3E0XA

The crystal structure of a lipase-esterase related protein from clostridium acetobutylicum atcc 824
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
245
structure length
245
Chain Sequence
SNAMLHYVHVGNKKSPNTLLFVHGSGCNLKIFGELEKYLEDYNCILLDLKGHGESKGQCPSTVYGYIDNVANFITNSEVTKHQKNITLIGYSMGGAIVLGVALKKLPNVRKVVSLSGGARFDKLDKDFMEKIYHNQLDNNYLLECIGGIDNPLSEKYFETLEKDPDIMINDLIACKLIDLVDNLKNIDIPVKAIVAKDELLTLVEYSEIIKKEVENSELKIFETGKHFLLVVNAKGVAEEIKNFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824
rcsb
source organism Clostridium acetobutylicum
molecule tags Structural genomics, unknown function
molecule keywords Lipase-esterase related protein
total genus 86
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3e0xA00
3NGMA 5AK6A 4X94A 1BEZA 4Q3LA 4Y2TA 3WKAA 5LIPA 1FJ2A 1GPNA 2PUJA 2I03A 1SFRA 4QNNA 2OAGA 1YA4A 4WY5A 3H2GA 3O9VA 4L9AA 4MYDA 1AC5A 4BVLA 3HYSA 4BBZA 4AN1A 4AZ3A 3NWOA 4K6KA 5K3FB 4HRXA 4HTAA 1MX5A 4X85A 4OD0A 3C5WP 1P0IA 4C4XA 4DGQA 5HKBA 1WCYA 4EY7A 3BDVA 2ZYIA 5IVKA 5D6OA 5JD5A 3C6YA 1HL7A 2JBWA 4ZXFA 3I1YA 3N0TA 3V1MA 2ZYSA 1XZCA 5ALTA 2WG2A 1LPOA 5AH0A 1HPLA 3KWFA 4PSDA 1ZI9A 2OCGA 1IVYA 4UBNA 4X6YA 5IVIA 4PSCA 4JEIA 4HRYA 4Y2XA 1M33A 2QM0A 5FKJA 2PU7A 1VA5A 2BKLA 1UZAA 4BDSA 1O6FA 1ZJ5A 3LIPA 1QFSA 1R3DA 1R9MA 4GI1A 1CPYA 1MNQA 4FMPA 5AKIA 2H7CA 1ISPA 4EBBA 3BL8A 3D2AA 5CXUA 3H04A 4YASA 1MJ5A 4FOLA 1RP1A 1CUYA 4ZREA 4H7HA 4BC1A 1QFMA 1Q0RA 1IUNA 3D7RA 3R40A 4H7KA 2O2HA 2WFMA 2Y6VA 3WK6A 1L7RA 5FPPA 3L1IA 1L7AA 4KE8A 5AK5A 2X76A 3A70A 4DYHA 3DOIA 3QMWA 5JD4A 3WWPA 3K2IA 1GQRA 2WJ3A 3STWA 1ZD4A 5HFAA 2ROQA 5BV7A 5DJ5A 3F9CA 2XUHA 1GXSA 2HA4A 1DT5A 2WIDA 3X3HA 1XRLA 2K2QB 2WUEA 1IZ7A 4E14A 4U2BA 1IZ8A 4CIBA 2WFZA 1EB9A 3WL6A 1EI9A 4Z49A 1Q0ZA 5CBKA 5AM1A 3WKBA 1QOZA 5T4HA 3QMVA 2Z3WA 4DNPA 5IKXA 3G02A 2DQYA 4CG1A 3M3DA 4B83A 3GBSA 2WUFA 4Y2QA 4FDMA 3G7NA 3YASA 3A6ZA 4BRZA 5ALVA 4FBLA 4C01A 1KU6A 5A7GA 4LYEA 3DCNA 1ZGCA 3CCBA 2PSFA 2J3QA 5AKKA 1QJ4A 4PV7A 1RWQA 3G8YA 1TQHA 2CMFA 5BWCA 3FAKA 4YX9A 1LPNA 3G0CA 1LNSA 2VF2A 4RE5A 2VJBA 4CG2A 3IUNA 1VZ2A 1U8EA 2PSDA 3HJUA 2GBCA 4QDOA 2XB6A 3VJKA 3AFIA 1J07A 1W4LA 1CUVA 4P08A 4BP9A 4C4ZA 3TJMA 3R3WA 3AIMA 1CIJA 3BWXA 2PBLA 2XUAA 4QE3A 4H77A 2GZSA 4K5QA 3CN7A 1YAJA 1GT6A 3H17A 3D3NA 4MWTA 1TCAA 2ZJ6A 3G9XA 3AIKA 1BCSA 4BRSA 2OXEA 1TKRA 3OC0A 4AMYA 3M83A 2RAUA 1J06A 4DMHA 5AM5A 2JGIA 2YXPX 4H18A 5D3KA 1USWA 2WHPB 2Z8ZA 3H2IA 2C58A 2VQ6A 3FCYA 3VJLA 4QDUA 3AUKA 5HZGA 5AP9A 4W9RA 3ZPXA 5K3CA 5K3EA 4PO3X 4BTLA 1H2WA 4FTWA 1FFAA 1J1IA 1R9NA 2EEPA 5EHQA 3VDXA 1XRRA 2WUGA 3F67A 5CT4A 4GDMA 2CZQA 1P0PA 3BE8A 4FFVA 5JALA 3E0XA 2V97A 3HEAA 3C8HA 4Y2RA 3I2IA 4H7FA 1Y7IA 2ONCA 5F4ZA 5AHXA 5I8PA 3WA7A 3C8DA 3AZPA 4UBLA 3ESDA 4DNQA 2VJDA 5AK3A 3CCCA 5EHZA 5AOBA 1UT6A 4WY8A 3DNMA 1AKNA 4GWLA 4X3CA 2PSEA 4MWSA 1BROA 2ZYRA 1Q84A 4GXNA 1VXOA 2ZSHA 3WK5A 4UFOA 3G9TA 5LKRA 5JIBA 3QITA 4BVKA 3W9UA 4E46A 1BN6A 2WIGA 4OU4A 4H7DA 5A7HA 5K3FA 3A2MA 4W1SA 1SOMA 3IULA 4B85A 2W6CX 2WHPA 5AKXA 2WUDA 3LP5A 4Q1VA 5JAPA 4IH4A 1CUHA 1U2EA 4FNGA 5LZ9A 1TCCA 4KE6A 5CH5A 5FV4A 4B81A 4NVRA 3DL7A 1BRTA 3DDUA 2V9ZA 3ICVA 4KRXA 3AILA 3I1IA 4N8EA 3I28A 5K5EA 5C8XA 1E8MA 5ALSA 4KACA 2RGUA 5LZ5A 1A8QA 3P2MA 4M0FA 1LPMA 1QIEA 1MU0A 1UFOA 2XMZA 4UHCA 1CUGA 4D9JA 2QOEA 1LZLA 2PM8A 3VKFA 2OQIA 5DYTA 3VJMA 2D0DA 1EA5A 1C7IA 3GROA 1CUDA 2AJ8A 4UBOA 2Y2UA 2RHWA 2HL6A 1EINA 3GELA 4GEGA 3Q0TA 1VA4A 1LPAB 4QDXA 2G5PA 1XZMA 1DU4A 1N8SA 5BOVA 2WHRA 2R8BA 3D5EA 5ALUA 2UZ0A 2QMQA 1XZEA 1LZKA 4CG3A 1YB7A 4OYLA 1BCRA 3H1BA 4C6HA 4B0PA 1MO2A 3WK9A 3SC2A 2WU4A 5ALMA 5K3DA 4P93A 5ALNA 4KAAA 2HA6A 1ZICA 4JNCA 4P92A 1DTEA 1KU0A 5CURA 1YA8A 1KEZA 2R11A 1TK3A 2DHDA 4BAGA 4UFPA 4DNOA 1UXOA 3FVTA 3HABA 4UBKA 2QT9A 4I19A 4G8BA 4KR0A 4G8CA 5FOQA 2XDWA 2J4CA 2GZRA 3FOBA 4M0EA 4N5IX 4JH0A 1Z68A 1PJAA 3O4IA 4IH9A 1FFDA 4G9GA 1H2ZA 1XZIA 3R3UA 5AM3A 4Y2JA 3WZMA 5JAHA 5A7FA 1QO9A 3I2KA 3R3VA 4HZGA 5JAOA 1EVEA 2BFNA 2RHTA 2EDCA 3FLAA 5FLKA 5JZSA 1A8UA 2QXUA 2H7XA 2DCMA 3B3QA 3MUNA 4G9EA 7YASA 3ICWA 3QMMA 5ALOA 4HVTA 3H19A 4DM7A 1B6GA 1THGA 3IB3A 5JATA 4IO0A 5YASA 5KWIA 2WLSA 1ETHA 4MQMA 3ANTA 3IDAA 3WZLA 1NU6A 5HQ3B 4UHDA 3QYJA 4OB6A 3RK4A 4QLAA 3ESCA 2V98A 1UOOA 4U2FA 4JUIA 4LIPD 3STVA 5AI0A 4B82A 4QDTA 4AZ0A 5HF8A 3BJMA 1GKLA 1ZIXA 2XUKA 5T4BA 2XQGA 3DKKA 4PNZA 1CUJA 3FWHA 3FNBA 1CV2A 1XRQA 4OCZA 4UPDA 5CW2A 4QWMA 1XZHA 3U1TA 4HS9A 3C70A 4AQDA 5E4TA 2CB9A 5ALWA 4LHEA 5ALXA 1OILA 3MVEA 1VXRA 3FYUA 1FFCA 5ALFA 4WCVA 3SK0A 4P9NA 3D59A 1SCKA 1W1IA 4XIIA 1G4HA 4NMWA 1L7QA 1ZD2P 1CUZA 3WL7A 1ODSA 3QBJA 4CIAA 2GYWA 5AM2A 3KSRA 4DNFA 1YCDA 5DWDA 3FSGA 3PDCA 2FJPA 5CT9A 4EY8A 1QIDA 4RGYA 5DTJA 3H0CA 3IIIA 3ESAA 3MUOA 3STUA 4WFJA 2OCKA 5CT5A 4BZZA 2H7YA 1H2YA 1XFDA 2WFLA 3E4DA 5JZBA 1QIJA 3I2FA 4BTVA 1FFBA 5ALYA 1BU8A 1EVQA 4U2DA 5AJHA 2WFLB 4NZZA 2FX5A 4BP8A 4ZI5A 1CRLA 1XZFA 4BB0A 2OGTA 1CLEA 5JARA 3I6MA 1T2NA 2HFJA 2CEKA 2JGEA 5ALGA 3H2JA 3PI6A 1ACLA 4G4JA 5HQ3A 1K8QA 2XUQA 2BAGA 2XT0A 4W1QA 4BDTA 1QGED 3ZLVA 5DLPA 1XQXA 5HKAA 2VAVA 3Q8WA 2VT7A 3STXA 1HQDA 4KRYA 1VZ3A 1OXMA 3WI7A 4FWBA 4GW3A 2CJPA 3EQ8A 1QO7A 1CUBA 3C45A 2B4KA 1LLFA 2VA9A 1EB8A 1TIBA 4GBGA 1Y37A 2QVBA 2WG1A 1IUPA 2QJRA 3PFBA 3OPMA 2VAXA 1UK6A 3AINA 2I3DA 3LS2A 3WL5A 5J3JA 4C4YA 4M0MA 4E11A 1F6WA 1QIFA 4OYYA 2B61A 2XMSA 2B9VA 1EX9A 2WHQA 4AMZA 4HAIA 1ZJ4A 3S2ZA 2YH2A 5HK8A 3D0KA 2RI6A 2XUOA 5A6VA 4DMKA 2JEZA 5AI4A 4WDQA 3PUIA 1XRPA 3B12A 3T4UA 1MAHA 4IH1A 4ARAA 5I7UA 4EB0A 3WIOA 4ZGBA 1QLWA 1CUXA 5HF9A 1H2XA 3C6ZA 5ALEA 4K6HA 1UKAA 5ALZA 4ROTA 4C89A 1UOPA 2XQIA 2AJBA 1I6WA 1XKLA 1UK8A 4QDZA 3DD5A 1A8SA 2CBGA 2VJCA 1PFQA 1R1DA 2DHEA 3WIBA 1LBSA 4CCWA 5D7BA 1XZBA 5K3BA 5LZ2A 1LPBB 4H7IA 5LZ7A 3F98A 1GZ7A 5ALKA 1K5PA 4F0JA 3O95A 2O7RA 5ALDA 3WKCA 5HF6A 3HLKA 3EIOA 2ACEA 4X93A 3FYTA 4X91A 2VATA 3I2JA 1WOMA 2Z5GA 4AO7A 3G9ZA 5DYYA 3L1JA 3WLAA 3W05A 1N5MA 3BXPA 3DYIA 4FLEA 1ZGBA 3H1AA 5AOAA 4OB7A 2XMDA 4ETWA 4LKOA 3G9UA 3O4GA 3IUMA 4Y2UA 4H7EA 4F60A 2QUAA 4EZIA 1CUWA 3JWEA 3G0GA 4OB8A 3LIIA 1K4YA 4QEKA 4BCBA 4C88A 2BJHA 1H22A 5CTAA 3O4JA 2AJDA 3RLIA 1VE6A 5C7YA 2JIDA 4X6XA 2XQFA 2D5LA 4J0KA 2XE4A 3QZUA 1K6EA 4Y2SA 2GBIA 3GUUA 3PUHA 4OU5A 3AIOA 4B80A 1ZOIA 3E3AA 4EY4A 1TAHA 5CT8A 4G4GA 2XI4A 3LCRA 3DLTA 3VXKA 3HZOA 1JJBA 3BDIA 1W76A 5JASA 3W04A 3FLEA 3I2HA 1QIKA 2XQJA 1ORWA 5AKYA 4Q34A 3D2BA 1W75A 4AB1A 4HXFB 3TRDA 1LPPA 4UUQA 5KREA 1YAHA 4GHWA 5JYCA 5AK4A 2JEYA 5KWJA 3WK4A 2BUCA 5C8ZA 1R50A 1K63A 1BE0A 3KD2A 1LGYA 1H23A 2DFPA 4W1PA 3HACA 1VOTA 4EY6A 1IMJA 1AURA 3DQZA 1U4NA 3GFFA 3V1LA 5FXMA 2WSLA 2JGFA 3SX4A 3O9MA 2J3DA 2HDWA 2C0PA 2FUKA 4XVCA 4DSAA 3WYNA 1QTRA 1SCIA 3FBWA 4UBIA 1MNAA 1IUOA 4A23A 3PFCA 4KAFA 1GQSA 4J3JA 5ALJA 4N8DA 1XZDA 3ESBA 2HU8A 4ITVA 5EI5A 2BGNA 2RIPA 3WMRA 2HU5A 3C6XA 4AXBA 3O4HA 4S0XA 4G8DA 5LZ8A 2QKYA 3VISA 2DHCA 1DINA 4X97A 4UBMA 3BF7A 2WILA 1XZKA 5T4EA 4H0CA 1SC9A 1J2EA 4ZV7A 3EQ7A 5JZ9A 5AI8A 1GPKA 5FDFA 2YASA 3HXKA 2XUGA 1DWOA 3R0VA 4X71A 1UKBA 5CH3A 5JAUA 1ORVA 1QIMA 1RYYA 1T4MA 1ZI8A 1QONA 5HCUA 4X92A 5AOCA 2QZPA 1D07A 1QIGA 1MT3A 2C4HA 4J0DA 2HRQA 3G0DA 5IVHA 4FBMA 1FFEA 4EY5A 4C87A 1WB4A 1HKHA 4J0JA 1CQZA 3F96A 4W63A 3C5VA 2XMCA 4TPKA 2AJLI 1YASA 2XUDA 5EIHA 1XQYA 2Z8XA 3GA7A 3QM1A 2OCLA 2YYSA 2Y2VA 4WDRA 2QUBA 1XRNA 3STTA 2C5GA 3R3XA 3OM8A 4B6GA 2XLBA 5C8VA 1EDBA 4GECA 2JGLA 4X6UA 1XLUA 4ZRDA 1DT3A 1XZGA 1TRHA 1GPLA 3QVMA 1DX6A 4ZV9A 1CUUA 2XLCA 1XRMA 2E3JA 2LIPA 2WG0A 3C87A 4FKBA 3H18A 4BATA 1MAAA 1XROA 4X90A 1QIHA 1DWPA 1MX9A 2RONA 1FSSA 3A2NA 3I6ZA 4OUKX 4HXEB 4Q3OA 4ARBA 2J4FA 1LBTA 5D3ZA 4H35A 2O2IA 2ORYA 5LZ4A 1UK7A 3PICA 4Q82A 1QTIA 5E4JA 2ZJ7A 3IUQA 4XWGA 4BVJA 4YPVA 3ZLUA 2W22A 1X2EA 4I3FA 1WPRA 4EUSA 4EA6A 3DYVA 4B0OA 3WK7A 3E1GA 1N5RA 5AIBA 1MN6A 3HC7A 4X7BA 2PSHA 2Z3ZA 1S8OA 3EBLA 3G0BA 3NUZA 3KWJA 1U65A 1CUAA 4BE4A 3FYUB 1VJ5A 5AM4A 4AO8A 2PL5A 1VLQA 2JGMA 1WHSA 2IITA 3UMJA 4Y2PA 1P0MA 5CXXA 2GYUA 4KE9A 1UOQA 2G4LA 3H2KA 2OG1A 3RARA 4BAUA 4UBJA 3BJRA 4GLBA 1CEXA 4KJXA 3VVLA 2QR5A 2XUJA 4K2AA 1HLGA 4AN0A 1JJIA 1ODTC 3F8SA 2WM2A 3R41A 2PX6A 2WU3A 2H9YA 1YR2A 1A7UA 5T4FA 4L3WA 4J7AA 1LPSA 1CUCA 1XKTA 4A5SA 1YS2X 5ALQA 5AO9A 3MGAA 4J0CA 5ALIA 1CUFA 4UHEA 1YSCA 3EF3A 5H3HA 3DKRA 2HA7A 2EDAA 2O2GA 2C5FA 4LYDA 1ZI6A 1G5FA 2ZYHA 4FHZA 4B9AA 1QIIA 5JANA 1AGYA 4B7ZA 3RKSA 2HADA 4J0HA 4J0IA 3V48A 3ANSA 6YASA 5ALRA 1UK9A 4U2GA 3A2LA 3H2HA 1E66A 3QPAA 4F21A 1JMYA 4WJLA 3IURA 5C81A 2GBFA 1OCEA 2Y6UA 2HA3A 3I6YA 1G42A 4QLOA 1AZWA 2ES4A 2H1IA 2PUHA 3ED1A 3O0DA 3NOXA 2OQVA 4B9EA 5CMLA 5CH8A 1X2BA 4W1RA 5JD6A 4MEAA 4OSEA 1BEEA 4BAZA 5DNUA 1JT2A 1WPXA 1BN7A 4J03A 2DQZA 5SYMA 1THTA 3PF8A 4J0GA 3DJYA 1WHTA 3R3ZA 4WFKA 5EFZA 1AQLA 4L72A 4UHBA 1DQZA 3S8YA 3BIXA 5HK9A 5FPQA 4X00A 3M81A 2VJAA 4IQ4A 2VSQA 1DX4A 3AZOA 4LXHA 5A71A 4U2CA 3V1KA 4WFIA 2I78A 3HSSA 2PVSA 1NX9A 4Q05A 1F0PA 1VE7A 4BYMA 5CRIA 3RM3A 2WQZA 4MYSA 3WA6A 3ZWQA 5DNVA 2G63A 5ISMA 1EHYA 1GGVA 1Q83A 3FSGD 4CFSA 3QPCA 5A2GA 4KAJA 4DLNA 3IA2A 4N5HX 4TVKA 2HRRA 4UHFA 5AICA 3WJ2A 4L0CA 5K3AA 2B20A 3N2ZB 4MXDA 3WL8A 3IVMA 1E89A 5FUMA 5IH7A 1C4XA 1GKKA 1CFJA 2WTNA 2QRUA 5EGNA 2AXEA 1VKHA 2JF0A 1ZIYA 2OGZA 3LLCA 3T52A 3ZLTA 1ZD3A 4E15A 5AI6A 5EHXA 4ZWNA 1MX1A 3GZJA 1W6RA 4F5ZA 3UUEA 4DTCA 1EH5A 1JKMA 4XJVA 3R3YA 3TGLA 1F8UA 3OTQA 1XQVA 3EQ9A 4QWWA 5ESRA 1DQYA 5CT6A 3VVMA 2BGRA 3DEAA 4KE7A 4RNCA 4CI9A 3D2CA 3OG9A 2JGJA 2CKMA 4Y2VA 1W52X 2GBGA 2I3ZA 1JU3A 1Y7HA 5AKLA 5ALLA 2C0QA 4BCCA 3AZQA 4BE9A 3K9BA 2XMBA 2G5TA 1N1MA 2BUBA 3ZV7A 3DS8A 1G66A 2C7BA 4KEAA 3SWWA 4FLMA 3I2GA 4DMCA 3FVRA 1E8NA 3W06A 4MQLA 1E8DA 5FRDA 2QTBA 1JU4A 4TGLA 5FP0A 4UFNA 2PKYX 3WKEA 1HBJA 2ZVDA 1SCQA 1MPXA 3KOOA 1CUEA 1ACJA 5AKHA 3OURA 3JW8A 3TEJA 4PSUA 4BZWA 3UUFA 4DMFA 4UHHA 5AKEA 4EHBA 1XQWA 3V9AA 4CCYA 1DWQA 1CVLA 3BIWA 3WKDA 5LKAA 1R88A 3IUJA 5AKJA 5HFNA 5EIAA 1UWCA 2X5XA 1CR6A 4FNMA 4Y2YA 1EXWA 1TCBA 3CXUA 4DIUA 4KYVA 5LYYA 1WM1A 3WK8A 2WJ4A 3FCXA 4MJ3A 2V96A 1JFRA 3DL4A 1QE3A 4PF1A 1O6GA 5AIAA 1C7JA 2WIJA 2XUPA 3PF9A 4B84A 4JYPA 4A16A 1AUOA 4G5XA 1P0QA 1YB6A 2NW6A 2HA5A 2WIKA 3G0IA 5EHNA 3WQHA 2P8SA 3M82A 1A88A 2HU7A 2WJ6A 2OGSA 1ZD5A 2O7VA 1XLVA 4XX1A 3D4LA 3IBTA 5LLSA 1F0NA 3HRHA 3WWEA 2Y1KA 3DOHA 2PU5A 1B41A 2WIFA 3PE6A 2Q0XA 3C6BA 4G4IA 1CQWA 4CCYB 3B5EA 3WJ1A 3KDAA 1EK2A 1JI3A 1MTZA 4I4CA 1PV1A 1UKCA 1R4ZA 5SYNA 4V2IA 4YK7A 2OPHA 1BS9A 2HHAA 4BCDA 1WB5A 2XMGA 4OPMA 4RPCA 5LP1A 4AO6A 1XZJA 2BCEA 2HA2A 2HIHA 2CUTA 1AMNA 2FJ0A 2XMQA 4PW0A 1EDEA 1XZAA 2HM7A 3FYUC 2XQKA 5JADA 4BC0A 4HXGA 3K6KA 2X8BA 3WWOA 4DSZA 4QA9A 5AKZA 4MEBA 4G1FA 5I9IA 3WWCA 2VT6A 1XZLA 1EDDA 2HA0A 2HFKA 2PSJA 4FFWA 3AJAA 1ODCA 1JJFA 4PQEA 2VTVA 2WKWA 3L1HA 2JGKA 2OLEA 1YS1X 4Q3KA 2QXTA 4Y9SA 5E4YA 3WYDA 5IVDA 5DTIA 5A62A 5EIEA 1E5TA 5DYWA 4LXGA 4Y7DA 2WTMA 1XLWA 4O08A 4RE6A 3C43A 1AX9A 5BWBA 3F97A 1CUSA 1E3QA 2OCIA 4IHAA 1QZ3A 5AI5A 3U0VA 5AM0A 3QH4A 4LXIA 4QZVA 5DNWA 1NU8A 4H7JA 3WWDA 3STYA 3W2TA 2IX9A 3ILSA 4NS4A 3V1NA 2XUFA 5AKGA 2XMRA 3KXPA 1WB6A 1JMKC 3FLBA 2XUIA 4K6GA 2BUAA 3W9BA 1CUIA 2ECFA 5AI9A 4AX4A 5ALHA 4X95A 2ACKA 4INZA 2ZJFA 4FLFA 5E2IA 2PPLA 3HI4A 1HDEA 1EK1A 2OAEA 2GYVA 2IIVA 4N8SA 2ZSIA 3QPDA 4JYMA 4U2EA 2QS9A 3ZI7A 5ALPA 3OOSA 3BF8A 2DR0A 2QJWA 1X70A 3CN9A 5KBYA 5HF5A 3JYHA 2VEOA 2AJCA 2DSNA
chains in the Genus database with same CATH superfamily
1MJHA 2C3MA 3EULA 1Z8FA 1ZCAA 4CFYA 3U19A 5JO0A 5IF3A 1SURA 4Q3LA 3F6EX 4IEIA 4K0RA 4HDSB 1T8PA 1FJ2A 1PQPA 3BZWA 2YUIA 3FUVA 2B3DA 3RFVA 2OHHA 1SFRA 3E3OA 4BE7B 1NVUQ 1P2BA 4ED9A 1X7XB 3WGIA 1CJBA 2FPUA 1YA4A 4JYAB 4M9CA 2VRWA 3DOEA 1E1RD 3H2GA 4TM7A 5H9WA 3ZD7A 2J6BA 3OLQA 1QV7A 4K9KA 1AC5A 4XYLA 1SBNE 5KOJA 3EBOA 1H2HA 3IGFA 4UHJA 2Z1NA 4RJIA 4MPJA 5EQFA 2O8CB 2H07A 4F2GA 4YBRA 3WS7A 3KJHA 5CPBA 3H8SA 4LHVA 4BO2A 2GBLA 4XVQA 5JZVA 3MJDA 3ABIA 2FRDC 3LX8A 4HRXA 2ERYA 5FA8A 3ZDCA 5KUTA 4X3OA 2NO7A 5DX0A 2VJMA 4PLWA 4EY7A 5JPDA 2NN3C 3AJ9A 4J2HA 4WI1A 1L4BA 1NVVQ 2C2GA 2ZK7A 2ZYIA 5GVRA 5K8JB 2IH2A 1I5EA 3RNOA 3C6YA 3JSAA 4K7JA 5GONB 2FSFA 1T3LA 4F6RB 1L4MA 2IWRA 3WP1B 2JBWA 3FCOA 3BSYA 4RTMA 1EBBA 2E7ZA 2XHEA 2XZTA 3AI7A 2O3JA 1AGPA 1RJ9B 3N0TA 1XZCA 1CEYA 2CXQA 3IUPA 5ALTA 2VPIA 4KGXA 3ZCXA 1I4TD 1MUUA 2PT7A 5KDDA 1ENZA 2C42A 4DWOA 3RABA 4J1SA 1E5VA 1RI4A 1Z0UA 2IEYA 1JQLB 3BMCB 3N87A 4X6YA 4MULA 4TTTS 3ODGA 4RENA 3L7MA 2OBNA 3ZYCA 3T7EA 5BVHB 1QQ7A 4HRYA 2V0NA 1S4QA 1Z0IA 2ZBVA 3L7OA 1WXQA 5FKJA 4G81A 1VKZA 1AZSC 2PU7A 2QTHA 1E2EA 1JDVA 1FNNA 2ZB2A 3E7XA 3FZYA 1P5JA 1O6FA 1E7WA 1OLXA 1ZJ5A 3GT7A 1Q44A 1YQUA 2YYYA 1DWUA 3LIPA 4Z9XA 4U0KA 3ROFA 2RHJA 4Q0MA 2Z2XA 3H3JA 1Y98A 5E9JA 2OGWA 2ZFUA 4CNBA 3OZFA 3CUUA 4ACAA 4GYKA 5HTOA 5FOUA 2GLTA 4J1TA 2UYHA 3TW8B 5CXUA 1OC2A 3H04A 1M6YA 2P4QA 3GR6A 3KEGA 4MQ5A 1YONA 4FOLA 4F96A 1KIAA 1GCAA 1M8PA 2HAEA 1HQKA 3DEKA 4YAGA 5CFOA 3W4KA 2PLWA 1DJLA 3EARA 4D9EA 4CLOA 2HHLA 4LJ4A 1QFMA 2JRLA 3ZVNA 3ZDAA 1E9BA 4G36A 4INOA 5CVJA 1AUPA 1Z37A 5TPWB 3V4OA 3W34A 4DQ0A 2CV0A 4LOKA 2QPTA 3TLMA 5B2EA 3JD0A 1EJ0A 3TZCA 3M4ZA 2WFMA 4XR4A 4A73A 4DBLC 1PWHA 2B8TA 4P36A 2CCJA 3CC8A 3DLIA 5FI5A 3BMOA 4REQB 3GD5A 1L7AA 4IGAA 1BDHA 1SHZA 3BGOS 2R5NA 4EFKA 1LSJA 2PD4A 1BG6A 4V03A 3B7GA 3D4PA 4ND4A 3RYHA 3QMWA 4GE0A 2V7XA 3AY0A 5JW6A 4IFIA 3WWPA 4UTRA 5JD4A 4MP8A 2QK4A 4YRSA 2AX3A 5EJIA 1TT5B 2WQ7A 2WJ3A 1L5VA 3EK2A 3IMKA 4I6GA 2CL7X 4OQFA 3STWA 1EXMA 2JG3A 4I5FA 1T9GR 1ZD4A 3ZLBA 5HFAA 3C2QA 5H4HA 2IXTA 1KZ6A 2OD9A 1RKUA 1GXSA 1S5PA 1DT5A 2HA4A 4F71A 2RDMA 3MRVA 4HLNA 4C7VA 1FTSA 4QYXA 2BFWA 2XY4A 1ZU4A 3K2BA 2DF8A 2FPMA 4LYAA 1TYCA 4MUEA 1IZ7A 5IYZB 4E14A 2D2IA 3EMKA 3LHKA 3QKSB 3R6TA 4WVFA 3UT5A 2XMPA 3T7CA 2RH4A 3DEYX 2DLCX 3O94A 4RFVA 4CM4A 5DCUA 1HNXB 3QEAZ 2ILTA 3CH4B 2X8JB 1V11A 3A37A 4Z49A 1E9EA 3R0QA 5HDQA 3K6RA 1ORDA 4FEEA 4YMSA 1E9DA 3GCZA 3QEOA 1ISJA 4B7CA 4B71A 1O89A 2X41A 4NZNA 4M21A 1KIMA 5AM1A 3OCZA 2BTOA 1PX0A 4W6ZA 3D8UA 4H1WA 2H2AA 2VDVE 2VF7A 5CM9C 5T4HA 2XB9A 5KU1A 2UUPA 2AFIA 1QRUA 1BMFD 1FPMA 3OHMA 5FORA 2EX0A 3ASYA 1NIPA 4KBGA 4DNPA 4YQYA 1KMCA 3OLCX 1A5SB 2AN1A 1HTTA 5IKXA 3FDZA 2X6TA 3GBSA 3IJPA 3NIFB 2QRZA 3L0DA 3NAGA 1WP4A 4AZ0B 3UJBA 4ND2A 1BMDA 1PZNA 3OM1A 3A6ZA 3JD1A 5B1EA 4B8YA 4WFQA 5IUKC 5DNYB 5LMNB 1U0EA 4FZ3A 5AHOA 4XUEA 5ALVA 1Z5GA 1UP4A 3OZBA 3RSQA 3W5SA 3RVLA 3RBAA 2C97A 2VF8A 1TQ2A 3SJZA 2GETA 1RDFA 1TCVA 1XDDA 4LYEA 2PFGA 1QP0A 3GJ7A 4YJFB 3CCBA 3VKWA 2QJFA 1C3LA 1V48A 3AY7A 2PGXA 3D5QA 3T61A 2PJRA 4UAJA 2OP1A 1D03A 5AKKA 4KQKA 2Y99A 2GTHA 5DXFA 1QJ4A 4PV7A 3R9XB 2PKQO 2QF7A 5C0OE 3E05A 3MWEB 1TB4A 3OP1A 3Q9NA 3GI1A 3G0CA 1CQPA 2KI5A 4GPBA 1FSGA 5HE8A 1NBMA 2WKQA 1RXSA 4R9RA 2VF2A 1YJBA 4ALMA 2VP2A 4CG2A 3QJGA 3X0DA 2QL9A 3I1FA 3ZY4A 3AFHA 1Y0BA 3MMPA 3O91A 5C4MA 2IDZA 3JZFA 4YMLA 1J99A 1UWKA 1NRXA 1Z0SA 3SSNA 3AK4A 4MPDA 1ENOA 4RSGA 1J07A 1W4LA 1IJEA 2H0AA 1HWYA 1GUZA 2IW1A 4F8YA 2PS0A 1B3RA 2XQVA 1FXWF 3LDFA 3R5HA 3MS4A 2P75A 3V8PA 1NMZA 1UEIA 4KQ6A 4TVBA 4G0XA 2WWXA 4PPNA 3Q8LA 3EY4A 3O1IC 1VG8A 2PBLA 4OOFA 3V34A 3E7WA 5JCOC 4KVAA 3WNBA 2XCOA 4QE3A 3ZHCA 1Z82A 3QF4A 4I8DA 3RUCA 3M9WA 3SR4A 4BV2A 5F98A 3LDGA 4JP3A 3LPLA 1JQAA 4BQEA 4QYWA 4IXWA 4PHGA 5K7SA 1LKZA 3CN7A 5ANRB 2JVKA 4U0JA 2UZ4A 1VLZA 3H17A 5IYZF 3D3NA 1QRAA 5HSGA 5EZSA 3NHYA 2X9QA 1V6SA 1FRFS 3AEKB 1KQNA 4ZYZA 5BYBA 4FGSA 3AUAA 3ZEIA 4B4KA 4CU5A 4DIKA 4TV8A 5C4IA 1WHSB 4TTSA 3RO7A 2ZUEA 3AIKA 4XA8A 2BEWB 1KK0A 3BXHA 4E07A 1BWRA 2GSWA 3BXFA 4GI7A 1N3YA 3D1LA 2I67A 1TKRA 1OZFA 2GH1A 2FEPA 1TTHA 3VYRB 2C61A 3JD3A 2VCEA 2RAUA 2VPYA 3TKYA 2PMEA 4B6RA 5BUCA 1J06A 2P5SA 3A6EA 1ZK3A 3ZI4A 3GPIA 1X1RA 1LVUA 2KS6A 3G2NA 5A4AA 5D3KA 1P2DA 1L5OA 5TMBA 2V03A 1PI3A 3KWLA 4MJLA 4R9SA 5D87A 3K2QA 4IDEA 3ASUA 2J33A 2VUSA 4PC3A 3NASA 2K7FA 5KQSA 3ZWDA 3KEFA 4Q9KA 5AW3A 3KNZA 3FCYA 3O8CA 2C07A 1PEDA 3ETEA 4L8FA 3AUKA 2HCRA 1SB9A 3EWSA 4K46A 2AB0A 5EKSA 4Q7QA 2J3HA 3ZPXA 4D4IA 5K3EA 1A72A 1CVIA 2II6A 2N75A 1GM5A 3HO8A 5CFZA 3P2EA 1E3TA 1MB9A 1P73A 1YBFA 1ZZEA 3BTVA 3JS5A 2ISCA 2QN9A 4P7GA 1R3UA 3I9FA 4BASA 4ADSG 3T94A 4RSRA 3AEXA 2J7PA 4O2BB 5EHQA 1SCUA 3NG1A 1FK8A 2YV1A 4A8PA 3NH9A 1KOGA 1NAHA 1Z6YA 5CT4A 3E58A 3KSZO 4LBYA 2J3IA 4C0JA 2HV9A 4KI0A 4MA0A 4LWQA 2PH3A 1U11A 4H0NA 4MH0R 4YRFA 2IHTA 1P0PA 4O4HF 3G9QA 3T3NA 3VSBA 1QHNA 1TOAA 1V8BA 2VWPA 3FFAA 5JALA 4MB2A 1THMA 2WTAA 1PX2A 3ETDA 2IXGA 4ZO6A 5FTJA 3BSWA 1ADCA 1TVKB 3C6QA 1ZR4A 3RD5A 3HKCA 4YPOA 2P3LA 3IQEA 2Q2NA 4JJEA 5E8RA 5J1TB 2GZ2A 5JXHA 2ONCA 1TD1A 2Y67A 3MK31 5F4ZA 5I8PA 1Z3CA 3VYUB 3C8DA 4E88A 2HMAA 2H0QA 1W49A 3TF5A 1WP9A 2B0JA 4YXFA 4URHA 1LFAA 2DBZA 1MAVA 3CCCA 1AXRA 4DUPA 4HKTA 5EHZA 1SXPA 4MSUA 2L69A 1QGUB 4UVDA 1N2IA 5AOBA 4QT0A 1UT6A 1ZQ9A 2Q5QA 2E4ZA 4BEWA 1FZTA 1W6UA 4WY8A 4CKZA 4XWTA 2FG6C 3B1ZA 3WGJA 2EP7A 4EB6A 5C1PA 3MBKA 2QQEA 2EL7A 4EUKA 5IKEA 3THYA 1ZRMA 4TUYB 4CEHB 4OXYA 2BI7A 3PDHA 1BROA 4CQMB 1VXOA 2ZSHA 3ZU4A 4QUIA 3VNAA 2P9GA 3MS7A 3FRIA 4Y9TA 3WLNA 1DKPA 3RYFA 1H4TA 2Q50A 1B3BA 2BBOA 1T8YA 4Q66C 5H8WA 2OWEA 2H06A 1FA9A 1FB5A 1M2VA 3EGCA 1QB7A 3NBUA 5L3SB 3U62A 2WIGA 1O96A 1KYIA 3D6FA 3CLTD 1RXYA 2R8ZA 4N6NA 2I2FA 5JAMA 4YUVA 2CLMB 5K3FA 3LA6A 2Y1FA 2O19A 4I1VA 4XPIB 4B17A 2CNBA 5SZJA 4JLSA 4QPPA 2V8BA 4B85A 1E3DA 1Z63A 3O3CA 4IVQA 2Q3EA 3BRSA 3EXIA 3DOOA 1YZKA 2WUDA 3F6SA 2P5YA 3TIGA 3LP5A 5EJ6A 1BMQA 1FRVA 2QX7A 2IYZA 1H05A 3WRYC 4K3UA 1U2EA 3EMVA 3W6NA 1Z25A 2OBXA 2ZRBA 3L3BA 2PUDA 4WX2B 1Y6RA 3L1VA 4FNGA 2SKEA 4Z3KA 2DUUA 3K0FB 3LP8A 5C34B 1XQ9A 2ZI9A 4ZDIA 3UGQA 4TT3A 2CFIA 2VDOB 3W2FA 4F9FA 2CLFB 4F3CA 4DIMA 1S2GA 1BHO1 3WWZA 1UWVA 2R7KA 3DL7A 3RASA 3RVDA 1Y48E 1HYBA 2V9ZA 1YR6A 3ICVA 4RVNA 5B7GA 2YIMA 1FU7A 2QN6A 2W90A 3AILA 4N8EA 4LECA 1HXHA 4QHYA 4C22A 5BW5A 2W2LD 4B3IA 3I28A 2RSLA 2V55B 4I2NA 1C50A 4HDKB 2F1JA 5BV2P 3F49S 4X1OA 3SXJA 3WGLA 4EG3A 2I6UA 4UVIA 1GY8A 4NBSA 1OIWA 3WIUA 4G1MB 2PX2A 2NSDA 2HJ9A 2OLJA 3NVDA 4BNVA 3PQ8A 3AEUA 3AUJB 2O0MA 5CPFA 1FRNA 4ABYA 1QMGA 1BVHA 2OV6A 3LLUA 1MU0A 1UFOA 3E9EA 3TQCA 2ZAGA 1X9GA 3ZE9A 5AVKA 5LLDA 2VP6A 2XMZA 1OX6A 1EIZA 2SCUB 3N2GB 4JOQA 2GN9A 5T6MA 5KTRA 4UMVA 2O9JA 3F3SA 3PC8A 4EVRA 3PQ5A 4YT4A 5BT8A 3I64A 3MJ4A 2O2XA 3OHSX 4JEMA 3KLPX 3ZJVA 3ZU3A 4K0KB 5FBHA 5KNCA 1E5QA 2CJWA 1YKFA 3Q8KA 3V5NA 4Q9HA 1U63A 5IXSA 1C7IA 4PYNA 4ENTA 3N6XA 1LWOA 4FHFA 4F4HA 1Q7GA 4AUEA 3V32A 1L8OA 2GOYA 3AVYA 5EC8A 4TWIA 1QRRA 3P2OA 5G1PA 1W4ZA 1XCLA 4TS1A 3DPIA 1D4OA 4LJ5A 1DADA 5IC4A 3LPDA 2DH5A 4OQ4A 1EGHA 4ETNA 1V96A 2PGDA 2C57A 4QDJA 1A9RA 3HA7A 3KTAB 4WCDA 1WV0A 4EYQA 4BLOA 4LDZA 1VLHA 3PL5A 4M37A 5K20A 1T1GA 3GDFA 2E4YA 1UQRA 2XBUA 3TZHA 5KDLA 1FNDA 1N0UA 2DCUA 2EP5A 1V5WA 2CD9A 2ZBQA 3EISA 3N9IA 1XZMA 4IJQA 2FZVA 3VKUA 3FFWA 5L7WA 4HZUB 3D5EA 4CTJA 1FFWA 2XRZA 2BE7A 2GAFA 2H2FA 4GNRA 4IV8A 3Q2IA 1UFQA 1AMUA 1WX1A 2I3BA 3THWB 3OA2A 3N2YA 4XGQA 1AK2A 5ECWA 1JLLA 1VP3A 1PIWA 3TK1A 1F4LA 3UPDA 4DCMA 1OX4A 4OKIA 1G6OA 4P84A 4WKGA 4C6HA 1XVVA 4ZI2A 2VO1A 3CA8A 4BO0A 5J23A 1VGRA 4A8JB 1EQ2A 4IIFA 4EHFA 2X5JO 4D3XA 2VRCA 3WK9A 1RJEA 4RLFA 4MLZA 2BJVA 2Q1SA 4OUDB 1GNLA 1I2BA 4RCYA 2JJ8A 2WU4A 3VSCA 3AVTA 2H2HA 1JLMA 4MVJE 2PMBA 3WBKA 5DNCA 4HQ6A 4PGAA 4II7A 1XP5A 1GOTA 2O8BB 2YXBA 2X0FA 1S1MA 2ZWPA 4UEJA 1E9FA 2BHTA 3EIXA 1DAGA 1UBMS 4BEJA 3KG2A 3CUVA 2JHFA 2CLDX 2PG3A 1DV1A 4JNCA 3IBYA 5G0VA 2B4TO 1LC0A 4XI9A 1BQ3A 4JVOA 2EW8A 3VYTB 4RY0A 4QOEA 4A0QA 2IE0A 1GWNA 1TK3A 3WQBA 1RIFA 2QW1A 2DHDA 2QROA 2WJGA 2QBYB 2EBFX 3I53A 2DAPA 4HSEA 4UFPA 1R0BA 5DCLA 4BLTA 4GQAA 3X1JA 3B38A 3EGXA 2FV8A 5BYJA 2VXYA 1MC8A 3N2KA 4CQJA 1T0HB 1XYYA 2A9PA 2FG5A 1N0IA 3VHRA 1YGPA 1GA6A 1CRQA 3PVSA 4DR1B 2QUJA 2YUTA 1KAGA 3ZCVA 4G8BA 3Q85A 3D8TA 4HDKA 4XJXA 4OLFA 1G2IA 1PL7A 5FOQA 4B3DA 2XWJI 1H2EA 5TB5A 5IJAA 1DBVO 4M0EA 1J9GA 3O8LA 4Q4CA 1XQ6A 4MVJI 1II0A 5ICEA 4KW7A 5CX4A 2JBHA 2GVDC 4COKA 1PJAA 1HORA 5D7NA 3CZRA 3CGWA 1KIFA 1TA4A 4G63A 3DEHA 5KNCD 4YCMA 1WSDA 1Y1QA 3HY6A 1T3SA 4Y0AA 5HBGA 4E5VA 2O8CA 3L0IB 1OT5A 2GYYA 2VBGA 2FH5B 4N5NA 4Y6RA 1JKJA 3UHAA 4Z3OA 3PFIA 1EM6A 2EF0A 4KR9A 1GRRA 3WZMA 3GA5A 4KLAA 2D0PB 4KO3S 4YRIA 2F3SA 2IY7A 3OTIA 2Q3DA 4DJ5X 3QVWA 4D9NA 2BC9A 1K4KA 1CB0A 1XVIA 2VPTA 3EF1A 2D8MA 4MWBA 5CGQB 1GFIA 4TXNA 3CJRA 3EXIB 2B4YA 2XEXA 3GJ6A 1EVEA 3KR9A 2MSNA 1GPUA 1IY8A 2FWBA 4AZWA 3NUGA 1HETA 4KFCA 4TWRA 1KARA 3PKZA 4ZT7A 4JDUA 3LCMA 4D82A 1VL8A 2OM6A 3ADPA 5THXA 2X4DA 5FLKA 1OD6A 4BP1A 2IK8A 1NI4A 2XE7A 3DEIA 2BZSA 2IYRA 2A33A 1RPJA 3F0TA 3IR5A 3PP8A 4RQTA 3GLFB 1ESNA 4R16A 2DCMA 3JTEA 1O08A 4ZT4A 4G9EA 1DTSA 4JJ7A 2VCYA 4D3ZA 7YASA 1I2DA 5BW4A 1MXFA 1XEAA 3H19A 1Y1PA 1Y4ZA 1TD9A 4IIJA 4QQNA 5CVDA 5JSZA 3HJFA 3QV1A 1H0SA 3IP5A 2WVJA 2Q4DA 2WI8A 3G5MA 4TYMA 5DHRA 5A3SA 1EEXB 4AC9A 4ZCTA 1ZD1A 4WL0A 1B8UA 1G0NA 3BX1A 1C1DA 5YASA 2XTNA 2OFXA 1ETHA 4LVNA 4MQMA 5KOJB 4HVAA 2F62A 3I9LA 1VRVA 1Q19A 2AI2A 3OAAA 3ANTA 2G67A 4RPJA 3QOXA 4A9AA 3WRYA 2YOFA 3KKZA 3WZLA 3B7PA 3UYLA 1N5DA 5A4JA 2D2XA 1NV8A 2IF2A 2RGGA 3ESCA 4HJXA 3S81A 2GPBA 4XW2A 3HUDA 3UB2A 3T3DA 2AFHA 2IUUA 4JUIA 3ZNPA 4HGPA 1QF7A 4JT2A 4CIVA 1T5IA 2HO4A 4O2LA 2YY5A 4MUMA 5BQOA 3ZNNA 4EB3A 1KZGB 1NG9A 2PTHA 4JLVA 1OZHA 4RF4A 2OHXA 2DYKA 5EL0A 1BKSB 5GJWC 4G0NA 3DXYA 3GUVA 3FWYA 4TTQA 1GKLA 1SUCA 2CVPA 2FMXA 2VK2A 5J47A 1P61B 1SZPA 1JL3A 4LHZA 4KDCA 3FCUB 7MDHA 2XQGA 3GJRA 5KVSA 3GOHA 4TMWA 2JGDB 4E03A 4BX9A 1GSOA 4TZKA 5GOZA 2L82A 1QO0A 2ZULA 2E4AA 3JSXA 2HLHA 4AY5A 3BZUA 3AC0A 2MSDB 3E27A 1CUJA 2C59A 1YZQA 2D5IA 4MUIA 5J9FA 3ZOZA 2H8GA 3W5BA 3T5DA 1P1BA 1A7JA 1UOEA 2I8LA 2Y8EA 1QVZA 4OCZA 3EDRA 4UPDA 4CQMD 3DUFA 2NUPB 3W1EA 5LNK6 1H8ED 3GLGE 5LDHA 1NHWA 1UCFA 4XYMA 3U1TA 1MQ9A 3G8BA 4WXEA 1T6NA 2GAJA 2XODA 4KZKA 2BM9A 2CB9A 2FHPA 2JIZA 3AUUA 1Y9AA 4M60A 1Q12A 4MRPA 3T7AA 4AU1A 3MXTA 1DCKA 1ZGHA 5ALXA 2LKCA 3BH6A 1T9DA 3HU3A 1O95C 5E4FA 2CXPA 2IS4A 1OILA 3M9LA 4R1MA 2CV1A 4OK5A 1WTAA 2VP5A 5DN6D 1D5CA 1VXRA 5A5GA 1ZOPA 3UB3A 1G3IA 2GASA 3PTLA 4GZ5A 5EYPA 1JG6A 3D59A 3SZLA 1DKMA 2H0RA 5JROA 1VL6A 1XALA 2OFWA 4BKQA 4DWWA 1FBTA 1L7QA 2A1IA 3WL7A 3CUYA 3QBJA 4M9UA 3HKEB 1KTIA 1F9EA 2JFOA 1C3OA 1PG2A 2BFFA 2Q3LA 4JB0A 3WSTA 3T5PA 4KGDA 3RVNA 2CWWA 3H7IA 3M8KA 4DCVA 5IXJA 2A5FA 4E2ZA 3F73A 3HKBA 2OSVA 3WIEA 1UADA 2NU6A 4Z5XA 5AM2A 4WN9A 4P7FA 3ZIAD 4DNFA 1AD2A 2CHQA 1TZ2A 3MGGA 5B1HA 3OP4A 1J8QA 1R5OA 3PDCA 4ZPXA 3IUEA 1EX1A 4C6RA 1YZYA 2OZEA 4RGYA 3RS0A 4D57A 3O9ZA 2OXFA 1OYVA 3ESAA 4NBTA 4R54A 4IBOA 4WFJA 5DVZA 1EUCA 2BP7B 2AGVA 4UXJA 4I9FA 4ITUA 4BZZA 1D09A 1T1SA 1SG9A 4F4FA 5B4TA 2D0IA 5MN4A 2V3VA 3DVSX 3UTCA 4O4LF 2CNDA 3M6AA 3G6WA 4WBSA 5EZYF 1UFVA 1DC5A 2WFLA 2KPOA 2WICA 3DH0A 1LDEA 4HY3A 1JAZA 2PGJA 3B2QA 4YJGA 3UJ8A 3NO4A 3PCRB 5KJ1A 2EJCA 4MW4A 3I2FA 3PV0A 1Z36A 4RJJA 4BTVA 2C1XA 2GEDA 5ALYA 5J63A 4G0WA 2ZP1A 1P9RA 3L0ZA 3ADOA 4U7FA 3HWX1 3MC1A 1G1MA 3LQ1A 4DPLA 4GR9A 3H99A 3BHJA 4LDPA 1O6ZA 5BN3A 4MVWA 1IOLA 1YOBA 2C2OA 1DEHA 2XVAA 5AJHA 2WFLB 1ECBA 1JG1A 3NETA 4NZZA 2FEAA 3L7BA 1E64A 4BP8A 3LTNC 2RMKA 2WWTA 2I65A 4I5EA 2D7CA 1XN4A 4EABA 3WIVA 3FZGA 1QRTA 1SAYA 1KI1A 1MP0A 3QEJA 2DTXA 4E2FA 2OGTA 3ZGLA 3USZA 1GNRA 2G09A 2AWNA 3UN1A 3AV0B 2EFDB 3BORA 3JVVA 1PS0A 1SRQA 1WCIA 1IXSB 1RJDA 4PBSA 2HLNA 4UCQA 3A9UA 3ORYA 1ENYA 1L5QA 3IVRA 4TMFA 1FU8A 1JN0A 1NW6A 1IN1A 2FEXA 3LCVB 2GPSA 5C32A 2Q6IA 1T2NA 4GPIB 3PENA 3PQEA 4TS9A 2AMJA 4XD7A 4C7JA 4DMGA 4EI7A 4P5DA 2EGUA 5HHTA 2G9QA 4LRXA 1KPIA 3S2YA 1ZGAA 1NF3A 2QYSA 3NOOA 2UXBB 3LPNA 5HQ3A 3K0FA 1SVWA 3H11B 3C6KA 9LDBA 5F3DA 1A8HA 1O58A 4RWEA 4GL4A 2J41A 2XT0A 1GUFA 3KEOA 4GKVA 4L6AA 3CKYA 4PTZA 1V7CA 4W1QA 5FF9A 3U9SA 5KWEA 1OHHA 2PWYA 3V7WA 1LTKA 2RGBA 2VAVA 5LQRA 5K0FA 1CZLA 4DFDA 2GCNA 1EG7A 1HQDA 2Z56A 3HCAA 5ERYA 1V9LA 4XH9B 1VZ3A 1PS9A 2W8BA 1OXMA 1Z5WA 3FE2A 1QCZA 3GIWA 4MW9A 4Q4AA 3TNFA 3PPVA 3UJCA 5JWOA 2HJWA 4GW3A 5AW1A 1ONBA 2YZNA 3ILXA 2AIRA 1IXRC 2BKVA 5LCXA 4BNNA 1ND5A 3D6JA 2GD1O 3OQ6A 5EMNA 4WEOA 4FMDB 4IFBA 3EQ8A 4RS3A 4QGFA 5MDHA 1AKTA 1QO7A 2JZCA 3MW8A 4YAIA 2IYUA 4MYUA 1CHDA 1CUBA 3H1FA 1GILA 4PLTA 1U81A 2HXYA 1YVRA 2C9OA 4UARA 3MJHA 3AQ4A 4MKZA 3HN2A 3RYIB 1GKYA 2J4DA 1ABEA 2V7EA 3O8NA 1PKXA 4IXDA 5K03A 1WQ3A 4MHTA 1Y37A 2QVBA 4BQIA 3H5WA 4PWZA 3TBFA 3FF4A 3ICEA 2QGFA 1F8YA 1IUPA 1VFPA 4GI3A 2PEZA 1AXEA 5D3MB 4ZVOA 1TVEA 5IPFA 1OWMA 3TW8A 3HVRA 3NI2A 1UK6A 4PZ9A 1EIWA 2X0IA 3AINA 3DMTC 3PK0A 4HDMA 4TMTA 3RAEC 3PRJA 4ISCA 1GTJ1 1DIBA 3L02A 1I94B 4BPBA 3EGIA 3OU6A 3QVLA 1XHLA 5DSXA 3V42A 4D25A 1ZN9A 4TV8B 1CRPA 1IN5A 1VBNA 2EZTA 4AIRA 3PJDA 4E11A 1RTTA 3A26A 2QVYX 4EF5A 5E2AA 1QIFA 5EKDA 1E4VA 3AP1A 3GHYA 1QXSA 2V8OA 3CEMA 3WGKA 4BNXA 3E22A 3DT6A 1NF8A 3ZCQA 4M1OA 4BFXA 1ZM2A 2XMSA 2EGGA 3O7WA 4CR6A 4DB2A 3CUTA 1CQXA 1DS6A 1EX9A 3ET4A 2R65A 5JYDA 2V59A 3K1YA 4HAIA 1T6BY 5HIAA 3S2ZA 2YH2A 4M99A 2AEJA 3RU9A 5HK8A 1D6NA 4RTKA 3P94A 4JC5A 2XUOA 1KFJB 4DR4B 3VOTA 4CV1A 2OVBA 4UDOA 4EYSA 1L4GA 5DCWA 5A9RA 1RWMA 3EWNA 2WYOA 1KY2A 2V58A 5AI4A 1NLZA 5TPZA 1DBQA 2E4XA 2BHLA 4WXRA 3ZHBA 3PUIA 4N0PA 1T0IA 5FQOA 1NSTA 1E6WA 3L4BA 4R01A 1XDWA 4ZCMA 1Q57A 2YZ7A 2ZJ4A 4RM3A 2Q99A 4XD7D 2DPYA 4OVKA 2YCBA 3NCTA 3RFFA 4IH1A 2Y05A 3GT4A 3PHJA 1UPTA 4MS3A 4ARAA 3IPAA 5I7UA 5LMUB 2WSSA 3LBNA 4QUDA 3M2PA 5LBTA 3AW9A 3T5TA 3T7TA 3PEYA 3TMAA 3FX2A 1CSEE 3OECA 3U7HB 3P9SA 3T7KA 3FETA 1DG3A 1II8A 1CJUC 1DLJA 1GCIA 3I72A 1H2XA 2GNAA 2ZJAA 3C6ZA 3FCEA 5E3HA 4D4LA 4DDMA 4J43A 4EGQA 8MHTA 3NS7A 4ZAWA 4UAGA 1ABFA 5ALZA 1ZH0A 2BM1A 5CNMA 4C89A 4GOXA 3A05A 2XV1A 4F46A 1SU4A 1NC3A 1Z0DA 2YWFA 4AY3A 2X0DA 2X4GA 1POWA 3KJZA 2XQIA 2FFHA 4P38A 4WHMA 1H94A 2ZREA 5D00A 3O1LA 2W98A 4WRRA 5AJVB 5B3LA 3U1BA 3H5OA 1HYGA 1T5DX 3LX6A 1XKLA 3H4IA 4BFCA 5C4GB 4RGQA 4X3PA 3B6ZA 3Q15C 1JX6A 3I73A 4GOND 1LJLA 1A8SA 2CBGA 3DC7A 1CR4A 1Z29A 1VCHA 1U8FO 5DT9A 2RBEA 4CMKA 2MYUA 1PUIA 2JAHA 1YFZA 3MTEA 2DHEA 1QH9A 4L22A 4Q24A 5FUMA 1I4EB 4TN5A 1LBSA 2ZIVB 4UVHA 1XZBA 5IC5A 2A14A 5FFFA 4G0OA 2B78A 5DW3A 3RRFA 4XX0B 5LZ2A 1QVAA 3IHLA 5GVSA 1F12A 5LZ7A 2DH6A 3E03A 4ID3A 4EW2A 4BJ5A 4RPHA 1QHSA 4RD1A 3AFOA 2D2EA 5B58C 4M1WA 2OECA 1CHNA 2OY0A 4LY0A 3DV0A 4PC1A 4E12A 4NFYA 1DJNA 4B4DA 5AWFC 1N33B 5J2TF 4PQRA 1U1GA 2FDXA 1J20A 4M9RA 4KXLA 3WFJA 3N6RA 3WKCA 1T0JB 1UJ4A 3HLKA 4CG0A 4PSAA 4PVCA 3AT1A 1FTGA 1N5KA 4ID9A 3PR1A 3LHSA 2A86A 3SZ3A 2YV5A 1G8JA 1YWGO 2GI4A 3T5BA 5A3RA 4NULA 3LA8A 3BZBA 4MHSA 2M98A 2Z5GA 4ZI7A 2Y0CA 3LFTA 5KPJA 4XTRA 4FU0A 4LZOA 3OKAA 4NZPA 4L1KA 4DYDA 4IIYA 5I3CA 1GL6A 2ENWA 3RUHA 4FYVA 2Q2OA 5JMOA 2FZCA 4GQIA 1BFUA 4ENWA 2RH5A 3C8ZA 3FPJA 1UPCA 1W4CA 1ZGBA 2PRYA 3PC3A 4RMNA 4O8ZA 2MCFA 4GYYA 4DDWA 2BDUA 3JCZA 1DHRA 4GM0A 4JT9A 4WKBA 4OB7A 2QNBA 4Y67A 4JI1B 3ULKA 2YJ5A 3FIJA 1A7KA 2C8VA 1RWXA 4RPIA 1XEXB 5FOTA 5TV2A 4ETWA 2PZ8A 2CFOA 5JC1A 3G8DA 2WSSD 5J5CA 5C51B 4ZTZB 4HDOB 4HN9A 3WMWA 4OQQA 1U3FA 1OTXA 4FE7A 3H9UA 4MCAA 4Y2UA 1CZHA 3CJTA 3ZIDA 1DZ3A 3H05A 3WQQA 4BWFB 4YMVA 1P0CA 3A14A 4YMIA 3PGKA 1Y3IA 1XXHA 4X20A 2GMWA 2OZVA 3AJEA 3JARA 3JWEA 3W5JA 4HUQB 2YVKA 4B4OA 2GJKA 4EK9A 4KJZA 2F90A 1EP3B 1W73A 3SC2B 2WE8A 2Z08A 3AI2A 3L7NA 3QKIA 3L40A 5DW0A 4HNAA 4ZCQA 3ZLJA 3PNVA 1H22A 3UWSA 5IZ4A 2XVMA 3OU2A 4Q5IA 1MO6A 2Z6VA 1VE6A 3I3OA 3G89A 3A4NA 4A8JC 5I5EA 5AT1A 5A4DA 1XLTC 1HSOA 1HRKA 1B8OA 1K7XB 1RWBA 1UR5A 4X6XA 1ATZA 3FTFA 2D5LA 2G3YA 3MTGA 3JARB 2Z30A 3CZCA 2J6HA 4R3WA 1C3XA 2ZRJA 5AR1A 5BRAA 3QZUA 2YQ5A 5SY9A 4HVCA 3NDPA 1KEKA 2TS1A 3DB1A 1PZGA 4FNAA 2FKNA 3GUUA 3MUEA 4PZZA 2OYRA 4BFVA 2QD3A 5ITVA 2VJQA 4TL9A 3AERA 4JLAA 4W6QA 2AZ4A 1R6AA 1ZOIA 1K5HA 1V1RB 1TEXA 3O3NB 4M1MA 4OBWA 1ECGA 1N3LA 3FHJA 3FPGA 4MAMA 4KYTA 3WLIA 3HE3A 3T9DA 2A59A 2KE5A 2BH9A 5KJFA 1HI9A 4W8HA 4D26A 5FUYA 5TGDA 1PFVA 2H3HA 2G0TA 1G8HA 1TAHA 3G8CA 4KXNA 5EZQA 5FWAA 1U9IA 4ENVA 1MHPA 2BLLA 4G4GA 3RVMA 1J0CA 3K6JA 3DVAB 2XI4A 4EEZA 3GAMA 3LCRA 5E1DA 4JV5B 1F8GA 1PUXA 3USCS 2OMKA 1TF5A 3HCCA 2QZSA 4ZJZA 1JJBA 4YMTA 1B14A 2VYVA 2ACVA 3JQEA 3BDIA 4QO8A 4QPZA 3L4JA 1W76A 3TCNA 3LSYA 2QV7A 1GTRA 1SVLA 3FLEA 3VC1A 1X80B 2PUEA 1O1YA 2H85A 1DIGA 2HJGA 1QV9A 2PZLA 1H85A 4GSYA 3U0BA 2AZMA 1K89A 1U0TA 3PX2A 3V7YA 1I30A 1M6EX 3RYTC 4Y9UA 4BO9A 4YJHB 1W75A 4AB1A 3TRDA 5AVWA 4HB3A 4RYDA 1QAOA 4R8VA 2M6KA 4ARVA 4WLNA 4BO3A 4EKYA 1WNTA 4BFSA 2QRNA 3OD1A 4FEYA 3S27A 5JBIA 4I14A 4NOMA 2JEYA 3IKLA 4R2HA 1NKSA 1KJYA 2PZBA 5C8ZA 4G5RA 2RKWA 1TJPB 2JA1A 4I9UA 1NR5A 2IPOA 3LF2A 3KD2A 4CLOB 4OKSA 3CXRA 1MQ8B 4E6EA 3A9RA 4WACA 1QF9A 2AEMA 1LGYA 5KI6A 1U9IC 4YRZA 3BCRA 1OB2A 3IVCA 1SHLA 2DFPA 2ZBUA 3H4MA 4IZOA 4I99A 4IEFB 2VF4X 4LMAA 3I32A 3R5XA 1ISSA 5LNK1 3IVXA 1CNEA 4GQBA 1D2AA 2AKYA 3GFFA 3TZEA 3V1LA 5IJ0B 4EPXA 5DNEA 2H1VA 2ZDHA 1E2JA 2C84A 2WSLA 2ZS8A 4OQNA 4GL2A 1OVMA 3ZGYA 5HGJA 3Q7QA 2ZCJA 3O9MA 4L50A 1O96B 1H2FA 3UOWA 2J3DA 2Q27A 4DM4A 1ZHHA 4EW6A 1TT7A 5IHPA 2I87A 2CSUA 2A9RA 2FUKA 1JSLA 1CEQA 1L1EA 1T3GA 2VHCA 3FNFA 4IHKA 4O29A 3TSOA 3OJLA 1QG4A 1E4EB 1UMDA 4QQRA 2H52A 1E0DA 1SCIA 2YVUA 2ZTUA 4S1WA 4UM7A 2MU1A 4QREA 1U6KA 4G07A 3I58A 1VE9A 4QBKA 3UJHA 4A3SA 1BD4A 3P9YA 4B09A 5KCZA 4MWOA 5FWNA 4C0SA 4ML3A 4IMRA 2GZ3A 1IRIA 3CNOA 1ZISA 2ZUUA 5EMKA 1DSSG 5ALJA 5FHQA 4BO5A 4Z4GA 1YB5A 1E7SA 1V5GA 1XZDA 2FSPA 2GCEA 2W6OA 1WMEA 3DV9A 4B44A 4RZIA 3WMRA 4KOAA 1PJ4A 2HCBA 5I51A 1Y3DE 4PQYA 4Y8VA 5EP4A 3QG1A 3NOVA 4YIKA 3PDIA 3PBKA 4BJHB 4YJHA 1DRJA 4YJ2F 1KZ1A 1Z4KA 1J2UA 2I3GA 4CT5A 1PNQA 1F4VA 3DNPA 3INGA 3P1JA 4JL5A 3TPFA 1ATIA 2ZT6A 2XUZA 1GNVA 3P0EA 2VSXA 4FC7A 2PXAA 2C4WA 4BQNA 4L27A 4BX0A 4B87A 4KLRA 1NMYA 2V4MA 4JA0A 1Q74A 4BYGA 2G36A 2QX9A 4HGYA 1YJ5A 2GZAA 4RQBA 5E9AA 2GCOB 5LZ8A 4CLRB 3EC2A 2N3ZA 5FH9A 1X92A 4JBXA 3TD6A 4EDHA 3VISA 4ICIA 1KRWA 1DINA 1O94D 3LDUA 5TARA 3PITA 1SKMA 1EMDA 3K35A 4EG0A 3W5AA 1NFFA 2J5RA 5EGSA 1Q92A 5EP3A 4EHHA 1J0DA 4RHEA 1DCTA 4MGEA 2JI8A 3PIRA 2R751 5TS3A 1XZKA 1JRLA 2I6QA 4BLWA 4BNKA 3DO8A 4HH4A 5EVJA 1JEYA 3IQGX 3WB1A 1ISMA 1TI7A 4H0CA 2JJQA 4MI6A 4YUYA 1ECCA 1Z4IA 4NMXB 4ZZ0A 1NJGA 1OWLA 5JSKA 4Y30A 5ELXA 4A1FA 5JZ9A 3K8OE 4OSPA 3FSJX 4DR2B 1T9BA 2BI4A 1MOSA 1PBTA 1YI0A 1MX3A 4NYJR 3HCFA 3SXPA 3CQ9A 3EUEA 1X1AA 3HXKA 4G0ZA 5FLEX 2AYYA 1UDAA 3L05A 4EKEA 4YDQA 1E2NA 1RHKA 1QLJA 1UKBA 3HV2A 2XNSA 4C5AA 1OX4B 1QCYA 3ETJA 4HF7A 5D5QA 1EE2A 3U26A 5JAUA 1EFAA 3L4EA 1XA0A 4D8TA 4JGIA 3EZGA 2NO9A 3UAZA 1Y8AA 1ZH4A 5HRCA 4RD4A 3BWMA 4JB8A 3JAKA 4PTLA 4DA6A 1D07A 4C9BA 1SXJB 3OCVA 4GX5A 4NICA 1BW9A 1N6HA 1OZGA 1SVOA 1XJWA 2J07A 4JP1A 3JD4A 3O38A 4GZ3A 4ND7A 1V11B 5FO1A 3WLOA 2ZYGA 4AJ1A 1IWOA 2F8TA 1Q3HA 3DKIA 1PJZA 3BD6A 4KVFA 4LYJA 4OAQA 5GQSA 2A9OA 5SY4A 4PAQA 5IVHA 4Z3DA 2IWHA 4DMLA 4U7HA 4QTXA 2W2PA 2QLBA 1JKIA 1YE3A 4FGWA 4RF2A 3VPBA 1BIFA 3WDSA 4UNNA 1WB4A 1HKHA 4OQXA 1SUAA 2Q5IA 1GTG1 4J1TC 2M6RA 2W70A 5A04A 1E59A 3VPDA 1CQZA 3A6DA 4EPWA 1ID8A 2JLCA 4UUPA 2REQA 2EWMA 5EJMA 4CU2A 3OX2A 1U8XX 1M6VB 4IEEA 1SO8A 4QHSA 1NJ8A 1IULA 1G41A 1L7MA 4A8JA 2WV7A 1P0FA 1YASA 2XUDA 3GJ4A 4JLKA 1EJ2A 1EX6A 4N39A 3ECSA 4AWBA 5LP6F 1H4QA 2P90A 1EK5A 2Q7DA 1M6WA 2PR2A 4PZUA 3NALA 2O0LA 4Q39A 3EXHA 1PVOA 2ZPTX 13PKA 3HDGA 3WXBA 2BEWA 4DDUA 3SQWA 2FF5A 4JXZA 4JVNA 1LK0A 2AUMA 2FZKA 1ZCZA 3MTQA 4V0OA 1G6KA 2OCLA 5EXEA 5IYZA 1D4AA 1YL5A 2VTBB 4GD3Q 1OFVA 1I3OA 2X77A 4J2TA 4BFLA 3PJGA 1I13A 1O97C 2OYSA 4H9GA 3OIWA 4NK5A 2GJ8A 1P77A 2C5GA 4AKGA 1RHMA 1CWUA 3R3XA 1JAHA 2RBGA 1I7LA 2HBYA 4MQFB 2IDJA 1R8XA 4QSHA 3ITDA 4MVJF 1CS0B 1O94A 3F8TA 1XEWY 4C4RA 1L5HB 3T5CA 4K86A 1NXXA 5JLJA 5EXSA 1A4XA 5ARCA 2B6NA 2R68A 2O2CA 1OXKB 2O07A 4HAUA 1DT3A 3KKOA 3LGSA 1GPLA 2I6XA 3MFYA 3LE8A 4KNWA 1E79A 1XWFA 4QUHA 4DMMA 1QHEA 1J8FA 1J25A 1JLHA 3BAFA 5AHRA 4ZV9A 5AMXA 3W5HA 3HCBA 5BSKA 4MQUA 2MSLA 1UIMA 2B30A 3PD7A 3U31A 1V0JA 1DFIA 1M1YB 1YBVA 4OGWA 4M8KA 1FLVA 1V8PA 4NLLA 5JT1A 3O8DA 1NT4A 5D86A 1I1NA 4ZVLA 1S8AA 3H18A 1FVFA 4F3YA 5JH7F 4A0GA 2Q5JA 3QU5A 5H3LA 3AB7A 2CLEB 2QNRA 3F6CA 1GVNB 1L3IA 1W46A 5FPKA 2D13A 1Z17A 1JT9A 1QS0A 1M54A 2J4FA 1R18A 4GGMX 1WXWA 2IOQA 3MB8A 4GGOA 1H1LB 1JS1X 2IU0A 4G2TA 3HTXA 2X9VA 4A7PA 4XXHA 2A7XA 2O2IA 3QUSA 4DOMA 4JXKA 4LNUB 2ZTHA 2QRMA 4CF7A 1NE7A 3WMFA 1YT5A 4Q82A 4XIFA 2VZ8A 4NOKA 2POCA 1FP6A 5A3VA 3DG9A 3PNBA 1JXQA 4NENB 3QNUA 1IK4A 4R6XA 3L1UA 1DCMA 1KOJA 1QKIA 2P1DA 3GLRA 4YRQA 4D9KA 5FX2A 5I9MA 2C3PA 4DJJA 3JALA 2CNNA 3NYIA 2IYPA 3ND5A 5EEGA 1KH3A 4YPVA 3LY5A 4N0MA 1EGVB 1L5FA 4YRDA 1KVSA 3LM8A 1UMCA 3CF4A 4L4ZA 4YP9A 1PR4A 1XT6A 2LXNA 2OHVA 3P9KA 5JAQA 4JJGA 5T8KA 4LCBA 5JD3A 1B8PA 2M1XA 3LZ6A 4LDQA 4C21A 2QU8A 1KO7A 3GLTA 1IN4A 1O97D 4TUYA 3JQ8B 3PXBA 1MN6A 1I1OA 2HMUA 2COKA 3KDSE 1W19A 3IBSA 1ADYA 3EUAA 5LR6A 1DIAA 1L4NA 1WDWB 1E94E 2XVYA 2PSHA 4DCTA 2BE9A 5A6SB 3G0BA 1UBFA 4HLUA 2J3EA 4CMJA 4ERNA 2UAGA 4NCKA 1Z26A 2NO5A 4I46A 1SCAA 3S2SA 2C5AA 4YUXA 3OQNA 4AO8A 4LAFA 3HBLA 1JQBA 2GUWA 1PAUA 1UH5A 2JGMA 2VN8A 3DT8A 5G3ZA 2QP4A 5BQ5A 3TD2A 4DDVA 2YN2A 4ZOBA 1Y4DE 1PLLA 2IITA 1V4BA 2Z04A 4BUZA 2X3UA 2QDXA 1P0MA 3UMJA 4V1CA 5CDSA 3AEKA 2IH4A 4TL6A 4OJQA 4PFSA 1JQJC 1QSGA 4ZVKA 1VKOA 2R6CA 1UOQA 4IFTA 4IOKA 5JO9A 4YCSA 1SJ9A 2G4LA 4Z4QA 4N47A 1Z2OX 2OG1A 4TTPA 4BAUA 1YBAA 2VLBA 4JJ6A 2CVQA 2V4ZA 3AF3A 4E70A 1FP2A 1N1DA 1L5NA 1SULA 2QZ9A 4RXMA 2Z43A 3AL0C 2BBSA 4IJMA 5EA2A 3QELA 5EERA 3RREA 4J3FA 3L7YA 1JJIA 2PN1A 1YC5A 3NBAA 1D7AA 3WVNA 2FOIA 1ODTC 3F8SA 4J75A 4PEVA 5BXYA 3FVVA 4YJ3F 2WU3A 1E79D 3O2NA 1OV6A 2I2BA 1O9HA 3LDHA 2IV3A 1P33A 5T4FA 3B51X 4HDRB 4L3WA 3UANA 5K9ZA 1LPSA 4F9EA 1AV6A 1G21B 4L5IA 4Y2HA 2QLLA 1CUCA 1WS6A 1SOVA 1JB9A 3PNOA 1OLXB 3H6GA 3N8NA 4JR2A 5ALQA 4WBNB 3I3SR 1ZEJA 1U8UA 4XSGA 3W5UA 5ALIA 4WKCA 3G2JA 5TMDA 2A3RA 3PSAA 1YSCA 1AQ6A 2IYAA 4K3VA 1SBZA 1NA5A 4RD3A 2ZB8A 4E09A 3EF3A 3VC3A 5K6TA 4R81A 3JQPA 5LQNA 3KUKA 2HA7A 1Q6YA 2EP8A 2QSYA 4DNXA 2PS3A 4DZRA 4FDVA 2PRSA 4JC4A 3L92A 4K9SA 5EHGA 4JY7A 4L3VA 1T36A 5BN4A 2CDBA 1IJKA 2ECQA 5DHAA 2XGMA 3QSGA 1D0SA 2VYQA 3GLHB 1BQEA 1V2HE 3LBYA 4EKDA 1CIPA 1QIIA 3I5YA 1RJ9A 2XTAA 4OFBA 2HADA 3UJ7A 4J0HA 1HK7A 1RZRA 2BZGA 1R0LA 1HFEL 1SXIA 1Y80A 2RHMA 3OY2A 1OBOA 3OCCA 4J0IA 2FLKA 4W5WA 3V48A 1HE8B 2Z1MA 3CLSC 3W78A 4E51A 2D7DA 3TFOA 3SOPA 3TQQA 5ALRA 1UK9A 2F9LA 3VHLB 4X63A 3OZUA 4WLFA 1Q16A 4ZCRA 3QVGB 1T2FA 1VI2A 4AJKA 1GNSA 3A2LA 1E66A 1ZVMA 2C1EA 3Q7EA 4RQAA 4QG3A 2QIOA 2XT9A 1YV9A 2GBFA 2YBDA 3S8MA 2Y6UA 2E37A 3L5KA 4Q48A 4TSFA 5P21A 4EG5A 3IV7A 3T95A 4CETA 3AM4A 4YROA 2ECKA 3UMGA 4FFRA 1PF7E 1ZNZA 3QU2A 1Z4OA 2H1IA 2PUHA 3IOEA 2PYDA 2OE2A 3CFYA 3A6GA 5HS4A 4R0VA 3ESXA 3NQ41 4BMZA 3TLGB 3NOXA 1XEWX 2PKCA 4LXTA 4W8GA 3U3JA 3U5ZB 2FZWA 4WT7A 1X2BA 2BKEA 1ZX1A 2JI6A 3LHFA 4LRTB 2B7LA 1A0OA 1H9BA 1H5QA 5I47A 4RXUA 5JD6A 1Z6TA 2EAUA 3D5TA 3WB2A 1RI3A 2V54A 2ZRGA 3DM5A 1PLKA 1BEEA 4NPAA 3CLUC 1PJCA 2XE8A 4CCSA 5EUQB 3BIOA 5FBWB 3N7AA 4RTQA 4Z0PA 1VBKA 1ZCFA 4FIZA 2HEGA 1QVVA 2RGNC 2YS6A 4IDNA 1ZUHA 3TSWA 2R87A 4ND1A 1NP7A 4C0KA 4KQ2A 1IPHA 3LF1A 1DOZA 2P9HA 3FYSA 4LVOA 4PS0A 1NR1A 3LCUA 2X8AA 1MOQA 4C03A 4WFKA 5BWNA 1VI5A 3I9NA 4UHBA 2XAAA 4LNHA 1J97A 5ITSA 4Q00A 3BIXA 3ETNA 3S8YA 3GEBA 3SY8A 5HK9A 5HCIA 5B64A 4Y9RA 5NULA 1H1LA 1WDKA 1M0WA 5CVCA 5AQEA 5ER6A 4XDZA 5FPQA 3RS5A 3PRKE 2XCUA 2ZRCA 3DAYA 2VJAA 3ZC3A 1ZOOA 2VSQA 1OBCA 1KGSA 4L0QA 1BTOA 1E2HA 2CNWD 5KNLA 1JFTA 4L4XA 4ZHQF 1GZHB 2C2MA 3AH8A 3EXEA 3GG2A 3D0RA 3LC7O 5TF4A 1M2OB 2WPNA 5A71A 5AW0A 5K8IA 2ONYA 5CB8A 1OA1A 4WFIA 4OI1A 1HA3A 4BWYA 4JLMA 4EAAA 4KQMA 3QFCA 1Z4MA 5TS2A 1PNRA 2I78A 1GJRA 1VLVA 5LDGA 3W6ZA 1WUIS 3EXG1 3D7KA 3LT2A 4IJWA 4MRAA 4WNIA 4ZXPA 6REQB 1VQ1A 2A4MA 4R3NA 1O0CA 4JUAA 2VJKA 2MSCB 2XD9A 2LW7A 1KAOA 3DA8A 3ZWQA 1WJGA 3NR2A 2QN8A 3GK3A 4D9HA 1WSWA 5FTLA 1IN8A 4KODA 1FP7A 1G8GA 2DLDA 3OQVA 1F48A 4CFSA 3ZJTA 1RHQA 3U7JA 3WLJA 1KEEA 3ZBPA 4DLNA 1XRJA 2DLNA 2DY0A 4KFSA 4PG6A 4BB5A 3NJ8A 1DELA 1QFZA 2PD3A 3QENA 1IJFA 3N2LA 4I5DA 3FFXA 4JA2A 4AZTA 3T9BA 1ADFA 2AFVA 1G291 3VO8A 5ILQA 1KJZA 5AICA 4P0PB 1N2CB 3GEPA 4FYIA 4QJ5A 2F8SA 3S70A 1Y6FA 2JZOA 1BOOA 3N2ZB 3QHAA 3FGNA 2QWXA 2EF1A 1IBKB 1RMQA 3OEEA 3WL8A 4XWYA 4XRGA 3U09A 3HLYA 3LQKA 3K5IA 4WERA 3TRHA 2O5VA 2GF9A 3C24A 2E6UX 5FOWA 5HCNA 3L0YA 1GKKA 2BEJA 4CDRA 2V3CC 1AU9A 2G1AA 1X15A 4HYEA 4HGNA 4LOLA 1ZIYA 2YC2C 3FPHA 5DHSA 1L5LA 2GLUA 1I0IA 1S96A 2OGZA 1HYHA 4UZSA 5U1PA 4AG5A 1CDDA 2SECE 3KR0A 3LLCA 3PLRA 1ZM9A 2PQ6A 4IZ6A 3COSA 4MEJA 2YIDA 4HNRA 1JILA 3A9SA 3ZLTA 3PSHA 1MPTA 1RLTA 3OIYA 5AI6A 3WIDA 4E15A 5EHXA 3QLEA 5I9SA 5JSZB 4ZWNA 1K5GA 1P1FA 2BCJQ 3AUTA 3Q3GE 3EW7A 4LGVA 2HR1A 3TRJA 3VYWA 2C03A 2FSHA 4XJVA 4CLXA 3BBLA 3I30X 4MB0A 3ROPA 3TGLA 2ZB3A 5BO5A 3PS9A 3D54D 3SLKA 2IYVA 2BMWA 3CVWA 2ZSJA 2AUNA 3DLBA 2NYRA 4QWWA 2WA1A 3UHJA 6CHYA 3MWFA 2AKEA 1YUMA 1GNTA 3VVMA 3PTAA 2CDNA 3B1FA 3GLUA 3FOAA 3DBIA 4KE7A 4RNCA 4D9FA 1UEXC 2O1SA 3O1JC 3LRTA 2AW3A 3SIPA 3UICA 4G0UA 4I3GA 1IEVA 2W4MA 3I39X 4RSHA 5IWAB 2JGJA 3DBHA 1P8JA 2DT5A 3CUEF 4Z0NA 3ZXSA 3K9CA 4EVSA 5K99A 3UAGA 1YA6A 2CVOA 5ARBA 3AUSA 3TE6A 2FPIB 4RMGA 3PX7A 3BM5A 2YRXA 1YRWA 1REQA 3BUSA 1XMQB 1OHHD 4PPYA 5ALLA 2R1VA 4GG1A 4WLEA 2X0RA 1N9KA 3JTMA 4BCCA 1YFJA 3AZQA 3R0XA 1VSTA 3SSMA 3AKZA 4LMBA 2Z6QA 4PZLA 3VR2D 3HKCB 3QA9A 2B6HA 2XMBA 3IAS1 4QPCA 4MKRA 3GZNB 4IXTA 5JSYA 3HNOA 1R0CA 1UUFA 5JSFA 2O5CA 3PPIA 3I45A 3HFJA 3V33A 4KVGA 2O8FB 1XR3A 4KEAA 3JQQA 1SR8A 4ZT2A 5CIQA 3O92A 1NHGA 2WM3A 2FP4A 4FLMA 4KYUA 4AMGA 1PV4A 4MO9A 1Q3KA 3IAHA 3K7EA 3TWOA 1XU4A 1Y8RA 4IQ0A 2JLSA 3LYUA 3OEWA 5AOVA 1NM5C 4MQLA 1E8DA 4OXKA 3O84A 5FRDA 3ZHRA 1L4FA 2BF7A 3A0UA 3CZ5A 1HOTA 2LNDA 3RRJA 3T54A 1RPTA 3OMXA 9LDTA 2XKKA 1GDHA 1I3KA 4Z0HO 5GONF 2LZ0A 3S7ZA 5TMPA 1G3UA 2G1UA 3K5HA 2Q8QA 3QPWA 1Y3FE 2PKYX 1EA7A 1CC1S 2XSZA 3U4QA 3U44A 2JLUA 2ZVDA 4L07A 4IV0A 2WWFA 3OEED 1CP3A 3KOOA 5EMMA 3CRW1 1ACJA 3NT5A 5AKHA 3LKZA 3OURA 7MHTA 4QBIA 3TZBA 1SQ6A 2VUTA 3TEJA 1EFCA 3HY3A 4MZDA 4NECA 3EYWA 3LKDA 2AE2A 3TVDA 1EVYA 3O8RA 1UBGA 1P1JA 4C0QC 4JQCA 3FGPA 3KXKA 3DAOA 3FFBA 4U02A 3QQPA 1G60A 2ECOA 2R2AA 1RFLA 3QFRA 2FZEA 4NYIR 4UHHA 5JE8A 3BERA 1TUBA 5K8LA 4X0EA 1XQWA 4UOZA 3NT4A 4MQBA 2GK7A 3JATA 2BSQA 1DAIA 1NW5A 2WF9A 2I9KA 1NFRA 4PE5B 2YICA 2P1RA 3ACDA 5F5XA 1RBMA 1NDUA 2PQ2A 3GAAA 2W2XA 2WKPA 2ZBDA 1Y6GA 5HFNA 2GLXA 2H2WA 3NIGB 5FR1A 4FC6A 2F17A 2X5XA 1QQTA 2XXAA 1UC9A 1FXSA 4FNMA 1ZOLA 5CVVA 1EXWA 2PGLA 4MGHA 1I9CA 1TCBA 5CLQA 5LB4A 3T99A 4V1CB 1R6TA 1E98A 3LI2A 4GI5A 2CLLB 2VDPB 5LYYA 4QQ8A 4XCVA 4MVJG 1JFRA 3DL4A 1A8IA 4RZ2A 1ZK4A 1M1UA 4M36A 4O1IA 4ZJYA 1J7KA 2BEUA 2IL1A 5AIAA 2ZRNA 3T8YA 3X43A 5T57A 1JQEA 1LBEA 1ODJA 1PZFA 1ADGA 1XCJA 3KJFA 4JU8A 4XEHA 3RC1A 1OOEA 4QU9A 3SFVA 4DKXA 3ZD6A 2J9XB 2O57A 3BEDA 3JR3A 4PYKA 1VM6A 5DX8A 1NQ5A 2RI1A 1W1UA 3FDJA 2NW6A 1QE0A 2WIKA 1BYUA 3H5LA 1P6XA 4FHEA 1M83A 4MP3A 4Q4HB 4UASA 3TQOA 4Z4CA 3WQHA 5DHTA 1MC4A 4KUGA 3UV3A 1XTSA 4BQRA 4E6PA 5LN1A 1YVPA 1YQXA 4N49A 3H9BA 2HV8A 3NNDA 4C7BA 2W2OA 2WJ6A 1JJAA 2A5LA 3VR2A 4ARZB 5BP7A 1BHQ1 4EMSA 3NCHA 3UTDA 4OQEA 2YFYA 4MV4A 1L7VC 4OL0A 2Q5EA 1SPXA 2BL4A 2Y1KA 4BBAA 5EINA 3B9RA 4ZEWA 1PFWA 3DOHA 1B41A 1RNLA 4WK6A 1Q0TA 1CZOA 4OQPA 5NLLA 4MVJM 3GLVA 3NDIA 1UMBA 3GPBA 3E2IA 2G08A 4YRNA 1CQWA 1PEYA 1HOXA 3UAVA 4FDLA 3TEMA 5L7TA 4DBZA 3N8GA 4M8IA 3BGWA 1YZNA 4KR3A 3I9KA 4M0UA 3IKTA 5KNDD 4MYCA 5JEDA 2VJYA 3AVVA 2PL1A 2JHAA 3F7NA 3HM2A 4UDNA 1H66A 5ILGA 2B34A 3HZRA 1N75A 2RGEA 5IS2A 2XSZD 2EG9A 1R4ZA 5G4LA 3FZNA 3QBTA 4YK7A 2H29A 2IU4A 3OQIA 2VP4A 2ZAYA 5CK5A 5JI3E 3HYNA 4LZWA 2ZJBA 2HJSA 2XMGA 3HDHA 1HNNA 3MYRA 3UT0A 1OW3B 1E6EA 1UXGA 2BCEA 4AUKA 4DREA 3UXMA 3OBBA 2P9ZA 5DOVA 5C7OO 2A78A 3EOBI 3QW2A 2A0UA 2CUTA 3ENKA 4FCWA 2XMQA 2BWJA 2QYOA 1GQQA 3DMRA 3EG9B 2FW0A 5HILA 2Y27A 2W8BB 3PUWA 4RDXA 3NVMB 2RC5A 3QU9A 1M2HA 4K05A 1C7RA 2C9ZA 2YMLA 4M9ZA 1DARA 4CTMA 1LUAA 4ZYYA 4RTNA 5EIFA 2PUAA 4QGGA 2DPXA 1PDVA 2M6LA 1CX9B 3C3KA 3FYUC 4HS4A 2BTQB 4BWVA 5JADA 4OF4A 2ZTLA 4BC0A 4TWZA 2GXQA 2ACWA 2DKFA 2HQOA 4B7UA 5CG2A 1D6MA 1TFRA 2KB0A 2NQTA 1IUKA 1J33A 3UT5B 4WCFA 4WUTA 5COBA 2VT6A 3UXHA 1D1QA 2J5XA 5IDVA 3V3KA 3KUXA 4I4NA 3RUEA 1D2CA 2HFKA 421PA 2R1VB 5AHKA 4Q4LA 4WOCA 2ORIA 2ZVQX 4MQ6A 5BPHA 1RRFA 5E0OA 5KTNA 4FFWA 4NEQA 3L4BC 5PGMA 1B6TA 1MB4A 3G1TA 3N74A 3T06B 3UJDA 2R4TA 1AM4D 5JS6A 4IWNA 4WJZA 3ELUA 4OUDA 4UD6A 5CEEA 1WBDA 1JJFA 3BD7A 4XVRA 4YJDA 2B1GA 1GYQA 2DPGA 2C83A 2VTVA 3LFHA 4ENSA 2FQXA 4AXXA 2VXCA 1EESA 1PNVA 2OLEA 2VDJA 3PC6A 4KXUA 3HJCA 4NHEA 3JXEA 2JH8A 2ORVA 4GXRA 4XQCA 4D74A 3MD9A 1YTUA 1Z56C 4FK8A 5A62A 5DTIA 2FFQA 1E5TA 1V26A 1CQJB 1LVHA 1H6CA 1NPDA 3VYSB 4KQFA 3PCXA 1I4OA 3H65A 4BX8A 2BEVA 2J0EA 4RE6A 5B2ZA 1U94A 1EWVA 1AX9A 3MWDB 4UDYX 4B2IA 4D45A 5BWBA 2ZVPX 2V7TA 2WDPA 3TAHA 5HBRA 3TXAA 4CL3A 1NN0A 1NXPA 1MC1A 2A1TS 1Q11A 2H5IA 3QH4A 3DO6A 3FI0A 5DNWA 1VPDA 1KAHA 5AD1A 3R3JA 3MINB 1NU8A 1Z6PA 2VWGA 4LDNA 3UXEA 4PCLA 3WWDA 5JJKA 1JYFA 5F9MA 3STYA 4AL4A 4IIDA 3W2TA 2GD0A 2IX9A 1A2KC 1IBCA 4RAQA 3ILSA 3MJSA 4XLZA 3ZUPA 5I7RA 5A4KA 2BTQA 3VR6H 4Z2YA 4P58A 1YI8A 1GTMA 2CLOB 1JG4A 2CVHA 2VUUA 1NVAA 3KZXA 3PQ7A 1CLUA 1HTWA 3OE7D 4P2GA 1LW7A 5IDYA 4P31A 2AK2A 3F7TA 3SHVA 4BMXA 3PLNA 4RULA 1C41A 3TECE 4YP0A 4QRIA 3TGPA 3UH0A 3LK6A 2BUAA 5A0VA 2NNWB 1SKBA 1YCGA 2PPVA 3DZHA 3U3XA 4ER0A 1JEEA 2ECFA 4JX9A 4ZAGA 2RK6A 3ZS9A 4JI8B 5ALHA 1MH1A 1PV2A