA 4B6OA 2G1JA 3D6UA 1J24A 1M1YB 1Y1SA 2JGFA 1P5RA 2O8BA 5ITWA 5JXGA 4ZZIA 5EMLA 1ZH8A 3TRJA 2AJ8A 2J6IA 1CDEA 2IDJA 1OC4A 4G24A 1S9DA 1GTVA 5EHZA 4IUDS 2C3YA 4I4NA 3AVYA 3I64A 3IAHA 2W8BB 4IVPA 2O2JA 3CPHA 2WI8A 1CLUA 1TEXA 2Z6AA 2FLWA 3AJEA 2AOXA 3OE7A 4OM7A 4DCNA 5LM3A 2RE8A 2I62A 2O8FA 4HWKA 5DV9A 2JFFA 3Q2KA 3IQXA 2PH3A 1M73E 1DJQA 1Z5WA 3OT1B 1JHDA 1F38A 2G25A 4TWIA 3MT8A 2JGNA 1Y8AA 1E58A 1P39A 3GQBA 3VNVA 1FSPA 4DV1B 1MJHA 2O0MA 4KUEA 1TIKA 4WNAB 3RIMA 3JQ8B 3ZLUA 3DCJA 4XRRA 4NICA 1G17A 2NXNA 5CT9A 3O75A 3PGMA 4JUBA 5EN4A 3F3KA 3H5TA 2VHJA 4ZAGA 2BUAA 3WIOA 3ZCQA 4AJLA 3L4BC 1RAAA 4NH4A 5KNDH 4ENUA 2QSYA 3U1TA 3SC6A 3D4BA 3R76A 4CDRA 1OX6A 4IIJA 1PZXA 4N48A 4N9QA 3CCCA 1CF9A 1I3CA 2PRSA 2VBGA 4R8RA 3D1VA 4W7SA 1PV4A 2HA4A 2FPGB 3K9GA 3B48A 1H93A 4ZO4A 5EEGA 3WZMA 4YUYA 1DQYA 2RJOA 4MYTA 5TE9A 5B3LA 2IYNA 4BBZA 3IJ5A 1LI4A 2G71A 5FO1A 1FXSA 2D5IA 5FPTA 5HKKD 2NW6A 4JASB 2FKAA 1FSGA 9ABPA 4CU2A 2VF8A 2ZSHA 4RVOA 4LYDA 4QOGA 2AR0A 3UN1A 4QZVA 3ETLA 5HFAA 3A6JA 3L1JA 4JQZA 4QQFA 4ZEVA 5I7OA 1PS8A 4JLMA 4TT3D 2SKEA 3R9WA 3PRYA 1GAQA 2LNDA 1EHIA 1Z08A 2FRDA 5CLQA 1GR0A 2BMFA 3PXBA 3R7NA 1L7BA 2VJNA 3S7ZA 1P5FA 1YS4A 1VGVA 3BMOA 4K6FA 3RTEA 4B6PA 1MTZA 4QJIA 2OYSA 1JSCA 1X42A 1ATZA 1DB3A 1LF0A 3G5UA 3OEHD 2H2WA 3QKTA 3FAKA 3IKLA 5CX1B 5BQ5A 2KBEA 1FYFA 1ESEA 1PKEA 1ZJ4A 3THXB 2CW5A 4D98A 3JVDA 1MGOA 1N5DA 1WCXA 3KPVA 3G0GA 3HDVA 2QTHA 4F4UA 3AFIA 1FP7A 3MS4A 4MLCA 5I4CA 1J00A 2RJ3A 2I0FA 3EC2A 4FILA 1UBKS 2OCYC 3SJUA 1C30A 1G66A 4E6EA 2HQOA 1GGKA 1CT9A 4GM0A 5FPSA 3OUTA 5TY0A 3I0MA 3HGTA 1FU4A 3IVXA 4GP6A 4IZ6A 1CY8A 4L22A 3ML1A 4YJ2B 3W34A 1XU4A 3GGPA 1EFKA 2B0JA 3FOAA 2XMRA 3QEMA 4CU5A 4CXMA 2PV0A 2R7LA 2PBRA 1A5TA 1UWKA 4ARVA 3K9FC 5A04A 3DDZX 2P9FA 2YJ4A 4FCWA 1IYZA 4JJZA 4D5EA 3PJDA 4XWYA 5EIFA 4ZKDA 1UMBB 2UVPA 3C7TA 4PHHA 1SVKA 3RS2A 4OH1A 4S1OA 2VF4X 1UJ6A 1S3FA 2A5DA 2BMDA 2C2BA 4KAXA 3WLIA 1PWHA 1VE1A 2CUZA 4PHTA 1HG1A 1SVOA 1MQ9A 2BMJA 2OOSA 2TS1A 4L74A 4UZFA 1RPJA 5TARA 4AJ9A 1SUAA 3CA8A 3G88A 5L4LA 5H9WA 3ZUGA 3V9AA 4C4TA 2G28A 3I05A 4GXRA 2ZBQA 6REQA 4JOBA 1DG9A 3LKZA 4AN4A 5C37A 4GYKA 3ZXIA 3DXYA 2B7BA 1XEWX 4JYBA 4DQLA 1EDOA 3GF4A 4J2HA 3VZDA 4AKGA 5TSDA 4HY3A 3A1CA 5EOVA 5EHGA 1KF0A 1SUPA 4ENRA 1YZGA 5JQGF 2VZ8A 2OFFA 5JANA 3OCZA 2BT4A 3EXFA 1E8NA 2V0CA 3DL2A 3CXUA 3O3MB 4GDMA 4QFMA 1RXSA 3M9LA 4URYR 1PVOA 1PGQA 1IM8A 2C1ZA 1EK1A 2RIRA 3ISTA 3K0AB 5EKTA 4E2WA 1NW5A 4EHJA 1E0AA 4MGYR 1LWOA 2H4FA 4BVAA 4BO5A 5LZ2A 2AZXA 1L7DA 2ZRHA 2QQFA 5EUQB 2VA8A 1N2JA 2JCXA 3PF8A 2OAEA 3CZCA 3L06A 1QP8A 5ER6A 3EXIB 5T8KC 5L7TA 3VOSA 4RTKA 1CQJA 1XFDA 1Q0LA 3C4VA 2HQBA 3IAM6 2H1VA 1EXWA 4GD3Q 4CMCA 3QVXA 4EKGA 1PF7E 1W1UA 1XZNA 2Y0PA 3C97A 3DFUA 2D0DA 1FRFS 2ZRBA 2OO5C 3A6KA 3W6OA 3WLMA 4M88A 4DSNA 4PNHA 2D5AA 1PWEA 3SQNA 2XVZA 3DOFA 1GL6A 1TUBB 1TTTA 4XFDA 4AKIA 3G13A 1VKNA 4LK3A 3FRJA 1G8SA 4TMVA 3V2IA 4RXUA 4YBZA 2E3JA 4C0JA 4L6AA 3IDOA 1NJ2A 3L4EA 2I6TA 4Q3AA 4OJTA 5KNCH 5LYJB 2GXQA 3ZWKA 4TTQA 3WB0A 3EG9B 3OJLA 4HWRA 5CP8A 3WBBA 1KIMA 3FBTA 5K0BA 3H2KA 5JSFA 4YRSA 3E9MA 2DAPA 4IIXA 4IRXA 2JI9A 2OFOA 5EFOA 4AZTA 1QFJA 2VPXA 2C2XA 2JDID 3KKMA 4L6CA 1R4NB 2BP7A 4ZDWA 1V8ZA 3AF3A 3T8YA 3IUMA 3P2YA 2BUCA 5JLJA 2BH9A 6AT1A 1SK9A 3IA7A 2IUEA 1XU7A 3AY0A 1N1EA 3KUUA 4IR7A 3RUHA 2ET6A 2X4IA 4WX2B 5L40A 1YVUA 4QNMA 3VR4A 2BAGA 2FEWB 5HM8A 4FLEA 1BROA 4B3MB 2HDHA 1C7FA 3C5HA 3K2BA 1AN0A 1W75A 2P7IA 1ECBA 4NV0A 4QNRA 1PLKA 1RS0A 1BCSB 2O5VA 2AKYA 4C7XA 1PGJA 3V7YA 3QU4A 2QR2A 7ADHA 2AEFA 2NU6A 4DV4B 5MN4A 2Z6VA 2R68A 3TINA 3WJ1A 4B33A 3W4KA 2XE7A 3Q3EA 1YJXA 2OLJA 1KU6A 1UXHA 1WDWB 5D5PA 3GFBA 4GVLA 1RWXA 1XEWY 5HIMA 1PJQA 5ALHA 4NMMA 2PH5A 1TC1A 1SHLA 1XNGA 3W5UA 3ZYCA 2O5CA 1X1EA 4LQ4A 3OJEA 3PFKA 3QEMB 1DI0A 1O94D 1O5IA 2QJWA 2Y67A 4D81A 3JQAB 1P1JA 1I0IA 2CXPA 3FLAA 4AL4A 2Y05A 1XVVA 1YJCA 4RA6A 5CEJA 1XHLA 2JAWA 2FXVA 3KQOA 5B7NA 2G70A 2Y9MB 3KOUA 4PS1A 3H04A 4KR9A 5JY6A 1GZ3A 3ZDDA 1E96A 1OJLA 1RMTA 3CV3A 4L4UA 5M3BA 4BO6A 4IHQA 3WL6A 2I80A 4INOA 5TQ2A 1KQNA 4E2ZA 4UTVA 3OF2A 3VTFA 1P1KA 4W5JA 3BQMB 1NW6A 4QREA 1J8QA 1E1CA 5F1PA 4BEJA 5KB3A 2XT0A 5GQSA 4UU7A 4D9CA 3QJ5A 1Q17A 2ETVA 3B1YA 3WIVA 1I6WA 2O8VA 3ZE8A 4NDAA 4EG0A 2P11A 2AFRA 2Q8QA 4DUGD 5CLLA 1IXZA 4PR0A 3OKFA 3PNBA 3QBDA 2J0SA 2HOQA 2ZXUA 4KN5A 1YUMA 4XUDA 4RHUA 4OQQA 4XCVA 1V6CA 2GZRA 2IHKA 3R8XA 2EFGA 1NPDA 1SHZA 1ZNYA 1L4FA 5CEEA 1SZJG 2GKSA 3F8TA 4L8GA 4B3JA 1YDHA 3EE6A 3I2IA 1DCFA 1Z6ZA 5ITSA 2HHHB 2BFDA 4E70A 4Y2QA 3T12A 4HWTA 3LA8A 3RODA 3DZKA 2HV8A 3IODA 1UJ5A 2VHTA 4KVZA 4I5FA 3U40A 5GZ1A 5SZKB 1ZK1A 1OUMA 3E05A 4JVSB 4B75A 3BL8A 4UUMA 4CMIB 3WZ2A 4RFSB 4DJEC 6ABPA 4ND3A 3EOBI 4OYYA 1SRRA 3RU3A 3FSGA 1E7WA 1I8TA 3U4AA 1WU8A 2FZKA 4U7TB 3NC1C 3BF8A 1SD5A 3G2HA 4IS3A 1DQRA 1EZ1A 2IHJA 3FA2A 4B3IA 1H3FA 4MCIA 5DU2A 1GTRA 1MAUA 3C70A 3RVRA 4EPXA 4NCNA 1N5LA 2JJ1D 2X2EA 4JS0A 4C76A 3EZ9A 1FEZA 4CUJA 2G9ZA 2CWWA 3CN7A 3LX5A 3SJCA 4OQMA 2H31A 4Z4EA 1CBUA 2I22A 1UPBA 1RACA 1WRBA 3TVTA 2GX6A 4DG8A 2NO7A 2OFWA 4Z7NB 1T9CA 5AM2A 4GOLD 2P2DA 4RYLA 1QIIA 4QBGB 2OORC 3DEFA 2IXTA 5IXSA 4EFKA 5HBGA 5C32A 4KO3S 2O2DA 3THOA 3PEUA 2ZJ7A 4F8JA 2HJWA 2X6QA 5AVWA 5JNUA 4MTCA 3QX7A 3RRZA 1QF6A 2H5EA 4UAVA 3KB2A 5FWNA 3A1TA 4D56A 1L5VA 2UV8A 3QKSA 1POXA 1AQYA 1XTUA 4KO4S 1SVNA 3I53A 1G6KA 3NM5A 1BH6A 4QOFA 4DT1A 4Z54A 3RADC 1Z0JA 2RHOA 1P3Y1 5AI8A 1BE8A 4OJYA 1MRZA 2HO4A 3KL4A 3IEVA 4G36A 5IC6A 2EG9A 4C30A 4F56A 1VKOA 2VJLA 3ZZUA 1QGDA 2YBDA 1P3DA 3DFMA 5ESXA 3WP1B 5DULA 4OPMA 1YFKA 4Y9UA 1E1RA 1NYRA 4GSLA 3ZWPA 4M4SA 4KC0A 2BDUA 3L0IB 3PPVA 1C1HA 3O8OA 1P18A 2P75A 2C7PA 5JNVA 1JFLA 2A9OA 1Q15A 2F59A 2HLPA 1G18A 1VE9A 4XJTA 1KZYC 1M2FA 3VGJA 2DVMA 1PT9A 1O57A 3KZKA 1KRWA 4YPVA 5JSZB 1BIFA 1M6NA 4MZXA 1SBIA 4PPGA 4ZRNA 4HTFB 4AZVA 1QOZA 3OQPA 1NXOA 2RAFA 5LFAA 3DO8A 5DSXA 2HUPA 1GG9A 4JLUA 4N5NA 4UC0A 4F93B 4RS3A 1OXMA 1C1XA 5T4HA 3F6CA 1MFZA 5B3AA 3S68A 5TMPA 5FB3A 4D9IA 4DG9A 1YMUA 4YAKA 2VRCA 3B13B 3CG0A 5J3JA 3OA0A 3P9IA 3RUDA 1RPZA 4J91A 3EB9A 3SEAA 2DHEA 4D4HA 2Y1WA 4H7IA 1Q2UA 1L7VC 5AJWA 1R6TA 1W5AA 1G0NA 2Z3WA 2VXYA 3UXMA 1K7EB 4KQCA 1QCZA 3DDOA 1F0PA 3DBRB 1UBUS 4G5SA 5IVHA 1B14A 4K8OA 3EA0A 2PBFA 5DGDA 3BRWD 3JYQA 1QYVA 3A10A 3K8OE 4H7HA 4WJLA 5HOEA 4BKQA 1SFRA 2EGUA 5ILOA 2BW0A 2ZBGA 1ZXBA 1NVUQ 1RSZA 2O7RA 4PG6A 4MVWA 1KARA 1KP3A 3RIYA 3VZPA 1HK7A 3FUWA 3RD5A 4ADSG 3K70C 1A1SA 4YO8A 4RTMA 4E2YA 3P20A 3DR3A 3I5AA 4DGQA 1Z2NX 1GA4A 5FQOA 2V7TA 2VH5R 5ISMA 3V80A 1YZFA 3P0EA 4PG4A 1ECGA 1NASA 1PLJA 4WA7A 2FUG6 1DELA 2D5CA 1XA4A 4FT4A 3FHJA 5K3CA 2CJPA 2WNHA 1M2EA 4GPD1 1NVVQ 4W5RA 3EGVA 4RE6A 3V5NA 1TTHA 3BYZA 2PZ8A 3IALA 4YJHB 1CJKC 5GAJA 4C21A 4O4JF 1WB4A 3I37X 5C7YA 2AEJA 4NABA 4BMPB 4F9TA 5G0WA 3ZQ6A 4HADA 4TS9A 5CCXA 3ES9A 1D2AA 2YWBA 3QVVA 4FDUA 3ZY3A 4MI1A 3JAWA 2PSJA 3LDAA 4LI0A 3T3DA 1VLLA 4YT4A 4YRDA 2PUEA 4C7OB 2O8EA 2EZUA 4QYTA 5CW1A 1F9EA 3IQGX 1E1QD 3Q10A 1JEQA 2GYWA 2C4MA 2IXDA 1GFZA 4KLZA 4RANA 5H70A 3T7KA 1V7QA 1PD0A 1OFUA 4A36A 1U3WA 1YR1A 1HDZA 3I09A 2FUKA 1ESDA 1E6MA 1DKMA 3NKFA 5LYJF 1QIKA 2WSIA 3GK3A 4RKEA 4KE8A 4MVXA 3RRYA 3WGNA 4E5KA 3HTXA 2I2CA 2QTFA 1G5HA 2EP5A 3VVLA 3WLAA 1MX1A 5EE9A 4XDHA 1ZUD1 3L0DA 1VLVA 2Y92A 2RG7A 3AUFA 3JR7A 5IZCC 2RDMA 1I2CA 3UMJA 3OD5A 2IU4A 2QZ9A 4J8PA 3EBLA 1UF9A 1H8HA 4FUQA 4Q4HA 1P33A 4ANFA 1QR6A 2PUAA 1CCWA 1HDEA 2CC2A 3ELYA 2ZRLA 1DKRA 1P7ZA 3PEYA 1AK2A 2JLRA 3SLGA 3T61A 4DDKA 1TAGA 13PKA 2Q41A 4I2NA 1JPNA 1QTRA 4Y9TA 3QOYA 2O8NA 3LCMA 1TQDA 3Q85A 2O8BB 1ZD3A 3SS9X 1Y1QA 2XUZA 3UWDA 2H9IA 2FQ1A 3Q2OA 5E1OA 1FXWF 4ENWA 4HWSA 3FYTA 4N39A 2A6PA 5FO0A 3GOQA 1BQ4A 3IPCA 1O94A 2TSYB 4J16A 3K1YA 3S0JA 1NX9A 2XUIA 1XVUA 6REQB 2AFIA 2FFRA 4J0DA 2WZBA 4JEUA 3CJRA 3O4GA 4BFXA 4YAJA 2IP4A 5JCJA 1QG2A 2IGBA 3E4CA 1BXKA 1FJ2A 3OLXA 4PZEA 4H31A 2XVAA 5IAAA 2I55A 1DBIA 4R84A 5CJ2A 1QR2A 2H00A 3TLBA 4DRXA 3FWNA 3VI4B 2PX6A 4XQ0A 4TT8A 1VTKA 1YC2A 1AK1A 1TCUA 3DAPA 4U0KA 3NM6B 3ICPA 4NCHA 4BCBA 2ZT8A 2C7GA 3K0AA 3O3OB 1E2BA 3WLFA 1GT6A 1S8OA 3EOAI 3Q9SA 4Q02A 3RQIA 3UT5A 4CMEA 1JFFB 1H6AA 2F9FA 1N7HA 1TL7C 1BQ3A 1HI9A 3C4QA 3G23A 4XE5A 3OTIA 1ILEA 1F1JA 3L1UA 2O9JA 1IMJA 3A6LA 3D6NB 4QTZA 4J4TA 5T6BA 4RKWA 4CODB 5JCXA 5DOVA 1C1XB 2D7CA 3L46A 1EGVB 3U3MA 3JYHA 4LTDA 3DLCA 3V46A 3VZSA 1D8TA 4D9EA 2ZBFA 3DOOA 1I1HA 1T0PA 3AU8A 5C4GB 2BJWA 4CKBA 4ER0A 3D3EA 1G3RA 3OO0A 4NZNA 3L6EA 2VEDA 3NT5A 1A5BB 1D2NA 2G40A 1NWHA 3G7NA 1X9HA 3G0CA 3HYLA 1E6UA 3R20A 3QX9A 4KX5A 5IANA 3T7DA 5JXHA 1RYMA 1WPRA 3CLUC 4F6RA 5EJGA 4BP9A 4CLRA 7MHTA 2Y76A 2I29A 2XYQA 2NSHA 3U3XA 3IT2A 5CG1A 2HBZA 3B8EA 1W49A 2WJVA 1O1YA 1XTVA 3A4MA 3FB4A 2G5CA 3UYLA 3AP2A 2YVQA 4HPJB 3UT6A 4CDNA 3K0BA 4QYXA 2JA2A 3BA6A 5EJ4A 5KSZA 3KV3O 5JJBA 2GRAA 1ABBA 2W2KB 4LZJA 2VTKA 4IXWA 2VATA 3CR3C 1RC0A 2KJQA 1UEXC 1WHSA 2VUHB 4NKRA 5AIAA 4BJ6A 2G5TA 4CMAA 3ASUA 4QHTA 4PO9A 1V3VA 4GKKB 2BTQB 2EX4A 2OTCA 4LN1A 3VR6H 1CRLA 2JIZD 4ME6A 3LS2A 1J9EA 2O8DB 3V8EA 3OCYA 2IL1A 3VR3A 4CFYA 4FR0A 4YY3B 3G8DA 2I6FA 3IAS1 2G1AA 3DPSA 1TOAA 3P0FA 2YDXA 4L8VA 3KALA 5JSKA 3ZHUA 1TYEB 2O8EB 1C8KA 1ZXLA 1GLVA 2CXSA 4HQNA 4AWXA 1BKYA 4DUZB 1JEQB 4WOBA 1HKUA 1L9KA 1FVXA 1IG3A 4P4TA 4YV2A 2DTEA 4OGWA 3H0EA 1XOIA 1K6EA 621PA 4CEHA 1BNCA 1LVUA 1H2YA 1QG4A 1OH7A 4RKFA 4M98A 4PPQA 4HAUA 5BOVA 2RH8A 3ZWQA 3U4QB 3PUJA 2FX2A 3LXMA 1YUBA 1T0BA 3CLSD 4JXKA 4DNPA 1K5PA 4RD1A 1ZFNA 1XYYA 3O8BA 1O5OA 3ANSA 3R7LA 2OSBA 5FEMA 4LMPA 4JZKA 3JAMA 5K4HA 5KJ1A 2P8SA 2P90A 4OEHA 4J1NA 2J7PA 3DWFA 5AUNB 4G0WA 2WUEA 5CJJA 3AUYA 1GZSA 3MTIA 4PFJA 2WWHA 3EPKA 2H57A 1RBQA 4PBTA 3WNZA 4FGWA 3HYTA 4RNCA 3D1JA 4GE3A 3P52A 3TTYA 1Z22A 4F38A 1SUEA 4B81A 4UUBA 6GPBA 4KQHA 5DNDA 3VTZA 1NUAA 2C5FA 1YASA 5DM70 3I1YA 4NDNE 3LWBA 4RA9B 1HGXA 3DLTA 2P4SA 3N2ZB 4RZXA 4TPKA 4X95A 1I7PA 1LV8A 4MVJH 4IG4A 4Q34A 1DPFA 3SJBA 5I7VA 5COBA 2FVYA 1XPOA 1KJYA 1O08A 1Z8NA 2GEJA 3P26A 4X94A 1B74A 2J3KA 2OCIA 2ODQA 3G2LA 3DMNA 4G86A 5A1TA 3ER6A 4QDJA 2QPLA 4X1OA 2YWCA 4JC8A 3HVIA 4KKXB 1K6IA 4AS2A 2PD4A 4QJ3A 4ER5A 5EJAA 1Z63A 4LZWA 1XWFA 2RKWA 2XXJA 5ED0A 3UCFA 4DJTA 2FDXA 3N8KA 4O4HB 2I7DA 4MHSA 2A5JA 4OJMX 4QU8A 4WUVA 1G5RA 4C7KA 4BP8A 1LH0A 2H2GA 1ZMTA 4A26A 1G38A 2D8AA 1OZHA 2N1MA 2COKA 3EYWA 4YRAA 1UFQA 1TCAA 2V7QA 3Q7EA 3NS7A 1SBCA 3MUEA 1BMTA 5L3VA 1AGNA 4CTKA 4EHFA 2VN8A 1G8FA 2VRNA 4F45A 4DIKA 3GZNB 5ALFA 2CVZA 1Z4OA 1XTIA 1NR5A 2AEEA 3CPJB 1ZQ9A 1FP1D 2CKDA 3F6RA 3KB8A 3PKIA 4FSXA 4ONEA 2WHRA 1I7LA 1PJRA 1PJTA 4FYVA 3QTLA 5KOYA 4YXWA 3RREA 4NEGA 5BPFA 1WMSA 1R7RA 1LEHA 4ZQHA 1CE8A 1M7HA 4L9AA 3HUTA 3R24A 3LPAA 4UOEA 3W5IA 4FK8A 1HQYE 5I5GA 4BZWA 1GADO 5KCZA 3HDTA 3O2JA 4OU4A 5KYVA 3O9MA 1SG0A 1I5OA 2PL1A 2QVLA 3KZ1E 4ZJYA 4NJMB 2AT1A 5IFLA 4JYAB 1OV6A 2HTFA 1F48A 1VMEA 1DXQA 1ZNQO 2XUKA 3ND8A 4GYWA 4L4ZA 2EJCA 3R0ZA 1F7VA 2GAJA 5BV0A 3W8DA 4DM4A 4CEIB 3RSSA 2X1MA 1G19A 2B20A 3AR2A 4PCUA 4V38A 3LFTA 3RVDA 1GR1A 4IX1A 3MGKA 3A06A 3DO5A 3ET5A 3R8FA 4I36A 2YV5A 2J5QA 1DBSA 4C7BA 2IA5A 2ZS7A 2Z2IA 1BX0A 4GPEA 1HF3A 2BONA 1Q22A 2WJ3A 4OHPA 3PEEA 3ZW8A 1KO5A 1XE3A 4OGKA 4QULA 4KSYA 4F8EA 4ECEA 5A5DA 3OHMA 4DTCA 5A4JA 5IXYA 1GQFA 2QP4A 1C14A 3I6ZA 5EJ2A 3V1KA 1UIMA 4CUKA 2XH8A 5C7IO 1UKZA 1RC8A 2OCPA 2OHFA 1GYQA 5FPYA 2VFAA 2NU7B 2R5FA 4HNHA 3SI7A 2FLVA 2XB9A 4NQZA 3ILSA 3TS1A 3RKUA 5GIOE 2DBYA 1HV8A 1NTOA 1X2BA 1G3UA 2J9FA 4W7IA 4MGHA 2XB2A 3BF7A 1QRDA 4P4SB 3T52A 4HQFA 5DI3A 3AL3A 1ZOSA 2I2BA 2QMHA 4X20A 2IU3A 4F3NA 3MZ0A 4L4XA 5DRTA 3CTMA 4YONB 1DXYA 2XVXA 3VFDA 3CF4G 2W2TA 5JMTA 2GN1A 5E9QA 3GCDA 5HQTA 3QUSA 3G6KA 2ZVJA 3EVAA 4MVYA 1K6MA 2Q2QA 5EQDA 5ES4B 1AIPA 5FAXA 1PK9A 3DZHA 3I12A 4Y2XA 4HTFA 3UG6A 1AMNA 1V7CA 5E7JA 1U1DA 2ECKA 1HMPA 1G4AE 1G2OA 3QA3E 4QEZA 4Q1VA 2NYRA 3C7AA 4P4GA 5H1YA 1TI7A 1GNSA 1VL6A 3EWNA 3GLVA 4B3FX 4CV0A 1DXHA 1QONA 2Q6OA 1DV1A 2DQKA 3DGFC 3M5DA 1N5OX 3PZBA 2ERYA 3ICCA 3GZJA 3RFXA 3UBTA 1RYHA 1ND5A 3PPWA 2RHDA 1Z5ZA 2W8ZA 1Y3HA 1ECCA 2P6OA 3HKCB 4X1IA 2NSJA 5GONF 4O3MA 4X6UA 1KAGA 2NVUA 1Z16A 2HLNA 1VE7A 1U0LA 3OOSA 5HS6A 3RS5A 4N5IX 3IHTA 3KLNA 3KVOA 2P0YA 4MH0R 4QUKA 5KBYA 4HBGA 3H1TA 4XYEA 2VP6A 2RIPA 4MPPA 2XIQA 1A9PA 3TIIA 2G76A 3TLEA 4KNVA 4DCPA 3ZU2A 2KBFA 4WUTA 3EXEA 1XPJA 5D7NA 3ZQ4A 3SQOA 2IW3A 1N2SA 4A6EA 1JEEA 2ABWA 3U7QA 2QMZA 2JI4A 1W44A 1AM4D 4LMAA 2C9MA 2VQ3A 3RSZA 3UMBA 2Q3BA 2YFKA 3JARA 3ZEIA 5ALPA 2Z98A 2AN1A 3S27A 1HXHA 3PR2B 1TVCA 5DI9A 1L1FA 1K7CA 4IS2A 2DULA 5ABPA 3BQNB 1ZIYA 4I3HA 1W5SA 1XTQA 1DQNA 3O8RA 2Z4TA 3BXZA 3BRWA 2G06A 3UJ6A 5AVTA 2PUDA 1KNQA 2ZIAA 3DMFA 4FFMA 5AI9A 2Q9CA 5ICGA 5TLSA 3U4HA 1WUYA 4XASA 4FKBA 2QTGA 1TIPA 3VPAA 3LDUA 2Y1EA 4PY2A 3OX3A 1OBFO 4TN5A 5SYNA 5JDCC 4XVQA 5LSAA 4L9RA 4QQKA 4GPTA 3U1VA 2QZSA 5KX5B 3M6VA 4BV2A 4RVUA 1W9HA 3TW6A 4JLKA 5B2FA 4J3NA 5BSKA 3Q6NA 2B94A 1C0KA 3A36A 4Q4LA 3DWGA 5IKOA 3BK2A 4D8XA 3I5YA 1YZKA 5EHQA 3FG9A 3KU1A 2YMLA 4UUNA 4JR2A 4O63O 1ZMBA 3EOZA 2CDCA 4A2PA 2XY4A 4Q4CA 3NV9A 1KK1A 3CWZA 3VJKA 4BVKA 1M8KA 2ZB3A 3ROMA 2AE1A 2P3SA 2R65A 3OHSX 2ZREA 4CLOA 4FCVA 4CZ2A 4OKIA 5LQKA 5K2MA 4XX0B 2XUQA 3FZGA 2R0QC 4M83A 1NUSA 4EHBA 3L07A 1SPXA 2WIFA 3FUCA 3A2LA 1H5UA 1L5YA 1DBVO 3OFVA 1DZIA 3WBJA 3W2EA 3L49A 1DEKA 1F0KA 1DRJA 4F46A 4XGKA 2QWXA 4ZVNA 4WFIA 5CIWA 2PNJA 5K05A 4QLOA 2GBLA 2O8CB 2EZ9A 3M6MD 3KTAA 5HIIA 5AW2A 1RJWA 3OKAA 1JXMA 2VHUA 4XM2A 4DMHA 5KNBD