2Q5EA

Crystal structure of human carboxy-terminal domain rna polymerase ii polypeptide a small phosphatase 2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
LLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics of protein phosphatases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
total genus 56
structure length 181
sequence length 181
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2q5eA00
3AR2A 1L7PA 2RARA 4IFTA 3BA6A 4EX7A 3R9KA 1WVIA 3D6JA 3L8FA 1L8LA 5AHXA 1RMQA 3QUQA 4UATA 2CFRA 1TE2A 3ZI4A 1YV9A 3PGVA 2HHLA 2WF5A 3UMBA 3RF6A 2NO5A 3OTQA 3E58A 2HOQA 1TA0A 1QYIA 1ZOLA 5AKZA 2YJ3A 1NRWA 4KN8A 2Q5EA 2GFHA 4NAVA 2C8LA 2W11A 4C4TA 5A3RA 3DDHA 5JJBA 4AS3A 2R8YA 3WK4A 4UARA 3OCVA 2G07A 2IYEA 2YFYA 1JUDA 2BDEA 3IB6A 5E0OA 5AW9A 3N8GA 3NALA 1QQ5A 3IJ5A 4HGRA 1LTQA 4ZEWA 4Y2QA 4L6CA 2C8KA 5AESA 1Z4MA 1XP5A 3OCUA 3QXGA 4HAIA 5ALQA 1J97A 3U19A 3I1YA 2CFTA 3KBBA 1RMTA 1WPGA 1U02A 3QU7A 1K1EA 1T5TA 2NYVA 5IT0A 4Y2TA 1U7OA 1ZD3A 3CNHA 1ZRMA 2G0AA 2ZBDA 5AW4A 3AR7A 3GYGA 3U13A 5AKKA 1U2SA 1L6RA 5AK3A 2WHEA 2HSZA 3E84A 3ET5A 4HGOA 4F71A 3VAYA 3L8GA 1RLMA 3OCXA 2G80A 1Z88A 4MUMA 1O08A 4XOUA 5ALTA 3AR3A 2ZXEA 2WF8A 4BEVA 5AVSA 1ZJJA 1S2OA 2AH5A 4Y2XA 3CZ4A 4CF4A 3OCYA 3U7HB 4Y2RA 2HF7A 1S8OA 1NF2A 4E88A 4CF5A 5ALVA 5AW2A 3QU4A 3EF1A 4UMEA 1X42A 4ZEXA 5ALEA 3B9BA 4OFZA 2I34A 1YNSA 2HCFA 3U26A 1SWVA 2GHTA 2FUCA 3MN1A 4EENA 3B8EA 3R4CA 2WM8A 4KNVA 2ODAA 3SD7A 5AW6A 3P96A 3WKCA 1T9ZA 1VJRA 2B30A 4KYTA 1RDFA 3FPBA 3PCTA 3ZX5A 1ZD5A 3ED5A 2QLTA 4Y2PA 4CF3A 1EK2A 4DFDA 3DAOA 5ALKA 3HYCA 3L8EA 5AM3A 3MC1A 3QUBA 3OPXA 4PNHA 5AI5A 3EF0A 5ALSA 1Z5UA 2I55A 2ZOSA 5ALDA 4CNQA 5AIBA 4UAVA 3R09A 1XPJA 1RLOA 4UU1A 2HX1A 2JARA 1RQLA 5AVQA 2BY4A 2B82A 3B9RA 2HDOA 5AKGA 4UU0A 3ZWDA 1RLTA 3QU5A 1Y8AA 5A3SA 2B1RA 4NABA 3ZU6A 1RMYA 3UM9A 3WK5A 3AR6A 3L0YA 2D2VA 2IA5A 4AS2A 3M9LA 4UASA 2FPRA 1Z4JA 3EWIA 4YIKA 4HGQA 2YBDA 4AP9A 2WF7A 2R8ZA 5AVXA 3L0CA 3QUTA 4GXTA 4HYTA 3AR5A 2JAUA 4J2TA 4BYGA 2YMMA 3M1YA 2I7DA 2IOHA 2O9JA 3L5KA 4XQ0A 1Z4IA 5AKHA 1Z4PX 2I54A 5ALJA 2FDRA 2FPUA 2PKEA 4Y2VA 1Z4KA 3E81A 3A1CA 5AI4A 3AR4A 2JAWA 3NIWA 5AVZA 2IOFA 4L57A 4BX3A 5ALRA 1ZD2P 4GIBA 3J7TA 3N28A 5ALPA 4NWIA 1Q92A 5ALNA 3N5KA 4DW8A 3ZX4A 1SU4A 5AM0A 4JB3A 2WF9A 2G06A 5AW0A 3MPOA 3WKBA 2HI0A 2RAVA 5AI8A 4H1WA 1U7PA 3WKDA 3ESQA 3W5BA 1WZCA 2YMLA 5ALXA 5AKXA 4YCMA 2CFSA 3QYPA 1VJ5A 2YMQA 5AW3A 2C88A 4EX6A 2GHQA 4FFDA 2GO7A 4UM5A 3W5DA 1NNLA 3SMVA 2Q4RA 2MU1A 3WK6A 3QGMA 3L1UA 3UMGA 2B0CA 4L6AA 2AMYA 2G1AA 3IRUA 3A1DA 3ZWKA 4DWOA 3ZTYA 4EEKA 5AW1A 5AK6A 1RKQA 4B6JA 1VFPA 2GMWA 2PR7A 3ZVLA 1SWWA 5AM1A 1U2TA 5AKLA 3UMCA 5AVWA 3ZVNA 1RPZA 3I76A 2O2XA 4IG4A 3ZTWA 3I6BA 3MMZA 4OD0A 3KC2A 3SKYA 3PGLA 1RRCA 2W4MA 4G63A 2JGAA 4NFLA 4Y2UA 4YIHA 4I9GA 1MH9A 5IT4A 5AIAA 5T41A 2P27A 2R8XA 3AR9A 2BDUA 1O03A 2OYCA 4BNDB 2RB5A 4G9BA 3OCWA 4BEWA 1Z4QA 1RKUA 3QX7A 1Z4LA 2IOFK 2CN1A 3KOOA 5ALYA 5AM2A 3NAMA 3DNPA 4BKMA 2G09A 1RQNA 3QNMA 2FUEA 1YJ5A 3L0BA 3KD3A 3WK8A 2FPXA 2R8EA 3K1ZA 3KDPA 3ZVMA 3S6JA 2MSNA 5ALHA 2DQSA 2RBKA 2YJ4A 2FEAA 2C9MA 2YMPA 4JDPA 5FP0A 4BX0A 5AVYA 2AUTA 3NANA 2OA0A 3AR8A 2JAOA 4UM7A 3FM9A 2EAUA 4O8CA 5IS2A 2W43A 1EK1A 4C4RA 3N1UA 4ZEVA 5AW7A 2OBBA 3QLEA 2ZBEA 1YS9A 4YH1A 4QJBA 4EZEA 4NV0A 2B8EA 2OM6A 4BX2A 4FYPA 1FEZA 2B1QA 3WGVA 1CQZA 1RC8A 1F5SA 1PW5A 1TJ5A 4C4SA 3F9RA 5AM4A 5AVTA 5ALWA 5AVVA 2C4NA 3FZQA 1ZD4A 2B8JA 2FPWA 3N07A 5AKEA 3WK9A 4XE5A 3W5AA 2I33A 3TLMA 3U7GA 2YJ6A 2ZBGA 4F72A 4HGPA 2YN4A 4I9FA 5ALUA 5AVUA 1Z4NA 4UMDA 3EPRA 5ALOA 5AK4A 3W5CA 5AI6A 5AW8A 5ALGA 1L7NA 3WKAA 3ET4A 1TJ4A 4Y3UA 4YCNA 1IWOA 4BNDA 1Z4OA 5AM5A 1Q91A 4EELA 4KX5A 3SKXA 3WGUA 4QQFA 5AI9A 2P69A 5A3QA 1T5SA 3A1EA 5AKYA 2G08A 4UAUA 3L1VA 5AK5A 3HLTA 3PDWA 2YY6A 3E8MA 2P11A 1ZRNA 3ONNA 5ALIA 4KX3A 5AI0A 4OHFA 2WFAA 2X4DA 1L7OA 1XVIA 3A3YA 5ALZA 1QQ7A 4BBJA 4RETA 4Y2YA 3BWVA 4Y2JA 3ZW7A 4HGNA 1ZS9A 4UMFA 1J8DA 2Q4TA 2HEGA 2ZG6A 1RKVA 3QUCA 3QU2A 3FPSA 3DV9A 1WR8A 5ALLA 3OCZA 4Y2SA 2EARA 3RFUA 4DCCA 4YCLA 1TJ3A 2AGVA 2P9JA 5AW5A 3NRJA 2FPSA 1QH9A 2NO4A 1LVHA 4RESA 1YMQA 3KZXA 2QYHA 3I28A 2ZBFA 4FE3A 1L8OA 1L7MA 3ESRA 5ALFA 4UW9A 3NASA 3U7EB 1Z5GA 3QU9A 2PQ0A 3FGOA 3FVVA 4OCZA 1N9KA 4XPZA 5AKJA 3WK7A 5ALMA 3SHQA 1QQ6A 2EATA 1N8NA 3U7FB 5AKIA 3SLRA 1AQ6A 2I6XA 2VKQA 3NUQA 3L8HA 1YDFA 4KNWA 1CR6A 4MWOA 3ZUPA 2FI1A 4UMVA 3SF0A 1KYTA 2HF2A 3L7YA 3WKEA 2YJ5A 5AICA 2HO4A 4CE6A 2WF6A 4J03A 4YGYA 5AVRA
chains in the Genus database with same CATH superfamily
3GNQA 1SCIA 4NLLA 3WHPA 3WY9A 4HMOA 5FQNA 2ENWA 1X3SA 3EJ6A 3TXXA 3TNDA 3WIUA 1QIGA 1XELA 1ZK0A 2ZIFA 3MIIA 1IE3A 3FHOA 4PYMA 5FTMA 2Z8ZA 4B3RB 3JAWB 1SXJC 2GHIA 3IVAA 3SHOA 4MW5A 5DK4A 4YJFB 3REQB 4ZI7B 3WRXA 1VG9B 1Y5RA 1E1QA 4LQLA 5DTJA 3SJ7A 1J8MF 2CFRA 1REQA 3D1LA 3PJFA 3SEAA 5I7SA 1GUZA 1A9YA 3WMGA 2JFXA 3PXEA 3KJHA 2DUMA 1IN6A 1DX9A 1GTG1 2J9RA 2OFXA 2VTVA 4B85A 4F92B 2PQ2A 5DBOA 1IHOA 1AHPA 3EOAI 4JI6B 3RSSA 3GAFA 3H87A 3TQQA 1IHXA 4RVUA 4QELA 2PD6A 1MB0A 4KN8A 3WAKA 3RUEA 5LQKA 4BBAA 3HN2A 4KLZA 1MHTA 1KZGB 2YOGA 3N8KA 3IOYA 1YE8A 2WLTA 2EYUA 3TUJC 2ZIXB 2IYEA 2LWIA 4FN5A 3HB9A 1NNI1 2AEEA 4IWYA 4PRLA 4QLAA 3UAGA 1X92A 1UBSB 1YU6A 4ZVTA 4B3FX 4PLFA 3FB1A 5H68A 3REQA 2AVNA 1RRPA 4IIGA 4BMOB 4MV8A 3O95A 4W9RA 1M72A 1WMDA 5ELMA 2CBGA 1C7RA 4BUZA 2QY9A 3DEKA 4HJRA 2Q5LA 1A8UA 2ZQYA 1Z2AA 3AQIA 3F6PA 4E07A 3K09C 4RNCA 4W5HA 4M53A 2XRYA 4Z0TA 3EIXA 2BI4A 1MO2A 5IH3A 1VPDA 4ZT3A 5LZ4A 4C30A 2YXEA 1QK3A 3D0KA 3VH1A 3K1AA 2V7QA 1T5TA 3G0DA 1HKUA 1P1JA 5KCZA 1PUXA 4DDUA 3WGMA 3PL5A 1WUJS 2EVWX 3TM4A 3CNHA 2WYVA 2HIMA 3AONB 4R2WA 4WZBE 4HDMA 4JI3B 1JR4A 5ILOA 3G8AA 1CQIB 2QAIA 1AD2A 2WSLA 1E3LA 1H1DA 3KPWA 4IJWA 1E2GA 4IVPA 4O63O 1KO4A 4ZEOA 4MP6A 3RRZA 3STWA 2J3LA 3UUWA 5JCJD 2WIKA 3A58B 1GRQA 4YUWA 5C81A 4Q39A 1DQSA 1M2EA 3PR3A 3TZKA 2JD2A 4MI1A 3DLIA 3HVUA 3IULA 5L53A 1KNXA 2QTCA 3BK2A 3KXLA 1BXGB 1M6HA 1YIOA 5K3FB 2QW0X 4OYLA 3GRFA 4DCGA 1W88A 4YV7A 3CPHA 3KSAC 2QTVB 2X5NA 1IAVA 1I4OA 1ZJJA 4G2TA 3RTDA 5I48A 5HKOA 3R3YA 2GNPA 1V11A 4ZZ3A 2JGMA 1MNQA 3CLRC 3DKVA 2AN3A 2Y1OA 4IHJA 3TTTA 3TD2A 1GLNA 3FTQA 4CMEC 3VDMA 1NR5A 2YINC 4FBGA 4M55A 1EDBA 1NUHA 4JUDX 5CM9C 1H2AS 1MLDA 2X0FA 1GGMA 4KXMA 3B1KA 1JG2A 4LJ5A 4ZGGA 2XKBA 1G5FA 3QVGA 2C8JA 2C83A 3HN6A 1IAQA 1U1CA 1JS1X 2EKBA 4KAFA 5KTRA 5HP4A 3VJRA 4ZV4A 1TMYA 5EE0A 2D5AA 1XTIA 2VL7A 2HCFA 1W36B 4TMTA 5H1YA 1VKZA 3BEDA 3RRJA 3U4GA 2QA5A 1CE8B 1TNDA 3F4KA 3ND9A 1RJFA 3F90A 2PH5A 5AW6A 4MMYB 4RH1A 1IN5A 5A62A 4AFNA 3NEYA 4YMSA 3NHLA 3H4TA 4ZOAA 4AVYA 1RDFA 5BR4A 2FRDC 3AKYA 4E5MA 4YRPA 4NE7A 3D8RA 2ZZMA 1KYZA 1QVZA 5DOVA 5SZHB 1D1QA 4IDFA 4Y98A 1EUYA 4G4GA 1G64A 2G25A 2VRWA 2WJPA 4FLMA 3ETHA 7REQB 1K2WA 4EAAA 2E6UX 2AFHE 2FEXA 2YXDA 3OJCA 4DUZB 1WVGA 1QHSA 4L2IA 1GG5A 5LL6P 3JQ6A 4LZOA 5ER6A 3UJAA 2BGLA 5AIBA 4ZAXA 2I29A 2V7QD 2NXNA 5I45A 4JHXA 2XSZD 3NTUA 1ONSA 1RAIA 1M2GA 3T94A 2V8BA 5L3VA 2EG5A 1ABBA 2GYUA 3DB1A 3GV0A 2Y3IA 2JGLA 4NMXB 4JASB 4FCTA 4ZCSA 2FCRA 3ASUA 3ZU6A 4JENA 1C0PA 2ZIUB 5CX4A 5HIMA 5BVHB 5BUQA 4BLUA 4R1UA 5JPDA 3S44A 4D0NA 4EA8A 521PA 1IDOA 1Z4JA 4LDNA 4P3OA 4A8JC 1FYEA 3SJUA 1SKYB 2SNIE 5DWQA 5DM70 3W90A 3AEUB 4R84A 3EZGA 3B5EA 3HR7A 3TLGB 3EUWA 1C80A 4BNUA 4BN5A 4DYDA 1H42A 4GAEA 1DIOB 3EXG2 1TMOA 5DF1A 2J08A 4PZPA 4MGHA 2BTEA 4OHRA 2YJGA 3BT7A 3Q8WA 2QXYA 1Q7RA 4JL5A 1LK7A 2QIOA 5EZQA 2FN3A 4HPXB 4Y1FA 4MO9A 4NHEA 1M0EA 5DYNA 1SY7A 3PUHA 1T24A 1AGNA 2H3HA 5A4JA 2QEQA 4NYJQ 1C0EA 2FPUA 5B57C 1VJTA 1Z4KA 4WXRA 3AR4A 3RREA 3GLUA 1PZFA 4KQ6A 2M32A 5IJWA 5AVZA 1YZ3A 5DNCA 1THZA 1DO0A 3ETNA 3CLRD 3GU3A 3IJEB 4L57A 1WMAA 2QRNA 1R6VA 2YZKA 2ZI6A 4TKMA 4WFKA 2CKMA 2JPDA 3CR3C 4IHAA 4DMKA 1DOHA 2H5JA 1WDLA 1ZCAA 2HK8A 4MZDA 3BFJA 3DZGA 1Y7PA 3IEXA 4TLCA 2FZGA 3N6XA 4JYMA 3PLNA 4Q4LA 5KJEA 4C2AA 2OFPA 1EH5A 3ZE0B 4K6OA 4CT5A 3O3OB 2QQEA 3K5IA 3OFSA 4MICA 3RASA 1IPHA 2FZCA 3N5KA 1QP8A 1Z0FA 3R0ZA 1YI0A 4X3CA 4PSUA 4GXQA 2QR5A 5LB4A 2BISA 1OBHA 2PN1A 2QD4A 4GOXA 4L22A 3QLJA 3ZG6A 4EMUA 5C1BA 5J43A 2GJ4A 3HBAA 3BSWA 4LWZA 1QP0A 2GKGA 1WXWA 2JLCA 2LPMA 4C0SA 3SSNA 4D9JA 3WTCA 2IPXA 1YS4A 5SYMA 4XQGA 5KX5F 4XWAA 2JLBA 4RFSA 9LDBA 1Z2OX 1OX4B 4W5WA 4NV3A 2C61A 4MK4A 4WCFA 4XTRA 3ASVA 4GH5A 4MQEA 2VSOA 1S02A 2HA4A 2Z30A 2O7VA 4X8MA 2C8VA 5KTOA 3MAGA 4D25A 4CIDA 4C5BA 4QYIB 2MSDB 1R9NA 5G4LA 2X0JA 1UXHA 4IOLA 1MO6A 3WYGA 3NRCA 4CXMA 2QBYB 3MRSA 1JBQA 3DLCA 3KYDA 4M6WB 4RS3A 2JIZD 1I3NA 3I1FA 4GEGA 1EFCA 1KO5A 1QU2A 5FOQA 3NV9A 1WHSB 1ZOSA 2QZ4A 1CNMA 3UFXB 4WBXC 5FPTA 1JLHA 2NXEA 5EQFA 5JBQA 2WR8A 1E1MA 1ZQ9A 4V0KA 5LWQA 3M34A 3ZCVA 5TT0A 3HA3A 4EJMA 1U80A 1NF3A 1VFPA 1UH5A 2O54A 1W1UA 3G0GA 1C7JA 4QUBA 2AC7A 2I8AA 1KMQA 1HORA 1Z2DA 2RHMA 2UYQA 3UMCA 4B83A 4WKGA 1MD9A 3VZSA 1VIYA 4AMBA 1UFVA 2GETA 4BGEA 4OHZA 3ZWQA 2HLHA 1N75A 3A1NA 3I76A 3PNOA 4ALKA 1F6BA 4RV5A 4O1IA 3RYFB 5KTPA 1XMJA 1C9JA 3GRVA 3TJZA 3FTEA 3KT8A 2QGZA 5T5QA 4DTCA 3AB3A 1BDMA 1EI9A 1FLVA 1E2MA 2O8DB 3FGPA 4PQEA 3SX0A 1KS9A 4HQLA 1JQ3A 5LLSA 1U4NA 1ZM2A 4V38A 2QTAA 2A59A 3EE6A 5HMLA 4TZ0A 3U3KA 2PWZA 5CDTA 1AU9A 1ADFA 3I72A 2YOHA 2HRQA 4J07A 4Y6LA 4ZRMA 1N36B 2VRCD 3U44B 1M5UA 4NH4A 1M7GA 3AERA 1MH1A 4UOZA 3NM5A 5D6NA 2O2GA 4ZI7F 5CXQA 5MHTA 1EP3B 1Z4LA 4C0KA 5LP6F 2P6NA 5HF5A 2OO5A 1OLUB 1VIMA 3E7DA 1Z5PA 1PQUA 1ORIA 2ISSD 2ZI3A 1E3QA 3KT0A 1S3SA 4LJKA 4MGKR 2FW8A 2FUEA 4S1NA 5EWMB 3JASA 2WTUA 1NMXA 4YJ2F 2ASEA 1LQUA 4L85A 4DQXA 4ZIRB 1P44A 2Q1XA 2R8EA 2BVNA 2MSNA 1V8BA 4IGFA 3OUUA 3S70A 5GIPE 2XRMA 3E2PA 3DT8A 3H1EA 4P93A 1SULA 5BW8A 4IUYA 1J2EA 4Q1DA 4WK0B 4H7HA 3LXUX 4YHBA 3TR6A 1HDIA 5LN1A 1Z34A 3WRWA 3MA0A 4MLZA 2QPOA 1JFFB 1NFRA 3RQSA 3GUVA 3CZCA 2WWVD 1ZVMA 3KL2A 1BYIA 2NVUA 3OIWA 1KJJA 3N86A 1EAYA 1XHLA 1Z13A 4V0QA 3FF1A 4BJ6A 1ORWA 3QLEA 4G07A 1T0HB 4JJ6A 3G2OA 2ZBEA 1YS9A 4KQCA 2H7YA 4I8XA 2P2LA 4I1OA 2CVHA 3UHAA 3WICA 1W5EA 4CPDA 1DRUA 3A10A 5DZSA 2QVGA 3OAAA 1AIPA 1NJ5A 2GA9A 2WJ4A 3ENNA 3HSYA 1YVDA 1W19A 5JNWA 4YP9A 3TGWA 2GN0A 1UFRA 4RA9A 4Y8VA 1E3TA 2IIQA 4NG5A 5FBWB 3TLZA 2AG0A 3WLFA 2HO5A 4Z53A 5JR3A 3L4KA 3CURA 1KRHA 2YH2A 5JXJA 3VM6A 2H06A 3CUUA 3WK9A 4EYKA 1CVRA 1EXVA 1RLJA 2XNJA 2QLBA 4PHTA 3TLMA 2ZT6A 1EB8A 2HH9A 4P81A 4WN9B 5TVKA 3UOAB 3WLEA 3WXMA 1AQNA 3AWDA 2XCLA 3GGOA 1UPUA 4JQZA 5I8ZA 2ZBGA 1K5GA 4K6GA 1W5BA 4HEQA 4K86A 2JLAA 3ZZUA 1Z6ZA 1H66A 4B6QA 1AQJA 1EEXB 2YQ5A 1Z4NA 3JQFA 5LZ5A 3LCRA 3H18A 4CEHA 1JHZA 3WTBA 2QT1A 3VTKA 3Q88A 4TLLB 2WJGA 3I2HA 4DM7A 4A6PA 5GVRA 3PGJA 3Q10A 4I1PA 1NW8A 2C5LA 1XCPA 3G2IA 3MHTA 3KM0A 1B00A 1B0AA 1JEQB 1O6GA 1ZUD1 3G88A 3FPHA 3DLTA 3O5AA 3OZTA 4IO1A 5IC4A 3F46A 1EVQA 2GOYA 4NP6A 1DAGA 1R5OA 1XDSA 5I9BA 4BASA 2HWKA 7GPBA 2AMVA 1P4SA 3L01A 3PUJA 5A3QA 5KPJA 4ECEA 1E5DA 4HK4A 3A2MA 1DV2A 1Z75A 4CMHA 4DANA 4N39A 2EBWA 4U1RA 3C6MA 3HLTA 5KAMA 2F1IA 1NVAA 4MI3A 4QPCA 1GKUB 4BNLA 5SYNA 1VLMA 5GZ3A 4AX4A 1O8BA 1E1NA 2QRGA 3EWSA 4MQBA 5CFQA 3LBAA 3B6IA 2BTOA 2QG9A 2P4EA 3HI6A 1V8FA 4DIEA 3QTBA 1QHFA 4MWSA 4RETA 2Z6QA 1E5LA 5GQSA 3VZQA 2GS9A 3RSFA 3M4ZA 4CHTA 3DVRX 4X71A 3U60B 1WMEA 3AOEA 3E7XA 1WXIA 3LYAA 4GL4A 2EGGA 3GXOA 3WMWA 5A4MS 4CI0B 1IBCA 1ZP6A 2OZLB 4LZAA 4BFZA 2Y76A 3G89A 1FRFS 1M33A 1LRKA 2XY4A 2F3SA 3VJMA 2MIIA 3BGWA 3MUEA 1DC8A 2YXLA 3BN3A 4QM6A 1R37A 2HQRA 3BB1A 3GRUA 2I22A 3IAM6 4D3XA 1Q1NA 1YQEA 3LT0A 4DB4A 2CFIA 4D8UA 3C5EA 5C51B 5HUHA 1YBVA 1AKQA 4I1IA 1QHNA 3WO0A 2V65A 1T3LA 4TWBA 3ORSA 3CW8X 4WBNF 5B4UA 4O4LA 5CYPA 5ALFA 5KC8A 3G59A 2Y2UA 1FNBA 4FGZA 4BPRA 1DWPA 1JAIA 2Q8PA 2Q6IA 4KPGA 4A2WA 1ZK2A 2QX9A 4DSUA 1UKCA 4MA5A 4MRPA 1AZTA 4D81A 1DQRA 3TLAA 3NXSA 4JBGA 1HXHA 3LCVB 1RTTA 3SLGA 1CDOA 1N8NA 1UBTS 1VYHA 2YDXA 5BSWA 2I2BA 3VR3D 3O7WA 3JQ9A 2X76A 5M04A 4RZIA 5DSTA 3GHHA 3W2HA 5CFRA 1JW9B 3ROKA 3JQRA 4PYLA 1V9SA 3MFYA 2ES4A 2FAXA 1C9MA 5ELXA 2ACKA 3OG9A 2BZSA 3DSRA 4MB0A 2QB5A 4FEGA 4YRTA 1L4FA 5J2TF 4YAJA 1VKHA 3AM3A 4BBZA 3WNVA 2DXIA 4CM6A 3MMXA 1B14A 1H4TA 4GOKA 2VAWA 3EZ7A 1FDWA 1B74A 4R9UC 2ZYWX 2GZSA 1T3HA 4Y6RA 4ETIA 1FRQA 1Z74A 4ZI5A 1XVVA 2CXUA 4CTNA 2PZKA 3CTPA 4B1FA 1CDEA 3ROGA 4BN0A 2V1UA 3TW8B 4C3ZA 4MDEA 3BMOA 3P0IA 2ODEA 2YCLA 3BGDA 2G9ZA 4WINA 2DCMA 4PR3A 5FR2A 4FGSA 1KY4A 2E87A 1T1RA 1QIFA 4XARA 1MOPA 4A1FA 4B3BA 1A9QA 2IHZA 1KXZA 4UHCA 5DBIA 2EDAA 3L46A 4HAUA 3MWKA 3UAOA 3ABRB 3LQ1A 4MW1A 2ZRJA 5JC1A 2AZMA 4PCLA 3PUYA 3ZWOA 3ULKA 1BXKA 4MJLA 1XTQA 2WF5A 3F2VA 4DNFA 1BMFD 5EFZA 5KDDA 4HKTA 1MORA 3FYSA 1S8NA 4W9NA 4R69A 1NC1A 4IILA 4DBZA 4YR7A 3BJEA 4RD4A 2QN8A 4DJ5X 4QZVA 1GA6A 1KARA 1T9BA 1NPYA 1VM6A 2GF2A 1QGUA 2PS9A 2QNRA 1OU0A 4EHLA 2PXHA 4QT4A 3V48A 5EJIA 4ALMA 4BVKA 1DDOA 1NDUA 1IN4A 4CM8B 4EVIA 3IDSA 1EGHA 3JQPA 3QX8A 3INYA 3T1NA 5K0EA 2R8YA 3LYLA 1RADA 1CP2A 4IJ6A 3B3GA 4J3JA 4K3VA 4UARA 1PL0A 1AKVA 5TMEA 1I3OA 4ND3A 2PTGA 2FR8C 2EJTA 4IRUB 4QO8A 3T4XA 3TCNA 2N1BA 3VH3A 3WNZA 1QQ5A 1ZM3A 4EI8A 4ZT2A 3ZVRA 5I7RA 3HVKA 2M1XA 4HQ6A 4FVTA 2QSZA 1PYGA 2JK0A 4D9NA 1E6LA 3P0FA 1FS4A 1GKLA 2A3RA 1RXEA 2X9GA 4JL6A 3H1GA 3SX4A 3BOSA 3M1IA 3ZU2A 4MP3A 4CCYB 4PFJA 1MEEA 4H27A 1OU4A 1BN7A 1LKZA 1R0WA 1GUYA 1K3TA 5JECA 4IUDS 1U02A 1KE1A 4PAWA 3DCIA 4ZQGA 1I0ZA 4R2KA 4BJHB 3WB1A 4CMIA 3ANTA 2JGRA 4P0PB 4PO3X 3SOZA 1DWUA 4Z6KA 2I78A 3IP5A 1V71A 1U2SA 3RYIA 5JS8A 3T54A 1JAYA 4EHNA 3OP1A 4DRZA 2I9PA 1Z3IX 3HPRA 4LY0A 2EYQA 5HTOA 1I2CA 4REQB 3K2QA 2WNSA 1SG0A 5CVDA 4TS9A 2GBIA 5F5XA 1Q1EA 5TR9A 4DRYA 5KO2A 1ML4A 3N3AC 3IBGA 3HO1A 1ZH6A 1P5HA 2E0IA 1V1MA 2IV7A 4EECA 3RYCB 1AN9A 1LK0A 1O2DA 5J59A 4NMHA 3PHGA 4NS1A 2CT8A 1XMXA 4E5KA 4FJ1A 5ECYA 4JEHA 3J81k 2AH5A 3KZOA 4LBYA 4YJ3F 1WMSA 2A9VA 4E1BA 3JRXA 3ZGZA 4Q18A 2TECE 3UW1A 3EFEA 1XDBA 2GM9A 1NJ8A 1YQ9A 2XADA 4X65B 5DE3A 2XAUA 3PYLA 2XUHA 2HM7A 2LRHA 4UZFA 2WD8A 4PSVA 5IXYA 1N6HA 3T9BA 5CX1B 1L7QA 2HV8A 2VSQA 5FPYA 3KUKA 4RM3A 4U7FA 5CTJA 3W7BA 4YT2A 3PG5A 1BJKA 1J7KA 3H8WA 2ISQA 3UKDA 1UPTA 3HGQA 1X7DA 4CV3A 2WM8A 3IAS6 4RTNA 1WQ4A 2IQ5A 2IW3A 3UWPA 3FOWA 2G1PA 2J3IA 3MCUA 3FOEC 1ONPA 1QV6A 2J3EA 1J0AA 1TM7E 3I2IA 4D80A 4N7MA 4YQYA 5HIIA 4JELA 1BSVA 1V37A 4D9EA 2IYLD 3EXHC 2B30A 1BE1A 1E5QA 3DD5A 2HFJA 1E1KA 3HXPA 4JLAA 1IRIA 3DFZA 4L8FA 2X0RA 2P8JA 1ZD5A 4BV8A 2ZAYA 5ED0A 3UFBA 1CWUA 1EE1A 2F3TA 3W2GA 2CDCA 4Q82A 4JBWA 4CM9A 3Q6IA 4RHFA 3HLYA 2DH6A 3DFFA 1VJ1A 3G5MA 5JIBA 2FZVA 4X85A 1KIFA 1A71A 2JJ2A 2PSEA 1GPLA 221PA 2ZJFA 5ALSA 4P33A 5FADA 2IEYA 2G6BA 2X1LA 3X1ZA 2HF9A 1OZFA 4N5LA 4UU1A 4YJKA 2XUPA 3HABA 1KKLA 2I66A 2BY4A 4I3HA 4PW0A 4P3KA 2HMVA 1BKSB 1ZIOA 2PVSA 1FTYA 3TVTA 1T8SA 4PGAA 1FVXA 3QEMA 2WZCA 5B7PA 2VAXA 3O26A 4HB3A 5LP6B 4XFDA 1UJMA 1WJGA 4LFBB 4XGQA 4NEHB 3PNYA 1C9NA 1QYRA 1W581 1YIAA 2ZITA 1W4RA 2FN9A 1LVUA 1H23A 2H1CA 3AEXA 2P90A 2MSEB 1IL0A 4KQGA 4HN2A 5E7JA 4DV3B 2XVXA 4EPTA 1KTVA 1GG8A 1LW6E 3GZ4A 2O20A 4FGLA 1KH2A 2LCFA 2QTZA 3UG6A 3E9ZA 3ROZA 3H9JA 3IT1A 1L4KA 2J1LA 2VCEA 1CJCA 3L1KA 1N4AA 3G9TA 1F20A 3UK2A 2AJ8A 4IDNA 1IULA 1I6LA 1C3LA 1P31A 2NOAA 3G13A 3JAKB 3MINA 2CXHA 4BMPB 4F4UA 1NW7A 1CY1A 1NW6A 1ZM4A 4G5YA 4S0ZA 2G8NA 3TLYA 4EHBA 2JAUA 3ABSB 4EI7A 3B2EA 5I7HA 1KORA 1JQ5A 5JWOA 2H85A 2AOTB 5CD1A 4EFKA 1JH8A 4K6CA 3ZE7A 2ADOA 2ZJOA 3CVOA 2IU6A 4E14A 2FDRA 4UTXA 2JLSA 2WQZA 4JBHA 3ZEIA 3ITNA 3B1FA 1S3GA 3PXCX 3B1XA 4IZOA 1OGYA 4QKQA 3UXYA 4LNUB 3GRPA 2AZXA 5BSTA 1LUAA 2QORA 3NIWA 1G3UA 4TXNA 5DULA 5IBRA 3K8ZA 3ZV3A 1WP9A 1X8JA 4AQDA 1C7ZA 3NPMA 3A36A 4EDFA 5JBIA 3ESXA 2O23A 1ZD2P 3T9EA 3ROMA 4B7UA 3EIFA 3OJWA 1NJ2A 2PO5A 4EKNB 2RSLA 4ZJYA 3L41A 1N92A 2JH3A 3O3MB 3OHPA 2NZXA 3OZIA 4TT3D 3UAYA 2QMUA 2EKLA 1WKBA 2GF0A 2H4YA 3FDJA 3LBHA 3O8LA 1G19A 3EAGA 4J6FA 4QQKA 5DBFA 2PCJA 1UC8A 3ZX4A 4LFAB 3Q4GA 4Y18A 3FNBA 2IHTA 4JJEA 3O6VA 1NURA 5EMHA 2A57A 2OFFA 3FI0A 2WF9A 3SIRA 2O5RA 4W4TA 3AIIA 2X9QA 3AY0A 5EEHA 3R40A 3RVBA 3TQHA 5F2KA 5AW0A 2OO3A 3ICCA 2B37A 2UUOA 3P32A 3OPYB 4ND1A 1YUBA 2HI0A 3SM9A 4F1KA 2OAQ1 1A76A 1V35A 1WZNA 2YV5A 3BMXA 4BWVA 4MR7A 3VPFA 2CWDA 5CFNA 3ESQA 3TZQA 5HTKA 2PAAA 2SCUA 3D6MA 3JX9A 2ZSAA 4E4TA 4HV4A 5F9HA 4PU0A 5DHSA 2GTPA 4WZAA 4N3NA 1OIVA 5DYGA 1XKTA 3I5XA 3J7AC 1F4LA 4PO9A 3ILYA 2EWVA 3BERA 4C3UA 5KYYA 1I5EA 3E5HA 3U5ZB 4QUEA 4N0MA 2HK6A 2LBPA 3CN7A 2GUGA 4N65A 3QX3A 4ZANA 1H22A 1WUKS 1YQTA 2J3DA 2NUPA 1IEWA 3GFSA 1V3UA 4H7DA 4TTPA 5AR1A 1PFWA 3EISA 4OKSA 3TGLA 2HU8A 1DRWA 1FYDA 3IRUA 1RYBA 4AG5A 2EZ4A 4IY1A 721PA 3U16A 3LOQA 3HPQA 2AOUB 4AG6A 2VUIB 3FSGA 1L6IA 3H5IA 1X1EA 4TTTS 1RKQA 1DLIA 2Q6VA 1SVSA 2PR7A 1YRAA 2BUBA 2X6QA 3D59A 3EEIA 3MTBA 3EQ9A 2UXDB 1NLZA 1GZ5A 2VSYA 4NF2A 4PZZA 1OH5A 2PJRA 3MJTA 1WUIS 3CX6A 3H9BA 3WNBA 1GPJA 5ITZA 5B1IA 2Q5CA 3GGSA 2WE7A 3ON5A 5B64A 2R6ZA 1NMQA 3D0RA 1TT7A 3MWLA 2AUNA 2RG1A 1KMNA 3SZ3A 4LYHA 1AQUA 1YNOA 1EBBA 2YDYA 2FP4A 3AEUA 3PGLA 4JEMA 2ZPAA 1TJNA 1DAHA 3ETLA 1YQQA 5ESRA 4YIHA 1JIXA 1K8XB 3S1AB 3UJBA 4ZZ1A 5LSAA 4UHBA 2PTHA 5JH7A 5JXWA 2BWJA 2EWWA 1SUFA 3PDIB 3PHCA 4R9RA 5DGTA 4B0PA 2ZROA 3R7AA 2YS7A 1X2EA 4U2BA 1A8QA 2HKIA 2OSVA 1N8TA 1WABA 5KYWB 1G41A 3ISVA 4BNDB 3K9QO 4BEJA 1CC1S 4MPRA 1U0OC 2DETA 3PC7A 1I2BA 5F12A 3RIMA 3RHSA 3OCWA 4AKIA 1W47A 1FNDA 1RKUA 1SB9A 2IOFK 1V16A 1K88A 2ZE6A 4KJXA 2W6JD 1JMKC 3BM5A 2JKVA 3CEPB 3QLUC 4LSGA 3WP1B 5KX5A 1Q95A 5F73A 3VHRA 1J90A 1NR1A 4RF2A 2G09A 1PBTA 5HBGA 4YQEA 3U3RA 1X1TA 4M9ZA 4WEOA 3F6YA 3OEWA 1SCKA 4U00A 1PJCA 4GGOA 1FRNA 4HRXA 4QBGB 1TU4A 2H00A 2HIAA 1FF9A 2P79A 1AB5A 3RV4A 1Q21A 2NV0A 1AVTA 2AUTA 3HCAA 3W7VA 2XJ4A 4YUYA 3OZFA 1FLAA 4LK2A 2XHZA 4NU0A 2PE5A 3G49A 4MKIA 2UDPA 1HEIA 2DHCA 1J99A 2X7XA 3R5KA 2E89A 4ND2A 3I58A 4D9MA 3IPRA 2WAOA 2JAXA 2A1UB 4QUKA 3HV2A 1XQ6A 2QTNA 4S1VA 4WA8A 3ZV4A 4AKSA 4QU9A 4U6QA 5EJ7A 3PPIA 4B6FA 4OXKA 1FCJA 1JHOA 3DEAA 4BX2A 4D0LB 1GJRA 1KO1A 4Q37A 4E33A 1F9AA 2WUWE 2D1FA 4WPGA 1MABA 5E9AA 2GN4A 3DE0X 3HCBA 4FSXA 1OVGA 3WLIA 3RUAA 3U4IA 4DR4B 2QG6A 2Q2NA 3FZQA 4QUDA 2GILA 4D82A 2XGGA 3O73A 3ZV7A 3P9NA 4GVPA 3HYSA 4BCCA 3Q3HA 4UCXA 2ZB3A 3H1AA 1JBKA 2Q07A 2Q4EA 2AD5A 4II3A 2KYRA 2V7EA 3IC5A 3FLAA 3K9WA 4O2BB 2OQ2A 1STOA 4XX1A 5DPMA 2W2OA 3AV3A 3RUCA 3UXHA 2Q5OA 4Q9LA 2V54A 3GK3A 3LVFO 3DDZX 4H59A 5AQEA 4JL8A 5ALOA 1H2YA 3TNYA 5IRCD 1CUVA 2W8BA 2IQIA 1CS0A 3AHEA 1XRLA 3KE8A 2P9CA 3PXUA 1BHO1 5F2EA 4LX0A 3TQOA 4ZCQA 3WAJA 1PD1A 4PGFA 3UBMA 1Q91A 1L5RA 2HHAA 3UPDA 1OD6A 2B83A 3N8DA 3QMMA 3NDJA 2W2TA 1WBDA 4FR0A 3HDVA 4IFIA 4Q93A 4XSGA 3WGUA 1LSJA 4RWEA 3W9YA 2VP6A 3V1LA 3E3OA 3FMOB 2ODNA 1XJ0A 3W7AA 4ER7A 4RZ3A 1MXHA 2OMKA 1ZGHA 3FZNA 2GPBA 4RZUA 3RIHA 4XX0A 5G1PA 1MGOA 3MTIA 1GGVA 4E31A 1XQWA 4OP3A 1I01A 4IEIA 2QUIA 2X4DA 1L7OA 1XZIA 4EARA 3CZAA 1JHXA 2ZLBA 3OUTA 3Q9SA 4WTOA 3T35A 3HS3A 4IMIB 4OQ4A 1ATIA 3EXIB 3M5CA 4RADA 4OFWA 4BBJA 4EVSA 2NSJA 3ZZ0A 3KZ1E 4TTQA 3T6KA 1U31A 4XFJA 5DNVA 2HEGA 5I3CA 1JSLA 1N3IA 1YKSA 4FBLA 1BFKA 2PNFA 3DNMA 2JZCA 5JMPA 3HDYA 3SAJA 5K6RA 2DQYA 4ZHQF 1ITZA 2QJOA 1PNQA 3E22A 2EARA 3MQFA 2OQIA 3HYRA 5IAGA 2P9JA 3D7SA 4NONA 1G8SA 2VHZA 5A1JA 4AKGA 1QH9A 3EMBA 4GI2A 1PJSA 3ZQJA 5B7QA 3DEFA 3SXPA 3TPZA 4RQTA 1O8CA 1OJ7A 1UMCB 2QYHA 1U4SA 3NP7A 3KSDO 4MKHA 3GPLA 1HQCA 2XBLA 2XMQA 1V11B 3C3WA 5A9SA 1K86A 1WOMA 2DP4E 1W5SA 1IATA 4Q05A 1KR5A 2B3DA 3MS7A 1C3VA 1VC2A 4H2DA 1KAGA 2D0IA 1UJCA 3FGOA 4G5XA 4GOJA 1A69A 4OEHA 3BRCA 1LF0A 1Y3HA 5ARCA 2V55B 3N2EA 5HM6A 3SHVA 1QQ6A 2XYHA 3GT3A 4XIGS 4YVFA 5F51A 4EZIA 4YJFA 3FVTA 4IUBS 4M8LA 3C8UA 4G0YA 4G5FA 4O4JF 1PEYA 1VB3A 2J3MA 2ZDQA 3A31A 3C6XA 5K8CA 2PUAA 4IIHA 5G3YA 4RBNA 3L8HA 4AROA 1NHWA 2QG4A 3K5PA 4J0EA 4PRKA 4BYMA 2Y92A 3M89A 1J0CA 3PL1A 5EXXA 3ZLTA 2VK2A 3CUKA 3I9JA 3VR5A 2DR2A 4IIJA 2F1HA 2OCIA 2ZPTX 3I5AA 3WYAA 3ZZNA 4CLRA 1W85A 2VWGA 4DR7B 1YVRA 2XMBA 3ZZ1A 1Q14A 4FBMA 3FGNA 4MIYA 4US1R 4C1NA 3QX9A 4M9QA 4ZVMA 1E3IA 3OJ0A 5B5SA 3T4UA 1MC5A 2B8NA 5AJZA 2XWBF 1PGQA 4Q1FA 2VAPA 1A2KC 3EVGA 4A8JA 2QPAA 5GONB 1VL6A 1E89A 3B9QA 3O2SB 1MNAA 2Q7OE 2ZCVA 4KR7A 3R9KA 1LNZA 3Q12A 3DZJA 1E77A 2BFAA 5ARBA 1JZQA 4ARUA 1Z12A 2HA0A 3VMFA 2BFCB 4B2YA 1XDGA 3SDZA 3QZUA 2ZYGA 4O59O 2FVXA 4LDQA 3RIYA 2XE8A 1DB3A 3K8YA 1W44A 4NR0A 1HRDA 1JT9A 3HWX1 4JJKA 4U0JA 2C7VA 4QREA 2F4VB 3ZHZA 5KWIA 4HBZA 2CDNA 4EHDA 1GQRA 3JZFA 2IYAA 3PF8A 4WBNB 2W6ZA 4NOKA 4PCVA 3FNHA 1TAHA 2R8PA 2QI9C 5C4IA 2R7LA 3H65A 3P52A 3P0EA 3DEHA 4MHTA 2GFHA 2NYUA 1NFFA 1QIJA 3RGGA 2ZYDA 5BMVA 3ANMA 1DKMA 1KEZA 5JJBA 3R7LA 4R1SA 2VJMA 3N6VA 1HLGA 3CX4A 2QT9A 2VNKA 3FI9A 1NG9A 1CVIA 3PCRB 1UCFA 3RB8A 3FOZA 2QDXA 5LQAA 1AKWA 1XZLA 4ARIA 2AJDA 5AW9A 4ERNA 2PZAA 1J70A 2VNHA 1WSDA 1LLQA 5DW3A 4MYRA 5A71A 3T1VA 4BKPA 4C0LA 3AVXA 3WFJA 4D3SA 3Q7TA 4KBGA 4IMPA 2FU5C 5E38A 1GFZA 4AJ1A 1G7TA 1L7EA 1SVLA 3T95A 1FMCA 2IP1A 3CRNA 1XLTC 4WXMA 5H02A 5JG7A 1HX7A 3GGPA 3NOOA 3ORHA 4RKQA 3CCCA 2NU7B 1WTCA 3C5CA 1TU3A 1HE3A 3FJOA 3GA0A 3DYVA 3PQ3A 4ILEA 1DT3A 4QFCA 1O89A 1CD5A 1ZI9A 2XXJA 3UBTA 4RTOA 3WYDA 4BWYA 4L1KA 3PQ8A 5FOXA 4TLDA 4U7GA 3F7MA 1W1IA 1BDJA 3DV0B 4QD3A 5AW4A 3WGJA 5K2OA 5JWHA 5C5EA 2GN6A 1GTJ1 4G9EA 1N7JA 4MVJD 2PQMA 2WHEA 4TYPA 5EWLA 1TEHA 4Z4CA 4DDVA 3VZDA 3EGOA 3ZK9A 3N7UA 1XK7A 1NQXA 1NVKA 3L0IB 3PD7A 4F0JA 2GAOA 4CMKA 4C22A 3MCVA 4AF8A 4Q01A 5LMZA 2D3TA 4WOJA 3N2GA 2O2CA 1CS4C 2J7PD 3V4ZA 1EA5A 1VYVA 4WHMA 5IAOA 3VHXB 1ZCBA 2B78A 3C5WP 3LUKA 2ZWOA 7ADHA 4LUCA 4NU8X 2IEZA 3FLMA 1T2CA 1TPYA 2JIBA 2QRQA 4IOMA 1A98A 5F7ZA 2Y4NA 4D9BA 2Y0BA 4R2XA 1ZNZA 3AUKA 4JLKA 4BY9E 3PK0A 3GDWA 5H70A 3HADA 4Z1MA 1ISRA 5LKAA 3U61B 1W36D 2OAP1 1QF9A 4JI0B 4RENA 3Q3EA 2PRKA 2YCBA 3EF1A 2VZ9A 4NJMA 4CNBA 1I3KA 2AFVA 1C81A 4HNQA 1OLOA 4LRTB 4HVLA 1FUUA 1FFBA 4KOAA 2PH7A 4GL2A 2I34A 5HR5A 1YNSA 3EFHA 4EW6A 3U26A 3P9IA 4YRJA 2H29A 1GRNA 1PVDA 4HI0E 4Q1VA 3PYMA 4DQLA 1CY6A 3OIGA 2Z1MA 2L18A 1K5PA 1L5VA 3D6FA 3NAGA 3SR0A 1TYZA 2FDCA 1T2UA 1TL7C 4NEQA 5B2FA 1OXMA 2H2AA 2NZ2A 3G2NA 1T9ZA 5E4YA 1UC5B 3PCXA 1NYTA 1EXMA 4G0MA 1QQAA 1SQ5A 1IZYA 1HT2E 1LWOA 4YPFA 1C29B 1NTOA 4CMCA 4LMPA 3PGMA 4CDRA 2V4MA 4Y0NA 4E5VA 5J5VA 1ODJA 3A6DA 2OGTA 3TSCA 2C4TA 5JW6A 3JZAA 4XRRA 2JVIA 3IHKA 1WM1A 1W75A 2D7CA 5C8YA 5CFOA 8ABPA 2WWHA 3R3XA 4JOQA 4KZKA 4UM9D 4K9RA 1U2DC 1U0SY 4FCCA 1Q22A 1WA5A 1XTBA 1RI1A 3RDPA 5JQGF 1A8SA 1P19A 3EF0A 3QKRA 4MRMA 4YV1A 2QUJA 4YJ2B 5FD8A 2YVQA 3CLTC 4KHZA 3OH8A 3QPBA 1TEXA 4EA7A 1JSCA 2OCGA 4OP2A 4RSRA 3VSBA 2PIAA 2PRYA 4RYLA 2FEOA 1IG0A 1QLWA 3AILA 3HFJA 3KLNA 3PXBA 2YYSA 3OESA 4OYHA 5AKGA 3KQWA 5GAJA 1OMOA 1TU0A 2I2XB 3B2QA 4D0GA 3N39C 3M6VA 1RPTA 1WHTB 3PTZA 3Q9LA 4O0LA 2PS0A 2P9EA 3L7KA 3V4LA 4FYYA 2ZIEA 1CZUA 3G2MA 5LUBA 2JFOA 4LI3X 4NFSA 4UD2A 1YC5A 3GP8A 1ZWLA 2RGWA 4YJ3A 1U65A 3UGTA 4N7BA 5IFLA 2QRJA 4C0HA 2IA5A 2RD2A 2W0MA 4RC9A 1EZ4A 1IH8A 1S3IA 4DSOA 1OXXK 1J0DA 3UJ7A 4OK6A 2L19A 3KYIB 2ZRCA 1F8GA 1FVHA 2DWPA 2ZDGA 4XPIB 4KJZA 1FDIA 4QGSA 3RC9A 2A9RA 4RTRA 2EFHB 2A9FA 1PGOA 4B43A 3ZXIA 4CIVA 3RG8A 1H4QA 4NZMA 3P9QA 3TF5A 2DSNA 3RSLA 3MBIA 4O2LA 3F5QA 1H6BA 1AMOA 2PUCA 4JI2B 2Q6KA 2CLOB 1Z0ZA 1RM3A 3ANYB 3G5LA 1P0MA 4G81A 2AWOA 3V4OA 4E2WA 2O7SA 2PWYA 5IM4F 5B7NA 2QKYA 3ORYA 4AKTA 2JNWA 1Z4PX 3TLXA 1WY7A 1Y3AA 3VVLA 4QFBA 3AVUA 4PQGA 1V3QE 2GAAA 3H8JA 4MQ5A 4TKVB 1HTBA 2PMDA 2V8OA 4ICIA 3A7DA 1UM9B 2XZOA 3Q1LA 4RCZA 2JGJA 3F8TA 4H1UA 5JEEA 4MR9B 1YCHA 1A9TA 3EY9A 3X43A 5E6SB 1JMVA 1P2UA 1E6WA 3MK31 5BUSA 1CF2O 1UT8A 1P18A 2GXUA 3SX2A 3ZE8A 4ZIRA 2G5GX 3PC6A 4L6IA 3PC4A 4CVNA 3OF3A 4NJEA 4O6VA 1V0JA 3LPLA 1TUIA 4BE9A 5TIIA 1YZFA 3CVUA 3VR2A 5ARDA 1CRPA 2IEIA 4YP7A 4R9VA 4L28A 1NXTA 3MZ0A 5HQ3A 3E2MA 1KMHA 4KVZA 5A5DA 5ANRB 2VP3A 1JSZA 2E4WA 1JSXA 2RBGA 3EK2A 5AI8A 5F7OA 1PTJA 3B13B 3UZUA 1U5BB 1DBPA 4V0OA 4RIGA 2PPLA 1UZLA 1WPRA 4O5AA 3JQ8B 3LZCA 2DWCA 2BF4A 1KIAA 4KV7A 4JDUA 4PPNA 1CDZA 4KDRA 4FWIB 1ZZGA 3CF4G 3ZGXA 3TQFA 5T8KA 4JKYA 3SIPA 4YRRA 4HS4A 2YYAA 5FNVF 5HNKA 1A9OA 2ZUFA 3E7WA 1SBQA 2IPMA 1TAGA 3E82A 1V4NA 1LY1A 3QELA 4IJKA 1E20A 2EIHA 2EKPA 1XEAA 1J1UA 3PC2A 5C53B 1RE0A 1R0CA 3BMCA 3OQJA 1MVNA 1M54A 4WNCA 1M2WA 2GZRA 3L8MA 3W8RA 3GGDA 2C7PA 2BSQA 2F3UA 3ZWKA 4ISBA 4IAOA 5JS1A 1R74A 3WNDA 1MJGA 3GLHB 4BFUA 4J0JA 1UFOA 2B25A 2NVUB 3WB9A 1Y5NA 2ON6A 4PYRA 1IVYA 4YRQA 4KR9A 3EQ7A 1BZYA 2ZJBA 2X6RA 1LBHA 3BXFA 3G0OA 1F38A 3KKMA 4KYIB 3HDQA 4B84A 4GLOA 4LWOA 1CEQA 3IMFA 3G2KA 4AP6A 1VFNA 1MW9X 3KYDB 3ILSA 3SGLA 4GE0A 1LFAA 4FI3F 1R15A 3VU0A 3UCXA 1EIZA 4FB4A 3ABQB 4QWWA 4E13A 1GZSA 1JDJA 1RVDA 3DTVB 5BNIA 4QYIA 4PWYA 1M6WA 4X3OA 2GFQA 4DGSA 3ZY3A 2YFKA 4U7DA 1KDOA 1DCFA 1U8EA 2VLIA 4F3YA 3P9XA 1IB6A 1K3UB 1GZUA 3SXJA 2Z3WA 1AT1A 1E1QD 3IHTA 2OZKA 1J9EA 1FMJA 4X1IB 1LJUA 1XZFA 5HWSA 1U28A 4TXHA 3KVOA 2XDQA 2RKWA 3UEOA 3NHWA 1QP7A 4GWGA 1II8A 4Q34A 3WDMA 5A05A 4B2IA 3VYUB 1HMPA 1CS0B 1PFVA 2QZ9A 1PNTA 3WBJA 4G25A 3W9UA 1M2VA 3AUSA 4C43A 1Z4QA 2CE2X 2UZ1A 3WLLA 3KOOA 4WE3A 5LQNA 3F6BX 3C39A 4Z3KA 3UQZA 4FFLA 2Q5HA 1XQYA 5K6AC 4U5XA 4E1AA 4GMXA 1Z82A 3D6HA 1ZITA 3EDCA 1RQNA 3EC1A 4O2BA 2ZVPX 4PRZA 2W4QA 4ZOEA 3TW0A 2GCNA 2DTEA 1X14A 5ENZA 1FS5A 2GEKA 4TZTA 1Z0AA 4C0AC 3CRW1 4RIIA 3WIBA 3OVMA 2OYRA 5HIAA 2FZWA 7MDHA 1ODKA 1U2PA 2WZQA 3WGNA 4ARVA 5ICSA 3ZR4B 2RJ3A 1CUSA 3E5MA 3QA3E 4F46A 4HSEA 2OA0A 3WWEA 2OCPA 3P9PA 3FM9A 3MSCA 3KQKA 2RDMA 3DDNA 3V4SA 4GE3A 3CR8A 3OLCX 2PXAA 3Q3JB 2HUPA 3ZHXA 1TVKB 4MS3B 1X2BA 3OU6A 1UBRS 1YR6A 2Q6TA 4A4DA 5TGTA 5AOVA 3KPJA 3UICA 2IOYA 2LDXA 3GEIA 3LI2A 4ZODA 2ZJYA 1LRLA 2GK6A 5FJJA 4BNGA 3PC3A 3LECA 5L95A 3OX2A 4RHYA 1IN1A 3ZDYB 3IVXA 3RUFA 3Q7SA 3VOTA 4YXFA 1PW5A 3BKXA 3FWKA 2P30A 4YALA 2DPYA 3C7CB 3HJUA 4RD3A 5CXUA 2PKQP 1N3YA 5JLJA 1EX1A 3EDMA 1OE0A 5AHWA 1RQ7A 2P78A 4M0MA 3M6FA 3RC8A 1OYOA 2N1MA 2G1UA 3BFXA 4HAZA 4BLSA 3HR8A 2R84A 3O1LA 3DR5A 3IUYA 3AL3A 3ROQA 4DBLC 4XM2A 5HMMA 2O0KA 3DVQX 4G1VA 3WL4A 5ALUA 4UFOA 1SXHA 4M7WA 4DWJA 2O1WA 3GW8A 4DQUA 4UMDA 4TT3A 5LOVF 4EFMA 4YB8A 1EZ1A 5UKDA 2IEDA 5C32A 1X7GA 2DFDA 4NMMA 3VTAA 2BJVA 3OZAA 5HUQA 3T1TA 1U3TA 2WIDA 4INOA 4F5YA 1TECE 1DFHA 3QOXA 2IF2A 4ARZA 1Y82A 3FAKA 3LX5A 4G4JA 4ZT4A 4QQFA 4ER0A 4MDFA 3PXXA 1OWPA 3QXCA 1R12A 2X8JA 2XDYA 5JDIA 3ND6A 3QITA 1PZMA 2QL6A 3M4XA 3CLTD 1W59A 3GJTA 3MT8A 4IH1A 4Y0AA 3GZNB 1IM8A 2NG1A 1E0KA 1CUJA 1Z83A 3NC0C 4M1EA 2Q7DA 1WXHA 2HA6A 3LL4A 2O0HA 2GBCA 3IUSA 3N2IA 3BE5A 4QFMA 1DT5A 4QU5A 4QG7A 5JDCC 4E2FA 3IURA 5KTMA 3Q1KA 2QS9A 4YI5A 5IPFA 5IJ9A 1KEVA 3LZ6A 2E3JA 1P2DA 2RAUA 3FN4A 4LHYA 3U9TA 4W82A 5FTKA 2OG2A 4UMFA 2G1KA 4EYQA 5DASA 2NM0A 1Q50A 3TUIC 2C31A 4S1TA 3EOZA 3MPUA 3QFHA 3UJPA 5KUTA 1T2NA 3BMQA 4EB3A 3QEOA 5HQJA 4MQFA 2Q28A 4Y2SA 4K9KA 4DCCA 3SLKA 1YA6A 2AKEA 4IHQA 2MR6A 1EESA 2R8RA 5BN4A 2FPSA 2XMPA 3G0IA 2X8AA 3L8YA 4FQ5A 4M88A 1ND5A 4Z9BA 4G09A 1U0BB 1Z5OA 4IVNA 3QWAA 2FR1A 1ZRHA 4TMZA 5CTAA 3MYYA 3UMMA 1L8OA 2G17A 3KTAB 1F0YA 1NVBA 2PX6A 4XYLA 2OQRA 3NTRA 5I7UA 4IDBA 1AS3A 3A11A 3COVA 5DYYA 4N0PA 3FVRA 1HL3A 2GRJA 2F8LA 2H9AA 2GZHA 2R7KA 4OB6A 5CVVA 5LA6B 1Z18A 5F78A 4DT1A 2FFRA 1NDQA 2CMDA 1DC5A 5T4HA 4RXTA 2BBWA 4EFLA 3MTQA 5DN9A 3IUQA 2EZ8A 2E1PA 2ODQA 2V7VA 4P4TA 4PTYA 1QTNA 3IAUA 1SHLA 2X8WA 4D74A 3MB8A 2GNAA 5AD1A 3F9CA 4CV2A 3I12A 5E7IA 2OKGA 4JLSA 1DC4A 3PZBA 1L4GA 2BPOA 2E18A 3HWSA 3LYHA 4L2IB 2O0JA 1W0KA 4N0EA 9GPBA 3MWDA 2YL2A 3X1XA 3I0NA 4K81B 2YN0A 3MT7A 1ND6A 3KKPA 3L4SO 3SF0A 3QVLA 1IUKA 1LQTA 4XVHA 4LHSA 2H3EA 3AP1A 1I0IA 4BZZA 1XXHE 4C7OA 4UM9B 4AXBA 4ENPA 1GCUA 5L3QA 1G18A 1LI7A 2BBSA 3CO5A 3S4YA 2AOTA 2VFAA 4BAGA 4A2CA 2GPYA 2GPTA 3W06A 1V5EA 1MQAA 1ECGA 3P7MA 1NM5A 3HB4X 4KIJA 4N82A 3N76A 4QXMA 5C31A 5SV2A 2BP7B 3IIJA 2QSUA 2NYRA 1CJSA 2P67A 2Z83A 3E9MA 4HAYA 1C8BA 2W2KA 1DTSA 2DERA 2B0JA 5HFJA 5CA1A 3ZDAA 1L7RA 4NATA 1B15A 1N2BA 5A7GA 3URMA 4KO4S 5F7XA 3ZI4A 4W8GA 1WBBA 5CEFA 4QDUA 3SE7A 3V8VA 1PNOA 1KEEB 2WNHA 5DSZA 1NSTA 5F4BA 1EDZA 1TLLA 2VDJA 5EY5B 4GMKA 4H0CA 1MZVA 2WQ6A 2QV0A 2E9SA 2HOQA 1F4PA 3DBOB 3IQWA 1XZCA 3EIEA 1PWZA 1QYIA 5AKZA 3MAAC 5IW8A 3NGXA 2J31A 4ZU1X 2FSFA 1GQ2A 4L5BA 5CCDA 4C01A 4FU0A 2FH5B 1R16A 1W48A 4B6EA 1UKZA 4HFJA 4ZVRA 4DILA 3RBXA 2DBRA 2OBLA 1FOEB 4HQ0A 4OF4A 4Y2GA 4BFLA 1JFVA 3EW9A 2JFBA 3AVVA 2O05A 3MWJA 4NKRA 4JVOA 1Z7WA 2D8MA 2YASA 3Q7QA 2PSSA 4LC1A 1OYYA 1AKYA 4M4SA 4TTJA 3TI9A 4YP1A 1CY4A 1Q83A 1NXPA 4DVJA 1ST2A 4BVEA 2CL5A 1N2SA 2FEWB 1LTQA 2OL4A 4QAJA 4XJXA 4LVCA 3STXA 1EHIA 2QAJA 2PIDA 1DIHA 1OY1A 3AETA 3DE6X 3O9MA 5FUXA 3P26A 5DI3A 3LQFA 2R0QC 4BGDA 1Q0QA 1I5RA 3L0ZA 3I5YA 4Q00A 1RRGA 3R3UA 1WMBA 2Q21A 4J75A 3KBBA 1AHIA 4UEJA 1WPGA 1KE2A 5BWNA 1R6BX 2JW5A 3QU7A 4V0MA 4BXOB 2IYSA 1JILA 3B5IA 2FMTA 4LG1A 1O1YA 1SCUA 3N9IA 1ZD3A 2D0OB 1VLVA 2XE7A 3ZY2A 1AK9A 1O4VA 3KT3A 5AKKA 5GV8A 5IWAB 1GPDG 3T1HB 1WUTA 3JVUA 4V03A 3JQQA 4B7AA 4YCDA 3RPEA 4HC4A 4LA4A 2GAFA 3H0EA 3VAYA 3OCXA 1FJ2A 1JSRA 2GPSA 4RKRA 3PNQA 5EIBD 3PEYA 3L0SA 5FWYA 4BV2A 2VSNA 3NVDA 3PFCA 1NX6A 3EGDA 3GBVA 3LLUA 1R9GA 1UKEA 1SPXA 1X13A 2JI9A 2QR2A 3AR3A 1NP7A 4NCHA 4NENB 1UXIA 4ZVQA 5ADWA 3OO0A 3ZHTA 1B0UA 2AN4A 1QC5A 4KR3A 3G2QA 4PPGA 5KI6A 4A03A 3T5PA 4QM7A 1Q0PA 2GBLA 4P4SB 4KRFA 1M6VB 2YHUA 4QL3A 5JALA 3NMUF 4GMFA 4E88A 1JQBA 2OM2A 3EEBA 3H5RA 1JI3A 1FJXA 2QMZA 3RKUA 2VCYA 1ST3A 1ICEA 1EQAA 3KEFA 4JJ8A 2RIPA 4QUGA 1X42A 1GHTA 3NTXA 2KLHA 3O8OA 3AFNA 2OHFA 1DCTA 4G0VA 4O1MA 5KWEA 1B8PA 1V1MB 3RYCA 1K3FA 3CMCO 4YT4A 5J4KA 3LA6A 1YI8A 3EWAA 1FA9A 4H3HB 4R7ZA 1CR2A 1KI9A 2CDAA 2M2IA 4OBWA 1NU6A 4P0QB 2C0QA 4Q7MB 4DG8A 2CDRA 1TFUA 3I9KA 3R7DA 2EU8A 1M73E 5FL3A 3AHHA 4IWXA 2QWXA 4O8ZA 1I5OA 3SFTA 4YXWD 3H7AA 2V98A 1OQAA 2JLQA 3AZPA 3X44A 4DLLA 1A82A 2G36A 1TGVA 1XRJA 2HJSA 5JZ9A 1E7QA 2MHCA 1HURA 3QEAZ 2K5UA 2JLWA 1BS9A 4NTZA 5LYJB 3U0VA 4ACBA 1ZUWA 3BTSA 2QLTA 4XVCA 3OQIB 1E58A 5TQ2B 3VX4A 2CF6A 2UV8A 3O3CA 3TKAA 4HDCA 5AM3A 3L82B 3HEAA 3MC1A 4CN9A 2B92A 3QUBA 2C5HA 3DUFA 2PK3A 1UQTA 5LUAA 1FP4A 2P1RA 1Z2EA 1CUYA 4MCAA 1Q2UA 2Z5VA 3C0KA 1XZDA 2HRZA 3ZWPA 1J49A 4P7FA 4M1YA 2GCGA 2WD7A 3E2IA 3QTTA 1Q1ZA 1YSCA 1RLOA 3EG9A 1B0PA 2XECA 3DULA 1YS6A 5AJXA 1YFJA 1JZTA 1GADO 1OIWA 1TQ2A 4DXDA 1PGNA 2WOJA 2D2XA 2VZLA 3ZGYA 3QU5A 4QO7A 3HJCA 1H2EA 4D8WA 4NZOA 1R7RA 1T9HA 2OV6A 3KZCA 4FFMA 3MGKA 4YI3A 2PYDA 4AY4A 2YTZA 4BZWA 2RHCA 1QGUB 4RD6A 3HYTA 3SG0A 2LTAA 1UZNA 3PHLA 2ZKIA 3MJFA 5KJ6A 2EBFX 1VLJA 1E7MA 1JHAA 2QM8A 2XA9A 4RY9A 3H2IA 2ZZNA 3IALA 4H6VA 4WK2B 1N5KA 4IVQA 3A26A 4DCUA 3WQRA 4N5HX 1UDRA 3D2CA 4OKNA 4DC0A 3RADC 2ZTUA 2ZUUA 3KKLA 4D96A 2VYVA 3S2YA 1U98A 5IASA 3DOFA 5IN5A 1YCDA 4Z0NA 1GCAA 3GLFB 1IHDA 3NC1C 4J90A 2IBTA 4B44A 5BW4A 2F17A 1FUIA 4HH3C 3LHDA 4HYEA 3I4CA 3VSAA 2H1IA 3LRTA 3VBCA 1USUA 3M5PA 4PINA 4KPUB 1NJFA 4ZA2A 4UEOA 3REOA 3RWOA 3IFSA 3WA6A 3IEUA 3BORA 4GRAA 2WKWA 4MVJI 1ECPA 1JHYA 3L5KA 5JAQA 3G79A 4E22A 5KEIA 3M6XA 3A70A 3OJFA 1SC9A 3QUAA 1R66A 4INAA 3YASA 4YAIA 5BVGB 5F2OA 1H6CA 4A6XA 2X2FA 3R3SA 3CXUA 3G9QA 2QVBA 3GLIA 2B2NA 2OXIA 1NNEA 2ECFA 2ZI4A 3ETCA 1I1HA 3NTVA 1OFHA 5D00A 1C30A 1ULTA 2IU3A 3OTWA 4QNNA 2OP1A 4IXNA 5JCPA 5J23A 4DNQA 4MJ3A 5FUMA 3C24A 1RPNA 4PQYA 4Q4JB 3H2JA 3KZNA 3WQSB 1GT6A 2V03A 2JHCA 3HQ4O 2HJHA 3C5HA 3OD1A 4V0ME 2VP5A 4URYR 5HIKA 5G0SA 4WW0A 3PSAA 3PA8A 3GNTA 3ZEAA 1KOFA 1CY2A 1S9HA 4EJSA 1JTEA 1EVLA 1YVEI 3D3JA 5CIWA 1NFQA 2C2YA 4ANFA 4E15A 1VXRA 1T1EA 2VF2A 4Q12A 1IWPB 3RYHA 2DOKA 2EP5A 1N1GA 2VDVE 4CKCB 1DXYA 3MRXA 1XZAA 2IYWA 4NDAA 5AXDA 1D5WA 4LK3A 5ECWA 2X41A 4O4LB 1AUQA 2Y9MB 1S1CA 4FD3A 2GWHA 5G0WA 1A9SA 2J0EA 1QAOA 3TUZC 3HUUA 2HCBA 3I2JA 3G0HA 2WLSA 5EIBC 4ZQHA 3I6IA 5BW5A 3NBZC 4KBFA 5CAEB 1KOLA 4DV4B 4UBOA 2H17A 1KI6B 1UBHS 3EIWA 4GX1A 1ESNA 2NGRA 4YO7A 4NXMB 4QOGA 4M7PA 3NDRA 4GYJA 2XQKA 4E4YA 4G1CA 1Q11A 3MJHA 4IIVA 3NS7A 3SE0A 1UMDA 4P92A 1H0SA 3GFOA 4FFVA 4DRXA 2A0YA 3UWOA 1LX7A 2B7BA 2W6JA 1IK6A 3EAQA 5BYBA 4AZ3B 4EEKA 1BVRA 3PVCA 3DTTA 1I7QB 2VYVD 2P9HA 1CEXA 2OHJA 4CIYA 3GRCA 2ZYSA 5T57A 5JD4A 4M98A 4DV6B 4OI2A 3H16A 2AZ4A 2CNWA 5AKLA 2YHIB 1G21B 3PKZA 2R97A 1NBEA 3NTQA 1GTSA 4WZBA 4E7PA 4LXUA 1CT9A 2J9FA 4PS1A 4CLEA 2VSFA 3E8XA 3JWEA 1WKVA 4D45A 4FGKA 3WDKA 1T43A 1TA9A 1I6KA 1XTVA 4G8JA 4IIUA 4N1AA 5IAEA 1GR0A 2NPFA 5KMGB 4OI0A 4PYJA 2H52A 3FAZA 5BNFA 4UDXX 2CV1A 1E7RA 3L6DA 3RFVA 1JZSA 3D64A 4XIFA 2BMVA 4YT8A 5EL0A 1C7IA 2O3QA 4Z3OA 2ZIGA 3ACDA 3L4EA 4M89A 1SXJD 2Z4TA 1NBMA 3V2UA 2HJRA 2WP8J 2F55A 1FX0A 5IT5A 2VPYA 3SBOA 1GPH1 1ZGJA 2PZLA 1MOSA 4OMDA 1QV9A 2HPZA 1JF8A 3KKEA 3RS4A 2J6CA 1QOQB 4A2PA 4W5OA 3M6AA 3VPDA 4AWBA 1VHTA 2ZBUA 1OH6A 5INTA 1J24A 3QX7A 4J4BA 2XQJA 3T7AA 5AM2A 2IBMA 1TKCA 1L4BA 5LXTB 1WW3A 4E4RA 1MIOA 4KH0A 1S9DA 3QNMA 2G1JA 3K53A 2A5YB 1G8FA 3NORA 1ZFNA 3EF3A 2ZR9A 5KNDH 1SD2A 4MDHA 5ALHA 3TIVA 3K0HA 3G2LA 3W5UA 3IEIA 4RVNA 3OECA 5D7BA 1FXWA 4EOGA 2D2FA 1VKNA 1R00A 2PX5A 2GDZA 1D2CA 4LMBA 1FPMA 2WU8A 4GF5A 3TD6A 5KVAA 4D6XA 5DWDA 2GN2A 2QXTA 1NVUQ 3HL0A 4C4RA 1I6MA 2JK1A 5DNEA 3PNVA 1RC0A 2W6OA 4OHMA 1E96A 5DCYA 5EIFA 5J3JA 3U7QB 4HWOA 3OZBA 4AIIA 1DWQA 5A4FS 3I01M 3T7RA 3H75A 1IOLA 4DV1B 3GBPA 4FPXA 4DXHA 3CF2A 4HDOB 1FEZA 2B1QA 1E8DA 2XA2A 3IILA 1B76A 4JT9A 4MDYA 5E4TA 3W2FA 4BO2A 4DCMA 6CHYA 2ZUWA 1T8RA 1ULUA 2JJMA 1NVTA 4D79A 3EOBI 5K4AA 4YWHA 3TW4A 3WFZA 3PPXA 1YA8A 3IVGA 3QVXA 4EW1A 1JG4A 3NH6A 4BAZA 4KIWA 3VO8A 4MVJF 3V1YA 5JI3E 4JYPA 4GPIB 2RGYA 4C0QC 3W5AA 1GXSA 1UDWA 3FDZB 2HNAA 2OGUA 3IOMA 4I6JA 1PG5A 1OHHD 621PA 3SKVA 1R4NB 2JJQA 2ZRLA 2J9GA 1WDKA 5JAIA 2SICE 5EQTA 1ZBQA 2X15A 4QOEA 3NHSA 4BC1A 2BBOA 4KC0A 2VAMA 4MULA 1HK7A 3KL4A 5AI6A 4KWIA 3UV3A 2EFGA 2GPNA 4LV6A 2ONKA 1UPBA 1I7PA 2JB9A 3GJ5A 1G16A 1GPUA 1E69A 3ETGA 4OYRA 2CVZA 3A4YA 1OZHA 2WD9A 4JCOA 3NUGA 4X1KB 1N5IA 1PJ3A 4X63A 1ZA1A 3AF3A 4HMPA 3ZHYA 1CRZA 2YWHA 3KVRA 2IX3A 1U9IC 4LXHA 2XMRA 3T7EA 1CBUA 1T5SA 1YMVA 3A1EA 3NO4A 3NOXA 4D4KA 4CR7A 3W8NA 4TLBA 4Y7DA 5FTJA 2CE7A 3VYSB 3H5TA 2BUCA 3ONNA 1KP2A 1K7FB 2QHXA 3DTNA 3MELA 4J3FA 4GO1A 2YHSA 3KQHA 4URZR 2GSDA 1LC0A 3B82A 4I2VA 5JWRA 4K7JA 1ZAYA 2VJNA 1BVYF 3WHLA 1ZCJA 2HUNA 5CG1A 1OXKB 1SBZA 1SQ0A 3IKLA 4HGNA 3VVCA 1FDSA 1Q7CA 4KRGA 4Y6GB 2NPIA 3M6MD 3S2UA 4D26A 2RI0A 1BRTA 4FDAA 3SS9X 2EIXA 3EH2A 3FYDA 4F6RB 1L5KA 2QK4A 4MQUA 2ZXUA 5A0VA 1VYUA 3TQTA 3AF2A 3OUZA 2X2EA 4B3GA 1R6DA 3DBHA 3GFRA 3WHIA 1DJQA 3KVYA 5BYJA 4UXJA 3H99A 1DBSA 3A9VA 6REQB 1N32B 3RSQA 2A6PA 1QX3A 5B3KA 5JYDA 4DNPA 3IA7A 3AF6A 1L2TA 1WS6A 3DO8A 3VRHA 4QLOA 2DT8A 1B2RA 2QVLA 2WV9A 5DGHA 1EX9A 2J5KA 1X7XA 1QPGA 4KTVE 5FA6A 4TOIA 3L40A 5FULA 3OLQA 4BC0A 3I3OA 3F6EX 1DBVO 5DYIA 4K6FA 2ZB8A 4AYXA 2BV3A 3QF4B 2VLBA 1E2HA 3VV3A 5FJIA 1EA7A 4N4AA 5I47A 4UHJA 1IYZA 1TRKA 3LD9A 1D7AA 1CSEE 4MPPA 1K0FA 4G5OA 5B37A 1L5LA 3SHQA 5B7GA 3CX7A 3H2GA 3PFKA 3KD2A 4XFKA 3JZDA 4TTSA 4AZTA 1MJGM 5AKIA 4K05A 4R1QA 1S8AA 1KGSA 4E5UA 1GZ4A 3P8ZA 5JH7B 2XLCA 1UEXC 4PZYA 4UDOA 1XTUA 4OY3A 1GNVA 1W34A 2EXXA 4D9KA 3CFYA 1L5WA 2O8EA 2FWRA 1A7KA 1UP4A 2PT7A 2ZP1A 2A78A 4KQFA 4ZREA 3EDRA 4AS1A 5EJ8A 3QG1A 3D7KA 4RQBA 2BEWA 3GVXA 2QSYA 1U0HC 3EMVA 2JIRA 1LVGA 1S7GA 3OM9A 3ZBPA 4PVDA 4AYWA 3B6ZA 5E9WA 3DZBA 5LM3A 1CLEA 2HL6A 1D2AA 2J09A 2RARA 1JTFA 1ECCA 3BA6A 3TB6A 2DH5A 1H1LB 5JYBA 1MGPA 1VZ2A 1JWAB 4Z86A 2H2WA 4ND7A 2GRAA 2PYZA 3PRYA 3SYKA 2V59A 1RMQA 4HL6A 2FDXA 3CH7A 3GT4A 3OE4A 2N3ZA 2FWAA 4M7OA 2ZE8A 4V02A 1E6MA 4ZRNA 3ITDA 2AIRA 4EFNA 2KLBA 1UWVA 1JIJA 1NGSA 4EL0A 1AGYA 4HNGA 5CHEA 1U7DA 2WSSD 4MUBA 1V48A 4JMLA 5JAHA 1ECLA 1Z9BA 2Y6VA 2CMFA 2O1EA 4YAEA 5EERA 1JNYA 3O8RA 3DP9A 3KHKA 3AG5A 3M4NA 1PV4A 1MFPA 5DHPA 5LPNA 4HNSA 1S96A 5DHTA 2LGJA 3TSWA 1T36B 3ENKA 4ZGBA 2CHUA 2H7VA 4DJAA 4ENSA 2XXAA 6PFKA 3UJ3X 3WDSA 4IGIA 2PUDA 1JUDA 3IH5A 2KWIA 3R0QA 4RLQA 5F4ZA 4RUKA 4DLKA 4MIKA 1LSOA 1NMSA 1QCCA 4L6CA 3IT2A 5D7NA 4IV0A 1UJ5A 5I9MA 4OXRA 3I9MA 2AK2A 2CVQA 1PX0A 2UVPB 3ML1A 4RTMA 3KVNA 1CHDA 1HG1A 1VJGA 1RJGA 2IDKA 2ZAGA 3DFMA 4NPHA 4MRNA 5KKAA 4I5IA 1DP4A 1XCGB 2RK6A 3DOUA 1RMTA 2QRVB 4HDKB 3IIMA 1P6UA 1CDDA 2IYXA 5JQGB 3S1SA 5IT0A 3H1FA 1YB2A 2AG5A 2P3QA 4G65A 2OLEA 4EPXA 1MQ9A 2VBGA 5EVJA 3DBRA 4UZEA 4GGMX 1KI2A 5ADUS 5IVHA 2CLIB 1GEEA 5BWLA 3ET5A 4GRDA 3TVYA 4Z7OB 2N47A 1A5TA 1D04A 2ECKA 4I66A 3X1WA 3TH5A 5KWJA 2F6RA 3FPJA 1I8TA 2MINB 1S4QA 5JAZA 1NSYA 3HVHA 3ZBUA 4X3PA 4DA6A 1ZNWA 3DKKA 2HD4A 5KSOA 3DBVO 3GOHA 1G3QA 3NWBA 4A27A 3LY5A 4HQKA 4I5DA 3AOGA 3KAJA 1DELA 4B6OA 2GVDC 3KE9A 1TZMA 2WU4A 2AG1A 3LVBA 2Q9UA 4S2EA 3D4IA 2W90A 4PX2A 5D86A 4ZXFA 4HGZA 1UJBA 3K1JA 3WJ2A 1BYUA 2CVOA 3PVSA 5GOZA 3U7HB 3B5JA 3OIVA 1MDFA 3UB3A 2HF7A 2PHZA 4MA4A 5JNUA 2PMCA 3RAJA 4CKEB 2HWYA 2WA1A 2H4XA 4GOOD 1Y0BA 2ZSIA 2P77A 2R5WA 4NARA 5LYYA 5JSFA 5KSWB 4P35A 2PGOA 4HX5A 2FZLA 5FUWA 3CU5A 1OILA 2H18A 1EUCB 4KWEA 4MS4A 1BEEA 3CLUC 4MAAA 4E5YA 2UUBB 1G66A 1PR9A 1OC2A 3R23A 3JXEA 2HMWA 3TLBA 4DHWA 3UHJA 4QULA 3WOVA 1EXWA 4MRVA 4EPRA 5BSVA 1JLLB 3TZBA 1PZGA 4NBVA 3VDQA 3AV0B 1CUGA 1VJRA 2E85A 3PICA 4RD2A 4ASUD 2PGAA 1CIJA 5EXPA 3A3KA 2HRRA 1T3SA 3VDXA 1RAFA 3Q3VA 1Y1LA 5DCUA 5FI0B 3GIWA 4PLYA 5IDYA 3L4BC 2PKRA 1ORDA 3KETA 2E2WA 2ZWMA 1CW2B 1K5HA 5E6UA 3X1DA 3ANLA 1NPTO 3Q3IA 2DZDA 5T4EA 4TV8F 1A04A 4OA5A 1P0PA 1NP3A 3O1JC 3NGLA 4IRXA 3HKDA 3ZDZB 4YRZA 5A4IS 4ZJZA 3UOGA 5EGSA 1LNQA 1MC8A 1O97C 5EHIA 5LJIA 1U8UA 2PSHA 3E9YA 3KTDA 3Q5DA 4R5MA 5J40A 4Z3DA 2AFHA 2COUA 1SKUA 1L0BA 1TCUA 3FDFA 1M34B 2OBFA 2JL1A 3EA0A 2VQSA 1H2ZA 2QZPA 4N47A 1VCHA 3HCFA 1E9AA 4LGCA 1DQYA 4NCJA 4CG2A 2WAYA 3CBGA 2H9YA 5EPUA 3MW8A 1IBMB 1N6IA 4FMCF 1N6LA 3HY6A 1RVV1 3BGIA 2JHGA 5G53C 4RH3A 2Z1DA 1C7QA 3X2FA 1NC3A 1JVNA 3F3KA 4ZYLA 4XQCA 1FTWA 1JLRA 3E9EA 3F2IA 3HUFA 3I6YA 4E3ZA 1PWEA 3WGHA 3NCHA 2EP7A 4OQLA 4AP9A 1GRCA 1G2PA 1ISGA 2R8ZA 2ZBQA 3RODA 3I62A 2IGBA 4ND8B 5DN6A 3I0ZA 1HNXB 1RZRD 2PT5A 4GZMA 1B73A 4CTKA 3CVJA 5FOUA 5E3IA 2OHGA 3GJ4A 4EQ6A 2VG8A 1X1AA 5TQJA 5DV9A 1YR9A 2J0SA 1W5FA 2DHRA 1UMBA 2J0UA 5GV7A 3LCUA 5BQOA 4ES6A 2NU6A 3EGIA 4MIOA 2QX7A 4BNWA 1YS7A 2RC5A 2I1QA 1CNEA 4GI1A 4B8ZA 1T0JB 4EMTA 2REQB 5CURA 1MG0A 3VC1A 2ZBPA 3PQ7A 4B6PA 2I3DA 1QB7A 2X7HA 1Q17A 3ESAA 3SPXA 4YV2A 5C1DA 2WM2A 1RYNA 4Y9DA 3CGWA 3RROA 3ZWBA 3V8QA 5HYVA 2IOFA 1QVVA 5D5HA 3S2EA 3L0OA 1QHHA 2O3RA 2IYUA 3T15A 1BX0A 3WS7A 1QDLB 3TSAA 1TK3A 2JD1A 4WNAB 4DS3A 1R8QA 3JYOA 2VYQA 5G02A 5C1PA 5JDIC 4XWWA 3M4YA 3O4VA 3X1MA 2VDWB 3CLHA 4DLRA 4DQ0A 4XWKA 2J85A 4W5RA 1P7ZA 3OE1A 2ID7A 4GSLA 3NYQA 1XA3A 3DEIA 3PUZA 2I8CA 4LJYA 5ALNA 3CWZA 3K4HA 3ONEA 5IK2A 1RWQA 3VR4H 5HJ5A 2JFHA 4WLEA 3JWHA 3TS1A 5K9ZA 1V6CA 3PUIA 4Y6OA 5FAKA 3P1JA 3R8XA 3IBFA 3SC6A 3QM1A 5C52B 1SZJG 2VYNA 3TINA 1MDBA 4RORA 4ZYUA 4K1LA 2O2YA 2IHJA 1WSAA 3TSOA 1XDWA 2FPIB 1E3SA 1VDZA 4G0NA 4AT1A 2H54A 2NO7A 2PMBA 1FXSA 1Q2XA 4TV9A 3T5CA 3HXOA 5ALXA 2VA9A 4UHHA 2CFSA 4F7DA 1R0RE 1I1NA 1EZZA 2AX3A 3DLBA 3B1YA 1S3FA 2MYPA 3BAFA 2AS0A 1HEUA 1GL6A 1M2HA 2ACEA 1X8LA 3GJXC 2PL5A 4KODA 4ARAA 2GHQA 2QD3A 1E9EA 1U0RA 1UXGA 3CB4A 2GHRA 2Q4RA 1CQWA 1KAEA 4OJQA 2MU1A 2A4KA 2OV2A 2Y1KA 1D2GA 2Q3BA 4OYYA 3W4IA 3KB1A 3L1UA 1NL3A 4HDRA 2B0CA 3BB4A 1K7EB 2Z3VA 4P7KA 1QUEA 2WWGA 3DTYA 4C6TB 3CRRA 2GDJA 1IM5A 3GCXA 1TAQA 2A0XA 4BVHA 1RBYA 1B6GA 2WW8A 3WLJA 1ZYUA 5DN6D 1Z0KA 8ATCA 1ABFA 2FMIA 3CT6A 4FHDA 2BGJA 4OJTA 1YOVA 3U4QB 3ZVLA 2PEZA 4XASA 1VMAA 1NI4B 3ZV5A 2OLKA 1EVEA 2XDAA 3FMGA 3V8BA 4ASUA 2AFHB 1N0HA 4CODB 3VR4D 2G82A 4DDHA 1I3LA 4OD0A 3GN2A 2QRPA 2IY9A 5GONF 1YZGA 3LC0A 4M1WA 3VTFA 3WRYA 5KJ1A 1XRNA 3MJDA 3CUVA 4ZCLA 4G63A 1C0KA 2FB9A 2A9OA 5G3ZA 2R2GA 4OGGA 2JGAA 2WDPA 4Q3EA 1QRDA 5J2TB 2QN6A 3K5HA 3CXRA 4MW9A 1SH7A 3RT1A 1KVRA 2C0CA 3UMSA 1YCGA 4AZ0B 3SP1A 4ZYYA 5DB4A 2Z6UA 2JASA 4TKZA 3GPCA 1U0TA 3GAZA 4HDQB 2FX2A 3M3PA 1D9XA 1MB4A 2VF4X 3DM5A 3HFSA 3IODA 2EJCA 1N2OA 4FXPA 4Y1RA 1Q20A 4XQ9A 2A0WA 3GWGA 5BY2A 1FYFA 4ITRC 2CLCX 3ZNNA 3TI7A 3ADOA 3JWJA 3KEOA 3NAMA 1Y9EA 1N6PA 1P1FA 2XIJA 3GROA 4ZTBA 5CT8A 1JR3E 3SC3A 1X39A 5BUZA 2BFOA 3I01A 1AS0A 3LP8A 2Q1SA 1RT9A 1TDJA 4JSTA 2E55A 5CH3A 3PXGA 3S6JA 3HB0A 4JDPA 4DCTA 2FEAA 1IJBA 2C9MA 3O92A 4Q9IA 1WXFA 3L92A 5SICE 2LP4Y 3L43A 3NANA 1T9KA 4U6SA 4Y1EA 1DU4A 5KU7A 2DY1A 5B55A 3P4YA 3DVAA 4JXZA 2BE9A 2YUIA 3HH8A 2W58A 4I4TB 3UH0A 2J5QA 1CQPA 2XB4A 1FBNA 1QNFA 1YRLA 4RDIA 4HZGA 5F3RA 3OICA 2IY8A 4J94A 1NASA 4HQNA 2KJQA 2WUVA 4S1OA 4OXIA 5KYXB 4GBGA 5BV7A 1QHXA 4GKKB 1ZL0A 1ZD1A 2UYOA 2Y1XA 4WJZA 5C2JB 4LYDA 1K9VF 1V7CA 3LWZA 1RC8A 5EXDA 1I6WA 1KMIY 4WGFA 4E21A 4I1RA 5BOSB 4IDPA 4GSYA 3ADDA 3O8QA 2PRSA 3LT1A 1BHJA 2C4NA 3KQMA 3HB7A 2WIFA 1NJGA 1QDEA 1ZD4A 3QOYA 4YCBA 2X13A 3EDOA 1V1JA 4LXGA 2BEJA 5ICCA 3LF1A 4DLZA 4CWAA 1NX9A 4C04A 3DBRB 2J87A 5AXAA 3U3DA 1YJAA 2JGIA 3FTPA 3MD9A 3DDWA 4YWJA 2HU5A 2B34A 2VDKB 3HM9A 1P2SA 1Q7GA 2GK4A 4D9IA 1D03A 1P0CA 3K96A 1QF7A 1O94A 421PA 3EFBA 5CR9A 5ALGA 3AVYA 1DAOA 1I94B 1QYVA 1XD2A 5BT8A 5JSHA 4JWKA 4JUBA 3EASA 2FSVC 2J5XA 3A9TA 3KYJB 1QQBA 1M1ZA 4R01A 1ZESA 3MWEB 5FWDA 3WLAA 3GMSA 5DMHA 1OZ0A 1RQXA 1R0LA 3RABA 1EJBA 3LUFA 2INGX 3DLAA 1JX6A 4XD7A 1ZVQA 4M3NA 1VA4A 2G08A 4PNEA 3W8FA 3IB3A 4YRMA 4G85A 1IVSA 3EGVA 2HXGA 4URUR 2EERA 3H2SA 1JG1A