3E0XA

The crystal structure of a lipase-esterase related protein from clostridium acetobutylicum atcc 824
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
SNAMLHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSMGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFMEKIYHNQLDNNYLLECIGGIDNPLSEKYFETLEKDPDIMINDLIACKLIDLVDNLKNIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
molecule keywords Lipase-esterase related protein
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e0xA00
3H04A 4G8CA 2WHQA 3QPDA 2QXTA 1QO9A 3L1IA 1U8EA 5AKKA 5LZ5A 4GW3A 2H7YA 1UOOA 2WILA 4UPDA 1WM1A 2WJ6A 2Z5GA 3NWOA 1T2NA 1XZKA 3DKRA 1IVYA 4WJLA 5AKYA 1YS1X 2EDCA 2V98A 3H18A 5CT6A 5A7HA 1IZ8A 2JGEA 2ZVDA 2FJ0A 3NOXA 4MYDA 2ONCA 4J7AA 5EFZA 1QLWA 3HEAA 2I3ZA 1YCDA 1L7RA 1CUSA 3WKDA 3QZUA 4QA9A 1CQWA 4KR0A 3PF8A 2OG1A 5C7YA 1BN6A 3UUEA 4Y2UA 1LPSA 4FKBA 4RE6A 4IQ4A 4EY8A 1CUXA 3FCXA 4TVKA 1YB7A 5ALSA 1U4NA 1XZFA 3V1KA 5BWBA 5ALLA 4UHCA 4GLBA 3DL7A 5C81A 3MVEA 4EY4A 5LKRA 5F4ZA 1X2BA 4P9NA 2HA4A 3BF8A 3R0VA 2WIJA 3JYHA 4H0CA 3A6ZA 1L7QA 4J0KA 4YK7A 4X95A 3G8YA 2CB9A 5LYYA 1C7IA 2QKYA 4C88A 2BUBA 2OGZA 2B61A 2WHRA 3FLAA 3GROA 2HDWA 3BL8A 3HI4A 1CVLA 1XRRA 1NX9A 3DNMA 4LYEA 4KEAA 1P0IA 2DHEA 1XRLA 1XLUA 4P08A 1AKNA 4HTAA 3QBJA 5AOBA 1PV1A 5KREA 5J3JA 1BN7A 4DM7A 4AXBA 5AKGA 1QIKA 1JFRA 3DKKA 3DEAA 4BAZA 1SCIA 1GPLA 5HZGA 4UBNA 2XUOA 4Q05A 3DD5A 3OURA 3NUZA 1R1DA 4P92A 1ZD5A 3R3VA 3IBTA 4KE6A 2HIHA 3WJ1A 1K4YA 3IUNA 3C6XA 2WM2A 1QONA 4WY5A 3GUUA 3ESDA 4J0HA 1DQZA 1H2YA 3IA2A 1HQDA 2WG0A 5AJHA 1CUIA 3AJAA 4QDTA 3F67A 4X90A 4J03A 2PUJA 4UBJA 4IHAA 4PF1A 4DNPA 1CUBA 5EI5A 1K63A 3H19A 1LZLA 1RYYA 2HU7A 5AM2A 1VZ3A 3E1GA 1CUVA 5E4JA 3A2MA 3H0CA 1MT3A 2JGFA 1EHYA 4PQEA 2FJPA 1E8NA 4W9RA 4Y2JA 5AKZA 3L1JA 2E3JA 5JAHA 1QJ4A 4Y2SA 2O2GA 2WIGA 2D5LA 3K6KA 1G5FA 4ETWA 2VAVA 2X5XA 2AJDA 1BS9A 4NMWA 4FLFA 1MO2A 5SYMA 1BEZA 1DX4A 5AK6A 5ALPA 2I3DA 1R4ZA 1HBJA 3RLIA 2VT6A 3C45A 2HA5A 4TGLA 2OXEA 2JGIA 4UBIA 1CUAA 5K3FB 3STYA 3C6BA 5AM5A 5HCUA 4H18A 4NVRA 4DIUA 4QDOA 2RHWA 5AK4A 4XIIA 2GBCA 6YASA 2DHCA 4CIBA 3WLAA 4B0OA 3IULA 4PW0A 3ESCA 3TEJA 3ESAA 1YB6A 3V1MA 4U2GA 4B80A 2DR0A 3PUHA 1DU4A 3TRDA 4EBBA 4U2CA 4J3JA 3F96A 4Q3OA 3RK4A 2WIDA 1AQLA 5DTJA 3LS2A 3V48A 1UK6A 3GELA 3ZPXA 2DHDA 4C4YA 3E4DA 1FFEA 1VLQA 1QZ3A 1THTA 5T4HA 1NU8A 3WMRA 4BP8A 1AC5A 2WUGA 2Y6VA 4ARAA 4B9AA 2GYVA 4PSUA 4CCYA 1O6GA 5IKXA 1CQZA 2JEZA 3W9BA 4FFVA 4X91A 1UFOA 2O7RA 4QZVA 5ALRA 1CUCA 1QFMA 3R3WA 4OB8A 5HKBA 3ZWQA 3WK5A 2B20A 1ZICA 2ZJFA 1EB8A 4BAGA 4K2AA 4BTVA 5AOAA 2XQFA 1C7JA 5CH5A 2O2IA 2QUBA 2HFJA 4IH9A 1U2EA 4BVLA 5DYTA 1SC9A 3WKCA 1TCBA 1H2ZA 5LP1A 4YX9A 4X6UA 2JGMA 3D0KA 4INZA 4UBOA 3IVMA 1VE6A 2G4LA 2ZJ7A 1ETHA 3Q8WA 3A2NA 1ZD2P 4CG1A 2XMRA 1QIJA 4LHEA 1DINA 4BCCA 4G8BA 4AMZA 5JAOA 1IMJA 4WY8A 1QIDA 3I28A 3AILA 1KEZA 3OPMA 2JGJA 1OXMA 4D9JA 1VA5A 3F98A 3WKAA 5DYWA 1EB9A 2PU7A 1MPXA 4W63A 4DGQA 1RWQA 2IITA 5JANA 2WUEA 2IX9A 3WIOA 3O4JA 4UHEA 4PNZA 3FVRA 2DQZA 3T52A 1KU6A 3DS8A 5CTAA 3CN7A 3WJ2A 1XZMA 1QGED 2WSLA 2Z3WA 5ALWA 2B9VA 1QIIA 4C4XA 3FYUB 2HADA 2QS9A 2HM7A 3PUIA 3BDIA 4JYPA 3MUOA 2XMZA 1WCYA 4ITVA 1DWQA 2OLEA 1WOMA 4E11A 4JYMA 4G8DA 1XFDA 4X6YA 5JZSA 1E3QA 2VJBA 3EBLA 1GT6A 3AUKA 5ALHA 2AJBA 2CUTA 4FBLA 5FV4A 1QTIA 3F8SA 3QH4A 5E4YA 5ALUA 2HRRA 2OCKA 5AM3A 4FFWA 3LIIA 3IUJA 2PU5A 3BDVA 4BRSA 4J0JA 2FUKA 4ZWNA 4FBMA 3ZV7A 2WG2A 5CT4A 5LKAA 4DMFA 4X85A 1N5RA 2WFMA 4QWWA 2QUAA 4FOLA 2I78A 3UUFA 5BV7A 1EINA 1JJBA 4B6GA 7YASA 2C7BA 3FAKA 3M82A 5HQ3B 2YH2A 5KWJA 5ALIA 4B7ZA 3QMWA 4BZWA 2OQIA 5I9IA 1F0NA 1UK9A 2AJ8A 3NGMA 3R41A 5ALKA 1CLEA 4H77A 2WTMA 1IUPA 2R8BA 3I1YA 3IUMA 1TRHA 1QO7A 2VT7A 2ZJ6A 5BOVA 3QITA 4M0EA 4H7JA 3F9CA 1XZAA 1J2EA 1JKMA 3WK4A 2HA2A 4FHZA 3HACA 1D07A 1EDBA 1LPAB 3PI6A 4G4IA 3AIOA 2H7CA 1P0MA 4CCWA 3WL6A 3CXUA 3QVMA 1BCSA 1X70A 4X92A 2ECFA 5A6VA 3H2GA 5EIEA 1EA5A 2GBFA 3AZQA 4B0PA 5K3DA 2WFZA 5KWIA 3HABA 2WTNA 5E2IA 1W75A 3G7NA 2GYUA 2QTBA 1ZI9A 1M33A 3WK8A 3ANTA 4MQLA 3W9UA 5YASA 5IVDA 4QLOA 1J06A 5DTIA 1E89A 4G5XA 3ZLVA 3DJYA 1LBSA 4J0IA 4JH0A 2AJLI 4C4ZA 4DNFA 4H7EA 1TCCA 2XQGA 1CUZA 4AMYA 4KRXA 5CH8A 1G66A 4UHHA 3STVA 2V96A 3H2KA 1ORWA 1EDDA 5AKLA 1B6GA 1MAAA 3I2FA 3O9MA 2VJDA 3WYNA 3ANSA 1BROA 5C8ZA 4A16A 5AH0A 4W1SA 4MWTA 5T4BA 3GA7A 2NW6A 3DYVA 3R40A 1ACLA 1VKHA 2HA3A 2Y2VA 4Y2YA 1QIHA 1EXWA 5ALVA 4N8EA 1UT6A 2VF2A 3IDAA 5EHXA 3KD2A 1JMKC 1UKCA 1SOMA 4GECA 2RIPA 1CIJA 4GXNA 3VJLA 2BCEA 5EHZA 3ZI7A 1THGA 1XRMA 2DSNA 5D3ZA 3E0XA 1A8UA 3WA7A 2JGLA 3OG9A 5HK8A 4TPKA 1XZHA 4LKOA 5FP0A 1JU3A 3MGAA 3C8DA 4BC1A 4H7DA 4DSZA 4J0GA 5A7FA 4J0CA 5EHQA 5HFNA 5AIBA 4U2DA 1LPOA 4BDSA 4XJVA 1Y7HA 1ISPA 5FLKA 4Y7DA 2VJAA 2VATA 4A5SA 5JATA 2H1IA 2IIVA 5AM1A 3HRHA 3HYSA 2CEKA 4RGYA 1L7AA 4F21A 4LXIA 4BBZA 2HA0A 3H2IA 2XLCA 5H3HA 3I2HA 4ZV7A 4PO3X 1MX5A 4QNNA 1EK1A 1W4LA 5D3KA 4JUIA 2K2QB 4W1QA 4BCDA 4BZZA 3G0IA 1K8QA 5AKIA 3ICWA 1XQYA 4EY6A 1AURA 5AI8A 4BE4A 1ODTC 2BFNA 1FFCA 1VXOA 3I1IA 3GBSA 3BJRA 3DQZA 3AFIA 2W6CX 5FKJA 5JZBA 4KACA 4MQMA 3C43A 3FVTA 5AP9A 1WB4A 4OPMA 4UBKA 4EZIA 1LNSA 5K5EA 4UHFA 4KE7A 2O2HA 3WZLA 4UUQA 4MJ3A 3FYUC 4F0JA 4HXGA 5ALNA 2Y1KA 2H9YA 1XZDA 3WYDA 3O9VA 4MWSA 3DOIA 4GBGA 4UFOA 3OOSA 1CUUA 3HC7A 4XWGA 4AQDA 3W2TA 3H2HA 3SK0A 3W05A 1EH5A 1WB6A 5ESRA 2J3DA 1MNQA 4QDUA 5KBYA 4OUKX 4U2BA 2WUFA 1CUDA 2CZQA 2ZYHA 3WL7A 2OCLA 3A2LA 1DWPA 5ALDA 2PSJA 3H1AA 4H7KA 5AKEA 1NU6A 3D5EA 5D7BA 5FPQA 3OC0A 3GZJA 3I6ZA 1AGYA 3B5EA 1MJ5A 3V1NA 5BWCA 1HPLA 4DLNA 2V9ZA 1E8MA 4L3WA 4FNGA 1XLVA 2Y2UA 5ALOA 2ZYIA 4C01A 1TQHA 2ZYSA 5AKXA 5LLSA 5CT5A 5FRDA 2Z8ZA 1GQSA 4BC0A 3QM1A 1WPXA 4QEKA 1N1MA 3FYTA 5I7UA 1UWCA 2ACKA 4GEGA 3K9BA 3FSGA 3KDAA 3DL4A 2WIKA 4CG2A 1TAHA 3HXKA 5CXXA 4C6HA 5JZ9A 1EVEA 1LLFA 3I6YA 1HKHA 2WFLB 4RE5A 3VXKA 1R50A 3VJKA 5ALXA 2RI6A 1VA4A 1XRNA 2YXPX 1VJ5A 4W1RA 2O7VA 4MEBA 3F97A 2JIDA 5CT9A 3OM8A 1BCRA 3FBWA 3BE8A 1YA8A 4Y2TA 1YS2X 4OSEA 2WHPA 2Z8XA 3QMVA 3S2ZA 1J07A 3OTQA 4EHBA 4N5HX 2ZYRA 1B41A 5FOQA 3IIIA 4OYLA 1CPYA 2WHPB 2UZ0A 3T4UA 5ALEA 2VJCA 4CFSA 4DMCA 1K6EA 5T4EA 2QJWA 1JJIA 3STUA 4BTLA 4K5QA 3WA6A 1Q83A 4O08A 3STWA 4FLEA 3WL8A 5SYNA 1VOTA 3D3NA 3KSRA 2P8SA 1GGVA 5AI6A 4KJXA 5JIBA 2HU5A 3STXA 2CJPA 5DYYA 1VZ2A 2WKWA 3UMJA 3VVMA 4Q3KA 3Q0TA 5JASA 3G9UA 3D4LA 1YASA 1LPBB 3VVLA 3RKSA 2D0DA 2QOEA 3VISA 1EX9A 1UK8A 3WKEA 2XUJA 3G02A 2JBWA 5JADA 2Q0XA 2VSQA 1AUOA 3G9ZA 2PSEA 1G4HA 2OGTA 1A8SA 2PL5A 3WWPA 4MEAA 1ZI6A 3G9XA 2XUKA 1TCAA 2W22A 3STTA 4Y2RA 3WK6A 4BAUA 4BE9A 1UOPA 4A23A 2C0PA 4OD0A 1XZJA 1JMYA 2I03A 3BIXA 3PFCA 1HLGA 4P93A 4FDMA 3QPCA 1HL7A 3G0BA 3ZLUA 1R88A 1XZEA 4N5IX 5AHXA 4M0FA 2Y6UA 2QR5A 3R3ZA 3WWOA 1N8SA 4ZREA 4UBLA 3WWDA 5DNVA 4L9AA 4K6GA 2HHAA 3O4HA 1ZD4A 2VA9A 1K5PA 4IO0A 1CUGA 4X71A 5EGNA 2BKLA 1ODCA 3C70A 1QIEA 3I6MA 2R11A 4F5ZA 1UK7A 4HRYA 1YAJA 1GXSA 5AK3A 4F60A 4J0DA 4DTCA 3H17A 4C87A 5AM4A 3U0VA 3G9TA 2ZSHA 4KAFA 1OCEA 5ALGA 1AMNA 1XZGA 3EIOA 4G4JA 2JF0A 3FSGD 4LIPD 4ROTA 1WB5A 3KWFA 4NZZA 3PE6A 3G0DA 3EF3A 3C5VA 5JAPA 1CUYA 4B81A 1LPMA 4H7IA 3ED1A 4CCYB 1ZJ4A 3N0TA 4BVKA 5AI0A 3HJUA 3QMMA 5AM0A 4RNCA 2YASA 1QIFA 2XUPA 1BRTA 3FNBA 4QDXA 2C5GA 4I3FA 3JW8A 3BXPA 3R3YA 3C87A 4WCVA 3EQ8A 3DCNA 1SFRA 1ODSA 5ALZA 2ACEA 1HDEA 4QWMA 4Y2XA 2WJ3A 2XMGA 3FOBA 4HRXA 3SWWA 4BDTA 5AIAA 1MAHA 4OU4A 4HXEB 4BB0A 5LZ7A 3O95A 2FX5A 1QOZA 4X93A 1X2EA 1E66A 1CUEA 1Y37A 3D2CA 4B83A 2OAGA 2YYSA 3H2JA 2XMSA 3QYJA 4KRYA 3LCRA 4RPCA 1R3DA 4Q82A 2OQVA 2OPHA 2HL6A 2XMQA 1IUNA 3U1TA 1UKAA 2LIPA 3WQHA 3S8YA 5HKAA 4G4GA 3WK9A 1I6WA 4WFKA 4YASA 2GBIA 2HA6A 1UKBA 4OYYA 2OAEA 5A71A 2QJRA 1DT5A 3W06A 1ZIYA 4DNOA 1F8UA 2WUDA 1IZ7A 1JT2A 3ILSA 4E15A 5HFAA 2RONA 3K2IA 1CV2A 1Z68A 2C58A 1W52X 4UFNA 5IVIA 1AX9A 3PFBA 3AIKA 1XZIA 5EHNA 3M81A 1LPPA 2XMCA 1MNAA 2DQYA 4MYSA 2J3QA 2J4FA 5CXUA 4FNMA 1EVQA 4ZI5A 3DDUA 4MXDA 4QDZA 1CUJA 4Y2PA 2ORYA 2CMFA 3HSSA 5AI9A 1YR2A 3TJMA 2WIFA 1CUHA 2BJHA 4X6XA 4AZ0A 4FMPA 2DCMA 4L72A 4OCZA 1A8QA 5IVKA 3VKFA 5HF9A 1ZI8A 3WWCA 4X97A 1ZD3A 1ZGBA 3WK7A 5C8XA 4H35A 4CI9A 5HF6A 1GPKA 1VXRA 2PVSA 4FLMA 1EDEA 5K3EA 5A2GA 1KU0A 4ARBA 1OILA 3LLCA 1JU4A 2WJ4A 1QIGA 2XMDA 2QT9A 4AB1A 1UZAA 3JWEA 1YAHA 5CT8A 5A7GA 1JI3A 5DJ5A 3RM3A 3D7RA 4G9EA 5FXMA 5JARA 1LGYA 1FFBA 5JYCA 4CIAA 3AZOA 4I19A 4BCBA 4S0XA 3A70A 2QM0A 3WKBA 1QFSA 2GZRA 1QE3A 4GI1A 1XZLA 1Q0RA 3BWXA 5CBKA 4GWLA 1MN6A 1XRPA 5HQ3A 3YASA 4UHBA 2BAGA 1CR6A 4G1FA 2X8BA 1MTZA 3G0GA 3MUNA 4EY7A 3FLEA 3AZPA 1LBTA 3ZLTA 5I8PA 2QXUA 4LXHA 1H2XA 4UFPA 1Y7IA 5LZ9A 3GFFA 1O6FA 5ALTA 1JJFA 1W6RA 2BUAA 3O0DA 1VE7A 2OCGA 4CG3A 2XDWA 4N8DA 2GZSA 4X7BA 4AN0A 1CRLA 1USWA 5DNUA 3C6YA 4WDQA 2JEYA 5AICA 5LZ2A 4AO8A 2VTVA 2GYWA 4N8SA 1RP1A 4EB0A 2BUCA 3CCBA 2C4HA 5K3CA 1GPNA 2JGKA 1R9NA 3FYUA 2EDAA 3C5WP 1IUOA 5AOCA 4ZGBA 3RARA 3WZMA 3W04A 2QRUA 1BU8A 5AO9A 1CUWA 3WIBA 5D6OA 4K6KA 4BYMA 4HS9A 4JNCA 2CBGA 2B4KA 5LIPA 5ALFA 3FLBA 1A7UA 2HU8A 5ALYA 4JEIA 3D59A 5DWDA 1N5MA 4OU5A 5EIHA 1E8DA 3WWEA 4KE9A 1A88A 3IUQA 4DMKA 3ICVA 1WPRA 4W1PA 4Y2VA 5LZ4A 1MX1A 5JD6A 4UHDA 1Q84A 3L1HA 1XZCA 1XKTA 5AKJA 4AO6A 4U2FA 1ORVA 4H7HA 2PM8A 2C0QA 4B82A 4XVCA 1H22A 2PSFA 1EK2A 2G63A 4EY5A 1MX9A 2EEPA 1FFDA 3CCCA 3V9AA 2AXEA 2G5PA 2XUQA 1DQYA 2ROQA 4DNQA 3M83A 5K3AA 3KOOA 4FWBA 1YA4A 4K6HA 1H2WA 1XROA 2XUFA 2XE4A 1SCQA 2ES4A 5ISMA 1Q0ZA 1W76A 4PV7A 4EUSA 2QVBA 4BP9A 3P2MA 1MU0A 5ALMA 2OGSA 1F0PA 4LYDA 2WFLA 2CKMA 4ZV9A 5IVHA 5E4TA 3WL5A 1DX6A 3KXPA 1XRQA 2PSHA 4X00A 3X3HA 4OB6A 4GHWA 4OB7A 4HAIA 2XLBA 2XUAA 2BGNA 1AZWA 1WHSA 2PKYX 4B84A 1ZGCA 3N2ZB 4AZ3A 3PDCA 3FCYA 5FPPA 4PSCA 2XUIA 3AINA 3I2IA 4PSDA 4KAAA 3I2GA 2XQKA 4M0MA 3EQ9A 3G0CA 2PSDA 3IB3A 3LIPA 4XX1A 5EIAA 5K3FA 5FDFA 4Y9SA 3WI7A 2AJCA 2XUDA 2WG1A 1P0QA 4B85A 5CMLA 4ZRDA 3SX4A 2RHTA 1G42A 3LP5A 4AN1A 2VEOA 1PJAA 3DLTA 1WHTA 4YPVA 4Q3LA 2PBLA 1QTRA 3BJMA 5C8VA 2H7XA 3PICA 4Y2QA 5HF5A 4E14A 3DYIA 5JD4A 5A62A 1QIMA 4BRZA 3B12A 3C6ZA 2HFKA 4QLAA 5AI5A 2QZPA 1UXOA 5JD5A 3EQ7A 2XUHA 3O4GA 5CURA 1GQRA 1PFQA 1S8OA 3D2AA 4IH1A 3HZOA 4QE3A 3H1BA 4AX4A 2XQJA 1J1IA 4HZGA 3BF7A 2PPLA 2OCIA 1EI9A 4NS4A 3M3DA 4EA6A 1YSCA 1FJ2A 1ZOIA 1U65A 1ZIXA 2XMBA 3CN9A 3I2JA 2XT0A 3VJMA 1ACJA 4KAJA 4H7FA 2WU3A 3D2BA 5DNWA 2PX6A 4DMHA 4LXGA 4X94A 1CUFA 4HVTA 5LZ8A 3ESBA 1GKLA 3HLKA 1ZJ5A 2G5TA 3R3UA 2XUGA 5AKHA 4FTWA 5IH7A 1XQVA 5ALQA 2XI4A 2VQ6A 2PUHA 4UBMA 4Q1VA 4WFIA 2HRQA 1SCKA 5DLPA 3B3QA 4U2EA 5CRIA 1FFAA 2C5FA 5HK9A 1CEXA 3E3AA 1DT3A 4V2IA 4WFJA 3VDXA 1GKKA 4I4CA 4C89A 1TK3A 2XQIA 4WDRA 3I2KA 2VAXA 1T4MA 3PF9A 1C4XA 1UOQA 4KE8A 4Z49A 1W1IA 4KYVA 4L0CA 1H23A 4X3CA 2X76A 2Z3ZA 2J4CA 1BE0A 3AIMA 2XB6A 4G9GA 2RGUA 3V1LA 2ZSIA 5K3BA 2GBGA 1DWOA 1E5TA 5CH3A 5CW2A 4Q34A 1DTEA 3R3XA 4DYHA 3FWHA 4E46A 2HA7A 5ALJA 4B9EA 3O4IA 3C8HA 1CFJA 1R9MA 5HF8A 4ZXFA 1XZBA 4BVJA 3KWJA 2BGRA 1FSSA 2DFPA 2QMQA 1TKRA 4GDMA 5AK5A 2WLSA 3DOHA 4BATA 2V97A 2WU4A 4IH4A 1GZ7A 2RAUA 5T4FA 5JALA 3QPAA 3TGLA 4AO7A 3IURA 1XQXA 4DSAA 5JAUA 3BIWA 1XKLA 4HXFB 1BEEA 1XQWA 2WQZA 1F6WA 1LPNA 1P0PA 5AI4A 3SC2A 1LZKA 1TIBA 5FUMA 1XLWA
chains in the Genus database with same CATH superfamily
4L2IA 3H04A 3KYDA 1VI5A 3A0RB 2Q9CA 3AHHA 3O73A 4L9WA 4D42A 3GDWA 3GEPA 5JD3A 4KPEC 4G5FA 1Z4NA 2CXNA 2G5CA 2QXTA 4MK4A 1H2EA 4PVDA 1DKOA 1HDZA 1C0LA 2P9FA 1VJCA 1OFGA 1VBMA 1U8EA 3DBLB 4ZA2A 1JF8A 2Z83A 3ED5A 4UASA 4GW3A 3RS7A 2A30A 5LNK6 4RD4A 5HOQA 1XTTA 1S3IA 3AQIA 3E5NA 2Q6LA 4PN3A 1ID1A 5KJ6A 4HPWA 4QREA 3H3JA 1AJEA 2BN4A 5K8VA 1SMKA 2KX7A 4H16A 1NUHA 1B8PA 1SKAA 4A0GA 2CSXA 1VJDA 3IAFA 3GLIE 1CBUA 1F0YA 1B76A 1IAQA 1T2NA 1JR3D 4QFBA 4LTDA 4R7TA 3KTAB 4MR8B 4EWLA 1IWBB 1MABB 1FC0A 1Q1QA 4MGIR 4ITRC 4WJLA 3SLKA 4HGPA 4ZZ1A 3RJTA 1YS1X 2A5LA 2IU0A 1IE3A 3H18A 3AJEA 1BQ3A 2I6TA 2V6GA 4MI3A 5CT6A 5I4CA 2JGEA 3OTWA 1CWUA 3VHQA 4BEJA 2VO1A 3RJ9A 5E6SB 1NUSA 5I8ZA 2QAIA 3I9LA 2IU4A 1OBFO 1DKUA 1U3CA 4DSNA 5LU8A 1XWFA 3KYCB 4J7AA 1UMDA 5FUYA 3IVRA 1I6LA 4D0GA 3DLHA 4ARZA 3HEAA 4B3TB 1E59A 1NR1A 2FFAA 2I3ZA 3EPPA 2GCNA 2QVYX 3OETA 2C82A 4JU9A 1KJJA 1NQTA 2AS0A 2IRWA 3WE7A 2BF4A 4ZARA 1YZVA 1QS0A 3WKDA 3GPIA 4G65A 4CV2A 3KVYA 3LH5A 3HDYA 4QA9A 4TVOA 4QJ3A 2XAAA 5TMPA 1ONPA 3IESA 1O58A 4NDAA 2I22A 5C7YA 4FKBA 3GQBB 1I3MA 1PFGA 3EBOA 3GA5A 3KC2A 4UTPA 4RE6A 5ARBA 1N36B 4IM7A 4DR1B 3FWPA 1ODJA 3OF3A 1RRCA 1FP2A 4H15A 3PTLA 4TVKA 5L6MB 3CF4G 3NB0A 3L84A 2PKWA 4IUCS 1XZFA 3KZVA 3EQZA 4BJ6A 5BWBA 1Q0TA 2HIAA 1KMHB 4O29A 1IYZA 1ZNYA 5ALLA 2O54A 1ZPDA 2QRGA 1GGHA 4FYVA 3AGPA 5C37A 1HNWB 2JLCA 2YQZA 3MVEA 1FDRA 1I32A 1YE5A 2GHQA 4M7RA 1K89A 2C83A 4B4UA 5I9LA 4UHKA 1QBGA 3ICQB 4BPBA 4RFVA 4BJ1A 2ZZMA 4P9NA 1VGQA 4BGUA 3FGOA 1ULAA 3O4RA 1WRBA 1HE2A 3OKPA 3GUYA 3KT8A 4ZRMA 3UK1A 5EE9A 5DFAA 3OLYA 3OZGA 3OCCA 4J0FA 2GNAA 2PD3A 2RGNC 1X7ZB 2IYWA 3R75A 2ID9A 5LYYA 1QAOA 3NWPA 1HT1E 2ZROA 1C7IA 4D3YA 2PGLA 2QRLA 2QKYA 2IHTA 4RVSA 2WYIA 3QU9A 2CDRA 3PQ7A 3TB4A 3GLGB 2OGZA 3F1KA 4EYKA 5JQGF 1SQ0A 2QD3A 4CXMA 2QRPA 3HR8A 1QRAA 2WM3A 2LNDA 3GROA 4MUGA 4B74A 3HI4A 3Q3EA 1DARA 3IP8A 1CQPA 1XRRA 4L4ZA 3JQ8B 4ZI7A 3FLMA 4QVGA 3ZWNA 4E2ZA 4ZICA 2DLDA 5J4HA 3Q3HA 2XDAA 4HLUA 4KEAA 1WXGA 2QV7A 4WIAA 4E94A 4ZVRA 3MAJA 4PIPA 5BYJA 2IPAB 1JKJA 1QPGA 5CFLA 4RMIA 3DBIA 2E82A 3BXHA 1LV7A 1AGXA 3CF6R 4P08A 4U9UA 3M6MD 1KETA 5G0VA 2GAOA 3CNOA 4KSYA 5LA6A 2V0GA 4TTRA 2DUNA 5AOBA 1PV1A 4BMOB 1PS9A 2IOFK 3V7FA 1XMQB 1EM6A 1JKFA 1FLNA 3CSDA 3I83A 2D13A 4TWIA 3W5AA 3T3DA 4WOPA 4HLQB 1RLJA 1NRJB 1Y4UA 1ZNXA 3DEAA 3DKKA 3E15A 3HEBA 3UYLA 1BVRA 1J56A 1GPLA 4BAZA 3EC7A 1RXCA 4BLPA 1GADO 4UBNA 5L4SA 2XUOA 3ZTWA 4AZVA 5BUZA 1YFJA 5EG5A 5E9AA 2CLIB 3AHDA 4RSRA 1VDZA 4GX0A 4UD6A 2NU6A 2RK4A 4CKBB 1J6UA 4JY7A 2WIBA 5BNIA 1OJ7A 2ODTX 4IMPA 1PZXA 1FNSA 3R3VA 3OJFA 3Q1LA 5D01A 4KE6A 2ON6A 1J5EB 4JP2A 3BORA 1Z7EA 4LJLA 2ZWVA 2HWWA 4TTIA 2TMDA 1JP7A 2LR0A 3AETB 1KYZA 3C6XA 4GD3Q 4JVLA 5F73A 2X40A 3TNYA 1MA3A 4IVQA 4N49A 3E18A 4Z4HA 3A3YA 3ESDA 1MIHA 1H2YA 2C29D 4FYXA 1XHEA 4I81A 5B1HA 2W4QA 3SS9X 4X64B 1KH2A 4ARSA 5LVAA 1FUIA 1S1MA 4QDTA 2QLNA 4OLFA 3EVEA 4YO7A 4E3WA 2ZWMA 4KI7A 1D0SA 3PT5A 4TQAA 1TZ2A 2WVHA 1IZYA 4KQIA 3OLXA 1XUOA 2PUJA 4LZAA 3D6VA 1L5HA 4UBJA 1GP2A 1UPBA 3SJ7A 3H75A 4QFMA 5EIFA 1CUBA 5FOVA 1OIWA 2XVAA 1MC1A 2NO1A 4NWIA 1LZLA 2X13A 4P33A 2J0VA 5HIIA 5JH7B 3L4KA 2PUEA 4NF2A 2BFCA 3T61A 4ADSG 1QFZA 3QU5A 4FS8A 1QMPA 1RYYA 3K32A 4ZCLA 1WLSA 4UOEA 5CD9A 3AM3A 1AUXA 2VJQA 3E1GA 4ILKA 2CW5A 2I1VB 2J41A 1E1LA 2Y1CA 1CUVA 1ZSVA 2V7PA 3MOGA 5E4JA 1SD5A 3MGBA 4ZEXA 5A4AA 3EEIA 4GYWA 3WMXA 2Y1OA 2FSPA 3V2HA 2ZR8A 5CTJA 3E53A 1CQXA 4OI1A 5HIMA 5I5GA 3C7DB 4KBYA 5G0WA 1MT3A 1ZUWA 1GKUB 5THXA 1Z4PX 2HF7A 2WP8J 3I39X 5JC1A 4CIVA 4PQEA 3QWHA 3MTAA 3PKIA 2KS6A 1C9EA 4DQDA 2ZTVA 2E4VA 2FSIA 5JAHA 2VHTA 1RPNA 1A5AB 1QJ4A 2X6QA 4FYYA 1DCMA 4CETA 4AJHA 2XVYA 3DEJA 3U2QA 3B3GA 3K6KA 4BKMA 5JMPA 3MWEB 4MIOA 3PK0A 2EU8A 2OHJA 2VRCD 2AJDA 3UV7A 2I4MA 2JI4A 1ZJJA 3HGMA 3IT3A 4FLFA 1WW3A 1P74A 1JDNA 1KY2A 4E5YA 4IPTA 2P9QA 3CKYA 1TI7A 3NHWA 5A06A 4LK2A 3UK0A 5SYMA 621PA 1UBKS 5DHAA 4ZDWA 3RFXA 3W5JA 3A6JA 1NMXA 3V4ZA 2VSFA 3S2FA 2OD9A 3WZ2A 1BEZA 1HLDA 5IMBA 3FPGA 1GYQA 5AK6A 4QDJA 4LOLA 5ALPA 1XTBA 5I7AA 2I1QA 4XGRA 4K05A 3CSSA 5LQKA 1R4ZA 3I76A 5JS1A 2RI0A 4WI1A 2AOTA 3NCTA 3U09A 3ZJTA 4MCHA 2O3RA 2QRZA 1C7QA 1J2RA 3IEXA 4E2XA 4IXDA 3QLVA 4Z0PA 5JO9A 5E2AA 4BNXA 2VT6A 3PYXA 2HA5A 4TGLA 4AJ9A 2DPGA 2PY6A 2OXEA 2H2IA 1EMDA 4Q7KA 5C1BA 2V1UA 4Q9NA 5LM3A 2J07A 5AM5A 2IKSA 3K0BA 1MGPA 3HCFA 4NZOA 1F8FA 2V65A 3W5BA 4A92A 3I6BA 2E4ZA 1R5OA 4L50A 3ZDRA 2I66A 2P67A 4RIGA 2VL7A 4RQTA 1YKFA 5A0VA 1W30A 3ZH2A 4C7MA 3KK0A 5CNIA 3WHIA 2ZJ5A 5LNK1 4HYYA 5LL6P 3FWKA 5DHQA 1WA5A 2DHCA 1YBVA 4HNAB 4NBVA 2BMAA 4MS1B 4XTCS 3ZI4A 3WLAA 4RJJA 4V0RA 1BMTA 1ES9A 3IULA 2V4MA 4PW0A 1M72A 2HK7A 1JZTA 2PT6A 3ESZA 4CM3A 2IS2A 4QT0A 3BN3A 1NVWQ 3ESAA 5IC4A 3PPVA 4U2GA 2V6JA 1UL1X 3RTDA 5AYVA 3ABSB 2QM8A 5L7YA 3O83A 1SUSA 1M2NA 1Z6TA 4RHXA 1IPFA 1MDBA 3EZLA 4UVHA 2ZB3A 1DLIA 3NYQA 3U37A 3TLMA 1SBTA 4J3JA 1Z6QA 1IZ9A 5WRFA 3L8HA 2P5SA 4MRAA 2QORA 2WIDA 1KAHA 1SD2A 5DTJA 4CQMB 2Q5IA 5GOZA 2BFBA 3U3DA 1XTIA 3IOMA 3V9PA 3CLUC 2EATA 1PYDA 5J47A 4OIMA 3KR9A 4KQGA 1Y33E 1T1RA 5A9SB 5TXGA 1FFEA 3HKEB 3RRJA 3M4NA 5HA5A 5K3SA 1JILA 1HT0A 3AR8A 3Q7IA 1M34E 3N0VA 3B9PA 1YZQA 4KGXA 2WJIA 3S0JA 5GADl 2AZ4A 3SF0A 1Y1SA 2J7PD 3AW8A 3TXAA 4U7GA 4DLXA 2AVDA 4K46A 1DZ3A 2A58A 1X80A 4L16A 2O2CA 1NQ5A 2UYOA 2JJQA 1R0XA 2ZU6A 2LE0A 3L8EA 5FUVA 2DBYA 4EELA 2O0HA 2ZVQX 3DTYA 3CWCA 5BW5A 2PZGA 1H2FA 4CMEC 3FCCA 4NCNA 2IHUA 3L7LA 4UNIA 4B9AA 2XKBA 3ROFA 121PA 1CQZA 1DLJA 2ODPA 2CT8A 3L6OO 3IP1A 3QIVA 4MW1A 1UFOA 5JW6A 3GRAA 3PFNA 3KDPA 4JLNA 1U7TA 4QZVA 2VJKA 1OVGA 4E07A 3GNQA 4ND4A 4S04A 1WP9A 3GZNA 1B6RA 1KY4A 2P6PA 4OB8A 1OH6A 1TW2A 1ZD8A 3K92A 1JS1X 4M1EA 3CS3A 3O82A 3E5HA 3I4LA 4N48A 2KHZA 2B20A 2VP4A 1YBHA 2M1XA 5B7QA 3EB9A 2PZ8A 2ZJYA 3UANA 2HWYA 1G3MA 3MMNA 1ISMA 4L6IA 4PINA 1ISJA 4K2AA 1VPWA 4KR6A 4C30A 1BU5A 4BKRA 2R8EA 1C7JA 4YCBA 1WL8A 2AH5A 2H11A 1VKNA 1C9MA 3OQHA 5CH5A 3NIGB 4F4DA 5HHTA 3GFOA 2ZU0C 3ADBA 1YR9A 3JWGA 4IH9A 1U3GA 1PIWA 3P9PA 2SKEA 4DRYA 4ZOLB 2UXBB 4J4TA 4J4BA 3WKCA 3D3EA 1A7JA 1E6UA 1RPZA 1NG9A 1U9IA 3ZWMA 2GNOA 2NOAA 1UF9A 3H16A 1P80A 3KVRA 4EPTA 1Q6YA 3QXCA 3QNUA 2C2ZA 1PBTA 3NTVA 2EBFX 1H2ZA 2PS3A 1N32B 1E3WB 3LGXA 2BZSA 4X1IB 1FFGA 1IQPA 4LFBB 1CVRA 1PTKA 1PZHA 1O6CA 1XXLA 2D2IA 3F49S 3R24A 5M2QA 4FMDF 4UU0A 4YX9A 2PX3A 2WC1A 5CP8A 4X6UA 1J9EA 2JGMA 2DP4E 2BSAA 4OAPA 3RRXA 1DOHA 1T3TA 4GZ6A 2IYFA 4O4IA 4UBOA 3JRWA 4DW8A 3MUEA 5EIOA 2BDTA 5ITZA 1W5AA 5IEBA 4GYKA 2TMGA 2R8YA 2XMRA 2VSYA 3AESA 3AWIA 4M0LA 1QHNA 3VH4A 4BMZA 4AMZA 1QC5B 4PC1A 2QN6A 1PE0A 1IMJA 3MWFA 4XQEA 4F1JA 5JY1A 3DEKA 4KFRA 5L3ZA 4EG5A 1Z47A 5JXIA 2Z43A 4DV4B 1UBRS 2FPSA 4M83A 3GG9A 2X0DA 4D9JA 2Q2WA 1I1NA 1N7JA 2GM5A 3QHPA 3SYNA 4DMCA 1ORRA 3GEIA 4RU1A 2FMFA 2P6MA 3WKAA 2QQ0A 3UGTA 4ZAFA 3KSBC 4RKWA 3KO8A 5DX1A 4A1OA 1EB9A 1MPXA 1I5RA 1RWQA 5FBVB 5EUMA 1V7ZA 5D7NA 3AOGA 4JYCA 3NC4A 3QOWA 4JUCA 2IITA 3ZIUA 2I91A 3AHGA 2WUEA 1TUIA 2HI0A 4TQ9A 2IS4A 3T5PA 1Y89A 4MPPA 1M1YE 4LVCA 1QGUB 2FF7A 5FB3A 3GL9A 4JYAB 3FI9A 2AJTA 4JENA 3FVRA 3T34A 2FLKA 4C21A 1TMOA 2PTGA 3T52A 3UXEA 3RRBA 3DS8A 3EGXB 5CTAA 3CN7A 3WJ2A 2YHIB 2LVBA 3E70C 4B8WA 2GFIA 2P9ZA 4RWEA 2J3JA 2OT3B 2QNBA 2NN3C 1VRCA 1EXMA 2ZRPA 3AUXA 1XZMA 3L1KA 4W5HA 5BUCA 1QGED 2FE4A 3AF6A 1J5XA 1J70A 2BM9A 2ZUCA 4WOJA 5CB0A 3ROMA 2Q3EA 1W0KA 2IVFA 3NDPA 3Q3GE 4JL8A 4ZANA 4EP1A 4X62B 1RJDA 5IX8A 2TS1A 4TMFA 4FJ1A 3KB8A 421PA 4C4XA 4RHUA 4AG3A 3RK0A 4UVDA 4TKLA 2NVUA 2V7GA 2RB4A 2HQOA 1FFWA 1GL9B 1OASA 5B2ZA 4LRQA 5EIEA 2LD4A 1G41A 3BDIA 4LUCA 5FLXA 3N76A 4H3KB 5TE9A 1IZ0A 3H9GA 4JYMA 2IY9A 4X54A 2CDNA 4EGJA 2TMYA 2QF7A 1VE3A 1XFDA 4KN8A 4OQYA 1KPHA 1A5SB 2G0TA 1DJOA 4NAHA 1GT6A 3D3WA 2ONZA 2PMWB 3DONA 3FZEA 1R27A 4BEWA 2IS1A 3OUZA 2AJBA 3C5HA 3M34A 2GI4A 2JB9A 2Y99A 2IPMA 1HZZC 2CUTA 1LSOA 3FF4A 4JCOA 3LKZA 4N3NA 4B73A 4QOHA 4AQYB 1XDBA 3D4PA 4OH1A 5ALUA 5HCNA 2OCKA 4BMCA 3K0FA 4GKAA 1BFKA 2O9JA 4HAYA 4MQ6A 4X1KB 4HRAA 5E1MA 2H4YA 4MWEA 3P71T 4DVJA 2I2BA 3E84A 3EXHB 1MENA 1QF7A 4FFWA 3FUXA 2VYND 3A1CA 2QTAA 4R98A 2Y66A 5T8KA 4MUNA 2PCLA 2ONJA 2QW8A 4JODA 2WY2D 2L2QA 4IIEA 5ER9A 1TQ6A 3A1NA 4WK2B 1YGYA 4IEFB 1K3FA 3LPDA 2Y76A 4EJFA 2W43A 4I6EA 4W8HA 2AFHA 1ZK1A 2JIZD 4J0JA 4Y1GA 5EWLA 2IXAA 4FYIA 4HFRA 1ZIPA 3U31A 3TSYA 2J5RA 1ADFA 4D4JA 1Q3KA 1U0EA 1KKLA 4OQ4A 2JW5A 1FLDA 4U3JA 2PH3A 5CT4A 4C9BA 1ATZA 3IYLW 3NPMA 4Q3BA 5JRZA 5IAJA 2ZWAA 4KFSA 5G4KA 3TTXA 4CT4B 3ST7A 4TV9B 3PNVA 5CCBA 3NWEA 2Q3FA 4KBFA 2E6UX 2QUAA 3TRKA 4AL4A 4CV3A 1N33B 4KQJA 2HBQA 3QJYA 3QOFA 4WPGA 1OYWA 4ZT5A 1AG9A 3TTYA 3LCVB 2JHAA 3UC5A 1JL3A 3ZUPA 4WT7A 1K6JA 1U0OC 2Q9BA 2QROA 4YJGB 2PZJA 1ABBA 1JJBA 2B21A 4DV1B 5T67A 2AYZA 1QKIA 2QVGA 4NCXA 7YASA 3FAKA 1BMQA 1P1JA 5HQ3B 2YH2A 5KWJA 1ZGAA 3AB8A 3PQ3A 1EGAA 4QNRA 5ALIA 3ROEA 5LP6B 1LX6A 3VYVA 3QMWA 5FWDA 5H4HA 2OQIA 1BJTA 3DKPA 1PZEA 2NTNA 2IH2A 1KO1A 2PS9A 4Z99A 3R41A 3GAMA 1KZ4A 1O4VA 1S0UA 5ALKA 2G88A 4H77A 3ODGA 3VHLB 3ZDQA 5IT5A 4PHTA 2CHUA 1IN8A 2OM2A 3G13A 4URUR 2WTMA 3MBOA 4D3SA 1U8YA 2GD2A 2GK7A 3TR5A 1AO0A 1Y34E 4O4LF 4YYZA 2RK6A 2FP3A 2DT5A 2GD0A 1GG8A 4HPJB 4IDFA 3UFBA 1FTYA 2P2ZA 5BQPA 2XCLA 3ZBQA 4BFSA 4IUBS 1G9TA 3GU3A 5JLAA 1QO7A 4YNBA 1L7OA 4KFCA 3K94A 1U81A 2R2GA 1V9CA 2XNCA 4AICA 4J7XA 3QITA 2VAPA 4M0EA 4E51A 1GV1A 1X7XA 1EIZA 3EGOA 3BQMB 3Q3VA 4DV6B 1EXVA 5JJIA 3WK4A 1CJSA 2HA2A 3NRJA 1EE1A 1FVFA 3HACA 4FHZA 4MR7A 5KNDA 1N2ZA 1KJYA 4ZK2A 4RCZA 4IV0A 3NNNA 1EDBA 2RH5A 3VMFA 3LXUX 4I4IA 3WL3A 3DCIA 1AQNA 2AIRA 4TM7A 3J81k 3AIOA 2O0KA 4RH0A 2IUUA 4B6EA 1RXSA 2QPLA 4LMBA 4ZGGA 2VJOA 3N8HA 4UDXX 1JPUA 1P0MA 1ZD1A 2I3GA 2W2NA 3A11A 4RIHA 3VZRA 4DIBA 4FUTA 4EATA 3L9XA 4JJZA 1NZFA 1SVKA 3GDGA 4XEHA 4CMHA 1N5JA 4BBAA 1PJZA 1P0CA 3SEQA 1IOVA 1WBBA 1FNBA 3FKSA 3TK1A 1EA5A 3NIDB 5FNVB 4BGEA 1PD0A 4D9GA 1MF7A 2BMJA 1QQAA 3DAFA 1P73A 2O05A 1S4QA 5E2IA 1L1FA 4FX5A 1MAUA 1OF1A 1T0JB 4CI0B 1GT91 3P9KA 2OV6A 3R0XA 2POQX 5DO9A 3I5UA 3IBCA 4QXQA 3HJHA 2JFZA 4QPZA 1SUCA 5FWYA 1E2UA 1JQAA 3DC2A 4YGYA 1MW8X 2P3SA 3PHCA 4PGAA 1GPDG 4P3OA 3UQZA 4F2PA 1K7CA 2IYPA 5CYOA 5JJBA 4CF4A 1MCZA 2Q5QA 3TNLA 4A0QA 2KBEA 1A9TA 4DQ0A 4R9VA 4G36A 3ESQA 3A1FA 3V4LA 4G5XA 5J4VA 2MSWA 1Y8ZA 3G79A 5DTEA 5EXTA 3ABIA 1O3YA 4JH0A 4DNFA 5EQJB 2VBCA 3B51X 1KEEB 4DN6A 2EQBA 2WTBA 1G66A 4UHHA 4QUJA 2V96A 3ZGZA 4I14A 5AKLA 2V1XA 3WRWA 3LLUA 1FMFA 2W00A 3I2FA 2A5FA 3O9MA 2QUKA 2P90A 3AY3A 3BHMA 3BHIA 3I72A 4P54A 4ZAZA 1U31A 4BTEA 5IRCD 4IV5A 1WKBA 2HB6A 2ZJ1A 3H84A 4RZHA 4OJNA 5BMVA 1QKJA 3BCRA 2D6FA 1BROA 3ZQUA 3J80A 3QUTA 1DRWA 1AGPA 1LLQA 2JAXA 3EMBA 3KV1A 1R8JA 5LQRA 2KJQA 2DX7A 3I9MA 2R96A 1T36A 2QMZA 1W7AA 4EFLA 3X44A 4MWTA 2YMMA 4FFDA 4F6CA 6REQB 1SUAA 1RHKA 1WSWA 3TGWA 5IAAA 1MJGA 2CXUA 2IP4A 2HGZA 4JYBA 2GN4A 3SM9A 4YXWD 1X7HA 4R8VA 2R6JA 3V2UA 5I4IA 4P5PA 5ANRB 2VNKA 1A9SA 2J5KA 4LOIA 1W0KD 2HA3A 1VMEA 4ZAWA 5CVDA 1E20A 5T8KC 1WJGA 1BRMA 1EXWA 3DZIA 5L40A 1YBMA 4IIHA 2HIGA 2QMHA 2WDZA 2YDYA 1K1EA 3TVYA 3ZHRA 2MYPA 1BSVA 3LLSA 3GLFA 4BUJA 1IJKA 1T29A 1UT6A 4QFDA 2YZMA 4EKEA 1JHXA 2F59A 1R6UA 1NLUA 2FEPA 3IR5A 4P3YA 4AJEA 3BFXA 1V11B 1BTOA 2Q0SA 1A82A 1K3TA 2XBUA 3R8CA 4BJ3A 1M9NA 4PZEA 5KC9A 4KMSA 3MTIA 1W36C 2YR0A 3BE4A 2XCTB 4M1KA 3EASA 3H9UA 1UBGA 4GECA 1NBMD 1M1UA 3R0JA 2RIPA 4LNUA 3PXXA 1AXRA 3GGSA 4HFNA 1JV2B 1ZNWA 3UWKA 3Q85A 2BCEA 3LY8A 3NXKA 3X0DA 4F46A 4ZCRA 2B7BA 3D6UA 5ARDA 4YRQA 2HX1A 2A1TR 3LT5A 3OPYI 4DLSA 1THGA 3KLOA 3T3NA 3LUGA 1U28C 3L8FA 3S5JA 1HT3A 4EIWA 1RJ9A 3HYTA 4P5EA 3MD9A 1AUVA 2OZLA 4FI3F 2FX3A 3X1KA 2JGLA 3OG9A 4F4JA 4LJ4A 4MJ7A 1A04A 5D3QA 6LDHA 2RG1A 3OOEA 3O75A 2P9HA 4BNUA 4KSCA 4PYLA 2P2GA 5FP0A 3U0BA 1D1PA 4I9UA 5FLEX 3KQYA 4KTVE 3U4GA 4M9SA 3EQ2A 1BXGB 2ZLBA 3MGAA 4KXQA 5FNVF 2ZBPA 4LMRA 4P8RA 1IL0A 1E1QA 2J0EA 2GPAA 5D1NA 1IONA 1J2TA 4PQYA 3HYLA 3VPGA 5A6SA 1L3IA 4DSZA 1FQWA 2OHGA 3P7MA 2OHVA 4Z86A 1ZVKA 2PD6A 3KYIB 1WZIA 3ABRB 5A9RA 2NT3A 4X65B 4B3SB 5DXJA 1DJLA 5FA6A 1O8BA 2YWRA 1EFAA 2WYUA 3JQ9C 4PTLA 5J5CA 1FNNA 3ZDAA 3EC2A 3D6JA 1YVPA 1DV1A 3EAFA 1AM4D 3OZDA 4OBEA 4XJVA 2P5YA 4E5DA 3ZE2B 3G7UA 3WSTA 1VJRA 2VJAA 2G40A 5IU6A 3P2YA 4L9SA 1QDUA 3PV0A 4HDNA 2FOIA 3AMVA 3EDCA 2IIVA 3K1AB 3MNFA 3O8QB 4R7ZA 5DASA 1JDBC 3DCYA 3BWEA 9ATCA 2JVKA 3DQQA 1QSGA 1J24A 1ND6A 1CIPA 1SN7A 1O95A 4G5OA 1FTNA 2OLJA 1U90A 3W6PA 2DQKA 4C7OB 1JFSA 2QAGC 3CLRC 4RGYA 4WWHA 2VPQA 4EUFA 4HZUA 1L7AA 3KJHA 2VLIA 4D4LA 3LLMA 2Z9BA 1M1ZA 1JEDA 2PL3A 2OPBA 4IKEA 2PT5A 2VDNB 4TLEA 4BBZA 4TVSA 2NSJA 2CF6A 3I2HA 3L43A 4S05A 1C3OB 1Y9DA 2QL5A 5LYJA 1RBMA 1FPQA 1AZSC 3JD4A 3BAZA 2C3MA 1W4LA 4I8IA 2K2QB 1JG3A 4Y2YA 1NR5A 4ARCA 2VTKA 3L3BA 1UJCA 2CC2A 2O48X 4RS4A 3UJ3X 3DE5X 1U8XX 3EN0A 3JQDA 3G0IA 3HB7A 5AKIA 1SIWA 4UAUA 4YXFA 5JPDA 2ZR7A 3TGPA 3THXA 2ZYUX 3ZS8A 2PA0A 1OE0A 1DFIA 3PP8A 5JAZA 5C1IA 4L28A 4MGKR 1VXOA 1YU6A 4B76A 1AN9A 2QT1A 4V03A 3TLAA 1NTRA 4MVJE 4I55B 4RSHA 2EWWA 1BKDR 2GQ0A 3E05A 3LC0A 4GP6A 1THMA 2PMEA 3DF9A 1KI4A 2AW5A 3BJRA 2CB0A 3EYWA 2HF2A 3DQZA 2DTEA 1F8GA 1QG2A 2PJDA 5A6SB 2EFCB 2CL7X 5SV2A 4F3CA 3AR9A 3P0JA 4WLOA 5ELLA 4RTJA 4LF9B 3FFBA 1G2QA 2EJTA 3ZHSA 5C18A 2Q62A 2AX4A 4CQNA 4WL0A 1XNGA 2R00C 3IRVA 4PCUA 3OEHA 4JN6B 5CEJA 3FVTA 4WEQA 2QLMA 2D1YA 4OPMA 1SQFA 3ICOA 3MT8A 2NU8A 4EZIA 4KE7A 4I8XA 1DIHA 2ZSAA 3GJ0A 2D00A 4YAKA 4N3GA 3IUBA 1I51A 2NPFA 4Y7CA 3H6HA 4F12A 4I1OA 4XSVA 1RWOA 3L7DA 3NP9A 4FGUA 5T6MA 3FN4A 1PV2A 4H17A 4R81A 1P7CA 1WXDA 4JB3A 4L8YA 1TLLA 4TMZA 4G5HA 4GMKA 3M6LA 2Y1KA 2H9YA 3CH6A 1YB5A 3S70A 4O59O 2J5BA 4KBGA 2YCLA 4CMEA 1WLYA 3WNZA 5KNCA 4PO8A 2P9GA 3ISVA 4MW9A 4C6RA 3OWHA 2AZMA 3SEFA 2WU8A 5D84A 3PUYA 4DBVO 1SBNE 1TC2A 1T5TA 4BO6A 3HC7A 4MVCA 1ITZA 1VHTA 3L77A 3DT6A 3H5WA 1A9ZA 4MV9A 4XWGA 4AQDA 4BO2A 1NI4B 2O8DB 1PL8A 5HSGA 1G0NA 1PR9A 3W2TA 5L95A 4V1CA 1UDBA 1WXXA 1Y9JA 2FYTA 2Z4RA 4B6OA 3GLFB 3SVZA 5TQ0B 5B58T 1EH5A 2CNWD 5EA2A 5HE8A 3EXHC 5ESRA 4YAGA 4G86A 2E4WA 1H42A 5JEEA 1SXQA 2NU9B 3GDFA 3OWOA 2JFQA 1IAVA 5KBYA 1Q20A 2R1UA 4Y2GA 4U2BA 5K0BA 2WUFA 4K1LA 1C7FA 2R0QC 4BO9A 3OHSX 1I33A 2BFMA 2VYQA 3PGA1 2H5EA 5TJHA 3U3RA 1HUQA 2OCLA 3D6TB 5LQMA 5MGNA 1WNFA 4PC2A 4D8XA 1DWPA 5ALDA 2VP6A 3I8XA 5A3JA 1IPHA 1GFSA 1XPJA 1NZJA 2W71A 3LNTA 4H7KA 4IIYA 3D5EA 3ET4A 4I3GA 1YS7A 1N6LA 1SUWA 2J8ZA 4P6VF 2D0IA 1NBMA 1U9ZA 2C9ZA 4C0LA 1GTRA 2BEJA 1GV0A 5FPQA 3OC0A 4M0UA 2IZ0A 4MLZA 1PJRA 1OXVA 4KYIB 2GWHA 3GZJA 3UATA 3I6ZA 3PXDA 2NMVA 2AN5A 4J1NA 2BHTA 2J9FA 3OEED 1MJ5A 3HVIA 4FDLA 1NTOA 2W90A 4PC7A 3UKOA 2QVCA 1MHPA 2YJ6A 3W2FA 4DLNA 2YWXA 4BKOA 4RHCA 1CF2O 1J1ZA 1E8MA 4NZ9A 4CR8A 1T5IA 1K08A 3D8HA 2IXTA 3X1ZA 3CVOA 1DEHA 5HM8A 5FO0A 1Z7GA 2OV2A 4L27A 2ZRMA 3FR8A 1DAGA 2ZYIA 1PGPA 3QVKA 3WYGA 2ZYSA 5F64A 3HCAA 3CTMA 3E2IA 2IXDA 3FPFA 5CT5A 1YR6A 3VZPA 2ZBGA 2I8LA 4LQCA 3OI7A 1ECFA 1UBTS 4BC0A 1H94A 3GNTA 1MG0A 4AMBA 3RE1A 3CZRA 3DXYA 4AC9A 4ER3A 3B7PA 3CBQA 1KE1A 2H29A 2C96A 5E6RA 1IPEA 2GAAA 1EFHA 3ON5A 5JAMA 4MW2A 1LBIA 1YDWA 3CUKA 4HH1A 1Y1KE 1D4AA 2ACKA 3LYUA 4G24A 4PCVA 1R66A 4MUXA 4A0SA 2HCTA 2NUPB 3TL3A 4B71A 2FDXA 4CPDA 5F9FA 1U5BB 3OBIA 4ZAYA 4B6SA 4C0AC 4OFWA 2W2KB 5FNVA 4AY4A 4Z2YA 2X0JA 2WIKA 2QAGB 3FUVA 1XLTA 3R7BA 2IEBA 2YDXA 2AF4C 1JA1A 4OHOA 1YZUA 2A9JA 2DWQA 2OV3A 2ZPUA 3HBJA 3HXKA 2PS0A 2YVAA 3TPFA 4X61A 1BJKA 1ZS9A 4NBLA 4R2LA 4YJ3A 4KR2A 4LF6B 1KZ6A 1CRQA 1P77A 5CXXA 2P2CA 3KEGA 3LW7A 3IQFA 3CO0S 1Y4DE 4HEA1 1XCLA 5EE3A 1EVEA 1L9KA 4CBVA 1JFLA 5I8WA 3W8FA 2X58A 2XYPA 1JR3A 4BC1A 3NUQA 3B9BA 2W6PA 1E77A 2I6FA 2XD4A 1UBLS 4FMCF 4M88A 1PYGA 3RNOA 3SHVA 3W8EA 4JJFA 2IHKA 2VF5X 3EZYA 4ZVQA 1F8YA 2X22A 1S9DA 3NTOA 1E58A 5ALXA 3W5VA 5LJIA 2C94A 4QG3A 2B3TA 1IHDA 2JZOA 3MHTA 1OI4A 4IZOA 1JNXX 4LAFA 3JAKA 1ZLYA 1HE1C 2XIQA 3CH5A 3A6FA 2IP2A 4YQYA 2FZEA 2IYSA 2PS1A 3QSGA 3S3TA 4D1YA 4QFCA 4U6QA 3KT6A 5CT9A 2BKVA 3WLIA 2XZDA 3OM8A 4F8EA 1VHLA 4YAOA 3BE8A 1Z6PA 3L0DA 1I4LD 3FMOB 4HK4A 4L9RA 4XOIA 1E2GA 1P7ZA 2O1SA 4I50F 4UU7A 3ZBPA 4A2CA 3AEQA 5IJ0A 4C0XA 1UIMA 4B6PA 1ZZEA 4FR5A 3EFOA 4H3HB 1KK2A 1JQDA 4MPTA 4N5HX 4JQYA 3T9FA 5HZHA 1B41A 1NG1A 2PYZA 4F2DA 5CFOA 3FWZA 4OYLA 1Y1PA 2QMYA 2UZ0A 2QL9A 3AERB 1XN1A 5A3SA 3S1AB 3RABA 5ALEA 2C54A 3UMBA 2BONA 1C41A 4WEOA 4EGCB 3IKMB 3WICA 5JZMA 3FHTA 1YUMA 5IJ9B 2R84A 1OA0A 1BW9A 1HZJA 1KBQA 3OX2A 2ZPTX 4R69A 2DFVA 3R9KA 2A4MA 1PVVA 3M33A 1ISSA 4LDQA 4KO8A 3B9QA 5DU2A 5EUQB 2B92A 4YMTA 1H9AA 1BXRA 3JAKB 4BX8A 1XALA 4Q6BA 5EVCA 5C5IA 2YXNA 2IOQA 2WSYB 4CF7A 4O08A 1XMXA 2GS9A 3JWJA 4BIMA 2Z3VA 4RZIA 2WVGA 2GLUA 1HDXA 4UDOA 4I8DA 4UUPA 1WZNA 3BJEA 3JWHA 2Z57A 4FLEA 1Z07A 3RHSA 5SYNA 4L7QA 4OIFA 2B99A 3AFGA 1Z3CA 3UJAA 1DJNA 4ZTZB 4ZC8A 3UKJA 1M66A 1IXKA 1R12A 2FCAA 2WJJA 1Y7PA 2WV9A 2HWXA 2NZ8A 3AHIA 4F45A 3TSCA 4G5QA 3DDWA 4NI5A 5JIBA 2IPOA 2IQIA 1O95D 4MVJD 5IZCC 1P39A 5GV7A 2WKWA 5DM4A 1ZISA 3CC8A 1T2CA 3N6XA 4F56A 2VNHA 1N9GA 4L5IA 1VLHA 1SCUB 3Q0TA 4XIJA 1JXOA 2I71A 4GVPA 1SVIA 2NUPA 3LSTA 1I30A 1QHYA 2OD7A 2P65A 2OC4A 1RWMA 3KOXA 1L4MA 1NW8A 1QHEA 2FG7C 3CX7A 5E6RB 4FUQA 4FIZA 4I1UA 3KFVA 2KPOA 3RKSA 2OKGA 3FOAA 2ATIA 4ESEA 5G02A 2WM9B 2YJTD 1WIWA 2OBFA 1D09A 1QV9A 3A1DA 3SBXA 2RDMA 4JWTA 1UK8A 4JVOA 4F96A 3G02A 1TCUA 2XZTA 4DA9A 2VSQA 4MUBA 1AUOA 1K8ZB 4YGXB 3IQGX 2RI1A 4KGZA 2H2GA 4M1QA 3DOCA 2AFHE 5DGHA 5CDFA 5T3UA 3ZS9A 3Q3CA 1SURA 4OK6A 3PUWA 3DHVA 4K88A 3VR6H 1PF7E 2XYVA 1QQ5A 4FHFA 1A69A 1CHNA 4IBOA 3WTBA 2XGSA 4IICA 3W78A 4EYOA 5JNUA 1PG0A 2WQ7A 1ZI6A 2WZDA 3ZTTA 2GOYA 2DTXA 3TW8B 4F6LA 2CNNA 3EIFA 4QOEA 5JS2A 4ESOA 4RL4A 1M6NA 3EGXA 4AWXA 3IELA 2IUYA 3B6ZA 1NE2A 4TTAA 4WN9A 3WWYA 2WQ6A 2IYRA 4GVLA 5EERA 3TMAA 5AFSA 1M6EX 1IEWA 1QGUA 1X1DA 2VKTA 2UKDA 3A7DA 3OQMA 3ORSA 3FSEA 1DCKA 3UJ7A 4Z7QB 2H5JA 2C0PA 2CXXA 2FW6A 4OD0A 4PBSA 3VPSA 3W6UA 2XMPA 1QANA 5I5EA 4DCUA 2GF2A 4MRPA 4Q9LA 1ZUHA 3ITDA 1QFYA 3KVVA 1IXSB 3VV3A 4ZHQA 2ZSKA 4KL8S 4YCNA 4UUBA 3PFCA 4C4AA 4XOUA 1F7VA 1L8LA 3CB4A 3ME5A 4KIWA 5JSQA 3X2FA 1QP4A 1D2MA 5FPKA 1HL7A 4YRCA 3G0BA 4LTNA 4ZK6A 4D8VA 3NEYA 1SQ6A 1MRZA 1XZEA 4RPHA 3ZOZA 4N5IX 5L7WA 4YCJA 1JEEA 4U7DA 3KPYA 1UAYA 3BXZA 2R25B 1I3KA 3NG1A 3ZTYA 4JI2B 4FR0A 3LA6A 2W6ID 5K20A 1FUKA 1V3QE 3KSMA 3MJEA 1VFPA 3AESB 1MEJA 4KDEA 3DWFA 4Z9AA 4ZREA 1KEPA 4LRYA 4BZPA 4Y6LA 3TFQA 5JV5A 3R5SA 2HHAA 3UJHA 5SY4A 1YDHA 3WRYA 3O4HA 3HXMA 4EM6A 3CW8X 5IJWA 1XKQA 2XOXA 3EODA 4IO0A 3TKLA 3B36A 1LNZA 2NZYA 1XC7A 3F46A 4EF4A 3C70A 1D2NA 1CF9A 1SIOA 1FS5A 2QQ5A 3O3NB 3PR2B 4JEMA 4A26A 1GRQA 1E3WA 3JALB 3ONDA 4ZJZA 4F86A 1NW6A 4CM5A 3S1SA 4B6FA 3N2GA 4O1HA 1O1YA 3G2KA 3IMEA 1PR1A 5FOXA 2QDKA 3OHPA 4ZHQF 1ZKDA 4IJ5A 1W2GA 3I8OA 4LMAA 2A9QA 3OE7A 4J0DA 4PRLA 4PICA 4FYKA 4CWAA 3BCHA 1NI5A 4R4JA 5AM4A 3UK6A 3QOXA 1JIQA 2OORA 4CDGA 1RPAA 3OFNA 5E4FA 5JCOC 2Q1YA 2AD1A 1E2MA 2WF7A 1BHSA 3G5MA 3KM0A 2YIDA 3H8VA 3W7BA 1JHMA 2VJLA 3OIYA 3NC1C 3S8MA 1NAHA 2CUNA 4OX9Y 1DC5A 3DLPX 5LOVA 2CXSA 1GL7A 1NVXQ 2C61A 2RCNA 4RD0A 4G4JA 2M6SA 2R47A 3K6RA 3OJLA 4ZI3A 1KI9A 4ROTA 2ERCA 1JHQA 1HYEA 3F5SA 4FCTA 4QJIA 2VPPA 1B0UA 5MN4A 3EMDA 3V4SA 1G21A 1A9OA 2MWMA 1I1QB 3PE6A 4M9XA 4H6XA 1DTWA 221PA 3CLHA 4DYVA 1L5SA 4E12A 1E98A 3KPJA 4DR2B 1LB1B 1WSBA 3THXB 1T9KA 4HLNA 4I1IA 1LPMA 4H7IA 1JLHA 1GL6A 5TB5A 1W4CA 2R2AA 2WWRA 1YRLA 3UH0A 3IT2A 4RVFA 4ZYZA 1XDDA 3GFPA 2EJCA 1C3OA 4CT0A 3GJZA 1JEYB 1FPMA 4BVKA 5HTOA 5AW2A 1E4EA 4HB4A 4DJTA 3JQAB 4YECA 13PKA 4OSPA 2ZJ0A 2VHCA 3OEHD 4ZU6X 4YP7A 1PFKA 1FDOA 4HZUB 3HJUA 1QHIA 2P8JA 1YRQA 1DKMA 2GWRA 2VT2A 4WECA 3TSOA 4BO8A 4C0SA 1RLUA 5IDYA 1XJQA 3R5TA 3UAYA 1V6AA 2PUBA 4PE5B 4O1MA 2YASA 2IUEA 3HKEA 3SC6A 4PQRA 3OT1A 1FQOA 3WJAA 1T0BA 2WVJA 5IM4F 1EAMA 1RWPA 2AT1A 1BRTA 2WIAA 2XEXA 4RVGA 3N1UA 1C1DA 2D3TA 2C5GA 2WNIA 4HDNB 4O33A 4PXYA 4UZSA 5IT0A 3QUCA 4EVSA 3EQ8A 2CLMB 2XECA 3GI1A 1OU4A 2IW3A 2XA2A 4RVHA 4J7CA 1F5NA 3EDYA 3GB9A 2ACEA 2V7QA 1VRVA 3ILHA 1VPTA 4E13A 2JLVA 3RNLA 2LDBA 3L49A 2A5GA 2YN4A 1I3LA 4AJNA 2XDQB 1A2OA 2C7PA 1HDIA 5AUQA 2PNFA 1XD2A 3FOBA 1OAAA 3PSHA 5FJJA 2GCPA 2RAFA 5TRTA 4YT8A 4MS1A 3QVXA 4Y9DA 3SWWA 4HNAA 4TTJA 2XIJA 3O31A 4R54A 5IH3A 3ZH9B 3HA7A 2MINB 3N8IA 3Q2IA 1C0KA 3DHWC 3OP4A 3OIFA 3FYCA 3RIGA 3M1YA 4IS3A 3VNBA 2BMEA 4BB0A 3O95A 5JMTA 1U9CA 1GGJA 3LVFO 2B78A 3FZNA 3VO8A 2FX5A 4OJTA 2GSDA 3SX2A 2AD5A 1DUVG 3HVJA 4RADA 5JDCC 4YRIA 1E2LA 3DFIA 3LMKA 4RESA 3WBBA 3D2CA 3VU3A 2FUNB 4B83A 4Y0AA 1CFZA 2EG5A 2VYVA 2SECE 4FD3A 5AXCA 3E9NA 1NQVA 2XMSA 3RSHA 3ZXYA 1JFFB 3TBHA 2ENUA 2NQTA 4QYIA 1TF2A 1NNI1 1UQUA 1ESEA 1KDVA 1KQOA 1L5OA 2J9XB 1II0A 3VGPA 5CITA 4FOSA 2W48A 2OPHA 3RVQA 4KLNA 2A9OA 2AOTB 3M4YA 2HL6A 4CMIB 4HWRA 2BJVA 2XMQA 1IUNA 3ADCA 3ORYA 3URMA 4R1TA 3U1TA 1UKAA 2DRIA 1E9EA 4AT1A 2LIPA 2ZYWX 3ENZA 1FDIA 4XW2A 3WQHA 1H8HA 1EM8B 5BURA 1DVRA 2YMQA 4G4GA 5AJVB 2X0IA 3II6X 2O3UA 3HBNA 4YEDA 4R51A 4XLTA 5IYZB 2TRSB 3HU5A 4YASA 4LZJA 1UXKA 2GBIA 2IEDA 1JDJA 1J33A 1IBMB 5BR4A 3K6JA 2JDID 1I4DD 1VMIA 2H4JA 5L3VA 1V39A 4WMLA 4BQQA 2JLXA 1XDUA 3GUZA 4S1OA 1VCOA 5GONF 5K9ZA 1S5PA 3H3FA 3KR1A 1FW8A 1ZIYA 1LI7A 4LRWA 5HIJA 1Z0ZA 3EXIA 2EGGA 2N46A 3JPYA 4GMHA 2GEDA 4A03A 2QSZA 4HSEA 1FFSA 4ALKA 2ICAA 4R5MA 1BMFD 2C7VA 2HF9A 3NVMB 4S3MA 1M1XB 1JT2A 4TXMA 5DT2A 3BMCB 3UJBA 3V8BA 3U17A 1XFAA 2ZJ8A 1WCIB 2RONA 4CMIA 3T9BA 1SKQA 4NE9A 3KLMX 1QR6A 1XJ5A 3PIDA 3PPIA 4G56A 4K9NA 3GJQA 2QNRA 4XPZA 4XSGA 1GCIA 1QGAA 2R68A 1X39A 2VK8A 3AIIA 4D8WA 5G1PA 3BTOA 3LD9A 5L3QB 2G1PA 3A9CA 5IVIA 2BSQA 3PFBA 1SG0A 1ZOLA 3PJEA 2G36A 3MLBA 2HK9A 3ZWWA 4B35A 2FMIA 3M2TA 5EHNA 1D8TA 3HCNA 4NFLA 2ZT6A 3J81A 3W5DA 1TE2A 3ECCA 2DQYA 3FUTA 4TL9A 3QE9Y 3F2VA 1K92A 3WSVA 5C5EA 2IA5A 1V4VA 4R9SA 1P0FA 3KX2A 1PHRA 1R0CA 2OBNA 2ZIVB 3FX2A 3ZHCA 5K8IA 3DDUA 1BC5A 1LFAA 2JVJA 2N1BA 1CUJA 3IAHA 4MXDA 4EA8A 2H2DA 5DP1A 4QTYA 4ZYTA 3IKTA 3CT4A 1WDMA 2NP6A 1OD6A 4MVJH 5KTSA 2OD2A 1JG7A 4HDRA 4BU0A 3ZGOA 4F4UA 1HYGA 4EFMA 3OQNA 1V3UA 2FRVA 1U7XA 1DJPA 1LRLA 4X3PA 3T5GA 4URWR 2C88A 3RWOA 2BJHA 4AZ0A 3EXEA 4CDMA 4EF5A 1H1DA 4QJ4A 1U2GC 4YFYA 3N8GA 5FWYB 3HVRA 4O2LA 2ZBEA 1PGNA 1TAUA 7ADHA 1ZJ6A 3ANMA 3OECA 8ATCA 1A8QA 2M6LA 3P32A 5EKXA 1QYIA 5HF9A 1GG9A 1ZI8A 3WWCA 2G9QA 3WK7A 2BE9A 2HMAA 4YJKA 4H35A 5C8XA 5JCJA 3IOEA 4ZYYA 4OLBA 1C1DB 3WLJA 1GU7A 4IXTA 1DL5A 1E2JA 2VBIA 5AJUA 1U7WA 2G70A 3M1AA 4QTZA 1QCCA 1EDEA 4MKFA 4MHSA 4F9FA 1RI3A 1RTKA 3FUWA 3UYKA 4DADA 3M5WA 5A2GA 3BILA 4JI3B 3HZZA 4H0NA 4IDPA 1G2PA 1KH3A 5FQNA 4LDRA 4JJ6A 2A5DA 3ZE9A 2ZXUA 2KE5A 5B64A 1JBKA 3RANA 1A4IA 4UNQA 3UXHA 1HT2E 1JU4A 2WJ4A 3IPCA 3QLJA 5KOIA 1RXYA 1O89A 4QUKA 3JWEA 5IC5A 1SOUA 1DDGA 3GVCA 2W6ZA 3IBSA 2Q41A 1RAGA 4WKOA 5EXSA 3QLUA 2HKIA 1VSQA 1HI9A 1JI3A 3RM3A 4YUVA 4YRZA 5F98A 3CX4A 3PIIA 1N75A 3JS5A 4KN9S 5FPHA 3TTUA 1LGYA 4GZLA 5JBNA 2G09A 3N6RA 5HOEA 3U7EB 1FFBA 4I5DA 4CIAA 3NEJA 5IYZF 4BYGA 3PJGA 3R9XA 2V7BA 4JX9A 4XAQA 3VKWA 1CZKA 1JHYA 1U0SY 4ZQFA 4NCAA 1Q0RA 1I24A 5TDHA 2FPIB 4GWLA 1LJUA 4DHWA 2HAEA 1MN6A 1JR3E 1RJWA 3TR0A 3ICEA 3D7SA 3Q98A 3SR3A 1RQNA 3A58B 5TVKA 2XAUA 2JIOA 4I2VA 2F3SA 3U3ZA 2X8BA 4B7CA 1BDJA 4D2IA 4G9BA 4RF5A 3KSAC 1WD7A 3X2EA 2QN7A 2VDOB 2IPNA 3JVDA 2R7MA 4BLRA 1UFQA 1WXHA 4YCLA 4JI0B 2ETXA 2NYVA 2QD2A 3BVPA 2DFDA 3WLMA 3ZLTA 4MZDA 1FXWF 2Q8QA 5KKAA 1CEEA 4RMGA 4QOJA 1RLIA 2GZAA 1BIFA 4UFPA 3VNVA 3FPAA 5U9CA 4FFLA 3EG9A 1CDOA 3FGZA 1J42A 1KFEB 3GFFA 3O4FA 3P52A 2BBSA 1FP6A 4GPTA 4OP1A 2W6OA 5ALTA 3SNHA 4YR7A 3N6VA 4BV3A 2P1RA 4OLAA 2H3HA 5ECWA 3KZOA 4ASUD 3F3YA 4Y0NA 2A9VA 2GEBA 1TIKA 4URYR 4WCDA 4Y2HA 1N4AA 4MQUA 1VE7A 3VO1A 3WX0A 3AI3A 1Q7CA 2PRYA 1H4SA 3KPVA 1G8SA 1NRIA 1UDRA 2UYYA 2VH2A 3EVDA 3LECA 2FSGA 5IN4A 4PXAA 3TDNA 2VYCA 1Y8QB 4AN0A 2ASVA 3J7AC 1PWYE 3DZKA 2BFWA 3E9YA 4U8GA 4AJKA 3OAAA 4IHQA 1R0RE 2RAVA 4F5EA 4JWKA 4HR7A 2JEYA 3KTFA 3HR4A 3E0QA 4D92A 1U4SA 2A0WA 3TIVA 4DJDC 4F2HA 5JHHB 3U3MA 1RYDA 1KO7A 3JVIA 5FA5A 1MABA 4OM7A 2BW0A 3ZYZA 4CTMA 2IF2A 4FN4A 4IG4A 1QUFA 4Z0HO 2GYWA 3CZ5A 4N8SA 4EB0A 4P4TA 3WBFA 1Z6YA 2ONKA 2PH7A 3PVZA 3GAZA 3Q6NA 4DIEA 3HFRA 2X86A 1QU2A 4BVHA 4PLZA 3WP0A 4QG7A 1Z0JA 2YW2A 5KSOA 1CY1A 2XCUA 4OK3A 2Y77A 3JQ6A 4A91A 3FDZB 1NY6A 1PZMA 1EG7A 4RM2A 1TA4A 5GONA 3ZDFA 3W2IA 2R00A 5DP2A 1E1RD 2ZREA 3CZPA 3VO2A 1N0UA 1BU8A 3G0OA 4DZRA 2JRCA 4R2IA 4L5BA 1TJ4A 3PYMA 2YHIA 2YV3A 5AO9A 5BSTA 2GPSA 3AUFA 2NVOA 3CLSC 4G0XA 3UQYS 4OXYA 1T8WA 5EZYF 2QIOA 3JZIA 3VC2A 3NHYA 1L8OA 5IK2A 2Y1FA 4JELA 2IL1A 3EEFA 2VPWA 3R6TA 2CNBA 4HBZA 4TMWA 5E1DA 3UICA 1UZMA 2J3MA 4YB8A 1X0VA 2PGAA 5EMNA 3HUEA 4GI5A 1R0SA 3MK31 2V7VA 2EIXA 3N2KA 4A8JC 3L0YA 2V0NA 5ALYA 5CCDA 3IMGA 1T9AA 1C30B 1YNOA 1BNCA 6ADHA 1LNQA 3HBMA 1PI3A 2Y1XA 2PO7A 2BH9A 2Y4OA 3OBBA 4M1YA 5AJTA 2Z2ZA 4OFZA 5EIHA 5CDGA 2IIQA 5JMOA 3CPEA 1T6NA 1URPA 2ZBVA 3DOEA 2D0OB 3T95A 3R6GA 4BWVA 1E1RA 3KFLA 3NJ8A 1Q14A 4JKYA 4XZ3A 3QVLA 4FSXA 1N9GB 2P9YA 4KDRA 3BMQB 4DMKA 3R0QA 1S1CA 3ZLBA 5EJ7A 1E2BA 5DB4A 2JKZA 2AE1A 3KYJB 4ER6A 3MD0A 1F4VA 2JFYA 1VG0B 2EL9A 3IKJA 2O2XA 2PZBA 3JD1A 4V0ME 4WOCA 3ZDYB 4BP3A 5KINB 4TTSA 1E9BA 3QVVA 1FE8A 1XNQB 4OGKA 4CU2A 5GGXA 2BFOA 1SK9A 5FTNA 5IUKC 1NIPA 2UVPA 3V97A 4B3HA 1QF6A 2OBMA 1KIMA 2ODWA 4JJGA 4UE2A 3DE4X 4PAOA 1ABFA 4A0RA 3AF4A 1ZOPA 1Z37A 5TMEA 2RARA 3LVQE 4IG9A 3SVTA 4INAA 4X1IA 1BAPA 2XA1A 4GUAA 2BEVA 2HR1A 5J58A 3ZHXA 4BKPA 2FH5B 4NEHB 3AM4A 3QW4B 1TM2A 1B26A 1BX1A 1UBOS 4V0OA 5BYKA 2TECE 4MVJG 1AV7A 1X1TA 3Q10A 5IJ9A 4DM3A 2LCIA 1CETA 3U49A 1ZXXA 4ETMA 3CCCA 3K30A 3OPXA 3PC3A 4CMBA 1X3SA 3U44A 3RRYA 1DIAA 3QKRA 3DGEC 3JQAD 3HKCA 1V3TA 3LWBA 3P96A 5K3AA 4R68A 4N4AA 1JHVA 2WJPA 2A6PA 3KPUA 3EFOB 4M9ZA 2EKBA 2VRNA 5AR1A 1DRJA 1O9HA 2V4UA 4FWBA 1YVEI 3QUSA 4HN9A 2YMLA 3SU8A 1XROA 4GLOA 2XUFA 3AEQB 1XIVA 1TQ8A 4QX6A 4OL9A 3OZIA 4XM1A 1P9LA 2XE4A 2ES4A 2XNKA 3CNLA 1BCRB 1V2GA 2BELA 3G9QA 1GU0A 3N74A 4M89A 2FRDA 3JSXA 2ZI5A 3K5PA 3FVVA 5F51A 1W76A 3ZHUA 1RXIA 4DLUA 5JT1A 4CODB 2H1HA 4ZVMA 3EK2A 3L2OB 1KSJA 2WWFA 4PLTA 5AT1A 2DR3A 2WJVA 2QVBA 3GPBA 2P1ZA 1J09A 3HXOA 1W4RA 3QY0A 1E0AA 2DEUA 3CUUA 4TUYB 2PXAA 1G60A 4FOPA 3FHLA 2UUBB 4D4IA 2WU0A 1QXSA 3VH1A 5CFZA 1IEXA 3R7DA 1Z0UA 1H8HD 2EYUA 1P2VA 2YUTA 5A04A 1TYAE 2J3IA 5H83A 1SUEA 4II7A 1WMAA 4J0EA 4BLSA 5AJXA 1AMOA 1TF7A 4WRRA 3I30X 5EMMA 1QYDA 1BGWA 5EE0A 1NNLA 3SSMA 4S24A 3CNEA 2QLFA 3NFYA 4DUZB 2EZUA 3WRXC 3KQPA 3T3PB 1YK1A 3IV7A 5L51A 3I4CA 2HV9A 1OZGA 5E4TA 1DX6A 1S4MA 1VI2A 3OT4A 1S01A 1XRQA 2PSHA 4IYRA 2GGSA 2QAGA 4O2AF 5C32A 3G2QA 2JASA 2CJWB 2G8LA 3CKLA 3W4IA 1YI0A 3JR3A 2QM3A 4GHWA 1CERA 1I0IA 2OMEA 3FTDA 5FAXA 2XLBA 2XUAA 2BGNA 1AZWA 4AUEA 1Y7LA 4JP8A 3PPWA 1ZGCA 3AOEC 4M54A 3N2ZB 3MERA 1GHTA 3PGXA 2X9VA 1TA0A 5TF0A 4B2LA 1Q2XA 1HF3A 2ZAMA 2YICA 3PHBE 4N5NA 4QSMA 4WUTA 1KI6A 1E7QA 1PW7A 2Z9DA 1MC8A 1UPXA 1TOAA 3OEYA 4IUDS 2E37A 5KCMA 4DMRA 3DZFA 1NUPA 4KO4S 4NARA 1BVUA 1L5LA 3AINA 2ZCJA 4P0TA 3H8WA 4X8MA 4GM0A 4MUAA 3I2GA 4D9FA 2XQKA 3GLUA 4O2AA 1Z06A 3P26A 5EHGA 3UAVA 4KXYA 3I73A 1ZRNA 4GC9A 3VAAA 3NKVA 4ODIA 4G0PA 3UB3A 1OV4A 4KMMA 1NBME 4GZ3A 4O3FA 3V8NA 2D7CA 2G9UA 2IYNA 5HPYB 1CE8A 5EIAA 2IBTA 3OIGA 4LHYA 3MWGA 1O97D 4PLYA 4V0QA 3NEPX 3GLKA 1U1EA 1A4RA 1JDPA 4QHTA 3LQQA 1NC1A 4S1VA 2P7HA 3LPCA 1PJSA 3KELA 4AI6A 4EDFA 2A1UB 3D4NA 4CT5A 4DLVA 2ZSBA 3T1TA 3MUFA 4HJXA 4ZRDA 4ZMSA 2I6XA 2QE7A 2RHTA 3OCZA 2GVDC 1U28A 5L53A 3DFFA 3U6KA 4ND2A 4K26A 1NWHA 4RX1A 4CQLB 4UJ3A 2VEOA 3LT0A 1ZHOA 5SZKB 2FPOA 1IBSA 3CLTC 3DKVA 4REOA 4XGKA 3NVDA 1SIBE 3LY5A 3O94A 1TX4B 1QTRA 2PBLA 1XNJA 3BJMA 4MRMB 5DCLA 5J1TB 4Y2QA 4E14A 5C8VA 4CHGA 3HGQA 1YRWA 1DBWA 4CLOB 2PANA 1P1HA 5LB2A 1OSNA 1E1KA 4FJ2A 1Q12A 2G6TA 2NXCA 4N5MA 5TQ0A 3GEEA 2ZR0A 4PRKA 3NYWA 4AY5A 5BSGA 3Q8KA 3FDFA 5KYXA 3U7FB 2O5CA 2HFKA 4K81B 3DBHA 3PJDA 3T7IA 5HDBB 3AHFA 4MPDA 2E4AA 4IGEA 3UXMA 3ZV5A 2DUUA 2VTBB 5AI5A 4UDYX 2ID8A 4UTNA 1UXOA 2DCUA 3IQIX 2ZXFA 1Y7TA 4MW6A 4L76A 1MQ8B 4LSZA 2JNWA 2ZUWA 2EGUA 4LC9A 4DIMA 1S8OA 3N3AC 4WKNA 4FDAA 2P2SA 3BULA 3RREA 1M2GA 1Q19A 3ROKA 3L40A 3D8TA 3S2YA 5DM60 4DKXA 3H1BA 1PDVA 2YYAA 5JZOA 2FW8A 4YRLA 2P5UA 3LX5A 1C4WA 4GM1A 1C9KA 1V7PC 2XQJA 1ENPA 2BFAA 1ISIA 4HZGA 1GCOA 1L8QA 2PPLA 5DULA 5DM2A 2XNJA 2OCIA 2PAAA 4BFYA 3T5MA 1GLVA 3A3PA 2WNHA 4QGSA 4MS4A 3REQA 5A4FS 1NHWA 3M3DA 5HJEA 1NLFA 4W9MC 1CEQA 1WBDA 1OH7A 3MJDA 4JI6B 1JSRA 2QENA 4ZT2A 4HUQB 3INYA 1L5HB 3OH8A 4DUPA 3CN9A 2BZ1A 2NTYC 2PWBA 3I2JA 3QLEA 4JK3A 4MOWA 1E2QA 1H66A 2BBTA 4JBXA 3IE1A 5E7MA 4HVCA 1MB4A 4KAJA 4MQ4A 4DA7A 4RF4A 1B73A 2PO5A 3D2BA 2GT1A 3JR7A 2XITA 4YJ2F 4CCAA 3NTQA 4LXGA 1OX4B 1FQJA 1WXWA 5EJGA 1G5RA 3R6WA 3JTMA 3LXXA 2A2ZA 2EC5A 2QPTA 2ZE8A 1BGVA 2CJYA 2FB9A 3QPWA 2RCYA 3OZBA 4M0DA 4MI1A 4QVKA 4LFCB 5CD1A 4FDTA 4Y6PA 1GWNA 4CEIA 1D6MA 1I4WA 1NLMA 3HLKA 4IILA 4BLOA 2D1SA 3M9LA 5IH7A 5BV8A 4FTWA 2VTEA 2RC6A 2EJBA 4Z9BA 3K8QA 1OB2A 5ALQA 1A9XB 1YDMA 2GZ2A 1NULA 4Q7QA 3LPLA 1ZN2A 5JAQA 1ORIA 1TYEB 2F8LA 2L0XA 3RFUA 2IE8A 3TBFA 4ACAA 1SCKA 3RHFA 2ZDHA 1ZWLA 1P9OA 3FHOA 2P2LA 2LGJA 3IO3A 5L3RA 1CB0A 1TFRA 4CV1A 5CRIA 6Q21A 2AI3A 3U39A 1XCGB 1NSTA 5LYJB 3LC7O 3BGSA 1GNTA 3BICA 5AVWA 3ZU3A 2GN1A 4XYLA 3KZ1E 3TYXA 3NHZA 4K2HA 3U80A 4DIKA 1NPDA 4AG5A 1DT3A 1R8QA 4TL7A 4F7DA 1R6VA 2YQ4A 4G25A 1T2AA 4MSUA 4U7TB 1ENZA 2NADA 4V2IA 4WFJA 3HU2A 1RXUA 2QGZA 4C7OA 4NPHA 3T1VA 4N3AA 3DE7X 2RHCA 4BNIA 4EDHA 4RTKA 4CZ2A 2H1OA 5CVVA 1G38A 3B20A 3O8QA 1UZUA 4NS1A 5T7BA 2X1LA 4MQEA 3ZZUA 4ARUA 1DDIA 4ON9A 3TWOA 1ZY2A 5K51A 1T4MA 3EDQA 1ESNA 3EXFA 3R0ZA 5TMDA 2WHXA 1NA5A 5C1DA 3F6BX 1O6BA 4NIMA 5CBPB 1EWQA 2COEA 4KE8A 3NVAA 1WG8A 4M87A 3SX0A 5KQRA 4EPVA 3VYRB 1X14A 2NZUG 1X7ZA 2Z3ZA 3IP6A 1GPH1 2W0MA 3RT1A 2C8KA 2Q49A 5CNJA 4XFDA 3ZCPA 2FKNA 1FMCA 5H80A 2QX7A 3AIMA 3N2IA 4PTYA 2ZAIA 3GF4A 4L22A 5E8JA 3PLRA 4QO7A 2OXTA 2WT9A 2RGUA 4LWQA 3V1LA 5EWMB 2ZSIA 1KDYA 1KFCB 4E22A 4FOTA 2GBGA 4KTTE 4C7BA 1E5TA 1FTSA 1U1FA 2FP4B 3M8KA 5DNEA