1SB8A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
341
Chain Sequence
b'MMSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords wbpP
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
total genus 127
structure length 341
sequence length 341
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb8A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb8A02
4HX5A 1VKNA 4DWVA 3H5AA 3RUFA 3HJAA 3TSCA 3L9WA 3I9OA 1XEAA 4PVDA 1U3UA 2ZATA 1CQJA 3DO5A 3MOIA 3RBXA 4Z0PA 3EDMA 1T2EA 1ZK4A 3HDYA 2VTDA 3L6EA 3M1LA 1F06A 4D3DA 3KM0A 2NACA 1P45A 2JCVA 4DPMA 3K92A 1LQTA 1AN9A 1X0XA 3OQBA 2VZ8A 3FBTA 2FR8A 3F5SA 1B2LA 3H9EO 4I5EA 2O3UA 3MJCA 3E5RA 3ITDA 2JKVA 4OIMA 5A04A 5JC8A 4J2OA 4NFHA 3D5QA 3ZU5A 4K9DA 4L4SA 3KOUA 1YQXA 4ZQEA 3LYLA 4ZQFA 5BT9A 4BGEA 4MJLA 2VUUA 4BOYA 1ZCJA 3C7CB 3PHHA 4LMPA 2Q2WA 2SCUA 4OXNA 4GLOA 1J4AA 4R3NA 4MVJP 1O5IA 1EFLA 3ABIA 1FDUA 4R9SA 1IPEA 3IL2A 2WTBA 1PZFA 1BXZA 2C82A 1TT5B 2D5AA 1OOEA 2UVDA 2VZ0A 1DLJA 1LNQA 3IP3A 1Q0LA 3LZ6A 4W4TA 2BFPA 3E03A 3PYLA 4IMRA 3AUSA 3DBRA 3ZHBA 3PJDA 4IINA 1E6EA 3RAJA 1LDGA 3TZKA 2YW9A 4KQXA 3C3XA 3M1AA 4LRTB 5JYDA 3DWFA 2IYPA 2Q1UA 3OEWA 2BKAA 1H6BA 1ULUA 3HB5X 5DOZA 4CQMA 3HNPA 2WJPA 4E5YA 3S55A 3EVTA 2HK7A 1KVQA 1VL8A 2HAEA 4H15A 3WS7A 2J5QA 3BHMA 4LCJA 3ZWXA 2VRCD 5EL0A 2GRAA 2J3HA 4WLUA 4DYDA 4WASA 2OFPA 3B20A 4CM7A 1PL7A 4CMGA 3JQBA 1SNYA 4DREA 3Q9NA 4R1UA 3PP8A 1PL6A 1Q7CA 2FOIA 2Y67A 1DB3A 4ZQHA 4ALIA 1W0CA 1U8XX 1PQPA 1WVGA 4RCVA 1DSSG 3AOEC 4HADA 1EK6A 4OKNA 5EMHA 5KWEA 1PJBA 3OA2A 3A06A 3AY6A 5HS6A 1PJ2A 1W73A 1ZEMA 4YBZA 1Z6ZA 2AEJA 4AVYA 5KVCA 3OFSA 5BSHA 2UUPA 1LLQA 3TZCA 3PTZA 4BKUA 5DBGA 4HKTA 2QRJA 5JAIA 2EERA 2VYND 4OOEA 1JQBA 3H9QA 3NGLA 5KTKA 5G0SA 5T6BA 2FZWA 4UUMA 3MJ4A 1YL6A 3KYCB 4ND3A 3V5NA 3RUAA 3OECA 4WLOA 2PH5A 4K6FA 1NX6A 3DBLB 4NPCA 1MX3A 3W8FA 2AQHA 3WIDA 2CVOA 1MB4A 1SC6A 4D44A 5TLSA 1W8DA 1PSDA 1QYWA 3WQRA 4D41A 1DIHA 1R16A 3FBGA 5G0UA 1EBFA 3ZHXA 1OC4A 2J5KA 2XPCA 2RHCA 5I7EA 2NSDA 3L6OO 1KEPA 3VPSA 1ZW1A 4TKMA 3I1JA 1XG5A 4OHUA 1L7EA 1PJSA 2I67A 3R6DA 1MLDA 1N2SA 1NQTA 4CM4B 2BFAA 1RYEA 4IMPA 5C5IA 3VZSA 3TZHA 1VSUA 3WGGA 1Y5RA 1RWBA 2LDBA 2VUTA 5C7IO 3FWZA 1PJQA 3IQDB 1HF3A 1PTJA 2C7GA 1RM5A 1H2BA 1LU9A 1DRVA 2YFHA 4EUHA 5JXWA 3BMQA 2Q2VA 1UR5A 2OBNA 3ZI0A 3JYPA 5GZ3A 1E1KA 1ZZEA 4BMSA 1HDZA 2YV1A 4GGPA 4P22A 4YXFA 1BDBA 4NNJA 3TOXA 5JSFA 5A05A 1E5QA 3UF0A 2I66A 4C4OA 4XIYA 5JDIA 4J7UA 3WSWA 1V3TA 4RPGA 1A5ZA 3E9MA 3MJVA 4W6ZA 1WDLA 3C24A 2VHYA 1PJ4A 3DHYA 5I8ZA 4DIBA 3GZNB 4QFCA 3GG2A 3GPIA 4RGBA 2FSVA 2GD1O 3QQPA 1T2CA 2CMDA 1M76A 3F9IA 4WE3A 3ROQA 5CDUA 2QX7A 1A7AA 5JS6A 3JQ7A 1ISIA 3PJEA 4Q3AA 1ZSYA 2HMVA 4MP3A 4DC0A 1ML3A 2QIOA 4P38A 1T1SA 3NEPX 2Q99A 3C1TA 2VNSA 4P8RA 1LSUA 2O7SA 3VKVA 3ZWBA 5F5NA 5IG2A 4I5FA 5A06A 3WLFA 3PHJA 2Z1NA 4RVDA 2OUIA 4ONEA 1Y8RB 4ZJUA 5BNTA 1N1EA 2BGLA 3JYQA 3E5MA 3LVFO 3TL3A 5IN5A 1YB1A 4MP8A 5A9SB 2DC1A 3I9LA 1DJQA 5EQDA 1IYZA 2EEZA 2W98A 4L75A 2O50A 2FMUA 3BTSA 3TWOA 1QYDA 2GNAA 1HE2A 2NQ8A 2DPGA 2HRZA 1U4SA 1X0VA 4DBVO 2OBYA 2PR2A 3I4CA 1VSVA 2DQ4A 4BO4A 3HFGA 3ADPA 3ETEA 3N74A 4J1NA 4O5OA 4ALLA 1KVRA 4RVSA 1ZIDA 1CERA 2ZYAA 1E7YA 2CDAA 2NM0A 2RBEA 3BXXA 3LT2A 3AK4A 3F6YA 3KSZO 1ADBA 1G0OA 4YRDA 5A02A 5A3JA 2PWZA 1MA0A 2C2YA 3H65A 1X13A 3LC7O 2Y66A 4AJHA 5HA5A 1PZHA 4HFJA 2P68A 3VH1A 4CM8B 1T26A 4IUYA 2B5WA 4J4HA 4R5MA 4NFYA 3PIDA 1Q2XA 3GDFA 1MP0A 5T5QA 2GZ2A 3NAQA 4OL9A 4ALKA 5IJZA 3AOGA 3U5TA 1NFQA 1YQDA 1EQ2A 1LC0A 2IODA 3ZGYA 3AJRA 1YBVA 4GLLA 5KJFA 1OMOA 2G0TA 2GCGA 2I3GA 4ROSA 5DOVA 1IHXA 2YY7A 3ZWWA 2C29D 1ORRA 2ZTVA 4BKPA 5F5LA 4D7AA 1H6CA 4E31A 1NAIA 3GAZA 3DOCA 1U3VA 4PN3A 1DHRA 1P33A 3AI2A 4HXYA 5U4QA 3I5MA 4CM3A 4NR0A 2OXIA 1Z75A 3P5SA 1GUYA 1N1GA 2PKRA 3RUCA 4LSMA 3RU9A 2VRCA 5L7TA 4FGWA 7ADHA 4GI2A 4OH1A 2YUTA 3BYZA 4D3SA 1SCUA 4EDFA 2FY8A 1F8FA 3VPFA 4NBVA 1C0IA 3IUSA 2I6TA 4XYBA 4II2A 3HUDA 1EDZA 2UUOA 2X7HA 4QTZA 5JLAA 3X2EA 2EG9A 4E5KA 3UCEA 2O3QA 4JP3A 4QQRA 1EUCA 4YRAA 2ZJ0A 3L4SO 2FWMX 5JMWA 4TSKA 1PU2A 3ETDA 1E3EA 5A03A 1VLLA 4FC7A 3STHA 3D4NA 1CRWG 2GSDA 3DAFA 8ADHA 1DIGA 1GYPA 4BGUA 1JTVA 2C20A 2VYNA 4IJKA 2O3SA 2DUWA 4UEOA 4J4TA 3L6DA 2R00C 3U9LA 3T4EA 2VYVD 3DZKA 2HK8A 1UP7A 1NPYA 2RAFA 5I9MA 4EEZA 4IDAA 3AY3A 1H2HA 1KY5A 3DR3A 4DQVA 2Q46A 4TROA 2FHSA 3GGPA 3PYMA 4BNKA 5G4KA 4DMMA 4CMIA 3L0DA 4HWKA 3ZHYA 1D4FA 1WWKA 1D3AA 3NJ8A 3O26A 4PLZA 1EE9A 1HSOA 2HMUA 4YVFA 1P31A 2AQ8A 4PG6A 2NVWA 1R4MA 4GVXA 2Q1SA 4FQ8A 4JCOA 4KZPA 2QG4A 1PGQA 1T2DA 4NU5A 4CLOB 5KNLA 4TWRA 2G1UA 5A5EA 3MJTA 2Y1GA 3T4XA 1PZEA 4DGSA 5CDYA 2VWGA 3ROKA 5G0TA 2HU2A 2QHXA 4FS3A 3W6UA 1GL3A 4XKJA 5DBFA 4U0KA 1LDMA 2DAPA 4PLVA 2OGUA 3S2FA 4IQ0A 1HE3A 2G76A 3AY7A 4ITUA 1NVMB 4NJMA 4WK6A 4CM1A 5I7FA 1JVSA 5L7WA 2DVMA 4QO8A 1B7GO 3ZWCA 1N9GA 1Y9EA 2O3JA 2RIRA 4YJHB 3CMMA 4U5QA 1FDTA 1FF9A 3FNFA 4DQUA 1PS8A 1TLTA 1HDRA 2X86A 3RFTA 1FMCA 4GPD1 1NR7A 5L45A 3KYBA 4CMHA 1ISHA 2A35A 3UN1A 1DDOA 2A92A 1CF2O 3LSYA 4RZIA 2ZCVA 5ICSA 1LQUA 4LN1A 5JAMA 2PA3A 2HJSA 2PZLA 3G1UA 2DPHA 4I1IA 3GQVA 3QW2A 1I3NA 1F0YA 1Y5MA 3GC6A 1HETA 4R1TA 2G82A 4R3WA 3W4KA 1PR3A 2Q50A 3I52A 1IPFA 4XJSA 3U4DA 3ZWYA 4XB1A 3ZWVA 5ITVA 1KC1A 2OO5A 5F3RA 4YT2A 1BDMA 3PQEA 4YQZA 4ZRMA 5A5FA 4XX0A 5T8KC 4NH4A 1KEUA 1A27A 1NVTA 1YJ8A 3CINA 3RUIA 3LC2O 4YT5A 2B83A 5AQ1A 1I3MA 1HDYA 3GN1A 1EEHA 2B4TO 2R2GA 4DMLA 3HZZA 4XZ3A 2JJYA 3OEYA 3WX0A 2ZTLA 1CYDA 1I36A 1AXGA 4Z0HO 5EINA 4IDGA 4TMFA 4FFPA 2ZB3A 3PHGA 4NFSA 1B8UA 1QYXA 1R0LA 4DC1A 3P7MA 3DXFA 2IZ0A 3KV3O 3EZYA 4DPKA 4K28A 1GCOA 1PZGA 4BNZA 1ONOA 5JFOA 1E92A 4PIVA 1Y81A 2YQ4A 3EC7A 3WBBA 4F3YA 1UXJA 2J3KA 2E49A 4TZTA 1RJWA 2X9NA 3RQSA 1WMAA 1F17A 4B3IA 5MDHA 4CR7A 4L76A 3GK3A 3JYNA 1WDKA 2B5VA 1P1FA 2DTEA 3MEQA 3T7CA 5JDCA 3KBOA 1MFZA 4N5NA 2FN7A 4OQYA 4TRJA 3INGA 3WGTA 1D8AA 2JFFA 3WLEA 2X0IA 4J90A 2HCTA 4E2XA 5HS4A 3DAPA 1NHWA 1N5DA 1V3UA 1ZBQA 5IDQA 1E3JA 1TI7A 3RSHA 4XR9A 3ZU3A 4ZGWA 5IXYA 3H4VA 3U4CA 1DIRA 3SC4A 4ZICA 3VAZA 4UVEA 3TFOA 3RFVA 1K3TA 1NP3A 4IZIA 1E6UA 3DMYA 5ILGA 2JL1A 4AJIA 1GY8A 1Z73A 3F3SA 4KDFA 3RUHA 2H63A 3V8BA 1X7GA 2IEBA 1YWGO 3RJ9A 3IC5A 4YDRA 4E3ZA 3FNEA 1JW9B 4MIYA 1LSSA 3E9NA 3GUYA 4KTVE 4A03A 3WNQA 1BTOA 2B37A 4J49A 2JHFA 4IQGA 3DBRB 1E77A 1XWFA 3PHLA 4FDAA 3AFMA 4WNCA 1QXSA 3L9XA 1EVZA 2VYVA 1I30A 2VHVA 4LCEA 4XD2A 1Q7BA 3DMTA 1M67A 1Y8QA 4M49A 3CSDA 4R1SA 3CEAA 4N7RA 4CQMB 3BMNB 4YYZA 4PG4A 4ZA2A 4BO8A 3K31A 4BNVA 1MG0A 3W8DA 3DB2A 4O0LA 4CQLB 2BGKA 4PZCA 3DL2A 3V1TC 3IKVA 5KJEA 1IUKA 2CF5A 3JQDA 4IJWA 3ZWMA 4FJ0A 1Q0QA 2JFHA 3PGJA 4N5MA 4GKVA 4L8VA 1IE3A 2FZEA 3C85A 2CNBA 3G3EA 1PJ3A 3HHPA 1EK5A 1JN0A 3BIOA 3SLGA 4EGFA 3U3XA 5ENDA 2BRUA 4YAEA 4PLCA 1EZ4A 2NQTA 4OOFA 5KJ6A 1VJTA 3JCZA 4OMUA 3RASA 1O94A 4QUKA 4F6LA 4B7UA 1C1XA 2DKNA 2A94A 5JCJD 1DC5A 2BF7A 4G5HA 3TF5A 2NVUA 1HWYA 2VWQA 3GNSA 3P2YA 3RC1A 1HRDA 2NNLD 2VN8A 3ZV3A 1E1NA 2F00A 4BNHA 9LDTA 4PVCA 4YAKA 1ZO8A 1Z45A 4B3HA 1ZEJA 1Z7EA 3GY0A 4DLLA 3ONDA 3KEQA 2QYTA 2V6FA 5AXDA 5DCWA 1FK8A 1I2CA 1M75A 4BQPA 2Y68A 4K26A 2O3RA 2DLDA 3Q11A 4W7IA 3RWBA 1NTOA 3TNLA 3JQ8A 1D1TA 3PZRA 5G0WA 1U3TA 5A9TA 1R37A 4RJTA 3RUEA 2GO1A 3BMOA 2IXBA 4BNXA 3GOHA 4BNTA 4BO3A 3TPCA 3AOEA 4YWJA 2VQ3A 2GYYA 2EJWA 3K73O 1YB5A 2O3TA 2WD7A 3IAHA 2HRBA 3NDRA 3WG9A 1GYRA 4PCVA 2WEKA 4YR9A 1DFGA 2PY6A 2Y1OA 2AQKA 1PGJA 3RFXA 4OSOA 4YPOA 1DLIA 3MOGA 1E3LA 2NUAA 1LSOA 1F8GA 4E4YA 3LLSA 1B8VA 5FFFA 5TJHA 2FRDA 2JCYA 4XDYA 1F12A 2WYVA 3EVNA 1NHGA 2O2YA 2EW8A 3IUPA 4N18A 1TB4A 1YE3A 5CG2A 1X14A 5DNAA 3OETA 5DZSA 3RC2A 4JJIA 3W4JA 4YAJA 2E48A 1BXGB 2PD6A 4IQ8A 5J23A 1EVJA 3AM4A 3MJSA 1KC3A 2JAPA 4MVJM 5AXAA 4CLRA 1VM6A 3RJ5A 3DBHA 2ZIZA 3WGQA 1X7HA 1U28A 4Q3NA 1SBYA 4AFNA 3W6ZA 3GFGA 4CR8A 1HZJA 3JQEA 3NT2A 1CIVA 1JA9A 3FI9A 3ZDFA 5HTOA 4B4VA 2EV9A 1RM0A 3U4HA 2UV8A 1U9JA 2HO5A 2PD4A 2PK3A 1FDVA 2PZJA 4QFDA 4XWYA 4N54A 4H3VA 1U4OA 2WD8A 1HYGA 3OIFA 3CPSA 4CMEC 1DIAA 2HMTA 3AUTA 1PGPA 2OORA 2ZTMA 5EQFA 4W82A 1LEHA 2X58A 2VWPA 4KWIA 1M6HA 2X0NA 1EUZA 3GGGA 1ADFA 1P0CA 2H5LA 5FI5A 3CZMA 4GX0A 4RDIA 4OXYA 2E4AA 3DBVO 3QP9A 1KY4A 2PH3A 4J16A 2CSUA 3U4IA 3BA1A 1H6AA 2YHIB 2B36A 1DC6A 2X8LA 1PEDA 1H0KA 4JX8A 3WYCA 3E8XA 4BUCA 1DJNA 2Q1WA 2BFOA 4BV8A 4KP7A 3PPIA 1R4NA 1TA4A 3H9UA 2YJZA 1GPJA 4IIUA 2HQ1A 5F1OA 2W2KB 1XQ1A 4LVCA 3KETA 1CETA 2VUSA 3EAGA 4M86A 4O63O 4WNIA 4WPGA 1N8KA 1EMDA 4URFA 2F1KA 3OICA 3LT4A 3HQ4O 1E1LA 4R69A 5KJ1A 4B4WA 3VZRA 3K2EA 4FFNA 4ND2A 3AUAA 2AEMA 1IB6A 1CWUA 4XYEA 4IIVA 5FWNA 1NPDA 1MUUA 3ZV6A 5CDTA 3OBBA 1JKFA 4TRNA 3KEOA 5TRTA 1D1SA 5A1TA 1U1IA 2BH9A 3P19A 4UREA 3E82A 1JAYA 3F5QA 5IDXA 4RPKA 4Z0TA 4Q39A 3WICA 1QMGA 3QRWA 3GVCA 2NWQA 2A9FA 2CDBA 1DFIA 1U2GA 2DM6A 5JCJA 1O89A 1I2BA 2O4CA 2FPPA 3A4VA 3KSUA 4EJMA 4AJ4A 4LW8A 3AM3A 4BNLA 4I9HA 4ALMA 5EIOA 4XYLA 4KMSA 5L95A 3UHAA 3D3WB 1SZJG 3DTYA 3ZWOA 1E7MA 1VC2A 3JV7A 5CHEA 3PWSA 1XQ6A 4YJGA 1U8FO 4B7XA 1B14A 3TZQA 2XAAA 2AQIA 2DTXA 3DZFA 1R0KA 5HBRA 3NT5A 5L3ZA 3OP4A 3QY9A 4ID9A 4TRMA 4G65A 5DCUA 1YDEA 3BZUA 4M8SA 4ALJA 2E37A 2J6IA 5I8WA 4LGVA 5C37A 4UVDA 4RF2A 3COSA 5G4KB 3MZ0A 1QLHA 3KYDA 3Q6IA 2HDHA 3CUKA 4RPHA 1BW9B 2VRBA 2YDXA 3BMCA 4DLAA 5COBA 4PLPA 5BNFA 2O23A 4OO3A 3UGKA 5B4UA 2XXBA 3WXBA 1PR9A 2EP5A 4CUJA 1QG6A 3JQ6A 1O95A 5LC1A 3E48A 3FPCA 4Y98A 4PLHA 1X1EA 1BHSA 3WGYA 1R6DA 4AJKA 1B3BA 4F6CA 4XB2A 5BSFA 1FDSA 1KVSA 4YQYA 3QWFA 1IZ0A 4KUEA 4LSWA 4B3JA 2OP1A 1LDEA 4UEJA 4PGFA 2ET6A 1LRKA 1WPQA 1MFPA 3FRJA 2QYSA 1KOLA 3UXYA 3VPGA 4EBFA 1HL3A 3GNQA 1ZK3A 3I23A 1XKQA 4RF5A 4IY1A 4U0JA 4BNUA 4J0EA 3RC9A 3NTRA 4NJMB 3WMWA 3JQFC 1OFGA 5HM8A 3D4PA 4BNJA 4IBOA 1FJHA 4O6VA 3WTBA 2P9CA 2PGLA 4DYVA 3Q0EA 5B12A 3H5RA 1C1DB 4S3MA 4CL8A 4FB5A 4J9VA 5FF9A 2VOJA 1PQWA 3ON5A 1U5AA 4H7PA 4DTIA 3ZW9A 2D0IA 4YEDA 1KVUA 4J2HA 6LDHA 3H8VA 5CEEA 4TQGA 1VJ1A 1XU7A 3NGXA 3WNVA 4KUGA 2Y0DA 3UCFA 4PLFA 4XIJA 4E5MA 3ST7A 3ASUA 1TT5A 4OSPA 3DOJA 3NJ4A 4BNWA 1S6YA 4HUJA 4KWHA 1LLCA 1UXIA 4D0SA 3E18A 4GH5A 4IS2A 1ARZA 5GZ6A 1YS4A 4GBJA 1K6XA 4EI2A 1LA2A 1A7KA 1GV1A 1OZAA 2WM3A 3CIFA 3GVIA 1X1TA 4QECA 1DRWA 1JKIA 1LLDA 4CLHA 2GN8A 5IN4A 4IS3A 2EKLA 4RLHA 1JU9A 1T25A 2OHXA 3FD8A 4XRRA 1ZFNA 4NI5A 5I9LA 5TT1A 1YL7A 2Q45A 2VNAA 4NDNE 4WLNA 1GTMA 1FXSA 4L4RA 3PZBA 5HRUA 1E3SA 1V8BA 2CFCA 3A14A 1GPDG 1RM3A 4FW8A 4FSHA 1UDCA 3E6AA 4GQAA 4M89A 4TKLA 5DT9A 4GX2A 3GEGA 5AOVA 1Z82A 1ZVMA 4NHEA 4J91A 2O48X 4XCVA 2DUUA 3DZGA 2QZ9A 1IZ9A 3OQ1A 3EYWA 2GGSA 3PWZA 2ZQZA 4PLTA 5G2OA 4ND4A 4HV4A 1XCBA 1ISJA 5JW6A 3EK2A 4LK3A 5T8KA 3WJAA 3L4BC 2JCXA 2GZ1A 2PTGA 4JJFA 4NG5A 4XGNA 3U49A 4WOKA 1VJ0A 2X22A 6ADHA 4E0BA 4YACA 1E7WA 3Q2IA 1U5CA 3KYCA 2G5CA 1Y9AA 1MC4A 3BAZA 3QWAA 2EW2A 4CM9A 2P91A 3DBLA 1B26A 4BMNA 1E3WA 1YOVB 3N58A 1MV8A 4WKGA 3VPXA 4BL5A 5L4LA 4QO7A 4XGIA 1LDBA 1B3RA 4PLWA 1L1FA 3PQFA 2YV3A 2QZZA 2PV7A 1E7SA 1GUZA 3EW7A 2C59A 2AG8A 2DTDA 3UICA 3ZU4A 1ADCA 2HSDA 3C8MA 1WNTA 3PYXA 3UFXA 3FR7A 4ALNA 4DQXA 1O8CA 1E0DA 3NTOA 3N7UA 4R68A 1ZMOA 4CUZA 1M2WA 1UZLA 3VDQA 9LDBA 3V2GA 4CM4A 4AICA 5JBIA 1J49A 4J1TA 1I24A 1YXMA 5EERA 3ADOA 1MC5A 3ZCXA 4PRLA 3PXXA 4ZU3A 4CMKA 5LDGA 2EF1A 1ZK2A 4J4BA 1HDGO 2Q2QA 4XGKA 4BNFA 4AJOA 4W99A 1WDMA 4E5NA 4NZ9A 3KO8A 3VC7A 4WCFB 4BMVA 3UVEA 2B0JA 2D5CA 3K5PA 3F4LA 1GDHA 4DRYA 5L4NA 3I6IA 3GEDA 5TJ9A 4FN4A 1MXHA 1YKFA 2ZKLA 1A71A 2X0JA 3OF2A 3S1LA 3SLKA 4X54A 4IDEA 4I08A 5ER9A 3IP1A 1P44A 2GASA 1U2DA 3HN2A 1RKXA 3NTQA 4HNGA 4I9UA 4J43A 1XELA 1NM5A 3U62A 4FCCA 1BGVA 2QRKA 3B70A 1UDBA 4RO0A 5JYEA 3GZNA 3WFJA 1JAXA 4FFLA 3V1YA 1J5PA 1ZSVA 1K89A 3WYBA 3MWDB 1UAGA 3JSAA 3UUWA 2D4AA 5K6AC 4GMFA 3NX4A 7MDHA 4W9NC 8LDHA 5IAAA 3JQCA 2JD0A 5TS3A 2IZZA 4EJ0A 4BO6A 2NTJA 3QSGA 2B4RO 3ZV5A 3ETGA 2VZ9A 1DO8A 1ENOA 1P77A 1YGYA 3BTOA 3ZHZA 1PJTA 3SXPA 3KRTA 3WFIA 4M54A 5KVVA 3AW9A 3OIDA 3HE3A 1IHYA 1Y8RA 2VHZA 3DTTA 2ILTA 1HE4A 4UULA 4JNKA 5DDIP 5A9SA 2O4UX 2GN9A 2TMGA 4YT8A 3FTNA 2FPGA 1I3LA 4E2WA 4Q3CA 4GX1A 3F1KA 3G49A 4NBRA 1Y1PA 3OJLA 3A1NA 3CKYA 2D3TA 3MTGA 2VWHA 3WTCA 3LU1A 4Q3BA 2RH8A 3O8QB 1DBVO 3MWEB 1HEUA 2JD1A 1QV6A 4HBGA 3JQGB 1I2ZA 4PFJA 4YRBA 2NADA 2WSBA 3TRIA 5KOIA 4RQUA 1PQUA 3PIIA 3JYLA 1GYQA 1HYHA 2V65A 4C7KA 1GCUA 3DONA 4CM8A 1SO8A 2C0CA 3PHIA 1EDOA 1PJCA 3O9ZA 3LLVA 3RU7A 4BIIA 4CL3A 4J3FA 3RI3A 1IULA 1ZK1A 3OHSX 4BNIA 1QV7A 2WYUA 1W6UA 3JQAB 2O7QA 4A27A 4UVHA 4PLYA 3LDHA 1ADGA 4RF4A 2DBQA 5THKA 2X4GA 4LRSB 4RDHA 4CM5A 5A4DA 4FJ1A 1MXFA 1SMKA 2P2SA 3GZ4A 4MPDA 2HMWA 3GMSA 4JN6B 4MIOA 3QVXA 1JKJA 2GDZA 4Y9DA 3QJ5A 1MG5A 2VT2A 2EHDA 1OAAA 3QVOA 3D7LA 3GH3A 2Y0CA 3QLJA 4Q3EA 1JWBB 2NU8A 1HDOA 2J8ZA 3F4BA 3FCOA 2NLOA 1HYEA 4RLSA 1SEVA 1V9LA 1BMDA 2YDYA 3AI3A 1K0UA 4JK3A 4GX5A 5JY1A 2NTNA 3KLPX 2VCYA 4YT4A 3G0OA 1DAPA 1IL0A 3GT0A 2NU9A 4MVJH 1V6AA 3WB9A 4DVJA 3SBOA 2ZQYA 3TDKA 1NQAO 3K8ZA 3NDJA 4DA9A 3WGIA 2B69A 2IDZA 4MKZA 2Z95A 5K9ZA 1E3IA 2PGJA 4M55A 4AJ2A 4CUKA 3PFFA 1DAOA 1R0SA 4GVLA 3OSUA 1ID1A 3IIEA 5GZ1A 4GGOA 3RCBA 5I7VA 2J3IA 1PWXA 2D59A 2Y05A 3H6KA 5AVOA 4D79A 3CTMA 3D3EA 1A4IA 3R3JA 1QR6A 1QLJA 4D45A 3ZV4A 4L4XA 3M6IA 3HDHA 3GRPA 2AG5A 3GPDG 3OQ6A 4I5GA 5IZ4A 1PS9A 3ZWPA 1UP4A 3M2PA 2DFDA 5B1YA 3R1IA 2AXQA 1Z74A 4E21A 3ANLA 5MGBA 3GUCA 1RPNA 4BNYA 3NYWA 3LF2A 2HKIA 1R4NB 2GN6A 3VPHA 1AGNA 2ZB8A 3OA0A 2JAHA 4CMEA 1ISFA 5JNLA 4QEDA 3WOHA 3S2GA 5KVQA 4ND5A 4IDFA 2P4QA 3I9JA 2I9PA 2D2IA 1DFHA 1ZXBA 5H82A 4JROA 4E30A 3QIVA 3K96A 4KDEA 2UDPA 4MVJI 1N7GA 4PG5A 3RKUA 3UAGA 4IM7A 3BTVA 2OMEA 2NTVA 3SVTA 2HUNA 3HB4X 1C0KA 1EVIA 1LBEA 2G17A 4YAIA 1UJMA 4YJFA 2P9EA 2EP7A 1I0ZA 1O9BA 1PX0A 4YJHA 2IE0A 2NV6A 1AHHA 4GSKA 3GEMA 3GLQA 5F21A 2CY0A 3JD2A 4K6CA 3U09A 4MVJD 3GFBA 5U9CA 2V6GA 1V3VA 4Z9FA 4Z3DA 1KEVA 3PJFA 4U7WA 5A9RA 4JQCA 1ZKMA 4K1LA 4OXKA 2EIHA 2P4HX 4JIGA 4A5OA 1WXDA 1YB4A 3WBFA 1FDWA 3DZIA 4WECA 5TT0A 3WGOA 1NAHA 3PEFA 3BHIA 2BELA 3WWZA 1LI4A 2DU8A 5JAZA 1G0NA 4JGBA 5IZCC 5EPOA 2C7VA 1GQYA 1DXYA 5DP2A 3PLNA 3BTUA 3FSRA 1NWCA 2EXXA 4IDCA 4XQEA 4BNGA 5G4LA 5FI3A 4QSMA 1XGKA 2POQX 3A28A 4M87A 3D1LA 4OAQA 3W4IA 1H5QA 1X7DA 3OH8A 3BMQB 4MVJF 4NIMA 2CUKA 1SB9A 2GN4A 4IXWA 4RZHA 5DULA 3FNGA 2AA3A 3LQFA 3VHRA 4AJPA 3JD3A 2Q3EA 3NT4A 5JDCC 1BXKA 2VOEA 2JFGA 5G0VA 3ANNA 1ZMTA 2QQ5A 1GUFA 3EMKA 3LT0A 5C3MA 1UXKA 4FFRA 3QV1A 4QT0A 1EE2A 1T4DA 2ZJ1A 2C5AA 4PLGA 3S2IA 4TVOA 1NWHA 1R12A 1I3KA 2BD0A 3KHUA 4R41A 2DBZA 3KSDO 4IJVA 1G1AA 2EWMA 4WEQA 2GERA 1NPTO 1RM4A 2WWRA 2XF8A 1BG6A 3SC6A 3ENNA 3CE6A 4Z9YA 2HLPA 1T2AA 5KJCA 2QW8A 5L7YA 3JQ7B 1EUDA 1P9LA 1HSZA 2P5UA 1X15A 5TX7A 2XOXA 4E12A 4XQGA 4FBGA 4BKQA 2PGDA 3RBZA 2P9GA 2E6UX 2YV2A 2AE1A 3MTJA 3SJUA 3EY4A 3P2OA 4WCFC 3WQSB 3HSKA 4LISA 5JE8A 1PL8A 4CM6A 5IXSA 3V2UA 3DMTC 2GF2A 1NFRA 3GHYA 1M6WA 3KLMX 1HKUA 5BQFA 3PQDA 4YA6A 4CV2A 1H94A 4R5HA 4YJDA 1I32A 3K9QO 1LRJA 5TF4A 4ZHSA 3ZN2A 3EGOA 2YHUA 4NQZA 3FR8A 2YQ5A 1LC3A 5BSGA 4WLFA 3W8EA 4FR5A 5COQA 4G81A 1QSGA 2HJRA 3V1UA 1UZNA 1T2FA 2IYOA 3I4FA 2Y93A 4FOSA 4ND1A 5GY7A 4CMCA 3WSVA 2XXJA 4EJ6A 3IKTA 1XHLA 1C14A 4ZN6A 1OI7A 3RC7A 4L0QA 2GLXA 3I9NA 2PFGA 4F46A 4HFNA 4D43A 3JQFA 5JAQA 3TL2A 3ICCA 4W7HA 1ISMA 1WW8A 5IDYA 4BHTA 4UEKA 3JQ9C 4GL4A 2ZTUA 3WIEA 1S7CA 1UDAA 4N5LA 1JDJA 3TZ6A 3BMNA 3H2SA 3JD0A 3ZW8A 2OZPA 1VL6A 2VHXA 1Q1NA 3PDUA 4CQLA 2C5EA 2Y1EA 3DZHA 1H9AA 3NDIA 2LDXA 2FSSA 2NU7A 1N92A 1Z7BA 3VKUA 3WGHA 4JP2A 4AG3A 4DBZA 4Y67A 1GQQA 5JCXA 3GNTA 4HFMA 3UH1A 3ASVA 4CM9D 2UYYA 2W90A 1JVBA 5CEJA 1YDWA 1PWZA 1DEHA 1E5LA 1NFFA 5DN9A 3S2EA 1OC2A 3SJ7A 1LLUA 3Q1LA 5CP8A 4J7CA 4MVJG 5KKCA 1L7DA 1YL5A 5KCZA 3MJEA 2X5KO 4KUHA 1EQUA 5DBIA 3ANMA 1PIWA 1O0SA 2IEDA 2H6EA 1QYVA 3QWIA 1ZXLA 3WYEA 4G2NA 2C07A 3IDSA 3F47A 1H9BA 3QWHA 2ZK7A 4Y6SA 1UUFA 3K30A 4MIEA 4U6SA 4AJEA 4E2ZA 4P4GA 1WLYA 2FR0A 4KOAA 5ICMA 4HNHA 3TN7A 1NASA 1SOWA 4CV0A 4DIOA 2X1HA 2BI7A 4J6FA 5EN4A 2C2XA 1VKOA 2UAGA 5ER6A 2Q4BA 3X2FA 3QWBA 1YVEI 1E3WB 4HP8A 4DLBA 1RYDA 4NMHA 1GEEA 4RVFA 4XR4A 4MVJA 2BLLA 4XDZA 4DIFA 3ZWAA 5I9NA 2WE8A 4FPXA 5L9AA 5GMOA 3GA0A 1EFKA 1KYQA 3A9WA 3PFWO 3UCXA 3DFUA 1K2WA 2AMFA 2X6TA 2TMDA 2PKQP 4CMIB 4GWKA 3FWNA 5A3VA 5ADHA 4CV3A 3LK7A 2CD9A 3L4BA 2CVZA 2PD3A 2Y0EA 1XIVA 2EJVA 2Q1TA 4AJLA 1I10A 1U3WA 2B35A 1R4MB 3OM9A 2DBVO 1I5RA 3JYOA 5F1PA 1K6JA 1EVYA 2D8AA 2CF6A 3IS3A 3TOZA 5TNXA 3I6QA 3UOGA 4NJOA 4NBTA 5JPIA 1TVEA 3VH2A 2R00A 5T57A 5TSDA 3DQPA 3B1JA 4E32A 2GUGA 4XQCA 2CDCA 4C7JA 5DF1A 3Q9UA 3INRA 2EGGA 3VH3A 2A4KA 1O6ZA 4WOJA 1YBMA 4NU6A 1BXGA 1LJ8A 1P1IA 3O03A 3Q3CA 4JBHA 4Q3DA 4MKRA 4J0FA 2P5YA 4CLEA 2V7PA 1GR0A 2C54A 2AW5A 2ZYGA 3ZNNA 4BGVA 1N9GB 4QX6A 5KVSA 1P1JA 1UXGA 3RIHA 1PGOA 4NBUA 3H2ZA 4A73A 1B8PA 4Z9XA 1WZIA 2I5PO 1K5HA 4FOOA 4MVJE 4Y6RA 4AL4A 1MGOA 1HDXA 5CAEA 4O59O 4TZKA 2H1SA 1WP4A 2I3AA 4PZEA 4QXMA 4L74A 4A26A 4ZQGA 4RVUA 3O4RA 2V6MA 3ROPA 2J5RA 2WMDA 3GAFA 3JQBC 1GADO 3JTMA 4WLEA 4JLWA 3DC2A 5JO0A 4A7PA 3RD5A 4UAGA 4EEXA 1AE1A 1LRLA 1WZEA 3AI1A 1PS0A 2W4QA 4AJNA 5K6AA 3FNHA 4R54A 5T64A 4EITA 1UXHA 4W9NA 4E2YA 1CEQA 1Q7GA 3DDNA 3DFZA 4WJZA 3ZNOA 4ILKA 4BKRA 3C1AA 3PWKA 2D1YA 4AJ1A 2YFQA 4DXHA 1QYCA 3RKRA 2YHIA 3DAGA 3CXRA 1I33A 5H83A 4IGEA 1LUAA 4E6PA 1A4UA 5FEUA 1YQGA 2ZYDA 2X23A 1N7HA 4EUFA 4CJXA 4L9RA 5BSEA 4BO7A 2Y1FA 4FD3A 2W2KA 3RVDA 5BNIA 4IGFA 2WYWA 5C7OO 1K6IA 3PRJA 4MKXA 3GMDA 4ZQBA 1KS9A 3D5TA 1VPDA 4XQ9A 3WQQA 3IJPA 3ITKA 1AHIA 1GQ2A 3I9MA 3DEYX 1ZJZA 4EZBA 1XYGA 3ZNQA 1NYTA 3K6JA 2AEFA 1J6UA 4BO5A 1SPXA 3TJRA 3VZQA 3GF4A 2PZMA 4D3FA 2W2LD 3VZPA 3C1OA 1YRLA 4XEHA 4CLDA 1KETA 2BHLA 3GGOA 3QE3A 2JHGA 1P1RA 3C7AA 3Q2KA 2E82A 2OL4A 4IXTA 2FR1A 5CPBA 4FFMA 5JMPA 4Z3KA 5B4TA 1XR3A 1M66A 2CZCA 4BO2A 2X5OA 1BSVA 1B15A 2HMSA 4OQZA 5JDIC 5IF3A 2Y99A 5KKAA 3LF1A 3LT1A 5L4SA 4UVIA 4WCDA 5B37A 5B4VA 1ISGA 4CLXA 4R01A 1QKIA 2B4QA 3VTFA 1NBOA 1IY8A 3C7DB 1B0AA 4BB5A 3D3WA 4CV1A 5CPFA 1HXHA 4JBIA 1QORA 1ZK0A 3NV9A 1LSJA 1XDWA 4HFRA 1BRMA 1ONNA 4JJGA 4BO0A 1YONA 2RH4A 5TIIA 5CDSA 2RHRA 4S1VA 3VDRA 2PKQO 5K0ZA 1NVGA 2EKPA 3QA9A 4FGSA 4RV9A 1YO6A 3ONEA 1GU7A 1I8TA 4AJJA 4R16A 2GZ3A 4IDDA 1Y8QB 1P1KA 3L77A 4ZRNA 3KB6A 1DRUA 2J3JA 1HDCA 1GZ4A 4LMRA 5L51A 1BW9A 3QVTA 3PI7A 2DT5A 4RPJA 3FHLA 1A9ZA 3ORFA 3G79A 4J9UE 4YTEA 1CQIA 3G1TA 3TFQA 5JY6A 4B4OA 1HLPA 3HWRA 3CZRA 5EESA 1C3VA 4A10A 4FC6A 4PRKA 4XJTA 1ENYA 4JXKA 4P4NA 5DP1A 5JO9A 4R51A 1AUPA 1CJCA 3AFNA 4LVUA 4MO2A 3KXDA 4YB8A 4UVGA 1SEPA 1BVUA 2O2SA 1E7QA 3GDOA 1C1XB 3AU8A 3NUGA 3KVOA 2AE2A 3H7AA 1JWAB 2NVUB 5F1KA 4YCAA 1GAEO 3EUWA 3GVPA 1D7OA 2NU6A 1V35A 3IOYA 4OYRA 3PK0A 3AM5A 3EHEA 3G17A 2BGMA 4J7XA 3DHNA 3T7EA 3ENKA 3I83A 5IDWA 1B16A 4CMAA 4YJFB 3IMFA 1E7RA 1T1RA 2Z5LA 4ZVVA 5CDGA 3E9QA 3SX2A 4OGWA 4DPLA 1XSEA 1C1DA 3RUDA 1LX6A 3HDJA 2I76A 3JQ8B 3AUUA 3PGXA 2I65A 1W4ZA 1GZ6A 4BNMA 3HDQA 4RL6A 3RROA 4RORA 3BMOB 5TQVA 1PGNA 1GEGA 1H6DA 3QVSA 4CPDA 1TEHA 3VOSA 5C7LO 3JQAD 2WD7B 3HADA 3AU9A 1XA0A 4Q9NA 4MP6A 4BVAA 3WGZA 1P74A 4MDHA 4MINA 3D0OA 2AHRA 4FIZA 4KTTE 1HE5A 3R3SA 4RVGA 1J0XO 4UUNA 1ENPA 1UH5A 2IZ1A 3PLRA 1WMBA 3MCVA 3ROMA 4I9NA 4B8ZA 4D0RA 3WR5A 1F14A 1GZ3A 1ZJYA 1PJLA 1U7TA 2IXAA 2X0RA 4RF3A 4U6QA 4BGIA 4JBGA 5FYDA 5H81A 1KIFA 2OOSA 2PLAA 1LDNA 3H3FA 5AXBA 1E1MA 1EBUA 1TT7A 1U7HA 4TRRA 2FPIA 5TGDA 4D46A 1LXCA 3O38A 1ZNQO 4PG7A 4D42A 1SAYA 2QRLA 5T67A 4ESOA 3DHEA 3QVWA 1ULSA 3CMCO 3WDSA 1HTBA 3KZVA 4J1SA 4NK4A 3U0BA 1UAYA 4BO1A 1WAMA 4UUPA 1P0FA 1P1HA 3VH4A 3ZWNA 5IZCA 2PZKA 4U8GA 1UP6A 1CDOA 4TVBA 3FN4A 5L53A 1NQOA 4CLRB 4BB6A 3R0IA 4INAA 1C0PA 3DBHB 1SB8A 3OIGA 3FF4A 5DCYA 2IRWA 4DUPA 1DC4A 1NNUA 3WMXA 4XRGA 4GAEA 4II3A 4WUVA 1IOLA 4R9RA 4BNNA 4BV9A 3ULKA 4BS9A 1R15A 3OJOA 5JC1A 4E5PA 3B6ZA 3NKLA 3DZBA 3ZH2A 1GD1O 1ENZA 2ZB4A 1ONPA 3S8MA 1HLDA 2W2LA 3INTA 3E1KA 5EJ2A 1KBZA 4B4UA 1YOVA 2OP0A 3ICPA 3PDJA 4XYMA 2X9VA 4J1QA 4XYGA 2WDZA 3FPLA 3OJEA 5ES3A 1KVTA 4WGGA 2JD2A 4WEOA 2WE7A 1GV0A 1UZMA 1DPGA 1BVRA 3V2HA 3WJ7A 5KIAA 3GHHA 2Y1CA 4PG8A 4CQMD 1A9YA 2DFVA 2V6BA 4A0SA 1Y6JA 4IZHA 3W1VA 4R1NA 4IDBA 2W8ZA 3OJFA 3GVHA 2BFMA 3AWDA 3I3OA 1T24A 4I5DA 1Y7TA 3F46A 4UUOA 3QHAA 3SEFA 3VVBA 4FFOA 4Y6PA 4RQTA 2RCYA 2BMAA 1DIBA 2Q4EA 3LC1O 4OJNA 3CH6A 5AYVA 5LDHA 2Q49A 1E6WA 2PNFA 2YZ7A 4RPLA 4ZD6A 4RVHA 5CEFA 4WCFA 2BI8A 3DOOA 4FJ2A 3BHJA 3GN2A 3OMLA 5TC4A 4CMJA 3D4OA 4CLOA 1NQ5A 5U1PA 2Z1MA 5IFLA 1DC3A 3RBVA 1YH3A 3JD1A 3HFSA 2ZB7A 4E13A 4PZDA 1KEWA 5CG1A 5BR7A 4BKOA 4O1MA 4BO9A 4CR6A 1NR1A 3EZLA 1KERA 2VTEA 1VRWA 1VI2A 3ZU2A 3B1FA 1DOHA 2VHWA 5THQA 2HK9A 5COAA 4P4LA 1P3DA 2NVBA 5L40A 2CVQA 1V0JA 2EKQA 1ZH8A 4KQWA 3WWYA 4CMBA 4EYEA 3H9JA 5HWSA 3KTDA 4MOWA 3UW3A 4IJUA 2VT3A 1VL0A 1QRRA 4GWGA 2EGHA 1T4BA 3VVCA 1ZSNA 3PJGA 4IPTA 2Y1DA 4Y8VA 2ZCUA 5ILOA 1OBFO 3L07A 5AXCA 3GG9A 4CODB 3GR6A 2R6JA 3D64A 1R66A 1ZUD1 1SOVA 5CFZA 1YBAA 1YJQA 4NBWA 1HZZA 3GVXA 3K2BA 1Q0HA 4A2CA 3JQ9A 3ZNPA 2YYYA 3H3JA 2X9GA 4GSLA 1TXGA 4EUEA 2FP4A 1JLLA 3IJRA 4R4JA 4OM8A 4B79A 4BQRA 1VE9A 3GRKA 4GKBA 3UKOA 4YAGA 3HN7A 4B7CA 3HG7A 1C0LA 2I99A 4B8WA 3B1KA 3F1LA 3VTZA 1NXQA 4E33A 1XLTA 4EW6A 3PVZA 3JD4A 3OJ0A 4DL9A 1QP8A 3DZJA 2H9IA 3O8QA 3GDGA 4YJGB 3TQHA 4GMGA 2DBRA 2GR9A 3FTPA 1DHTA 4Z6KA 1H93A 2GPTA 3H5NA 4L73A 1GFSA 4M1QA 5ENVA 3JQGA 3ZZNA 4H16A 4WLVA 1LTHR 4I8XA 3ONFA 1LDYA 4F45A 3I9KA 4HY3A 4NK5A 5I7SA 1BWSA 1AXEA 3KYDB 3H9GA 1HT0A 1I01A 3BMCB 1G6KA 4XA8A 5ITWA 3JQAA 5LCXA 3M2TA 4OKIA 3NRCA 2X5JO 1A72A 1XU9A 3KUXA
chains in the Genus database with same CATH superfamily
4HX5A 2PVSA 3EGWA 3NHJA 1JFFB 1QRDA 3EDOA 3H5AA 3RUFA 4BQNA 3M6FA 3HJAA 2FUEA 2OK7A 4M7RA 3BL6A 1DI0A 4H3SA 5ANRB 2IS1A 1P72A 2Z2ZA 2ZATA 1CQJA 2B4AA 3I92A 3NDPA 1OLUB 4DCOA 3ERCA 2XEDA 3RBXA 2R62A 2W6NA 3EDMA 1T2EA 1G8JA 1XXLA 2IYNA 3DV9A 3M1LA 2FLVA 3EF1A 1CR1A 4TMVA 3CGGA 9ATCA 1QG0A 1X7YB 3K92A 1LQTA 1UMBA 2V55B 2P27A 3JZDA 2P6PA 4GGMX 4R0MA 4V1CB 1GVHA 3BDVA 3MINA 1C1YA 2Q0QA 3BH0A 1LB1B 4DR4B 1MORA 4I5EA 3HEAA 4KXUA 4LXHA 4ZTUB 1DEKA 1Y9JA 4N49A 3H05A 4M4SA 1G59A 2AFHB 3GRZA 4J2OA 4NFHA 4BLOA 2ONJA 3ZU5A 3K6KA 5BV8A 1JI3A 5AVWA 1SXGA 5EZYB 4L4SA 5JPCA 4AK9A 4MHSA 1UAAA 4IUDS 2YX1A 4Q15A 2J0UB 2FSUA 1P1BA 2NZ2A 1ZRSA 4KYIB 3SHOA 4NXMB 4XFKA 4B6GA 3GELA 3C7CB 3L7AA 4OB6A 1SJ9A 3UGTA 4LMPA 1W0JA 1N0VC 2Q2WA 2M1ZA 2FDRA 2J59A 3IAEA 1Q6ZA 4Y30A 4DSAA 2QL6A 1J4AA 1GVNB 2XUJA 3VO2A 1A8QA 4N3AA 2GK3A 1EFLA 3A8TA 2GKOA 2Q6VA 3BBPA 1QZXA 1JVNA 3IL2A 1MTOA 2R9VA 1I2DA 2R5NA 1PZFA 4PFQA 3T94A 4CQLB 2FMXA 1OOEA 2XGOA 2ZJOA 1UQRA 2XVZA 3H8WA 2VZ0A 3KOWA 2BEJA 1WMFA 2OKGA 2P67A 2W00A 1T34A 1TVMA 4IMRA 3E03A 2PU5A 2WM9B 1Y7IA 4XX1A 2WV7A 3AUSA 1ZIYA 4G1EB 3L8DA 4J07A 4KFRA 4IINA 4D92A 3PL5A 3IQIX 3DE1X 1LDGA 3P8ZA 4LVNA 3RAJA 2J4FA 3SEQA 3TZKA 2YW9A 2M32A 4RD6A 2QXUA 2VATA 4ZAVA 3OEWA 3QIAA 2PO7A 1KRXA 4HYYA 3SF0A 4CQMA 4PR0A 3EVTA 3HJRA 1F2DA 1DQYA 2ALJA 1KVQA 1UBKS 3DV0A 1EP9A 1H05A 1JSCA 1VL8A 2O06A 1XZFA 3OMWA 4KAFA 1JEDA 3VR5H 3I2JA 5DPMA 4Q3OA 4AUNA 4BV3A 4UHCA 2VRCD 3KT6A 1DUIA 2YY5A 2GRAA 4D0LB 4E07A 4D9HA 1XB2A 3ACCA 4CMGA 3BFKA 4DREA 4R1UA 3PP8A 2BL4A 5DU2A 2EZ9A 4QAJA 4ALIA 2CLDX 1U8XX 3N59A 4ZREA 1YAHA 1QHNA 3NVDA 4M7WA 5E4FA 3VV3A 5AKHA 3TG8A 4RK7A 1Y80A 2Q9BA 4TTQA 4XDGA 1CR0A 3A06A 3AY6A 1FRQA 3DEZA 3GLHE 2BPOA 4RVCA 5KVCA 1D2EA 2VT7A 1KPGA 1VHQA 1RRVA 3AR5A 3NVKI 2P3SA 1ZJ5A 4G0QA 1B73A 2DJ5A 3PTZA 3B89A 5DBGA 3TZCA 3CLTD 3THWA 1KMMA 2XHZA 3DMFA 3PNYA 3FPFA 4LYGA 3X1YA 5FOTA 2VEDA 3MS2A 1NDHA 3AX6A 5KTKA 2EYUA 4OB7A 2FZWA 4BVFA 1JG6A 1U8TA 2ORYA 4OBXA 3ZK9A 4ZU6X 1U8CB 2I1LA 4MTLA 1J22A 2O9JA 3OECA 2E5WA 4K6FA 4IDUA 2FRDC 2ZREA 3C45A 1XA4A 2I33A 1MX3A 1FL9A 1A9SA 1V48A 3WIDA 2OECA 2CBXA 1MB4A 1UPCA 3BSFA 3L4EA 3RREA 4E1AA 5B7NA 3HNRA 1UJ2A 3LPNA 2JCGA 3LX4A 4D41A 1UIRA 3M3HA 1DIHA 4R71A 2DFLA 4M6WB 3KKPA 4DM3A 1SULA 3KDAA 2WUGA 1EBFA 3SZLA 3ZHXA 1NY6A 1XN1A 2RHCA 1IJBA 2WOOA 3JATB 3I05A 5I7EA 2NXNA 3NC4A 4BBPA 1IJFA 3VPSA 5M29A 4TKMA 2CXSA 4IFTA 4PF1A 1QGZA 1MA3A 4OHUA 5CHYA 5LP6C 1FTQA 5BVHB 2V4UA 4IMPA 4F6RA 2AXNA 1K08A 3TZHA 3WGGA 3KHKA 1Q15A 1EK1A 2IXEA 2JCBA 2VUTA 4MW0A 4MRPA 5C7IO 3GAAA 1BNCA 1SQSA 1TD9A 1YS6A 2PBZA 4QDZA 5C1OA 2VK1A 2AX4A 3AEXA 3KC2A 3IJEB 3NCHA 4LY6A 1OTYA 4I1SA 3K94A 4EUHA 3HK2A 2WNIA 5BSKA 1WXQA 1NVVQ 2BOVA 3Q6NA 1IHUA 3D0QA 2OR3A 3FMVA 1ULBA 2JHPA 1UR5A 4K9MA 1JHPA 2OBNA 1RPZA 3D2AA 4JENA 1TM1E 1E1KA 3R5HA 3L1JA 3RTCA 2A9QA 5AW3A 5DNDA 5JVDA 1Y6ZA 3E3NA 3GFOA 1JH9A 3TOXA 4EUKA 2CXXA 3K0HA 5LQJA 2H1HA 4B7ZA 5B30A 4J7UA 4LNUA 3WSWA 1KFKB 1V3TA 4P93A 4RPGA 3E9MA 4MV7A 5B5SA 2PX5A 3K09C 1WDLA 2A67A 2ADMA 1N6OA 3IOCA 4HZGA 1JS1X 2ZSJA 2W4IA 3DHYA 1G64A 4ZI3A 1BMTA 2GN2A 3GZNB 4DKJA 3S4YA 2XRZA 4OK3A 1X1QA 1J8DA 2NO5A 2YZNA 3GG2A 3GPIA 2WD9A 4RGBA 5LU8A 4DR1B 2ZR9A 4LE1A 2VP0A 4R81A 4BJHB 3DTVD 2Q7OE 5CDUA 5A4FS 4UKDA 5C1BA 1E32A 5IJAA 3LY9A 4D9GA 1RI5A 1IY0A 1ZRNA 3FMGA 4PBSA 3NANA 3O8LA 3I9V1 3WY9A 4MP3A 2W71A 4YY3B 3AVTA 3AESB 3OUUA 1W30A 2QUBA 4BQSA 1NJSA 2Q99A 3CNBA 5DK4A 1SCAA 1M33A 1Y42X 1XYVA 2IOQA 2O7SA 3VKVA 5F5NA 3CVVA 4Z53A 1FZTA 1ETHA 3VXKA 2QBYA 4RVDA 1SPBS 3W79A 2FG5A 4DQKA 3U7QA 5IULC 4DZTA 5AVJA 3LVFO 3AFGA 2G25A 3JU3A 1U2EA 1KJ9A 1YHNA 2CMKA 2HBYA 2P1RA 4PPQA 1XD9A 2EEZA 2FSGA 2QDKA 4HMOA 4Y0AA 3KQYA 2E7ZA 3FLEA 4FEYA 3TWOA 5I3CA 2PZEA 3N8NA 3P1JA 4L9SA 4F5YA 1HE2A 2NQ8A 5AW1A 2UXCB 1PW5A 2HNAA 3EGXA 1MB3A 2DQ4A 3CUWA 3HFJA 3ADPA 2D2VA 3PQ6A 4WZAA 3N74A 3ZVRA 4B0OA 3FOEC 3AVVA 4X3PA 4TTRA 2YJTD 3EZXA 1X1CA 3G59A 3LGSA 5AK5A 3ZHUA 1W5SA 2GKSA 2WHPB 3PNSA 1ADBA 4GNKA 4G0MA 3R2JA 4YRDA 3FCCA 4QHYA 2PWZA 2CFSA 3VNQA 4ZQCB 5AI8A 3ELUA 3DYVA 3UMMA 3LG2A 1HNXB 1CY2A 2G9UA 3AKDA 4HFJA 4EKEA 4MKIA 5DI9A 3CNOA 3SFZA 1E0KA 1X42A 3QFHA 2B5WA 2C7OA 4R5MA 3OU2A 1Q2XA 1DUSA 4PONA 5DYNA 5T5QA 4YP1A 1SD1A 2GZ2A 3KNZA 5JZMA 1TJPB 3L5KA 3AERA 3FRIA 5CMLA 2QROA 1Z15A 1SVUA 3C3BA 1KOGA 2P11A 1KJJA 3LFTA 5B55A 1EQ2A 5BOSA 4ERNA 3K20A 4WA8A 2OD2A 4F97A 1YBVA 4GLLA 3UUFA 2RHMA 2IQIA 2G0TA 2GCGA 4ROSA 1JRLA 1RLIA 1VBFA 3QPVA 3AKZA 4B6SA 3KELA 1R3DA 3GLIB 1KZGB 2WK1A 3KQMA 3DKKA 5F5LA 4YUAA 1NBAA 2R5FA 4OLBA 1DRJA 1BYUA 3G1WA 1GPWB 3HBLA 4X24A 2CJXA 3RNOA 1U3VA 4PN3A 1F2VA 5K3SA 2N1MA 3G2NA 3C3WA 3ICVA 4CM3A 2VJQA 2Y9MB 3AHDA 1L7QA 2O52A 4MWCA 4Z5XA 3VPCA 2PRYA 3RUCA 1XMIA 3BGOS 1A5AB 4LSMA 2IEZA 1GPMA 3RJMA 4UUBA 1VFPA 3E9DA 2CKDA 4XDHA 4D4MA 4C87A 1EU1A 3H84A 3VFDA 7ADHA 4UTVA 3EXG1 3VR6A 4GOJA 2H8KA 2ZE8A 3A58B 2VJPA 5AVXA 5LBTA 1SCUA 3W90A 4DNFA 1RJGA 3AUFA 3PDIB 2AIRA 3U1TA 3U4QA 3IUSA 4U4AA 3H1EA 5ALJA 1DTEA 4O4HA 2JFPA 4XUDA 2YIDA 1E2KA 2UUOA 2V9PA 2X7HA 3QG1A 4UEQA 1LI5A 4E5KA 3UCEA 4JDUA 5KSOA 3IEPA 2F9FA 2O3QA 4JP3A 4DJ5X 1BU5A 2VHCA 1EUCA 5LJIA 3HKCA 4L8WB 4PW0A 2ZJ0A 3L4SO 4BFWA 3ZDZB 2H7CA 1E3EA 1S8AA 3ETDA 5A03A 4OP3A 3B6JA 4MUGA 4XM2A 4G23A 1GYPA 5H3CA 1U81A 4DDVA 1A9QA 4BGUA 2H29A 1JTVA 2P0YA 2YYZA 2YJGA 5AVUA 4WZ6A 4IJKA 2CNOA 5GIOE 2DUWA 1RAIA 1K2VN 4K0RA 4ZPXA 3U9LA 3L6DA 1E60A 2IHUA 3RSGA 2I4IA 3K0EA 1FS5A 2EQAA 3DZKA 3I2HA 1TO6A 3LCMA 4XM0A 1UP7A 1NPYA 4QC2A 5I9MA 2FSHA 3ETHA 2Z2JA 3T3DA 4YROA 4DV0B 1KY5A 4MGKR 1LVGA 2NP7A 1R6BX 3UK7A 2Q46A 3HYSA 1YSCA 5KTSA 3WIBA 1ICIA 4P84A 3GFRA 4LWQA 4BNKA 5G4KA 2O2EA 4TPKA 2JFWA 3UFBA 3LUDA 4HWKA 3WKCA 1WWKA 5K01A 2QAJA 4B33A 3JRWA 1N8SA 3B6EA 3W3AA 5C31A 3B51X 4ML3A 1WE2A 3E3OA 1P31A 3OTWA 3CX4A 3BA6A 5DYWA 3EZ7A 4RYDA 4C30A 3VC2A 4F86A 1WUTA 3TLBA 3P9YA 3B6IA 4JCOA 5TQ2B 1IXYA 2OVBA 3GJ7A 5I51A 4DLPA 3RIGA 3IDQA 4YMIA 4P3PA 3H99A 4PAOA 5A5EA 1O94D 4I9GA 2Y1GA 1ATZA 1IRIA 2DQYA 3R0XA 4JASB 5CDYA 1M1YB 2VWGA 3KOXA 1WBJB 2X8BA 3GLVA 3NHWA 4AKIA 3SYMA 1W2GA 2NAFA 3RVBA 2I3ZA 2PR7A 2BEVA 5ALSA 1EHYA 4NHOA 1Q14A 2DAPA 1QS0B 2P69A 1WEHA 1KHTA 1XRJA 3S2FA 1HE3A 3KVYA 2QRPA 1U9CA 4H7IA 4NJMA 1E66A 1GTSA 2RBGA 3GT3A 2VP6A 1TU3A 5L7WA 2FSFA 4BDSA 1Y5NA 3G9ZA 3JPWA 4PZYA 3ZZTA 1JFTA 3RC8A 1ZC3A 4QO8A 4EKYA 1B7GO 2D5BA 3ZWCA 1PJ8A 1Z8HA 3IIKA 5DX8A 1CRLA 1Y9EA 3ZU6A 4U2DA 4OK5A 4DEXA 2OG1A 1ZCFA 3KL2A 5LP1A 3H0CA 2HQSA 4ZT3A 4RUKA 1FDTA 3D81A 3LKVA 3UAVA 4DMCA 1FF9A 1SM4A 3FNFA 4IJ6A 1COWA 4MPJA 4FR0A 1TLTA 2YJ3A 2IOFA 3TIVA 2XB9A 1E2LA 5AFSA 1NR7A 4KN6A 4CMHA 1ISHA 2VJAA 3UT5A 2Q4RA 4ZOEA 3NEYA 3ENQA 1CF2O 1KZ4A 1SUPA 2JGEA 1MJFA 1NG9A 1R4AA 1OZHA 1AZTA 2HJSA 2PZLA 4U2GA 2DPHA 3NRBA 1E9DA 4JAVC 3QW2A 4PX5A 1QHXA 1XRNA 3ABZA 1Y5MA 1J33A 1FCJA 1P5HA 3I6MA 2WZQA 4ER6A 2B5OA 2OCPA 4M2LA 2Q50A 3I52A 1Z0AA 3ZWYA 1CY8A 1SBTA 2VXYA 4JOCA 1WQ1R 2HCJB 3ZWVA 1T8RA 3GUHA 3KSMA 5F3RA 2HD4A 4YT2A 3PQEA 1IRXA 4YQZA 2D06A 5K8UA 5T8KC 2VTBA 2V7WA 3WLHA 2X6RA 1EVEA 2DHCA 3WDKA 5BSRA 2X8AA 4OFWA 2B83A 1SRRA 4MIKA 1BRTA 2K5UA 4M38A 1J21A 3BFJA 4WD3A 3B3QA 4I2NA 2WSSA 3O8NA 5CITA 5MHTA 2O5CA 2AC7A 1M2KA 2KQUA 1FQWA 3PNQA 2IV7A 3TK1A 3UJHA 4XZ3A 2JJYA 3OEYA 4XWOA 1UK7A 1UFQA 4FNGA 5IX8A 1NJ1A 1I36A 3REQB 1T9ZA 2XAUA 5LQRA 5EINA 3FDFA 4IDGA 1MX9A 2FQ1A 4BVHA 1QMPA 2AOUA 3C8UA 3I39X 3FSGA 4IOJA 1R0LA 2P2NA 1KU6A 3U9SA 1ODTC 2IZ0A 2RG1A 3AINA 3KJGA 3LBAA 5EJIA 1NF8A 2FZKA 3DVAA 4QBGB 3PEUA 5BW4A 4JX9A 3EOBI 1NR5A 2C4MA 4HLNA 1J1IA 1D8TA 1E92A 3FDZA 1LPSA 1Y81A 4Y2PA 4B3XA 4OF4A 2PCJA 4OQNA 3EC7A 3I6YA 3FIJA 4QJIA 4UE2A 1F1JA 2RGYA 4HEJA 2J3KA 3AVUA 2XGSA 3RQSA 1NYQA 2IYXA 1F17A 1UBNA 1A8SA 3TR6A 2H7YA 4JGGA 4ZDJA 4DB4A 3DUWA 3CNQS 3RDPA 5JXJA 4LC0A 4DCVA 4YV0A 1ZXXA 1EJ6A 2HTFA 4YX9A 3MINB 5FKJA 5BRJA 2QLBA 3KBOA 4KC0A 5LP6F 2KBFA 1UT6A 2AD1A 3INGA 1PX2A 3NHZA 1IIBA 3BE8A 3A3KA 2JFFA 4IFBA 5KSPA 3CC8A 1L4BA 3BD9A 4YJ3B 4E2XA 4B73A 4S24A 1YJCA 3ANTA 4JB2A 4DV6B 5IDQA 1PUJA 3CZCA 1YRWA 3OP1A 4BQQA 3RYTC 1E3JA 3H1BA 1VLJA 2OLKA 4DIMA 2X8JA 3ZU3A 5DVZA 4HYTA 1C9YA 1WBDA 1XNQB 5CM9C 2VDLB 1NJ8A 3E35A 5JQGA 1DIRA 1JR3E 5ALQA 1Z37A 3FKJA 3VAZA 4UVEA 3TFOA 5EZQA 1RRKA 1XD2B 3LXRA 3L0IB 4QPPA 4DA6A 3AL0C 3RUPA 1E6UA 2PRKA 1T2NA 2JL1A 3DMYA 1KSJA 4CXMA 1T8WA 3Q7PA 4EFKA 1GY8A 5JARA 3B12A 4KDFA 4MITA 4AF7A 2H63A 2OV1A 3V8BA 2DULA 1IUPA 1X7GA 1V4BA 5BW6B 4Z4IA 2GEKA 1GLGA 1C50A 4Y1RA 3E9NA 3TOSA 5ITSA 3GUYA 3OOWA 4KTVE 4A03A 3LMKA 3WNQA 2VDMB 2JHFA 4IQGA 1DAHA 1E77A 3KQSA 1XWFA 4FDAA 3AFMA 1M1NB 3HABA 3MTBA 4NMWA 3RB8A 3EUEA 4JB3A 1JQDA 4XD2A 2E4YA 1HDIA 5AVKA 4JI0B 4TMKA 5DE3A 4FKZA 5A71A 4NULA 2OVFA 3A31A 3C14C 1YVUA 3CEAA 4BX8A 4N7RA 4CQMB 4AN4A 4ZA2A 4HYQA 3K31A 3IVXA 2Q7XA 4PYKA 1MG0A 5EHQA 4AMUA 1EHCA 4ZXPA 4UQLA 3DL2A 1RZUA 1SC4A 1X8JA 5GADl 2NU7B 4PIPA 3PGJA 2V7VA 4N5MA 2NZJA 2GILA 5H59A 4ZVQA 1U7PA 3EF3A 2CNBA 2O2XA 1JN0A 2BTQA 3DC7A 3PE6A 4LZJA 5H8WA 4L6CA 3PG5A 3L6RA 4F2DA 3LDUA 2BRUA 3QVMA 2LBPA 1EZ4A 2R7NA 4YAEA 2NQTA 5KWIA 2GTPA 2QL9A 5KJ6A 1VJTA 3UKDA 2P35A 4QXRA 4E70A 3GRCA 4OMUA 4KIFA 5LKAA 2QPOA 4I6EA 2P7IA 3NBXX 4V2UA 3KPUA 1U5BA 1S4QA 3WRXC 2J0EA 3PDWA 4RGVA 3ZHVA 1WL8A 1HWYA 3LNTA 3RC1A 4QTYA 1KO7A 2VN8A 1E1NA 2APJA 1T35A 1KS2A 2F00A 2IHZA 5K2MA 3TAHA 9LDTA 1VRCA 4NDAA 5JCPA 2WWIA 4HNQA 1B6TA 2N0SA 3I6ZA 1CUYA 2JDIA 4B3HA 1E2QA 4IMIB 3HUTA 1UJ4A 1GTJ1 2J30A 2QYTA 2V6FA 3ND8A 1OBHA 3H1GA 4BATA 3LDFA 4BFUA 4BQPA 2GN1A 3DS8A 1FFAA 1R0BA 2SKEA 3VNBA 4KXFB 4PGMA 3GP8A 4IDUB 1E1CB 4E14A 3Q11A 3AL3A 2GT1A 3OJXA 4PC2A 5EIBC 4UE3S 3TNLA 5CT9A 3PX7A 4X62B 3KAQA 3TNJA 5LLSA 2NO0A 5TGTA 5G0WA 4EJ2A 5A9TA 5G3YA 1CQXA 1MV5A 2VJMB 1L1QA 3SY8A 2GO1A 3BPSA 4RIFA 4IXDA 2QN8A 4EY6A 2OCYC 3CZ4A 5IFKA 4A2WA 4BNXA 5LNK1 2H0QA 2H59A 2R65A 4KAJA 1YZNA 1AXRA 3M34A 2RI6A 3P9SA 2E4UA 4LWOA 1Q0TA 4I4LA 3K73O 1XDBA 1KI8A 4E1BA 2HRBA 3WG9A 4U39A 1GSOA 4PCVA 4F6RB 1N3BA 2WEKA 4LF4B 3DULA 3T8YA 1KOJA 1TW2A 1VCIA 4C76A 4EI7A 4PC1A 4BKMA 1V11B 1CUUA 2PN1A 2WWFA 4KRXA 4PY2A 1GJRA 4EK9A 5IVPA 1Q50A 3MOGA 5IT4A 3NATA 2PSJA 4PHGA 2Z3WA 1JEYA 4YC7A 3RV3A 2P2YA 2QE7D 2YHSA 5ECWA 1CF4A 3HYRA 3EVBA 3G5MA 4PYLA 3RLIA 3LUCA 2CFRA 5FFFA 1H2AS 2HV8A 2JHAA 2VYQA 3BKWA 3TTTA 3GLFE 1GG2A 3FSJX 2PZGA 5C0OE 1AQYA 1W36D 2C92A 4NBKA 3CLUC 2EZ4A 2EW8A 4NF2A 3TLGA 5DXJA 2W9XA 2VDPB 4N18A 4EW3A 1KDTA 4LNUB 1CKEA 1X14A 4UU8A 3HMQA 5DNAA 3QYAA 4HAUA 1WHTA 4HZUA 4L3VA 1C3EA 1SOAA 3W4JA 3Q8LA 1N2CB 5ALFA 4HWTA 5B7GA 2PD6A 3JRNA 1XTKA 2B6HA 2XE8A 3IAM1 4RFVA 3LUHA 4BHHB 1VG0B 4X20A 4EOGA 1ABEA 1T9HA 1N5OX 1MR3F 1UPTA 2J67A 3TD9A 1P75A 2OLEA 3U6BA 3DLIA 3NBQA 5AXAA 4NDZA 2F1IA 4ARUA 3DBHA 1X7HA 4Q3NA 4BFZA 4WACA 2RCNA 2QTFA 5HTOA 3ZDFA 2EV9A 2UV8A 4R1LA 2HO5A 2P6NA 5KNDD 2H4JA 1V37A 2PZJA 4WXPA 1T29A 3RM3A 3CUSA 1CV2A 1MQ9A 5HSGA 4N54A 1ZD4A 2I1QA 3DZ8A 3HSSA 5P8WA 1YVPA 1RYYA 1P62B 2I22A 2RGGA 1KRWA 3RS7A 4B31A 3AUTA 1QDLB 3PA8A 1PGPA 7YASA 2R1VA 2G83A 4W82A 5BN4A 1AK1A 2VWPA 1L5LA 1M6HA 1V1JA 2MHCA 1EUZA 1XP8A 3KSRA 1QTQA 2LCIA 1ADFA 1JLMA 1P0CA 2B1QA 2OHFA 3EGXB 3M6WA 4LBZA 4JFAA 4LOLA 4GX0A 4W5WA 1RE1A 5CGQB 4RDIA 2HRQA 3UG7A 5IS2A 4WZAB 2ERYA 5HF9A 3B8HA 1ZVVA 2R47A 4B32A 4LI0A 2CN1A 3BRWA 4O4IF 4M7PA 4IXMA 5E1DA 4PSKA 3W5IA 2PH3A 3ESDA 1UBJS 3CEMA 4WOBA 4E11A 2PWYA 3BA1A 2DPLA 3QLTA 4DCSA 2DR2A 2XCUA 4B75A 2JFXA 2QT1A 4QVKA 5K51A 4JU9A 5LUBA 2HA3A 1C4KA 1PEDA 1H0KA 2ECFA 2X8LA 1BCSA 2YWHA 3AUYA 3BQNB 3EFBA 4JX8A 3T0GA 5B7QA 2AZ4A 5K3CA 4LF5B 2XUOA 3E8XA 5DNUA 3AF2A 1G8AA 2BFOA 4BV8A 4CF6A 2CNDA 3PPIA 3QVUA 3ORRA 4F3NA 5KWSA 2YASA 2NXCA 4JMPA 4TL6A 1XFDA 5HX7A 4GIBA 2HUPA 4IIUA 4KFSA 5C80A 3KEFA 2Q6KA 3N28A 4LVCA 4URZR 2OBLA 2HQRA 4JEMA 4MS4B 2FXIA 3CGWA 4XB6B 1RWPA 1KTIA 3EAGA 4WNIA 4M46A 1E2GA 1RYZA 2L19A 2ZS8A 4M21A 1EMDA 3UMJA 1NN3A 3WKDA 3DHVA 3BMXA 4QPDA 3V6MA 3G2OA 1E1LA 4R69A 4RA6A 4UW9A 1I2AA 3QELA 2QOEA 1YR1A 5CA0F 4G5SA 1IB6A 2QG6A 2WIDA 3OT5A 521PA 2AN1A 4F96A 4POOA 5KQPA 4BNDA 5B2EA 3EMBA 2ZSAA 1RHMA 1YFKA 2Q9AA 4K9LA 2ZGVA 3UJDA 1G98A 3W34A 4NRDA 1X6VA 2OHHA 2FW6A 1OUMA 1Z26A 2W7TA 4AUKA 1ZGZA 1JKFA 2XV1A 5K4AA 5PNTA 3S2SA 1EGHA 1SCUB 4LBWA 5EOVA 1RAGA 3E0QA 4FDMA 4FYXA 3RS0A 2HCBA 3C97A 4NYIQ 5IDXA 2NO4A 2FWPA 3ZVKA 3ZCTA 3WICA 3E81A 3QRWA 5EJ6A 4YQEA 3S2YA 5E1MA 3SBEA 1EUCB 4B6OA 2W48A 5JCJA 1O89A 3A6ZA 5AM3A 4BQOA 1NDUA 5D85A 2QENA 2FLWA 4F92B 5BN3A 3A4VA 4AJ4A 5LDDC 1NUSA 2QGNA 4Q6WA 1C30B 1J24A 1Y3CE 1P8JA 1VXOA 4I9HA 1SR8A 4OA8A 1P7WA 4XYLA 4MJ3A 3CUYA 1O6BA 5E0KB 5T3YA 1HFJA 2BBTA 2GBLA 3VR3D 3F6PA 5K4GA 4JR0A 1FYWA 2OD7A 5GJBA 1L4GA 3G9QA 3PWSA 5AMXA 4ZHQF 4TWBA 3UK6A 1B14A 1EA5A 1M74A 3PIRA 3TZQA 1ORVA 4P4SB 4KMMA 4M7OA 4UOQA 1J07A 1NOKA 1R0KA 5KREA 3KXKA 2IC5A 1F38A 4N03A 5EEHA 3NT5A 4EABA 5L3ZA 5ADUS 1MVNA 3QY9A 4ID9A 1CP3A 3EDRA 4G65A 4G63A 3RVKA 3HH8A 3LVRE 5IVHA 2UYHA 2A0YA 1HE1C 2B2NA 3BERA 3BZUA 4MXDA 4M8SA 3E8SA 2E37A 4ALJA 4LGVA 2ODPA 4GD3Q 5G4KB 1TEZA 1OASA 3HPQA 4PPYA 4D9IA 3CUKA 3WA6A 2WWWA 3OZUA 3E23A 4G9BA 3BMCA 3MLAA 5HOEA 2AL7A 4DLAA 2XSZA 5BNFA 3PNBA 4FZ3A 4L7VA 1DIOB 1WD5A 2XXBA 3VOAA 4RZUA 1JUDA 3P9PA 5FOWA 3WXBA 1QG6A 4DMRA 1O95A 4QUBA 4Y98A 1K9VF 3QF4A 2AS0A 1FFBA 1KFJB 2WIKA 1RQ2A 1ZOIA 4JVNA 2VI5A 5J4YA 1B3BA 5EJAA 4F6CA 4RW0A 1XA3A 3PFIA 5BSFA 1KVSA 4MQEB 3KTFA 1QHSA 4EAAA 1Z5GA 1WEKA 4EI9A 2VP2A 1P2VA 4KUEA 4B3JA 1SHJA 1P6UA 1Q16A 1LDEA 5IC5A 1L4YA 3RSOA 1DT3A 3C4QA 3CLKA 1OB5A 3UWKA 2CCJA 3T1HB 3FRJA 4V3CA 3TE6A 3UXYA 2BEVB 1GDDA 2QMZA 1HL3A 3DHWC 1WRBA 5LR6A 3U4GA 3ZDEA 2VP5A 1XKQA 4EA9A 4AT1A 3IV7A 1GZHB 1WW3A 4IY1A 4U7HA 3RC9A 3NTRA 4NJMB 3WMWA 3WB2A 4X8LA 1DVRA 1XZHA 1Z4QA 3OF5A 2NUTA 3U1VA 5A5VA 3ZXSA 3EZNA 4IBOA 4FXPA 4C0JA 1YHZA 2F8LA 5CT5A 1FFWA 1VSQA 3QXJA 4B71A 5KDOA 2YNMA 3H5RA 4K2AA 16PKA 3A27A 3QVKA 4G0PA 3T7IA 1MO6A 1UPXA 2QN3A 1C1DB 1PVDA 2XQVA 3W2TA 1TM4E 4MR7B 5K0FA 4X65B 4CF4A 4AS2A 5GPBA 1F5NA 1I9GA 3V9PA 2JGDA 4IV8A 5ARCA 4YEDA 1OJLA 3PXGA 5EE9A 5CEEA 1O5TA 2VPQA 2FEKA 1XU7A 3WNVA 1IMJA 2R3SA 3UAXA 3CB2A 2X9QA 4XIJA 1U3DA 2W93A 3GJ5A 1G2QA 1TT5A 2OE2A 4FHFA 2R1TA 2WF9A 3NJ4A 3ER6A 3TRFA 3UTDA 1W5EA 2PM8A 2V0CA 3IO5A 3DA8A 5KNCD 2J3EA 3WMGA 4BCCA 3RSLA 1QAQA 1U7XA 1ARZA 1YS7A 5GZ6A 4LYYA 4QE3A 3SC2A 4BFLA 1K6XA 1YC5A 4PQFA 4Q34A 4KIWA 4L95C 3ORYA 5F23A 5IF9A 1XOIA 2P7HA 5C8ZA 1USUA 1LLDA 5IN4A 2AC4A 3K4QA 4ZU1X 4Z4HA 2GESA 1C7JA 1EE1A 3U37A 1J1ZA 5J1TB 3H7IA 5EKSA 2XCSB 3O7WA 4P82A 4R8SA 1T25A 2BHSA 3FD8A 2WHYA 1U1CA 1ZFNA 4NI5A 4XRRA 5FFNA 3M33A 2RKBA 3VO1A 3L0ZA 5E6SB 5AKLA 3FHJA 1R0YA 4J0DA 5KQSA 2O6LA 1PR4A 2V8BA 3PFGA 1E3SA 3TQOA 3JASA 5KNBH 4BB0A 2OHOA 2FE1A 1RM3A 4FW8A 2AG6A 4BEVA 2JFBA 4FSHA 3DV2A 3CN9A 2JI7A 3REGA 4N3BA 4JP8A 3E6AA 4GQAA 1N9KA 4KXXA 4O2BF 1II8B 4AYXA 5IEBA 1U6KA 4JMLA 3GEGA 4O3FA 5HF5A 1LD3A 2E4ZA 1LI7A 1SXJA 3NRJA 4EECA 3N8HA 1ZVMA 3Q3HA 1RXEA 1O4WA 1TNDA 3IBGA 4MYDA 4DQDA 4C7VA 3QOXA 3KXPA 1QE0A 5KB3A 2GGSA 4OHPA 5JADA 3JY6A 1LVUA 3I04A 4YP6A 4NL4H 5IH7A 1Y4ZA 4EHNA 4XWWA 5JW6A 4M60A 4C1BA 1YB7A 3MT8A 1Z83A 4UJ3A 3UAZA 1I14A 1JU4A 1Z18A 2JIZA 3WJAA 3L4BC 4O2AB 5EIFA 4NG5A 4RXUA 1VJ0A 1BGWA 4Y2UA 1GTRA 3USCS 3EZGA 4X1KB 1E7WA 1Z0KA 5BXQC 3IH5A 1JBKA 3B6MA 5AM1A 4C2TA 3KYCA 2PX3A 3PCTA 5CU7A 1BX1A 1NT4A 2H18A 4IF6A 1CVLA 2EW2A 1U7ZA 4AW9A 3DBLA 2RD2A 1E79D 1SU4A 1JAHA 4ME6A 4S2UA 1E98A 3T5GA 3G5LA 3RS8A 3OEED 2X8JB 3IPYA 5TPZD 2C94A 3D43A 3EZ6A 2AG8A 3UICA 4EYGA 3NHRA 1UBSB 2B4YA 1ADCA 2HSDA 3C8MA 2I29A 4LZZA 1L3IA 3UFXA 4ALNA 5LMZA 2XKKA 4DLKA 1CU1A 3CKKA 4LOAA 1O8CA 1RXIA 3NTOA 3PB3A 3D0KA 1ODFA 1VIYA 2DERA 5E4JA 3V2GA 1TCVA 5LKRA 1TK2A 4FDTA 4KO8A 4J1TA 1K68A 3A6JA 3FCSB 3IVMA 4YRQA 5EERA 4BGPA 1MC5A 3TSOA 4RFSA 4G5RA 3ZCXA 5LOVB 3PXXA 4JH0A 4ZU3A 1XPRA 4YV1A 1EXNA 5TQ0B 2ACVA 2AFVA 3N2GA 2VRNA 1RWKA 4NCBA 3OQIA 3R8CA 4OQLA 1H1TA 4KWCA 3I62A 1O03A 1OROA 1QF7A 4OJQA 3UJ7A 3TW4A 4AJOA 1DAGA 2J85A 4LC9A 3LP8A 4KAXA 3VC7A 3PENA 3TD2A 4BMVA 2GFHA 2PPVA 2PRZA 4CKBB 2YMMA 4HNVA 1CUXA 2F67A 4Q1BA 2D5CA 1MW8X 2ID7A 4LHZA 1NUTA 1T43A 2FSPA 4MYUA 4OUDA 3GEDA 3TLXA 5CNMA 1WY7A 1YKFA 4C0XA 1A71A 5FEMA 2BAGA 3QLVA 3WMEA 5JCOC 4IDEA 1V8FA 1VHDA 1P44A 2P2LA 4HNGA 1RKXA 2C4NA 4I9UA 4DZZA 1SBNE 2VAPA 5KYYB 1NM5A 1W88B 4DRYA 4FCCA 5BMVB 1XROA 3QVGB 3STXA 4X6UA 3T7TA 4E2FA 4ZYYA 1MNAA 2RGBA 5KEIA 4HWGA 3S1AA 3V1YA 1P1CA 1ZSVA 4JD5A 4WERA 2RHLA 3MWDB 2BTQB 4ASUD 1I6LA 3H1PA 5IAAA 4CT5A 1TE2A 5TB5A 5CT8A 4EJ0A 2IPMA 3H11B 2GJ8A 1M7BA 3C6KA 2VZ9A 3Q0IA 4F4IA 1Q7TA 3ET5A 4K6OA 1JG2A 2DB3A 3DM9B 4C78A 3OZXA 2FJ0A 4H60A 2XUIA 5FUYA 1MB9A 1GKYA 5I7HA 3C5EA 4BAUA 2FPUA 1IHYA 4OLJA 2AJLI 4E1VA 1U6JA 2XLCA 3GFPA 2RGNA 3IXMA 4I2VA 4ZIRA 2WJZB 4U8HA 1GZDA 2XF2A 2PUEA 2AI1A 1GNQA 1NUAA 4EZIA 1EDEA 1PR5A 4CF7A 5EXSA 1NUPA 4CGZA 1NRXA 1IY2A 4XOUA 2ZE7A 3EXFA 3F1KA 4Q1EA 5AR1A 2WTXA 4LFCB 4NH0A 1C0EA 1PYDA 3IMGA 2OZEA 3OJLA 1YZVA 5DN6A 1XZQA 1KZ1A 1YIAA 2V3VA 5FNVA 4FSXA 2J9RA 5CVTA 2BM9A 4MS3B 5EIEA 3HEBA 1B0UA 2RH8A 5FHRA 3O8QB 2HB6A 4RKFA 4QBTA 3HYNA 3OZCA 3FW1A 3B3FA 4MGYR 4UPVA 4HS9A 1QV6A 4HBGA 3A11A 1KKLA 3HACA 3PUIA 4HSGA 1QO0A 4IVQA 4UM5A 4FHGA 2J5BA 2QPAA 4EWLA 1NUUA 2QKYA 4YXWD 1HYHA 2V65A 2C84A 4BZWA 4C7KA 5MF6A 1W76A 1EDOA 2AV6A 4NCAA 3RU7A 5IJWA 3VJRA 4PO3X 5I8PA 1W85B 3VTKA 5HKKA 4F85A 1QV7A 1G7SA 3K9CA 2R8ZA 3JQAB 2BMWA 5LQDA 2O7QA 3F2VA 3K1ZA 4GUAA 5LZ8A 3LTEA 1UFVA 1BH2A 3CUTA 2BJVA 4PLYA 3T41A 1JEYB 4GSYA 4WBNA 2EL9A 3T3OA 2PWBA 3EVCA 5LPNA 3MBIA 2C95A 3MMSA 3OCCA 1IZ8A 3WFZA 1SGWA 4HNRA 1S3FA 2XNSA 2H1FA 4PSVA 2VNKA 5KYVA 2X4GA 3VSCA 1EP1B 4RDHA 5A4DA 1Z5UA 3TSWA 4DWJA 2ZSEA 2A5JA 2BGJA 4DIUA 2I2DA 2QI9C 5K0CA 2OLJA 4JN6B 1ZU4A 4JA0A 5T4HA 3OCJA 2VT2A 5IBRA 1HE8B 2EHDA 4DJEC 1FMTA 1NA5A 3D7LA 4HZUB 1O8BA 4KYVA 1D09A 3KPYA 3QLJA 2H7XA 1DWQA 5IVDA 1LF5A 1UKVY 2Y1KA 3EZ9A 4Q3EA 5LA6F 1B8OA 5C34B 2NU8A 5F4BA 4GR4A 5CB4B 2BGUA 2NLOA 3EDYA 2FW1A 1S5PA 3VV2A 2IBTA 3DMRA 1RVV1 2A5GA 4OYYA 4EY7A 4YRSA 2OEPA 1IB0A 4JFRA 4K5QA 4EFNA 4A5SA 3OD1A 1JPNA 3ZCVA 1TLLA 2PFSA 1AF4A 2QQFA 1IL0A 1FJGB 4RSHA 1W0KA 5EUMA 2A58A 2NU9A 3RS2A 4HB3A 3HN6A 3GLHB 3ZQ4A 4ZCMA 1V6AA 1PT9A 1MX1A 1PD1A 4CFYA 4N6OA 3IEUA 3A2MA 3SBOA 2V9CA 4DF3A 4W1PA 4E3WA 3GRYA 1K4KA 1FZQA 3AUXA 5FJIA 1HO3A 4RV4A 4ZVSA 4DA9A 4EP1A 3O0TA 2OGWA 4HNSA 4OYHA 1GTVA 2IDZA 3KTAA 4WV3A 5FUWA 2BBWA 2ZYTX 4HUTA 5B6PA 4CEIB 3L7OA 3PFFA 5DMHA 1DAOA 1R0SA 1G5RA 1YJXA 3TXXA 4EB6A 1B23P 4GVLA 2J3LA 4GG1A 4NJEA 4ZT4A 1WZUA 3IIEA 1FFCA 4CDRA 2EVWX 4M0EA 1W1WA 5B7PA 3L8GA 5GZ1A 4LDRA 2RGCA 4LTDA 5I7VA 4UARA 3C8DA 5AVOA 1T9DA 4BMDA 4F71A 4G0YA 4QPZA 3MCZA 4ZMSA 1QR6A 3EFHA 4MW4A 4L4XA 3ZV4A 1XL1A 1PO7A 3HCRA 4O0MA 4Y2YA 4EVRA 2AG5A 3GPDG 4B2IA 4I5GA 1Z3CA 4DEYA 1PS9A 1W9HA 3NPMA 3ZWPA 5MN4A 5C4GB 1IDOA 1S96A 2FEPA 4KQJA 5JI2E 4OX9B 2DFDA 2WKWA 1BCRB 2X4IA 1BFUA 1PJRA 2QRHA 3PL1A 3R0VA 4FSDA 3SYLA 1FVHA 1L7OA 2WB2A 1KO1A 3D6TB 5MGBA 3DL4A 4KPUA 1VSBA 1YE5A 3GJXC 4J75A 1CXZA 4ARIA 1AGNA 3OA0A 3QKTA 2ZT7A 4H0NA 3TIFA 1ISFA 1Y8ZA 3HJBA 2W2MA 4BC0A 2FTKE 2V74B 4DSUA 3T5AA 3I4LA 1LBTA 3EMVA 1PZXA 4I55B 4YYEA 2I9PA 3MG9A 2WF5A 4BYMA 2RONA 4E30A 2ODQA 4JROA 3IUBA 4UD6A 3PHCA 3K96A 1OA0A 2QX6A 3LRXA 3Q41A 2UDPA 1PEYA 1VJRA 1DBQA 4LJYA 4ZAXA 3RKUA 3QELB 4IM7A 2BCJQ 3ESZA 1QHEA 5DIFA 2NTVA 1FNNA 3O8OB 3HB4X 3P4YA 4BNDB 2DWOA 1BMFD 4B9AA 4C4ZA 3TPZA 1EVIA 3QE0A 2ZSBA