1SB8A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
341
Chain Sequence
MMSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords wbpP
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 127
structure length 341
sequence length 341
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb8A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb8A02
2Y1GA 1FMCA 3OFSA 3GC6A 1V3UA 1DIAA 4Q3AA 3WS7A 2A35A 3HZZA 3RUAA 4HFMA 2X9VA 3GNSA 3TFOA 1OZAA 1H6DA 3T7CA 3D5TA 1LNQA 1NFQA 3JQAA 3AFNA 2Z5LA 1P77A 4PLCA 2C07A 2PKQO 1UH5A 4B4OA 1ORRA 2VWGA 2C29D 2BFOA 3QSGA 1NQTA 1NASA 4MINA 4OQYA 3NKLA 3DBHB 5AYVA 4DBVO 2YHUA 2ZQYA 4EI2A 3I9KA 4IZIA 3GMSA 1X7DA 4TROA 1HYHA 1VJ1A 4JQCA 1N9GA 3RUFA 2V6BA 5ENDA 3KYDA 2VZ0A 4DREA 2BD0A 5BT9A 1HLDA 1XQ6A 4MVJF 2C54A 4HFNA 3STHA 5JCJD 3SLKA 1UZLA 5ICMA 2CF5A 1MP0A 3OQ1A 3ZU5A 2PKRA 4KOAA 4CLEA 3WMXA 1OOEA 2PGDA 4A2CA 1EBUA 3ZU2A 2ZTMA 3H5RA 1LRJA 4RVGA 1LDGA 1JKJA 2OXIA 1B15A 1ULUA 1W6UA 4HFJA 1LJ8A 1NM5A 1X0XA 4AJKA 2C2XA 3QJ5A 3W6UA 2GN6A 3CUKA 4UUPA 2NU6A 4JCOA 1SB9A 1XU7A 3BYZA 1P1IA 5IDXA 5TGDA 1RPNA 4XWYA 4ILKA 1YJ8A 4R01A 2QHXA 3PJDA 4BHTA 4BKRA 4WGGA 3Q9UA 3JQFC 5EERA 4NIMA 5CAEA 3CMMA 1WWKA 2QYSA 3AY6A 4KWHA 3ITKA 5HS4A 3UGKA 5BSFA 4EEXA 1KY4A 4H3VA 3WGZA 4KDFA 1E7YA 4ZQEA 1VJTA 3SLGA 4L4XA 1Y9EA 3WMWA 5B4VA 2R00C 2YV1A 3MJTA 4DQXA 1UZNA 5AXBA 3VAZA 4KTVE 3DBLA 1LDMA 2OFPA 4XA8A 1DC3A 2ZCVA 1P44A 1DJNA 5KVVA 3RFTA 3UCXA 4L8VA 4FC7A 1XG5A 1Q0LA 3H5NA 3PQEA 1N8KA 1T1RA 2V65A 1ZO8A 3OEYA 4PG5A 3WGOA 2Z1MA 2YW9A 4KP7A 2DQ4A 5C7IO 1HDXA 2PGLA 4XQ9A 6LDHA 1RWBA 4O63O 1RM0A 4BKQA 1PEDA 1IB6A 1H6CA 3EAGA 4DMMA 3NTRA 4FFOA 4OXNA 2LDXA 1MV8A 1LLQA 1NQOA 4NG5A 5A9TA 4G65A 2G17A 5JYEA 4B4UA 3WIDA 1G6KA 1YQXA 3CTMA 2QG4A 2RIRA 4YTEA 2JHFA 1TT7A 1CWUA 3AI1A 1BRMA 3PPIA 4BQPA 2HKIA 3DMYA 2GPTA 3DXFA 4QFCA 4I5DA 3H9GA 4PIVA 3TZHA 3WLFA 3E9NA 2HO5A 3IUSA 4EUHA 2H9IA 3AY7A 3ZWNA 1Y8QA 4PG6A 4Y98A 5DULA 3F5SA 1BWSA 3L4BA 3UHAA 4B7CA 3OJLA 4J7CA 1EQUA 2Q3EA 3I9JA 1U3TA 2OUIA 4YAEA 3ZWOA 3PHJA 3ZZNA 4YAIA 4ND4A 4CM6A 1PJCA 5FF9A 2IE0A 1DRVA 4NHEA 4EITA 4RF2A 1K5HA 4GGOA 2BFAA 4M54A 1IHXA 4PZEA 1MFPA 3CSDA 1ADCA 5IXSA 2JCVA 1MA0A 2GO1A 4WCFA 5T5QA 1QG6A 4JBHA 1YE3A 1KYQA 2DKNA 4I5GA 1KY5A 2AG5A 4B79A 4CM4A 3FPCA 4HX5A 2X5JO 3R3JA 3GHHA 2NV6A 4P8RA 2VNAA 4GL4A 2X0RA 5L45A 2JJYA 5HWSA 1D7OA 1JTVA 4IMPA 2ILTA 5KJ6A 1YGYA 1X0VA 1P9LA 4LN1A 3RC1A 4PG7A 3OJEA 4YQYA 3SXPA 1T25A 1GUYA 3G79A 3P2OA 2PZLA 3ZV5A 1QKIA 2EW2A 3KVOA 4EEZA 5KJCA 4IM7A 3JD1A 5JE8A 4J4HA 4MO2A 1GD1O 1HKUA 2PFGA 4R3NA 4QQRA 4BOYA 1SBYA 1ZEJA 2DUUA 5H83A 1CYDA 4XKJA 3IP1A 4XX0A 3I9OA 4M1QA 3WYBA 1CQJA 3ZI0A 3VC7A 2X0JA 4KUEA 4CV1A 1NPDA 2AXQA 1Z45A 4TZTA 1HETA 2G76A 4IDBA 4CV3A 2I6TA 4URFA 2CUKA 3FTPA 1ZUD1 5MGBA 1A4IA 3EUWA 5TRTA 4EDFA 1B2LA 4MJLA 2VCYA 2Y1DA 2FPIA 2P9EA 4I9HA 4BO6A 3H8VA 2GLXA 3CXRA 2GUGA 4CM8A 4XD2A 4K6CA 2VRCD 2V6MA 3I83A 3W4IA 4CR7A 3QE3A 3WNVA 1ISGA 5CDYA 3B6ZA 3PXXA 4FQ8A 1YDWA 3DO5A 3C24A 2TMDA 4H7PA 4NMHA 5L4LA 1EDZA 1HZZA 4OKIA 4AJLA 2Y0CA 3DBRB 4E5MA 3F9IA 3GEDA 4JJGA 1YO6A 2V7PA 3ANLA 3Q6IA 2GN9A 2Y05A 4PLFA 3ZW8A 2FY8A 4QECA 2AE2A 3RC2A 3LQFA 3PYMA 1SMKA 3RC9A 2X6TA 4ESOA 2AMFA 4FFLA 4XJTA 3KYCA 3M1LA 3RJ9A 1U7TA 2JFGA 3VH4A 5JLAA 1P31A 4CQLB 1JU9A 1NXQA 1B3BA 3VZRA 3K30A 3PJFA 4M89A 1V0JA 3T4XA 1NAHA 1NAIA 3HDYA 3SC4A 1ISHA 4ROSA 3LYLA 3V8BA 4KTTE 3E9QA 3QVWA 1TT5A 4BNJA 5DZSA 1XWFA 3C7DB 4Y67A 3EC7A 4OXYA 4NI5A 1LU9A 4R3WA 1VL6A 3GN1A 1HT0A 1ZFNA 4YEDA 3E6AA 1LDYA 5B37A 1UDCA 1XA0A 3WWZA 3DOJA 1DIBA 1RYEA 2QYTA 3RSHA 1DAOA 3KRTA 1QMGA 5JW6A 2NNLD 4YPOA 4EJ0A 3B1KA 3G49A 4JGBA 4UUNA 3R3SA 3JYQA 3AM4A 1E92A 1QLHA 5LDGA 1X1EA 5JAIA 1CIVA 3C7CB 4R1TA 5A04A 4FBGA 1YB1A 4CM9A 2BHLA 2WD7A 1NVTA 1U3WA 5DT9A 3I1JA 2BLLA 1W73A 4DL9A 2YYYA 1GY8A 4IZHA 1LLUA 1S6YA 1N7GA 2Q45A 1EUZA 1YB5A 2ZYAA 4AG3A 1IY8A 3LT4A 4TVBA 2ZK7A 2DTEA 4ONEA 3U62A 3TZCA 3S1LA 5JBIA 2X9GA 4L73A 3ZNNA 4F46A 1BXZA 2PLAA 2X1HA 4R16A 1I2ZA 1D8AA 4Z3DA 3JQAB 4R41A 3LT1A 1E77A 4Q3NA 3EVTA 5A05A 4KZPA 5I7EA 2AQ8A 4LRTB 3ZHYA 1JVSA 4DC0A 4QTZA 3E82A 2JCXA 5I7FA 3N58A 2RH8A 4YAKA 1NHWA 2X4GA 3CPSA 4DYDA 3A9WA 1FDWA 2IRWA 4BNIA 5U4QA 5L53A 5F1PA 3H9QA 3OIDA 1VC2A 1YDEA 2NTNA 3B20A 3ETEA 1C1XB 1B7GO 4U5QA 3AU8A 1Z7BA 5U9CA 3BZUA 3AOEC 1PQPA 3ZWYA 3EMKA 1M2WA 1BTOA 3QA9A 3Q2IA 2DVMA 1IZ0A 4BUCA 2NTJA 2C59A 1Y7TA 1OC2A 1KEUA 4JXKA 3ZGYA 1F8FA 3QVTA 2FN7A 3AFMA 5EN4A 2B37A 1UXIA 2OBYA 2J5QA 4J90A 4WLOA 3EDMA 3KXDA 3PJGA 4E21A 2NVBA 4M55A 4EBFA 2YV3A 1R0KA 4DLBA 1PWXA 1D4FA 4UUMA 3U4HA 3H9JA 4O1MA 4U0JA 3WB9A 3ZNOA 1UXJA 4U7WA 5DBIA 1ISIA 2PTGA 3VTFA 2I3GA 4BIIA 3DZBA 1B8UA 2GF2A 3OQ6A 3RI3A 1UJMA 1E0DA 5CFZA 2G0TA 4FB5A 1I30A 2H6EA 4P4LA 4DTIA 3SEFA 3E5MA 1E1MA 1O8CA 1ISJA 3CKYA 2CF6A 4RPLA 2JAHA 4FW8A 4ALNA 5ILOA 1ZXBA 3VVBA 3OIGA 1NPYA 2ZTVA 4KQWA 5I9LA 3KBOA 1MFZA 1XSEA 5F21A 3A4VA 3JQGB 4R1UA 5TT0A 3PRJA 1ZK4A 1EE9A 4TRRA 1PL8A 3D4NA 1DAPA 5JDCA 4AJHA 3H6KA 2NVWA 2VYNA 3GUYA 3K2EA 4IJWA 4OSPA 3WQRA 2NM0A 2ZJ0A 2J3IA 1EEHA 2WYWA 4JX8A 3DMTC 4U8GA 3BAZA 4WOKA 1C0PA 4XIJA 3NEPX 1IOLA 1JVBA 4EJMA 4GI2A 3WGYA 3DZJA 3T7EA 2CZCA 1Y5MA 4CLXA 1PZFA 1DLJA 1PS9A 3DFZA 3ZV4A 2QW8A 5AQ1A 2VHXA 5FI5A 1GYPA 4XR9A 5G2OA 5L40A 3ROMA 2BFMA 4NU5A 3RUCA 1YL7A 1PGJA 3KSUA 3OF2A 4II2A 4F45A 2VNSA 3BXXA 4NNJA 4WECA 1A72A 5T8KA 4Y6SA 2FRDA 1ZH8A 4L74A 3OEWA 4E2ZA 3LU1A 3EZLA 1O94A 1BDBA 4CMKA 2VOEA 2GASA 1WMBA 4YACA 4WE3A 1WPQA 2DU8A 4XGKA 5EINA 5ILGA 2HK9A 3G0OA 1HE5A 1SO8A 1X15A 5G0VA 4IQ0A 1IE3A 1I3LA 4RVDA 4Y6RA 3RIHA 1DFHA 4XRRA 3AM5A 3CZRA 2E49A 1EVJA 4GKVA 1L7EA 3DTYA 5BNFA 4LSMA 2E48A 3HSKA 2BGMA 4DBZA 2W4QA 3KLMX 4N5MA 2D5AA 2HJRA 1VKNA 4YDRA 2Q50A 3IKTA 1B8PA 2OHXA 1R0LA 5FFFA 4MVJD 1DC6A 3OP4A 2YFQA 5B1YA 4MP6A 2O7QA 4P4GA 3M1AA 4IINA 4ND3A 4QSMA 1LDEA 1H9BA 2P68A 4D41A 2HDHA 1IPFA 4WKGA 2EW8A 2H63A 3Q3CA 5JMPA 4PRLA 7ADHA 4CLRA 4J3FA 3GY0A 5JY6A 1KVSA 2IEBA 3ZWXA 2I3AA 2ZYGA 3W8FA 1K6IA 5JS6A 4AJ1A 5FEUA 1YKFA 3UKOA 3DB2A 1V6AA 1QXSA 1JWBB 5ER6A 2ZKLA 4DPKA 1U4SA 3D4OA 3CZMA 4KMSA 4D0SA 2PKQP 3NDRA 4PLPA 2HQ1A 4DVJA 2WE7A 1GQQA 4I9UA 3P2YA 2IYOA 5IXYA 1VE9A 2EV9A 3DZGA 3HB4X 1QYVA 1G1AA 1DDOA 2J3KA 3F47A 3P7MA 4W6ZA 2UUOA 2HK7A 2LDBA 2Y68A 3HADA 5L7TA 2QRLA 3G1TA 2XF8A 3PI7A 2VYVA 3U09A 4AJOA 1PX0A 5IDQA 3UH1A 1BGVA 4E30A 3PWSA 4Z9YA 4UEOA 4A27A 1R6DA 1MX3A 1MUUA 1QYXA 4GWKA 1ZK1A 5DCWA 4BGEA 1M6WA 1XCBA 3GHYA 3O8QB 3GDOA 4MKRA 1I3KA 3BIOA 5JDIA 5H82A 5EJ2A 1DRWA 2C2YA 3GT0A 1ID1A 4YCAA 4JP3A 3DC2A 1U2GA 3F5QA 1HDZA 4LRSB 4LGVA 4PCVA 2NUAA 1H6AA 1EDOA 4ZU3A 4BS9A 1RYDA 2C82A 3HFGA 3PYXA 3KZVA 3EY4A 4B4WA 1XU9A 3DBRA 3NRCA 1N1EA 5CDTA 2EP5A 4TVOA 2NTVA 4A26A 1R4NB 3K6JA 2DM6A 2DPHA 2GERA 3MJEA 4MKZA 4OM8A 3GF4A 4YJDA 4PLGA 3PJEA 1CETA 3WYEA 5BSHA 3D0OA 4K1LA 3ZHXA 4GVLA 4EZBA 3ONFA 2PY6A 1XDWA 2HCTA 4CQLA 4WLVA 3KLPX 1GQ2A 4RPJA 3ASUA 5T57A 1DXYA 3VH3A 5CG2A 1K6XA 4YVFA 1PWZA 1O6ZA 4NFHA 3MEQA 3VZSA 3LK7A 1LEHA 1U8XX 5DNAA 1CEQA 2CVQA 4OXKA 3E03A 3K9QO 3TL3A 4BB6A 9LDBA 4IQGA 1I24A 3VZQA 3K96A 3VTZA 4D7AA 1T2EA 1GYRA 3JCZA 2CNBA 1A4UA 2B83A 1YWGO 5IF3A 4EW6A 3W8DA 3D5QA 4E6PA 4I5FA 1LC0A 3ZWBA 3FF4A 3H3JA 4L4RA 3S2EA 1Q0HA 4LMPA 3JQ7B 1I2BA 3QWIA 5B12A 1E6EA 1T2AA 2OZPA 4TKMA 3K92A 1JW9B 2HMSA 1M6HA 4DYVA 2Y1FA 3GDGA 5DP1A 3VH2A 1M67A 1T4DA 3IOYA 3DHEA 3UXYA 4NQZA 1O9BA 2BELA 4NBUA 4BQRA 1GPDG 1I01A 4BNUA 5CDUA 4X54A 3L6DA 1N1GA 1CJCA 2EWMA 3EGOA 4QFDA 1WMAA 4K6FA 1MXHA 5JO9A 2YJZA 2VQ3A 3JD0A 4BO4A 4NBVA 3DZIA 4E3ZA 1MGOA 5KJ1A 3V2HA 3QVOA 1E3WB 2CVOA 3MJSA 4YQZA 1YS4A 3GZNA 2YUTA 2PD3A 3ZHBA 3NDJA 4CQMD 5TJHA 3GPDG 4FSHA 4CR6A 3TSCA 3JD2A 3U49A 2AEMA 2GN8A 3OA0A 4HXYA 4BV9A 3IP3A 2YDYA 3AWDA 1HE3A 4Z0TA 1HSOA 4PZDA 1C1XA 3BHMA 3TPCA 4L75A 5DCYA 4WJZA 3WYCA 4PLHA 1T26A 3E18A 2DC1A 3AUAA 5K6AC 2O48X 1WAMA 4CMEC 1I36A 3K5PA 2P9GA 2B4RO 4UULA 4RVUA 1IUKA 5BNTA 3FI9A 4J49A 5IN4A 4XRGA 1P0CA 4A73A 1W8DA 1R0SA 1WDLA 1RKXA 4WEOA 4DA9A 1PJQA 1PGNA 4J1QA 4NK4A 3KOUA 5TJ9A 2FWMX 3EK2A 1VL8A 4ZA2A 1PS8A 4FFPA 4BNZA 1EBFA 4FGWA 1TLTA 4OYRA 1QR6A 1VSVA 4MIOA 2E82A 3I9NA 1QV6A 3GG2A 3QWFA 1Y8RB 3ZNQA 4XYEA 2RBEA 1PR3A 1LX6A 3CE6A 1ZZEA 2O50A 2CMDA 2VHWA 2VT3A 1N92A 3DL2A 4NPCA 2X58A 3RFXA 2FR8A 2H5LA 2BKAA 2HU2A 5EL0A 2NVUB 3RROA 4CMCA 3PWKA 4RDHA 4FCCA 5A3JA 3PHHA 4GSKA 4ZD6A 2IXAA 3GG9A 2CFCA 4S3MA 3JQGA 4GQAA 2JKVA 3FWNA 4QEDA 3QWBA 4W7HA 1K2WA 2IZ0A 1BVUA 5F1OA 3VZPA 4CMAA 9LDTA 3NGXA 3UW3A 3GVPA 4Q3DA 1Z6ZA 4IMRA 4BNLA 3EHEA 5C5IA 1UXKA 4HP8A 4BGUA 1KVUA 3RQSA 4J4BA 2UV8A 3O03A 3PHIA 1FDUA 1FXSA 3BTOA 3H3FA 1F06A 4CMBA 1JWAB 2OORA 4E32A 3LSYA 1UR5A 4D79A 3AI3A 1KETA 3M6IA 2Y99A 5DBGA 1NHGA 3AUTA 4CL3A 3F1LA 2P4HX 4YT4A 3QY9A 5JC8A 1E6UA 3PFFA 5TSDA 8ADHA 2FHSA 3GVIA 4J7UA 4B7XA 4EYEA 2R6JA 1DBVO 2XXBA 2NLOA 4LK3A 4IPTA 2Y67A 3P19A 4W7IA 5F5NA 3VHRA 1YBMA 1SZJG 3ZU3A 3H4VA 1QYCA 4O5OA 1QP8A 3AU9A 5CDGA 1BG6A 3OSUA 4L4SA 4NR0A 4BO3A 3U4IA 1MG5A 1HF3A 4DQVA 1CQIA 1A5ZA 1ENYA 3NTQA 4GMFA 3I6QA 2AEFA 3G3EA 3H9EO 4HFRA 4GX2A 3ZWAA 4CJXA 5IJZA 1UDAA 4AJ2A 2XOXA 3PQDA 3RKRA 1GU7A 3GVHA 3H5AA 4AFNA 4BNYA 4BNMA 2HLPA 4LISA 3FRJA 3X2EA 3C3XA 4CLRB 5JCXA 3FWZA 5KNLA 2JCYA 4XZ3A 3GK3A 3IDSA 3IJRA 1DC4A 4OIMA 4OQZA 3WBBA 5KJFA 2Z1NA 4FJ0A 3ZDFA 3HQ4O 4E13A 2Q46A 3OA2A 4UVEA 7MDHA 3K73O 1Y1PA 2Y0EA 3DR3A 1DC5A 2Y1OA 3T4EA 1Q7GA 4QXMA 5BNIA 4J16A 1BHSA 3LVFO 3KHUA 1EK6A 4Y8VA 1BVRA 3JQBC 1KERA 2HMUA 4GBJA 4N7RA 4W9NA 4CPDA 4NZ9A 1Y9AA 3WFIA 4RPKA 3K2BA 5CG1A 1H0KA 2VZ8A 3GLQA 1NPTO 2O3QA 2JHGA 1GUFA 4MDHA 4MVJE 2FSVA 1DRUA 1C14A 2ZB8A 3GA0A 3AOEA 3GH3A 3ZNPA 2YHIB 5B4TA 1VI2A 4XGIA 1ZSNA 1KC3A 5I9MA 5G0UA 4RVFA 4BO9A 1EVIA 1PJSA 1DFGA 3DDNA 1GAEO 4NFYA 3WGHA 2I9PA 4B3JA 3D3WA 3HHPA 3NT2A 3E5RA 1KC1A 1ISFA 3NT4A 4NDNE 2Y93A 3ANNA 3GGOA 5ENVA 2PK3A 2A4KA 4B3HA 1PTJA 3VVCA 3WGGA 1RM5A 4MOWA 5JNLA 1EMDA 4TRMA 4WLNA 1U3UA 1X1TA 3E8XA 3UCEA 1VRWA 1H2HA 2HUNA 4IDCA 2V6GA 2I66A 1L1FA 3UAGA 1ADFA 2R2GA 2AHRA 2Q2WA 2Y66A 3GFGA 3O8QA 3GPIA 4HNHA 5JPIA 1MXFA 3OBBA 3EVNA 4IXTA 4BNHA 2HJSA 1IZ9A 4AJJA 1WP4A 2GR9A 3IAHA 3UCFA 3I6IA 1I3MA 3WLEA 3Q11A 5IZ4A 1EUDA 5JCJA 1J0XO 2UDPA 4DIOA 3MJVA 5EQDA 4AJPA 3FR7A 4E2WA 1ISMA 1PJBA 4RCVA 4IDAA 3U5TA 1O0SA 1PZEA 4RPHA 3UUWA 1R4NA 2C20A 1XYGA 2RAFA 4GAEA 3AM3A 3GRKA 2B4TO 4TQGA 1C3VA 3WTBA 3NDIA 4IJKA 4WUVA 2PA3A 3UVEA 2HAEA 3WXBA 3BA1A 4YAJA 1Q7BA 1F0YA 1C0IA 3B1JA 3JD3A 4CLHA 2IEDA 5K0ZA 3NJ4A 3V1UA 1NNUA 1B26A 1HYGA 3BTUA 4E5NA 5IDYA 4UVGA 1LA2A 3IQDB 4PLTA 3ANMA 1XKQA 4KUHA 2VZ9A 1U4OA 2WD8A 4XYBA 3GN2A 3ZW9A 3HB5X 4E0BA 4HUJA 1JKFA 1I5RA 2WWRA 1HDRA 2WTBA 2GN4A 3WGQA 1F17A 4ND2A 1IYZA 1KOLA 1GL3A 5H81A 1S7CA 2Q49A 3RC7A 3GVCA 2BFPA 1WNTA 4JJFA 4C7KA 1OFGA 4CLDA 3Q2KA 3JQ7A 3WWYA 3GFBA 5KWEA 4XR4A 5ADHA 4YT8A 4E5KA 1BXKA 4L76A 3RBXA 2Q1TA 3VPHA 3C1TA 1H93A 3ON5A 3LLSA 3NX4A 3W8EA 3C85A 3L4BC 1CERA 1ONOA 5KKAA 1UDBA 3TFQA 2DTDA 3B1FA 5TLSA 2J6IA 2ZTLA 5BR7A 3EYWA 3GZNB 3RUHA 1KS9A 3OM9A 3ZCXA 4BO8A 2W2LD 4IXWA 5C7LO 3W4JA 4MVJH 4Q3BA 4GWGA 1ONPA 5G0WA 3TJRA 1CDOA 2C7VA 2D8AA 3IS3A 3PP8A 4DPLA 1PZHA 3OETA 1AUPA 3I52A 4F6LA 1E3WA 2JD2A 2O3JA 1E3SA 2PWZA 1DOHA 1Y6JA 3O38A 3FBTA 1HTBA 1J4AA 2UAGA 4WCFC 1R15A 3AK4A 3GVXA 3WQSB 2Q4BA 3TDKA 1GV1A 3E48A 1EFLA 1BXGA 5GZ1A 4CM5A 4CMGA 4YJGB 3HN2A 3JQ9C 3WDSA 1X7GA 1AXGA 1QYWA 1XEAA 3DBVO 3FD8A 1E3IA 3RVDA 1U3VA 4NK5A 4ITUA 2YFHA 3BMNB 5A9SB 1RJWA 3C1OA 2OMEA 2VTEA 4OSOA 1YL6A 1J49A 3W1VA 1PJ2A 4J6FA 4JK3A 1AE1A 3NYWA 3LF1A 1LRKA 1ZJZA 4M87A 3CMCO 1HDOA 5DOZA 2RH4A 1VLLA 3GAFA 1KBZA 3ZV3A 2VHZA 1TB4A 4HKTA 2QX7A 1WZEA 5A02A 1IL0A 5BQFA 3JQDA 3S2IA 3UOGA 3WGTA 4CV0A 3TZKA 1HEUA 2IZ1A 3CINA 5CEJA 5GZ3A 4INAA 3INGA 4FIZA 3CH6A 4CUJA 1YQDA 1Y8RA 1WZIA 3ASVA 3FNHA 3IJPA 1CRWG 3WGIA 3DEYX 3RFVA 3AOGA 3AUSA 3VKVA 1HLPA 2NVUA 2QQ5A 3WR5A 5KIAA 3LF2A 5CEEA 4E5YA 2E4AA 1GTMA 2NADA 2HRBA 4DMLA 3FBGA 1KVQA 5I8WA 1N7HA 1P74A 4NJOA 4YRAA 4UVHA 2HRZA 4TZKA 5IZCC 1LDBA 4Z0HO 3HNPA 5DN9A 1AHHA 4I9NA 1DIGA 1YL5A 2CVZA 2AEJA 3CEAA 3PTZA 1JN0A 2D2IA 2Y1EA 3RBZA 3TRIA 3RU7A 2POQX 1ENZA 1MLDA 1NBOA 4FGSA 3GQVA 1H9AA 3GOHA 4KUGA 4FOSA 3OMLA 3RU9A 3TOXA 1BW9B 1UXGA 1MG0A 3OECA 2P5YA 5EQFA 3F1KA 2HK8A 3A06A 5G0SA 4JP2A 4WK6A 3AUUA 4WNIA 2D4AA 5ER9A 5L4SA 2VRCA 4BO5A 2X9NA 3DONA 4J0FA 2Q1UA 2P2SA 3KM0A 1PSDA 2FPGA 4AVYA 4PRKA 5A9RA 2B69A 4L9RA 3JQAD 3FNEA 1B14A 5JC1A 3PVZA 3U0BA 4UVIA 1P1HA 1EVYA 1E3JA 1YH3A 1LXCA 5ES3A 5JFOA 2ZATA 1FK8A 1C1DB 2F1KA 2Z95A 3PDUA 2JL1A 2DBZA 3WNQA 1JKIA 4J9VA 1ULSA 1ZK2A 5KTKA 5ICSA 1VKOA 4BKUA 5GZ6A 2Y0DA 3ZWMA 1NP3A 4ZQBA 4RF5A 1TA4A 2QRJA 2PGJA 1DO8A 4P22A 5EPOA 5HBRA 4JBGA 5HS6A 3S2GA 3UICA 3P5SA 4NU6A 3RWBA 1YB4A 4AJIA 4TMFA 1ML3A 2ZB4A 2Q1SA 4IY1A 1Q2XA 3OH8A 2TMGA 1ZBQA 2WDZA 4BMNA 2FR0A 3I4FA 4RVSA 1GQYA 2EP7A 2EJWA 4IDDA 4R4JA 2QZZA 2PH5A 2CD9A 2EGHA 1EVZA 4YT5A 1ZMOA 1NFRA 4R1SA 5FI3A 1X13A 4TWRA 4WOJA 1HYEA 1T2FA 1D1TA 2DFVA 4S1VA 4ZQGA 2FR1A 3DTTA 3GNQA 4RF4A 3N74A 1OMOA 1LTHR 1SC6A 4PZCA 3UFXA 3VPXA 2IXBA 4G81A 4IIUA 5AXCA 4BB5A 4FJ1A 3PK0A 3DQPA 3BMCB 3HE3A 3DAFA 3D3WB 1YONA 4BVAA 1ZEMA 4EUFA 4H15A 2YHIA 4OJNA 3U3XA 5K6AA 3VPFA 4CMEA 4UEKA 3WQQA 3FTNA 3INRA 4UREA 1ADBA 3DHNA 2YQ5A 5LC1A 3WBFA 3FNFA 1U28A 3O26A 4J7XA 4EGFA 4NFSA 3ZWPA 5K9ZA 1NYTA 3OJFA 2B4QA 1YQGA 1P45A 4DUPA 3UF0A 2VWQA 4BO2A 2IZZA 1FF9A 1WLYA 2X5KO 4ZHSA 3MTJA 2DT5A 1ZCJA 3F6YA 3RUIA 5KOIA 1ARZA 3JTMA 3PLNA 3TZQA 5TC4A 3UN1A 3WOHA 3QQPA 2WEKA 3DZKA 1E1KA 3VH1A 3JQFA 4PLYA 4I8XA 5CDSA 3PQFA 2O4UX 4J1NA 1I8TA 3WSVA 2DAPA 1QLJA 2W8ZA 3L6EA 4N5NA 3FNGA 3OJOA 1QYDA 1N2SA 2R00A 2WYUA 4M86A 1JDJA 4LVCA 4OMUA 3ULKA 3ETDA 3EZYA 5TIIA 4CV2A 1PGPA 2V6FA 3GEGA 4JBIA 4F6CA 1BSVA 1I32A 2DTXA 2EKLA 2Y1CA 4RORA 5JMWA 5JDCC 1B3RA 4E5PA 4RZIA 4HBGA 5LDHA 4OKNA 1A9YA 4OOEA 4FDAA 4U6SA 5AXAA 4ALJA 3KSZO 3S55A 1UAYA 1XQ1A 4WPGA 3JYNA 4W4TA 1DLIA 2FPPA 2VN8A 3QP9A 2PNFA 4IDFA 1LUAA 3GR6A 4YRBA 5ITVA 1C0LA 2X0IA 5IN5A 2CDCA 1SOVA 3ENNA 3I9LA 1EQ2A 4EUEA 3DZHA 2P5UA 4YAGA 5L4NA 3HN7A 4GLLA 2PV7A 5I8ZA 4II3A 4JN6B 4R1NA 4PFJA 2YDXA 2VWPA 3HDQA 1DEHA 4MP8A 1RM4A 4IDEA 1IHYA 4DXHA 4PG8A 4M49A 3ZV6A 4CM3A 2OO5A 3K31A 1KEPA 1M66A 4MIYA 4ZICA 1P1FA 1ZK3A 3R6DA 2NQ8A 3L4SO 3LC1O 2GDZA 1NQAO 5EIOA 4YJFB 3A1NA 3U4CA 2DBVO 2UVDA 1XGKA 5T6BA 1GZ6A 4UEJA 1GEGA 1E7QA 1JQBA 4IQ8A 3FSRA 1K3TA 4IJUA 2C7GA 3GAZA 4CLOB 5U1PA 2YY7A 1I33A 4E33A 3ADPA 4Z3KA 4LSWA 4DLLA 3RBVA 3W6ZA 5A06A 5L95A 1UP6A 2OGUA 5IDWA 2VRBA 3BMQB 2ZIZA 4GVXA 2P4QA 3GMDA 2VTDA 1TXGA 2AE1A 2OBNA 2E6UX 4ND1A 4IUYA 4C4OA 3KUXA 1V9LA 4MVJG 1JAYA 4BV8A 4FPXA 1BXGB 1O89A 5KVCA 2HMWA 4YR9A 1OAAA 1HRDA 3PHLA 5F3RA 4A5OA 5A5EA 3JQ8B 2OOSA 2I5PO 3JQCA 1VPDA 2CDBA 2BGKA 2BH9A 1LSJA 5JAQA 3JQBA 2G5CA 3JV7A 4U0KA 1G0OA 3COSA 1SPXA 2D0IA 1YBVA 3C7AA 3QWAA 1E7SA 4YJGA 3H2SA 5COQA 3AI2A 2JAPA 2RHRA 1VM6A 1HE2A 1WXDA 4WLFA 1SCUA 4AJNA 5FYDA 3WG9A 3I4CA 2HMTA 1DHTA 1SEVA 1X14A 3TL2A 3KEQA 4MVJA 3O4RA 3BMNA 1D3AA 5A9SA 1U7HA 4J4TA 5JY1A 4FOOA 4Q3EA 2B36A 4GLOA 1Z74A 5DCUA 1D1SA 4QT0A 2AQHA 1PQWA 2E37A 3F4LA 1P1RA 4PLZA 4E2XA 2JFHA 3X2FA 1GPJA 1U8FO 1EUCA 1UAGA 1R66A 1IULA 1ENOA 1WW8A 4J1TA 2ZYDA 2QIOA 3JYPA 1PL7A 4D46A 3GEMA 3PFWO 1QSGA 1B8VA 4JIGA 5JDIC 2O7SA 1U5CA 5IFLA 2PD4A 2WMDA 2O3SA 1LSOA 2BF7A 3LC2O 4J2OA 1UZMA 1MB4A 2DFDA 2EKQA 2NU9A 2QRKA 2IYPA 1LQTA 5GMOA 5L7WA 1J6UA 3I5MA 3RASA 4IS3A 1I10A 3SC6A 4BNVA 5F5LA 5A1TA 3ICPA 3NUGA 2DUWA 3E1KA 3KTDA 4YWJA 3Q0EA 2Q2QA 5G0TA 3OIFA 5THQA 1SEPA 3PZBA 4ZN6A 1GEEA 4CM9D 5B4UA 1AGNA 1A71A 3FN4A 1ADGA 4NJMB 1A7AA 4D44A 5C7OO 1E7RA 2D5CA 1PR9A 2GRAA 2SCUA 4WLUA 2EKPA 1BW9A 4XIYA 3KSDO 2H1SA 4DIBA 3BTVA 3ZH2A 3DWFA 2OP0A 1KVTA 3WFJA 4NBTA 1AHIA 2PZKA 1PZGA 8LDHA 1N5DA 4RF3A 1UP4A 3ENKA 4GGPA 4J1SA 4XYGA 2HSDA 3MTGA 2O2YA 2YZ7A 3QW2A 1Z7EA 4NH4A 4DWVA 4PVDA 2Q99A 4RZHA 2FMUA 3GDFA 4OH1A 1OBFO 2EJVA 1PL6A 5COBA 4UAGA 5AOVA 4CMIA 1C1DA 3DOOA 1L7DA 3D1LA 4YB8A 5G4KB 3ZHZA 1NFFA 3H65A 3PIIA 4RPGA 1RM3A 4NBWA 2NU8A 3HDJA 3JYOA 4LCEA 1E3EA 4CUZA 2VUSA 1ZSVA 4R9RA 1LLDA 2X7HA 1DPGA 3S8MA 2ZQZA 1A9ZA 1E7WA 4PG4A 1VJ0A 1CF2O 1YOVB 4UVDA 2JFFA 1BDMA 4RO0A 4CR8A 1P3DA 1ZIDA 4RL6A 3D7LA 3QVSA 5IG2A 2YV2A 1MC5A 3BMOB 3ITDA 3DZFA 1LBEA 1ZNQO 3V1TC 3INTA 4O59O 4Q3CA 5I9NA 4IGEA 5HA5A 1R4MB 3F4BA 4K28A 4CM7A 4OO3A 1GCUA 1P33A 1V3VA 3PGXA 4OHUA 4AJ4A 4ND5A 2WSBA 4R69A 4RV9A 1DIRA 3G17A 3GUCA 2ZB7A 4Z9FA 3JQ9A 1O5IA 2GZ1A 4Q39A 1H6BA 3DHYA 1LRLA 4GX5A 4MKXA 4Y9DA 5LCXA 2I99A 3L77A 1Q1NA 4YYZA 2ET6A 3BMCA 3R1IA 2C0CA 4W99A 4I1IA 4I08A 5DF1A 5TNXA 1UXHA 4P4NA 2B35A 4Z6KA 1PGQA 5A3VA 3H7AA 4YBZA 5JAZA 2X22A 2VYND 3JYLA 1GZ4A 4XDYA 5L9AA 4QUKA 5CPFA 3ZN2A 3FR8A 1I2CA 1UP7A 2O3UA 1GZ3A 1EE2A 1ZKMA 2RCYA 3HUDA 2OP1A 2A94A 4XCVA 6ADHA 3RKUA 5A4DA 2DBRA 3NAQA 4CQMA 4BKOA 4AICA 1EK5A 4D0RA 1V8BA 1K6JA 3QVXA 4J2HA 3ROKA 3RAJA 2WM3A 4OGWA 4YJHB 2W90A 4FN4A 5EMHA 4BNXA 3ABIA 4RVHA 3NGLA 5F1KA 4QX6A 3MJCA 1FDTA 5TX7A 4ZQHA 2J8ZA 4YT2A 1LSSA 2JD0A 4NBRA 1F12A 3KB6A 1XIVA 2Q4EA 3KO8A 1ONNA 3JD4A 4KQXA 4CODB 1W4ZA 1SAYA 2B5WA 2GD1O 1ZW1A 3DMTA 3ONEA 4QO7A 2EERA 1A7KA 1HSZA 1Z73A 3KETA 2NWQA 3JQEA 4FFRA 2O3RA 3F3SA 2ZCUA 4D3DA 5DOVA 1I3NA 5IZCA 2C5AA 2RHCA 1E3LA 3TQHA 3MWEB 1XELA 3E9MA 2BI8A 3A14A 4BNWA 1PJ3A 1T4BA 2UUPA 2GSDA 2O3TA 3H2ZA 4FFNA 4G2NA 1E5QA 4I5EA 4KWIA 4MVJP 4JLWA 1I0ZA 1NQ5A 1E1LA 1E6WA 1NVMB 3PLRA 3QIVA 4E4YA 5BSEA 1Z75A 2VOJA 3WX0A 4BNNA 5HRUA 4FJ2A 2W2KB 1X7HA 3MOIA 3QRWA 3SX2A 4Z9XA 4ZGWA 3HWRA 4XQGA 1P0FA 1XLTA 3S2FA 2EF1A 2GGSA 1R37A 4JROA 1AXEA 4CMJA 1VSUA 3M2PA 1NTOA 3PGJA 1DIHA 1K89A 1PIWA 1MC4A 1GR0A 4C7JA 5KCZA 2J5RA 1U5AA 1NWHA 3V2UA 4GMGA 5AXDA 2DPGA 4B7UA 4DLAA 4MVJM 3L9WA 2P9CA 1H5QA 4DRYA 1WVGA 4ALIA 5A03A 5I7SA 5DBFA 5JSFA 2XPCA 1ZVMA 3LC7O 4YJFA 4GX1A 1TI7A 3A28A 3IKVA 4RGBA 1KIFA 1ZSYA 4BMVA 4CM1A 4WNCA 1U9JA 3KYBA 4LCJA 4RQTA 4TSKA 2VUTA 4CLOA 1R16A 2X5OA 1A27A 3D4PA 1QORA 1HL3A 3AW9A 2O4CA 4ZRNA 4D43A 4MVJI 1GADO 3BTSA 5THKA 2ZJ1A 5G4LA 4E31A 3BMQA 4N18A 4AJEA 1DHRA 2Q1WA 4BNFA 3MOGA 1PJTA 1NVGA 4CMHA 4N5LA 4IJVA 4HWKA 2VYVD 3N7UA 2DLDA 4BNKA 2I67A 1DSSG 4W82A 2D59A 2A92A 2EG9A 3HG7A 5MDHA 3IC5A 5JYDA 4IBOA 3HJAA 4RJTA 2G1UA 3JQ8A 3WJ7A 2UYYA 4Y6PA 1DB3A 2VUUA 3L0DA 1H94A 1B16A 4ALMA 4ID9A 3MJ4A 4XYMA 1V3TA 1HXHA 3QWHA 5C3MA 4B8WA 4OOFA 3PWZA 2JD1A 3Q9NA 4W9NC 2DBQA 1N9GB 4WEQA 3KYDB 4Z0PA 3VPGA 1XHLA 4B4VA 5HM8A 2WJPA 4XB2A 2ZTUA 4BMSA 4IS2A 4MP3A 1JLLA 4FC6A 4OAQA 5JO0A 3PZRA 3R0IA 3ZWVA 5CEFA 3VPSA 3DBHA 3PIDA 1ENPA 1LDNA 3C8MA 2GZ3A 3D64A 3HFSA 1AN9A 2I65A 2J5KA 2P91A 3RJ5A 1JA9A 2AA3A 5KKCA 4BNGA 2BGLA 2F00A 4WLEA 4D3SA 3U4DA 1BMDA 1T24A 3TN7A 3L9XA 4XJSA 2GNAA 2VT2A 2AW5A 4YA6A 1R12A 4A7PA 1KEVA 1NX6A 1U2DA 2NU7A 3JQ6A 2PD6A 3WSWA 1G0NA 4K26A 1J5PA 3TWOA 5L51A 1GYQA 1LSUA 4DGSA 3B70A 1ZJYA 3VDQA 3LT2A 3ONDA 1QRRA 3RUEA 4N54A 4BL5A 4LVUA 1HE4A 2FSSA 3V1YA 4CUKA 2AQKA 5CHEA 3ZU4A 4A10A 4O0LA 2B5VA 3DBLB 3GNTA 3I9MA 2EXXA 1FJHA 3Q1LA 1T1SA 3PHGA 4D45A 1LQUA 1PJ4A 4TRNA 1GCOA 1E5LA 1F8GA 1KVRA 2GZ2A 1P1KA 4A0SA 3FCOA 5DDIP 2EGGA 1VL0A 3JSAA 2FP4A 4BO1A 1OI7A 4NJMA 3SJ7A 3ETGA 5I7VA 3K8ZA 1PGOA 4LW8A 4PLVA 4XEHA 2WYVA 1QV7A 2D1YA 2WE8A 3QV1A 2FZWA 3KV3O 4KDEA 3TNLA 2X0NA 5TS3A 1PS0A 3NTOA 1KEWA 4M8SA 4BKPA 4K9DA 2W98A 1LC3A 3LZ6A 3OJ0A 2D3TA 3ORFA 3PEFA 1NR1A 4JJIA 1GV0A 4CMIB 1YXMA 4U6QA 2I76A 5TF4A 4GSLA 4ZJUA 3IIEA 2C5EA 4WASA 1Y8QB 1M76A 2A9FA 4A03A 5FWNA 1Q0QA 3F46A 3G1UA 1H2BA 1Q7CA 5ITWA 2J3HA 4P38A 3VDRA 5IAAA 4J91A 4L0QA 4J9UE 4CL8A 4LMRA 4RQUA 3ROQA 2ZB3A 3LLVA 4BGIA 5A5FA 5G4KA 3SVTA 2EIHA 1PU2A 5L3ZA 4ALKA 3HDHA 5KVSA 4J43A 3DOCA 4FS3A 3NV9A 5CPBA 3AJRA 4WCDA 4PGFA 2CSUA 1T2DA 2NSDA 4RLSA 1TVEA 1HDYA 1PJLA 2BMAA 5GY7A 3IL2A 3IMFA 5L7YA 1DFIA 4IIVA 3GGGA 4DQUA 4WCFB 2FZEA 4D42A 1YOVA 3I3OA 3H9UA 1XR3A 1IPEA 3MCVA 4CM4B 5KJEA 2X23A 3RD5A 2AQIA 3MWDB 4XQCA 4R54A 3BMOA 1F14A 1HDGO 3VOSA 1E1NA 3CIFA 4PVCA 1PQUA 4GKBA 4DC1A 1R4MA 4HNGA 1FDSA 1Z82A 4B8ZA 2X86A 5KVQA 1GUZA 4AL4A 2J3JA 3LT0A 2O2SA 5AVOA 1GFSA 1U1IA 3BHJA 4PLWA 3RUDA 1E7MA 5C37A 4ZRMA 1Y5RA 2VWHA 2VHVA 1ZXLA 1FDVA 4XGNA 2QZ9A 1WDKA 3ROPA 3ST7A 4D3FA 4E12A 4OL9A 5BSGA 4BGVA 1TEHA 5TQVA 1LI4A 3SJUA 1SB8A 3WIEA 4CQMB 2W2LA 1M75A 3NT5A 4PN3A 5DP2A 3WTCA 3L07A 2IDZA 4R5MA 3C1AA 1T2CA 3OICA 2PR2A 3DFUA 4GPD1 4R5HA 2EEZA 2CY0A 4IGFA 4HV4A 4ALLA 4R9SA 4QO8A 4BO0A 3IUPA 4H16A 2EHDA 4RLHA 3GGPA 3LDHA 4EJ6A 1HZJA 3AY3A 1WDMA 3SBOA 1SNYA 4HADA 1YRLA 4XB1A 1NWCA 3DAPA 4YJHA 4CM8B 5T67A 3DAGA 1EZ4A 3FHLA 2O23A 4DIFA 3FPLA 5CP8A 2FOIA 4MPDA 1YBAA 4FR5A 3ADOA 4BNTA 2B0JA 3TZ6A 3GRPA 4DPMA 3M2TA 5J23A 5HTOA 4TKLA 2OL4A 2IODA 1DJQA 2Q2VA 5JXWA 3MZ0A 1OC4A 3L6OO 3V5NA 1K0UA 3D3EA 5TT1A 3ZWWA 1ZK0A 2AG8A 1P1JA 4XDZA 1UUFA 2GYYA 2NQTA 2PZMA 3KYCB 2G82A 3PDJA 5JAMA 4ZVVA 1ZMTA 4YRDA 2VHYA 1V35A 3BHIA 3OHSX 1Y81A 3WJAA 3WICA 3RCBA 2PH3A 4IDGA 4UUOA 3OQBA 2NACA 4XYLA 3QLJA 4J0EA 1YVEI 3PYLA 1C0KA 4ZQFA 1JAXA 5T64A 2W2KA 1TT5B 4BO7A 4HY3A 5T8KC 1YJQA 4YXFA 3ICCA 3I23A 2HMVA 4MIEA 4RDIA 3TOZA 2X8LA 4B3IA 3ZWCA 3W4KA 1HWYA 1O95A 1HDCA 1EFKA 3KEOA 1W0CA 2YQ4A 4FFMA 1B0AA 4R68A 4Q9NA 2BRUA 4R51A 3U9LA 3TF5A 5COAA 2XXJA 3QHAA 2PZJA 2WD7B 4GX0A 4XQEA 1NR7A 3VKUA 4F3YA 1LLCA 4TRJA 3EW7A 4GH5A 4O6VA 3V2GA 4E2YA 1GDHA 2BI7A 4G5HA 3GZ4A 2GCGA 3O9ZA 4JNKA 4FD3A 1SOWA 2XAAA 3NJ8A 2CDAA 5EESA
chains in the Genus database with same CATH superfamily
5ARDA 1CRQA 1SBIA 1FJ2A 4B87A 4C30A 2NSJA 1M6NA 2FJPA 4ZP1A 1Y3FE 2A35A 3H4IA 4XARA 3HJGA 4X44A 2BE9A 1FPQA 2ATVA 2Q6OA 5K8TA 4CRWB 1GZDA 3RYFB 3WMEA 3PNQA 2HIGA 5B30A 1OZAA 2PH1A 2V54A 4MB2A 4HH4A 4KH1A 4URYR 3ZJVA 1SVOA 1LNQA 1QAMA 2XVMA 1NFQA 4CVNA 4QYMA 1Z4MA 4UBIA 4M7WA 3VR3A 4UCFA 1FOEB 3KZ1E 3VYTB 5GV7A 4C2UA 3G7NA 4YREA 3REGA 3G89A 3EUEA 3B1ZA 3MD0A 3MPUA 3H9BA 4W1PA 3IJEB 1ORRA 2ZIAA 2I1VB 3IPYA 1T5HX 2C29D 1IDN1 1A5BB 1NASA 1Z18A 5BO5A 3MJFA 2DY1A 2NO1A 3WNZA 2V0NA 2OHVA 4BXOA 2C5FA 2ZQYA 3ZUPA 4EI2A 2PRKA 1ZITA 1NN0A 1SIOA 1XALA 2XYVA 2R7LA 3HCOA 3I9KA 4IZIA 3K2QA 3KL4A 4US1R 1D2NA 1VJ1A 3FZNA 1N9GA 5DEOA 5AVYA 4NLLA 3EGIA 4KL8S 4BEJA 3UGQA 4C4AA 1PYDA 2QAGB 2DXIA 1HLDA 4MVJF 1IHPA 4YMUA 5F2EA 5LWHA 2JI6A 2PRSA 1P7VA 5JCJD 3SLKA 1UZLA 3AL3A 3OX2A 621PA 4BU0A 3QU7A 1JDSA 4PYNA 5IH3A 1L4GA 2UVQA 2WQZA 3P0EA 3ZU5A 4PAQA 2PKRA 4KOAA 4NZYA 3ZQ6A 3HCNA 3WMXA 2PGDA 3P9NA 4NNPA 3RSLA 5B5SA 1AOXA 2YZKA 3W0LB 2ATCA 2ZTMA 2VA8A 4RVGA 4WZBB 2OXIA 1U28C 3DDZX 4QTYA 4F4CA 1W6UA 3K6KA 4KN8A 1X0XA 2RIPA 4UAVA 1BX1A 2WJYA 4QGSA 1Y7IA 1OJLA 1SRQA 1XXHB 1DOZA 4CTKA 3CUKA 3IA7A 3S29A 1Y3HA 1EVKA 2CNDA 2NU6A 1F3LA 4JASB 1IG3A 4RSMA 5IKXA 5BW5A 2C04A 5EUCA 1V8PA 1E66A 1H8HA 1W76A 3CWQA 2QHXA 5JCOC 4NMLA 2QZPA 3IQZA 4YV7A 3ZGLA 1YDGA 3H17A 3PFGA 4TVKA 1AK1A 3ABZA 5KNDA 2EX4A 1JSCA 3Q9UA 2WLSA 3JQFC 5AKKA 3O4JA 4B47A 2C9OA 1ULHA 1BMQA 1A9QA 1Q19A 2QYSA 3ORYA 4Z4GA 2JLBA 4L8YA 5I51A 4LS3A 3RRJA 3TG8A 1BCSA 3CX4A 4H3VA 3WGZA 1TQ4A 3L6CA 1E7YA 3KDSE 1VJTA 1VHQA 5GVRA 1Y9EA 3FETA 3IMEA 4J03A 3MJTA 4CG2A 3MUOA 1B23P 1UZNA 5CT8A 5BN4A 1E4EB 3U7QB 2XCIA 4B74A 2VXYA 1QFZA 3DMGA 1DC3A 1DJNA 2EQ5A 4KPUB 3QA3E 3HYNA 5KVVA 4L8VA 5EE5B 5CLFA 1XG5A 3QMPA 1Q0LA 1TVKA 4Q93A 4YAUA 3U1BA 2KWIA 3ICWA 4PAOA 1N8KA 3OEYA 2V65A 3ZC3A 2WC1A 4JSYA 4PEVA 4PG5A 3KCQA 2Z1MA 2DQ4A 2LKCA 2WY2D 6NULA 2PGLA 4XQ9A 4HNUA 1U8AA 2PSEA 2K7FA 2GAIA 4J0CA 4JR0A 3PJRA 1NYLA 1EB8A 4HDKB 5K1ZA 4FFOA 3HB9A 2J9FA 1BOOA 1E2LA 3EXG1 1AK2A 1Z17A 2YWGA 3AF5A 1LLQA 1NQOA 3N8DA 4FCTA 4MGIR 4QXOA 3U4GA 3HJUA 2FH5B 4MQUA 1L6RA 1H8ED 1N4DA 1N8SA 1XZEA 3ENQA 4B4UA 1M8FA 1JE1A 2QG4A 3CRNA 1RAIA 2RIRA 3NI2A 5D51S 3ZLAA 3AI1A 3EXHA 1SXJE 3JR3A 2HKIA 3A4IA 1Y1LA 1ZICA 4N7BA 4QFCA 3G23A 5FH9A 1Z0IA 4R1LA 2HO5A 2H9IA 4E5UA 3ZWNA 3CNEA 1ZQ9A 2R8EA 1ECCA 3LO8A 5EZYA 3WWDA 1C4OA 2PQMA 4BQQA 4Q82A 3JZFA 1EQUA 1UJ5A 5KYUA 4MW9A 5F23A 1NW6A 2ONYA 1YCDA 2C7QA 3FSJX 3GXBA 4II7A 5JROA 4ZQIA 1Z6TA 3PHJA 4D80A 5FUXA 1PJCA 4H7JA 3R4VA 1DRVA 3MGGA 1IXKA 2R68A 1XDBA 2QOEA 3OOWA 3AIIA 1O4WA 2FB9A 1HT2E 1K5HA 2XE8A 4FFWA 2VJOA 4V2IA 1CZOA 1V25A 2MMCA 2H7VA 1ADCA 1D04A 3CSDA 3S6JA 2BR3A 2C4HA 2QMYA 4GKJB 1Y98A 1JP7A 3GUZA 3HUEA 2OB1A 1H85A 5B57C 2FGKA 2JCVA 1MA0A 5IHXA 4RTOA 1QG6A 2A9VA 3STVA 3U7RA 1YE3A 1KYQA 1ZKDA 3B5JA 3E4DA 1KY5A 2AG5A 3KTAB 3MB5A 3HZHA 4PYMA 5AHKA 5B1SA 4HX5A 4B79A 3G5AA 3R3JA 5A1JA 5KWVA 4DR4B 4NG4A 4QL3A 4B2LA 1EJ2A 3VV3A 2GYVA 9ABPA 1UJCA 3LX8A 4KRFA 2NXNA 3F67A 3MFYA 3DNMA 4IMPA 2JCGA 3QVUA 3B8EA 2ILTA 3C41J 1X7WA 4I4CA 1K8YB 1RIFA 3BRWA 3K6SA 1ABEA 2JARA 1AKQA 1X0VA 2H11A 4W9RA 3RC1A 4PG7A 3ZW7A 3N87A 4IOJA 4UUBA 3E5NA 3WL5A 3CLRC 1NW5A 3OM0A 1JQ3A 1GUYA 2KBEA 2VBFA 2PZLA 4OMDA 5AK3A 5F52A 3RH0A 1QKIA 1U0EA 4EEZA 5KJCA 4IM7A 5EIFA 3BILA 4RMNA 4RIIA 1PVVA 3MERA 1KYXA 4KVFA 2D7CA 2QTWB 3LGSA 4R3NA 3HCRA 4ES6A 2GDJA 4QQRA 1SBYA 4PNEA 4O4JB 3G0HA 4N8EA 2JAQA 1CR0A 5FIUA 1ADJA 5K0TA 3IOBA 3BWYA 4M1QA 1YMQA 4ZMSA 3V1MA 3VC7A 3C6YA 2X0JA 4C20A 4EL0A 4TSFD 3UV7A 3NKFA 2Q5LA 4X00A 4M0KA 3IDQA 4A5SA 4BEBA 2AL7A 3DD1A 1AG9A 4ZTBA 4Z8XA 1CHNA 3FTPA 2WUFA 3UMSA 4JJKA 5TPWB 1A4IA 1G60A 1RXSA 1XEWX 2P78A 2FWNA 3TLCA 3A6EA 5JYBA 5BNZA 3MTQA 4IEFB 1RR6A 5IEBA 3CT4A 4QZVA 3P45A 3NCTA 3OHPA 3CXRA 3AP3A 1CUAA 1POXA 1NNI1 1U94A 1ZG3A 3GW8A 2VRCD 3ZXUB 3W4IA 5KMGB 4I7EA 4JXXA 1ZMXA 3O3NB 3QE3A 3B2EA 1ISGA 3PTLA 4GFDA 2PMEA 1G5HA 2REQA 1UJ2A 2Q7DA 3WNVA 4R40A 2X4DA 4G37A 4MW1A 3SZUA 4H7PA 2F64A 5BYAA 2NTYC 1AV6A 1HZZA 4OKIA 1QGED 1JU4A 1F51E 2XWBF 3NOQA 2H1HA 1AD2A 1OH5A 1RDFA 1RJEA 4BRWA 1TIPA 4GOXA 4QYTA 2V7PA 4IILA 4NAVA 3WLRA 4EPTA 1ZVKA 4QECA 2IGTA 3RC2A 4PSVA 4COKA 3W77A 4IHJF 3I76A 3RC9A 2FSGA 1PV2A 4B73A 5I45A 2AMFA 4C07A 1L4YA 3E22B 1U7TA 2OBBA 2CHFA 2ORVA 5BSMA 4CQLB 4CIBA 3IPXA 3FUTA 1XCPA 3PJFA 1MOZA 1Z33A 4DLKA 2W2PA 4O2LA 3X1MA 1NAHA 1IPHA 2ZI6A 4MI3A 1ISHA 2HOQA 3SC4A 4UNQA 1WSDA 3V8BA 2A0UA 1JSXA 3JWJA 1I9CA 4EGQA 1DOAA 3E9QA 2OCBA 1I5OA 2V7GA 1FRVA 2O0JA 3KNZA 1JRLA 1ZESA 5DM1A 3FVQA 1TCVA 1XWFA 1UBSB 2XJ4A 3C7DB 3RWOA 3T9CA 4OXYA 2VJBA 1FXWF 4BV2A 2P9QA 2RG7A 1ZFNA 3E6AA 1QIKA 1NW3A 1P7YA 1RCUA 4EJSC 2J3QA 3BJRA 1KDYA 2IS6A 3TJZA 2BLNA 1NIPA 2W93A 2AB0A 2VJMB 2MSDB 3ADKA 4C4TA 1GT91 2QYTA 3KKOA 4CNQA 1CUVA 4QXRA 3MUFA 6PFKA 1MJGM 4I4TF 3GJ6A 4A8HA 4QE3A 4EJ0A 1KO4A 1H2RS 3G49A 2RGXA 1K5PA 1WDWB 2QTLA 3N6XA 4F6RB 4EO4A 3AM4A 3RVRA 2UYHA 1QLHA 5LDGA 1X1EA 3OTHA 4LHWA 1CIVA 5AKHA 4EHFA 3IR5A 4PFSA 4CM9A 4GWLA 4Q7EA 5HZMA 5CBKA 1KI6B 2WD7A 1NVTA 2IA5A 1VQ1A 1OF1A 2C8KA 2JVIA 3DF9A 3I1JA 4DL9A 2YYYA 1GY8A 3GA5A 1YZUA 4TKVB 3PRKE 2OPHA 2Q45A 4PQRA 1YB5A 1ST3A 5IBCA 2QRVA 3Q5DA 4TVBA 1Y7HA 1OLXB 2DTEA 2V8OA 3NEAA 2P41A 1WR8A 3LCMA 3QI7A 3W3AH 5JBIA 3TZLA 1OTHA 3U3KA 1BXZA 4KPEC 4R16A 1UBUS 2HM7A 3OAAA 4R41A 3N7AA 4Q3NA 4KN5A 3QKUA 5DYWA 4AKTA 5A05A 3BEDA 5J5CA 4OHVA 1AB6A 2AQ8A 4MX8A 3PHBE 2IYLD 3ZVNA 3TLXA 1E2QA 1QNLA 4QTZA 1PQ4A 1XYVA 1UKZA 3N58A 4AMZA 2RH8A 1NHWA 4RNDB 2EGUA 3GLHA 4UDXX 3THYB 2C95A 2YJ6A 3TSYA 3AETA 1AKVA 1VYTA 5U4QA 3HU1A 1KSGA 3HU2A 4FNOA 5F1PA 1M2VA 1VC2A 1YDEA 1W2HA 3MS7A 3RSCA 7REQA 5LFAA 5F3WB 2GMWA 1HPLA 1B7GO 1GARA 1KFBB 3NONA 4IKPA 1FU8A 2ZG6A 2GPWA 1J9GA 1T8TA 4HZUA 3SYLA 1Z7BA 2I29A 4TQ9A 3V34A 3AOEC 1A50B 1K3FA 3JVDA 4QUGA 4L57A 4BUJA 2P6UA 4HWSA 4BGDA 1BTOA 1MVNA 1P2VA 4KE9A 1FYVA 2XLBA 1MOQA 1OC2A 1KEUA 4I0WB 2BGRA 4GXTA 4WUTA 4YDSA 5DX8A 5AVSA 5B58T 5IX8A 1W5FA 1GR1A 1G3QA 4LBVA 4PZ0A 5AMXA 3MG9A 3ANYB 4EBFA 3B3QA 3AHFA 1SCQA 3KJZA 2C5HA 2QEQA 2O2GA 3EGXA 4MQFA 4DLRA 1XZCA 4BYMA 2FZCA 4DV7B 4WKPA 3R0XA 1E5DA 1NZDA 1FW8A 4BLQA 2IHVA 3ZBQA 1V7PC 1B8UA 4DADA 1QS0A 3RI3A 1GA4A 1NVFA 3JQQA 1E0DA 1XT6A 2G0TA 4RPIA 1DQPA 2QI9F 4Q1AA 4IHQA 4K1XA 5KHOC 2XZTA 2XD4A 4X60A 3T7JA 3ABRB 1W5EA 3GMTA 4RPLA 1R5JA 1T9GS 2JAHA 2D1RA 1NJGA 1ZXBA 2P5TB 3A2NA 4RV4A 3OIGA 1VKZA 3UH0A 4BJ5A 4FFVA 4KQWA 2RB4A 1F2VA 2R1ZA 3A4VA 4R1UA 5TT0A 3KR2A 3X44A 3PRJA 4L4YA 4QAQA 1Q0RA 4LE0A 3D4NA 5HIIA 3AL0C 4L9AA 4G5YA 5JDCA 2XUGA 1M2FA 3H6KA 2NVWA 1J9ZA 2O5RA 2QV7A 2YOHA 3DYVA 2PZAA 1JTEA 1SXJD 3GUYA 3IEIA 4K46A 3COJA 4EFNA 5B6JA 1GVNB 3GRAA 2J3IA 1R6XA 2WYWA 2XMPA 4MWZA 1A9PA 2M6LA 1M1YA 1TO2E 4XIJA 3CVUA 1XL1A 3Q5EA 1IOLA 1JVBA 4JBNA 5IVDA 4AMGA 3RODA 3WGYA 3T7EA 1SD1A 4DW8A 1PZFA 1DLJA 1H65A 3REFA 2QW8A 2XB4A 5AQ1A 4AULA 1GYPA 4MWTA 1USWA 3BWBA 4REQA 1L5GB 1G20A 2BFMA 1A5SB 1U31A 3BL6A 3N2ZB 3KSUA 1PGJA 2ZU0C 3OF2A 4G01B 4YUAA 5EIAA 2BCJQ 1N34B 1PEKE 2ZRDA 4NNJA 5T8KA 4HVLA 2C7RA 1NIJA 2H9AA 5I6DA 1QQTA 2W2OA 3KKLA 1YZHA 1TTPB 4M2LA 4E2ZA 1D0VA 2R8PA 1O94A 3QTBA 4I1VA 3KZMA 4CMKA 2HV8A 2GASA 1WMBA 1MH9A 4Y1EA 3ND6A 5FPQA 4YMWA 3NBKA 1NMQA 1WPQA 2DU8A 2P62A 1W9HA 4XGKA 3HZOA 1M2JA 5EINA 5ILGA 3R7SA 4BLRA 3H5OA 3FHOA 1T43A 4ARBA 5EJGA 5CH5A 4D9JA 3MLEA 1WZUA 1HE5A 3KALA 1FTSA 4Q3LA 4M1SA 5G0VA 4YP6A 2WWIA 1SOMA 4JDUA 2EFDB 5CUQA 3WLAA 3SE7A 2E49A 4PAMA 1NLMA 2EBWA 1L7EA 2MR5A 4GP7A 4V3BA 5CW1A 3KZNA 4DDUA 1W96A 4MQMA 4HOYA 3L8HA 1ORVA 1WSBA 1GIAA 3DLBA 1WM1A 4HDOB 4H6XA 4M9RA 5CH3A 2XE7A 2D5AA 4YDRA 5EZSA 1DPFA 1P4HA 2QG9A 3T5AA 5FFFA 4ER6A 3N2EA 1AA9A 1DC6A 4FBMA 3GCWA 2GPAA 3IQWA 3VSEA 2O7QA 3G2IA 1OTYA 3M6FA 4HJXA 4DA0A 2ST1A 3FPKA 2ADOA 1N0VC 1IAQA 1G8FA 1L5ZA 2VTBB 1LDEA 1QO0A 1T9HA 3K8OE 4G8BA 4GC9A 5CGZA 3N2IA 2ONKA 3VNAA 5AW2A 3WKBA 2QSZA 3EIFA 5HFJA 2DFPA 2X4LA 2HN9A 4DLUA 4PRLA 3PFKA 2IKQA 3NASA 2YXNA 3CGWA 1GNSA 2VK1A 4AP9A 4M9QA 4HDQB 3GARA 3W8FA 5ALSA 1HI9A 1K6IA 5JS6A 2JA1A 2GPBA 2WB4A 4FB4A 1YKFA 2BSAA 3MRVA 3H83A 4QTUB 1SKUA 5HKKD 3DB2A 1V6AA 1KZYC 3FFBA 3VMFA 5B7PA 5IK2D 1QXSA 4EAQA 2WHQA 3JASB 2XLCA 5ER6A 5MN4A 1JE0A 1U4SA 1F20A 3CUVA 4H08A 2GM5A 2Z8YM 1RPJA 4KMSA 4OF4A 4Y1RA 4D0SA 4CEHB 3NDRA 1QGDA 5L3QA 5J2UA 3ZHQA 3NVDA 5E6SA 1GQQA 3RVPA 4IFTA 3W5BA 2IYOA 1XZLA 1YZ3A 1VE9A 3IMCA 1QHSA 1O3YA 4JAVC 2KI5A 2CNOA 2LTAA 1NONA 1Q0UA 1DEAA 1QYVA 2ATEA 5KPJA 1ZD9A 1KNQA 3MCTA 3P9IA 3VYVA 4ZEVA 2HK7A 2LDBA 3KOWA 2P3OA 3HADA 1QANA 4TMKA 3IAS6 2XF8A 2YNMD 1JQJC 4C01A 3U09A 3Q7RA 3DLHA 1G38A 3KSBC 3S0JA 4O4JF 4H1TA 1U8YA 1MT0A 4Q4AB 2OFXA 3N8HA 1QYXA 5HPYB 4GWKA 3UWKA 2A14A 4BGEA 1HDIA 1EFVA 1LV8A 1M1NB 3FPFA 3HO8A 3CPJB 3S70A 3O8QB 4HXGA 1M54A 2I87A 5JDIA 5FQOA 4EYGA 1PG2A 3QJGA 4OQNA 2Z30A 1C3XA 2C2YA 3GT0A 2ZDGA 1ID1A 4YCAA 3M5DA 2O8BB 4GYYA 1EYZA 5KEIA 1G21A 3HV2A 3FWYA 2DHQA 2PMCA 3EE6A 4NU0A 1GZVA 3VMMA 3F5QA 2WFMA 1GG9A 2OD2A 4S1TA 1A2BA 3ESCA 1WVIA 2D54A 1EUDB 3A2LA 1RYDA 3GYBA 3V8VA 2ZJAA 1LI5A 4O29A 3FH0A 1JB1A 3EY4A 5BN3A 3DZDA 3DBRA 3NRCA 1N1EA 1W0JA 5CDTA 4NYIR 2BM8A 5E3HA 2DUMA 2J59A 2WKRA 4BMZA 3F6EX 2DPHA 1V96A 3U3OA 1FSZA 2IEGA 2IHKA 3CRVA 3KIPA 1XTQA 3RADC 1IBSA 2GI4A 3DEJA 4PLGA 4PXSA 2D6FA 3VI4B 4XTRA 4ZOLA 1TA9A 3RIXA 3ER9A 3BOSA 2CBGA 1M2OA 4WLVA 1X42A 3KLPX 3MT0A 4NU8X 5FOXA 4BJ1A 3HN6A 4FZRA 1F2UA 1K6XA 4YVFA 1PWZA 3VZSA 1FLDA 4NFHA 3ZUGA 1LPAB 5TS2A 1U8XX 4BCDA 5DU2A 4BWFB 4OXKA 4TWJA 2EZ4A 2D06A 1V5EA 1SU8A 4XXHA 3FJOA 2IKSA 2Z4RA 3E03A 3K9QO 1XMXA 4Y1GA 4ZODA 4MRMB 3CLSC 4X24A 3SHOA 4AX8A 1I24A 4DV1B 1G7RA 1OROA 3K96A 4D7AA 5LIRA 3H5LA 4FD2A 4RX1A 4QTXA 3D7KA 1N25A 4LXUA 2B83A 4L16A 4A2QA 2WJHA 3QSYA 4ARZB 3W8DA 3DFIA 1A1VA 1IY0A 2QL5A 5C81A 2XBUA 4I5FA 3FF4A 1X86B 4MB0A 4L4RA 1R9MA 3S2EA 3INNA 1Q0HA 3M4JA 2GVNA 3JQ7B 4KO8A 3MINB 3QWIA 4LMPA 4M8KA 5B12A 1IWPB 1V7QA 5E38A 1I14A 1E6EA 1T2AA 3E9YA 4RJ2A 3PPVA 3FWKA 1SXGA 5EXPA 4WFIA 2OV3A 5M3BA 1N36B 2XDQA 1FQJA 3WLPA 1G41A 1I6LA 3VH2A 1M67A 1T4DA 4IKOA 4X1KB 2VRWA 2WFLB 3DHEA 6YASA 2FP3A 2GZRA 4YC7A 3UK6A 1M3SA 4RKQA 2JDIA 1N57A 4EHDA 8AT1A 3E61A 3QFHA 5J4HA 3FDZA 5HJEA 1EM8B 1PKEA 5BW4A 1E1CB 1JHPA 1I01A 4KBGA 4LXYA 4S1NA 2X9QA 4BNUA 5CDUA 1N1GA 3E3MA 4KR6A 3EGOA 2EWMA 4M46A 5AM4A 4K6FA 4Y9RA 4LKOA 1L5VA 3JD0A 2FPOA 2XUZA 4KQGA 5KJ1A 2X42A 3V2HA 2A0YA 3QVOA 1ZX1A 1E3WB 2PX8A 2JASA 2WK1A 1O6GA 1RW4A 2XH8A 3MJSA 3NBYC 3WHIA 4ARVA 3ERCA 1YS4A 3GZNA 3AHCA 3V3KA 2JCSA 1GRNA 4R2KA 4CQMD 3GPDG 4QUEA 1MJHA 2PH7A 1OLSB 3U4MA 5EXXA 4ISBA 1RVDA 3JD2A 3U49A 1JZQA 4HWGA 2AEMA 4HXYA 4JUIA 4NJEB 3F96A 2YDYA 5D87A 3M9LA 3A1SA 1JR2A 3AWDA 3PWTA 4JU8A 5I8PA 4Z0TA 3QG5A 1U8UA 1C1XA 1RRPA 4L0DA 3GP5A 4IH4A 3TPCA 3W5HA 2F4VB 3IHLA 5DCYA 1TCUA 3WWPA 1R00A 3OJWA 4NYMQ 4PLHA 5H59A 4XTCS 2DC1A 1V4NA 4GR9A 1E62A 4LRQA 5KAMA 3K5PA 5D5QA 1NC3A 1BU5A 5IMBA 4E5DA 4QYSA 4C78A 1IUKA 3NXKA 4QVGA 4YS6A 1Z0DA 4DXAA 4G5GA 3GJZA 4TKZA 3KSMA 3VDNB 1P0CA 1KI4A 1W8DA 1C1HA 1RKXA 2ISSD 4HDSB 4D57A 4PYQA 4TMVA 2I2DA 4YIKA 3M6VA 1E4YA 5HIJA 2IYFA 5TJ9A 1VL8A 4EMTA 5IMSA 2V7QD 1A8PA 2EKZA 5GV8A 1BVHA 1XEXB 1M7GA 2ZR8A 1QR6A 2Q7OE 3W7VA 4FTWA 3IAS1 4TLDA 4D5GA 4CQJA 1LPMA 3PS9A 4CEIA 1PR3A 4X0EA 2JGKA 4D2IA 1JDPA 1Q12A 2CMDA 3D4BA 4LRUA 3DL2A 4NPCA 2Y76A 3PF9A 3SKXA 1ESNA 2FEXA 5AW7A 1ILEA 4UFOA 2BKAA 2HU2A 2WIDA 4KIJA 3G8BA 3H0CA 2NVUB 1U9IA 3RROA 3T41A 1ZJWA 4D4MA 5C53B 4LXGA 2XHEA 1YDFA 5FWAA 4RDHA 3UK2A 1EA5A 5BQOA 4HAWA 2CHEA 3MW8A 4D8XA 3RUPA 3G5MA 2R4TA 3D6JA 4GSKA 1Z0SA 4ZD6A 2PUFA 1E98A 2H7YA 1R0RE 3WHKA 1BDJA 4UMVA 5GTDA 1DG1G 2JI4A 1K2WA 4QGGA 4W7HA 4X61A 4YRQA 4K9LA 5F1OA 5FYQA 3UQYS 1IVSA 3MTDA 2X5XA 3O8DA 2W6JA 2ZRCA 3UBTA 5ALPA 4EG6A 5JJLA 3AGPA 3V6LA 3OKFA 2RG1A 4BJ6A 4BGUA 2PSJA 5EIEA 4B32A 1YCGA 2QUKA 1UANA 2OFOA 3PDWA 4BX9A 3KB8A 4AS2A 4XIFA 3LRTA 4L1KA 1JKMA 3BTOA 1FXSA 2MSEB 1ZMRA 2RI6A 2B3DA 1F06A 1STOA 1SWVA 1JWAB 2OORA 2ZJBA 3DP9A 1QE0A 3LSYA 1UR5A 3NANA 4UD6A 2NYVA 5K05A 3A3KA 1ADYA 1YJAA 1UINA 2FV8A 1NJ1A 2X7JA 3DW3X 3GRVA 3OZEA 4H18A 1T15A 3P2JA 1H0HA 4KO3S 3TNFA 4G07A 1ZGJA 4L27A 3F1LA 2P77A 3AF1A 5CVDA 2BPOA 5DW0A 4AB1A 2CL7X 2OBFA 1MZVA 2R86A 4CKXA 4GZ6A 5KNCH 5ECDA 5TSDA 8ADHA 1XTJA 4D9FA 1V5IA 3KYIB 4WOPA 4S24A 2Q5QA 1SKYB 2NMVA 2IP4A 2X2PA 2IBMA 4IPTA 4Q37A 5F5NA 1Z26A 2GJKA 5TMBA 3VHRA 1Y5IA 1C7RA 2BVNA 3HHEA 1SC1A 3OQVA 4JB3A 4JYMA 4PHFA 5GP1A 3WRWA 3H4VA 3ZU3A 3CZ4A 3ZCPA 1PT9A 1QP8A 4KHZA 1ETHA 4UQOA 3OSUA 4KDCA 3LDGA 4NR0A 3WRYA 1C3JA 4BO3A 5AVRA 7AT1A 4JX9A 4RS4A 1C7FA 1VFNA 4U2BA 1MG5A 2BRUC 2BHSA 4J0QA 1VIYA 2NV0A 4PANA 1HK7A 1YAHA 3F0TA 4N6NA 1A5ZA 4Y9UA 5TGZA 4F72A 2J41A 2AJCA 1ZVQA 3IR7A 3NTQA 4GMFA 3UXEA 3AJDA 1CV2A 1E0SA 2BKEA 1DJLA 2XX3A 4KU4A 4HFRA 3N3AC 1NURA 3GGCA 3R41A 1UDAA 4MVCA 2CJYA 3C7TA 4ND8B 1E2JA 1Y4AE 1A5TA 5CVVA 4E5SA 2W2MA 1FX1A 4U7HA 2H07A 2IHTA 5C9ZA 4BNYA 4BNMA 2O14A 4QUJA 4F7WA 1U2EA 2GA8A 3H42B 4LISA 3T7SA 1H4QA 2FF5A 3FRJA 3GQBB 3U1VA 1JYFA 5BR1A 3RS2A 3ZGXA 5JCXA 5LP6A 1BWRA 3GK3A 3BE4A 1DC4A 1KEZA 3IJRA 1L5HA 4WXMA 5BSUA 5L3SB 2Z1NA 4U2EA 3RE1A 1Q20A 4GKAA 1E58A 4ZCSA 3OA2A 3OZGA 2JGDB 4DUGD 2Y0EA 3CKKA 3DR3A 4IV8A 3TDMA 3WA6A 3WLLA 3B2NA 1DTEA 2RKBA 3R24A 1T10A 1L7AA 4NZNA 1PK9A 3FYCA 1SCDA 4LNHA 4OQFA 4XM1A 3CH4B 1BHSA 2A5FA 4OQEA 4PZ9A 1UMCA 2E89A 3TQQA 5DM60 4DLWA 1EK6A 2GEBA 3R3WA 4Y8VA 5EHIA 5FBWB 4X63A 3JQBC 5LYJA 5BOSB 5FX2A 1KERA 4GBJA 3UFXB 1E4VA 2LUOA 4MUYA 3K0SA 1H0KA 2HQRA 2VZ8A 2O3QA 3G0IA 1EHCA 1GUFA 3FKSA 3GZTB 2OAP1 4GOND 4ND7A 2ZB8A 1C14A 1KJWA 4KYTA 4URVR 2WSIA 1U9YA 3A10A 4TPKA 2IYQA 4I55B 4QIHA 4TXLA 4LDPA 2RBKA 4BN5A 5I9MA 3AP2A 3PE6A 4BO9A 1EVIA 1ZRSA 1A8HA 1GDTA 4EO7A 3W06A 4NFYA 3R7DA 1FFCA 3WGHA 4B3JA 3E5RA 3BICA 1IBMB 2PKYX 3DA8A 5EGSA 2ETXA 1IXSB 3GB9A 2J31A 4MI1A 1EVEA 2R7MA 3E1SA 1O6FA 4IP0A 4KB5A 3OPYA 1ETUA 4HDRB 5IUNC 3CVYA 2GCNA 4AYXA 2A4KA 1DX6A 1PTJA 3E9EA 3WGGA 3EDOA 4MOWA 4ZI7A 5BOVA 2FDCA 5REQB 1A2KC 1EMDA 1UIRA 2E18A 1X1TA 3DYIA 3E8XA 4WLNA 3UCEA 3BE8A 3DYBA 1BC5A 3CLSD 2V6GA 2FF7A 3H2YA 1ADFA 3G82C 4HEJA 3KR9A 4XI9A 2RC5A 1TMOA 1FC0A 1RHQA 4XLZA 2AYYA 2NZ2A 1MXFA 4P2GA 4ACAA 1SQGA 2UZ1A 2VHCA 4GM1A 6REQB 3TLYA 5B1HA 1XNJA 2GXAA 1K8RA 1WSAA 2OQIA 3R9IA 2GR9A 3UCFA 3WQBA 2BISA 2G40A 2AR7A 4EB3A 4WNYA 3UXMA 3AF0A 2MYTA 5DWVA 3WLEA 3Q11A 2ADFA 4AY4A 3NALA 2YRFA 3MJVA 3E8MA 2QJFA 3ET4A 1RZRD 1J22A 1RBZA 2JJ2D 1MAAA 3AF2A 4CCYB 3HI6A 1PZEA 2XUFA 4Q6BA 1DAHA 2QNRA 3D6UA 4RY9A 4RBNA 1E2FA 1NRXA 4XSHA 1SD2A 4OG2A 4ZAXA 4IJKA 2QT0A 2CV2A 2OCYC 3C16C 3GFSA 2XB6A 3SR0A 2C8VA 3VO8A 3WXBA 4I46A 4EIWA 4I2NA 2JANA 2VSYA 4DNXA 1NNLA 2EW1A 2RKWA 1CY6A 1F0YA 2REOA 3EDYA 2Q5FA 3B1JA 4CLHA 5KQGA 2IEDA 4ZYLA 3RWMB 2V3WA 5JVDF 1G17A 4H7KA 1MPTA 2Q4OA 4GP6A 5E0KB 3ZVMA 1Z6QA 2GCPA 2ZEJA 3BTUA 4HGPA 4I4IA 5SV2A 4HLUA 4IDUA 2FX5A 2FMKA 2PEZA 3IQDB 4PLTA 4KUHA 5TR9A 3UWOA 1K8XB 1U4OA 2GJAA 4WWHA 1G2OA 3I32A 2FWAA 4E0BA 3SHTA 1R3UA 1I5RA 1SQ5A 4LY6A 5B2ZA 2GN4A 2BI4A 2XW6A 5JRJA 1N77A 3HKBB 3FOBA 1TF2A 1XNQB 1GL3A 1M34A 1KEKA 1LNZA 1R6UA 2AF4C 1Y80A 2CLFB 4DMGA 1WEKA 5CK4A 2IHNA 1BVYF 5EZ5A 4ZAZA 3AZPA 3DE4X 3Q2KA 3WP0A 1C30B 3CPHA 3AHGA 3EXHC 4YRSA 5KNBA 1UBMS 5KWEA 3ZR4B 4IX1A 2H0QA 3EGDB 3M83A 2VDUE 4WMLA 1RQNA 2Q8NA 4D92A 2I4NA 4B3SB 2GKOA 1JHAA 2Q1TA 3C1TA 1VFPA 3EEIA 4XFJA 5HJ2A 3UZUA 1GA1A 3NX4A 4I81A 3FVVA 2A3RA 3C85A 3OM8A 5KKAA 3L01A 1I80A 1UDBA 4RXUA 2O1EA 3I12A 4PNHA 2B78A 1NVVQ 4UHEA 3ZCXA 1O77A 2YIDA 3BN3A 3LUBA 3OM9A 2AFHB 4FWIB 1I13A 4KV7A 5ALWA 4B6RA 3FB1A 1U11A 2X9LA 4YRTA 2GFIA 2XSZA 2HA2A 4UASA 5EUBA 2P79A 1E1QA 3TJRA 1JR4A 1P5RA 4YWHA 3VGJA 1G2QA 4AKHA 5C7YA 1PV4A 3OETA 5IAGA 4F6LA 2VDKB 3HBJA 2JD2A 2ASVA 3EYAA 3ILHA 2PWZA 3FG9A 5KAPA 1YNOA 1Y6JA 3EASA 4KXVA 3FBTA 4QARA 1J4AA 3HM9A 4IZ6A 3WQSB 2B82A 5JSQA 3A4YA 1IEQA 2Q4BA 4Y9TA 3UHOA 4G36A 1Z8HA 1KHHA 4UXJA 1L5RA 5CNKA 4ZHQF 5DBHX 3MXTA 4ZO8A 3A6PC 1WB4A 2C1XA 3O1JC 1KZHA 4OM7A 1TJPB 5INTA 2UXBB 3ZBUA 5KOHA 3WDSA 1U0LA 4O3MA 5JFGA 3CF4G 4QNNA 3F9CA 3OTOB 1NLFA 3O90A 4V1CI 2IP1A 3DFKA 1UT5A 1E3IA 1CRZA 2QNIA 4L08A 3WRXA 1WCIB 3MS2A 3PEWA 1C7JA 1GGEA 1U3VA 2AR0A 2TECE 3IPLA 1A4XA 1TK3A 2VDRB 3B78A 4WX2B 2YFHA 1M2NA 3FFTA 4YPVA 5A9SB 2VTEA 2P1DA 1C2TA 2GTPA 4YUZA 4A1FA 2HRQA 3QVJA 1F2DA 1MORA 2QVYX 4HRXA 3T0IA 3VU0A 1PJ2A 1U1FA 1AE1A 4R71A 4XLLA 2XA9A 1A69A 1LRKA 3BIJA 3Q7TA 1T1GA 3FGPA 2X8JA 3THOA 1YQEA 4PXAA 2XJ9A 2EIXA 5DOZA 2BTQB 3GAFA 3O47A 2ZRKA 2R1VB 1KBZA 1DIOB 5DEIA 2WHYA 4HSEA 1FFGA 3OPMA 2VJLA 3IQGX 3WGTA 3UOGA 3EEFA 1SBZA 4HMOA 2X2OA 2BEVB 3TZKA 1J2TA 4UAUA 2IZ1A 1ELOA 2WAYA 5CEJA 2BM9A 5I5EA 1R5OA 2G09A 3Q9SA 1YQDA 3NHAA 4F2WA 1NVAA 2PJZA 3EAFA 3G0DA 2OCAA 1GZ5A 2YWEA 2W42A 1CRWG 1JJBA 3SJBA 4U8HA 2AX3A 3WGIA 4FGLA 3LE8A 3OUZA 4GOLD 3UO8B 2UUCB 5C8YA 1IONA 3VKVA 2W11A 5IBRA 3KPYA 1HLPA 3SSAA 5KIAA 1UADA 3P2MA 1JHVA 2J0EA 3LF2A 1AGRA 1IY1A 2J3MA 2LXNA 3DQZA 3SC3A 5HBGA 2W5UA 2NADA 4P5PA 1UDWA 3CW2A 1FS6A 1TZKA 3R5JA 2CUZA 2D2FA 4OV6B 5AOCA 1V48A 1Q3KA 4G67A 1CDDA 1NT2A 3K0KA 1W0KA 5FA5A 2DRIA 1N7HA 5IASA 3HZRA 1P74A 4NJOA 4AWBA 1HZZC 4UVHA 4YRAA 4TZKA 1IZ7A 1LDBA 1P62B 1YR6A 2BEUB 4NOKA 1KQNA 1AHHA 5FHRA 2FK7A 5AVZA 2X2FA 4ASUD 1M5TA 3HTXA 2QT1A 3KUCA 5A62A 3WBKA 3P5BA 1JN0A 4EJSA 2POQX 1NBOA 1MLDA 3Q3HA 1I7PA 4L5AA 4KUGA 5ALKA 4W5RA 1NDUA 4MYHA 3TOXA 4X20B 3BCHA 1W4BA 2GZMA 3OECA 5EQFA 2J6BA 1CEXA 1X7YA 1YQ9A 3LQ1A 5TQ0B 4UEWA 3LPMA 4RVCA 4JLOA 2GTIA 2ZJZA 1BHO1 4HBZA 2IYVA 2COUA 4EY7A 4LBWA 3LGXA 3DONA 4J0HA 5JH7F 7ABPA 1PSDA 1QX3A 1A04A 5KU1A 2BFEB 3WQHA 4UCQA 1TD9A 1QTRA 3M6UA 3HXOA 5A9RA 2QZ4A 3DKPA 4D4JA 4HQOA 1XF1A 2X3UA 3DVRX 3H16A 5J63A 4MEBA 1CUEA 4ZAVA 3DBIA 1EZ1A 3KE9A 3UIEA 4AWAA 4YUWA 3TG2A 5JC1A 3S1SA 4I50A 3PVZA 5DM4A 1HUQA 1W25A 3VR3D 4RD3A 4D6YA 1P1HA 1NG9A 2CK3A 3CX7A 1LXCA 2ZSFA 1HLFA 4RJKA 2H2AA 3A3PA 2XT6A 1BWPA 2JJQA 2BFFB 1XTKA 2F1KA 2ZBUA 1GQOA 3PDUA 3RIEA 3WNQA 1JKIA 1FLAA 3G1WA 3LVQE 3WA7A 2EATA 4LWZA 2ZETA 1MZPA 1IOZA 5FPSA 1ZI9A 1R6AA 1K2VN 2AD5A 1M2KA 5EHXA 4Y2UA 1Y8ZA 4JI8B 1K4MA 3L93A 3RS3A 3ZWMA 4ABYA 3M4YA 1NP3A 2C2HA 1TA4A 2GJ8A 2GX6A 5EPOA 3CHYA 5HS6A 3UICA 2HJ9A 2XTAA 1GAJA 4NU6A 4LOIA 3RWBA 3MJHA 1F4LA 4AJIA 4CKWA 2ATIA 4KXWA 1ML3A 5EWLB 3QEKA 1Q2XA 3SP1A 3CZAA 3ZS8A 2ZBQA 4HC4A 3ZBPA 2FR0A 2JVKA 2QE7A 1V5GA 4TQUS 1JVNA 1PLKA 3K9GA 1FFXB 2EJWA 3LUGA 5KX5B 4EABA 2QZZA 4XDGA 4WKNA 2PH5A 5CBPA 3Q9LA 4Y1FA 3DMFA 2YJ3A 1ZMOA 1FBNA 1NFRA 4YT5A 3MAGA 1X13A 4XVUA 1UK8A 1V8FA 1D1TA 2R97A 2IFTA 2DFVA 1H8HD 2BH2A 1OXBB 2WJGA 3ZK7A 1H1DA 2JGNA 4LHEA 4LE2A 1X2EA 1LTHR 1SC6A 2ZT6A 3AONB 3ZE7A 2IXBA 5AXCA 4IIUA 4BB5A 4C0LA 5K6TA 5KNDD 2J87A 3IVCA 3W5UA 3PK0A 4CU2A 1QWSA 3BMCB 5EI5A 1HOTA 3FA2A 1COWD 3KOOA 3WYAA 5IJXA 2ZJFA 3DAFA 3D3WB 4DIKA 5CFQA 4EUFA 4C3OB 2QORA 5K6AA 2Y9MB 4LF4B 5IH7A 2B8TA 5CA0B 4UEKA 3KU4A 1GNVA 1UBKS 3QFTA 3WQQA 1GUDA 1KH1A 4UREA 1P5FA 1XTPA 3CZ9A 2YQ5A 3NHPA 3KUDA 1CUGA 4I55F 4Q9LA 5B1DA 1SG9A 1PK7A 2BZ0A 1SUCA 2WMOB 1YS7A 3E3NA 3GFOA 4LRWA 4OFBA 4R05A 3WK7A 4IIBA 2B4QA 1YQGA 3C48A 4AMUA 3R5TA 2B1IA 4TTSA 4CBVA 1RI2A 4V0QA 3ZIAA 1W5BA 4DUPA 4X1YB 1WLYA 3OOEA 3VHQA 2QQEA 4ZHSA 3MTJA 2DT5A 3IE0A 3ECAA 5E7JA 1ARZA 1GAWA 3JTMA 2XCLA 1MC8A 3GJ8A 5TC4A 1ICIA 1F7VA 5HQ3B 2DHCA 2WEKA 1A98A 1E1KA 2OEPA 3WFZA 4ZCTA 1KI2A 4UTNA 1O57A 1RJFA 2GJSA 3ILSA 5IS2A 3QEAZ 2NUPB 3NG1A 4Y0VA 4P08A 2YYSA 3DS8A </