3E0XA

The crystal structure of a lipase-esterase related protein from clostridium acetobutylicum atcc 824
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
SNAMLHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSMGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFMEKIYHNQLDNNYLLECIGGIDNPLSEKYFETLEKDPDIMINDLIACKLIDLVDNLKNIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
molecule keywords Lipase-esterase related protein
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e0xA00
2XMBA 4FMPA 5CH5A 3YASA 1GPNA 3D3NA 1A88A 3OTQA 5ALZA 3AIKA 4Y2UA 4OU5A 4B0OA 3W2TA 4P08A 3HSSA 3RK4A 4PW0A 4BB0A 3D7RA 1YAHA 3R3ZA 4V2IA 2WIFA 3KDAA 4WY5A 1CUJA 2XMZA 4DSAA 3IUNA 3L1JA 1WB5A 2DSNA 4EBBA 5HKAA 1A8QA 1CVLA 1BE0A 3C6XA 3I2HA 4RE5A 4BVLA 5FV4A 5AK5A 3B5EA 3HC7A 3T4UA 3F98A 1EVEA 1LPBB 4Y9SA 5LZ5A 3R3XA 3WZLA 4WY8A 2JGLA 4N5HX 3C8DA 1Q84A 1G42A 5D6OA 4J3JA 3FAKA 3AIOA 2HU5A 4Q3LA 1CUGA 2VTVA 5CBKA 1GGVA 1P0PA 2FJ0A 4J0JA 1WOMA 2ORYA 2PSDA 3HLKA 4BCBA 1UT6A 1TCBA 1VA5A 1UK7A 3OG9A 3WWDA 5ESRA 5AH0A 1AURA 5LYYA 3JYHA 3G9UA 2H7CA 4H7IA 4LXGA 1Z68A 4XX1A 4X6UA 4C87A 2IX9A 3I2GA 1CLEA 3K6KA 2H7YA 4E14A 1ODCA 2P8SA 4KAFA 4Y2VA 3U0VA 3I6ZA 5ALQA 5HF6A 2XUKA 3B3QA 2OPHA 2HFKA 1CUVA 5HF8A 3WKDA 3WWOA 2BJHA 1GXSA 1XRQA 2XDWA 1MAAA 4B81A 3W04A 4DNQA 4C89A 1UWCA 1YA8A 1GKKA 3A2MA 4IO0A 3DD5A 1XLVA 1QIKA 1FFCA 2VJAA 4U2BA 5EIHA 4PSDA 3SWWA 2OGSA 3VDXA 5ALSA 1JT2A 5JAPA 1TIBA 2AJ8A 2V9ZA 4JNCA 1E5TA 4BAUA 1LPPA 1SC9A 4DNFA 4AN1A 4G8CA 1QGED 4UBMA 3C6BA 1MT3A 4QA9A 1QIMA 4TVKA 4YPVA 1EXWA 1EDDA 3Q8WA 2XQIA 1CEXA 2RGUA 3CN9A 2QVBA 2XMGA 3A70A 4FNMA 3U1TA 1XROA 3FVRA 2Z5GA 4ITVA 1Q83A 1B41A 1TQHA 1VXRA 4WCVA 5C81A 1B6GA 5AKJA 3BF7A 2HA7A 2XUGA 1ISPA 1H2XA 4OYYA 3IBTA 3I2JA 4Y2PA 3I2FA 4L3WA 3R40A 2Z8XA 3HI4A 2EEPA 3H2HA 1VZ3A 3KSRA 2O7RA 2BGRA 1GQSA 3SK0A 2HRQA 3SX4A 1JI3A 2GZSA 1J06A 2HIHA 1E8DA 4GWLA 3ANTA 3EQ8A 5AICA 5AM5A 5JARA 4G4GA 2PUHA 2ZSIA 1CUFA 1F6WA 2WIDA 5ALFA 4NS4A 3EQ7A 4HZGA 2PVSA 5JIBA 3G8YA 1Q0RA 3FNBA 3S8YA 5DNVA 3KWFA 2QUAA 3C6ZA 1ZI8A 3G9TA 3X3HA 2BKLA 4X93A 1LNSA 4W1PA 1IUPA 4GDMA 1XZAA 5KREA 4OD0A 4FLFA 5AI5A 1LZLA 2WUFA 1LPMA 4UBNA 4E46A 3GELA 3I6YA 2WTNA 1ZJ5A 3WK9A 1U2EA 5LKRA 3G9XA 3STUA 4B84A 2QUBA 2CKMA 5KBYA 4GHWA 4B0PA 4FHZA 2XUIA 3WKEA 2QKYA 5D3KA 4H7DA 3UMJA 4O08A 2VJBA 3MGAA 4BZWA 5CRIA 4EY4A 1LPOA 2GBIA 4K6KA 1CUYA 1X70A 2WJ6A 2XMDA 4DLNA 5AK3A 2W6CX 4E15A 4X6XA 3IB3A 1T4MA 2OG1A 1BEZA 1QIJA 2EDAA 1CUAA 3DKKA 1WHSA 1F8UA 5ALRA 3WJ2A 2HA6A 1ZI9A 4BC1A 5CXXA 2R11A 4LYDA 4BTVA 2HADA 2X76A 4AXBA 2O2GA 4GEGA 2I3DA 1EK1A 3HXKA 1EK2A 4UHFA 1EDEA 4CIBA 2ZVDA 2WJ4A 4INZA 1XZGA 3AJAA 1K5PA 4H18A 4H7FA 3FOBA 2BCEA 1XZDA 3DL4A 1UZAA 4BE4A 1XKLA 1GPLA 3WIOA 1AGYA 5CH3A 4MEAA 2WUEA 2YXPX 3PUHA 5ALWA 2V96A 3R3VA 2VT7A 3EBLA 5ALYA 2FX5A 5ALIA 1N8SA 2UZ0A 4H7EA 5JZBA 1WB6A 3BL8A 4UBKA 5JZ9A 2VATA 3G0DA 5A7GA 2D5LA 1L7QA 4HXGA 3BJMA 1XLUA 4FOLA 4MEBA 3F97A 2CJPA 3WI7A 2QRUA 2WFZA 2HRRA 4X94A 5CT8A 3DOHA 3QYJA 1MNQA 2JGMA 3RARA 1NU6A 4MYDA 3ESCA 4UFNA 1TRHA 2XMCA 4QWWA 4CI9A 3ZWQA 3VKFA 2VSQA 2PSHA 3FYTA 3STTA 1S8OA 3I1IA 3W9BA 5H3HA 5SYNA 3ICWA 3WKAA 2RHWA 2JGIA 2CEKA 2JF0A 5ALPA 2XMQA 2HL6A 3CXUA 1JJBA 4CG3A 3RLIA 5ALDA 2XI4A 3GUUA 2JGEA 3LIIA 5AM0A 1KEZA 4F0JA 1TKRA 3ESBA 5AK6A 3F9CA 1E66A 3H19A 2Y2UA 5JAOA 1XRLA 2XUOA 3O4JA 1CUEA 3FSGA 4RNCA 4ZV9A 4G9EA 2DHCA 4J0KA 3F96A 1ZOIA 2WQZA 4G5XA 4CCYA 4LYEA 2HFJA 4RE6A 1Y7HA 1G5FA 1L7RA 1HDEA 4AMZA 1UK9A 3O95A 3EF3A 3PFCA 5HF9A 4QDXA 4U2FA 3PFBA 5A2GA 3OPMA 4DIUA 2OAEA 4L0CA 4H0CA 3LP5A 4H7KA 2O7VA 1DX4A 2OXEA 1T2NA 4HS9A 4HTAA 5ALNA 5AOAA 4B9AA 4DTCA 1E89A 3D2BA 1K63A 4QNNA 5E4YA 1LZKA 1UOPA 1YS2X 3UUFA 3QPDA 5CTAA 2RHTA 3V1KA 4M0EA 3AZQA 5AIBA 2X5XA 2PL5A 4GBGA 4KEAA 3ZLTA 5HQ3B 5LLSA 4FFVA 1UK6A 4MXDA 2WFMA 5HK9A 2DCMA 5DYYA 4K6HA 2ZSHA 3D4LA 5A7HA 3G02A 2QJRA 1VE7A 5HZGA 3STWA 5HFAA 5FRDA 4EY6A 4C01A 4P9NA 4BDTA 1H2ZA 4BP9A 1XLWA 4WFKA 1IVYA 3DEAA 4IHAA 3PF9A 5HKBA 5BOVA 5JATA 1DWQA 2OCKA 1C7JA 3M81A 1RWQA 2RIPA 4DGQA 1CIJA 5AK4A 1QZ3A 2C0QA 1LPAB 2DHDA 2V97A 5K3FB 2WSLA 3QMMA 1QFMA 5YASA 5LP1A 3A2NA 3P2MA 5A7FA 3FLBA 4EY7A 1N1MA 2H9YA 2XLBA 4YK7A 4C4YA 1UKAA 3HRHA 2XQKA 1HLGA 2V98A 3ZI7A 4G8DA 4P92A 1Y37A 1YS1X 2ACKA 1SCKA 5CT4A 4J0GA 4AMYA 5C8XA 2XT0A 3HYSA 4AN0A 1BS9A 1CUBA 5IKXA 5AIAA 5AO9A 4Q05A 2XUHA 1X2EA 2GYWA 1ORWA 4AO6A 5CT9A 4DNPA 4EY5A 3R3UA 1WCYA 5I8PA 3BDVA 4BYMA 3G0CA 1QO9A 5AI6A 2PU5A 4BCDA 2ZJ7A 3HZOA 4F5ZA 1EI9A 4JUIA 1WHTA 4EZIA 3C5WP 1P0MA 4UFOA 2HDWA 2X8BA 1Q0ZA 1P0QA 4GI1A 1GPKA 5DTJA 5KWJA 5LZ8A 3C45A 5C8VA 2GBCA 5DJ5A 2B61A 3WK8A 5FDFA 3VJLA 4IQ4A 5DYTA 2AJCA 3LS2A 3GA7A 1MX1A 2CBGA 5ALUA 2Y2VA 2D0DA 4BBZA 4NVRA 2QXUA 3WK4A 4Y2RA 2XMSA 2C7BA 2OGZA 1BCRA 4C4XA 2RI6A 3W9UA 1LBTA 4Y2QA 3BXPA 4L72A 3NOXA 5IVIA 1MNAA 5EFZA 1J07A 5T4EA 3L1HA 4AO7A 1U65A 4BTLA 1SCIA 4UUQA 4UHDA 5HCUA 2CB9A 1QIHA 2IIVA 1RYYA 5E2IA 4BCCA 4W1QA 2YH2A 3Q0TA 1BCSA 5K3DA 4B9EA 5FKJA 3O9MA 2OQIA 3AIMA 2DFPA 3V9AA 3FBWA 3F67A 4QZVA 4KE6A 4B83A 2QJWA 1C7IA 5K3EA 5LZ2A 3I28A 3GFFA 2ACEA 3RM3A 1ZGCA 3D0KA 4CG1A 5E4JA 3FYUC 4AZ3A 4W1SA 3DQZA 1DT5A 5DLPA 4IH9A 4F60A 3WKBA 3QPAA 5JD5A 4S0XA 4KE8A 5EHZA 1UXOA 4FTWA 4G1FA 1E3QA 4U2EA 2OQVA 5AI8A 4FDMA 3WWCA 4BRZA 5JASA 3WYDA 3AILA 3LIPA 4LXIA 3ZV7A 3CCBA 1XQVA 4C4ZA 2I3ZA 1DWPA 1K4YA 2WTMA 1H23A 2DR0A 1XZKA 1JKMA 3C6YA 5ALHA 5HF5A 3FCXA 4B80A 4KR0A 4Q3KA 3WL7A 2ZJ6A 1HBJA 1LPNA 4X7BA 3LLCA 1QIIA 3G0GA 5FOQA 5LZ9A 5AJHA 3DCNA 5JAHA 4ZREA 3VVMA 4MQMA 4OB7A 1QE3A 5AKIA 1L7AA 2JBWA 4D9JA 4YASA 2VJCA 4QDTA 1UOOA 1XZIA 4FLMA 1Y7IA 2HHAA 1QIDA 2XUAA 3G9ZA 1CUWA 5DYWA 1YCDA 3OC0A 4DNOA 4Q3OA 3VVLA 3TEJA 2B20A 3K9BA 1FFDA 2PKYX 4DMFA 1IUNA 4W9RA 5D3ZA 2JEZA 1HQDA 4LIPD 4GLBA 5K3CA 5ALGA 4N5IX 1MX9A 5J3JA 4Q1VA 4G8BA 4TPKA 2WG0A 2Q0XA 4RPCA 3HJUA 1R88A 2OLEA 4CCWA 4ZV7A 1JMKC 4PV7A 4OB8A 3QH4A 1YA4A 2HU8A 3C87A 2JGFA 2ONCA 4ARBA 1YR2A 5AKEA 3GBSA 1CQWA 4ROTA 1UOQA 4QDUA 1QOZA 4Y2SA 4WDRA 1HL7A 3QITA 3STXA 4DSZA 3IVMA 1LBSA 4KAAA 5LZ7A 4WJLA 2H7XA 1ODSA 3DDUA 3WKCA 2XUFA 3WYNA 5LIPA 4OU4A 1IMJA 2XUQA 3FVTA 4QLAA 4PNZA 4KRXA 4A23A 4DYHA 3FYUA 1N5RA 2AJBA 4KE7A 2HA0A 1IZ7A 3MVEA 2XB6A 1MO2A 1MN6A 3AINA 5K3AA 3K2IA 4J0DA 1EA5A 3WA6A 4X97A 1PFQA 1W52X 1XZFA 3DYIA 4FBLA 4QEKA 4JEIA 2XUPA 2WFLB 5EHNA 3M3DA 4C6HA 5AKLA 1AX9A 3D2CA 5CURA 1ZI6A 4I4CA 3I6MA 3STVA 3VJMA 5IVHA 4JH0A 1VE6A 1DQYA 5AP9A 2DQYA 1ORVA 4X3CA 1BN7A 1EX9A 3FLAA 3H2KA 1OXMA 4PQEA 2HU7A 5BWBA 1AQLA 3D5EA 3QM1A 1AZWA 4EA6A 4C88A 1N5MA 3IULA 3VXKA 3WK7A 4G4IA 2QR5A 2VT6A 3R3WA 4W1RA 3D2AA 1M33A 4B82A 3A2LA 1A7UA 1XQYA 1ZD2P 3KD2A 4DMCA 5EIEA 3N0TA 1QLWA 4OPMA 1DWOA 1GZ7A 1JJFA 3G0BA 2H1IA 4QLOA 3FCYA 4GECA 3WIBA 4UFPA 3NGMA 4BVKA 4OYLA 1QO7A 3E0XA 4QDZA 1WB4A 1ZD4A 2C5FA 1AUOA 2WFLA 2I78A 5AKKA 3WLAA 1EHYA 4G9GA 2QS9A 1U4NA 4J0IA 3WWPA 4DM7A 5JYCA 5EHQA 2JEYA 4A16A 3WA7A 4W63A 3VISA 1R1DA 5A71A 3DL7A 2XUJA 3G0IA 1XQXA 4KYVA 5FPPA 2PSJA 3DS8A 1W1IA 1ACJA 1W75A 1XRMA 4B7ZA 1IUOA 5HK8A 3VJKA 1JU3A 4OSEA 3IIIA 4E11A 5AHXA 5T4FA 1G66A 4OCZA 4Y2TA 5DNUA 4BC0A 5AM3A 4HXFB 3H1BA 4KRYA 5FXMA 2XQJA 3ANSA 3R41A 4X85A 1CV2A 2GBFA 2OCGA 3PI6A 2CUTA 2G5TA 3PUIA 2WG1A 2WHPA 1BROA 1NX9A 4I19A 2QOEA 2RONA 2ZYRA 1R3DA 1DTEA 3CN7A 2WHRA 3FSGD 3H2JA 4ARAA 3CCCA 1XQWA 3C8HA 1VXOA 1CUHA 1ODTC 4M0MA 5EGNA 5I7UA 4EB0A 3DJYA 1FFBA 3UUEA 5A62A 5ALLA 4PSCA 5CXUA 2WU3A 1ZGBA 2HA3A 4U2DA 1XRNA 3BJRA 5ALVA 1HKHA 1FSSA 2R8BA 1GQRA 1TCCA 1R4ZA 1NU8A 4U2GA 4X71A 1CUZA 2J4CA 5LZ4A 2FJPA 1ZD3A 3IA2A 3ZPXA 3D59A 2JIDA 4HRXA 2Z8ZA 2ZYSA 2G63A 1YB7A 2YASA 1YAJA 4HXEB 3V1LA 1THTA 4IH1A 4MWSA 4RGYA 5CT6A 2CZQA 4N8SA 4XWGA 5IVKA 5EI5A 5BV7A 4MYSA 3OOSA 3H2GA 4LHEA 1MTZA 1R50A 1XZHA 1DINA 2ZYIA 3TGLA 3DYVA 1LPSA 3HACA 5T4BA 1ZIXA 3DLTA 4X00A 4FLEA 1CUSA 1W76A 1XZJA 3EIOA 4Q82A 1CUXA 4F21A 2Y6VA 1XKTA 3H1AA 2PUJA 4EHBA 4NMWA 5AOBA 2WHPB 3O9VA 5DWDA 3WZMA 2PM8A 1VKHA 3C70A 2J3DA 1EB9A 4G4JA 1O6GA 5ALJA 1XZLA 4HRYA 2C58A 4EUSA 3M83A 4XIIA 2BAGA 1F0PA 2QZPA 1W4LA 3T52A 1J2EA 4P93A 4N8EA 5HFNA 5LKAA 1CRLA 1K8QA 3H2IA 4CFSA 4X90A 3BWXA 4L9AA 3V1NA 1QIEA 2WU4A 3QMWA 1GKLA 3AFIA 3KWJA 5DNWA 2YYSA 1OILA 4OUKX 4FNGA 3RKSA 3GZJA 2VQ6A 3R3YA 5E4TA 2WIJA 3O4GA 1YB6A 1DQZA 1WPXA 1YASA 2EDCA 5CT5A 3HABA 4KJXA 1VA4A 4ETWA 3PE6A 1KU6A 4A5SA 3O0DA 1JJIA 4AQDA 4X92A 5AKGA 1TAHA 1OCEA 4FBMA 2I03A 1LLFA 2G5PA 3DOIA 4ZGBA 3IUJA 3TJMA 5ISMA 3JWEA 2GYUA 4JYMA 4UBOA 3S2ZA 4BDSA 3L1IA 3IURA 4QWMA 1ZD5A 4PO3X 3FLEA 1U8EA 2C4HA 3WK5A 1CUCA 2JGKA 4B85A 3E1GA 1HPLA 3H04A 3ILSA 2K2QB 1THGA 2PPLA 3F8SA 1D07A 3KOOA 1ACLA 4K5QA 4H77A 5ALMA 1H2WA 3IDAA 2C0PA 3EQ9A 4Y2YA 4EY8A 1BRTA 4PSUA 4AZ0A 4X91A 2QTBA 3STYA 1IZ8A 5AI0A 4BE9A 5JZSA 2WIGA 1QIFA 4XJVA 1CFJA 2XLCA 4J0HA 5JANA 1TK3A 2HM7A 2PBLA 2BUCA 2VA9A 3B12A 1E8NA 4UHHA 1SOMA 2WUDA 1XRRA 5AM4A 1TCAA 4B6GA 2Y1KA 4LKOA 1JFRA 1XZMA 2VEOA 4AX4A 2GYVA 1JMYA 4UHBA 2XQFA 2OGTA 3ZLUA 5FLKA 1PJAA 4DMKA 1SCQA 2ZYHA 1VJ5A 2OCIA 1F0NA 5JD4A 1UFOA 3ESAA 1XZBA 5ALTA 2JGJA 5AKZA 1BU8A 4I3FA 2VAXA 5AKXA 5AKHA 2OCLA 1QTRA 4BP8A 1AC5A 5F4ZA 2HA2A 5DTIA 1CR6A 1QFSA 5AM2A 3H18A 5K5EA 4LXHA 2HA5A 3PF8A 4QE3A 5ALOA 3HEAA 1FJ2A 2HA4A 3IUQA 4J7AA 3NUZA 1J1IA 4H7HA 3M82A 4Y2JA 3WK6A 3O4IA 4KACA 1QIGA 1XZEA 3A6ZA 2FUKA 2B4KA 2OAGA 4Y7DA 5C8ZA 3WL5A 5CH8A 1XRPA 2G4LA 3GROA 4NZZA 3PDCA 2W22A 3H17A 3KXPA 3I1YA 4UHCA 1FFEA 3QVMA 2Z3ZA 4UBIA 5K3FA 1W6RA 1DT3A 3WQHA 1EVQA 2ROQA 5ALKA 1H2YA 4FWBA 2VF2A 3MUOA 1RP1A 2AJLI 5KWIA 5CW2A 4U2CA 4Z49A 2XQGA 2C5GA 2GZRA 1CUIA 4WDQA 1E8MA 5I9IA 5JALA 5ALEA 1ZIYA 3R0VA 3WMRA 3E4DA 3E3AA 5SYMA 2BUBA 1BEEA 3NWOA 1UKCA 3ZLVA 4BRSA 1MJ5A 2ECFA 3FWHA 1MAHA 2BFNA 4ZWNA 3FYUB 2WILA 1CUDA 3BF8A 4H35A 3O4HA 4GW3A 2WG2A 4YX9A 2WUGA 4K6GA 4TGLA 1VOTA 4H7JA 2BUAA 1QJ4A 4CCYB 2QXTA 4UHEA 1O6FA 3WL8A 4BVJA 1WM1A 1UKBA 2PSFA 4M0FA 3IUMA 3G7NA 1EDBA 4BAGA 4FKBA 4CIAA 5ALXA 3DKRA 1QTIA 2WKWA 3W05A 5HQ3A 4X95A 1VLQA 3V1MA 5BWCA 4HAIA 5JADA 2IITA 5A6VA 2LIPA 2NW6A 2ZJFA 1WPRA 3I2KA 1VZ2A 3V48A 1EINA 4WFJA 1CUUA 4ZRDA 4GXNA 1UK8A 4BZZA 4JYPA 1SFRA 5AOCA 4J03A 1ZJ4A 3TRDA 3ED1A 2VAVA 3AZPA 1YSCA 2QM0A 4HVTA 4J0CA 1X2BA 3H0CA 3C5VA 2Y6UA 3DNMA 2VJDA 7YASA 4KE9A 3C43A 1K6EA 2XE4A 1EH5A 5FPQA 2XMRA 3QMVA 2WHQA 4UPDA 5C7YA 2DHEA 4UBLA 5K3BA 4XVCA 2B9VA 2PX6A 4K2AA 5EIAA 2J4FA 4KAJA 2WLSA 1CQZA 2PU7A 4OB6A 1H22A 5AI4A 4N8DA 5CMLA 3WL6A 4Y2XA 4BATA 5D7BA 1PV1A 3N2ZB 3I2IA 3OURA 5FUMA 2QMQA 2WM2A 1ZICA 3OM8A 4IH4A 1DX6A 3BIXA 3BDIA 4UBJA 3QZUA 5AI9A 2BGNA 1JU4A 1DU4A 1LGYA 1MX5A 2J3QA 3WWEA 2AXEA 5AM1A 3ESDA 2XUDA 5EHXA 3JW8A 3AUKA 1CPYA 1A8SA 4CG2A 5AKYA 3W06A 3SC2A 1QONA 2RAUA 5JAUA 1MU0A 5IH7A 4ZXFA 2QT9A 1C4XA 2E3JA 1AKNA 2GBGA 4ZI5A 1EB8A 1XFDA 2ES4A 5JD6A 1MPXA 4MJ3A 1USWA 2O2HA 4AO8A 1XZCA 4FFWA 4DMHA 5IVDA 3AZOA 1G4HA 5T4HA 3QBJA 1KU0A 2PSEA 1P0IA 4QDOA 3ICVA 3BIWA 6YASA 2WJ3A 1ETHA 4AB1A 3LCRA 4WFIA 1A8UA 3PICA 2DQZA 3MUNA 1FFAA 5FP0A 1BN6A 1R9MA 2CMFA 2AJDA 3QPCA 1AMNA 4MWTA 2Z3WA 4MQLA 4BAZA 4X6YA 4Q34A 1I6WA 3BE8A 4PF1A 3WJ1A 1GT6A 1R9NA 2O2IA 2WIKA
chains in the Genus database with same CATH superfamily
2JA1A 3W79A 5KO2A 4MRAA 3FDJA 3QKRA 5SY6A 3LKBA 3YASA 5CFQA 2O8BB 2H48A 3D3NA 4HOYA 4JLOA 1A88A 5ALZA 1YZQA 3NHAA 4U7WA 1K4MA 4OU5A 2R00C 1RXWA 1K3FA 2V7QD 2JJ2A 4CKXA 4PINA 2XWBF 3FWYA 5JFTA 1ULAA 1NVUQ 3AU8A 4TXJA 3ZKAA 4YCJA 1Z7GA 4B0OA 1UZUA 2QX6A 5JVDB 2GB4A 5JVDF 3THRA 3FBGA 2JCSA 4HGZA 4KG7A 5ELMA 2QWXA 4BB0A 3D7RA 1YAHA 3OEHD 3R3ZA 4A0QA 3AJDA 4ITRC 3DV9A 3R09A 2BMEA 4BLTA 3DXFA 2X23A 1P29A 3BUSA 2IDJA 2R1TB 1EA7A 2XMZA 1PD1A 1Z4LA 2YVAA 4G4SP 3EDYA 1WOYA 2RJNA 2BI4A 3N2GB 5JW6A 3TK1A 4BRWA 2A5FA 3UBMA 2JA2A 1EUDB 3F6PA 1QZXA 2DSNA 2HF2A 3MHPA 4EBBA 4RK1A 3MLEA 4J7CA 3W2IA 3KQKA 1DG9A 1G5HA 1GILA 1A8QA 3NHLA 1FU8A 1H0RA 2INGX 3OBIA 521PA 1KO5A 1ZQ9A 3NM4A 2FF7A 5I7HA 3OF5A 1JHQA 2YXEA 5F9MA 2WMOB 4JAVC 1OY1A 2VDNB 5FBRB 1J23A 4BVLA 5AVYA 2NQ8A 2B78A 3KKMA 3FHTA 5KNBA 3B5EA 3KJNA 3GRYA 1Q0UA 2PUEA 3T4UA 4BX0A 3F98A 4Y6RA 1UWVA 3OEHA 3WGLA 5SZKB 2D0IA 1XVVA 4EGFA 1VSVA 3JQ8B 1E6KA 4BYGA 3QEMB 4DDMA 3MJVA 2AFIA 4L9WA 1J8YF 5DF1A 2Q1UA 1E99A 2NM0A 3ZBUA 3Q87B 1V8PA 4CQJA 5IK2D 3OTHA 3U7FB 4FEEA 4PR3A 3QUCA 2YIMA 4CL2A 1MC1A 2IUYA 2XEDA 4EYQA 3DV0A 1M0SA 3B1JA 3JQ9A 2HK8A 2HU5A 3AIOA 2J3JA 2XDQB 1ACMA 1J99A 4Q6WA 5KOJB 3W7BA 5CBKA 1XV5A 3V7UA 2VRWA 3DW1X 2ZTHA 1T4CA 2FJ0A 3C3KA 4J0JA 1A9RA 3X44A 2EG5A 3ROKA 1D7OA 2DYKA 1WSBA 1UBHS 3DLAA 1CG6A 3JQPA 1BGWA 3DO8A 3NWEA 4N3AA 5GQSA 4FOOA 1NR1A 2I6XA 2NAPA 3LK6A 4LZJA 5EQDA 3IMGA 3B78A 4GZ3A 4M8KA 1IATA 2EIXA 2JD0A 3V4PB 2RH5A 4GXTA 4KSYA 4RHUA 1VA5A 5IYZF 2NVOA 3BK7A 2WT8A 3LZCA 1G21E 3MG9A 2EBHX 5EWMB 5IRCD 4B2YA 4RDIA 3W90A 3I53A 3IQFA 2BT4A 1YRLA 3FNFA 4IDQA 3GLRA 4O4JF 5LYYA 4EI8A 4ZYLA 2QTWB 3LX5A 2H7CA 3NVDA 3Q3HA 3M89A 3UHPA 3PSAA 2VSOA 2Y93A 1VL5A 2H7YA 3A8TA 3K6KA 3Q9SA 4AURA 4E14A 1ODCA 4CKCB 4Y2VA 2W6NA 1JFSA 4TWAA 4WBSA 2I65A 3LY7A 5D2CA 5REQA 3IYLW 1ABFA 5CUQA 2IE0A 1EYZA 4ZI7B 2AQHA 1GEEA 1L4HA 4EA9A 3B3QA 3O3OB 2JFFA 3SYMA 3GH3A 1O5IA 1TD9A 5FNZA 3G5TA 5DBHX 3UATA 5CVEA 2FUNB 2DR3A 3QVXA 2BJHA 3NZEA 5FTKA 3TRFA 3UV6A 4TQUS 1GGEA 3WWOA 2DUWA 2O0MA 1O03A 4Q47A 1QLHA 3HYNA 3QLVA 4JQOA 3ZE9A 3HJHA 3RWBA 1NUUA 1R0LA 4GRIA 3HP1A 4P38A 5CM2Z 1ZNQO 2XZOA 1QPZA 2A59A 2VTKA 1KJJA 1JKIA 2VI5A 1RCFA 2XT6A 1LVGA 3KT6A 4XGRA 4LDAA 3D7KA 4R9SA 4BPBA 3BWEA 4IIDA 2IHUA 4IO0A 4ESEA 3SJUA 3E2MA 1I3NA 5HYVA 4CODB 2AE2A 5EMNA 5LU8A 1PZFA 4NBTA 4Q6BA 4JN6B 5HMMA 4O25A 4CG0A 2E6KA 4PSDA 3NEAA 5BSWA 3KTDA 5IN4A 3QYFA 1P2UA 5CNMA 1JH8A 1GD1O 1Y8ZA 5KCMA 3W6PA 5DSXA 5JAPA 1E5TA 1KY3A 2GEFA 3NJRA 1LPPA 2YXNA 3HCWA 1A95A 3P0HA 1NBHA 1EWYA 1U2PA 3JR3A 3L79A 3ZG6A 4LV8B 4AN1A 2W6JA 3IERA 4UBMA 3F6RA 3E22A 3AVWA 4EB6B 3C7AA 4RESA 1SZDA 1ORDA 4R1LA 3NONA 4KMOA 4OHOA 3WRVA 4A0FA 5IKMA 3G6WA 1SHLA 3Q8WA 2XQIA 3MT9A 2WAXA 4JKOA 1M0TA 2F64A 4D82A 3JZFA 1P6QA 1C7QA 2RGUA 4G09A 4Q3AA 3A6LA 4RHCA 2XMGA 5AD1A 3ETNA 4H0FA 2P9JA 3FGNA 3RVKA 1XROA 4M4SA 1YI1A 1OX4B 1ULUA 3EJWA 4NHEA 4TM8A 1S2GA 4LJ5A 5EYPA 3UK2A 1ODIA 2FJUA 4TTPA 2YJ5A 3WGHA 1GGJA 3E3LA 1Q83A 4EAAA 3HWSA 5EY5B 1ADGA 3B9RA 1AMUA 1OR8A 4G0UA 5HBRA 3PB3A 3PJGA 4KI7A 1VXRA 1TMGE 1FA9A 2JGRA 5GP1A 4EJ6A 5K0JA 1JSLA 4HNSA 3T0GA 1B6GA 3LV8A 2HA7A 2ID7A 2JAXA 2JCXA 1ISPA 2QLTA 3AEKA 4UEKA 1E7MA 1H2XA 4OYYA 1A7AA 3RIYA 5CK5A 4BGEA 1VPLA 1Y80A 4ESOA 2ZRBA 2WIAA 4XTCS 3ZE0B 4CBVA 4DE5A 2E9SA 3SFTA 1HI9A 3D54D 1JE0A 4RKEA 2PO5A 5DNAA 1CDZA 2Y68A 4KPGA 4L6IA 3KM0A 5IYZB 1SKAA 4NSNA 3JTEA 3NHPA 3MMNA 2IHNA 5CTJA 4I1OA 1II8A 2JDIA 3QKSB 2HTFA 2HUPA 3GN2A 5FO1A 1UJCA 4HB3A 5PNTA 5BV0A 3FGOA 4ENTA 1N9GA 3WRYA 3SX4A 1I3KA 4M0PA 4KMRA 3LQ2A 3JRNA 2GZSA 2Q29A 1AO0A 2WF6A 2FVYA 1U9IA 3DNPA 3VYTB 1GPJA 2WF7A 4XI9A 2PWPA 3EXFB 4E5YA 1E9RA 5TF4A 2O2SA 3VSAA 2C7OA 1L4MA 4C5CA 3ISJA 2ZIXA 4EI9A 1YHZA 2ZSIA 2AN3A 1RNLA 2WD7A 2JH3A 1ISMA 1PK9A 1Q1AA 4ZAGA 4B35A 2FXVA 1YVRA 2WIDA 3ZI0A 3WYCA 4NS4A 4NCKA 3EQ7A 4PRKA 3KPUA 1JFFA 4OJMX 5JIBA 5CGQB 2O5EA 3T99A 3AV3A 3EW9A 3E18A 1QF9A 4PGFA 3S8YA 3VTKA 3J81k 4LQLA 4D9KA 1IM5A 1P9LA 1REQA 2I7CA 2PR2A 2R1ZA 2WMDA 1N5OX 2ZAOA 3S2UA 1JIKA 1T1IA 3CTPA 2P77A 3PKIA 3M49A 4P3YA 3M5CA 3NAZA 3IOEA 5JG7A 5T64A 2QUAA 3G1UA 1X3LA 1F2UB 4MUNA 5H59A 4D3DA 1KI6A 1OLOA 2D00A 4P0TA 2BEKA 4RQUA 4P98A 5KTNA 2VYQA 4LDJA 3BBPA 2QAGC 5L3QB 1HE1C 3FNHA 2ZIXB 2JFYA 3G9TA 3HB0A 3EC7A 2ATCA 1SXJD 1R6DA 2QLJA 3MJFA 3N5KA 3X3HA 7MHTA 1V5FA 2QMOA 4B47A 1S9DA 1UJBA 3CFYA 4JA0A 3TNDA 3JZMA 1MEEA 1U6IA 1IUPA 5LXTA 5KREA 1XZAA 4QOIA 1JT9A 3PDJA 4OD0A 5H8WA 4GPIB 1LZLA 3IO5A 1Q16A 2WUFA 3D02A 1Z17A 2EFHB 1KEEA 1LPMA 1XZPA 3IJRA 4E46A 1KBOA 1MVOA 1Y1LA 4ZVUA 3JRWA 2QZ4A 4JOQA 4P4LA 1JLKA 1P8AA 2W8ZA 3FE2A 5F5XA 1KIAA 3VVBA 4ZOQI 4HQRA 3UW1A 3G9XA 3OFJA 4MV5A 3ES9A 4D8YA 4EF6A 5LQDA 2QUBA 3KBOA 4X64B 3G9QA 1FU4A 1XP8A 3NAMA 4K46A 4FHZA 4CMIA 3A1WA 1QP0A 5E9AA 3EK2A 1BX1A 3CR8A 1QGYA 2I3BA 2OD7A 1H94A 1ZSVA 3LBFA 3L4EA 1G1MA 2XVAA 1CJBA 4P81A 2Z09A 4O08A 1RYFA 4BZWA 5CRIA 4KMMA 4YMTA 4R1SA 1K06A 2X3UA 3DP9A 3OJ0A 3GWGA 4MDYA 2O3SA 5E1DA 5HRCA 2IS2A 1Z0UA 1NFRA 3UIEA 1JL3A 1P91A 5J9FA 5IMSA 1O8BA 1SURA 1UPAA 1REQB 2HCBA 2R751 4KXNA 4ND7A 5GM2A 4DC9A 4TS3A 1O3YA 4EKYA 5CIYA 2GBIA 4RVSA 3C3YA 4DLNA 2PNFA 4QFDA 4JEMA 4L0DA 4NMLA 4E15A 2HXSA 4NOMA 2JKVA 1W5AA 1P75A 1M1NA 5I6DA 5DGIA 1U80A 1WCWA 4OO3A 1Z2DA 3EXHA 1YR3A 4AMVA 4XRRA 5BN5A 3I61A 2H9IA 3K4QA 3ETLA 4FIDA 5EE1A 1QRDA 3DKKA 3M70A 4LZOA 4MQBA 3U3XA 1N6HA 1GRRA 4DA4A 3ZWAA 2FSPA 4FN4A 4FEGA 2TMYA 1F2TA 2XNDD 5FUVA 3V9PA 3Q4GA 1DFIA 4LG1A 1U5BB 4QULA 4YVFA 1CZHA 4P32A 5CXXA 5DOVA 3VSDA 5LJLA 3DHEA 1EK5A 4LYDA 4BTVA 2ICAA 2VJMA 1JIQA 2X76A 3X2SA 4GZLA 4AK9A 3R0XA 5JXIA 1SCDA 3AT1A 2R4QA 2PMFA 1Y9ZA 4GEGA 3T9FA 1YQ9A 2YQZA 2JAHA 2C7VA 3D6UA 2PX4A 1EK2A 2WSIA 1O95C 3AR7A 4UHFA 4DLZA 4RTQA 4RMIA 1PS8A 5TMBA 1SB8A 4FGUA 3U3RA 3EIQA 1S5PA 1XGKA 2PJZA 1BMTA 1XZGA 1UADA 2X42A 3BS4A 3NANA 4D8VA 4EG0A 1QAOA 1KORA 2OFXA 4H18A 4MYRA 2V6JA 1I5EA 2VK2A 3C41J 2QU8A 3QA9A 5EXSA 2BCEA 3A6JA 1TYAE 3RC7A 1TTPB 3B1FA 3CZRA 1ZCFA 1F3OA 3H0EA 4GXQA 5J2TF 4WADA 3SEFA 2EEZA 1D1QA 2XQVA 1YDFA 4LMPA 5KVQA 2ZCVA 3BQMB 1DXHA 3R5KA 5C80A 5C8YA 1DCTA 4K86A 1CERA 1N2IA 2HMVA 4GE3A 4W5HA 4JP5A 4PLPA 4A2WA 3WAKA 2WUEA 4QYMA 2NOAA 2RB5A 3NHKA 4CDNA 1QF6A 4KPUA 3MOGA 4ZK2A 2P9EA 1X77A 4MICA 5I9LA 4O2BA 1NBIA 3R3VA 1E4EB 1FK8A 5AVZA 2ZUUA 3OJCA 1JZQA 5EJ2A 3SFZA 4R7ZA 2FLKA 3DVSX 5FBWB 3QWAA 1EIWA 1G6HA 2X14A 2C88A 2QTVB 2C92A 4DV5B 2GM4A 1A76A 3FRHA 5EPEA 4RZ3A 1E58A 1DS6A 2FVXA 2RHRA 4RV5A 5ESXA 1WP9A 2PY6A 1XAIA 3ZZMA 2D5LA 2OOKA 4HXGA 4YRQA 4MQFA 4ZT3A 2QRQA 5FA6A 3V7WA 2G06A 3KSMA 4MR7B 3GVXA 1R4MB 3F97A 1MP0A 4ZO8A 3RC1A 5JEEA 4LGCA 1UPFA 2AZDA 4A1FA 3M5PA 3C3JA 2HIMA 3RSOA 4W5QA 3OQOA 3H9BA 3ETCA 3L0YA 5MN6A 4JLWA 3NIFB 1E4EA 1SXJB 3P2EA 3PSHA 3BRWA 4NCJA 5H83A 3KR9A 3VZDA 3ABOB 3EA0A 1MNQA 2JGMA 2BFCB 4UE2A 3RARA 1NU6A 1D0IA 2WTUA 8MHTA 4BO6A 2BKXA 3TLYA 2ET6A 1KH2A 3HPQA 4Z7QB 2GH1A 1B7GO 4QWWA 2GHTA 4UCXA 1W36D 4BN5A 4YT2A 4BB6A 4CMAA 2JL1A 3GUZA 3GMDA 3WHKA 1RI4A 8ADHA 3GFTA 5IT9A 4NBKA 4WAUA 1VDZA 3QHAA 4MR7A 3QSGA 4RA9A 1V8ZA 5JBQA 5K45A 2DETA 3GJ3A 3K1JA 1WV1A 1B2RA 3LL7A 4PHGA 4KXVA 4Q9DA 3SQOA 4AIRA 1N0HA 2HJWA 5ALPA 1DC5A 2QTRA 4YRRA 1J42A 2A6PA 2A9QA 1THMA 2KLBA 3NHFA 3KP1A 4HMQA 3UMBA 1QFXA 3OI7A 5EEHA 4A8JC 2PQ2A 1T9HA 2C1ZA 5ALDA 5D5PA 1M2KA 3AHJA 4BLVA 3GUUA 1QK4A 1M83A 1OFVA 1GDDA 2JKZA 3A6FA 1P73A 3D6TB 2P3OA 4BBAA 1ADCA 2GZMA 2QY9A 1DIGA 2P9YA 2RB4A 3LIIA 5JAQA 4Y2GA 3A05A 3VTAA 4DKXA 3ACCA 4UVEA 4GPD1 1GNTA 4BWGA 1I14A 1TKRA 2L42A 3AJ9A 3OQHA 4ZRMA 2JLXA 4EFNA 3CF6R 3F9CA 2RC5A 3FG9A 2YW2A 3RS9A 4URXR 2E89A 1E66A 2JJ1D 2IX3A 2OV1A 2VP0A 2QL5A 4ND5A 4Y6LA 2JZNA 3CRQA 3SBEA 3ZKWA 1WXQA 2ZIEA 1ZUIA 3ZJVA 4EGQA 1GCAA 3FSGA 3DP7A 3GGOA 1ZJZA 1VBKA 4R2KA 1NVVQ 4HLCA 3RTBA 2H65A 4ACBA 4CNBA 4G9EA 4DLVA 3GDHA 1KRWA 4X1IB 1SZJG 3RHZA 1SBIA 2WQZA 2IELA 2BFCA 3CH5A 1ONNA 3IQXA 3WJ7A 1J8QA 3QW2A 2XHZA 1MIHA 1OWLA 1NW8A 2X7JA 3P2IA 4RE6A 4F91B 5J47A 5L3SB 2YVUA 3RHFA 3PTAA 2QAIA 3HCEA 1J25A 1XYVA 2N42A 4M98A 4ON9A 4YAJA 1A9XB 1UPTA 3ORHA 5C8DA 3I9FA 1Q15A 3WYFA 2E5LB 2E18A 2A2ZA 4H4CA 1BKDR 1GAXA 3ZGLA 2BJWA 4I5FA 3T1YB 2HT6A 2X0DA 3HO1A 2HC9A 3QFHA 5DTMA 1KMCA 3EZ7A 3UJHA 4HRVA 1L3BA 5A2GA 1KJQA 1F7UA 2AOTA 2OAEA 2Q2OA 4H0CA 4LOIA 3TQTA 2O7VA 2W6MA 1NDQA 3J81A 3C7CB 1WE2A 1TQ2A 1N7GA 3CZPA 4DLLA 2Q6VA 2QZJA 4QLBA 4HTAA 5F1YA 4D9IA 2FZ4A 4B9AA 2GFIA 4DTCA 3MAJA 1XVLA 3H1GA 4N4AA 1M1YA 1GR1A 1LZKA 4QXOA 4IOJA 2YYAA 1KPGA 5KSPA 2Z9CA 1DRKA 2BMWA 1GPMA 1WJGA 3MGCA 4MR8A 5F7ZA 3R9KA 3LPCA 1EGQA 3O90A 3P2KA 1V11A 4JIGA 2SCUA 4DQ0A 3QWBA 4M0EA 5ES3A 1I6KA 1A8HA 4FYPA 2GHQA 5J5AA 1N6NA 3CX8A 1KYQA 4NNPA 3RS2A 1JHVA 1LI7A 2QQ5A 13PKA 4KEAA 1JEAA 4ZMBA 3CKKA 4UOQA 5TE9A 1U7WA 1N1EA 4M89A 1MQ9A 2Q2WA 3EZ2A 5DASA 5EERA 1UQUA 4CEIB 2MSNA 2WFMA 4YHBA 5HK9A 2IYTA 5MF6A 2CHEA 1ZP6A 2DCMA 1Z25A 4UC0A 4LS3A 2NXWA 2IOHA 1NW7A 4K6HA 3NTVA 5DYYA 1E0DA 1FFXA 3EGXA 3JYNA 4MKRA 1VHLA 5JSYA 1XTVA 3QTLA 4RDCA 2IYQA 3RU2A 5H81A 4IDPA 1NX6A 1V37A 3ASZA 4OI1A 3F6BX 5JO0A 4PCLA 4DB2A 1NVFA 1TGVA 1J90A 5HFAA 5LUBA 3JQEA 4DEVA 3MCWA 4IS3A 3DBRA 1XWWA 4XE5A 5GVSA 3H4TA 5JEDA 4Q4JA 1RMTA 2C42A 3EN0A 4FK8A 1MJGA 4OQMA 4JWTA 3NQ41 2QW0X 4DLBA 4HAWA 5CBPB 2CXQA 3GO4A 4MIOA 4R2HA 4LF6B 2HO5A 3DEAA 1B6SA 1SUWA 3V00A 1RWMA 5HKBA 2ODPA 5BOVA 5JATA 2F17A 3DCJA 3KHUA 2GN8A 1QH0A 1G2QA 1NUSA 2GXSA 1RWQA 2PN1A 1AQNA 4QC2A 4Q3BA 4DBVO 1P80A 1CIJA 1VIVA 4D81A 1AK1A 1P18A 1RLOA 1NATA 3K9LA 1MIOA 4H59A 4RVOA 3EEOA 1LPAB 1IJKA 4JLJA 1E3WB 4HMPA 2I1WA 3T3NA 3VKGA 2P2NA 5BR7A 2FHSA 5FBQB 5GGYA 2WSLA 3KUDA 3BSFA 4G26A 5LP1A 2QD4A 4B6FA 1NULA 1AHIA 2EZTA 1KDPA 5EMJA 4CKWB 3RGGA 1E2UA 2WNSA 4P4TA 1I4TD 1GPDG 3ABRB 1OPRA 4WECA 4ENUA 3MS2A 2QAGB 3EUWA 2JFWA 4RY2A 2XXJA 2ZRNA 2GHRA 2ASEA 4RMNA 4ZVVA 2WSMA 3Q3IA 1T4DA 2IXDA 2J3IA 4LWZA 4ZT6A 3LDUA 4C4YA 1PL7A 1TVEA 1EQ2A 2G7MC 1C0EA 2IOFA 3ITNA 4WCFC 2ZATA 2DLCX 4F9TA 4DV6B 3U4QB 1YS9A 1Z4OA 2KBFA 3D81A 3FIJA 4TWJA 2UYCA 4Z3KA 4MW0A 1KJYA 2QNBA 4V0KA 2QLNA 3KJFA 3WLKX 2JIRA 4R0MA 4MR9B 2PRKA 3B60A 4K88A 1KR2A 2IXTA 3A4TA 3BH0A 4G8DA 1ND5A 4GVXA 3VKHA 1J2RA 1UC8A 4BIMA 4XEUA 3NAQA 3KQUA 3QQ5A 3EDMA 5ICGA 1YKGA 1FPMA 2ACKA 3MMSA 3NNNA 3S7TA 3TLAA 2ZR8A 4BMOB 5L7YA 4RTLA 3GRPA 1W9HA 3DLIA 4AMYA 1TJPB 4ZICA 1VJDA 4KXUA 4JYAB 1FFYA 5IKXA 4A2CA 1B8OA 1NJ1A 1XLTA 3U5ZB 3KUXA 4FYHA 4GNKA 4KWIA 4XIYA 5GPBA 1ZWLA 2WNIA 1FUIA 1Z0ZA 5JD3A 3QGMA 3AB8A 2GYWA 3L84A 3PGKA 1OYVA 3AEQA 4QUGA 4AO6A 4MKXA 1E9FA 3T5TA 2E4VA 3DEKA 4HLUC 2RGYA 4Z9BA 4D7AA 2IYZA 4Z9XA 1HE8B 2C3OA 3EZ6A 4D98A 2ECPA 4JOBA 4FGSA 4O2AF 5ULLA 4EVIA 4UVIA 2GD6A 4I1RA 5JBNA 1Y89A 2C7QA 3WICA 4MCHA 3ECAA 1NP3A 4I2VA 1IXRC 4P7FA 4Q4HB 5DM4A 5HILA 3MHTA 2WFAA 4M87A 4BYMA 1JG7A 2CUKA 3RAFC 4YUZA 5A02A 1DC6A 4KXFB 3ROXA 5F35A 4G85A 4BLWA 4WLFA 1L7PA 2W83A 3H97A 4WZ6A 1Q19A 2KW5A 2R4UA 3LPAA 4U39A 1RHMA 3P1JA 4Y18A 4DA9A 1Y4UA 1XDUA 3U9TA 4Z4GA 2R2GA 3VDQA 1M8JA 3Q6IA 4OLHA 5LM3A 3U60B 2V58A 4MVCA 4OEHA 4WXEA 5KUTA 2CL6X 4FMBB 4RZIA 5JQGB 1EFRA 3IOBA 1A1VA 3HK2A 5FPYA 4J2HA 3AHGA 4KR3A 1XN4A 5CU7A 4ZCQA 4JUIA 4CIXA 1GVHA 3PGA1 1QG4A 3ZLBA 4EZIA 1NMEA 4S35A 1JEOA 3SC6A 4OQLA 4YP6A 5KX5B 1LBQA 1YJXA 1V8OA 4URFA 3GZNB 5ERXA 2BM8A 4PG5A 2Q9CA 1FX1A 2VP9A 3UKJA 1GNQA 1B3BA 3I5MA 4GI1A 4TTIA 1QV6A 2PV0A 4O4JB 1Z47A 4N6NA 2ENWA 4A8TA 2ZM6B 2QRGA 1OFGA 2XYHA 3PC6A 1KFEB 4YMGA 3L8MA 4QFBA 5DJ5A 2B61A 1GL7A 3BFPA 1P6XA 4ZVPA 2NSHA 5SY4A 3HGTA 3IAM1 2H17A 3ENNA 3EVNA 3AUSA 3IKLA 3T61A 2NLOA 1T9BA 4I4IA 3O8QA 4KZKA 1IK6A 4OQFA 1OFIA 2PMDA 2V0NA 4IJVA 4EFDA 3AG6A 2Q6OA 4IDEA 3E9RA 3O03A 1GOTA 1NFQA 3DBIA 1W4BA 2C77A 3DZDA 3GA7A 1ZJJA 4G1EB 1E3LA 1SQ0A 2W6JD 1C3XA 3AM3A 4MRNA 4Q4AB 3DXXA 5CYOA 5C37A 3NATA 4ETMA 3RROA 3Q72A 5K6TA 4CGYA 2D0DA 1P1BA 2X1MA 4HYTA 2D7CA 4LHYA 4WXHA 3ZDQA 3NOQA 1T0HB 2ZRQA 3ONDA 3Q8XB 1IN7A 1IXZA 2P1ZA 2QAJA 2QXUA 3CT4A 3HMKA 3WK4A 3ZWKA 4B1FA 4QAJA 4D6YA 4IVPA 1W93A 2GEUA 3KZMA 1EJ2A 1RLMA 4TRNA 4X63A 4IQ0A 1ZLXA 2R8RA 3OECA 2QN2A 4UMEA 1EFKA 4U8HA 1TMKA 3E9QA 1LWOA 3AERA 3DOEA 3V7NA 1WIWA 2PMEA 3CIFA 3QYAA 1VC2A 1SUBA 2ZKIA 1OH7A 1Z4MA 4E13A 2JLCA 1AKEA 2OCAA 4QU9A 5HIKA 4PQYA 2VTBA 3W9UA 1Z6ZA 1XR3A 2G1JA 1L5HA 4H1WA 1Z4KA 3DONA 2Z9BA 4Y2QA 2X22A 4FWTA 3VX3A 3FHJA 5HKKD 3BXPA 4JLSA 4XVQA 2AZMA 2FE1A 1IQ0A 2AOXA 2B6HA 2QE7A 4M60A 4N7MA 3NOXA 4B3TB 3DE0X 1F60A 4BEBA 3DF9A 1CJSA 4KWTA 2DERA 2ZULA 1C9NA 4O02B 4YMIA 3L0ZA 3IP8A 3TZCA 4E4RA 1BZYA 5CLLA 2FWRA 3SYRA 4ZZIA 1KI8A 1SUDA 2JHAA 4KLCA 3NT2A 2B0JA 4F8JA 1J7KA 5F23A 5LYJF 1VL6A 4UHDA 2JLZA 1N33B 5I4BA 4W9MC 4H6WA 5AFSA 2Q1TA 5FUQA 4TZKA 3P0IA 3VC3A 1MABA 3VJRA 1G3UA 2I9PA 3B6KA 4IW3B 4C6TA 2B1RA 3OP1A 2W48A 1EE1A 4RQAA 2LW7A 4M22A 5K3DA 3HFGA 5FKJA 2J0UA 2QYSA 4HAOA 4E7PA 4QQNA 3KPYA 5I7SA 3THXB 5FBZA 2WBLC 4EAQA 4JC5A 3AIMA 5JSZA 1PSDA 1GQYA 3L3BA 3V9AA 1C1HA 1FLAA 1I36A 1ZM3A 2C9MA 4GI5A 2R1TA 4I1VA 1PQWA 1QX3A 5CD1A 2P1RA 5JTTA 1W4AA 4EGSA 4B83A 5K3EA 3ZWBA 4D9GA 4PAGA 1R5JA 3E7WA 3LUBA 3K0EA 5JI3E 2OORC 4U0KA 5ED0A 3L04A 2W8BB 1E18A 2X9LA 2C03A 5MDHA 4DV3B 4NU0A 2HZBA 5TB5A 1SCUA 1TVKA 1BOFA 4M3NA 3T15A 1ZCBA 2XA1A 2BOVA 5FFFA 3FYUC 1TJYA 4AZ3A 1R6AA 2HV9A 3LC1O 1Y1SA 1U7TA 3DQZA 4AY5A 3EYAA 4BB9A 1ECPA 3QNUA 1L1FA 4DWOA 4F60A 2CDNA 3WDKA 5IKPA 2NX2A 2P79A 3FMIA 4I4TF 2QE6A 4S0XA 3TSAA 2XEXA 2EKLA 1WMEA 1T2VA 1UXOA 4N0PA 3SR4A 4MDEA 4KLZA 4A27A 4FTWA 4G2NA 2A9VA 1PWXA 1V5EA 2C8VA 3LJKA 4ETIA 1I30A 3NM6B 4HEA1 4YN3A 3SMQA 1GU0A 3GP5A 5CBPA 1HDCA 3T06B 2IHZA 2P0EA 3Q7SA 2AMFA 3O8CA 1ZD9A 1JQEA 4I3GA 4DMGA 1Z5GA 1X7XB 1LA2A 2NZ2A 5HEKA 2GN6A 3AILA 1V1RA 3LIPA 4XDGA 4BU0A 3W6ZA 4C30A 4F6RA 5F21A 3ZHQA 3RUPA 1PR5A 3ID6C 3JQDA 3PL1A 3RS4A 1JHMA 4E09A 3VKUA 4FEAA 1BIFA 3KQPA 3VU0A 3IEPA 1R12A 3P9SA 1XQVA 4NMXB 1PGOA 4XQEA 4C4ZA 3KV1A 1YR9A 4OHBA 4NXMB 3ZJYA 2NQ2C 4E6PA 3DR3A 3LF2A 4CV1A 1DIRA 3L18A 1DWPA 2D06A 2B4QA 2XVMA 3OZBA 4EJSB 4JITA 3PWSA 4G4SO 5KVAA 3LO8A 2EGHA 2DR0A 3MGKA 4M21A 1OTYA 5HF5A 4NFLA 1VHQA 3K0FA 3ZDXB 1DIBA 4LJLA 4Q1AA 1H8HD 4KR0A 3ZGNA 4B80A 1ZY2A 1IHXA 2XVYA 4B71A 5BOSA 4HAXA 3LQFA 2E49A 4HFJA 5AXDA 4F6RB 3H11A 1FQJA 1YZVA 3LLCA 1QCYA 2HEIA 3C5EA 4ZIRB 5LZ9A 2V4UA 3OTIA 4GYJA 1LBHA 1JQDA 3DBRB 1IBSA 1DO2A 4KN6A 2O07A 2XBUA 3PD1A 4OXRA 1FDRA 1UBEA 1ZJ6A 1ONSA 2AUNA 2PKQO 1X1EA 5D00A 4EHHA 4O8ZA 5E9WA 1PVDA 2ZVPX 4CFYA 1DTSA 3IXQA 2VHYA 4KZPA 1YJ8A 1MC4A 2B7CA 3NV7A 3IR7A 3B82A 4MKFA 3B89A 3NLLA 2AHRA 2FPIA 5D84A 2TRSB 2QMUA 3F3YA 3WHPA 2G1PA 1O7JA 1P81A 4FLMA 1Y1QA 4M9QA 4KREA 3H05A 3QHQA 2HHAA 4HTFA 2FCAA 4WACA 2HGSA 2COKA 3PJFA 4BEJA 1CUWA 1XAGA 2R7NA 3EASA 3PFIA 4X24A 1YCDA 5DYWA 3ZE8A 2Q5OA 3AKZA 3CH6A 1XD9A 3OAAD 4QU5A 4DNOA 4GD3Q 2JIBA 3HRKA 3HY3A 4P0PB 5I51A 5GJCA 3NHRA 4Q3OA 2Q41A 4BKPA 5C46F 3BTOA 3INNA 3TEJA 4HGQA 3BREA 4U7FA 1AIPA 1ENZA 1TO2E 4MUFA 2ZR0A 2XRFA 2PKYX 2QTCA 5DNEA 2HNAA 1QDUA 1GAQA 2C8JA 4H15A 2CXUA 5IDXA 1BG6A 4RCVA 4FHEA 1E2NA 1LD3A 1HQDA 3HUDA 4M38A 3VGJA 1N5JA 5K3CA 4TWRA 4U7GA 1L4BA 2WWTA 4N5IX 5DEOA 3TZQA 3SZMA 2YWXA 4D9MA 1WF6A 1NGSA 5CIWA 3EVDA 1BGVA 2NTVA 4QUJA 5A06A 1W581 1ISIA 2GRAA 4QDKA 4A0SA 4OM7A 1XWIA 3V1TC 4U0JA 4CR7A 4CM9A 5BMVA 5GZ6A 2OLEA 4O2AA 1YQWA 2XTMA 2WD7B 1GV0A 3E9CA 3MWDA 5FCDA 3PXUA 4U9UA 4BQQA 1U3FA 1ZHOA 4ZV7A 4KRFA 5BN3B 1FTGA 4Q66C 1J20A 4V03A 2YZ2A 1OA0A 1WXHA 2ZTLA 2J7KA 2HU8A 1YF3A 3BSWA 1UMDB 2ZTMA 2P9QA 2VL7A 4YB8A 5HRUA 1BU5A 2WUVA 3GLIB 4DUZB 4HZIA 4DQDA 1DQPA 1IHUA 2EKPA 2NTEA 4XTRA 1UOQA 3JSXA 1UBOS 3TZBA 4I5IA 2MSEB 4RLQA 2WYVA 1F2DA 1OOEA 2E55A 3SC4A 4OAQA 3QITA 3S2FA 1I7NA 2QSYA 3D64A 2ZSDA 3M6LA 9GPBA 1O4WA 5KYYA 2GAJA 2XYGA 2Q45A 3BGWA 3GLIA 2VQFB 2WKPA 3IVMA 1CRZA 4XYBA 5C5DA 1DC7A 3JYLA 2ZJ8A 3U4HA 4ZAFA 5E8RA 1MRSA 1H8ED 5FLEX 1OTXA 1X9IA 2HBYA 3O8QB 1H0HA 5LZ7A 1NXTA 1WF3A 2EQAA 2H7XA 3PJDA 4WJLA 5I4IA 1Z7YA 4D4JA 1Y6FA 1WMBA 2PZKA 1XPRA 3G2OA 1FYFA 1E2DA 2FQQA 3I37X 5HTOA 2XUFA 4KCGA 2YCBA 5F77A 4BWFB 4IKEA 3ASYA 1I9CA 1TZBA 4FMCF 4OU4A 4EPXA 1UAYA 1QC5A 1Z2NX 5TVKA 2ONJA 3L7JA 1K3TA 4KRXA 3K2BA 4PNZA 3OPXA 1NZDA 2W90A 1SD1A 3L8ZA 3FYUA 1FUUA 3WQSB 1Q1BA 1K6IA 2XPCA 1N5RA 2A9RA 2WPDA 2ZS9A 2DTEA 3EDOA 5IH3A 5HJ5A 2IHYA 3U7HB 3FH0A 2N75A 2DWOA 2P5UA 2OOSA 1PWYE 4WBNA 4XRGA 4J7UA 1SVWA 3CNHA 4FGZA 1DJMA 1G8HA 2LXNA 2XVXA 1YRHA 1YCGA 4ND1A 4FXPA 2HCJB 3FI9A 5BNTA 4DSNA 3WYAA 3RSSA 2RH8A 1P1HA 1M6VA 1U02A 3N74A 2FR8C 3WA6A 2G7ZA 4P54A 1RRPA 4I36A 2VDPB 2F1RA 3BWYA 4X97A 1YVPA 1HOXA 2YVLA 3WRXA 3VOSA 3CW2A 3SIWA 3ZCXA 2AEMA 1C7FA 1L5ZA 3HUUA 1NN3A 2AFIB 4LMRA 4TT3A 3AFOA 4RH1A 4OP1A 2AQIA 2D8AA 2JI8A 2AG0A 1NVWQ 1N2ZA 2Q50A 1U2QA 2QRLA 1JR6A 3E9MA 1EQAA 3KDSE 2CXHA 3EFOA 2QUZA 1TE2A 4BEWA 1JX6A 3DMRA 4U7TB 4O59O 3IBGA 4LDZA 4ZJPA 3ND9A 1T4BA 4QL3A 1RABA 4QVKA 4PZPA 1SRRA 4JMPA 3RK1A 3O4RA 4YECA 2E0IA 4RYLA 1TX4B 1XF1A 3TKYA 1Y82A 2NO9A 1DQYA 1IEXA 2BRUC 1UAGA 1UZMA 2VF7A 1UMKA 3H2KA 5IUKC 4CDRA 1XCMA 2P2SA 1K0UA 1ZH4A 2WVHA 3B51X 5DM2A 4BUJA 1KZ9A 3QM1A 1OTHA 3W5HA 4EA6A 1HXHA 4C88A 1KWGA 3WNQA 2E5WA 3COSA 4JP3A 1JA0A 2LE0A 2H18A 3HA7A 3I9KA 1FS4A 2OB2A 4E30A 3UT5A 1V25A 3K05A 3OIYA 3IAXA 2VS1A 3P26A 1QYXA 2VOEA 3A6HA 1EP3B 4K9OA 1VI6A 4ZCPA 1AH2A 2H85A 1EFDN 4GBED 2ESRA 3PR2B 1HGXA 4J2TA 4OXNA 5KNBD 3BMQB 3ENQA 2J6HA 1QGDA 3IX7A 2J3LA 4Z7NB 4X9XA 1VECA 3A2LA 4MX8A 5IZCC 1XQYA 3FR8A 3T7SA 4A3SA 4OBWA 1NG9A 2ASVA 3AUFA 1D1SA 1Q0SA 4B3BA 2P40A 3LUKA 1YR1A 5EIEA 4QASA 4GKAA 3RUIA 1XELA 4DRZA 1VE3A 2YWGA 1XF9A 1HSZA 2I2FA 5DN6A 1JLLA 2NVUB 1GZ7A 5LMNB 1P4JA 1IY9A 1JJFA 1QHHB 1SHKA 4NJMA 4G0NA 3Q7RA 2OECA 3KAKA 1UH5A 3DMYA 4KTVE 4UZFA 3C3AA 1T9GR 3WIBA 5A3JA 1EGMB 1SUEA 1RCTE 4QUDA 4UDOA 5TQVA 3VZRA 4XZ3A 3SR0A 1EHIA 4BFVA 4WGGA 4TS9A 4Y1GA 4JBLA 1WB4A 3S7ZA 2L0XA 4NAVA 4BMCA 4PNEA 3T9CA 1V1MA 3ZIAD 4DCSA 1DNPA 3NMUF 4C4OA 1R5NA 4JFAA 2ZU0C 1AUOA 4EH1A 2OD9A 2V03A 2G5CA 1ZWKA 4LSWA 4M2LA 1XEWY 1QORA 3LHFA 4J43A 4KB5A 4QAQA 2WFLA 3ERCA 1QHXA 3HZRA 4FKZA 3TTUA 3L6CA 4MPDA 4URYR 4Z6KA 4X8HA 3TX6A 1XJQA 3SX2A 5B2FA 3GRZA 1ZN8A 1S96A 1UMCB 3I4CA 2Q8NA 2YV4A 4RTNA 1AHHA 2I6QA 3DWIA 1NZFA 1KTIA 3N59A 4Z4QA 4IKOA 1ATIA 3HVHA 4EB3A 4F85A 3PGXA 5EHQA 3UENA 1FPQA 2PMCA 4G0OA 1DC8A 3DAFA 3GUYA 4XDZA 1W36B 5FULA 3AOGA 4H17A 1W4RA 2M6LA 3AVVA 3G0IA 2QLMA 4IUCS 1Y81A 5DT9A 4ZRNA 4ZAZA 3EPJA 5FPPA 3CW9A 1JYFA 2PSJA 3BMNB 3PDWA 4DG5A 3DS8A 5CHEA 3TKLA 5BXYA 5J4YA 2EKBA 1HK7A 1HLDA 3JD0A 1DMSA 4P53A 1TF5A 1AKRA 4MUMA 1B0AA 1U2ZA 3F6CA 2IODA 4C7JA 3ZY6A 2HK9A 3K32A 1CIPA 3LDHA 4HG2A 4RIGA 5DH9A 3VR6A 5AVXA 5KWSA 2J48A 3KQNA 1KEVA 1DC3A 1VHJA 5K9ZA 4JROA 3F0TA 3K6JA 4B7UA 5JJLA 1ADFA 3M7IA 3WB0A 3E2PA 4ID3A 4U3JA 1Z5WA 5T4FA 2Q1YA 4ETNA 4LVOA 5BNIA 1NVAA 1QG0A 5KTRA 4TKMA 3WGIA 3HJTA 4RHYA 1FMCA 3MJTA 4F45A 3UK0A 3EVAA 2YXBA 3H1BA 2Q3MA 1TM7E 1YTLA 4RPHA 4EL0A 1BA3A 1D09A 4X85A 1J97A 4CM5A 1PLJA 2RE8A 3OFVA 4R7TA 4TMYA 3KB6A 2GBFA 3PGJA 1N2JA 4DR5B 4AJEA 1HNZB 1YQTA 1II8B 4LYYA 3WGGA 4QBKA 4UE6A 3PUIA 3RT9A 4UVHA 2WG1A 1QYWA 2WHPA 5D3QA 4K0KB 2X9VA 3KT3A 1RYHA 1I24A 1OVGA 2CMKA 1IHYA 2NXEA 3LCVB 3PA8A 3QV1A 1QQ7A 5J43A 1ZOPA 1HTTA 4F96A 4B6EA 2F1HA 3WWYA 1IBRA 2WDZA 4WGFA 4C21A 3AR3A 4E03A 2G9ZA 3JALB 4L8WB 3FMVA 2FN3A 3A1FA 4WOCA 1K7YA 2W6QA 2A9FA 2F59A 3DHNA 3BERA 3EY9A 2P0AA 1GL9B 3GRCA 3H2JA 4JI8B 3CXRA 1ID8A 5ANRB 4XQ9A 1LBEA 4MB0A 4LQ4A 4P1ZA 1I7LA 1KAGA 1CUHA 2RHGB 3DOUA 3WSWA 4DC1A 2AOTB 1AUVA 4JNKA 4C2TA 4C7OA 4PYNA 1RRVA 3EXEB 3DPSA 3L0DA 5IXJA 3TLKA 3EJ6A 4M0MA 4V0MA 4IDCA 3DZCA 5E3HA 1NDUA 4O33A 3VZCA 3O7WA 1S2OA 2PZFA 3L8DA 2ZYUX 4DIEA 1GGNA 1RRKA 3O2NA 4IV5A 5I7UA 2BEWB 1SM4A 3TIGA 3A1TA 1I7QB 3S2YA 1G8AA 2BBWA 3U16A 2G07A 3UXMA 1P2GA 2NU6B 1OV6A 1Q22A 2FEWB 5CXUA 3TQFA 3F6YA 3RJTA 5LNK1 4PSAA 3ZU5A 4P7KA 1QFZA 1GQFA 3NEPX 2HA3A 5IFKA 4ZHQB 5DLDA 1YZKA 3QFSA 3F1LA 3EMBA 3NYIA 5ALVA 1OC4A 3EXIB 1SU4A 5CYPA 3FKSA 1ZN7A 4K40A 4NDAA 1NV9A 4MVWA 3T7RA 2DT8A 2R8BA 3UQYS 1Z6TA 4G89A 4XYMA 1NU8A 3V8QA 4RZHA 2N47A 3L82B 4J6EA 5JD5A 5B6JA 4LHZA 1EVLA 3CZ5A 4B8YA 2RKWA 5KC8A 2B7LA 1PR9A 1M1YE 1NRWA 3GLQA 1OXSC 2QMHA 3R2JA 5BSVA 1ECFA 1IM2A 2Z8ZA 1WSAA 3KVOA 4QRIA 4NIMA 1PL6A 2J87A 2ZYSA 2NP6A 2F6RA 2CGEA 4OHFA 5ETJA 1UXHA 1KARA 4L6CA 1SK9A 3SP1A 5DDIP 3C3MA 1AY0A 2HPVA 2OC4A 1C81A 2QLLA 2NG1A 4OQZA 4X65B 1EFVB 3WLSA 2V3WA 3LT1A 2V59A 1T9DA 2X3YA 1PSWA 4RSGA 2RD2A 1RAEA 4MWSA 1O5OA 1WRBA 2PQ6A 3QEKA 1N0VC 3TQQA 1AD2A 1E2IA 5ITSA 3ZHZA 3KNZA 2V6FA 1S4QA 1WXXA 4GOMD 1T3SA 2VAWA 4NZ9A 3VO9A 1P7VA 1RM0A 1KJWA 3ESRA 4AYWA 2ZBEA 3DZFA 4CN9A 5EI5A 4RZXA 5C3MA 2P9GA 2OBMA 4IVRA 2CYAA 3SHWA 3VR5H 1CQIB 2JCVA 1XNJA 3O6VA 2QI9C 4ZT7A 3C7KA 4YMWA 1GRCA 3D4NA 1S2MA 3H2GA 3V7YA 1UKZA 5BPHA 4BO3A 3CEPB 4I8DA 3PUJA 5JY1A 2WAYA 3KEFA 8ATCA 1DINA 4YDHB 5ENVA 1NPDA 4CUZA 3CVUA 5TQ0B 1RQLA 1W0KA 4C4TA 1UT8A 3I83A 1A4RA 5KNCD 1PJTA 1KNQA 4UCWA 2ZS8A 5BUCA 1IJFA 1BMFA 3WGJA 2FMFA 5G0VA 2FG6C 4X00A 4XPIB 2AWOA 2IP1A 3GR6A 2F67A 3UN1A 2FEKA 3WNVA 3UAGA 3MTIA 4M88A 3QRWA 1G20B 4Q82A 3TE6A 4IHJF 4CKYA 3TOVA 1JF8A 4F21A 4LE1A 4NK5A 1XTRA 2D1YA 2X7XA 3QWFA 1TM2A 2AB0A 2CJFA 2Y6VA 1P0FA 3EQZA 1XKTA 4IJKA 4DJ5X 3OESA 5MFPA 4ZTZB 1JRLA 2UZ1A 3R7NA 1B1AA 2BP7B 1UXIA 4K03A 1A4XA 2PUJA 1Q21A 1RJWA 4KQKA 5JWHA 4YXWA 2A0KA 1MA0A 2Y1XA 3OM1A 3UUGA 3H16A 5DTRA 4ED9A 1PU2A 3TSYA 4J3NA 4PO8A 4ZOAA 5A4DA 2BTQB 1CR1A 5KX5A 4MAAA 3K30A 3VTFA 3F90A 2IFTA 4BVBA 3TZLA 3WR5A 9ATCA 5HZMA 3EC2A 2QBYA 3O9VA 3RYTC 2QTTA 2QRHA 2YV3A 3OY2A 1M7BA 1S89A 2FF5A 4DEXA 1S8NA 1L7NA 5JYEA 2YICA 2EAUA 3EAQA 4DJTA 3UMGA 4PG8A 1WBDA 4TKVB 3BCUA 4MCAA 2QD3A 5HFJA 4B7AA 5DU2A 4EB6A 3ZQKA 3T6KA 2V5AA 4R2IA 4N12A 4E5SA 5KQPA 3D31A 4DYDA 2W2PA 2B37A 5EZ6B 1VLZA 3L43A 2BYTA 3TQIA 4MA5A 3ABZA 2C58A 4NCNA 5CDYA 9ABPA 5EUBA 4ZYVA 4ER7A 4JA2A 2ETVA 4MWOA 1KEWA 4A8HA 3FFBA 1K86A 3QTBA 4OI2A 4WXPA 3UPDA 5C32A 1OT5A 3MS7A 3EZGA 1KQ3A 3KHKA 2FPPA 4DAEA 2HMWA 2W0MA 3T52A 4P93A 1SXJE 1ZXBA 2DRIA 5C1OA 2R47A 2DC1A 1IEVA 1CRLA 1K8QA 2NZXA 3H2IA 4N8EA 3UJ9A 3TD9A 1X19A 2QN8A 4RTMA 5KPJA 3K5PA 4L9AA 4KXQA 4B6SA 1NYTA 1ESCA 3V1NA 1VYUA 2WU4A 3A7DA 1GKLA 1CZNA 2A0XA 3OJXA 5B55A 4DW8A 9LDTA 2MJLA 1C1XB 1LV7A 2CWDA 3AUTA 4DF3A 3FPHA 2YYSA 3MJEA 5DWVA 3CVXA 4RFSB 2SICE 1V4NA 1GTG1 2OA0A 4FNGA 3RKSA 3T7DA 4H1VA 3LBYA 3RIGA 1IY1A 3DVLA 1T6YA 2YR0A 3UB4A 3DKVA 1FL9A 1QRSA 4GPTA 1YB6A 4PFKA 1E2FA 1P7YA 2AVDA 2ZR9A 2GJAA 2HD4A 2KQUA 3W78A 1WPXA 4KPEC 4D9FA 2EDCA 3KSZO 4N76A 2X9NA 4LXXA 3HABA 3HCFA 5CT5A 4R1NA 2QENA 3JARB 3GRKA 4WZAB 3VYUB 1M1NB 1RVV1 2O14A 4YFYA 3WGQA 4E5DA 3U62A 2FFHA 2IHBA 2Z56A 3VNQA 3OEED 4UPEA 4X92A 2EX0A 1OCEA 1SBHA 2BR5A 2F4NA 3A26A 2F8MA 3M1AA 3DOIA 3LF1A 3E9DA 3NHMA 3DPIA 4EFKA 5HKOA 1HYGA 3BKWA 1PL0A 3W7VA 4LI3X 3IUJA 3AUXA 5CNJA 4E0BA 1EQUA 2P68A 4Q1EA 4R69A 4GS5A 4LF8B 1A8IA 2XXAB 3S2ZA 2PKRA 3NUQA 2EJVA 4FYXA 4JYMA 3DH0A 4KFTA 4PHHA 1QVRA 1CS0A 1YONA 1RHUA 2AR7A 4Q15A 1PFUA 3SX0A 4CFZA 4ZCIA 2J0UB 2WM3A 1SBYA 2GERA 1FS6A 4MWGA 3JYPA 1TU3A 3GGJA 4N6GA 1QUEA 1UIRA 1L4YA 1ZVQA 2C4HA 1ORTA 4H3KB 2KYRA 3WK5A 2Y1OA 3UCEA 1PNVA 4YMVA 3H04A 2WWXA 2B36A 3U37A 3ADBA 3ZDAA 4M0LA 3Q85A 2K2QB 2MSDB 3FUCA 3GNSA 3LAWA 1TUBA 3UG7A 2PPLA 1DKRA 3F8SA 5DHTA 5LYJA 4CKEB 3TFWA 4S24A 4OXIA 4F5YA 4L95C 2EJCA 2PE5A 3QSYA 4E5NA 1AXEA 2CD7A 2Z9DA 4MITA 1HY3A 3VZQA 1CS0B 2BLNA 1RAGA 2C5EA 1SBZA 3SOZA 4DM3A 3PEWA 2C0PA 3DULA 2D2EA 1U1CA 2IPXA 4WMLA 1XCBA 3E1SA 3MF4A 1PS0A 3F7MA 1G8GA 2BFBB 2VKTA 3PQ4A 2ID9A 4GQAA 4X91A 1HYQA 4ZARA 5I9SA 2D6FA 1Y3IA 3UO8B 1EP1B 1B1CA 2WIGA 2R60A 4DB4A 1QIFA 3HKCA 1ZYUA 4FD2A 4YRFA 4MQEA 3VPGA 1LC3A 4BOYA 4J0HA 3GARA 3OSUA 3WLRA 5B7PA 1TK3A 2A5JA 3ZLJA 3S8EA 1RDFA 4R2LA 4YRIA 2VA9A 2ZW9A 1QMPA 3E9EA 1Y6GA 2HDNB 4WN3A 2I6GA 1W30A 2CN1A 3DDCA 3SZOA 5CDFE 3MSCA 2A9JA 1UDXA 5CPFA 4J8PA 1EDZA 2LPMA 4B3GA 4JJ7A 2O5VA 1Q7BA 4LBWA 4MPPA 3SOPA 2AFHA 3UGQA 3D2LA 4MUJA 5DBEX 4RY8A 2WUDA 1ESDA 2QV7A 3LGXA 2OO5A 4YLEA 4BJHB 1GR0A 3QELA 1PNRA 1TCAA 3ETGA 4LKOA 1JDJA 3WAGA 2Q21A 2H1RA 3AHHA 4KYIB 4QYTA 5DE3A 1XZMA 3ROPA 2VEOA 2GYVA 3VM6A 1JPVA 1FQWA 4E5VA 4G5YA 1VDMA 3C3PA 3VAZA 1JR3E 2P2GA 2NUAB 5FLKA 1QUFA 4GM1A 1PJAA 5IWAB 2NADA 3PYLA 4LYGA 4B3HA 1YMVA 4FQ8A 2ZBVA 5E1OA 1A9XA 5LDHA 3W6OA 2OCIA 1GPYA 2H0AA 1YHNA 4QG3A 3BT7A 3BZWA 2PHZA 5GONB 4FHGA 2EZ8A 1XZBA 4BWVA 2XSZD 1NVDA 2CLDX 3UB3A 2AH5A 5H4HA 2WTAA 3DAPA 3QTTA 1P33A 4MH0R 4F92B 3WNZA 4I3FA 1GSHA 1N8TA 3IPCA 4ZALA 5IAGA 4HX5A 2R25B 3TXXA 3MWKA 1U0JA 5CLHA 2J30A 2BZ1A 4IIFA 5E6UB 1ZK2A 4EMSA 4LOJA 2CLMB 4EYEA 1IY0A 3TDMA 5CVVA 1LU9A 2Y4OA 4CTJA 1KK1A 5F4ZA 4HDKB 3DAOA 2D1RA 2KE5A 3KYBA 2WM8A 3HKEB 2GLXA 1V7ZA 3R44A 4D9BA 2PRYA 3WBBA 4LXHA 1S7CA 5G0UA 4PC6A 2VXCA 4B8WA 4ZOLF 4HGRA 3MYYA 3BXOA 1FFHA 1IEWA 4IVNA 3UOAB 5P21A 4YRGA 3HEBA 5L8VA 4PPGA 3OJEA 4XW2A 4CNQA 2MYNA 1FTQA 2UVPA 4FFPA 4FIZA 4YJ3B 4R1QA 4XUCA 3RT1A 4I1PA 3ZK7A 3OA0A 2OFWA 1QP7A 3LWBA 1EGAA 1TOAA 2JNWA 2QX8A 1EZZA 3EF1A 3P7MA 3D4IA 4FX2A 3R8FA 2VO1A 2Q4TA 1P72A 3NHJA 1J1IA 3U1VA 4D42A 4EK9A 3KXKA 2PO7A 1Y3FE 2OO7A 5D3MB 1NDHA 2HYIC 1GTL1 3RRBA 1FVFA 1EE9A 2VA8A 4EW1A 2J7PD 3UTDA 4X61A 4Y7DA 2NMVA 1QS0A 5TQ0A 1F4LA 4KUEA 5CH8A 2PBFA 2XE7A 2OCBA 2Q0SA 5BUQA 4XIJA 3K4HA 1ZO8A 2CXOA 2D3WA 4HGYA 4KDCA 3S2SA 4PN3A 2NNLD 2NIPA 2G4LA 3GROA 2OCYC 1CF4A 4D8UA 3PDCA 5BQXA 2ZUVA 3KXPA 3IAM6 2D2FA 2ORVA 3I1YA 5EXXA 4C4SA 1N6KA 5BMVB 3GLFA 1GWNA 2IA5A 3U44A 1N2OA 1QJCA 3FX2A 4GOKA 1OREA 2Z3ZA 3RKUA 3IDZA 4GP6A 3PT9A 2QRMA 2H4JA 1W6RA 4IDGA 1L5YA 3WQHA 2BHRA 4RULA 4EG8A 2AJTA 3NR2A 1ENYA 4FWBA 3MUOA 1IM8A 1TT5A 2IS6A 3FJ1A 3LBHA 4L57A 1E20A 1X1CA 1G3RA 3AETB 4IIYA 4Z49A 2WV7A 4EG7A 1XTBA 2XQGA 4PZYA 1Z4IA 2AEJA 1DTWA 4YROA 2H51A 1CUIA 4JHXA 3ZW7A 1L4GA 3ODPA 1JHAA 4BO9A 2V45A 3QXHA 3WVNA 3NAGA 3R0VA 4XD2A 3KUKA 4EZBA 3OOHA 3WMRA 3TD2A 4YJ2B 3ZH9B 5C3UA 2EW1A 3R6WA 1OBHA 4Q9IA 1KAEA 1VP3A 5EUCA 3TFOA 1HT0A 2Z2XA 1F12A 3UANA 1YQDA 5F5LA 2BUBA 3DZJA 4M8SA 1U04A 1MO6A 1RJFA 3HA5A 4MP8A 4DABA 4YAIA 5I3ZA 3Q0IA 2Z4SA 4Q4HA 4ZVTA 3WGOA 5JXWA 3NPMA 1OHHD 5IJ0A 4GZ6A 1QZTA 3B1YA 4M1YA 5GTDA 2O57A 5M29A 1DAOA 4CT0A 2XB9A 5AUQA 3V4VB 5B1EA 2ZBFA 3AXSA 1MAHA 3WWZA 1PTJA 2VPZA 4WKNA 4AJ4A 3KKKA 2WILA 4QXRA 4U63A 3U4GA 1K7SN 5KSYA 3MTQA 4H35A 4JL8A 5TQ2B 1NKSA 2JFZA 2WG2A 5GMOA 3GHHA 3S40A 1WLSA 4LJ4A 3U3ZA 3RVPA 1UEXC 4MZDA 3PNBA 4HWSA 3LUAA 3B53X 1PJRA 2D2XA 2I2XB 3LQQA 2QQ0A 4MVJP 4Z8XA 3L6EA 5AT1A 1B0UA 2H2DA 3T7EA 2QXTA 4UTNA 1MV5A 4RV4A 4DGSA 4ENPA 2OMKA 4MZXA 4M0FA 3JAMA 1EDBA 1OI2A 3EY4A 3E5RA 4J9UE 5KNBH 4WK6A 1TQ4A 1IPHA 3SS9X 4Q18A 1QTIA 2QU7A 3N8HA 3W05A 2PUGA 2EU8A 2CJYA 5KDLA 5A1TA 4QD3A 2OBYA 1E3JA 5F64A 4G1UC 2XJ9A 1G21A 5C1IA 5BNWA 3V1MA 3QG1A 3U81A 3AP2A 4C08A 5LVAA 4YDQA 4DCTA 2JJ2D 3WS7A 1OASA 2CLCX 1X8LA 3BAZA 5JADA 2D5AA 2RARA 4IPTA 4B3SB 2JI4A 2NW6A 3IVRA 2ZJFA 5DRTA 5IMBA 2Q0HA 2GAAA 2KSQA 2WAOA 4IMJB 4PC2A 1KF0A 1PLKA 5LA6B 5E8JA 1QKIA 1CETA 1JALA 3BCSA 4WFJA 3ZY4A 5D86A 3THWB 2IS4A 1GG2A 1N5KA 4J94A 2PGDA 3T1OA 2EX1A 1PNTA 2HUNA 1U9JA 4LDQA 1FZTA 5DGHA 1GYPA 1P1JA 4BZZA 1SFRA 3TQOA 1FUYB 1OYOA 4FYWA 2YWBA 3A37A 1UJ5A 3QVVA 4MWZA 4AKHA 4TSFA 1G21B 3EEBA 3EZFA 1BS1A 1UP4A 1XP5A 3OQIA 5HG0A 3BHJA 1V16B 1ZXXA 1N36B 3ED1A 1A9OA 3CUSA 2VAVA 3WX0A 4DCCA 4ZYZA 4J0CA 4F86A 1PZNA 1QVAA 2O0JA 2ZLBA 1BMDA 3HU3A 4XGKA 3RE1A 1N0WA 4CVNA 4EPRA 1CZOA 2Y6UA 1R9GA 2YFKA 1RMYA 3C5VA 3DNMA 1VSUA 1WMFA 4KE9A 5GOZA 7YASA 2ZRLA 2OUKA 3OMXA 3LGSA 3H86A 1Z2EA 2XE4A 4LWPA 1AS2A 3B6EA 3IQZA 4FHCA 3GLSA 3IOMA 5J5CA 2GNOA 2CXXA 2ZBUA 3COVA 1F2VA 1S8AA 2XMRA 4P34A 5KHAA 3R0IA 4U00A 5PGMA 4F12A 1SULA 5IULC 2WW8A 4ZDWA 2WHQA 4L28A 3R24A 3ORSA 1PUJA 4UPDA 4WK0B 3RIMA 3C3CA 3TM4A 2ZU6A 4EDFA 4LEIA 3RRZA 2DHEA 4WNIA 2BZGA 2VP2A 2Z2JA 2AEFA 4RSRA 3UA4A 3HEMA 3W5JA 2LRHA 5I7VA 2QRNA 5B4VA 5LD2B 1QVVA 3HP4A 1Y8CA 2BBTA 2PL9A 1IFXA 3L4SO 3S1LA 4A8PA 4PFQA 4RVDA 4ZDJA 2NYAA 3CF2A 1CQZA 1Q1EA 1DSSG 3EX7C 1UXJA 4YGXB 4OB6A 4DRYA 3CUYA 4FZ3A 4G0YA 3INRA 3ZHYA 5LA6A 1DAIA 1GYRA 4G5HA 5I7EA 2I2DA 2OFOA 2X4GA 1FB5A 4K6FA 4OF4A 4BB5A 4N8DA 4CMHA 1P4GA 2W2QA 3GEIA 4D3ZA 3B2NA 2LDXA 3QOFA 2QA5A 4NBSA 1H65A 1F20A 1OAOC 5D7BA 4PG6A 3UFBA 1BWQA 2GBLC 1YOBA 3R7DA 3E7XA 1J0EA 3AUYA 4C4PA 1QQAA 3GNLA 2QMQA 2B6NA 2WM2A 4PAWA 1ISJA 4Q37A 3MWFA 2NNWB 2YNMA 3OM8A 2F3UA 4N3CA 3JYOA 4BGUA 2UVDA 1FTYA 1T3ZA 1V4BA 4LY3A 1JPNA 2GWHA 4JLPA 5LUAA 3PJRA 5EPOA 2CBZA 3UWKA 4CUJA 1I2ZA 5SYAA 2HCFA 4RL6A 4UBJA 5DVZA 4RU1A 1DEXA 2RJ3A 5EMMA 4KX5A 2VUUA 5K09A 4PQRA 1XMSA 5AXCA 2YFYA 1PHPA 1YIOA 3FOCA 3E48A 3SJBA 4POOA 5B36A 2F62A 2WR8A 5LP6C 1QGUA 3NDIA 2BFWA 2WC1A 3E5MA 5KTKA 2YWEA 2OHJA 3EA5A 3GLHE 2HQOA 3IOCA 1SCNE 3DFKA 4OK6A 4CTOA 1H1DA 4KI0A 3QUTA 4LKRA 2QTVA 1NXOA 3JW8A 1QNLA 1X1AA 4R0NA 2FSIA 1V6CA 2BDEA 4TSKA 2C3PA 3FDIA 1RLIA 1X3SA 1CPYA 1MZVA 4MTCA 4RIEA 2APJA 3U56A 2ZBDA 2REBA 4IOKA 3PEUA 3PPWA 4F5DA 5AUNB 1R0YA 1ZL0A 2DPYA 1PNQA 5J1SB 1I6LA 3VR5D 4TKZA 2FI1A 1Y98A 1C50A 2RAUA 2PWZA 1MU0A 2CXTA 3NC0C 5LDGA 3V32A 3LTEA 5IJ9B 3HG7A 3M1LA 1F5NA 1G8JA 3AUJB 4FBGA 4G86A 3AB7A 4DIFA 4QJIA 3V4RA 3DDSA 2ZI6A 1ABBA 1S9HA 5DLEA 5F12A 1VPDA 1OXTA 2E3JA 3DVRX 3MB5A 3LT2A 1I33A 4M1MA 1PVOA 2BV3A 4NY1A 3KDPA 3KYDB 1COWA 1AXRA 1NMQA 1Y34E 4C0JA 1WTCA 4BS9A 2ZJ1A 2PZ8A 5HXAA 3FM9A 4CM4A 1G59A 5JD6A 1AF7A 3VH4A 4LJ7A 2PZEA 3NU1A 4H31A 1GQOA 4QGAA 4AO8A 5EIFA 5D3MA 2C9CA 2ZIFA 3FPLA 4IGIA 2N1MA 1X39A 4IIVA 1AV6A 1G4HA 3FCSB 4TXLA 4L27A 3RAEC 4WCFA 3VPHA 4R98A 1JB1A 4TYNA 1Q44A 1T26A 2A5GA 2H59A 4PZ9A 3HPRA 1POWA 1Q5PA 2PUWA 5FH9A 1PFKA 5EQJB 4C5AA 2A1IA 2ACWA 2HREA 5CJPA 2KS6A 1YJAA 4HKTA 4ZO6A 3T5GA 4AB1A 2QPOA 3B20A 3LCRA 3DBLA 3TX2A 4EUFA 1PEAA 3G79A 5IDQA 4OHYA 5FT9A 1A8UA 1SA0A 4MW9A 5L3RA 1XMIA 3CB2A 1C7ZA 1JJVA 4MMXB 4XVRA 3RWMB 4B3JA 3ENWA 4XJSA 2QJTA 3ZYCA 1LDMA 1L4UA 4I99A 5IUJC 1EM8B 1WG8A 4DDUA 1UM9A 2ZIVB