3E0XA

The crystal structure of a lipase-esterase related protein from clostridium acetobutylicum atcc 824
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
SNAMLHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSMGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFMEKIYHNQLDNNYLLECIGGIDNPLSEKYFETLEKDPDIMINDLIACKLIDLVDNLKNIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipase-esterase related protein
publication title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e0xA00
3IURA 2WTNA 1XQWA 2G4LA 2XUDA 4PSUA 4CCYB 4ZV7A 4AB1A 5EHNA 1CV2A 3D2CA 2HDWA 4C6HA 3PF9A 5A6VA 5CW2A 4G1FA 5ALRA 3WA7A 4DYHA 2HL6A 5I7UA 2C5FA 1Q0ZA 5JIBA 3G0IA 4G8DA 3WJ1A 3HJUA 2WIGA 4GEGA 4F60A 3WLAA 1THTA 2BUCA 5DYTA 4CIAA 4XWGA 3AZQA 3MGAA 3HEAA 3M3DA 1AGYA 3VVLA 2R8BA 4DM7A 2OCKA 4KAJA 2Z8XA 3OG9A 5JANA 1WB6A 1JMYA 3WJ2A 3MUNA 1LZKA 4Y2RA 4Z49A 1DINA 2OQIA 2WHQA 1ZD5A 3G0BA 4KE9A 1P0IA 4UHEA 1XLUA 4UHBA 4G4IA 3O95A 7YASA 3G9XA 4OUKX 5AOBA 5IVIA 4FOLA 4Y9SA 5K3EA 3GUUA 4H7JA 2QJWA 1AZWA 5AI4A 3FOBA 5CXXA 1R88A 4KJXA 5AKIA 5AK4A 4LYEA 4FWBA 4TGLA 2JGKA 2XUHA 3I2IA 4CFSA 3PUIA 1ODSA 1UOOA 1XLVA 3FYUB 3G0GA 3O4JA 4H18A 1QONA 5EFZA 1MX9A 3ZWQA 4IHAA 4JUIA 5D6OA 1FJ2A 2Y2VA 1ISPA 2OQVA 4L0CA 3MVEA 1UWCA 5JD6A 5ALWA 1F0PA 1AQLA 1Y7HA 5AH0A 3H2GA 4BCBA 5JZSA 3IIIA 2XQIA 3KOOA 2JGMA 2VJBA 1XKTA 3D3NA 3WIBA 4AMZA 2I78A 5FDFA 4ZRDA 4M0MA 3IUNA 3H0CA 2B9VA 3LIPA 1VXRA 2AXEA 4GHWA 1W4LA 5KBYA 1JU4A 2WHRA 5HF5A 2XUJA 1G4HA 4J0CA 1SFRA 1XQXA 4QA9A 4OU5A 4UFOA 4X3CA 5HFAA 3K9BA 4UHDA 3BF8A 1VZ2A 2P8SA 3DOIA 1DWPA 3DJYA 3H19A 4Y2XA 1EH5A 1J06A 5C8XA 3D5EA 1SCIA 2B20A 4J7AA 2O2GA 2XMGA 3R3UA 1OXMA 2AJ8A 3ESBA 3G9ZA 3ZV7A 1YA4A 2ZJ7A 4UHHA 2HRRA 1CIJA 5DNUA 2AJDA 5C7YA 4J0DA 4GI1A 2JGLA 4TVKA 3V1LA 5JZBA 2BCEA 4CG2A 3LIIA 4KE6A 4DGQA 3X3HA 1QTIA 2BFNA 4DMCA 1MNAA 2UZ0A 4BYMA 3EQ7A 4QLAA 1AUOA 3F98A 3G9UA 1GGVA 3W2TA 1FFCA 1K8QA 5FOQA 4H77A 1Z68A 2VJDA 4MWSA 1X70A 4WCVA 5H3HA 1CUWA 5LZ5A 2O2IA 4E14A 2WIDA 4FDMA 1GZ7A 1LPMA 1AX9A 4LKOA 1W76A 5DNWA 3WK5A 3DL7A 1HQDA 2WFLB 1VE7A 1XQYA 1UT6A 4L3WA 1DWOA 2ROQA 1TQHA 3T4UA 3EQ9A 2J3QA 3IUMA 4X71A 5AIBA 1DX6A 4H7KA 2WG0A 4AO6A 3ZI7A 5ALPA 5HZGA 4C4XA 5FP0A 3BJMA 5AJHA 2ORYA 4ARAA 2O7VA 2I3ZA 5KWIA 2PL5A 4AO7A 4X93A 4MQMA 4F21A 1YB6A 1WB5A 3V1KA 1LPNA 4INZA 1FSSA 4C87A 3FVTA 1K6EA 2QKYA 5AOCA 1CUYA 1U2EA 3D7RA 4WJLA 1EX9A 3WKAA 3QPDA 4C4YA 4YPVA 1B6GA 5JAUA 5LIPA 1N8SA 3V48A 1KEZA 3OURA 4X00A 1L7RA 1EI9A 1W6RA 3BWXA 5JALA 3M83A 2I3DA 3SK0A 4BDSA 1ODTC 4MYSA 2XLCA 3B12A 1N1MA 3K2IA 5K3BA 3VJLA 1Q83A 3C43A 1OCEA 4FKBA 4BC1A 1PFQA 4QDXA 1XLWA 4KYVA 3O0DA 5DYWA 3C6XA 2XI4A 2XMSA 2XUKA 2G5TA 2PBLA 2FUKA 4M0FA 5ALIA 3I2FA 5EGNA 5AI5A 4WDQA 2QS9A 2X76A 5AKXA 5ISMA 4FLEA 3HXKA 4QWWA 1QFSA 2YYSA 3A6ZA 1VXOA 3STYA 3PFCA 1LZLA 4EY5A 1YASA 3C8HA 2QRUA 5EHXA 4AX4A 1ZIYA 1CUGA 2PX6A 2V96A 5FRDA 5BOVA 1LPAB 3QPAA 2GBFA 2QUAA 1ETHA 2WHPA 1Y37A 3EQ8A 2Y1KA 4BE4A 3H2HA 2WFZA 2Q0XA 3FCXA 3RK4A 2OLEA 2FJPA 3FCYA 2PU5A 2G5PA 2WSLA 3AZPA 3VXKA 1ORWA 4X6UA 4GXNA 3BIXA 2C58A 4ZGBA 2EEPA 5AKEA 1IUPA 5FPQA 1E66A 1Y7IA 4F0JA 1QIFA 2WUGA 1CPYA 4G8BA 3OPMA 6YASA 5AKZA 2AJLI 3PI6A 3C8DA 3DLTA 5LZ8A 4G5XA 1H2WA 5DLPA 1K63A 3N2ZB 1WPRA 4J3JA 3ANSA 4HXEB 3ESCA 4IH9A 4LHEA 2WG2A 3FNBA 2XUPA 4Y2VA 3A2LA 4H7IA 4BBZA 1QIKA 4P93A 4GW3A 4QNNA 1P0QA 2HA5A 1LBTA 4J0KA 1VLQA 3VKFA 3FYTA 3HSSA 3AUKA 1UFOA 2QOEA 4Y2JA 5DTJA 4GLBA 1A88A 3O9VA 3IUQA 2XMCA 2VJCA 4HTAA 2VSQA 3STUA 3AIKA 4W1RA 1X2BA 4EBBA 3C6YA 5AI0A 3OC0A 2GYVA 3F9CA 3F96A 3CXUA 1JT2A 2DSNA 4MJ3A 1XRRA 1ZIXA 2XUGA 2XUFA 3U0VA 3WK9A 1BU8A 3O9MA 3FSGA 3U1TA 1KU0A 1MN6A 1CVLA 4ETWA 1CUVA 1DWQA 2VT7A 4NVRA 1TAHA 1R50A 3GFFA 3DKKA 1VKHA 2QTBA 3G9TA 4U2CA 3F97A 5FUMA 3Q0TA 2PSJA 4W1PA 5HQ3A 4GDMA 5K3DA 1YA8A 2XUOA 2GBIA 3EIOA 1TKRA 3KSRA 4JYPA 5A71A 5T4BA 4CG1A 4FFWA 4FFVA 5C8ZA 3HC7A 1R4ZA 3IDAA 2J4FA 1Q84A 3QH4A 3W04A 5HFNA 4BCDA 2OXEA 1NU6A 2H7CA 1MX1A 3LLCA 2Z3WA 4EHBA 4PSCA 5HK9A 4ZV9A 4BRSA 1PJAA 3PICA 3MUOA 4AXBA 2X8BA 2JGFA 1BN6A 1FFEA 5DWDA 1YAJA 2CZQA 3ICWA 2CEKA 2ZYHA 5AM4A 5HF9A 3ZLTA 3UUEA 4C88A 2VA9A 3QMMA 5E4YA 2ZYSA 3W9BA 2RHWA 4PV7A 4UHCA 4EZIA 1UK7A 5A7FA 4X94A 3QM1A 4KE8A 1UOPA 5ALQA 1G42A 4K5QA 4DSAA 5D7BA 5ALZA 3A70A 4NS4A 4DSZA 4LXHA 4UBMA 5JAHA 2QXUA 1U65A 2XQGA 1E89A 5BV7A 1ZI8A 2PUHA 4ZREA 1D07A 2VAVA 4Y2SA 4KRXA 1BCRA 1WM1A 1EK1A 1YR2A 2PKYX 1BEEA 4E11A 4A23A 4BAGA 3QZUA 4H35A 3R3YA 4PQEA 2QM0A 4MYDA 2YXPX 2K2QB 4DTCA 4UHFA 3FSGD 1GPNA 2ONCA 1M33A 3E0XA 3A2NA 3WKCA 4Q1VA 4YX9A 5I8PA 5AKHA 3RLIA 3HACA 5CBKA 4GWLA 4K6GA 1XZLA 1CQWA 4X85A 3R41A 3QITA 2HHAA 3DKRA 3HZOA 4PW0A 2DQZA 4IH1A 1A7UA 3HI4A 1BN7A 2XUQA 1MAAA 2DHDA 3V1NA 1J07A 4AN0A 1NU8A 1RWQA 3SWWA 2OGZA 1W1IA 4B9AA 2XQFA 3F67A 2BUBA 3BJRA 2WUDA 1ODCA 4Q82A 2ZYIA 1QZ3A 4BVLA 1QJ4A 2C0PA 1JMKC 5AICA 5AM3A 3PE6A 4UBIA 3AINA 4G9GA 2XMQA 4UFPA 3ZLVA 5HK8A 3C45A 3ED1A 1DQYA 5CH5A 3R3WA 1P0MA 4XIIA 2I03A 3KWFA 1W52X 4NZZA 3IVMA 5ESRA 2CUTA 4EY4A 1EHYA 1YAHA 1ACLA 1XRLA 3PFBA 3PUHA 1XZIA 4Y7DA 3F8SA 4RPCA 1VJ5A 2GBCA 5FV4A 1QIDA 2HA7A 4KR0A 1UK6A 2C0QA 2WQZA 4O08A 1LLFA 3G02A 4AZ3A 4J0HA 3ESDA 1YS2X 3GELA 2XUIA 4QWMA 5T4EA 1T2NA 2J3DA 3S2ZA 3H17A 3KD2A 2JIDA 1JJFA 2WU3A 3B3QA 3IBTA 3D59A 5ALVA 1DQZA 2HA2A 5JZ9A 3WWEA 1HKHA 3JW8A 5AKKA 1KU6A 2QR5A 1AURA 4N8EA 4J0JA 2GZSA 3STTA 4B82A 4DMKA 4EY7A 5E2IA 4OSEA 2Y6UA 1ZJ5A 2OCGA 1XZBA 4HVTA 5ALYA 2CBGA 4CCWA 4EY8A 2CJPA 1CUEA 3DQZA 1UK9A 2WHPB 1SCQA 3DEAA 4H7EA 4KACA 2RHTA 1IZ7A 3ANTA 2QT9A 1FFBA 3JWEA 2PU7A 5AK3A 3WL6A 4RGYA 2ACKA 2W6CX 5FLKA 1BRTA 2HRQA 4GECA 5K3FA 2CKMA 3BDIA 5AK5A 2HU5A 1XZAA 4Q3KA 3RM3A 5D3ZA 4YK7A 1XKLA 4QLOA 2DFPA 4N8SA 2C5GA 1VZ3A 1L7AA 4PO3X 1XZEA 4FNMA 1P0PA 2WTMA 5JD4A 1JI3A 5IKXA 1DTEA 2JGIA 4M0EA 1L7QA 1XRQA 2OCIA 4UBKA 1C7JA 5LP1A 3KWJA 3G8YA 1R9MA 4G8CA 1VA4A 5AP9A 3I1YA 1VOTA 2DHCA 1XRMA 5ALHA 2DCMA 2WILA 2ACEA 3WKBA 2W22A 1CUBA 1DT3A 5IVKA 1U8EA 5EIHA 1ZD3A 4B85A 5J3JA 5JADA 5FXMA 2HU8A 3FAKA 3WMRA 4OD0A 3A2MA 2RGUA 4L72A 4UBNA 3DYIA 2R11A 4H7DA 4QZVA 3VVMA 5JAOA 1QE3A 2V9ZA 4AZ0A 4U2BA 3C5WP 2BJHA 1GKLA 4A5SA 1CFJA 5AOAA 4L9AA 1QOZA 1R9NA 3H2JA 4Q05A 3VISA 4B0OA 5LZ2A 5SYMA 5JASA 4UBLA 5K3CA 3AILA 2HU7A 3G0CA 3HABA 4P9NA 2OCLA 3WI7A 5CT5A 3BDVA 2ZYRA 5HQ3B 1CUJA 1QIGA 5EHZA 1CLEA 4JH0A 4BTVA 4LXGA 1QIIA 3I6ZA 4WY5A 2ZSHA 1GQSA 4FHZA 1WHTA 5ALXA 1U4NA 2DHEA 1XRNA 3E3AA 4P92A 1K5PA 1ZD4A 3WL7A 3H2KA 4ZI5A 5LKRA 4F5ZA 3I2JA 4DNPA 2XE4A 1EDDA 4Q3OA 1XFDA 1N5RA 3IB3A 2C4HA 1UOQA 4QDOA 4XVCA 4N5HX 3QYJA 3GBSA 4BB0A 1ZGCA 3O4GA 4U2GA 4GBGA 4C89A 2QVBA 5AM1A 5IVHA 1CRLA 1A8QA 4FLMA 3M81A 5CXUA 1BCSA 1VE6A 4RNCA 5F4ZA 1XQVA 3P2MA 1LPSA 1SC9A 3H1AA 3O4IA 2IITA 4H0CA 2HFKA 1ZI9A 4EY6A 2WFMA 2CMFA 5AM2A 1EK2A 4X95A 2C7BA 2JEZA 5JAPA 3LS2A 2V97A 1MAHA 4X6YA 4RE5A 4QE3A 4WDRA 4Y2TA 3WK6A 1R1DA 4G9EA 4JNCA 3L1JA 4B80A 3AIOA 5DNVA 1YB7A 1YCDA 2GZRA 1CUDA 1CQZA 2HA6A 3AFIA 2QUBA 2LIPA 1H22A 4N5IX 3HYSA 3BIWA 5ALUA 4OB6A 4BAUA 2VEOA 1G66A 5CH8A 1BEZA 3WKEA 4E15A 1JFRA 4J0GA 5LZ4A 1ZD2P 3FVRA 2VTVA 1B41A 4DMFA 1MU0A 3Q8WA 4MQLA 4U2EA 2GYWA 3T52A 3JYHA 1J1IA 4AN1A 2JGJA 3H04A 2JBWA 5T4HA 4BAZA 3WYNA 3TJMA 1F0NA 3HLKA 3WKDA 4D9JA 3SX4A 2OGTA 5HKAA 1GKKA 5CRIA 2BAGA 4B0PA 4IO0A 2WJ6A 5HCUA 5ALNA 1H2YA 4I4CA 1ZGBA 2H7XA 3STXA 1ACJA 4WFIA 3SC2A 3HRHA 3CCCA 2ZVDA 4C4ZA 2DQYA 1QTRA 3C6BA 3DDUA 2H9YA 1QO9A 4Q3LA 4EA6A 4J0IA 5FKJA 5AKYA 1A8UA 3K6KA 1A8SA 2OAGA 1JU3A 5EIEA 3G7NA 4OB7A 5JATA 4I19A 2OG1A 2AJBA 2WJ4A 5ALJA 5AI6A 5DTIA 2Z8ZA 4HS9A 3BF7A 4FLFA 5EIAA 1ZI6A 4FTWA 1PV1A 1TRHA 1LGYA 5DJ5A 2BGRA 3RKSA 3CN9A 1WB4A 2XMBA 5AK6A 5E4TA 3ESAA 4KEAA 4OU4A 3WK7A 4Y2YA 2BUAA 4V2IA 1SCKA 1QO7A 3GZJA 2JGEA 3LP5A 2X5XA 4HAIA 2VAXA 5LLSA 3TEJA 4BVJA 3WQHA 1ZOIA 4B81A 3I2GA 1C7IA 4OYLA 3WK4A 1MO2A 5ALEA 2Y2UA 5A2GA 1TIBA 5AKLA 3DS8A 5D3KA 4MWTA 4G4GA 3RARA 3WL5A 1LPOA 2H7YA 4YASA 2ECFA 4JYMA 4X92A 2D5LA 1DT5A 4WFJA 2PSEA 4U2FA 1YSCA 3DCNA 4EUSA 3ILSA 5CT8A 3V1MA 4KRYA 5JYCA 4X7BA 1THGA 4IH4A 2FX5A 5KREA 3NOXA 5K3FB 1FFDA 3D2BA 2EDCA 3L1HA 5ALTA 2ES4A 1XROA 4ARBA 4OB8A 4Q34A 4BVKA 3G0DA 3QVMA 5IVDA 2NW6A 1HPLA 2BGNA 5SYNA 1UKBA 2GBGA 2ZJ6A 2DR0A 5A7GA 1VA5A 2WUEA 2Z5GA 4KE7A 1EVEA 2HIHA 3EF3A 3W05A 4BC0A 1JKMA 3H2IA 2HM7A 1BS9A 4LIPD 2WIJA 5FPPA 5CTAA 1E8DA 3FWHA 5AI8A 3FYUC 3KXPA 1CUFA 1W75A 3CN7A 4CCYA 3QBJA 3OOSA 2VJAA 5LZ7A 1GQRA 4AO8A 1EB9A 1E5TA 3WL8A 1AKNA 3OM8A 1XZKA 3S8YA 1EVQA 4Y2PA 1ORVA 4DNFA 5AKGA 5LKAA 1GPKA 4DIUA 2HA0A 5ALFA 1LNSA 1EXWA 3L1IA 2ZSIA 3WZMA 3D2AA 3AJAA 1MX5A 3GROA 4B7ZA 3R3XA 2QXTA 1AC5A 2XLBA 2HADA 1ZICA 1XZHA 3D0KA 4ROTA 2XUAA 3KDAA 1XZCA 5ALDA 3ZPXA 1NX9A 4KAAA 1WPXA 2B61A 1XZDA 1IUOA 3E4DA 4W9RA 4UPDA 2V98A 4W63A 3AIMA 3WIOA 1USWA 3FBWA 4HRYA 5A7HA 4FMPA 4ITVA 1CUSA 4OYYA 2O2HA 1AMNA 4BP8A 1X2EA 4K2AA 4W1QA 2B4KA 4UUQA 3FYUA 1IVYA 1TCAA 4BE9A 1MT3A 2QJRA 3W9UA 5ALMA 4RE6A 3WZLA 1GXSA 4BZWA 3D4LA 1XZGA 2WJ3A 1QIMA 3YASA 5C81A 3I2HA 2XMRA 1CR6A 3V9AA 3O4HA 4HXFB 4S0XA 2XQKA 3C6ZA 1H2ZA 3IA2A 5KWJA 3M82A 4MEBA 5I9IA 1UKAA 5CMLA 2FJ0A 2QZPA 1GPLA 3I6MA 2VQ6A 4PSDA 4JEIA 2WU4A 1IZ8A 1CUAA 2JEYA 3DL4A 4X97A 5ALOA 3I1IA 3WWPA 1O6FA 4UBJA 1SOMA 1LPBB 3EBLA 5AIAA 4ZXFA 3C87A 1UXOA 3R3ZA 4K6HA 3R40A 5CT6A 3NGMA 4E46A 1MTZA 4QDZA 2IIVA 4XX1A 5ALLA 2CB9A 3FLEA 2WUFA 5JARA 5T4FA 3WWDA 1MPXA 4BP9A 2VT6A 4CIBA 4X91A 2OGSA 4BCCA 5BWBA 5YASA 4BATA 2GYUA 1R3DA 4WFKA 4J03A 2Y6VA 3DD5A 3H18A 1BE0A 2HA4A 1UK8A 2AJCA 5LZ9A 1BROA 1HL7A 1GT6A 1XZJA 5HKBA 4TPKA 5EI5A 3VJMA 3C70A 3FLBA 5JD5A 1DU4A 3ICVA 5E4JA 1UKCA 5IH7A 5AO9A 4AMYA 4UBOA 2Z3ZA 3OTQA 1CUHA 5CT9A 3B5EA 5A62A 4P08A 1QIJA 4MEAA 3PDCA 3FLAA 4HZGA 2PUJA 4ZWNA 4LXIA 2PPLA 1XRPA 1S8OA 3WWOA 4DLNA 3R3VA 1XZMA 4FBMA 5K3AA 1WHSA 1HBJA 1IMJA 1CUCA 5HF6A 1TCBA 3I2KA 3AZOA 2WFLA 2WIKA 5K5EA 4IQ4A 4A16A 3N0TA 4QDTA 3DYVA 2PSDA 4QDUA 1EB8A 1Q0RA 1OILA 2PSFA 2VF2A 4KAFA 2YASA 1J2EA 3LCRA 4X6XA 1QFMA 2G63A 4XJVA 1RP1A 5AI9A 2EDAA 4QEKA 3TRDA 1C4XA 2OPHA 3STVA 1O6GA 4I3FA 4B6GA 4BTLA 2XQJA 5ALKA 4B83A 5AKJA 5BWCA 2H1IA 2RONA 3UUFA 1WOMA 4MXDA 1JJIA 2O7RA 3E1GA 5EHQA 1EA5A 2XB6A 1CUIA 1HLGA 1CUXA 3H1BA 2J4CA 2HA3A 2PSHA 1E3QA 1UZAA 2XMZA 1H23A 1EINA 2PVSA 2YH2A 2XMDA 2QMQA 2JF0A 4G4JA 5ALSA 4OCZA 4C01A 3I6YA 5LYYA 3DOHA 3VJKA 1I6WA 1QLWA 3C5VA 1CUUA 2BKLA 4HRXA 5AM5A 2D0DA 1XZFA 3UMJA 4K6KA 1N5MA 3CCBA 1H2XA 3NUZA 3QMVA 2VATA 4AQDA 1HDEA 4U2DA 2XDWA 2OAEA 3BE8A 4X90A 2WIFA 1TCCA 2RAUA 4Y2QA 2RIPA 4NMWA 4WY8A 4N8DA 5CURA 4DNOA 5AHXA 1QGED 3BL8A 4B9EA 4DMHA 1ZJ4A 1EDBA 1QIEA 1TK3A 1DX4A 5AM0A 3IUJA 4W1SA 3GA7A 3VDXA 4OPMA 1IUNA 3BXPA 1JJBA 2XT0A 5CT4A 1YS1X 2WLSA 4B84A 5CH3A 4BRZA 3QMWA 4UFNA 3STWA 3NWOA 1MJ5A 4CI9A 5DYYA 4FNGA 4BDTA 4BZZA 2HFJA 3WYDA 2WG1A 5C8VA 3WA6A 1QIHA 1WCYA 2PM8A 1EDEA 4PF1A 3WK8A 1MNQA 2IX9A 1K4YA 3R0VA 1CUZA 4HXGA 3WWCA 1RYYA 2RI6A 1E8MA 1LBSA 1FFAA 5HF8A 5ALGA 3IULA 3W06A 4EB0A 2E3JA 1CEXA 3I28A 2ZJFA 4FBLA 3DNMA 3PF8A 1E8NA 3QPCA 3ZLUA 4PNZA 3TGLA 1F6WA 4H7FA 4LYDA 1F8UA 1T4MA 4DNQA 2WKWA 1G5FA 2WM2A 4Y2UA 4H7HA 4CG3A 1LPPA
chains in the Genus database with same CATH superfamily
3KEMA 4UASA 3RODA 3I3SR 1JU9A 1XNRB 2I87A 2BPOA 1VIAA 2Q2NA 1G291 2VPZA 3Q15C 4OK6A 1I6LA 3T0GA 4OJMX 5JRZA 3MCZA 4LG1A 2NO7A 1SXJC 1V7CA 4OHMA 3R5JA 3HB9A 4KYTA 4RCVA 3S0JA 4EITA 4RACA 3AEQA 4BNWA 1TADA 5IXJA 5FA8A 5FBQB 1X1QA 3EEQA 1TU4A 1WV1A 1DKRA 3ACDA 4KFUA 1CV2A 1KI9A 1ZQ1A 3KAQA 4PC6A 5CG1A 4EPWA 3P52A 4C6HA 4IMRA 1UPXA 1A8PA 4MUKA 1NDQA 1IYZA 1Z4MA 4MUEA 4G1FA 3MZ0A 5CW2A 5ALRA 1UAAA 4WXRA 1ULUA 1JR6A 1FBNA 3WA7A 2EP7A 4B8YA 4BLTA 1UBLS 3SQDA 5DN6D 1A9XA 2GD2A 2ZBVA 5I48A 4R8VA 3G0IA 1K75A 1KY2A 3GZNA 4P3XA 2ODTX 3AR2A 4TXLA 1BWRA 1JBQA 3HJAA 1FYFA 4AYTA 1TQDA 2H11A 2ZYVX 1RM5A 2C9OA 3KLMX 3UMCA 4AF7A 1OQAA 4IX1A 4EDHA 1OX4A 4GMFA 2JFVA 3SXPA 2QR3A 3T7RA 5DYTA 4NYIR 4E33A 4XWGA 1PNQA 3PQ6A 3AZQA 5JSZA 2EYQA 3NV9A 4YREA 3M3DA 1OWOA 2XGOA 3T7AA 3ZZMA 3DPIA 1NBMA 3P19A 1HTBA 3HU2A 4PZCA 2RARA 4C7BA 1PLJA 4GE3A 3FGOA 4BJHB 2GCOA 4JT8A 2FXIA 2Z8XA 3IQZA 1J9GA 1WB6A 5EMLA 5GADl 3WJ2A 4WSOA 1O95D 4QPNA 1PP4A 1CZRA 2VUIB 3OJCA 2QL6A 3R75A 3RUFA 3RVDA 2VT2A 3BORA 4B40A 5U4QA 4Z49A 1MXFA 4QTTB 1XEAA 1Y8RA 5AVKA 4YR7A 2WHQA 4ID3A 1THZA 2Y0EA 3CLSD 4P86A 5T64A 2R85A 3G0BA 2VDWB 3FYHA 3MOSA 4KE9A 3ZJ5A 3I5YA 2C5SA 4ZCPA 3WYAA 1Q6YA 3K0BA 4FU0A 1PNTA 3BXFA 5T3UA 4NCBA 3M6AA 3ZN2A 2W7TA 4LCEA 3RSQA 1K5GA 2VXOA 1XLUA 5EWMA 1IHXA 2NAPA 4F7DA 2GCGA 1XEWY 1NBEA 2GM9A 4ALIA 2CVPA 2PG3A 2FZLA 2XWSA 1KARA 1PJRA 3G9XA 1FRNA 3OE7A 4JR0A 4OJQA 4XJXA 5IVIA 4B6QA 4BFXA 1G55A 4Y9SA 3BUSA 1SMKA 2WMYA 5LMCA 3FNRA 4E5VA 1N2CB 3JQDA 4H7JA 4EB6B 4S04A 5JRDS 5JO0A 2NZWA 4AURA 3PENA 2FPGB 4Z54A 1JDZA 3CH4B 5CXXA 3DYBA 3WWYA 1R88A 1RPAA 1Q20A 4KJXA 1QFZA 5F78A 1RVV1 1ATIA 3PC8A 4LYEA 4FWBA 2JGKA 2A6PA 2YN4A 2H29A 3LUBA 3RU2A 1JQBA 2EIXA 2CN1A 3TOXA 4C6TA 2BGWA 1XLVA 3FYUB 3G0GA 3QHPA 2IHZA 4U5XA 3ROEA 2FQ1A 5EMJA 1MX9A 2ZTVA 2XCUA 3HCBA 3WLIA 4WLUA 2E5LB 3RJMA 1YQEA 3AL3A 5D6OA 2Q8NA 4DLLA 1ITZA 1EGAA 3EEYA 2ZB7A 3OA2A 1B0PA 1R9GA 1L2TA 3IUEA 2AH5A 4L8GA 1R5OA 3OZDA 1W5FA 4QX6A 3CJRA 4RPHA 3Q7IA 5KQLA 4C2BA 3RYCA 1DBRA 1NX6A 1OZ0A 3QJGA 3GLFA 3PNKA 4RJIA 4L0CA 4LDZA 3WRYA 3SVTA 1ZVVA 2JBHA 2OGUA 4UOZA 3IUBA 1Q74A 1VFPA 2JKZA 2R7KA 3CTMA 1SM4A 1ZOOA 2LXNA 3AFNA 3Q85A 2BZ0A 2XRFA 3IP9A 4BCBA 5JZSA 4UEJA 1XFAA 3H97A 2AK2A 3IIIA 3OLXA 4JQSA 4QUJA 3W77A 1CJUC 4EBFA 5C5EA 2GK6A 3SNHA 2H59A 2ZB8A 3TG2A 3QQPA 5EJ9A 3TI9A 4BLOA 4PYQA 1V1MB 5DW3A 4D80A 4XKJA 1GGFA 4MVJP 2IH2A 3WIBA 2R8EA 4JR1A 2IPNA 1L5NA 3RFCA 1UBRS 2QQGA 3H0KA 5KYUA 4XCVA 3PEEA 3FPEA 4XLTA 2P6UA 3C1TA 1KF0A 2H5LA 3U7GA 3AVTA 1JR2A 4V0LA 5H81A 3LIPA 4KQFA 1VXRA 2V58A 4GHWA 4IUCS 4AS2A 1VGQA 1KSJA 3PKJA 1EHIA 4HH1A 4Z3KA 2NYUA 4UNSA 1H3NA 3H8JA 4MWOA 2PFKA 2H5JA 1CQIA 4FC7A 3SKVA 5A2QA 4IKEA 5WRFA 2C59A 2RGXA 3ROQA 1D2GA 1PJLA 3LYUA 4PFJA 4QA9A 4FINA 4OU5A 1NBWB 3P27A 4NYMQ 3NXSA 3N2GA 1WP9A 4X3CA 3RVBA 5HFAA 3E61A 4UHDA 2AT1A 5K6TA 3AEKB 4H1HA 1VKJA 2BFAA 3GGPA 3C15C 4YQFA 3WMXA 2E48A 2O8NA 5BYKA 1NKVA 3PITA 1DWPA 4CHGA 4HNGA 3VV3A 4BB6A 5C5CA 2NUBA 3C1AA 5GZ1A 3GVHA 2C2KA 3GLSA 2WTBA 3LUFA 3MD9A 4GI5A 4J43A 4OQ4A 3TPFA 1M76A 3A9SA 4JVNA 4QJBA 3RLFA 2P40A 2WA1A 2D5CA 3L7DA 3PXEA 4J4BA 3SAJA 2Y1DA 2B20A 1SU4A 3T06B 1XB2A 5TF4A 2R96A 5LP6B 2GJ4A 2XMGA 4FMBB 1R0KA 1CY6A 1Y3HA 3BMCB 3CW8X 3G59A 3PTZA 4WINA 4D99A 3PX2A 4L85A 3OECA 1E7SA 1LDMA 1M6EX 2W71A 4L28A 1PSDA 3TZQA 2QDKA 2WOOA 1JPUA 3ESBA 2QSZA 3K32A 1YK0A 3LDFA 4DR1B 2A9FA 2C78A 2PMFA 3GFRA 3KZ1E 4YUVA 3L84A 3NLLA 2GQ0A 1H8EA 4JP1A 1O9HA 4BKRA 4HFMA 1R66A 2AJDA 3TTWA 3ESRA 1U7WA 3ZI4A 1RCUA 4KLCA 2JGLA 4TUYF 1AN0A 3TSZA 1OFUA 1U6IA 1P73A 2ZAYA 1IWBB 3H2YA 4RV5A 2GCIA 3TR5A 2BCEA 3IDFA 4CG2A 1US8B 4DGQA 3X3HA 1T6NA 1VJ0A 2JIRA 3NBMA 4J8PA 3M1LA 2JRCA 1QJCA 3D4PA 2BFNA 4KDFA 5TMBA 4S2UA 3NOOA 1E1NA 4N82A 4CHTA 4YCBA 4ZIRA 4DSTA 2WJJA 5TEWA 1P9RA 1ZSNA 2FMFA 3F98A 4HAVA 821PA 2OVBA 4CR7A 4BBPA 1A2OA 1PR4A 1TVCA 5DZSA 2AV6A 2CF5A 1IC6A 2A30A 3PNPA 1FFCA 5TXGA 1T2FA 1UAYA 1IB0A 4H77A 4MWSA 4HUTA 1I4TD 4QU0A 4EB8A 3IYLW 5HTOA 4V1CI 4P6VF 4KMSA 3GJ4A 1UKEA 13PKA 4M0LA 5H3HA 1CUWA 3I01M 1C81A 3EPRA 3PNQA 1P1RA 3QPBA 2ZR9A 1U63A 3CH5A 2RGDA 2ZGVA 3GEBA 1OLSB 1SUIA 2QRZA 4H6WA 3HLTA 2I4MA 3H5OA 4N1AA 1AX9A 4RX1A 1YBMA 3GFQA 4IJKA 4JXZA 4KL8S 4UEQA 2J0VA 1NW9B 2X4LA 2BEWB 3DL7A 3WK5A 2WFLB 1CP3A 4P4NA 4M8LA 4NU5A 1USIA 1XQYA 2VN8A 3IAS1 4LTNA 3UK7A 1UT6A 3P9SA 4DAOA 1V37A 3GVPA 1Y8QA 1UF9A 5JJLA 3IB6A 3NCHA 3PE3A 4WCFB 2YNMA 4JKOA 4YCAA 4DANA 4OLBA 2I8CA 2D2XA 4GPD1 4G63A 4MIEA 1J8YF 1ESEA 2Q3DA 3PX7A 2GZHA 3Q0EA 4G25A 1ZLXA 4ND2A 5B5SA 3AWDA 1NVVQ 2FN7A 5EXEA 2J3QA 2XT6A 4BV8A 3OCJA 3RIXA 2GTIA 1GVNB 3QKSA 5AJVB 1LFDB 2BFFB 2D3TA 4YDSA 4QGAA 2ZLBA 1L5YA 2HLDD 4H7KA 4D42A 5CB0A 5ECDA 5ED4A 2CNNA 3KSBC 3ID6C 4UAGA 1KY3A 1LBQA 4AO6A 5IKPA 2ZJ1A 2LIVA 2LVBA 1V16B 3HCAA 2DE0X 3WLTA 1VJTA 1RTKA 4KLZA 2BTOA 4TMFA 1P1IA 3ELWA 2FUG1 4YMGA 2GCEA 4M9QA 1MABA 4MLPA 3BJMA 4CGZA 1IE3A 1RSZA 5AJHA 1D3AA 3O5AA 1SQFA 4IJ6A 5T67A 5IM5A 4F56A 4KGXA 3SF8A 1XT6A 1BHQ1 4XPZA 5KWIA 4KZKA 4AO7A 1L8LA 5HYVA 1GRNA 1PUJA 4F21A 1KGSA 3SZRA 1IXYA 3QLUA 2R65A 4GNKA 4TWZA 3V1KA 3X1MA 3E7DA 2UVQA 1XHFA 4YRJA 2ZJZA 1UL1X 2VNKA 2VHXA 3T35A 1OR8A 3W2GA 3TTXA 1K6EA 4MB0A 1DAEA 2VF7A 2R751 4IXMA 5H16A 4GVPA 3CVJA 1OAOA 2PH5A 2GEUA 5BYAA 3JQGA 1CUYA 1WKCA 1KJ9A 3V6LA 3QELB 3ZS8A 2VS1A 3D7RA 4DRXA 5D51S 1EX9A 4Z4CA 3UYLA 2ZBRA 4CMBA 2Z2KA 1V9CA 4ZQEA 1OXSC 4TQAA 1B6GA 5JAUA 4LDPA 4FFRA 4MS1B 5JCOA 3V48A 2VXYA 4Q03A 1Q3KA 3IAHA 3OURA 4GE0A 4ZQGA 3EVZA 4XTRA 3UJBA 3VNBA 4AY2A 4QYWA 4LV5B 4BNHA 3L79A 4E3ZA 1Y5NA 4G85A 3G9QA 1EI9A 4IG9A 1G38A 1W6RA 3DDOA 1VHDA 3S1LA 2C2ZA 2QP9X 5JALA 2BF4A 1YB1A 3DFIA 3M83A 5D87A 4ZZIA 2DU8A 1E3JA 2ZIXB 4L6AA 2I4RA 3LUAA 1ZITA 5FWDA 2PA0A 3SJCA 2ZG6A 1RCFA 5CPFA 3TDKA 3VR3A 2IYZA 1YQXA 3O3MB 4EZBA 1OI4A 1QHFA 3CZPA 1N1MA 4KBFA 3K2IA 3GRFA 1VPTA 2WY2D 2QRVA 2Y66A 4AXXA 1IRIA 1WW3A 1O0CA 3C3PA 1OCEA 4BC1A 3QRWA 1PFQA 5E4FA 4DMGA 1VKNA 1JKJA 1XLWA 4HGZA 5KNBD 5KSZA 1SBYA 1CFZA 3PWTA 2SNIE 3OY7A 1E32A 4AJ2A 4FHFA 5L7WA 5KYYB 2ZEJA 3OP4A 3NS7A 1P7VA 3CA8A 4M37A 2I2XB 3RW9A 1XNHA 1R4NB 2YXNA 1FRZA 1NAHA 2ZYUX 4FE7A 4UNQA 1A9ZA 1U8CB 2JKYA 3SOZA 3GP5A 3VGJA 1MQ9A 3VR4H 3SXUA 1A76A 2XMSA 1BSVA 1VFNA 3HY3A 2X9NA 3A4LA 1MO5A 2G5TA 3CKYA 4EUFA 2XCOA 4NMXB 3HSKA 4WXMA 3USCS 3DKVA 1GWNA 5BORA 4BNXA 1AHNA 1SBCA 5ALIA 1Q57A 2FRDC 2QX6A 5EGNA 4E08A 2YL2A 4RZUA 3TZEA 4RLFA 4F3KA 3A1EA 3NBXX 5KDDA 4XX0A 4I50F 1NPYA 5HG0A 1R0ZA 4XRRA 3LV8A 4AF8A 2BFEA 3CEPB 3HU3A 2N9UA 2C4UA 2IXGA 1U31A 2POQX 2PWYA 3HXKA 5DN9A 1H2AS 4YXWA 1M67A 2AF3C 1QFSA 4A26A 2YYSA 2B36A 1RKQA 1TFUA 1XTTA 3BKXA 2RE8A 3PZRA 3E5RA 4NOKA 4BEBA 2IHUA 2OD7A 4ZK6A 1GCGA 1OTXA 1DQRA 2HT6A 4LRTB 3G2KA 4MR9A 1HYQA 2D8AA 1PWEA 3AQ4A 1YB2A 2JI8A 3CQ9A 2IVFA 1JH8A 3MRVA 3BMXA 4OHWA 4TYWA 1LI4A 1ECCA 3C8HA 3PFIA 2V0NA 3SDBA 4EYEA 1WETA 4AX4A 1D6SA 4X20B 1U8TA 2EWVA 1TC1A 4FYWA 1YKSA 3QEMB 3L8YA 3DDNA 4O59O 1NG9A 2ERYA 4MI3A 4Z0NA 3HN7A 1N0VC 3AFHA 1MP0A 3FFXA 1KVUA 2FSUA 1WE2A 4H1WA 4BMDA 3O73A 1WULS 3E0QA 4BU1A 4EEZA 1N0WA 1ETHA 4YQYA 3QV1A 1B3BA 3EIWA 3B6EA 1KI4A 2G7ZA 4XTCS 3W5IA 5G02A 4B7XA 1LNQA 3FCXA 4PYNA 2OXIA 3PNVA 3DGEC 5K0LA 4R5HA 4WT7A 3MUEA 4M9XA 2QU7A 3LX8A 1U0TA 3HBNA 3EYAA 4V39A 2R7MA 1DHRA 1ZK4A 5A4JA 3E82A 3BSSA 1YQGA 2XYRA 3QP9A 1HE4A 2G5PA 2NU9B 4AJJA 3KU1A 5CCBA 4PVDA 2FW0A 1TGYA 5LUBA 4JYBA 1Y82A 1XO1A 3A1SA 1IJKA 4UMFA 4P0QB 2XBUA 1A04A 3CVXA 1X92A 3E9YA 2QW0X 1F51E 2Q3CA 3OEHD 3KZVA 2HD4A 3LHSA 5KNLA 1XTQA 2C58A 1P17A 2YIDA 4RD4A 5JJKA 4LY9A 4PPYA 3ND7A 3HBJA 1M34E 4QSMA 4XUDA 3V2GA 4YCMA 3U61B 2CMKA 1IUPA 2BGTA 4NMHA 3ICCA 2VYND 4LQCA 4X45A 2VKQA 4U9IS 4DWWA 2V4ZA 4N7JA 2O0KA 1KEWA 2PEYA 4YFYA 3KT6A 3REQA 5AW0A 1AV7A 5B64A 1D7AA 3HV2A 4KRFA 3R0IA 2JLWA 5TX7A 4ZAVA 2OB2A 1VBFA 1Z6TA 4KMMA 1LF5A 5EJIA 4L51A 4QHTA 4E5SA 5AKZA 2AJLI 2IP4A 3L6UA 3MQ2A 2QP4A 3DLTA 2ANCA 1XC7A 3PI6A 4GUAA 4J1QA 3UKDA 1GNTA 2ZIWB 4C9BA 3RIMA 3K9GA 1SVMA 1Z5ZA 3LUGA 1WPRA 4GOJA 4ERXA 4DPMA 3GD5A 1PQ4A 2OE2A 3ANSA 5DBFA 2W6NA 3ZVNA 2VRNA 4S1WA 4QTYA 3DEZA 3N05A 3QE4A 2A4MA 2OYRA 1V8PA 1ZN2A 5EPEA 4AMGA 3FNBA 4X3PA 5K20A 3PRKE 3QEKA 5T6MA 4ZJUA 1JLKA 4JB2A 1E98A 1AE1A 1EYZA 2PWBA 4H7IA 4Q7MB 1QIKA 4P93A 4GW3A 1VMKA 3IPCA 4TV9F 1HETA 4JGIA 4R6WA 1QDUA 4K6FA 2DUNA 2WMNB 3A6EA 4KX3A 4MKGA 4QNNA 5DCUA 4ZKDA 3A8TA 4P22A 3OPQA 4WZBA 6NULA 1S02A 1UM9B 5HOEA 4CN9A 3H5NA 4KXWA 1Y3AA 3BK2A 3P0IA 5LDDC 4G4SO 4EK9A 2VZ9A 4OP3A 3K0CC 4NATA 4WKBA 3WLFA 4O4HB 4BLVA 1YE8A 2GZ2A 1FSPA 3FJYA 4MMZB 1UFOA 4FE3A 4UW9A 2AC7A 4V0QA 3H5VA 1IM8A 5CVCA 3KEGA 1TQ4A 2CUKA 1A9TA 1FXWF 1I8TA 4GLBA 1A88A 4GXQA 3JSXA 3O9VA 4CQLB 4DCUA 1T9KA 1FP4A 3JWGA 2HMWA 4ETNA 1X2BA 3V46A 4BWFB 2I29A 3ZD6A 4ILKA 3TSAA 1TF7A 2XMPA 2WJZB 3PNSA 3T5PA 1VCNA 2IU3A 2FYTA 2VH2A 1NBOA 3GAAA 4C4PA 4QD3A 4LJLA 3T7JA 4Q19A 2PS9A 3B9QA 4LJ6A 1Y98A 3DE6X 1BGVA 2VDPB 3AEXA 3CXUA 4LRQA 4TSFA 4BFVA 4B3SB 5EP2A 1B73A 4M8KA 2DM6A 2IEBA 2EC5A 2PTGA 5L3QA 1XRRA 3JQAD 2XUGA 5E2BA 2XUFA 2VPPA 9GPBA 1E92A 2IJGX 1OC4A 4EW6A 1XPUA 2EGGA 3BTUA 3O9MA 2GA8A 3U1TA 3KQPA 1AS2A 1QBKC 1MN6A 4Y6PA 4D0LB 1R9JA 1CD5A 4B32A 4ZEMA 1C7EA 1ZSYA 1W46A 1YZQA 2JZOA 1SUCA 4QU5A 3C14C 1L8OA 1OX6A 2R6R1 5FR1A 5FUXA 4BFZA 4HGYA 1HRKA 5DWQA 3WX0A 1SC4A 4FDVA 4R9NA 3ER6A 1L1FA 3USES 4E5MA 4IHJB 2XCLA 1ZH8A 1PZEA 2PK3A 1XK6A 2WYIA 3BGVA 3HUTA 3HYNA 4HZIA 4RUKA 1YZYA 1TVEA 5DM4A 4XM1A 1OZHA 1HE2A 1ZM9A 4IG4A 2DWQA 3F97A 5FUMA 1RYNA 2PSJA 4LF7B 1UUFA 4ZHQB 5HQ3A 1NOKA 4KQMA 3ZKWA 1OH7A 1Q16A 1I1NA 2GRJA 1N9ZA 2GBIA 4ZKEA 4F5DA 3JD0A 4UEKA 1U2RA 5GM2A 1LSUA 3C3MA 1BX3A 1UXJA 3C98A 3OEYA 3C6KA 2C4NA 2WSMA 3JVVA 1EFCA 5ES4B 3H3FA 3FI9A 4CG1A 1U9ZA 1ISJA 2DUJA 2DFVA 1ULBA 4UVGA 4UAJA 4AWAA 1KAOA 3OZCA 4F97A 4LZLA 3NETA 4DPLA 3Q5DA 3NC0C 3CM0A 3MUFA 4G01B 3IDAA 5EERA 4EABA 1E69A 5I9LA 4DF3A 4F91B 2V4MA 2X4GA 5P21A 5THQA 2AEEA 1ULAA 2Q41A 2BC9A 4Z2YA 4GH5A 2G9UA 2RGAA 4KNVA 3W1VA 5HFNA 3U09A 3GJ6A 1NU6A 1ZMTA 4AWBA 2GHRA 1GOTA 2H7CA 5DFAA 3V4ZA 4CEHB 4MQFB 1NE2A 1F2VA 1RPNA 1WF6A 1E7QA 2BR4A 2PMCA 2QIPA 1F3LA 2UZIR 2Z3WA 3DNPA 3I30X 4UOEA 5FTNA 1W48A 4F4UA 2BGIA 2L42A 1KWKA 2YJ5A 4FT4A 4X44A 1H6CA 3UOAB 4BRSA 4TKVA 4Y6QA 4H7PA 1PJAA 1T15A 3UG7A 2AL7A 3UZUA 1YUNA 1TCVA 3MUOA 4M1KA 4QPDA 5EJGA 2ASVA 3AI1A 2QV0A 3C8MA 3F6CA 1N57A 1UC9A 1T4CB 2X8BA 4J2OA 4CKYA 3AR7A 2PRYA 4BUJA 2ZRBA 2IDMA 3OZEA 4M86A 5BNTA 3ZH2A 3INNA 2WM9B 2II6A 4CG0A 1JHQA 1H3EA 3COVA 4RFVA 1FQJA 1K9VF 3ZWPA 2P27A 3HKEB 4BNGA 1P6QA 2CZQA 4F4DA 1P7YA 3ICWA 4Q9IA 1FQWA 1L8QA 4XA8A 1T9AA 2I9KA 4B6OA 3DCIA 3PRJA 1HFEL 2HC9A 1GPH1 3GZTB 3MCTA 3HWSA 3OZBA 4C88A 2ZIAA 3AP1A 3KDSE 5A9SA 4LF6B 5JXWA 4DQDA 1IIRA 4UXHA 4WN9B 3W9BA 2P4EA 4BGVA 3L07A 3UMBA 5K1ZA 2XZPA 2FEWB 4KXQA 2DBYA 1Z9BA 4PR0A 3E23A 2P2DA 4H60A 3TIXB 2DEUA 5THXA 3NFYA 4C6SA 5C7LO 2Y9MB 4DCTA 3SIXA 2WJYA 3W8NA 1FFGA 4DG8A 4EZIA 3NHKA 1YVDA 2NAFA 4LZPA 4P4LA 3INRA 3QU2A 1UPBA 4EPXA 1RZRD 3ZBTA 1OD6A 1UIMA 2FQQA 2GN9A 2ODBA 3BHNA 4K5QA 4UQPA 1KJNA 1K68A 4PZDA 4WN3A 2AD5A 2YN0A 4ZVOA 5LIRA 3VHXA 4P1ZA 4EATA 4PFKA 1KVQA 4RAOA 3VMFA 4UBMA 2G5GX 2ZJ0A 4UXIA 5JAHA 2XWPA 1QM5A 5F73A 3QENA 1C1XA 4U2GA 2YWXA 3FG9A 3FTDA 4ZMRA 4OIMA 1CLUA 1ESMA 1VIYA 4B5LA 5BV7A 3HB0A 4WV3A 5K0NA 4HDSA 1S4MA 2Q3FA 2PUHA 3HY4A 3I92A 3TLXA 3ZWMA 4E22A 1I7QB 5FFNA 4Z3DA 1BNCA 1JQLB 4IFTA 4RFSB 5A9TA 1KPIA 3N0WA 1KVTA 1Q7TA 2AZDA 4FGSA 5F1YA 4AY3A 3RVNA 2VHUA 4R1SA 4RQTA 5FR2A 3VDMA 3ZXYA 1FUEA 4PNPA 4E11A 4COOA 3BQMB 1E1YA 3M49A 4A8PA 3E9QA 3MT8A 3AHEA 4JVSB 1C1HA 5J4LA 1KE2A 3BJEA 3R3YA 1TM5E 4U0KA 1XYYA 1DXYA 1STOA 1YR9A 2L17A 1MR3F 3KB1A 1XLTA 2V7BA 3HCCA 1T5OA 3O8QB 1T3SA 5CVVA 2CDAA 4S24A 2FLKA 1CQJB 3GC6A 3HM2A 4PAWA 4W5JA 1KFJB 4XYGA 3WGNA 4AD8A 4C1NA 1M2HA 2JFXA 4MVJH 4ND8B 5LQKA 3A6FA 2ECKA 3B70A 1JHDA 1GPNA 1IZZA 5DK4A 3G6KA 3IAEA 1BOFA 2ONCA 2W9XA 4I8DA 1EX7A 1NC1A 4FE4A 7MHTA 1C9NA 2JI7A 5BQOA 4U8GA 4NCNA 1YS4A 3DOOA 1FUIA 2GD0A 4N0EA 1V3QE 1LSSA 3EYWA 4QFBA 1MRNA 1BXGB 1CIVA 2OBYA 4S1TA 5CK5A 2RAFA 2ZI3A 4IR7A 5FPYA 3FPLA 3D0OA 1W2HA 4JLWA 1WLYA 1RRVA 3A2KA 2GZAA 2C9ZA 3AJEA 2CVHA 1FMTA 4D26A 4K6GA 1P33A 2FCRA 3O2JA 3D6HA 3WIUA 5K0GA 1B8UA 4B48A 3E22A 4FOSA 1XCOA 2VUUA 1O94D 1PL7A 3LZCA 3VYSB 1CJMA 1DAMA 2J59A 2GFHA 3G1WA 5KU7A 3U3KA 4PW0A 2QJTA 5KVSA 4X64B 2JHPA 4LX0A 4P4TA 1QORA 4CT0A 1F8FA 3MJCA 3HHEA 4BEVA 2DSTA 1JSXA 4HMPA 4IH1A 2GM4A 1GQOA 2OOSA 3KELA 4KLAA 3IHWA 5AVJA 1OXBB 1MH1A 2O5RA 4AX8A 1MAAA 1UC5B 4NAHA 2AIRA 1JBKA 2XGJA 3DNFA 3CLKA 2D0OB 1XA0A 5IK2A 1J07A 4FYXA 4AN0A 1W9MA 4F2DA 5K8CA 3PQCA 1FYDA 3ZIDA 1NIJA 1BQEA 3O8DA 4MICA 1Q1EA 1XCPA 4ZEVA 1R27A 1P5JA 2DBQA 1L7XA 4U7FA 2R84A 2GTPA 3DWGA 1WZIA 5HGXA 2XH8A 4LYFA 2R60A 4BFYA 3R23A 4DILA 2P90A 2ZSEA 1ZD8A 1CJBA 1WU8A 1ZIPA 2HSEA 1WVGA 2XNDA 4LMBA 3JARA 5B1YA 1KEVA 2ZRKA 5HR5A 3RQSA 4R7TA 1YS9A 5H1YA 3GZ4A 2N46A 2C0PA 4Y1FA 1M1YE 1SBHA 3TK1A 4LUCA 4EL0A 3EDRA 4GOKA 4OY3A 3ONVA 4RTSA 2FPPB 2Y68A 2YNMC 3PT9A 4RIFA 5FL7A 3AEZA 1JN0A 3OOHA 4HQLA 4HWKA 4RPJA 4U02A 4I5GA 2A8YA 4O4LF 4Q3NA 4WMLA 1RQ7A 3L7OA 1SVUA 3HBAA 3AINA 3E7WA 2ATXA 2OECA 2ZRCA 5DMXA 2Z43A 4Z7OB 1PQPA 3QWAA 4NCXA 2XMQA 3HP1A 1LV8A 1LA2A 3LRTA 2JFNA 4UFPA 2PUCA 3LPAA 2PUVA 3ILXA 1FTGA 1G21A 1UMCA 3ED1A 5GVRA 2FDXA 3R3WA 2FCAA 2QRKA 2QRLA 4XIIA 1VJRA 1IY8A 1M2OA 3JTMA 3X1KA 1MHPA 5JH7A 3KOUA 3GWGA 2CUTA 2JNWA 3A31A 3OPYI 3KB8A 3AV0B 3OIDA 4EY4A 2WWYA 4BLSA 4R2JA 4GQIA 1A50B 2XBLA 3SYKA 1I3MA 4O2LA 1ND6A 3PFBA 1SVNA 3ZGXA 1E64A 4EQ6B 4Y7DA 2D1SA 3LHDA 1JDPA 2CHEA 3F8SA 5B58T 4ATNA 3MWFA 2NPIA 3DMRA 1XDDA 4ZU6X 1Z63A 1GTZA 4YDHB 4EVSA 1R8JA 1L5KA 3VBCA 2CLEB 1IN4A 4KR0A 2GFIA 1E9RA 1GG9A 1S01A 3D0RA 4RAQA 4RDCA 3JQ9C 4QUEA 3RTAA 1YVPA 3MAGA 2FR8A 5DISB 3AF6A 1EZ4A 1FRQA 1X0XA 3QLUC 1LLFA 1N25A 2NZVG 2ZQZA 2RI0A 3G02A 4AM8A 4J0HA 1EVYA 1ODKA 2W2KA 5TJ9A 3LWDA 2AN1A 2QPLA 2ZR8A 2G70A 3CRVA 1DTSA 3M4XA 5FI0B 4C7XA 1HNZB 4YBZA 2B1JA 2JLQA 2WICA 2WNSA 2O54A 1U7ZA 1GPJA 4YWJA 3S2ZA 3TW8A 5KDLA 2OV6A 2AN4A 4KQJA 4JROA 2R8XA 1KZHA 3JQAB 4Q9LA 3SYNA 2F9FA 2JIDA 2PRJA 2QLNA 3KD2A 1C7RA 3IQHX 3O2QB 3N39C 2UYYA 4DA9A 3RNOA 1G7TA 1N33B 1JJFA 5JCOC 2WU3A 3B3QA 2H07A 1AK1A 1RAIA 2YBDA 5E3IA 3ZHCA 4D4HA 3KQLA 2UUCB 3GFVA 4W8OA 3LTNC 2H0QA 3WWEA 4WKNA 1GSAA 3QKRB 2PVCA 2NO6A 4R83A 1UBMS 3O93A 5IABA 1CZUA 4YJDA 1KU6A 2YVKA 1Z7YA 2G82A 2QR5A 1QZTA 1NWHA 4E4YA 4ER6A 1P1HA 4FFNA 4INPA 2WV7A 2GZSA 3CPEA 4K9NA 5J4VA 3AXTA 3I42A 3W1WA 1IPHA 3WV5A 2NTYC 3G8CA 3Q0IA 4QOSA 1HA3A 2X2FA 1D2MA 2JANA 4B8WA 1OKKD 4B82A 5JBNA 3GVCA 4RIGA 1DQNA 3RTCA 4LDNA 5BRJA 5I7FA 4MAAA 1RBQA 2Y6UA 5TQ0A 4DT1A 3BWBA 4MV9A 1QTQA 4PFQA 2Y1WA 1PI3A 4IDAA 2Y27A 4EY8A 2I4TA 3A14A 3EZ6A 4ME6A 1F4PA 1U6KA 2ZE8A 1CUEA 4OMFG 5SY6A 4D25A 2O8CA 2GPBA 2V7GA 1UK9A 3D8HA 1HFKA 4IVPA 1DG3A 2WHPB 5KO2A 3WGHA 1SCQA 5DW0A 4BP1A 5IXSA 1Y5RA 1E2PA 4C22A 1BXRA 2HJ9A 3PL5A 4NL4H 1KH1A 2QT9A 2QN2A 4A91A 5K6AA 1FFBA 3JWEA 4CMGA 3LPDA 5FH9A 2OAP1 3KZMA 3VC3A 4MV1A 1U7DA 1UZMA 3RYTC 1RRPA 4OYHA 2FEKA 3AFMA 3PQ3A 2Q4BA 3W0LB 5DU2A 2OHFA 2IBMA 1TU3A 3FMOB 3NJRA 4K9KA 4RGYA 5SV2A 4AL4A 1QH9A 4G5SA 5CEFA 4K6CA 2PSSA 3DOUA 2N3ZA 5FTKA 5I01A 2IDJA 1UP6A 1G4AE 1MQSA 1ZUWA 4GECA 1ZXXA 4QNRA 1TA9A 3U17A 1HI9A 2DJIA 3ETNA 1RYBA 3GLVA 4GF5A 4CKWB 4Z7NB 4CTMA 4N76A 1Q77A 3K5WA 4HAUA 2IK8A 1H69A 4X1KA 3E58A 2HU5A 3NORA 5ILQA 2MHCA 4NU8X 2ZATA 1KZ4A 3ZHVA 2G1JA 3GRPA 4M7PA 3W5BA 2FW6A 4JI1B 3QLEA 4M88A 3CNEA 5EPUA 2IZ1A 4MITA 4L78A 3KU4A 4YK7A 4IOJA 2FMHA 1SULA 2FWIA 1XKLA 4QLOA 4PLFA 1GDTA 2ZUDA 2O4CA 3K31A 4ZICA 5JECA 2RBEA 2C5GA 4MJ7A 3TLGA 3RG8A 2N75A 1MV8A 3UA3A 1NJ1A 1XZEA 4FNMA 3TH5A 5IDWA 4EJMA 1X13A 1ULZA 2WTMA 5AVSA 1RXSA 5JD4A 1DIOB 5IKXA 1DTEA 2JGIA 4EELA 4M0EA 2BF7A 3JXEA 1ZRHA 5G1PA 5J5AA 3WLPA 2HDNB 5TT1A 1DCFA 4BL5A 4E51A 3IEPA 3TQRA 1XRQA 5AXBA 1L7VC 4EI7A 3I4LA 4M38A 3SX0A 4ZARA 4UBKA 2C2HA 5L4SA 1NY6A 2XDAA 3EZ9A 1YIAA 3PC3A 1ILEA 1CE8A 1ZHOA 1H66A 5A5VA 4EGQA 4UDYX 4EMTA 3BM5A 3FJOA 4HX9A 3NKLA 2AXQA 2WVJA 3C3WA 3CR8A 2ENUA 4RKQA 1VOTA 2Z5LA 4H08A 4MIKA 2A5FA 3VNQA 3EDYA 1HURA 4DXHA 1ZWLA 3ZGOA 4DIMA 3WKBA 2ZE5A 4PINA 1LLCA 1QUFA 2W22A 2LW7A 4XR9A 3CINA 1NGSA 4HSGA 1DT3A 3RAJA 3B3FA 4DIFA 5KNDA 4P5EA 4EUNA 1P6UA 4ID9A 1H94A 1Y1LA 4JP3A 4LYGA 3TLZA 1WCIB 1ZD3A 2X58A 1N4AA 3H5IA 4B85A 5JADA 4NH4A 3FAKA 3FLMA 1LWNA 3EB9A 3IEVA 2JFGA 4RK4A 4Z9BA 5JYEA 2GFQA 4TTVA 2QRHA 3GEEA 3RK0A 4BN0A 4KX5A 1EUDA 1OFTA 2ZT5A 4KVAA 4L72A 4QICA 1IMOA 1GNRA 2V55B 4IIJB 3HO8A 1X74A 1Z4KA 2Y99A 2NU6A 3BCHA 4LVUA 4P83A 3SR3A 8LDHA 3THWB 1H6DA 4Q18A 1NQ5A 3VVMA 4QZVA 3KZNA 4PIMA 3IUPA 5FTWA 1E1RD 5JAOA 2CLLB 4AZ0A 2JA1A 4MA5A 2XVZA 5BSUA 3TUIC 5C53B 1L7PA 2BJHA 4RL4A 4D6XA 5K9ZA 1W85A 4A5SA 3G5LA 5BV0A 4DZZA 5AOAA 3DBRA 3UCXA 3HDTA 3LI2A 1IEWA 3KXDA 3LPLA 2WB2A 1L6IA 3W8EA 5LB4A 3UAOA 4Q05A 4HNUA 1ELOA 1JB1A 1W0JD 1AMUA 3FW1A 4CKBA 1XG5A 1UXKA 2LR0A 4KP7A 4DDKA 2HU7A 1UP7A 1PJ4A 1ESZA 4JC8A 1NE7A 3HABA 3IVRA 4ZQCB 2OCLA 2VYQA 5IDVA 1BA3A 1XAGA 2C8LA 1MAUA 1PGQA 1VRVA 4W99A 2G9ZA 5DO9A 1JG4A 5LXTB 1D5WA 3I9JA 5DGIA 5CT5A 1Z08A 1A7JA 2Z6QA 2RGNA 3P96A 5KYXB 1SURA 4KFSA 1JS1X 1C14A 1CUJA 1ST2A 3OJOA 4X7MA 1QIGA 4G24A 1TF5A 1YBFA 1K98A 1LY1A 2RHBA 3CEAA 3PGXA 2G09A 1OWMA 3I0NA 3ANMA 4JH0A 4BTVA 5D3QA 4L8WB 1U1DA 1ONPA 3LH5A 2C2WA 3N2KA 5IYZA 3HVUA 2Q6IA 3DV9A 5JCJA 2OBBA 2ZSHA 6AT1A 3A6GA 4WD3A 1X42A 2E1RA 4BO7A 4Q7KA 1N1GA 1CDOA 4IJQA 1GQSA 2OORA 1WTAA 3L6EA 1BWQA 1WHTA 3E05A 4WUTA 1YZNA 5ALXA 3HFSA 4J76A 1QRRA 3I9KA 5DKFA 3RIYA 3C7AA 2I7XA 3BCRA 2CFTA 1ZD4A 3A32A 4TV8F 3RADC 1M1XB 2YMMA 4E3WA 2H2AA 4PC1A 3K20A 1GQQA 2ZB3A 4ZI5A 4B76A 4EG1A 4DUGD 4F5ZA 1NYQA 1SUWA 4IXNA 3D3QA 4TXHA 2Q0SA 2RJOA 2M6KA 1USUA 2CK3A 5T8KA 4DMUB 1UBUS 2D8MA 3DB1A 3KEFA 4LJ8A 5DGDA 3RE1A 5K0EA 3IB3A 2GNOA 4NFYA 1U0GA 1LB1B 1U0EA 4LJ9A 4UTXA 2ZRFA 3LXRA 4EB6A 1UOQA 1HK7A 1FFXA 3LWBA 5KJ1A 3EHEA 4N5HX 1J22A 4YUYA 2JBAB 5EIWA 1O77A 1GFIA 1YV9A 5LQDA 1PD0A 3PZBA 3TQQA 5IVHA 5IZCC 2C83A 3DDSA 3ZHYA 2VUSA 3ICOA 3KJQA 5CXUA 4K2HA 3EX7C 1RHQA 4RKWA 2OLKA 2C5BA 4PPNA 4RNCA 3SY8A 5A4IS 2ZP1A 4QUIA 1KC3A 1XXHB 5GJCA 4JAVC 3QVJA 4UNPA 1TMKA 1SQ6A 1LPSA 2JFUA 2AI1A 4UEOA 4EA7A 5GY7A 4KU4A 2VDLB 1ZSVA 3H9CA 4EG3A 2HFKA 3UJ9A 1WLSA 2NU8A 3SDSA 2GERA 3Q7RA 4Q9NA 1L7NA 1NUPA 1UWVA 2GM3A 1Z4PX 2GLUA 4P3OA 4UKDA 5DN6A 4F5WA 8ATCA 1RRMA 4JDUA 4QELA 3VDNB 4XWAA 2C7BA 2XHZA 2ZYGA 5K3OA 4IY1A 2NADA 2WD9A 3T1OA 4H6VA 4Z4HA 3EARA 3EEOA 1SOAA 4Q37A 2WR8A 2XOEA 3JAWB 4LE0A 4MV0A 4OBWA 2GN4A 2EG5A 3PXDA 4QE3A 3CFYA 3MJEA 4Y2TA 1E2JA 1RWKA 3WK6A 1TM4E 1R1DA 3AQIA 3JQ8A 3Q9NA 5C37A 2VHYA 4HB4A 1XELA 3LVFO 1NTOA 1ZPDA 3SQMA 4JMPA 3V55A 4XFKA 4LZNA 2XKBA 5FBZA 5G4LA 3G2NA 1P4HA 2POCA 3W6UA 4X84A 1JHVA 4NV0A 1FU8A 4KPGA 5C3MA 1MB9A 4PCVA 1CUDA 1LCIA 2HA6A 3K70C 2QUBA 1IN5A 4N5IX 2EFYA 2J0EA 5JHGB 4RKRA 1DARA 4IO1A 3A0UA 4RF2A 1PZFA 1JA0A 1I3KA 3CLTC 3T4XA 1ES9A 3RS8A 3VZRA 3ZJYA 2G04A 4QBFA 3QLVA 1U04A 5M29A 5IDQA 1E60A 5I45A 1OBCA 4FS3A 4M7RA 3NHMA 4WNIA 3L1UA 5BT9A 2QTFA 3UATA 3LQKA 3U4AA 3AUSA 1ILWA 1I0ZA 1GNVA 1HDOA 2O0LA 3QJ5A 4HEJA 4Q4AA 3WP0A 5I9TA 3BH7A 5AVTA 1L5WA 1SCNE 1W59A 2CFOA 4DIEA 1KNXA 5KTOA 4XSGA 4RXUA 4RL6A 1UBSB 3T3MB 3E84A 4PBSA 2G67A 1J2UA 2HIMA 3B38A 4IS3A 4MW7A 3FVRA 4NJEB 3EVNA 4HQOA 3P9YA 4YAIA 3P9KA 5TPZA 1AO0A 4O3FA 4MDHA 4QTZA 3D3JA 1AS0A 4MQLA 2DB3A 4U2EA 3ZU6A 4KXMA 1Z82A 4LFCB 1MVLA 2ZS8A 1ZK2A 1YF3A 2RJNA 4YAFA 4C3OB 1QX4A 2QTVA 4NZMA 2Q4OA 5CM9C 1J1IA 2C99A 1UPTA 3L7IA 1BYUA 2VRCD 2WWWA 3K16A 3KV1A 2PUTA 3H04A 4IDDA 4Q66C 4OUDB 5JS7A 2JBWA 2R7NA 3BXZA 1DBSA 2C03A 1DRJA 3DDCA 3HYLA 4RKYA 4BAZA 3O3CA 1JJAA 3IE2A 5GTDA 5CFRA 2R87A 3JASB 4JSTA 5A6SA 2C7QA 2HWUA 3VMMA 3HLKA 2XXAA 1W93A 3WKDA 4AKGA 4YDRA 5EQDA 5E6SB 5EOVA 2OGTA 2W2NA 4L9WA 5F1OA 1KZ9A 3SQNA 4NXMB 4IIYA 3MWLA 2EXXA 1JR3A 2YVAA 5GIOE 5CRIA 1OROA 4BO4A 2VJOA 1Y1SA 2I2DA 2QZZA 3KJGA 1ND5A 1QNFA 2XWBF 4KVGA 1JA9A 4B0PA 2HK9A 4DDMA 5JVDF 4YBRA 1D1SA 2C42A 2RK3A 4GL4A 4RSRA 4PLCA 5TGDA 3WQBA 2NU7A 4BNMA 1EK5A 5C4IA 1Z5OA 4AP6A 3OMLA 4E88A 4EI9A 3ANYB 4URXR 4BPBA 4JGGA 4QVGA 4BFSA 3LA8A 4PNHA 4MGEA 5G3YA 1UMDB 1ULSA 4KIFA 4P3YA 2RHOA 1C50A 3CUYA 3DTNA 3STXA 1MB0A 1D2HA 1QKJA 1ML3A 2ZI4A 3PPYA 1WG8A 4EKGA 1TM3E 3F49S 1A9YA 5EP1A 4FGZA 1L5HB 1HZJA 2B78A 2W2TA 4K86A 2ZCJA 1CRPA 3UGQA 1KS9A 3CCCA 4B43A 2CCJA 1EWKA 2CLOB 4M1MA 4UUOA 4A6DA 1QS0A 1Z88A 2EBWA 1T8UA 3PL1A 4ER3A 1EEHA 3WWZA 3DUWA 1QO9A 2VSYA 3AF3A 4B7AA 4Q3LA 2OXCA 2YZNA 2ZETA 4R6XA 3G88A 4EA6A 5KJCA 2K7FA 3DP9A 3IILA 5BMVA 4TN1A 3ZOZA 3I5XA 5FKJA 3LPNA 2A0FA 3ROFA 3S2IA 1HT2E 3GN1A 1UBHS 2J3MA 1NP7A 2C97A 2GAAA 1Z6ZA 5G3ZA 1EJ0A 1T8RA 2IYXA 3VPAA 5D84A 1QCYA 1A8SA 2QY9A 3H1GA 3MB5A 1UBCA 4KXUA 2WAMA 4E13A 4CIVA 1V3UA 1ESDA 4OB7A 1JFSA 5FAKA 5DH9A 3BSFA 4U3JB 3AB7A 1P44A 3JCZA 5JATA 2CLDX 3CWQA 4K9DA 4WW0A 5BO5A 1A96A 1SUBA 4PHFA 1VP9A 3RC9A 1VMAA 4MV3A 4AZ3B 3DWFA 2R4TA 4R1UA 3N5KA 5AI6A 2ZANA 3NALA 1MXHA 3NATA 5FHQA 5KSPA 4IJ5A 4DMLA 4EX6A 1DJPA 1U2TA 3FPFA 1TTHA 2C2YA 3N2IA 1ZI6A 4FTWA 4GLJA 2GARA 3LBHA 3AESB 1DXOA 1WTCA 4JUBA 4M6WA 1ZL2A 5IN5A 4F5YA 5JPDA 2Y3IA 2J0UA 3HFJA 2O8DB 2O2XA 3RKSA 4TLLB 1OHHA 1VJ1A 2ZRJA 1KI6A 3CN9A 1XZQA 4US1R 1YQTA 5CCEA 5MGNA 2P1ZA 1N0UA 3DDZX 1SKYB 3RGWS 5LQCA 1T2AA 1YBHA 2XMBA 1PJ2A 1YL7A 1X6VA 3PQ5A 4ESEA 3ONFA 6REQB 4AU1A 1SGWA 4NE7A 2VDJA 1XIVA 1Q1BA 4KVFA 5EUMA 2IE0A 1XVVA 3R9IA 3GZJA 1ZM4A 1Q3TA 4X65B 2A94A 1IM2A 1G8YA 1VJGA 1UPUA 2VAXA 2HOQA 1NKTA 2ZT7A 1D0SA 3AERB 3EZ2A 2AMJA 5LLSA 2VSNA 3TEJA 3A6PC 3BHIA 1P4SA 4FT2A 4IEIA 2GEBA 4PWZA 4FZ5A 2X9QA 3GG2A 1ZVJA 3FKQA 3WQHA 1SVKA 4K8OA 1ZOIA 4QT0A 2F00A 4RA6A 3ZGNA 2FR8C 9MHTA 1CX9B 3E9EA 4B09A 3DLCA 1QC5B 1QU3A 2HBQA 1IFXA 1Z2DA 3DF7A 3H9JA 5DX0A 5ESDA 4Z0PA 1DAOA 1QKKA 5ESXA 4F46A 1MO2A 2YDXA 5IULC 3MCVA 1NSFA 4TXNA 2Y2UA 3FPGA 2YDYA 4GICA 4KWCA 2NPOA 4KSBA 2AN3A 2VJLA 2IPMA 3V7WA 4MWTA 3ZCTA 3EQ2A 3QY9A 2NYRA 1L4NA 3WYBA 1I7PA 4NBRA 3RARA 2H7YA 5JAZA 3E7FA 4ICIA 4YASA 2IY7A 1NKSA 4FMCF 4KQHA 5JFTA 2GRAA 4KHZA 3T3PB 4WFJA 2PSEA 2WNHA 4QBGB 1GDDA 1QB8A 1YSCA 1RAEA 1XF1A 2V7UA 4C03A 3ILSA 3K9CA 3NYRA 2RGBA 3A1FA 3ZLBA 4X7BA 4BGUA 1VLVA 2VXCA 2WB4A 4PZEA 5CB8A 5LWQA 5EMNA 4HJRA 1D1TA 4NNJA 1TECE 1J8DA 4ETIA 3ND9A 3DE5X 1Q0LA 3TBHA 3NHBA 3DW1X 4H15A 2ZSFA 1P19A 1P60A 1DC4A 2HLDA 1XCGB 1KEUA 3D2BA 3L04A 3QUAA 3R09A 5E7QA 2X8LA 3ZZTA 4F86A 3K53A 2XDQB 3V1UA 2V6IA 2ES4A 2PX3A 4QREA 4BO1A 4CWAA 1QP7A 2VJPA 1HLPA 1JQEA 1L9KA 1NBIA 2O1WA 4R2MA 1W19A 2A9KA 4AMVA 3WAJA 4FFSA 3MTEA 3OJEA 1P2BA 2CXOA 3G49A 4REQB 5CK4A 3UC5A 1XVTA 1SC3A 2JATA 1IXKA 3G0DA 1QQTA 1YOBA 2I65A 1WPGA 4FX5A 3QVMA 4BNDB 5EJ5A 5IVDA 4N0QA 4N3GA 1HPLA 1L4HA 4IINA 1PX0A 3DMFA 1HKUA 3NC1C 3JQ7B 3JD4A 4HDMB 4FFBA 4NECA 3RC8A 1UANA 2ZU6A 2HB6A 5FTMA 2NM0A 1UBGA 2Z5GA 3EGXB 4KE7A 5F2KA 1NR1A 2H4YA 4ZAZA 3QOYA 1D1QA 5K6AC 4HG2A 4NBTA 5MN4A 3KO8A 1A1SA 1BS9A 1OT3A 2XZLA 3PJFA 4OHYA 1KVSA 1J1ZA 2JC3A 3GJRA 5FPPA 1C8KA 1KEEB 4KR7A 2CNKA 3P32A 4PY2A 5J23A 3FYUC 3HB4X 4R3UC 2HR1A 1ZHHA 3N86A 3KXPA 1K06A 3LUCA 4R3NA 4EUHA 4BWGA 1E9SA 2HGZA 3A27A 1TO2E 1T6YA 2Z98A 1JZSA 3CN7A 3GBPA 1M0TA 4II3A 2C82A 3BGIA 4K88A 1QFJA 1S6YA 4EB3A 1ADFA 2I55A 2VJAA 2ZVJA 2QRMA 4HWPA 3OO1A 1YGYA 4I4NA 2PWZA 4JJKA 2CXSA 3Q5GA 1QGZA 1E1QA 3OQIB 3ADCA 2C8JA 1AB6A 4M1QA 3IQXA 1EDZA 5KX5A 1QRTA 2R1TB 2DFNA 2OK8A 1RJ9B 3DVLA 3GQBA 4URZR 2NUTA 2B8TA 2WW8A 3FPHA 3QEAZ 2Z6UA 4IKOA 4TYQA 1VJCA 1T13A 2JAPA 4ZHSA 1RLJA 5BWOA 1DAPA 1M72A 2JFQA 4IJVA 1N77A 4GXTA 1JXMA 1LLQA 2AFHE 2QX4A 3GMTA 3NWJA 4EECA 4MKIA 1C5KA 1OWLA 2XYGA 2AE2A 2PAAA 5ETJA 3WZMA 1N8NA 4BNYA 1IQRA 2LWIA 5DM60 2QD1A 4ZVLA 5BXQC 1GG5A 1M9NA 1T5BA 4B7ZA 3R3XA 1W7AA 1KI8A 3D02A 3F90A 5EXPA 1RWNA 4L08A 1RWWA 4DUPA 2PWAA 2XLBA 3NO4A 4O3MA 3D0KA 4DJAA 3EH1A 1HMYA 3HDYA 3L0OA 1P2FA 2PKCA 1N2HA 2V6FA 4NBKA 5ALDA 2B3TA 4JNKA 2JDIA 4OKNA 4KXLA 2K4MA 5CB4A 4LGVA 5BQPA 2P5SA 3IJPA 4I3HA 4EHJA 4HVAA 4AECA 4II2A 3E9RA 5CW1A 4PAMA 3UWDA 3P5SA 1XYGA 3PDIB 3AR8A 5DNEA 3DLIA 1Z16A 4J0FA 1O6BA 4URWR 4EF6A 3F3SA 3CVWA 2AC4A 3VR6H 4O2BA 1GNQA 2FP4A 2IU0A 4ZJPA 3FHOA 3I52A 1W49A 3WMWA 1P4RA 1PT8A 1AZTA 4UPDA 1NHGA 3AIMA 4ZQIA 2OKGA 1KOLA 4DCMA 4ZZ2A 2BMFA 3FBWA 4RGBA 5EINA 4L4UA 2RDMA 4DV2B 2HKIA 2JJ2D 4CVNA 4N6GA 5A0TA 2XGMA 4NBUA 3RSCA 1KBQA 3UF0A 2YVQA 2WWVD 4D8VA 4MA4A 2I4LA 1R6TA 3IH5A 3IO5A 3CR7A 3OKAA 4Q1EA 4WLEA 4WUVA 2V7PA 2O2HA 3IIKA 4JN6B 2BIFA 2HHJA 3OQJA 4CFYA 3DSRA 1SXGA 4A0QA 4K2AA 3M4YA 2B4KA 2XVXA 5FUYA 2WTUA 3CNHA 1IVYA 1TCAA 3EA0A 3IAFA 2XEDA 4M1OA 2FZKA 4WERA 3UJDA 1C9EA 3VZBA 3EXFA 5FYDA 5J43A 3JAMA 4K05A 2OSVA 2FWNA 1P8AA 1FYEA 2E89A 3L4BA 4PBRA 4XUCA 1JHMA 3CT6A 4TKLA 5B2FA 4YMLA 3MF4A 3AONB 2R6FA 1QIMA 3H5AA 4NYMR 5DBGA 3BD9A 1IAQA 2IA5A 2N42A 3PV0A 2R47A 3V9AA 1NXWA 4UD6A 4RMIA 1I6KA 4O4JB 3FUCA 1G16A 1RQNA 2JIMA 2TMDA 2WE8A 1RKVA 2E4YA 1Y5IA 3K0AB 4E03A 1H9AA 1OAAA 3M82A 4MEBA 1UKAA 3OZRA 3RBVA 2QZPA 4GMHA 5JISA 4H1VA 1ADGA 4X66B 4DDWA 1VKZA 4JU8A 1Z8NA 1D1PA 5IW8A 4JEIA 3TNJA 2WU8A 4GP6A 3KXIA 4EFMA 4TYYA 2OKCA 2PAFA 1O57A 1R74A 2OO5C 5D86A 4TZ0A 1H1LA 3Q11A 4RTOA 4GKJB 2IHBA 1WKBA 1UWLA 4BFWA 3HLYA 1D4OA 1LPBB 2VYNA 4HB3A 2ZI9A 2IH5A 1BCSB 1W4AA 4QGGA 3RUIA 1UMBA 2FSVA 4QEZA 1MJNA 3OUZA 4Q4HA 4ZMSA 2Q8PA 1ORIA 1N0IA 3R3ZA 4K6HA 3VNAA 5ITZB 4D4LA 1R8YA 1JZQA 3G8DA 2P3QA 4W4TA 4E46A 2OORC 2GRUA 3FGPA 3GV0A 1AKWA 1JPVA 4O4LB 3B20A 2MYNA 1QO0A 4QDZA 4XX1A 3LK7A 1QF9A 1C9KA 4CLRA 4M0CA 4D8TA 1AN9A 2HF7A 2HREA 4IIGA 3EZLA 4DHWA 5HX7A 1QK4A 1BFKA 3G79A 1PT6A 1GTRA 1GGEA 2G9QA 1GM5A 1Z2CA 3QTBA 3ZZ1A 2ALJA 2DQKA 4E94A 4LVCA 1FX1A 3DZBA 5T8KC 2HSWA 3SG0A 3FYCA 2Z4TA 2AVNA 1N3IA 4GLFA 7AT1A 4CIBA 2VWQA 1IWPB 1MT0A 4TVOA 2P5TB 4L22A 3PNLA 3NFRA 5FADA 2RHRA 2DQ4A 5FBRB 4V2UA 1U5BA 3UFXB 4AKIA 4BATA 2UUAB 3TXXA 1NASA 2JJ1D 3V2HA 4AJIA 3AV3A 3WGMA 5KQRA 2GB4A 2DC1A 1E1DA 3GPDG 4PNEA 3ADDA 4BASA 4B6JA 4KO8A 2Y6VA 5EKXA 1K7XB 3DD5A 3OJ0A 4C3VA 5IU6A 2CVZA 1N3YA 1NQAO 4ZOLA 1TMGE 4RK6A 1W581 3V7FA 5DPMA 4R40A 2ODQA 4ND5A 2Z09A 2JLVA 1GT6A 3GHHA 5HKBA 3ET4A 4PAQA 1ARZA 1NVEA 3FWZA 3WDKA 1XNGA 2KM1A 1EMDA 4IMIB 4JD5A 3VJMA 4CEIB 4U1RA 5LQRA 1BQ4A 1DU4A 1JLRA 3A10A 3H9GA 4LJRA 5E4JA 2WSSD 4LZWA 1GGJA 5CLFA 1XMVA 3KZOA 4LJ4A 3G1TA 1G8GA 2ARKA 3C3CA 4B34A 2RD2A 1BU5A 1AGNA 1ZNZA 5G4KA 3JY6A 3DHYA 3WL3A 4AG3A 4OG2A 2LZ0A 2W2OA 1CUHA 1E63A 3PNYA 3PS9A 1L4KA 1REQB 3A4IA 1NVVR 3ZX4A 5F2EA 1W4RA 6LDHA 4P08A 2HHHB 2VJKA 1ZGAA 2ATEA 2YWEA 1TZ2A 3I45A 1OBFO 1WIWA 1D04A 2E4UA 3L06A 4D7AA 4EJSC 3SDZA 5JW6A 1J0EA 4TS1A 1Q95A 1I1QB 3HR7A 5IHXA 2HCTA 4DLNA 1TUBA 3EZ7A 3N8HA 3BILA 4PYKA 3HDHA 5EQJB 2BOVA 3ESZA 5TQ2B 4FBMA 5K3AA 3TWOA 3OLWA 2LKCA 4JT4A 1RKBA 4YCDA 3T5BA 1IU9A 4MV8A 4Q7JB 1J0CA 2WIAA 2GF9A 5DP2A 4HGNA 4BFUA 4DCCA 1H4SA 1EGQA 1QE0A 3FPKA 5CVEA 5HF6A 1SEPA 1TCBA 2ZB2A 4ZQHA 2QLMA 1O95C 3COZA 1O0SA 1YCFA 4IIXA 1CY2A 2ISQA 4Y2HA 1R10A 1VLZA 3CHYA 4CNQA 1PR5A 4LNHA 4KN5A 2YXDA 4A16A 3N0TA 4MR8B 3CLSC 1BDMA 1T1RA 1C0EA 2Q7XA 1R0YA 1EFKA 2PSDA 3RJTA 4HQ0A 2ADFA 3OTGA 1EB8A 5FEMA 1ADCA 2H4HA 2NXWA 3D5TA 2I6FA 4IDQA 1Z36A 1S2OA 5EKUA 1K7CA 4G1UC 3AC0A 4KXXA 5AW3A 2G1PA 4B3HA 1IAVA 4P4SB 3HN6A 2V8OA 4JJIA 4A8HA 3WGVA 5KVAA 2PSFA 1W4CA 2CNWA 3ZCVA 2DX7A 3KQVA 4J90A 4KAFA 4YC7A 2YASA 3OTOB 1J2EA 5EQTA 1Y48E 5FA5A 2HH9A 4CL0A 2GESA 3U3RA 4JYCA 2P30A 4NWIA 3KTOA 5CNIA 3AM1A 4XJVA 3CJQA 5EPOA 5UKDA 1FVOA 3DBLA 4M1SA 1V4NA 1T3GA 2OPHA 1RW4A 2Q3EA 1BKDR 3LLVA 3KQQA 1R4MA 4B6GA 1V1RA 1I36A 4XOUA 5CIYA 5FORA 4MUIA 3HZHA 4ZT4A 2FFBA 3SKYA 3LUHA 3TLJA 5TT0A 2YS7A 2CVOA 3H05A 1YZVA 3WBBA 4N54A 1I0IA 4LNUB 4XFDA 3FKSD 2PH3A 1DTWA 1GQFA 2VAMA 4OA5A 3S7TA 3EAQA 4I4TA 4LXTA 3QPUA 3HN2A 3JQPA 1EX1A 4B3FX 5KSYA 4PTZA 1UT8A 1IOZA 4FNOA 1X14A 3H7IA 3UTDA 1CB0A 1T5DX 1JJIA 2O7RA 1EA5A 4KLRA 3W4KA 1CUIA 3SN6A 2NWQA 5IJZA 2YJ4A 5EZYA 5FF9A 4EAQA 1ISRA 3VU9B 2P2CA 1CUXA 5KC9A 1CNMA 3FNEA 4HK4A 4HFJA 1TKCA 2JH8A 3W78A 2G25A 3P26A 1UZAA 2XMZA 2EKQA 3I6BA 3NWBA 2A14A 3EIEA 1E6MA 1XXHE 2F8MA 4GP9A 5CTJA 4R9RA 4XRGA 4LFBB 1XA3A 5JT1A 3PNMA 3WAGA 4DDTA 4UE2A 2IYTA 2NVOA 4R81A 4AMBA 1R6BX 2D5AA 1K3UB 3L7YA 1MC5A 1VCOA 5DMHA 3KAJA 2B1GA 1UAGA 4C01A 2EFHB 2GN6A 2BFBA 4Q4JA 2XNKA 1QUEA 2CKDA 4FGWA 4TLAA 3FDFA 5FO1A 3RVQA 3U3OA 3W9YA 3IMCA 3S55A 1UDBA 1ZU4A 2OM6A 2P2NA 2TRSB 5EJFA 2Q49A 3M1YA 4V1CB 3KYCA 2I0FA 2VTBB 4JJFA 3RJ5A 4JEHA 1BA2A 2W90A 3CWZA 4GSYA 1GJRA 3I32A 1Q2XA 3CCBA 3VX3A 4QLBA 2FK7A 4U7PB 1UJ6A 3QMVA 1PVDA 2QVYX 4HDOB 4AQDA 2XYQA 3W5UA 1C3XA 1GL9B 5K45A 3VUFA 3K1YA 1H2HA 1ZH4A 2J4DA 4IDCA 4XLLA 1PL6A 2CNDA 2WIFA 3NGXA 1V35A 3HI6A 3PVCA 5CFLA 2RAUA 2BKEA 4OQMA 1IEVA 3A4MA 5C35A 5CURA 5B53A 1OH8A 3GMDA 4U7WA 3G89A 1U2GA 3E1KA 4DNOA 1BQ3A 1E6LA 1U7UA 4ISCA 1T9ZA 1YVUA 1OTYA 1G60A 2PQ0A 3ZD9A 3DQQA 1TK3A 4D6YA 5DXAA 1D9ZA 1PHPA 1KO5A 2AZTA 2P4UA 1QU2A 2X14A 3IAAA 4BOYA 2I4IA 3IUJA 3MAJA 3MRSA 4W1SA 5EY5B 4O1MA 3GA7A 5IWAB 3P2YA 4XEUA 3IEIA 2XVMA 4EPRA 2PIDA 3GRAA 3Q6NA 1KMHB 3PQ8A 1GSIA 4WBNF 5HKKD 4JP5A 2YUIA 4KQKA 1Q7GA 4OPMA 5GJWC 1JJBA 1QH8A 1RI4A 5H80A 1YS1X 4E5DA 5EVCA 2YHAA 2C9DA 1JIVA 1PW5A 2A78A 3CNQS 4GMXA 4OQFA 4B84A 5KTPA 4NYIQ 3TAHA 3AM3A 3CVVA 1OH5A 1W35A 1A5ZA 4IZHA 3BMOA 4JP2A 5I9BA 3BX1A 1UXGA 1V39A 3A4NA 3EHDA 3BICA 3NWOA 3VR5D 4MJLA 4WXEA 4ENQA 2R0QC 3K0KA 1FS4A 4IDOA 1F12A 1NXVA 1RABA 4B8ZA 5CAEB 3PG5A 2X1MA 2V3VA 1R0XA 2HFJA 1SXIA 3WYDA 1RE1A 2OM2A 4CTKA 4UAUA 5KCZA 3QTTA 4I9NA 4GX2A 4PZ0A 4ZEXA 2PM8A 3RT9A 1FTYA 3IEMA 2XJ9A 4GX1A 1TT7A 1QP8A 3SYMA 3EJWA 1TX4B 1AUVA 2G8NA 3ZE9A 4HXGA 1AS3A 1RYYA 4YJ2B 2NTEA 4X1IB 2DR2A 5AW2A 1AKRA 1OLUB 3CG4A 3KQSA 5G0SA 3W5HA 1PFYA 3K5HA 5ALGA 3T38A 2J48A 1GKYA 2CLIB 2JCGA 3UGKA 2J6HA 4AIIA 5EJEA 4AY6A 1E3DA 3U7JA 3DOCA 3HDQA 3IMKA 4RF5A 5E95A 1D2RA 2O14A