3E0XA

The crystal structure of a lipase-esterase related protein from clostridium acetobutylicum atcc 824
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
SNAMLHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSMGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFMEKIYHNQLDNNYLLECIGGIDNPLSEKYFETLEKDPDIMINDLIACKLIDLVDNLKNIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
molecule keywords Lipase-esterase related protein
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e0xA00
2DR0A 3HEAA 1UZAA 3IURA 1KU6A 3SK0A 2RI6A 4MYDA 1IMJA 1GPNA 2DQYA 2VT7A 3D5EA 1P0MA 4V2IA 5F4ZA 3IVMA 2QTBA 3VJLA 5DLPA 4Y2VA 4X7BA 4FMPA 4DMCA 3KSRA 1EB9A 5IVDA 4H7EA 1AURA 4G9GA 3G9XA 3I1IA 1ZI9A 4YASA 4FFWA 4EY6A 2PSJA 3HACA 4M0FA 4RPCA 1H23A 5DYWA 4PNZA 4X6YA 5ALTA 4X3CA 4BCCA 2BCEA 2WFLA 3OC0A 2JGKA 3ZPXA 2ZJFA 1GQRA 4IQ4A 3WWPA 1J1IA 4BBZA 2OG1A 2C0PA 2DCMA 1U4NA 3ZI7A 3I2HA 3C43A 3H2KA 1K8QA 1G66A 4GWLA 3FAKA 3VVMA 1UK8A 2OLEA 3WZMA 4MWTA 4XJVA 2G4LA 1VA4A 3STWA 4BATA 2QJRA 1UT6A 4KR0A 1G5FA 5DWDA 4K5QA 4QDTA 1DT3A 4UBMA 3V48A 4AB1A 3AZQA 3NWOA 3A2NA 4Y2PA 5AKIA 1CUZA 5JZSA 1U2EA 3P2MA 3U0VA 3CN7A 4UUQA 2D0DA 1QIEA 2QUAA 3WYNA 2WM2A 2B61A 2G5PA 3H1BA 5EIEA 2VEOA 2WTNA 3MVEA 2VJAA 5C8ZA 4BTLA 3F98A 2XUJA 3WL6A 2WJ4A 5A2GA 1ZJ5A 3EQ8A 2XMSA 4H7JA 1ZIYA 4X93A 1DTEA 4K6GA 4FWBA 4OYLA 2H9YA 4WJLA 4P93A 4ZRDA 3WJ2A 3HZOA 1IVYA 1SCQA 4GLBA 2OAGA 5AK4A 5DYTA 3E4DA 1QZ3A 4B80A 1FFDA 4OSEA 5ALMA 5AKJA 3G0CA 1U65A 2C5FA 2Y2UA 3STTA 3RM3A 5CRIA 1CUDA 3C45A 2BGNA 3L1IA 2OGSA 4W1SA 3FYTA 4KE7A 4HXFB 3QH4A 3HXKA 4GEGA 4JYMA 4BZWA 1HQDA 3VXKA 1YAHA 4X00A 2OCLA 3C5VA 3FSGA 4MEAA 1NU6A 1AX9A 3F67A 1XRRA 4KYVA 1ACLA 4W1RA 1H22A 2DSNA 3H0CA 1RYYA 3GUUA 4WDQA 2QR5A 1CPYA 1YS1X 3BF7A 1VLQA 3PDCA 4BRZA 1H2XA 1YA4A 4BCBA 4KRXA 1H2ZA 1BEEA 4I3FA 5AOAA 4WY5A 5DNUA 4OD0A 5CT8A 2I3DA 5EHXA 1XZLA 1ZD4A 5AI6A 2E3JA 1A88A 4EY7A 4KAJA 5JZBA 1Y37A 2HA3A 1XRNA 2WIDA 4BB0A 1ORVA 1QTIA 3F97A 3GA7A 4G4JA 1N1MA 1WOMA 5HK8A 2EDAA 4NS4A 4BP8A 4CG3A 3D7RA 4UFNA 2WJ3A 1Q0ZA 4LKOA 4ZGBA 4BAZA 2VT6A 5HKAA 2X5XA 2AJDA 2JGLA 1J07A 2XI4A 4PW0A 1CUAA 2FJPA 1CIJA 3O9VA 2CUTA 2RHTA 4YK7A 3R3XA 1LNSA 1QO9A 5FOQA 1WPXA 4Q3LA 4X97A 2R8BA 3WL5A 3MUOA 4BTVA 5SYMA 2QUBA 1O6GA 1N5RA 1XZDA 3WL8A 5CXUA 4QWMA 5CW2A 4BE9A 5A7FA 2ZYRA 5AICA 1GZ7A 1ZD5A 3GROA 1XLWA 4FNMA 3WYDA 1IUNA 3V1LA 4U2FA 4F5ZA 2PUHA 3R3UA 1QO7A 3S8YA 1QIFA 5FPPA 1R9MA 2XUHA 5CBKA 3VJKA 1ODCA 3O4IA 5A7GA 4RE5A 5FP0A 4GHWA 1LPNA 4J0CA 5DNVA 4ARAA 5HF6A 5AI5A 1JJIA 3GFFA 3CN9A 1O6FA 4HRXA 3PFBA 1G42A 1FSSA 5LP1A 3QM1A 3NOXA 2XLCA 3FLEA 1IUPA 1JI3A 2XUIA 1CUWA 1IZ7A 5CH3A 3B5EA 4M0MA 2J3QA 4GXNA 3DOIA 3SC2A 2WU3A 3DS8A 1EDDA 4QWWA 2HFJA 4W1QA 1LPAB 2JGFA 3R3ZA 4X94A 2HM7A 3ANTA 1UOQA 5AIAA 3FLBA 2RHWA 1WPRA 5K3EA 1P0PA 1BRTA 4XX1A 3X3HA 4UHBA 2G5TA 4FLMA 5ALPA 5KREA 5JANA 2PSEA 2WHPB 3TJMA 5EIAA 4L72A 1HDEA 3RK4A 2Z8XA 3WQHA 5AP9A 4Y9SA 3C5WP 5LYYA 5LKRA 4HS9A 3C6BA 3W04A 3O4JA 3C87A 1PFQA 2Y2VA 3GELA 3DKKA 4C4XA 1SCIA 4QLAA 2OQIA 4C87A 1X2BA 1XRPA 1MJ5A 1R88A 1LPSA 4DM7A 3AZOA 2XUFA 1CUJA 2DQZA 4ZI5A 3HSSA 1LPPA 4ZV9A 4JEIA 5CMLA 1XLUA 4Q05A 4J3JA 2XMCA 5EHZA 4J7AA 4DNPA 4Q82A 4AQDA 2BUAA 3BIXA 3LS2A 3AZPA 4KEAA 4BAGA 1IZ8A 1F0PA 1JU3A 1E89A 1DX4A 4C89A 4DMKA 3LIPA 3BDVA 5ALOA 1BN6A 3QMVA 1FFEA 1J06A 4ZV7A 4G9EA 4OPMA 1THTA 3HRHA 1B41A 1LBSA 4MJ3A 4DYHA 2O7VA 1CFJA 2Q0XA 4UHEA 4M0EA 1TAHA 4PQEA 3A70A 4QNNA 3F9CA 4Y7DA 5EHQA 3DEAA 5HFAA 2YXPX 1WCYA 2WG0A 5CT6A 2WILA 2PX6A 5K5EA 2FJ0A 5AH0A 2IIVA 3LIIA 1TQHA 1CRLA 3WKAA 1EI9A 3ESAA 4OYYA 1MNAA 5AI8A 4X71A 3PF8A 5T4HA 1WB4A 4H35A 3IUMA 1UK9A 5KWIA 1ZI6A 4AO8A 3PFCA 5FPQA 1VOTA 2XT0A 1UK7A 5HFNA 3AFIA 1EDEA 4QDXA 3B3QA 1LLFA 1A8QA 4O08A 4AMZA 2RGUA 4E15A 5H3HA 4G8BA 4X85A 4X91A 1ODSA 2BJHA 1K4YA 2WUFA 1ACJA 4JYPA 4KRYA 2H7CA 4C88A 4IO0A 3KD2A 1BU8A 4BE4A 1EH5A 1XQXA 1XZHA 1DQZA 4QZVA 3EQ9A 3H2GA 2VTVA 5ALKA 4B0OA 4J0JA 4LYDA 2FUKA 4H7IA 4UPDA 1WB6A 1XQYA 4JNCA 2GBIA 2ZJ6A 1E8MA 2I3ZA 3TGLA 1W6RA 3B12A 3DL4A 1JT2A 3D0KA 1Q84A 4ZWNA 1TIBA 4PSUA 1VZ2A 2YYSA 1FFCA 3O4HA 4WFKA 3HJUA 3C8HA 4AO6A 4H7KA 5K3FB 1EHYA 2X8BA 4UHFA 5JAOA 1QGED 1YSCA 4U2CA 4INZA 3RARA 4F21A 1EK1A 1CUHA 2X76A 1H2YA 2IX9A 1SCKA 3KXPA 3WA6A 3DD5A 4L0CA 1OXMA 1CLEA 5FRDA 4DGQA 4DTCA 1CUVA 4X6XA 1FFBA 1CR6A 4KE8A 5I8PA 5YASA 1XQWA 2HDWA 4BZZA 4P08A 1U8EA 1E3QA 2WQZA 1E8NA 4L3WA 3GBSA 3OPMA 5JD5A 1H2WA 1XZAA 5KWJA 1E66A 4K2AA 2WUGA 5DTJA 5ALSA 4ARBA 3FCYA 3S2ZA 4LYEA 2XUDA 4OB6A 4H0CA 4UHDA 4IH1A 2HU7A 3JW8A 4XVCA 3ZLVA 3BE8A 1DX6A 2DHCA 3D3NA 2B20A 1MU0A 3OTQA 4LXIA 2ZSIA 5AIBA 1EK2A 2ECFA 5K3BA 1W75A 4D9JA 2AJ8A 3WWCA 2DFPA 1GQSA 5AKYA 5ESRA 2XMDA 3H19A 4HTAA 3H2JA 1DT5A 3R3VA 4TVKA 2HRQA 1QIGA 4Y2XA 2Z5GA 3ZLUA 3FVTA 5A7HA 2H7YA 4U2EA 3WK4A 2HIHA 5JD6A 2C4HA 1UKCA 2VF2A 4WDRA 3PI6A 3QBJA 2RAUA 1GPKA 3NGMA 5LLSA 3C8DA 3ESDA 2GYUA 3V9AA 1Q83A 4ITVA 1K6EA 4OU4A 5AK6A 5HZGA 3T4UA 1C4XA 6YASA 5ALIA 4MYSA 2HA4A 1RWQA 4W9RA 5A71A 1R9NA 4B84A 3QMMA 4WFIA 3QPAA 2H1IA 3WWDA 4OUKX 3MUNA 1R3DA 4Q1VA 4BAUA 3H04A 4IH9A 3H2HA 2NW6A 1QIHA 4EHBA 1QE3A 1Y7IA 5ALVA 3WKCA 2XMBA 5AKEA 1MX1A 5C7YA 1A8SA 5DNWA 1PV1A 5CURA 5AKKA 5JAUA 4U2DA 4Z49A 1N8SA 2XUOA 1Y7HA 1XLVA 4EY5A 4H7HA 1YB6A 1BCSA 4XWGA 2VAXA 2GBGA 4DSAA 1ISPA 5ALLA 4LXGA 5DTIA 3DNMA 4FBMA 1ZGCA 5ALEA 5IVKA 3K2IA 1EX9A 2WFMA 2CKMA 4FOLA 2VJBA 5HK9A 2ORYA 5HF8A 1E8DA 2XQIA 1JFRA 5JADA 3H1AA 1ZD3A 5AO9A 3W2TA 4DIUA 3JYHA 4G1FA 4OU5A 3FCXA 5IVHA 4ZREA 3STUA 3WA7A 3OG9A 4B81A 3WKBA 1GPLA 5BWBA 4JH0A 4DLNA 3LLCA 1QTRA 3ESBA 5AHXA 2HU5A 4A23A 3HABA 5AKXA 1QOZA 3G9ZA 3I28A 4A5SA 3W9BA 4A16A 1F0NA 2JGMA 2D5LA 3N2ZB 2ONCA 4W63A 5JATA 4BDTA 1HBJA 1YB7A 3WIBA 4CFSA 5EGNA 5IH7A 3STXA 4KAFA 3SWWA 3CXUA 1A7UA 5T4EA 1K63A 1UKBA 3FBWA 1SFRA 1W1IA 5ALYA 3HYSA 4PF1A 3IB3A 2VSQA 3QVMA 3WK8A 4EBBA 3DLTA 3ED1A 4FNGA 2WIKA 3WK7A 3KDAA 3V1MA 5C81A 2WSLA 3G8YA 1R1DA 1MT3A 4GI1A 5AOBA 1DINA 4LIPD 4CI9A 4UFOA 4X92A 2Z3ZA 2HADA 1ZOIA 1LGYA 2GZSA 1LPBB 4AZ3A 1W76A 4BCDA 3HLKA 5ALJA 1ZICA 5CT5A 3IUJA 3O0DA 1JKMA 2OGTA 5CXXA 3YASA 2XDWA 3WWOA 1EDBA 3AINA 3WL7A 1CV2A 4GBGA 5D3ZA 5HQ3B 3IULA 4B6GA 3CCCA 2XUGA 1AUOA 1LPMA 5ALQA 2OQVA 2ZVDA 4KACA 3JWEA 4YPVA 4C4ZA 1M33A 4UBLA 3W05A 4BVKA 1QIMA 4RNCA 4EZIA 2C58A 2ES4A 3HI4A 1XKLA 3C6XA 2V98A 2XUAA 3I6YA 3G02A 4UBNA 2JEZA 1EXWA 3VKFA 5AM1A 3V1KA 3AIKA 5AM2A 2HA2A 5EFZA 3WMRA 1XROA 2WG2A 4X90A 1K5PA 5JARA 1WB5A 2JGEA 2WFZA 2XMRA 4DSZA 4JUIA 4C01A 1CQZA 4FTWA 4BYMA 5FV4A 5IKXA 2AXEA 1QIIA 4WY8A 1T2NA 4NVRA 1W52X 5BOVA 3FSGD 2QXUA 2V9ZA 2PU5A 1QIDA 1XQVA 2AJBA 4IHAA 1UK6A 4RGYA 1HL7A 4QA9A 3WK9A 4Y2YA 1MPXA 3KWJA 4PV7A 5JASA 2JF0A 3OOSA 2ZYHA 1Z68A 5ALUA 3AJAA 3DJYA 4N8DA 5BV7A 2CBGA 1BE0A 2JGIA 2PUJA 4DNOA 2XQGA 3L1JA 2LIPA 2QZPA 3D2AA 1JJBA 1GGVA 3IUQA 1TK3A 2R11A 1I6WA 1TCAA 1X70A 1NU8A 2GBFA 5J3JA 1CVLA 2C7BA 2PSHA 2QJWA 1QFSA 2Y1KA 4CCYB 4I4CA 1LPOA 4U2GA 4E46A 4XIIA 5AKHA 3G0BA 5LZ5A 4W1PA 1R4ZA 2XQJA 3D59A 2Z3WA 1GT6A 3ICWA 5ISMA 1NX9A 4KE9A 2WHPA 4G5XA 2YH2A 1VJ5A 1XRQA 2J4FA 3R3YA 4HAIA 3BL8A 4DNQA 4J0HA 4DMHA 3DYIA 3C6ZA 5AI4A 1XZEA 3WK6A 1D07A 2WLSA 3A6ZA 3BWXA 4BC1A 5LZ4A 2WFLB 3OM8A 4AN1A 2WKWA 5JAPA 1BCRA 5LZ9A 1MAAA 3IDAA 1MN6A 2VJDA 2B9VA 3RKSA 5I7UA 4QDOA 5CH5A 4G4GA 1WHTA 4N5HX 1DWOA 1QIJA 3IA2A 2AJLI 4FDMA 1AC5A 3V1NA 1ZJ4A 5HQ3A 4OB7A 2CEKA 1TRHA 4GDMA 3D4LA 4S0XA 2CB9A 3UUEA 1QLWA 4BC0A 1CUIA 5FDFA 4X95A 1AZWA 5AOCA 5HKBA 1ODTC 2ZYIA 4I19A 3GZJA 4N5IX 3ZLTA 3PF9A 5EHNA 3DQZA 3QITA 1S8OA 4AXBA 4HVTA 2O2IA 1B6GA 2ROQA 1AGYA 1XZMA 3BIWA 3H17A 3L1HA 2G63A 1TKRA 1LZLA 5E4YA 5CT4A 3D2CA 2PU7A 4AX4A 4QLOA 4G8CA 3LP5A 1CUUA 3WIOA 4MQLA 4QEKA 1X2EA 1XKTA 3PUHA 5I9IA 5AK5A 4C4YA 3M83A 3M81A 3MGAA 4PO3X 1THGA 1GXSA 3FWHA 2QOEA 3G0IA 2RIPA 5AM3A 3ILSA 5BWCA 3R0VA 4GW3A 3KWFA 4ZXFA 3G0GA 3A2MA 1MO2A 4MQMA 4F0JA 3DKRA 4QDUA 4B85A 5EIHA 4H7FA 1XZFA 5ALFA 2CMFA 2OCKA 4L9AA 3M3DA 4FHZA 2QT9A 4AN0A 4P92A 1VZ3A 2J3DA 4G4IA 4Y2UA 1EINA 1CUBA 5CH8A 4UBIA 2VJCA 1RP1A 3O9MA 4B7ZA 3BXPA 4GECA 3QPCA 3G0DA 1L7QA 1MX9A 1JU4A 4NZZA 4Y2TA 4CCYA 5AKGA 3SX4A 5T4BA 4U2BA 3F8SA 2XUPA 3EIOA 3AIMA 1DWPA 1P0IA 3K6KA 3BJMA 3R3WA 4Y2RA 2WUEA 1CQWA 4J0DA 5ALNA 3AIOA 2WUDA 4EUSA 2PVSA 1F8UA 2HA5A 5LKAA 2PPLA 5K3FA 2CJPA 2ZYSA 5CTAA 2WIFA 2JEYA 2Y6VA 1KU0A 3WKEA 2XMZA 4J03A 1QONA 1W4LA 2K2QB 3IBTA 3I2GA 4B0PA 1JMYA 4EY4A 1HPLA 4H18A 1XZJA 4LHEA 1T4MA 2QM0A 5K3DA 5JAHA 1CEXA 2H7XA 5FKJA 4N8EA 2OGZA 3HC7A 5JIBA 2JIDA 4OB8A 1ETHA 2WHQA 5EI5A 5DYYA 4UFPA 3BF8A 3I2KA 1YS2X 2AJCA 1USWA 5A6VA 3I6MA 4F60A 1MX5A 4EY8A 3T52A 2Y6UA 3STYA 3AUKA 2JBWA 1A8UA 1YAJA 3WZLA 1AMNA 1CUGA 3K9BA 2C5GA 1XZGA 2OCIA 2XB6A 1BEZA 1UXOA 3DCNA 1CUYA 2ZJ7A 2V96A 2W22A 2ACKA 5AM5A 1AQLA 2WIJA 1G4HA 1GKLA 1IUOA 3DOHA 4OCZA 4AO7A 2PSFA 3ICVA 2HRRA 4B9EA 4HRYA 3W06A 3UUFA 3WLAA 1XZBA 5CT9A 1J2EA 2O7RA 1ZGBA 2JGJA 3O4GA 2HA6A 1QIKA 1DWQA 1DQYA 2XUKA 1YCDA 1C7JA 1PJAA 1XRMA 2J4CA 3DL7A 2ZSHA 3I2FA 3ZV7A 2BUBA 3ZWQA 5AM4A 4K6KA 4BVLA 4FFVA 3FNBA 5E2IA 2PL5A 3I1YA 3H18A 5D3KA 3R40A 3STVA 1FFAA 3IUNA 3E3AA 3FYUB 2XE4A 5DJ5A 2OPHA 1ZI8A 3WK5A 1XZIA 4WFJA 4TPKA 5HCUA 2PM8A 3EBLA 5ALZA 2O2GA 1VKHA 2CZQA 5AKLA 1UWCA 5LIPA 5AKZA 2P8SA 1WHSA 5A62A 1LBTA 5E4JA 1TCBA 5FLKA 5KBYA 1XZCA 3VJMA 3BJRA 4KE6A 5SYNA 3FYUA 1CUSA 3Q8WA 2UZ0A 2GYVA 1N5MA 4TGLA 4MEBA 1L7AA 3EQ7A 4AZ0A 4H77A 2OXEA 1UFOA 2QVBA 2OAEA 2WHRA 5ALGA 1OILA 1VXOA 3C6YA 7YASA 1FJ2A 2DHDA 5AK3A 2WG1A 4HZGA 3N0TA 2PKYX 2VATA 4CIAA 5FUMA 1VE6A 2EDCA 2HA0A 3FOBA 3F96A 4QDZA 1YR2A 5FXMA 2XQFA 1EA5A 2QS9A 4Q3OA 1ZD2P 1MAHA 2GBCA 5LZ2A 1CUXA 1VXRA 1R50A 2GZRA 5JD4A 4J0IA 1HKHA 4CG1A 4KJXA 3C70A 4QE3A 2PBLA 4B82A 5LZ7A 2BUCA 1UOOA 4LXHA 2WJ6A 3E0XA 4FLEA 1YA8A 1ORWA 4MXDA 3PE6A 2EEPA 3A2LA 4Y2QA 3W9UA 3ANSA 1XFDA 3QPDA 4CCWA 1EVEA 3G9TA 5JYCA 3O95A 4DNFA 3VDXA 1DU4A 1EVQA 5ALRA 4Q34A 2WU4A 3QYJA 4Q3KA 1P0QA 4UBOA 5E4TA 1QFMA 2DHEA 3RLIA 4B9AA 4AMYA 4IH4A 2HA7A 1OCEA 3VISA 2GYWA 5AM0A 5C8XA 1CUFA 3BDIA 4E11A 4PSCA 2RONA 5JZ9A 1KEZA 2QMQA 3QMWA 4CG2A 1SOMA 3TEJA 3H2IA 4EA6A 5AI0A 4X6UA 3DYVA 2V97A 2B4KA 4UBJA 2W6CX 1MTZA 4BDSA 2HL6A 3D2BA 1LZKA 4DMFA 2VQ6A 3I2IA 4K6HA 1Q0RA 5ALWA 1UOPA 1GKKA 1EB8A 4BP9A 4G8DA 5D6OA 3WJ1A 2I78A 4FBLA 1HLGA 1XRLA 2WTMA 1ZIXA 2OCGA 3U1TA 4Y2SA 1WM1A 1CUEA 4PSDA 4CIBA 5T4FA 2Z8ZA 1JMKC 4HXEB 3ESCA 4MWSA 1E5TA 3R41A 3WWEA 2HU8A 3KOOA 3TRDA 5ALHA 3E1GA 3I6ZA 5C8VA 1YASA 4UHCA 2FX5A 4J0GA 2BGRA 3G7NA 2I03A 1F6WA 1VA5A 4WCVA 1AKNA 4C6HA 3EF3A 3PUIA 2XLBA 4BRSA 3FLAA 4NMWA 2XMGA 3AILA 5IVIA 2PSDA 5AI9A 4ROTA 5HF9A 3FVRA 1VE7A 4YX9A 3UMJA 4HXGA 2XMQA 1C7IA 5JALA 1SC9A 3OURA 5ALXA 2VAVA 2C0QA 4RE6A 5AJHA 3M82A 1UKAA 4UHHA 2O2HA 4FLFA 3VVLA 4N8SA 2WIGA 4ETWA 3IIIA 4E14A 5K3CA 3I2JA 1JJFA 2BAGA 5LZ8A 3QZUA 2XUQA 2BKLA 1XZKA 3CCBA 2VA9A 3DDUA 3Q0TA 4P9NA 1BROA 2QXTA 4H7DA 4UBKA 3LCRA 5HF5A 4Y2JA 5ALDA 3PICA 4BVJA 1BS9A 1TCCA 1L7RA 2HHAA 4FKBA 3WI7A 3NUZA 1MNQA 5D7BA 3WKDA 1BN7A 2IITA 5K3AA 4KAAA 2ACEA 2BFNA 3G9UA 2HFKA 1CUCA 2QKYA 4B83A 3FYUC 2QRUA 2XQKA 1QJ4A 2YASA 4J0KA 4EB0A
chains in the Genus database with same CATH superfamily
1T5DX 3UJ7A 5TGDA 2MHCA 2WVGA 3HGMA 3LHIA 2FPLA 4K88A 5K20A 2D0IA 2Q27A 3HEAA 4JJGA 1LK7A 1HFKA 4OHXA 4WFQA 5TQVA 1HGXA 3IURA 1AQ6A 4EP1A 1GD1O 3KAJA 4RLFA 1X7WA 3LKZA 2C2GA 4OFXA 1K0UA 1YJQA 3M4XA 4FKZA 1GADO 1GPH1 4YV2A 4EAQA 4I55A 3W2GA 3AR9A 4V2IA 1J09A 1P0MA 2ZKLA 3DAHA 5F4ZA 1V35A 3IVMA 1QGAA 4MP3A 4KO4S 4CIDA 3MWJA 1FC0A 1MRNA 2JASA 2QTBA 3QQPA 2J48A 4YCNA 1QQAA 2DBYA 3CGGA 1ZGAA 1G20E 3SM3A 3WNBA 2HQRA 2P35A 5DLPA 3JAKA 2WF5A 2A9OA 4K86A 2CZCA 3H9BA 4I2VA 4EG0A 2CDRA 1V39A 4L76A 1KDYA 3KSRA 3MS2A 4UTPA 2I2CA 3VTKA 3DVAB 1GARA 4H7EA 1AURA 3DFIA 3GIWA 1XVUA 4ZA2A 1PG0A 2P4SA 5GIPE 2EZUA 2Y1OA 2G7ZA 4GVPA 1AHNA 1CXZA 3ZIUA 3RDPA 1DSSG 3W90A 3FIJA 1N3IA 2F17A 4LF4B 1IXZA 1M6YA 3PQ3A 3GRAA 1L3CA 1W87A 2IHBA 4DV4B 1Z4JA 3MWYW 3MRVA 4FFWA 2OSBA 3DVRX 4RZQA 3PKJA 3I6BA 1SK9A 3HACA 4UTNA 4M0FA 4P4TA 4MYCA 1X0VA 3BIOA 4PX9A 1A4IA 4U4AA 3RREA 2J9ZB 2E1PA 1BG6A 1TQ6A 2BCEA 2G76A 2IDMA 4D6XA 4GM4A 1AV7A 4D96A 1N2JA 1ADGA 3DOCA 4F12A 3BORA 1I4TD 1K8YB 4TLAA 3KPUA 2X19A 2IXEA 2X8LA 3QE2A 3FBGA 3DVAA 4O02B 3TQSA 2Y93A 1NF9A 4JVMA 4J9UE 4L6CA 5BNZA 1Z7EA 2OG1A 3KSZO 1MAVA 4K6FA 4ZOQI 3PEYA 5K6RA 1A9ZA 4FN4A 4PSKA 4Y1FA 3GVIA 1KK2A 2AYZA 2P5SA 2UUOA 4C07A 4LZOA 4JD5A 2GN8A 1Y5IA 1E7MA 3QOXA 1FDVA 2ZRCA 3DEFA 2NAPA 4Q24A 1YZGA 4R8SA 3ROXA 2H6EA 4K40A 4XZ3A 4QXQA 4V0OA 2FEPA 2XVZA 3ZY2A 2ENWA 3SJCA 1R10A 5IJ0B 4QUBA 3FAKA 4J0QA 3VVMA 3CZQA 5A05A 1AXRA 1BXRB 4AWXA 2QUZA 1NJ8A 2OLEA 2A9KA 1Z6ZA 3TH5A 4JFRA 2IHZA 1E1KA 2O5EA 4MR8A 3R6TA 1RZRD 1O5IA 1T3TA 4XJVA 2G4LA 4E21A 2ZSFA 2BGWA 2QJRA 3L0PA 5I9NA 1UT6A 2EJUA 3ECSA 3PHBE 1RBYA 4IIDA 4ZO6A 3H5VA 4G5OA 3Q3GE 2C9DA 3RWBA 3DXFA 4KUEA 3ESZA 1OGIA 4A8JB 1VPWA 1V96A 1JKJA 4Z9BA 1MVOA 4W7HA 4CQLA 4MGZR 2C07A 4CODB 2HBRA 2AQ8A 1B16A 3IE2A 1R00A 1I3KA 3ZNQA 4QNRA 4JI6B 5G4KA 1Q7RA 2ENUA 2PTHA 4BX9A 4TKVA 3NWOA 4DC9A 5IBPA 2P9QA 4JJ4A 4U7TB 4Y9UA 2NU8A 3DZKA 1BXRA 2SHKA 3CRQA 2QMOA 2FN9A 2JB9A 3FPAA 4MV1A 2RGRA 2ORED 4AF8A 1QPBA 2VDLB 2EARA 2Z43A 5LN1A 1MFZA 5DHPA 1II8B 3FHJA 1KS2A 5AQEA 4GI2A 4JVSB 3HN7A 2D0DA 2GSDA 3MBKA 5KTNA 4EHHA 1F8YA 4FMDF 1J8MF 3BTOA 3B60A 5J2TB 1WW2A 2WM2A 4A8JA 1P5ZB 1NRXA 2QNIA 5CGZA 2VEOA 3A1FA 3SZRA 4AG6A 4EJFA 1FIUA 1HT0A 3F5QA 4YAOA 3CF2A 3U31A 1IBKB 4HEJA 4BTLA 4WE3A 4LOJA 3ND8A 4PCAA 2JIZD 4G5QA 4EM6A 1COZA 4EG5A 5BPFA 5B1IA 4ANFA 3KKZA 4QXRA 3COZA 3V8BA 3E58A 1MA0A 3EQ8A 3H11A 4ILEA 3L6EA 4H4CA 4OMFG 1CD5A 2Q8QA 2QG6A 4FWBA 4MOWA 4DJ5X 1UC8A 2WT8A 4GI7A 2Q7XA 2H9YA 4DG8A 1WW3A 2J9GA 2O19A 4AMBA 4BLRA 1VL1A 1E4OA 1BYIA 3OHPA 4HOYA 8MHTA 4N7JA 2PANA 3UH0A 1SCQA 5TDHA 1ZX1A 2ZIWB 4IRUB 4J6FA 4KN9S 3V7FA 1RKQA 1TJ3A 4GLBA 2W6MA 4REMA 1RJWA 2OAGA 2P5TB 4LYAA 3RVOA 1JFVA 2NZWA 3D9QX 4C22A 2FZLA 2VXBA 2IKQA 3IQFA 3MGGA 1QZ3A 1TI7A 4B80A 1GDDA 4ZHQB 2P0AA 1G3IA 1QZXA 2CNWD 3KJGA 3ADPA 4PX5A 1U2RA 4UPVA 4A3SA 1JQJC 3Q7EA 3QLTA 5AKJA 4DPLA 4ICIA 3V3KA 5HYVA 3NALA 3CX3A 5AUQA 4OM7A 3MELA 1RXYA 3GLGA 1V4BA 4RPJA 2AJTA 3NP9A 1TEXA 2WIBA 4KXUA 2JVKA 4GNKA 2DCUA 1NIPA 2GTIA 1BFKA 2CVOA 2VH1A 2ZSBA 4M7PA 1OZGA 3L1IA 3JVDA 4ZTBA 2QJTA 4W1SA 3LG2A 2ZUDA 3KYDA 5EIXA 4HN9A 3RBZA 1WD5A 3L0BA 4HXFB 1XCBA 4LV5B 5ICFA 4YHBA 1W0KD 3QLJA 4JYMA 1CE8A 1U8FO 3G1WA 4KBYA 3WHLA 4C4TA 2F1RA 3DUFB 4QVKA 3EG5A 1KI3A 1NY6A 4UVIA 4J0EA 5KYUB 4KOAA 3AI7A 3OOHA 3KK0A 4EG4A 2XCRB 4G07A 1P5FA 4MEAA 1Z15A 1NU6A 1AX9A 5FOSA 1M67A 1XRRA 4NR0A 2P2LA 2OYCA 4QGSA 4JSTA 4YUWA 2XYGA 2OBXA 2IYEA 1CZNA 4R9UC 1CYEA 2QR5A 1CPYA 1OGYA 2B94A 3A9TA 4JI4B 2FA9A 1QH1A 3HGQA 1FS6A 1VLQA 1XJ5A 2MSWA 4EHJA 4OFWA 4IKEA 2R00A 1H2XA 5G1OA 2Q6LA 4EA8A 1U04A 3CSDA 5F9MA 1C0LA 1YA4A 3T3OA 3KLOA 3R2JA 2N46A 1NN1A 2NSJA 5EJ2A 3AESB 2PWBA 2FFRA 1MC1A 3DDHA 3K0BA 3KJNA 5TR9A 3T3PB 3VR2A 1L9KA 4BCBA 1OTHA 3O03A 1G9SA 3T41A 4IMJB 3WGQA 4I3FA 5AOAA 1HSZA 3ZK8A 4GOJA 1CW2B 4WBNB 3QIAA 2FW8A 2J31A 3NHPA 1GFSA 4BB5A 5GAJA 4BKOA 4BNUA 4BO1A 2HF2A 4CI0B 1C9EA 3HDQA 2PX5A 4OJYA 1E7SA 2R5FA 5BT9A 6NULA 3VOAA 2WVJA 1YRHA 3VPCA 1E3EA 1CF9A 1TT5B 2OMEA 4IIBA 4Q9AA 1S8NA 3E5MA 4EY7A 4KKXB 4KAJA 3NNSA 5LQDA 2IV7A 1Y37A 3H2BA 4C7KA 1G59A 2W2TA 3E9NA 3ZE6A 2FN3A 5L7TA 1NVDA 4LISA 2ZUTA 3GRVA 4YP7A 4YMLA 2ZRDA 3ZD6A 2A0UA 1G38A 1X8XA 4LDQA 3IEIA 4RC9A 4LJRA 4JFAA 3F97A 1N1MA 3EEFA 4KNWA 3VSCA 1CBUA 1OXKB 3MBOA 4WBNA 1MW9X 3GH1A 1TC1A 4C0LA 4CG3A 1W25A 4KSBA 2AN1A 1T2FA 1X7ZB 3A0UA 1L5FA 4UFNA 3LECA 1KIFA 1KC1A 2JLYA 4ALJA 4WASA 4NBUA 1EXVA 1TT5A 3IXLA 1RYNA 1WCIB 1PT7A 2VP2A 2ZJAA 2OHHA 3O9ZA 3P7MA 3TLYA 5LQCA 5DYGA 4FJ2A 3LBFA 1KJJA 1DP4A 2QQ0A 3LT4A 2JGLA 3TW6A 4GFDA 3VTZA 1YFJA 3G5MA 1J07A 3BB4A 1T9GR 1HKUA 1ZS9A 3DSRA 5BWNA 1DL5A 4OXYA 1U8XX 2ZXUA 1JIUA 4R1TA 3R7DA 1A5BB 4MMXB 4ZCTA 3LOPA 4GRAA 2CNOA 2W2KA 4XD2A 1CIJA 1HEYA 3O9VA 4H7PA 3BMOA 2C5EA 2ZR7A 1N2ZA 2G17A 3H42B 3RFFA 4AX8A 2B6HA 1LVGA 2EL7A 2ZWOA 3UTDA 1RCUA 2FUEA 1T3GA 3CF4G 3LDFA 4J9VA 5JXGA 4FXPA 1QO9A 4JP2A 1RWBA 5TEWA 3QWHA 3MEQA 1PCXA 4A10A 3U37A 1XCPA 3TFQA 5A4MS 1JDVA 1NBHA 4QREA 3FX2A 4X97A 1BMDA 1N25A 3WL5A 3WLAA 4ZYUA 3ENQA 3MUOA 2KSQA 3T4PA 3CLTC 3E5RA 3O1LA 3B1KA 4FT2A 4LDJA 1XZQA 2AA3A 3D4BA 4IDOA 4FFRA 5D1HA 3TMAA 4FGSA 3BXXA 4YAUA 4NV1A 3JX9A 2C4NA 1ZH6A 4AJ2A 3I52A 4PAGA 4D0LB 4O8ZA 4MKFA 2JIPA 2J3LA 4KFTA 5CW2A 1F0YA 1ZHFA 2AWOA 2GD1O 2GKGA 4R7TA 1BWSA 3NCHA 5BUSA 2VH5R 3IP3A 2M1ZA 1CF4A 4O0LA 3GROA 4TS3A 3W0LB 4EYOA 4MHOA 3R76A 1UJNA 1E0DA 4JI7B 4GZMA 2AUTA 1E3DA 3V1LA 1A9XB 2A9PA 4OHWA 5CXSA 1E2DA 1YUNA 2P40A 2W4IA 3DDCA 1LSJA 3GVXA 1U6KA 2FPUA 3GMIA 3S8YA 2XYVA 3AEKA 1QIFA 2JAXA 1T26A 3PGKA 4L57A 2JZCA 3N2NA 4OYRA 4KREA 4CV3A 2BH2A 2OEPA 1KDRA 1GAEO 2F8MA 2CYCA 4LVCA 5BVHB 1KAHA 1C4OA 1E4EB 2WM8A 4D9CA 1Y1TA 5JT1A 2V1XA 4MW6A 2PCLA 1GOTA 1ODCA 1MJHA 4QO8A 4YLGA 2Q7DA 3ZHYA 4LECA 3JQAB 1MRSA 2UVPB 1FP4B 3BQNB 2JGNA 3LUAA 3LFTA 5F2EA 1Q44A 1PD0A 3GAZA 3CINA 1M75A 5KNDD 3D6VA 3RH0A 1AM4D 3TL6A 5JJIA 1U9CA 4Y9RA 4P5DA 3GGGA 5AI5A 1YE8A 1HEUA 1V16A 4LWQA 2H52A 3EFEA 4R1PA 4K28A 3GOQA 4KTTE 4QDJA 2DBVO 5B2FA 4II7A 3EIEA 4CKWA 1PK7A 1ZGHA 3CN9A 1O6FA 4HRXA 1U8YA 1WHSB 5LQRA 3PFBA 1GV0A 2OZPA 3DNPA 3IV9A 1JEOA 1H9BA 5BVHA 1G42A 4UAJA 2VHWA 5EMJA 1FCJA 4Z4EA 2W2LA 3AUTA 1J2RA 1FSSA 4H3VA 4ZHQF 2ZU0C 5LP1A 1GXSB 5IDVA 5FO1A 1O5TA 3DMRA 1XRJA 3NOXA 3OD5A 3IILA 2W2OA 2YMPA 4A9AA 3D3WB 4XVUA 3FLEA 3HBMA 3LT2A 3LDGA 3ZGVA 3W3AD 1P1CA 1RLUA 2ZYGA 5CH3A 1NC3A 5C1DA 2HWUA 4OKIA 4DWJA 2A59A 3B5EA 1K92A 2J3QA 1NOKA 3DOIA 1P4JA 2WU3A 1JT9A 1RXEA 3NJ4A 4UTXA 1BKDR 1C1XB 5FD8A 1FUUA 1XA0A 2I2WA 2X1MA 1EDDA 1U5AA 3C3XA 4WBXC 1JFLA 1AG9A 3AF0A 2GRJA 1P0FA 3L1KA 4KGDA 2JGFA 3R3ZA 3TDKA 2VIIA 1E18A 1UOQA 2AN3A 1ZSVA 4MUXA 4HN2A 4MULA 2Q1XA 3RBAA 4WNAA 1P2SA 2RHWA 1TIPA 2Q8PA 5EUBA 3Q7SA 2RH9B 2GI4A 1KMCA 3QGMA 5JQGA 3TPFA 5BR8B 3V6LA 1NPYA 3D3WA 3IHLA 3L7CA 1WO8A 2OMKA 5FNVA 1V4VA 3WLEA 1VL5A 3BC1A 4YUZA 3O92A 1SNYA 2P6OA 4QC2A 4UQOA 4EJSB 3COVA 4CTJA 3TE7A 1DAGA 3C0KA 3VHLB 5KREA 5T6MA 3GDGA 1ZVMA 1JKXA 3DBVO 3II6X 4Q6BA 5JANA 5DK6A 3C3WA 1Q19A 5AVVA 2F1IA 2CF6A 1T9DA 3P5SA 3NLLA 1A9PA 1G3RA 4LVOA 4NEHB 2PGXA 4L72A 1NPTO 1HDEA 3IRUA 4HFNA 4B7UA 3WQHA 5KYXB 3KXIA 3GLIA 4Y9SA 2PRYA 1Z22A 1QOQB 4OQLA 4IFEA 3DC7A 4LXUA 4WNAB 3GJ6A 2QN8A 1NUSA 1OA0A 4M1OA 1OXTA 5FUBA 4D80A 4YRRA 4EX6A 2XY4A 3W5BA 3B6ZA 3V5NA 3QNWA 4V02A 4NMMA 1P19A 1UM8A 3ETNA 3N2GB 4CMIB 2Y2VA 1NDUA 4LZJA 1UBKS 2K7ZA 5IC6A 1F6DA 1E9RA 2EYQA 3B3FA 3I8OA 4C4XA 3ABRB 3ESQA 5KAPA 4C7XA 4CLHA 3DR3A 4P0QB 2VDQB 4D44A 1YJAA 1TMYA 1MB9A 1N2HA 2CLOB 2QU7A 4ZVNA 3VGPA 3EEOA 1M1YB 1YFKA 3WAJA 2BDUA 4MLZA 1KEEB 4ND1A 5IUNC 1X2BA 2Q4TA 3LGXA 3R0XA 3V8PA 1AZTA 3AZOA 3SS7X 3ZH9B 4ZYVA 3IH5A 4IHJB 5KC9A 1G5TA 1ADBA 3FWYA 3O1IC 4DQVA 3EX7C 4ZEOA 4ZI5A 2F9MA 1GGKA 4DIBA 1OXSC 1XBTA 3HUTA 1NYLA 2PWPA 3PEWA 5A1JA 4P80A 1E2FA 2WVHA 4Z9AA 1B8UA 1C41A 2H1CA 3AWDA 4CU2A 2REOA 3OU7A 5G1NA 2Q3LA 5SZHB 1OAOA 4Q05A 5DNAA 3QRWA 3KKKA 1GILA 4CKXA 1XMQB 5IM5A 2QM7A 4NS1A 3F3SA 4WEOA 5CFZA 2UUPA 1WVMA 3C6KA 4W5OA 4D45A 4DNPA 3GOHA 1ESEA 1JQKA 4F11A 3P4UA 4DYVA 4U7FA 1JQBA 1NR7A 1OF1A 5L3VA 2XD9A 4E4RA 3DE3X 4CWAA 4POAA 3WDMA 3DMGA 1W8IA 2BUAA 3BIXA 2YINC 1U2PA 4K9RA 4N3NA 4YRJA 1Q0QA 5KNCA 1K0FA 1SBYA 2XOKD 4KEAA 2XB9A 4FC7A 5BV0A 1N5JA 3JR7A 2ONKA 1JJVA 5AUNB 2X15A 1IHPA 2C88A 2ZXEA 3LIPA 3T9BA 1WUTA 2XNCA 2P3LA 2V7PA 5T57A 3W4KA 1MENA 1BN6A 4GXQA 1IN1A 4RXUA 3QX8A 3KR2A 3NYRA 2YY6A 3QNMA 2O2EA 3JXEA 3PUXA 3T5CA 4I5IA 2Z4TA 2RHOA 4EEXA 1Q1GA 1C9JA 2R60A 2ZATA 1X7DA 1TJ4A 4BJHB 5AVUA 3OLVA 1EHIA 1R6AA 1A77A 1B41A 4GXRA 2AUNA 1XHFA 3GA5A 2OFFA 1Z3IX 3REQB 4ZDIA 4BMXA 2R8PA 2ZE6A 2BCGY 3J7AC 2OXRA 1A7AA 2VNJA 4MJ3A 5TMDA 3QF4B 4ZEWA 2O7VA 1G7RA 2BTOA 2R25B 4JI2B 1A9YA 5BSMA 4R0MA 4EZEA 2ZUVA 3RAGA 3ZNOA 4LPSA 1NQWA 1HDYA 4O4LF 3AERA 3RRYA 2XX3A 3F47A 4AMVA 5JH7A 3W5DA 3K0CC 5FJIA 4BUJA 1JW9B 2BLLA 2PTGA 2XYPA 4WADA 4F7WA 1LF0A 2V7TA 4XUDA 2D5CA 5JR3A 1P6UA 4QNNA 4B4VA 3F9CA 3KKNA 3QYFA 5H4HA 2YIVX 2YXPX 3MIZA 4M3NA 3T15A 4OJMX 4D4LA 1WCYA 2ZM6B 3ZU5A 4IDPA 2W8BA 3P4YA 3GCWA 1EMDA 2WILA 1Z39A 2VJKA 2PX6A 4AKTA 5MF6A 2QU8A 4NK4A 1P91A 2Q2OA 2FJ0A 2WZDA 5DMHA 4ZZ2A 1TQHA 4X45A 2PMEA 3RVSA 3MCWA 3IXQA 1EI9A 3RSCA 4OYYA 3HFRA 2C2YA 4F4UA 5AI8A 4R2JA 3BCSA 2XZLA 3MIIA 2AN5A 1TGYA 2KWIA 1D5WA 4BNDB 4XE5A 2JFXA 1CEQA 5KI6A 4CETA 1Z62A 3P2JA 3WRWA 1DKNA 3AM3A 2R2GA 3NHSA 1I0IA 5CW1A 1XNQB 2WF7A 3L7IA 5AJTA 4EB6B 1AJEA 3Q2OA 2CY0A 3NRCA 4TSFA 5FBKA 1C2TA 3FRIA 2W8BB 1R8SA 2JK0A 3GUZA 1XUOA 5FI5A 3VR4D 2YMQA 1FVOA 4TMFA 3N75A 3SVZA 3AFIA 2X2OA 1QHXA 1TM5E 3B3QA 4HYTA 3IHKA 4LCEA 4EJSC 4EEKA 2IUSA 4U39A 3BRWA 4AMZA 2VUIB 3F7OA 2BOVA 2RGUA 3U7QB 4ETNA 3KSUA 5IX8A 3RYCB 1L8OA 1AQNA 4G8BA 4ZT6A 2O3UA 3TLCA 4QUHA 4DDTA 3ZXXA 1CDDA 4X91A 1ODSA 3CPSA 1MIOA 5H0IA 1K4YA 3WGOA 1O94D 1KWGA 2J3EA 4ALMA 2XH8A 1U8ZA 1L5QA 4JYPA 1ACJA 1LSUA 1U2SA 2GBLA 3COPA 4W8HA 4G0WA 4PZAA 1BU8A 3SLKA 3VKUA 4EKNB 5JZMA 4P81A 3N5KA 1EH5A 1IE3A 3C8MA 2VF4X 4JEUA 4QRHA 4BMYA 2OVBA 5BO5A 5E0OA 1DQZA 1XTQA 4B17A 1E5XA 1ZUWA 3I0NA 1RLMA 2DTDA 1NG1A 5AXBA 5TQ2A 3JRNA 3VAZA 1U94A 1AS3A 3EQ9A 5K99A 4BB9A 2LKCA 1VTKA 3H2GA 3I8SA 3OM0A 1DEHA 4GG1A 1DAOA 1JHVA 1ICEA 4TZKA 3O0TA 3MJRA 5EE5B 5J4VA 3DHEA 4E5SA 2XKKA 1OXXK 4GD3Q 2AQIA 2CLEB 3S55A 1ZCJA 2J6BA 4A0HA 4PS1A 1B6TA 1KP3A 5E4FA 3FOFC 4H7IA 1WB6A 4TVOA 2ID9A 5E38A 5T67A 2QY6A 4JKYA 4G09A 4DA6A 3LBYA 3CUVA 3Q9UA 2IEZA 3DLPX 3JQGB 1D7AA 2FPMA 4NATA 1DJOA 1XT6A 2PRSA 3FDJA 4YT5A 4CQMB 2RHLA 4YT2A 2H51A 1MQ9A 1PZEA 2CSXA 1XELA 2XKJE 1FFCA 3O4HA 2NXNA 3LWZA 2QSJA 5FNVF 5K3FB 2EEZA 4D57A 2N1BA 1RKXA 5F1KA 1NGSA 5DXJA 3B85A 2CJYA 5KU1A 1WV1A 4LXTA 3C85A 5JAOA 4FQ8A 1WPGA 3N8NA 5DZSA 3LUKA 2O8EA 3KYCB 3BSWA 3QE3A 2PBZA 2GK7A 1TYZA 3SX2A 4K6MA 4HG2A 1MAUA 5EXSA 1CUHA 1MQSA 1PP4A 1H2YA 2AEJA 1GAWA 2AFVA 2X76A 4MGYR 3OIDA 1DC5A 5C1BA 5L3SA 2IX9A 2XDAA 2Y1LA 4KXMA 1GZ6A 1IWOA 2IW1A 2AFHE 1R4NB 2CHFA 3TLJA 2DYKA 3GCDA 1TJYA 3KZCA 2Y4OA 5LPNA 3KKPA 3LC7O 1KPGA 2GPTA 3D8TA 2WRZA 4KLRA 4HAVA 4L0CA 2HQSA 4G1EB 2ESRA 5HP4A 1CWUA 3M9LA 5CLGA 3D64A 4Y8VA 4C20A 4HWOA 5TMBA 3U3KA 4DGQA 3IEMA 1ZN8A 2RGDA 3AEXA 4H4EA 1VJCA 1NE7A 3GT7A 5TV2A 1DAEA 2A1TS 2W6QA 3FF1A 3FTCA 1SHUX 4JQZA 3ABOB 3LC2O 1ECFA 3UMCA 1U2QA 1D09A 4BZZA 1T5IA 2BFOA 3KQNA 2DB3A 3Q9SA 4D79A 2C4VA 4A7PA 4NU6A 3VC7A 3MS7A 1E8NA 2BGIA 4OKSA 4DA0A 5EJ5A 4CVNA 5L3SB 4IZOA 4QUAA 1BDIA 2ZZMA 2I76A 4L4YA 5DP2A 2IE8A 1E6CA 5CM2Z 2M98A 1NWCA 3OPMA 2VPXA 1RPJA 1OH6A 1E66A 3PLRA 3AG5A 2LRHA 1RAAA 1XJWA 1EDZA 2BV3A 4P31A 2HJWA 5FTJA 5IBQA 3QKRA 4KUHA 3OZAA 3IKLA 3KB1A 3FCYA 4UXIA 2C57A 2D1YA 4ENQA 1P31A 3PLNA 2HBZA 5E1BA 3AB8A 1I2DA 3VOTA 2IH5A 1TU4A 4C4OA 1T9ZA 1BS2A 2DWUA 2HU7A 4C4RA 3Q7QA 1EM8B 3RBVA 5CJ2A 5LVAA 4TMTA 4RKWA 5DN9A 4BNKA 2G5GX 3PK0A 1GUYA 1TJ5A 4F3TA 1DUSA 1JHZA 2I2AA 2CMKA 4L7QA 4ZXPA 3SNKA 2IYYA 4IVRA 2W0MA 3OBIA 1LXCA 1B73A 4B74A 1RQLA 2KX7A 2QT1A 4MRSA 2J85A 2EF0A 5EEGA 3E9YA 5BRNA 3RC7A 1JZQA 3W6UA 2ZSIA 1W34A 2XDQA 1PT5A 3QVVA 4RIEA 3ZWVA 2FPGB 3EOBI 1RXCA 1F8XA 5IZCA 2OQ2A 1MG5A 4NL4H 1VDMA 4MITA 5AVSA 2JVJA 4LG1A 2WTBA 1VBFA 1ZGJA 4HC4A 3GEMA 4WJZA 3U13A 4HQ6A 3PJFA 2FSVC 3V8RA 2ZRBA 4XI9A 3V4VB 1GNVA 4YCAA 1J8FA 3QX3A 1O6ZA 1ENZA 2V3CC 1Y1RA 2FW6A 1OSNA 3HYLA 3RF6A 1LDNA 4HTAA 1DT5A 1VJGA 5J4KA 3IXMA 3O6VA 4RF4A 1G16A 2VUTA 3ADKA 1DBSA 4B6PA 4ZN6A 1T1GA 2HRQA 2FH5B 1ZA2A 3BA6A 4KSYA 4RGBA 5ARDA 2NNLD 4Y2XA 3WICA 4C76A 1OPXA 2Z5GA 3FVTA 5A7HA 4ENRA 2JPDA 1RQNA 5I3ZA 3E05A 3I5UA 4P3OA 2H7YA 1Y7PA 2CMDA 4R98A 3UV6A 1SU8A 4DJEC 1M2HA 3UUGA 3KQTA 2LDBA 4MVJF 2BFEB 1SBZA 3RYHB 1XEFA 7ADHA 8ATCA 1NFRA 4UUNA 2DH5A 2OOKA 2VF2A 1E60A 4JNKA 4A5OA 1H8HA 1XEAA 1E64A 4HPJB 4A6EA 4FVTA 5IULC 3K70C 4WZ6A 2OCAA 4L2IA 3W4IA 2EGGA 4QHTA 3NKVA 1X0XA 5A03A 1TTPB 2WZQA 2GN1A 1ZH4A 3MTAA 5LLSA 1A96A 3C8DA 3RCBA 3ROTA 1XVIA 4U8GA 2GJ8A 2GYUA 3V9AA 5JNTA 4F6LA 5AESA 3H3JA 1BDMA 1H1LA 4G26A 3BEOA 4P4UA 4FMBB 4TSKA 4QRIA 3SC4A 1VJRA 3WIVA 1AUPA 5HZGA 4ZVVA 2CB0A 1C4XA 2PQ6A 3H1FA 1JGTA 4JXZA 4IJ6A 1NXPA 2G83A 4MYSA 4Q3BA 2HA4A 3G5LA 2BGMA 3ZDXB 3NAMA 4DF3A 4PS0A 1JLHA 1N0HA 1OOEA 2ZI3A 2W7TA 4N47A 1BZYA 3QPAA 3WWDA 1M83A 4ZQIA 4DN6A 3NDRA 3W8NA 2BWJA 3GJSA 4MDYA 5EIFA 4D97A 3UMFA 5HRUA 1ETUA 3RTBA 4OF4A 1R3DA 1WMAA 1E20A 1CQIB 2IYVA 2Q5IA 1AMUA 1T8TA 2I6SA 1E5DA 3BE6A 3FM9A 3QKIA 1Z73A 3REGA 4AU1A 2BKUA 5FLXA 1BCSB 2YJGA 4ZCSA 3H04A 4IH9A 5COAA 4HX2A 2NW6A 3I3SR 2YL2A 2VTBA 1AKEA 2PX0A 2V9PA 1ODIA 2I67A 1QIHA 1X39A 4YMSA 3IT1A 3L4KA 2X0EA 2C9OA 3DMFA 1UJ4A 1S4QA 4X8LA 2IEAA 5A4KA 2P6MA 3OIFA 1GTSA 1WETA 3BCRA 2QTHA 5BV2P 1PWEA 1PG2A 2ZSEA 2ILTA 1U0GA 2OORC 2J30A 1PV1A 2B5OA 2JKVA 4B4UA 3BS4A 4QFCA 1VL8A 5EE1A 5K8CA 4D9MA 5B2EA 3L5KA 4XCQA 1GDHA 3UOGA 1Y7HA 4PGGA 1PF7E 1DVRA 1XNJA 2NU8B 1N0WA 1R66A 4H6XA 3BD7A 3UOWA 4D0RA 5JDCC 5BN1A 3I6QA 3I61A 3MA0A 2OXFA 2WD7A 1BJTA 3BA1A 4DPKA 3MRXA 1BCSA 3LOUA 3H1EA 1A95A 4I9FA 2GH1A 3QKTA 4F06A 3LY8A 4PONA 4ZI2A 4DM3A 2WU0A 4LE2A 4I4TA 1EZZA 4R1SA 3JRWA 3Q10A 2ZOSA 1G8KA 4DJDC 1TF2A 3TGPA 2IYQA 3DNMA 3WGZA 4B79A 4LF7B 1R3UA 1H8ED 3F4KA 4MUKA 2OBFA 1WXDA 1U0OC 3P19A 3TZBA 1NONA 3QQ5A 2GX6A 2IRWA 4N3AA 4AS3A 2B8NA 2QTVB 3PFNA 2V45A 3EN0A 3G2PA 4CL2A 2NV6A 2Y1DA 3LWNA 4FOLA 5BSWA 5CB6A 3RD5A 3EZFA 3JQ8B 4LHYA 4EGAA 3L0SA 2HEIA 1HI9A 2XQIA 1WQ3A 4GLOA 4K9QA 4O4HA 4HZIA 1T91A 4MW2A 1H8EA 3FNHA 4RETA 3IUYA 1ZSNA 2QRJA 1Z0IA 3GGOA 1EUCA 4I1VA 1TVEA 2XNSA 3H1AA 5JADA 1QANA 1DEAA 2J9FA 4C2BA 1TX4B 1QP4A 1SHTX 2EYUA 4RY2A 2VZEA 3NRBA 4CKZA 4QXOA 4JUFA 1G17A 1K86A 2VDWA 3HWRA 1YHZA 1T9AA 2DWOA 1EEXB 1OI4A 3KQMA 4JC4A 3WJAA 4BNMA 1XD8A 2DWQA 2CNKA 2NV0A 2WMYA 3FCXA 4OU5A 1LS1A 4DYDA 2IYLD 5I8WA 5F5LA 2IIPA 5GV7A 1FUEA 3TG8A 4G84A 4B81A 1I36A 5LMCA 3U4GA 2C42A 2QRMA 3DE2X 3R0QA 1Q0TA 2GLTA 3D7NA 3LL7A 4MTCA 4V38A 3LLCA 1QO0D 3FR8A 2W2XA 1KVSA 4CMCA 5E9QA 1E6KA 2A92A 4JU8A 4ACBA 1BVRA 1K89A 3KQQA 5AKXA 3KZMA 3KJIA 2YHIA 3I28A 1IK4A 4A5SA 4JVLA 4IHJF 2CLCX 4F6RA 2DBQA 4CMHA 3E2MA 2JGMA 4WINA 3LUCA 4KKVA 4WK6A 5EJ4A 4Z4GA 4EO4A 4BN0A 4FFPA 4Q0MA 2B2XA 2HCFA 1Z6PA 1ATZA 2JG3A 3E81A 1R6TA 4FP9A 3PGA1 3TTTA 1L4GA 2WWYA 2WSSD 2G8LA 1BHO1 1B7GO 4P53A 2OUIA 1N7JA 1CRWG 1YCFA 1HBJA 2QROA 3ND7A 1JQEA 4IDDA 4NYJR 5DW0A 1JR3E 1NUAA 4S1NA 1KGSA 1QCCA 3N7AA 4WCFA 5DX0A 3KNZA 2ZBPA 1J7KA 2KPOA 1JHPA 4LWOA 4TXHA 2QTRA 3CRMA 4UUOA 4YJ2B 3WIBA 3ZWMA 4ID9A 3D8NA 5JFGA 1M10A 2VWPA 4X1KB 4YROA 2PUEA 1GTVA 4KO8A 1UFQA 2Y1WA 3MD0A 1OBCA 3MTDA 3ZHRA 1BH6A 4FNAA 2QYOA 5IWCA 4CTNA 1ZCFA 1KMQA 2FUNB 3MJ4A 1L5VA 3SWWA 3L8YA 2QLLA 1Y4AE 3NFYA 2FW0A 3VI3B 4JL8A 1I8TA 1A7UA 1H66A 2B8EA 2G3YA 4WI1A 1GZHB 1XKXA 4TRMA 1IQRA 2EQ5A 5JNWA 1UKBA 1VFPA 2GPSA 4M46A 1E2JA 1W1IA 4EMSA 1EVJA 3K2EA 2VT3A 4E7OA 1WKCA 1ZAYA 4FYIA 4H1UA 3TB4A 1A9RA 1C0IA 2RSLA 1QK3A 2V8OA 4JR1A 4K8RB 3ZXIA 2Q1UA 4PF1A 3ASUA 3DOEA 1C5KA 4G1VA 2VSQA 3GF4A 3MSCA 2O7QA 5TGZA 2YN0A 3QVMA 4LHWA 4MW0A 1O96A 2NO7A 5WRFA 2W4MA 3DLTA 2NPIA 3IDSA 3CISA 1KSFX 1LBIA 3C4VA 4B73A 1NP7A 2Q2NA 4BN5A 2H2AA 3KDAA 3V1MA 5A4JA 3ZWBA 1RZRA 4YMWA 3EVTA 3EWAA 1B15A 3HNPA 2VHYA 4MVCA 1R9JA 4JKOA 4LHSA 1NSFA 1MT3A 2CFCA 3Q7IA 3EGOA 1FYXA 3SQMA 2PX4A 3GJ3A 4OTZA 5LMNB 4YR9A 1GPYA 3I0MA 1U3UA 1F1JA 1AS0A 1V6CA 4WVFA 2ZI5A 4X92A 1ISRA 4UZEA 3DE4X 3QYAA 3TRFA 1EHCA 2IYOA 3I5MA 4B87A 4IGFA 2R6DA 3PUWA 1MO6A 3S27A 5I7AA 1IRXA 3JQ6A 4OSPA 3HP1A 4RVHA 4UQPA 2HRZA 1V6AA 2IF0A 1LPBB 1N75A 4AZ3A 3UQZA 5LC1A 2ZKIA 3HNOA 3QENA 4BCDA 2A0YA 4OLBA 1K7EB 4TTRA 4ZQHA 1DXQA 3F0TA 3F6CA 4ZOEA 2QIOA 1EFLA 3O0DA 4BO2A 3K9HA 4FEYA 10MHA 4RK1A 1L7VC 4HFJA 4DBLE 2VSOA 2VVTA 3G5TA 1FLDA 3SZMA 4AKGA 3ABSB 3RRFA 2J3MA 4R1NA 3S6JA 2Z3VA 4ARZB 2JKZA 4HH0A 4U0JA 5CXXA 2ZANA 3WWOA 1KOFA 3FMFA 4L75A 3TSZA 2ERYA 1T5BA 4YQFA 1T4GA 1KQNA 3JCZA 4BPRA 3KUKA 4D8YA 4GBGA 5HQ3B 4KN6A 1ZVKA 5JD3A 5F4BA 1G2QA 1XB2A 1S2DA 4OGWA 3MPOA 4L78A 3CCCA 4QYXA 4NBTA 3DO5A 4AZ3B 3CVUA 1GZ3A 2QQGA 2XGSA 4RYDA 1KY4A 1CLUA 4MO9A 2ZVDA 3KB2A 4KACA 1TU0A 2OV4A 2JKYA 4Q02A 1XWIA 1N9GB 3ER9A 1W1WA 4BJ3A 2RKOA 5C8YF 3CH6A 2VJNA 5C37A 2ZIFA 5EJ8A 3OE7A 2FEMA 4UBLA 4BFCA 3PT5A 3CJQA 1PUIA 5L53A 1AS2A 2BJVA 1YZLA 3O1HB 1QIMA 3NPAA 4WKGA 3AOEC 1UBEA 4RS3A 4YREA 3T06B 2JI4A 1Y7TA 2F64A 4QU8A 1E2PA 4RKQA 1LD3A 4AW9A 2FEXA 2PWYA 2VK1A 3L2OB 4WZBB 1YTUA 4NYIR 1PWZA 3PXGA 2CHUA 4YCLA 1J33A 1FDUA 3JTMA 1HV8A 1RBQA 2XUAA 3OI7A 4PRYA 3TR6A 1Y9JA 2WSIA 4BX2A 2NQ8A 4AJOA 5ELXA 2NTJA 1UEJA 4LCBA 5GM1A 3GWGA 3MGKA 3I05A 4J8PA 3HXMA 5AM1A 2I54A 4CQLB 1L4LA 3AIKA 1PT8A 3HYRA 1FSZA 3KV3O 5AM2A 1TIKA 3I04A 4R71A 2DQKA 3GN1A 3V4FA 3Q8MA 3R9XA 3IP8A 3TNDA 2ZQZA 2OCXA 4KMRA 4F1WA 2CXUA 1TOAA 2VJYA 3MQ4A 4O2AA 1U8CB 2GS9A 4KQMA 1F9EA 3K4QA 3AVUA 1PW5A 1R8QA 2FG6C 4JELA 4P3PA 1ARZA 3S5JA 2DULA 4AL4A 5FV4A 3EQ2A 5E9WA 3ZK9A 4XDGA 3RUEA 1O4WA 1Z2CA 2WZCA 3I01M 3KS9A 5CFNA 1E5QA 1T2NA 5IXSA 1D0VA 1VI6A 3H9UA 4NVRA 3T3NA 1W52X 3KHSA 1YKSA 5IC5A 4RULA 2AOTB 4R9SA 4RD6A 3DBIA 5AW6A 1WB9A 5HIKA 2FTKE 1U28C 1Y3HA 2O3JA 4DC0A 4G1UC 5K6AA 1QIDA 3A27A 5DGCA 1A9SA 1XQVA 4N0PA 3R6DA 5JNRA 1LTHR 3BBLA 1YOVA 4OEHA 2F6RA 3GJYA 3F6BX 4QTUB 4FFBB 3LW7A 3D6AA 1H6BA 3ZDZB 1DJNA 1KY2A 4JLUA 1HDIA 2W6PA 3HCBA 3P2KA 1WY7A 4M4SA 5CM8B 1EFVA 3GP3A 4TKLA 1U7WA 1OE0A 3WBJA 4E12A 5DNCA 4JBWA 5FJJA 1FXWF 4CKWB 5GQSA 2E9SA 5EVCA 3WK9A 1MPXA 3DPIA 1E3WA 3H4TA 5JSFA 4N76A 5L4NA 3SE0A 4E3ZA 3UXMA 1QBGA 2DUNA 3NM6B 5EC8A 4E51A 4Z3OA 3AEUA 3KSMA 4URHA 5D3MB 1YHNA 1GG9A 3PR2B 5C4GB 1VHQA 3ZXSA 1GA6A 3PXAA 3AO0B 4HJRA 4NFLA 4N8DA 2CHVA 5BV7A 5K0EA 3DL2A 2JGDA 2R2AA 4D5EA 3QKSB 1KSJA 3FNRA 4DNOA 2XQGA 3L1JA 3UENA 4Z4CA 2QZPA 3D2AA 4LBWA 5L4LA 4KR3A 3QU4A 4WZBE 1TTHA 2AD1A 3TEFA 4CKCA 1U3TA 1AB5A 1WW8A 3NANA 1TK3A 1HR0B 1CRZA 3HCFA 3EULA 5CVJA 2R11A 1SIBE 4DSUA 2IXGA 1NU8A 2XRMA 3WLHA 4I50F 1M8FA 1IL0A 2GBFA 5H82A 1I10A 2Q29A 5EKUA 3U4HA 3RYFB 4GQIA 4RTOA 2Y1KA 4CEIB 1L1RA 4XX0B 3VVCA 1L5YA 3O82A 3UCFA 4I1PA 5FL7A 4OJNA 3MFQA 1SMKA 1H69A 4MWZA 4EQ6B 5F12A 5AW5A 4UKDA 1QRDA 3QXJA 1XDWA 1WIWA 1VYTA 2AZMA 3KVVA 3PNSA 2PVCA 2WSBA 4UU1A 3D59A 3IHWA 4QDKA 5D5HA 1GT6A 3T7IA 3DUFA 4QKQA 4UTRA 1E3SA 2IYPA 2R7AA 2WZBA 5HTOA 4G5XA 2A4MA 4O1MA 1NFFA 2ZYAA 1N2SA 4L4ZA 1VJ5A 3JQ7B 1T36B 1VMAA 3R3YA 4CLXA 5E3JA 3ZVRA 2IHVA 5DNDA 5E2BA 3BL8A 3S1LA 2QUIA 3SC3A 4DNQA 3EIUA 1U9IA 3ODGA 4DMHA 5F2NA 5IDQA 3A6FA 3OOYA 1N6HA 3AR4A 1KMHA 5D00A 1DBRA 1H2EA 2Q6KA 1W73A 3EZ6A 4BOYA 4PG7A 4MLPA 3VNVA 5LZ4A 1YZFA 4K9MA 3LNCA 3OM8A 4GUAA 5DHAA 2J6IA 4B43A 2AC7A 3QKWA 1KORA 2V7WA 3ZE0B 4WH0A 4JB8A 4HNTA 1WF3A 4PLTA 5LZ9A 3UHFA 3P9XA 4BV3A 1RMYA 5JS2A 5H3LA 1GLGA 3KSDO 4NDZA 2ZRIA 3LCVB 4AP5A 4CIXA 2PGLA 1TM1E 1H0KA 1I30A 1K7XB 2C5BA 3AHHA 4NJMB 3RNLA 5BQ3A 3G2LA 4IHJA 1Z34A 3B6KA 2B9VA 3KOWA 4Y0NA 5G4LA 3RKSA 3HHPA 3MPUA 4YAIA 2AG0A 3EDCA 2UU9B 3FZGA 1TYAE 3SFVA 3U26A 4DARA 2IZOA 4G4GA 5IXJA 3IEVA 2CL0X 1SAYA 2J1LA 3I1FA 3H8JA 1XMIA 4R3WA 3RJ9A 4NU5A 3ZHSA 3BTSA 4OIMA 2BCJQ 2FG7C 2JHCA 3JALA 1EGVB 3PYXA 4PIMA 4ZMSA 4DCNA 2PCJA 3LBHA 2FWNA 1PQ4A 1PG5A 2B0JA 2O0LA 1CX9B 4CUZA 4YUYA 4PO9A 2PVPA 3K9LA 1QIJA 3RU9A 1J2YA 1HETA 1HE8B 1SWWA 2OZVA 1D0SA 4EG3A 3OUZA 1SK8A 2BR4A 4XM1A 2LXNA 3X2FA 5I8ZA 2PIDA 4NJMA 3L8EA 3DXYA 1XWFA 4R5HA 5BSUA 4LJ5A 3RS3A 3W2FA 3ZLBA 3NV9A 1FFGA 3K5HA 1DMRA 3P32A 2QP9X 1BE1A 3T9FA 2Q1WA 2B35A 3C7KA 1C81A 1X14A 2CB9A 3EEQA 1O77A 3LZ6A 4NTZA 5A3SA 3UUEA 3I23A 2O05A 3NETA 3GRCA 4N3GA 5KYYA 3LK6A 1FLNA 4BC0A 3H9JA 4GVLA 1QHHA 2JRLA 1LLCA 3E8XA 4QEZA 2Z6UA 1MBZA 3OHMA 2B1JA 3KWMA 3FGOA 3K72B 1AO0A 3EGXA 4PX2A 1KI7A 1V1RA 5CVDA 1T4CA 4ZOCA 1I3OA 5AOCA 3EC2A 1QGUB 1UBMS 3B89A 3P0EA 4RHXA 2X2EA 4U7WA 5ITSA 4HDSB 4BWYA 2UUAB 5KNDA 2BTQA 3WLQA 3DQZA 1XN4A 5KX5F 1RWXA 1TL7C 4Y30A 4AUNA 2DT8A 2Z1DA 4AXBA 4HVTA 1R15A 2H2WA 3CLKA 3E1SA 5EKXA 3S2GA 4MIEA 2BDEA 2IZ7A 2YWGA 1XZMA 2NVUB 1U9IC 1PLJA 3FYHA 4UASA 3QA3E 4NCXA 2R4TA 3BIWA 2ADOA 1BE6A 3LPLA 2BSXA 4O4HF 2GRAA 3BX1A 3O7MA 4WZZA 2JJYA 2NU7A 1M8JA 3GCGA 5HIJA 3TLXA 1A2BA 6REQA 1OB2A 2JD1A 2P67A 3ZWPA 2PU7A 2JC3A 4GPZA 3S28A 2DLNA 3HB1A 2FDRA 3M8KA 4M9RA 4QLOA 4AX4A 4DV0B 3LP5A 3WIOA 1EUDB 2FPXA 3DTVD 3DVQX 3L92A 4QEKA 4BIIA 1YACA 3W3AA 2F8TA 4XEHA 1VG0B 1ZAKA 3RS9A 2G71A 2EX1A 3CNOA 3BIJA 9LDTA 1U8TA 5JJLA 5JO9A 2FPRA 2HK8A 4GT1A 4V2UA 5FPTA 2H06A 2Y1XA 3RWOA 4FHFA 2ID4A 3RFTA 1GAQA 4TV8A 1COWA 4FYWA 5KU7A 5B3KA 2QG4A 2QOEA 3IQIX 3KM0A 4ZVPA 2QLMA 4KLCA 1U4OA 2I1QA 2ZRFA 4JZYA 4HWGA 3FJ1A 3PPVA 4PFJA 3ZQUA 4U02A 3AQIA 5TY0A 2OXCA 3LBAA 1SHZA 3J81k 5BWLA 1XD2A 3ZV5A 2O1XA 3ZYCA 5KEIA 2HMTA 1Z17A 2GBPA 1ST3A 4D42A 1MO2A 4IUCS 1E2LA 4F0JA 1UMDA 4QDUA 1KPIA 2XE8A 3HTXA 3HDVA 2OFXA 4LDPA 4Q9IA 1AN9A 5TSDA 3SDZA 4GPIB 3AR2A 4E5PA 1OBFO 2KI5A 3C7TA 4P4SB 5ALFA 5H4GA 5JFOA 1ZL0A 3PSHA 1Y82A 2OCKA 4CTKA 4FWIB 1J1UA 1WKVA 3TR5A 2Q0SA 4AN0A 4P92A 3O2SB 5EPEA 4Y2UA 4EYKA 4KW7A 1EINA 2FDXA 1JDPA 3N2LA 2NX2A 3FMVA 3GJ4A 3QSGA 2VJCA 2QVZX 4R40A 1UC9A 3PNQA 1DRUA 4B7ZA 5E6RB 3EIFA 4HDMA 1CJTC 3ZWOA 1A69A 3BXPA 4TTAA 2QD2A 3C5CA 4MRNA 1KMNA 5FBLB 1MGPA 1PLLA 4O29A 4GECA 3PNKA 3QPCA 5E1MA 1ZD8A 1UP7A 1L7QA 3UZUA 1MX9A 2V6FA 3VU9B 4NZZA 4HNUA 4ARCA 3OOWA 5K0TA 4DDHA 2PXHA 2CXSA 5FOVA 3M4NA 1KAOA 3QIVA 2UAGA 5DLDA 5E0KB 3EXEA 2Q3BA 2O0HA 2QJOA 2GERA 2FLVA 3HXOA 3F8SA 2EGHA 1J9ZA 2JK1A 3S7TA 1ADFA 4UJ5A 1G8HA 2DHRA 1ZFNA 3H6KA 4I4TF 4WUTA 1BAPA 4HO1X 5LXTB 2OD9A 1XHEA 2JJ1D 3GNLA 4J1SA 3BJMA 1EWQA 1LI7A 1FU8A 3SOZA 4F2HA 2GHQA 3N0VA 2XNDA 1OIWA 3L41A 1CQWA 3ZBTA 3I04M 3NTRA 4J0DA 3AIOA 3H5IA 3Q7RA 2Q3FA 1F8UA 1GTG1 3IVGA 4ESEA 3ISTA 4LBVA 2FMFA 3KTOA 3HEBA 4JBGA 1YD7A 4M6WA 1DGQA 5IKOA 1MJGM 4LTNA 5K3FA 1XFAA 2ZSAA 4GEKA 3S0JA 3RC3A 1UP4A 5I4KA 5HG0A 1RP7A 1PR5A 1X8LA 3COJA 2QK4A 1EE1A 2XXAB 3GNQA 3LC1O 5FX2A 1O5OA 4RMGA 1YZUA 4H0NA 3PQDA 4QYWA 4FR0A 1UPFA 2QHXA 1XTTA 2IHTA 3TX2A 4QOIA 1TTQB 1E9BA 1PQYA 3EXG1 4JR0A 5KJ6A 1MDFA 2PLAA 3E53A 4I2NA 4C08A 2E49A 4O6VA 5CB0A 2F48A 3CF0A 4B1FA 2WBLC 1PGOA 4EY4A 4ZFNA 1HPLA 2QV7A 2G9ZA 4XH9B 3QE0A 1XZJA 4LHEA 4ZHSA 3L93A 1RXSA 3UK2A 2GXUA 3OU2A 4WECA 1CEXA 3DP9A 3H9QA 3VKHA 2H7XA 2I4OA 1VLZA 2HI0A 2R68A 4N8EA 3ZU4A 3V4RA 5JIBA 1N3YA 2ALJA 4HCJA 1QFJA 1ETHA 1WDLA 1TM7E 1I80A 4EFNA 2PE5A 1T6XA 4MROA 1DC3A 1E9EA 1TDJA 3BF8A 4YRSA 3CF6R 3AOGA 4U8HA 1MW8X 4CQNA 4H60A 2AMVA 1UPUA 3GLIE 3P9QA 1G5PA 1JA9A 2X3UA 1GITA 2QUHA 2QW8A 4BO6A 2HQ1A 2ATVA 3EZYA 1TZKA 2AHRA 3GYBA 4PZZA 3STYA 3VDQA 3OZEA 1JAHA 2V7VA 4M0CA 4OUDA 2QVCA 3EYWA 1Y4ZA 4DHEA 1L7EA 2J0VA 1A8UA 3PWTA 2G1UA 4IZHA 2YW9A 3GW8A 1AT1A 4YXWA 2CMHA 3PQ4A 1E7WA 3ZWNA 1SCJA 3Q0EA 4NMXB 3QKRB 3RUIA 4HYYA 1M66A 2WJAA 2GVDC 4FSHA 1UXOA 3GC6A 4KQ6A 4JHXA 2BRUC 1R64A 1X9IA 2BSAA 2W6JA 2X86A 4RS4A 2PZFA 4D8UA 4KNYA 1K6XA 1RCFA 2V96A 5AHKA 4DT1B 2SCUB 1UDBA 1AQLA 3GCZA 2OV6A 1G4HA 4KVFA 5FTKA 3HKBB 1M2VB 1T4DA 1ZK4A 1QCZA 3K0FB 1GKLA 4ZVKA 3PJRA 1OLOA 3L84A 1IRIA 2E87A 3VC1A 2PSFA 2N1MA 3AXSA 2Q1SA 4HRYA 3QK7A 1XMOB 2DF8A 2H9AA 1SVUA 5TIIA 4U3JB 1FRQA 4R5MA 5CT9A 3ONWA 4W7IA 5ERXA 2Q4OA 3RKUA 1H2FA 2O7RA 3GT4A 2C03A 2FUCA 3O4GA 4GO1A 4FU0A 4CV1A 5LOVF 1TQ8A 3VR3D 2IDZA 3FFWA 4JJEA 1Y80A 4A2WA 2FRDC 2VK8A 1YCDA 1X1BA 3B78A 3BL5A 2FLKA 3EZ2A 3GUCA 1GFZA 5A0FA 3BTVA 4CM9A 1FJHA 2NV2B 1JQ3A 3VPAA 2J4CA 5IZCC 3NWPA 2A14A 3DL7A 2AG1A 4OBBA 2CLFB 4MINA 3AV3A 2H07A 2QAGB 1W0JD 3O8QB 4FIZA 5AM4A 2XVMA 2CVQA 3R3JA 4CKBB 1ONOA 3NOVA 5K7SA 3WBFA 4BLPA 3R8FA 1U9ZA 4K6KA 2YWJA 4BVLA 4Q4AB 5HUJA 5JXIA 1F7UA 1B43A 1GPUA 3PRYA 3ST7A 4RFSA 3V2UA 4F45A 2J41A 4ZRNA 621PA 3I1YA 2WU1A 2EHJA 3T99A 3OEHA 1O94A 3ZJYA 1DRJA 3R40A 3GI1A 3PA8A 3FUVA 2FE1A 3ZNPA 4YACA 2D8AA 3ZGYA 7ABPA 4ZVMA 3E3AA 2Z09A 2XE4A 4PFKA 2O1WA 1GNQA 3W6OA 2A6PA 2C8JA 1JG4A 1W46A 1ZI8A 2OPHA 3U1BA 4IDNA 3OEED 1UDXA 4GKBA 4FCCA 2WTUA 2GEKA 2BEUB 1TKAA 1ULHA 4CKBA 1G98A 1SXJB 4OXKA 2PM8A 3EBLA 4FGJA 5HCUA 5BR1A 5JEEA 3G2QA 4KAXA 2Q4DA 2CZQA 1UFKA 2BMVA 2C5HA 2GDJA 5IYZB 2W93A 1SHJA 1A04A 5K8TA 2P8SA 4FSDA 2C29D 2VWHA 2PMBA 5B3LA 5BNTA 5KBYA 3AVWA 1FP2A 2HLPA 1R0LA 2VTDA 3VJMA 2CBXA 1KRXA 4PBRA 2H54A 3BJRA 3FPJA 2HF8A 5SYNA 3TAHA 1QP0A 4IP0A 4CUJA 2XBUA 4GMFA 3H16A 3NBXX 2GYVA 3QXXA 3S2YA 5EJ7A 2ZYDA 4W5QA 1QTQA 4V0MA 3SJAA 5EQDA 1MOSA 5CLHA 1NR5A 3WISA 8GPBA 1NE2A 3L1UA 3T7SA 3D3QA 3U44A 5I7VA 5J5AA 1L7AA 1FY2A 2AN9A 2C83A 3A1VA 3EK2A 3HBLA 4KPFC 3EQ7A 1L5KA 2ISSD 4AZ0A 4H77A 1AGNA 1OLXB 5LD2B 2R7MA 2OXEA 1SQ6A 3TIIA 3P2OA 2P9ZA 4JEHA 2CLMB 3TQFA 5EJAA 4RPGA 3RRZA 4AMGA 4MUYA 3EXG2 5AK3A 3EZ9A 3O47A 1TAUA 3GL9A 2H1VA 2H3EA 3WYGA 1BVYF 2ID8A 2BM0A 3QYPA 4UULA 2PLWA 4ZI7F 1L4HA 2BHTA 1GY8A 1RQXA 2NYVA 1U1IA 1D1TA 1VE6A 2BC9A 3EVEA 5ES4B 3FOBA 5J2UA 1RXVA 2HHHB 3F96A 1AKYA 1C9YA 1P2GA 1BXKA 2DP4E 4ZALA 5K4AA 3TGWA 5A06A 5JBNA 2XQFA 4B76A 1SIUA 1MZPA 3ELBA 3GB9A 5LDDC 4N6NA 5H8WA 4P3KA 1WR8A 2PUTA 2Q4EA 2QS9A 2G06A 3D7KA 3GDOA 4PXSA 1FXUA 2J6CA 2LWIA 4RD0A 4R9VA 3HADA 1EYZA 3RC8A 1ZD2P 4QQRA 4MV6A 4BYGA 2IHUA 2I7CA 4I4TB 4N82A 1VJ1A 1YE3A 4QOSA 2IIQA 1AQYA 2KQUA 4OM8A 1I3NA 4KH0A 4RVDA 3HYNA 1M6NA 3ET4A 4ALIA 2JAWA 2NXWA 3D6UA 4IIJF 3L4EA 4FDLA 5LDGA 3RO7A 3UKDA 1KGDA 2GZRA 1PL8A 1C50A 2ZI6A 1J2TA 3E22B 3EHEA 4HMOA 1OB5A 2PUBA 3KJZA 2R1UA 4R83A 4CG1A 4B6OA 1MB3A 1RS0A 1CIPA 4KQCA 3ZW7A 4Q66C 2XOKA 5GIOE 4C2TA 2X7JA 2RB5A 2PBLA 1PJRA 1KETA 1R12A 4WXHA 2BUCA 4A2QA 4CT5A 4BFZA 1A5TA 4LK3A 2RB4A 3ZW9A 3WYAA 2QX8A 2I4MA 5DCWA 4ALLA 2E4VA 3H5AA 1CRQA 3WRYA 1UBLS 4FLEA 1IPFA 4KWTA 4YRPA 3LQ4A 4LDAA 3NHKA 3TVDA 1OX5A 4E94A 1IZ0A 2GZAA 4JA2A 4QYSA 1N2CE 3FPEA 4HXYA 5HIMA 3W9UA 3QPDA 3OKCA 4CCWA 4R54A 1C30B 4NBKA 4N7MA 1JXAA 5JYCA 1R6XA 2AD5A 1E0KA 3G82C 3KJHA 3OHSX 4Y7CA 1DU4A 3BT7A 5F9FA 2VPQA 4ZO7A 2II6A 3V42A 2H1LA 3GP5A 2WV9A 1LKZA 1OLUB 2PMKA 2WU4A 4Q34A 3QYJA 5GJVC 1Y8QB 4Q3KA 1P0QA 3ZIAD 4EUKA 4UBOA 1AA6A 4G1CA 5E4TA 4H1WA 1LV7A 1QFMA 3BD9A 4JJ8A 4IMPA 1RHUA 3ELDA 3W8DA 4YXWD 3AFNA 4AMYA 4IH4A 4D46A 1PLKA 5KYKA 2PD3A 2J3IA 4IJQA 3VSBA 1G7TA 3TKYA 4AG3A 2I1LA 4IDFA 5AM0A 3ZBUA 4C7JA 3HMQA 4LWZA 3BZWA 4UNQA 3OQIA 5CPFA 2J3JA 1YBFA 3EOAI 1XF9A 4RAOA 3ZY4A 4QG7A 3TS1A 1LWNA 1JTVA 5FL3A 2HAEA 4QAQA 3ZW8A 4YJFA 1KJ8A 4YMVA 4EHAA 3AMVA 2O5RA 3KEGA 1O9GA 4XD7A 1SUIA 2G1JA 3IIMA 3QMWA 3QU5A 5JZ9A 5KQGA 3BAZA 1KPHA 1SOMA 2Q21A 4N5LA 3TEJA 1JSCA 3CH7A 4MUIA 2D2XA 2EFJA 3KUCA 4UJ3A 4CRWB 5AI0A 3I3OA 2ZE5A 3AI1A 1FRFS 1A2OA 2B4KA 2J4DA 1O87A 4US1R 5C1OA 2F7SA 3UM9A 2AFIB 2W6CX 5G41A 3G68A 3D2BA 2FSHA 1BFDA 3CR8A 3RFVA 4UQLA 3GT0A 3I2IA 2C99A 4PHHA 4XD7D 2JD0A 3KQVA 5KQMA 2JW5A 3CVWA 1K9SA 2Q3CA 1F2TB 5ICGA 1UOPA 3LGSA 2G08A 2DKFA 5JLJA 3ZHXA 4NNPA 4DILA 4BP9A 1CYDA 2C2HA 5A1TA 3BRSA 1Y5RA 4IOMA 2YXEA 2I1WA 2DM6A 3FI9A 3PBKA 2ZRJA 4FBLA 5LNK1 2Q5JA 1KNXA 3A4MA 1KKLA 1B1AA 1V9LA 3F1LA 2X7XA 4L4XA 2EAUA 2WTMA 4XB6B 4OHKA 1ZIXA 1II9A 1P81A 3HCRA 1SBCA 3Q1LA 5ECYA 3P2EA 4ZC1A 1KS9A 1DJQA 1NVGA 1RM0A 4OLHA 2W37A 2MWMA 1JMKC 2XAAA 5EWLB 5KTMA 4Z2YA 3ESCA 1F0KA 1HTBA 3MB8A 4BBJA 4LFBB 1U9JA 4GR5A 1E5TA 2FK7A 3WWEA 5F2KA 3NVMB 1R5BA 1Z33A 3KOOA 1HWYA 1M2JA 3Q8KA 1SKQA 2Q3EA 1UDRA 1V71A 4RTRA 2NUPB 4BQEA 4DJFC 4JN6B 4MRMA 4R3NA 2P9YA 2FZCA 3QWFA 2A33A 3DEJA 2QTMA 3GFSA 5I4CA 4YFYA 3KE9A 2QTFA 4DEYA 1L7PA 1SU6A 3SG0A 4Z4QA 2NSYA 3KU1A 1VG9B 2IEBA 1F6WA 2OC9A 3EZLA 3FJOA 4BV2A 1IJFA 2ZDHA 3IERA 5AVYA 2O52A 3BTUA 4C6HA 4YLYA 2I6FA 4KIWA 3SVTA 4DR1B 3FLAA 1TUBB 2Z2YA 3NC1C 4H1VA 4NMWA 3SHFA 1G8JA 3MAJA 3WGTA 4ATNA 2NQTA 5IAJA 1PS9A 4ROTA 5AI9A 1YR1A 1Y1KE 3F6SA 2ERXA 2IWHA 4A27A 2MYTA 4E1VA 5IJAA 1Q7GA 3UIEA 3GNSA 1J4AA 4JLMA 1VE7A 3TSAA 4YX9A 3NORA 4UATA 1G60A 4OO3A 2YUTA 3DAFA 2Z1NA 3F73A 5F33A 3NFRA 3OECA 4JGBA 4JP5A 4PNEA 2WC1A 2XMQA 5JALA 3QVOA 4MZDA 4PSAA 2PV0A 2GCOA 4L5IA 3IYLW 3CUSA 4GC9A 2QMHA 5EMMA 5BN5A 1SC9A 5NLLA 4CEIA 1E7QA 4JB3A 2ZT8A 4WMLA 5KSOA 4DDKA 3FUTA 5TEVA 1PJCA 1CY0A 2VAVA 3AJRA 1S3GA 3N8IA 4RE6A 5AJHA 3WNQA 5IF3A 1Z47A 1CR2A 2YOHA 1UKAA 3GLUA 1H65A 4MLDA 1E1QA 3C5HA 2LCQA 2CN1A 3SBDA 1N7IA 5C51B 4PIVA 4UHHA 2O2HA 2H1SA 2JJ8A 1LK5A 3X1DA 5IN4A 3WV5A 2CT8A 1P1JA 1DQPA 3WWYA 2VUUA 1CY2A 1SG0A 3H9EO 1E98A 3GV0A 4IUBS 4N8SA 3CX6A 4NV0A 3HXLA 4KQ1A 2J0EA 2R65A 2RBEA 5EMLA 1VL6A 5J23A 2PZ8A 4GYYA 4RNDB 3FD8A 1A8HA 3I2JA 2NU9B 1JJFA 4HK4A 2FZKA 4WZAA 3E27A 5EL0A 5IXYA 1C3EA 1ZXXA 1QLJA 4KRFA 4UCFA 4P34A 2VH2A 3OFVA 2AZXA 4NCJA 2KLHA 2QTGA 3JYLA 1NBMD 1PWYE 2BZ1A 2E6UX 2QXTA 3WBKA 2NZVG 4XOUA 4UBKA 1KL7A 4TL8A 5F1PA 5B7GA 1TMOA 1YUBA 1A7JA 4FOPA 3CZAA 1H05A 1KHTA 4M99A 4WK4B 4UZSA 3USZA 5ALDA 4AURA 1EVKA 5LP6B 3ZWCA 4KVAA 5U9CA 2A30A 5E8RA 4F2GA 4WKCA 4EPYA 1L7RA 1EGMB 4GPTA 1E96A 4WZAB 4D99A 4EYSA 4IIGA 4RJTA 2HHAA 3V4OA 1KYQA 1OFTA 1Z6YA 2D5BA 1K6JA 1HYBA 3A28A 2QTVA 3PZBA 3UXHA 5KSYA 3U7IA 2OHFA 1EFKA 5FNZA 3EMDA 3EFHA 2JI8A 3JSXA 4Y0AA 5JXWA 4KWIA 3W6NA 2X0RA 3JQ8A 1Q50A 1UEIA 2GLUA 5D7BA 4O2AF 5AK0A 4YCMA 3QVSA 1WSAA