1SB8A

Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4-epimerase complexed with udp-n-acetylgalactosamine
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
341
structure length
341
Chain Sequence
MMSRYEELRKELPAQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLDNFATGHQRNLDEVRSLVSEKQWSNFKFIQGDIRNLDDCNNACAGVDYVLHQAALGSVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGDHPGLPKVEDTIGKPLSPYAVTKYVNELYADVFSRCYGFSTIGLRYFNVFGRRQDPNGAYAAVIPKWTSSMIQGDDVYINGDGETSRDFCYIENTVQANLLAATAGLDARNQVYNIAVGGRTSLNQLFFALRDGLAENGVSYHREPVYRDFREGDVRHSLADISKAAKLLGYAPKYDVSAGVALAMPWYIMFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of WbpP, a Genuine UDP-N-acetylglucosamine 4-Epimerase from Pseudomonas aeruginosa: SUBSTRATE SPECIFICITY IN UDP-HEXOSE 4-EPIMERASES.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Isomerase
molecule keywords wbpP
total genus 127
structure length 341
sequence length 341
ec nomenclature ec 5.1.3.7: UDP-N-acetylglucosamine 4-epimerase.
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1sb8A01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1sb8A02
3ZU3A 4D44A 2QRJA 2BI8A 3CEAA 1E6UA 3TN7A 4J4TA 3EVNA 3ZV5A 3TZ6A 4CMAA 1DLIA 1GYRA 4XCVA 2PGJA 1NFFA 4FFNA 2BMAA 4XYLA 1YE3A 1KYQA 4OXYA 4BO7A 3Q6IA 3GNSA 1I10A 2CVZA 1RPNA 1HZZA 3NRCA 1T1SA 4H3VA 1X7HA 1RJWA 4ZQFA 3LT0A 3WGTA 3JD1A 2HMTA 3IUPA 1MFZA 4L4RA 3IJPA 1XQ6A 2Y67A 1B0AA 4RVGA 3TL2A 4AVYA 2X1HA 3H3JA 4CM4A 1EE2A 4R16A 4KQWA 4XYEA 4RPGA 3LT1A 1M67A 5T6BA 4DYVA 2QRLA 3E9NA 4FS3A 5JO0A 2BFAA 3IJRA 1EUZA 2PGLA 4GVXA 4F6CA 4GLLA 3TZHA 4MO2A 3S8MA 3DHNA 1X1TA 4CMEA 5COQA 2YQ4A 1LI4A 1HDGO 1E3EA 4BO6A 2ZB8A 2HK7A 3GZNA 3W8FA 2NM0A 2VNSA 2VWGA 3JQCA 4HY3A 4I1IA 4NIMA 4FFPA 4B4OA 4BB5A 4I9UA 2J5RA 3QJ5A 2PLAA 2WM3A 4CM7A 1HL3A 3PPIA 4JNKA 5C7LO 4LK3A 2CSUA 4FBGA 1EDZA 4XDYA 2O50A 1HYGA 2IZ1A 1X7DA 1BXZA 4JBGA 1LXCA 3Q3CA 3EDMA 4RORA 1YKFA 1EE9A 3W6ZA 1E6WA 3GA0A 4XYMA 1O5IA 1D1SA 2IRWA 2Q50A 3H65A 1PQWA 4NHEA 2AG5A 3WLEA 4XRGA 2RBEA 1R15A 1UDCA 3ZI0A 3OBBA 2E37A 2AQKA 4E33A 4XKJA 4GMGA 3RFTA 1T4DA 2TMGA 1ONOA 5A4DA 1K3TA 5IZCA 2NU9A 1JWBB 4ESOA 2DLDA 2CDCA 3G3EA 4EUFA 2DPHA 4AJ1A 5DNAA 4DLAA 3D1LA 4ILKA 1DRUA 3WGGA 3WBFA 4BO2A 2FP4A 4FW8A 2F1KA 2B0JA 3PFFA 4L0QA 2HK8A 2DM6A 1P3DA 4YPOA 1IPFA 3RBXA 4E0BA 5KJ6A 2YHUA 2ZIZA 4JQCA 2P91A 1PJ4A 2RCYA 3H5RA 4Z6KA 1UR5A 2EEZA 1UP6A 3OA2A 5CP8A 4ZU3A 3DOOA 4MP8A 4UEOA 4BUCA 4BS9A 4PN3A 2OP1A 2J5KA 2IXBA 2YYYA 4U6SA 1JQBA 3H2ZA 5KTKA 4E6PA 2QRKA 2HK9A 1ORRA 5TNXA 4NBWA 3LF1A 5JDIC 4WNCA 4HFNA 3JQAD 5DOVA 1EK6A 3JQFC 4XWYA 5F5LA 2Y05A 1MA0A 1MV8A 4M55A 1E7WA 2R2GA 2VHWA 2UDPA 1YONA 3PHHA 1AGNA 4PLZA 1LJ8A 1NAIA 1PGPA 4BNIA 3OQ1A 2EXXA 1B15A 2BLLA 5GZ1A 3G49A 2VT2A 3GDGA 2C20A 3ZW8A 4R4JA 3ORFA 3L77A 3PQEA 2DBVO 4FOSA 5HM8A 1SNYA 2OBYA 3ENNA 5FYDA 1KS9A 1XSEA 2PR2A 2UYYA 1NX6A 3E6AA 3GAZA 1VPDA 3FN4A 3F1LA 4IINA 3RC1A 4BV8A 4WLEA 4FC6A 5K6AC 3FPLA 2XAAA 3OIFA 2H9IA 1TA4A 4AJLA 1Q1NA 4WLUA 4N18A 1T25A 4TROA 1XQ1A 1Y8QA 3O03A 4XQEA 3W4KA 4JBHA 2DFDA 3SC4A 1ZFNA 1DAPA 1A4UA 3JYQA 3BIOA 3OA0A 2YFHA 5T5QA 4RV9A 4IQ8A 4AJ4A 3SVTA 3MJCA 3ADOA 3NTRA 1NVMB 1Y5RA 2Q2QA 4CQMD 3H9GA 3FNFA 1F0YA 3ABIA 5JAQA 3TNLA 3KEQA 3BMOA 3K96A 1HDZA 1ZMOA 2Y99A 4BGVA 3LLSA 3N7UA 1V3VA 1Y5MA 2FSVA 3BZUA 4ALLA 2W90A 4JJGA 4B4VA 3D3EA 4MVJP 4P38A 4PG7A 5HTOA 1B16A 1TXGA 4N54A 3M2PA 4B7UA 3KYCB 3PHGA 5TIIA 2WEKA 2PNFA 4JP3A 2Y1CA 1ISHA 2RIRA 1U1IA 5LDHA 4CQMA 1I30A 5JNLA 1J0XO 3ETGA 3WGOA 4ZA2A 3TRIA 1T2AA 4HFJA 1ZVMA 2OL4A 2HSDA 5DF1A 1T2FA 3DMYA 4A10A 2OZPA 3TFOA 4GQAA 2Y1EA 4QUKA 1DLJA 3STHA 1JN0A 2OFPA 2PZLA 2Q1WA 4BO3A 5DP1A 1F17A 3DL2A 1O9BA 4LGVA 2PZKA 1JWAB 2X5OA 3HSKA 1NAHA 5C7IO 1ENPA 5L95A 4BNJA 2B5WA 1UZNA 3GZ4A 3IMFA 1R4NA 4YJHA 1BXGB 1L7DA 1OBFO 4TVOA 3ZCXA 3GGPA 4IGFA 3JV7A 3QW2A 4K9DA 4E5KA 1MC4A 3U4CA 4E5NA 5L7WA 5JC8A 4B4UA 4LN1A 4WEOA 4O6VA 1Z6ZA 2EERA 4DRYA 2W2LA 2CVQA 3UCFA 4BNHA 2ZTUA 3JQ8B 1NHWA 1U2GA 1LUAA 3L9XA 3IQDB 3U4IA 1ADFA 1DOHA 3CINA 5BSEA 3O4RA 1KVQA 4TKMA 3MWDB 3V2HA 3BMCB 1P9LA 4MKRA 1RWBA 3D5TA 4J90A 2AQIA 1CEQA 3ASVA 1HE4A 2I5PO 3E5RA 4MOWA 3KV3O 3ROMA 3SLKA 4BL5A 4ZJUA 5JY1A 1N1EA 1DC4A 3EMKA 3P2OA 4DPKA 1A5ZA 5B1YA 3PP8A 5H83A 3JQGA 1HXHA 1D3AA 1Q0HA 4E5PA 4MVJF 4QFCA 4PLVA 1Q0LA 4WOKA 2ZJ1A 1E3WB 4CM8B 5IF3A 3U62A 3VPXA 1YB5A 3S2EA 4QO7A 2B36A 3WICA 1SCUA 1LU9A 4EW6A 1YDWA 3I9NA 3PRJA 4FPXA 1I2CA 3OF2A 4HKTA 5G0UA 1HETA 3AM4A 1EVIA 2VHYA 4YAEA 1R16A 3K31A 4QQRA 5AQ1A 1X15A 1UP4A 1HSOA 3DTYA 1CDOA 4MINA 4AJKA 4O59O 1XCBA 4BNNA 1FDWA 3ZWNA 2O3TA 4CPDA 3DDNA 3B1FA 1ZUD1 3ZNPA 2YDYA 5IFLA 5DZSA 5LC1A 1R4MB 3JYOA 3TPCA 1W73A 5A1TA 1B3BA 3JQ8A 3ANMA 2CFCA 4CMJA 4JLWA 4NMHA 4OQZA 3WXBA 3HB5X 3VZSA 1M76A 5JY6A 5L7YA 1G6KA 1CIVA 5IN4A 4I5FA 3NDIA 1P45A 5CEFA 3C7AA 1FXSA 3CIFA 1C1DB 3MJSA 5EMHA 2G5CA 4R5MA 5L4NA 2X8LA 2ZB3A 3M1AA 2CUKA 4AJOA 1IZ9A 4I5EA 3JQ6A 5G4LA 1QSGA 4E32A 1DJNA 2D8AA 2O7SA 4GX5A 1U2DA 1EVYA 3RBVA 4IQGA 2IE0A 2R6JA 4PG5A 3DZIA 4DXHA 3BMOB 4E2WA 3PTZA 4IDAA 3W8EA 4ALJA 5EJ2A 4BNWA 4KUHA 4CUZA 1PJCA 3ZHYA 3BHJA 3DR3A 5G0VA 4JN6B 3GQVA 2B5VA 3FNEA 4OQYA 2FR1A 1L7EA 4IDDA 2HO5A 3OIGA 3H6KA 3WNVA 2C7VA 3PQDA 4YDRA 2DC1A 3NX4A 1KBZA 3PYLA 4OSOA 1BVRA 3KLMX 1DHRA 3PWKA 1KETA 1V8BA 1HWYA 1GCUA 2EIHA 2HLPA 4OKIA 4C7JA 4D3DA 1VLLA 3OICA 3QSGA 4OOFA 1IB6A 2BELA 1EUDA 2GNAA 4CLOB 5IZCC 2QQ5A 3RASA 2JCVA 1BMDA 2O3RA 3UICA 2JFGA 4FFRA 5K9ZA 5TGDA 1P0FA 4GPD1 3ONEA 3D4PA 4Y98A 4FJ1A 3UCXA 3ZWYA 4L9RA 5I7SA 5K0ZA 2OP0A 1NFRA 2VRCA 3Q11A 4PCVA 2LDXA 1NQTA 2GLXA 3V1TC 3OFSA 1ZSNA 2LDBA 4YJGA 2G1UA 1DC6A 5GY7A 4CMGA 4NFHA 2OMEA 5JCJA 2ZYGA 1OFGA 1E92A 1OI7A 2R00C 4BO8A 2I67A 4JROA 1HDYA 4YBZA 5JO9A 4CQMB 4J1SA 1FK8A 3CE6A 2NU6A 4WEQA 1WDLA 2JD0A 1H94A 2OUIA 1BDMA 3HFSA 3QVXA 3ROKA 4XB2A 1HT0A 1LLQA 3EC7A 3GOHA 2E48A 3WGZA 4YAGA 5TQVA 2D5AA 3GG9A 4WKGA 4PZDA 2POQX 2RH4A 1QMGA 5JAIA 3QE3A 1QG6A 1U7TA 2VYND 4RPJA 3TSCA 2AE2A 5I9NA 1YWGO 4D43A 2IZZA 5KKAA 1EZ4A 2WD7B 4R1TA 2NVUB 3QWAA 4N5LA 4Y6PA 3K30A 2EKLA 3DB2A 1ZJYA 1N7GA 3PWZA 3BMQA 3C3XA 4I5GA 1PQUA 3ZU5A 4CQLA 2BKAA 1ENYA 4YWJA 1EUCA 1ENZA 3X2FA 4PRKA 4EI2A 1D4FA 1DRWA 1H9BA 5DBFA 3DHYA 1WMAA 3WGQA 3I4CA 5HS6A 5CG1A 2HMUA 4ND5A 1ADGA 1X0XA 3T4EA 1GU7A 1EMDA 2ZB7A 4FC7A 1H6BA 1NBOA 2P2SA 3HWRA 4KWIA 3PYMA 4QECA 2VTDA 2V6BA 3UHAA 3NJ8A 2GDZA 1GYPA 2P4HX 3L9WA 2VUTA 5L40A 4GLOA 4Q3NA 5A9SB 4DPLA 3LK7A 2NQTA 4II2A 5CDSA 3KEOA 2PH3A 2YV3A 3UN1A 5ADHA 2JAHA 2ZK7A 3G79A 1F14A 4MVJG 1O0SA 3KRTA 3VC7A 1JKJA 3L07A 2PH5A 4P8RA 4LVUA 3VDRA 3V5NA 3ANNA 3D3WA 3HDHA 1XR3A 3JTMA 1ZEMA 3AFMA 4J2HA 4XB1A 3WIDA 3IP3A 4QO8A 1YVEI 3C1TA 2YFQA 3DBLB 1Z7EA 1E5QA 2XPCA 3AOEA 3DAPA 3EYWA 3GDOA 4IQ0A 3A14A 5BT9A 1VKNA 4GSKA 3AUSA 3HFGA 5T57A 1VSVA 2FPPA 5A9RA 1H93A 4IJWA 4XIJA 2TMDA 1PL6A 2VHXA 1MC5A 4RVDA 4NU6A 1F06A 1UAYA 1VJTA 2WE7A 3K92A 3GVCA 1YJ8A 1X1EA 1YS4A 3CMMA 3EAGA 3DTTA 4J1NA 4LSMA 5L9AA 1HYHA 5C7OO 4PLGA 2X7HA 3U4DA 1AN9A 4RLSA 4FJ2A 2R00A 5J23A 1LLDA 2G0TA 4IDFA 3RKRA 5THQA 1O94A 2Q1TA 3P5SA 4CR7A 3OP4A 1E1LA 3ZNOA 1GZ4A 1BHSA 1YBMA 4KTVE 3PYXA 1TT5A 3PGXA 3TWOA 4ALKA 1CYDA 2AXQA 5B12A 2ZCUA 4D0RA 7MDHA 2QX7A 2ZYAA 3F5QA 4PIVA 5COAA 6LDHA 2NV6A 1KVSA 3KETA 1VL8A 4U7WA 3HN7A 4FN4A 1D8AA 1W0CA 3O26A 1HLPA 3DBLA 2C0CA 1ZXLA 4U8GA 2W98A 2YV1A 5JBIA 5G4KA 4D79A 2VWPA 3BMNA 2FRDA 3QY9A 5EN4A 4P22A 1UUFA 3DFUA 2VN8A 5G0TA 3W6UA 4YYZA 2G17A 5TX7A 3VPSA 3VZRA 2WYVA 2Q4EA 1VI2A 2BD0A 2PKRA 4RQTA 4GMFA 4FCCA 1I8TA 3AI1A 3FHLA 3V8BA 2EGHA 2ZYDA 2BGMA 2FMUA 1C0LA 1U8XX 4WECA 1A7KA 4BO5A 4XA8A 1I2BA 4BKPA 2JHFA 3A9WA 1X13A 5FFFA 4D7AA 4YT4A 1I32A 4J3FA 4UUMA 2P5UA 3LT4A 1LDEA 4WE3A 4JJFA 2B35A 1H9AA 1LDNA 3GNQA 3TDKA 3RFVA 4Y67A 3H9JA 4HADA 1C14A 1UH5A 1PJTA 2WD7A 4YVFA 4FFLA 4TRRA 3GRPA 4IDGA 2P4QA 1OC4A 3VDQA 1XGKA 2EP7A 3G1TA 5JCXA 3PWSA 2P68A 5ER9A 3AK4A 4EGFA 3DBHA 3IOYA 3ZNNA 4W6ZA 2PZJA 3IL2A 3WQSB 1NQ5A 2WYUA 3ULKA 4UVDA 4B3HA 5BSGA 3DFZA 1PL7A 3FF4A 3UCEA 3QV1A 5CHEA 3BMNB 4LMRA 4NJMA 4O5OA 4H16A 2Q99A 4ZVVA 3K2BA 2VZ9A 2JFFA 1ADBA 1H0KA 1UZLA 1HSZA 3JD2A 4ND3A 5CDGA 3ZWWA 3TQHA 3ROPA 1GV1A 1HEUA 2EKQA 2OHXA 3H5AA 3PK0A 5IXSA 4LRTB 5ILGA 3F5SA 1NTOA 3RCBA 2H63A 3H3FA 3QIVA 5A9SA 1H6DA 4IXWA 1HE2A 3HDYA 3SJ7A 3MJ4A 1DXYA 3L4BA 1ZO8A 4AJEA 1I3KA 4ZICA 3BMQB 4OH1A 1PTJA 4J4HA 1CF2O 2D1YA 1QYWA 4HBGA 1K89A 1K6XA 3U0BA 1YH3A 3L6EA 2NSDA 1BTOA 1I3MA 2JD1A 1PEDA 4BKUA 4IMRA 1ML3A 3QVWA 4RPHA 4EEZA 1WXDA 1HYEA 3DBVO 4ALNA 3DC2A 1U3TA 5CEEA 4YRDA 2YV2A 5L53A 1E6EA 2Z95A 5JPIA 3WDSA 1MP0A 2AQHA 3DBHB 4FD3A 4PGFA 4A0SA 1UAGA 3HB4X 4I08A 1E3SA 4YJFA 5JAMA 4XGKA 2RH8A 1A4IA 4GSLA 3OJFA 4IIUA 2DVMA 4BO4A 4NJMB 3F1KA 1QRRA 3KB6A 3Q9NA 5H82A 4OXKA 5DDIP 3VVBA 1GQYA 4NQZA 1CJCA 6ADHA 4W9NA 5CEJA 4AJNA 4AL4A 4YT2A 2VYVD 3AFNA 3Q1LA 3VAZA 4QXMA 4OXNA 1EBUA 3EVTA 2W4QA 2VYVA 2FY8A 1YB4A 3QWBA 1TT7A 2V6FA 4RZHA 1NPDA 1EBFA 2D59A 4NU5A 4DWVA 4URFA 2Q2VA 1TVEA 4WLFA 1BG6A 3C1AA 1ZK0A 1GUFA 2WJPA 2W2KB 4MP6A 1QR6A 3RC9A 3QVTA 1K6JA 5TT0A 1P0CA 4W9NC 2YW9A 3AY6A 5JYDA 3ZHBA 1GPDG 4HP8A 4DL9A 1ZK3A 5KJFA 1SPXA 2NTNA 3ANLA 3SX2A 3VPFA 1DC3A 2EHDA 3K8ZA 3FRJA 4Y9DA 1BVUA 3CPSA 5MDHA 4MKXA 4XGIA 1E7RA 1VC2A 2EW2A 3H7AA 3I9MA 2PFGA 3ZWXA 1MUUA 2O48X 1I24A 4EUEA 3C7CB 1AHIA 3G0OA 3PJFA 4D41A 3BTVA 1EVZA 2WD8A 4E2XA 4AJJA 1X14A 4M86A 3ZWOA 1PS0A 1SMKA 4BNGA 1V3UA 3PHJA 4GX1A 3KXDA 4ZRMA 5ENDA 4PG4A 1P1FA 3NT5A 4Y6SA 3ON5A 5BQFA 1GQQA 2X9VA 5IDQA 5DOZA 4NFSA 4Z9XA 1WZIA 3RWBA 1VSUA 3QVSA 4TRMA 1JVBA 3DO5A 4NFYA 4W82A 5HBRA 3ETEA 5KVSA 4EITA 4YR9A 5CDTA 5JMWA 3TF5A 3ZWAA 5I9MA 2FPIA 4DIOA 4CLHA 2C54A 4BNKA 3PLRA 5HA5A 1NR1A 1N7HA 1IL0A 4UVHA 3MOIA 4UVIA 1KVTA 1Z74A 2JJYA 2Y66A 4WPGA 4BIIA 4KMSA 1QYVA 1NXQA 5AXDA 1ZK4A 1E1NA 1LSJA 4G81A 4R01A 4YJGB 4LW8A 1ULUA 3RUAA 5DP2A 4JBIA 4EYEA 4AG3A 2HAEA 1ZXBA 3EZYA 3ICCA 5JMPA 5JS6A 3SEFA 5IZ4A 1NVTA 3WYBA 1GR0A 2FZWA 2PD4A 4BB6A 3JQFA 2UVDA 3GN1A 3I9KA 4J49A 1PS8A 1VE9A 2H5LA 3DZHA 4JP2A 1Q2XA 4UVGA 4YQYA 3AJRA 3Q2IA 1DC5A 1YL7A 2X6TA 2AQ8A 5CG2A 5IAAA 1G1AA 4MVJM 3RU7A 2C5EA 1T4BA 4PZCA 1Z7BA 5JDCC 3DAGA 4YJHB 3WBBA 3RROA 1WLYA 4JGBA 2ZQZA 2DQ4A 1P1IA 3WNQA 3KVOA 3CMCO 2IODA 4EJ0A 5F1OA 5A06A 1KVUA 4R9SA 1NPTO 4Z3DA 4FSHA 4BNFA 5MGBA 3GHYA 3C1OA 3ONFA 4PLYA 4AJIA 4IDCA 1QV7A 4R1SA 4RL6A 2CF5A 1HF3A 1LDBA 4RVUA 5FEUA 1MB4A 1NHGA 5AXBA 2I3AA 5KJCA 3IKTA 4L76A 1KEUA 5A3VA 2YHIA 4KDEA 2Q1UA 4LCEA 1GUZA 3E9MA 2BRUA 2RHCA 2ZATA 3HG7A 4ZD6A 3W8DA 5GZ6A 2BGLA 2BH9A 1I5RA 1NWCA 4CMIA 3DQPA 3GC6A 4AJHA 3PFWO 1ONNA 1CQIA 4E5YA 3HUDA 1PX0A 1YDEA 1ZKMA 5T8KC 3I83A 4TSKA 2UAGA 2C2XA 2NADA 3JQ9C 1FMCA 1XA0A 2NQ8A 4EEXA 1DPGA 1EVJA 2ZTMA 3CUKA 4OKNA 4AICA 4GL4A 4A5OA 4Q3EA 1K5HA 2FOIA 2O3QA 3LC7O 2WWRA 4BKRA 9LDBA 3GVPA 1F8GA 4BMSA 2RAFA 4DYDA 1L1FA 3WYEA 2JL1A 4BKOA 4B3IA 3GGOA 3RAJA 1ISGA 1OC2A 2EKPA 3VH4A 1EFKA 2VRCD 4IDEA 3RFXA 4RPLA 2UUOA 3WYCA 3JQGB 4BNLA 1S6YA 1PL8A 1FDVA 3WOHA 3PQFA 3UH1A 4IPTA 4R68A 4HXYA 1GZ3A 3CZRA 2VUSA 3HADA 1BDBA 2WDZA 2ZB4A 3E9QA 4GAEA 4GWKA 4XX0A 1P44A 1PZEA 1DB3A 4BO1A 3OIDA 1TLTA 3DMTC 2CD9A 1Y8RA 1NM5A 4B7CA 4B8WA 1E3JA 2DFVA 4YB8A 2QZZA 4QEDA 3EK2A 4WNIA 5B4UA 5I9LA 4A26A 1DIBA 3ETDA 2D3TA 1U5AA 3RU9A 3OJLA 4GGOA 4HFRA 3RJ9A 3O8QA 4BNYA 3H9QA 1R4MA 2X0NA 3WG9A 1YL5A 2OBNA 1PGJA 4PZEA 2HRZA 3S2GA 4CM6A 4CMKA 3WFIA 4WCFC 3PGJA 2HMSA 4L8VA 3E18A 4IZHA 4DMLA 4BO0A 3OJOA 3B1KA 3SXPA 4DGSA 3WTCA 1HDXA 1XDWA 3PIIA 3WB9A 1WPQA 4R5HA 3WQQA 4BOYA 4Y6RA 5JYEA 3Q0EA 4U5QA 1UJMA 1DJQA 4IZIA 4CLOA 2Q4BA 3AWDA 2X58A 2I6TA 2IYOA 5CFZA 5BSFA 2FR8A 2JAPA 4HFMA 4Z9YA 4BNUA 3I6QA 4OYRA 4RJTA 1UXHA 2EJVA 1WNTA 1RM5A 3VH2A 3L4SO 1E7YA 1ZZEA 4IGEA 1EFLA 3ROQA 5CDYA 2AEJA 3H5NA 3MJTA 3IS3A 3H9EO 1ID1A 1LRJA 5ITVA 4WCDA 5KJEA 4TQGA 1DFHA 2XXBA 4BGEA 1ADCA 2IEDA 4O63O 4UAGA 4FJ0A 3ITDA 4C4OA 2WSBA 4ZHSA 1H6AA 2VHVA 4R9RA 3O8QB 4GX0A 4DQXA 1KY5A 2GZ2A 4GI2A 2X9GA 4HWKA 3KUXA 3M2TA 4ZQHA 4PG8A 4GX2A 4XQ9A 4LRSB 3FNHA 1C0IA 2DTXA 4OHUA 2EF1A 4K1LA 5IN5A 4JK3A 1NWHA 4DQUA 4H15A 4NI5A 5JCJD 2Y1FA 1SBYA 3KYBA 4J1TA 5G0WA 5FI3A 4ND1A 4NBVA 4UUOA 1ISIA 3V2UA 3QWHA 2NU7A 2B4TO 3OH8A 3RVDA 4A03A 5EPOA 1P33A 4HNGA 1LSUA 5HS4A 5L4LA 3K2EA 3BMCA 4Z9FA 3TJRA 1NVGA 4J1QA 1R66A 3IP1A 3WGHA 4CLXA 3E48A 3RUIA 3QQPA 1NQAO 1WDKA 4TVBA 4Q39A 1QYXA 3JQ7A 1HE3A 3VTFA 1KERA 2EGGA 5KVQA 5EINA 5THKA 3AI2A 5TJHA 3M1LA 5L51A 1PZGA 2J3HA 2I9PA 4A27A 5I8WA 1DDOA 1WP4A 2J6IA 4MIOA 4K28A 2B4RO 3PVZA 4CV3A 3OSUA 4IMPA 2W2LD 3SLGA 4S1VA 5I7FA 2XXJA 1GTMA 1R12A 2HJRA 4HX5A 3EZLA 3HN2A 4WCFA 3VPGA 4CLDA 1DHTA 5A5FA 4BNZA 1A72A 1DIRA 1GADO 4A73A 1R0LA 4NBUA 4CQLB 3IDSA 3C8MA 2DBZA 4D42A 3O9ZA 2GGSA 1HE5A 3RUHA 5T67A 3ZWVA 4M87A 1CERA 3ENKA 1LTHR 1J5PA 3GR6A 4E13A 1N9GB 4W99A 3AU8A 3KSZO 3QP9A 1WZEA 4CMIB 2YJZA 1ARZA 5ICSA 3H9UA 2DTDA 1PR3A 2VUUA 3I4FA 1DEHA 2E49A 3F9IA 4Z3KA 2I76A 1BWSA 2QYTA 2ZTLA 5KWEA 3JQDA 1ZH8A 3INTA 3F3SA 4G5HA 3TZQA 3EUWA 2GZ3A 1LC3A 3W4IA 1O89A 4UEJA 2VTEA 1LQTA 4BNXA 1I01A 1XHLA 1N1GA 1MFPA 1F12A 1B8PA 4IDBA 1A9ZA 4QFDA 3VKVA 3K5PA 4FR5A 4NK4A 1M6WA 1ISJA 1IULA 1U28A 2PZMA 4WUVA 1B7GO 1I33A 5DT9A 2PA3A 1E1MA 1RYDA 3BYZA 4B79A 3U3XA 4UVEA 4L73A 4HV4A 2QZ9A 4GWGA 1PU2A 4YAIA 2AW5A 3QWIA 4JIGA 3NT4A 1QV6A 3OEWA 1NYTA 1YQXA 3BHMA 1AUPA 1PJSA 2GERA 2E4AA 4GBJA 4LSWA 5KVCA 4GKVA 4NK5A 4WASA 3FWZA 1E1KA 1LLUA 3B1JA 1ENOA 4K6CA 3OHSX 3H2SA 1XG5A 4MPDA 1BW9A 2DBRA 2SCUA 3JQ9A 4L75A 5G4KB 9LDTA 3JYLA 2P5YA 4MVJH 4P4LA 3HZZA 3RUCA 4KQXA 3S2FA 1VL0A 1GDHA 4ND2A 3LQFA 1D7OA 3IIEA 4ITUA 2GD1O 1CQJA 1LSSA 1JVSA 4FDAA 5U1PA 1H2BA 3ICPA 4RDIA 4J7XA 1TT5B 2W2KA 3ZV4A 2HCTA 4QTZA 5ER6A 5JXWA 3JQBA 5JSFA 3BA1A 3GEDA 2GRAA 2I99A 3NJ4A 4RVFA 3PJDA 2OO5A 3I9LA 3OETA 5TF4A 3RQSA 1U7HA 3WIEA 1GEGA 1LQUA 3JYNA 2QHXA 4E5MA 4B7XA 4XD2A 3LT2A 2CF6A 3BXXA 3GUYA 4CLEA 4FFMA 1A71A 4EZBA 3KTDA 4WLOA 5EERA 1DSSG 2D5CA 5HWSA 1Y9AA 1JTVA 3B6ZA 4BNTA 1ZW1A 2F00A 4BVAA 1FDSA 4LMPA 4UUNA 2PTGA 3RUFA 3PEFA 4CMHA 2YY7A 3LDHA 4C7KA 3CSDA 4J6FA 3JSAA 4YJDA 3QHAA 1Y7TA 4D0SA 2J3KA 3LYLA 3CH6A 3LZ6A 3AUAA 3B20A 4UEKA 1PZFA 1A9YA 3I3OA 3T4XA 3S55A 4XEHA 2I65A 3JQ7B 3AOEC 5TS3A 4MP3A 1RM3A 1JAXA 1P31A 1IZ0A 3ZW9A 1XYGA 4OL9A 5AYVA 2Q3EA 2Y0EA 4GVLA 1IOLA 2B83A 4DBVO 5KVVA 4D46A 2A9FA 3KOUA 3MCVA 1K0UA 3ST7A 1N92A 2A94A 1RM4A 4DC1A 1MGOA 3WSWA 3ONDA 2AE1A 3D7LA 3NTOA 5BNIA 1OMOA 2IZ0A 1XLTA 1VRWA 2X5KO 4WGGA 1M2WA 1P74A 2VHZA 3C24A 3LSYA 1BGVA 5COBA 2WE8A 1LDYA 4WJZA 3UOGA 1ZBQA 3JQEA 1KC3A 5I8ZA 1XEAA 2O4CA 4TRJA 3SC6A 4CMBA 1XU9A 3HE3A 4XYGA 3WS7A 2UV8A 1PGOA 4ROSA 5F5NA 1LNQA 3RJ5A 1QORA 1WVGA 3ADPA 1B2LA 1FDTA 3RI3A 4I9NA 2GASA 5IDYA 2YDXA 3OEYA 1MG0A 3TZKA 4QT0A 3WSVA 2BFMA 2D0IA 4Z0PA 5F1PA 3NT2A 5T64A 1MX3A 4ND4A 3C7DB 3HDQA 1Q7CA 1J6UA 1RYEA 1K2WA 5EESA 1R6DA 1OOEA 2VQ3A 4E2ZA 5KNLA 4BNMA 1ZK1A 3SBOA 5EIOA 4W4TA 3RUDA 2YUTA 3FTPA 2VZ0A 1BXKA 2DUUA 2P9CA 4YRBA 5F3RA 4J9UE 4YAKA 2AEFA 2VCYA 2DBQA 4WLVA 1DFIA 3M6IA 1AE1A 4MVJI 4NZ9A 1Q7GA 4MIYA 1IYZA 3SJUA 4RVSA 1KOLA 5FF9A 1V35A 2H6EA 4OMUA 3JQAA 4R3NA 4CM1A 4F6LA 1LA2A 5TJ9A 4YJFB 1C0PA 3QWFA 3PLNA 1AXGA 5ES3A 2YHIB 4DQVA 3GVHA 4YXFA 2EW8A 4J91A 4KUEA 4ZRNA 1EQUA 3JD4A 4FIZA 1B26A 4HNHA 4PLPA 1ZNQO 4PLTA 1YO6A 5ILOA 1EEHA 5IXYA 1N5DA 1VM6A 3DHEA 4PLCA 4J4BA 4J0EA 3JQAB 4NJOA 1NP3A 2OGUA 4R41A 2ZJ0A 3GG2A 5F1KA 2HMVA 2I3GA 3A1NA 3ZWBA 1LLCA 4BNVA 1N9GA 1SB9A 3GFBA 3I9JA 2Q1SA 1GCOA 4ZQGA 4EUHA 2GN9A 2V6GA 1BRMA 2FWMX 4MDHA 5KJ1A 2X22A 4YTEA 2JFHA 4UUPA 3RSHA 3WQRA 3NEPX 3UXYA 2Y0DA 4D3SA 3QA9A 4GH5A 1IY8A 1VKOA 2BFOA 1FDUA 1KC1A 1KEPA 3HHPA 3L4BC 4RF2A 2GZ1A 2HQ1A 4FOOA 4XRRA 4O0LA 2IXAA 2JCXA 2P9GA 7ADHA 1UXKA 4CM5A 3BAZA 1HKUA 2V7PA 3A28A 4IJUA 1T2CA 4E12A 4IXTA 2E82A 4CMEC 3OMLA 3DZJA 4J43A 2PKQO 1UXIA 4U0JA 4F45A 3PHLA 2ZTVA 3COSA 2O3SA 3MWEB 3HQ4O 2Y1GA 2IEBA 3ZH2A 3W1VA 3QLJA 4JX8A 5DCYA 1M6HA 5BR7A 3GRKA 2X4GA 1T2DA 1RKXA 3MTJA 4N5MA 2UUPA 2Q46A 4J9VA 4TKLA 3KZVA 2Q49A 2QYSA 3I23A 1B14A 3GH3A 3KM0A 1YB1A 4E30A 3B70A 3RBZA 3L0DA 4N5NA 4A2CA 3OJEA 4MJLA 5DN9A 5IDWA 4DBZA 4I8XA 4PVDA 4DMMA 1C1XB 3G17A 4RVHA 4BQRA 4Q3CA 3A06A 2QG4A 3E5MA 3LU1A 5CPBA 3TZCA 3X2EA 3P7MA 3U9LA 5A3JA 1KIFA 1HTBA 4CL3A 5DCWA 3NTQA 4DREA 2HRBA 1HDOA 1IUKA 4NBRA 3FD8A 1ULSA 1GYQA 3DONA 1Y8QB 3KO8A 4D45A 2AEMA 5KKCA 3MOGA 3GEGA 1V0JA 4U0KA 1P1RA 1V3TA 1F8FA 1GZ6A 3DZKA 3GY0A 2O23A 4N7RA 3VTZA 4OOEA 3G1UA 3DOJA 1B8VA 2O3JA 1MXHA 3NDRA 1ZEJA 2ZCVA 4BQPA 5L4SA 4NG5A 3T7EA 1CWUA 4IS3A 2B37A 1PWXA 3U4HA 1P1KA 3WR5A 4CLRB 2H1SA 2J3JA 5B4VA 3VKUA 4RF4A 1H6CA 4EJMA 3OQBA 3F6YA 3UAGA 3MZ0A 1MG5A 2C82A 3GMSA 3GT0A 3DEYX 4IBOA 4KWHA 1PJQA 1MXFA 4WCFB 1ZCJA 1U4SA 3WMXA 4K6FA 1NQOA 1PJ2A 1H5QA 3FSRA 4KDFA 4WOJA 2GCGA 3EGOA 3CTMA 4FB5A 3HDJA 4DA9A 1DAOA 4ZQEA 2Y0CA 2X0JA 4KZPA 3QRWA 1U4OA 1DBVO 2PY6A 4MVJE 3VHRA 2EWMA 3AW9A 1PJLA 2J3IA 4BGIA 3FBTA 1E77A 4WLNA 1CRWG 1R4NB 2IDZA 8LDHA 1E3LA 3D3WB 1QKIA 4AFNA 3D5QA 1I36A 1LRLA 3LLVA 3QVOA 4J0FA 3EW7A 5C37A 5G0SA 4CM3A 1VL6A 2ET6A 5TSDA 2VOEA 3AUTA 4BMNA 5JLAA 2Y1DA 4EJ6A 1JW9B 1H2HA 3WMWA 5U4QA 4L4XA 5I7EA 4JJIA 4E2YA 3L6DA 3INRA 5JC1A 1VJ0A 3C85A 2OXIA 3K6JA 1PZHA 4IY1A 5KIAA 3FR8A 1E7MA 1B3RA 5CAEA 3LC2O 3U49A 1PJ3A 4R1UA 4BO9A 2HKIA 5HRUA 2A92A 3R1IA 1FF9A 2GN4A 3TFQA 3NAQA 3FR7A 4KTTE 3ZWMA 2BHLA 1Y8RB 3D4NA 4DVJA 4UULA 3GUCA 4E21A 1S7CA 2Q45A 5B37A 4YA6A 1HZJA 2DPGA 3AY3A 3GEMA 1NR7A 4PLHA 1U3WA 2HDHA 4CUJA 1WMBA 1JLLA 4L4SA 4M8SA 1PSDA 2VT3A 4E3ZA 3N58A 1QYCA 2DUWA 4MIEA 4PLFA 2FSSA 3JYPA 5GZ3A 5TC4A 5ICMA 2PD3A 1XWFA 3ASUA 3L6OO 1T2EA 2CMDA 1ZMTA 1D1TA 4BHTA 1T1RA 4RGBA 5AXAA 3LC1O 3K9QO 2Y68A 5JFOA 5L45A 1GQ2A 2DAPA 3PJGA 3F4LA 3AI3A 5K6AA 5DCUA 2AA3A 3GVXA 4GKBA 3VH1A 4PVCA 1GD1O 4FGWA 4RLHA 2NU8A 5U9CA 2X23A 1E0DA 1K6IA 1YL6A 1PGNA 2HU2A 1XIVA 3D0OA 3JD3A 4INAA 3F4BA 1P1JA 1ZSVA 4XGNA 4J7UA 3PIDA 4NDNE 4Q3BA 2Q2WA 4Z0TA 3UVEA 4CR8A 1GL3A 1QP8A 2AHRA 3KSUA 4R51A 1UDBA 4YAJA 1SC6A 3UF0A 4CR6A 2OORA 4Y8VA 3A4VA 3WJAA 1N2SA 4W7IA 3WWYA 2C7GA 4RZIA 2G76A 3WTBA 3O38A 2V6MA 2YZ7A 4XZ3A 3Q9UA 4CV0A 1C3VA 1NPYA 1PJBA 3KHUA 4B8ZA 2WYWA 4DIBA 1GFSA 4CM9A 5A03A 3KYDB 3ZV3A 3I1JA 4XJSA 3F46A 4A7PA 3PJEA 4MVJA 3FCOA 2XF8A 5JDCA 5JW6A 3P19A 1I2ZA 3HNPA 2PD6A 4DLLA 4FGSA 4ZN6A 5IJZA 1O95A 4NPCA 4P4NA 3ZWCA 2HMWA 1GV0A 4M89A 1G0NA 1SAYA 3S1LA 3D64A 4R3WA 3RD5A 4CL8A 3HJAA 3PZBA 1DIHA 1KY4A 3FTNA 3WX0A 1U3VA 1Z73A 1U5CA 2NTJA 2JKVA 2EG9A 1JKFA 1GUYA 1BXGA 4XR9A 4YRAA 3DXFA 1ZSYA 1KEWA 4PG6A 3PXXA 4PLWA 5EL0A 3NYWA 2VWQA 2D2IA 4OSPA 2GSDA 4TRNA 2PGDA 4XDZA 5EQDA 3ZDFA 3AM5A 2Y93A 3MTGA 3ZZNA 1WAMA 5T8KA 4M1QA 5I7VA 5JAZA 1P77A 3CKYA 2GR9A 2ILTA 4ALMA 3NDJA 1B8UA 1EK5A 4U6QA 4MKZA 2C2YA 1XELA 1SB8A 4PFJA 2QW8A 1I0ZA 2PKQP 3BTSA 3WWZA 1J49A 3Q2KA 4RCVA 1LEHA 3AOGA 2VZ8A 3BHIA 4LISA 3GPDG 1YJQA 3VVCA 4CMCA 2OOSA 1X0VA 4DTIA 1UZMA 3ZNQA 3U09A 1LDMA 3GNTA 2WTBA 3DZFA 4DLBA 3GMDA 3UGKA 1U9JA 3NKLA 3ZV6A 1AHHA 3GLQA 4CV2A 2EP5A 4UREA 2Z5LA 1GEEA 3GDFA 1HDRA 3ITKA 2FR0A 2ZQYA 3JCZA 1SOWA 3K73O 1ZJZA 3GFGA 1Z75A 1JDJA 2AG8A 4E31A 4RO0A 1M66A 1W8DA 5JE8A 5LCXA 4R1NA 5TRTA 3GF4A 1E3IA 1QYDA 4TWRA 5BNFA 4TZKA 2O7QA 1SEPA 2PWZA 1M75A 4CM9D 2XOXA 4XIYA 1LC0A 5GMOA 3ZWPA 1ZIDA 3AUUA 2NVBA 1DIAA 4OGWA 3P2YA 1IHYA 4M49A 2J8ZA 4RPKA 4XQGA 3R0IA 2Z1MA 2E6UX 4CODB 2B69A 3VOSA 3UW3A 2O4UX 2RHRA 3DBRA 1C0KA 3FBGA 4BKQA 2B4QA 3DWFA 1ZK2A 1E3WA 3AU9A 4RQUA 3WGIA 2BFPA 2DU8A 2X5JO 1PIWA 3GVIA 1YOVB 5L3ZA 4IUYA 2GN6A 1JKIA 5ENVA 1JA9A 2C5AA 2CDBA 5AVOA 4RF5A 1T24A 2ZKLA 1HDCA 2GPTA 4PRLA 5AOVA 4IS2A 3EY4A 3OJ0A 4R54A 5BSHA 3N74A 1WW8A 5C3MA 1XU7A 2JHGA 4R69A 1NASA 1SOVA 1JAYA 2Z1NA 1VJ1A 3DMTA 3KSDO 4X54A 1MLDA 3PI7A 3AY7A 1QLJA 3H4VA 4NR0A 3H8VA 2DKNA 2C29D 1QLHA 4YT5A 3V1YA 1UP7A 1Y6JA 4ONEA 4G2NA 2CVOA 2GF2A 5FWNA 4YEDA 4NBTA 3JD0A 3RIHA 1BSVA 1CETA 1PR9A 3ZN2A 5G2OA 3GK3A 1E5LA 2NACA 3VZQA 2G82A 2GO1A 3E82A 4QSMA 3JQBC 4L74A 3S2IA 3OM9A 4BV9A 2JCYA 4XJTA 1SO8A 4P4GA 5TT1A 2NWQA 4CUKA 5KCZA 1C1XA 4J2OA 2A35A 1YQDA 1OAAA 3KLPX 2GUGA 4OAQA 1IPEA 4II3A 1I3NA 4D3FA 1Z45A 4OJNA 3I5MA 4LCJA 1Q7BA 4K26A 1GAEO 3PZRA 4YQZA 1Y1PA 3DZBA 4I5DA 4XYBA 3V2GA 2I66A 2O3UA 4CJXA 2QIOA 4HUJA 4Q3DA 2X0RA 1PWZA 3PHIA 4KUGA 4MVJD 4XQCA 2EJWA 4M54A 1V6AA 1ISFA 1LBEA 4F46A 3GAFA 5F21A 3U5TA 3FI9A 4F3YA 1LSOA 1KEVA 2GYYA 3I52A 4WK6A 2X86A 4Q9NA 1YQGA 1X7GA 1WWKA 1O8CA 4W7HA 1HRDA 1R0SA 2CNBA 5CPFA 1J4AA 5LDGA 3PDJA 3GPIA 1YGYA 4DC0A 3ZHXA 3ZU4A 4CLRA 1R0KA 4BMVA 2O2YA 2BF7A 1N8KA 2FPGA 4J16A 1E7QA 3DZGA 4ID9A 4RF3A 4ZQBA 3WLFA 4YT8A 2GN8A 1UXGA 5A9TA 2NTVA 2NVUA 3IUSA 3INGA 1LRKA 3RKUA 4DPMA 2NLOA 4YACA 1YBAA 1IHXA 3DAFA 4AJPA 3VPHA 3FNGA 3GN2A 5H81A 2NUAA 4OIMA 4Z0HO 1UDAA 1GY8A 1NFQA 3NV9A 4NH4A 4CM4B 2NVWA 5DULA 1G0OA 2WMDA 2J5QA 5A5EA 3KBOA 1IE3A 3NGXA 2DT5A 1TEHA 2HJSA 2W8ZA 4FFOA 2FHSA 3VH3A 4KOAA 1V9LA 3T7CA 4H7PA 1R37A 3GZNB 2IYPA 4IJVA 5A05A 3DBRB 4E4YA 3LVFO 3WFJA 1DFGA 4YCAA 2CY0A 1P1HA 3I9OA 2BI7A 1PQPA 2V65A 4CM8A 3F47A 5L7TA 3ZHZA 5AXCA 4DUPA 3GHHA 4CV1A 5JDIA 4GGPA 5FI5A 3RC2A 2VOJA 3BTOA 4TMFA 1U3UA 5CDUA 1YXMA 1HLDA 3IC5A 3R3JA 3E1KA 1E7SA 4DIFA 3IAHA 4B4WA 2EV9A 1OZAA 3LF2A 8ADHA 3WJ7A 4ZGWA 1EQ2A 3R3SA 5A02A 2JD2A 4OM8A 3TOXA 3D4OA 3FPCA 1Z82A 3MJEA 1XKQA 1ONPA 4LVCA 1DO8A 1LX6A 4J7CA 1W4ZA 4XR4A 3MEQA 4FQ8A 4RDHA 3UUWA 3OQ6A 1W6UA 3TL3A 4IM7A 3WGYA 2C59A 3EHEA 3UFXA 1I3LA 3E8XA 1DIGA 5TLSA 3UKOA 2CZCA 2YQ5A 1YOVA 1AXEA 4IIVA 5DBIA 2Y1OA 1ISMA 5C5IA 1Q0QA 5ITWA 1SZJG 3BTUA 3ZGYA 1BW9B 4TZTA 5IG2A 5IDXA 1RM0A 3GGGA 2BGKA 1NNUA 2NNLD 2HUNA 1EDOA 2VRBA 5A04A 1A27A 4ALIA 4AJ2A 4KP7A 4OO3A 2C07A 3AM3A 3W4JA 2FZEA 2X0IA 1A7AA 5DBGA 3E03A 1Y81A 3DOCA 2DTEA 2VYNA 2PV7A 5KOIA 1C1DA 5BNTA 5B4TA 2A4KA 3NGLA 1TI7A 1T26A 3RC7A 2AMFA 2O2SA 1KVRA 4IJKA 3MJVA 2D4AA 4EBFA 1U8FO 3R6DA 3TOZA 4I9HA 1PS9A 1WDMA 2CDAA 2PK3A 1DRVA 3ZU2A 4QX6A 1TB4A 3PDUA 3I6IA 1QXSA 1JU9A 2X9NA 3OECA 3FWNA 3KYDA 2VNAA 4O1MA 2P9EA 3VZPA 2FN7A 1O6ZA 4B3JA 4EDFA 4JCOA 4BGUA 1LDGA 4G65A 1YRLA 4JXKA 1Y9EA 1YBVA 1UXJA 3IKVA 4NNJA 3RUEA 1GPJA 2VWHA 3CXRA 4S3MA 3KYCA 1PGQA 1SEVA 3NUGA 3CZMA 5EQFA 3V1UA 4Q3AA 1FJHA
chains in the Genus database with same CATH superfamily
2QRJA 3BSWA 1WP9A 5EE3A 4AG5A 3OCYA 3I73A 1V41E 1TQ8A 1I4TD 3CEAA 3E9YA 3S0JA 3T9FA 4DHWA 4EHKA 3KXIA 4G5QA 4TLEA 2VXBA 2JIOA 4GXNA 1UODA 1F9EA 3ZV5A 1CG6A 4C0QC 1AKUA 4D9KA 1YKSA 2I33A 1E3QA 1KK3A 4FFNA 4OLJA 2YOGA 5AHKA 3OZCA 3S8EA 3S29A 4AB1A 5F5XA 3HNRA 3T94A 4U3JB 3P9XA 1KYQA 1Z3CA 1T0PA 4XVUA 3GNSA 2CVZA 1RPNA 3E2PA 1HZZA 3NRCA 1T1SA 4ZQFA 3ZY3A 2AEEA 4G67A 4XPZA 3FTEA 4AAYA 4BQNA 1F4VA 2UVPA 1V7CA 2VLBA 3IUPA 4L4RA 3T1OA 3DVQX 4X92A 3IJPA 4EPTA 4LZLA 1P1BA 1T2VA 2O8FB 4BFTA 3P9QA 1THGA 2X1HA 5LZ7A 3H3JA 4EY8A 4R16A 4URUR 4XYEA 2XQJA 4LCBA 5T6BA 1CY4A 2XZDA 2QRLA 4DUYB 4OBEA 1XX6A 1EUZA 4CTNA 7REQB 4M9ZA 1UBEA 4BWVA 2G04A 2Y1WA 1B6RA 5B6IA 1T1GA 2XWSA 3T4PA 4E1BA 2VATA 3IXMA 3UV7A 4GM4A 1UOOA 3HBFA 1PFGA 2R6DA 1XNHA 1F0NA 4RXTA 4UDXX 5HJ7A 1JG2A 1HDGO 3HBAA 3QITA 1M1YB 1E3EA 1VJ5A 2I7VA 4RV4A 4YP5A 2XZOA 1VZ3A 2ZB8A 3F6CA 3GZNA 2NM0A 2PBLA 3R3HA 1JEQB 3HYTA 4B8YA 2OK7A 4I9UA 2J5RA 3CLSD 2WM3A 2XA2A 1HL3A 1WZCA 5M04A 4H59A 3HM2A 3CNNA 5J9FA 2VIIA 1EDZA 1KMHA 2GF0A 4MA0A 4D9BA 1X7DA 5CXSA 3SZGA 4B7ZA 4RORA 1LXCA 2C5HA 4F3KA 1IN1A 4G63A 1X19A 2W6JA 1YMUA 4ZK2A 1NULA 1NXWA 5LMNB 1NMEA 1O5IA 2IRWA 3PDHA 4A36A 3H65A 5JHHB 1RJ9B 3LM8A 1TZBA 2AN4A 2FWPA 5DLPA 3LWZA 4NEQA 2BUCA 3OBBA 1XUOA 2E37A 2AQKA 1EIZA 1RHJA 2J9FA 4O4JA 1IUNA 2G6BA 3RFTA 2A2ZA 2XYVA 3SSAA 3IEIA 1DQPA 2EHJA 2NU9A 2BRUC 2CDCA 2IYAA 1EHIA 1SC1A 2DPHA 2H48A 1PP4A 2CFSA 4Z54A 4ZOLA 3D1LA 3D8BA 2L17A 1DRUA 2OD2A 1O96B 5FWXB 4FR0A 2FP4A 2B0JA 1T4CB 1XZ8A 4ARAA 4UNQA 1G64A 2P35A 3LIPA 4HDCA 5SZKB 4CHTA 1P3DA 3C4VA 2YWCA 1IPFA 3QVVA 3S7TA 4F2HA 3NHZA 4HG2A 2XYPA 3HA3A 1JHDA 1SHLA 5AHWA 2BKVA 3AJEA 2BM9A 3KEMA 5FBQB 4F71A 5EZSA 3TQRA 2RCYA 3E3MA 3SX0A 2JIMA 1UM9A 4Z6KA 3HXKA 2EEZA 3UC5A 1UP6A 2WJHA 4ZO6A 4F4IA 5A2QA 2RGNC 3DOOA 1G7SA 1B6TA 1G3RA 2YWHA 3MC1A 4BZQA 3WMRA 1K8XB 3UK7A 2CXTA 4E6PA 5LZ2A 4H3KB 4C5AA 3FNBA 3H17A 4TVKA 5C4MA 4NBWA 2PS3A 3R76A 5KOJB 2PX0A 5JDIC 3OCJA 2O8VA 4NARA 2RHWA 5M5BA 1UOEA 1DC8A 1O95C 2G40A 3GAAA 3JARB 4XWYA 3TQSA 2IU4A 2Y05A 4Q1CA 5CTJA 3ERCA 1MA0A 3N0TA 2HBRA 2ZLBA 3I32A 3OPNA 5HE9A 2UDPA 1R7RA 4CTOA 4D26A 1AGNA 3QY0A 3H11A 3J7TA 4ETIA 5BYBA 5LA6F 1PGPA 1YFKA 1TZMA 2RCNA 4BNIA 3OQ1A 1P18A 1D2EA 1FVHA 3G49A 5CXUA 1BN7A 3ZW8A 1PDOA 1WXGA 3H87A 4MW6A 3L77A 1OIVA 3PQEA 5TPZD 3RDPA 3ZUGA 4D3ZA 1JHUA 1SXGA 1KS9A 1P0MA 3DVLA 1OV4A 1ZGGA 3NYRA 5M2QA 1NX6A 3BIJA 1P5RA 3O7MA 3F1LA 4TYQA 1JZTA 4R8MA 2IT1A 3IAS1 4BC0A 1WMEA 3FPLA 4AULA 4DIEA 2ZBFA 1TA4A 4AJLA 4WLUA 4L72A 4DEVA 2YS6A 2X1MA 4NXNB 2RHHA 1JHZA 3A6FA 1S9DA 2E4WA 3W4KA 4Z4QA 1DAPA 1CFZA 1PSWA 2VK1A 3JYQA 1QQTA 1YZHA 1BU5A 1XTBA 4YGXB 2GKOA 4FBLA 4HEHA 4JZYA 3RSFA 3B3JA 3ZQKA 1RYHA 2R62A 3MJCA 3SXUA 2QRUA 2Y0PA 3THXA 4ZTZB 1AB5A 1YU6A 4B3CA 1PQYA 2B25A 1W75A 4CQMD 4EQZA 3ABIA 3CXUA 3VXKA 1XZKA 2IUSA 4M22A 3BMOA 4RIFA 5F4BA 2A14A 2CNLA 3K96A 4NCBA 1XAJA 3I76A 2I7XA 2QQEA 3BZUA 1SURA 4C21A 3QLEA 1V43A 3L8GA 3I05A 1W85A 1B16A 3P5BA 7GPBA 2O8EA 3GIDA 1TXGA 3IV7A 4KG7A 4N54A 4NZPA 1YFZA 4G0QA 3EIQA 4GDMA 4XWOA 1RWMA 2C04A 3WAJA 1I4EB 1REQA 2HIGA 2B2CA 3IBTA 3NANA 5BWNA 1N2HA 1PK7A 5HOEA 3PX7A 4LF6B 2EX4A 4RM3A 3T06B 4ODIA 1MABA 4AJ4A 2NGRA 1T15A 1XFAA 2Y1CA 4G37A 2ZB2A 4RA9B 4WK4B 3L7BA 3UT5A 3NIBA 3LFHA 4J1TC 4ZAGA 1I30A 1NUAA 4G84A 4YLYA 5JNLA 4ZA2A 4KITB 1ZVMA 2OL4A 3I4LA 3CO5A 2ZIWB 3TOVA 1F1BA 1B23P 4A10A 1QDEA 1RQ2A 4GQAA 4QUKA 4X00A 3STHA 2PZLA 4YMSA 1WSBA 2XCOA 1O9BA 4QOHA 3NG1A 1NAHA 1Y37A 1ENPA 3K9WA 4BN4A 3AR8A 4AO7A 1X86B 2B5WA 3A6JA 4CIWA 3L7NA 4A6EA 5I01A 3B1WA 1OBFO 2XUZA 1P2TA 3FVQA 3QZUA 4ZO4A 4AX4A 4JC5A 4UQPA 4AY2A 1QO9A 2HA5A 3L5KA 4KFTA 4RHXA 3RC3A 3D31A 1CE8A 4YJ2F 4JLSA 4LY3A 4GOJA 1E1DA 1LGYA 4KW7A 5FL7A 4IJMA 1XMJA 4O6VA 3U7EB 3ZJVA 3PC8C 1Z4MA 5AJWA 4PWZA 2B61A 4IXMA 4A6XA 1L5YA 2WV7A 2CVQA 3ZTTA 3T7RA 3UCFA 1IIRA 1OTHA 1XEXB 3COJA 4MHSA 4ZOLF 3FTDA 1LUAA 3L9XA 3IQDB 2YIVX 1E1CB 3CINA 2VHTA 3FZNA 2RGWA 4XSVA 4KO2S 4OFXA 1KVQA 1XZFA 4TKMA 1RQNA 3BMCB 4FUTA 2QRVB 5FUMA 3TW8A 1CEQA 2H4ZA 2BGTA 2I5PO 3OE1A 4TQ9A 3SLKA 3ZXSA 3QJYA 4EGFA 4XUEA 3EMKA 5FYQA 2JI6A 2C3YA 2BFFA 1MQSA 5H3CA 3P27A 5B1YA 3BGSA 5CURA 5H83A 1J90A 5BN4B 4E5PA 1O1YA 1O2DA 1S8NA 1FYXA 4EGSA 2GBCA 2R7NA 4ZGGA 5IF3A 1JIIA 2NO7A 2XDAA 1YB5A 3VPXA 1VMEA 1T9AA 4E08A 1XVUA 5AIAA 2F1HA 2QAJA 1YDWA 1XTJA 1Z35A 2CLMB 1H65A 3CC8A 2HEGA 3H42B 1JS1X 3I9NA 3PRJA 4U5XA 5KNCD 3ER8A 5G0UA 5F64A 3GLHB 2QSUA 2JKZA 1KAOA 1EP2B 1EVIA 3OX4A 1D1PA 1T4CA 3PHBE 4Q4CA 4QQRA 5JH7F 2P78A 1VYHA 4Q21A 2P4EA 6NULA 1JALA 5KSZA 1W49A 2D4HA 1CDOA 1OZFA 4YRDA 2FSVC 5ADVA 4MINA 2PUFA 3EULA 4MQFA 3VDXA 5EQTA 4LXQA 5SV2A 4H7JA 4CPDA 4Y1RA 5BSWA 5HKAA 2WOOA 2XNHA 1L3CA 1ZUD1 1OX5A 2YDYA 3G7NA 3LX8A 3N2NA 4FDUA 3NEJA 3ZNPA 4HSGA 2V3CC 4Z5XA 2YWBA 3JYOA 2ZJYA 4FU0A 4WDRA 1W73A 3L8YA 1LW6E 3TQCA 4CT4B 5MFZA 4N76A 3A6HA 3ANMA 2JEZA 4K88A 4LF5B 4J76A 2D1FA 2HV9A 4M0UA 3EQ9A 4FMCB 2RAPA 4OQZA 2ZUCA 4D4MA 1S96A 2JJ1D 1Z2DA 2BISA 3VZSA 3HU3A 1TD1A 4F56A 3DUFB 4LDAA 3BD8A 3NBXX 4JVNA 3A70A 3NDIA 3SQOA 3O94A 4QUBA 5CYFA 2R751 2DY0A 3T9EA 4MEJA 5IF9A 2Z6UA 2QE7A 4DWJA 3UC9A 2C5FA 1D2CA 2GRJA 1XCPA 2ODNA 1CUDA 2ZJ7A 2QJFA 4YRFA 3CUEF 2XJ4A 2ZI3A 4HDSB 2QVBA 1SVSA 4OQMA 4ZEXA 4RY8A 4Q4JA 3WMGA 2I03A 1EI9A 2L42A 4P81A 1XPRA 3WV4A 5F9FA 1F38A 3JQ6A 5G4LA 2XCTB 2RGDA 1QOPB 3OT5A 4BRSA 3RBVA 4GX5A 1U2DA 1EVYA 2QDXA 4IQGA 1LK7A 4DXHA 2XYHA 3LXRA 4JBXA 3PTZA 4KRYA 1BHO1 5BW6B 3W8EA 4IICA 2PUJA 3ZQ4A 3L05A 3F74A 4KUHA 2ATVA 3JVUA 3T9DA 1DL5A 5HIIA 1PJCA 2M6SA 2EFYA 2B2NA 4NCAA 1HNXB 3G9QA 4QVIA 1O77A 2CHFA 4Y1RB 4Q1BA 3R6GA 5KBYA 1FJ2A 2FRDC 2PDAA 4BECA 3G2PA 3OQNA 1A2QA 3JPWA 5H9VA 3ZGVA 4LXTA 2C7VA 2D7CA 4YDRA 1HYQA 3OM0A 1KOJA 5CYPA 1KBZA 4NEHB 2Y9PB 1BVRA 1W93A 2PKWA 3HGTA 1QFMA 4NDAA 2J46A 2O1XA 4D9NA 4A1FA 2QTVA 3CVVA 3ECAA 2DH6A 4D3DA 5MHTA 2R2AA 1UBFA 2XBUA 4GC5A 4L27A 2D0PB 2IW1A 2QMUA 2GM4A 4DMUB 2O0MA 1IJEA 3CWCA 4KB5A 3R6TA 2JCVA 1RHMA 2PVCA 3QVGA 5KSYA 5IM4A 1N2OA 5K9ZA 4K05A 4UAVA 1P0FA 4TS9A 3GRZA 2W43A 4X62B 2BFDB 5LOVF 1CS4C 2OECA 1RBYA 4AK9A 4D9EA 4DT1B 2O8FA 5I7SA 1JKMA 1SG9A 3L40A 1Z22A 2VRCA 4F85A 2D1SA 3GWGA 2XSZA 3ME5A 4JL8A 2F8LA 2LDBA 4YJGA 5D5QA 1U3FA 2G1UA 4YUYA 4Y30A 2ZRCA 2V96A 3NASA 2JNWA 3FI0A 2IXGA 2P90A 2Y8EA 2ZYGA 3LECA 4NQRA 4RH3A 5CK4A 1TZ2A 5IFKA 1OCEA 4J0GA 4NX2A 3A0UA 3DLIA 1PR1A 4XWGA 3WLJA 1RRGA 1AHNA 1FK8A 2P2NA 3CE6A 1ND5A 3RIXA 3WLPA 1SK9A 3HFSA 2QV0A 1BDMA 2X9QA 3QVXA 4HDNA 4XB2A 4JR0A 1C8KA 1TC2A 1KAEA 1KOGA 4PTYA 1H22A 2QG9A 5DN6A 2E48A 4NMLA 1SUAA 2F3PA 2XTAA 1WF6A 2BMDA 1SBNE 3WGZA 1FY2A 1Z5ZA 2D5AA 1BZYA 1OHHA 3BL5A 4WKGA 4HZUB 4RUKA 3U3OA 3HMQA 4PZDA 1I5OA 2CHEA 1K8YB 2POQX 1CRLA 2MSLA 2RH4A 5JQWA 1COWA 3D2AA 2HSEA 2WY2D 1OBHA 2B7LA 2ARKA 1X8KA 1RWXA 2W6JD 1EZ4A 1CUZA 2VNJA 2WD7B 4IVQA 1G2IA 1V47A 2FKAA 5EIBD 3ZTYA 3QWAA 4L5CA 3FDXA 3OT4A 3WISA 4Y6PA 2O52A 4EYQA 1FZTA 3C3XA 4INOA 1PQUA 3ZU5A 3BOSA 2A6PA 3Q5EA 4P7FA 7YASA 1TUIA 3R5SA 4TX1A 1B2RA 4KPUB 4PRKA 1VKZA 5HWSA 5I4BA 1DRWA 1M2VB 2V74B 3KXKA 5DBFA 4U9HS 3W79A 4KQ1A 1MJFA 4H7KA 1Q92A 4EZIA 3WGVA 3OCCA 3P0FA 2ZB7A 4E30A 1KI6A 1NBOA 3TR5A 4H18A 1SUWA 2VZEA 4UATA 2MT9A 2VTDA 4BQEA 2V6BA 5JXJA 1UPXA 1GYPA 2P4HX 4F5ZA 5K4HA 1Q57A 1AHPA 4XDHA 4P3PA 1G7RA 2DSTA 1JQKA 1RXVA 1EQAA 1KDPA 2JGMA 3G7UA 2IDJA 3A6LA 3NAZA 4R84A 3UWDA 5KU1A 2Y1LA 3BGDA 3HPQA 4ER7A 2JLUA 1KKLA 4K2AA 4TSFD 3N28A 3V55A 3THRA 2QM8A 4DA6A 2ETVA 3G0IA 4FYJA 3CH7A 4JOBA 4FYPA 4Y18A 4ZYYA 1KZGB 4OH7A 3S1SA 1HUQA 3G79A 4QDUA 4ZI7A 2VP0A 3KRTA 3DEJA 5TARA 4E46A 3L07A 4P8RA 3OCXA 4PZPA 4ZCMA 4AUKA 5JR3A 2BUBA 1C3OB 3X44A 4AMUA 4ZCSA 1ZZGA 3OZEA 4J2HA 4CN9A 1RJ9A 4C6TA 4CFYA 1UPFA 3IP3A 1C9NA 1KMQA 1T3GA 1R0RE 1CZUA 1DWQA 1YVEI 2QNBA 4QO8A 2B4KA 1X2EA 1T43A 2EFEB 2RHOA 1JQJC 1E5QA 1Z7EA 2XPCA 3GDOA 3C70A 3K9NA 4NCJA 5LDGA 4G1CA 4GSKA 4OCZA 1ZM9A 2CXNA 2ZJFA 4LNUB 4OFZA 3LS2A 2PL1A 2QAIA 3CIOA 4JJKA 3A4LA 4AMBA 1UJ2A 5DM60 3NYIA 3F6BX 1AKYA 1MC5A 1F06A 2VBGA 2WE7A 3AF3A 2VO1A 3FVRA 3IESA 1GKYA 2XUQA 5EWJB 1X1EA 3E70C 3KAPA 4RKRA 3CLUD 5AVSA 2NUPA 3GLVA 4LDZA 4LRXA 2M2IA 3DNMA 4Q1DA 4YUAA 3EAGA 4LSMA 5L9AA 2O6LA 1T5DX 1N2EA 2HWKA 2QN2A 2Z09A 2JS7A 3EIOA 1NYLA 4JJ4A 4RH0A 2WBLC 4F38A 3U4DA 5C7OO 3KSRA 2F8SA 3LRXA 2O6HA 5J23A 4M38A 4UAUA 2XWJI 3PVCA 2PG3A 2Q1TA 3U7FB 2GBFA 4RELA 2G1PA 3EEOA 1E1LA 4KN6A 3NWJA 1R9NA 3EDRA 1BHSA 3NTVA 2BR3A 3PYXA 1ELOA 2QVCA 4ALKA 2IYSA 4D0RA 2OOKA 3LT5A 2ZYAA 5G41A 2AI1A 3F5QA 5EFOA 4ERNA 3LXMA 5COAA 2XUHA 2W42A 4YRRA 3I34X 5THXA 3KETA 5LMZA 4URYR 3IT0A 1H2AS 2KBEA 1W0CA 4MMXB 5IM4F 3DBLA 1E61A 3HC7A 1ZXLA 3IVXA 4HSEA 4KYIB 4TV9A 4ZVUA 4BFSA 5HG0A 4OHVA 3K70C 1H4QA 2OGZA 3WBKA 3UHJA 3HA5A 4HYEA 3HVKA 1NOJA 4OHWA 2GEFA 2WNHA 3ER9A 3R8FA 3QY9A 2XGJA 3COYA 3DLAA 3QVUA 1K1EA 2VN8A 4E09A 5IC6A 3W6UA 3T1NA 5DRYA 3RNLA 1B6GA 2G17A 3HLTA 5FRDA 5TX7A 3LPCA 3VZRA 4M6WB 3FUTA 5DTJA 4ZYWA 2WYVA 4WKOA 4A91A 4L3VA 4C78A 1MDBA 2FG5A 2N1BA 1BDHA 3MXOA 2R84A 3L0PA 3FHLA 1KZ9A 3LE8A 1QS0B 3PR2B 1V16A 2GK7A 1W76A 3T7SA 2P3OA 4BO5A 2QMEA 1VB5A 1F0KA 1U94A 1NZDA 1YZ3A 3VKFA 5D3KA 1LPAB 4IHQA 5FFFA 4DGQA 2FW1A 3LUCA 3AJDA 4Y2RA 2ZRPA 2QM3A 3LT4A 3UAYA 4FEGA 4KQMA 5BQ3A 4BLSA 4MCHA 2H2DA 1OVMA 3HYLA 1MENA 1H1DA 2PRYA 1UH5A 3ROFA 1PJTA 3OF5A 3VSEA 3QEOA 3ER6A 4DXAA 3PUKA 1XGKA 2EP7A 2K7ZA 3KBBA 2JJ2D 4J2TA 4P33A 4I55A 3PWSA 3IQIX 1BGWA 4HATA 3EQ7A 5ER9A 1WETA 2PBZA 1E0SA 4UC0A 4TMYA 4UTVA 4Y9TA 4XLZA 4B4DA 3GU3A 3IOYA 3ZNNA 1SBTA 4W6ZA 2Q6LA 3IL2A 1OT5A 1DDGA 3OPYB 1NW8A 4UVDA 4UCFA 3NONA 4X3PA 3NVDA 3DFZA 4N7MA 1EK2A 1ZJ4A 3RODA 5EJFA 4BP3A 3QV1A 5CHEA 8GPBA 1A7JA 3DDOA 4LMRA 4NJMA 4DZZA 4F3RA 4ZVVA 1N4AA 1FTQA 4JB8A 1BD4A 1W581 1ADBA 1H0KA 1UZLA 1HSZA 3JD2A 4ENTA 4HZUA 3ZWWA 2QUHA 3TQHA 3HWX1 3QYAA 2PTHA 1U8YA 1XVIA 1YS6A 2REOA 3JWEA 4GOLD 4CNBA 5ILGA 2ASEA 3L7IA 3F5SA 3IRUA 2OUKA 3RCBA 2A0FA 3W2IA 4ASUD 5TF0A 1SC3A 5EGSA 4G1EB 1P9OA 3E7PA 4XUDA 1D2NA 1RTTA 1FFCA 3TX6A 3VM6A 1TYAE 3R3YA 2X5NA 3SJ7A 5EIEA 4JEMA 5TPZA 1YIOA 1ZO8A 4UCWA 1V1MA 3ICOA 4OH1A 1PTJA 1CF2O 1Z0UA 1VKJA 1VL2A 2K5UA 2QW1A 3ADKA 3CF2A 5DNDA 2Q07A 2FU5C 4D9CA 2C95A 3L6EA 3MTEA 1E6MA 2C2GA 1H42A 1BU8A 2FW8A 3AFHA 5KTYA 4IMRA 5ERYA 5I5GA 2CB0A 3I2IA 1TW3A 2B78A 1WXDA 4Q9AA 1U3TA 4NJEB 4JQYA 3K0FB 1Z8FA 1TVMA 1W1IA 3FNQA 1E6EA 2Q2OA 3KDPA 1BEEA 1UAGA 3C3WA 3LL7A 1WW3A 2QL5A 1YS9A 4YJFA 1YR3A 3ABRB 3R7FA 3SFZA 4BB0A 5JAMA 2FEMA 4XGKA 5A7FA 3CH5A 3OCWA 2CL0X 2FZ5A 3IMGA 2IIPA 3RH0A 4IJ5A 3HR8A 5K6RA 3KB6A 3KR2A 3Q9NA 4QGGA 1M33A 4CL0A 4E5SA 4JBYA 4YCSA 1LH0A 1YR2A 1XBTA 1XALA 1Y1KE 2BW0A 4K0RA 1HKHA 4G5YA 5TQ0A 2WG0A 3SZLA 3VVBA 4UBOA 1CUHA 1G5FA 2RHMA 1FPMA 3PC7A 3ZDBA 1QV9A 3BA6A 4OXNA 1IZ7A 2C4KA 2HEIA 2W4QA 3PCRB 4KZKA 4ZO8A 1POWA 1UXOA 3MWJA 4GZ3A 5SZHB 2XB9A 2V6FA 4RZHA 1EINA 3UJ3X 1NPDA 1EBFA 3BD9A 2WJVA 5KYNA 3HVIA 2VDMB 4BFVA 2Z2IA 4URFA 2J3LA 2WIDA 3A6ZA 4CGYA 4E4TA 5F77A 2Q2VA 1SVMA 1TVEA 4G8DA 5A6SB 1F5SA 4ZCTA 3C1AA 4NY1A 1OYYA 2ERXA 1BFUA 2PRJA 2G8LA 3LX5A 4B43A 5HCUA 4RD1A 4ZWNA 1J8DA 3V7WA 1NP6A 4EKEA 2XOKA 1P0CA 1A8QA 1QQ7A 3AY6A 4ZHQB 4HTFA 5IKOA 2YQZA 1M2KA 2RH9B 4U9IS 1M34E 2GESA 5B1DA 4F8YA 1ZK3A 1NONA 1SPXA 3VPFA 2Q3CA 3RRJA 1DXQA 2CC2A 1V8OA 2PX8A 2RH5A 4Z4HA 5HHTA 2EGUA 3L1JA 4MKXA 1UM8A 4N5IX 3A9UA 3GJ4A 4Y1GA 2ZPTX 4GZLA 1QE5A 2O48X 1WUKS 3QYJA 4EUEA 4MKHA 4RMGA 3PJFA 1VBNA 2RGRA 3BTVA 4IJSA 3C3AA 3PQ4A 2FX5A 4URVR 1UMKA 3RTAA 2P9TA 5JAHA 2Y2VA 1SMKA 4MLDA 1RRPA 4BNGA 2RHGB 4IX9A 3RTEA 3PHJA 4DWOA 4EL5A 3BT7A 2OHGA 4MS4B 4MMYB 3DWEX 3NT5A 1ODKA 3OZ7A 3ON5A 1GQQA 2X9VA 1IDN1 3OPMA 1SXHA 3QFHA 4B6QA 3R24A 4Z9XA 3LUHA 3F5MA 1XU4A 3QVSA 3FHTA 1NRJB 3R3XA 1PEKE 3ETEA 5KVSA 4N39A 4YR9A 1EGMB 3ZWAA 1EB8A 4DAEA 4PXAA 3BRWA 4EKIA 4R71A 2FPIA 2QX4A 2W4MA 2C54A 3G2JA 4IHAA 4LZZA 3PLRA 1NR1A 4UVHA 1IL0A 4PZUA 3AKDA 4X95A 1XPOA 1FX0A 3AHCA 1SVKA 4P31A 2QV7A 3WNDA 3EGXA 2A9JA 3G2OA 1J42A 1J9EA 4XVCA 1E1NA 4G81A 4LJ9A 2HLDD 4WKBA 2LKDA 3NTXA 4QXOA 5HJ5A 1L4YA 1WD7A 4YAUA 3H05A 4R01A 3I9FA 1Y4AE 3KJXA 4LSGA 1YUMA 2E0IA 3KOWA 4UZFA 3RUAA 3SEZA 4R05A 2H16A 3ND9A 5DP2A 1IK4A 3RYTC 4ARVA 1ZXBA 1J23A 4KGXA 1NOKA 4PS1A 5IZ4A 1KMHB 3BFKA 1I7DA 1BKYA 2X3FA 1JFRA 1WPXA 4RHYA 2YCLA 1COZA 3K70D 1GR0A 4N3AA 2DLCX 4CIAA 5PNTA 4Z49A 4BB6A 4KLCA 5DSZA 2AZDA 3I9KA 4S2EA 3UPDA 1PS8A 4GPZA 2VK8A 3EUFA 5T4HA 4NOKA 3PKZA 2JA2A 1L5FA 2E4ZA 3Q2IA 4P93A 1N8TA 3LHDA 1VE3A 2C1EA 2J9FB 3TECE 3V4RA 2JIZD 1JYFA 1N2BA 1SD1A 4JOSA 3WGLA 2R5WA 4OJYA 3HS3A 4QBTA 1G1AA 5BMVB 1C7FA 4TUYB 4ZV9A 4PM4A 4DR7B 2XHZA 2WAYA 1T4BA 3BWEA 1T1EA 1Z7BA 2FDXA 5JDCC 4YRCA 5KQSA 3DMGA 3E9RA 4OQ4A 1P1IA 2IODA 4KDCA 4NWIA 4EJ0A 1LB1B 2CV2A 3ZKAA 3GJRA 3N8DA 4TLDA 3G13A 4D9JA 3K71B 2WSSA 1I1QB 2CD7A 3ONFA 3QPBA 4HDRB 1XCGB 3AZPA 4BVLA 1QV7A 1OX4A 2P9YA 1MRSA 1DOAA 1N5KA 1FW6A 2V4ZA 3CKMA 2P7IA 3DXXA 4G1BA 4ZVRA 1HF3A 1LDBA 1SA0A 5FEUA 2KLBA 1NHGA 3B8EA 4DSAA 3P52A 5BRAA 4L76A 1R9GA 1V26A 5A3VA 4WIAA 4LJ7A 3ZHTA 2Q1UA 1CZRA 3OTQA 1ZN2A 4RZSA 3IVAA 4S1WA 1CC1S 3W8DA 4JX9A 5GZ6A 4B09A 3GZJA 3E81A 3OKAA 3UJ7A 1Y6GA 2N0SA 5IH3A 3OZWA 5EMKA 4UM9B 3BF8A 4AJHA 4CZ2A 2BM0A 4L5AA 3JWJA 3LFTA 3N9IA 4X45A 4IDPA 4E5YA 1E2UA 2P6RA 1LK0A 1VLJA 5T8KC 1GG9A 3I83A 2O7NA 2C2XA 1Q77A 2NADA 1TFUA 3JQ9C 5LLTA 5AW8A 1DPGA 3EXFA 3CE9A 4D8XA 5AJXA 3K70B 2YBDA 3T6KA 1T5OA 5PGMA 3CJQA 1KAMA 2O3QA 3LC7O 4K9LA 2WWRA 1VRVA 1F8GA 1NL3A 3K94A 1Q44A 1L1FA 4N0PA 3WLMA 1Z8HA 2HHAA 3IELA 5DKFA 3S5UA 4DNFA 2C7QA 4ZT2A 2EKPA 3K9GA 4BMZA 2Q6VA 2WPNA 2O5RA 1ISRA 2E21A 2UUOA 4GUDA 4IDEA 3G6WA 4PHGA 3WYCA 4BFCA 1NMXA 4KFUA 4OEHA 3RB8A 4DLSA 1FDVA 1B73A 4HLUC 1ZGBA 4C2BA 4UTNA 3UYLA 1SRRA 3G7SA 3UAWA 1SQFA 2FETA 3C5CA 4MK4A 2QTZA 2ZUVA 3FM9A 3SN6A 3UTCA 4Q6WA 3CISA 4GWKA 4INPA 1E2FA 1IXYA 3WLLA 1NW3A 1N0VC 1KJQA 3H6HA 1DB3A 1UC8A 2O2JA 1E94E 3D8TA 1F3LA 4N0DA 3EEYA 4NICA 3T0IA 4AZSA 3EZXA 1J8YF 2JGKA 1AKQA 3AEKB 1Z68A 5KHLB 1YDMA 1JLMA 1T1JA 2F43A 4B7CA 3MA0A 3EIHA 1YVRA 4HDMA 4L02A 4AO8A 1PNRA 1ESEA 1E3JA 4QVGA 1HLFA 1W0KD 1DG1G 1D4ZA 4FNMA 4FMCF 1OBCA 1DIBA 3ETDA 1T8WA 2D3TA 3RU9A 1SVLA 4M9SA 3O8QA 5BQOA 4BNYA 4UTXA 4FNOA 3H9QA 3W6NA 4F96A 3SBEA 5FPYA 5L3QA 5AW4A 1YL5A 1XRLA 2IXDA 2W00A 1X7ZB 2ZJ4A 3FKQA 2HRZA 1Z7YA 2I54A 4ENVA 3RYCA 4F1WA 3WFIA 4S1PA 3EISA 3PGJA 4QRDA 4RGQA 4UKDA 4WCFC 2QP4A 1ACJA 1L4BA 4ML3A 5FQNA 4HXEB 1H3EA 3F9RA 3VVLA 1HDXA 3PIIA 3GLIE 1RR6A 4FMDF 1WPQA 4Y0NA 4B32A 4BZZA 2QX9A 4I1VA 4OHRA 1QKJA 2OBXA 4Y6RA 3Q0EA 2JLQA 2NUTB 2WB4A 5DLQC 2NU8B 3ZGLA 3GMIA 2VH1A 5JH7B 3CNOA 1WABA 1KSHA 1QVAA 4CLOA 1U98A 2VDOB 1ZYUA 2C4HA 2E18A 4II7A 5AVJA 5JWHA 4RBNA 1C4WA 3AVPA 1LNSA 2FR8A 2JAPA 5H0IA 1T5SA 2VG8A 4Z9YA 1E5XA 3CX3A 2Z2KA 4OYRA 5JLJA 1PUXA 3EWSA 4RJTA 2QRGA 4D5GA 3J80A 3DV2A 2M98A 2GK4A 2F67A 3E27A 2A9PA 4V1CB 2J5BA 1ZZEA 2FX3A 5EIXA 4C9BA 3O3NB 4CXMA 2HJHA 3DSRA 1WV1A 5ITVA 4WCDA 5HQ3B 2O7RA 1N32B 5DJ5A 2A1UA 1C0EA 1M1ZA 1VBMA 4O4LF 5BO5A 5KI6A 2XXBA 5P8WA 1W34A 1ADCA 1XE3A 3TXXA 4EHHA 5K8LA 2Q3BA 2J9GA 3QEJA 5LLDA 1H6AA 4GLJA 1UBMS 2XTMA 3CGWA 2BBOA 2XIQA 3DOUA 2IYWA 4LHEA 4OXIA 3FUUA 1AQ6A 2C2BA 4PYRA 3H7IA 1IUPA 4MICA 3KR0A 1OSNA 4G2TA 2OV1A 4RV5A 2X9GA 4PZ9A 3KUXA 2INGX 4PG8A 2PUCA 3H6GA 2XNDA 4XQ9A 3AETB 4AKTA 2ORIA 1TM3E 4G85A 3REFA 2H1CA 1AA9A 1YRWA 4FLEA 3H5WA 4DOMA 2ADMA 2JZNA 1EFPA 1PLLA 2W8BB 3ZIDA 5JCJD 1SBYA 2UU9B 2TS1A 2G09A 4J1TA 3VO2A 5HJEA 3ZHCA 1QJCA 2ZIUB 5G0WA 3UB2A 4C2TA 1RRVA 4GEGA 4ND1A 3ETHA 5IC5A 2JFBA 3QIAA 3V2UA 3WK9A 4PX2A 2PX2A 3OH8A 3OOHA 1EP9A 1FSSA 2HA7A 4MS1A 1J39A 5EPOA 1P33A 4CEJA 4IKOA 5HS4A 4OX9Y 1Y3CE 2UXDB 3TJRA 2I4MA 3O3MB 1NVGA 3HCWA 4J1QA 1R66A 5DTMA 3WGHA 4LVOA 4CLXA 4DR6B 2ORWA 3AF0A 4FEYA 2NX2A 2HUPA 1IJBA 2ACKA 3QQPA 1NQAO 1QTIA 3T52A 3W04A 1C7IA 1QYXA 4B82A 4WXPA 2JLSA 1HE3A 1U1EA 3FVVA 3HY6A 1XTVA 2HPVA 5LBUA 2RC5A 2O8CB 4QPDA 4TMVA 5KVQA 4URHA 3KKMA 4FGKA 1E18A 5THKA 5GV7A 2O2IA 1PZGA 1VFPA 4G26A 4WZAE 4EOGA 2G9QA 4YROA 1ODFA 2FB9A 3AGQA 3SIXA 4IEFB 4A27A 3UHOA 5LU8A 1WP4A 3D6VA 5BNZA 2JJQA 2J6IA 4MIOA 2HIMA 2XBLA 2B4RO 3FYSA 3PVZA 5G1PA 1KR2A 4IMPA 2W2LD 4CCYA 4DKJA 4JASB 3N2KB 5I7FA 2Z98A 1L5OA 5IMBA 2XV1A 3J7AC 4FR2A 3K20A 2OCGA 4BNZA 4Z2AA 3PEUA 2NAFA 2QSYA 5AI8A 4A73A 3LWDA 1X1AA 5K3BA 1SCAA 1W44A 3C8MA 1ORIA 4CQLB 5HOQA 2GGSA 4B46A 1UKYA 4QOEA 4E1VA 1VIDA 2FDCA 4NLLA 2JKYA 4EPRA 2JPDA 4GD3Q 5MGNA 2ZSJA 4M87A 3RBAA 3ENKA 3GR6A 1J5PA 5BUQA 1USVA 1JU3A 1MT0A 1RAEA 1Z15A 2H52A 2H3EA 1WZEA 2I3BA 3GLTA 3IIIA 3ITEA 3L0ZA 2L69A 2HDOA 3N59A 2ZJOA 3F7OA 4K6OA 3DEZA 1FRQA 2W70A 5ICSA 3LBIA 2ZUUA 1V5EA 2NO0A 3I4FA 4WSOA 2E49A 3F9IA 1O8BA 4K8RB 1V5FA 4JI8B 4H0CA 2I76A 2OHVA 2Q6OA 4EVQA 1SCDA 5IX8A 2OHHA 3GEIA 2XEDA 4FCTA 4ZAYA 4CU2A 4B35A 3RS4A 1I51A 4IDQA 2WFMA 3GRAA 4WAUA 1C50A 2W2QA 3FMIA 1AURA 3B9BA 3MCUA 3AKZA 1D09A 1QRAA 4UNSA 4F91B 2GZ3A 4JKOA 4HYTA 3W4IA 4QUEA 3IODA 3F3MA 1ZOPA 4D4KA 5IBPA 2AOWA 3WKEA 2Z30A 2VJNA 4HGQA 3TQTA 3FHOA 4EENA 3PPXA 1A9ZA 2JGRA 3LI2A 1PFUA 2FTKE 1F2TA 3K5PA 3SQNA 3PNQA 3IQGX 4LKOA 2OAEA 1U28A 2GYUA 4AS1A 1VIYA 2ZT6A 4JHLA 3E22B 1P5JA 3SSOA 2AXNA 3BYZA 4B79A 2ODEA 3F8TA 5GJVC 4L6AA 2ZDQA 4DLXA 1M9NA 2P6OA 5ESRA 4RPIA 1FP7A 2H17A 3OPYI 2XZLA 1QV6A 3C8ZA 3DD5A 5FPQA 1RHUA 3M8KA 1NA5A 3K6SB 2E4AA 3TNYA 4DQXA 5KVCA 4WASA 5D7NA 1L5MA 1EX7A 1G2PA 3HACA 1JNYA 1H4SA 2BCEA 4FLMA 2E9SA 4N7BA 1WSDA 1E2EA 3QXHA 2J3MA 3KPUA 2IOFA 1XG5A 4LJAA 1RRKA 5DNUA 1DJLA 2JF0A 1IUOA 1MW9X 3AYXB 3W90A 1TEZA 1R3UA 3RUCA 4FFWA 1RD4A 1U80A 4X64B 4GZ6A 1ZU5A 2R79A 3HYCA 4ITUA 1R5NA 4ERXA 1QRTA 4KR7A 2Y27A 3D43A 3K3PA 4O2BA 1RTKA 1OF1A 4FDAA 4UNNA 1H2BA 5U1PA 3SC2A 1FCJA 2ACEA 4LDRA 1BYIA 4J7XA 5KTNA 4CYMA 3BD7A 4BGPA 4UHKA 2F8TA 4KE7A 5ER6A 1DAHA 4EVRA 4M0FA 1BKDR 1BOOA 1SBIA 3NFRA 1THMA 4MUIA 4RVFA 3WXMA 5ABPA 1P5FA 1HORA 3AF6A 3C6YA 2Q4TA 1P9RA 5FKJA 3V8NA 4H3HB 3H1PA 1LQUA 4US0R 4QRIA 5HFJA 3DDCA 4RD2A 4RAOA 4XD2A 1NVBA 1SHKA 2J3EA 2CF6A 1QVWA 5B3JC 3RQIA 5CVCA 3MILA 3OJXA 2PMDA 2IUFA 1S3FA 1DWOA 1JTVA 1Y9AA 1FP6A 2C8JA 2F00A 3B6ZA 3M3PA 3M6LA 4L8GA 3PUIA 5AM4A 5CB4A 4PV7A 5BN5B 3MYRA 3LDHA 4BHHB 3CSDA 2P0EA 3EB9A 3LKVA 4D0SA 5F35A 1EJ2A 1ZESA 5CCBA 1FRZA 4UEKA 3AUAA 1RJEA 3B20A 4LMBA 2Z8YM 3AVVA 4HQLA 4FDLA 1JPVA 3I3OA 4AT1A 3AOEC 5JSQA 3DXZA 1RYYA 4MP3A 3TD6A 1NUTA 1RM3A 2AI2A 1JAXA 1HY3A 1WDWB 2XA1A 4FI3F 4RYLA 5C80A 2FYTA 3ZW9A 4OL9A 4BBAA 1KGSA 4IWXA 4RK6A 2J85A 4MQ6A 2AJTA 4GOKA 3OQVA 4ZIRB 3KT0A 3FMOB 4FKZA 3DVRX 4LPSA 4Z51A 5JALA 1RXYA 1QVRA 1UOPA 2ATXA 3OT1A 3WBJA 4PPQA 4ZGBA 2PIAA 2PBRA 1ZVQA 5JXIA 3ST7A 3P0IA 1L4UA 2RGAA 5KDDA 3DB1A 1XCOA 3WSWA 1YQWA 1N6OA 3OURA 4ZT3A 1ZS9A 5BNIA 5SZJA 2XMGA 3ND5A 5AUNB 3LGXA 1VRWA 3MB5A 1N57A 1P74A 2R47A 2VHZA 3F8WA 3L0CA 2ZBQA 1LDYA 2VSYA 1AM4D 4WJZA 1M5UA 2A9VA 1N2CA 3MMXA 4ZVSA 5HDQA 4ZYTA 1KC3A 5I8ZA 1XEAA 1UK8A 3B12A 4XYGA 1DT3A 4EYGA 2UV8A 3I01A 3UW1A 3B78A 1RCUA 2RHTA 3DDZX 1FLVA 3L7CA 1TCBA 3GFFA 4C4ZA 4XOUA 3IEVA 3H5OA 2XI4A 4RY2A 1S01A 2GASA 5IDYA 3TGPA 2H9AA 3OEYA 1D1QA 1CZHA 4QT0A 2ECQA 2RGCA 4UBLA 5IBRA 1G8SA 2D0IA 4MGKR 4Z0PA 1D2RA 5T64A 5DN6D 1DEAA 4HNVA 3C7DB 3PFGA 1LVGA 1IJKA 1J6UA 3MIZA 1BE6A 2GCPA 4HQOA 3BEDA 2ZJAA 2AK2A 2P9HA 4HQNA 2QL9A 1R6DA 2DP4E 2VQ3A 4E2ZA 2J0VA 5KNLA 1YI8A 3INYA 3N07A 3LMKA 4RK5A 4W4TA 1MIHA 3KT3A 1TU0A 2HA4A 2IPMA 5DH9A 3UEOA 5AVQA 2VPQA 4UE3S 2J3QA 3LUFA 3GD7A 1FBNA 4NAUA 4W8GA 3UT6A 1U0OC