1SB8A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
341
Chain Sequence
MMSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords wbpP
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 127
structure length 341
sequence length 341
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb8A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb8A02
3C1OA 3U4IA 4M54A 1QYCA 1X15A 1KBZA 3ENKA 4EEZA 2HAEA 1QV7A 1Z82A 5THQA 3K31A 1KIFA 1ZK2A 3BMCB 3AM3A 1HT0A 5COQA 2O2YA 4NMHA 4RVUA 4NNJA 4LVCA 3VZSA 3GMSA 2HMUA 4RQUA 1NFRA 4M55A 1P0FA 1O8CA 1HWYA 4YDRA 1P1HA 4CLEA 1VPDA 1E5LA 3ZWWA 1PJQA 3ZH2A 3GNTA 5H83A 3NJ8A 3OJLA 3P5SA 5TX7A 1PS0A 1ZH8A 4MJLA 2DBQA 3ANNA 3JQFA 3MTGA 4EUFA 3BAZA 3BHIA 4BO0A 1BHSA 3GEMA 3OM9A 4J2OA 2RBEA 3R1IA 3EY4A 2ZTVA 3GVXA 3NGXA 1I3MA 4Z0HO 2NVUB 3G49A 3ZCXA 4GGOA 4OL9A 4XQ9A 1Q0QA 1X0XA 1DHRA 2DPGA 1DIGA 5JCJD 1NVTA 3FNFA 1E3WB 1VJ1A 2D59A 2HMSA 3M6IA 2ZB4A 3GRPA 1QG6A 4WOJA 5I7EA 3EVTA 3JQ9C 5JC8A 2D3TA 2O2SA 4B4UA 4ZICA 1UXGA 5JYEA 3N7UA 1SEVA 2VYVA 5U1PA 2Q1TA 4XKJA 4W4TA 4RPJA 2GN4A 3DC2A 3OIDA 2BFMA 1X1EA 3WYCA 3OA0A 3D5QA 3H4VA 1ZMTA 5HRUA 1HKUA 3K96A 1V9LA 1DDOA 3OF2A 4OKNA 1YONA 3U5TA 1ZK3A 1Z7BA 3WTCA 1GD1O 3E9QA 3GVPA 3UCXA 3OETA 3ROKA 4PIVA 2Y67A 2BI7A 4DWVA 2JHGA 3WICA 4AG3A 4XYEA 4J4HA 5B37A 5JLAA 1JWBB 4KQXA 2GR9A 2G1UA 2O7QA 2ZJ0A 3U62A 4PRKA 1E7SA 1EUCA 3IKVA 3HE3A 3IJPA 4RPKA 4IQGA 3V1TC 3H3FA 2OMEA 3C7DB 3TFQA 4RORA 1PZGA 4NBWA 4KDFA 4XJTA 3U4HA 2FR8A 3GGPA 3GOHA 2XAAA 1YRLA 3PIIA 3QVOA 4L8VA 4R9SA 2Q50A 4G2NA 2BGMA 2O48X 4NFYA 2JAHA 3IC5A 4CUJA 1PX0A 2NTVA 3FNHA 4GAEA 4GGPA 4OYRA 1Q7BA 4GPD1 5A5EA 3CE6A 3MTJA 1NQTA 1PGQA 5DNAA 3WQRA 4YRBA 1LDNA 2WM3A 1E3JA 1ONOA 4WPGA 5EPOA 1B15A 1PGPA 1QLHA 3CEAA 3DHYA 1C0LA 5CDGA 2EV9A 4D3SA 2EGHA 2I3AA 4BNXA 3GHHA 1N1GA 4DBZA 3WFIA 1ENPA 1NHGA 2C20A 3PPIA 4J1TA 3NAQA 4F3YA 2CZCA 1P77A 1Q2XA 4FC6A 1K6XA 1HE5A 1NR1A 1ISIA 5DZSA 2VQ3A 3WLEA 1YBAA 4N18A 4OOEA 1Y9EA 1HSOA 4CUZA 1RWBA 4Z9XA 4JP2A 4QTZA 2CVZA 4J91A 2W90A 1ZW1A 2W2KB 2J3HA 3WSWA 3L0DA 1X7HA 4JN6B 4LISA 4TZTA 2YW9A 4QUKA 2AG8A 4B7XA 1GQQA 1LQUA 1O5IA 4NBUA 4F6LA 5BQFA 3VKUA 3AY3A 5J23A 5C7OO 3WMXA 2LDBA 2GPTA 2I67A 3WNQA 1KEPA 2W2LD 2WJPA 4NH4A 3FBGA 2P2SA 1HYHA 4XDYA 3ETEA 4RVDA 2G5CA 4FCCA 1NWHA 2YZ7A 1ZXBA 4YJGB 1KERA 1T4DA 3I52A 5JAMA 2GD1O 2VT3A 4EDFA 4BGVA 4J1QA 3AK4A 1XKQA 1U3WA 3OQBA 1Q0HA 5I9NA 3AUTA 4K6CA 5CG2A 4A0SA 1GQYA 2Y66A 4YQYA 1JDJA 1V3TA 2IZZA 4FN4A 2V6GA 5T67A 3VPGA 1JKIA 4E5YA 2PZMA 5KKCA 4HUJA 2VOEA 1GL3A 3OJEA 1IHYA 1P1JA 2PGJA 4HBGA 4R69A 3PWSA 3UVEA 1XLTA 1E6EA 4TKMA 9LDTA 5JFOA 4FIZA 3NDJA 1DFGA 1BXZA 4QO8A 1T1SA 3PHGA 1D1SA 3DAGA 4BIIA 5IZCC 1WMAA 2JFFA 4JK3A 1P1IA 2Y1CA 3GT0A 3OJ0A 3Q2KA 3IUSA 1NAHA 4IMPA 3GEGA 4GWKA 4YWJA 1SO8A 3GK3A 4NJMB 3BMQB 1B2LA 1BG6A 3C8MA 3GFGA 4HADA 2BFOA 2Y1EA 2P9GA 1R66A 1VL8A 1EUZA 1M67A 3OEYA 4O63O 3IAHA 3E6AA 4MVJH 4WUVA 3GGOA 1N8KA 4MIEA 3F3SA 1T2CA 2PLAA 1KYQA 1WZEA 4FS3A 3MJTA 4BO8A 1WZIA 2HJRA 2UV8A 4AJJA 4RF2A 3PWKA 3ZU3A 1EK5A 1XU7A 2YY7A 1CQIA 2C59A 4BNMA 1Z6ZA 1TT7A 1Z74A 1YS4A 1P3DA 2FWMX 5KTKA 4JBIA 5EN4A 1XCBA 5TQVA 4QO7A 3PDUA 3OIFA 4YAKA 2CD9A 1C1DB 3RBXA 3UH1A 1DC3A 4BV8A 1ID1A 4CM4B 2FPGA 1LLDA 4PZCA 4M87A 1PS9A 3GVIA 4CM6A 1P44A 4DIBA 2VZ0A 5ICSA 1NYTA 4WJZA 1BDBA 1T2DA 4E2ZA 5I7FA 4CV2A 4MKZA 4PVCA 4RO0A 4CLRB 5LDGA 1I2BA 1F14A 1PU2A 2RHCA 2Y0CA 3DZFA 2DTDA 5TJHA 1OZAA 4DQXA 4MPDA 4O1MA 2OBYA 3N58A 3TQHA 4GL4A 4II2A 4EEXA 4QT0A 4MVJP 4I9HA 5BR7A 4NK4A 1QSGA 3A9WA 2CNBA 4JCOA 2W98A 2FY8A 1CERA 1GUZA 3EVNA 3X2FA 4INAA 4EYEA 5I7SA 4CLHA 1NPDA 2VTDA 3INTA 1LX6A 4S3MA 1I8TA 2P4QA 3F5QA 4DLLA 3DHNA 4BMVA 1V3VA 1LEHA 2AEJA 5HS6A 3VTFA 4D3DA 2BELA 1GUFA 1U4OA 3K30A 4J0FA 3LT1A 2HJSA 3DOCA 4L9RA 5FF9A 1YOVB 1H93A 3H9EO 4E2YA 4IDGA 1GY8A 1N92A 3OIGA 1O0SA 3PI7A 4LRTB 1F12A 3KSZO 4XZ3A 4UREA 1JWAB 2X9NA 3U0BA 1HF3A 3UUWA 4RVSA 5EIOA 4PLTA 4D3FA 5DCYA 5FI5A 2O3UA 2YHIB 1G0OA 4AJ4A 4R16A 4L75A 3KSUA 1D8AA 2DVMA 3BTOA 1FJHA 2GCGA 1H2HA 1DOHA 3TZKA 3IUPA 4DPLA 3ASUA 1GEEA 3G1UA 4YBZA 3VVBA 1YQXA 4Z3DA 5TC4A 1J0XO 1HLDA 4LGVA 1ZSNA 3GEDA 4EW6A 3DBHA 1U2GA 1LTHR 3ZGYA 1BW9A 1Y6JA 2NU7A 1ULSA 4NHEA 1NFQA 1X7GA 3AW9A 3TZ6A 3BHMA 1DHTA 4MO2A 3NGLA 1IULA 3M1AA 2PZLA 3OA2A 4WLFA 3LT4A 4D0SA 4Y67A 3CZMA 1S6YA 1D3AA 1Y7TA 5JE8A 1I3NA 1PQUA 3F5SA 2G82A 1Y81A 3PFFA 2A94A 5ER6A 2HCTA 3WIDA 4IJWA 2Q99A 4OXKA 4Q39A 2JCVA 2C07A 4U0KA 3NTQA 4YA6A 1UJMA 3I6IA 1G1AA 4WCFC 2Z1NA 3I6QA 2BGLA 3EDMA 3SC4A 3NX4A 4WCFA 2VTEA 2RH4A 3RC7A 1JKFA 1KY5A 2DUUA 3ZN2A 1BXGA 3H9QA 1UXKA 3I83A 3DAFA 3T4EA 4N5LA 4CJXA 3ZNPA 4CV0A 1HE4A 2PFGA 4D0RA 4P4NA 4WEOA 3V2GA 4U8GA 1Y5RA 3KVOA 2PY6A 1PR3A 3L77A 1MLDA 1LDYA 4W9NC 4YQZA 5HA5A 2EKPA 1FMCA 1QR6A 3MJ4A 2EIHA 3HHPA 5JDIA 2E82A 3D3WA 3JQAA 2J3KA 2PKQP 4KWIA 4NPCA 4URFA 5G0TA 4LCEA 5ENDA 4YRAA 5CEEA 3DFUA 2PZKA 1LU9A 4Q3DA 4FSHA 4XGIA 4E33A 1LDEA 2FZWA 4KP7A 3QVSA 3DTTA 5JDCC 3I9NA 3TZCA 2PV7A 4FFRA 5CFZA 2J3JA 3LC7O 1RYEA 3E9MA 4TVOA 2EERA 4PLFA 1Q0LA 4AJPA 5F21A 1XEAA 2DBRA 1I10A 5IZ4A 5IJZA 4XJSA 2V6BA 3OECA 4GX0A 4O5OA 1H9BA 5GMOA 5H81A 1EDZA 3DTYA 3ZWXA 4IBOA 3RC1A 2BKAA 1VC2A 5AXAA 3Q0EA 3RUEA 4ALLA 1FDTA 3ZNOA 3UHAA 3ZW8A 3KZVA 3RUFA 5JSFA 1X0VA 1M76A 1WWKA 3LK7A 4GQAA 1HDZA 4PLYA 1B7GO 3RI3A 3RC9A 2O3RA 3CSDA 3OJOA 2B36A 3FHLA 3U4DA 1SEPA 4CMBA 4Z3KA 2WE7A 2Y1DA 1T2AA 1UAYA 4I5DA 3C3XA 1AXGA 1IPEA 3RUCA 2E49A 2ZYGA 2IXAA 3EHEA 3BMNA 1O6ZA 3A28A 3O38A 4M86A 4ONEA 3UKOA 1DB3A 3WBFA 3KYBA 4CM1A 3KEQA 4O0LA 1H6AA 3O8QB 1VM6A 4MP6A 1Y8QA 2JL1A 4CQMB 4BO6A 4PLPA 1ENZA 1HL3A 3V2UA 1VJ0A 3ZHXA 4Q9NA 2D1YA 2VWHA 5A02A 2I66A 1CDOA 5EJ2A 4DC1A 4I5FA 3EGOA 3ONDA 4UVEA 4DXHA 2B4RO 5TLSA 4M49A 3LZ6A 1NTOA 1AGNA 4DREA 1A4UA 4ND2A 4BNNA 4ALJA 5G4KB 1MG5A 1UP7A 2PD6A 1JVSA 1LXCA 1BRMA 3ULKA 5ITVA 1DRWA 3H7AA 3SLGA 3DBLB 5MDHA 1NVGA 4ZQBA 3KETA 1N1EA 3BA1A 2AQIA 3KYDA 1NNUA 1DJNA 2D0IA 3JQBC 1HLPA 4K6FA 2VUSA 1B8PA 4ZVVA 1W4ZA 2V65A 5I8ZA 3KXDA 3G3EA 2WYUA 2HUNA 4F45A 1U9JA 5ICMA 4AJ1A 5JMPA 4FQ8A 2PGDA 4GKVA 2YFQA 4II3A 5TF4A 4ZGWA 2AW5A 3WGGA 4I5EA 3KO8A 2WYWA 2DTXA 3HN7A 1T4BA 4ZRNA 3MCVA 4E5MA 2VT2A 2X86A 2AA3A 4XQCA 3RUIA 3CIFA 3WSVA 2A4KA 5F5NA 3G0OA 4TRNA 4LN1A 2GN6A 1EFLA 3DMTC 3L6OO 5EL0A 3PWZA 2YJZA 1NX6A 5HWSA 4R3WA 3U4CA 2WDZA 2UYYA 3VZRA 2C2YA 3N74A 1K5HA 1KS9A 2Z1MA 4CQLB 3DONA 2I65A 4YACA 5A3JA 2JFHA 2WEKA 4CLOB 1IE3A 2OUIA 1MUUA 5AVOA 2Q4BA 2X9VA 4CM9A 2VN8A 4L76A 1V8BA 1W8DA 3FNGA 4NDNE 4UEOA 3PZRA 1HYEA 4KDEA 2X6TA 3TJRA 3VPXA 2QRJA 5BSFA 1I0ZA 1NPTO 2IRWA 3PYMA 3O03A 4P8RA 5HTOA 3AY7A 1U7TA 4PGFA 2P4HX 1CQJA 1IL0A 3PYLA 1B8VA 2QRKA 3W8EA 1DFHA 3WGOA 1QKIA 2FSSA 1HEUA 2AHRA 1I24A 5BSEA 4XIJA 5KCZA 4BB6A 5DCWA 5F3RA 2VOJA 3H2ZA 4CM7A 1DSSG 4IS2A 3TDKA 2QIOA 1EK6A 3HN2A 4J43A 4UVHA 5K6AC 4ZA2A 3RROA 1YL7A 1P9LA 5A5FA 5K6AA 3S55A 5CG1A 5JPIA 4DC0A 5F1KA 1LLCA 1W0CA 1TLTA 1CIVA 4IS3A 1B8UA 4WGGA 1E1LA 5C3MA 1A5ZA 2GZ3A 3HDQA 5IXSA 3G17A 3GAFA 1A7AA 5L3ZA 3NRCA 1EFKA 3GC6A 3WR5A 3NJ4A 2J5KA 3UFXA 1ZEJA 1ZZEA 2CY0A 3ZV6A 4RLSA 1KEVA 1A4IA 3A06A 3PTZA 5KOIA 1ENYA 2OP0A 2GGSA 1V0JA 3OH8A 3E8XA 5JS6A 4BMSA 2VUTA 3GNSA 4HX5A 2Y05A 3RVDA 2C7GA 1KVUA 4TZKA 4YT4A 1NXQA 1KVSA 3D4PA 3GVHA 2ZB3A 3LU1A 4BNVA 4CQMD 4R4JA 1Y8RA 1I5RA 4QXMA 3PQFA 2D5AA 4BNJA 3F47A 4PLGA 2YV2A 4BNZA 4JGBA 3D3EA 4YAJA 3ZHZA 2OZPA 1AXEA 1HDOA 3BMOA 4ESOA 1GTMA 2DLDA 1K6JA 2NM0A 2DUWA 2V6MA 1XWFA 2IE0A 2WWRA 3H3JA 2X0IA 3QVWA 2OGUA 4K1LA 1T25A 1ISGA 3JQFC 2P9EA 4CR8A 3PHHA 3UCFA 1XG5A 3MWDB 1RM0A 1DAOA 4GMFA 1RM5A 1ONPA 4B79A 1E3EA 3EAGA 5JW6A 5TGDA 1NWCA 2VYNA 1ISHA 1UDBA 3B1FA 1K3TA 4PG6A 2X5KO 1ZVMA 4BKRA 3PJDA 2Q1WA 3H65A 3QLJA 1X1TA 3L6EA 3RBVA 3OICA 4ID9A 1QRRA 5CPBA 1LSJA 3TFOA 4FJ1A 3PGJA 1PL7A 1I36A 1U5CA 4UULA 5G0VA 2J3IA 1E3IA 3L07A 2BD0A 1C14A 4MVJA 4TQGA 3ICCA 3ZWOA 5A3VA 3ENNA 4XRRA 1EE9A 5THKA 4QSMA 5CP8A 1I3KA 3VVCA 3I23A 3F1KA 3WJ7A 2P9CA 4AVYA 4BMNA 4E3ZA 1E92A 4NK5A 1R16A 2H63A 5KVCA 4GH5A 4WOKA 3HDHA 5B4TA 4XRGA 4HFRA 3D64A 3NT4A 5T8KA 4X54A 5KVQA 4DMMA 2BFAA 2P68A 3FSRA 4ZU3A 4LMRA 1VL0A 4KMSA 2ZTLA 4B3JA 3FBTA 3GZNB 4ND3A 4IMRA 4L4SA 4DA9A 3JQ7A 4J0EA 1H2BA 8LDHA 3BHJA 4H16A 4EZBA 4AJLA 4MKXA 2PD3A 2UAGA 4XQEA 1MFZA 3INGA 3X2EA 4I1IA 1KVQA 2GLXA 1UUFA 1HETA 4GLLA 1AE1A 2CFCA 2H1SA 4J90A 2CUKA 2OOSA 1WDKA 3EYWA 3FWNA 1XIVA 4EJ6A 1Z7EA 2DQ4A 2WYVA 1HDGO 4E5KA 1C0KA 3L4BA 3BYZA 3GZ4A 2DTEA 3NTOA 3PYXA 1X14A 2XXJA 3C7AA 2VYVD 1E3SA 2NU8A 1EVJA 4HNGA 5T64A 3JQEA 4XGNA 1UP6A 1R4MB 1E6WA 3V8BA 4B8ZA 4I08A 3GR6A 1PJ2A 3MJSA 4YJHB 4CM8B 4XQGA 1VKOA 3PQDA 1PWZA 3NT5A 4I9NA 4ZD6A 5JXWA 1JA9A 2ZATA 3OHSX 4MVJF 3IOYA 5B4VA 5KIAA 1ZUD1 3QA9A 5G0UA 3GG9A 2ZB8A 3QP9A 4RPLA 2JAPA 1EBFA 1HYGA 4CR6A 3WOHA 4YPOA 3ZW9A 2OO5A 1NQOA 1O89A 1WW8A 2FN7A 2IODA 3QW2A 2Z5LA 3DZHA 4H15A 4KUGA 2DFDA 4DRYA 5L7WA 2X8LA 4A27A 3UW3A 3GUCA 5CEJA 3CMMA 1HXHA 4J7CA 3AUSA 3VAZA 2HKIA 4N7RA 5LCXA 4BO9A 1CWUA 4R54A 3RKUA 5BSHA 2B4QA 2HU2A 2NVUA 1BVRA 4YVFA 3GFBA 1J5PA 1BVUA 5IG2A 3NT2A 4ZN6A 3W4JA 4YR9A 3FWZA 2UUOA 3F6YA 1E3WA 2CDBA 4BO5A 4FR5A 4XEHA 4DVJA 3LF1A 2A92A 4JXKA 5HM8A 4MVJG 2RCYA 2DPHA 4ND1A 3AU9A 4IY1A 3VTZA 2ET6A 1BGVA 5L40A 2AEMA 2ZQZA 3WNVA 3D4NA 5TS3A 4U5QA 2SCUA 4YEDA 1ZXLA 4CLXA 4ITUA 4XR4A 3C7CB 4A26A 5KVSA 1DRVA 4YXFA 1RPNA 1GYPA 4L4RA 1DRUA 1P31A 1B26A 3OMLA 4YJFB 3WGQA 3SC6A 1IPFA 3AOEA 4PCVA 3S2EA 2H6EA 3E82A 4MOWA 3VOSA 1YXMA 5K0ZA 4BNHA 5DULA 3MJCA 1L7EA 4E30A 1KOLA 4RVHA 4RZIA 3RASA 4NBRA 2QRLA 5AXDA 3JYQA 5IDWA 3PHLA 2EF1A 2GNAA 4CUKA 1OOEA 1OC4A 2X0NA 3HDYA 4AJEA 5DT9A 3DDNA 3LC2O 2E48A 3V5NA 1E7WA 3W8FA 4NBTA 5COAA 4NU5A 4CMJA 4LVUA 3ETDA 4O6VA 2FR0A 5L95A 7ADHA 3H2SA 1PGOA 3RC2A 1LJ8A 1PJCA 3F46A 2X9GA 1R0LA 1SCUA 3ICPA 3ZWVA 4XYBA 1ML3A 4P4GA 2EEZA 3RFXA 2A35A 4A5OA 4E2WA 3ADOA 2W4QA 2I3GA 3ONFA 4BKUA 4GX5A 4BHTA 4UEKA 2DBVO 3UAGA 2X58A 2PTGA 3DBRB 3TL2A 1T2EA 1H6DA 2GDZA 1GPDG 2O3SA 4DPKA 2NU9A 3SX2A 1J4AA 4PG8A 2VHVA 1R4NB 4OGWA 3WGZA 2CDCA 3ETGA 1D7OA 2XXBA 5TNXA 3ROQA 3CZRA 1IZ0A 3DB2A 4IJUA 3GGGA 2C5EA 3JD3A 5B1YA 3DZKA 3L4SO 4B7CA 2VZ8A 4NI5A 1ISMA 4BNIA 4W7HA 1Y1PA 1EDOA 4Q3BA 4OKIA 3ZNNA 4BB5A 6ADHA 3K9QO 1I2CA 4WCDA 4CMCA 4AICA 2W2KA 3TOZA 2GN9A 3ZZNA 4YAGA 4DUPA 3PDJA 1MGOA 2PK3A 4RJTA 2VWGA 3IS3A 1MC4A 4WCFB 4XB2A 2X4GA 3P2YA 1XQ6A 1MX3A 3AI1A 4R1TA 2EWMA 1U2DA 3RD5A 3CKYA 5BNIA 2C54A 3GNQA 1A9ZA 3WQSB 5GZ1A 1DC5A 1ULUA 3H5RA 4YJGA 2BGKA 5AYVA 4UVGA 4ND4A 3I9JA 3A14A 1ARZA 3KB6A 3QQPA 1PIWA 4DLBA 4YT5A 1TT5B 3FF4A 4JNKA 3LF2A 4NIMA 4GMGA 4QEDA 4ZJUA 1CETA 1X13A 1K0UA 2NLOA 3FD8A 5COBA 1VSUA 2EKQA 3R6DA 5T5QA 4P38A 4MVJM 5IDQA 1ISFA 3MEQA 2Z95A 1F8FA 4B3HA 1BTOA 3WX0A 5BNFA 4QQRA 2GERA 5KNLA 2Y68A 1T26A 4OXNA 2ZJ1A 3LVFO 1A7KA 2PA3A 3FTPA 2FPPA 3NDIA 1N9GA 4LSWA 4EJMA 3WQQA 3RBZA 3RUAA 3LYLA 3MOIA 1LA2A 1P45A 3PJEA 2GUGA 1UZLA 3W1VA 2NTJA 3BMQA 3CUKA 4NJMA 1KEWA 3INRA 1DLJA 1JLLA 1TXGA 4MIOA 2Q1UA 3ROPA 3NEPX 3WGTA 4ND5A 3WWYA 1FDVA 4IM7A 1EQUA 1EVYA 1OFGA 4RLHA 5KJCA 1PS8A 3SEFA 3TOXA 3V2HA 5T57A 4M8SA 1HE2A 2JD2A 2HRBA 5GZ6A 4BNGA 4J1SA 5JYDA 5KJ6A 5CDYA 2NACA 2OL4A 4BNLA 3C24A 2BMAA 3OP4A 2R2GA 3K2EA 3TPCA 4A7PA 2AQ8A 1WMBA 4FJ0A 4CMHA 1XHLA 2FHSA 3JD0A 3F4LA 3JQDA 1SOWA 1AUPA 2P5YA 1GADO 2J8ZA 4OH1A 3ZNQA 2PD4A 4G81A 4PLZA 1BWSA 1Y5MA 3KLPX 5TT0A 2BRUA 4RL6A 3DZGA 2VRCA 4NBVA 1T1RA 2WD7B 3I4FA 4AJNA 4CM4A 5DBFA 2OBNA 3C85A 4GBJA 4ILKA 5EINA 3TNLA 4J9VA 1L7DA 4PG7A 4BS9A 2YFHA 4IZIA 2TMDA 2AE1A 2HMWA 3FRJA 3S8MA 4CLRA 3JQGB 4FGWA 1L1FA 3EUWA 4XCVA 1OI7A 4E32A 4W7IA 2BI8A 3MWEB 3OBBA 5I9MA 1JVBA 1ORRA 2BFPA 1TVEA 1CRWG 3P19A 4RDHA 1R0SA 1MB4A 2IXBA 2PNFA 3KYCA 2C82A 4TRMA 1ZKMA 4RF3A 4ALNA 5TSDA 1A9YA 1K6IA 1C3VA 4AJIA 5JDIC 3ST7A 4DLAA 1CJCA 4XYGA 1HZZA 3PFWO 4IXWA 4GSKA 2O3JA 3M2PA 2PKRA 3DOJA 3QRWA 1DEHA 2OXIA 3GDOA 4IGFA 4R41A 1NQAO 5I7VA 3VH2A 4D42A 3VPSA 4IUYA 4Z9FA 1WLYA 1YDWA 1VLLA 2G17A 4KTTE 1E7YA 5A05A 3O9ZA 5F5LA 2QHXA 4GLOA 3PP8A 2I5PO 1YOVA 2VUUA 3WGIA 4KQWA 3NV9A 3ITKA 5L51A 1U5AA 4FB5A 1E3LA 4KUEA 3VH4A 4CMAA 1U1IA 4E2XA 1C0IA 1ENOA 3LC1O 3ZWPA 1E0DA 2NSDA 5C7IO 3VZQA 4D41A 5DP2A 1ADFA 3RUDA 4M1QA 2B35A 3WFJA 5KVVA 4Z0TA 1LSUA 1YWGO 4B8WA 4ZHSA 1MXFA 2Q4EA 1DFIA 2HMTA 4OQYA 4LRSB 1SB8A 3RJ5A 4YB8A 2Y1OA 3GUYA 3OEWA 1LRLA 3DZBA 5FYDA 3HB5X 1JN0A 1VL6A 5JCXA 1UZMA 5JNLA 1FK8A 4BO1A 1YQGA 4A10A 3GLQA 1GYQA 3T7CA 5CPFA 4GX2A 4BO3A 4QECA 3AM4A 4LW8A 4J16A 4XWYA 3D0OA 1CYDA 4F46A 1VE9A 3JQAD 2X1HA 1T2FA 2YHUA 4UEJA 2QW8A 2Y0DA 5AXCA 1VSVA 1X7DA 1PTJA 4XDZA 1JTVA 5JAIA 4OMUA 4NZ9A 2EP5A 3MJEA 3IIEA 1DXYA 4AJ2A 2RIRA 4GVXA 1WDLA 2O4CA 4J3FA 4TKLA 3DFZA 5JY6A 1SOVA 1YB1A 3GDFA 1IB6A 4CMIB 5F1OA 3BZUA 3EK2A 1B3RA 4ZQFA 4BO7A 1QLJA 1GQ2A 3DZJA 1FDUA 5EERA 3W8DA 4EI2A 4CMGA 3FPLA 2C29D 3PHJA 5IN4A 5GZ3A 3ASVA 3U49A 1QORA 2E37A 1UDCA 1EQ2A 5A9SB 1HDCA 3LQFA 4UVIA 2C5AA 4WNIA 1C1XA 1YE3A 4U6QA 1KVTA 2Y93A 1KC3A 4N54A 4PLHA 2O3QA 5CDSA 3TN7A 4IDBA 3QWAA 1N2SA 3CTMA 4IQ8A 3KV3O 4JJGA 4P4LA 3GMDA 2O3TA 1QYDA 4FPXA 4HXYA 4R51A 2CF5A 2WE8A 5KJEA 2IZ0A 4J7XA 1I01A 1EVIA 3PZBA 3COSA 4AFNA 4JIGA 4QX6A 4W99A 4OSPA 4FC7A 2WTBA 4ZQHA 3C1AA 2NWQA 1EMDA 5DBGA 4GKBA 1Z75A 2CMDA 4J49A 1Y8RB 2Q2WA 4WEQA 5DN9A 1DPGA 1PGJA 2ZYDA 1PZHA 4BGEA 2P91A 3G79A 3RWBA 4IZHA 4TRRA 2Q49A 2JFGA 4B7UA 1GV1A 4BKPA 5A9RA 3UGKA 4Q3CA 5G4LA 3I5MA 4BNYA 2GASA 3IDSA 3SXPA 3ZHYA 4HFMA 4NJOA 1MG0A 3VPHA 3TZHA 1E6UA 1EZ4A 3WG9A 4CLDA 4RDIA 2OP1A 4EITA 4XB1A 3ANLA 4D7AA 1V3UA 2IZ1A 4FFOA 3PJGA 5BT9A 2ZCVA 3TF5A 2D5CA 5K9ZA 1QYWA 3WJAA 4BO2A 3FI9A 4JX8A 1N7HA 5U4QA 1JW9B 2JHFA 3LLSA 4IDFA 4A73A 4E12A 4IGEA 4FFMA 5I9LA 1LDBA 5AQ1A 4MIYA 1F17A 2VNSA 3LLVA 1H94A 4FOSA 1LQTA 4B3IA 2GF2A 1JAXA 4HY3A 3HWRA 4ALKA 1W6UA 1H5QA 4TROA 5L9AA 1JQBA 3LT2A 3ZV4A 3WXBA 5A4DA 2HO5A 4PG4A 4BOYA 1GZ3A 5CEFA 1XA0A 4K26A 1NBOA 3B6ZA 2HLPA 3T7EA 2G0TA 2FRDA 1ZO8A 1PGNA 2HK9A 3GHYA 4IDCA 4EGFA 1FXSA 3B1KA 1P33A 4KOAA 1WP4A 3K2BA 1KETA 3O8QA 3BTSA 2Q1SA 2EG9A 4PLWA 1O95A 1D1TA 1JAYA 3W6ZA 1SC6A 4HKTA 3UF0A 1E1MA 1ZSYA 2Q45A 2NUAA 4J2HA 4MINA 4DBVO 3L9XA 4QFCA 4R5HA 4Y6RA 1CEQA 4IDEA 2FZEA 4CMKA 3O26A 4RVGA 4BV9A 4RCVA 4XX0A 4CM9D 1KVRA 2QG4A 3R3JA 2J5QA 2GN8A 2V6FA 1ZBQA 1GU7A 3JQ7B 3ZHBA 3JQ8A 5U9CA 3E48A 5G4KA 3KTDA 3QVTA 2Q3EA 1J6UA 1SMKA 3GAZA 4PLCA 3RQSA 1VI2A 4N5MA 2LDXA 4MKRA 2W8ZA 3KLMX 3DBLA 1XELA 1ONNA 2AQHA 3F4BA 3WB9A 5TT1A 1FF9A 3CXRA 2X0RA 1HE3A 2JJYA 1RYDA 4OJNA 4I8XA 1JU9A 4IJKA 1MV8A 4BGIA 1A71A 3S1LA 4BO4A 4S1VA 3W4KA 5C7LO 2OFPA 5JCJA 4BNUA 1ISJA 4TSKA 1ZNQO 3ORFA 5TJ9A 1EVZA 2ZKLA 4RZHA 5A04A 4W82A 3U3XA 2NV6A 3PLRA 4PZDA 3TL3A 3WS7A 3ANMA 5IF3A 3DAPA 1E7QA 4UUPA 3AU8A 2RH8A 5KJFA 3UN1A 1YL6A 2C0CA 2O50A 2X0JA 3SLKA 1PQWA 3WBBA 3RU7A 2YUTA 3I9LA 3L9WA 4RF5A 4EUEA 3Q9NA 2F1KA 5ADHA 3Q3CA 2JD0A 2ZQYA 3A4VA 4R01A 4HV4A 3E5RA 4E0BA 3GPIA 4N5NA 5JAZA 3AI3A 3V1UA 3KEOA 1Y9AA 2PH5A 4OM8A 4BVAA 4CQLA 3PRJA 4Z9YA 5CAEA 4CLOA 3QWIA 4IJVA 2JKVA 4DPMA 2DAPA 4JQCA 3WWZA 3FN4A 4R3NA 1R15A 4Y6SA 5H82A 4OIMA 5TIIA 4WE3A 2ZYAA 4OO3A 3K6JA 3HDJA 4JROA 4CODB 4F6CA 5IDXA 1A72A 3ZWCA 4GVLA 1WXDA 3R3SA 3PHIA 3D7LA 3FNEA 3OQ1A 4HFJA 4FFPA 2AXQA 5CDUA 2FOIA 3PEFA 4GX1A 2BHLA 3SVTA 5T8KC 3VZPA 3FR7A 1ZK1A 1H9AA 3I3OA 4JJFA 1GAEO 1WVGA 4R1UA 4XGKA 1MP0A 3K92A 1IYZA 1AHHA 2O23A 2EJVA 3WYBA 3JQ9A 5ILOA 5EESA 3T4XA 2VYND 1U3UA 5C37A 2X5JO 4I5GA 4DTIA 3IJRA 1YQDA 1GZ4A 1ZIDA 4IIUA 3TSCA 4CM3A 4K28A 3QHAA 3H5NA 1UXHA 2QQ5A 2VWQA 2FSVA 2I9PA 2GRAA 1O94A 2XF8A 3AM5A 2I99A 4Z0PA 2FR1A 2Y99A 5L4LA 2Y1GA 3L4BC 4FGSA 3H9JA 1YB4A 2EXXA 1RM4A 1KEUA 2J5RA 9LDBA 4MVJD 2Y1FA 2WSBA 4J7UA 3QSGA 3DZIA 4GSLA 1YL5A 1LLUA 1NVMB 3JV7A 3FTNA 1GR0A 3K73O 4NFHA 3C1TA 1PL8A 2QZZA 3A1NA 2JCYA 5GY7A 2JD1A 4DL9A 1YBVA 3BMCA 4HFNA 4YT8A 3S2IA 4HWKA 4P22A 1YKFA 3Q2IA 1PJ3A 3DQPA 2DM6A 1DIAA 2EP7A 2QYTA 4DYDA 3B20A 1PQPA 1P1KA 1U8FO 2OORA 2EW2A 4YRDA 5DP1A 2W2LA 1ZJZA 4J9UE 3RUHA 2ILTA 3QV1A 4J6FA 4WLNA 3IP3A 2NQ8A 5LDHA 2EKLA 3E18A 3NKLA 3H9UA 5DBIA 4UAGA 3D5TA 3DO5A 3JYLA 2NQTA 1BDMA 3ZWAA 5L4SA 2DKNA 1XQ1A 1M6HA 4NR0A 4Q3AA 4B4WA 1WPQA 4BNWA 6LDHA 5IFLA 1WAMA 3NTRA 2I76A 3Q6IA 1Q1NA 3G1TA 4WKGA 4FOOA 3E9NA 4L73A 2IYPA 2PH3A 3JD2A 4IQ0A 2VHWA 4PFJA 3WGYA 1ZFNA 1IHXA 4OXYA 4UVDA 3SJ7A 5B12A 3AJRA 1HDYA 1R0KA 3TWOA 1GDHA 3GF4A 3PVZA 4E6PA 1GZ6A 3ABIA 2IEBA 4BL5A 2UUPA 3OJFA 4CV1A 2GZ1A 4TMFA 3JSAA 3LSYA 4U6SA 1DAPA 3H8VA 5CHEA 3RAJA 2ZIZA 4YCAA 1EUDA 1LDMA 1O9BA 2DU8A 5A1TA 1C0PA 3DMYA 1VJTA 3UOGA 1YJQA 3ADPA 5FFFA 3AOEC 1P1FA 3JD1A 4XR9A 2YV1A 3W6UA 3FCOA 2NNLD 3WYEA 1LRKA 1LLQA 3GZNA 4A2CA 1WDMA 1UZNA 4DMLA 4L74A 3GY0A 2V7PA 3ONEA 2E6UX 1RKXA 4IDDA 4MDHA 3GPDG 2QYSA 1LC3A 4BKOA 1E7MA 4I9UA 1BXKA 2F00A 3NDRA 4DIOA 1S7CA 4YJDA 5JO9A 5L53A 1PJ4A 3P2OA 1LC0A 1B0AA 4XYLA 1LNQA 1F8GA 2G76A 3AI2A 5ITWA 4AJOA 4LCJA 5F1PA 1XR3A 1N9GB 2CSUA 2PGLA 3OQ6A 3VH3A 2AE2A 4BQPA 1PJSA 2NU6A 1E77A 2B69A 4E5PA 2IDZA 5IZCA 1I33A 2Y0EA 5G0WA 3HADA 2R6JA 3WMWA 3M1LA 4RF4A 1D4FA 1TB4A 4PVDA 1I2ZA 2YV3A 4E4YA 1R4MA 3PIDA 1YBMA 3DBHB 1MA0A 4YJHA 2BF7A 4Y8VA 4CM8A 3QIVA 1BW9B 2D2IA 3R0IA 2ZTUA 3RCBA 2HMVA 1XYGA 4FFNA 1MXHA 3U9LA 2GYYA 3UICA 1GCOA 3BXXA 3ON5A 2VHYA 1BMDA 3GN2A 3QWHA 4XYMA 1N7GA 3EW7A 2AQKA 1PZFA 4JP3A 4NG5A 1U3TA 4UUNA 2EGGA 3HB4X 4B4OA 3ZWMA 4OHUA 3KSDO 2CVQA 3KOUA 2DBZA 4NQZA 2BLLA 4M89A 1HSZA 1PL6A 3E03A 3IMFA 4HP8A 4A03A 4FFLA 5IAAA 3LT0A 4C4OA 1NASA 1DO8A 2VCYA 3CH6A 3KM0A 4G65A 4XIYA 3MOGA 1Q7CA 5CDTA 1BXGB 1J49A 1MFPA 1PWXA 1P0CA 1Z73A 2PWZA 3HUDA 1UR5A 1LDGA 3RFVA 2I6TA 3AOGA 3WDSA 4RQTA 4AJKA 1AN9A 5TRTA 1UAGA 3RFTA 4Z6KA 4R68A 1I3LA 4XD2A 2VRBA 3GVCA 4MVJI 2FP4A 2X22A 5A9TA 3AFMA 1YDEA 3ZU5A 2PR2A 4YAIA 3HNPA 1QV6A 1TI7A 1DIHA 4MP8A 3AY6A 2Q2VA 1NR7A 3KYCB 1U7HA 1W73A 4ALMA 2FMUA 1EEHA 4J4TA 5MGBA 3GA0A 1ZK4A 3I4CA 4CM5A 1Q7GA 4KWHA 1B16A 3TZQA 3D3WB 1Z45A 2YYYA 3JQAB 4CL3A 1PZEA 5EQFA 2B5WA 1E7RA 4YJFA 1XGKA 1ZCJA 3SBOA 2EHDA 3GG2A 3D4OA 4R1NA 1QMGA 5JMWA 1H6BA 4FW8A 4WNCA 8ADHA 2UVDA 3RU9A 4CMEC 3OFSA 3GRKA 3WGHA 1DC6A 2Q46A 4AL4A 5KWEA 4WLUA 4JLWA 4CMEA 3BTVA 4H3VA 3LDHA 3EZLA 4R5MA 3H5AA 3ITDA 2WD8A 3KRTA 3GN1A 3HG7A 3STHA 4PN3A 4KUHA 1SB9A 1N5DA 1K89A 2VHXA 3PGXA 3D1LA 2R00C 5JAQA 3AFNA 3SJUA 1E1KA 1HDRA 2PKQO 3P7MA 1SPXA 3DR3A 2R00A 1PR9A 2B4TO 2HK8A 1HZJA 1ZEMA 1T24A 5AOVA 1HDXA 2J6IA 2CVOA 5KJ1A 1EBUA 4D43A 3CMCO 1DBVO 3HFSA 1FDWA 1ZK0A 4WASA 3DXFA 4OSOA 2OHXA 2E4AA 3DBRA 5A03A 1YB5A 3HQ4O 4RPHA 2X5OA 1VRWA 2B0JA 3IKTA 1NAIA 5IXYA 3M2TA 2YDYA 1R4NA 2H5LA 3TRIA 3BMNB 4WK6A 1C1DA 4RV9A 4GWGA 1UH5A 2QZ9A 3HFGA 4R9RA 3L6DA 5JBIA 4CV3A 1Y8QB 1A27A 2X7HA 4R1SA 4ALIA 4OOFA 4IINA 1V35A 1G6KA 1SBYA 3FR8A 4PLVA 4W6ZA 1ZJYA 1DIBA 3OSUA 2C2XA 3B70A 4WECA 5ES3A 2JCXA 4JBGA 2C7VA 2YQ5A 3ROMA 3VDQA 1YJ8A 1GEGA 2DC1A 2IEDA 3DL2A 3EMKA 1PJBA 1UDAA 3WLFA 4OAQA 4D45A 4YTEA 1ZSVA 4AJHA 1HRDA 1PEDA 2ZK7A 4TVBA 4CL8A 4WLVA 1C1XB 3PK0A 3MZ0A 5C5IA 1LI4A 3O4RA 4CR7A 4Y6PA 4BNKA 2O4UX 3EZYA 2HQ1A 3KYDB 5FWNA 2HDHA 3QWFA 1GUYA 5T6BA 4Y98A 2X23A 4IPTA 3I1JA 1OBFO 5DOZA 5JO0A 1TT5A 1PSDA 3ZI0A 3KHUA 2AEFA 4NU6A 4TWRA 1XDWA 4ZQEA 1NM5A 1OMOA 2VRCD 3FPCA 4O59O 4W9NA 1SAYA 2GZ2A 2B5VA 1ADCA 2O7SA 4E13A 2YDXA 2DT5A 1NHWA 1I32A 3NUGA 3CPSA 4UUMA 3QVXA 1CF2O 2D8AA 3F9IA 4K9DA 4DQVA 5IN5A 3K8ZA 2YHIA 4FD3A 3I9MA 2NVBA 3AUAA 4RGBA 5BNTA 1TEHA 4D46A 7MDHA 3Q1LA 1KY4A 4G5HA 1PJTA 2CF6A 5JDCA 3F1LA 4KTVE 4EJ0A 2HK7A 1V6AA 1LRJA 3BTUA 3PLNA 5DDIP 2GO1A 1NFFA 3RSHA 2VWPA 3ZU2A 4FJ2A 1K2WA 3HSKA 4L0QA 1M75A 3ZU4A 2GSDA 5IDYA 2VNAA 3JD4A 5JY1A 3ZV3A 1QYVA 1B14A 2XOXA 4FDAA 5DOVA 3UXYA 4HNHA 3DOOA 4E5NA 5HS4A 4FBGA 3BIOA 4QFDA 3GH3A 4EUHA 1R12A 4Q3NA 3JTMA 1FDSA 3S2GA 2UDPA 1GV0A 4IDAA 1GPJA 5DCUA 3DBVO 5HBRA 3MJVA 1NQ5A 3B1JA 3RJ9A 3AUUA 2B83A 1DC4A 1LBEA 2WD7A 5LC1A 5ENVA 3PQEA 1SZJG 5AXBA 4C7KA 4LSMA 3W4IA 3WIEA 1NPYA 1NP3A 4BQRA 1MC5A 3IQDB 5A06A 1H6CA 2EW8A 4PRLA 4YYZA 1QP8A 4D79A 4CPDA 2AG5A 1YVEI 3JQGA 1F0YA 1GYRA 1LSOA 3K5PA 2Q2QA 2ZTMA 4BUCA 1IOLA 5FI3A 2IYOA 5G2OA 1TA4A 3E1KA 1IY8A 3JCZA 2WMDA 4IIVA 3RKRA 3JQ8B 3VC7A 3ZDFA 1YH3A 1M2WA 3VDRA 1YO6A 4LMPA 4E21A 1R6DA 4OQZA 3UCEA 2VZ9A 2HRZA 2VHZA 1OC2A 4C7JA 4U0JA 1VKNA 3IP1A 4ZRMA 1DLIA 1GCUA 2XPCA 4RPGA 2QX7A 1ADBA 4UUOA 1JKJA 4WLEA 3JQBA 3RIHA 5L4NA 2ZB7A 3VKVA 2HSDA 1G0NA 1U28A 2EJWA 3BMOB 2BH9A 2POQX 4ZQGA 1WNTA 5ER9A 4NFSA 2NADA 1LUAA 1HTBA 5L45A 3HZZA 3DWFA 1E1NA 2FPIA 1I30A 1EE2A 3JQCA 1XU9A 4PZEA 5DF1A 4PG5A 1AHIA 1E5QA 1UP4A 4YT2A 4J4BA 3E5MA 2CDAA 3IL2A 2A9FA 5ILGA 3GQVA 3JYNA 5B4UA 3DMTA 3I9OA 3QJ5A 3GDGA 3QE3A 4E31A 3VPFA 5L7TA 4U7WA 5EMHA 4B4VA 1M66A 2DFVA 1P74A 3DEYX 2P5UA 4DIFA 3Q11A 3H9GA 4DGSA 3CINA 3KUXA 4JJIA 5G0SA 4Y9DA 3V1YA 4BNTA 3PJFA 5FEUA 3JQ6A 4IXTA 4XA8A 3H6KA 4D44A 4DQUA 1U3VA 4WLOA 1YGYA 1P1RA 3ZWBA 4MVJE 4CQMA 3AWDA 1QYXA 2ZCUA 1IZ9A 1B3BA 4EBFA 1RJWA 2YQ4A 1DIRA 1DJQA 3JYOA 2H9IA 1BSVA 5BSGA 4J1NA 3JYPA 5L7YA 3WTBA 3I9KA 4BNFA 2TMGA 4CMIA 2RAFA 5KKAA 4MP3A 3VH1A 4JBHA 2AMFA 3VHRA 1OAAA 3EC7A 3ZV5A 2RHRA 4DYVA 4KZPA 3ZWNA 1ZMOA 4GI2A 1F06A 1UXIA 1XSEA 2NVWA 1U8XX 3HJAA 4ROSA 1IUKA 4Q3EA 2NTNA 3QWBA 5A9SA 1H0KA 3KBOA 5JC1A 2PZJA 3PXXA 4YAEA 3Q9UA 3U09A 1KC1A 1M6WA 5I8WA 1GFSA 3QY9A 3S2FA 4L4XA 4TRJA 1QXSA 1LSSA 5EQDA 1RM3A 3ZWYA 4RVFA 2D4AA 4LK3A 1U4SA 3DHEA 1UXJA 1PJLA 2B37A 4BKQA 1R37A 3NYWA 4BGUA 4H7PA 1SNYA 1ADGA
chains in the Genus database with same CATH superfamily
3KKMA 4DR7B 3KB1A 4GPEA 3VR2D 4IZ6A 2FYTA 2NAPA 5TY0A 1KBZA 4EEZA 1S96A 1W581 1Z82A 1L8LA 5THQA 4BTLA 3LGSA 1JR3A 1KIFA 3IBCA 1O95D 4ZVPA 3HKDB 3AM3A 1KEEA 4NMHA 3L92A 1P4GA 1C7RA 3CNOA 4L5BA 3NOQA 3R8CA 5T4HA 2MU1A 5E6UA 1B23P 4ZO9A 2OWEA 1EGMB 1D5WA 4RQUA 2FQQA 1GN9A 3MILA 5ERGB 3F8WA 1E8NA 3FLAA 3BC1A 1P0FA 4TMKA 1O8CA 2BLNA 4NZMA 5REQA 1GU0A 2ZR7A 1VPDA 3V34A 1D9XA 3ZWWA 2YJTD 2YN2A 5BN3B 1N5LA 1FUKA 1QO0D 3NHPA 1Q1QA 2FEKA 4KGZA 1KZ9A 3VJLA 1CF9A 2DBQA 3JQFA 2A67A 3MTGA 4JAVC 4KO1S 3WDKA 1G5PA 3EZ2A 4LEIA 4AWXA 4BO0A 3D3QA 3OM9A 2GPNA 4J2OA 1IMOA 2RBEA 3GVXA 2F4NA 4B3GA 1I1NA 5JQGA 4MARA 4GGOA 4XQ9A 4ENSA 2WILA 4KFUA 1X0XA 1RSZA 1DHRA 1TQ6A 4QASA 1OFIA 5E6RB 4OP1A 3FNFA 5C18A 2QI9F 4IWYA 2HMSA 2YZGA 4JL5A 1DEAA 1KXJA 1Y5IA 2Q5IA 1QHNA 1RIFA 3L6RA 2JATA 3GRRA 4OAOA 3AGPA 1VE7A 1Z47A 4ROTA 3EVTA 1W96A 3JQ9C 4AS3A 1W48A 1A9RA 1P6UA 1XDGA 1NP6A 1KMQA 2C5GA 2FSHA 2R8ZA 4WY5A 5JYBA 4MKGA 1TO6A 2CNDA 5GP1A 2XGJA 1IUNA 4U02A 4HK4A 1D03A 4MW1A 5CH3A 4CDNA 3T3IA 4IWXA 3FPKA 3P4UA 2OGSA 3OIDA 5HRAA 1G3UA 1EUDB 3DCYA 4PXYA 1F60A 5KI6A 4IGIA 3G88A 4B7AA 1X1EA 4X3CA 3R7WA 1C4OA 5JMOA 2CK3D 3WHPA 1Z6QA 2YYZA 1N2BA 2H9AA 1GZVA 2IHJA 1AB6A 2VK8A 1ZJWA 2X4DA 4MGZR 3C3AA 3K96A 5AUNB 4FEAA 1DDOA 1G7TA 2Z6UA 3SOZA 5FPQA 2VDMB 2ZREA 1BAPA 1Z7BA 2QVGA 4R8KA 3LZDA 1Q0RA 5GINE 3AI7A 3U7GA 3KPYA 4IIJA 2YIVX 3ILVA 5EG5A 1N7IA 5HF9A 5CT9A 3ROKA 3HI4A 3FNRA 2RGNA 3L7NA 2HUPA 2Y67A 4PIVA 4OQ4A 2JHGA 3IDZA 4X92A 3WICA 3EX7C 4MRRA 1CE8A 3V4LA 4LECA 3K94A 4MLDA 1U3GA 2X4IA 1JWBB 2YC4C 2O7QA 2H06A 1J22A 3U62A 1EUCA 1NXWA 4N3NA 4MJ7A 4IQGA 4UTZA 4GPIB 5KCMA 3V1TC 5A4FS 3MNFA 1KYWA 3C39A 3H3FA 1L4EA 3WIVA 2HHHB 3FOWA 4NBWA 3GWGA 4QLBA 4IX1A 4KDFA 2FR8A 1BO6A 3B48A 3HU1A 4L8VA 1NIPA 1YRLA 2FN9A 2Q9AA 3EGDA 5ALNA 4BLOA 1WD5A 1W4RA 2JLVA 4NFYA 2JAHA 4QGAA 2FWRA 2XQIA 4UKDA 3M4NA 4BE9A 2NTVA 4CUJA 4HAWA 4FOLA 1JEQB 4B46A 3LVQE 3QTLA 1OXTA 2D62A 5C51B 3DFFA 3GLRA 1PGQA 4N39A 3WQRA 4FUQA 2XQJA 1U2ZA 1LDNA 2QT9A 1AY0A 2ACVA 1PGPA 4TXHA 4DJTA 3CEAA 1NKSA 1R0BA 3Q9LA 4MUNA 4QXOA 3WOVA 1E5DA 1NDUA 3R7SA 2ODTX 2AOWA 1E2MA 1OJLA 5EJ7A 5J3JA 1N1GA 3EQZA 1GNPA 3TOVA 1SOAA 2C20A 1ADYA 1PEYA 1ZGCA 2HY7A 2YINC 3MT7A 3MC1A 2CZCA 3VYUB 1S9HA 3M6XA 3OTIA 3CUUA 3EFBA 3OQHA 1HE5A 3DEHA 4I50B 1ZD2P 1ISIA 3C7TA 1LD3A 3ZGVA 1I7SB 2VQ3A 1YCHA 4QYXA 1XWWA 4N18A 2OXEA 1X94A 4JR0A 2YVUA 1WX1A 3E2PA 4LPSA 4P53A 4QARA 4CUZA 5AW6A 4UARA 1RWBA 5IJ9B 1K6MA 4FYIA 3GGJA 4JP2A 3H4MA 4QTZA 4QWMA 4Z9XA 1BEEA 1RU3A 2ZKIA 3ZHQA 3WSWA 1WSWA 4X8MA 3LWZA 4KAFA 3OCXA 4JN6B 5B2EA 1XMVA 1HX7A 3W3AA 1R1DA 5L3RA 4DJAA 4QUKA 4GS5A 2AG8A 3V4RA 4EY6A 3RV4A 2XNDD 3GWZA 1LQUA 3C6XA 2QM8A 3L02A 4X7MA 4MCAA 1U0OC 5J23A 1JTEA 4EJFA 1TOAA 3TECE 2W2LD 1WKVA 2WJPA 3DAOA 1KP9A 2C31A 3KQSA 1BXRA 3MMXA 1ZI8A 4H7FA 4UDNA 1NWHA 2YZ7A 4BMCA 4PZUA 2WVJA 1JYEA 1EWRA 2A0XA 3G02A 4WA7A 1EFCA 4EDFA 2FP4B 4BGVA 4J1QA 4UHCA 1RHUA 2J59A 3A3PA 3KKKA 4V0LA 2B7LA 3S4YA 4OHWA 3IJEB 2C96A 4U3JA 4YQYA 3ZCRA 2GPWA 4UBNA 4DZRA 5T67A 3S2UA 1JKIA 4HTAA 3EPKA 1GL3A 2O8VA 3LAWA 1KDZA 3K09C 1XL1A 3NR2A 3O8LA 4LRUA 4N8DA 3OQMA 2XRZA 2FKNA 1XLTA 3DBIA 4JVSB 4JI2B 3B12A 2LCIA 2FFRA 3DSRA 1QK5A 2ODWA 4GP7A 3V1LA 1LFAA 1JHOA 2ZIGA 4DNFA 3ZYCA 2CNNA 3RHTA 1DFGA 1BXZA 2FPPB 3KJFA 2WTMA 1NN5A 3IEIA 4QO8A 3M6VA 3PHGA 1GA1A 5AHOA 2VQ6A 1SXJD 1TCCA 1XAGA 2W0MA 3O8BA 1WMAA 1F1BA 3IKLA 2JFFA 2J5BA 1M8PA 4IXDA 4YXWA 3GLKA 3T5BA 1NAHA 4IMPA 4A0RA 1SO8A 2VR1A 3GK3A 2Q4OA 2J30A 2ZYUX 1Y4DE 3LLUA 4Z8XA 3WL8A 1BG6A 5EIBD 2WZQA 2VBGA 3BB4A 4YRFA 1XZJA 3ECAA 3FGOA 4FHCA 2J4DA 4O63O 1UCFA 4O4LF 4K9PA 3DLCA 1QIFA 1P18A 3R75A 2WV9A 4GR9A 1AURA 1H5UA 2AOUB 1CRLA 3GGOA 4TLBA 4MIEA 4D8UA 2VF2A 4QU8A 3ZVMA 3ZLAA 2KM1A 1KO7A 4AKIA 2JFPA 5IC4A 5B57C 1U94A 3MJTA 5LPNA 1XK6A 3TQFA 3CVOA 1LBSA 1QS0B 3P0EA 1R8YA 3X44A 4BNMA 5JJ5A 3BB3A 1G8PA 3GRAA 4F9FA 5JXIA 1MTOA 1BZYA 3I3SR 1TUBA 1YS4A 4RHCA 3U17A 1XMSA 4BUJA 4HN4B 4OFWA 3JZAA 4UMFA 2GJSA 2J0VA 2PKXA 3PDUA 2D7DA 1YFKA 2YS6A 4EL5A 2HXSA 4DJEC 2X0FA 1P2BA 2JIPA 1LLFA 3B82A 1G3MA 3IAAA 2IH5A 3HGQA 4M87A 3CN7A 1ZONA 4RJIA 4D5EA 2DZDA 4IQFA 4EHDA 4B3TB 4OI0A 1YBFA 1NYTA 1Z0AA 5I7FA 1T2DA 4P86A 2AFVA 2ZU0C 4BRZA 4E2ZA 4EL0A 2AR7A 4MKZA 4GOND 1F1JA 4DEYA 4CLRB 1XA4A 2XWQA 2AOTB 4KSBA 4QG7A 3RRNA 3K70C 2ZITA 1I2BA 3F6PA 4P4UA 4U7TB 2RHCA 1KI2A 3HZHA 4UASA 3KHSA 4JOCA 5M5BA 4AIIA 1IXYA 1OZAA 1BX1A 2X1LA 1VLHA 2OBYA 3EODA 3MRTA 5EC8A 4G5GA 4MB2A 1X70A 5K8CA 4ZK2A 2EQBA 2SNIE 3VJMA 2ZI3A 4BVFA 2PUGA 2GJ8A 1QSGA 3A9WA 5LZ9A 5JROA 3EVNA 1GUZA 3IE2A 1YAHA 1YFJA 3G5AA 4MUHA 4EYEA 4HNAB 2QUAA 4KXYA 3INTA 5LYJF 3EUAA 1MT3A 2IWHA 2PKYX 3F5QA 1I4LD 1QHHA 3DHNA 4I4NA 1V3VA 3IAEA 2C4MA 4QGFA 5AW9A 4J6EA 1Y3IA 2AC7A 2AMYA 2NUPB 2PANA 3FPHA 3LT1A 1QCDA 5IAJA 3WDLA 3QVUA 3X43A 1GOTA 3A31A 1O7JA 1YS2X 1ZCZA 1MVOA 4ZVQA 1Z7GA 5F2EA 3NTVA 4G5FA 2H7VA 1RKQA 3AUYA 5CT4A 4XWKA 2QVXX 2YY5A 3PI7A 3SZOA 2XTZA 3I0NA 3SQWA 3I58A 4Q9KA 4X1YB 1ZHFA 2PKCA 1DTWA 4PLTA 5DCYA 1UBHS 1D4OA 2FVYA 2O3UA 1XXHB 1P80A 2N1BA 2QD2A 4R16A 7YASA 3KELA 4QOGA 3PUIA 2AJLI 3I12A 4EM6A 1ONSA 3PUWA 3Q41A 4FLEA 3EQ2A 2AI2A 3NVAA 4FINA 1I2MA 4H60A 5AVJA 5F3WB 3GJTA 4DPLA 3PSAA 2OCDA 4J0QA 2BYTA 3Q7EA 3G1UA 4JSYA 1VB5A 1U99A 1YQXA 4LHEA 4YBZA 3VVBA 1C50A 4HAXA 2Y1WA 4Q4DA 1S3FA 4YJ2F 3ZGYA 3LKZA 4PRYA 4KU4A 2FQYA 4N6GA 3RFCA 3TLXA 3D2CA 3KB2A 1TTPB 4DDWA 1AV7A 1X7GA 2YRFA 2WV7A 3H6HA 2CMGA 5EWMB 4BVHA 2ERXA 1VA5A 2JIRA 4MO2A 1RBQA 3GYBA 4Y6OA 5EHZA 2XCLA 1IULA 2QV7A 2QVYX 4N01A 2XMCA 5CNJA 3BRSA 2BN4A 4PCUA 3VUEA 2P1RA 5CH8A 4D0SA 1TEZA 4TV8A 4ZCTA 4P3KA 1ZGJA 3TBHA 3VTKA 2GD2A 1D3AA 5LJIA 4TQUS 1H2XA 1I3NA 4EHNA 4ESEA 5LLTA 1PQUA 3HJRA 2G82A 3WKAA 1CT9A 1UK8A 4JLPA 3THOA 4ASUD 4IJWA 5EZYF 2Q99A 4QODA 3SEZA 3PDWA 3PL1A 4ZTZB 5J2TB 2QYOA 3VDXA 3RSSA 3CSSA 2P75A 2C07A 3AFOA 1Z6TA 2CD7A 4RTQA 4YP9A 2YJ5A 3I6IA 5C52B 1UOPA 3VSDA 4B2LA 2QN3A 1NVDA 2D00A 3T99A 4Q7JB 5L6MB 1GKYA 4Q4AA 1CY0A 2UYGA 4DLXA 1YQUA 3N75A 2DUUA 4UNQA 1QG4A 3ZN2A 1BXGA 3AR9A 3T4EA 2P3OA 4CJXA 1L7QA 1RWVA 2A0WA 2NW6A 1EVQA 1WCWA 4XLLA 1R0RE 4ZT7A 4CV0A 2F7SA 3ZG6A 4ZPJA 2JZCA 3PHBE 5A6SB 3VR4H 2IYWA 2RBGA 4G4IA 3GYGA 4YI3A 1Z63A 4QLOA 3TMAA 3DULA 5F3DA 4DILA 2F1IA 1DWUA 1CNFA 3AG6A 3GI1A 1MLDA 2X6RA 4J2TA 1JQDA 1OXSC 1KI8A 4NS1A 4I2NA 4W9NC 5HA5A 5JEEA 4YASA 4ZQIA 2GPJA 3LIPA 3FOAA 3MJ4A 4RJJA 1J24A 3DVLA 3A4LA 3HUFA 3JQAA 5KNCD 4D9HA 4LRQA 4KWIA 4C01A 2VF4X 4OKSA 4NPCA 4NU8X 1CEYA 4LCEA 3T3MB 5ENDA 3PE6A 3T7SA 3VR3A 3DQQA 2Q6KA 1PR0A 4BP9A 4F9GA 2N47A 2MINA 1RXIA 4FSHA 2AB0A 2ZWIA 4G1CA 3RHSA 4AQYB 4LGYA 2F55A 4HNQA 4G4JA 3COWA 3I64A 3I9NA 3NBQA 5DX8A 5KPJA 2PV7A 1S2DA 1YUMA 1M6VB 1T91A 1XTBA 3LXRA 1YD7A 1RJ9A 3ROEA 4PLFA 4WFKA 2YXDA 4F84A 3S1SA 1PLJA 2RGEA 5F21A 3SYRA 1E2GA 1WF6A 2FEMA 3HYTA 3QX3A 1SVKA 1H3EA 4HUQA 3I1IA 5EHQA 5IJZA 4Q01A 1H9BA 4E7OA 1CY4A 5FWXA 2PDAA 4O4IA 1M34A 3QKWA 1KMNA 4JB8A 4IBOA 3TSOA 4RSMA 4I55A 1XL0A 3NHMA 4KBFA 2PX8A 1WM1A 3S7ZA 1FDTA 3EA5A 3ZNOA 3QEMA 9MHTA 2WHEA 4AZ0A 3H86A 1JJAA 3RUFA 3NEJA 1I14A 4NE7A 1C7QA 3GP8A 2XBMA 4GVPA 4CKZA 2E4WA 3MGBA 1R9JA 1G5IA 4O2AB 4ZP1A 4MUXA 1HDZA 2E85A 4HS4A 3RI3A 5AP9A 2HSWA 4QOJA 4EAQA 3CISA 1U0BB 3D6AA 3OIUA 4G2TA 4YAWA 5LA6A 3PNOA 4MNTA 1XQWA 4QG3A 4N48A 1EWQA 4XUGB 3K2IA 1AXGA 2A5FA 3SK0A 4CG3A 1QYRA 1EUQA 1NC3A 1MOPA 3O8OA 4HAVA 1QTQA 2E49A 1J90A 1V11A 2IXAA 1ZD5A 3BMNA 3EZGA 4M86A 1CQPA 1GCGA 1DB3A 3CX6A 3GGSA 3QVKA 1HG0A 4WTOA 3K1AA 4AN4A 2FEAA 5C81A 2G0NA 1H6AA 3PF9A 3VI3B 2B1IA 2X15A 3S2SA 2GOYA 4CQMB 1OBCA 1E18A 1ENZA 2ORWA 3V2UA 1UJCA 1JQAA 1OREA 2PLWA 4YMWA 3ZHXA 4OIFA 2NUAB 3FSEA 2VWHA 2O59A 3C3PA 3FVTA 1P62B 5LVAA 3TCNA 1XTRA 2IF0A 1UC8A 4I5FA 5TPZA 5HUHA 2XA2A 3N07A 4UVEA 4K9RA 4EW2A 3MT8A 2FPKA 2P2GA 3EULA 1Q21A 4M49A 5BP7A 2YXBA 3KX2A 3LZ6A 3WK5A 5JYCA 2GPSA 3C5CA 2Q9BA 1A4UA 1IY2A 1STOA 3EYAA 4RD0A 4UJ3A 4ALJA 4B3XA 4BVGA 5G4KB 5KNDH 1VBNA 3VKHA 4M98A 2QK4A 1UP7A 2I33A 4ADSG 1U2EA 3CFYA 3NKFA 5BN5B 1IONA 3OO0A 2DKOA 1Y82A 3NHUA 1U7PA 3H2HA 3BGSA 3UGTA 3KETA 1M1UA 1C30B 1N1EA 1DCKA 2AQIA 3FAKA 5C35A 4K6FA 4Q9JA 4C22A 4H08A 1B8PA 3DLTA 2VDRB 3QYAA 3W1WA 3G3EA 3R7DA 2IXFA 2ZYVX 3EH2A 2VKTA 4HDMA 4YP0A 5DHAA 4DN6A 2G63A 1EWYA 1UFQA 3HJNA 5HIMA 3ZKWB 1U9JA 4I19A 2I0FA 1Q0TA 1Y1SA 2Y9PB 4JH0A 4TN5A 2FV8A 2ZRIA 3E3LA 1ECCA 3K8QA 8AT1A 1N7JA 3MUFA 3AT1A 4J03A 4ZEMA 4ESVA 2YFQA 3D2AA 3KXKA 4LZAA 5TF4A 2AW5A 2JAWA 3DFKA 4I5EA 4MV9A 5B36A 3BJMA 3BWDD 1TZKA 2O2IA 1FSZA 1S3GA 5E9WA 4E5MA 4PZLA 1Y89A 3GIDA 3UY4A 4E08A 2BMFA 5ITZA 1MCZA 3M34A 1MZVA 3GBSA 1FMFA 3G0OA 4TRNA 3ZCSA 2X1MA 4L8WB 3RGGA 4LBWA 2PQ0A 1NX6A 4KR9A 2OCLA 4R1MA 2C84A 2WDZA 2Q3BA 1E2QA 5FP0A 2MYNA 1K5HA 3RJZA 5F51A 2I65A 3SQNA 4YACA 2JFHA 5CX1B 3TTYA 5BMOA 2H1RA 3HDGA 3CLSD 1P7YA 4G0NA 4OBXA 1MUUA 3H1PA 5AVOA 5BWBA 4DW8A 2YJ3A 1RTKA 1MF7A 2PA0A 4D9GA 5EUBA 3MUNA 1KL7A 4TV9B 1L3IA 2NP6A 1TJ4A 1EDBA 4UEOA 3PZRA 5LBIA 2BTQB 2X6TA 2Q3JA 2QRJA 4IMJB 3UUEA 1HH4A 1TF5A 1I0ZA 5FA5A 1AQJA 1E89A 1N5KA 1IMJA 1QX4A 3IIJA 4KLCA 2X2FA 3ZDXB 4QJ4A 5LMCA 4KN5A 1U7TA 4V2UA 3KZKA 2JS7A 4NABA 4BLSA 2P4HX 3NBAA 3LO8A 1V6CA 4AY4A 1E8MA 4DVGA 5FI1B 1IL0A 2VBIA 4R9UC 3BRWA 3JVVA 4MUIA 4LOKA 1QKIA 1GKUB 1HEUA 4J3NA 1ILEA 4LY3A 5EXXA 3LA6A 3R2JA 2J33A 4BB6A 5KCZA 1FYFA 1YK0A 3TDKA 1VIMA 4CM7A 4J43A 1M54A 1SBCA 4LJSA 5K6AC 2LKDA 4FYYA 2N75A 1K63A 1HNWB 5GVRA 3WV4A 4J0DA 2W6ZA 1H4SA 1P9LA 2ZI4A 3E0XA 3Q8WA 1K92A 4DC0A 3EZ7A 5F1KA 5FUQA 1W0CA 3R0ZA 1ISSA 1T8RA 1B8UA 3KUUA 3C97A 4IS3A 4CT0A 1E2DA 1A5ZA 4V1CA 2R87A 2QLBA 1JDVA 2CMFA 2QI9C 2YCBA 1DGQA 5AKGA 3T7JA 3W78A 2YXLA 1JKMA 2FSUA 3IXMA 3WR5A 1IDOA 5AK5A 1GAQA 2Z2KA 4TYPA 3IGFA 3UUGA 2C9DA 3E7DA 3VU1A 3ZV6A 1QE3A 4Z5XA 1T0JB 1P17A 4O4HF 2PKEA 2ZIXA 3TBFA 4YRSA 2ZCJA 1THZA 3RK0A 1A4IA 2ID7A 4KXNA 3DG9A 2OP0A 3URMA 1U0GA 5D3QA 2XV1A 4D1YA 3OH8A 4W8OA 2CHEA 3ICOA 1Q1GA 2Y05A 1XTPA 2P9YA 3EGCA 3O31A 3Q6MA 2ZSUA 3TRDA 3RHFA 5JS7A 1VL1A 3GVHA 5DVZA 2WPDD 3LU1A 2P5SA 5DASA 1XMQB 4ZZIA 1N2ZA 4QXMA 4F4UA 2C61A 5AOAA 2UVPA 2P9BA 4HWOA 5DLDA 2KBEA 2PYZA 3D3EA 4YAJA 2DWPA 2PL3A 3ZHZA 1FXUA 2QRMA 4COOA 2R8XA 4CHGA 1DJPA 2OZPA 4DLKA 3ZWQA 3THRA 1UBLS 2P79A 4QBFA 4JWTA 5LQJA 1Y48E 4C0BA 1M7GA 4Q12A 1II8B 4ZIRB 1HURA 2BR4A 2C2WA 5JADA 1W2HA 2SKEA 3Q7IA 3MMSA 4HYYA 4LV8B 4U2BA 2LPMA 4MUYA 1XG5A 3LT5A 5CIQA 4M9SA 3MWDB 2ZIVB 2PUEA 1RM5A 3IEXA 1W88A 2CXUA 5JW6A 1Z9BA 2AN1A 1XRJA 2OQIA 2HWWA 3HEAA 4HDSA 4QOEA 3VNRA 4KYUA 2GM4A 4C4SA 1OWOA 2X5KO 1ZVMA 2YVLA 3QLJA 3ZXSA 1D2EA 2R48A 4LNAA 3E7PA 4DQKA 1X1TA 2PUTA 1JLSA 2RDMA 2W5UA 3TRKA 2WNIA 2HT6A 4C76A 1HOTA 3VR5A 4U2KA 1UK9A 3RVQA 2AKAB 1LSJA 3TFOA 4WDRA 3T9CA 1U0HC 4OXIA 4B3DA 2LCQA 1X1QA 4R05A 4Z9AA 1T13A 4MK4A 2R62A 1DWQA 3VVMA 4WBSA 2FG6C 4FYKA 4JEHA 1B1CA 5FD8A 4E7PA 1JR3D 4HWGA 3PPYA 1AD2A 3N53A 1C14A 3G2IA 2VP6A 4TQGA 4O4LB 3ZWOA 1H69A 1ZD1A 1EE9A 1Z16A 3L6BA 4IOMA 4QSMA 5CP8A 2CMKA 3I23A 4BFCA 1T0PA 3EPJA 5AIAA 4XVUA 1JP7A 1AK9A 2IW1A 4AKTA 2IIBA 4GH5A 3PNMA 1FLDA 3OPNA 5B4TA 4LXGA 1BROA 3HNRA 1KZ6A 1AVTA 3BFXA 4NWIA 3I6MA 4X54A 3ZD6A 2E55A 1JFVA 1RRKA 1VJGA 2BFAA 3FSRA 2OD2A 5KQLA 4LMRA 1E0AA 3NM5A 3FBTA 2OT3B 3D3KA 3ND9A 4CF7A 5ELXA 1DKMA 2Z3WA 4JLBA 2W2VA 2WFLA 1MB3A 3JQ7A 4J0EA 4L5YA 3U37A 1K68A 2XVYA 4C2TA 5J4KA 3ML1A 1MAAA 2XZLA 1UDXA 2J6BA 4TWAA 3OLXA 3FOEC 4XQEA 2NZ8A 2EJTA 2G07A 1SCJA 2XVMA 4KV9A 1AOXA 1X9HA 4LWQA 2W6MA 3INGA 2DPYA 4FD2A 4FNAA 3LA8A 1UUFA 2BGRA 1HETA 1HQCA 4KO8A 5AKXA 2AF4C 2ZRKA 3T0FA 3INYA 4EZIA 3HCAA 1AX9A 1TNDA 2QTCA 1A7JA 2CFCA 2H1SA 3PBKA 1DBSA 1QQ7A 3H11B 3U7QA 2UYHA 4ZZ2A 5DBHX 2OOSA 2PUFA 1G2OA 3F7NA 4PYQA 3ROTA 4RV5A 3ESAA 1XIVA 4EI9A 1KFCB 2Z09A 3C6YA 2JZOA 4OMFG 2DQ4A 2WYVA 1G19A 1HDGO 3HDVA 3KXIA 4E5KA 5JASA 3BYZA 5EMLA 1QTRA 2DTEA 2PS0A 3NFYA 2GXAA 10MHA 1UDWA 3TD9A 3TMKA 5L95A 5J2UB 1P0IA 1QFMA 5HGJA 1QB8A 4TZ0A 1EVJA 1V71A 2FI1A 621PA 2XNHA 1BE8A 7GPBA 4FGJA 4S0ZA 1SA0A 2A5DA 4YNBA 4HVAA 3U7EB 3KYJB 4B8ZA 2XKAA 4YJHB 1E99A 4C03A 2PXCA 3EPPA 2HCJB 5DTMA 3EBOA 4ZD6A 3V8RA 4CM8B 4GEKA 3HKDA 1JA9A 4MVJF 5HFJA 3S68A 4LJ7A 5CDFE 5KIAA 3DM9B 2NO0A 5G0UA 2EARA 2ZB8A 3PGVA 3X1YA 3QP9A 1NATA 1J5XA 3MWGA 4K88A 2QVZX 1D2NA 1EBFA 1NKVA 3KBBA 4G0OA 4QSHA 2VJAA 4RXMA 1BVHA 3WOHA 4YPOA 2HTFA 4NMMA 3ZW9A 1NQOA 4BEJA 1WW8A 2Z5LA 3H2IA 4G9BA 2DFDA 3NRBA 5BN3A 2PMDA 4JJ7A 4DRYA 3GEPA 5JRDS 5CFQA 3CMMA 1GG9A 2C3OA 4M88A 2ZVQX 3FNQA 4GD3Q 4CYMA 2HFKA 3AZOA 3UC5A 4TX1A 1UOQA 4N7RA 5LCXA 3FDJA 1F48A 1RI2A 1S2MA 4R54A 4U2GA 2Q5FA 4C78A 5JOQA 2HJGA 3FDXA 4PC3A 2P11A 3H1TA 3I5XA 3EA0A 1A1SA 1PDWA 2VHQA 5C5DA 1Z2PX 3W4JA 5EHNA 2P5TB 3FWZA 3F6YA 3IAM1 5E6RA 2FZGA 2PIAA 4TXLA 4FR5A 1AU9A 2B2NA 2QUIA 2YL2A 3A7DA 4OYYA 2ZUWA 4OJKA 1P81A 1IN1A 3L6CA 3AHEA 1KSJA 1WA5A 4IY1A 3K0HA 4ND6A 5CIYA 1CZHA 1NRXA 2B78A 3AP2A 4QFMA 4WDQA 3CS3A 5A3SA 3JQRA 5DNYB 1U63A 1AS0A 3CX3A 1O54A 1CJMA 4YHHB 5TS3A 3OOSA 3VBEA 3DE0X 3RS9A 4YEDA 4ETWA 1FLVA 4ISBA 5J1SB 3L79A 3NXKA 4BU1A 4A26A 5KVSA 3TLAA 1M74A 4TS1A 1DRVA 4YP1A 4YXFA 1MO5A 1XCLA 3REOA 4TTIA 1KSHA 1AJEA 4CQNA 2X14A 3OMLA 1E1RA 3QU7A 4FK8A 1X7XB 4LE2A 4HVCA 2UUBB 4QJ5A 2NYUA 3NBXX 1G3QA 4AW9A 4DSOA 1CYEA 1O4VA 4N8EA 4ZDIA 3LNCA 3VOSA 2H5JA 1F6WA 4MV5A 1YXMA 5EJMA 3CLVA 5L8VA 1EZZA 2ZVDA 4E70A 1KOLA 1MVLA 1JDSA 5IK2A 2G9NA 1XTJA 4RVHA 4JI7B 3KR0A 3NOVA 4RZIA 3NIGB 5E9JA 2QRLA 2HX1A 3QXCA 5G40A 5AXDA 3W3AD 4DV4B 3TR5A 3VSCA 5JVDF 1ZM3A 2EF1A 2GNAA 4RKQA 3SYMA 3UEOA 1QPZA 4OB8A 4A0FA 3MGKA 2Y71A 4N0PA 1OX4B 4BLTA 1YZTA 4KK3A 4FWTA 4TLCA 1A5BB 5EJ5A 3RABA 3SVLA 2R6DA 3KSMA 2VRNA 4GOLD 4NU5A 2XB9A 4Y1GA 3HCNA 4D9KA 1NG1A 2GFIA 3I53A 1SUFA 5CLGA 4D8VA 7ADHA 1OLXA 2VBCA 3IVRA 3JZDA 1NU8A 5HZKA 4B44A 4PU0A 3RC2A 1USGA 1LJ8A 1DG9A 3LZCA 3ICPA 1KKUA 3EWIA 4K87A 2RHOA 4RDXA 4F8YA 2YRXA 1AKYA 1FNCA 3KTAB 1J99A 1E2EA 1TM3E 2PMEA 2O8FA 3O21A 1B2RA 1E1CB 3NHZA 1LFDB 3V7NA 3TO5A 2R4QA 4Y6QA 2OK8A 2R6AA 1GSOA 1MQSA 2YBEA 5EMJA 1RRVA 1ULTA 1R50A 2IY9A 1T8TA 4R7GA 2RE8A 4DSNA 1T2EA 4FZ5A 3P94A 1UQRA 1GPDG 1RLUA 4ARCA 3O6VA 1DIOB 4KB5A 4PG8A 4DF3A 1W35A 5LOVB 3UK6A 2H48A 5EAIA 7MHTA 1TW2A 4HNUA 5LUBA 2FJ0A 2VPQA 4RMIA 1IZ0A 1SOUA 3DB2A 2BMDA 3G2QA 3QJGA 1RLOA 4IJUA 4YRCA 1G98A 2C5EA 3BH7A 4DIEA 4I50A 4Q4HB 3DZKA 1R00A 3LECA 2VZ8A 3UATA 4XIGS 4FFBB 5EJGA 4YXWD 5EJAA 4W7HA 3FWPA 5IBQA 4CNBA 1EDOA 4Q3BA 1MB2A 2RMKA 3GXOA 5DW0A 5IJ9A 3K9QO 3TZEA 4ZYVA 1P75A 2AZMA 4C21A 4RA9B 3AVTA 3V4SA 1YUBA 2G04A 3ZZNA 4AUNA 3UMSA 3K05A 1PNOA 3L46A 2C2BA 2PK3A 4FXPA 1LPNA 4NDAA 1CP2A 2RJ3A 4W5OA 2CLKB 1CZOA 1SUAA 3IS3A 2JBWA 1IJFA 1TM4E 4WN9A 1ACLA 1YAJA 1AN0A 3R0QA 1UPTA 1T0BA 3BBLA 4URUR 1J0EA 4QDKA 4MUAA 4R1TA 1U2DA 1H4TA 1L5WA 3RD5A 3O7MA 3I09A 3ESDA 4OGLA 3VO9A 4AROA 3RU2A 4RKWA 5AJVB 1A9ZA 3MWJA 5GZ1A 1DC5A 3OM0A 1NVVQ 3L05A 1CUHA 1DL5A 5AYVA 1BD3A 3WFZA 1YTLA 4ND4A 4B48A 3I9JA 2YZNA 5HR5A 4M8KA 4MI3A 3REQA 3OG9A 4DLBA 4YT5A 1Z33A 3T5TA 1OIXA 5K7SA 4C7MA 4E6EA 4QEDA 4ZJUA 1UBOS 4UPDA 1ZN2A 2EKQA 3R6DA 4H59A 1UBSB 4P38A 3I8XA 4JBWA 1CY8A 2FZVA 4O1HA 1IVYA 1REQA 4TXMA 5IDQA 2XB2A 1POWA 2ZRJA 4RS4A 2Z95A 4ARUA 5ICGA 1W87A 4UTOA 2OKCA 1XNJA 1T36B 2OVFA 4OQLA 3KIPA 1ZQ1A 3H3XA 4E22A 5BNFA 2DUMA 1F4VA 2Y68A 3KZOA 3LVFO 1ZP6A 3MGGA 3UM9A 5FPKA 2A86A 2FPPA 5HIAA 1N9GA 3NM4A 4H6XA 4LSWA 4KGDA 4JX9A 2PX5A 5IKOA 4BMXA 4BQEA 4JP1A 3UMVA 2FP3A 1Z2CA 3UO8B 1FVOA 3HB7A 4J29A 2PUAA 1S4QA 5J4HA 2WHPB 1BJKA 1JHQA 3ODPA 4JSRA 4BJ6A 4QVIA 1UZLA 1KYIA 2NTJA 4NVRA 1KEWA 2BGIA 3INRA 3W6OA 4BAGA 1DLJA 1S2OA 3IXLA 3KHTA 3S8YA 1YVPA 2MYPA 2FETA 3NEPX 3RS3A 3WLTA 4ND5A 3TDNA 5ALLA 2HQRA 2HZ7A 2XT6A 2ZS8A 5F2NA 2EKZA 1NLYA 1EQUA 1EVYA 4RLHA 4UD2A 5KJCA 1ZICA 5KOYA 5A4JA 2QV0A 3AQIA 5AD1A 4LVNA 3Q1KA 3PUZA 2HRBA 5EE3A 5GZ6A 3GX1A 4UBLA 5JYDA 2NACA 4PQGA 1A2QA 7ABPA 1TCUA 2A5GA 3C24A 2Q6IA 3KZCA 3UJ3X 1R4AA 3WRYC 4ZCQA 4A7PA 4QAQA 4B84A 3AR6A 4DE5A 2A5YB 3SAJA 3D5EA 1YJBA 4G0MA 4HWPA 1XHLA 2VJOA 3ER6A 3CPHA 3FPGA 3OM1A 3F4LA 3CUYA 1RRGA 1SOWA 1QKJA 3EDYA 3JQDA 3BH6A 4EVRA 4OH1A 3F90A 3ZNQA 4YUAA 1DQYA 1LH0A 4GLFA 1HBJA 2BRUA 1XZEA 2OM6A 3BM5A 3DZGA 1N2OA 1A5AB 3GD5A 2Q0SA 1VGQA 3IEUA 2P9HA 3NAZA 5SY9A 4NBVA 1T1RA 1M8JA 5BR1A 3RG8A 1CUWA 4LFCB 5DBFA 2QE6A 2OBNA 4Q82A 4EPXA 5EINA 3AM1A 5BXYA 3ONNA 3TNLA 3DUWA 1TZCA 4RTNA 1HM5A 1Z4LA 2EX4A 2PZFA 1E9RA 4BX2A 1NI4B 2AE1A 2HI0A 3FRJA 2AOTA 4D02A 3JQGB 4CLRA 3EUWA 1N2CE 2GBLA 3LUAA 5FFMA 2A9PA 2Y1XA 5CK4A 5I3CA 2P6RA 3HM2A 1JNXX 2LRHA 4E32A 5I9MA 4RXUA 5LP6C 1SIWA 1TVEA 1CHNA 3CRZA 4K1XA 4Z4IA 5EP1A 2AK2A 1U2SA 3P19A 4N3CA 4WFIA 3KYCA 2VJYA 4FN5A 1SCDA 1ZKMA 1ZHHA 4RF3A 5GJCA 5H4HA 4ALNA 3NHJA 1C8BA 4NCIA 2IV7A 1YA8A 1C3VA 5JDIC 2O5EA 3B5IA 3ND6A 4HZIA 1AC5A 1OGIA 2BFFB 1Y5LA 4QU9A 4QUHA 4IXWA 4MICA 3QRWA 4NRDA 5ILQA 2XCTB 4IGFA 1IEQA 1OBOA 5HM6A 5I7VA 2IIPA 1ZLXA 5AJUA 4D42A 1ZLYA 4P4TA 4DNXA 2G17A 3ROZA 1X92A 2C4KA 2VK4A 3ASYA 4JI8B 3EFOB 4D8YA 2ZYSA 1U2QA 2NUPA 3O9ZA 4L0CA 5A05A 1P7VA 2I5PO 1JE0A 3E1GA 1NSTA 2QRQA 3N05A 3OFKA 3ITKA 3SZLA 4C29A 1TU4A 1YQ9A 4KUEA 4BPRA 4BWVA 1U9IC 3C3BA 4V0QA 2WJZB 1DPFA 1GTG1 1ZNYA 2YN4A 3B3JA 4GPZA 4M4SA 4P34A 4GXTA 3THSA 3ZWPA 4E2XA 4F85A 2P4EA 5KTMA 3R6GA 1B6SA 1E0DA 1N1DA 2K87A 1UC4B 4JUIA 4O02B 1O8BA 1BE1A 1ADFA 3P9CA 3RUDA 4Z0TA 5JD5A 2F3PA 1XXHA 4B8WA 1MXFA 2Q4EA 1DFIA 4Q93A 5EUCA 4OQYA 1HTTA 1NYLA 2Y1OA 3E9CA 2YC2C 3ZGXA 2IGBA 2JFUA 3DZBA 4MKHA 3ETLA 3OE4A 1ECLA 2CZQA 1MA3A 1ZJJA 2ZIAA 1UZMA 3QHPA 4MXDA 1NSFA 5F76A 5HK9A 2YWBA 3COPA 5KAMA 5JNLA 3U61B 4QA9A 3T7IA 3GFSA 2UKDA 4YP5A 3H1BA 5CPFA 5KWIA 1G1MA 1Z36A 2PRYA 3OAAA 2VXBA 3AM4A 4EGSA 5BSWA 4QVKA 4LW8A 1CZNA 2Z2XA 3O84A 4XWYA 2WOOA 2AF3C 3JQAD 3UK1A 4A8HA 3HP7A 5LZ8A 5TMEA 3L8YA 4OP3A 5EWMA 1JHYA 1L5RA 3DQZA 4NBLA 3R8FA 4X45A 2Y0DA 4JT8A 3VR3D 4D98A 1PTJA 2QD3A 2V96A 5HIKA 4Q0MA 4YDHB 1CUFA 5JAIA 3G82C 2FB9A 1VRVA 1L7MA 2GCNA 4MTLA 3YASA 4WZAE 4ZZ1A 1HNXB 3WZMA 3QLVC 1U0EA 3TSWA 1AKEA 5JV5A 5IAKA 3ABRB 4V0MA 4CFYA 1WDLA 2OSVA 1FSGA 2E4UA 3GLUA 4AO6A 4Y9RA 4UZEA 1X3SA 5LD2B 4GEGA 1WW3A 1YB1A 5MFPA 3ZQJA 4Q4CA 2VL7A 1W85A 4CMIB 3EK2A 1B3RA 1WPGA 1T9KA 4IIEA 4UBOA 1ZAKA 5KHOC 2XD4A 3SIPA 1QLJA 1GNSA 1RYMA 2W6QA 2F2TA 4AY3A 4EI2A 1BFKA 3QHQA 3IPXA 1U1FA 1M5RA 4X24A 2C29D 1ORTA 3GJQA 4DLYA 1PJ8A 2WD9A 2CC2A 3U49A 1JDTA 3OLCX 2EGUA 1EQ2A 5JZSA 4AMBA 1HDCA 2PT9A 4Q4LA 1C1XA 1F0KA 4FP9A 4U6QA 3IP5A 4LZPA 3NMUF 4PS0A 4PCLA 3K0FB 2F3QA 2JAOA 3TN7A 3THWB 1XVIA 2FHPA 4C6HA 2A0KA 2ZSFA 1RWXA 4Z4EA 3F3KA 3F98A 5A6SA 1YZLA 3ZJYA 1E6KA 4QHTA 2GHIA 3RS8A 3IEPA 4DQ0A 3ZVNA 4LI3X 4FPXA 5DYYA 3FFTA 5LQDA 2KB0A 1ZRSA 3S29A 4W1QA 2C92A 4JLJA 2IZ0A 4PGHA 3UAZA 4ON9A 5C31A 2R60A 1QH8B 2P9JA 3GCWA 3PZBA 4RD4A 4TWZA 2HIHA 2ARKA 1YI0A 4MV8A 2P7IA 3C8HA 4PC6A 4QX6A 1AF7A 5TR9A 3T94A 4LF8B 4LHSA 1WSDA 5BV7A 1N5IA 4GBED 1Q95A 1YSCA 2Q3LA 3PTAA 1EMDA 3GMIA 4GKBA 1G291 1RHJA 1XZLA 1XD9A 3A6LA 2O1SA 2COEA 2HQSA 521PA 3FVQA 3H8SA 2ZRLA 4D9CA 1PZHA 4NC9A 1HDIA 3LMKA 4GM0A 4TRRA 2P6MA 3ELDA 2QPOA 2P65A 1U9CA 4Q3LA 3AJAA 3SG0A 5G4LA 3UGKA 1UBTS 3HBFA 4INPA 4OJTA 1G21B 5TPZD 4GOOD 4LJLA 3SXPA 3U81A 5JZMA 2IQIA 2BEUB 1L4MA 2DFLA 1MG0A 4LKOA 4F4HA 4DGSA 3UJ8A 2H1OA 1Y8AA 4F72A 2MIIA 4EITA 4XB1A 3ANLA 4D7AA 4JB3A 2IZ1A 1ADJA 4FFOA 5BT9A 3C3EA 4B3BA 4BMZA 2Q1YA 5FTLA 2ZJYA 1DMRA 3TLYA 2CXRA 2W83A 1G5FA 1QYWA 3V8MA 3FI9A 2E87A 1ORDA 2REQB 1SC3A 3S70A 2IOQA 5U4QA 1U0FA