2Q5EA

Crystal structure of human carboxy-terminal domain rna polymerase ii polypeptide a small phosphatase 2
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
LLPEVTEEDQGRICVVIDLDETLVHSSFKPINNADFIVPIEIEGTTHQVYVLKRPYVDEFLRRMGELFECVLFTASLAKYADPVTDLLDRCGVFRARLFRESCVFHQGCYVKDLSRLGRDLRKTLILDNSPASYIFHPENAVPVQSWFDDMADTELLNLIPIFEELSGAEDVYTSLGQLRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxy-terminal domain RNA polymerase II polypeptide A smal
publication title Structural genomics of protein phosphatases.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 181
sequence length 181
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2007-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03031 NIF NLI interacting factor-like phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2q5eA00
4EX7A 4UMFA 2FPUA 4RESA 4BX0A 4E88A 1XP5A 2CN1A 5AI8A 2D2VA 4EELA 1X42A 4L6CA 5AESA 1WVIA 4UM7A 4RETA 3CNHA 5AW7A 3WKCA 3A1DA 3PGVA 5AVSA 3WK7A 3I1YA 2EATA 2ODAA 1WPGA 1ZOLA 4BX3A 5AVRA 2EAUA 2C9MA 3AR6A 5AI0A 5AICA 4AS2A 5ALOA 3B9RA 1YDFA 5AW6A 2YFYA 5A3SA 3PDWA 5AIBA 4H1WA 2Q5EA 3ZUPA 3W5BA 1YV9A 2QYHA 1FEZA 4KN8A 1ZRMA 2YY6A 5AKLA 5AVWA 3RFUA 2NO5A 4KNWA 5AW0A 4AP9A 3DAOA 5AM0A 4HGPA 3ZVNA 2ZOSA 3N5KA 1VJ5A 4EZEA 3EF1A 5E0OA 1TJ3A 3OCWA 5AM2A 4MUMA 1RQLA 3L1VA 3MMZA 4KYTA 3QX7A 4Y2UA 1T5TA 2HCFA 3FVVA 1U2TA 4UAVA 3VAYA 5AHXA 2AMYA 3NASA 3QUCA 3PCTA 5FP0A 2GO7A 2HX1A 4OHFA 4GIBA 3KC2A 2HEGA 4CF4A 5AM1A 4ZEXA 3A1EA 1WR8A 2B0CA 1ZD3A 1ZRNA 2WFAA 3D6JA 5ALKA 5AM3A 3WK9A 1SU4A 3NAMA 1RQNA 2FEAA 1YS9A 2JAUA 2YJ4A 4XQ0A 3A1CA 2AUTA 5A3RA 5AK3A 5AVXA 3R09A 5AVUA 1PW5A 3WGVA 1TE2A 1XVIA 4JB3A 3S6JA 3ZTWA 4Y2RA 1T5SA 2OA0A 1ZD4A 3L0CA 2O2XA 3OCZA 2BDEA 3R4CA 2O9JA 4IFTA 1LTQA 2ZBGA 5AW9A 3AR2A 2HI0A 3AR9A 2AH5A 1U7PA 3IJ5A 4UMVA 3IB6A 2ZBEA 3U13A 5AW3A 1RPZA 2FPSA 2Q4RA 1QQ7A 2NO4A 1L6RA 2IYEA 2G06A 3SMVA 1WZCA 2OBBA 1EK2A 1Z4PX 3QXGA 4IG4A 1S2OA 3OCYA 3QNMA 4OFZA 4Y2PA 2VKQA 3NIWA 2R8YA 2HF7A 2RAVA 5ALSA 1F5SA 3SLRA 2WF6A 3CZ4A 3B9BA 3QU7A 4BNDB 2B8JA 2OYCA 2FPWA 3ET5A 1Z4JA 1SWVA 5AKEA 2P69A 5ALEA 1RLTA 4JDPA 3OPXA 4G9BA 3UMBA 4HGNA 3QU9A 1Z4QA 5AK5A 4Y2XA 1RDFA 3RF6A 1RRCA 5ALGA 1AQ6A 1Z4IA 4G63A 1Q91A 5ALLA 3W5AA 3W5CA 2JGAA 5AVTA 3L7YA 1L7PA 5ALWA 4XE5A 4CNQA 1O08A 1S8OA 1Y8AA 4YCMA 4UASA 3BA6A 4EENA 3E8MA 2IOFA 4AS3A 4Y2TA 2I34A 3ET4A 3AR4A 1NRWA 3NALA 3KZXA 2Q4TA 3EPRA 4HAIA 4J2TA 5ALZA 1L7OA 2HOQA 4MWOA 3UM9A 1TJ4A 3WGUA 5AM4A 4I9FA 4KX3A 2HHLA 3L8FA 5ALDA 1U2SA 3MN1A 2C8LA 5AKXA 1YMQA 2RARA 3WKAA 1RMQA 1EK1A 2HSZA 1XPJA 4BEWA 4QJBA 2W4MA 3QUQA 1SWWA 4NAVA 5ALFA 4Y2JA 1NF2A 4J03A 4NFLA 5T41A 1Z4OA 4BEVA 3AR3A 2GHTA 2G0AA 2HDOA 4B6JA 2W43A 5ALVA 4EEKA 3WK4A 2B82A 2WF8A 3E84A 1QH9A 1RKVA 2B8EA 1ZD2P 4Y2VA 1L8OA 2NYVA 3KOOA 2G80A 3N07A 1KYTA 4HYTA 3L1UA 4XPZA 3E81A 1Z4NA 3OCUA 4UATA 2G07A 4BNDA 3NANA 3E58A 2IA5A 1YNSA 2R8XA 3TLMA 4YIKA 5AKGA 4UM5A 3EWIA 3GYGA 1N8NA 4C4SA 2R8EA 4QQFA 4CF3A 3AR5A 5ALIA 2ZBDA 4Y2YA 1ZD5A 3UMGA 2B30A 1RLMA 4ZEVA 2BY4A 4UW9A 3IRUA 2R8ZA 3ESRA 2HF2A 1TJ5A 4HGRA 4UMEA 1QYIA 2CFRA 4KNVA 1VJRA 2WF9A 2YJ3A 3QUTA 5AI4A 1U02A 4UMDA 1T9ZA 3F9RA 2WM8A 3EF0A 3I76A 2DQSA 3SF0A 3N28A 2X4DA 4KX5A 1N9KA 4C4TA 4L6AA 2FI1A 4YCNA 3L8EA 1Z4KA 1L7MA 2JAOA 4I9GA 4YIHA 3U26A 5ALQA 1QQ5A 2WF7A 2YBDA 3KBBA 5JJBA 2WHEA 3QU4A 3SKYA 3FPBA 5ALRA 4YGYA 5AIAA 3L5KA 2FPRA 5ALMA 2W11A 2GFHA 5ALXA 1CQZA 2QLTA 2AGVA 2C88A 5AKKA 5IT4A 1LVHA 3NUQA 3U19A 4Y3UA 4NV0A 3ZVLA 1JUDA 3HYCA 3QLEA 3NRJA 5ALYA 3L0BA 3W5DA 3PGLA 4CE6A 3L8HA 4DW8A 5AKYA 2GHQA 3A3YA 4OCZA 3KD3A 4BKMA 5AW4A 2IOFK 4DCCA 5AK4A 1NNLA 4FYPA 3ZWKA 4GXTA 5ALHA 5AVQA 2PQ0A 3QUBA 5IS2A 3UMCA 4BX2A 3K1ZA 1ZS9A 2I54A 3J7TA 5AI9A 3KDPA 3WK5A 5AM5A 3HLTA 1Z4MA 2B1RA 2MU1A 2MSNA 4OD0A 4C4RA 4BYGA 3QGMA 2JARA 3SD7A 2YMMA 2OM6A 4BBJA 2YMQA 5AI6A 2RBKA 1QQ6A 1MH9A 3ZTYA 4HGQA 1O03A 4PNHA 3I28A 3U7FB 3SKXA 3N8GA 3U7GA 2PR7A 3AR8A 2YN4A 1RKQA 2WF5A 4L57A 5AI5A 3ZW7A 1CR6A 4UARA 5IT0A 1L8LA 3FZQA 1Z4LA 3R9KA 3P96A 3ZU6A 3OCVA 2G08A 4O8CA 1RMTA 2PKEA 5AW5A 3WK6A 5AKIA 3ZX5A 2FUCA 3ZX4A 3ESQA 2RB5A 2I33A 5ALUA 3FGOA 4Y2SA 3QU2A 2ZXEA 4FE3A 5AW8A 4Y2QA 1ZJJA 3L8GA 2CFSA 3DDHA 3OCXA 3FPSA 3OTQA 3ZVMA 1TA0A 1Z5GA 2CFTA 2G09A 3WKDA 2YJ6A 5AVYA 2I7DA 2BDUA 4XOUA 4F71A 3QU5A 2P27A 3M1YA 1RLOA 3ZWDA 1RC8A 2EARA 1J97A 2YMLA 3L0YA 1RMYA 1YJ5A 2G1AA 2HO4A 5ALJA 3SHQA 1IWOA 3ED5A 5AVZA 5AKZA 1Q92A 4YCLA 3I6BA 5ALTA 1Z5UA 2I6XA 3AR7A 3BWVA 2C8KA 4NWIA 3WKEA 1VFPA 4UAUA 5AVVA 3MC1A 1J8DA 2FUEA 2C4NA 5ALPA 1RKUA 4HGOA 2ZBFA 3B8EA 4CF5A 3FM9A 2GMWA 3MPOA 4UU1A 2P9JA 1U7OA 2ZG6A 3WKBA 5AKJA 3DNPA 4FFDA 3WK8A 3ZI4A 3U7HB 4DWOA 3ONNA 2FDRA 3N1UA 3QYPA 2I55A 2P11A 2JAWA 3U7EB 5A3QA 4EX6A 5AK6A 2IOHA 3M9LA 5AKHA 4NABA 4DFDA 2FPXA 3DV9A 4UU0A 1K1EA 1L7NA 1Z88A 2YMPA 2B1QA 4YH1A 5AW1A 2YJ5A 4ZEWA 4F72A 5AW2A 5ALNA
chains in the Genus database with same CATH superfamily
1NNI1 2I7TA 1U9CA 4EX7A 3A3NA 3DWFA 5FLKA 3BD8A 4QKQA 1W36C 1YBHA 3LRXA 1TX4B 3ZU4A 2UYYA 4YROA 4HL6A 5D2CA 3LL4A 4LJ9A 2I2XB 1I01A 3DULA 4LXUA 2VK8A 5KBYA 1PCXA 2D13A 3KXLA 1Z56C 2CXNA 1RWPA 1C3VA 2BJHA 2GJ8A 2ZI7A 1UIRA 3FXAA 2PGNA 2F17A 1KQNA 1CRWG 3W4KA 1GLGA 1RCUA 1ZA1A 1BWQA 1P5JA 1ECGA 5E6RA 5IAKA 4HATA 1L5FA 4YXWD 3RQSA 1TQDA 2PXXA 2QM7A 5HBRA 4YR9A 5FEMA 4RLFA 2CHEA 2J0SA 3ZNNA 4C2TA 1CRZA 4KO2S 2DQZA 1UZLA 3ZCQA 1V0JA 2FX3A 4HAWA 4AKGA 3OQBA 2YHSA 3GA5A 5CNKA 1JLMA 3GEMA 1G8HA 3VH1A 1ESDA 1RZRD 2GVDC 1Z0UA 5JDCA 5K3AA 8AT1A 1ZGCA 1NNEA 1I2ZA 1DO2A 1IZ9A 2P9CA 1FFHA 1X1QA 2Y77A 3FNBA 4YAEA 1BW9B 3BM5A 4L5BA 5DX0A 3QEKA 3S70A 2YJTD 3B3GA 1OBOA 3TJRA 4B2LA 1ZO8A 1IMOA 2H11A 4FWTA 1C1YA 4WBNF 4ZWNA 1Q7RA 3E61A 3WC4A 1DIAA 3AXSA 3FOCA 3L4SO 3N5KA 2VTVA 1EFTA 2H1HA 4WKPA 3TVYA 1XNRB 4WKOA 1JHRA 2EBWA 4FFWA 4HFNA 5I9NA 3UQZA 3BGOS 1X7GA 4MUMA 2I1LA 3B7PA 3L3BA 3MRSA 1ECLA 4FKBA 4Z9YA 2FV8A 2W2NA 4QYIB 2GEUA 1TGYA 1ORIA 4ALMA 4GL2A 4TXNA 4K81B 4Y2UA 4Y1GA 4PZEA 4DVJA 2J9FA 4TVOA 2ECKA 4MIOA 1KK2A 1PNOA 1ZA2A 4HMQA 4ODIA 1O89A 1JIVA 3LUDA 2AX3A 3QTLA 5IT9A 3PCTA 4FDLA 1PGNA 2XWBF 4AMVA 2QZJA 4F2DA 1CETA 3PR3A 3FJOA 4F2GA 4P38A 3HB7A 4OHFA 1NBIA 1KMCA 1Y7LA 2R79A 4BIIA 5DHAA 7GPBA 2UXDB 3U61B 3KUXA 3U7QA 4D2IA 1PX2A 3FWHA 1ZD3A 1VYHA 2C59A 4TYPA 2V7VA 4WJZA 5A71A 2IXGA 2I99A 4BUJA 2VXCA 3HDYA 3ZGNA 2AEJA 1BHO1 1TAHA 3DC2A 3SPXA 3TOVA 2CE2X 4PRKA 2JAUA 4Z99A 3W8RA 1EDOA 5CDFE 4R3NA 3EDCA 3UGJA 2V3WA 5GTDA 2FK8A 2QLJA 3KHKA 1RHJA 4Z49A 4DLAA 3QSYA 3ZDRA 2ZSUA 3OU7A 4FK8A 2DQYA 3NBXX 2QA5A 1LLFA 5I8WA 2IXEA 3OICA 1T6NA 1ZD4A 3WB0A 1RS0A 3H5VA 5AFSA 4TV9A 1Y6GA 1JT9A 4DLTA 4C3UA 3OX4A 3NTXA 3PWTA 4QQRA 4NENB 1F1BA 2I6GA 4GMFA 3AR9A 1IPHA 3GRYA 4GKAA 4NU8X 3HP7A 4PLHA 4WOJA 4CYMA 5BWCA 3P9ZA 1LBQA 3PEEA 3CG0A 2J3IA 1DAGA 3CHYA 3QELA 5FOWA 3FF1A 3U13A 2WHQA 1Y89A 3NHBA 1YA8A 2J46A 4GECA 3IOYA 2QG9A 4BGIA 5C32A 1Z6YA 3SR0A 4BNHA 5IF3A 2FWIA 2O8CB 2FZCA 1HYEA 1EX1A 1FA9A 2J5BA 3LDHA 2FWNA 3FDJA 3VVCA 3PEYA 3ND9A 2X0IA 3TDKA 3VZCA 1A5ZA 3WGOA 1M34A 1PVVA 1DO8A 1TIPA 2CJWB 1V3TA 4KJXA 3NGXA 2MYUA 3AETA 4PSKA 3T7IA 4D96A 3DJYA 1F5SA 5FT9A 3KPWA 4C5AA 3A6ZA 3WYDA 3URKA 5E38A 4ZO8A 5TPZA 2GBGA 3Q7EA 5ETJA 3TLYA 3HACA 1VJGA 4BZXA 1JKMA 3JD1A 1U8XX 3GFGA 1BWPA 1UP7A 2HPAA 2PBLA 2ORWA 2RGDA 2XY4A 3C1TA 3NAZA 4EG6A 2ZI6A 1F7VA 4MR7A 4AKIA 1IL0A 1YJ8A 5EHQA 3D2AA 2R2GA 4JDPA 5JC1A 1QAMA 1R2QA 2V6IA 4PZUA 2V1UA 2NACA 4BS9A 2G1UA 1IQPA 1Z5OA 4N8SA 4AZ3A 3ORQA 2QAGA 3ZJYA 3TGLA 1RDFA 2YRXA 5T7BA 1LPBB 4Q7EA 3HHPA 4BVFA 1RR6A 3RFFA 5DBGA 1SBQA 4D9IA 1MOSA 3L5OA 1CFJA 2IHZA 1JMVA 1YJCA 2O4CA 3QMVA 2QLNA 3SHOA 2JD1A 4DNXA 5ADHA 5JPCA 4LNUA 1QRRA 4FTWA 5LIRA 1D04A 2RI0A 2JGAA 2J0EA 3KCNA 3AZPA 4FQ7A 4JJZA 4MZDA 2ZXFA 3MT9A 5DHRA 4M0LA 1SD2A 4W6ZA 4BN5A 4LF4B 3D7MA 1E5DA 2GERA 2V7EA 4AMBA 4F6LA 1EUQA 4JLNA 2GESA 2UYOA 4W9MC 3VKWA 2W4IA 5EJIA 3UAOA 5BSRA 4C6RA 1S4MA 1NQAO 5FOTA 3SBOA 1AJEA 2J0QA 1M8FA 5K0LA 3MTDA 2PU5A 1OMOA 5D6NA 5H70A 2DTEA 4JNKA 4DS3A 4FR2A 2ECFA 1PJ8A 4IGIA 2VYND 3VMFA 3KFXA 2FKAA 3WRYA 1V25A 3OLYA 1O94A 3OVMA 3VA7A 1XF9A 2X14A 2NZJA 2OSBA 3IP6A 1WZEA 2HADA 3QOXA 4ZEOA 2PUFA 3QFTA 3W2EA 3INGA 4EVIA 1FS6A 3L1KA 4YJ3B 5IZCA 1VMKA 4IILA 2G88A 2YICA 1YOVB 3OBBA 3IEPA 3KKLA 1R88A 1WVMA 3H5AA 1PJSA 4QQ8A 3SVZA 1YQWA 5A3VA 5EXDA 1Z73A 2BFWA 3UICA 4YMHA 2VRWA 1S01A 4L15A 4NYJQ 5ALFA 1NVFA 2W5UA 5EEGA 1DXHA 5LL6P 1VBFA 2IP2A 2XD9A 3OPVA 1IZ8A 4G8CA 4R1QA 2WU0A 2V8BA 3UWMA 2DYKA 4B76A 4MRPA 3ZHYA 1I3MA 4OLJA 4WKBA 4N03A 1PFUA 2OSVA 1PZMA 4XQ9A 1N2JA 2VHUA 3I92A 1WB5A 3G0GA 5I51A 4BTEA 2HREA 4KAAA 1E0DA 4LY9A 3ZJUA 3HDQA 1GGKA 3L0SA 1L3CA 1TU4A 5GVRA 4B74A 2OHJA 4CQLB 1QCZA 4LKRA 1GYPA 3WR5A 1TKBA 3I8XA 4DEYA 4B43A 1D6JA 4Q15A 3GFVA 4RS4A 5HIAA 3D8NA 4B7XA 1P18A 4KLNA 3UO8B 4BP8A 4L3VA 4YIKA 3CX6A 1DCMA 2X8JA 1VHWA 3H9GA 1U6IA 5HKKA 1T2DA 3HXKA 4GDMA 4LYAA 3WLOA 3ADCA 3IA7A 2Z8XA 4GEGA 3QV2A 4D3SA 1A9SA 4QEDA 3O1LA 2NUBA 1AUPA 4YJKA 4PWYA 2X0KA 3HFGA 4L22A 3FFWA 1Y63A 3D7KA 2WIGA 3MSCA 3U4QB 1SU6A 1BXZA 1WUIS 3Q2IA 4LRWA 4UULA 1WMDA 2RCYA 1MC5A 3A7EA 1OIXA 4RBNA 5DNEA 3TD2A 1ZVVA 1USIA 1V41E 1Z13A 3T7TA 1GUFA 3BPSA 4FZJA 4Y1RB 2YH2A 1NL3A 5IM5A 5HS4A 5FPQA 4KAJA 4GR5A 4NEHB 1UBCA 3MWGA 3GDGA 4P54A 1G8MA 3F9RA 3KV3O 4B8ZA 3FHTA 4ROSA 3WWPA 4OKIA 1F6BA 3B1JA 2G04A 1QOPB 2GK6A 4HS4A 4HWRA 1LEHA 3ESBA 4HZUA 2PL9A 4NOLA 1YJXA 2CK3A 2BFEB 3C2QA 3CYFA 4N9WA 3H5LA 5CG2A 5FKJA 1MX1A 5HF6A 3C6QA 3DBRB 4KK4A 5IEJA 4YJHB 1AZTA 5F1PA 2HLPA 1G63A 3AC0A 3TJZA 3DL2A 3TSYA 4BBPA 2CVQA 3ONVA 3FPBA 4IR7A 5EQDA 4YP1A 2AD5A 2JZOA 3UJBA 3WGKA 4NXNB 5MHTA 4DIMA 3CTPA 4JSTA 5C5DA 3SJAA 3WGHA 3PT9A 1FS5A 2ZWOA 3UAGA 1AV6A 2P78A 2HBYA 3B7WA 3BULA 3N0WA 3QBJA 4JN6B 3N6XA 4I8XA 2C4VA 4MQFB 4PNEA 3J81k 3ORYA 4I1RA 4J1NA 1JI3A 4Q3NA 1JU3A 2W2KA 1GL7A 1NUQA 1EGQA 2PKCA 2V65A 5EJFA 3RSFA 1XKXA 1ZESA 3E6AA 3Q2OA 5HXAA 2AEMA 3TLBA 3QLEA 1U80A 3LXMA 3W2IA 1I1HA 3FBTA 3STUA 2VQFB 2V9ZA 2A84A 2GPJA 1AT1A 1XJCA 4EI8A 3DFFA 5IZ4A 3BWXA 1LRKA 2FPIA 3RBVA 2NVOA 2OFOA 1HE4A 3NRBA 1PK7A 1DE0A 1L3IA 2GBLC 3OLZA 4WGGA 3NYIA 2QTBA 1Q1GA 4BLSA 3DKKA 1DJPA 4DRXA 4LZZA 1CERA 1VIAA 4DQXA 4KR6A 3UA4A 3NBQA 1MD9A 2I1VB 3BOSA 4TRJA 2GN1A 1CY4A 1XNHA 3QWHA 2QRHA 1O0BA 4RFSB 3J7TA 1Y3HA 3LA6A 4TMVA 5EI5A 1YIOA 1OXSC 3WDMA 4P4GA 1N2CB 4I1OA 4OD0A 2YTZA 2E5LB 1Z15A 4ND3A 3G2PA 4MVJI 1L4FA 1LDGA 3ZJ5A 4AK9A 2CEKA 3E8SA 2FUG1 2H1WA 5AI6A 1YZKA 4JB0A 4MUEA 2PZBA 2WUGA 3KYCA 2NYUA 1UODA 3VO2A 2EKZA 2QX4A 4FILA 2PR7A 3Q7SA 3WYFA 3GN2A 2XB2A 5IKOA 4XUGB 1Z0AA 3G8DA 4NZYA 4BVBA 3RCBA 1XKQA 3JYPA 1ZD1A 5KKAA 4BNJA 1N25A 2ISQA 5FI0B 4ZVPA 2VNJA 4YMSA 1H0HA 1CS4C 3TTYA 3D4NA 2JJQA 2JA2A 3OM8A 2ATXA 1N4AA 4ZGGA 1Q74A 1QKJA 3WDKA 3N58A 5DHPA 1KI9A 1P4GA 4LISA 1J5XA 4LTNA 4CMCA 3BN3A 2QM0A 4QDTA 3HKEB 3VGJA 4TWAA 1OROA 2BSAA 2JHGA 1P62B 2JIOA 3CC8A 3JWJA 5ENVA 3C8ZA 4R0VA 1RMTA 2Q6TA 3ZWBA 1CIVA 4PPGA 4M86A 1XMJA 1UBMS 3IQEA 3GJYA 4I4NA 4F8EA 3ESQA 3FHOA 5AJUA 2I33A 4FN4A 2QSZA 5KOJA 2EQ5A 5KUTA 2HB6A 2OL4A 1YULA 5FFMA 3DVAA 3X2FA 4AKSA 3IUEA 2A3NA 2H18A 2QV7A 3ESDA 4IIFA 4O33A 1AUOA 5SZJA 4KXUA 1FUUA 2VWQA 3V34A 4DDTA 1YI1A 1C9NA 3OCXA 4NQRA 4P7FA 5TGTA 7AT1A 1SELA 4HNSA 1MIHA 3DLHA 1JIKA 4LE1A 4FFRA 3CLTD 3W1WA 4I5DA 4PSAA 4POOA 4D3FA 1KVUA 2I7DA 3H0CA 3AU8A 4WZAE 2DXIA 1U3FA 1UM9B 2J3HA 2VRCD 1Q0UA 3WTCA 1SZPA 2NVUA 1PF7E 1W8DA 4NCXA 3ZW9A 2RH9B 3B6MA 3SDSA 1NKSA 5CDSA 1KKMA 4IFBA 1OLXA 1RMYA 4R2MA 4HDQB 1Q92A 3EVEA 1AKTA 4EDFA 2EEZA 2IUTA 4MXDA 2DULA 2HZBA 3VPDA 1SN7A 3WKEA 4KUHA 1L5YA 4I3FA 1Q22A 4IHJF 1Y9EA 1YSCA 2ZIWB 4LWQA 1Q6YA 3VC7A 4ALLA 4HV4A 1JIJA 3P97A 1V8OA 4UE3S 2X7HA 2VHCA 1IVSA 3ZYZA 4QG3A 4J07A 4OMCA 3KZVA 1DRUA 4MQ5A 4RD6A 2IHKA 2IDJA 4BRUA 4EHAA 4EHJA 2ENUA 1EFVA 2I2WA 3VYRB 1Q0ZA 2D2FA 4JLMA 4X90A 4RGVA 4U7DA 3F6RA 3OM9A 1F14A 1YQQA 3ESYA 5BSMA 2FSHA 4MYUA 3WKBA 2DY0A 1UPCA 4RKYA 4AQYB 2ZQ5A 1KJZA 3FOWA 4BLUA 5KQRA 3IDSA 3RU9A 1GNRA 4JOCA 4DWOA 1ZICA 3DMGA 1YWGO 4NL4H 1DTSA 1IY9A 1HK7A 2B4TO 3CA8A 4PR0A 4NNJA 3IIEA 3X3HA 5C8ZA 1ID1A 2AG5A 2YOGA 3MM4A 3NWBA 2XADA 4M1YA 1G21A 4PGGA 3QYFA 5P21A 2FUNB 2PGXA 2ZSJA 4BKUA 2RGNA 4GXRA 3U7EB 4RF5A 1CJCA 1X15A 4JP1A 2ZT5A 2ZBRA 4I0WB 5AK6A 4IIGA 4MGYR 2GCGA 4BMDA 4K6CA 2G1PA 3SSOA 3R40A 3DNMA 2I8LA 1TYCA 1RFGE 2PT5A 2CF5A 1NYRA 3I1FA 3USCS 4LYYA 3WNCA 2V3VA 2B5VA 2WKPA 3AP3A 4RENA 1Z88A 2QS9A 1WMSA 2YMPA 3FDXA 4DQ0A 2FP3A 1DMSA 2PS1A 4YH1A 4M0MA 4TLDA 3RHTA 3T7AA 3HJHA 4L5IA 2B83A 2Y68A 5AW2A 3GMSA 4C6TA 2GCOA 5JXGA 3GLFB 1R1DA 2PDAA 3SE7A 1E7YA 2AF3C 1CG6A 2ZU6A 5LQSA 4GXNA 4TGLA 1BEZA 4O5AA 4N12A 4DF3A 3CCBA 1XB2A 3ZDBA 4I8DA 2ZI9A 3WIEA 4AWAA 2WSMA 1DKLA 3ANXA 5IHXA 1I36A 1S2LA 3DXXA 2VDPB 2IC5A 2AUNA 5DNWA 5ERXA 5BN4B 3RVQA 5KYWB 2FHPA 2DFVA 1IDN1 3A1SA 3I4FA 5FOVA 1E2JA 3PQ4A 3QWBA 1MPXA 4YMTA 4Q9HA 4BMCA 1BX3A 1JLHA 3V7FA 4I2VA 1LKZA 3IOBA 2QRGA 3WB9A 1AQNA 1SKMA 4Q48A 4P2BA 2QL5A 2EAUA 2QN9A 1KMIY 3T4PA 2I4TA 3CEJA 2XIQA 3H0KA 2ZW9A 1GNVA 4LDNA 1E69A 3KZMA 4M83A 4WZZA 4JC5A 4QGGA 3ZE0B 1RTKA 1O95D 2IW3A 1KF0A 4L76A 1KDPA 2A9KA 3N2NA 1FPMA 1T3TA 2BRUC 1ND6A 2QL6A 4RVGA 3L8ZA 1XFDA 3R7SA 4ZYTA 4LMRA 2P9QA 1ORRA 2OWDA 1QAOA 3I3SR 1TLLA 4G4GA 4ASUA 5KJ1A 2UXCB 1AGNA 4OQNA 2RIRA 4D99A 2HHAA 4F3YA 2OVFA 1JTEA 5FUWA 1GU1A 2MR5A 2I3ZA 3B20A 3E0QA 1I6WA 3G8CA 2BWJA 3GZTB 3PHIA 4KN8A 4RNCA 1UPUA 4WQMA 2RONA 2C7PA 4AJ2A 4BMVA 3ILVA 1X9IA 3RHZA 2GK4A 4EUEA 4C3VA 1QV7A 3L79A 1UZUA 2BMDA 3WNVA 3D7NA 3LECA 3AW8A 4GI7A 4K6GA 5GJWC 2CDBA 3ZYCA 2CZGA 4PICA 2ZRFA 3WFJA 3WP1B 2H8GA 3NQ41 1NPTO 4XVCA 3K94A 3GB9A 4PC1A 1OVMA 1CQWA 4NPHA 4M1OA 5B53A 4HH4A 3RVBA 1W4LA 4DREA 1WKBA 4EPYA 1BS9A 4KYTA 3C5CA 5E1OA 3DHWC 1THMA 3X2EA 5BW4A 1JG4A 2VYFA 2XLCA 3TDNA 5BMOA 4HYEA 1T5TA 3KRTA 1ODTC 1J2RA 4O08A 2Y93A 1P3DA 2X5XA 4CLOA 1ZUNA 3DUFB 1E66A 2H2IA 3V8BA 3GLVA 4A03A 4UUNA 2OECA 3RDPA 3JTEA 3OTWA 5J5VA 3EG9A 3DT8A 3I0ZA 4NQZA 3VH4A 5A5VA 2I2BA 2JAPA 5KOYA 2FLVA 1O9GA 1JHPA 1H1TA 2D8AA 3KJXA 3DJFA 2MYNA 2FLKA 4MV6A 4D4LA 2H4HA 5T57A 1ISHA 3SXPA 2OXRA 2O0JA 4OKSA 4PZYA 1W88B 4WASA 5IG2A 4JL8A 2ZRNA 2OV6A 5HRUA 5GJBA 3LSTA 5ALKA 5F1KA 5F5NA 2BGRA 1W49A 1E98A 4YR7A 1QGYA 4I36A 4B3MB 4O4IB 2YVUA 3DE5X 4XQ0A 5JSQA 2ZXUA 5K4AA 4HBGA 2PXCA 2BL4A 4RZIA 4FOTA 4ID9A 4B71A 4GMKA 3KKOA 1NPYA 3OZAA 4EB8A 4ZHQB 1JAXA 3KPYA 4H18A 1CZLA 3UJ8A 1O87A 4HTFB 1W7AA 3R4CA 4NCAA 2OCYC 2OUIA 5DGCA 2PD6A 4RLSA 2NN3C 2RI1A 2ZIFA 5BN1A 1WUJS 2HWKA 2AH5A 2CJFA 1RXYA 2GZRA 4C7OB 1C8BA 3G5UA 4BWVA 2C2KA 1Y4UA 2EJWA 1JQ5A 3PD7A 1LSJA 3MGBA 1KWKA 4QXMA 3VNVA 3QEMB 3HSSA 4RAOA 1P9WA 4H4DA 2ZTVA 1O8BA 3X1XA 3G2LA 4AUEA 2QLFA 1XIVA 3HCAA 4RHTA 3HVRA 4D4GA 2OZLB 4YP5A 5CX1A 2W70A 5CITA 4A91A 1JW9B 3A36A 4I99A 4TVKA 4QZVA 4DZTA 2JLRA 3EIOA 1R8JA 2FB9A 2R68A 3VKVA 2FSPA 3C1OA 1EJ6A 2XVAA 3UPDA 2FZEA 1JZSA 3D3JA 1AN9A 1E8DA 4G8DA 2Y1FA 1QIFA 1GN9A 2BP7A 4B82A 1SUFA 2PK3A 1A3CA 3GT7A 3MVEA 1SWVA 1ZN7A 3LHFA 3AUUA 2EV9A 1SG9A 1OXUA 3I53A 2HF8A 2R4QA 1O3YA 2C7GA 3TSCA 1UQUA 1RWKA 2D4HA 3NIDB 3RT1A 2BTQA 2DR3A 3L0DA 4MW6A 4XRGA 1U0JA 3NBUA 4M6WA 1R10A 3C85A 3JRNA 4QX6A 1YBMA 4IMIB 4WXYB 4UTOA 2QAJA 3PVCA 5AK5A 1KP2A 5DBEX 2BE9A 3D3KA 1F6DA 1WMAA 2FRDA 2HWYA 3HKCB 5BSVA 3G1TA 1JEQA 1SOAA 2RI6A 1P29A 3K5IA 4KOAA 5C3UA 3U7JA 4J0KA 4NMLA 4KNYA 3TB4A 3K31A 3VR5A 3AEUB 3WY9A 5CA1B 4I4TB 1RLIA 4IS3A 4TV8A 3WMEA 1L8QA 4JLKA 3Q41A 4K3VA 3VPHA 4LJYA 1I4DD 2HGZA 3U5TA 1S8OA 3ZH2A 5J1SB 1SUDA 1QE0A 1Y8AA 3F5QA 4EFKA 2VJNA 2C5FA 2RC6A 4QHYA 5LZ7A 1L7XA 3CXUA 2RK4A 3O6VA 1LF0A 1OVGA 3HZHA 5DGDA 1CE8B 1LPOA 1W5SA 4B17A 4I3GA 1K8XB 2LRHA 5G41A 4H6PA 4I5EA 4ZVVA 4P34A 2BZGA 1HBJA 1WDLA 2VZEA 3HKBA 3NTUA 2GN9A 4LYHA 2RHWA 1HDIA 1LI4A 4Q01A 4U9HS 4X93A 3O3MB 3L41A 4RKRA 1B73A 3TSZA 1E9DA 1YHNA 4NU0A 4LCBA 2JS7A 1KR5A 1OIWA 3U16A 1HX7A 1F9EA 5IAEA 2C8LA 4FNMA 2EYUA 1Y34E 1ONPA 3KLBA 1NQXA 1T1JA 1IHUA 1O97C 4R1NA 3X1ZA 3B3JA 4QPNA 1H2HA 2AMVA 1W48A 5LU8A 4E94A 3DMRA 4U2CA 4F11A 1F8FA 2BM9A 1SWWA 4NAVA 1MJHA 4ISCA 3T0IA 1U98A 3UTCA 3WWOA 4CT5A 421PA 1X1SA 2WTAA 3VPBA 2R6GA 2R8BA 4DKJA 4LF8B 3ONFA 5EQTA 1UXHA 5E3IA 3LQRA 3S7TA 2P75A 4BFYA 3HCPA 3PNMA 1D1QA 2B82A 1C30A 1NJ2A 3G2MA 3L0OA 5FA8A 5TMBA 3EMBA 2WD7B 5JVDB 1FLNA 1EIZA 1U1IA 3QNUA 3D31A 4C05A 5HNKA 3I4LA 1DDIA 2O1SA 2QMEA 1LWNA 1N3BA 3FW1A 4TYWA 3SSMA 1Y1RA 4YRFA 4BKOA 2BMAA 2HWXA 1L1QA 3I9KA 3NVKI 1M2OA 3GOHA 1KEEA 3DOCA 1WHSA 2ZR0A 5F1YA 1XTJA 4JGIA 5FR1A 3BIJA 3GDWA 3GP3A 4CJXA 4HAVA 5HSGA 2ZAIA 2XYRA 1XHLA 3RRMA 2AZXA 3JQGB 5MN4A 2R8EA 3KDAA 1GGVA 1OLSA 2BFCA 4ILKA 2ROQA 3VPXA 3PLRA 1LDYA 2R7KA 2FEWB 4HYQA 3DOOA 2GYYA 1HTWA 1JV2B 2CL5A 2CNKA 4M1TA 2X7JA 4N65A 5FDFA 1X1RA 2QTLA 1T1RA 2RGAA 1JYSA 1Z36A 2PEZA 2VP6A 3L9XA 3ZKWB 2AOWA 3CWCA 1U94A 3O03A 1VE5A 1T36B 1ENPA 2I2AA 4AL4A 1NVVR 4AT1A 4A1OA 1DEXA 2CFRA 4PYKA 2WTMA 2VJLA 5CYGA 1XTZA 1IG0A 1T4DA 1EVYA 3JZMA 1K7SN 1PX0A 1UDWA 2ZVJA 3Q7QA 4PO9A 3D2LA 4HEQA 3HU5A 1W59A 1LVGA 1SVMA 4Z9AA 3CJRA 4NZZA 4XUDA 1XPUA 5DGTA 1XZNA 1NLMA 2RH5A 4REQA 5CT6A 1ICIA 1QG6A 2E2WA 1GZHB 2L0XA 2EZ8A 2H00A 2VHQA 1QH8B 4BMXA 2WIAA 4YJ2B 1WLSA 2XRYA 2EFDB 4JS0A 2OHXA 5AOVA 4DNQA 3IVGA 3TNLA 4LZNA 2G5GX 2VF4X 2YHUA 4OU5A 3FOBA 5F77A 4ARSA 5CD1A 1W0KA 3RV3A 3U40A 3PKZA 1Q0SA 3U39A 4W1SA 5DHQA 1SHTX 5P8WA 3KHTA 3E9EA 1IVNA 1E9SA 3HRIA 2JATA 3IEXA 4GRIA 3U3RA 3F6PA 3COSA 5FBHA 4CM6A 2PVCA 5TE9A 2GFHA 1UT6A 1BYIA 1P0PA 3GMDA 4NTZA 4B81A 5D84A 7REQB 2C88A 2AKYA 1RFLA 5LR6A 2QVYX 3K2QA 3D6HA 1Q2XA 4IDCA 3UMSA 1NOJA 3M83A 4L8LA 5COAA 4E5YA 4Z9FA 1IONA 5KQMA 4BO6A 2H2FA 2X76A 3GBPA 4JGBA 4KRFA 4XFKA 5K51A 2Y1LA 4YTEA 4X71A 4YRAA 2JCYA 4Z7OB 2R6ZA 1NJFA 4TLBA 2WLSA 3AUKA 5IYZF 6CHYA 2IOFK 2AJBA 1QVZA 2ORED 4LEIA 2BKXA 4UNNA 4DYHA 1GRCA 1K88A 3H5RA 4TKVB 4V0OA 3ZE8A 1NJ6A 2PLWA 2WZCA 3CR3C 3PX2A 1T4MA 3NEPX 2PKXA 2W0MA 1MQ9A 4CEJA 2BKAA 2WICA 1PWYE 2VJKA 4J2HA 1DJNA 4TTVA 4BX2A 2XVXA 4RD3A 2H3HA 2RAPA 4M1SA 1Z45A 3O2NA 4DCOA 1EXDA 4RWEA 1B15A 2GZHA 3HLTA 2Y05A 4OH7A 1F6WA 1B8PA 1A8PA 4R9NA 4GE0A 3DEAA 2GX6A 4JUDX 3P0HA 4EH1A 3I9NA 1QQ6A 1O03A 4EO9A 3QTBA 3DVRX 3LKVA 4QASA 3COWA 4MV8A 3V97A 5I7SA 4GKKB 4Q3KA 2D62A 3KWLA 3S28A 2Z5GA 3K9GA 4M36A 4L5YA 4CN8A 2G67A 4M9ZA 4EFDA 1R4MB 3EXAA 1U0HC 1KAQA 1U2DC 3E3OA 1I51A 3KQNA 4M7PA 1RKQA 2WF5A 4EKNB 4ZK2A 1YQUA 3HZZA 1EWRA 5IT0A 3OIVA 1SBNE 5B6IA 1V2HE 1XZGA 4HVAA 1KU0A 1IOWA 3MJDA 5IJXA 3FUVA 2NSJA 5B6PA 4B3TB 5LYJF 4EKDA 3OCVA 5ELLA 4NONA 1LBSA 4FEGA 5AVKA 1PIWA 4BFVA 4BDSA 5AW5A 1C4WA 4I3HA 3LX5A 3R0XA 2IYAA 4BCBA 4N5MA 4ZU1X 3RS5A 3VZRA 3H4VA 3HYNA 1EWTA 3BWCA 5ALUA 4CEIB 3TLGA 1RVDA 2AZTA 4FUTA 4Q47A 5C0OE 1GGNA 1FB5A 1M0TA 1QPGA 4FX5A 1TAQA 4I81A 4QOIA 2CVPA 4Z9BA 4KIFA 3U4CA 1IG3A 1J6UA 2HIAA 3P2IA 2OXCA 3IUBA 4WKCA 4ZZ3A 4BCCA 3GLIE 4F4DA 1YFJA 5JEEA 4KXXA 2CL0X 4DLLA 1I4OA 2R751 2VXOA 2QWXA 2YIJA 5BP7A 3AESA 5AVYA 2DCUA 4Q4DA 4MW0A 1U6KA 2PX8A 4IIJA 2A5JA 4KYIB 3IPYA 3BF7A 3CPSA 2OXTA 1PNTA 1YS1X 3QU5A 1JHMA 3GROA 2YMLA 1OX4A 4DLNA 1FBNA 1YB6A 2G1AA 1EUYA 2M32A 5E0KB 1G20B 3M1LA 1JDJA 5ARCA 2ZTLA 2BJVA 3QPCA 2CLFB 1F5NA 1KI4A 3PEVA 3GAZA 3LK6A 4QGSA 1Z5UA 4CIVA 3Q8WA 1T1SA 3TRIA 1A9YA 2L18A 1DPFA 1H66A 1YK1A 2HT6A 4GSKA 1PJZA 4PBRA 4B3FX 4LY0A 4TMXA 5TQ2A 3BE5A 1F12A 1Z7WA 2NU7A 3HPQA 5DHTA 3D4IA 1GYRA 3DAPA 4L0MA 5C7LO 1JNYA 5I9TA 1RKUA 4DHEA 1GARA 5KYYB 3B2QA 4GXQA 1E79A 3H11A 4IEEA 5IN4A 1YBFA 3IIMA 4I08A 1V16A 4ID3A 4Z0HO 4NEQA 3TK1A 1ZGZA 4Z2YA 4ZK6A 1O77A 5BN5B 2Y9MB 4W5OA 3HEMA 2HRCA 1FX1A 4XCXA 1ZJZA 1VG9B 2FPPA 1W96A 1ZNZA 3BB1A 3ETNA 2WJPA 2ZYIA 1XG5A 3V8NA 1T1EA 2H7CA 3SVLA 2VL7A 3C48A 4NP6A 1GOTA 1YS4A 1AG9A 1VHLA 2H08A 4ITRC 1H1LA 5JHGB 2J6BA 2IW1A 2P11A 2PPLA 5G1NA 4CIBA 4CM7A 3OBIA 1NIJA 2I2DA 1D2HA 1W5EA 2FEKA 4GU5A 2Q6VA 3K0CA 4MSUA 4RVSA 5J5CA 1CVIA 2QPAA 2J0UA 3N0VA 4K9MA 4TN1A 5E9WA 2FFJA 1XO1A 5BOSA 5HCIA 1R12A 1G4UR 1L7NA 5H8WA 2IVFA 1F2VA 5EPUA 1E1RA 1Q3KA 1XV5A 4D26A 3DD1A 3FHJA 1TUBB 4JR0A 3WJ7A 3F6SA 1ULBA 3M3DA 3SFTA 4NDNE 4BASA 3UQYS 2WFZA 3MTJA 3MGKA 2EBFX 3DTNA 2WJWA 2ZS7A 2WJIA 3PP8A 2PRYA 4Q39A 3ZW8A 1EK6A 4BX0A 5L4LA 3EZ2A 4RCZA 4IVQA 2AFHA 1FTNA 3QKTA 2I6UA 4J0QA 3SJUA 2Z6UA 1WVIA 5LMUB 1KZHA 4AZTA 4W5QA 1YS6A 4O4LA 4OPMA 4CV1A 3A6KA 4RY0A 4JEUA 3INTA 3IV7A 4QFCA 5E8JA 4NYMR 1OLUA 4G9EA 2GH1A 1KGDA 1Y4ZA 4P58A 3VVBA 3AVYA 4KB5A 3O3NB 2ODPA 1TW2A 1JZTA 3BAZA 4WZ6A 1ZM9A 2F1OA 2C2MA 2OBYA 2QVGA 4LGYA 3RGGA 3JQQA 4OP1A 4D97A 2FE4A 4WINA 1WOYA 1UKCA 2WZQA 4L7VA 4JBNA 3OU6A 1GTMA 1NR5A 2F1HA 2XAUA 4OXQA 1T13A 2ZRIA 4RANA 2NNLD 2D1QA 4M98A 1J00A 3E3LA 3SEQA 4A6EA 5CFNA 4DY6A 3MCTA 1A04A 1XK7A 2P6NA 3E1KA 2HHCA 3FN4A 1QGUA 2HBQA 4PAOA 4BJ3A 2YY6A 5FL7D 2IU0A 5D00A 5CVUA 5B36A 1G55A 3IAAA 5DLPA 3GLGA 3RYFB 2AF4C 2X1LA 2NP6A 4O4JF 1A8IA 3WMXA 5TEVA 2JCGA 3LVFO 3GRVA 3D0KA 3OHSX 2C2YA 5FI5A 5E0OA 4YRJA 4R83A 3VDQA 1Z08A 2PO5A 4I50A 1C0EA 4IVRA 2IS6A 1W4ZA 3QVSA 3X44A 1JKJA 4AY4A 4L50A 5F12A 2Q2WA 2EKBA 2Q4EA 3OIGA 4F1WA 4B40A 1V3UA 5TEWA 5A4KA 2CUKA 3D3NA 3L49A 3V9AA 3W5VA 2JGIA 1OUMA 3AF1A 3PUKA 2FZKA 1ELOA 2G4CA 2IU3A 4O3FA 2CLOB 1P31A 3RAGA 5I7VA 1S7GA 3A9TA 1E7QA 4GP7A 2HX1A 4Q21A 3ND8A 4EJ0A 2DTDA 5GZ6A 1BROA 5JJKA 2H0QA 1AQYA 4Z4GA 1JR3A 4HZGA 1DUVG 3BIXA 3AP2A 2B0CA 3FOEC 1Q1AA 3EVNA 2AE1A 5CPBA 1ZRNA 1JZQA 2XCLA 3GJRA 2I0FA 2XHZA 3H2BA 1N2EA 3PUHA 5CTJA 4MITA 1WMFA 1GITA 2IYUA 3WK9A 3P9NA 4Y6QA 2QR3A 2JBAA 2YJ4A 3BMCA 1EFLA 4GOJA 3A1CA 3VHXB 3WOVA 4M7RA 3L4JA 1DHTA 2KYRA 3NLLA 4RMHA 4IHJB 1RYHA 3T12A 1C9MA 3QX9A 4CL0A 3INRA 4WX2B 1T6XA 4F60A 1KYQA 4D4MA 2G40A 3GY0A 3QE3A 5LP6F 5C5IA 3CZQA 4HG2A 4HF7A 5K6TA 5K6AC 1HMYA 3LPAA 2BDEA 3TXAA 3TN7A 5E2BA 4TL9A 3ZGZA 1HG1A 4HOYA 3NUGA 4HQRA 1RQGA 3NJ8A 5KOHB 1HOXA 3PUWA 4LZPA 2NZXA 3B2NA 1FTSA 3R3SA 4OK6A 4PLTA 3RC9A 3EFBA 4EJMA 3DL4A 2FE1A 2C9CA 4KCGA 3TD6A 4CGYA 1G8FA 1G2OA 2IZ5A 4PBTA 1OBCA 4AJ9A 1NHWA 2C3PA 1HDRA 1B0UA 3RJZA 2C7OA 1KSHA 2W6NA 4ER3A 4Z54A 4EJ6A 4LDJA 1ECJA 2Y71A 3C14C 3KALA 3X1YA 4OHZA 3MPUA 4BKRA 3KLPX 3C43A 1OWLA 2CMHA 1QQ7A 3K0AA 5EMMA 4CETA 1CC1S 1UKBA 1HFKA 1ADYA 4XSHA 3EN0A 3B3QA 3L7LA 5KNCA 4IW3B 3BILA 4NBRA 4YV2A 2X1VA 4ARIA 2FQYA 3LUHA 3NATA 2OOKA 3GNSA 4UREA 2Q9BA 3UGKA 2RHDA 1ZZEA 3AEQB 2BFAA 4MULA 4AURA 1EGHA 4FW8A 5EJMA 3ZV5A 2ZE7A 1W1IA 1TYEB 4DEVA 1YS7A 1ZP6A 3DAHA 5FWXA 3RC3A 1RTTA 3SLRA 3TIFA 4MW5A 5JLJA 1PR6A 1C3OA 3FVRA 1PKEA 3R7BA 3DOHA 1JJBA 1X3LA 3QHQA 3S55A 1Z28A 5JSHA 1M34E 4L4XA 3W5HA 4NSNA 3O9MA 1MZVA 1IBSA 2HIHA 3KTAA 2JI7A 1X8JA 3VYTB 1YB4A 4AF6A 1W9MA 3HUEA 4KVAA 2B5WA 1GU7A 4WFJA 3O8DA 3CFYA 1A0OA 3L2OB 1C14A 4R2HA 2HMSA 1MLDA 1U2PA 3ICPA 5CFLA 2AEEA 4G4SO 4JJ8A 3RVLA 4ZOQI 3EGOA 5ALGA 4C5BA 1PS9A 2PMCA 3PSHA 1NDQA 1EHYA 3JQPA 1WCYA 3M8KA 4DDVA 1KEKA 1S8NA 3N8KA 5JY1A 2PUVA 1B93A 3G7SA 2PXAA 3BRQA 3CN9A 3EC2A 4PZLA 5CW1A 4E1BA 3MILA 1YI8A 1ZSVA 3FPLA 2VBFA 4FBMA 3RVKA 3ABOB 4XYLA 1GKLA 5JCOC 4ZOLA 1E4YA 3B5EA 3CMMA 1QYRA 3PVZA 2C03A 2XBUA 5BQ5A 4CL8A 4EHNA 3LUJA 1IZZA 2TMYA 5F7JA 4UQPA 1KHTA 4FFSA 2Z83A 3GLQA 1QTQA 4KHPB 5H3HA 2PUTA 2CZCA 3CONA 3DFIA 4IUBS 3EUEA 4NOJA 4R8VA 1OAAA 1ESMA 2NTYC 3IPRA 5EE1A 3WDSA 1T35A 1JJFA 3QI2A 1WXGA 3FR7A 1L7OA 2HOQA 2WA2A 3IAS1 4BNYA 4F4HA 1IIRA 2GF0A 1WSBA 1DC8A 1CLEA 2DZDA 3UGTA 5TQ0A 2I7CA 3G7NA 4NBTA 2N75A 2BMWA 1USGA 3O3CA 1R8QA 5IU6A 1NYQA 4PG7A 2J8ZA 3EZNA 5SY6A 2FMHA 3WMWA 3CRRA 4C4PA 3AV3A 4M7WA 1HQDA 4KO1S 3OEHA 3K0KA 5LMZA 4QICA 3QTTA 3QUQA 3F6YA 1RJDA 3DAGA 4Y2JA 1KMHA 1V95A 2Q8PA 1QYXA 4NK5A 1B0AA 3T3PB 4HFRA 1K6IA 3W6UA 1WABA 3KZNA 1V3QE 1VBNA 1SKBA 5BQOA 3N2ZB 3R3VA 2O8FA 4TS3A 1GV0A 3EFOB 2UZ1B 2PVPA 4IX9A 1ZN8A 3H9EO 4H0FA 4YP0A 5E9QA 1A7AA 1KY3A 1XZIA 2C2HA 2Z4SA 3SJ7A 4DKXA 2CLMB 2VTDA 5CM2Z 1L8XA 1RWBA 4IQ0A 5AW3A 5IDXA 4IGKA 1WBDA 2VJDA 2ZCUA 3STYA 2XXAB 2YS7A 3OD5A 1X2BA 1GZ4A 1O9HA 1TU3A 1ST3A 3UXHA 1ZJYA 2DWUA 3PFBA 1H3NA 1P0MA 3UUGA 3KEQA 3AZQA 4PYIA 3MCWA 2GRAA 3P2MA 3WQRA 3EVCA 2CCJA 2R8XA 3R5KA 1SCQA 2J4DA 2FSFA 5EY5B 5I7AA 3CWZA 1FFBA 1WCIA 2P2CA 1I4TD 1NXXA 3UOGA 2A14A 1YDMA 3EWIA 3EPHA 1FNSA 3ABSB 1CUCA 4C4SA 5WRFA 1K5PA 2HWUA 2PZGA 2XUQA 1R9MA 1NOKA 2PN1A 4UPEA 1JSLA 5TY0A 3TM5A 4F6RB 1JG3A 5ICMA 4KR2A 4RH1A 1CZOA 2IY9A 1G6HA 3TQCA 1XNGA 1SVSA 1ZJ4A 2DCMA 5EVJA 3AI2A 5F52A 3C7DB 4OYHA 3TTUA 2HRZA 1B00A 3FPCA 4N3NA 3S8MA 1TW3A 1NMYA 3QPUA 3DFMA 4O59O 4ZOBA 3EEQA 5B7GA 2P0AA 5AHWA 2WAXA 1SUCA 1R0RE 4FYVA 5D5QA 3DZIA 4R0MA 4M0CA 5EXTA 1UJCA 4A73A 3GRPA 3KXIA 4R8KA 5HIIA 3QPWA 2P9FA 2Y3IA 1DFIA 3O7MA 3WG9A 3D2BA 1CQJB 1WSDA 3N6RA 2Q1UA 3N9IA 3D5EA 2IBMA 2QGFA 3ASUA 3KB1A 3COJA 2UYCA 5J1TB 3EGDB 2NV0A 3FOAA 3RAJA 4L6AA 1JIXA 1UK8A 3HRHA 5DW3A 1WKCA 3VR5H 1E6KA 3F9CA 1SKYB 1QLWA 3ZVRA 5I7FA 1LI5A 5GPBA 2XZPA 5IDWA 2QY9A 2JLQA 1L5SA 4PSCA 5JJBA 2ECQA 4FZ3A 1HE1C 3PB3A 1DC3A 2IXDA 2V98A 3EWNA 3WGYA 5T6BA 5BW8A 1UPBA 1J2YA 1JQLB 1T6YA 3C24A 1Z83A 4X7MA 4YGYA 4U8GA 1QCDA 5AIAA 1OHHD 3UKJA 2BISA 1CNMA 1C7IA 1XZPA 4RS3A 5ALXA 5DM0A 3E05A 2C94A 3D4PA 1X0VA 1QGZA 3NO4A 3I4CA 3K3PA 1S8FA 5JYBA 3U9LA 3THWB 1S9DA 3O4JA 3A10A 3JXEA 2VSQA 4M1MA 4J2OA 1LDBA 1IM2A 2VBCA 4NVRA 4RFVA 4PSDA 1DB3A 1DXQA 1E2IA 4H6XA 2OXFA 2HD4A 3PFNA 3IE2A 4ZTBA 4O4HB 1L7VC 3VU3A 3TDMA 3KD2A 1T8SA 3SVTA 4EO4A 4HNRA 1YKFA 3KD3A 1GGEA 1L7RA 2BMFA 4BKMA 4LJSA 2X13A 1QQBA 1WJGA 2A1TS 1JEEA 3EWSA 3PXDA 3LMKA 4KRYA 3TLKA 3ZWKA 4L1KA 1EBBA 2JFUA 3E2IA 2I22A 5ALHA 1EHIA 2G8LA 3C6XA 1N57A 3OECA 4INPA 4Z0NA 5IULC 5KWSA 2X6QA 2P62A 3FWNA 4II7A 3K96A 4COKA 1UXGA 2SKCA 4RK5A 3D2CA 3WK5A 4E5NA 1YT5A 4QWWA 1J8MF 4BYGA 1V5WA 3KQYA 1TTTA 3UBMA 2GJAA 4ROTA 3EIQA 3TG2A 3M2TA 3OZ7A 1UXIA 2GI4A 4ZJYA 5BQFA 1RCFA 4FYYA 2RBKA 3B38A 3IXMA 3UUEA 3ZTYA 4FNGA 4R5MA 5KZMB 3ICEA 4AG3A 2I9PA 1ZHHA 3TAUA 2WP8J 1M2EA 3NWEA 2VDKB 1Q2UA 4CT4B 4BO2A 4LC1A 1U3WA 1C81A 2QK4A 4E2ZA 1NASA 4QYTA 1GTRA 5CIQA 4L57A 2Q6OA 4ZODA 5AT1A 5JZ9A 1W46A 3K8OE 4YJDA 3A4YA 2PWBA 5FR2A 2OC4A 1FDWA 2QSUA 1CEXA 4QOHA 4R51A 5ENDA 5I5EA 4KFSA 5FUYA 4JUIA 5KNBA 5LSAA 2KLHA 1GA6A 1YC5A 2B8TA 2IK8A 2B99A 1E20A 5H68A 4B5LA 4TTJA 1TZMA 4V3CA 1FFCA 2CJWA 3G02A 3BJMA 4OQZA 3ZX5A 3CH7A 2C04A 1S7CA 3ZZ1A 3PDIA 1ZMXA 4PYNA 3H97A 4GOND 3VYUB 3OJEA 1Z38A 4H4CA 1YFLA 5HVNA 4IJKA 1IPFA 3N7TA 4OP2A 5EIAA 3ROQA 4BO1A 5BSEA 4LZWA 4M0UA 3KJQA 2AG1A 3L6UA 1ZW1A 4DZZA 4GFDA 4ENTA 3DDHA 1PQ4A 3AUAA 4HDCA 3A4TA 3TPFA 2ODQA 2XUZA 3FFAA 1L0BA 4PINA 3H19A 4TT8A 3SC4A 3CNEA 1PFWA 1CK4A 1ZJ6A 3KYDB 3E48A 1TT7A 5H4HA 3KP1A 3G9XA 1VI5A 4XJVA 1TM7E 4J6FA 4CF7A 2CHVA 5ADUS 1MXHA 4ONEA 2NO7A 4F1KA 2ZRDA 3P2EA 4ZAZA 4C20A 4DN6A 4Z4IA 4K88A 1KZ9A 1LBTA 5KMGA 1D7OA 2WSYB 1SD1A 4G5OA 5B2EA 3DV2A 1QO7A 1IWOA 1XD9A 1Y81A 1JWLA 2F9MA 4OOEA 3WLPA 4FE7A 1DI0A 4KRGA 1A9TA 4ARVA 4IXTA 5I6DA 4IVPA 4G65A 5CB4F 1GPMA 1SBTA 3RS4A 1RP7A 4C4YA 1JDPA 2JCVA 4ZIRB 2O3UA 4ATNA 4UAUA 3H1FA 4LHSA 1Y3DE 1DX4A 4OQEA 4BNXA 4C9BA 1K66A 2AUMA 3EXIB 4XYGA 4B84A 5A4IS 1Z33A 5CEFA 3HLYA 1BQ3A 4K9DA 4YQYA 4HGOA 2A0XA 4MVJM 5AMXA 4A7PA 5C1BA 4DJFC 3FM9A 4MI3A 4M2LA 3QBVA 4JLVA 2GRUA 3VJLA 3WMGA 1JA9A 4D5GA 4Y0VA 2ZG6A 4X65B 3OWOA 4B2YA 1OWNA 2DEUA 3COPA 1SXIA 1EBUA 2BEVB 1G42A 1XVAA 4LDPA 1TT5A 1ZH4A 5FBWB 3LDAA 4S35A 4URYR 1JILA 1W4AA 5GWXA 4YYEA 3SQNA 1FRVA 3DVLA 4YJ3A 1O9BA 1V8BA 1YR1A 2AVDA 3KKQA 1PT5A 1JBKA 5IWAB 4D4JA 1RAAA 1WEHA 3VH3A 2E4XA 2ZB2A 4M0KA 2A0KA 5AKHA 4PC2A 3GLTA 5SY9A 3TZKA 1ZIPA 3QNWA 3P0EA 1UADA 3MGGA 5BV8A 4IFEA 4OMUA 2VIIA 4IJ5A 1G21E 1AA9A 3EXFB 4JLBA 2OBLA 1PQWA 2QX7A 2VZ0A 2YXNA 1CV2A 4GMHA 3FG9A 1MABB 1SCNE 3LTEA 2CVZA 3GLSA 1KP9A 2IS1A 1BEEA 5KVVA 2B69A 2Z08A 4YMIA 3RAEC 4S24A 1Y9ZA 4QC2A 2OMKA 4V0NA 4F04A 4F4CA 5DX8A 3TD9A 1CEEA 2Z09A 3U37A 2PLAA 5IYZB 3L05A 1EUCA 1ZI8A 4YAFA 4Z2AA 4KE7A 3I2IA 2JIDA 5AI8A 3A4LA 4OEHA 2ZDGA 2H5LA 2EL9A 3G5TA 4CV0A 3U60B 3HO8A 1TCAA 1CY0A 2OHFA 1L7EA 5LXTA 2VHVA 5FPYA 4HFMA 3DMHA 2QD4A 5F7XA 5IASA 1MJGA 3TZEA 5DJ5A 3KQWA 5JPDA 5DI3A 3IXQA 1Q0QA 2WWHA 4WLOA 1DP4A 2NLOA 3I2JA 2X42A 2B78A 3CW8X 4LXIA 5AVRA 2FEOA 3W05A 3I9FA 1SZJG 2PIDA 3BGSA 5DMHA 1QU3A 3OZDA 2VJBA 4K8OA 2CHUA 4RY8A 3AG5A 1FY2A 1WXEA 1WDWB 2RAFA 4ZFNA 1UJ5A 1TUGA 3U4QA 3HYLA 3DVQX 1UDXA 2CHFA 4RE6A 4YRQA 3TTXA 1SXJB 4BEJA 3CNNA 3GVPA 3JWIA 3H6HA 4FI3F 1U1EA 4Y1RA 3UAZA 1LGYA 1O0CA 2AT1A 4MPPA 4D57A 4E13A 4WGFA 4Y6SA 3PNBA 2NO0A 2GTIA 1U9IC 3AIKA 3HHEA 4IDGA 2WHXA 2EX4A 4WRRA 2PFGA 3BQ9A 4R4JA 3K72B 1ENOA 4WKNA 4CM1A 5LYJB 1IEWA 2QTZA 5JASA 2JLUA 4L3WA 1QH0A 3T3OA 3KTDA 5C52B 2UXBB 1ULSA 4CEHB 4OAQA 2PRJA 2AC4A 1XMSA 4YJHA 4KGDA 3BSWA 1KS2A 3HA2A 5FFNA 3ROPA 3HB4X 3HABA 3PRKE 3PRYA 1FYDA 3OA0A 4HNQA 4IV0A 4Q1VA 4F46A 3FCOA 4FCVA 4L0CA 5LCXA 3IQGX 4JDUA 5EUCA 1I3KA 2JDID 4DA7A 2PLFA 2GO7A 2XSZA 4PHTA 2OHGA 5IMBA 1MAWA 2EFJA 3VC1A 1JB1A 3GEBA 3OPYI 4PGMA 4R1TA 3QBEA 3SHTA 2J45A 2NTVA 1B3RA 4PV7A 5KAMA 4A6DA 4NXMB 3UUWA 3HXOA 3A6HA 3ZBUA 2JRLA 4N8DA 4B73A 4C1BA 5AHOA 5KREA 3CW9A 1O57A 1WLYA 1HO3A 2DPYA 4IOJA 2P2LA 3AUJB 4Z51A 1AUVA 3I6ZA 1CB0A 3SDBA 4MYTA 4QE3A 1GKKA 4F4FA 5KVCA 1T34A 1W87A 5IDVA 5I7EA 3WAJA 3TLEA 4MUIA 4F3RA 2BGGA 1N2SA 5I4CA 4S0XA 4NCKA 4OMFG 4N5HX 2YXDA 1WVGA 1DGQA 1NUSA 2DT8A 1K4YA 5CB8A 2R96A 1FXWA 4BMNA 1E0JA 1YRQA 1GAXA 2JBWA 3QUAA 2QVZX 1T0IA 4U63A 1QBGA 1Q44A 4RHCA 2P35A 3M9XA 1XQWA 2Q07A 2DFPA 4QDXA 4TRNA 4D0LB 3N70A 2HXSA 1FJHA 2FW1A 4M89A 2A7XA 1XTUA 4OI4A 5BT9A 2E1RA 3JWGA 4H7HA 5ED0A 2PPVA 4FGWA 5A2GA 1B4DA 3RH0A 2XVMA 5U9CA 5JS1A 5HJ2A 1PRYA 4UMVA 4BWGA 3OFVA 2Y27A 1KZYC 3LGAA 4CTJA 1QLJA 2ZRKA 2MIIA 3HYSA 1M7BA 2FPSA 3L4KA 3PUIA 4MA0A 3CINA 5CX4A 1YL5A 2Y1WA 3M5WA 1FP7A 1V3VA 3VSAA 4OYYA 1Z18A 2OBXA 3ZKAA 4LJRA 5A3JA 1R9JA 1E1DA 3IR7A 3DC7A 1U3GA 3QNMA 4UEWA 4LFBB 4NY1A 3IAM6 2EX1A 2ZJOA 3L7NA 4TM8A 5TLSA 1T6ZA 2ZBUA 3LCVB 4OJTA 3DVSX 3VHLB 4UHBA 3T95A 3B9BA 1G8GA 1HE5A 5E4YA 3PNYA 1NMEA 2QN7A 3O82A 3H18A 2WAYA 3C8DA 2G72A 1VJCA 3ELUA 3EW9A 2OG1A 3UK2A 3G68A 1TM1E 1I3CA 2X0NA 4X24A 3QQ5A 4B6RA 3CO0S 1VL8A 3P0IA 3KKMA 4KLRA 1U04A 2HQBA 5EJGA 3BXZA 4ZZ2A 1RLTA 4FS8A 1I3LA 1XGKA 3FH0A 2IE0A 2OVBA 2TMDA 4H7IA 2YV4A 2D1TA 3QU9A 1GT91 1HL3A 5IJZA 1XROA 4PFQA 5ESWA 5K4GA 3RF6A 3ZQKA 5JWOA 2BLNA 1YVDA 5TARA 2I91A 2R87A 3R5FA 3CX3A 3GGDA 4YQZA 5T4HA 2C98A 1QE5A 1T2CA 1O58A 1NVWQ 1UM9A 2E4VA 2ZWPA 3ACBA 1DQRA 3DKRA 4LZLA 2JIPA 1U0OC 4GQAA 3EVGA 2FWPA 3HJNA 2ACVA 3RK4A 1DC4A 4PYJA 1FX0B 4EO7A 2V3CC 4O5OA 2MJLA 1XNJA 1Q7GA 1YHYA 4XE5A 3PIRA 4JP2A 3H04A 4UASA 3PHLA 2ZYTX 1A71A 2VWGA 4UFNA 3R9IA 4D9GA 3F2VA 5HILA 2KQUA 5GONB 3QH4A 5BNZA 1W85B 2I34A 3H5TA 3INYA 4G5QA 1YR8A 1GGJA 1WDTA 1XAHA 2SCUB 2VC2B 4BLQA 2VF2A 4DLKA 1PWXA 2QW8A 2QRVA 1TGVA 4A23A 1G9SA 5FUVA 2DBYA 3WGUA 2OILA 5FA5A 4ZVRA 5EERA 4P7JA 3E3MA 4IWNA 2XDQB 1XZ8A 4JUFA 3BRWA 1P1KA 5M04A 2GEVA 2O7SA 3PYLA 1EK1A 2HMVA 3R3UA 4NMMA 3PJRA 3JVDA 2RD2A 2BMEA 3TW0A 1R5NA 2C5EA 4YLYA 3ZEIA 1FCJA 1QHXA 4AJNA 1OI7A 1IH8A 3K4PA 4EA7A 4F9TA 1XYGA 1RHKA 3FPHA 1T8UA 3A1TA 4P7KA 4R9SA 4BEVA 4ZTUB 3BKXA 4N47A 3TG8A 4N54A 2XQGA 3V7NA 2IZ6A 5B7QA 2Q49A 1RE0A 1WNFA 3AF4A 1RADA 3EQ8A 1VSUA 1QP4A 4FYJA 3DQQA 3LGSA 3TEMA 2ZIZA 3HQ4O 4G81A 3GVIA 1IN4A 5I9IA 1DKUA 3QG5A 1P1IA 4JX9A 1FRZA 2V6MA 4UZEA 2C4KA 3CUKA 4Q03A 3WYBA 2QMOA 2V7QD 2HFKA 2R85A 3EVBA 3QVJA 4HGZA 4FMBB 4QUEA 2I67A 1JDVA 4QPZA 1SEPA 4LRYA 1IY0A 3FMVA 1GXSB 1XVLA 4EZBA 3W9YA 5KTMA 3GLFA 4D25A 4AI6A 3W79A 1Y7HA 3QPBA 5KNCH 1ECFA 3NM5A 4YCDA 5EEHA 1YVPA 1GPAA 2ERYA 5F5LA 1DZ3A 3P9RA 2WJGA 5EHGA 4AWXA 5JMWA 4LRTB 4HUQB 4D02A 2QDXA 3ZD7A 1JFFA 3A05A 4A0RA 5BN4A 3O95A 1SJ9A 1L4LA 4MS4B 5KYWA 2JLCA 2X86A 2ATCA 1DXYA 2OCDA 1CNEA 3ESXA 4B34A 3KKZA 5LP6B 3R2JA 4RPCA 3ZV6A 1EM6A 1KI6B 1U2DA 1L5HB 3AVOA 4V0KA 4XYMA 2JJ2A 3MB8A 3WLSA 2R7AA 3IXLA 3COZA 4KO3S 4UC0A 1J24A 1H85A 4MK4A 4XCVA 3F73A 1E2BA 4BB5A 1WULS 3CVYA 1WPQA 4IYRA 1RZRA 2VHYA 3M1IA 5K0SA 2VS1A 4HGRA 4IIEA 4FCWA 3AF6A 2A57A 1VZ2A 4ZANA 1KHHA 1P9OA 5GINE 2GEDA 3JD4A 2EZUA 3Q6IA 5HX7A 3EZLA 1GQYA 1XU4A 2OHIA 3FB4A 3ZGLA 4BNUA 2WM8A 4ZGWA 3P45A 1KYXA 2NZWA 3A06A 3LBNA 3P9CA 1KZ7B 2P67A 2QTWB 2O2GA 2KBFA 1F7UA 1YZ3A 4ABTA 2OK7A 3U3OA 1X70A 5DWQA 4E21A 5K8VA 4U7JA 4YP7A 5IDQA 3TS1A 2DERA 4A10A 2GAAA 2XMRA 3NWPA 1DUSA 5HCUA 5BRJA 4JV5B 2GUGA 3DD5A 5CM9C 4P4LA 4ZDWA 1E3QA 3ZBQA 4JNCA 3OTIA 1FPQA 2VOEA 4G84A 4EATA 2R00A 4F5EA 3MWFA 5CA0F 1E1NA 5PNTA 1J21A 3CISA 5A4MS 3KSBC 5JSFA 1DT5A 1DXOA 1IYZA 2I80A 5HF5A 5LQCA 1FIUA 2AGVA 2H0RA 3IO5A 4KRXA 1XT6A 1VHQA 3MW8A 4LJ6A 5AKKA 5EP1A 1W94A 2PX2A 3QI7A 3ZS9A 3NUQA 3D6FA 3DUFA 2D54A 3G5LA 1XN4A 3DMNA 3KOMA 4DG8A 2GZ1A 4XRRA 3OQMA 2QTAA 4P3OA 5ALYA 5ECWA 2WJJA 3L0BA 1B6RA 1EG7A 2EDCA 1UMDA 3CX7A 1QIMA 2DKFA 3C41J 3ENKA 3F4BA 1ISJA 4PHFA 5DCUA 1KMMA 1KARA 1VMAA 1NXQA 3DUWA 4R6WA 4HEHA 4LE2A 3KUUA 5CLQA 1EVLA 1LBHA 2J3LA 4ALJA 4CLXA 1W88A 5E7IA 5LFAA 4ZXFA 2F48A 3C7TA 1LZLA 3VOAA 1VA5A 3E53A 3WJAA 5K05A 1AK2A 4GPIB 2D2XA 2O05A 4CQMD 2PRZA 3CLHA 3A70A 2QTFA 2A5GA 4G37A 1U5AA 3F8WA 3K9NA 4ZOAA 4HI0E 2OUKA 3OEED 2CFCA 4Q0MA 1J9ZA 3PD1A 3N75A 1PR1A 2IE8A 4GLFA 4AD8A 4LFAB 4IGFA 4FQ8A 5LP1A 3HCDA 2ZSFA 4AM8A 1ORHA 4MWDA 4MIYA 2ESRA 4EW2A 4P7BA 1TA9A 4KXMA 3DO8A 3IMGA 2QJOA 1L8AA 3U3JA 1GQRA 2HM7A 3FTNA 1B1CA 3Q10A 2GASA 4HTFA 1TC2A 4LWZA 1LW6E 3IH5A 3I45A 1N1MA 2HRRA 1HZZC 4DMRA 2YJGA 4JT4A 1XDUA 3N8GA 4W9RA 2Q8NA 3PLNA 4MQEB 1DKOA 3C4QA 3FPFA 5H82A 1BWSA 4G0YA 1Z2DA 3SE0A 1JXAA 4EG5A 5IUNC 1SQ6A 2QRJA 3MT0A 3RS3A 1JH8A 2OQVA 3V4SA 1QS0B 3ZW7A 3NHFA 4HDKB 3LIIA 3A0UA 4M8KA 1UJ4A 2BF4A 5JIBA 5JNWA 5HTOA 1A2KC 1R4AA 1EFPB 1MRZA 3WGNA 1JN0A 5L8VA 1CY2A 1JIQA 5FF9A 1N3IA 2FETA 2DHDA 5L40A 4AP6A 4PRYA 2G08A 2GZMA 3RUFA 1WHTB 5K9ZA 2ZZNA 1WXFA 3I6YA 1L5OA 1SXJC 1VYTA 3PQEA 5BXQC 1TMGE 5ARDA 3T1VA 1HNXB 3E9CA 4AXXA 1P75A 2R3SA 3I52A 1MNQA 4FCCA 4A8JB 5HS6A 5JAIA 3MWKA 1EFRA 4HX5A 2ZUSA 2GVZC 4OQLA 3ZE7A 2F55A 1TEXA 2EHDA 1NT2A 1F4PA 3CNLA 3M33A 3ZWMA 2C3YA 4PY2A 1M7GA 4KXNA 4Y2QA 1G0OA 2R47A 4D9KA 2CFSA 3IC5A 2GLUA 4FFPA 2X5KO 2I4RA 4EYKA 1OU4A 2WZDA 4YRCA 1G6KA 5DYIA 2CXSA 5HK9A 1EKXA 3QRWA 4BQNA 1RQ2A 2CXRA 5B7PA 1SVIA 2GB4A 2DPMA 2FN8A 1WAMA 1TD9A 2WJZB 3K20A 3LFHA 5HMMA 3IESA 4P4SA 5EJEA 1QYWA 3URMA 2IH5A 4KPYA 2RDMA 5AXAA 2DETA 3ZCVA 4DQVA 2HO4A 2P9GA 5CFZA 1BTOA 1RM5A 2OAEA 5CA1A 1JFTA 4I4TA 5ALTA 4FGJA 1GAWA 1H6AA 1KAOA 5F9FA 2I6XA 2XGOA 2XB9A 2DF8A 4PGFA 1Q11A 5K2MA 3T0GA 4D9JA 3NHZA 5KTOA 3VR4A 3AKDA 5LZ8A 3KVOA 4NZPA 5IAAA 2C54A 3F1KA 5KIAA 9LDBA 3QOFA 3WGIA 1Q0HA 4BWYA 1TA4A 1CE8A 3PI6A 2ZP1A 3CUEF 2FKNA 3BBLA 3DFKA 1M54A 1PR0A 2OV2A 2XNDD 4Q6WA 2ZB4A 3RT7A 3BYZA 1YDEA 2XCQA 2ZBFA 3JQFC 3W7AA 1XKLA 1ZM7A 3F7NA 3UC5A 4CKBB 3OA2A 4ZT5A 4MI9A 3RTEA 4H0NA 1FJXA 1RXEA 2GWRA 2P9JA 3KXDA 1H9CA 4X54A 3UAXA 3MT7A 3V2HA 4C0JA 3C6KA 1WU7A 2GAOA 4YV0A 1M1NA 2Q50A 4ZKDA 1JF8A 1UDBA 2AMLA 3DCJA 3WK8A 1R8SA 2ZAOA 3ONNA 3G2JA 2KJQA 3OO0A 4IMRA 1OZAA 4ECEA 1A7JA 1MX5A 3GDFA 4NYIR 4G1BA 1GYQA 4KXLA 1P4HA 2QVLA 2ZVPX 1ADJA 1CUEA 1U7TA 3I1IA 2X58A 3EXHB 1HT2E 1XAGA 3B1XA 3AW9A 3M9LA 3PXXA 3R5JA 4ZRNA 3TVDA 3ZS8A 3O0TA 1XEWX 1SR8A 3FYSA 2CYBA 3HBJA 1SG6A 1ZW6A 2V0CA 4RSMA 5D7NA 2PIAA 4E12A 4XDHA 2ZPTX 3ECSA 1RC0A 1XDWA 3MFYA 1XD8A 3ILHA 3NHWA 1OI3A 4FDMA 4EL5A 4RJ2A 2Q2QA 4X3OA 3IVXA 4JP5A 4BVKA 4CCAA 5JVDA 1L1EA 2QLLA 2FPUA 4HQKA 5CRIA 2FR8C 2FX5A 3T4XA 3NHPA 3J7AC 5K6AA 4MRSA 3ONDA 1BX0A 3FCEA 5KNBH 1TB4A 3OMLA 4KKXB 4BO8A 2YINC 1A98A 4HNUA 2PT6A 4YN3A 5B4UA 1G8KA 4JVOA 1QZXA 1YL6A 3Q2KA 3VISA 5AESA 5HR5A 4LNAA 5JAHA 4D6XA 1M66A 3PGVA 4UCWA 3WK7A 2IU4A 2GNAA 1E2GA 2C2XA 1Y48E 1MUUA 1NVMB 2RGBA 3JQGA 3P2YA 3MMXA 3WBFA 2CLEB 2I1QA 2PWYA 2Z1DA 1DDGA 5EMKA 5ISMA 3B36A 1BE0A 5H0IA 2AFHE 3V4FA 2P6PA 4QUGA 5AJWA 5TC4A 1WXDA 3ZU5A 3AIIA 1OYWA 1FYXA 3IUPA 1LDMA 1T3LA 3VDRA 3FF4A 4B87A 2FH5B 3FUUA 1V11B 3AGPA 5FQNA 1RIFA 3ZKWA 2C96A 4UVGA 1GNPA 1XA3A 2IDZA 2ZYDA 2Q4DA 1T36A 1ZSNA 2QMHA 1JIUA 2VAMA 3MNFA 4W1PA 5LQDA 3R9XB 2YWDA 3P26A 5MN6A 5BUZA 2Q5EA 2G25A 4P22A 1K5HA 4W99A 2OFFA 4N7BA 1SCKA 3IP5A 3K1YA 4YRZA 1AGPA 1ZRMA 2OBMA 2AE2A 4MW2A 2D59A 5HDQA 1U3CA 4AC9A 4TKUB 4OG2A 1XVUA 3IRVA 3L7JA 1MB4A 4WBSA 2RJOA 3NETA 2IIVA 1QH8A 3AP1A 4YJ2A 1ZI6A 2DP4E 1MRNA 3MTAA 3I04A 3IQZA 3AM4A 1EK0A 1YL7A 1IK4A 1TJ3A 1C3EA 5B58T 1U9ZA 1Y4DE 2HU5A 2NZ8A 3Q8LA 1CLUA 1CZKA 2XWSA 4JWTA 2CXQA 1R15A 1W93A 3G17A 3K2EA 2QRNA 3QOWA 4DM7A 1H3EA 1Q6ZA 2BAGA 5JV5A 5HKLA 2HQRA 4B31A 4HDSB 1GKUB 4ZALA 4JWKA 5JYDA 1Z2OX 4INZA 4LHWA 3R75A 1L5WA 1X13A 3RYCA 2GS9A 3R3ZA 3VC3A 3PU6A 5FNVA 1LSUA 1R6TA 4PU0A 4D8UA 1E2HA 2W9XA 1XP8A 3KEFA 1X7XB 2I2CA 4NEGA 4ZMSA 7REQA 1YZGA 4QJ3A 4KLZA 5FUQA 1A8HA 5JBNA 1M0SA 3SBDA 5IXYA 1NG9A 4RORA 2YHIB 3NV7A 5JCOA 3HVKA 3VPSA 4CF4A 1BFDA 4DC9A 4M1KA 1DPGA 4FBGA 4IDPA 3IA2A 2YN2A 3BICA 3G89A 3AQ4A 4P3NA 3GK3A 2WFAA 1XTPA 3TZBA 2XF8A 2WLTA 1E2LA 1GZ5A 1Y5NA 4HH0A 3ZBTA 1NBHA 2YQZA 5AM3A 1V8PA 1YZTA 3QLVC 1DFGA 3ZNQA 4FHCA 2PKWA 3TQIA 4TKVA 4XJSA 8OHMA 1DBSA 1JR3E 1RD4A 4G1EB 2ZVQX 1LF5A 1VSQA 1PW5A 4FQ5A 3WGVA 5UKDA 4R68A 2J9ZB 2PSJA 1DT3A 4DILA 2P2GA 2X0FA 4CTOA 3HA5A 4K05A 2WPNA 2XA9A 4S3MA 4UHKA 4OXXA 5A5FA 4B2PA 1L5KA 4IFTA 1TNDA 4MEBA 3F4KA 4QFBA 2ZBGA 1EU1A 2GEBA 3H84A 3C3AA 4MS1B 1RAIA 3KOUA 3SEAA 3D6NB 1P7YA 4Y7DA 5JMPA 4C88A 1VE9A 2VKTA 1SMKA 2QROA 2BD0A 5IH7A 5U4QA 5LP6C 1DADA 1ITZA 3SSAA 1R4MA 5LZ9A 2CSUA 1P77A 1COWA 2VA8A 3LX4A 1M6HA 4BKQA 4BNIA 1QIDA 2IDMA 2JGFA 2IEDA 4YLGA 5G4KB 2CYCA 1N5MA 1PL0A 4U5XA 3O75A 4JJIA 2VF7A 2MSEB 3H2GA 5GM1A 5C8YF 4CXMA 3LZDA 1R18A 3X1WA 3MQ2A 3GH1A 3Q3IA 2RAVA 1N2ZA 4I6GA 1KPHA 4I5GA 1IK6A 2B4RO 4NE2A 3F5FA 3OM0A 4UJ5A 2WWIA 1YR9A 2TECE 4TWJA 2C5HA 1EAMA 3BEOA 2HCBA 3H9QA 1VLVA 1QVAA 3CRW1 2R5FA 2YZGA 2PGLA 4AJKA 4ZCRA 4CEIA 2IS4A 4JKYA 2HNBA 1BU8A 4NHEA 4N39A 1JWAB 1QLHA 1TYZA 1ZOOA 2II6A 4JU8A 1M5UA 3EEIA 1ZX1A 3UKDA 2NU9B 1KC3A 1H0SA 1SU7A 2VRCA 5AXCA 2C31A 4UBIA 3RADC 2FRXA 2FOLA 4P31A 4FSXA 1YF3A 4EGJA 5FBVB 1YRLA 2M6SA 1NMZA 2ZRBA 3BJRA 1N0VC 5CLHA 3OLXA 2HU8A 1L4UA 1EFAA 4QRIA 1CNFA 2W6CX 2C4HA 2WU4A 2ZGVA 5DWVA 3RQIA 2WSBA 2Z9BA 1LRJA 2IF2A 1XDZA 2HQSA 1L7PA 1VIVA 2H92A 3GNLA 1CU1A 3P7MA 4TUYF 1WBBA 5DM60 1G20A 3T9FA 1I2BA 2Q3BA 4GR4A 3U17A 5JZMA 1GUDA 3ZWXA 4A8PA 3OIUA 1Q7EA 4H1HA 3QMWA 2QRUA 1I1NA 3ET4A 3ZIAD 2OWEA 5DGXA 2G63A 2VF5X 3MAJA 1EZ1A 3ROGA 1SUPA 3CM0A 3F0TA 1E1CB 2AL7A 3ANLA 4U7TB 4HAIA 1T8PA 4JKOA 4X66B 5GJVC 1MV8A 4XYEA 5LA6F 1IZ0A 5KYYA 4AU1A 5J63A 2O8DA 3EVTA 2W6JD 5EJ8A 5COBA 2VT2A 4XASA 1PFYA 1SUEA 3GT3A 3ZDYB 3Q3JB 1E3LA 3ME5A 3MJSA 4P6VF 3R7NA 1Z26A 1PUIA 3WS7A 4DPMA 1FJGB 3LC1O 1MVNA 2QUKA 2HLNA 4W9NC 1OV6A 4C06A 2JH3A 4OXIA 1AKRA 2RGWA 4PFJA 3IVAA 4TLLB 4Y30A 2GF2A 2XRZA 1FFWA 4MJLA 4OF4A 1QGOA 1ACMA 3KBOA 3O93A 3Q11A 3U4HA 4DV4B 2ZCJA 3DEJA 5ICFA 3L0PA 3VRHA 5BXYA 4PO3X 2FPGB 4PX5A 1U6JA 3PTLA 5LQMA 3FI0A 4J03A 5BWLA 2XMQA 2JJ8A 3I8OA 3IQWA 5C81A 3D6MA 3MRVA 1PJQA 2J33A 2ZRPA 3KSZO 2G0AA 2GZAA 4AKEA 3EGXA 3CIOA 4MP3A 3ULKA 1PJRA 2G5TA 1R0WA 4K2HA 4IFIA 4WFIA 2R1TA 4YREA 3N5CA 3E84A 3G85A 4Q00A 5F3DA 2YVLA 4HAXA 4BATA 4E0BA 1RNLA 4J3FA 1FL9A 1HNWB 3C3BA 1N8KA 4R71A 1KYTA 3E9NA 2IELA 2H3EA 1MC4A 4US1R 2UUCB 4S12A 1X1BA 1E9RA 3OWXA 3OCUA 3LCUA 2O50A 2YWRA 1LA2A 3WTBA 5K2OA 1CDOA 1P1CA 4R05A 1YNSA 5K6RA 1RZUA 4I14A 1UXJA 5FWYB 5A6VA 5DTMA 2PKRA 2LTAA 2WA1A 4FW9A 1W29A 5TB5A 1N8NA 3RHSA 1Z6AA 5DULA 4RTKA 4A8JC 2FPLA 2HK8A 1XDDA 1Q3TA 2QE7D 4JY7A 1BCRB 1XQVA 1GPUA 3IKLA 2YJZA 1E92A 4XD7D 2QTTA 2H9AA 5FUBA 1KWGA 2HA5A 2NAFA 3H42B 1Y3AA 4UDOA 3W2GA 3E22A 3IKTA 2JA1A 4Y1EA 2JFNA 4FDVA 1N6KA 4BJHB 2WJVA 4A6PA 1F4VA 4KJZA 1T5DX 3PEFA 3GH3A 3HU1A 3NGMA 3CZ5A 3SZUA 4YT4A 1JECA 1ADFA 1FP4A 1S2MA 1YIDA 1E64A 3TTWA 2YJ3A 4JA2A 4OLAA 1FDRA 2DC1A 3CH6A 3I34X 4PC6A 2PNJA 2AJTA 3DTVA 1HOTA 1ZK0A 5IJ0B 3MJCA 4XDZA 2V7TA 1GRQA 2FU5C 3MS2A 4FFVA 1FYWA 1LD3A 4HDRB 1AKWA 1EUDA 2O7RA 3PTZA 4KX5A 2LKCA 3BHMA 3DZ8A 3LNCA 3DG9A 1P1FA 4LE0A 3X1DA 2H1FA 1J8YF 1HDYA 3TFOA 3RYFA 3WL4A 4S1WA 2YZKA 1B6TA 4ND1A 2W4QA 1OZ0A 1ZIXA 1XTRA 1RC1A 2W90A 4KL8S 3SFVA 1AKQA 3BCHA 3KVYA 2G28A 3L7IA 4JHXA 4G0MA 2CDNA 5ADVA 3P8ZA 1QPZA 1X3SA 4Q4JB 1XYVA 1QH1B 3WZ2A 1Z6PA 3IHTA 3QHPA 5BUCA 1X9HA 2CCKA 3QLTA 4MLCA 1W2GA 4L75A 4RZQA 5IT4A 5JNLA 5G0WA 5HJEA 3L7DA 3RC1A 3PZBA 3GJ0A 2RCNA 1WDMA 1ZKDA 2DWCA 3BFJA 4IV8A 3NXKA 1BYUA 3H2HA 3G5MA 3R7DA 2GYVA 4E03A 1DKQA 1AQIA 5KOIA 4JAVC 3ODPA 3L8YA 1QANA 2GZSA 1N2GA 3NTOA 3OZCA 5E95A 4CQMB 2RE8A 1KR2A 3T1TA 1VPTA 2UU9B 5IM4A 3JD2A 4L78A 5J2TF 3RD5A 5JECA 4LY6A 2H59A 1GM5A 3EXHC 2ZI5A 3C3XA 3KDSE 1HKHA 2WM3A 1IXKA 5LZ2A 5BQ3A 1J56A 4MTCA 5AVQA 3MXTA 2ONKA 4BTVA 3NH9A 5I01A 3HV0A 1DQNA 3KV1A 2XDWA 3UMCA 3BJIC 1PS0A 1RWOA 4LAFA 3CR7A 4LZAA 5YASA 5K5EA 4B4DA 2XB6A 1B74A 4UOEA 2PGDA 3PJGA 3D59A 1Z4MA 1HE8B 5F23A 2OQIA 3RKUA 4YK7A 2W58A 2JFBA 1KERA 1NJGA 1F38A 2NUTB 4YV7A 1XRMA 1SOMA 4PE5B 3V8VA 1MH9A 3JYHA 3RV4A 3M81A 4CFSA 2IXTA 1JAZA 1EB8A 4IEFB 5MFZA 2MMCA 1CYEA 2JJ1D 3JAKB 4LVUA 2OCAA 4MUJA 2YWBA 3EPJA 4EWLA 1V9LA 1K97A 1VG8A 2DPLA 1QK3A 1X77A 4K2AA 3EGIA 4EI2A 3UJDA 4YALA 3RJMA 1P1HA 4DDKA 1B23P 2GUWA 3FZQA 4CM9D 1U2ZA 5EA2A 5B1EA 2PAAA 3A28A 1HSOA 4EI7A 5HFJA 3OF2A 4E07A 3MCVA 3LXRA 4I19A 4QUKA 4ZVQA 4KDCA 1OX6A 1HF3A 3VUEA 3KWMA 5ALPA 3SYLA 1DBWA 3I6MA 1YZYA 4CKEA 4MWTA 1A8UA 2EBHX 2GN4A 1FZTA 5C80A 2FQXA 4TYYA 4RO0A 4QSMA 1WPRA 4L2IA 1V2GA 4DABA 1ZWLA