3E0XA

The crystal structure of a lipase-esterase related protein from clostridium acetobutylicum atcc 824
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
b'SNAMLHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSMGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFMEKIYHNQLDNNYLLECIGGIDNPLSEKYFETLEKDPDIMINDLIACKLIDLVDNLKNIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase-esterase related protein
publication title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e0xA00
2XUFA 5DYYA 1QE3A 4JEIA 2H1IA 4HRXA 4BAUA 3D2BA 3WJ2A 2XMQA 1E66A 1ZOIA 1QIDA 3R41A 4DNPA 5AKKA 2WUGA 3K9BA 2OPHA 5A7FA 4FLMA 4FNMA 4BTVA 4JH0A 3FNBA 2JF0A 1EDBA 1U2EA 1E5TA 2WG1A 3WKAA 1MT3A 2EDCA 3DS8A 4J0IA 3M3DA 1VA5A 3HZOA 2B20A 5FUMA 3VJKA 4QZVA 1ODSA 2HADA 2ORYA 3IA2A 1E8NA 3RARA 1CUWA 5AI0A 5LZ2A 3RKSA 3H17A 4L9AA 4WY8A 4LKOA 4PSCA 1SCKA 2B61A 1DX4A 2XMSA 1YAHA 4CIAA 1JU4A 2QMQA 5A2GA 2BUBA 1PFQA 4OD0A 4B85A 2XMDA 3V9AA 3WKCA 1ORVA 2HDWA 3F8SA 4EY8A 1C7JA 5FPPA 1UK9A 3LIIA 1QIFA 2DQZA 1VXRA 1LZLA 1XQWA 4ITVA 4AN1A 4HXGA 2CEKA 1XROA 4PV7A 3NOXA 3HC7A 2GBCA 4E11A 3OURA 4KRXA 4AMZA 4CCYA 4BAGA 4JYPA 3HYSA 2J4FA 4DSAA 1EDEA 4H7FA 2YYSA 4J0DA 3GROA 3FOBA 1L7AA 5AI4A 1RP1A 4U2GA 3IBTA 2WJ3A 1XRMA 3WZMA 3ESAA 4Y2PA 1YS1X 3WMRA 1JFRA 1F8UA 3DDUA 4ZRDA 4EY6A 3AILA 5K3BA 1CUHA 5K3CA 4GECA 1Q0ZA 1JU3A 5K3AA 5E4JA 4UPDA 1XZKA 5K3DA 1LPBB 4ZXFA 3H19A 1S8OA 5EFZA 1H2WA 4G9EA 4ARAA 5CURA 1JKMA 2DFPA 3PF8A 4UHFA 1XLWA 5AM1A 1AUOA 5AM2A 3FYTA 3BE8A 1K5PA 2ZSIA 1QIKA 2RAUA 4UBLA 1QO7A 3B5EA 3DJYA 1THGA 3W05A 5C7YA 3M81A 4J0GA 5CH3A 5CT4A 1ODTC 4X6XA 3R3UA 2XUPA 1ZD5A 1SFRA 3VVMA 2V98A 3WK8A 2D5LA 1D07A 3CCBA 2WU4A 2V97A 3IULA 4QWWA 3V1KA 3DOIA 2WHRA 3PFCA 2WM2A 4U2CA 4Y2VA 1FFEA 3AIKA 3DEAA 3AUKA 5ALMA 5EHXA 1F6WA 1DWPA 5JAHA 3AZPA 5DJ5A 5HFNA 1N5MA 4N5HX 1SCQA 2ES4A 2YASA 4BTLA 1CUDA 2Z3WA 3BF8A 4P9NA 5AO9A 1BCRA 1E89A 1QTRA 3IUQA 4OB7A 4FBLA 1IUPA 1EVEA 4B9EA 2XMBA 4C89A 4BDTA 3A2MA 4CG2A 5A7GA 2WFLA 3FVRA 1WB4A 1L7RA 1O6FA 3RLIA 2PX6A 3WL6A 3MVEA 1EK2A 4J0HA 3WWCA 4J0KA 5HK8A 2E3JA 3YASA 1EINA 1QIJA 3HACA 1Q0RA 5DLPA 3DYIA 1DT3A 3DNMA 5LP1A 3SWWA 1R88A 4MYDA 3WLAA 5ALOA 4G9GA 2RHTA 1NU6A 2XUQA 3N2ZB 3WIBA 4DNQA 4G4GA 3FLEA 3FCXA 2OCLA 1CUZA 4QLAA 2EEPA 1ZD3A 2WIDA 5IVIA 4EY4A 3HLKA 3QVMA 1K4YA 1LPNA 2GZSA 2XUHA 2DHCA 3D7RA 2JGIA 4GDMA 1SOMA 1CRLA 3ESCA 1YCDA 4U2DA 1IZ8A 2WUFA 4Y2RA 2PL5A 2GYVA 1ZIXA 5E4YA 1XZLA 1LPMA 2I78A 5AM4A 3G8YA 1GXSA 4XIIA 3D59A 3VISA 5ALRA 4DMFA 2CB9A 4PW0A 3R0VA 4UBNA 3U1TA 1U4NA 5HKAA 1QFSA 3C70A 5E4TA 2PSEA 4FFWA 5ALIA 1CR6A 3GA7A 4KRYA 4UBOA 2O2HA 3STTA 1AGYA 3R3ZA 4B0PA 5ALHA 4J3JA 4PSDA 5JAPA 2PSFA 4WY5A 2WFMA 3HABA 2XI4A 3QPAA 2BUAA 2HIHA 3PI6A 4DMCA 1Q83A 2WIGA 5H3HA 1YA4A 3C5VA 3V1LA 4XJVA 4XVCA 1X2EA 2AJ8A 4D9JA 2XUAA 4K6KA 4C87A 2HHAA 3C6YA 4B83A 1CUCA 2VAVA 5LIPA 3LP5A 2QUAA 4S0XA 1E8MA 4G8CA 2W6CX 2XE4A 5AK5A 3PFBA 5JAOA 4WDRA 1XRPA 2ACEA 2ACKA 2H7YA 4B0OA 3BDVA 2XMGA 3Q0TA 1AMNA 3C87A 2VA9A 4Y2SA 2VJBA 3IUNA 5EGNA 4ZI5A 1DTEA 3C6ZA 4DNFA 4BVJA 3D2CA 1THTA 1J07A 2QUBA 4OB6A 2BCEA 3VXKA 1J2EA 5CT9A 2VJCA 2DR0A 2PU7A 5C81A 3CN9A 3S8YA 5ALDA 2HM7A 1VXOA 2JGFA 3WZLA 3QPCA 4PO3X 2ROQA 4UFPA 5E2IA 3AIOA 2BGRA 2P8SA 1QOZA 1VZ3A 4X3CA 2Z8ZA 3KSRA 1CV2A 1SCIA 3OPMA 3RK4A 4ARBA 3AIMA 4MWTA 5AH0A 5CT5A 4IH9A 2XMRA 1HLGA 4BP8A 4UHBA 4UFNA 1ZD4A 1K8QA 1F0PA 2C0PA 3PUIA 2XQIA 3F96A 1YB6A 2JBWA 4BZZA 5CXXA 4UHEA 5HQ3A 2XUOA 4W1RA 4BP9A 1QZ3A 4H7IA 2Z3ZA 4GEGA 2FX5A 3NWOA 5AI8A 3G0BA 4PSUA 5JD5A 2WFZA 4LYEA 3OC0A 4J03A 2HA5A 3C43A 1WB6A 2HA4A 2J3QA 4OUKX 5AKZA 2GBIA 4EA6A 3D0KA 2ZYSA 4CG1A 5FKJA 3WWDA 3I1YA 4JYMA 4EB0A 2WHPA 4DTCA 2B9VA 1GKLA 2ZJ6A 3STVA 5JZ9A 2OAGA 4AQDA 2DHEA 2VTVA 4IQ4A 5K3FB 5CMLA 3DKKA 5D3ZA 1GPNA 3ZV7A 5C8ZA 1O6GA 1LPSA 2WUDA 1JMYA 1NX9A 3K6KA 4BCBA 3HSSA 3BXPA 4FHZA 1X2BA 2GBGA 5CXUA 1WB5A 5AOAA 1CUSA 1MX9A 5FOQA 1ZJ5A 3IDAA 5DWDA 3QYJA 1CUUA 4L3WA 4LXHA 4UFOA 2V96A 3C6BA 4X7BA 1BN6A 1Y7IA 1AQLA 1W4LA 1LPOA 2X76A 3GBSA 4I3FA 4N8DA 4MQLA 4NS4A 4UBIA 1GPLA 3H1AA 1AKNA 2RIPA 2XQJA 5AI5A 2G5PA 4EY7A 1ACJA 3WK5A 4F21A 4KR0A 2GBFA 5AKJA 3O95A 5ALVA 2VF2A 1ETHA 1WPRA 2WU3A 3WQHA 3GELA 1UOQA 4Y2YA 3G9ZA 4G1FA 5KWIA 2WIJA 3R3YA 1CEXA 1A8UA 4G8BA 1C4XA 3Q8WA 1CUYA 3PF9A 3OM8A 2NW6A 3WJ1A 4U2BA 3V48A 1BEZA 1FFCA 3STXA 3ESDA 4RPCA 1BRTA 2QTBA 5JZSA 4X00A 2HU8A 1VKHA 2GYWA 3F97A 3W2TA 3WWOA 1JJIA 3G0CA 4UHDA 5AK4A 3H0CA 5C8VA 4BE4A 2HA2A 3UUFA 1M33A 5AI9A 1MJ5A 4B80A 4XWGA 2WJ6A 3G02A 2OCKA 2Y1KA 2PSHA 1W75A 2XLCA 5LZ7A 3DCNA 3OTQA 2OXEA 3DYVA 3VJMA 2CKMA 4EHBA 4U2EA 3FCYA 3SC2A 4CI9A 1LBTA 3ICWA 4KJXA 1CIJA 5AKLA 1OCEA 3A2LA 3KDAA 3CN7A 4UBKA 5AP9A 5I8PA 3BDIA 1JI3A 1A7UA 1R50A 3E3AA 2JEYA 4NZZA 4DLNA 1Q84A 1EI9A 2RONA 2Z5GA 4FLEA 5ALFA 4P93A 2VJDA 2JGKA 3D5EA 4UHCA 5AKHA 2CBGA 1Y37A 4AO6A 4LIPD 1USWA 2HFKA 1ODCA 4PQEA 1MN6A 3JYHA 2ZJFA 1YS2X 1ISPA 1E3QA 4EBBA 1QIMA 4AB1A 4W1QA 1HKHA 5ALNA 1NU8A 2HFJA 4H7DA 4F60A 3QH4A 3BWXA 1GZ7A 1MAHA 1R4ZA 2WLSA 3R40A 1WOMA 4MYSA 4K6GA 2IX9A 4X95A 5HF5A 1IUOA 3QMMA 1MU0A 5EIHA 1QIGA 1U65A 1DINA 2X5XA 4V2IA 3ANTA 5A71A 1XQYA 1XQXA 3ED1A 3BJMA 2PUJA 5KREA 1ORWA 2WKWA 5ALSA 2Y2UA 4E15A 1WCYA 2PSJA 1QIHA 2WILA 4TPKA 5HF6A 4KAAA 2RGUA 5SYMA 4QEKA 2WUEA 3FWHA 5DYTA 4FTWA 4G4IA 5FPQA 4BVLA 4QE3A 1E8DA 4WDQA 3U0VA 4Y2QA 2DCMA 2B4KA 2JIDA 4N8SA 4CCWA 2BGNA 1XZAA 3HI4A 1RWQA 2QVBA 3FSGA 1B6GA 4HAIA 4CG3A 4HZGA 1GT6A 1SC9A 1R9NA 3R3WA 2HA0A 2QT9A 1A88A 2ZYIA 3QMWA 5FXMA 5JD6A 1QTIA 1BCSA 1EK1A 1XZBA 3W9UA 1ZICA 1TCCA 1FFDA 3RM3A 4Q3LA 5HF9A 3R3XA 2YH2A 1ZGCA 4KE7A 2JGLA 1H2ZA 5ALEA 4X71A 3H2JA 5LLSA 1EB9A 2OGZA 1QIEA 1K6EA 1CPYA 3G7NA 1N8SA 1XKTA 3EQ8A 5FRDA 5AKXA 2I3ZA 3WK4A 4X97A 2CZQA 1XZDA 3KWFA 2J4CA 2C7BA 4FWBA 5ALPA 1CUAA 3GUUA 4YK7A 1HPLA 3FYUB 4X92A 1HBJA 5AKIA 3FAKA 1XKLA 5T4HA 2OGTA 2O7RA 1CLEA 4M0FA 2C0QA 1GGVA 7YASA 2WQZA 5AM5A 5IVHA 4OU4A 2HA6A 5K5EA 2WHQA 2CJPA 1PV1A 5HFAA 4Q3KA 4AX4A 1XZHA 4I4CA 3IURA 3I6MA 4X90A 4C6HA 5EIEA 2FJ0A 3WL7A 1BEEA 5CH8A 2Q0XA 5FV4A 1YAJA 2WIKA 4X6YA 5BWCA 4BB0A 1LPAB 2CUTA 1UXOA 4L72A 5EHQA 4X94A 2XUJA 5HCUA 1KU0A 4CFSA 4Y9SA 2RI6A 1W1IA 1UT6A 3VKFA 1TCBA 4ZREA 2HRRA 2O2GA 1P0MA 3L1IA 1P0QA 5ALXA 5ALKA 2H7XA 4L0CA 2HU7A 3FLAA 5BOVA 1HDEA 3EIOA 4BRZA 2O7VA 3HRHA 5EHZA 3C5WP 5ALJA 3H1BA 3IUMA 4Q3OA 4A5SA 3EBLA 4J0JA 4X6UA 1N1MA 4FKBA 4J7AA 4FOLA 3T4UA 3WL8A 4U2FA 3CXUA 5ISMA 2IITA 2EDAA 5D6OA 3WK9A 2VEOA 3TJMA 4BAZA 2HL6A 2GZRA 1JJBA 1GPKA 2LIPA 5KBYA 3H2HA 3LCRA 1XQVA 3KD2A 2FJPA 3PE6A 4KYVA 3I2FA 5AOBA 1ZI8A 4KAJA 1EH5A 3MGAA 4MQMA 4KE9A 4KACA 4EY5A 3ESBA 4B6GA 2XMZA 1UOOA 3B12A 1EX9A 1GQRA 5JD4A 3HEAA 1ZI6A 1JT2A 3F67A 3E0XA 4TVKA 1EVQA 5DTIA 5SYNA 5J3JA 2XDWA 3JWEA 1BU8A 1CUEA 1WHSA 5ALYA 3D2AA 3D3NA 3IIIA 3JW8A 5AM0A 3VJLA 4HVTA 3NGMA 4QDZA 1K63A 3DL4A 3X3HA 4ZV9A 1YSCA 1EA5A 2QM0A 4INZA 1CUJA 5AK3A 1YA8A 3UUEA 5HZGA 2WSLA 3WWEA 4G5XA 3I2KA 3D4LA 3AJAA 2XQGA 1XLUA 1R9MA 4H7HA 1MX5A 5JALA 4GWLA 1CQZA 1W6RA 3WK6A 4AXBA 4A23A 4E14A 4H7EA 3C8DA 1VE6A 3PDCA 2WG0A 4Q82A 4KAFA 2BAGA 4CIBA 4MEAA 3MUNA 4MJ3A 4FBMA 2WTNA 4DMHA 2FUKA 2G4LA 3QITA 1RYYA 4WFIA 5AICA 1OILA 2AXEA 1XZIA 2XT0A 5T4FA 5A62A 4FDMA 1YASA 2OQVA 2XUKA 1A8SA 3W06A 3STYA 4C4ZA 2QJRA 2X8BA 1DQZA 1J06A 4LHEA 3K2IA 2C5FA 4BVKA 1EHYA 4BBZA 5BV7A 4JNCA 1Y7HA 3BJRA 5DYWA 4ROTA 4Z49A 3ZWQA 1W52X 2WJ4A 3HJUA 2XB6A 4H0CA 1XRNA 5BWBA 4BE9A 1LGYA 4OCZA 3E4DA 1UFOA 1G66A 2XUDA 5IH7A 4GW3A 3GFFA 3ZLUA 3A70A 4B81A 4WCVA 4MEBA 3KOOA 5HK9A 1TK3A 3QMVA 2XUGA 3HXKA 3EQ7A 5AHXA 3R3VA 1LZKA 5F4ZA 5ALTA 1H22A 1UKCA 4ZWNA 5JADA 2PVSA 3DQZA 2DSNA 3ZI7A 1CFJA 2JGEA 1HQDA 4AO7A 1XZCA 4OPMA 1CUXA 1MO2A 5K3FA 4B82A 4B84A 5YASA 1XZJA 5DNWA 2OLEA 5AKGA 4C88A 2QZPA 3O9MA 4BCCA 4HS9A 2XQFA 3G9TA 4HXFB 1CUIA 1FFAA 2PPLA 1BN7A 5JANA 2QJWA 1TKRA 1W76A 4QLOA 2VSQA 3O9VA 1IUNA 3OG9A 3H04A 2C4HA 1QGED 1WPXA 4OB8A 2DQYA 2PU5A 5I9IA 4QDTA 1TRHA 3O4JA 5CBKA 4CCYB 2OCIA 2Y6UA 1IZ7A 4N5IX 2YXPX 3VDXA 4ETWA 3TRDA 4BDSA 1ACLA 1QO9A 4BC1A 1GKKA 5DNUA 1ZJ4A 3NUZA 3ZLTA 1JMKC 1X70A 1XRQA 4OYLA 4F0JA 3WL5A 5AIBA 1T4MA 4UHHA 3W04A 2QXTA 5ALZA 3QM1A 3A2NA 1VA4A 1QLWA 3IB3A 3QPDA 4X91A 6YASA 2QKYA 1AC5A 2OG1A 1PJAA 2OCGA 5EI5A 5ALWA 4QWMA 1KEZA 2QXUA 4FLFA 1XZGA 1B41A 1DWQA 4W1PA 4M0MA 4QDXA 1DWOA 5I7UA 4C01A 4DSZA 2C58A 5IVKA 5D3KA 5A7HA 1G42A 2WIFA 2DHDA 2ONCA 1IMJA 3AZOA 4Y2JA 1QJ4A 4ZV7A 1MTZA 3DL7A 5T4BA 2HU5A 2CMFA 3I28A 4M0EA 5CT6A 4E46A 1H2XA 2WG2A 1JJFA 1FJ2A 3DD5A 4GHWA 1I6WA 1EDDA 4FFVA 4AN0A 5AM3A 2GYUA 3L1HA 1QONA 4TGLA 2OAEA 1CVLA 5ALGA 5ESRA 4B7ZA 3WI7A 3C6XA 1F0NA 5KWJA 2JGMA 1DQYA 4P92A 3W9BA 3BIXA 3FYUC 1J1IA 1DX6A 4QDOA 4I19A 3M83A 1VOTA 4QNNA 1P0IA 1N5RA 3DLTA 1WM1A 2QOEA 1MPXA 4LXIA 2XLBA 5IKXA 2ZYRA 4Q1VA 3WA6A 4KE8A 2BUCA 2HA3A 3EQ9A 4Q05A 4Y7DA 3FLBA 5EIAA 5LKRA 3TGLA 2ZVDA 3VVLA 1AURA 1CUVA 2WFLB 5JIBA 2PM8A 5IVDA 3AFIA 4AO8A 4GXNA 5LZ8A 5D7BA 1XLVA 2PKYX 4BCDA 1OXMA 3SK0A 4W63A 4O08A 5EHNA 4YPVA 1MAAA 4YX9A 1CQWA 2RHWA 3MUOA 4WFKA 2PUHA 4JUIA 5ALLA 4NMWA 3LLCA 1MNAA 1VZ2A 4OU5A 4EUSA 2HA7A 3I2JA 1A8QA 4W1SA 2H7CA 3H2KA 3I6YA 5AOCA 3ICVA 3C8HA 4OSEA 3AZQA 1XFDA 2VQ6A 2OQIA 4BRSA 1MNQA 4K5QA 4BC0A 3I2GA 4Y2TA 4GI1A 4IH1A 3FSGD 3STUA 4W9RA 2QRUA 4UBMA 3TEJA 1TQHA 5FDFA 3G9XA 1EB8A 1VLQA 2OGSA 3KWJA 5ALQA 3I6ZA 5A6VA 5DNVA 4Y2XA 4N8EA 4H7JA 5CRIA 3WA7A 3WKEA 1ZIYA 3WK7A 2IIVA 1TIBA 4RE5A 4HRYA 4F5ZA 3ZPXA 5JARA 4KEAA 3F98A 5CW2A 5DTJA 2D0DA 3H2IA 2WTMA 4J0CA 3UMJA 1R3DA 1YB7A 3G0DA 2J3DA 3WKDA 4XX1A 3M82A 5LZ9A 2BFNA 1QIIA 3PICA 2G5TA 3FYUA 1CUBA 3E1GA 2K2QB 2VJAA 4Y2UA 2ZJ7A 3BL8A 2G63A 5JAUA 1ZI9A 4AZ0A 1UWCA 4DM7A 1ZD2P 2BKLA 1UZAA 1WHTA 1C7IA 1AZWA 1FFBA 2VAXA 5CTAA 2PBLA 4X85A 1P0PA 2Y6VA 4DMKA 2VT7A 1T2NA 1R1DA 1TAHA 1LNSA 4Q34A 3DOHA 1TCAA 3PUHA 1DT5A 5JASA 1CUFA 4C4YA 1G4HA 4KE6A 2XQKA 3WYDA 3AINA 1LBSA 3DKRA 2VATA 2ZYHA 4X93A 1DU4A 3WYNA 4C4XA 1CUGA 5JYCA 5T4EA 1BROA 5ALUA 4P08A 3V1NA 1YR2A 3I2IA 3B3QA 3N0TA 5AK6A 2QR5A 2JEZA 4H18A 2AJLI 1QFMA 3S2ZA 4FMPA 5LKAA 4PF1A 2PSDA 3LS2A 1XZEA 1UOPA 1UK7A 4K6HA 4GBGA 4ZGBA 3WIOA 2Y2VA 4WFJA 1BE0A 4LXGA 3G0IA 4G8DA 1U8EA 3A6ZA 4H77A 4RGYA 4QA9A 1Z68A 1LLFA 3ILSA 3IVMA 2H9YA 1UK8A 1H2YA 5CH5A 2HRQA 5C8XA 3KXPA 4H35A 5JATA 2V9ZA 2I3DA 2ECFA 3QBJA 3BF7A 1VJ5A 5LZ5A 5LZ4A 3SX4A 4AMYA 3CCCA 5AJHA 3WKBA 1UK6A 4UUQA 2AJCA 2JGJA 2VT6A 1G5FA 3QZUA 5HQ3B 5AKEA 5K3EA 4YASA 1GQSA 4LYDA 5CT8A 3ANSA 3O4HA 4HXEB 4A16A 2Z8XA 5AIAA 4PNZA 1IVYA 3H18A 3I2HA 4DNOA 3ZLVA 3V1MA 4K2AA 5HF8A 2XUIA 1MX1A 3L1JA 3T52A 4GLBA 4RNCA 4DGQA 5FLKA 4RE6A 3WWPA 2AJBA 3O4IA 1UKBA 3H2GA 4MWSA 4FNGA 4IH4A 5AI6A 2WHPB 1AX9A 3G0GA 3O4GA 4H7KA 5FP0A 4OYYA 4G4JA 2XMCA 1ZGBA 1FSSA 5AKYA 5JZBA 2O2IA 4AZ3A 2R8BA 2UZ0A 4BYMA 1LPPA 3O0DA 4QDUA 3FVTA 3STWA 1XZFA 3GZJA 1HL7A 2I03A 3LIPA 4EZIA 2R11A 3IUJA 3EF3A 1BS9A 4NVRA 3I1IA 1UKAA 2BJHA 4MXDA 4WJLA 1XRLA 4BATA 2ZSHA 1XRRA 3OOSA 4IHAA 4HTAA 1EXWA 2AJDA 1H23A 3G9UA 4IO0A 5LYYA 1L7QA 2W22A 1VE7A 2C5GA 3BIWA 4B9AA 4DIUA 3P2MA 5HKBA 1KU6A 4BZWA 2QS9A 1XZMA 4DYHA 4UBJA 3C45A 3FBWA 3F9CA
chains in the Genus database with same CATH superfamily
5B2ZA 2XUFA 2OORC 3C4VA 3DMHA 3Q6MA 1G7SA 4QXPA 4B2IA 2EG9A 2PL9A 3E0QA 5A03A 4JEIA 4MV1A 2H1IA 3NG1A 3OOEA 4BAUA 5A1TA 2OKCA 4GM1A 1S1MA 4RFLA 5AVSA 2AGVA 2BEUB 4HZUA 1SZPA 3WJ2A 5CM2Z 1ID1A 4G56A 3T9AA 1ZOIA 2I7TA 4GXQA 1YR8A 1ZQ9A 3O8QB 5JRDS 3RVKA 5KCMA 3FNRA 2W7TA 1W2HA 2X4GA 2WUGA 4OJKA 3AHGA 3MMPA 3QIAA 1J4AA 1UZNA 2JARA 1HL3A 2EXXA 2WE8A 2XA9A 3AEXA 1MQ9A 4ZCLA 3OX3A 4PC6A 2HUPA 3PJEA 1PDOA 3G89A 3PUWA 3ZEIA 2A9VA 1S2DA 2V59A 2GBLC 3V33A 2GBPA 3TG2A 2ZCUA 2JFHA 3BMOB 1ZC3A 4KH1A 1YZTA 3FPJA 5FBZA 1PS0A 2EDCA 4UAJA 5C1IA 3NHWA 2Y66A 1OTYA 3P5SA 2NQ8A 2I34A 3M3DA 1X15A 3HZOA 2B20A 3VAZA 5E6UB 5FUMA 4XX0B 1SXPA 2JAPA 3PP8A 3A6HA 4QYWA 1NWHA 2JBAA 3EGCA 1V8DA 4IWYA 3T99A 4EP1A 2X7JA 1NY6A 2LPMA 2P9EA 2HADA 1LJUA 1XTUA 2HK9A 5EUQB 2ORYA 4Z0TA 2I4NA 3LCJA 3N74A 1ZHOA 4D82A 5GQSA 1CUWA 1M2OB 1Y7LA 2GXSA 3E3LA 3AI3A 5AI0A 1OV6A 4UARA 5IM4A 1YQWA 2H2WA 1TFUA 2HSDA 2XYGA 3SC2B 3RKSA 4DNQA 4RVHA 4MKRA 3NBFA 4L16A 3A11A 1UR5A 3BDAA 3VYVA 5L3VA 5D6NA 1P9OA 2IZ7A 1T8PA 3GXOA 1YHZA 3VU0A 1ZVVA 1FLDA 2C5BA 3M89A 3T9FA 2H54A 2B61A 4QPPA 4YRCA 5DZSA 4PE5B 3D02A 2CLOB 1DX4A 3DEHA 4QYTA 4ZVPA 4OHUA 2XMSA 3U4QA 2V7WA 3I9FA 1HOXA 1H8HA 3WNVA 5J43A 1JU4A 2AEJA 2GEKA 3S99A 1OFIA 1WMEA 1GADO 2D74A 3BD6A 4OHOA 4B85A 3K30A 3EXEB 3LUHA 1LW7A 2AX3A 4QEZA 1L5HA 1ORVA 4BNNA 4XQGA 2RGGA 1UADA 2Z8YM 1IN8A 2EP7A 3E58A 1N8TA 2D2IA 2GRUA 2ZJ2A 1D1QA 4ES6A 2HO5A 3HDHA 5LP6A 4GOJA 3EULA 3FMOB 3IMKA 2XXAA 4W5OA 3P9CA 3UM9A 3GWGA 2JDIA 1YNOA 2VZEA 4BKOA 1UBRS 3KSAC 1XQWA 4ITVA 3F47A 3AF0A 3DJFA 1MHPA 4WVLA 4DWOA 1LRKA 5AVYA 4AURA 5K3OA 5LSAA 2AF4C 2H1FA 2GBCA 4LJ8A 4E11A 2JLBA 4OJYA 3OOWA 3T54A 5C8YF 4B7CA 3ICEA 2IEIA 2P3OA 5LQJA 5IJWA 2B25A 4CDMA 4O02B 5JO0A 4BAGA 2ZRHA 1INLA 1XYVA 4KXXA 3KTDA 2X1HA 4RAQA 3RUPA 2PE5A 1GSIA 4QD3A 4MR8B 2YYSA 3M1IA 1ZVMA 1ZMTA 3N05A 3Q41A 1QZUA 1W59A 3FOBA 1GHTA 2PUAA 2Q6TA 4HJRA 4NQRA 3OUUA 4N48A 4ZDIA 2GR9A 1ILWA 3QVWA 8OHMA 4M6WA 1HYEA 4ALNA 1GPYA 2H0AA 1TU4A 5KVCA 2TECE 5CM8B 3OX1A 3OQPA 2EW2A 4LE1A 3RRMA 4GX2A 4C43A 3URMA 5HVNA 2CV2A 1JDJA 1FU4A 3DT6A 3ESAA 4MQEB 2C04A 1YS1X 4EHDA 4XB2A 5EKXA 2PLNA 1ORHA 2IXGA 3SQNA 4AJ2A 1Q15A 2Y1FA 4BB5A 2XITA 2I8CA 5TS2A 3IBSA 1AIPA 3A1UA 3ZU2A 2Q8QA 1YCHA 4P7BA 3AILA 5JSFA 4BO4A 1UBFA 3PYXA 4R2IA 1VHTA 5K3CA 1WVIA 4GECA 3TAHA 4PYNA 1U9JA 1Q0ZA 2W2KA 4Q9NA 3O82A 4FR2A 2Q4DA 4E2ZA 3FVQA 4UMDA 5AVOA 1V9CA 5JEDA 3P9ZA 2JHCA 1GTJ1 2GILA 5K4GA 1TD1A 3TM4A 3PQ8A 4PFQA 1I5OA 4EUNA 1Z4LA 1R4MA 5C46F 4KUEA 2BFAA 3BREA 1I3LA 1GCOA 3E6AA 5E4JA 3L4KA 4HS4A 4QXQA 1MABA 1XZKA 3PQEA 3RPEA 4JIMA 1LPBB 5K3DA 3ID6C 3EEYA 4FGZA 4P5EA 3VOSA 3WGUA 1NIPA 3KLNA 1KFJB 2J6BA 1XCMA 4FU0A 4G9EA 3ROKA 5CA1A 4DR3B 2R44A 1RADA 5J1TB 5CURA 4AFNA 3EBPA 3HA7A 1D04A 1JKMA 2D4AA 2CWDA 1GNTA 4HX2A 2DFPA 2UXCB 3CRRA 3PF8A 3RHFA 3W1WA 1GZ3A 3GGGA 3MINA 4DZTA 1AUOA 1U3DA 3FLMA 1UPAA 2V5VA 5AM2A 1L5MA 1ZPDA 2VBCA 4KIGA 4YACA 3TMYA 3DSRA 3TX2A 1OYYA 5CFOA 5FADA 1GNSA 2CL7X 3U39A 2WWGA 1PEDA 4XYGA 2V3VA 1QO7A 3CIFA 1SU8A 5HCIA 1CY8A 2HLDD 1Z5PA 2Z5VA 2Q46A 5C7YA 1QVWA 1CQIB 1Z45A 2VZ9A 5AW4A 3WFJA 2OL4A 3CF0A 1T3LA 5THQA 2Q5EA 3IE0A 2X86A 3R3UA 1D4OA 4LOHA 1B0PA 2ZIAA 1E2DA 4JBLA 2Y4NA 4XWKA 3F5FA 5DN9A 2D5LA 2JLQA 2I2AA 5BQ5A 1S3GA 2AFVA 4FCVA 3UJHA 2WU4A 4EVRA 5C8YB 4NIMA 1ZD8A 2V97A 4ZOEA 3SF0A 5DLQC 3LUDA 3V1KA 1T9BA 2WHRA 1K0FA 4IDPA 3OPYI 4Y2VA 2GJKA 3AIKA 3NVKI 2EC5A 2VDNB 3ET4A 4JYCA 5ALMA 2H4FA 4D96A 1OZFA 2CY0A 5E8JA 3T1TA 1NXTA 1IY2A 1M67A 3TCKA 5M7EA 1G21A 3DV0B 5DJ5A 3KOXA 5AMXA 3OX2A 2X3FA 1ETUA 2A67A 1N2CA 2F1JA 3E7FA 3KEFA 5DHTA 5LJIA 4BTLA 1F4VA 1D2AA 4I8IA 4OBXA 1NF9A 3BF8A 5AO9A 4WKGA 2GWRA 1PGOA 3DZIA 3I9KA 5H4GA 4P82A 1EVKA 3UWKA 2IVFA 2DUMA 4NH0A 3W3AD 2ODNA 3PVCA 5LQNA 6REQA 4HUJA 4PZPA 4YRBA 1QTRA 2NQ2C 4DJJA 5FFFA 1QQ6A 3PGMA 4PSVA 4BMZA 2PX3A 1DLIA 3MWEA 2FMIA 2GZ3A 4FBLA 1P3JA 1B14A 1W93A 4GPZA 4JWKA 2HHHB 2KE5A 3GJQA 1IUPA 1E6LA 2Q2QA 3LOPA 4OBWA 4KK3A 3FOFC 4PR3A 3T3PB 4CEHA 2RGWA 3PEWA 2BRUC 2XMBA 3AVVA 4MW0A 1Z17A 1W8IA 1YZQA 4NMHA 3VDMA 4BDTA 1JQEA 4MUIA 2JATA 2O0HA 3A2MA 4R2KA 3W3AH 1FJHA 4K6CA 3FVRA 4EMSA 5HNKA 3A6GA 2TSYB 1L7RA 1QMPA 2W6JA 3E5HA 4MAMA 3RLIA 3PHCA 5HZHA 3A1WA 3KPWA 2P35A 3I23A 3EW9A 1EK2A 1JR3D 3MVEA 4HWGA 4REMA 3WL6A 1L5WA 2RGAA 1QAOA 3U3OA 5HK8A 3YASA 3LT1A 1N6RA 2P7HA 4JNKA 2OTCA 1QIJA 4GRDA 3DP7A 4MV6A 1P4HA 3ESQA 4FYPA 5KOJB 2JW5A 4AJLA 1NXWA 3HYTA 5A4KA 1GNLA 2F64A 1XVVA 3QW4B 4H3KB 1T35A 3KUKA 1E9RA 2Z5FA 3ROFA 3DNMA 2Y0PA 3ZWWA 4E1AA 4AJ9A 9LDBA 2OK7A 4ARVA 4BLQA 4MYDA 3UJDA 1C30B 4BYGA 2GOYA 3A3OA 1YMVA 5EYPA 3QVTA 5KDOA 4QVIA 1JJAA 3H83A 1NU6A 5FPYA 3R5TA 4WA8A 4QPNA 3N2ZB 1PZNA 5IM5A 3SJZA 3BTUA 4YAFA 5M3BA 1GWNA 2FFRA 1B15A 1Y5NA 1CNEA 4G2NA 2P2NA 2O0KA 4G4GA 4YJ2B 5IC6A 3ZIAA 1SCJA 1Z7GA 4RF4A 4G67A 3EASA 3IEKA 5CJPA 1E3SA 4A0SA 4QLAA 1H2HA 4IG9A 4NTZA 3CYFA 2E85A 3K9QO 2Z9BA 2WIDA 3ICCA 3JQDA 5IVIA 5JCPA 3GDGA 2VTDA 4GU5A 2VNAA 3NMUF 2I87A 3BFJA 1UWVA 1EFTA 3P9SA 4HX9A 4MO9A 2ZKLA 4UKDA 1MB9A 1W96A 1QTQA 1WE2A 1WOYA 4PHGA 4MUJA 2GZSA 4DUPA 2DHCA 2JGDB 1EE9A 4LF4B 3KQTA 10MHA 3AFNA 3I8OA 3RUDA 3L9WA 4YYEA 2O57A 5FJJA 2XGMA 4G5YA 4A6XA 4OV6B 4HDNB 1UL1X 3G13A 2ZE8A 1YR1A 3GEIA 4W8OA 2VBFA 5ICCA 3TQCA 1OZHA 4G1BA 4PS0A 4Y2RA 2PL5A 5H9VA 4MLDA 5ELLA 1GYPA 1Y9JA 4EI7A 1I7NA 1ZH4A 3GCGA 2GYVA 4GMXA 1BHJA 3MWDB 1ULZA 5E4YA 1ADGA 2KLHA 1LPMA 5C5DA 4GPTA 2H9AA 2EP5A 2I78A 1V3QE 2MSKA 4NLLA 2RFLA 3RABA 1R5BA 2PY6A 4KYIB 3JRNA 1UBEA 3RHTA 2FR1A 3VISA 4OH1A 2L18A 1PJQA 4RVDA 5KCZA 1T1GA 3DDHA 4NKRA 1UF9A 1HE2A 3WWZA 3WLLA 4IDBA 4TYNA 4G1CA 4P83A 2FWIA 4Q9AA 4OFXA 3W2HA 1XVAA 3KJIA 4JC5A 1SELA 1WNFA 2FPPA 2VS1A 3JAKA 4MCJA 3U1TA 1WSAA 3JD1A 4Y6OA 5HKAA 2VUSA 2HPAA 3P9NA 3C70A 5E4TA 5IH3A 3WS7A 1IPFA 3VC2A 2W4QA 5CITA 1XNJA 4KR6A 1OUMA 1X94A 5ALIA 3ZS9A 4F3TA 2VG8A 2ET6A 3IOEA 3LPAA 3P0IA 4PINA 1WXWA 3ADOA 3H8SA 1AGXA 2HSGA 2YV2A 3N2EA 2VXBA 3NT4A 4HYYA 4PRYA 2EEZA 3T7IA 5HSGA 2O2HA 1AGYA 1P74A 3EPPA 2YN2A 4LBWA 1SXJC 2B8NA 3E9DA 5DCYA 5F7ZA 4B0PA 4S12A 5JAPA 2RI1A 4M76B 3CUKA 1TM4E 1CJTC 1NVVR 1KYVA 3C5CA 4Y0AA 3T94A 3HABA 3WHIA 4F2WA 2AHOA 1TQ6A 3KAPA 3IR5A 2YHBA 4LZJA 1KI9A 2Q50A 3T12A 3BB1A 2FSSA 4D8UA 2I6XA 3C7DB 3E05A 1KKMA 5EP3A 1A5TA 2HIHA 4N5MA 3SBDA 2HQSA 3PI6A 5H16A 4CLOB 4DMCA 2RGCA 2CVHA 1NX6A 1IZ0A 2WIGA 5H3HA 4F3CA 3JQFA 1OC4A 5CDFA 4FHDA 4RPKA 3O1JC 2P2YA 4RYDA 4OI2A 4MR7B 4L9RA 4FQ7A 4MUEA 4P1ZA 5IYZB 1E5DA 1NF2A 5BN5B 1H0SA 3MS2A 3SQDA 4BRWA 1FSGA 4JD5A 2H08A 4G4SP 3QYFA 1J8QA 4D9HA 1X2EA 3A36A 3ONWA 5F76A 1G9SA 1T5SA 1HE4A 3UG7A 4QUIA 4DDUA 4B83A 2WA1A 4C5CA 1T91A 2VAVA 3KQSA 3OECA 3CO5A 3E8SA 2HBQA 3TOZA 2W8BA 1FYDA 1E8MA 3AV0B 5LOVB 3R5HA 4DG9A 2AFHA 4UDXX 2W2QA 3ZLJA 4M46A 2W6CX 5H3CA 4AZWA 4B7XA 2XE4A 2FOLA 3OLXA 2Q21A 3H9EO 5AK5A 3UJ7A 1J8VA 4C0AC 4F1JA 3EXHB 2F3RA 1OOEA 2O3RA 4MRNA 1ADFA 2C3PA 2Y3IA 4YRRA 4BCDA 3CW8X 2AR9A 3MTQA 2I91A 5JS2A 1ZCJA 3IKJA 1Y4ZA 3D6NB 4RJJA 2EYUA 2YMMA 3A3KA 4JB8A 3G59A 4CMEA 1WXQA 2ACEA 2PRZA 4N5LA 4EGFA 2C3MA 3OQ1A 4V0OA 4N03A 3L4JA 4QU9A 2DFLA 3I0NA 4B0OA 2IU3A 2YOHA 5D8DA 2D4HA 3AVUA 3BDVA 2XMGA 1YZLA 3PLAE 4NCXA 1K7CA 4WBNF 4DPMA 5B55A 1SUSA 1RHMA 3PI7A 4LNUA 2YTZA 4ZVRA 2Q2OA 3IP5A 1K7XB 1KI8A 2IYOA 1EFRA 3EVCA 3I01M 4R4JA 4RSMA 1AMNA 1NV8A 2ODQA 1FS4A 1U3VA 3VKHA 4KUHA 4QPZA 1PV4A 4LOIA 3MCUA 3C6ZA 1MB4A 2B8TA 3SZ3A 4LDPA 3AVXA 3OZGA 3A27A 4TWAA 1EFDN 2F67A 4H6VA 3TCXB 3EWAA 3UAWA 3WG9A 4GMDA 1IZZA 1HTWA 4HPXB 3G6WA 2C2WA 3GNLA 1THTA 2JCBA 2E4UA 3CUWA 2ZRDA 3AKEA 1Z56C 3B6IA 4F5EA 5KNDD 1PE0A 4OB6A 2ZATA 1OSNA 3C3EA 3QNUA 3NHYA 5EUMA 5CT9A 4GZLA 1G8AA 2RDMA 2DR0A 4YMSA 1IQPA 3D6FA 2L69A 3ACCA 3GIWA 5DYNA 3DLPX 3ROMA 4G36A 2HM7A 3I12A 5DGDA 4MH0R 2GNAA 2WT4A 4MQBA 4MI6A 1ZU4A 1O0SA 3NRJA 5MGBA 1A4UA 4B1FA 1QHIA 2IHUA 3QPCA 3R6LA 5EE0A 2Q7OE 4EQ6B 4DCPA 2JKYA 1YIAA 2ROQA 3PC2A 2JZNA 1R0ZA 2C5LA 1U8XX 1QF9A 4UTZA 1ZK1A 2LCFA 3CWCA 3JQ9C 4MYRA 3AIOA 2NT4A 3N2GA 5KNDH 1V4NA 2CMHA 1TT5B 1XMSA 4L76A 4X3CA 3UA4A 4NL4H 2J6HA 1VMIA 2IIQA 2Z8ZA 3JQQA 4BX0A 2ZM6B 4YCCA 3C7AA 5ED0A 4FGSA 4MVYA 4DR5B 3OPMA 2HRZA 4C3OB 3EA4A 3HDTA 1JB1A 4TKLA 3AIMA 3BGIA 3RK4A 5CDUA 4DY6A 4NICA 3HBNA 3L0PA 2OA0A 1AQUA 3KJXA 4RVOA 3HL0A 4D9BA 5ELXA 1WXDA 2Z95A 2B98A 2Z83A 3AF6A 3UBTA 3N6VA 4XTCS 3WWYA 3RIEA 1C4OA 1ORTA 4R2HA 5CT5A 4PFJA 2GVNA 3INTA 1EGHA 2F7SA 5DHAA 4IH9A 4QM6A 3ME5A 4BP8A 4KDEA 1BHO1 3E4CA 1FPQA 1GRRA 4R6XA 1ZD4A 2CXPA 3L41A 3L84A 1K8QA 1P2FA 2QMOA 1AKUA 1F0PA 3EEOA 4R0VA 1BH6A 2PANA 2C0PA 1OYWA 3D6MA 2WF8A 1SG9A 2J45A 1D7OA 4OI4A 1FUUA 5EKUA 3WIVA 1XTKA 1K6IA 1T9ZA 2XQIA 4H6WA 3WLHA 5EJ9A 3IEVA 3DMGA 1YB6A 2VYND 1SGWA 3L8YA 4BZZA 4P84A 2BMJA 4UHEA 3DDCA 2OZVA 1QHGA 3TG8A 2DX7A 4HEA6 4FFPA 4HQNA 4Z9YA 1ZGZA 2Z3ZA 4HB4A 2REBA 2ZP1A 3TTTA 2JIBA 1NVGA 3AVPA 5A3QA 2VP2A 3RVQA 3BX1A 3NUQA 4BZXA 3AUUA 3LK7A 4FHFA 3K1AA 1PGPA 1JP7A 3BIOA 1JR4A 2FPRA 3G1UA 5FPTA 4WN9B 1J0XO 1CE8B 4WIAA 2Y4OA 5ER9A 1AN0A 3Q0IA 3QX9A 2PZEA 3B6ZA 4ZVNA 4DTIA 5GWXA 2ODTX 5TT1A 1V3UA 1TM2A 1MG5A 1T2EA 3B1FA 2LD4A 2DLNA 1WU8A 2B2NA 1RJWA 2PKWA 2ZSDA 3GLIA 3OC0A 5B7NA 2Q62A 1ZFNA 4IDEA 4J03A 1Z4NA 1OWOA 3Q88A 1DBVO 1FRVA 1KY5A 1V5FA 3G3EA 4N4AA 4F85A 1MRZA 5L6MB 3RVSA 3QW2A 4HUQA 3KZNA 1YZNA 4ENVA 2J3QA 5AKZA 5HIMA 2ENUA 2XZOA 1VFNA 3NX4A 5KYWA 3JWGA 1A27A 2HIGA 1BKSB 4XUDA 5HKKA 3KEOA 3A28A 5FKJA 3LVBA 5H0IA 4ZV4A 1MA0A 3NDRA 4WXPA 3KB6A 4E13A 2WHPA 4DTCA 2QTNA 1OU4A 2FF7A 4BXOB 3ZDRA 3PZBA 1Z6QA 5BV1A 7MDHA 3OQ6A 3OZCA 5DI9A 5E3JA 2IEZA 3RB8A 4WBSA 2VA8A 2GJ9A 3L8CA 1IIRA 3QF4B 1HDOA 1P77A 4YLEA 4CW7A 4TTTS 4CRWB 4IVRA 1TF7A 1Z0ZA 1RPZA 2NUAB 5AD1A 4KXMA 5K3FB 3DKKA 1PJTA 4B31A 5D3ZA 1GPNA 2VQ3A 4N47A 3PQDA 5LJLA 3U7QB 1NX9A 1JEAA 4JEUA 3K6KA 3ECSA 3HSSA 1HA3A 2ZB8A 3L05A 3HGTA 4FN5A 1AXGA 1XMJA 4A3SA 4AP9A 3LKZA 5BSFA 5JT1A 1MG0A 3A4TA 1E2JA 4I5DA 1XN4A 5AOAA 5E9WA 1CUSA 1MXFA 1TZ2A 2FEWB 1N9ZA 4D9EA 1BFDA 3RG8A 4HO1X 3GFVA 1CUUA 4H6PA 1TO1E 3A58B 4LXHA 4II2A 4PLZA 2PQMA 3FPAA 4ND8A 1L9KA 5D5HA 2WR8A 3C0KA 1I3KA 2PKQO 4XIYA 1FRNA 1O94C 3FNGA 3B20A 4NBKA 3IUSA 4UXHA 1Y7IA 4JC0A 2YHIB 4YALA 4I3FA 1RAGA 1LPOA 4MQLA 3ROQA 1STOA 3JATA 1X1TA 4L8YA 3BEOA 4B33A 1OLXA 3DLBA 5IJAA 2GRJA 5CVUA 5I8WA 4XFKA 3VH2A 1ZIDA 1ZUD1 5JS8A 1OFVA 3R5KA 2G5PA 2QMYA 4AJPA 4DUGA 4EY7A 3KP1A 5A5FA 4P4TA 1QV7A 4D9GA 1CP2A 3F7OA 3CVVA 2XBMA 4IIGA 5EOVA 3O95A 1YVUA 1AKRA 3SVLA 3OIFA 1SUWA 1JKJA 2VDMB 3WLOA 4DMMA 4XYEA 2RHDA 2QRVB 3TKAA 2ZAOA 3DEFA 4GOOD 2IS1A 1W5BA 1WPRA 2WU3A 2IKSA 3RBVA 1SKBA 2FG5A 2GM9A 2P1DA 4Y2YA 4ADSG 3L7LA 1XIVA 3FR7A 1W0JD 2ZRBA 4Y7CA 4B4VA 2CT8A 5KWIA 2ZYAA 3CEJA 4ZVKA 1KBOA 4QJIA 1CEXA 1FFGA 4R83A 1A8UA 3NBMA 2HV9A 2XDYA 3NTUA 4LJAA 2BKVA 4MYUA 5TNXA 4X60A 2O8FB 1PFUA 3EQ6A 1PT8A 4AMVA 5FBVB 1D3AA 1Z8HA 2D2XA 1HG1A 1ODLA 5KPDA 4QU5A 2CHQA 4RDIA 4RJ2A 5F3RA 4BWGA 3ESDA 4CQMD 1ILEA 3AW9A 4Q9LA 2Q8PA 1BRTA 3KOZA 1JMVA 4EH1A 5C37A 5L51A 1Z16A 5AJYA 4LRWA 3U4MA 2PZAA 4D7AA 1T4BA 2Y1WA 1IEVA 4TWRA 4XJXA 2C77A 2QV0A 4LVOA 4CLDA 1XMIA 3TW8B 3KSUA 4HNQA 4YRNA 4O2BF 5HZMA 4L75A 1E1NA 2H65A 2AFIE 3BJZA 3LQRA 5HQTA 4HPWA 3WB1A 4Q19A 2ZJ5A 1XN1A 3O8QA 2N42A 1TZCA 2BDTA 1XI2A 4R6WA 3D9QX 4CE6A 2CE2X 3H0CA 4ND3A 4ARUA 5I9TA 3KE8A 4Q3NA 5MN6A 3AYXB 4RL4A 3TJRA 1F5NA 5DXFA 3I5UA 2VVTA 1ZXLA 3E03A 3KEQA 2KWIA 2ZSAA 5JBQA 4QOSA 1EXVA 5HJEA 3JSXA 4LV6A 2P62A 2YUTA 1M33A 3BMOA 4TYMA 5L7WA 4HMPA 1D03A 5I7AA 1Y1SA 1Y9ZA 4J16C 5E6SB 4W6QA 4EDHA 1J2UA 5E6UA 4N65A 1GO2A 2RE8A 4XX0A 2Y1KA 4XA8A 3V4LA 4G5FA 1PQ4A 2JANA 4TTPA 4WJZA 4CBVA 3VO1A 3DLHA 5T67A 4ZTBA 3EYAA 5LZ7A 3TLMA 3P0JA 3DZFA 2O8BB 2FPKA 1JQ3A 2OXEA 3H16A 4GVLA 1X8XA 1M2OA 1Q2XA 1X1CA 2ZRGA 3FRHA 5CLQA 3DMPA 1KC3A 1Z18A 3LXMA 4OMDA 3FCYA 4U2EA 3SC2A 1Q21A 1E3MA 5F7XA 3DE0X 4ZTUB 4R3UC 1Y80A 4P7FA 1E0JA 2UYHA 4ZQBA 5KVQA 1P1RA 1MEEA 1KIAA 1LVGA 2X5NA 3HYRA 2A9PA 4CQLA 1F3OA 4YVFA 3SZGA 4JLBA 4MDYA 4WKOA 4GPBA 4TT3A 1SO8A 1UAGA 4R1UA 2D06A 3KXKA 5KWSA 1JSZA 4N39A 1JW9B 3AEKB 3RSFA 3CX8A 3DBVO 3NC4A 5AP9A 5L6LB 1J0CA 1XD8A 2B1RA 3PEEA 4QOHA 1F7UA 2VHUA 2B4TO 3EXEA 1DADA 2BM8A 2AH5A 4LQCA 5JTUA 3E3AA 4MP6A 3NONA 3OCUA 4P98A 3T5GA 2AOUB 3EFHA 3OWXA 4DYVA 3DFIA 4BLVA 1R6DA 4EMBA 3S1AB 4E31A 3IODA 3CLVA 2GPAA 4I8XA 2P4EA 5GY7A 2IV2X 2YMQA 1E1RD 2ZE6A 3Q7TA 1XHLA 3UGQA 1DKMA 2D0PB 4MR9B 3D5EA 1DCFA 1IG0A 1H1TA 2A0KA 3LCMA 4MTLA 2R60A 2ZRFA 3JQBA 3PA8A 4HAZA 4I5GA 2GJAA 4WN3A 2FR0A 4UMFA 1X42A 1Y82A 6PFKA 1EEXB 1YKSA 1ODCA 3LXRA 4RQUA 3RSSA 4F8EA 5BVGB 3EE6A 3NAMA 1MN6A 1RTTA 1C80A 3JYHA 4MQ4A 1JG4A 2O2JA 2ZJFA 1Z5UA 4O8CA 5BYBA 4WLVA 4DCTA 3MHTA 4IQ0A 5HOEA 4MR8A 3S5JA 1ISPA 1NNLA 3P52A 4ZCRA 3LSYA 1ECCA 1N6KA 3EAFA 1NG1A 2WVJA 3DWGA 2WOJA 5HX7A 3RWOA 2DWUA 5ELMA 3HKBB 4UTXA 4O8ZA 3BJEA 3FD8A 4CDGA 2I8AA 3QPWA 4CM6A 3BUSA 3C4JA 4X3PA 5H8WA 2W6PA 4HH4A 3V97A 1YRYE 2YXLA 1FE8A 3EFEA 4TZ0A 5KSZA 4H7DA 4F60A 2AYXA 1GZ7A 4DA4A 2TMKA 3KC2A 1QQBA 1VSQA 1ZJZA 2A9RA 2GK7A 3R40A 5KC8A 3U4IA 2QG9A 5CP8A 3Q3JB 1E9SA 4MYSA 1ESNA 3QFCA 4JR0A 3L1UA 4NENB 3FYHA 4B75A 3BHNA 4K6GA 3LRXA 4L3VA 3WE7A 4CF3A 1EK5A 4RTQA 1A69A 3DOUA 4RH0A 3DFUA 2OHGA 2GF9A 5A4JA 3KEGA 4LHYA 4B73A 4EO4A 1IUOA 3GAFA 3TLKA 4QUKA 5WRFA 3NHAA 3N7AA 1R10A 3CS3A 3NXSA 4K3VA 4BLUA 3FHOA 1QIGA 1BD4A 1ONOA 4EG4A 1DINA 1VHJA 4K87A 3WLPA 2I9KA 1EBFA 2X5XA 1O6CA 2RIRA 3U9LA 3ZE0B 1LF0A 2BFOA 2X5OA 1Z6TA 1WQ3A 3KELA 1RT9A 3FETA 4LRSB 2XYHA 4WEQA 1PNVA 1J2JA 3OJFA 3KAQA 3DXXA 1ORWA 5EXTA 5I9SA 4EYOA 1XDBA 1E5LA 2JB9A 4I1UA 2H2DA 2YY6A 2PSJA 4AMGA 2OBNA 4RY0A 1IB0A 1YQDA 1TM5E 5IK2A 4DADA 2FCAA 4QUBA 4KAAA 4M1EA 5DTRA 1E4VA 3HJRA 3AP2A 3BE6A 2QMUA 3EWNA 1B7GO 3FWHA 5BRJA 4RJKA 3ABQB 3SJCA 1VJTA 3NCHA 5AJUA 5L3SB 1PX2A 3A14A 4ZZ3A 2WHXA 3N28A 1CQIA 2OV1A 4RCVA 3SZUA 5A06A 3JTEA 1ICEA 3OIDA 3OEHA 4L51A 5AVJA 5CEFA 3EH2A 1RI2A 1OU0A 3KQNA 1GGJA 4OX9B 5AXAA 1S2LA 4ZKEA 1VG0B 3L4EA 4J1QA 3OA0A 4E4RA 4BVBA 2A0UA 5LDGA 2HUNA 2JIDA 3QI2A 4BFVA 4CMEC 1XPRA 1W5SA 3OZBA 5B36A 4K40A 2Q3LA 1MO6A 4C3UA 3KR9A 1R0SA 4D8XA 4IG4A 1VRCA 1GAQA 1SIWA 3IMGA 1AQJA 5SZKB 2AK3A 3DF9A 5F33A 1B6GA 1DKLA 3KRTA 2LE0A 3K7EA 1ECFA 5LBUA 3CUSA 3IQXA 3KKOA 3TSAA 4HAIA 1R6TA 1TJNA 2BSXA 2IH4A 2VP6A 1GT6A 4RZSA 5FX2A 2BD0A 1U6IA 4R40A 2P2CA 3R3WA 3DV0A 3AEYA 3ZGNA 2C78A 5B12A 1GJRA 3C3WA 3L1KA 3W6UA 1RM5A 2X4LA 5GV8A 1A0OA 9ABPA 3B7WA 1EX6A 1ZESA 1CR1A 5IAAA 4FJ1A 3ZGOA 4M1YA 4ZHSA 4YUAA 3Q9LA 5ABPA 5JFTA 2ANBA 3RHZA 3UHAA 1E18A 2ZYIA 3QMWA 2CUZA 5FBKA 4QUAA 1GP2A 3L8HA 4F97A 3BL5A 5JD6A 1MAUA 4GC9A 4IOMA 3VBCA 3W9UA 3NGXA 5LQAA 1CF4A 1JZQA 3RS4A 1R64A 4ZYLA 3AFGA 1FFDA 1ZOSA 3UMBA 3F4BA 4Q3LA 3LUBA 3QVUA 5EJEA 3R3XA 3V8NA 1T0BA 3F90A 1U81A 4JB3A 1CJKC 1TO2E 4JP3A 1CCWA 2HLPA 1S8NA 1CR0A 1ZC4A 2NSYA 2ZS9A 2ZYGA 3IMFA 5KQSA 4TXLA 4LF7B 1AQYA 4HG2A 4KE7A 3W4JA 3E9EA 5ALEA 4HWTA 3C6KA 3T15A 4RKWA 4GL4A 4R8KA 4H4DA 2JIZD 5LB2A 3REQB 4UDOA 1SXQA 2VWPA 1OD6A 1IB6A 1I4LD 3WNDA 4Q9JA 5H9WA 1CFZA 1T1JA 1YBHA 4OJQA 1F8GA 1I2BA 3H2ZA 1XKTA 2JD1A 3EQ8A 4QQNA 4EFKA 1EFCA 5TX7A 5TEWA 5AKXA 4A82A 2I3ZA 5CLJA 1L5YA 3BWMA 3KQOA 2CZQA 2ZUVA 4X97A 3D6UA 5A02A 3GT0A 3UAZA 2BDEA 1M54A 1NMXA 1JXAA 1ZDMA 1DIOB 1ZGHA 2WLTA 3LBNA 2FN3A 5JAQA 4PZUA 5SZHB 4OLAA 2VHWA 4FWBA 1CYEA 2VJOA 3HR4A 3HBJA 1AOXA 2YOGA 4X45A 3L3BA 3CSUA 3ZGYA 4AZTA 5KOJA 4RD1A 2JAUA 3L40A 5L53A 4X92A 4LMPA 3MFYA 4U7TB 5AKIA 4AULA 5IM4F 1E98A 1C3OB 3UAXA 1C30A 3FAKA 5A4DA 2ZJ0A 5DM70 1JIQA 2JCXA 3ACDA 3ZBTA 1OXXK 4MMYB 3T7KA 1RHJA 4D4GA 1WLYA 2EZ9A 4K9PA 2W8ZA 3RSQA 1PAUA 3H11B 1N7HA 2HQOA 1UKYA 5AM5A 3LRPA 1V47A 4AJOA 5IVHA 4YJ2A 4OU4A 4KDRA 2CJPA 5B1DA 2OCBA 3AI1A 5JS7A 2EOAA 4E2YA 1J24A 4RF5A 1FTYA 1KIFA 1R5JA 1W36B 1BMDA 2HIMA 2SKEA 1XHEA 4CCAA 3IURA 4MI3A 3B6KA 3GEDA 4X90A 3ZY4A 3HY3A 3CKMA 2HSEA 1BEEA 4I14A 4KSCA 4V1CI 1SQ0A 2X58A 4M0UA 3PRJA 5LXTB 1YAJA 1JX6A 2WIKA 1AB6A 4BB0A 2IYVA 3DD1A 4XVQA 3SXUB 3V80A 1KO8A 2PLWA 1LPAB 4XSVA 5LBIA 4WH0A 3ZG6A 5LP6F 3VNVA 2PFGA 1TW2A 1UXOA 1DQPA 4L72A 5AXDA 2XZPA 4DDKA 1JEQB 4J4TA 4Y6LA 4F72A 3OE7A 5HCUA 3FOCA 1SQ5A 3K8ZA 3SIPA 5B5SA 2IHKA 3EVFA 3PPWA 4HDNA 4Q9IA 2GPWA 2JASA 5LL6P 3G0OA 4R1LA 3DOFA 1YOBA 3I05A 4NH4A 1H2EA 3UCEA 2PUCA 2E87A 1EXMA 4HB3A 2HF8A 4J9VA 3TH5A 2P2LA 3Q9UA 2GZ2A 1UMCB 1AUQA 2WAYA 3VR3D 4B4KA 4D98A 4ZREA 4KSYA 1N2ZA 1PNOA 3KCNA 2AX4A 3MWDA 4IV5A 3W6ZA 4B4WA 3Q5DA 4ZJZA 2DKOA 1D0IA 2HRRA 1G17A 4AZSA 3J81k 2R1TB 2XW6A 4ZQGA 1YJCA 3VR1A 4A27A 1P2VA 4BFSA 2ZVJA 2O2GA 3FAZA 4HHEA 3PVSA 4GMGA 1MXHA 3NEJA 4DSUA 5ALKA 4PR0A 4L0CA 2C4KA 3I45A 4RA6B 3R8XA 3H2BA 3TTVA 1VMDA 4EKYA 5BOVA 3EOBI 1HDEA 1C0LA 2CJFA 3H4VA 5I9MA 2DUNA 4KPFC 1DV2A 2LXNA 4CDRA 3BB4A 4RQAA 2BGMA 3RK1A 3VYTB 3HHEA 3F7NA 1GPBA 4L5IA 1NPTO 1Z38A 1NJ8A 2C7VA 1NLMA 1P7PA 4IILA 5LA6B 2VYFA 3U4DA 4UMEA 5DKFA 5EJGA 2CHGA 4EGJA 3RYFA 4D9KA 4WTOA 4Z99A 1JG6A 3LWDA 4TXJA 5TJHA 1LA2A 4Q3OA 2IUYA 3C3AA 3R24A 4J0JA 4JLVA 4X6UA 4A5SA 4BKPA 2PVPA 2Z57A 3D6HA 1N1MA 5EPOA 3LA8A 5FYDA 4J7AA 4MW1A 3T4UA 5KINB 3CXUA 3SFZA 1BIFA 4ACBA 3T34A 5BURA 1QVVA 1JFTA 2IITA 4DR4B 2EDAA 5D6OA 4GE3A 2WSYB 2OXIA 1PZXA 3LBAA 4HGRA 3HB1A 1Z82A 4J76A 4DIMA 2FMHA 3HVIA 4BAZA 2XHZA 5KKNB 4RTSA 3HXOA 5K51A 5CA1F 3KXLA 1JXQA 3PUZA 1KP3A 3ZYCA 1RYBA 2DBQA 3O7MA 5F21A 4TLCA 2BFDB 4LOKA 1FSFA 1ZSVA 5EWJB 3B5IA 1EJBA 1FP7A 1P7ZA 1YHNA 2HXGA 3TD9A 1YI1A 3LCRA 4D79A 1SN7A 1MJGM 2I0FA 3CURA 2FJPA 3FHLA 3OUZA 4QQKA 4CLOA 3DBIA 4XGRA 1Q0HA 1GUAA 4KYVA 2WD9A 3VR3A 1BA2A 1PCXA 2AKAB 3HPQA 1DC8A 1UJBA 4NBVA 2E4AA 4MR7A 3FG9A 3GEMA 3MGAA 1XMQB 1MQ8B 3LX6A 5TGZA 2E49A 5ADWA 5IYZA 4IHJB 1KMHB 2HREA 1AM4D 2IDMA 5BN5A 3JZAA 1LLUA 2P3QA 1P4SA 4FYWA 4IHKA 3QE2A 4LRYA 4B3MB 5JLAA 1TYBE 3ND8A 4DIDA 5I7VA 3NNDA 3L82B 1KETA 2W6ID 4U5XA 2PAAA 5FWYB 2G1AA 1JAZA 3HEAA 1ZI6A 5EZSA 1C9JA 1KYIA 5FUBA 4CU2A 2F9LA 1UIRA 3RJTA 2AZTA 5B57C 5ITVA 5MN4A 4TVKA 5SYNA 1PJLA 4QYXA 1SHTX 1X1BA 4L8LA 5LOVA 4LCEA 4B80A 1K8RA 2XDWA 1OXKB 1Q22A 3OFSA 5F1PA 2XRMA 3BRWA 4K9OA 3WNQA 1JHDA 3HA2A 3W8EA 5JYEA 1R4NB 3Q2OA 2IXFA 1JLRA 1U2TA 3EXHA 4E1BA 3T3DA 2RK6A 4ARSA 2R86A 1Z4PX 1ZJYA 2AKEA 3G9QA 5BV8A 1TVKB 1C7ZA 3JVDA 4TTRA 4LSGA 3SFTA 4MGYR 3GLGB 2IXEA 5KTTA 1JFSA 4CKWB 3GJTA 3NGMA 4QDZA 4WACA 2PAFA 3FIJA 2JFZA 4B3BA 3TRFA 3EXG2 2VT2A 4PZ9A 4EYSA 1I0ZA 2DP4E 2PYDA 3IV9A 3M4ZA 5CIQA 1EUYA 1CUJA 1UP6A 1A96A 1T1SA 3OESA 4BVHA 3N39C 4FILA 3UKOA 4EHKA 5DP2A 3TIGA 1D0SA 4KXUA 4MA4A 3JWIA 1M6VB 1AQIA 1VPDA 3ANXA 1RCUA 2C2HA 3OSZA 3IQFA 4TQAA 3KV3O 2XQGA 4N01A 4NZYA 4H7HA 4C06A 2FMXA 3IA7A 4EZEA 2YIVX 1XALA 3F6EX 1NBWB 1YS4A 4P2BA 1PR0A 1WF3A 4ZZ2A 1K92A 3WK6A 3R6TA 4KCGA 5CCEA 4MKZA 3A9SA 1JVBA 1Y1RA 3PLRA 1U7OA 1GSHA 5EQJB 4QFBA 4H7EA 2JVKA 4QUEA 3PR2B 2UVDA 4UZSA 5JSKA 4E88A 1GZ5A 3PDCA 4FGUA 2BFPA 2BZ0A 4AZ3B 5LIRA 4FJ0A 1BO6A 1N1GA 1W8DA 3DKVA 2UVPB 4U39A 1GGNA 2P0EA 3DF7A 2IGBA 1KS9A 3N59A 3TBKA 1XV5A 4JROA 3LOQA 1L7XA 5G4KB 4E5VA 4KKXB 5K8JB 1MZPA 5CNIA 4MS1B 2G4LA 4EQ6A 4TYWA 4CU5A 4J6EA 1PUIA 2I7XA 3QJYA 5LUBA 3HADA 4EKNB 4JP8A 3B3AA 3MYRA 2BFCB 4KQ1A 4ANFA 4E5NA 2DKFA 2IS6A 5AICA 3RS5A 2V58A 1X92A 4YV0A 1U7XA 4JJEA 1QU2A 2AXEA 4XDGA 5LC1A 2GLTA 4EUEA 4CWAA 4OK5A 2ZJOA 3HXTA 2LWIA 2ECOA 3JU3A 4KQCA 3ZWDA 2Q5HA 2WHYA 1T9DA 1A8SA 2XR1A 3GCXA 3KB8A 4LSMA 3STYA 1E4OA 2YICA 4PZLA 4D6XA 1JSXA 2NTYC 2H52A 3NAGA 1TUIA 2O8CB 3R7AA 3WLNA 3MT7A 1FDOA 4S3MA 5IBQA 3T5CA 1J06A 4LHEA 2WMNB 1BSVA 4FE7A 1R6AA 4BVKA 1SU4A 2MSNA 1EHYA 2FYTA 3RKUA 3O8OB 3RYIB 4OMCA 5JW6A 4Z5XA 1SHLA 1XRSB 2JFBA 1Y7HA 3QLUA 5CLIA 2RHBA 1KOJA 5DNCA 1J0EA 2B8EA 9ATCA 4DCVA 3QEBZ 3DVAA 1Z37A 1PR4A 3IAM6 2HN9A 1GZHB 2RH9B 4G4SO 2A86A 3JQBC 2KBFA 3BBPA 1RM3A 1CJMA 2Q1XA 4IQ8A 1A9SA 3AHFA 4S0ZA 2AN5A 4YN3A 4OIMA 1FNCA 1HE8B 1OGYA 5KI6A 2HYIC 1Z25A 3KVOA 1RHUA 4BOYA 3MJHA 1WBDA 3AKDA 4W5QA 4F6RB 2BLNA 3H05A 2CFRA 1H5QA 2D8AA 4DGSA 4K88A 2XGSA 1VPTA 2NO7A 3ZU5A 1ODJA 3AR9A 3CTPA 4V0NA 1SXJD 5LQRA 2CGEA 2WU0A 1LBIA 1UFOA 5CDHA 4RDCA 3WO0A 3KPYA 1I6MA 1X9HA 4DMGA 3I9OA 3G2QA 3AK4A 3EUAA 2XUDA 1VCMA 4ID3A 3NHBA 4R1QA 3EZFA 3T0GA 4CN9A 5JNUA 2NNLD 4Q3CA 4JQCA 4WN9A 1RFLA 1PGNA 2C4WA 2QY6A 1IXYA 3V7NA 3UHJA 5TQJA 3SBXA 3QEAZ 4QBIA 4ZDWA 1Z47A 4XCVA 2FK8A 3G2PA 2GEVA 5FCDA 3SE7A 2CLMB 4WCVA 2JVIA 4IEFB 4OAQA 3U4CA 3PCTA 3BK1A 1JT9A 1C3LA 1JHOA 1J99A 4GP7A 3VDQA 5HK9A 2NXNA 5FBQB 5AHXA 3R3VA 1GY8A 1N9GB 1Y6QA 4MQFB 2G06A 4NG4A 2V9CA 4P4SB 4BQEA 3WXMA 3F9IA 4KR2A 1EBBA 1FMLA 4PLGA 3Q6NA 3OF2A 2NYVA 3A1DA 4NCHA 3M2PA 4I4NA 3GGDA 3SYNA 3VNQA 3WBFA 4ZWNA 3SIWA 4RK5A 4UPVA 1D5CA 2XD9A 1FMFA 4D80A 2FEPA 4MVCA 2DSNA 2A35A 3ZZUA 2VHZA 4ZHQF 1Z15A 3L79A 1YL5A 3NTQA 4ZOCA 3QF4A 4UTRA 2WZQA 2ZK7A 1UODA 3DH0A 2W2TA 4AO7A 3RD5A 2NUAA 1CUXA 2YZNA 1MO2A 3JQ7B 5K3FA 5CLLA 4UM9D 4B84A 5YASA 1TYDE 4GYJA 4HGOA 4WNCA 3FH0A 3O4VA 3N5KA 5F51A 3TI9A 2HGSA 1WMDA 1E0AA 5IBPA 4JUCA 9LDTA 4E5MA 2YY5A 2EG5A 4OKNA 3QV1A 3U7QA 4L4RA 1FOEB 3TIIA 5FQNA 4B46A 5D1HA 2OBYA 2AXNA 4RZIA 4BCCA 3ABOB 3H9QA 2ZJ8A 3O3OB 2GVDC 3EMKA 3LU1A 1CUIA 4BLOA 1FFAA 2X5KO 4TMTA 4BVEA 4FMCF 4TQ9A 1RQRA 2IYTA 3I92A 2DR3A 5BR8B 1FEZA 3BBLA 4BBAA 1TKRA 1LSSA 2LNDA 5JMWA 2VZLA 3QU9A 4FYJA 4ENRA 5IDVA 4HEHA 2Z1DA 2JK0A 1L4GA 2IPMA 1RQNA 1NDUA 5JQWA 1M5RA 1IUNA 1P0CA 3U3DA 1AA6A 2AZXA 3H04A 1UBSB 5TPWB 3W4KA 5K8TA 5DK4A 2YHIA 2RKOA 3OI7A 1BHSA 1P1HA 2C5HA 4RCZA 4BQSA 3N8HA 4CKEB 2QIPA 3L4SO 4PQFA 3GLFE 2PN1A 2G9RA 3PT9A 3R0ZA 2HCTA 4V0MA 4WMLA 3S68A 3T7RA 1LC0A 3I53A 4ZRNA 3FPFA 4HF7A 4MKGA 5IULC 1XCPA 1OASA 3L5KA 4LBZA 5DK6A 3G17A 5I9IA 1HYGA 4JBXA 4HFMA 3KVYA 4I1PA 2QRVA 2FU5C 2W2VA 4E3ZA 4LF8B 1RQPA 4N5IX 2H4HA 2QE7A 3P9KA 4ETWA 4JLAA 1ACLA 1UIMA 4TTIA 4PYJA 1DJLA 1UJNA 3GJXC 3GIDA 1JAYA 1PJRA 1ECPA 4BC1A 4CMHA 2O05A 4EA8A 4ZEXA 5DNUA 4XQEA 1T5BA 3NEPX 3NUZA 3K9FC 1QDEA 5JDCA 3OKCA 5JH7B 2PD6A 3NOOA 1FDTA 2OSBA 4RK6A 4RK0A 3F3SA 1Q0UA 4M88A 4HVLA 4NCAA 4B79A 2FKNA 2AL7A 2QTRA 2R3SA 4U7DA 2O8FA 4N18A 3CZRA 4A6DA 3FDIA 3HUFA 1W581 4F4HA 1G7RA 4FEAA 4DT1B 4KWTA 1B3RA 3W04A 2VJPA 2FG7C 1KA9H 5ALZA 3T6KA 1XJ0A 1KERA 3IB3A 4D4HA 2E0IA 4Z9FA 2V7UA 3TSCA 3VSAA 3X1XA 3ICPA 2QKYA 2A3RA 1WBBA 3BCRA 1HDRA 4KL8S 3W7AA 1PG5A 3TW8A 1H1LB 1X80B 1H8HD 1FU7A 1P45A 2C2BA 3HCDA 1L9XA 2OB1A 3I01A 4R8LA 2E5FA 2E48A 1UDWA 1V5WA 4FHGA 4ZAWA 5IAJA 2ATXA 2VDKB 1B41A 3FUTA 1G8HA 2FFAA 1OGJA 3HB0A 3I04M 2AG0A 4PAOA 4Y18A 4G3XA 3C7KA 1HEIA 3MEQA 5H82A 3WLIA 4JSTA 1J5EB 3HLYA 5KJCA 4ZODA 2IX3A 4TWBA 2BGGA 1G291 4FUTA 2VNIA 2IUEA 1A2QA 1U9IC 2B37A 3UG6A 4OGGA 1BVYF 1VJGA 2A59A 2F8LA 2O2SA 2ONCA 2PK3A 2PRJA 3UJ8A 3VA7A 4P0TA 3MT0A 3AJRA 4O4JB 5HRCA 1IBKB 3A37A 5E6SA 3AEQB 1ZAKA 3NH9A 1F8XA 4PPQA 3CKKA 3I28A 2C5AA 4H9GA 4PFKA 4B47A 3TMAA 1EESA 2AMYA 1SZCA 1H2XA 4BEJA 3ITEA 4IEIA 2WG2A 2WMDA 1KVTA 2FQXA 2H4ZA 4G24A 5CVDA 1U0BB 4FMDB 1WBJB 4MI1A 1ZR4A 3LV8A 3VNUA 2O8BA 1SKMA 2ZRAA 3CC8A 4GHWA 4NAHA 1G8SA 2WT9A 3V4PB 3QVKA 2PA0A 1LUAA 4CM5A 1KVUA 1F8FA 4FFVA 4AN0A 3FPCA 4JLSA 3FYDA 2YV5A 3HZZA 3GA5A 1VLVA 2GYUA 1A8PA 3FMIA 3ZC3A 3L1HA 1QONA 2OAEA 2QWXA 1J0BA 1V96A 2WJWA 3A6JA 3AEKA 4D0GA 2J0VA 3TE6A 4L4XA 4B7ZA 3WI7A 3NV9A 4MKXA 5T8KA 1DQYA 4MB2A 2ABWA 5C2JB 4A4DA 4OG2A 2GLXA 4JVLA 3W9BA 4G01B 1QP0A 1J1IA 2FE4A 2AOUA 2Z1NA 4OFBA 3AESB 3P8ZA 4X8OA 3TJZA 5I9NA 3R9XB 3S1AA 1VOTA 3E9YA 5D1NA 5F2KA 4GEKA 2R6DA 3DLTA 1V0JA 3EDQA 3ESZA 3FMFA 2I6TA 4N76A 4NJMB 5CNMA 2CV1A 1N78A 4BN0A 2OFWA 3HBLA 3C1TA 2H5JA 3MIIA 3QWFA 3ASZA 4H7PA 4MR9A 5SZIA 1BCRB 4TKMA 5A5DA 3HXMA 1GNVA 1NBOA 2WV9A 1AZTA 2EQ5A 5D86A 4E5YA 2ZYRA 2Y9PB 4QVKA 3VJRA 4WNAB 1A9XB 3PR3A 2OECA 4JLJA 1OH5A 1LK7A 4WZAB 2GZMA 3QI7A 5BVGA 1N0UA 3X2EA 5KQPA 1LBHA 2ZJAA 3FUVA 3QWHA 3WA6A 1IJEA 4N3GA 3CZMA 6NULA 1GFIA 1JYFA 3EQ9A 3WGMA 4MUFA 4DVJA 2F90A 2FZ5A 4Y7DA 3FVWA 5JNWA 4GO1A 4GWKA 2QG6A 2XOXA 2O1SA 4LA4A 1R8SA 3R74A 3I5XA 3JTMA 2NVWA 2OLKA 4YLYA 3TGLA 4NONA 1E5XA 1GGEA 1UM9B 2SHKA 2ON6A 1O9GA 4MZDA 5K0FA 3HKBA 1IEWA 2V55B 1CUVA 1U3TA 2WFLB 1ZJJA 2A58A 1HFJA 2IYUA 2X23A 1SVNA 1KP9A 3AY7A 2PM8A 1V9SA 1F20A 1M3SA 5I48A 1O94D 1WCXA 2XV1A 5E9JA 4DCOA 3QLVA 5KVSA 3PD0A 3K1TA 4KYUA 1N6PA 2NWQA 1GAWA 1U8UA 2W9XA 2Q2NA 1IIBA 3NFRA 2QVLA 3ZU6A 3FTPA 2PKYX 4Z0NA 1E9BA 3K4HA 3KJZA 3ZBQA 1T8YA 2UUBB 4GIBA 4NENA 3WNBA 2WYOA 1U4OA 1ZUIA 3L2OB 5J58A 1QFXA 1YJAA 2IHJA 1AKVA 3EXFB 3SK0A 1Y4AE 3MWKA 2X1MA 4W63A 4O08A 4WOJA 3NJ8A 4YEDA 2PWAA 4ENSA 4NV1A 4A7PA 1MAAA 2VCYA 1FC0A 1YI0A 2NXCA 1L4MA 1KFBB 1W35A 2VQFB 1RLIA 2ZWOA 3MMSA 3K0HA 3EMBA 4IO1A 3OJCA 1NVUQ 1VSUA 2RHWA 2PUHA 4E5SA 1TADA 3KEMA 1CSEE 4QPDA 1MNAA 4I1SA 3LC1O 2CJXA 3AP1A 2OD2A 2C4NA 3EZ9A 1FXSA 1JHZA 1I8TA 4JSYA 4OU5A 4N9QA 1HNXB 5A2QA 3PQ3A 1YUNA 2OWEA 2IPAB 1KMIY 1L4KA 2ZSFA 4X1OA 2CFSA 4UU7A 3GH1A 5IT0A 2H7CA 5DM2A 4D3XA 3FCSB 1XO1A 3KAJA 4A10A 1KZ9A 3DA8A 5AOCA 3ICVA 1JA0A 4OM8A 4L2IB 3C8HA 4OSEA 2J9XB 3AZQA 5AVTA 4DIBA 2B2XA 1VGRA 1DIAA 2P68A 2VQ6A 4P3XA 4REQB 2QPTA 4PNPA 3OC6A 5L3SA 4KJZA 1M0SA 2UUAB 1U3FA 3F71A 4HKTA 4XDZA 4I6GA 4BC0A 5JZOA 3I2GA 2HC9A 2JKVA 2VPZA 3K0FB 4YUVA 4O2RA 3ZUPA 4E33A 4YRMA 3I09A 4GI2A 2RD2A 3IHTA 4NBTA 2AOWA 4PBTA 4AS2A 2X0FA 3GRVA 1L5LA 2FZ4A 4ZT6A 4CIWA 1Z4OA 1J5PA 4O63O 2KX7A 1AUXA 4QRHA 5TGTA 3P32A 3VYWA 5L45A 2PGJA 1Y6FA 1J39A 5EMKA 4QUHA 1RR6A 3R2JA 3U6KA 3EEBA 1TQHA 3FF1A 4IJVA 3LTNC 4LYAA 1VLQA 5K8CA 1DKRA 4GUAA 4MJLA 1N2HA 4UDYX 3LX8A 5DNVA 5F52A 4UQOA 3VPFA 3VPHA 5CFLA 4Y2XA 5EUCA 3MJCA 4N8EA 5F3WB 2BGKA 2R5WA 2JPDA 2VDPB 3WA7A 2WD8A 3E35A 3OP4A 1ZGGA 2NUTB 4M9QA 1BOOA 3EZGA 2B1QA 3ANMA 4R68A 1NVMB 4KOEC 3WDMA 2XX3A 3ASUA 4OXKA 4O25A 5C18A 4RH1A 2P6MA 5REQB 1D1TA 1KSJA 4DQUA 3C5EA 5JY6A 4MVJE 4IMPA 4Y6GB 8GPBA 5ITZA 1E9VA 4RJLA 3A6LA 3AVOA 3I6IA 1P8JA 1FBTA 4MGEA 4IS2A 3IAHA 3INNA 3IDFA 4E7OA 2UUPA 5JARA 3LBHA 1XTSA 3GK3A 1VDMA 3GZ4A 4BB9A 2WC1A 5EN4A 4X6LA 4RTJA 1YB4A 3OFVA 4OJNA 2QYSA 3PCXA 1SCAA 4JUBA 3F3MA 1RYEA 3KD3A 4H4EA 3DFMA 3N5CA 1N2JA 3GRUA 3KOUA 4AJJA 1SH7A 2PJDA 3EBOA 3REQA 5BNWA 2G82A 4AWBA 2CNLA 1V25A 1ZD1A 1DZIA 3KM0A 5JXJA 4DA8A 2PIDA 2QP9X 4NCJA 4JGIA 5J4KA 1S4QA 5JMPA 3L4BC 1V16B 3WKDA 2R96A 1UFRA 3LW8A 2DULA 3F6CA 1TKCA 1S4MA 2ADOA 1DO2A 2P9JA 3PYMA 5FUYA 2FH5B 1MR3F 3RIMA 2WBLC 5LZ9A 2GK4A 1WZ2A 4ZEVA 1UBCA 1PG2A 3PICA 2Z2IA 3E1GA 1DI0A 2PUFA 3UMRA 3VNSA 1BX0A 4MCAA 4Y2UA 4F2HA 1FK8A 1C3OA 5FNVA 1YDGA 3VR6A 5JOQA 1XBTA 721PA 4QJ5A 5JPIA 4CTOA 5FI5A 1ZI9A 1XU9A 5H83A 3H11A 1OB2A 4AZ0A 1UWCA 4KWHA 1KK3A 1P2TA 3VZQA 2R48A 2ZB2A 1CC1S 1GU0A 1ZD2P 1RPAA 2II6A 4IJMA 1GU1A 2BM9A 5HRAA 1QC5B 4NE2A 1AZWA 1FFBA 1MC4A 2VAXA 2RG1A 1QNFA 3IAAA 3O8RA 4BP1A 4X85A 2MHCA 1Q44A 3VX4A 5JWOA 2G8LA 2Y6VA 3MD0A 2YZ7A 1R1DA 3L18A 2J09A 2OCDA 3PWKA 1YD7A 1XDDA 5FI1B 3KPUA 4D9NA 5LXTA 3SXUA 3HUEA 1E1YA 1UEJA 3A3NA 1T25A 4NWIA 4Q34A 4RK1A 4UUAA 4JLWA 4BWYA 4F71A 2I54A 2PBFA 2YVQA 1IQUA 2WNIA 1TCAA 3DOHA 1KDVA 2GPYA 3ZU3A 2O8DB 3ANLA 5JASA 2N46A 2QUKA 2GUGA 3ZJ4A 4D42A 1XQ1A 2XQKA 3OUTA 4GKBA 4IOLA 3O1IC 2EKLA 2RGXA 4YUXA 1Z6PA 2YDXA 4L0MA 3LQYA 1LBSA 1PT9A 1UMCA 1DAKA 2FR8A 2K87A 4L5BA 4Y1EA 3KTAB 4BGDA 4RIIA 4X93A 1VCNA 4ZZ1A 3K72B 4IICA 4IRXA 4XWWA 2JLYA 3MJTA 2R1TA 1WP9A 2GDJA 5L3QB 2BOVA 3S4YA 4CR6A 3KVNA 5U4QA 2CDBA 2Q9UA 3HN6A 3EN0A 3KXIA 1ULTA 1E3EA 1N2IA 3V1NA 3HJCA 3I2IA 2H2FA 3DFFA 4RA6A 4N1AA 4D81A 4NDAA 2CLDX 3CB4A 3RS9A 4BMOB 1Q50A 4C6SA 3KALA 1PK8A 5B1IA 2NQTA 2OHFA 4FYKA 4H18A 4IYJA 4MRMB 1CX9B 2IYXA 4LJRA 1N33B 1QQTA 2P9FA 1T29A 3TQRA 2JBHA 5KSOA 3MAGA 5LKAA 1DDOA 1X1AA 2FEOA 1LVUA 1ZN7A 2PX5A 5LA6A 3WLMA 4EYGA 2C2XA 2GH1A 4HN4B 2B83A 1V7ZA 4JMLA 2WM8A 1F9EA 4LDNA 1UOPA 3VPGA 1DC6A 1ECLA 1MH1A 3ENWA 1CZLA 2LVBA 1E32A 4GBGA 2ZTSA 4AVYA 2C3UA 1U3CA 2Y8EA 4CPDA 3NPMA 1E1DA 1HSOA 1U8EA 2NAFA 2QYTA 4LQLA 3JD4A 3VHRA 2XH8A 3A6ZA 5DBEX 1LY1A 1RKUA 1Z2PX 4PCLA 1FNSA 4D97A 3N0XA 1HE1C 3HB9A 3PGJA 4G0XA 4JV5B 2EBWA 5EIXA 3LPDA 3UT5B 4Z9XA 5EXEA 3SDZA 3I9NA 3HLTA 1Z68A 2QL6A 1T9AA 3FDXA 3ILSA 3IVMA 1XQ6A 4LX8A 5JYDA 4JVOA 2WZBA 1YMQA 2W71A 2W2NA 3HUDA 5IKMA 1HT1E 1B1CA 2PLRA 1KI2A 4HWKA 1CYDA 4G07A 5CH5A 3U19A 4UNSA 1XZNA 4YDRA 3UJ3X 2BFDA 1M34E 4H35A 5EWJA 3UOGA 2EFDB 2NAPA 2WDZA 4JI1B 2HPVA 4MCIA 4RSRA 1ECGA 3HBMA 3PHGA 3W77A 4RS3A 1EFRD 2VYVA 3AW8A 3GUVA 1GUYA 5LU9A 3UK1A 3HBAA 1T9GS 2ECFA 4JI7B 1IFXA 1KMHA 1ZGAA 2QX9A 4IHJA 1E0KA 4JODA 4MGIR 4XB6B 2FN7A 3PXXA 4JKIA 4BUZA 3LP6A 4N82A 2M1XA 2P1ZA 1IXRC 1G63A 4U7HA 2KPOA 2E1PA 3ZU4A 1WZIA 3LLSA 1TFRA 5AJHA 3THRA 4ETNA 5I51A 4HAUA 1AH2A 1UK6A 4BX2A 1U8FO 4KLCA 2QJTA 3G0HA 4RM2A 5FWYA 1C0PA 5ECYA 1NJGA 5HQ3B 5LCXA 4AY6A 2HDHA 4QYIB 2ZIZA 4QNRA 3SZLA 3ZK8A 1E6UA 1Y48E 1Y1QA 1Z2NX 2R7NA 5TY0A 3ZTWA 2OXRA 4Y1RB 1U8ZA 2FP4B 2JZCA 3OETA 2QY9A 1VKJA 3OSUA 4Q3AA 3WGLA 4ESOA 2Q6IA 1GQSA 2BMDA 3CISA 2AC7A 5GJBA 4CN8A 4MNTA 2WYVA 1JF8A 1U5AA 3K9GA 3OZEA 1H0KA 3H9GA 4PG5A 4HC4A 4KV9A 1R4NA 1XEAA 2VF4X 5HBRA 3WR5A 3GYGA 6AT1A 2I2XB 2C2MA 5E95A 4RHEA 2AD5A 1LSUA 5GOZA 5HMLA 4RYLA 1RHRA 2GX6A 5KJ1A 1UWLA 3HN7A 3I2HA 3NAQA 1NLFA 4DNOA 1RWNA 1VKRA 3K6RA 1TVKA 4QULA 3V1MA 3O2JA 3GLGA 3IPLA 1N5IA 1KBQA 4CKWA 3PPYA 1PW5A 2XUIA 1W4AA 2V0CA 1GVHA 3L1JA 1U0SY 4P35A 4UUMA 5HEKA 2ZM5A 4FVTA 1LEHA 1A97A 3J7TA 4XWAA 1I14A 1JBEA 5AW1A 3TFQA 1MAWA 1XTPA 2IYRA 3PNPA 4OUDB 5FLKA 1Q0PA 1PSZA 4M2LA 4DCSA 4C7OB 1VB3A 4NPHA 2GZAA 1QBKC 2C1ZA 4MUNA 1PL7A 3VU3A 3H2GA 3MAJA 1M6VA 3IRVA 3V7FA 1NUHA 1E2QA 5F5XA 3ZDDA 5AI6A 2H18A 4BV8A 2QT0A 1LCIA 4K9LA 1IOWA 1TJ4A 2DF8A 2OHIA 3G0GA 4H7KA 1U02A 1H8ED 4PIMA 1N92A 1TF5A 2EWVA 4XLLA 1AXRA 4ALLA 4DBLE 5EJIA 4BMDA 1EGQA 3O8NA 4H31A 3NBZC 3I1FA 2ZTMA 4MIKA 5DHFA 2QNBA 5A5GA 2I5PO 1BTOA 1C14A 3M0EA 1YV9A 3SYMA 1JG1A 3MOGA 4E70A 2GD2A 5AKYA 3PJGA 2Q4OA 1G16A 2AG8A 3GDWA 4KZKA 5JZBA 3ANNA 2C42A 4C07A 4AZ3A 2ZXUA 2PMEA 1FF9A 1ZRNA 3L6OO 1TK9A 2UVPA 5CGQB 4BYMA 3D6VA 3HM9A 2XSZD 3HI6A 2CXOA 4QDUA 1U6KA 3STWA 3GZJA