1SB8A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
341
Chain Sequence
MMSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
molecule keywords wbpP
total genus 127
structure length 341
sequence length 341
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb8A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb8A02
5BR7A 5T5QA 1YBMA 1K5HA 4M1QA 5I8ZA 1YJ8A 1OBFO 3KLPX 2G76A 3SEFA 1T24A 2NADA 4XQCA 1PR9A 4WPGA 3FWNA 3NKLA 2YHIA 4KMSA 2NSDA 2WEKA 2PKQP 1DIAA 1XYGA 5JDCC 3C7DB 3RC1A 3WYEA 5K9ZA 2AEMA 1T2FA 4RVHA 1BVUA 1EBFA 4MVJF 4NU5A 4XD2A 3T7EA 3ZU2A 2D1YA 3FPCA 2C07A 3FI9A 3HUDA 5ILOA 1C1XB 1YL5A 3IOYA 3MJVA 4AJKA 5KVVA 1Z74A 4FGWA 5IDWA 1PL7A 1U8FO 1XGKA 2Q1TA 3MEQA 3OJFA 4YA6A 1E6UA 1SAYA 2GPTA 3OQBA 4IIUA 4AJHA 2X4GA 3Q2IA 4J7CA 2X23A 1R37A 4KQWA 3STHA 1IB6A 3AJRA 5F5NA 3GFBA 1HLPA 1LLDA 3AUAA 2JFGA 1ULUA 4L76A 3OIDA 4O5OA 2A35A 2DM6A 1GAEO 4OGWA 3WGOA 5BSHA 1FDVA 1IZ0A 2C2YA 4XJSA 5CEEA 4OSOA 4AFNA 3ZH2A 2BFPA 4DGSA 1R4MA 1QRRA 2ZTLA 4IMRA 3GHHA 3DHYA 2H5LA 1AE1A 1VM6A 1W8DA 4MDHA 2Y67A 1EZ4A 1MLDA 1MFZA 3JCZA 1FDSA 1OI7A 1UZLA 4FOOA 4IXWA 5FFFA 1ZSNA 1PU2A 1KOLA 3TZHA 3ST7A 1YQDA 4CV1A 1KVTA 4INAA 1HEUA 3AFMA 3JD3A 3VDQA 5ADHA 1V3UA 2BRUA 4E2XA 4E31A 1RKXA 4FIZA 2O2YA 3TZQA 1TA4A 1E5QA 3F1LA 3BHJA 2VOEA 3TQHA 3U4DA 4EZBA 2PA3A 2JD1A 3HE3A 3JQDA 3NT5A 3ROPA 5I7SA 2RH8A 1BHSA 2PD4A 2JCYA 4WUVA 3JD2A 2E4AA 4GWKA 1DBVO 1XSEA 4WCFA 2Y0DA 2Z95A 4NBVA 4FBGA 1FJHA 1SOWA 4XYMA 1LRJA 3H6KA 2UV8A 2VCYA 1X7DA 2FR1A 1Y7TA 2FMUA 4JBGA 4RO0A 4R5HA 2VHVA 3KEOA 3FNGA 3O8QB 3PYLA 3MJCA 3P5SA 3LLVA 2JJYA 1VL8A 3ZI0A 1IPFA 4MVJP 2QZZA 1ZIDA 1N9GB 2PK3A 5A9TA 4FDAA 5L7YA 4FC6A 4RDHA 1D7OA 2QRJA 2P9GA 2YV3A 3NT4A 3PHIA 3I4FA 2PZLA 3GF4A 4PLGA 3U62A 2NNLD 1NPYA 4O0LA 4RVDA 5DP1A 2Z1MA 2P2SA 2O3UA 2EKPA 1BRMA 3ZHXA 5K6AC 5DNAA 5TF4A 4NHEA 5JY6A 1KEPA 4Z3KA 3TSCA 1Q0QA 4CQLA 3DO5A 5DULA 4J0EA 1LDGA 1KY4A 4LMRA 5COQA 5G4KA 3WLEA 1YB1A 4AJ2A 5BNFA 5AYVA 4D46A 2GDZA 1DAOA 3QIVA 2ZTMA 4CQMB 3H5AA 3ZV5A 2PD3A 4CM9D 4HFNA 1W0CA 2PTGA 1U2DA 1ZBQA 1UR5A 4DIBA 2OOSA 5KJ6A 2JAPA 1PJ2A 3DL2A 4CM6A 1NFRA 2C0CA 1E7RA 3FCOA 3F3SA 4HNGA 2CD9A 3P2YA 2IE0A 1TXGA 3JQ7B 1NYTA 4L9RA 4WECA 3IP1A 3H9UA 4N5LA 1DLJA 1DPGA 1VPDA 1GUZA 2D2IA 4CM5A 4WCFC 3WS7A 3WXBA 2V6FA 1VJ1A 1Q0HA 4X54A 4XIYA 3AUUA 4YT8A 1EQ2A 3TL3A 2AQ8A 1C0IA 3ANMA 4TRNA 4ZQHA 4E3ZA 3ZU4A 3Q0EA 1JKJA 5EIOA 1PGJA 3QY9A 1ONPA 4CM8A 3EC7A 1BW9B 3OA2A 1PJ3A 1LC3A 4GSKA 3QJ5A 3ROQA 5F1PA 1BXGA 3UN1A 3RFXA 1U5AA 5JPIA 3S1LA 2PZJA 4CV2A 4TRRA 2BGMA 3QLJA 1J5PA 2VZ8A 1HSZA 4NZ9A 3PLNA 4I8XA 1B8UA 3ZWWA 5CP8A 5COAA 4IDCA 2PR2A 4RVGA 2NQ8A 2F1KA 3WTBA 4A7PA 2P91A 1DJNA 4P22A 3NTQA 1EVJA 4JROA 4LISA 2DTDA 1C1DA 4LCEA 5MDHA 4UAGA 4ITUA 5J23A 2WD7B 4W99A 1A71A 3WFJA 2FSSA 1DIBA 5A3JA 3RQSA 5A9RA 4TVOA 1ZK0A 2J3JA 3E9NA 1N8KA 1X15A 1E1NA 4BMSA 2VZ9A 5JAIA 4BQPA 4WEOA 3GFGA 4CLHA 1DIRA 1CRWG 3DR3A 4S1VA 3KLMX 1E1KA 2E37A 4XKJA 1R0LA 3UUWA 4J6FA 1YOVA 4FC7A 3DOCA 2W2KA 4WCDA 5IAAA 3LF2A 3GDFA 3AY7A 3DONA 4HX5A 4BKUA 4RF4A 1WLYA 4XQ9A 3GNQA 5BSEA 5IXYA 3KYCB 2O3QA 2Q4BA 4DLAA 4L73A 1CQIA 1DSSG 2DU8A 2IYOA 3NDRA 4W9NC 1OMOA 4U5QA 1KEWA 3D7LA 3NX4A 1A72A 1RM4A 3PYXA 3P7MA 4YJHB 1NX6A 3WR5A 1E7WA 2BH9A 4TKLA 3SC6A 3OJEA 3MCVA 4B4UA 1H6DA 4YB8A 4J1QA 1VI2A 3E5MA 3COSA 1LLUA 4E32A 4PLCA 3FNEA 4BO1A 4CMKA 1GADO 4UUNA 1YS4A 2B36A 3PQDA 1YQGA 5C3MA 5KJCA 2FHSA 4MKXA 2B37A 1I24A 2WD8A 1E3WB 3VHRA 1H9BA 1DC6A 5DCYA 1F0YA 4CV0A 1F12A 1M67A 3RUDA 3TN7A 1YVEI 3GQVA 1Y8RA 4R9RA 4GGPA 1IHYA 4RPGA 4EUEA 1E0DA 1QYXA 1GZ4A 3BHMA 5CDGA 1TT5B 2P68A 2IEBA 1TT7A 2CDAA 3LU1A 5KVCA 5AXBA 2Y1DA 2IRWA 3IJRA 3OEWA 1R0KA 4E5MA 1E7YA 3RU9A 3WBBA 2B4RO 3WGHA 4HNHA 4IGFA 1ZJZA 1E3WA 3PQEA 5G0UA 3ICCA 1HYEA 1KEVA 4MIEA 3AK4A 1ZSYA 3AFNA 5JCJA 4TKMA 5TT0A 1VSVA 2OBYA 1PS8A 1K2WA 2RHRA 4HADA 4XGIA 4OSPA 4JLWA 3F1KA 2WMDA 4TWRA 3AI2A 1GUFA 3PDJA 2PFGA 4NBWA 4J9UE 2I66A 4O1MA 4E6PA 2CDBA 3RU7A 2W2LA 1YB5A 2GN9A 1A4UA 4CM7A 4IINA 3O26A 3OSUA 1ISIA 1LDYA 2GERA 3RI3A 1ZMTA 3KBOA 4I5GA 1ZO8A 2OGUA 3PYMA 2WE7A 1O6ZA 1WMBA 5JXWA 4MKZA 3PWSA 3KYDB 4CMIA 4D45A 3W1VA 1YRLA 3PWZA 4S3MA 2EHDA 2HJSA 4KZPA 3WICA 3H9GA 3PPIA 4YJFB 1T2EA 2O50A 3AWDA 2EW8A 4E33A 2UDPA 3AU9A 2X8LA 4M54A 2AHRA 2JCVA 3L77A 4PRLA 3G0OA 1NP3A 3KUXA 5A02A 4DXHA 1Z82A 4LMPA 3TJRA 4D3DA 2P9EA 3WQQA 1C1XA 1HTBA 4BGVA 4ND2A 1LRKA 2R00A 4D3FA 1GYRA 1X1EA 2VYVD 4YJHA 1Q7GA 4CM9A 5A5EA 4W7HA 5L45A 4QSMA 1HZZA 4NH4A 1PQUA 5CDTA 1EFKA 3WIEA 5JCJD 1EQUA 5JMPA 2YHIB 1HKUA 1E77A 4MP8A 1IY8A 3GAFA 2X0RA 3WOHA 2PZKA 1LDEA 3RWBA 1VC2A 3ZV4A 4OH1A 1NVMB 4NI5A 4ONEA 2BHLA 3RKRA 3W8EA 3OICA 1ISFA 1LLQA 1MB4A 2XXBA 4WLNA 5F1OA 3A4VA 5F21A 4YJGB 4II2A 1KVUA 3C1TA 3F4BA 3ANNA 1L1FA 4OM8A 4GWGA 4BNWA 2D59A 4OXYA 4IQ0A 1KC1A 5ER6A 3PZBA 5EPOA 4PFJA 4BVAA 4YYZA 4XDZA 4OOEA 2HMVA 1NFFA 3H9JA 5KVQA 2A94A 2OP0A 2RHCA 4AICA 2Z5LA 2V6BA 4CMJA 4P38A 1O95A 2EF1A 2ZB7A 2Y93A 3JYNA 1BXGB 3PFFA 4JCOA 4ND4A 5JYDA 2X7HA 4FOSA 4FFLA 5BT9A 2WYWA 4II3A 4MIOA 4BIIA 3PRJA 3U49A 1U3WA 3KXDA 5CFZA 1BW9A 3Q11A 1ZNQO 5BQFA 4GVXA 3UF0A 1M76A 5IN5A 2B0JA 3W6ZA 4O6VA 3T7CA 3WWZA 3WYBA 3DBRB 4ND5A 1FF9A 4B7UA 3O03A 1AXGA 1GCOA 3E82A 3ADOA 1DJQA 3BYZA 1PL8A 2J6IA 1U3UA 3V2UA 2LDXA 3L9WA 4NBUA 4XX0A 4A27A 3JSAA 4YQZA 1G0NA 2EIHA 1YDEA 3JQBC 2ZATA 4CMCA 3FNHA 2P9CA 3H9QA 4CM4B 1U9JA 4PLFA 5ICSA 4UVEA 4TSKA 1NQTA 4PG7A 3VZRA 3UW3A 2J5RA 3GZNA 4CQMD 2DUUA 4E5NA 3GN2A 1GEEA 4GLLA 4L74A 3L6EA 2O48X 3PTZA 3ZNOA 2HDHA 4OKIA 5L51A 2BGKA 4JJFA 2E48A 4YACA 4YR9A 3VAZA 1X13A 4E5KA 1JVBA 2VWGA 2PZMA 4KTTE 4BO6A 1B15A 5HRUA 4FQ8A 1YB4A 3C85A 3KM0A 3W4KA 3KO8A 1ENZA 4J1NA 4OL9A 4H3VA 4NJMA 1Y8RB 2J5QA 3E48A 4TZKA 1CQJA 1F8GA 3DBLB 4PLTA 4BO4A 3U0BA 1G0OA 3IKVA 1WP4A 4P8RA 3M1AA 4HXYA 4QXMA 1AGNA 1CWUA 2PKRA 5G0TA 3PFWO 2Y99A 4RVUA 3B6ZA 4JGBA 2DPHA 4FCCA 5IN4A 1E7MA 5L95A 2C7VA 4KDFA 1HE2A 5DN9A 4Q3AA 4RPLA 4I9HA 2ZCVA 1OFGA 3F5SA 4MVJG 1O89A 2QQ5A 3KEQA 1T4BA 4DWVA 4E5PA 4WE3A 2IZ0A 4TMFA 4GLOA 1I30A 2GSDA 2I67A 3RUCA 1BWSA 2HLPA 3JQAD 3NGXA 2J3HA 1HF3A 4IXTA 2R00C 4J7UA 3INRA 4XGNA 4DQUA 4GMGA 4OAQA 1LTHR 4E13A 1D4FA 4L4SA 5JMWA 3PHLA 1N1GA 3VZQA 1XU9A 3MJEA 3PHHA 5T6BA 3SXPA 2YDXA 3VOSA 4BO0A 1B8PA 1HT0A 2C59A 1GTMA 4WOJA 2OMEA 5FYDA 4FFNA 2HK8A 3I1JA 3QVWA 5JO9A 3UKOA 2C5EA 5JAZA 4B4OA 4PG4A 3VH1A 4DA9A 1F14A 4NBRA 5HS4A 3FR8A 3IC5A 4JIGA 3K73O 4YAKA 2J8ZA 4KUEA 1I5RA 3W8DA 1ZK4A 1ISMA 4NK4A 3VKVA 1U7HA 4J9VA 1ZSVA 3WNQA 4CM3A 4CM1A 3EVNA 2UVDA 2OP1A 4XDYA 2JKVA 3WGIA 5U9CA 2C7GA 2YFHA 5HTOA 1R0SA 3ZN2A 5JS6A 4GKBA 3C24A 3F6YA 4P4GA 3RBVA 5AQ1A 3EHEA 5KJ1A 2NVWA 2IXBA 2C5AA 4Q3DA 5GZ6A 2W2LD 2ZK7A 5GZ1A 2DAPA 1YWGO 1VRWA 4F6CA 3B1JA 3RASA 2TMDA 2VWHA 3F47A 1VL6A 1P1FA 1YL6A 1SEVA 2JFHA 3NJ4A 1P1IA 2GNAA 3PHJA 3OJ0A 1Y81A 3QRWA 5JC1A 5KOIA 1D3AA 1CEQA 3WSWA 3FF4A 4BQRA 5IG2A 4GX2A 4D79A 4NPCA 1M75A 5L4SA 4A10A 4OO3A 3TRIA 5L7WA 1EVZA 2HK9A 2ZJ1A 2W2KB 4MPDA 4YRAA 1ENPA 2FOIA 1Q1NA 5TT1A 1YXMA 3LLSA 3MZ0A 3WSVA 2Q45A 1ADGA 2D0IA 4R3NA 4WLUA 5T57A 5LDGA 3FWZA 4EEZA 1IOLA 5KIAA 4M89A 4ZRNA 4R01A 3HJAA 5AOVA 4KDEA 4N54A 1CERA 3HHPA 4NFSA 4Y6SA 4BNHA 4IDGA 3H8VA 3QVXA 4ZD6A 2JHGA 2XAAA 1C1DB 3EUWA 4XGKA 3GLQA 1GFSA 4DIOA 3MWDB 3FD8A 3CMCO 3SLKA 3ZWBA 4PZCA 1I0ZA 1S6YA 1D8AA 2HU2A 2OHXA 1R16A 3DFUA 3GVHA 3K5PA 3DB2A 4KQXA 4RPKA 3WGYA 4Z6KA 1I2CA 1XWFA 5IZCC 4J2HA 3A1NA 2FPIA 1GU7A 1B2LA 5F3RA 4BNYA 1PEDA 2WWRA 1N7HA 3L0DA 2O4UX 2Q49A 1EK6A 4IJKA 2ZB8A 4A2CA 2CMDA 4GSLA 2E82A 1YGYA 3GOHA 3D4OA 3GMSA 3BHIA 3NUGA 5AXDA 2BFOA 4NU6A 2WSBA 1GV1A 4B7XA 3D0OA 1TLTA 3D5QA 3KRTA 2VYNA 2Z1NA 3ZU3A 3JYPA 3IL2A 3C7CB 1M6WA 1P1HA 4ND1A 1D1SA 1ENOA 4ZN6A 3WGGA 1QYCA 2NUAA 4EDFA 2JAHA 3LQFA 4AVYA 1Y8QB 2ZTVA 3PGXA 3QV1A 3S55A 4FR5A 3WMXA 4CLDA 4DTIA 1QP8A 3QWHA 1H5QA 2Q1WA 3D4PA 3LT1A 3WIDA 2HAEA 3H5RA 4YT5A 4CODB 4QTZA 4I5FA 3QSGA 4JBIA 4XYBA 1NAHA 1ZH8A 2AA3A 3QVTA 1X1TA 5DBGA 1EUZA 1ISGA 4HFJA 4EUHA 4PG5A 1TB4A 1QR6A 1NVTA 3VVBA 1W73A 1BDMA 1YONA 4YBZA 3X2EA 2EJWA 1R66A 3DEYX 1BG6A 3JQ7A 2HCTA 1LI4A 2DC1A 3ABIA 3O9ZA 3QWFA 4NG5A 4ZJUA 3Q6IA 5LC1A 4A26A 5AXAA 4XYLA 5A9SB 5CDSA 1A4IA 1IL0A 1QXSA 4N5NA 1N9GA 3DWFA 1AHHA 1SB9A 1FDWA 3WFIA 2FWMX 4AL4A 3HDQA 3ZHYA 3NDIA 4J49A 4KUHA 2FP4A 2O3RA 5FI5A 3V1TC 3BA1A 4RLSA 4NR0A 4XR9A 2D5CA 1TEHA 4L8VA 5ENVA 2D8AA 4ALNA 4U7WA 1D1TA 4JP3A 2NU9A 1XQ1A 3H5NA 2NU8A 4I1IA 1LDNA 4O63O 3ITKA 2YDYA 1ISHA 3SJUA 4JN6B 3GVCA 3GVIA 2HSDA 4FFPA 4MVJH 1U3VA 1DRUA 1PZGA 2HKIA 5KJFA 3F46A 3LT0A 4E2YA 1HYGA 4D0SA 1QYWA 4IZHA 2EP5A 1R4MB 2JL1A 3MOGA 4DC0A 4BNVA 4RGBA 3ZWCA 3NTOA 4J7XA 5DT9A 3ZGYA 3E6AA 1R15A 3RVDA 3BAZA 1BGVA 2GO1A 4BGUA 1H2HA 2I6TA 3JQ8B 3ENKA 1KEUA 4D44A 1Q0LA 1GQQA 1ZKMA 4K6CA 2JCXA 1E3IA 5JC8A 1V0JA 4TRMA 4XR4A 3DBRA 3BIOA 3V1YA 2BKAA 5DOZA 4BO9A 1YQXA 1UXKA 2GYYA 1P0CA 2HMWA 4WKGA 4AJEA 4YT4A 1DO8A 2CNBA 1PJ4A 2G1UA 3EDMA 2W4QA 3KSDO 4HY3A 3UVEA 1NVGA 4ALKA 1PZFA 1C0KA 3EVTA 3E18A 1XG5A 5KTKA 1KVQA 2Y1OA 1L7EA 3GDGA 3JQ9C 2UUPA 3OA0A 3PHGA 1DFHA 3TOXA 4CMBA 2B5VA 2ZCUA 2Q4EA 5GMOA 5I7VA 5JAMA 1KETA 1RJWA 3B70A 3W6UA 5EERA 3BMCB 5K0ZA 1Z7EA 1QYDA 4Z0HO 3FRJA 5FEUA 4CR7A 3IAHA 1DC4A 3DBVO 3HFGA 1UP7A 1A27A 2GASA 4OXNA 3DAGA 2GZ3A 3H2ZA 1SNYA 3BXXA 4H15A 1J4AA 1GR0A 3AI3A 1H6AA 2VZ0A 3FNFA 1KC3A 1MXFA 5T8KA 1DRWA 4DRYA 3PLRA 3JYLA 2ZTUA 2D4AA 3WLFA 1ZMOA 1DRVA 1P74A 2FZEA 4M49A 5L7TA 2NQTA 4CM4A 1E1MA 3UICA 4WNIA 2B5WA 3RUIA 4AJLA 4FGSA 4BO2A 1I3KA 4OKNA 4R1SA 3VPFA 4EJ6A 3B20A 3QWIA 1CETA 5T64A 3QHAA 1E92A 1J49A 1QORA 4DYVA 3I9MA 3JYOA 3I52A 5FI3A 4RVSA 5LDHA 3JQGA 4QO8A 1K0UA 5HWSA 5DOVA 1VJTA 3F9IA 4ZQFA 3DTYA 4PVCA 1XCBA 4K9DA 2GD1O 3JV7A 3BTVA 3HQ4O 3INTA 5BSGA 4NNJA 2HMSA 5A1TA 4IM7A 3ZU5A 1HDOA 2WD7A 1DHRA 3GVXA 1E1LA 1P0FA 4FFRA 3HG7A 4CLOA 2C2XA 4I5DA 3ZWMA 3GRKA 3IIEA 1BXKA 2VYVA 2ET6A 1HYHA 3EZLA 1K6XA 1E6EA 1LQTA 1TVEA 3PJDA 3RUFA 1BSVA 4YRDA 2Y1FA 2H63A 4U0KA 3EYWA 2PH5A 4Q3EA 2VOJA 8ADHA 2O23A 3CINA 2NV6A 2AXQA 5GY7A 1DC5A 4HWKA 1XIVA 3PJFA 3AM5A 4A5OA 4BNZA 1WDLA 4CLRA 4KOAA 2NU7A 2DTXA 3PIDA 4DQXA 4RZHA 3L6OO 4MIYA 5EL0A 1EUCA 5EQFA 3JD4A 1XR3A 3CE6A 4GAEA 5KKCA 2X86A 1KIFA 4PLVA 4A03A 1B3BA 2B83A 1WVGA 3D4NA 5L4LA 3ROKA 2GR9A 1T1SA 4YQYA 1E6WA 2G17A 4P4LA 1Y5RA 4G65A 2NWQA 3E5RA 1PJCA 4YAGA 4PG8A 1CYDA 3PJEA 1NPDA 1TT5A 1HDXA 3NTRA 4FJ1A 4UUMA 5K6AA 1I3MA 1LBEA 1FDUA 4Z0PA 5HA5A 4XYGA 2VUTA 2EXXA 3FN4A 3PP8A 1I3LA 5JBIA 3JD1A 3I9LA 4D42A 4GPD1 4BNKA 2YW9A 3OETA 5B4UA 4IDEA 3GRPA 1NR7A 4R1NA 4AJNA 1ZK1A 5CPFA 1NHGA 4AJ4A 4YXFA 1A7AA 3KYDA 4FN4A 3WGTA 1UXHA 4RF5A 4CMIB 5I9LA 3OF2A 4EW6A 1B16A 3OH8A 3ITDA 4LVCA 2BLLA 2LDBA 1NASA 1V3VA 3LVFO 4N7RA 4L4XA 3RBZA 5HM8A 1DDOA 5A05A 2Y66A 4C7KA 5L3ZA 3GZ4A 3ZCXA 5JW6A 1U4OA 1GZ3A 4MINA 5DP2A 5F5LA 1BVRA 2WYUA 3RSHA 3ZWNA 2RCYA 3EW7A 2AEFA 4B7CA 4R1TA 4GMFA 1K6IA 1LSUA 2QYTA 1T1RA 3SJ7A 4ESOA 1GPDG 3KOUA 1EBUA 2E49A 4FS3A 4WEQA 1PJBA 4EYEA 3FTPA 3KYCA 1ARZA 2V6MA 1GQYA 4WLFA 5AXCA 1NR1A 5KJEA 2ZB3A 1KVRA 3GK3A 1LNQA 3GG9A 3GY0A 2CFCA 2HJRA 3F5QA 1LSSA 1YKFA 1P77A 1UP6A 2Y1CA 4YJFA 3RJ9A 5L53A 1U28A 2I3AA 2AG8A 4LVUA 4XCVA 3AU8A 3JYQA 5C7IO 3Q9NA 2CUKA 1XKQA 4YDRA 3QWBA 1J0XO 4MP6A 2ZB4A 2ZQYA 4EJMA 3HDHA 3K6JA 2QRLA 4ZICA 1U3TA 3UHAA 1T2DA 1K89A 3HN2A 3C8MA 1GUYA 2YV1A 3DZHA 4BNNA 2F00A 3NT2A 3I5MA 3GPDG 3NDJA 2XPCA 1KERA 3I6QA 3L6DA 5TLSA 2DBZA 1Y9EA 2OUIA 3DXFA 3DMTA 3BMCA 4PGFA 4PLYA 3DBHB 1RM5A 1GPJA 4XB2A 1KY5A 1RPNA 3RC2A 4BO8A 2DVMA 3ENNA 1N1EA 3KSUA 1GL3A 3TOZA 1YE3A 3L9XA 3UAGA 2X1HA 1UZNA 1IYZA 2CZCA 1V35A 3PVZA 2FN7A 3OFSA 3TNLA 4FW8A 2BFMA 4EITA 1QG6A 1PGPA 3PI7A 4A0SA 3LZ6A 5L9AA 4EEXA 4B8ZA 1T2AA 2NM0A 5I7EA 1I2ZA 5JNLA 1UDAA 4Y8VA 3ZWPA 4A73A 1E5LA 3CTMA 3CMMA 4IMPA 1HE4A 1XQ6A 3AY6A 5ILGA 3VPXA 3CZMA 5DCWA 3DFZA 3BTUA 3PJGA 4IY1A 5TJ9A 5THQA 3WJ7A 1HRDA 3VVCA 5I8WA 2VHXA 4Z9YA 1ID1A 4M87A 3U4HA 5KCZA 3Q2KA 1NAIA 2PV7A 2RAFA 1KVSA 1UJMA 3UCEA 3JD0A 4JJIA 4OYRA 4J1TA 4PVDA 5CG1A 4NBTA 1PX0A 1PJLA 1W6UA 2VHYA 3WMWA 3SVTA 4D3SA 1PTJA 2PH3A 2XXJA 3VKUA 3JQEA 5G4KB 1HDZA 5CPBA 4HFMA 3VH2A 3OP4A 3DBHA 1KS9A 5ES3A 3P2OA 1RYEA 5CG2A 4ALIA 4Q3CA 4OOFA 3A14A 1R6DA 3HSKA 2A92A 3ETGA 3K92A 4DMLA 5ITWA 1I32A 4QX6A 4CMAA 3O38A 4RVFA 1P1KA 2O3TA 3ROMA 5I9NA 2QW8A 3OIFA 4KWIA 3GGGA 1R12A 1UXIA 1MG5A 2NVBA 4J2OA 3BMOB 2QZ9A 4BNXA 5JYEA 1ONOA 3IKTA 2NTNA 3PQFA 1LEHA 5TS3A 2CVOA 3GAZA 4PLPA 4XQEA 3H9EO 5TNXA 1ONNA 4GX0A 3ZNPA 3GPIA 5EMHA 4LSMA 2VT2A 2ZYAA 1Z6ZA 2FZWA 1Y1PA 2GF2A 2IODA 4FSHA 1DOHA 3OBBA 2YFQA 1N92A 3JQCA 1WWKA 3LSYA 5TJHA 4CM8B 2I3GA 3QQPA 4KWHA 1UH5A 4HFRA 1ZCJA 4ND3A 1LDBA 3JQBA 4RZIA 3ZWOA 1ZZEA 7ADHA 4B3IA 4E5YA 1RM0A 1HL3A 2EV9A 2QRKA 4J0FA 2C54A 2VT3A 3B1KA 4CUZA 4B8WA 1Y9AA 5ER9A 2BD0A 2UAGA 3GA0A 1GD1O 4URFA 4WCFB 1B26A 1LSOA 1ZW1A 3DQPA 4LCJA 3DBLA 3GUCA 4DYDA 4W6ZA 1QMGA 2YYYA 5DCUA 1BTOA 5JAQA 3KZVA 5TC4A 2VYND 2DBQA 4KTVE 1N7GA 3O4RA 3LC1O 5CEJA 1SBYA 4CL8A 4BGEA 1MGOA 4F6LA 2J5KA 1IZ9A 4ZGWA 5B4VA 3IUPA 1V8BA 2ZJ0A 3RJ5A 3LK7A 4J1SA 2SCUA 1VJ0A 1VKOA 1V9LA 1NXQA 3DHEA 2HRBA 2IYPA 4R5MA 4BO3A 1QSGA 4B4VA 2BF7A 4ILKA 4JXKA 3ASVA 2GN6A 2VNAA 2PD6A 3GGOA 3UH1A 2DUWA 1HE5A 1ML3A 4BMNA 3A28A 1LSJA 4RL6A 3VC7A 1WXDA 3NRCA 3EAGA 3ETEA 4RDIA 2EGGA 4ZQGA 4RQUA 4E21A 1I3NA 1RM3A 2Q2WA 4L0QA 4Q3NA 2B4QA 4RF2A 1P9LA 4IDBA 5DZSA 2QYSA 3RROA 3S8MA 1EVIA 4JK3A 2RBEA 3TFOA 2G82A 3DOJA 2TMGA 3NJ8A 3LF1A 4DLLA 2B69A 3D5TA 4BB6A 4B3HA 1R4NB 1XHLA 4ZHSA 1C3VA 4WJZA 1MP0A 4K1LA 3R3SA 1M6HA 3JTMA 1OC4A 3CEAA 2WYVA 4EUFA 3GT0A 3L07A 3DTTA 1SOVA 3M6IA 3IUSA 1T26A 1JW9B 2NACA 1Y5MA 5BNIA 2YUTA 4UEJA 4J3FA 4Z9XA 3VDRA 5C5IA 2O3SA 3M2PA 3V8BA 2O4CA 1X0VA 2BMAA 4YJDA 3BTSA 1JWAB 1ZUD1 5ICMA 5EQDA 1PGOA 4B4WA 2ZKLA 1SB8A 2A4KA 3R3JA 2HMTA 4YCAA 4JP2A 1EUDA 4YJGA 4ZA2A 2AQKA 1MA0A 4IPTA 4BB5A 1UDCA 4BKPA 2EEZA 4CLXA 4CMEC 4XWYA 2VRBA 1HXHA 1NTOA 4LSWA 4LW8A 2EJVA 4Y6RA 4E2ZA 4BS9A 5TX7A 3TZ6A 1O94A 5JFOA 2I76A 3EY4A 1N2SA 1WZEA 4DPKA 3RFTA 5JDIC 2AE1A 3WJAA 3EMKA 3AUTA 4ALLA 3WWYA 3D64A 3I4CA 2OL4A 3WBFA 1FXSA 3PGJA 4IS3A 5B12A 1A9ZA 1BXZA 3X2FA 4FPXA 1SEPA 3G1TA 1XEAA 4PZDA 1DEHA 3HADA 4QQRA 4QO7A 3GNSA 2WJPA 4D41A 4QFCA 4I9UA 3I9OA 4WLVA 1NHWA 3NYWA 1U5CA 4GGOA 1EE9A 2JD2A 1I33A 4BL5A 4BKOA 1AXEA 3K9QO 4YAIA 5JE8A 4HUJA 5I7FA 2I65A 4W7IA 4FB5A 1E3LA 3WX0A 4WK6A 3V2GA 4EI2A 4CLOB 2Q3EA 4ROSA 4ID9A 2DFVA 1XELA 4W4TA 2H1SA 3DAFA 2X0IA 1Z7BA 3ON5A 5U1PA 4KUGA 3S2EA 3ZW8A 4BNFA 3WDSA 2FPGA 2HRZA 1YDWA 4LRTB 5EN4A 3VTFA 3W4IA 3Q9UA 2W8ZA 2UUOA 1B3RA 3GZNB 3AI1A 4RQTA 4CLRB 4E12A 1O9BA 3G49A 5G0SA 3QA9A 3E9MA 1XLTA 4UVIA 2YV2A 2FR0A 3ZW9A 4DBZA 2O2SA 3UGKA 1GEGA 2VQ3A 4MP3A 1LQUA 1JKIA 1M66A 3DZFA 4CUKA 3BMQA 8LDHA 2Q1UA 3JQFC 1SZJG 4BHTA 2VUUA 3LDHA 4G5HA 4C7JA 4WLOA 3JQAB 3HFSA 2HK7A 3IS3A 4J4BA 5G4LA 1PQWA 1QV6A 2ZIZA 1MV8A 1JWBB 2IDZA 1IHXA 1UZMA 3OHSX 2FRDA 3BMNB 1VSUA 1PJSA 4NQZA 1GCUA 3GH3A 4WASA 3N74A 4Q39A 4IZIA 3DC2A 1P33A 1ORRA 2GRAA 2NU6A 2FSVA 1Q7BA 1IE3A 4FJ0A 1Z45A 2XF8A 3UXYA 1ZFNA 4Z3DA 4IIVA 4NK5A 2X5OA 1ADBA 1I2BA 5TRTA 3U4CA 2I9PA 1HE3A 4AJOA 4DQVA 3ZWVA 4TQGA 4KP7A 1LA2A 1L7DA 2V6GA 2YY7A 4NIMA 1S7CA 1JKFA 1G1AA 5DDIP 4ZU3A 4EJ0A 1J6UA 5FF9A 3GDOA 3WNVA 1KYQA 4BUCA 4B79A 5A9SA 5T8KC 1H9AA 2UYYA 1UUFA 1WPQA 2YHUA 4QECA 4JJGA 2VN8A 4W9NA 2VWQA 3H2SA 5TSDA 4BNMA 3AOEC 1LDMA 4OQYA 3LT2A 4OHUA 1GYPA 1DHTA 4YTEA 3S2GA 2R2GA 1NM5A 1FMCA 3I23A 2HMUA 2BFAA 5JLAA 4R68A 3HWRA 4Y98A 3W4JA 3FBGA 3L4BC 4IQ8A 9LDBA 1NFQA 4I08A 1PS0A 4F45A 3I83A 4ZQEA 3DZBA 5EJ2A 3EGOA 2X0NA 1U8XX 1PZHA 1HWYA 1U7TA 3ZDFA 4D0RA 4E4YA 4CUJA 4GH5A 5TQVA 4PN3A 1GQ2A 1GV0A 1SO8A 2EP7A 3OQ1A 4TZTA 3JQ9A 3RUAA 1MFPA 1TI7A 3KHUA 1YOVB 3RUHA 4E0BA 1EE2A 4TROA 2OO5A 2OORA 1YO6A 3AOEA 3FR7A 4NDNE 4YVFA 4ALJA 4W82A 1JDJA 1EMDA 1Y6JA 1B7GO 2GN4A 2QG4A 3OJLA 3K2BA 5IDYA 3U5TA 3ONDA 1XDWA 3DAPA 1OC2A 3ZZNA 5B37A 3CIFA 3EZYA 4N5MA 2QHXA 5H82A 2A9FA 2FPPA 2YQ4A 2NVUA 1E3EA 2O7SA 3RFVA 1LC0A 1C0LA 1PWZA 4DC1A 5CDYA 3L4BA 4QUKA 4PG6A 4RV9A 3OMLA 3NEPX 3RIHA 2DKNA 4BNUA 3IDSA 2AW5A 4DPLA 1E7QA 3Q3CA 2X22A 3GG2A 1PIWA 5DBFA 5IF3A 1QKIA 4DLBA 3D1LA 3HZZA 1PS9A 2IEDA 5I9MA 2QIOA 3M2TA 2X5KO 3AUSA 2IZZA 4PLZA 2PY6A 1U1IA 4WGGA 4HP8A 1DAPA 2G0TA 4MJLA 4OIMA 4RORA 3W8FA 5THKA 4UVDA 1ZEMA 3S2FA 1PSDA 1LRLA 7MDHA 1DC3A 1F8FA 1WMAA 5IJZA 1HETA 2IXAA 1T4DA 2X9VA 2C20A 4Q9NA 4QEDA 3OEYA 3WB9A 3I9KA 3NGLA 1PWXA 1U4SA 2B35A 2PWZA 3ASUA 2Y1EA 2RIRA 2NTVA 3LYLA 3DHNA 3G79A 1ULSA 4GI2A 4JX8A 4R3WA 3OIGA 3TWOA 5H83A 3ZWXA 3HDJA 3VTZA 4IDAA 4J4TA 4UVGA 4R54A 3VPGA 2OXIA 4UUOA 3DZKA 4XRRA 1IULA 2VNSA 3NAQA 3SLGA 3OJOA 4LN1A 2VRCD 1WZIA 4GX5A 3QVOA 2PNFA 1DXYA 4AG3A 2CF6A 1IPEA 2GUGA 1HDGO 4IGEA 2WM3A 2DFDA 3UOGA 3T4XA 1EDZA 4GL4A 3GEGA 3RBXA 1UP4A 4K6FA 1WDMA 2P5YA 3IP3A 1P3DA 1W4ZA 4J16A 5GZ3A 2FY8A 1MC4A 3GHYA 3RD5A 2C82A 2CSUA 3PXXA 2Q1SA 2VTDA 1H6CA 3KYBA 4AJ1A 1I01A 1OZAA 3DZGA 3CH6A 4M8SA 5KNLA 4UUPA 4BMVA 3K2EA 4G2NA 2W90A 2YZ7A 3ORFA 1DLIA 4CR8A 2CF5A 3OQ6A 1P1RA 4BKRA 4F3YA 3S2IA 5BNTA 1QV7A 3ZHZA 1VE9A 1B8VA 4E30A 4PLWA 4J91A 2DQ4A 3DDNA 1CDOA 5DF1A 3H7AA 1RWBA 1YBVA 3I6IA 1V3TA 3WGQA 3U4IA 2P4HX 3PEFA 1I36A 1NQAO 2DT5A 1NWHA 3O8QA 3UCFA 2PLAA 3K30A 3D3WA 2EKQA 1EVYA 4AJJA 1YJQA 3P19A 4XQGA 4QFDA 2NVUB 4CMEA 5A5FA 5B1YA 4R9SA 4BKQA 6LDHA 1R4NA 4CQMA 3M1LA 2ZQZA 4BNIA 1JU9A 3LC2O 4RCVA 1SMKA 1CIVA 1OOEA 2DTEA 2G5CA 4IJVA 3TZCA 3V2HA 1CJCA 5ENDA 5BSFA 2BI7A 4ZQBA 1NQOA 4CJXA 4NJMB 5JDIA 4E2WA 3ETDA 4IDFA 2DBVO 2NTJA 2Y0EA 1MUUA 1JVSA 3DZIA 3F4LA 4GX1A 4TRJA 1JAYA 3CSDA 4DVJA 1NPTO 4MOWA 2O3JA 4MVJM 4XB1A 4Q3BA 1BDBA 1X7GA 4IBOA 4R51A 5IDQA 5ITVA 1EEHA 4Z0TA 3UFXA 3MJSA 3FTNA 2XOXA 2Q50A 4UVHA 2D5AA 3V1UA 3ZWAA 4BO5A 3ZWYA 1GYQA 4DREA 4OXKA 1MC5A 3I9JA 4GBJA 2GZ2A 3ULKA 2JD0A 1X14A 2O7QA 5JDCA 4I5EA 5C7OO 5IZCA 1DFIA 5DBIA 2HQ1A 1Y8QA 3WQSB 1NNUA 2OZPA 3RCBA 5JO0A 2AMFA 3ICPA 4MVJA 3R1IA 5C37A 5G2OA 4GQAA 1HLDA 2X9NA 3PDUA 2RH4A 4I9NA 1I8TA 2X58A 1P31A 5KKAA 4RPJA 5HS6A 5CDUA 4N18A 3WQRA 4JNKA 1YBAA 2C29D 2PKQO 4PRKA 3TFQA 1OAAA 1V6AA 3BTOA 1A5ZA 2VHZA 3QP9A 3QW2A 3ADPA 4AJIA 3JQFA 1LUAA 3TDKA 4Z9FA 2AE2A 2VUSA 3K8ZA 3H3FA 4J43A 4JQCA 1YL7A 2X5JO 1CF2O 1AUPA 1T2CA 1WW8A 2BI8A 2POQX 4BNGA 1NBOA 5A06A 1A7KA 2X0JA 2WTBA 4IDDA 5COBA 4PCVA 5CEFA 1K6JA 1E3SA 2ZYDA 1YH3A 3KETA 1Z75A 1M2WA 4FJ2A 5HBRA 4WNCA 1KBZA 1GY8A 3TPCA 1C0PA 3GN1A 4UREA 4CQLB 3GMDA 4OQZA 5KVSA 1DIGA 3GVPA 4FFOA 3H3JA 4CPDA 1X7HA 1O0SA 3VPHA 3CUKA 3I9NA 3GC6A 2V7PA 4ZVVA 3SC4A 2JFFA 4H7PA 2D3TA 2NLOA 2Y1GA 4DBVO 3ZNQA 2GCGA 5T67A 3G1UA 5C7LO 2JHFA 4XRGA 1ENYA 2J3KA 3AM4A 4GVLA 3IQDB 1U2GA 1WNTA 2EKLA 3GGPA 4XYEA 4J4HA 3VH3A 4F46A 3AW9A 3PWKA 2YJZA 2PGDA 4H16A 3CZRA 1LXCA 4BO7A 1DIHA 4XJTA 1XA0A 4U8GA 4ZRMA 3I3OA 3ONFA 3RKUA 1O8CA 4UEKA 2Q99A 2CVQA 3MOIA 5L4NA 3D3WB 2P4QA 3BMOA 3L4SO 2H6EA 1Q2XA 1AHIA 5AVOA 4UULA 1H6BA 3HN7A 3NV9A 3GEDA 4PLHA 3SBOA 3RAJA 4OMUA 4RLHA 4R41A 5FWNA 1VKNA 3LT4A 3K96A 4BV8A 4J90A 4WOKA 2GGSA 3FPLA 3HB5X 2OBNA 4YPOA 4U0JA 2B4TO 5IDXA 4MKRA 1JAXA 3JQ6A 5A04A 4GKVA 1ZJYA 4M55A 4NFHA 2P5UA 4DL9A 1I10A 3Q1LA 3GUYA 1F06A 1WAMA 4DIFA 1UAGA 1C14A 3CPSA 1H0KA 4BOYA 3KV3O 1JTVA 3GNTA 1SPXA 5CHEA 1JQBA 1PZEA 3CKYA 5A4DA 1LLCA 5L40A 3KVOA 2EG9A 3E8XA 2HUNA 1GZ6A 2PGJA 1FK8A 3MWEB 4MVJE 4NMHA 3QWAA 3D3EA 5EESA 2Q2QA 4TVBA 1ZK2A 3TF5A 1QYVA 1XU7A 2CDCA 3OECA 4BNTA 3G3EA 1K3TA 1NWCA 3OM9A 3AM3A 2VRCA 3LC7O 1MXHA 3C3XA 4ALMA 1JA9A 5JCXA 2EWMA 4XA8A 1B0AA 3WGZA 3ONEA 1T25A 1SC6A 2DBRA 2VWPA 3IJPA 2BELA 2EERA 4O59O 1ADCA 4YEDA 3GEMA 3CXRA 1UXJA 1DFGA 1ZXLA 4YAEA 4PIVA 3UCXA 4UEOA 4CL3A 1HSOA 1PGQA 4CMGA 1ZEJA 1ZXBA 2V65A 2AQIA 3DZJA 2GLXA 4YT2A 3N7UA 3GR6A 1FDTA 2WDZA 3V5NA 5B4TA 2OFPA 1ZK3A 3WTCA 1GDHA 1ZVMA 1SCUA 3T4EA 3DMYA 1B14A 3INGA 3K31A 4K28A 3FBTA 4IUYA 4M86A 3BMNA 5TGDA 4EGFA 3PIIA 2EW2A 4RF3A 4U6SA 1A9YA 4FFMA 3RC7A 1H94A 4BV9A 4CR6A 1O5IA 1PL6A 1JLLA 1PJTA 1N5DA 4MVJD 3U9LA 3R0IA 9LDTA 4OJNA 5JSFA 1LU9A 3TL2A 1PGNA 3A9WA 1PJQA 4IJWA 1E3JA 3N58A 5H81A 3HNPA 1LX6A 6ADHA 4L75A 3ZV3A 4LRSB 3SX2A 1UAYA 4R4JA 3KTDA 4AJPA 1Z73A 4NFYA 2X9GA 1X0XA 4MVJI 3MJTA 1EDOA 1P45A 5U4QA 1DB3A 3TZKA 3MTGA 5IFLA 4DMMA 5A03A 2H9IA 2ILTA 2VTEA 4JBHA 1F17A 2VHWA 4Y9DA 1HZJA 1UDBA 2GZ1A 4R1UA 1HDYA 3BZUA 4XEHA 3RUEA 3C7AA 4CV3A 3PK0A 4LK3A 4XZ3A 2AEJA 4HKTA 4NJOA 2ZYGA 2AQHA 1LJ8A 2CY0A 2Y68A 3FHLA 4Y6PA 5F1KA 3VPSA 2FR8A 1UXGA 2IZ1A 3R6DA 3DMTC 4P4NA 4R16A 4MO2A 5EINA 4EBFA 3U09A 1H93A 3QVSA 4CMHA 1HDCA 3VZPA 1ISJA 2GN8A 4WLEA 3VH4A 3DOOA 5CAEA 5JY1A 2W98A 1VL0A 4Y67A 1QLHA 5MGBA 4G81A 1NQ5A 4L4RA 3KB6A 4IQGA 1PQPA 2R6JA 5IZ4A 1Q7CA 3H65A 3VZSA 4LGVA 1MX3A 4K26A 2CVZA 3AOGA 4B3JA 2DPGA 2Y05A 2J3IA 4C4OA 5TIIA 4YAJA 2QX7A 3EK2A 4BNLA 1AN9A 4D7AA 2E6UX 3MTJA 3H4VA 1P1JA 4R69A 1RYDA 4YRBA 3C1AA 4FD3A 3U3XA 3WG9A 2DLDA 2PGLA 3MJ4A 2BGLA 1WDKA 2AG5A 5A3VA 3E1KA 3JQAA 4PZEA 3RC9A 2Q2VA 3HB4X 3C1OA 3FSRA 3ZV6A 4DUPA 3ZHBA 5KWEA 4BGIA 1PR3A 3JQ8A 1MG0A 4IJUA 4CLEA 3B1FA 4RJTA 2HO5A 3ZNNA 4D43A 4BNJA 3ANLA 1HDRA 2WE8A 4IS2A 2I99A 4YWJA 1E7SA 5LCXA 3WYCA 4HV4A 3IMFA 1JN0A 3QE3A 1VLLA 3E9QA 2X6TA 3AY3A 3PZRA 4QT0A 1EFLA 2YQ5A 1P44A 3KSZO 1QLJA 3BMQB 4U6QA 1BMDA 5G0VA 5G0WA 3A06A 5IXSA 4HBGA 1H2BA 2Y0CA 1EK5A 1ADFA 3JQGB 4RPHA 3HDYA 4XIJA 2Q46A 2I5PO 3G17A 1IUKA 2EGHA 1G6KA 4DPMA 3E03A
chains in the Genus database with same CATH superfamily
2HW8A 1G2PA 5BR7A 1DKRA 1LJLA 2OCAA 4NULA 5D86A 5ALOA 3RS2A 1K5HA 4GDFA 4D4MA 1DG9A 1OBFO 1FSSA 3KLPX 1H2EA 3AINA 1CY1A 2NADA 4HGOA 4XQCA 5DYWA 1GG2A 5EEGA 5TE9A 1YI8A 1JHYA 1G291 2WG1A 3LV8A 1EP1B 3NKLA 4N12A 4RWEA 4X85A 5A6SA 5LLDA 2NO5A 1HQKA 1CUAA 3DSRA 5JDCC 4WKNA 4ZEVA 5DXJA 1FP4B 5JXIA 4LZAA 1T2FA 4CIBA 3TEFA 3THWA 4JMPA 3BE6A 1SBCA 3IEIA 4DSNA 1QOPB 1N5RA 2DFKB 2ZWMA 2ZM6B 1NV9A 4AY6A 4LTDA 2D1YA 3L8HA 3EGVA 1YVPA 4EF5A 2YYZA 3JWPA 1YL5A 4AJKA 2I4LA 3MJVA 5AR1A 2D5LA 2HF7A 1PL7A 5BSKA 3G7SA 4Q21A 1TAHA 3D8BA 1TVKB 3EOZA 1E6UA 4IIUA 3FB1A 4EH1A 4ZARA 4EAQA 3Q2IA 2XXAB 3LCVB 4KQWA 3R9WA 4C87A 4WRRA 1IB6A 1R1DA 1W5BA 1KK0A 4KGVA 3STYA 3BG5A 1TCVA 3DVQX 3DGEC 1DCTA 1ISSA 5HRAA 1G3UA 4OY3A 1CJVC 1LLDA 2BE9A 1QF6A 2JFGA 1MENA 4HLUC 3LE8A 5BR4A 5K6RA 4L76A 3S8EA 4O5OA 2A35A 1TJ5A 2DM6A 3IURA 3AG6A 4U2CA 2X0DA 4ZHQB 2R7LA 2FA9A 4OGWA 3C43A 5BSHA 1WZNA 3FOFC 1Q3TA 3RODA 1Y6ZA 4WJLA 1IZ0A 2C2YA 1R10A 2QTGA 4XJSA 4ZCRA 4M0LA 1AZLA 3ZH2A 3W6NA 1WUIS 4KO3S 3GJTA 5LBTA 3JASB 4ZOLF 1P2GA 2AIRA 3DHYA 2JI8A 4URXR 3JARA 4JDUA 3QV2A 1O6GA 4OI2A 4TL8A 4JLVA 4UNIA 1MLDA 1MFZA 2BW0A 1FDSA 3JCZA 3L3BA 3OCCA 3WWDA 2A0UA 3LA6A 1ZSNA 3KB2A 4BWVA 2C77A 1MQ8B 2H2WA 4D82A 1DQRA 2NU9B 2L42A 3MINB 2F43A 1CQWA 5EJ7A 1T6XA 2J7PD 5AM5A 1KZ7B 4ZVPA 3ZBQA 4C6SA 4A16A 4X92A 3CH7A 5ADHA 2YVLA 4LNHA 5EJEA 4GE3A 4RHFA 5FLYA 3OIUA 2XUAA 3W79A 3HFRA 1ZH0A 2O2YA 3DF7A 4QAQA 1E5QA 3PQ4A 5F4ZA 4LFCB 1Y4AE 3F74A 1MH1A 2WTMA 4W5TA 1NQXA 2PMBA 2ZZKA 3IPLA 1H4QA 4URZR 4R2XA 3NNNA 3O8NA 3ROPA 1LW7A 4ZIRB 1F8UA 4OQPA 3VYUB 1Y7IA 1RJGA 4FX2A 3NOQA 1GUDA 3BB1A 2OBFA 4JJKA 1H2AS 1FQOA 3UAVA 2XIQA 2W6JD 4PC3A 5IMSA 1FJHA 3KJHA 5JECA 3G8YA 1NUHA 1MPTA 3IBFA 1KZ9A 4BLRA 5KYUB 5CUQA 2V59A 3AP2A 2W6NA 3NC4A 3H6KA 1FBTA 2UV8A 2FR1A 1J00A 3JZFA 4Y7DA 4CKEA 2HLHA 3KL2A 3LL4A 4RO0A 3D8HA 4CI9A 5IANA 5IUNC 1H1LA 4QC2A 4HWOA 3K0AB 4RMJA 3L4JA 3IAM6 3P5SA 4DM3A 5IPFA 1U2DC 2Q62A 3NBQA 4NBKA 1W48A 1MTZA 2FZGA 3MCTA 1O1YA 2QZZA 3K9CA 2A30A 2H00A 3RK0A 4C01A 1JLHA 1IWOA 3LPMA 4TYYA 4FC6A 4RDHA 1TKBA 4ZOLA 5LKAA 2P9GA 3PHIA 2C3PA 2PXAA 1JQJC 2WKSA 2IL1A 3BB4A 3DYIA 4JT8A 4MI9A 2PZLA 3GF4A 4NYMR 3H86A 4PLGA 3SM9A 4AMYA 4B2PA 1OIVA 3I09A 1AKYA 1YKGA 3KJNA 2XLCA 4RVDA 1RQNA 2G06A 2FPMA 4LRUA 2O3UA 3CX3A 5K8IA 1BRMA 3HM9A 3QY0A 5DNAA 1T6BY 3AGQA 1J39A 1WNFA 1G17A 3ESQA 4NHEA 1E94E 1QP7A 1SC9A 3S2YA 2A9OA 2G71A 3IELA 5M7EA 3GLFB 1K6EA 4KITB 1A2KC 1IOWA 1M2HA 3DO5A 1KQ3A 4UHDA 2WF5A 1QCCA 4WXEA 1ZVKA 5DULA 5G4KA 4LMRA 4NCIA 4U63A 3W2HA 1DAHA 1WZCA 4RKEA 4ZCLA 1VRCA 2HR1A 2XGGA 4AJ2A 3FOEC 1EESA 2FKNA 4Y1RA 4KR7A 4OTZA 2AKEA 3EZXA 1DAOA 2H2HA 4KQ1A 3PQ5A 1RQRA 4CQMB 4P3KA 5DKFA 2E4YA 5ADVA 1RWVA 3T7DA 4HFNA 3D4BA 4FW9A 2DHCA 1E9AA 4BQQA 3QKWA 1UR5A 3KWFA 1VCOA 4GW3A 2E21A 2JAPA 2XYGA 3G5LA 2OZLA 1JQEA 1FA9A 2I1WA 3OPXA 5C7YA 5LPNA 1K9VF 4LE0A 1DUSA 2Q3BA 4N7MA 4OA8A 5TPWA 4B2YA 1GT91 1QX4A 3HJHA 4DEYA 4F3CA 4U2BA 1KP3A 1TXGA 1DIOB 2HMAA 3JQ7B 1BGWA 4PSDA 1NMXA 1V7PC 5CX4A 1M0WA 3IP1A 5KHLB 3H9UA 2NGRA 1DPGA 1VPDA 1GUZA 2BM9A 1GPMA 1Z0FA 2IDKA 3WS7A 3O3NB 5EHIA 3EXG1 1RIIA 3RSQA 4YMUA 1ZAYA 1KYVA 4LDAA 3K4PA 3NWOA 3OQIB 2ZANA 1JQLB 3O74A 3OLYA 4P33A 5EZYB 2H08A 1NRIA 3A3PA 2HQBA 2X1LA 2VSOA 4QQFA 2G9VA 2PYIA 2VPYA 3ZU4A 1MDBA 4LYEA 5EIOA 1BX0A 1ONPA 3G2JA 4JV5B 1ID8A 3N7TA 1YFLA 3OY2A 2Z08A 3OA2A 3TTYA 2B9VA 1RQGA 1G18A 1PJ3A 3RIYA 2V0NA 5F1PA 2C96A 1VSTA 3MCAA 1MAHA 4NYMQ 3T41A 3CH5A 1XPUA 1J5PA 5AK3A 2FFAA 3U31A 5LYJA 2A8YA 5CP8A 1VIVA 1OTYA 3RS8A 121PA 1VG8A 3N3AC 5FUMA 1NONA 5BVGB 2BFDA 3LQQA 2F1KA 4NCHA 3EEFA 2X76A 3KKQA 4P3NA 1G9XA 1M8GA 5ALGA 2P91A 1T8SA 1KOFA 3STTA 2EZ4A 1EJBA 3NPMA 2JBAB 4G4SO 2V9CA 5C1DA 1IQUA 3UWSA 4A6PA 5MDHA 4Q15A 4YV1A 4ITUA 3O3MB 1A71A 1KO8A 4MI1A 5K1ZA 1A8SA 3C3DA 3VYRB 1RBZA 3WFJA 5A9RA 1VFPA 5IVKA 2HDNB 5AUPB 4LF9B 1BVHA 3ZCSA 2ZBUA 4HPWA 5DSXA 4ZVOA 4A91A 1TYZA 3ZUGA 1N8KA 1X15A 3T7AA 5JAIA 4RW0A 3KXIA 4WEOA 3LI2A 4CLHA 3BGWA 5ESRA 4C78A 3QYPA 1V16B 3KLMX 1E1KA 5GM2A 1THGA 1V5GA 1O9GA 1R0LA 5KQSA 1YOVA 3LOPA 3DOCA 2B4YA 4HEQA 4B33A 2RHOA 1C3OA 2FUG6 1N1MA 2DHEA 5SZKB 1D8TA 1JR4A 1RZRA 2BTEA 1NMSA 4N5IX 2CBXA 1UBRS 2JARA 3GNQA 4ZKEA 3DNPA 5DBOA 2XMRA 5EKTA 4CKXA 1SKMA 1W44A 4RETA 2ZSBA 4NJEA 2O3QA 3LLUA 4NE7A 4WK0B 4CCYA 1W30A 2DU8A 1WQ3A 3NDRA 1P7ZA 1YHNA 2RHHA 1BD3A 1ZU4A 3JQPA 4UAUA 1M6YA 2AR0A 4LY3A 2BISA 1KDYA 4JR1A 3NX4A 4ZFNA 1XYYA 1DO0A 3PYXA 2E4XA 1HQDA 1NX6A 1WUKS 4Q4AA 5GPBA 4BV2A 5FBVB 4TKLA 2Y1KA 2VTVA 3E27A 4AY5A 5LWQA 3OJEA 1RSZA 5ANRB 2ALJA 2HQRA 4JLUA 1Z5OA 2XOKD 4LJ8A 4DR5B 1G7CA 2OPBA 1WBDA 1WIWA 2XQIA 3U3DA 2XBUA 4E32A 2AFHE 4XFKA 4Z9BA 4BO1A 1KYYA 5EXEA 2B78A 5CLJA 1JG3A 3WLRA 1YS4A 3IAEA 4FZVA 2B36A 2XF2A 4I1VA 1YQGA 4U8HA 3RSOA 4BP9A 4DSUA 1MABA 1XF9A 2YJ4A 4H6PA 2W2XA 4RAQA 2FHSA 1Z5PA 4NYIQ 1QIIA 4MKXA 4BFXA 2ONYA 2D3WA 5JFGA 2EATA 1GJRA 3FY4A 1H9BA 3HXPA 4KGXA 4ZVNA 1F0YA 2E89A 4CV0A 1IVNA 1J8VA 1B8NA 1BE6A 5HKBA 1U90A 4ZDIA 4J0QA 3N3BC 4RESA 1M67A 2FMTA 3TN7A 4JS0A 3GQVA 1FU7A 4EKGA 1Y8RA 5J1SB 4OX9B 2N42A 5F73A 1PDOA 1E0DA 3HBNA 1QOZA 5BWCA 5E95A 1YDHA 5C5CA 3VR5D 2A9VA 2FVYA 4RFSB 5LBUA 2VJLA 5LUAA 4CF6A 4Z1OA 4GFDA 2DWQA 1ZUWA 2FFRA 4WESA 5CNKA 1JEYA 1YR2A 1VA4A 3CPEA 5KVCA 3GFSA 4KK3A 4R81A 2CJPA 3WRYA 5LMZA 2ZUWA 4M0DA 1G8HA 1ZOOA 2GAFA 3WBBA 1DOAA 4H7FA 1I4TD 2ZVDA 4R6WA 4PCLA 1ZGAA 4Q6BA 5J2UA 5HIIA 3ZX5A 3ICCA 3CVYA 2LCQA 3MAAC 2D2EA 1TLLA 2QTVB 3AFNA 4RSGA 5JCJA 3DDCA 1VSVA 4O29A 1QVAA 2BV3A 4OSPA 2QJWA 4TWRA 3PQ8A 3Q8MA 3SZLA 4NCNA 4NBWA 4XLTA 2CB9A 3QBDA 3WGKA 2YICA 2JG3A 1XVAA 4FCTA 1WF3A 2I66A 4O1MA 2ADFA 3IP9A 4JI5B 2CDBA 2QGZA 3QKUA 4FN5A 4HDRB 4E6PA 8ATCA 3RU7A 2D4HA 4U7FA 2QN7A 3EEIA 3DTVB 2WNIA 3F5DA 3CXUA 2R7AA 1LDYA 4WN9B 5BWBA 4LHEA 4WUTA 4KW7A 3LKVA 4HL6A 4I5GA 1ZO8A 3H83A 4QGFA 3HVKA 5DCLA 1AS3A 2W2NA 5DW3A 4RX1A 3UB3A 1SU8A 4MV7A 2RJ3A 4N0PA 3O5AA 1VE3A 3SC2A 3AUYA 3M5CA 4QJ3A 4XX0B 3SEQA 4D45A 1U81A 2TSYB 2HWXA 3COPA 3HACA 1VBFA 4GSYA 3PWZA 1SUDA 4LYHA 1TM2A 1PR6A 1YRQA 1XL1A 3Q12A 1JR3D 2Z8YA 3DEJA 1T2EA 3UJHA 1UFQA 3F2IA 4ZO9A 1OBCA 2VS1A 2VJBA 1LX7A 3ICWA 4G9EA 2OB2A 2UDPA 3AU9A 2X8LA 1NVVQ 2ZIGA 2HJWA 3L77A 4X60A 3G0OA 2A7QA 1E60A 2EBFX 4P82A 5A02A 2XQJA 1JV2B 1LFDB 2QRVA 2PBLA 3ND8A 4M0CA 3QOWA 4D3DA 3OU6A 3IT1A 1ZL2A 4ZT6A 3A6KA 2HXGA 2XYVA 1HTBA 4TLBA 3FWYA 4BGVA 3VO1A 1SU4A 1X1EA 3GUZA 1RYFA 3OF5A 2WIKA 2ZS9A 3KS9A 4CM9A 4W7HA 1PBTA 3S27A 2CXRA 1OGIA 2V4ZA 3LOUA 2AKYA 1PQUA 3SR3A 3VHLB 5JXGA 3WAGA 2H1OA 5JMPA 3JQQA 2P6NA 1MX9A 3ZPXA 2NSLA 4KR2A 3R3YA 1GFZA 1KFKB 1P19A 4WK2B 1U3GA 1LDEA 1M72A 5C1PA 5KYKA 1FC0A 5HTKA 1Y8CA 3ER6A 5JARA 3S1SA 2P2NA 1NNEA 4WOCA 4KQ6A 3W8EA 4NI5A 3RKRA 5TGTA 3O8CA 3VSDA 3CEHA 4V39A 3AB7A 1LLQA 1Z4NA 1RRFA 4EY7A 5LU8A 2XOEA 1QGOA 2XNHA 1I2DA 3R41A 1JR3E 1EG7A 1FTSA 2YH2A 2PG3A 2X13A 3A4VA 3BM5A 3KVNA 1PNTA 4IH4A 4JHLA 4II2A 4YJGB 1XNRB 2ZUEA 3DDHA 1CDZA 3LDUA 3LGSA 4ZQIA 1L7PA 1FFHA 2PVSA 3E1GA 2YQZA 3O21A 4EKNB 1ZA2A 3EZFA 4GWGA 4YUVA 4KVGA 3BGDA 2CL0X 1DPFA 4MCAA 1ZWLA 1V7ZA 4OXYA 1KC1A 2Y2UA 1GVHA 3WMGA 5KTOA 2WA1A 3E3AA 1RKVA 5DJ5A 3ZQUA 3LWBA 5BQXA 3IV9A 2QD4A 3KT6A 3DGFC 4X20B 5JMOA 4YYZA 5DM60 4LXIA 4IDHA 3LCJA 5D7NA 4AN0A 3U6KA 4CIAA 3FZEA 1JYEA 3TL6A 2A94A 5JT1A 2GFHA 2JLZA 4MKIA 2GILA 4QTXA 1IZ8A 4LF7B 2VJCA 3GRAA 1VL1A 3BSWA 4EJSA 5EWLB 4EHJA 2EF1A 1QIKA 1EGHA 3ESAA 1BXGB 1JHAA 2GPWA 3JYNA 3MD9A 3KUKA 4FOSA 4G4SP 3A9UA 5EYPA 4IHJB 3KOMA 4OFZA 3KXDA 4R2JA 4S12A 5FOTA 3CX8A 1Z5NA 1JIXA 4XAQA 3Q11A 3BE8A 3HY3A 1NYRA 4MYHA 5DH9A 2NUPB 3GYBA 3NIWA 3MFYA 2IOYA 2VDMB 3KDAA 2GX6A 3DBRB 1MJGM 1VFNA 3ZE6A 4B7UA 1C3EA 2MINB 1K88A 1BCRB 1NJ1A 3E82A 1XQVA 3O03A 1UF9A 4GI7A 3BYZA 4RACA 5GVRA 3L05A 1P5FA 2WYOA 1U3UA 5WRFA 1T0BA 3L9WA 4CG0A 5EMNA 5I4IA 4N82A 1Z4MA 5TMDA 4DY4A 3DNFA 4EJSC 4RTQA 4Q5IA 3R5SA 4XX0A 4LX0A 3CSSA 1G0NA 4L8GA 4LA4A 4P7FA 1J56A 3MVEA 1YDEA 1KU0A 4K3VA 2BGGA 1KU6A 3ANYB 4KRXA 4DQVA 3T0FA 1YQQA 3LCRA 4CMCA 3H9QA 4IV8A 5LQRA 5HF6A 1KRHA 1XTVA 2ZT6A 4C9BA 3AXSA 1POWA 2FPXA 2QN3A 3OZIA 4H1VA 3VR4A 3UW3A 5IWAB 1NBEA 3HXQA 3GZNA 2JJ2A 1GEEA 5M3BA 4KV7A 1NZDA 4L74A 5L51A 1CG6A 1RCUA 3Q7EA 4OKIA 2BGKA 3DBIA 4DMHA 4LF4B 2Q0QA 3HJRA 3VAZA 4E5KA 1JVBA 1P91A 4BO6A 5HQ3A 2FK8A 3C85A 2WJ6A 1V11B 3EVAA 1ENZA 3AHHA 4KLRA 4DAOA 4NJMA 2PWBA 2J5QA 4TZKA 3DFIA 1CQJA 1FVOA 3U0BA 4NY1A 3GB9A 3IKVA 3W04A 3HBFA 3ER9A 4MI6A 5GWXA 3LY9A 1DQSA 1CWUA 2YIVX 5CW2A 5CCEA 1UZUA 5TMBA 1EXVA 2PUCA 2IV3A 5LN1A 3BEOA 2DPHA 3PFIA 3JZMA 4RJIA 1E7MA 1FDRA 4REMA 4KDFA 4Y2TA 1QFXA 4CFYA 4I9HA 4OQXA 4TV9A 3QXGA 5MGNA 3M5DA 2J3QA 3RVQA 4MVJG 4PV7A 8AT1A 1T4BA 2IEYA 4OHCA 5FTKA 4B0OA 1FFSA 4IIFA 3ILXA 2V97A 4GLOA 5FV4A 2PX6A 1SHUX 1VYHA 3RUCA 1GILA 2F8TA 2IP2A 1PTJC 1RXIA 1RPJA 2R6CA 1G8GA 4M88A 1CUIA 3RRMA 2J3HA 1JDNA 1W94A 4KIJA 4J7UA 4F9TA 1JA0A 3FMGA 2VDOB 3K1AB 4GMGA 4TN5A 2IYRA 1PYDA 2K5UA 1K4MA 4L6IA 5TVGA 1XTPA 1XU9A 3MJEA 3PHHA 3AKZA 2OHOA 3WRXC 3VOSA 5K8UA 1B8PA 3RSGA 4EEKA 4TLDA 1GTMA 1X9IA 4FYWA 4OJQA 2RDMA 4N4AA 2OMEA 3GLHE 4WOJA 2C7OA 1MEEA 4F71A 1FTNA 2VCEA 1KOJA 4Q4DA 1D6MA 1QH0A 3BSSA 1A1SA 5DNWA 3WZLA 2DR2A 1LH0A 3QVWA 5CNIA 2ZR7A 3UKOA 3WLSA 2C5EA 1OFUX 4OQNA 1RWXA 1LVGA 4P9NA 4PG4A 4QUHA 2XR1A 4B4OA 1FY2A 2ZROA 3ONNA 4X1YB 5E3HA 1F14A 2W43A 3U37A 2C1ZA 2H29A 2QQGA 3KEGA 4H59A 4I3GA 2QNIA 3IC5A 4C0SA 3K73O 2OM6A 2R5WA 3EWIA 3P0IA 3IUYA 1I5RA 2XNCA 3R8XA 3VAYA 1LZKA 1GPUA 3DWEX 3KWMA 3QVMA 4NK4A 3VKVA 2W0MA 4J9VA 4DV4B 1MB2A 2UVDA 1E2KA 2OP1A 3FVWA 4LDZA 2Q4TA 4JHXA 3P32A 2YFHA 1NMEA 2R87A 3DB1A 5J63A 3RAEC 1XZDA 2SBTA 4UHJA 5K7SA 4ZAVA 5HUQA 1Z37A 1EUQA 2Y1LA 4Q3DA 2GFQA 2HA5A 2I22A 2W2LD 3CNBA 3D7NA 1FP2A 3SMQA 3FFXA 2ZVQX 2EFEB 1QGDA 4DB4A 5C31A 2R8PA 2HIAA 2I4NA 2TMDA 4BQEA 2ZJ5A 5DN6D 1UEXC 2BH2A 5FUVA 3F47A 2A67A 2I1QA 1VL6A 1XRLA 2Q6TA 4OFXA 1YRWA 2HY7A 2JGMA 2KMLA 1SEVA 1FYFA 3PHJA 2GNAA 1T5DX 4EI8A 3PITA 1ADJA 3O94A 2ORIA 3QRWA 2VQ6A 4HDKB 3D5EA 3QU5A 4DM7A 2FOLA 3E22A 1U8TA 4LDQA 5DU2A 3W1EA 1QZUA 1QWSA 1RRKA 4BQRA 4CIYA 2EJBA 3D6VA 4DLKA 1XQYA 3A9RA 3AVUA 1M75A 3LO8A 2ZZMA 2JBAA 4A10A 3QNMA 2PMFA 2YV5A 5TGZA 2DYKA 1IDN1 1I1NA 1MC1A 2HK9A 2ZJ1A 4PICA 4V0QA 4BRWA 4YRAA 2FOIA 2ZRAA 1W5EA 1C7JA 5LUBA 4P32A 1ADGA 1I6KA 3W8RA 1KI6A 5D51S 1G3MA 4N7BA 3S1AB 4HB4A 5LDGA 4EEZA 2MMGA 5A5VA 1TEVA 1TO2E 4M89A 3T1VA 1DDIA 1BKDR 2BHNA 4A0QA 5KIAA 1UXOA 1IOZA 4KDEA 2N75A 2P9TA 1Z4JA 3IAUA 4BX2A 3SU8A 1XPOA 2PL1A 4LY9A 2W2PA 1CERA 1SD1A 2XUFA 3STWA 4ASUD 4A4DA 3FMOB 1C3JA 3OFNA 4ENSA 1QU2A 4ZD6A 4D25A 3DLCA 1P9RA 3HR8A 2VAVA 1XP8A 4Q4LA 4XGKA 4QUJA 1BX1A 4GRDA 3ZGNA 4HVCA 1JU4A 3SLKA 3G2MA 4OG2A 4BLOA 4PZCA 2PX5A 3IBSA 2IYTA 4HBZA 1WY7A 4FE4A 2HU2A 3LCMA 1L4GA 5HIJA 3WGYA 4Z6KA 4LYDA 3DB2A 5AT1A 5IZCC 4CIWA 2I62A 5ALXA 3A1NA 4BU1A 2FPIA 5KAMA 3T12A 1B2LA 1Y5NA 4MAMA 4CETA 5JSKA 3BRQA 2HSJA 1SIOA 3KV1A 5F3RA 3BB3A 4EG7A 1PEDA 2WWRA 4RHUA 4RTKA 1P0MA 1YU6A 4MUJA 2O4UX 5D6NA 3ZY3A 2EWVA 4QGSA 2YHAA 5LQCA 2CMDA 5KWJA 4F7WA 3GJ3A 2GAAA 1U1CA 4GP7A 2PRZA 1DCKA 3KDPA 1DXQA 3VSEA 2CUZA 1GV1A 3VI4B 3QLVC 5DHAA 3QOYA 1TLTA 3EVDA 2GD2A 2NZVG 4IRMA 1GN8A 5F7JA 2VYNA 3T7TA 5CA1A 5KMGA 2WQ6A 4M1SA 3ZU3A 3ZHRA 3NALA 2W6ID 5F2OA 3IL2A 1FW6A 3HA5A 4ND1A 2D0OB 4LXYA 3CZCA 3GCZA 2P4SA 2QQFA 3BF7A 3R5TA 2Q3CA 4ZN6A 5LM3A 2D13A 5E6RA 4KX5A 4H0NA 2NUAA 1RC1A 2JAHA 2ZI5A 2QEQA 2ZTVA 3H04A 4YJ2A 3WMXA 3Q0TA 4BWYA 1MVOA 4FHDA 4Z2YA 2YS7A 2JFVA 2Q1WA 2VKTA 1DINA 1PWHA 2HL6A 3B9BA 2KLBA 3EF1A 3KKOA 5EKUA 5F76A 2ZJFA 3TQRA 5IU6A 4TWBA 3OE7A 4MR8A 4X6YA 2AC7A 4NEQA 1M1ZA 3O0DA 1NAHA 1PD1A 4I0WB 4L57A 5A7FA 2WI8A 2ORYA 1X1TA 3WL4A 2FWRA 2AMJA 4HFJA 2J6BA 1AIPA 2HF9A 1PNQA 4MGHA 4X8OA 1TB4A 1KQNA 1EBBA 2RHWA 3QLTA 3THYB 3JWHA 5EXPA 4EG0A 5K3SA 4YCDA 2VHCA 1KZHA 1ZAKA 1LVUA 1ZOSA 4H7JA 4KXYA 5DYYA 3DUWA 2A0KA 3RSLA 5BWOA 4YBZA 2EJWA 1R66A 1BG6A 3CBGA 4NG5A 4A8PA 5AUOB 4V02A 4RKRA 5KQRA 1F0PA 5LC1A 1F1JA 5AXAA 2O8BA 3G9ZA 5CDSA 1A4IA 2O1SA 3G6WA 3SEAA 1P4SA 5KC8A 1CR2A 4UE3S 3ZGLA 2B7CA 2O7NA 4WNAA 5J2UF 1HK7A 1U7UA 3LLMA 1FRZA 1SOAA 2CNNA 1JYSA 1PT5A 2W37A 2YV4A 3HDQA 4Q00A 4KUHA 1BA2A 2FMFA 3DDZX 5DEOA 3CONA 2QUIA 3BA1A 4RLSA 3UWPA 3D2BA 1L5QA 3HUUA 2PDAA 4HDKA 4ALNA 3OCYA 2IYXA 5KYXB 3KLOA 1D1TA 3LUJA 1X2BA 2Y0PA 3SI7A 5CA1F 1ZITA 3H5NA 2NU8A 4I1IA 2ANCA 1W2WB 2QSZA 4O63O 5JWHA 4EA8A 1JIKA 1Z7GA 4AZWA 3HKEA 4JN6B 3IMKA 3GVIA 3UPTA 3M82A 5AKZA 3W2FA 2ZAMA 3Q3HA 1PZGA 1ZXXA 4RENA 4JLDA 5BR1A 1NMYA 3F46A 3KQVA 4XW2A 1DADA 1HYGA 3BWDD 4YGYA 4W6QA 4M8LA 1JPJA 1R4MB 3MOGA 3X2SA 3N0VA 2GMWA 3AV3A 4ABTA 5DW0A 2WHPB 5CDFA 4CFZA 2G28A 4UE2A 2IKQA 5AVYA 2PFSA 1E5TA 1KYWA 1KSGA 2JA2A 3V4PB 3E6AA 3KALA 1IPHA 4N3GA 3DEIA 2H9YA 4GUAA 2I6TA 3FGNA 4D44A 1Q0LA 1GQQA 1WPXA 3NWJA 3NHFA 3L8ZA 1FSFA 5DM1A 1GHTA 2DFTA 2C04A 1CUSA 2I2BA 3QELB 3AL2A 3OOEA 5IVIA 2PS9A 2Y1XA 1KRWA 2PUHA 5FTLA 4BO9A 1F2UA 1PK7A 1S2MA 2HZBA 2XMZA 1LKZA 4WKGA 1SXJD 1Z2OX 2Q41A 3Q7TA 3GQBA 3QQ5A 1FXUA 2G1UA 3HKBB 3IQZA 1E2FA 2W4QA 3EDMA 4HY3A 3O90A 5ELLA 3UVEA 1A5BB 3ZS9A 4C4ZA 1NVGA 3NWBA 1U3FA 4ALKA 4QT4A 1PZFA 2FZ4A 3PPVA 1BKYA 3D8SA 1JT9A 3EVTA 4XPIB 3BGSA 2HU5A 3GUUA 3DPSA 1QS0B 1L7EA 3JR3A 4MW2A 3AETA 1ZIXA 3ZE7A 1JSCA 5ERGB 3PHGA 4A0RA 1DBWA 4CMBA 1OFTA 2JRLA 2YBDA 4L8LA 4M0UA 1WEKA 2VDPB 5ADWA 1T35A 1EKXA 2OWEA 2CFOA 1K86A 4Z0HO 1YJBA 3JVUA 1KJIA 2FN9A 2QTMA 2VAWA 3HFGA 4PX2A 5FTJA 3IUNA 4D98A 5AI8A 5C18A 1EFAA 3R9XA 3R3ZA 1JSRA 1Q7RA 3DAGA 3EFHA 3QLVA 1SNYA 3HJCA 5FO1A 3RS9A 1TTTA 1DQZA 2Q3DA 1GR0A 1T0PA 3AI3A 1JR2A 3GJ7A 4PGMA 2O8EA 3FNFA 2IYWA 3HYRA 2EG5A 5T8KA 4A2QA 3LWDA 4DRYA 1G41A 2WF8A 3FKSD 1G5HA 4IUBS 2GVNA 4DNFA 2R44A 4K40A 1GPH1 2AG1A 3BE4A 4XIGS 4XPZA 3TG2A 1R6TA 4FZ3A 1YR1A 5L7TA 3NAZA 3K71B 1Q84A 2JI7A 1Y8AA 3IRVA 1B00A 1SVKA 4WNIA 3GCGA 3I42A 3CHYA 1RLJA 4FGSA 1Z06A 3RARA 1OLSA 3NIDB 4IDQA 3KZKA 4K5QA 4OKNA 4UNQA 5SICE 4JVNA 2WT9A 3VR1A 1W1IA 2HC9A 2R5NA 3AIMA 4EJ6A 3T0GA 1CETA 4X45A 1CY8A 5CIWA 4DG5A 3GA5A 4C76A 5ISMA 3IQIX 4IRUB 2QUHA 4QO8A 1CY2A 1TYDE 2VA9A 1LV8A 1K0UA 2F3UA 4N6OA 4N8EA 5DOVA 4XCQA 4MHSA 4PVCA 1XCBA 2F1JA 4CIXA 1RXUA 4K9DA 1GXSB 4EA7A 1XXHA 3DT8A 3HDVA 1WV1A 4WZAA 5CLHA 2ZRKA 3HDTA 5NULA 3I01A 3QHQA 3FLAA 3CRQA 3ZU5A 1E4YA 4Y6QA 5D6OA 2WD7A 5CFQA 1CXZA 4HSGA 4OD0A 4I5DA 4BFLA 1SKBA 3GRKA 2IS1A 3P9SA 3BJZA 1GT6A 1ECPA 4LI3X 1DVRA 2X6RA 4Y2UA 4AI6A 1E2QA 2B99A 3EVCA 5D00A 2M1ZA 3KKZA 4WMLA 3LGAA 2PKYX 5DHRA 5LP6A 4YBRA 3ZGZA 4L5IA 3RIGA 1RRCA 1E6EA 1VYVA 5KBYA 4GU5A 1BSVA 5HKKA 5IK2D 1V6SA 2Y1FA 3I01M 4MUXA 4PSUA 3OQMA 3U4QB 5EQTA 2VOJA 2YBEA 5SY6A 2O23A 1HPLA 1ZIOA 2G80A 3EIWA 1OT3A 4AK9A 4HLUA 3PXGA 4EB0A 5GY7A 3L06A 4HWKA 2GJ4A 3PJFA 4OKSA 4A5OA 2NZJA 2X6QA 2HNAA 2QT1A 3A37A 3N8HA 4OIFA 1MX5A 1JE0A 1RCTE 1GLGA 3N5CA 5FULA 2FSHA 5IBRA 1WOYA 1MR3F 1JHMA 5EL0A 4JI2B 5HCIA 1EUCA 1X80B 5EQFA 1MEOA 1XR3A 4IJ6A 3IH5A 3TCNA 4GAEA 4G5OA 2ZDHA 1ZRSA 5KKCA 3CRMA 2ZBVA 2BR5A 4PLVA 4A03A 4J3JA 2G9UA 4KN8A 2B83A 1S8FA 3R75A 3REQB 1X38A 2CL6X 2PCJA 3N0WA 2P4UA 1BC5A 5CK4A 3G88A 2K7ZA 4I99A 4F9GA 1Y5RA 2H1RA 4MROA 1PJCA 3IAAA 2ZRCA 3PVCA 3D1VA 3W3AA 1GCGA 1Z68A 3PJEA 3OE1A 1TT5A 3NV7A 1BQ3A 3H4IA 2LGJA 1JEOA 1CR6A 5SZIA 1I3MA 4Z0PA 5K6AA 4UXJA 2JLVA 1KIAA 2HPAA 1LK7A 4WBSA 1T2UA 2EXXA 3CRRA 3I8SA 3PP8A 2W6IA 4TTAA 1L5ZA 4LIPD 3RRYA 2IOFK 3H2BA 3OETA 3TUZC 2ZCJA 3LRPA 2PR7A 2X7JA 2H2DA 1LTKA 4BJ3A 1KPGA 4PTLA 1KK2A 3GUVA 4AJNA 2IE8A 2P0AA 2AFIA 1H0SA 3USZA 1W0JA 4MA4A 1JFRA 3AF1A 4CDRA 1FS5A 1K8RA 4IIYA 4EW6A 3QVJA 2BM1A 4J0GA 1JDBB 4LXUA 1AQNA 1NSFA 3RBZA 3GIDA 1SD5A 2AYXA 3A32A 5A05A 1Z56C 3RVSA 4C7KA 2Z30A 3D43A 3ZCXA 3ADBA 3FETA 2NPFA 4AM8A 3O75A 3EZ7A 5DP2A 8OHMA 1BWRA 1QIFA 1BXRB 2A9JA 2AEFA 2GK4A 2QYTA 3U19A 3R6TA 1H05A 1GPDG 4ZYWA 2Z2KA 4RD4A 4B3MB 2JJ1D 1JI0A 1QGUA 3NTVA 4P58A 2R96A 3NVMB 4QOGA 5F9HA 1CV2A 3G82C 5HK8A 4NJEB 4RZUA 4BQIA 2TYSB 1P61B 1N77A 3J7TA 1GQYA 2BGRA 2CNOA 4D9MA 3KQLA 1QX3A 2I8AA 1EDBA 5KJEA 3KXKA 1H2ZA 1XALA 3GY0A 4GIBA 2LNDA 4QYWA 5BT8A 3SQWA 3LC0A 5I5GA 1DX6A 1ZLXA 2BUAA 4MJ7A 3IVAA 1AV7A 1NNLA 4YJFA 3LPCA 4PXAA 2I3AA 4YXWD 3JYQA 3FJ1A 5J4KA 2ZRHA 3UB4A 4D9GA 2ZRNA 1I1HA 2ZAIA 3MMXA 1J0XO 3NWEA 2ZB4A 1CS4C 2A9RA 3CNNA 3OAAA 4YDRA 4D9EA 1NW8A 3BD9A 2OOKA 2QRLA 3P27A 4AQDA 5I3CA 2PNJA 1MJ5A 4P93A 1FSZA 1DKOA 3W9BA 5LJIA 1IJKA 1F20A 1T2DA 2B1GA 1TJNA 4AQYB 3AHEA 1SK8A 1JLKA 1NUUA 3ZDXB 3UENA 1S2DA 4QUBA 3VC2A 3E05A 4D6PA 4MLDA 5JZ9A 3ABZA 3NDJA 2XPCA 2UUBB 1JVNA 3L6DA 2QTCA 3C3AA 1OWOA 2NSJA 3EXFA 5EMLA 1RIFA 2BL4A 1SVIA 1FOEB 2DBZA 1L7QA 1ZESA 3HP7A 4J76A 3DMTA 3BMCA 1SUWA 4XASA 3T1QA 3GWGA 3FNBA 1RM5A 1GPJA 4EX6A 3OMWA 2GYVA 5DYIA 5FBQB 3RC2A 5EHQA 4LPKA 5FCDA 4BO8A 2C00A 2GEJA 4HQNA 5DGCA 4WY2A 4BZZA 3RG2A 2FF5A 4O3MA 1N1EA 5AK0A 1GL3A 3R23A 3C48A 5DNVA 2FEAA 4EY6A 3AZOA 4ZCSA 2YYSA 1AH2A 4NENB 4MUMA 2B2NA 4GD3Q 4NOMA 2X1HA 1Q7EA 3LP6A 4DCNA 4YMTA 1IYZA 2PSDA 4AQ7A 1GAQA 5DXFA 3D54D 1AF7A 2ZSJA 2R8RA 4WZAE 3EVGA 4F5YA 3HDGA 1ABEA 5I7AA 4TMXA 3IESA 1SVWA 2B34A 3P2JA 2ODQA 3E70C 4EEXA 1T2AA 2NM0A 1G5PA 1CUFA 4CU2A 4B45A 2Q5LA 5JNLA 1HTTA 1M34B 4A73A 1K7EB 4OK5A 3N53A 1ULTA 1WHSB 1Z6AA 4JC0A 4LMAA 1HT1E 4ZCPA 5CA0A 2BY4A 1Z3CA 3TIFA 4C14A 2ZS7A 1HE4A 1E2DA 2AYYA 5ILGA 1F2VA 3ODPA 1JILA 4NPAA 5TQ2A 5E6SB 3THXA 1JSLA 4Q93A 3ZR4B 5K0BA 2L69A 5JTTA 1HRDA 5FOSA 1SWWA 1E1QA 2QMEA 2VHXA 1ID1A 1WV0A 2XA9A 4P80A 3TNJA 1EEXB 3QX9A 4QEKA 3E8MA 5KCZA 1VG9B 3Q2KA 2C42A 4TXNA 3WV5A 1UJMA 2PXHA 4JJIA 4Y7CA 5P21A 4EY4A 1SBHA 3ETLA 5J2TF 2HIGA 5HRCA 5A7GA 1UJ5A 4ETNA 1JZQA 1PJLA 1W6UA 1YC5A 3D6FA 3W34A 4TKVA 3ZYCA 4PHHA 5CVUA 1VJCA 1NUSA 2PH3A 4C4RA 2XXJA 3VKUA 3I2GA 3JQEA 1YMVA 2PTHA 3RF6A 3M3PA 2WWFA 3DBHA 4R31A 4J03A 3UJNA 3TD6A 2BUBA 4Q3CA 2VL7A 3UAXA 1Q0TA 3U1BA 2FP4B 4OOFA 1DL5A 2JFPA 2MTBA 2YXLA 4V3CA 2H65A 3K92A 4DMLA 1I32A 4QX6A 2AUMA 3O38A 4X8LA 3RJMA 3VKWA 4RVFA 4C20A 2QZ4A 3BZBA 3SR0A 4WOPA 5EJ8A 4DM4A 5BQ5A 1CD5A 1X8LA 1NRWA 1UXIA 2J3LA 5EE9A 4WZBE 2YKGA 1MG5A 2NVBA 3B6KA 3BMOB 1QTNA 4J2OA 2OQVA 1H3FA 2F55A 4RIEA 2NTNA 2Y0BA 4LZJA 5KZMB 3HKBA 3CKMA 4X9XA 3ZTTA 1WLSA 1ZY2A 3RIEA 1SJ9A 2W6OA 1FSPA 4WK4B 1ONBA 1ONNA 2R6DA 3GELA 3T06B 5EMHA 1EXMA 4LSMA 3ELBA 2VT2A 3DMPA 4IZ6A 2WB4A 1Q11A 4D02A 4F3NA 3OP1A 5HE9A 1V4VA 2X4LA 4FZ5A 2YFQA 4LZZA 1QHYA 1NVEA 4BN5A 1WWKA 1EB9A 2I1LA 5ALDA 3FKJA 3I53A 3IBTA 3HA7A 1IOVA 2QVZX 1RVDA 2XVYA 1IN8A 1JLSA 3ML1A 3P2MA 2IKSA 1TADA 4ABYA 3QVVA 3N8IA 2P5SA 3V9PA 2I87A 4NECA 4O08A 1ZD1A 1N4AA 1EJ6A 4B3IA 4LVOA 2QRKA 3AT1A 1YK0A 4NZYA 1G16A 2XZPA 4CIVA 2C54A 3B1KA 3IPRA 5BSMA 1M6NA 2F62A 2BD0A 2UAGA 3GA0A 4WCFB 3KKEA 4PQGA 1ZW1A 4JLSA 4G97A 2A5GA 2Y1WA 3S29A 3DBLA 3GUCA 5BPFA 3B3QA 2PKWA 3JZIA 4MGIR 3K6KA 2YYYA 2QF7A 3RSFA 2VA8A 3TQFA 1RHRA 2IHZA 1P9NA 3KZVA 4XD7D 1E2GA 3NUZA 4Y2GA 2DBQA 4YWHA 1IY9A 2WJJA 4JX9A 3COZA 3CYFA 1FUYB 2HRQA 3RYHA 1XTZA 5HDQA 4YV0A 4L51A 4ZGWA 2YMPA 4CKYA 5AW1A 1N6LA 1QIHA 4TZ6A 3WAJA 2O20A 5EJMA 3UPDA 2LCIA 3RJ5A 1QQTA 4HQ6A 5E2BA 4HHEA 4MW0A 1N34B 4K7JA 1VKZA 1SCQA 1XD8A 1RYZA 5I6DA 3ET4A 3R3HA 4WKBA 4H2DA 1V9LA 4EK9A 2FZKA 1XZHA 4Y2QA 4PHCA 4BO3A 2ODNA 4OBXA 5EP2A 1OFHA 4MQLA 4ILKA 5SZJA 3T7JA 2EFGA 2XGJA 2TMYA 4N3AA 2DUMA 2BMVA 2YN4A 4KG7A 3LFHA 2VNAA 4JR2A 3M4JA 2JVKA 3H17A 3LNTA 3IBGA 2UUCB 1G1MA 4I46A 2XVMA 1ML3A 3VA7A 2ZRFA 4BMNA 3HBJA 4JJAA 4YRPA 4H60A 4RL6A 3NRCA 4NU8X 2EGGA 2GPSA 3LM8A