3E0XA

The crystal structure of a lipase-esterase related protein from clostridium acetobutylicum atcc 824
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
SNAMLHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSMGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFMEKIYHNQLDNNYLLECIGGIDNPLSEKYFETLEKDPDIMINDLIACKLIDLVDNLKNIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Lipase-esterase related protein
publication title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e0xA00
1JMYA 2WHPB 4E11A 4DNPA 2OLEA 1Q0RA 4WY8A 3FYUB 4N8DA 1NU6A 1A8SA 3NGMA 2GBGA 4C87A 3EBLA 1DX6A 4U2BA 4B80A 4X91A 5K3FB 2WFMA 4FWBA 4EA6A 5CT8A 3WYNA 5JYCA 4I19A 2PU7A 3WMRA 4W63A 1JMKC 3BE8A 5AM1A 1DWOA 3AIMA 2YASA 4INZA 1THTA 2DQYA 1SCKA 4F0JA 2R8BA 1CFJA 3MGAA 2BFNA 2ORYA 1RYYA 2VF2A 1W75A 4OB7A 3BWXA 4U2GA 4CG3A 3DOIA 3H2JA 4ROTA 1EINA 4KE9A 1CUWA 1X2EA 2ECFA 4Y2VA 3WKDA 3PF8A 1XQXA 1WPXA 3DJYA 1W76A 4LHEA 1LPMA 2B4KA 5KBYA 3HZOA 1ZJ5A 5LZ4A 5D3KA 1TQHA 3R3UA 2LIPA 3OTQA 1QGED 1OXMA 3MUOA 3MVEA 1CUAA 5LZ5A 1TRHA 4H7HA 4M0FA 4Y2TA 4U2EA 4EY4A 5JATA 1EK1A 3I1IA 3FLEA 1RP1A 5AP9A 2BUAA 3HI4A 1GPLA 3IURA 2OG1A 1ACLA 4BVLA 3FLBA 4H7KA 2VSQA 4J0CA 4AO7A 5AKKA 3PI6A 5I8PA 3VKFA 2XUJA 5JAOA 4N5IX 3R40A 4QDUA 4XJVA 3AIOA 4MWTA 4GHWA 1P0IA 3TJMA 3V1KA 1E3QA 5AOCA 2IIVA 1YA4A 3PDCA 1EB9A 1CQWA 1P0MA 4QLOA 3O4HA 3BF8A 2DHEA 1IUOA 3H2KA 4IH9A 4UBNA 1XZIA 1CRLA 1CUXA 4NS4A 5ALXA 1MO2A 1DQYA 5FUMA 1BEZA 2ONCA 3IULA 4EZIA 1QZ3A 3A2NA 3F98A 2FJ0A 1UOOA 1VE6A 2C58A 1UZAA 4UBIA 3ICWA 3ZLVA 3DDUA 1X2BA 5JADA 3AFIA 2CMFA 2PU5A 5CW2A 1H2XA 3G0GA 1GXSA 3V48A 2C5FA 5DYYA 3PFBA 2XDWA 2W22A 5ALNA 3Q0TA 3ZLTA 5JD4A 2RAUA 4HXEB 1ZGCA 4KAJA 5EHQA 3HABA 3D5EA 2ACKA 1JFRA 4IH4A 3STTA 1BN6A 4FMPA 5AKHA 1EVEA 3ICVA 5JAPA 4BBZA 2QJWA 1ZD5A 3FAKA 1K5PA 4QDOA 2XMBA 4X3CA 4UFPA 2Z8ZA 4BAUA 1D07A 3LS2A 3WWCA 3PE6A 5ALUA 3R3WA 4BE9A 3DEAA 3W2TA 3OURA 4MYSA 3ZI7A 4B9AA 2QT9A 4U2CA 2XMRA 1UK9A 2XUHA 2V98A 5HKAA 1XZKA 1E66A 1MX1A 1UKAA 4F5ZA 5C8ZA 3WWOA 3DCNA 2XQGA 5A6VA 4AQDA 1SC9A 3GA7A 4GDMA 4FDMA 4DMHA 1W52X 4G1FA 3I6ZA 3BJMA 3HEAA 1BE0A 3ESBA 5AI9A 5HK9A 2HU8A 1Q83A 2B20A 2GBFA 4AB1A 2HFJA 2BGNA 1XRMA 3C6BA 5ALLA 4BATA 1EHYA 3CN7A 5AM0A 1NX9A 4DNQA 4WDQA 2WHQA 4KAAA 5ALGA 2WUEA 1H22A 4HAIA 4ZREA 4C4XA 1IUPA 3GUUA 3GELA 5ALRA 3QBJA 4QNNA 2JEYA 3DL7A 1L7QA 1ZI8A 1TCCA 1GKLA 1WOMA 2PL5A 3WL7A 1R50A 4Z49A 3TEJA 3WKEA 4ZV7A 3L1JA 1YB6A 1EH5A 3CCBA 3HLKA 2HRQA 3H18A 2JF0A 1WHTA 4BAZA 4QWMA 2WHRA 4FFVA 4W1RA 1T4MA 1AKNA 1W4LA 1BN7A 1GPNA 1J06A 3QH4A 3QM1A 4JNCA 3B12A 1G42A 4FFWA 2RHWA 3CCCA 3PUIA 1VKHA 4Y2RA 1MT3A 2VQ6A 5SYMA 2QMQA 3WL6A 1P0QA 2Y2VA 4KYVA 2HA6A 3WZLA 5DTIA 2I3ZA 1XFDA 5FPPA 2ZJ6A 5EIHA 4W1QA 5HQ3A 2XUIA 4EY7A 2DHDA 2WG0A 4AZ0A 2C0QA 4QLAA 2PKYX 4MWSA 4BC1A 2JGEA 4K5QA 1YAHA 5ALYA 1GQRA 3ANTA 4Y2XA 2NW6A 4E46A 2ZSHA 3QMWA 4Y9SA 2WILA 2Z3ZA 4J0HA 2XLBA 1IZ7A 5ALTA 4B82A 4JYPA 1UKBA 2FJPA 2BCEA 2HA5A 4G8DA 2PSHA 4DNFA 3T52A 5AK4A 2WM2A 3AINA 2YYSA 3H04A 1EDEA 2ZYHA 4FNGA 5ALMA 4BZZA 5CH3A 5AOBA 1QTRA 4X95A 1EA5A 1BU8A 4KEAA 5JD6A 3BXPA 1EB8A 4GWLA 1MTZA 5E2IA 5LZ8A 5DYTA 3KXPA 1ODCA 3T4UA 3BJRA 4BP8A 3PUHA 5ISMA 1C7JA 3YASA 5T4FA 3UMJA 1H2WA 2ZJ7A 1DT3A 2YH2A 3I2JA 4MXDA 4G9EA 3R3VA 4OPMA 5SYNA 2IITA 1TCAA 1XZMA 2WUFA 4QZVA 4OCZA 5IVHA 5HF8A 4G4GA 3A70A 3HXKA 5JIBA 4H0CA 4BDTA 4H35A 4PW0A 1O6GA 1MU0A 4OB6A 4V2IA 2XQKA 2JGJA 1R9NA 4JUIA 5K3CA 1XZHA 3EQ9A 1EX9A 1VA4A 3EF3A 5LYYA 5ALJA 4BDSA 4BVJA 4H7FA 2G63A 3DQZA 4QWWA 3RKSA 3R41A 4C6HA 4M0EA 5JZBA 1VXRA 4FBMA 3O9MA 3VJKA 1ZD2P 4AO6A 3FSGA 2C0PA 4DYHA 2O2GA 5C7YA 4UBJA 4BCDA 5A2GA 2J3DA 2VJDA 2BUBA 1DT5A 2WIFA 2C7BA 1E8NA 1AMNA 1QO9A 4W1SA 1TKRA 3IA2A 2Y6UA 3FBWA 3B3QA 4KE6A 3BF7A 1C4XA 1JJIA 3AZPA 2J4CA 3ESCA 4P08A 3H2IA 1IZ8A 2QS9A 2XMQA 3EIOA 1CUSA 1EDDA 5HFNA 3IUQA 3V1LA 1CV2A 2Y6VA 4P93A 1CUEA 2HL6A 1WHSA 1GQSA 4IQ4A 4DIUA 2AXEA 2R11A 1ZI6A 4B0OA 3R3XA 4UBMA 4J0KA 2QR5A 4LXHA 4U2DA 1A8QA 4LXIA 5EGNA 4FLEA 1MN6A 1TAHA 5LZ7A 1BRTA 3WKBA 5LZ9A 3G0BA 2X76A 3O4GA 2GZRA 3DYIA 3HJUA 5AKEA 5DNUA 2GBIA 4UHEA 2JGFA 5HKBA 4BCBA 2I3DA 5LKRA 4PSCA 3N0TA 3WL8A 2XI4A 3F96A 5E4JA 2HADA 3C8HA 1CQZA 4B83A 2WTNA 5JZ9A 5JAHA 2OAGA 4QDZA 4X97A 2DFPA 4L72A 1DWQA 1ODTC 1UWCA 2GYUA 2WUDA 3D2CA 3O0DA 3A2LA 5HZGA 1A88A 4DM7A 4FLMA 3I6YA 5IVKA 4N8EA 3G0IA 5AK3A 3IBTA 1MAHA 1U2EA 1ZD4A 3BDIA 3RK4A 4BTVA 1GKKA 4B9EA 4B81A 1UK6A 2D0DA 4Y7DA 5HFAA 4ITVA 4PV7A 3WK5A 4B84A 1QIFA 5EHNA 5JARA 4X90A 3R0VA 3DL4A 1XROA 4UHDA 2XMDA 5CXXA 4ZRDA 4EB0A 1DWPA 3FVTA 3VJLA 1EK2A 1LPBB 2VAXA 3VISA 5K3EA 2WJ4A 3Q8WA 1S8OA 4OYLA 1GT6A 1EI9A 4WDRA 5CRIA 1FJ2A 2QUAA 3DS8A 3FVRA 3IIIA 1A7UA 5AK6A 4AX4A 3NWOA 1QIKA 4Q3LA 1PJAA 3L1IA 1QIGA 3H2HA 4FHZA 3IDAA 3WWPA 4OU4A 2PM8A 4WFKA 4LYDA 1U65A 1QOZA 2O2IA 4K6HA 2O7VA 1YCDA 2WUGA 5AI4A 1VLQA 1X70A 4F60A 3IB3A 1AZWA 3HSSA 3KD2A 5A62A 2H9YA 4GECA 5AIBA 1YB7A 1G4HA 2PX6A 5AOAA 4RGYA 4UUQA 1H23A 3OC0A 1VZ3A 2WFLA 3UUFA 3ZWQA 4PO3X 5ALKA 3WIBA 1XQVA 3W04A 2HDWA 2XUFA 2B9VA 4IO0A 2ZYSA 3WWEA 1CUGA 4CCYA 4PF1A 2ZYRA 3STVA 3G9TA 4EUSA 3WK4A 5AO9A 2X8BA 4H7IA 7YASA 2RIPA 3DNMA 2HA0A 1BCRA 2WU3A 4P9NA 2JGMA 1LPOA 5K3DA 1MJ5A 2OCLA 4NMWA 2V9ZA 4H77A 5CT6A 4EY8A 3F97A 3K2IA 3RLIA 4G4IA 2GBCA 2C4HA 2WJ6A 1ZIYA 1QFMA 3AJAA 5AH0A 2OPHA 1LPNA 1LGYA 4ETWA 5AI0A 4UPDA 5ALWA 5AM4A 3HYSA 2PVSA 3IVMA 2OQIA 4X6UA 5T4HA 4B0PA 1YSCA 3H19A 2D5LA 2J4FA 1VXOA 3GZJA 3C45A 3KSRA 1E89A 3HACA 2XMSA 2Y1KA 2G5PA 4HXFB 2DHCA 1E8DA 4EHBA 1JU4A 2HU5A 1CUFA 4KE7A 5AKLA 1L7AA 2WHPA 5ALQA 3R3YA 4CFSA 4Y2YA 1Y7IA 1UXOA 2CJPA 2OCIA 1LPAB 5ALDA 5JZSA 1NU8A 4AMYA 2V97A 5EHXA 3NUZA 4BC0A 5K3FA 2E3JA 1MX5A 2BAGA 3V1MA 1U8EA 3G8YA 4G8CA 3I2FA 1E8MA 2H7XA 1WB6A 3JWEA 1LZLA 1FFDA 1Y37A 5AM2A 3H17A 2ZVDA 1QIDA 5CURA 5LLSA 2QTBA 1J1IA 5FRDA 5T4BA 5DTJA 3DKKA 5CTAA 3CN9A 1MAAA 3SK0A 1YASA 2RGUA 1J2EA 3ZLUA 3F9CA 4CI9A 3TGLA 1Y7HA 1E5TA 3D0KA 5BOVA 2WFZA 2H7CA 3AZOA 2HA3A 1B6GA 1ORVA 5ALPA 1T2NA 2VEOA 5A7GA 1W1IA 5FDFA 5FLKA 5YASA 4OSEA 5JALA 1LNSA 1LBTA 3W06A 4YK7A 3C43A 3RARA 4AZ3A 4ZV9A 4B85A 3MUNA 5AKIA 5D3ZA 2WIKA 2WJ3A 1XRLA 1XKTA 1WCYA 4CG1A 1XQWA 4H7JA 1Z68A 3ZV7A 5JD5A 5D7BA 4FNMA 3UUEA 1FFCA 2QM0A 2I03A 2EDAA 1XZJA 1CUUA 3A2MA 1OILA 4BZWA 3D2AA 3G9ZA 2OQVA 5AKZA 4MJ3A 1ORWA 4RE5A 5KWJA 3BL8A 3F67A 1R88A 3WK7A 1ACJA 4DGQA 3IUJA 3D59A 1R4ZA 2WIJA 4J03A 1UKCA 1CUZA 3E0XA 3AIKA 3M82A 5AI6A 3WI7A 1XZAA 1DTEA 1FFAA 4RPCA 3S2ZA 2OCGA 1F6WA 1O6FA 4J3JA 3BIXA 2WSLA 1QIIA 2XUQA 4KACA 3PF9A 2JIDA 4G5XA 2AJ8A 4X6XA 2XMGA 3VJMA 4UFOA 4E14A 5EHZA 2FUKA 2WQZA 4X85A 2O2HA 4J7AA 5DYWA 2VT6A 4C01A 3H0CA 5AM5A 4WFJA 4B6GA 4XWGA 1JJFA 3DD5A 1ZI9A 2BUCA 5AJHA 5AHXA 2JBWA 4K6GA 1QIMA 2XMCA 5BWBA 3ZPXA 3KOOA 3H1BA 4G9GA 1OCEA 1HL7A 1QE3A 3DKRA 5FXMA 3H2GA 1JU3A 4UBKA 5K3BA 4KAFA 5AM3A 4GXNA 3L1HA 1MNAA 1EDBA 2OCKA 3FWHA 4UBLA 4IH1A 1THGA 3C5WP 1QJ4A 5A7FA 1MPXA 5ALIA 3SX4A 4X93A 5CXUA 2WFLB 4QA9A 2OGSA 1XLUA 4DNOA 5D6OA 4B7ZA 2VJAA 4NZZA 4X7BA 1USWA 1LPSA 4WY5A 5HK8A 4TPKA 3QITA 4Q34A 4GLBA 3D3NA 1R9MA 2PSFA 2AJBA 4Q05A 4BVKA 4UHHA 3RM3A 5K5EA 5BWCA 4BYMA 2OGZA 2XLCA 3QVMA 3QMVA 4HS9A 1CVLA 1TK3A 4X94A 4QDTA 4MQMA 1CUYA 1MNQA 2EDCA 3WLAA 1H2ZA 4AMZA 2PBLA 2I78A 1YS2X 4C4YA 1N1MA 2H1IA 5LIPA 1CUIA 4FLFA 2Z8XA 4PNZA 3WJ1A 4A16A 4WCVA 1QIHA 4G4JA 1XRPA 5CMLA 1CUBA 3M83A 2XUKA 1EVQA 1LPPA 3DLTA 5FP0A 1JKMA 4W1PA 3DOHA 2HIHA 2VATA 3LIIA 1P0PA 3O4JA 5IKXA 5AI5A 5AK5A 2BGRA 4AN0A 3SC2A 4MEBA 4ARBA 3I2GA 3STUA 3W9UA 3AILA 4Q3OA 3FLAA 1G66A 4DSZA 1PFQA 3V9AA 2VAVA 3C6YA 1A8UA 4F21A 3JYHA 1XZEA 5I7UA 5IVDA 3OPMA 1CLEA 2QJRA 4MEAA 2DSNA 4XIIA 1DU4A 2QXUA 4UFNA 4W9RA 1ODSA 3WA6A 4J0DA 2PSEA 3O95A 1WB5A 1CPYA 1AUOA 4YPVA 2O7RA 4GI1A 2G5TA 4HRXA 4BCCA 2IX9A 1BROA 2QOEA 1TCBA 2XUAA 4CIBA 1KU6A 5E4YA 3G0DA 3QYJA 2XUPA 3QPDA 2V96A 4X00A 3WIOA 2ROQA 1Q84A 2W6CX 5ALOA 1LLFA 4BRSA 4M0MA 4I4CA 1SOMA 1UOPA 4PSDA 2VJBA 3AUKA 4KRXA 3I2IA 2CUTA 2HFKA 3IUMA 2DCMA 2RI6A 4JEIA 5ESRA 4Y2SA 1HQDA 3FSGD 3WWDA 2Z5GA 1DQZA 1IMJA 2QZPA 4G8BA 4YX9A 2XUOA 2JEZA 2GYVA 3C87A 3TRDA 2BJHA 3QMMA 1GGVA 3CXUA 3M81A 4MQLA 3LIPA 4H7DA 4LYEA 1BEEA 2PUHA 3D4LA 4UBOA 2PPLA 5HQ3B 2VT7A 1XZDA 2AJCA 3U0VA 5CT4A 3SWWA 1RWQA 3G02A 3F8SA 5EI5A 2XT0A 2JGLA 3PICA 1HBJA 3W9BA 3C70A 3WKAA 1LBSA 2RONA 1XZBA 1IUNA 1F0NA 2WIDA 4BB0A 3N2ZB 2BKLA 5CH8A 3LLCA 5T4EA 1FFEA 5KREA 4TVKA 2GYWA 1PV1A 4EBBA 1K63A 5EIAA 2HA2A 3H1AA 1TIBA 4Y2PA 2XMZA 1U4NA 1M33A 2WU4A 5C8XA 2CB9A 5E4TA 1GZ7A 1XZGA 1XZCA 4FKBA 2HHAA 2VJCA 4L3WA 3ANSA 3W05A 3C5VA 4K6KA 1AGYA 3E3AA 1CUHA 1Q0ZA 2WLSA 4LXGA 3ILSA 2QRUA 3GBSA 4HXGA 4Y2UA 2XQIA 3K6KA 1CUVA 4XVCA 5LZ2A 4DMFA 1HKHA 1K6EA 4DTCA 3E4DA 4TGLA 4AXBA 2ACEA 2XUGA 4DSAA 4RE6A 5ALSA 3STXA 5ALZA 3STYA 1DX4A 4OB8A 3FCXA 4ZI5A 2WTMA 3E1GA 3PFCA 5ALHA 3X3HA 1QONA 2WIGA 3OOSA 1CEXA 2HRRA 5AI8A 5HCUA 3OM8A 3BIWA 4L0CA 1EXWA 3ED1A 4BE4A 3G9XA 4N8SA 4Q3KA 3GROA 4RNCA 1WPRA 3WK6A 1C7IA 5CT9A 4UHCA 4JYMA 1IVYA 1I6WA 4I3FA 5ALEA 4Q82A 2ES4A 3WKCA 1VA5A 3WYDA 5I9IA 2Z3WA 5DNWA 4X71A 4EY5A 1UK8A 2WG2A 1ZOIA 3M3DA 1ETHA 4CG2A 3GFFA 3FYUA 4BP9A 4KE8A 1AX9A 4BRZA 3C6ZA 3I28A 3ESAA 1QTIA 3VVMA 2VTVA 5JAUA 4Q1VA 1F8UA 2XB6A 3I6MA 4Y2JA 3EQ8A 6YASA 2Y2UA 4A5SA 4GBGA 4OUKX 1CIJA 2JGIA 4LIPD 2HM7A 1CUJA 5JANA 4KRYA 5ALFA 1JJBA 1UT6A 4GEGA 1UFOA 1UK7A 1SCQA 2QVBA 1FSSA 1HPLA 1XKLA 1XZLA 4WFIA 1CUDA 2HA7A 5HF5A 2RHTA 1F0PA 1WM1A 1HDEA 1XZFA 4QDXA 5AKGA 4LKOA 3G9UA 3WQHA 1KEZA 3WZMA 5A7HA 2YXPX 5BV7A 1VZ2A 3P2MA 2DQZA 5FKJA 5C81A 2K2QB 4OD0A 4H7EA 1AURA 3KDAA 2P8SA 3WK9A 3WK8A 1XRQA 4NVRA 5LKAA 3WJ2A 3I2KA 3I2HA 3B5EA 1JI3A 4C4ZA 1XRRA 5KWIA 1XLVA 1UOQA 1R3DA 4C89A 3I1YA 4KJXA 3C6XA 1QFSA 3LCRA 1ZICA 2J3QA 4J0GA 2G4LA 1YA8A 4Y2QA 4GW3A 4PQEA 5FOQA 4MYDA 1QIJA 4N5HX 1ZJ4A 1SCIA 5HF9A 1QIEA 4XX1A 2XQJA 1XLWA 5IH7A 1XQYA 4ZGBA 1HLGA 3FNBA 4U2FA 4S0XA 1B41A 3HC7A 4QEKA 3WL5A 2H7YA 5AKYA 4DMKA 5AICA 1J07A 4O08A 1N5RA 4FBLA 4J0JA 3FCYA 5FPQA 3VVLA 4K2AA 4HTAA 4UHFA 3S8YA 1CR6A 2ZJFA 2FX5A 2OAEA 2VA9A 3VXKA 4DMCA 5J3JA 4X92A 1K8QA 3EQ7A 5FV4A 1H2YA 1YAJA 1SFRA 2PUJA 3O9VA 2PSDA 3VDXA 5EFZA 5DNVA 4A23A 4EY6A 4CIAA 2CKMA 4J0IA 3V1NA 1BCSA 5H3HA 2OXEA 1YS1X 3A6ZA 5K3AA 3G0CA 4IHAA 3R3ZA 4P92A 1ZIXA 5AKXA 1VOTA 2B61A 4E15A 3G7NA 4OU5A 1AQLA 1G5FA 2PSJA 4L9AA 1VE7A 1WB4A 2HU7A 4DLNA 3C8DA 4X6YA 3BDVA 4PSUA 3STWA 2GZSA 2XQFA 5ALVA 1JT2A 4AO8A 3KWFA 1K4YA 2WG1A 3D7RA 5DJ5A 3JW8A 5DLPA 2CZQA 2Q0XA 1GPKA 3WA7A 4WJLA 5AIAA 3OG9A 5DWDA 1ZGBA 3O4IA 5CT5A 2AJDA 3KWJA 1CUCA 4HVTA 1FFBA 5HF6A 4ZWNA 2DR0A 4AN1A 1AC5A 2ZSIA 3QPAA 2CEKA 5IVIA 1N5MA 4H18A 4QE3A 1BS9A 3FYTA 4CCYB 1N8SA 4KR0A 1MX9A 2QKYA 5CH5A 4BAGA 1QO7A 5LP1A 3LP5A 2CBGA 2QXTA 4YASA 2X5XA 2AJLI 2XUDA 1W6RA 1YR2A 4BTLA 1XRNA 3NOXA 2QUBA 4ARAA 3FYUC 3K9BA 2XE4A 1L7RA 4FOLA 5C8VA 4C88A 3HRHA 4FTWA 1ZD3A 2HA4A 5EIEA 5CBKA 1R1DA 1ISPA 2JGKA 5F4ZA 3D2BA 1VJ5A 1QLWA 2OGTA 3FOBA 4D9JA 2ZYIA 1DINA 3QPCA 5JASA 4CCWA 4ZXFA 3IUNA 4UHBA 1KU0A 1LZKA 3QZUA 3AZQA 4HZGA 5AKJA 3U1TA 4OYYA 3DYVA 4HRYA 4JH0A 2EEPA 2C5GA 2WKWA 2UZ0A 3ESDA 5A71A
chains in the Genus database with same CATH superfamily
5BMVB 3EGEA 2XJ4A 3FCCA 3HUEA 1E5VA 4J0FA 2WHPB 1RQNA 4KXUA 2OLEA 1XD9A 5AHKA 3RSLA 1AUVA 1Q0RA 1QX4A 3Q7RA 3ZE7A 1DNPA 1COZA 3QW4B 4CMJA 4HX5A 3RK0A 1M7HA 1WXHA 4I4IA 2V7PA 1IQ0A 1WVMA 3NGMA 5HJ5A 4ZOCA 1PSWA 4C87A 4F3NA 1C2TA 1DX6A 3VKUA 4X91A 1U11A 2EQAA 3P52A 3W8FA 4QQ8A 1LJ8A 3RRYA 2AXQA 1ZX1A 1G8PA 3QG1A 2FMIA 1JDSA 3PL5A 1IZ0A 4EA6A 4I1OA 1L1QA 1L5RA 2H16A 2FPPB 1U3WA 2HXGA 3LFHA 4H3VA 4D45A 4LFBB 3CJRA 4YRRA 4U3JA 2DUWA 1NVAA 2I4RA 3NQ41 4MS3B 3GQBA 4OJMX 3BZBA 3DUWA 1KRXA 1A95A 2EX0A 3ZN2A 1KI3A 4PLFA 3RC7A 1KYTA 1KYZA 2IHKA 2QN7A 3MC1A 4RIFA 5F1PA 2HZ7A 3KOZA 2PWBA 4OHOA 1SIWA 1CP3A 2Y92A 1DWOA 1WXXA 3HP1A 4INZA 4QHTA 3Q98A 4URXR 3NTLA 3PDWA 1THTA 1XF1A 3TSZA 1JSZA 3Q9LA 1UJCA 1OLSA 3R5TA 1B42A 5HZHA 1XHFA 2M1ZA 1SCKA 1GPH1 3K6JA 2QX9A 3MGAA 4D57A 4ED9A 3HXMA 7MHTA 3IR5A 3TW8A 5DM60 1J2JA 1TK9A 2BFNA 3ECSA 2JZCA 4J2TA 3MRSA 2O5RA 4BNDA 1WW8A 4LJ7A 5CTJA 2X1VA 2VF2A 1UJ6A 4MA4A 1H0KA 3EZNA 3L0PA 2WIBA 1GZ6A 2P2SA 3EE6A 4Y6QA 1HETA 3IDOA 3AVYA 4B2YA 3F46A 1E6EA 2F59A 3ET5A 2NZWA 2NAPA 1OROA 4U2GA 2C9BA 5D1NA 1MXFA 2A8YA 3UJHA 3TLMA 4CG3A 3PSAA 2ZIUB 3B3FA 1HTBA 5A5FA 2ZDQA 4GYYA 2VBGA 3TZEA 2RDMA 2G0TA 2XWBF 3T7CA 4QOSA 2HQ1A 3FNQA 4QUHA 3QKRB 4PZDA 4EM6A 2I6TA 2ZS8A 4EUEA 1G16A 2DT5A 4BLOA 1AT1A 2Z83A 1K8YB 5FBQB 5E8RA 2MCFA 4Y2VA 3SBEA 3WKDA 1JTFA 1XQXA 1IBKB 3RVNA 1MKYA 1TTHA 3DBOB 1BSVA 1ZVKA 1I3NA 4YMIA 5LBTA 5HRCA 3V6LA 1MVLA 2Q8NA 5F4BA 4AIRA 3IIMA 3SSNA 5IJAA 3VKVA 1ZCZA 3O83A 1NJ8A 5KNBA 4J7UA 1W0CA 5GGYA 2O8FA 1Y5RA 2GRAA 3PNVA 1LVGA 4Z9FA 5D3KA 2J33A 2NM0A 5GWXA 3HBJA 4AZ3B 2FLWA 2ZAYA 5JPCA 4ESVA 4NFYA 5HIIA 5KYYB 4I81A 2CUKA 1IPFA 2LIPA 3OTQA 2CL6X 3LC2O 3IMCA 5JTTA 1SCUB 3JPWA 4EYQA 4A9AA 2W6PA 4YJFA 2AWNA 2P6MA 1CUAA 1I4DD 1NF8A 4EO9A 1QHGA 4MUBA 1PGJA 4M0FA 3T9AA 2HBZA 1T5DX 2JD1A 4X24A 1JWBB 5A5EA 5JDIA 5JS1A 2VJMA 1G5TA 1Q7BA 3D7KA 4G81A 5DX8A 2X22A 3MJ4A 3TQHA 1JQAA 3UV6A 2XSZD 1SRQA 2FFQA 2J6IA 4RJIA 2WSSD 4V38A 4FMDF 4NDZA 2IC5A 4YLEA 4XD7A 3UB3A 2G8NA 5BSKA 4A0HA 1RP1A 2BMAA 3RSZA 1P4RA 1LDGA 4HLQB 3K05A 4NCNA 3IURA 4Y2HA 4MH0R 1ACLA 2FZLA 4HNAA 4KNWA 4BVLA 3FLBA 4F6CA 4U00A 4FZRA 1Q21A 2PXHA 1GVHA 3FVWA 4K1LA 1M6YA 4XOIA 1P81A 4J1QA 3QPUA 4HPWA 1E69A 3DZDA 3RRZA 2YZ7A 3SQOA 4J0CA 2Z08A 3JVVA 3PWSA 5AKKA 4E5SA 5GQSA 5JAQA 4EGSA 1UPFA 2C9OA 4EKDA 2IODA 1PGOA 4EUFA 2J9FB 4YCSA 3PC6A 4S1TA 1RM5A 4RMHA 3WGVA 2JAQA 2JI6A 2WJIA 4XJVA 2WC1A 4BFUA 4MWTA 2I7VA 4RTPA 1V7QA 3AI7A 3ZH9B 3V1KA 5KQMA 1BMDA 3B1ZA 5I3CA 1V3VA 3UENA 4QPPA 5FTWA 3L7DA 5AOCA 3TBFA 2IIVA 4EVQA 6REQA 5MN6A 4NCBA 1BDJA 4XM0A 5JT1A 1UFRA 1SD5A 2B2XA 3HDGA 1VECA 1KL7A 1NW7A 3SQLA 3DZHA 4ZVTA 4M0PA 1PK7A 2VH5R 1J23A 2DUJA 2CDNA 3TPFA 5I45A 1YJCA 2DHEA 4DUYB 1V1MA 1E4YA 3FR7A 2V5AA 4ZHSA 1E9EA 4PBSA 1XZIA 5EMJA 3ZZ0A 3IAHA 4DZTA 3OOEA 4BQNA 4MI1A 2BL4A 2QL6A 2RH5A 5ALXA 4CKEA 2WVGA 3GW8A 4QBFA 4QVIA 3I04A 5T6BA 3DQPA 1VE1A 2E6KA 4UAJA 4M1TA 2JEOA 1F8FA 1M0TA 3IULA 5DRTA 5REQA 4EZIA 2KB0A 3A2NA 3F98A 1G4AE 2XYHA 3HH8A 5K6AA 3K0FA 4PAOA 4WGFA 3MQ2A 4A2CA 3LXXA 1BD3A 4M76B 1WNFA 3R23A 4N5MA 4DVGA 4XYEA 1P5RA 1X2BA 1Z6QA 5C1PA 5LIRA 1UIRA 3AFIA 1P44A 4F93B 5ARDA 2PU5A 4A8JA 5CDUA 3OETA 2XE6A 5TQ0A 2O1SA 3V48A 4WVFA 3FKSA 1PS8A 3WE7A 1AGXA 1QS0B 2JKVA 1M2OB 3OTHA 3PFBA 1U9YA 1DJLA 2XDWA 4M46A 5JBNA 5KOIA 1QRDA 1T9DA 2HAEA 4ALLA 3L4BA 4MUEA 3KD3A 4L15A 1KMQA 2NO0A 1PWEA 2ZUUA 3N39C 1C9DB 1VP3A 4JT9A 1JHVA 3JALA 3O47A 2BT4A 1SXJD 3MS2A 2G9NA 4Z51A 3T9EA 1BHO1 3JTMA 1Y80A 5C5EA 1QJCA 3JAWA 1EDZA 2RAUA 1KO1A 1N1GA 3ZXYA 4L0QA 2BMVA 3L7CA 4F4FA 1JSRA 1ZGCA 4KAJA 1O0BA 3EH1A 1X7YA 1O9GA 4CM1A 2ERYA 1CIVA 3WRYC 4UQLA 1L2TA 3JQ6A 3EGXB 1Z29A 3STTA 3UUGA 1DC3A 1CNMA 3D8NA 3OD1A 3HV0A 3LUHA 3ESRA 4FMPA 4D26A 4DV0B 1SCDA 3WGZA 4LF7B 1EVEA 3GX1A 1AJEA 2QJWA 3TTTA 1PFYA 5DIFA 5EG5A 1DPGA 1L3BA 4NBLA 1L5QA 2J7PA 1B8OA 1TJ5A 4NC9A 4NCIA 1C3OB 3FDZA 4ENTA 2I8CA 1KFEB 2JPDA 2OTCA 3RAEC 1J7JA 1K5PA 1BJKA 4BQRA 1YHYA 2PS9A 4L27A 2BMWA 3ETLA 4UNPA 5JG7A 2P11A 1SK9A 3S6JA 4B3BA 2REXB 5J4YA 3K9CA 1GG2A 3KPYA 1P8JA 2O0KA 1KMCA 1J8QA 1DC4A 3IAS1 4UEKA 3D8TA 1U6IA 1EDOA 4NH4A 2ZE8A 3MT0A 2R25B 4YRIA 3R3WA 4DGSA 1C1XB 3E5HA 3BRCA 1J9EA 2V6GA 4YMUA 3H65A 2HMWA 1LF5A 4M9XA 3HUUA 3DV2A 3ZI7A 5F2KA 1CG6A 2QT9A 3BCRA 3Q2KA 4EGAA 4XJSA 2XMRA 1K6XA 3BE6A 3O8NA 4PN7A 1PX0A 4YMWA 2JRLA 4RX1A 2IOHA 3VU1A 4QFCA 3U7QA 2FPOA 1P2SA 3UH0A 1WMBA 5C8ZA 4DDVA 3WWOA 4P0PB 4ZDJA 2W8BB 3ZTWA 1MO5A 3C1UA 1HORA 2VQDA 5CK4A 4OLAA 2A58A 1K97A 2ZVPX 3NAQA 4MUNA 5A6VA 2IIPA 4F4IA 2XDQB 3ZWMA 4AQDA 5LXTB 5TS2A 4Z4QA 4GDMA 2PTHA 3NKFA 4D43A 4M2LA 2ZAIA 1U0OC 4JUFA 5GONB 2AH5A 3N75A 4G1FA 4RCVA 2FN8A 2PUVA 2YN2A 5BWMA 3I6ZA 3LL4A 4PPNA 4RPIA 3PXGA 1QQ7A 3FZNA 4Q15A 5TIIA 1XA3A 1PTJA 2D0IA 2VPZA 4J43A 4RD3A 3P9IA 1NYLA 1A96A 3PDJA 3PFKA 3RRMA 4OY3A 3H5TA 3N5CA 4XQEA 5B7QA 1DFIA 5HK9A 2HU8A 4RY2A 1Q83A 4J07A 3X2FA 3THXA 1GN8A 2FP4A 3OQOA 4IFIA 4U7FA 4MRRA 5FFMA 2Q3FA 3SIXA 3KQVA 2GBFA 3MHPA 2QRGA 3B89A 5IJ0B 2HFJA 1JKFA 3UFBA 5CIYA 1WCXA 4QUIA 1GPUA 1RXEA 4FHCA 5ALLA 4M9RA 1LF0A 1U2PA 4BATA 3DFZA 4W8HA 5FLEX 2A9QA 3DXFA 5GM1A 3USCS 1ESDA 2BELA 3HYRA 4QBGB 1T5LA 4M0CA 2BFPA 1KY4A 4DNQA 1CEEA 1HC7A 3HR8A 4RM3A 2Q5QA 4WDQA 2IHVA 4JXJA 1DLJA 3LZDA 3LVBA 3WYFA 1VPLA 3A1CA 4KFRA 2AA3A 4FYYA 4KAAA 4M9QA 3DTNA 4ERNA 3DAOA 1OUMA 4IBOA 5ALGA 3GVXA 4AJEA 2WUEA 3AM1A 1Z34A 1U2GA 3HVJA 1J1ZA 5TY0A 3QMPA 4RLQA 4AY6A 1IUPA 3GUUA 4PZZA 4QO7A 2B25A 1L8QA 4KZPA 4AMVA 5ALRA 4TKUB 5C1IA 3HY6A 2PLWA 1PT8A 3DCYA 2H85A 4JVSB 4LNHA 5D84A 4B3DA 3DL7A 4RHYA 3TOZA 3ADKA 4HADA 2ZBDA 1UZLA 2IHBA 3SM9A 2CNOA 1EYZA 1GKLA 5K51A 1M76A 4IHJB 1S2OA 3VZBA 2YIMA 4OHKA 4ZT5A 1C30A 3IELA 5K8CA 1VE9A 1WAMA 4ZZ0A 4NS1A 1N0HA 3TEJA 3TXAA 4YJKA 3OE7D 1N0WA 3UN1A 5FOTA 4DBLC 5FWYB 1ECLA 1D6SA 3QVXA 2O8NA 1L4MA 3L1UA 3OT1B 4Z4IA 2G71A 4PCLA 2FOLA 3UANA 2V5UA 4AC9A 3QV2A 1MLDA 2AL7A 2QTVB 4P35A 4C7VA 1YB6A 1DOZA 4HYEA 3BTUA 2G06A 2QHXA 1EH5A 5IAJA 1TZJA 4HZIA 3BEDA 4KQ1A 5I9NA 2NU7B 3ES9A 2PIAA 3JCZA 1SKAA 2O2CA 3P94A 2UDPA 3M4NA 3RYCA 1ODFA 3AV3A 2YV2A 4L5BA 2OGWA 5EZYF 4I46A 3DOJA 3F7NA 4LXUA 1GRNA 4N7BA 4YP0A 4BAZA 5A6SA 1GGHA 1GFZA 1M6EX 4EARA 3OQNA 3BFVA 5DIZA 3RC9A 1FFHA 2W6ID 1QH8A 2X4LA 1V25A 3BREA 3OWHA 2XADA 4RFSB 3K16A 1T4MA 1SVIA 4XUCA 4DJ5X 5BN4B 5TQVA 2PZLA 3QM1A 4F3YA 2ZCVA 3KNZA 1KJJA 3B12A 4JHXA 1ZW1A 3RWMB 5E9AA 1G8JA 1ZMTA 3L7BA 3MSXA 2FG5A 4RD2A 4WCFC 2NQTA 2ODEA 2IEYA 1PQPA 4N47A 4PHFA 4MJXA 1Y8QA 4JB8A 1MT3A 2I91A 4Z9XA 5SYMA 4AKTA 4C0SA 4NYMR 3OOHA 4JT4A 5HS6A 4QG3A 1WKVA 2ZLBA 1JYFA 3M4YA 3FPAA 1N2OA 3TCXB 5DXJA 5C0OE 3OZDA 2Y2VA 3MUEA 5F5NA 3S5JA 3WZLA 5DEOA 4OH7A 1JAZA 3NLLA 5EIHA 1MB0A 4D9EA 1R0WA 5I7RA 4RTRA 5EEHA 4P3PA 2OESA 4RJTA 1XUOA 3CLVA 3CNEA 5BSMA 4IX9A 4UREA 4FIZA 4EPWA 5C9ZA 1WQ3A 4QLAA 1N0UA 1PT7A 5FH9A 4RTKA 4FOOA 1ZW6A 3GMIA 5LOVA 4RSRA 5TEWA 1RRMA 3PHIA 3VR2A 4DA7A 4D0SA 1XO1A 1BO6A 1V16B 4UZSA 4CEIA 5CAEA 3RS2A 5I4KA 2IUSA 4MZXA 5ALYA 3ONVA 4E5PA 4M9CA 3CEJA 2BFDB 1GOTA 1NT2A 4R2IA 4BGEA 4ZPXA 4JEHA 5IMSA 4OJYA 3A1NA 3A6FA 2VPIA 4HN2A 2ZSHA 3B7WA 2R7KA 3QELA 3EY9A 2QG4A 1G20B 4GZ5A 1IZ7A 4EQ6A 4OI4A 3MMPA 1ZBQA 3CKMA 3PPXA 1UKBA 2GTPA 3I61A 1TPYA 2XDYA 5ICGA 4NU5A 5D7NA 2WTXA 1C3JA 2COKA 2PGIA 1WUTA 4X9XA 3B3GA 2W6NA 1EP1B 3EGOA 4CKBA 4EITA 1U8FO 2HUPA 3DMNA 4OHUA 4R2HA 2FMHA 3F90A 4M1OA 3PEWA 5CBPB 2Z04A 1GDTA 1HOTA 2GZDA 1E58A 5JCOA 4FCVA 1S3SA 3RVMA 3RVKA 1CB7A 4HNUA 3B1YA 4H6PA 5C46F 1AO3A 1V95A 5LNK6 2A86A 1QBGA 1QHSA 3I6QA 4JXKA 4MKZA 4N6OA 4RUKA 1QK4A 1NTOA 4UDOA 4H1HA 5EN4A 3ZW7A 4PC6A 1QGDA 3RFXA 3IUYA 1QG4A 5AOBA 4TV9F 1JDJA 1QTRA 2E5FA 4MJLA 5HA5A 1JX6A 1S9HA 5EXSA 3G3EA 5IN4A 4YAEA 3QRWA 1EB8A 1YFKA 1XNGA 4DLPA 2VYND 1OBVA 1MTZA 5EA2A 1D0SA 1RRCA 3JQPA 3IQZA 4A8JC 3BTOA 3LGAA 3T9BA 2OFFA 2A9KA 1WUIS 4OXQA 5AXDA 3HGTA 3JD2A 4WADA 4DARA 1E4EA 3S99A 1IDN1 3B2EA 2IHYA 5EOVA 2IP4A 4DEVA 3I37X 3ECAA 5ESXA 1CIPA 4ACAA 2IH2A 2OEPA 2I71A 3QKIA 1O95D 5DTMA 5FNVA 1VIAA 1UJ5A 1WEHA 2GPJA 3RI3A 2O0MA 2O20A 1YQGA 1QAQA 2B0CA 2BONA 3I2JA 5DOVA 1I5OA 3SJCA 2OFXA 4QQFA 2WYIA 2IITA 1ZKMA 2GA9A 1C3VA 1Y1SA 1TCAA 1NYQA 1XZMA 2C2OA 3KPWA 4LDJA 4Q24A 4Y6GB 3JX9A 3RJ9A 3U7GA 5IVHA 5TVKA 1K98A 1U0RA 2AV6A 3DAHA 3HXKA 1G17A 5B1SA 5JIBA 3V4FA 1J6UA 5T3YA 1RBMA 4BDTA 1IIRA 5I3ZA 1ABBA 4YY3B 2GK4A 4DZRA 3NUQA 2YFKA 1GIAA 1VIVA 1HE2A 3H5OA 4ECEA 1KZ4A 3KSAC 4ARIA 4IEIA 4HJRA 2OQRA 4GBED 2WF5A 2GHQA 2IYNA 3EQ9A 1OKKD 1QYWA 3IYLW 2IU4A 2O7SA 1VA4A 3AB8A 2UXDB 5ALJA 4FB4A 3TQOA 2G63A 4LDPA 3T3PB 3Q7SA 2QL9A 2M9MA 2RKOA 1J70A 3H83A 4GC5A 4Q4DA 4RTSA 1AKWA 3ZU2A 1O5TA 3PE3A 2VHTA 2NUBA 4L9RA 4RZHA 2Q6IA 4NI5A 3GT0A 1XDUA 4MULA 3JQAA 4DMUB 4JJGA 4RSMA 5DM4A 4F8JA 3R5FA 1JEQB 3BBPA 2EJUA 4IZHA 4QGFA 1KEKA 3L0ZA 2J1LA 4WOJA 4M0EA 2ZUTA 4CCAA 1VXRA 4ZYXA 3OICA 4YRQA 1GXSB 2I80A 2YS7A 3EVGA 3OZUA 4ZT6A 2CKDA 2H0RA 2JL1A 2MSWA 3IX7A 4RFVA 2Q29A 2VWQA 1DRKA 3VJKA 4AO6A 3MOIA 1KSJA 2CE7A 1XU7A 3D5QA 5C7YA 1E1DA 3QWIA 1O54A 2NO5A 3A0UA 5CM8B 3RB8A 4YP7A 3O03A 3KB8A 4DLLA 1Y34E 2DBRA 3M6WA 1A4UA 2NSJA 5IEBA 2R1TA 4FOSA 3S55A 4YR7A 3I92A 3EPKA 4PX3A 1AMNA 2P91A 4UTXA 3USZA 3GN1A 4B3HA 5TT0A 4ZIRA 4PIPA 5IFKA 1JDZA 1G60A 3D3WB 3HJCA 3S68A 1PNQA 1TO2E 3HJRA 1L7PA 1N2CB 3FBWA 3K0BA 4M89A 4NBUA 4CM5A 4F3TA 1NNI1 1WCV1 2NTNA 3DBHA 4PG5A 1A9PA 1JJIA 3QLVC 3BH0A 3ZY3A 4BASA 5ICEA 3AZPA 1KRWA 1NFFA 2QTWB 4II2A 1KERA 4UUOA 4P08A 4CFZA 4NRDA 1MC5A 1PTJC 1ECGA 1G8MA 3OX4A 1JP7A 1A4IA 3PPVA 7GPBA 2YJTD 2C83A 2FEKA 5LMUB 3QFTA 1JLHA 3Q10A 1PQUA 4N3CA 4DOMA 2VTKA 5CDHA 1RVDA 2XAUA 4QFDA 4D3ZA 3ZWCA 5KJFA 4JITA 4XQGA 4ZTBA 5DH9A 5IVPA 3OLZA 2ZJ2A 3ZD7A 1XJ5A 3HI6A 4INJA 1SC4A 1LVHA 4P93A 5CVUA 2W2VA 2HL6A 2O3UA 4EZBA 2YXLA 4KNVA 3ANXA 1WHSA 1GQSA 3FVQA 1EFPA 2A9JA 2I54A 4PYRA 2B94A 4GL4A 4POAA 3RUAA 3EIFA 3MJEA 2R11A 2F4VB 3M5PA 1TJNA 2FRXA 2ZROA 3KYBA 2J4DA 3P0HA 4KO4S 4ZAZA 5BPFA 1AS3A 4XUEA 5C51B 3ASUA 5DNYB 1QHYA 2ERCA 2QR5A 4P7GA 4LXHA 3NATA 1LS1A 2UUBB 2B4AA 1A8QA 3PGVA 2Q1YA 4LXIA 3T8YA 4KQMA 4TWBA 2RGCA 1AUXA 3EWSA 1YDWA 1BS1A 3BH7A 3RYFB 3SXJA 3KLOA 3AEUB 1HFJA 1U2GC 5EAIA 1P31A 3T7TA 4M0LA 4D4HA 4HGQA 2IPLA 4LYGA 4JL8A 1YU9A 4TSKA 3G0BA 4HY3A 4U8GA 3S0JA 4D3FA 5BXYA 4KYTA 2QM7A 5AKEA 2Z2ZA 5DNUA 1OYVA 3LBYA 4L50A 5GIPE 1XJQA 2CJXA 2I3DA 2WU8A 1WTCA 4LK3A 2O9JA 4RTMA 1X7HA 2ZJ3A 2JBAA 3VGJA 3N0TA 3WL8A 1L0BA 3L9WA 2G28A 2YWDA 1MOQA 3A3KA 13PKA 3C8HA 2RGNA 4CF3A 1CQZA 3CNHA 1N3BA 5CDSA 1T0UA 2WTNA 2ETVA 3BXXA 1QF9A 3IHTA 3ENKA 4HH1A 1NVVQ 2YOFA 4AD8A 1MHPA 3TIIA 1LU9A 1EXMA 2Q0SA 1FRFS 1U28A 2G7ZA 1KSGA 1DMRA 1HQKA 3WQQA 4UTPA 3ICQB 1ZBDA 3C3PA 5U1PA 1PE0A 4BO8A 4FZJA 3O94A 3A2KA 3WDSA 4RW0A 1QTNA 1DWQA 3BULA 4WQMA 4D80A 1NQVA 2JHCA 3KOMA 3RC1A 1QU2A 3UPUA 1RAAA 2VPYA 4C7BA 4BMXA 1QR6A 1QG0A 1O2DA 3E53A 4FGJA 3KT8A 2ZXEA 4L73A 1NBWB 2X1LA 3DO8A 3VO9A 1RZRA 5BORA 3IIJA 3O0DA 5TSDA 3FTCA 1PDWA 3E3LA 3ITDA 2C82A 1H2RS 1ZCJA 4OGLA 3DEZA 1CDOA 1C9JA 1QYIA 3OJXA 3PYXA 4DM7A 2HQBA 1EK6A 5BYJA 3SS9X 5AVRA 4C7OB 4GKKB 2QX8A 3AEXA 3L8CA 4I5DA 2YVAA 4HN4B 5HPYB 2IQ5A 3RSFA 5C7IO 4YQFA 2PRKA 4V0NA 3AR2A 4N8EA 4B4KA 4YUZA 3A9WA 5AK3A 3C6KA 1PT9A 3HMQA 4Q01A 5DSTA 5HSGA 1U2EA 3T7KA 3D7SA 2WD7B 1K6IA 1NBOA 1FNSA 1B73A 1NWHA 1QBKC 1ZM2A 3HFGA 3ZV6A 1ZD4A 4X1IA 3BDIA 1VHDA 3AJ8A 3I9FA 5T5QA 5L4LA 1KZHA 4QJBA 4K0RA 1RMTA 1W44A 1M2JA 2VDOB 3SBXA 3ZDYB 2WTBA 2NUAB 2QAGA 4B81A 2E1PA 1KK1A 4BZXA 2UVDA 1PJTA 1Z06A 1Z5GA 3ZVLA 1ZR4A 2K87A 4LC0A 4NCHA 4CXMA 4XLTA 5EE3A 4ITVA 3SR0A 3BFXA 4ME6A 3TGWA 4DT1A 2OFPA 2R1VA 1XTBA 3GYGA 3ENNA 3TE7A 4EG8A 1DKOA 1E5XA 2MT9A 3C7TA 2V7TA 3BRWD 3Q7IA 1GARA 1M6WA 2KI5A 4I1RA 3WK5A 4KO1S 5TE9A 1XVAA 3WMFA 4B84A 3AVWA 1L7XA 5FR1A 2CCJA 3EZ7A 4NEGA 2PWPA 1Z8FA 3L2OB 4LZAA 3EVNA 4G0ZA 5EHNA 1J8MF 1EUYA 4Z0PA 3V00A 3DL4A 4E5KA 4D97A 2FW0A 1XROA 1Z22A 1L8AA 1V5WA 2EHDA 1A2BA 4UHDA 2XMDA 3MJVA 4ZRDA 1V4VA 2ADFA 4RKRA 4AJ9A 2O54A 4JI7B 3F6CA 1DWPA 2G76A 4FNAA 1IQPA 1LPBB 1NXSA 4GOND 5JCZA 3NOQA 4JJ8A 3ISJA 3K1ZA 5M5BA 5BR8B 3MJHA 1QGAA 1HI9A 3UOWA 1WX1A 3QK7A 4OYLA 1D5CA 5ECWA 4DLTA 5L3SB 5LYJB 2G7MC 2E5LB 3ASVA 1YMVA 3MTIA 5E1DA 3T3HA 2HIGA 5JCOC 2VNHA 4AM8A 1LDMA 3SHTA 1WCIA 4D9BA 4OSOA 2ODAA 2FQQA 4A26A 5HRUA 1GAEO 2R5WA 3DOOA 2APJA 4J94A 3U3DA 3LL7A 2QW1A 4PX9A 4LHWA 4WOPA 1KZ9A 1TEZA 5G40A 1NJ5A 2AI1A 2WJAA 3LT0A 2QVGA 3FVRA 1RJ9B 1SU7A 3O1IC 4KXFB 1HZZC 3KQKA 2N75A 4UAUA 1H6DA 2GCNA 4OXXA 4AZ0B 3RS3A 2WTAA 4MDHA 1KI1A 1PJAA 4JBXA 3L6BA 2RHHA 5JVDB 5KTRA 3RREA 1UDWA 3A6HA 1MB9A 4C6TB 1JEDA 3KP1A 4RGQA 1YZ3A 5WRFA 4DCVA 3BGSA 1FNBA 1TM7E 4Q6WA 4RD4A 3GLGA 3EAFA 4AECA 1FW8A 3A6DA 4CTKA 5LFAA 1SWWA 1PJQA 1OYWA 5DYGA 1U65A 3QVVA 1SVWA 2O2IA 4GYKA 4XZ3A 3AR5A 3UPTA 5KCMA 3HLYA 1QX3A 5C3UA 3BEOA 4YCLA 2JA2A 2WUGA 4RDXA 2H2IA 3PT5A 4JJIA 2MYNA 3ZQ6A 4KU4A 4QOJA 3AJEA 2IU0A 4WXMA 5F21A 3PLAE 4BO2A 5FA8A 5L3QA 3NTUA 2HHLA 3F0TA 1PGPA 4PFQA 4BNHA 2FR8A 3LCUA 2GZAA 4KG7A 4QUJA 1SC6A 5D86A 3REFA 1Q3TA 1O9HA 1ZISA 3IV6A 3JR3A 1IL0A 1JKIA 1DOHA 2QPOA 6GPBA 2AFHB 1YB7A 3GNSA 2TRSB 3H7AA 3ORQA 4DY6A 1V26A 1R37A 4PTZA 1HYBA 3COSA 3MK31 4UUQA 1MOZA 1OWLA 1SHTX 1UEXC 2GJ4A 3D81A 1B0AA 2V0NA 2ON6A 3L8ZA 1KYYA 3MELA 4Y9UA 5DM1A 3THOA 3U81A 3VO2A 3CPJB 3ZOKA 3NHUA 3GQVA 3CE6A 3FDFA 1RMQA 3RRFA 4G37A 1O0SA 3UUFA 5IKMA 1QPZA 1YDFA 4MS1A 4HNSA 1X7WB 1ZNZA 4O2BF 1Y3DE 3RTCA 3ZWQA 5M29A 2DPLA 1RE0A 3QE9Y 1M2FA 2HDWA 1RHMA 1LQTA 3B7PA 3QX9A 2LV8A 1P1RA 5DGCA 3X0DA 5AJVB 3AFGA 1PK8A 1EKXA 2HIAA 2LDBA 2XUFA 3PNPA 4IO0A 4KLRA 1KI2A 4LECA 4WXPA 5D6NA 4MV0A 1J97A 1T2CA 2QM8A 4BNUA 5K0JA 1TI7A 3D4PA 1OLUB 4YUVA 2W58A 3H9QA 4G09A 4DL9A 4IJVA 3RGWS 3O74A 2CCKA 3EGDA 3N9IA 4CCSA 1NWCA 1XL0A 1H9BA 1PVVA 7YASA 3L46A 1TPZA 1V7CA 4U39A 3FY4A 4NL4H 1UP7A 4FONA 1GSHA 1BCRA 1SCJA 4GOOD 4RD0A 3N7TA 4INAA 4DMLA 3GOHA 1Z2CA 3X2SA 4ZJYA 1QSGA 1LPOA 4KQFA 2P5YA 2WSMA 3NT5A 5K3DA 4DQKA 4ZK6A 3HRIA 4NMWA 5K0FA 4ZICA 1KRHA 4TUYB 4UOQA 3THYB 4ZTUB 1DZ3A 4IQFA 1S1CA 4DV2B 1NGSA 3W5UA 4CL8A 4NDNE 4E5MA 1YE3A 1QR2A 3SYNA 1Z8NA 4PR0A 2OP0A 3LI2A 4TRRA 3D3JA 2C4HA 3ZEAA 1AM4D 3VR4A 4N0EA 4GO1A 3ZI0A 3BS4A 5AH0A 2ZTMA 3HY4A 3JSAA 3V34A 4HH3C 2VRCD 4OLHA 5IBRA 2YJ4A 1Z45A 4LJYA 1L9XA 1QGYA 5IUKC 2JD0A 3AUAA 1RT9A 4JOQA 3QU4A 5AI0A 2HSJA 1KJIA 3SZMA 2FLKA 4QGHA 1W7AA 4B48A 1C1DB 3GPCA 3W2HA 1RAFA 2D3WA 1UKZA 1FZQA 2P9ZA 4P4GA 2HWYA 3NJ8A 1G20E 3I5MA 3O2SB 2VZLA 4BX0A 2BGTA 4GS5A 4TXLA 2B34A 3L1KA 5ARBA 4F6LA 1FFXA 4RJJA 3ZTYA 1HDRA 5C80A 3IQFA 5DB4A 3PGLA 3HXOA 2XMSA 3OM9A 2BP7B 2FAXA 1YI1A 2Y1KA 3HCEA 3M49A 2JGDB 3D6MA 3FNIA 4DCGA 1KQFA 3QWBA 1DAMA 4FZ5A 3ZHBA 3ZNOA 3F3SA 3WQRA 4B4OA 1E8DA 3TBKA 2W90A 1E1MA 4K81B 1JU4A 4M1QA 2FSPA 2FEPA 4FHFA 4EHDA 5B5SA 4BZQA 4MUMA 5EWLA 4J0EA 1AF4A 3KQQA 2VAMA 1H1TA 3N70A 3LY7A 3V9PA 1WXGA 3G8DA 1M1YE 2RHLA 5BV2P 1R9GA 4N3AA 1CJKC 3O2QB 4ALIA 4XWWA 3VO1A 5FEMA 3PHLA 3ODGA 2Z30A 3FPBA 4KDRA 1EUCA 5FWNA 2Q9BA 5AW4A 1JIJA 1XJWA 3HB5X 3QUCA 4KBGA 3P0EA 4CFSA 4Y2YA 3GEMA 3REQB 2OCIA 1LPAB 2O50A 5ALDA 5JSZA 1P4GA 2V55B 1OLOA 3HCRA 4Q9LA 3GLGE 1A7JA 1YE8A 4ZOLF 2BR5A 1NRWA 1U28C 4ZCPA 3RF7A 3MWEB 1SCNE 2FFRA 3LUCA 3PFNA 4J4HA 5KHAA 2RC6A 3ADOA 3HCFA 3X1XA 2E3JA 2BAGA 2OM6A 4BN4A 2OWEA 2Y27A 4G0WA 1U8EA 4HAZA 4YJGA 4LWQA 4BJ5A 3I5AA 2GWHA 3OU6A 2Z3VA 3RYIA 1Q6YA 5E6UA 4CMBA 2JRCA 1DO8A 2RI0A 1VL0A 1WB6A 1D2AA 3T7RA 1WETA 4BP1A 1H3EA 4GICA 1SMKA 4QGAA 1FFDA 1SUFA 4P5EA 4Y1EA 5EP3A 5TMBA 4LXXA 4BV9A 4JIMA 1IAQA 4FW9A 2ACWA 3KEOA 3LXUX 4LOHA 4PAWA 3O8RA 2GARA 3L7IA 3F6EX 4NOLA 1BEUB 5J43A 3R7NA 3CIOA 1AQNA 1ZXBA 3BK2A 3WRWA 4IP0A 1J1IA 3H9CA 3UWOA 5JZOA 1NMSA 1JH8A 5BW8A 1G59A 2BFEA 5DTJA 3KZNA 3SN6A 1IJEA 3CN9A 3F4KA 3GGGA 4JU9A 1FX0B 5JCJD 3CV3A 3DKIA 1D4OA 1MAAA 3CEHA 3ZJ4A 4ZI7A 3I5XA 3BMXA 5JW6A 4KVAA 2Q8PA 1KFJB 3PDIA 5TMDA 3EMDA 4DWOA 3TG8A 2GCEA 1VMIA 1YZTA 1J2EA 2H8KA 1B4DA 1I2BA 1NONA 2GK6A 4OHYA 1W29A 1WNTA 1QFYA 5EXEA 3VM6A 1OU4A 4EG1A 2LUOA 1JR3A 4R84A 4BMVA 1N3IA 2C98A 2CWWA 1JZSA 3NM5A 3TGLA 1Y7HA 3AJDA 4A1FA 2QAGC 3HDJA 3RW9A 2SKDA 4D82A 3OJCA 5CDFA 4TYWA 3RFFA 2BD0A 4D4IA 1NZFA 4ARCA 1U0TA 2HA3A 2WSIA 2VK8A 3AZOA 1FUUA 3LV8A 3MS7A 3CUEF 3MM4A 5A9RA 1N4AA 1C9MA 2P6NA 4MRPA 5ALPA 1T2NA 1MPTA 2P77A 2XOKD 1AZSC 2F9LA 4CTNA 2ZUBA 4YJ3A 4P2GA 2CXSA 1BQEA 3LT4A 3TIGA 3VSEA 4BO0A 1ZN2A 2V6MA 1YONA 2QXYA 3A9SA 1AB5A 4FR0A 3UW1A 1SH7A 3NV9A 1FRZA 3C43A 2Z8YM 4ZV9A 3UGTA 3MUNA 4Z4FA 3HHPA 4P98A 4AW9A 4E2YA 3RSGA 1T2AA 2WIKA 3JQFC 2YYZA 4TLDA 1YT5A 3I8OA 3S8MA 5FOXA 4I50F 5DV9A 1C14A 2QTCA 3U4HA 3R7LA 1AMOA 4EHIA 4KSBA 2IUUA 1A7KA 1ZUD1 2CLOB 1LW6E 1NBHA 2WKRA 4YRCA 5G53C 3ZV7A 5JD5A 5JRZA 2KJQA 1RCTE 1OGJA 2ICAA 4KV7A 2H1RA 4PU0A 1VCIA 3FHCB 1EVJA 3KVVA 2AFVA 4FNMA 4MCIA 4V1CI 1QVVA 2DUUA 2QA5A 2WP8J 1BIFA 1XZJA 3A2MA 1I2ZA 2GCPA 2H2AA 3KZXA 2LIVA 3PHJA 3KETA 1EWQA 3BB1A 5GZ6A 2ZR8A 3QNWA 1QZXA 2EZ9A 1JDUA 1WL8A 2Z2YA 3AF1A 4P0TA 2K5UA 4V0RA 4TQAA 3TTUA 1XAJA 2VP3A 2A7QA 3IR7A 2YCBA 3F2IA 4G01B 3HCAA 2OLKA 2C2BA 1H5QA 2MIIA 1A2OA 4ND2A 3FHTA 4Y6LA 2AK3A 2Q0HA 1U8XX 1UBRS 2WQ6A 5TQ2A 4K9RA 4P2BA 3Q9SA 4F4UA 2QN3A 1P61B 3IUJA 4A0FA 4GBJA 1R4ZA 3JWPA 5AVSA 2CFRA 3KZMA 3WOHA 3A1UA 3AIKA 2GSWA 2BM9A 2J31A 4TYNA 1EZ4A 1LWOA 1C9EA 4A10A 4CR8A 4ENSA 5KOYA 3EIQA 3UAWA 4DC0A 2WF8A 3Q3EA 4WBNF 1KZGB 1CT9A 1OI4A 3OOJA 5AI6A 4JN6B 5EIBC 3GGCA 1F5NA 2Q4EA 2EKLA 3NBYC 521PA 1U3TA 2VPXA 4DMRA 3DBRA 3SBDA 3VMMA 2NPOA 3PQ6A 2Q3LA 5CNJA 4S05A 2OCGA 4EJ0A 5CJ2A 1BVHA 4LMBA 1O6FA 3AERA 1W4RA 1QIIA 2X4GA 4XUDA 1LK5A 1SC3A 2R6GA 1KOJA 3MCVA 2NUPB 3V7FA 4EPVA 2YIVX 1VPEA 1TTQB 5ICMA 1NULA 1Z5NA 1OI3A 1E6CA 3O1JC 5BSWA 1EXVA 4O4JF 1H6CA 3VHXA 2LDXA 3AEYA 4QPDA 3SZOA 4BO3A 5BT8A 3NFYA 1V2GA 1OZHA 2O3SA 4LOKA 2QSJA 3O3OB 3SQMA 4CUZA 1JHPA 3NVKI 1W30A 1JHOA 2BBSA 4YT4A 2R00C 4Q12A 4PS0A 3IEIA 1ODLA 4E7OA 4I50A 3LY5A 2P9HA 3JWHA 2D54A 4LSWA 2ATCA 3RJMA 5KYKA 2M2IA 4JK3A 4MYTA 4AYXA 4KGZA 4DHEA 2G3YA 3TW0A 2V74B 3SZLA 2PRZA 2BTEA 3G7UA 1E7SA 5GAJA 1UDRA 4C01A 3H16A 2RK4A 3JWGA 4BVEA 1IEXA 4MRAA 3IFSA 4HYQA 4OM8A 3OPQA 1LRKA 5DNEA 1AV7A 1H2AS 2XE7A 5BNIA 3U3XA 3H1PA 5FHQA 1DJMA 3AY7A 5GJBA 1OC4A 1Z62A 3DD5A 1SXPA 3ELUA 4MWDA 1MENA 3PGA1 1EEXB 4L3OA 3ZKWB 1T8UA 3GGJA 2YDXA 4Y98A 4BBPA 1B1CA 3ESQA 5AHXA 1MHTA 2VIIA 4YMLA 5IANA 4ZC1A 2OO3A 3LHIA 3HYCA 4GPAA 2DQKA 5BWBA 4EJFA 5KVVA 1S2MA 1JDBB 2A88A 1IEWA 4TMWA 4H2DA 1GU7A 3IH5A 4CLOB 4OHCA 2BM0A 1H1LB 2A92A 1HL7A 1C0EA 2R4UA 2YVKA 3OIWA 1G18A 1LSSA 5FXMA 5DCUA 3L7LA 3LRPA 5LDGA 1JU3A 4H6WA 3G2NA 4UBKA 5AM3A 4GXNA 1NQTA 3S2GA 2VT2A 1OYOA 3UT0A 3NNNA 4IJUA 3OMLA 1JR3E 5AUPB 2HEGA 2WM8A 1M0SA 4H1WA 1E7MA 4CF6A 3FROA 4CMHA 2ZUEA 3WJ7A 3QBDA 3AGPA 4IINA 1NN0A 3E9NA 4ZRMA 3K1YA 3N2LA 3ROQA 1GQQA 3GA5A 1DPFA 1NVVR 2P2YA 4G2TA 4UBLA 2BTQA 3W4IA 1IQUA 1KJ8A 4IH1A 1YVRA 2G1AA 3OJLA 4FCTA 1J42A 1V41E 4B32A 2IHNA 1AKYA 1WSWA 3L5KA 4FMCF 1I14A 3ELDA 1O4VA 3OSZA 4M60A 4O4JA 5BN3B 1MPXA 2MINB 3DE1X 3L49A 2X8JB 1QDLB 3CBGA 4PSAA 3UK2A 1Q50A 1WXFA 2AVDA 1E3EA 1K6JA 2HMSA 2YHSA 1YJ5A 2AMVA 4JY7A 5EZQA 5FI5A 2H48A 4E03A 4EG6A 1AXEA 3FWPA 4ZZIA 3A9VA 1J24A 3AHJA 3ZW9A 2P7HA 4AJ4A 1E18A 3SM3A 5JS2A 2D7DA 2C5SA 3I5UA 1U3CA 4HAWA 2X41A 1CB0A 4UMVA 2OBYA 3A1SA 1AG9A 2P9QA 3V3KA 1JR4A 2QAJA 2PEZA 1NJ1A 4KR6A 2CMKA 3AY6A 5LA6F 1I30A 1LPSA 2ISCA 2NU6A 4OAOA 3ITKA 3OPYA 2VJYA 4WY5A 5BN1A 3HWWA 5KYUB 1NVXQ 4FE7A 3GP3A 4Q34A 4GLBA 1D6NA 3ETJA 1ARZA 2ZI9A 1PVOA 2DUMA 4TQ9A 1WSAA 3HXTA 1KEWA 1YULA 3C24A 2KQUA 5BWCA 1OD6A 2WWWA 4RD1A 2XLCA 3QMVA 1G3UA 2ZWAA 3JD0A 4KX5A 3T7DA 2AC7A 1LC0A 3VI3B 4R83A 2C5BA 4AMZA 4BFYA 2DU8A 2VAWA 2YHIA 4MINA 4LHXA 1DE0A 1SG0A 1WD7A 4CUKA 3C8MA 2QRVB 3NHPA 1ZNQO 3SSAA 1P6QA 3QLUC 4OI0A 2COEA 1N1MA 2H1IA 5EPOA 1NXTA 4K9PA 4TSFD 1MCZA 3E7PA 4IS2A 1T36B 3CNBA 1E2JA 4R8RA 1C3EA 4AG6A 2WSSA 3R09A 2UUOA 4WCVA 5K1ZA 3TL6A 4KXNA 3K70C 1K4KA 3SC3A 5IULC 1MJGA 1VKRA 3R1IA 1ND6A 4JHLA 4ZQGA 1XRPA 3LRTA 3AM5A 2RE8A 1I2MA 4GXQA 2XUKA 1EVQA 1ZMRA 2X0NA 4D1YA 1FYWA 4W1PA 4HV4A 2HJ9A 3DOHA 5ELXA 1JHDA 5BMOA 4AX8A 5CUQA 4B8WA 4E6PA 1P0PA 1USIA 1WLYA 4H17A 5AI5A 3PC3A 1M8JA 1PN3A 1F2UA 2Q4DA 4YYEA 1I32A 4CV2A 1QV7A 3ROZA 2QVYX 1MB4A 5LL6P 4JT8A 4ARBA 3SYRA 1EHIA 1P39A 1CNFA 3W9UA 5L4SA 2QSYA 4DF3A 5C37A 3TLYA 1O8BA 1XLTC 1G66A 1D7AA 4GMGA 2C7VA 5AUQA 1U7WA 4NQRA 1PFQA 5KTKA 1RCUA 2P9BA 2AFHE 5MDHA 4QICA 2WIAA 4ZT3A 4D5GA 1YNOA 4PYOA 3ETNA 3MGCA 2QGZA 4EPTA 1XCGB 1GZ3A 1SKUA 1XZEA 3I6IA 5IVDA 5I7UA 1BXRA 2XTAA 1PHPA 4RKYA 3D5TA 2QJRA 3DTVD 1YJXA 1LY1A 3JQ9A 4MEAA 5D00A 4OIMA 5DI9A 1JDNA 2DSNA 3BSFA 5EE5B 1F3LA 5C1BA 4ZDKA 4OA8A 3AQIA 1KJNA 2PYDA 3RVOA 1FS4A 4Z86A 2W2XA 2QXUA 4E3ZA 1ISRA 3WTCA 4JKIA 4UFNA 3WA6A 1J2TA 3GZNB 4O1MA 5JJ5A 4IUYA 1F4PA 4I3GA 3BIFA 5JNUA 2XQVA 5CCEA 3IP9A 5TXGA 1U2DA 3ESZA 2MWMA 4KWHA 2PPVA 5JPIA 4RXMA 2W6QA 1UBHS 3QEOA 3M9WA 2WJWA 3IUEA 1ZJWA 2IUFA 4A6EA 1Q2XA 1WZ2A 1WB5A 1YGPA 3LUPA 2O0HA 3UV3A 4HFJA 4NTZA 4CU5A 4GI1A 3T0FA 1L8XA 3I5YA 5DN6A 4F46A 1OFTA 2GTHA 4CLRB 2IX9A 3DHVA 4S0ZA 3DVSX 4X66B 1QLHA 3STHA 2ZFUA 3NIBA 5H8WA 3UQZA 1AKTA 4M37A 3JATA 3K2BA 2BEVB 2D2XA 3HCDA 1INLA 4G1BA 1SXJA 4K2HA 2IYZA 5C53B 1XMSA 5FOWA 1XR3A 4D0GA 1WZCA 1FDOA 4U0JA 3WR5A 2V96A 5J2UB 4BMZA 2UAGA 1Q84A 1T2FA 3BK1A 3EVTA 4O2AB 3RIXA 3AHGA 2YQ4A 3EGIA 1E7WA 3G2LA 1SRRA 4DREA 4XLLA 4NAHA 3AL0C 5I8WA 4GRDA 3AUKA 3K0AB 1VTKA 4KRXA 4DXHA 2CUTA 4OMDA 3TX6A 3TKLA 2WAMA 1FIUA 3IUMA 3O6VA 2BDEA 5FTLA 8MHTA 1TYEB 2XMPA 3OOYA 2ATVA 1G3RA 4K05A 2RI6A 3VNQA 3RG8A 2ZPTX 2NVWA 3TXYA 1E3WA 1FL9A 2O8EB 1XTQA 2C9MA 4O4IB 3FSGD 5CNKA 4UNQA 5E8JA 3VZDA 2HRZA 4BIMA 5E1BA 4WK2B 2YWCA 2GDJA 3G9QA 1Q77A 3DF7A 3KKLA 2CJYA 3ETGA 2C03A 1ZH8A 4TVOA 2FKNA 2AYZA 3O4RA 4C3UA 2YOGA 3QVGA 2FUG6 3W7BA 4DZZA 2VOEA 4W9MC 4DCUA 1J0XO 4G1CA 5IHXA 2I9PA 2BF4A 4D99A 4YRPA 3B6ZA 2BJHA 3QMMA 1G6HA 4CZ2A 4JEUA 3M81A 1C8VB 1Y6ZA 4GPBA 4PLHA 3AVPA 4CKWB 5CA1B 3IL2A 2XTNA 4K9LA 3LIPA 1ZA2A 3K0HA 2H08A 4YCJA 3OQMA 1NVFA 1T3SA 3N07A 3M4JA 1DEKA 1IXSB 1REQB 3G6WA 2ZRPA 4UBOA 3WLOA 2IDKA 1BC5A 3PXUA 4OLJA 3U4QA 4RIGA 1RWPA 1XMOB 4I8DA 5F7XA 4X63A 1SQ5A 5HQ3B 1B26A 5TV2A 3ZE0B 3C4QA 4XIFA 3RYHB 1W25A 4DDMA 1Z5WA 1I2DA 4CKYA 5HIMA 3EPJA 1BE1A 1J2RA 3W7VA 3EK2A 3U62A 1UBFA 4Q47A 1VGRA 4FQ5A 1F17A 3GHYA 3WB1A 1JNXX 1Y9EA 3PR2B 4EHNA 3PJGA 5DLDA 3H42B 1Z35A 1QORA 2WZQA 3AUTA 1WXDA 3DOFA 1OXTA 3LPNA 1HLDA 2TSYB 3P9PA 4MKIA 1N2GA 4NENA 3OQ6A 3T1VA 4CEJB 1P5FA 2ARKA 5EI5A 1CVRA 2C61A 2YRFA 1I94B 2A5YB 2QTHA 1EUDB 2FYTA 4BXOB 1VJTA 2OBLA 3FX2A 2XCSB 1CWUA 4JLJA 4RZIA 3X1JA 3RTEA 3C70A 1BE6A 1UJBA 3QELB 2A78A 4LRUA 4PZLA 2C4UA 2PKQO 4Q00A 3IOBA 5K6TA 1K3TA 2Q3CA 1CR1A 5FBWB 4BB0A 1E1RD 1WMEA 5EMKA 1S1MA 4ZYZA 4O1HA 3K5PA 5T4EA 2HCJB 3LX6A 1IBSA 1TEXA 5JNRA 5KREA 4KREA 3T4XA 1SXIA 1GRCA 1YMQA 1J0DA 1GUAA 1U7HA 2MMCA 3QYPA 4J6FA 4E4TA 1O03A 3PD7A 4BLUA 4AAYA 4TVKA 4EY3A 3MINA 4B3TB 2ANBA 1CDDA 3ZXUB 1EWVA 4WZBB 2B35A 2P2NA 2HA2A 1D8TA 2RG1A 3KE8A 3LBIA 4IFBA 4UASA 3RWBA 1ONNA 1HT3A 1QGUB 1LQUA 3A1WA 3EVBA 3OZCA 3JQBA 4PYLA 2XMZA 4Y3UA 1RAGA 1U4NA 2EKQA 2WU4A 3I9JA 4AJNA 2V8BA 2QPAA 2CVHA 1TQ2A 3LPDA 1M1ZA 2A5DA 2I6QA 3G5AA 3V8MA 1F3OA 3WMGA 2IELA 1GQOA 3OE7A 4TZ0A 2CD7A 2OUIA 3RAFC 5GMOA 3RS5A 1V4BA 4GPEA 2HHAA 3UHFA 4CIXA 1O57A 4FZ3A 4NG5A 3HB7A 4UNNA 2FEMA 4HDOB 4YUAA 5G1OA 4BPRA 1FF9A 3LLSA 1KDRA 1PGQA 2LWIA 4K6KA 2XDAA 1PBTA 2RGXA 2VHWA 1CZUA 1SXJE 2JDID 3CSSA 3DOUA 3E3AA 2Z4TA 2WLSA 1DIGA 3ILSA 4LXGA 1RWKA 3ZDQA 4BLVA 4BQOA 3HUDA 4D8WA 4X1YA 1T6NA 5BMVF 1K88A 2XYQA 4FVTA 1SC1A 1Y1PA 1RZ3A 3A32A 1IFXA 5A04A 4DMFA 5L6LB 3H11B 2YINC 4BJHB 2Q3MA 3K72B 1ZMOA 5TT1A 2W6IA 4KV9A 1LDBA 1JWAB 3E4DA 4I4TA 1AH2A 2UZ1B 2OMEA 4AXBA 1U5BB 4PHGA 5THKA 1MC1A 3UKOA 4YCBA 2AN4A 4HCJA 5KOJA 4EMTA 2W2KB 5ALSA 4PNPA 5E4FA 3EDOA 4G0YA 2I4LA 4CTJA 2HPZA 3VJRA 1OFUA 2ADMA 4Q9KA 2OXFA 4RVHA 3GP8A 4BNJA 2QZ9A 2GZ1A 4HHEA 1CETA 4OGGA 4MVYA 4RDHA 3NIDB 4YRZA 2WEKA 1S9DA 1I24A 3P2EA 3DV0A 5FV7A 5F52A 1CEXA 4GWGA 1UINA 2RGEA 2DX7A 2A1UB 1QWOA 3LCMA 1RWNA 3NXSA 4NBKA 1IG3A 3CZQA 2VJNA 2YRXA 1AGRA 1KTVA 2OVFA 5EWMA 3VU3A 4JP2A 3TLJA 5KQRA 2ECQA 2JD2A 1E98A 1EP9A 2ZUFA 3BIWA 4C04A 5IJZA 3B6EA 3KFXA 3A4TA 3D54D 3ETHA 3FMIA 1ELOA 3G9XA 4IVQA 4LJAA 3CVYA 4G1VA 3GROA 4H16A 1Y4UA 2WSYB 2E4AA 5JH7F 5G4LA 1HLPA 2GAIA 1TC1A 4I5EA 4YLGA 4S04A 2GM4A 2YZNA 5CT9A 3F4LA 1X8LA 4DBZA 1L5FA 4JYMA 2H92A 3G2IA 4UHCA 5DRYA 1VG9B 4MVJF 4XWYA 1O4WA 3OIVA 3PUXA 3ZHYA 2PLNA 3EOAI 2IDZA 2PBFA 1R0YA 2RMKA 3WKCA 2C92A 3GJ0A 3AW9A 4HPJB 4WBSA 3LP6A 4ZOLA 2P2LA 1GDHA 1C1HA 1IBMB 1T5IA 3H75A 3OFJA 4H4EA 5DNWA 2QY9A 3TL3A 5BMVA 3KT3A 1BOOA 1E9RA 4X71A 2PUGA 5BSUA 2C5LA 3PGKA 2QX4A 1X7XB 2C7OA 3NKLA 1JHYA 1EWKA 4FP9A 4N01A 2WKPA 3NDIA 1C9YA 4QYSA 4OLFA 4TTSA 4J7CA 5HUQA 1SIOA 4NNPA 1K5DA 3N28A 4YDRA 4KIFA 1JHAA 1DKRA 3HUFA 1QTIA 5HBGA 5KX5B 1M2EA 3K53A 3JQ9C 1TF2A 1Z5PA 3I9V6 3MZ0A 4PY2A 1FQWA 4MP8A 4Q1VA 5K4AA 1GU0A 1XA0A 5TGDA 4ESEA 1UC9A 2F3TA 1W5SA 5TGTA 3K6SB 2W00A 2XB6A 2C1ZA 3I6MA 4HWTA 3RRJA 1Q1ZA 1YI8A 1V3UA 2XH8A 3EQ8A 1OX5A 3MCTA 2ZRMA 2C9DA 4HGRA 5COBA 3CR8A 1Q1GA 1E2DA 5FWAA 1DRUA 1UBGA 3SU8A 2HM7A 2OY0A 4RCZA 5JANA 1K75A 1A9QA 4I5GA 4ZKEA 7ABPA 1DQPA 5FTNA 3EAQA 1BGVA 2VYNA 3EZ9A 1JJBA 4P32A 3UJDA 2PUFA 4MV6A 4BQQA 4W6ZA 2HMVA 2I2DA 2B9EA 2QDXA 2YJ5A 3JARB 3RFUA 4XRGA 1VJ0A 3C3KA 4URVR 1FSSA 5A4DA 4RK4A 3ZE6A 3NWEA 1HPLA 2DH5A 2OHIA 3L02A 1MW8X 3SC2B 2GB4A 5B4TA 1ZITA 3QBTA 1O95A 1XZLA 5JH7A 2A0FA 2PMKA 4WXYB 1ABEA 2HA7A 2V54A 4B8ZA 2QN1A 5HF5A 1PJBA 4LZNA 3MMZA 4K6MA 5AVQA 1F0PA 3ANNA 3O4VA 4H60A 2DTXA 5BSFA 1TUBB 4HPXB 1T8WA 3V4SA 4IDBA 2PKWA 3GVHA 3OY2A 4PGFA 4C7XA 4Q1AA 4LKOA 3G9UA 5SV2A 5FD8A 3WZMA 3A10A 4L4UA 1GTG1 2ZK7A 2IV7A 3QKRA 1ONSA 4MYUA 4ZQCB 1KJYA 5A7HA 2HR1A 4LZWA 4X1KB 5BV7A 1JR6A 5AUOB 3QP9A 4BO5A 3NX4A 3OQIB 3P2MA 4ZVRA 2Q9UA 2OD7A 5DF1A 1WZIA 1ZH0A 4GMHA 3CZCA 4GP7A 4H0NA 4MVJP 3S70A 2FPKA 1XEFA 3TB6A 2WSBA 2JIZD 2K2QB 2WYUA 4H7EA 1R8XA 1U81A 2A3RA 1SQGA 3NV7A 1OKKA 4ZO4A 5BQ5A 2UU9B 5KTYA 5EIFA 4PWYA 3PD1A 3SNHA 4CLXA 3KR0A 1XJCA 4Z54A 1FQKA 3IT1A 2Y1EA 3GFRA 3VC7A 3BAZA 3WK8A 1N75A 1M1NB 2BEUA 4EI8A 5LKAA 3WJ2A 2ZSDA 1T0IA 5CEFA 1E92A 3PPIA 4JCOA 4TV8A 2VNJA 3QU2A 1WXEA 3I2KA 4CM9D 1TK2A 1U90A 1JI3A 4JMLA 1Z3IX 1E9VA 1PJ8A 3PENA 5HCNA 3QX7A 4MV9A 5CG2A 1GO2A 1NKTA 1UAGA 1N3YA 3GLIB 4K6CA 3C3JA 5TR9A 4TKLA 1II8A 3I1YA 2GM3A 3MMSA 4JJFA 4UPVA 1BQ3A 3I0NA 5JSUA 3C6XA 3TLEA 2IU3A 4AJJA 2CK3D 3GY0A 4LVNA 2DFLA 3LCRA 4REQB 3ZX5A 1TKCA 3GAFA 3FRJA 3PA6A 1E2NA 1YJBA 2AD1A 1O58A 1R5OA 2FN9A 2FSHA 3ROGA 2F55A 3O4FA 3CVJA 4URYR 1U8CB 5BN5B 2OHVA 4QHYA 3OZSA 5DMHA 1P4AA 3N74A 1SVLA 3SEQA 4M36A 2C8LA 1QMGA 3EXEA 1D7OA 3DMTA 3P9NA 4JBHA 4ZK2A 2GJAA 2GLUA 2O8VA 5HF9A 2BFWA 3W5HA 3IE2A 3SHQA 1CXZA 2EJWA 1G8YA 3RC2A 4XVRA 3VPDA 4BO4A 1BKSB 2P8JA 2PX5A 2O1WA 3L4EA 2X0FA 2IYUA 4OKNA 5EY5B 4EB6A 5T6MA 3ND5A 1NUAA 1X80B 1QP0A 3QEBZ 1ORTA 2E6UX 2GJ9A 5DBFA 1GTZA 4PO9A 2WPNA 1NAIA 4XM2A 2Q4TA 5ITZB 2QD5A 4C76A 2GN1A 2JFOA 1J07A 2O59A 5TF4A 1GG9A 3A1TA 4OO3A 2XNJA 4QJ5A 3RVSA 1G8FA 3VU8A 1T9CA 2I4IA 3WVNA 1Q57A 4A5OA 3IA7A 1N5RA 1D1QA 2DTEA 2QPTA 3DZGA 3KXDA 1KQOA 4G5YA 1S89A 3QXJA 3FDJA 3VOAA 1R8JA 1XZQA 4RA6B 3VVLA 5L6MB 1P7WA 2OV8A 1OC2A 2SNIE 4EG3A 1KIAA 4F4HA 3LUAA 2Y1CA 2ZJFA 1Q11A 3AB3A 2BFBA 4DCSA 1D2GA 1K8QA 2DFDA 4M7OA 3VHLB 2R751 1VFPA 3D0OA 5TPWA 1AA6A 2PUJA 1KTIA 3T0GA 3AT1A 4MW2A 3VDXA 3U44A 1XHLA 2Y1GA 4C1BA 1XN4A 4DR6B 1ZRHA 5I9TA 4CIVA 3D8SA 1ZEMA 4WOBA 3C5CA 2IPMA 4F5WA 2IZ7A 1K9VF 3GGSA 2B2NA 5CFOA 4NR0A 4BFVA 8ADHA 5KYXA 2F1KA 4J0IA 3GH3A 2OGUA 3KZCA 1ZH6A 1BCSA 2A2ZA 2FGKA 4ND8A 4NEQA 4PC3A 5H3HA 2IWRA 4EWLA 3EUFA 1WE2A 5DT2A 1T34A 3NAGA 1SQSA 1D1TA 3B9BA 4RD6A 3BG5A 3JQBC 1IK4A 1NG9A 1CZLA 5ABPA 2J5RA 2NXWA 1YS1X 4KXMA 3A6ZA 1EQ2A 1GEEA 1CQIA 4P4SA 4ZMSA 2POCA 4IHAA 2QV0A 3DAPA 3DE4X 3GVIA 1NLYA 4R2WA 4FOPA 4QKQA 4R1QA 1UFKA 5AKXA 1FP1D 1U31A 2B61A 2WTEA 1RD4A 3IJEB 2QT0A 4L4XA 4UKDA 3F5MA 3N6VA 1MD9A 2BLNA 5DEIA 2VHCA 2XGSA 5LXTF 4MWEA 1GQ2A 1G8KA 4JI0B 4HWRA 5JU6A 2H2GA 3MJRA 1PZHA 3SYMA 3VSCA 1KI6B 1G5FA 2XYRA 3C3DA 1VE7A 3ZUGA 5GONF 4LHVA 3IP1A 2PVCA 1FXWF 3CT6A 3CWQA 5FPSA 3WS7A 1W6UA 4YCCA 5JZMA 1B0PA 5DBIA 2QW0X 2X5JO 3BDVA 4UEOA 2O06A 5CYFA 4EX6A 4YAGA 1H4QA 3STWA 4B7CA 2R7AA 3B8HA 3JQ8B 4WHMA 1ONOA 1ENOA 2VSNA 4YMHA 1YKSA 2YKGA 4CR6A 2EQ5A 3S27A 3KQOA 4TLCA 3CLSC 1L4FA 3D4IA 3ETDA 3KWFA 1PJ2A 2QMUA 3GT4A 5KU1A 5DJ5A 4A15A 4AWXA 1XCBA 3I72A 5IAEA 3JW8A 3ED5A 5DLPA 3P9SA 2A5LA 4US1R 1WPGA 3FI0A 1R4NA 3OI7A 4W82A 1TJPB 4DWVA 4F04A 3BSYA 1BKDR 4KR2A 3MG9A 3BQ9A 3K9LA 1CQPA 4QEZA 2DKNA 4LYJA 4P80A 4E32A 1AQYA 4KXYA 1LLCA 2JATA 4XI9A 1O6ZA 5I48A 1CUCA 4Q3AA 3AQ4A 3U3KA 1FNNA 1XEXA 4NABA 1FFBA 1V4NA 5L7YA 4ZN6A 3H5LA 1XRJA 5JS6A 2F9MA 3X43A 2O0JA 1JFSA 4BPBA 1AC5A 1MABA 1H85A 2XRYA 1S4QA 4LF8B 1ZYUA 3B78A 2DUNA 1TU4A 4GGMX 4RS4A 3TLGA 2CEKA 1ADJA 3QKSA 1N5MA 4BVAA 1JEOA 1N6KA 4WXRA 1BHQ1 4H18A 2VQSA 1JQKA 2X0DA 2B8NA 4IIJA 1XMIA 2HXSA 3UCEA 3SY8A 1V8FA 2I9KA 3P71T 2PBZA 5CR9A 2A35A 4BAGA 4IHJF 1T9ZA 5AHOA 3E8XA 1MAWA 5LP1A 3BRWA 3LP5A 1YB2A 2AX4A 2CBGA 4EVIA 1M9NA 2WF7A 4EYEA 5KYNA 3QE2A 3WNZA 2CFOA 2AJLI 1YL5A 1ZN9A 2XUDA 2Y1DA 3T3DA 3AFHA 3BH6A 3BGOS 2ZULA 2ZYWX 5L3VA 3FMGA 2FE1A 1XRNA 3LYLA 3Q3JB 4RVGA 5F2NA 3V2UA 4CEHB 4KWIA 4X8LA 1EG2A 4RGVA 1VSUA 4EX7A 3GZTB 5T41A 4RHFA 1SU6A 1B0UA 4JIGA 1H3FA 2XE4A 4BEJA 4IIYA 4Q16A 3ZDFA 3GLFB 1NOIA 3MAGA 4EDFA 3BJEA 2ZIXB 3HRHA 1JTVA 3WY9A 3SPXA 4ESHA 5EXDA 2HA4A 1ZK2A 4Z5XA 3T1TA 1ADFA 4LXQA 2IGTA 1C4OA 1W88B 1PO7A 1E6UA 1MH9A 1WF6A 4GMDA 4PANA 4TQGA 2QQ0A 1N9KA 2XR1A 5CVDA 1AN0A 1J1UA 1ISPA 4M1EA 1SG6A 3MAAC 1TVCA 2YY5A 4PINA 5F3RA 5JNTA 1VJ5A 3FTFA 3GO4A 2AB0A 3FOBA 3OJEA 4ARUA 4WTOA 4EG0A 1M6VA 1PZFA 1X8KA 2ZYIA 4C6SA 4KX3A 4JODA