1SB8A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
341
Chain Sequence
MMSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords wbpP
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 127
structure length 341
sequence length 341
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb8A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb8A02
2I9PA 4GH5A 2D4AA 4YR9A 1C1DA 2BGKA 2HMUA 2BKAA 3TZ6A 1CEQA 2ZKLA 1E0DA 4CMHA 1V3VA 4IY1A 3X2FA 1IPEA 2YHUA 2DUUA 4MVJG 4HNHA 3WWYA 2FR1A 1LRLA 3OFSA 5C7OO 4JIGA 3TOZA 3LSYA 2JFGA 2O4CA 1UXKA 1KEWA 1ZKMA 4UVEA 2Q1UA 4N18A 3UGKA 3VPHA 1MUUA 3UFXA 1YQXA 4AJ4A 3MOGA 3H2SA 4YAIA 3DZGA 5AXDA 4WLOA 3EGOA 1Z7EA 2CY0A 3VKVA 4A26A 1PGQA 3QIVA 4AJKA 3Q2KA 3I9JA 3RUAA 2RIRA 4YCAA 3RFTA 3TRIA 4RLHA 2JL1A 3G0OA 4BNFA 4WUVA 1JAYA 3E18A 2EW8A 3NTQA 3H9GA 1V3UA 1M67A 5FI5A 5L40A 2XF8A 3GEMA 1P0FA 4ND4A 5DNAA 5KKAA 4DYDA 1RM5A 1DDOA 3WFIA 8ADHA 2AE1A 1DLJA 1E3LA 3MJVA 4EJMA 4C4OA 3U62A 1U4SA 1I5RA 1T24A 2C5EA 4RVUA 3L4SO 3WGGA 3WQSB 4F45A 4ND5A 1BXZA 4GX1A 2VHWA 3NJ4A 4LISA 2EERA 1U3TA 4BNWA 4ZQGA 5JAZA 3WS7A 1O6ZA 2DKNA 2HO5A 3M6IA 3IJRA 1ZW1A 1ZNQO 4M54A 4R1UA 1YO6A 5HS6A 2EWMA 1U3WA 3E03A 3EK2A 4AJOA 5IFLA 4E33A 1C1XA 1BXKA 5FI3A 3ONFA 3GA0A 3OICA 2EW2A 4O1MA 4B79A 3VPSA 3ZWNA 3VC7A 3ZHXA 4IPTA 1QG6A 4HFRA 2DT5A 3JCZA 3DWFA 3R3SA 4LVCA 2C20A 4XB2A 5TX7A 3BAZA 4L76A 3EZLA 1ZO8A 3PJDA 3RC7A 1B8VA 2WE8A 3M2TA 4PLPA 1G6KA 2VUUA 3RUHA 1WP4A 2D2IA 2E82A 4Q39A 3GHYA 5B37A 1BW9A 1GQYA 5T57A 3W6UA 6LDHA 2WD7A 4FW8A 1KEPA 1I2CA 5EQDA 3DC2A 3ZWCA 5G0TA 1I30A 1NVMB 2JAHA 3JQ6A 4MIYA 2VYVA 3P5SA 4CQMA 3VH4A 4D43A 4UUNA 1FMCA 2OUIA 2GNAA 3H7AA 1PQUA 4QFDA 1SBYA 4XZ3A 4RVDA 1E6UA 1NFRA 1O9BA 4R16A 2Q50A 2V7PA 1NR1A 5JAIA 4RPGA 1GCOA 4ROSA 5I7EA 3FR7A 1JLLA 2ZYGA 4LN1A 3GVPA 1EE9A 1E1MA 5K6AC 2J3HA 4J1NA 4UAGA 4LCEA 3WNVA 3BXXA 2B4TO 2EP5A 5HS4A 1U8XX 4PLTA 3F4LA 5G4KB 5CAEA 4BO6A 1XHLA 4XRGA 3ZGYA 1MX3A 3HE3A 3TSCA 5KWEA 3PJEA 4WLEA 1IZ9A 2QQ5A 4CUJA 3OH8A 1KERA 4MKXA 2X5OA 4FFLA 1NFQA 4MKZA 4YWJA 1E6EA 1H6AA 4J49A 4XQGA 4XYMA 2O7QA 4BNHA 5JC8A 3EW7A 2H63A 2X9NA 3I9NA 3QWFA 1YDWA 3OQ1A 2WWRA 1IOLA 1K0UA 1IPFA 3H9QA 1SO8A 5TF4A 1UZMA 2EV9A 5F1OA 3BHJA 3HN2A 3DBHB 1LXCA 1HDRA 4J2OA 2HCTA 3JYPA 1YKFA 3KOUA 1EVJA 3ZU2A 1BDMA 1KS9A 2GRAA 1RM4A 3INTA 4DIBA 4NJMA 3JQCA 1HSOA 1E1NA 5I9NA 2Y1CA 4JK3A 4DRYA 4BHTA 1WDLA 4GAEA 1RJWA 5ES3A 3VTZA 4DC0A 1PR3A 5IDQA 4CM9A 1FF9A 3WNQA 4BO3A 4NPCA 1DXYA 1GV1A 1WPQA 3UH1A 4IUYA 1A7KA 5C37A 4D46A 2VYVD 2XXJA 4CQMD 3PQEA 4O6VA 4DTIA 1X14A 3OM9A 1BXGA 1WLYA 3BZUA 3PYXA 4KP7A 3RUFA 4XD2A 5ER6A 1P31A 2PWZA 4PG7A 4AJJA 4YACA 2Y66A 4G2NA 5EMHA 2Y67A 2ZJ0A 1LQTA 1XA0A 1SPXA 4LSMA 3TZKA 1ZEJA 2NVWA 3RSHA 1ORRA 1KVUA 2GR9A 4BNYA 2P9CA 3KO8A 3PJFA 4CMEA 4KOAA 3WGYA 1EK6A 1ZFNA 1J4AA 2ILTA 4IM7A 1OC4A 2C0CA 1XU9A 3PI7A 5BSFA 3JQAB 4XA8A 2J3KA 3DMTC 3KLPX 1U4OA 1QXSA 2W90A 3GNTA 3UXYA 4AJ2A 2X86A 4A5OA 3H9UA 1R12A 2EHDA 4UVHA 3LT4A 1B16A 3IP3A 1BGVA 1VJ0A 2OZPA 4HADA 4U5QA 1V6AA 3I9OA 4XRRA 3D3WA 4I5DA 5KTKA 1LC3A 4WLNA 5AXBA 3ZWMA 3PWKA 3SEFA 4PG6A 2CNBA 4JBGA 2JCYA 4AJHA 4BV8A 4NBVA 5A06A 9LDBA 2NQ8A 3C24A 3H9EO 3SJUA 2UUOA 1E3SA 3ICPA 3MEQA 3SLKA 4S3MA 2Q1WA 2PFGA 3ROQA 4YRAA 4ONEA 1MG5A 2O7SA 2O3SA 3DZFA 4L75A 3FI9A 2QG4A 2PGJA 3QY9A 4CLRA 4YAJA 1NVTA 4UVGA 3UVEA 3ETEA 3F6YA 4L73A 8LDHA 2OXIA 4RV9A 4E12A 1H9AA 2GASA 2JHFA 1DSSG 3QP9A 4XJTA 3PFFA 1JN0A 3FD8A 3UW3A 3I9KA 2W4QA 3I9MA 4J4HA 4CM9D 2RCYA 1DEHA 3ROMA 2IZ1A 3ULKA 1PZFA 3TN7A 3LQFA 4YRBA 1OMOA 1HT0A 2DTDA 2VOJA 2P91A 2ZK7A 4WGGA 4A0SA 3AFNA 4TRJA 4BMVA 4B4UA 4NBWA 1QLHA 2JD0A 4OO3A 1E1LA 1ISJA 2BD0A 1AHIA 2Q49A 4WK6A 3ROPA 2AEJA 5COQA 1YB4A 4XX0A 1JDJA 3LT0A 4BB6A 3LF2A 4DQXA 1XQ6A 3I4CA 3RBXA 1LDGA 4J9VA 3NT4A 3CZRA 4R3WA 1P1KA 1FXSA 3PK0A 4YJHA 5JPIA 4BKRA 1N2SA 3DXFA 2VRBA 2VWGA 2X22A 1KYQA 5BQFA 5C7LO 1VL8A 1Z6ZA 1ZSYA 2CF6A 3DTYA 5EQFA 2TMDA 1ONPA 1F17A 4WNIA 5G2OA 1SAYA 4Y6SA 4DQVA 2D5AA 1IZ0A 4B8ZA 3WSWA 1FDTA 1E3EA 3DOCA 5F21A 1YH3A 2AXQA 1T26A 3AI2A 1R4NA 4BGEA 3N74A 2Q4EA 3P19A 1MFZA 2NQTA 3RAJA 1BVRA 1Z74A 3B20A 2HLPA 1R4MB 4CJXA 3NUGA 3DAGA 4RPKA 1HYEA 3WQQA 2G0TA 2AEFA 2J6IA 4BGVA 4PG4A 1Q0HA 3H3FA 3S2GA 1E1KA 3ZZNA 4FOSA 4U6SA 1CERA 4BNKA 3IL2A 2O23A 3LVFO 2I3AA 4YB8A 4WLVA 4IDGA 1DC4A 5C7IO 2NACA 2IODA 2OMEA 4E21A 1TA4A 2Y99A 4YJGA 1PZGA 4XEHA 3A1NA 3TFQA 3K2EA 4FPXA 3KSUA 3ETDA 3G1TA 3I9LA 3Q6IA 4FJ0A 4NR0A 5F5NA 3C7DB 3H65A 5JMPA 3BA1A 3SX2A 4BL5A 4WCFC 4Z9FA 4Z0TA 1D1TA 4I9UA 3PHIA 2Y0DA 5JSFA 2WEKA 3ANMA 3BMNB 3QHAA 2F1KA 5IDWA 2GN6A 3NX4A 3BMCB 5G0SA 4IXWA 1GYPA 1ZK1A 3WJ7A 1Z45A 4E5PA 1E3WB 2NTVA 1NNUA 5DDIP 4I5GA 1CYDA 4W7HA 3B70A 2ZTLA 4JJGA 1JWBB 4YJFB 4II2A 3MJTA 5JYEA 3WXBA 4CM6A 2E48A 3E9MA 1EFKA 4Q3NA 3BMOB 2DAPA 2IRWA 1PJQA 2NU7A 1GUYA 5KIAA 4I5EA 4L74A 3DL2A 1GPDG 2O3UA 4AL4A 1OZAA 2EJWA 5KJEA 3JQ9A 4L4RA 3UUWA 3ZV3A 3OETA 3KYBA 2RHRA 3RKRA 4LMRA 2GO1A 3TF5A 1BWSA 4AJPA 4RF3A 3ZWOA 4D42A 3F9IA 1YOVA 4HY3A 3EHEA 2Z1NA 4BS9A 4DA9A 4LSWA 2D8AA 3EYWA 1GZ6A 1HRDA 2PD6A 3T4EA 1J0XO 2NV6A 1H93A 1NTOA 1I3MA 2CDAA 3IUSA 4HKTA 4MJLA 4CMIA 4CQLB 2AQHA 1GEEA 2YHIA 3HDQA 4TZTA 4NFYA 1ENOA 4Y6PA 1T25A 3V2HA 4NBTA 4JXKA 3C1AA 1H0KA 4EITA 4N54A 1YBVA 4G65A 1U3UA 1H9BA 2D59A 5H82A 1Q0LA 1GTMA 3JQ7A 5JFOA 2E49A 1EVIA 1UZLA 4IZIA 1ZCJA 5HWSA 2X1HA 3R6DA 1D3AA 4GVLA 3D64A 4HP8A 3UKOA 4BIIA 1ISHA 1VJTA 2PZLA 1HEUA 1VSUA 1XU7A 1KY4A 3JQ9C 4TSKA 2FWMX 4C7JA 3NGLA 2Q3EA 1T1RA 2NM0A 3LC1O 4A27A 2FZEA 1BDBA 4R5MA 5G0WA 2FZWA 2JFFA 2X6TA 2C59A 4QO7A 1DJQA 5TGDA 1GCUA 3L07A 1YJ8A 1O89A 2HU2A 2HSDA 3KYDB 3BIOA 5IDXA 1ISIA 3E5MA 3KEQA 3GZNA 1ZEMA 4YT5A 1KVSA 4R5HA 2X0NA 4TZKA 4WLFA 3ZI0A 4JP3A 1JA9A 2HRZA 4GI2A 2XOXA 1P1RA 3T7CA 1E7MA 3ANNA 3ADPA 2EJVA 5DCUA 5JBIA 3PDUA 4HFNA 3B1KA 4A7PA 1EFLA 4CMCA 3OF2A 1LLCA 2PGDA 1GUFA 3NTRA 1O95A 4M89A 4XGIA 1ZVMA 5GMOA 4U8GA 1YB5A 1YL7A 4PLZA 1HF3A 5THKA 4UUOA 2O3JA 4TRNA 1HE3A 1Y1PA 4CR7A 2G5CA 4NU5A 2YW9A 4EJ6A 5TRTA 4IBOA 2Q99A 3DZIA 3UHAA 2QX7A 4YAEA 1WMAA 3RFXA 2C5AA 4CUKA 3JQBC 1PGJA 4WJZA 3FWNA 4WEOA 2C2YA 5KJFA 2RH4A 2DPGA 4NI5A 4UVIA 3FWZA 1TT5A 2CZCA 3WBBA 1ZK4A 1ISMA 3W8DA 3JV7A 3WGZA 3G1UA 4II3A 2B37A 1U8FO 1Y8QB 3DHEA 1DO8A 3IS3A 2AMFA 4BKUA 4ND2A 1E7SA 1J5PA 3KLMX 3L6OO 4ALNA 3MJ4A 3RKUA 3KSDO 1KOLA 5A5EA 5JE8A 4Z3DA 1N7GA 4P4LA 4C7KA 1IB6A 1AE1A 1AUPA 1XIVA 2PD4A 1LDBA 3GRKA 1LC0A 3GFBA 4I9HA 5T8KA 1B0AA 3PP8A 5JAMA 3DEYX 4NG5A 3PGJA 1Y8RB 3I3OA 2PK3A 3ZU5A 3GPIA 3CTMA 4CM4A 1LI4A 1CETA 2NVBA 4FBGA 1B2LA 2P9GA 3HB5X 5L9AA 3HJAA 4I9NA 4FSHA 2IDZA 2VHVA 2ZJ1A 5IZCA 3O26A 1DHRA 1PR9A 3GPDG 1ZSVA 3JQ8B 4JCOA 2FSVA 3IKTA 4JP2A 1BMDA 2OORA 5U9CA 1ZXBA 3HG7A 4CM8B 2IXBA 3E9NA 3IJPA 1YL6A 1FDSA 4RVFA 3EY4A 3V5NA 2NUAA 3U3XA 1DC5A 1DJNA 4DXHA 2J3IA 3KTDA 3WDSA 4E5KA 3QWIA 1JVSA 3FPCA 4D0SA 1I2BA 1LDMA 1U28A 4PLVA 1FDWA 3P7MA 4BO2A 4WCDA 3KVOA 1F8GA 3AM3A 4R69A 2HMSA 3DAPA 3QRWA 1KEVA 1D8AA 3K9QO 4QTZA 1H2BA 5CDTA 3DTTA 2YJZA 4RZIA 5ER9A 5A04A 1RM0A 3GLQA 2VHXA 2YFHA 3PRJA 4IS2A 4WOKA 4XQCA 3NTOA 5EJ2A 3RC2A 1Y5RA 4EZBA 1PGOA 2QYTA 1MFPA 1F8FA 1X7GA 4YQZA 4B7XA 2HAEA 1L1FA 5TT0A 1EVYA 2BRUA 4KQWA 3EZYA 2P2SA 3WTBA 4E2WA 4W99A 5KKCA 1ZJZA 3JYLA 1ZSNA 3ZHBA 1PZHA 4CLDA 1XYGA 1IE3A 2RAFA 2OP0A 4D3DA 4JQCA 2AG8A 3ZNOA 1GV0A 3OJLA 3W4JA 3K5PA 3WMWA 1QYVA 3AM5A 1B8PA 1C14A 1B26A 2Y1FA 3IMFA 3AOEA 3K31A 4AFNA 4YJDA 5KJCA 5A9RA 3GFGA 3WYBA 3D4PA 2PH5A 1MP0A 2ZB3A 3DBVO 3NDJA 5BSHA 1E7RA 3HHPA 4IJKA 2OL4A 1EBUA 2Y0CA 1FDUA 1PTJA 3ANLA 5DT9A 2HRBA 3RASA 4HNGA 5A03A 4L4SA 4DGSA 2ZCUA 3QW2A 1MLDA 3GC6A 4Q3EA 4RPJA 4EUHA 4H3VA 1UP6A 3DAFA 2EGGA 4FB5A 2F00A 1YBMA 4N7RA 4AVYA 3UCFA 3AOGA 5CDGA 1VC2A 2ZYAA 5TLSA 3ZHYA 1FDVA 4YAGA 2VWHA 5COAA 2A4KA 2GN8A 2O50A 4R1NA 1GAEO 4EUEA 2UVDA 2Z1MA 4IIVA 4CODB 1UDBA 3CMCO 3W1VA 4ZA2A 1ZK2A 3UCEA 3LF1A 3JQGB 4D41A 3A28A 3A4VA 3DDNA 2ZQZA 3PDJA 4QX6A 4GGPA 3F3SA 4NNJA 1XLTA 1AHHA 1JAXA 4Z6KA 3MOIA 3WGOA 2J5RA 4NFHA 3QQPA 1K89A 1C3VA 2AE2A 2X9GA 5LDGA 1HWYA 3INRA 3WTCA 4LMPA 4E5YA 2YFQA 1Y6JA 5L7YA 2B5VA 5L51A 2RH8A 1Q0QA 1A7AA 1ENYA 3E48A 2JHGA 2YZ7A 4MVJE 1S6YA 2WE7A 3BTVA 4N5LA 5GY7A 5TQVA 1PJ3A 2QRLA 3WG9A 5A9SB 1S7CA 4X54A 2FPPA 2NLOA 4Q3BA 2BGLA 5U1PA 1XQ1A 4UEOA 1GQQA 3E9QA 1WAMA 3PPIA 4Q3AA 2R6JA 1I36A 5G0VA 1LRKA 2O3TA 4LRSB 1C1DB 5FYDA 3V1YA 2C07A 4E4YA 1QYCA 4RPLA 4FD3A 2GERA 4KDFA 1MC4A 4B3HA 4OIMA 1LNQA 3DBHA 4PLFA 3WWZA 3RBVA 5A3JA 3KM0A 1A4UA 2UDPA 2EKLA 3WX0A 1ZXLA 3GT0A 3STHA 5LDHA 5THQA 2P5UA 4QUKA 4TRRA 4UEKA 3DZHA 1N92A 2Y1DA 1JVBA 4CMKA 4CV2A 2HK9A 2NVUA 3GZ4A 1QYXA 1RM3A 4ZHSA 5DF1A 2FN7A 1ZK3A 1PL8A 1TLTA 2J3JA 3GR6A 2PKQP 1ADBA 4R68A 1ARZA 2BFMA 2OBNA 3ONDA 1HYGA 2H5LA 4PGFA 3GEGA 3ABIA 3DHYA 4A03A 2IEBA 3O4RA 2R00A 3AW9A 5KJ1A 3VTFA 1M2WA 1X1TA 3FHLA 4CMBA 3Q1LA 5LCXA 1YGYA 3H6KA 1E3JA 5L7WA 1XWFA 4O5OA 4MP3A 3OIFA 1K5HA 3GRPA 3H8VA 2DFDA 3PWZA 4PZEA 1TB4A 1V9LA 3NYWA 2EEZA 4HFMA 3PWSA 5MGBA 3D0OA 1A5ZA 1IUKA 1K6IA 4FIZA 1HDCA 4MVJF 4R1TA 2GSDA 3ZWPA 3UN1A 3GMDA 3U4DA 4MVJI 4M55A 1C1XB 4S1VA 5F1PA 3FBTA 3RUIA 1T2AA 1WXDA 1GUZA 2AA3A 5L7TA 3GOHA 3K6JA 1EUDA 1ENZA 3GK3A 4GX0A 4P4GA 5DN9A 3ZWYA 2POQX 1QP8A 3QLJA 4BB5A 1HDGO 3U5TA 1PS8A 3MJEA 4YBZA 4DC1A 4J9UE 1NPYA 1F12A 4DVJA 3GG9A 4H16A 3S55A 1PEDA 3I1JA 1P1IA 3TPCA 2BELA 1ADFA 4FGSA 4AJIA 1B3BA 4B3IA 5CEEA 2GDZA 3ZV4A 4YT2A 3LDHA 1LSJA 4J0FA 2W2KB 2PZKA 4YQYA 4W4TA 1PGNA 1VKOA 4OAQA 1MC5A 2D5CA 3F1KA 1R0LA 3RC9A 3L0DA 3UOGA 4F6CA 4MIOA 1GR0A 1XSEA 2IYPA 2GN9A 3PQDA 2PGLA 4E30A 1RYDA 2V6GA 4BO4A 3BHMA 2GN4A 4DLBA 3OIDA 3D4NA 3RVDA 4AG3A 1GYRA 2B35A 4HBGA 3D1LA 3HSKA 1YDEA 2JD2A 3KUXA 4DWVA 5C3MA 3INGA 4IQ0A 1U7TA 4OQZA 3PHHA 4BNLA 2QRKA 3KRTA 2J5QA 2X0JA 2YYYA 1GEGA 4B7CA 1QMGA 2PD3A 4RJTA 5HRUA 3ENNA 4D79A 4XIJA 5JCXA 2C82A 3SLGA 3U0BA 2X9VA 4Y67A 2BMAA 3PYLA 1UDCA 2ZTMA 3G3EA 3WQRA 3PVZA 2YV1A 4BMNA 2HJSA 4RF4A 4WPGA 1P77A 2CF5A 2CUKA 3RUEA 1LQUA 4MINA 3CH6A 3LC2O 2AQIA 5JAQA 5DOZA 3CPSA 1BSVA 4JN6B 1Y5MA 3VHRA 4B3JA 4UREA 1PZEA 1RPNA 2DBVO 4D0RA 5AQ1A 3BTOA 1PL7A 4J16A 2FP4A 4NJMB 4YT8A 4L4XA 4BNUA 2Q46A 2G82A 1AXEA 2GYYA 1DRVA 2Q4BA 1MGOA 4GBJA 4BNNA 3Q11A 1O5IA 5G4LA 3G49A 2BI8A 3E5RA 5GZ1A 3MTGA 1WMBA 4WE3A 1T2EA 3VH1A 1R37A 4XYBA 1NFFA 3WGIA 2YQ4A 1D4FA 3B1JA 2YUTA 5GZ6A 5JCJA 1ZMTA 1PS9A 3T4XA 3O8QB 4NJOA 4R1SA 3PIDA 2DM6A 2FPIA 4MVJA 1LDEA 1Y81A 4XKJA 1IHYA 1SC6A 4FFNA 1BXGB 1P3DA 2AW5A 2TMGA 3EUWA 3H9JA 4FJ1A 3FRJA 4HUJA 4RCVA 1NQOA 4XIYA 3NV9A 1MXHA 3TL2A 2WJPA 4OXKA 3AFMA 4RZHA 1Q7BA 4KUEA 1LX6A 1KC1A 1A27A 1UDAA 1P74A 3HZZA 3ICCA 5J23A 1PJLA 5JO9A 1NM5A 3KXDA 3PXXA 4IZHA 3BMCA 3ZNQA 4PIVA 2FOIA 1O0SA 3GVCA 1E92A 5F3RA 3DB2A 1JTVA 2X4GA 4BNJA 3RWBA 1GD1O 4GLOA 5DP1A 4YJFA 1TEHA 1HL3A 5DP2A 4FC6A 3QE3A 4FR5A 1DIAA 3O38A 1NHGA 4OQYA 3WSVA 4E3ZA 4IQGA 1M6WA 1DB3A 1BTOA 4CV0A 3NGXA 3DZBA 1QSGA 2WMDA 3TL3A 2EP7A 1B3RA 4Q3DA 2YQ5A 1AN9A 3TWOA 3KB6A 1UP7A 2DBRA 4J1TA 2VUSA 1LJ8A 3U9LA 4ALIA 5CEFA 2Q45A 4OKIA 4ESOA 5TJHA 4IJUA 3VDQA 1U7HA 1N9GA 3AUUA 4KUGA 1CWUA 4RVHA 2GCGA 3DBRB 3DBLA 4PZCA 1NX6A 4F6LA 4PLCA 5JDCA 2CDBA 4E2XA 5JW6A 3I5MA 5EPOA 4LGVA 4ALJA 3VZQA 4CLRB 2DPHA 2HMTA 2Q1SA 1BRMA 3NDRA 1C0IA 3W6ZA 1HE5A 2CVOA 1DBVO 1M75A 3L9WA 2EG9A 4LVUA 4FC7A 3E6AA 1I2ZA 3COSA 4RF5A 3VPFA 3MJCA 1IYZA 3WOHA 2FMUA 1Q1NA 1VE9A 1PQPA 2YY7A 2C7VA 3LC7O 5JCJD 3D5QA 2WYUA 4FCCA 3WLFA 1PWXA 2BGMA 4CLOB 4MVJD 4TVBA 3TZCA 7MDHA 5ICSA 3HFSA 1NPDA 4B4OA 1EBFA 4URFA 3BYZA 3ZCXA 4AJEA 1QV7A 3BMQA 4WOJA 4W6ZA 1Y9EA 3VKUA 3PLNA 3WR5A 2UUPA 4M86A 4HV4A 4DPMA 2BF7A 4R01A 3DZJA 4MDHA 3GQVA 4BMSA 2B5WA 3JD1A 1QORA 1E3IA 2O2SA 4YJHB 3Q3CA 4BNIA 1HDXA 4WCFB 4IDDA 4ZU3A 4EW6A 4ZGWA 2VRCA 3SC4A 2WYVA 2X0RA 4YVFA 4PRKA 4UULA 1DIGA 3KYDA 3TDKA 2DBZA 2VHZA 5T67A 1W4ZA 3AI1A 3H5AA 3JQFA 3C7AA 4NFSA 4NK5A 2P5YA 1LRJA 1B14A 3C7CB 3DO5A 1LBEA 3JYOA 4GKBA 4AJ1A 4O63O 1R4NB 1KVRA 1H94A 1R16A 2OHXA 4EJ0A 3B6ZA 1E7YA 3GY0A 1IY8A 1W0CA 4FGWA 3ON5A 3RJ9A 1QRRA 3C1OA 1D1SA 1NASA 4ND3A 3WYEA 5L53A 4Z3KA 1HYHA 3EC7A 3A06A 4NHEA 1B15A 4KZPA 1NWCA 1W6UA 3EDMA 3PZBA 4FOOA 3FR8A 4IJVA 1GPJA 3PTZA 3ZV6A 3GMSA 1WW8A 3RUDA 4PCVA 1SCUA 4KDEA 1Z73A 2QZ9A 5HM8A 4ZQFA 1DPGA 5TJ9A 1UH5A 1ZH8A 3DOOA 1DHTA 2G76A 4LRTB 4OHUA 4YJGB 3DR3A 3KETA 1NAHA 3KEOA 3K2BA 1X15A 4RVSA 4BKPA 4J7XA 3Q2IA 4YTEA 3E8XA 4YRDA 3DMYA 3K73O 4G5HA 2OFPA 3JD0A 1R0KA 1PL6A 1F06A 1GDHA 2A9FA 4UUMA 5KVVA 3IC5A 3WICA 1V0JA 2CD9A 3ITKA 3KV3O 3TNLA 4AICA 3QSGA 5H81A 5T5QA 5BNIA 1XG5A 2GD1O 3HQ4O 4RDIA 4BNTA 2Y0EA 4XQEA 3RIHA 1RKXA 5DCYA 4TROA 1BHSA 3PZRA 3TOXA 2NU9A 2AHRA 1UAYA 4TWRA 4BOYA 1N5DA 4UEJA 3T7EA 1JKJA 5TNXA 1X7HA 1UUFA 4J3FA 2PY6A 1DIHA 4FS3A 3QVTA 5FFFA 1NHWA 3GNSA 3NDIA 3WYCA 4D44A 2GZ3A 1TXGA 1Y8RA 1QR6A 2BI7A 2D0IA 2D1YA 3KYCA 1PJ4A 2FPGA 3M1AA 4GSKA 4JNKA 1M66A 2VRCD 3VZPA 4GQAA 1PJBA 3L4BA 5JC1A 3FF4A 3NJ8A 1R6DA 3JQDA 5CPBA 3AJRA 3GUYA 2G17A 1DRUA 1LSUA 3A14A 5AXCA 5IZ4A 1C0PA 3C8MA 1YOVB 1G0NA 4J4BA 1E5LA 3P2YA 3ZNPA 4NIMA 4I1IA 1YL5A 4CM8A 1V3TA 4AJLA 2Q2QA 4J1SA 2YHIB 2EXXA 3CIFA 2ZCVA 3RROA 3G79A 1I3KA 2WTBA 1CQIA 4IJWA 4LCJA 4CL3A 4I8XA 3RBZA 4BNMA 1U5AA 3OBBA 3LYLA 3RUCA 5ENDA 1ISGA 3CZMA 2DQ4A 2W8ZA 4E5NA 9LDTA 4NH4A 5CPFA 3JQ7B 1U9JA 1U3VA 4KTVE 3SC6A 1QYWA 1YVEI 1DC6A 1LLUA 2J8ZA 4IXTA 4YPOA 4KWIA 5CDSA 3O9ZA 1K6JA 1M76A 1ZMOA 2IE0A 3X2EA 3OECA 4YT4A 5GZ3A 1GL3A 4BNVA 2DTEA 3PHGA 3PYMA 4ZVVA 4IGEA 5A05A 1NQTA 4ID9A 2I66A 5IXSA 1N7HA 3WIEA 2NU6A 4GX2A 5F1KA 4CLHA 1Q2XA 2OBYA 1C0KA 3E82A 4GLLA 4P4NA 2RHCA 5ICMA 2QRJA 1U2DA 3U4IA 1I0ZA 2J5KA 1BVUA 4RQTA 1LDNA 3PHLA 2OP1A 4BO7A 3P2OA 5JXWA 3LLVA 1PGPA 3CKYA 4PN3A 5JO0A 4KTTE 4WASA 5KVCA 2Y05A 3AUTA 3CE6A 3LT1A 1PJCA 1C0LA 1N1EA 3IKVA 3DZKA 3OMLA 3ADOA 1EDOA 4W7IA 3NEPX 4CM7A 3PHJA 4DLLA 4HWKA 1U5CA 3UF0A 3GVXA 2O2YA 1SNYA 5KJ6A 6ADHA 1DIRA 3CMMA 1GYQA 5TIIA 1WZIA 3DOJA 4EYEA 3HDHA 3QVOA 3S2EA 4U0KA 1HDOA 2E6UX 5T8KC 1ML3A 2HUNA 2YDYA 3JD3A 1OC2A 3FTNA 1P1HA 3JD2A 3OJEA 4HXYA 2O3RA 5TS3A 1ADCA 3UICA 5A5FA 4AJNA 3WJAA 1ULUA 4GMFA 5BSEA 5IZCC 3PQFA 3GG2A 4J90A 1A72A 2ZYDA 2QIOA 2B83A 3R1IA 1I32A 3ITDA 2X5KO 4H7PA 1HLPA 2X0IA 5CEJA 1NAIA 4BQPA 2FSSA 4WECA 3JTMA 3PEFA 5K0ZA 2B0JA 3PFWO 4XDZA 5L45A 4ZQHA 1ID1A 2YV2A 3U09A 5B12A 3L77A 1RWBA 4OSOA 4CM5A 1NQ5A 3WGHA 4ALMA 4NDNE 3GN1A 4XYGA 5LC1A 4CM4B 4QEDA 1JWAB 2Z5LA 3ROKA 3WGTA 5I9MA 3AU9A 4RGBA 2VN8A 2W98A 1YJQA 1VL6A 4FFPA 3DQPA 7ADHA 3V2GA 5ILOA 3FN4A 3IOYA 3RJ5A 4DPLA 1DFHA 3MTJA 1P1JA 4J2HA 5IN5A 2HQ1A 4UUPA 3FNGA 4E5MA 3WIDA 1UXJA 2VCYA 1Z7BA 4FDAA 4IMRA 4J43A 3ONEA 2P68A 4GKVA 5BNTA 1I10A 1BG6A 2NNLD 4JJFA 1X7DA 2NU8A 1LEHA 4M49A 5DULA 3IUPA 4M87A 1Z82A 1X0XA 3RC1A 2R2GA 1EVZA 5I8WA 2EF1A 1R15A 1ULSA 3VOSA 3G17A 2VZ0A 4DBZA 4MVJP 1NXQA 2V65A 1E5QA 2YDXA 2PA3A 4JJIA 4WKGA 3ZWVA 4J0EA 2W2LA 4FN4A 3GVHA 3AOEC 1IULA 1Q7CA 1N1GA 3BHIA 2DFVA 2IZ0A 1N8KA 5G4KA 4JGBA 4F3YA 4E31A 1YXMA 4NBUA 4Q9NA 3ZU3A 5BSGA 3RCBA 1PQWA 4ZD6A 4MKRA 3D7LA 3MJSA 1KEUA 4E32A 3LLSA 5I7VA 2JJYA 4K26A 4MIEA 1XR3A 3S8MA 2GZ2A 1PSDA 1HDYA 1P9LA 2V6BA 3SXPA 4PRLA 1MG0A 1MV8A 5K6AA 5JY6A 1H6DA 1DLIA 2A35A 3AK4A 1QKIA 3ZWXA 2NWQA 1FK8A 4P38A 1LSOA 1I01A 1SMKA 1F0YA 3OHSX 1LLQA 2GUGA 4K28A 4W9NA 3JQEA 1UZNA 3L6DA 1K2WA 1R66A 2ZTUA 3HN7A 4ITUA 1HE2A 1MA0A 2PZMA 1O8CA 4DUPA 4L0QA 2C29D 5JMWA 3CEAA 3F5SA 2OOSA 1DFGA 4YDRA 1I3NA 1EUZA 5L4SA 4XYLA 2GZ1A 2W2KA 1I8TA 2ZIZA 2V6FA 1T2DA 3L9XA 1I3LA 4PLWA 4ALLA 3CINA 1UR5A 5DZSA 1CRWG 5L95A 3DONA 1PJSA 4F46A 1OBFO 2CDCA 1ONNA 1P0CA 2QHXA 4MPDA 4HX5A 1M6HA 4WNCA 3AUAA 1GY8A 1ZK0A 4U7WA 5IN4A 3ZU4A 4I08A 1GQ2A 3ORFA 4DMMA 2P9EA 1W73A 2HK7A 4XQ9A 5BT9A 2PKRA 4BO1A 2W2LD 2A92A 5L4NA 1EMDA 1VPDA 4KQXA 3AU8A 1SOVA 3JQAA 4BQRA 5AVOA 4W9NC 2GPTA 1PX0A 1L7DA 3C3XA 4DBVO 4OSPA 4RDHA 4IDAA 2CMDA 1U2GA 4M8SA 1DFIA 1X0VA 2VNSA 2CSUA 4PFJA 4MP8A 1V8BA 1VKNA 3C85A 1EDZA 3IQDB 4TKMA 3UCXA 1XEAA 5I9LA 5IAAA 3K30A 2VZ8A 4INAA 2EGHA 1P1FA 1HDZA 3IIEA 1UAGA 1ZZEA 5IDYA 1BW9B 2HKIA 3NT2A 4KUHA 2WD7B 4N5MA 2R00C 1VL0A 1TI7A 1PJTA 2FR0A 2XAAA 4B7UA 2PZJA 4E6PA 1QYDA 3LU1A 4J7UA 4GGOA 4BO0A 1KVTA 1WNTA 5BR7A 1F14A 4FFRA 3DMTA 5L3ZA 3ZV5A 4BNXA 4CQMB 3OJ0A 4K1LA 4OMUA 1VM6A 3ZH2A 1SOWA 1WZEA 4J6FA 3D5TA 2NVUB 3QVWA 2WD8A 1I33A 2LDBA 4YEDA 1YS4A 5CFZA 1HXHA 2HMWA 3CUKA 4GX5A 1T2CA 3VDRA 3OP4A 4OGWA 3PJGA 4BNZA 3O8QA 2HMVA 3OIGA 4D7AA 1J49A 3LT2A 3WBFA 2DC1A 2FHSA 4IQ8A 3D3EA 3IDSA 3JD4A 2B36A 2WSBA 1WVGA 1CF2O 3NT5A 3HFGA 2H9IA 5F5LA 4DQUA 2EKPA 4JROA 4KMSA 4BV9A 2D3TA 3NRCA 3GGOA 3Q9UA 3FNEA 3WLEA 4WLUA 4BGIA 4E2ZA 3ASVA 5L4LA 1SEPA 1IL0A 1OAAA 1JKFA 4YA6A 1YRLA 2Y68A 4CLEA 3NKLA 2PH3A 4OXYA 3H4VA 5DBIA 5JNLA 2EIHA 3FCOA 4RQUA 3F46A 4BKQA 5JY1A 3AY6A 3PGXA 1YBAA 3I83A 1HZJA 3JQAD 3RU9A 4RO0A 4MVJH 1DAOA 4TKLA 5JDIA 5T64A 2VZ9A 5A1TA 3GAZA 4EUFA 1O94A 3FSRA 1E7WA 1NBOA 1CQJA 5I8ZA 4D3SA 1IHXA 3TFOA 3E1KA 2JKVA 2HK8A 5JLAA 5U4QA 2B4RO 1NQAO 5ITWA 4KWHA 3OEWA 1H2HA 1NWHA 1R4MA 4BUCA 4QFCA 4GSLA 5EIOA 4QECA 4N5NA 2VTDA 2PTGA 4EGFA 2B69A 3ENKA 3SBOA 1G0OA 5AYVA 5CHEA 4R3NA 3TZQA 4BO8A 2BHLA 1B7GO 3WFJA 3DBRA 5DBGA 4ZRNA 3W4IA 2PKQO 4Z9YA 4BNGA 5FWNA 1T1SA 2VYNA 3EMKA 3C1TA 5BNFA 4OJNA 1JKIA 4FFMA 3A9WA 1W8DA 5T6BA 3GHHA 2JAPA 2Z95A 4BO9A 3M2PA 2QW8A 3U4HA 1HE4A 4GPD1 5HA5A 2ZB7A 3GEDA 1EEHA 3BMNA 1EE2A 3VPXA 1JW9B 2HDHA 5TC4A 5JDIC 2EKQA 2ET6A 2IYOA 4CLOA 2CFCA 4RPHA 4A10A 4EEZA 3I23A 1E3WA 2JCVA 4CLXA 3MWEB 5EN4A 1WDKA 4XJSA 4DIFA 4BGUA 1NYTA 4U0JA 1LLDA 2PR2A 1Z75A 4GWKA 4RLSA 2VHYA 3VH3A 4CM1A 4NU6A 3RFVA 1PS0A 4LK3A 5KCZA 1QLJA 2BFPA 3BMOA 3Q0EA 4IIUA 1ISFA 4K6FA 5IJZA 3HDYA 4JX8A 4XCVA 3D3WB 2VT2A 3V1TC 5I7SA 2I65A 3D4OA 3OEYA 1ENPA 3FNFA 3F47A 4IINA 4R54A 4WCFA 3KBOA 2VUTA 2FY8A 2E37A 2BFOA 1JQBA 1UXIA 2P4HX 3Q9NA 4CV1A 2VWQA 2X7HA 3H5RA 3QVXA 1VJ1A 1NPTO 4HFJA 1E77A 4IDFA 2PNFA 3AY3A 4OM8A 5CG2A 3K96A 2G1UA 2I67A 1MB4A 3F5QA 3OSUA 4CMEC 4YXFA 3LK7A 1SB9A 2ZATA 4JBHA 1A71A 4MVJM 1H5QA 1A9YA 2X8LA 1LDYA 3U4CA 4QT0A 4O0LA 2PV7A 1YONA 4GVXA 2FR8A 4P22A 1A9ZA 3U49A 4M1QA 4LW8A 2ZB8A 4CQLA 1ZUD1 1TT7A 3H3JA 4E13A 4YAKA 4H15A 4IDEA 4E2YA 1I24A 2DU8A 2ZTVA 4W82A 1ONOA 3GVIA 4B8WA 2CVZA 4ZN6A 5KNLA 4R51A 1DRWA 4EI2A 3B1FA 3LZ6A 2AQKA 1PIWA 4BKOA 4DIOA 2DLDA 4ND1A 5EINA 3S1LA 1GADO 3MWDB 1NR7A 1PWZA 4ZQBA 5K9ZA 1HTBA 2VYND 1SB8A 1YB1A 3TQHA 4EEXA 5TSDA 4QSMA 5CDUA 5CDYA 1VI2A 3K92A 4XDYA 3BTUA 3GDFA 3WB9A 3GN2A 2Q1TA 4XB1A 4CL8A 2E4AA 2WYWA 2O3QA 4Y8VA 3OA0A 2BLLA 3IP1A 1Y7TA 3R3JA 5AXAA 4CM3A 4I5FA 4ZICA 5JDCC 3ZDFA 1EK5A 2AEMA 2NTJA 4DREA 2AQ8A 2O4UX 2VOEA 3SVTA 1JU9A 1EUCA 4XWYA 2H1SA 4U6QA 1FJHA 2BFAA 3W8EA 4NK4A 3EAGA 2YV3A 1X1EA 1YE3A 4J1QA 3GGPA 1E7QA 3O03A 1KIFA 1T2FA 3HNPA 4K9DA 5A02A 4OH1A 5EL0A 4YYZA 4ZJUA 1J6UA 2Q2WA 1EZ4A 2C7GA 1OI7A 4TVOA 4Y6RA 3ZHZA 2DTXA 3QWHA 2WDZA 4IDCA 4XR4A 4J91A 4CR6A 4PVDA 3AM4A 1SZJG 2QZZA 4PG5A 1P44A 2VNAA 1XGKA 2UAGA 1CIVA 2X5JO 2GLXA 1SEVA 5DOVA 2C2XA 1UP4A 2DVMA 4ZRMA 5ENVA 3FPLA 1P33A 2VWPA 3M1LA 2IXAA 1N9GB 3DBLB 5ADHA 1A4IA 4IDBA 4TMFA 4MP6A 2VT3A 1GZ3A 1KBZA 1AXGA 5G0UA 2I6TA 2O48X 3IAHA 4WEQA 3W4KA 1RYEA 1XKQA 1VSVA 2Q2VA 1NP3A 3W8FA 4DL9A 4ILKA 1LSSA 5EESA 3VH2A 2ZB4A 4DYVA 2B4QA 1L7EA 1Y9AA 2UV8A 1EQ2A 5A3VA 1V35A 3ZWAA 2FRDA 3S2FA 4BVAA 3GGGA 3N7UA 4PLHA 2ZQYA 1E6WA 5IF3A 4FJ2A 3I52A 4Y9DA 1YQDA 1Y8QA 2OO5A 3HADA 2SCUA 3HB4X 3JQFC 1D7OA 3GAFA 3I4FA 3QJ5A 1DC3A 4NQZA 3WGQA 2I76A 5KVSA 3BMQB 1K3TA 4L8VA 1PU2A 2X58A 4OOFA 4DMLA 2VQ3A 4A73A 1HZZA 3QA9A 4GL4A 3AUSA 2PLAA 2OGUA 1HLDA 3JQBA 2IZZA 2Y1OA 5ITVA 3ZW8A 5I7FA 2LDXA 3OA2A 5KVQA 2GGSA 1YQGA 3OJOA 5B1YA 4Z9XA 4R41A 1DIBA 1UXHA 2Y1EA 3GUCA 3QVSA 1GZ4A 2I5PO 3F1LA 2UYYA 4CMJA 1LUAA 4CUZA 4IS3A 2IEDA 3HWRA 4JBIA 2NADA 2CVQA 4BO5A 4OKNA 1GU7A 2JFHA 1H6BA 4RORA 4GWGA 1AGNA 3H2ZA 4B4WA 5CG1A 3JQ8A 5FF9A 4R9SA 3GNQA 4Y98A 4CMIB 4FQ8A 2QYSA 3HUDA 3CSDA 2Y1GA 1XCBA 3GH3A 3VZRA 1ADGA 3MCVA 1KVQA 4TQGA 4IGFA 4K6CA 3DFUA 4GMGA 5A4DA 4PLYA 5C5IA 1T4DA 3R0IA 2VTEA 1H6CA 5DBFA 1LTHR 2GF2A 3PLRA 1X13A 2RBEA 3RD5A 1EQUA 5JYDA 2I3GA 4Q3CA 1R0SA 4PG8A 3F4BA 3JYNA 4O59O 5IG2A 5IXYA 1TVEA 1HETA 3MZ0A 4A2CA 1KC3A 5HTOA 2P4QA 4FFOA 2NTNA 3EVTA 3N58A 4CPDA 2JCXA 4D45A 3FNHA 4XGNA 5JS6A 4IMPA 4ALKA 3L4BC 4PZDA 4R9RA 3KHUA 1VLLA 4J4TA 1ZBQA 3VVBA 4L9RA 4QO8A 1G1AA 4OOEA 5COBA 5B4UA 4DLAA 3HDJA 3KZVA 3K8ZA 4RL6A 3GDOA 1B8UA 2XXBA 4XYEA 4EDFA 3GZNB 4MOWA 5A9TA 3ASUA 3WMXA 5TT1A 3ZWBA 4CMAA 4Z0HO 4OYRA 3VZSA 3OQ6A 4B4VA 3ZNNA 1U1IA 2Y93A 1Q7GA 4RF2A 1OOEA 3V1UA 1VRWA 3KYCB 3RU7A 4DPKA 4XR9A 5CP8A 4OXNA 1HSZA 3H5NA 3JSAA 3TJRA 2DUWA 4NBRA 3OJFA 1CJCA 2DBQA 3V8BA 4XGKA 5MDHA 1XDWA 3VPGA 1LU9A 2AG5A 1NVGA 3RI3A 5KOIA 5B4VA 3S2IA 3I6QA 1KETA 5EERA 1GFSA 3NAQA 3TZHA 4Z0PA 1UJMA 3ST7A 4EBFA 1LA2A 3OQBA 5FEUA 2NSDA 1HKUA 3L6EA 3DFZA 2H6EA 1DAPA 4E0BA 1ZJYA 3AI3A 5B4TA 3FTPA 1T4BA 2X23A 3I6IA 1TT5B 4CV3A 1MXFA 1ZIDA 4UVDA 2V6MA 4CMGA 2BH9A 3KSZO 4R4JA 4P8RA 3JQGA 2WM3A 3CXRA 1QV6A 5HBRA 3ETGA 3VVCA 3VAZA 1OFGA 4NMHA 1CDOA 1K6XA 1UXGA 5H83A 1PJ2A 4QQRA 1P45A 2XPCA 4RVGA 3V2UA 4QXMA 3RQSA 3ZWWA 1DOHA 5AOVA 4ZQEA 3QWAA 4PLGA 2JD1A 1YWGO 3GF4A 4JLWA 1KY5A 3GDGA 3AY7A 3QWBA 1WWKA 3UAGA 2I99A 4MO2A 3PIIA 5A9SA 4PVCA 4TRMA 3SJ7A 3DHNA 5DCWA 3QV1A 2HJRA 3AWDA 1XELA 4OL9A 2A94A 4J7CA 2C54A 5ILGA 4D3FA 3EVNA 3BTSA 4G81A 3ZW9A 3FBGA 3ZN2A 3JYQA 1WDMA 4CR8A 4NZ9A
chains in the Genus database with same CATH superfamily
4GMXA 1RQ7A 1WPXA 2BZSA 1IEQA 3N07A 2RGGA 3IJ5A 2BGKA 3NOVA 2AOUA 2XVMA 2PGNA 3MBOA 4IJQA 5H80A 3U4GA 5FFNA 1CEQA 2QUBA 1Y1LA 4DRZA 1UPBA 5B2EA 4ER6A 2IHZA 2WWXA 5AK4A 1W44A 3X2FA 3RS7A 3LOQA 5I48A 5ARCA 4LFAB 3D3KA 2ZYSA 3AVTA 4GDFA 4DG5A 2P6RA 4U9HS 1SUSA 5IXJA 4I14A 2AHOA 4N0MA 2XQIA 4JIGA 1QGDA 3NFYA 4TKUA 5C7OO 1XMOB 1UXKA 4UVEA 1RFLA 1Q22A 5CAEA 1AY0A 3OZSA 2HIAA 2UVPB 4O2BB 4JLOA 5A4FS 4MV4A 5TF0A 3DSRA 3X1XA 3LUHA 4TQUS 3EGOA 1Z7EA 1YC5A 4DRXB 4L8LA 3SZUA 2P6OA 3I9JA 3RUAA 1CUUA 1VYUA 2PWPA 2Q5OA 2QT1A 1WHSA 3BJMA 4MMYB 3RFTA 3NANA 3WLJA 8AT1A 4BNFA 1JAYA 5IBCA 2DKOA 2HF8A 3STWA 2R751 2ZUBA 1VLZA 2AWNA 3BL8A 3KKZA 3NTQA 4YS6A 1T9GS 5LQRA 4KBFA 4KXFB 4DYDA 1CE8B 1DDOA 2HSEA 5HKOA 2J31A 2AE1A 3MJVA 5AQEA 1JIJA 1ZQ9A 4JLDA 1GPKA 2DHQA 3KU4A 4FFDA 4RVUA 3T7TA 3TPZA 2CL0X 3NHLA 3WQSB 1G7SA 1YR9A 2VHWA 2Y9PB 3KXLA 5K3CA 4F96A 3LLUA 2ANBA 3TLKA 5FLXA 5CNMA 5JAZA 3AHJA 5JZOA 1O6ZA 2DKNA 2KHZA 1IHPA 2QW1A 3HKDB 3TAUA 4CQNA 2YJ6A 5F4BA 1HT3A 3HA3A 4QQNA 4AJOA 4KIUA 3SU8A 4HUQA 1X38A 4BZZA 1II0A 4E33A 5FI3A 3A8TA 3KXIA 3OOHA 3QUAA 5K0CA 4CTOA 4KIGA 2I7TA 3ZWNA 2RE8A 3ZHXA 4IPTA 3I2GA 4GD3Q 4RNCA 2QQ0A 2A0XA 4MWTA 2E7ZA 1JGTA 4R8VA 2IXGA 5CFMA 5BQPA 1FQOA 2DT5A 1MX1A 2I33A 2ZRHA 3R3SA 4I55B 2QAJA 4ITRC 4KXNA 4L3VA 4OREX 4XB2A 5TX7A 4L76A 3SS8A 1ZO8A 3PJDA 3QF7A 3RC7A 3L4KA 2PGIA 1A96A 4M9RA 2VUUA 1WP4A 4QDKA 5B37A 3RAGA 3W6UA 4G1BA 3ZQUA 2RHJA 1Z33A 5EQDA 5A4JA 4EB6A 4BGDA 1YE8A 3NHFA 3M3DA 5BW6B 2WVHA 1I30A 4AX8A 2X4IA 3V8RA 5AJTA 1NVMB 4EF6A 1K4YA 4OLBA 4FYJA 4FDLA 2Z9BA 4JLPA 3EEIA 2GCPA 4MW9A 1SULA 3VH4A 4D43A 1FMCA 4MGZR 2OUIA 3KKLA 5EHNA 2ZUTA 5H9WA 4IJMA 3KQPA 5IWAB 3KZNA 4RVDA 2A7XA 3DL7A 4G09A 2V7PA 4HATA 3E7XA 1Q7TA 1LI7A 1P9NA 1KXZA 1ZUNA 2QVGA 4OQ4A 6GPBA 1O6FA 1UK6A 4F5DA 1FYEA 1TNDA 3GJ0A 3LX6A 4D4MA 4RTPA 2ZYGA 4Z9BA 1M6VB 3P9QA 4HYTA 3T1NA 4OLAA 1E1MA 2ZRNA 1RQ2A 3AINA 4KLAA 2B6NA 3VNVA 2R6CA 1D6SA 4J1NA 5EKDA 1V16A 2G04A 4UAGA 4WFQA 1RPZA 1X42A 1W88A 2Q5IA 3KR9A 4TGLA 2OVFA 1U9ZA 4FZJA 3COYA 4IVQA 4PLTA 4LCBA 3UJDA 1Z6QA 4BO6A 3EEFA 4XRGA 2HTEA 1OLXB 2FEWB 1R4ZA 4X41A 3DPIA 3ZGYA 3UATA 3GEEA 3PJEA 4WLEA 4JUFA 3LECA 3PFNA 4UBJA 3HCFA 3THXA 3ETCA 3NIGB 3BEOA 1NN1A 3ONVA 3N0TA 1NFQA 2GM3A 2EJUA 1DI0A 4A2WA 1H6AA 4K6GA 2P8SA 1Z5ZA 2NAPA 4XQGA 2O7QA 4XYMA 2IV7A 2IYZA 1RQNA 2W70A 1CRPA 2AD1A 1C8VB 3EW7A 4ZO7A 5JC8A 4Z0NA 1PR5A 3QWFA 4AJIA 5IW8A 1DO2A 4QLBA 4PRZA 4DJTA 4DR1B 1SQSA 1IPFA 1OT5A 1UZMA 1WF6A 2EV9A 2R7KA 3NWOA 4N6GA 5F1OA 3BHJA 5TPWA 5DYNA 4OLJA 3EGVA 1ZESA 4QQFA 4J2OA 4D9MA 1FSGA 2WB4A 2WHYA 3BPSA 2ZBUA 3U4QA 1YKFA 1QS0A 4NZNA 5CCDA 2X13A 1VG1A 3X1DA 3ZVKA 1U81A 2GRAA 3REGA 2VLBA 3HBLA 4NJMA 1E20A 1QRTA 1MB2A 3R74A 6REQA 4X62B 2RGCA 3IOBA 1IBKB 4MEBA 2Y1CA 3TMKA 2OPHA 2NZVG 2ST1A 2LTAA 1V5WA 1ZC4A 3AGQA 4QFBA 1A9OA 2OK7A 3VOBA 1ECGA 2DH5A 4GAEA 1RJWA 4MUKA 3HJCA 4PBRA 1WHTA 1JJ7A 5ES3A 3FFBA 3EG9B 1PR3A 3FYUB 3PCXA 5EMNA 4EW3A 1FF9A 2NXJA 4BO3A 4Z7NB 2QUZA 2WAOA 3B6MA 3PUVA 5C8VA 2AZXA 1GV1A 3ZXIA 5LIPA 4BP1A 3B6KA 2HIGA 3FMIA 4EY8A 5C37A 5DIZA 3RF6A 1B8OA 4CQJA 2VFAA 3B1XA 2FFQA 1X14A 1PAUA 4C0KA 2C7RA 1I7LA 2H7XA 2H0RA 3A2KA 3R7WA 2X0KA 2ZJ4A 1AU9A 3IOCA 2I6SA 3RUFA 2XXAB 4OQQA 4PG7A 4ND7A 4R84A 1SPXA 4LSMA 2NVWA 4JI4B 1GKIA 3KO8A 4CMEA 3V1KA 4ARCA 1XZHA 3HXKA 1ZFNA 2ILTA 3HBFA 4BMCA 3G02A 2VA8A 1EFRA 5KYUA 2JCGA 5B1DA 3PI7A 3U7RA 4LZPA 1V95A 4KG7A 3KLPX 4BFXA 4L27A 1TQ4A 2X1LA 3DMGA 1CHDA 2P2NA 3L8GA 1S2IA 4DLNA 2AYZA 1L2TA 1EXNA 2IVFA 1GIAA 1MAHA 3ZHVA 2ZXUA 3LHDA 4N9QA 2Q8NA 2AR0A 2AK2A 1B16A 5ECWA 1JJVA 4LF9B 4RUKA 4HADA 3VZCA 4RQAA 3CX7A 1A04A 3ESXA 1GRRA 2NMVA 1LC3A 2BW0A 1PFYA 2PXHA 5GVRA 3UFBA 3VMMA 3EWSA 1JIUA 2H1VA 3OCZA 3KLBA 2R3SA 2RC6A 4MVCA 3TLZA 4ZVTA 3TZEA 4AJHA 9LDBA 4FGKA 1EFUA 4FVTA 3MBKA 4XPIA 1SHUX 3SJUA 1U6JA 3P1JA 1V11A 2UUOA 2GPSA 4FDTA 4RHXA 4DSUA 4ZHQF 4BX0A 4W5HA 1RWQA 5CA0B 1JS1X 3T3NA 2JG3A 5TGZA 5JS1A 2Q1WA 5JAPA 2GFIA 3D3JA 3ZE8A 3ZD8A 1NJFA 4X8MA 5GINE 3E7FA 5AOBA 3I5YA 3UBTA 1EHIA 3V4FA 3AXSA 3FI9A 2PUGA 2QG4A 2DFNA 3QVKA 2PGJA 4JYBA 4M36A 1FPQA 3CZCA 4RPCA 4YAJA 4WY2A 1NVTA 4ZAFA 3F6YA 2PX0A 3D5EA 1LCIA 1H9AA 1Z4OA 4JITA 4QPJC 4V24A 1DSSG 2ZE8A 4KGXA 4LHWA 3E1GA 5DM4A 3R0JA 1NXWA 2R1UA 3KAJA 4HAZA 4JLBA 4ZQCB 3TBKA 1W0JD 1VPTA 2OLKA 3ROMA 4DNXA 1JHPA 1E1RD 3SVLA 5F51A 3Q6MA 3QYJA 3V8VA 3BFXA 2XTAA 1Z4IA 1OUMA 1OB2A 4A0SA 2FWJA 1Q0SA 2GZRA 2AL7A 4TRJA 4JI3B 1M34B 3RSOA 4BMVA 3CF2A 1QLHA 2JD0A 2VXBA 3ROPA 1S4QA 1R10A 1ES9A 1WY5A 4BCBA 2BHNA 3O2JA 3STTA 2D6FA 4BB6A 3T9DA 1T1JA 4EJ2A 2QU8A 4DQXA 3I4CA 3D2BA 1N75A 4LZAA 3A04A 3LA6A 4YJHA 1P1KA 2Q0HA 2ZJBA 1MN6A 2Q6IA 4BKRA 3P9NA 1I4DD 4YJ2F 1KORA 3BD6A 4IIGA 5BQFA 4P4UA 3SF0A 3G2HA 2YZMA 1DBIA 1ZSYA 1OU0A 3DTYA 5EQFA 1J8MF 4YMGA 1ONPA 1HBJA 3E2IA 4G4GA 5E3HA 5I7RA 1I7SB 1SAYA 4Y6SA 4DQVA 3C3KA 1AKRA 2XQVA 1SOUA 3RYFA 1RRGA 3HJFA 1PZNA 5K3BA 1OYWA 4HDNA 1D2GA 4JB2A 1YH3A 2AXQA 3MCUA 4X0EA 4EIWA 2BR3A 1THGA 1R4NA 4XGRA 1VRVA 2JAXA 4HAIA 4LSGA 4BGEA 1DKMA 3H9CA 5DHFA 2VUHB 1T3ZA 2FPLA 1FDRA 2Q7DA 5K99A 1BVRA 4QQ8A 2JBWA 3B20A 4I6EA 2HLPA 3CZ9A 1R4MB 2JK1A 3U26A 2VK8A 4QOGA 3LYHA 1UKZA 3CEJA 4EGSA 1KYIA 1HYEA 3WQQA 2ZZMA 2NPFA 1ZHFA 4PGHA 2J6IA 4BZQA 4DKJA 1ORIA 1Q0HA 1OIXA 4EG0A 1EA7A 3ZZNA 2CL6X 4FOSA 4TQ9A 4U6SA 1J0AA 3W5HA 4EFKA 5IT4A 3NAMA 4YB8A 2ZU6A 1E9BA 1R8QA 1WMFA 3LKDA 1DC4A 3AEQA 2IHTA 2IODA 1FFXA 1USKA 2WAMA 2Y99A 1NNI1 2WFLA 3K2EA 3NJRA 4FPXA 3I9LA 3Q6IA 5LSAA 4TUYB 5DLDA 4P4SA 1UPAA 3EZNA 2R25B 5FLKA 5E6RB 5JMPA 2GM4A 3KPVA 1MHPA 4IHJF 2IH5A 1S3GA 1FFCA 4PHTA 4XWWA 2GPWA 2YJNA 2PLNA 3KUDA 1LZLA 4KNWA 3CN9A 2ZI3A 2EC5A 2GN6A 3ZCSA 1JQ3A 2FPOA 3BGIA 3GZTB 2JCBA 4MQLA 4URVR 4ABTA 3EIEA 3W5AA 5AOAA 4YHHB 4FUTA 4FYYA 1XEWY 1J1ZA 1B6GA 4M21A 4W7HA 3S7TA 4Y2RA 4TYMA 4YJFB 1YRAA 4YBRA 2FR8C 4OSEA 4ZHQA 4II2A 1MJ5A 1U5BA 3S81A 3PCTA 4JLSA 3ZY4A 1MW9X 2VTKA 2H51A 2WNIA 2PAAA 1Z5WA 2F64A 3BMOB 3QX8A 1W8IA 2GQ0A 3IAFA 4KYUA 5P8WA 2OHIA 2DT8A 1TJ5A 3LG2A 2IOYA 4DW8A 3OSZA 1IBRA 1GUYA 3G9UA 2ZROA 1J2RA 1JR3E 1K75A 2GOYA 3OT4A 1P18A 4I5EA 3DL2A 1GPDG 1XTBA 4MWCA 3E23A 4H4EA 3R7FA 2H1FA 4L4RA 3BERA 3ZV3A 4ER5A 2COKA 3IRUA 4R1QA 3H1FA 1QZZA 4TT3D 4JVMA 4AJ9A 4PIMA 4WZAA 1LK0A 5ALDA 1G7RA 1BWSA 3HCEA 4GNRA 3OMWA 4RF3A 3ZWOA 4D42A 2E4ZA 3F9IA 4HY3A 4BS9A 3EHEA 4XGQA 3LDGA 2B94A 3QEMB 2D8AA 1HLGA 3QI2A 1OI3A 2VDWB 4PZYA 4EMBA 1OBOA 2FJUA 3RARA 1GR1A 1YGPA 2BFCB 4U2BA 1NP7A 4HKTA 4CMIA 3MQ2A 4MJLA 2PJUA 3VR4H 3IAAA 2F8MA 3SP1A 2YHIA 3NKVA 1O97D 1R6UA 1JNXX 4QYWA 3WLAA 1LPSA 3KOZA 3TQSA 4M7RA 3MINB 4L3OA 1A9XA 4TLLB 3DKIA 5JRDS 5JFTA 3K0FB 3GPLA 3FRHA 3G2QA 3N75A 1PKXA 1RBYA 2QOEA 4FYXA 4YJ2A 3DTVB 2LKDA 4D3XA 1T91A 2VJBA 2PO5A 1EH5A 2I2AA 2Y1WA 3JQPA 1IG3A 4HAWA 1FRZA 3TS1A 1IXZA 2Q4RA 4HWOA 2P65A 2PX6A 3L4EA 4UE6A 1HV8A 1VJTA 3LDUA 4LV6A 2PZLA 1XTVA 4ZRDA 4BIIA 5JSKA 4ETMA 2CLOB 4YLEA 2PJDA 1HEUA 4D56A 4CHTA 1USUA 1GAXA 4QDTA 5E7JA 1UCFA 2XB8A 4TSKA 3ZTWA 4C7JA 4KN8A 4FWBA 4A1OA 3UKJA 1T1RA 4A27A 2WHQA 1JH8A 4LVOA 5JI2E 3DP7A 3S44A 3UO8B 1G5HA 1U8CB 2HSWA 1R0XA 1F0NA 1JQEA 1WMEA 5TGDA 4G36A 4J6EA 1OYVA 1GCUA 2QG9A 3D43A 3L07A 3DVSX 4GBMA 4RLQA 4X93A 5EYPB 3ILSA 2EQ5A 1V48A 2GK6A 4TWJA 3WZ2A 1BA3A 1O89A 3DTNA 2V3CC 4TOIA 1R5NA 2BFEB 1Y5IA 2PBFA 2JI4A 2LPMA 3BIOA 1AQNA 3GZNA 2GBLA 3OZEA 2H1LA 3B1VA 3LRPA 4NBNA 3BB1A 3OTQA 4F9EA 5B30A 3ZI0A 3EVZA 2X0NA 4OP1A 4GNKA 1FVXA 1JZTA 3D3QA 3L49A 4QGGA 4GI2A 3EQ8A 1IY2A 4DR2B 4G37A 1DT3A 3J7TA 3P0EA 2EZ9A 2FCRA 2FRDC 4H18A 4YAOA 2C5SA 2Q7OE 2D2FA 1E4EB 2EKDA 4H2DA 2ILVA 4D8XA 3IKLA 3VR0A 4Z49A 2EJVA 3O1JC 3PDUA 3B1KA 1EFLA 3CRRA 3LBAA 2FF5A 3MJFA 1R9GA 1Z4JA 4IHJA 1YT5A 4MAMA 4EAAA 3PQ6A 5AIBA 3LQ2A 5J2TB 5A0FA 2V3VA 4Z5XA 2G4CA 5FA5A 1GUFA 3INNA 4XD7D 2C3PA 3VDNB 2BKVA 1KK0A 2IPOA 2ZR8A 3PNVA 1EHCA 4XGIA 5H02A 2VF4X 5LVAA 1E5TA 2MJLA 1YB5A 2YRXA 3K9NA 1HF3A 4N47A 3BCSA 2TECE 1Y1PA 2G5CA 1CNFA 2VC2B 4RHCA 1KDYA 5D00A 3HFJA 3G82C 4AN4A 2RGWA 3OQJA 3X1ZA 3RFXA 1YR3A 4P86A 1PGJA 1VI5A 1U94A 5ADUS 2QV7A 4XH9B 1B41A 4CT5A 3AM1A 4WEOA 2C2YA 5KJFA 2RH4A 1RHJA 5PGMA 1LFDB 1TUGA 1R0YA 2BR5A 3R41A 1Y3HA 3H16A 2LIVA 3JV7A 3WGZA 4C20A 4CKCB 4RD0A 1G8PA 2O52A 1U3DA 3DHEA 1DO8A 5L6LB 3Q3GE 2FMKA 1NKSA 3IS3A 3O91A 4UM9B 5CMLA 2AMFA 2VDLB 4MV3A 3STUA 3IUMA 3FUCA 5DXAA 4RXMA 3TD2A 1ATZA 1F48A 4LC9A 2K6GA 1JG6A 4RA6B 3PRHA 4MRMA 2GF9A 1N7GA 4ILEA 1JKJB 1WF3A 4P4LA 4V0ME 5HNKA 1AE1A 1AUPA 1XIVA 1QE3A 2PD4A 2FK7A 2VJMA 1LDBA 2VSNA 5GONB 4D26A 1B0AA 5JAMA 2I8AA 2RGNC 2Q5JA 2WF5A 1EZZA 1I9GA 2QPOA 2PK3A 3G8AA 3UJ8A 4RSMA 5A62A 5HZGA 3GPIA 3M33A 5EUCA 5JQGF 4DYHA 2WIGA 1Y1KE 2AJLI 1J90A 3LW7A 4MQFB 2VXCA 4FZ5A 3SQOA 2ZRFA 2B61A 3A0UA 1HE8B 1B2LA 5JT1A 2JLZA 3W8RA 5E3JA 4B47A 2C92A 3HJAA 5L9AA 1KI6A 3PWTA 4EO4A 4FSHA 4YRIA 1DKLA 1TKCA 2BHSA 2YWFA 3O26A 1CUCA 4EATA 5LQJA 1JXOA 4C0XA 2LV8A 2QNRA 3EYAA 1SXJA 3GPDG 4Q9AA 5LUBA 1POWA 4MTLA 4YAWA 3JQ8B 3FX2A 4MZXA 2FSVA 4IMIB 4P2GA 3ZIAD 5CFRA 1CSEE 3WGKA 4C0LA 2J0SA 1E2EA 2G8LA 4UXJA 1U1DA 1VG9B 3E9NA 5BQ3A 5HGJA 3IJPA 5BWOA 1NJGA 2XDQA 2ZRGA 3R09A 4OI2A 3K9FC 4UHCA 2EL7A 2I2CA 2HYDA 4WNYA 2ECFA 2NUAA 2HHHB 8MHTA 2ODWA 3U3XA 4UZEA 5AP9A 4KIWA 5CVEA 1AQLA 1P5JA 3SOPA 2GS9A 3TRFA 2L19A 5BPFA 1FY2A 1O95D 1NOJA 5KQRA 3KTDA 4JH0A 4E5KA 1K7XB 4MJ3A 4V0RA 5FX2A 2Q0QA 4FYMA 3P7MA 3TNFA 1CVIA 5A71A 4R69A 4DSTA 3CTPA 4ZYYA 1L3IA 4HLDA 2CJYA 3FZYA 1QIHA 3L1VA 1YRHA 4CCWA 3DTTA 4OHFA 2YJZA 4M9XA 1JPJA 3BJZA 2O59A 3GLQA 2VHXA 4XQCA 3PRJA 4XXHA 3RC2A 3HKEA 3NTOA 5EJ2A 5J2UF 2CLDX 4EZBA 4Q7MB 2GH1A 3U17A 1QBGA 1PGOA 3WE7A 1I2MA 1MFPA 4RHEA 4B4KA 3UYLA 1HGXA 2Q27A 3KVNA 4MQEB 3DKKA 4COKA 5TT0A 1L7RA 1L3BA 2VDNB 3D7RA 2ZUVA 3QITA 4IRUB 4KQWA 4RK7A 4RZUA 5EMMA 2P2SA 3OD5A 4C04A 5BWMA 5JWRA 1XK6A 3HCCA 1QHNA 1TA0A 4C4YA 1YS9A 3RWMB 5KKCA 2HT1A 4R8KA 1JXMA 3EFEA 5AW9A 4MS4A 2RAFA 4QULA 2HJVA 2FK8A 2OORC 4P0PB 3K6SA 5A2QA 3LNCA 1N2HA 2R8RA 3FVWA 3JVVA 1PR2A 1RYZA 1WO8A 3WMWA 1YDGA 3K5PA 4WN3A 1NUPA 1M10A 1R50A 1U99A 2XCUA 2RKOA 1CCWA 3L6UA 2ZJOA 4WXEA 1H0SA 3RREA 2V0CA 4AZ0A 1C14A 3WJ2A 3FZQA 4HDCA 2D54A 3L2OB 4OB6A 5ULLA 3IMFA 3K31A 4ZVMA 4F56A 2C4MA 5D1NA 5KJCA 5HTKA 1YZVA 3ETNA 4YO8A 1TVKB 3Q9LA 1KYYA 1QYIA 3BQ9A 3C74A 1SUBA 3ZJUA 2HC9A 4R2XA 4IJKA 1YQ9A 1REQB 4DDUA 2XMRA 3ODGA 3H5IA 5H8WA 1EBUA 3ANLA 4LJ8A 1Z68A 2YWHA 4AN0A 1QO7A 5T7BA 1R8XA 1KMCA 3A7DA 2I2XB 1E79D 5HE9A 4QLAA 3RASA 5EJ7A 5A03A 1RAIA 3O5AA 4L4SA 3ZDZB 2ZCUA 4DGSA 5FWXA 1MLDA 2YQZA 3GC6A 4X3CA 3NPAA 1GQOA 3P2IA 4Q3EA 4WZBA 5AW7A 4EUHA 4QHTA 5C1OA 1ETUA 2O0MA 4H3VA 4B3FX 1CUAA 2EGGA 2F00A 2MDTA 1QCYA 1I2DA 1K4MA 2JGDB 2IXFA 4JJ4A 1Z3IX 3AOGA 2P9BA 1VC2A 4GI5A 1L4LA 4LNHA 1C9EA 2O6HA 4CNBA 1JYSA 3B3FA 1QP7A 1CDEA 3PD7A 1RTTA 2O50A 1NSYA 3N2GB 1A82A 2FZGA 3L8MA 2Z1MA 3OIYA 1H65A 4IIVA 4PAWA 3W34A 1UDBA 2HX1A 2DFTA 2W6MA 3C8ZA 3PDIB 3F67A 2CDNA 3VOTA 4ZI2A 1L4BA 5JQGA 2PSEA 3A28A 3DDNA 5E1MA 5K8CA 3K35A 1GTZA 1R0RE 4U2EA 4CV2A 5BORA 5DWVA 4UM7A 3DUWA 4NNJA 1OQAA 3R5JA 2V45A 3EIWA 1SBIA 3FHCB 5K03A 5F7OA 4IIXA 1EVKA 2ZVQX 3EDQA 1K89A 1JR3D 1C3VA 4PYMA 5LDGA 5IH7A 3CVYA 3JR3A 1HWYA 4XWAA 2W71A 5DI3B 3KJZA 4MMXB 4NE7A 1YSCA 2YFQA 2H4XA 4LJSA 2HREA 2JLYA 3DAHA 5AHKA 3SICE 1TAGA 1XFAA 2WP0A 3VC3A 1O0BA 3O3CA 4I5IA 3W5VA 4MCIA 4MH0R 2QTMA 4X44A 2R47A 4YJKA 4E14A 3TG2A 4X54A 3QYAA 2HI0A 3RS5A 1XTZA 3RYIA 2NLOA 4Q3BA 4TKZA 4TYWA 3A4MA 3AB3A 2BUCA 1FFYA 4PWZA 3BXFA 2D1FA 3II6X 3K0CA 3OLXA 2ZRLA 4UEOA 2Z04A 3E9QA 3U4AA 1WAMA 3DPSA 4UQOA 5L3SB 3AR7A 4IUBS 1I36A 2BOVA 4KX5A 4QYTA 4E4YA 1C1DB 2EBWA 2C07A 3E7WA 1XD9A 4ZCRA 1QK4A 2GERA 2X8JB 3C6YA 3GRRA 3NU1A 4R6XA 3MJHA 1Y3AA 4S1NA 3TI7A 3WNDA 4DLSA 4KPUB 4OIMA 3VVMA 1ZLXA 3DBHA 4PLFA 3RPEA 4DZZA 5KX5A 1PFWA 4TQAA 4UJ5A 1QF9A 3B53X 3WGJA 4QZVA 2GCEA 5GADl 4W8OA 3ISTA 4U7FA 5IABA 3RYTC 5KOHB 2P5UA 1UKVY 1ULHA 4WADA 4TRRA 3SDBA 5J2UA 1YF3A 5FHRA 4MKFA 1U98A 3HS3A 1CRQA 3DZHA 1N92A 3DULA 4M1YA 5FUBA 4CMKA 1QRSA 2HK9A 3GMIA 2NVUA 2WKPA 1QYXA 1RM3A 2FVXA 3ANTA 4MX8A 1HTWA 5DF1A 1IY0A 3RFCA 4NE2A 1Z7WA 3ZCVA 3R24A 3ENQA 1ADBA 3ONDA 5DBOA 4PGFA 1OH8A 2KLBA 3ABIA 3BL6A 3N9IA 1YUMA 2ERXA 2ZDHA 4A03A 2IEBA 3O4RA 4LX8A 4P9NA 5BUCA 2VT7A 1MRNA 1GRQA 1XQWA 3CLSC 4MK4A 4IX1A 1MOSA 3VTFA 4EPXA 3OF5A 5KTYA 1HMPA 2ZUSA 3Q1LA 1YGYA 4HF7A 3H6KA 2Q07A 2UYGA 3WDLA 5KKNB 5BWBA 3CUSA 1BEUB 1BHO1 4FTWA 1K5HA 4R8SA 4D9NA 1ZD9A 1DZIA 3GRPA 4G41A 2DFDA 4ZDKA 2BHRA 4Z2AA 3R44A 2EATA 1NLYA 3OUUA 3EJWA 3ET5A 3NYWA 4HNTA 1RWVA 1KPIA 4HFMA 1NF8A 1A5ZA 4WXPA 1IUKA 2F8LA 2BYTA 2XHEA 2O8EA 3ZR4B 2WIBA 4PSUA 1UBGA 3D81A 5F76A 2ZSFA 3NEJA 3EAFA 4L28A 1DC7A 1SKYE 5JFGA 1TE2A 4MVJI 2NZYA 3WLSA 1RDFA 3WHIA 4S1VA 1WPRA 3AKDA 3RUIA 1T2AA 2UXBB 1IRIA 2HDWA 2PGXA 3BKWA 3U3DA 3FDZA 4R7TA 4EG8A 1E6LA 1QIFA 3KQMA 2AA3A 1YFJA 5L7TA 4RK1A 2HCRA 3TM4A 1N6HA 3K9WA 1MJNA 4TL7A 2WOJA 1ENZA 3GK3A 4GX0A 2JS7A 3AQ4A 4J0GA 4MRAA 3KOWA 4WWHA 3PQ2A 1PS8A 1CJSA 3CUWA 2SBTA 3KLNA 4J9UE 3NNSA 1WU8A 5CLJA 1R8SA 2F1HA 1FP4B 4V0KA 3LMKA 3M82A 2RKWA 1GP2A 3GG9A 2HJGA 3PS9A 4H16A 2PEYA 2JK0A 2COEA 2WQ7A 4R98A 1P1IA 4YX9A 4I7EA 4X1OA 5AKXA 2BELA 4FGSA 4D9GA 3ZZMA 1B3BA 4B3IA 1N8SA 3ZV4A 4YT2A 5EWMB 5KNCD 3SNHA 1G291 4L8YA 1LSJA 2AMVA 2W2KB 4ERXA 4IQFA 4B2IA 1NSTA 3WHKA 4GRIA 4W4TA 3PQCA 3LM8A 2YWEA 1MAAA 3DE1X 1R0LA 4FLMA 3BILA 4HPXB 1NI3A 4GPIB 1T9ZA 1GR0A 2FVYA 5ALLA 2WWHA 1FMLA 1WBJB 1L5QA 1T4CA 4ZEWA 2IHNA 2PGLA 4E30A 2I22A 2V6GA 5HFAA 3EZ9A 3BHMA 2WJYA 4LXXA 4CEIB 3RVDA 1GQFA 2VP0A 3ZQJA 1H4SA 1FBNA 2I87A 2P2LA 4UCFA 2FXIA 3D1LA 1R6VA 4MUNA 3HVRA 2K2QB 1YDEA 2ZSHA 2JD2A 1U0NA 1YZUA 1DDIA 3SR4A 3INGA 2QXYA 2ZE5A 1BX1A 3PTLA 1FW6A 2YX1A 4QU8A 1CP2A 3AUKA 1P5FA 1EG7A 3EVEA 5BSKA 3KRTA 4U5XA 2J5QA 2PGAA 4LHSA 2YYYA 3LUCA 1H5UA 1YK1A 4LY0A 3NYIA 1GEGA 3NBUA 3QE2A 4EZIA 3BWDD 4XIJA 5JCXA 3V7NA 3U0BA 4NG4A 3AIIA 2AN9A 1TC1A 2BMAA 2ODAA 3VNQA 2AOTB 2I2FA 3IQGX 3PXUA 2JIDA 1PJ8A 2L69A 2O2ZA 3QUBA 5DM0A 1TTQB 2IS2A 4JI7B 4Q7EA 1EJ0A 3OT1B 2YV1A 2IPMA 3PITA 3P2JA 1UMKA 2E1RA 4RF4A 3I92A 3S99A 3BWVA 4C6SA 1P77A 2CF5A 5B5SA 4Z1MD 2FCAA 3K8QA 2ZGVA 3VSDA 1OFTA 1TUBB 3LO8A 1BCRA 2VPQA 3DVAA 1OFIA 5H9VA 5JAQA 3UAOA 5SZHB 1K6EA 5DOZA 1BOFA 4OEHA 2JPDA 3R3UA 2NXWA 1DG1G 3GGSA 4JN6B 3ML1A 1Y5MA 1Y80A 4IEIA 3VJKA 4B3JA 4UREA 1PZEA 4IGIA 2DBVO 3IYLW 4NNOA 1B6TA 5K6RA 1F8XA 3BTOA 2JGKA 4F4HA 1TU4A 4L4XA 3SS9X 3M6MD 1R5OA 4BNUA 1L7PA 1CVLA 1AXEA 2Q4BA 1U63A 2F8TA 2VSYA 1O5IA 3KJXA 3W6PA 3G49A 1N33B 1VIVA 2BI8A 2A5DA 1GPMA 3E5RA 4KGZA 4RXTA 3MTGA 2UZ4A 3PNBA 4WE3A 4GOOD 5DMXA 1AOXA 1V6SA 4L7VA 1S3FA 1SVMA 1ZS9A 1K9VF 3GELA 4YP5A 2M32A 5BUZA 1JHZA 2XADA 1CUVA 1ZONA 2WD9A 2DM6A 1L6RA 4ZAVA 4PSKA 2H92A 4UATA 4ARUA 1XZIA 1KEZA 1VFNA 1ZICA 3N2NA 4F2GA 4OF4A 1SC6A 3MWDA 2WY2D 5K09A 3V7YA 4B3RB 4ZCLA 2WDPA 1LWOA 1WUTA 2A1TR 1FLDA 3CA8A 4MRVA 3NV9A 4FMBB 3TL2A 4EB0A 2E3JA 4UFOA 2B8TA 1KJNA 3EOZA 3CUTA 3U19A 4H0NA 1LX6A 1ZH4A 2LKCA 1KC1A 2GHQA 1JR4A 2W00A 3CZQA 3HZZA 3EC1A 4NFLA 4BC0A 1NM5A 3PXXA 4IZHA 3BMCA 3MWGA 4QELA 3ZNQA 4PIVA 2UUAB 1K1EA 3A4TA 3VR6H 1DVRA 1JQJC 2AJDA 1E69A 5BO5A 1N25A 2G9UA 1GD1O 3AQIA 3BOSA 3E27A 1V37A 3OZFA 3WRXA 1N5MA 1BWPA 2CV1A 4NCBA 3BWCA 4MB6A 2VTBA 4QPCA 3KE8A 4HDKA 1UKCA 3ZE1B 3G2PA 5CFOA 5T4FA 4MVWA 5ECDA 3NV7A 1IONA 1MDBA 3HU2A 3QE3A 4FR5A 4C3ZA 3QFHA 1FB5A 1NHGA 4E3ZA 5HDQA 1DB3A 1KIAA 3EQ9A 3E3AA 4CKEB 2OVBA 4OX9Y 1ZDMA 2A5YB 2FUCA 1QDUA 4UNRA 4BQFA 2YQ5A 3TWOA 1CTQA 4IWYA 1UPFA 4RLFA 5ICFA 4J1TA 1T6NA 2YIMA 2A78A 3FGZA 2ETVA 4Q7QA 3U9LA 4GW3A 3CUYA 3GROA 4HDOB 4HVTA 2H2GA 4LGYA 1LVUA 3P9ZA 1NMQA 1W5BA 1RE0A 2E4VA 3T9BA 1AA9A 4KUGA 3OE4A 4EQZA 4PZCA 3RANA 1XPRA 1Q0TA 3EFOA 3UFXA 4BU1A 1VPWA 1DDGA 2GAFA 1SHTX 1XT6A 4GP7A 3FAKA 1YRWA 4N3GA 4WKCA 3IP7A 1ZOLA 5EPOA 4ALJA 4CLRB 4IHAA 3U44B 1WS6A 1TYBE 2DPHA 2QLFA 4OY3A 1C0IA 1UIRA 1IEWA 4NJEA 3RFFA 2CVOA 1M75A 4KH1A 5MFZA 1G63A 3GLVA 4D82A 4TMYA 5IT0A 4P7BA 2UZIR 4LJ4A 2QQGA 1W4RA 3IBFA 1GLVA 3U40A 5IFKA 1A9TA 1IYZA 2KS6A 4PZ9A 1UQUA 2FMUA 1FFAA 4O8ZA 1W0KA 1UDRA 3SJZA 2XEXA 4FCCA 1FQKA 2WYUA 2Z5FA 1PWXA 2BGMA 3EXHA 4M9UA 3WP0A 2FKAA 1FZTA 3P0FA 5HEKA 1E99A 1RNLA 1S1CA 1SIUA 2XOKA 3IEUA 3NWEA 4GYJA 5DH9A 3BYZA 1QAMA 4AJEA 3WKBA 2EJBA 1RQPA 1J22A 1PWEA 3VKUA 4Z54A 4M86A 1ZD8A 4YLYA 2BF7A 4QYIB 4F71A 4R01A 1BJRE 1BU5A 1SH7A 3RLIA 2CEAA 3SIPA 1G21B 2PVPA 3Q3CA 5EWLB 1L5WA 5CFLA 2V1XA 1BJTA 1OD6A 4WCFB 1ZGJA 3RIXA 2JFBA 3G1WA 4ZGWA 2VRCA 3D8TA 3DMNA 2P2YA 4PU0A 5HKLA 4AKTA 4Q4HB 3A3PA 3KJEA 3UG6A 2IL1A 3EHDA 2JJ1A 4TTIA 1YR8A 4PINA 3SBDA 2IQ5A 3C98A 4IW3B 4LXQA 3ZWDA 1DIGA 2B2CA 2VAWA 3KYDA 3FWHA 1O96A 1SU7A 5T67A 4JGGA 3AI1A 5A7HA 4KPYA 2ZIXB 3F6BX 4R83A 4EH1A 3F73A 3OU2A 4NFSA 4F12A 5DGCA 2P5YA 3FFAA 3EODA 2VAVA 3C7CB 3DO5A 3NWPA 5F33A 1QHYA 2PZEA 4AJ1A 3I53A 2ESRA 3VQTA 3B5JA 4IVPA 2ZVDA 1VYTA 2YIVX 4KBGA 5GV7A 3KSBC 1S4MA 4EJ0A 2CZGA 4H7FA 4K7JA 1QPBA 3AVYA 5B7GA 3BZBA 1A2KC 1SCQA 1O87A 4TPKA 5GIOE 2H65A 4HXFB 3OCJA 4AKGA 1NBME 4OCZA 4N3NA 3V4LA 5EHGA 2BM8A 3V8NA 1B15A 3R5SA 1TGVA 1W6UA 1EWVA 1VHWA 2O1XA 3EDMA 3PZBA 5FL7A 3FR8A 3L8CA 1Z15A 1JRLA 3WIVA 5JI3E 1L1EA 3GMSA 1F20A 4IF6A 4JBYA 4PCVA 5HM8A 4ZQFA 4AXXA 3FG9A 3FLBA 3PPVA 2ZAYA 2QUHA 3DOOA 4LRTB 3TR5A 1NQWA 2Y4OA 2C4VA 2SECE 3M6WA 2D3WA 4OHUA 3KETA 2HBQA 2AOVA 1CFJA 2AVDA 2BDUA 3K2BA 4RVSA 2XUIA 4FKZA 4J7XA 1XZCA 4R3UC 3NTXA 4M0KA 5DEIA 4BZXA 1LVHA 4KFSA 5CX1B 5CT5A 1Y82A 3K73O 4C29A 2VCEA 1UEXC 4LRWA 4D9KA 1GDHA 1BCSB 2X0EA 4FCWA 2A9FA 4UUMA 4P80A 2Q9CA 4IDHA 1BKDR 3KV3O 5DKFA 4AICA 3QSGA 1MBZA 4O2BF 3FUTA 5EQTA 2NV0A 3TCKA 3DKPA 1YTUA 1PNOA 2VPWA 3HQ4O 3HVIA 4IFTA 3HWSA 3ICQB 5NULA 3VYUB 4G07A 5DCYA 4A16A 2YH2A 1BHSA 4UHDA 2HMAA 3MTDA 4P7GA 3H2BA 2AHRA 5IF9A 3EIUA 4HAXA 1JTFA 3KIPA 1K7CA 1N3BA 5JNSA 4QBHA 5AO9A 2J6CA 2VAPA 1X7HA 3LUFA 1T29A 1IIBA 3UHOA 1GG9A 3WMFA 5BN4A 3NBXX 1LV8A 1NHWA 3TIVA 2DSTA 2MMGA 1TEZA 1JB9A 1TXGA 3PQ4A 1Y8RA 2RHGB 2C9OA 3AP1A 3CWCA 3X44A 4CDNA 2D1YA 4TTPA 1DG9A 3M1AA 4JXJA 4C0SA 4JNKA 4D96A 2WPNA 5JIBA 4GQAA 2JLWA 3PEEA 2Z9CA 3RODA 4AMZA 1RW4A 4EPVA 4NABA 2AUMA 2XYVA 5EZSA 3GUYA 1DRUA 2H8KA 3O0TA 5IZ4A 1YNOA 1GPUA 2PV0A 2XDWA 2TS1A 4KQIA 3I2FA 3LH5A 2JANA 3HR7A 1E5LA 4J4BA 1CY2A 2D06A 3U1VA 1KPHA 1T9HA 2HF2A 1RVV1 4NIMA 3T3GA 4I1IA 1YR1A 2XNKA 1DMSA 3KALA 4J1SA 2EYQA 3G85A 1JG3A 5FJJA 1WL8A 4I55F 3NIBA 4JLNA 2C9MA 3AJEA 3K4PA 4V39A 1IPHA 1WB5A 2J6HA 1C7IA 1T13A 1YJBA 1P6UA 3AEKA 4I8XA 5CVCA 4BNMA 4CL3A 4LBZA 4OL0A 5INTA 4R2IA 3RUCA 5FXMA 3VUEA 1NJ1A 3CRVA 2GAIA 1KWKA 2RH5A 1MB9A 2MSWA 3HJRA 5CPFA 4E15A 2R7LA 3VR5H 2GBLC 3UQZA 4AZ3A 2RJ3A 1DC6A 2V0GA 3OE7D 2IUTA 5CDSA 2DGDA 3NORA 2VK1A 2DCUA 4X71A 5CVTA 3I2IA 3C41J 4Q9LA 1M76A 2O8DB 1NURA 2LCIA 1N0WA 5TEWA 1FNDA 3BBPA 3LCMA 2IYRA 4ZVVA 3VOAA 1Q16A 2GO7A 5KAMA 2I4TA 2JCSA 4S1WA 4GM0A 4LJRA 3SVZA 4GX2A 3KT3A 4CLHA 1NXTA 1MAUA 1Q2XA 3E35A 4WW0A 3WLIA 4D8TA 4O3MA 2DY0A 4F5EA 4DLXA 5IKXA 4ZYXA 2RHCA 5ICMA 3TRDA 2QRJA 4MKGA 2QYHA 3N8DA 2R44A 1I0ZA 2J5KA 1FJ2A 2QDXA 4QDJA 4LRYA 1LDNA 3PHLA 2OP1A 4BO7A 5JXWA 1PGPA 1KFBB 2OHJA 4PN3A 4PSCA 4RJKA 4PIPA 4URZR 1ZH0A 2Y05A 4JC5A 1ZR4A 5ETJA 3G9TA 4IOKA 1PJCA 4FHZA 3CS3A 2CDRA 3ZLTA 2XY4A 3TSYA 4M83A 4D4LA 1IDOA 3NEPX 4CM7A 2CNWD 2LXNA 4DLLA 2KMLA 3I1FA 2QW0X 5J9FA 1U5CA 5LZ5A 3THWB 3GVXA 2O2YA 1P39A 4BFZA 1UBNA 4AURA 4B48A 5KJ6A 1N36B 4QC2A 3KDAA 3AVWA 3NHKA 4KGDA 1AGRA 2UVPA