5HFNA

Crystal structure of a loop truncation variant of thermotoga maritima acetyl esterase tm0077 (apo structure) at 2.75 angstrom resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
280
Chain Sequence
AFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGRGFPHDWLFWPSMGYICFVMDTYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cephalosporin-C deacetylase
publication title An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
total genus 98
structure length 280
sequence length 296
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hfnA00
3CN9A 4RE5A 5BOVA 4B0PA 1RWQA 1FFBA 3BE8A 3KWJA 1BROA 4K6KA 1XFDA 3WKBA 2O7VA 3H2GA 1USWA 3V9AA 2H9YA 1WM1A 2H7YA 2ES4A 2PL5A 3I2KA 4CG2A 3A6ZA 2PSDA 1W4LA 4QLAA 5JANA 2XUDA 4KEAA 5DJ5A 4U2CA 3WA6A 3QITA 5DNVA 5LKAA 4AXBA 5CH5A 4G9EA 1XKLA 2RHTA 2ZSHA 2O7RA 3MGAA 1EDDA 3PF8A 2H1IA 3G9UA 3D3NA 3TRDA 2WJ6A 3C87A 3P2MA 4BRSA 4X94A 4PNZA 4Q82A 2C58A 2BKLA 3QPCA 1CPYA 4QEKA 3C8HA 4GHWA 1T2NA 2H7CA 1ZD5A 1DWQA 2EDCA 3H2IA 5LLSA 3C45A 2HFKA 1R1DA 5T4FA 1B41A 1XZKA 3K6KA 2WIDA 3I2JA 3I6MA 1GT6A 4AMYA 1QIGA 3TEJA 5I9IA 3DYVA 2XDWA 3F67A 5ALSA 3WJ2A 2ECFA 4KE6A 4QE3A 2XMCA 3OC0A 4G9GA 4FMPA 3AIOA 1QIJA 3R3VA 1WPXA 1SCQA 1XQWA 4I4CA 2Z5GA 3STVA 3O9MA 4P92A 1DX4A 1THGA 3FLAA 5T4EA 1GPNA 1C4XA 2XUHA 3STXA 3MUOA 1E8DA 4BYMA 4FNGA 2C5GA 1CUCA 1HL7A 1CUIA 1HDEA 1ORVA 2ZJFA 2HA5A 4XWGA 1LLFA 3C70A 5ALMA 3HACA 1DINA 1MAAA 2Z3ZA 4UFOA 2OGSA 4UBIA 5AI0A 4Y2SA 3DEAA 3V1NA 1EK1A 1HLGA 1ZI6A 4HAIA 1FFAA 4CIAA 1ZJ4A 4Y2TA 3FLEA 2HU5A 1QIEA 1A88A 1A8SA 5KWIA 5LZ5A 2FJ0A 3VDXA 4OCZA 2XMBA 3E3AA 3JWEA 5H3HA 1CUHA 4FKBA 2W22A 4DSAA 1KEZA 4YPVA 1BEEA 2CB9A 4QDTA 4EY5A 3DQZA 3FYUB 3BDVA 4UUQA 4WY8A 1BN6A 5CBKA 3PUHA 1ACLA 4X97A 1TIBA 4UBLA 2FUKA 2WTNA 4GEGA 4KJXA 3G0DA 1K6EA 4X95A 4WFIA 1ODTC 5ESRA 2XE4A 1EHYA 2VJBA 1DT5A 4U2GA 2ROQA 4H7DA 1R50A 4C4XA 2PSJA 4H7KA 1IZ8A 3HYSA 5EGNA 1ZICA 5J3JA 3W9UA 1Y37A 1XQXA 3U1TA 4Z49A 3VKFA 1BRTA 1TCBA 3QYJA 1UZAA 2WIGA 2G4LA 4XVCA 5D3KA 3ESDA 3WA7A 1FFCA 4J03A 4H7HA 4EY4A 2YYSA 2DQYA 5AK6A 1W75A 4FLMA 3WK8A 1AKNA 4N8DA 1QJ4A 2PU7A 1ZD3A 4BC0A 3H2KA 4FTWA 4L72A 4BZZA 3A2LA 3R3WA 1MT3A 1QTIA 5DTJA 3AZPA 1MX9A 1ZIYA 1CUWA 1UK6A 3D2BA 4D9JA 4UHCA 3GZJA 2D0DA 4DMKA 4OYLA 2BAGA 2ONCA 4Y7DA 1WHTA 1N5RA 1F6WA 5LIPA 1VA5A 3M3DA 5AKEA 3WK4A 3PFCA 1WB4A 4K5QA 5CTAA 5KWJA 2OGZA 1YS2X 2PUHA 3FCYA 4LXGA 3SC2A 5YASA 2VA9A 4Y2UA 1CUGA 3WIOA 1EVEA 1JT2A 5CT6A 4W1SA 4BDTA 1LPPA 2XMRA 2BCEA 1W52X 3OURA 2JGFA 4YASA 5F4ZA 1S8OA 1WB6A 1DQYA 1CVLA 2JGKA 4M0MA 4BP9A 1A8UA 5C8VA 1J06A 2DSNA 1MX1A 1CUVA 4CG1A 1EDBA 1EX9A 1BS9A 2Y1KA 4PSUA 4F60A 1TK3A 4BBZA 3OG9A 4N5HX 1E5TA 4Y2PA 5D7BA 3ZLVA 5EHXA 3I6YA 1JMKC 3ICWA 4QDZA 2GBFA 3VVMA 3FVRA 1ZGCA 4OPMA 4PO3X 2LIPA 1XKTA 1KU6A 1UFOA 5AI4A 1JU4A 2AJBA 3WIBA 3EQ7A 1XZJA 2JIDA 1BCRA 5HF5A 5EHNA 3G8YA 4PF1A 1IUNA 4X91A 5FRDA 4P08A 2UZ0A 2WUFA 1E66A 5JAPA 1JKMA 4Q34A 3ZV7A 3F9CA 4FBLA 2DR0A 1TAHA 5E4YA 3QMVA 3WKEA 5JZSA 1MU0A 1G4HA 3D2CA 2QXTA 2ACEA 4X6UA 2OCIA 3WK6A 1LGYA 1EINA 5HKAA 1QIDA 1XZDA 3ZLTA 4F0JA 3GROA 3I28A 4LHEA 4ZXFA 5IVIA 4UHDA 4FFVA 4AX4A 2ZYIA 5LZ7A 3WWCA 3FLBA 4EHBA 5JYCA 3RM3A 4EY8A 4FDMA 4WY5A 1N5MA 4GW3A 1YASA 1AX9A 2QOEA 3WK7A 4BTLA 2IIVA 4ZWNA 4ZGBA 4AO8A 2JGEA 5HQ3B 3CCBA 3QPAA 4Y2XA 3B12A 2ZYSA 5K3FA 3W06A 4B81A 4DMFA 4H7JA 1QFSA 3B3QA 4J0KA 4H35A 4BAUA 2VATA 4ROTA 1JJBA 1UKCA 2OXEA 2GYWA 3HI4A 1JJFA 4MXDA 2CEKA 5FPPA 2GZRA 3QBJA 2IITA 1F8UA 5A62A 5DYWA 5DNWA 3R0VA 5K3AA 4ARBA 3OPMA 3O95A 1P0PA 2BUBA 2HL6A 1CUEA 2HA3A 4CCWA 4LKOA 1MO2A 2K2QB 3LIPA 4XIIA 1G42A 2RAUA 4W1QA 3V48A 4CG3A 1Q0RA 4GDMA 2YXPX 2OGTA 2XUPA 1AQLA 4UHBA 2XT0A 3V1KA 4DNPA 1DQZA 4MJ3A 5LZ4A 5AM3A 4BCBA 2C0QA 3WWEA 3I1YA 3FOBA 5KREA 1E8MA 4YK7A 2H7XA 2WLSA 3WWOA 1THTA 3WL8A 2V98A 2HHAA 2BGRA 5LP1A 3G0IA 3R3XA 4I3FA 2WTMA 4BZWA 3ESAA 3FCXA 5ALXA 3G0BA 1WPRA 1OCEA 1CLEA 3WQHA 1R88A 2ZSIA 3C5VA 1CUYA 4FLFA 2WG0A 1AGYA 4G5XA 3N2ZB 4UBJA 2WUGA 4YX9A 4IH9A 3ANTA 2BGNA 1ORWA 1MNAA 1XZHA 5FXMA 5AKGA 2OQVA 4PSCA 2XMGA 3R3ZA 3C6YA 4QWMA 3QMWA 4Q3LA 5ALFA 5I8PA 1YR2A 2QXUA 4AZ0A 3GUUA 4OB8A 3L1HA 5IH7A 4K2AA 1A8QA 1VZ3A 1VE6A 5AM4A 4BVKA 1JU3A 4RNCA 2EEPA 5K5EA 1BU8A 4EY6A 5D3ZA 1AZWA 1AMNA 3QVMA 1UWCA 3K2IA 3BIXA 3UUEA 2FX5A 5DYYA 4OUKX 3Q0TA 1EA5A 3ESCA 3DOHA 3STWA 1DWPA 3WYNA 3WK9A 5ALJA 1CUSA 5FKJA 3FWHA 3IURA 5DNUA 3G02A 4U2FA 4B85A 5K3CA 1EB8A 4JYMA 5T4HA 1R3DA 1CUAA 1U8EA 1K4YA 5EIAA 2I3DA 1QIIA 4OYYA 3IIIA 4C6HA 3IUJA 3ED1A 2ZVDA 5FOQA 4BAGA 4Y2YA 1ZI8A 2I03A 5JD6A 5JD5A 5CURA 4BVJA 1CQZA 3DS8A 4OB7A 5ALVA 4JYPA 5ALPA 3PUIA 1QGED 3NGMA 4GI1A 4E11A 3ZWQA 2WG1A 1IVYA 2DHEA 2P8SA 2XQKA 2AXEA 5AOAA 5K3FB 2V9ZA 4B9EA 1E89A 5AKJA 1CQWA 2C7BA 3WYDA 2AJCA 4ZREA 4HXEB 3BJMA 5EFZA 1AURA 4ITVA 3WL5A 4C88A 1QFMA 1TRHA 3FSGA 4QA9A 4X6YA 1ODSA 3E1GA 2XQGA 1PFQA 3WL6A 1XZLA 5ALLA 3FYUC 4BCCA 1J1IA 4J3JA 2HA6A 3AUKA 2OLEA 1QLWA 3I2HA 4W9RA 5AKKA 2I78A 4UHFA 3S2ZA 1N1MA 4ZV7A 5EIEA 2HFJA 3AIKA 3BF7A 1LPAB 1GQSA 1GGVA 4UFNA 2R11A 3ZPXA 2JF0A 2OG1A 3OTQA 4RPCA 1UOQA 2HU7A 4S0XA 4H7FA 4MQLA 1QO9A 1XZBA 4MQMA 1D07A 2WIJA 3VJMA 3BIWA 1UKAA 1AUOA 1EH5A 5HF8A 4UBKA 1AC5A 4QDXA 5EIHA 4G4IA 3SX4A 3SK0A 2AJ8A 5E2IA 2OAEA 1VE7A 1VJ5A 2WKWA 5AI5A 3O4GA 5AKHA 4P9NA 3U0VA 5AK5A 1M33A 2OCKA 1LPSA 1VXRA 4UPDA 3PFBA 1RYYA 5DYTA 1ZJ5A 2PBLA 2WILA 1TCCA 3M83A 2WU4A 3N0TA 5CXUA 1LNSA 1X70A 5IVKA 2PPLA 2BJHA 3VJKA 1Q0ZA 1FFEA 5HKBA 3H2JA 1LBSA 4Y2VA 2CKMA 2WJ3A 5A6VA 4BVLA 5ISMA 2VAXA 7YASA 3EQ8A 5HK9A 3D59A 4L0CA 5AM0A 1H2YA 1LZKA 1VA4A 2HIHA 4BCDA 2VJDA 3DL7A 5CMLA 3DYIA 4AN1A 1MJ5A 1DWOA 1EK2A 5HQ3A 1FJ2A 3R41A 2VEOA 1QIFA 2WFMA 4BE9A 1ZGBA 2XUFA 1WHSA 2BUAA 2XLCA 1QIMA 2QKYA 4DNQA 4A23A 1UK8A 3MUNA 2HA2A 4KAFA 3H04A 2C5FA 4Y9SA 1TQHA 4WJLA 3W2TA 3AINA 1O6GA 4NMWA 3PE6A 3EBLA 2QT9A 5LZ2A 3WWDA 5K3EA 1DX6A 4CCYB 5JZ9A 3PDCA 2WSLA 3IUQA 5A7GA 1MAHA 1ZIXA 2GBIA 4Q05A 1YCDA 1U65A 3PF9A 3AZOA 1MX5A 3MVEA 3WWPA 4ZV9A 2QS9A 3FVTA 3I2GA 1VKHA 2RONA 1WB5A 1A7UA 3GFFA 5BV7A 1EB9A 2I3ZA 1EVQA 4OU5A 3WKAA 4H7IA 1LPOA 5HFNA 4A16A 5IVHA 3I2IA 4W63A 5ALWA 5JIBA 4EZIA 2GBCA 3K9BA 4HXGA 3M81A 1W76A 4ZRDA 1BN7A 5IVDA 3VXKA 1GZ7A 4KACA 2YASA 1EI9A 4FWBA 5ALDA 2AJDA 4MEAA 1DU4A 1QZ3A 2GZSA 4HRYA 4DNFA 4M0EA 4IO0A 2Y6UA 2PVSA 1QONA 1CRLA 2DFPA 3O4HA 3A2NA 5A71A 1XRNA 3G9XA 3T52A 5FDFA 1H2XA 4I19A 5ALZA 4XJVA 2WHRA 2DHDA 2O2IA 4X7BA 5CT8A 5CRIA 5AI6A 5AOBA 2DHCA 4KRXA 4TGLA 2XMSA 4LYDA 5JALA 4HXFB 1XRLA 3HLKA 1XZAA 2JEYA 2Z8XA 2WU3A 1Q83A 2WUDA 3DLTA 1U2EA 1UKBA 4NZZA 2RIPA 4B6GA 2Q0XA 1BCSA 2GYUA 3G9ZA 1JMYA 1VZ2A 4AMZA 5ALHA 4N8SA 1K5PA 3QPDA 4G1FA 3YASA 3IULA 1F0PA 1TCAA 4BP8A 3HSSA 4AQDA 2WFLB 5LZ9A 5K3DA 4H77A 4KE8A 4M0FA 4K6GA 3IBTA 3T4UA 3M82A 4A5SA 2B9VA 2QRUA 5AO9A 1UXOA 5JAUA 3LCRA 4LXIA 2DQZA 4BRZA 4FBMA 2QJRA 4B82A 5AI8A 2G63A 4KR0A 5AI9A 3D4LA 4H7EA 3KD2A 2B20A 4J0DA 5CT9A 4ZI5A 2PM8A 2OCLA 3WK5A 1SFRA 5FPQA 2C0PA 4MEBA 1XZFA 2G5TA 3PI6A 4OSEA 3SWWA 3F96A 4C4ZA 1SCKA 3AZQA 4FHZA 2QVBA 4N5IX 1XROA 1XRMA 1HKHA 1CUXA 1P0IA 5JARA 2QR5A 1MNQA 3WLAA 2C4HA 3C6BA 1LPBB 4OU4A 1WOMA 2V97A 4J0JA 1E8NA 2XUOA 3D0KA 2HM7A 1C7IA 4E46A 1JJIA 1UOPA 3O4JA 2NW6A 3IUNA 2IX9A 5ALYA 1K63A 1H2ZA 2Z8ZA 4FFWA 5JZBA 2JEZA 4Q3OA 3EIOA 2QUAA 1U4NA 5E4JA 2QJWA 3BXPA 4Y2QA 4U2DA 4BC1A 4B80A 4HVTA 1H22A 2CJPA 3G0GA 1CUBA 4PV7A 2HRRA 5ALQA 1G66A 2PSFA 5FLKA 4E14A 2V96A 3DDUA 2ORYA 5ALRA 2CUTA 3BDIA 3DNMA 4TVKA 4BE4A 3WKDA 1XLUA 4Y2JA 4X92A 1ZD4A 2EDAA 4IH1A 3ZI7A 5FUMA 4N8EA 1RP1A 3OM8A 3FBWA 1YSCA 1P0MA 3R40A 1X2EA 2XUGA 1ETHA 4GLBA 1YA8A 1CFJA 1BEZA 3GELA 3I6ZA 2WIKA 1W6RA 3LS2A 5KBYA 5AHXA 1Q84A 1LBTA 1GQRA 1XLWA 3F97A 1IUOA 1ZI9A 4IQ4A 4O08A 5AICA 1ISPA 4CIBA 4QWWA 2VTVA 1CUUA 5SYMA 5LKRA 2OPHA 5ALOA 1HPLA 3KOOA 1LPMA 3HC7A 3D7RA 4C4YA 3VVLA 1XZCA 2PSEA 2PUJA 5BWBA 4WFJA 4F5ZA 4K6HA 1VXOA 3FSGD 1IUPA 2JBWA 2ZYRA 3C6ZA 5JAHA 3D5EA 3HEAA 4AB1A 5AKYA 3B5EA 4KAAA 2B61A 5HCUA 5JAOA 2VJCA 4B83A 4CCYA 3R3UA 4ARAA 1Y7IA 5C8ZA 3A70A 4AO6A 4BATA 2WIFA 2XUAA 3L1IA 3STYA 2XQIA 2XMDA 1CUZA 4Y2RA 1P0QA 3EQ9A 4UHEA 4MWTA 1LZLA 1FFDA 5A7FA 4X90A 1VLQA 2YH2A 3G0CA 3TJMA 2RI6A 5CT5A 1EDEA 4BAZA 1QIKA 4DLNA 2DCMA 3HZOA 1PV1A 3A2MA 2Y2UA 3STUA 3O0DA 3STTA 1XQYA 4RGYA 3CCCA 3AJAA 3H17A 2PSHA 3UUFA 1GPKA 3D2AA 5IKXA 4UFPA 5AK3A 3HRHA 1ACJA 3DJYA 4HTAA 2XLBA 2QMQA 1OXMA 4G8CA 4UBMA 2Y2VA 5AM1A 3WMRA 2HA0A 4H18A 4J0CA 3E0XA 5CXXA 2CBGA 4DNOA 3IB3A 1NU6A 2VF2A 3DCNA 1CR6A 1CIJA 3AIMA 4U2EA 5AH0A 6YASA 1QE3A 1R4ZA 5DLPA 4IHAA 2JGLA 2WHPB 5HFAA 4GECA 1FSSA 5DWDA 5CW2A 3E4DA 3IDAA 3RKSA 3W04A 2XUJA 2ZYHA 4X3CA 3IVMA 4B7ZA 5C8XA 4DGQA 5AKZA 2GBGA 3C5WP 2RGUA 5SYNA 2XUKA 2X76A 4W1PA 4FNMA 2X8BA 3NOXA 2VAVA 1JI3A 1ZD2P 5AKLA 3L1JA 5A7HA 4QNNA 1L7AA 1Z68A 1IMJA 4EA6A 4FLEA 1NU8A 2HU8A 5CT4A 5ALKA 3O4IA 4C89A 5HK8A 1QTRA 5ALIA 3FYTA 1CUDA 1SCIA 3AILA 4DYHA 1XRPA 4NVRA 3AFIA 4G4GA 4GWLA 2QM0A 3PICA 4L9AA 5ALGA 4X93A 2WFLA 5BWCA 3QZUA 1H2WA 4KRYA 4QDUA 1O6FA 2WQZA 5AKIA 3FNBA 3EF3A 4WFKA 3QMMA 3C8DA 3CXUA 2WG2A 1N8SA 4INZA 5AIBA 1EXWA 4QDOA 5ALEA 4B0OA 3BF8A 3ICVA 1QO7A 2G5PA 1R9NA 1DT3A 1R9MA 1YA4A 4CFSA 3KDAA 3ANSA 3DKRA 3ILSA 1LPNA 1C7JA 2VT7A 4KE9A 5FV4A 2QTBA 1CUFA 4W1RA 5AJHA 3H1AA 1J07A 3LIIA 2XUIA 1E3QA 4NS4A 1YB7A 2J3QA 2QZPA 4Q3KA 2Z3WA 4UHHA 1BE0A 1SC9A 5LYYA 3NWOA 4QLOA 2J3DA 2OQIA 2HA4A 4DSZA 2FJPA 4V2IA 1GKLA 3RLIA 1XZMA 2PU5A 1XQVA 2HADA 3IA2A 4EY7A 2O2GA 1Y7HA 2HDWA 4FOLA 2VT6A 2XI4A 4UBOA 3OOSA 4X6XA 1KU0A 1XRQA 5EHQA 3LP5A 5CH8A 5AM2A 5AM5A 5C81A 4DMCA 3WL7A 3RARA 5ALNA 4AZ3A 2B4KA 4G4JA 3ZLUA 2ZJ7A 2ZJ6A 5T4BA 1HQDA 3C43A 5AOCA 3S8YA 4GBGA 4LYEA 4B84A 4J0IA 4H0CA 1L7RA 4U2BA 3UMJA 1QIHA 1XLVA 3BL8A 4UBNA 1T4MA 4HRXA 2WUEA 3DKKA 4CI9A 3IUMA 1HBJA 3F8SA 4XX1A 3JW8A 4BB0A 4IH4A 4KYVA 1UK9A 4WDRA 3W9BA 3CN7A 4PW0A 4EB0A 1PJAA 4X71A 5LZ8A 3WZMA 1VOTA 2BUCA 2WFZA 2J4CA 5JADA 4J0HA 4HS9A 3ESBA 4GXNA 2CMFA 2XMQA 4OD0A 2J4FA 4LXHA 4J7AA 3I1IA 3O9VA 4PQEA 3C6XA 1XZEA 1I6WA 2BFNA 3LLCA 2CZQA 4ETWA 5JATA 5C7YA 4AO7A 2HRQA 5AP9A 1J2EA 3R3YA 2OAGA 2VSQA 3KXPA 1MTZA 2HA7A 4KE7A 5HF9A 3X3HA 1L7QA 4F21A 2RHWA 3FAKA 1YAJA 4JH0A 4BDSA 1YB6A 4OB6A 4L3WA 1CEXA 1ODCA 2O2HA 2XUQA 5JASA 1UT6A 5EHZA 3H1BA 4PSDA 3VJLA 2R8BA 4HZGA 4KAJA 3W05A 1DTEA 5A2GA 5AK4A 1WCYA 3KWFA 4X00A 3TGLA 1IZ7A 3KSRA 2XQJA 2VQ6A 3V1MA 5I7UA 3BJRA 4E15A 4JNCA 3HJUA 4G8DA 2W6CX 1MN6A 1XZGA 3I2FA 2XB6A 1K8QA 2PKYX 3G7NA 3HABA 4WDQA 3WZLA 2E3JA 2WHQA 4TPKA 4LIPD 3GBSA 4DMHA 1UOOA 2VJAA 3G9TA 4G8BA 4Q1VA 5ALTA 3NUZA 1CV2A 4C01A 3V1LA 1TKRA 3GA7A 3BWXA 4X85A 4WCVA 4P93A 2JGJA 4QZVA 5DTIA 3Q8WA 5JD4A 3VISA 2X5XA 2JGMA 5AIAA 4MYSA 5FP0A 2PX6A 2ACKA 1GXSA 3H0CA 4EUSA 1F0NA 5EI5A 3HXKA 3F98A 5AKXA 1X2BA 4DTCA 1QOZA 3WKCA 3H19A 5HF6A 5E4TA 4DIUA 1GPLA 1GKKA 4J0GA 4MYDA 3H18A 3QM1A 2GYVA 2WHPA 1NX9A 2D5LA 5K3BA 3WJ1A 1XRRA 2Y6VA 1SOMA 4C87A 3DD5A 1CUJA 2QUBA 1YS1X 2OCGA 1XZIA 2WM2A 2XMZA 1JFRA 3WI7A 4RE6A 4BTVA 5CH3A 1OILA 4JEIA 1H23A 4AN0A 1ZOIA 2JGIA 2AJLI 3DOIA 3H2HA 1MPXA 4MWSA 4DM7A 3QH4A 1YAHA 3FYUA 3JYHA 3DL4A 5ALUA 1B6GA 2XQFA 5HZGA 1UK7A 2WJ4A 4JUIA 1G5FA 5D6OA 4EBBA 3RK4A 1W1IA 4B9AA
chains in the Genus database with same CATH superfamily
3SBDA 5KTMA 3ZOZA 5B1YA 1JRLA 4EOGA 3THOA 1YI8A 2PFSA 4YP7A 3VR5H 1IHDA 1E1CA 5ETJA 4GQBA 4RE5A 4HDRB 3CXRA 3OZCA 1T8WA 4GMGA 3NS7A 1OBHA 1RWBA 3OEED 4QFBA 2FSGA 4KCGA 1QM5A 5JSZA 4FGJA 1CZLA 3GGCA 2SKDA 3FH0A 5E6SA 2AOTB 3GI1A 1GTL1 3TB4A 2E4XA 1K7YA 1RXCA 1XFDA 3TL3A 3ZIAA 2P6NA 4BNFA 4C4OA 4DBLE 4CM4A 3BB1A 4MPJA 3E9ZA 4YRDA 1YHYA 3FPKA 4G1UC 2X4GA 4EW6A 5ITWA 4FOOA 3PD0A 4GSYA 4TZTA 3U7QA 2MDTA 2I54A 4Y18A 2ODEA 3LW8A 3ND9A 2HF7A 2ERCA 4MWBA 1RYMA 2FW6A 1RTKA 3FWYA 2HWUA 1XRJA 3WQRA 5KNDA 2ODNA 2CV2A 3SQXA 3U4QB 1I13A 3I9MA 1DG9A 4GVLA 4KEAA 2BEVA 1IG3A 2W2KB 4U02A 2RBKA 4B8YA 4B71A 2BZGA 2JS7A 2PMBA 3R7WA 1H3NA 2R1VA 3KZ1E 3WA6A 4UVIA 4FMCF 5AJTA 1IY1A 5EYPA 6NULA 2DFKB 3OBIA 3DUFB 1YZLA 1P17A 5DNVA 3UKJA 5LKAA 1RKVA 2HK8A 1I4TD 1NKSA 4IQGA 2R8OA 2PUEA 1B8PA 5CH5A 4LVCA 4ZQCB 4G9EA 2ZIWB 2RHTA 3OTIA 4QG7A 3VX3A 4G67A 3MGAA 2WY2D 1ORRA 4MVJA 4YDHB 2R8EA 1NP3A 2H1IA 3QLUC 1R6BX 1A50B 1VG9B 4Q1EA 3G9UA 4BS9A 4YHHB 1GTSA 3D3NA 4GWKA 1XLTA 3IBSA 2I4NA 3P2MA 3I5UA 1MB0A 4BRSA 5AQ1A 5I7RA 3KEQA 3S99A 3WGJA 5IJ0B 2C58A 2WMDA 2ODWA 3GLRA 2NVUA 2BKLA 4FUQA 4LSWA 5DSXA 4ZAZA 1CJTC 1JDJA 5B2ZA 5KOYA 1D5WA 4KFRA 4ZC8A 4OHBA 3KTAA 1Y33E 3L7DA 3U09A 4GHWA 1C3OB 2D1RA 5MFZA 1Z73A 3UK0A 1J8DA 3KELA 4KXFB 2AFIE 2GESA 1M75A 5JSQA 5D8DA 4L6CA 1P44A 2GEBA 2AF3C 2UUOA 4N03A 5JQGF 3E22A 4XX0A 2REXB 3FJYA 3AR6A 1Q0HA 1PZEA 3P2EA 4IIBA 4L0DA 1YBHA 4NBRA 1E1LA 4G0ZA 3K6KA 3NRCA 3I2JA 3I6MA 1JTFA 1DDGA 4ZK2A 3AESA 1I2CA 3PXXA 5JY6A 2RARA 2I3GA 3KR1A 3PX2A 4AMYA 4LF9B 3FHTA 3DYVA 3SQDA 3V3KA 5JW6A 4CM7A 2GM9A 4AN4A 1CF2O 4O6VA 1ABBA 2ECFA 4KE6A 1NKVA 1OD6A 3OC0A 4HB3A 3OAAD 4M89A 4DAOA 4UCWA 3EIQA 2AFVA 1VL8A 3ICCA 3GT3A 1QUFA 1TMGE 2TMGA 3BMXA 4FMPA 3TL2A 2OM2A 3SHOA 4BLQA 4DYVA 4EFLA 2PTHA 4OQFA 1YVUA 1TECE 3QEMA 4V0OA 3OZFA 2WP8J 1QIJA 3H3XA 3E1SA 4AICA 5AUOB 4RH0A 2G77B 3STVA 2BH2A 2RK6A 1RYHA 2CBXA 4Y6QA 2IS6A 1NNI1 1PJBA 1MDFA 4P92A 3GJ8A 3QE0A 4BKOA 2D3WA 3R5KA 1G20B 1YU9A 4PX9A 4RF5A 3U49A 3WLNA 5BW4A 1I94B 4MZXA 2XUHA 1WCWA 4YJFB 3EMBA 2YWHA 3UKDA 2CN1A 2YWXA 1RYDA 2NV0A 2IUYA 2PO5A 2YVUA 3KHKA 1LLCA 3QNUA 4FJ2A 1FU4A 2VS1A 4NBVA 3GRUA 4UAGA 5DGIA 3ZGNA 4ND5A 3OY7A 1GZSA 1KXJA 3JWPA 3SCZA 4CKWA 4Q4DA 4QBHA 1Y8QB 2HIAA 1T2VA 2JHFA 1P1IA 2QJTA 2ZJFA 3MWFA 4CKEA 2VR1A 4XWGA 1YZUA 4BU0A 1BS1A 2WJHA 4GLFA 1H66A 3TNDA 1NXWA 3PE3A 1FTYA 5EQDA 2QI9C 1DLJA 1QG0A 3RSOA 5DISB 4Q00A 1IHOA 2R751 2X7XA 1I3NA 1EUDB 1TGYA 2N47A 3BAZA 2IUUA 3DHNA 1QG4A 1EFPA 2Y05A 1P7VA 4MUHA 3S68A 4UBIA 3WDMA 1OFHA 1ULTA 5FIUA 1O96A 3BVPA 3DEAA 4HD8A 3ZE6A 3FFBA 4D92A 4JI0B 1EK1A 3BB4A 1HLGA 1PJRA 3VPBA 5HBGA 1OTXA 2E4UA 4HAIA 1ZONA 1L5MA 3NTVA 3ACDA 4J6FA 4A0RA 5JBNA 3HUEA 3O26A 3ZDYB 1G6KA 2ZVPX 5JXIA 3FLEA 2HU5A 5EAIA 4U6SA 1YB5A 1CQPA 1G3IA 4LA4A 1A88A 3LFHA 3PQ8A 5KWIA 1FSZA 5DO9A 2FJ0A 2G88A 4AROA 1Y4UA 1NFQA 4WOCA 2WYVA 5JCJA 3AMVA 3ZLBA 2PUWA 1RQNA 2RJOA 3D2LA 2IXEA 3JWEA 3RK1A 4C0AC 3R24A 1EUZA 1V3VA 3T1QA 1SU7A 1CWUA 2E6KA 2WPDD 3AR8A 3KVOA 4PAOA 3WB0A 4DDWA 4AJOA 4OQZA 1IVSA 3B6ZA 4PICA 1H9BA 4ONEA 4UASA 4YBZA 4D0RA 2GN4A 2CB9A 5CDTA 1JKJB 1MH1A 1TB4A 3A6KA 4CF4A 5HKKA 3FYUB 4DY4A 2WNHA 1B74A 4CQNA 4A36A 1X80B 3ZV3A 5I4BA 5F52A 1DIHA 1I7NA 1CY8A 1UBMS 1V1MB 3PDHA 4KITB 1QR6A 2IU4A 1BN6A 3I9OA 1CZRA 3PUHA 2JK1A 4X97A 3DVRX 3BXFA 3GPBA 4O29A 4BASA 4GEGA 1QVRA 5E2AA 3HBAA 1YRWA 1NR7A 2A5FA 4WX2B 3TSYA 3WGUA 1NBHA 4L4UA 4EI7A 5DU2A 2OV6A 2OXRA 1E2UA 3AVQA 5EVJA 3SHTA 3SYTA 1M8JA 3BMNB 4GPIB 4A2WA 3IL2A 4DR7B 5F2KA 3SJCA 2QT1A 5I5EA 3IOYA 1L0BA 2ROQA 3B2EA 3ABZA 4H7DA 2AMJA 5CD9A 1O94A 2C4NA 2XVMA 2GPJA 2OUKA 4PG6A 1G8GA 4RD0A 2GXAA 3OZBA 4OLFA 4URZR 1ZY2A 4J75A 2J6CA 1J1UA 1VYUA 1K27A 1JJVA 1FS6A 4LNUA 2HR1A 1DS6A 4ZVSA 2YIMA 5B12A 5JYBA 1S01A 1ZBQA 2BGUA 2VPPA 4PHHA 3FWPA 4H7KA 3IHWA 3DE7X 1R18A 1J99A 1EVIA 4FGUA 2IHYA 3WLEA 2ZRMA 2IU3A 1IZ8A 1NT2A 1U9IC 3HYSA 5EGNA 3K96A 3WNQA 4RK5A 4ER6A 1RFLA 3KJEA 4CM4B 4F7DA 7MDHA 1LBQA 1ZICA 5ES4B 1R0CA 4HUQB 3NETA 3RTAA 2Q2WA 4HLUA 3U7QB 1GLNA 4CU2A 3B1KA 3H5VA 1TZCA 4ZZIA 4MSUA 3GIDA 3TZQA 2UZIR 3TR6A 4D57A 4K1XA 1KFJB 1BRTA 3HBLA 1TCBA 2QAGA 3T5GA 1UZAA 2WIGA 2YVAA 3TAHA 1XX6A 3EGXB 5HWSA 2ZRCA 2HMUA 5JT1A 1M0WA 4IVQA 4TWBA 1HDOA 2C94A 3WLPA 1JAYA 3OMXA 3RBVA 4B6PA 2BEVB 4YRCA 4AG3A 4TYNA 4I1PA 5DCLA 1E20A 1WSDA 3DBHA 3TTYA 4F9TA 2YYSA 2DQYA 4HWPA 3M6LA 1W75A 4IGFA 5AK6A 2Q9CA 3WK8A 2GDJA 2QLLA 4BX3A 4WCFC 2VTDA 2XXAB 4HMQA 4ND8A 1E2DA 4CKCA 2XDQA 1QJ4A 3EISA 1A96A 2HBYA 1H3FA 4BC0A 1DE0A 1LVGA 2VF4X 2VK1A 3H2KA 1T8RA 2ZRFA 3MCTA 1AUXA 3P9IA 3QJ5A 4BZZA 4OLAA 2PRZA 2BCJQ 2XITA 3LQYA 3R3WA 4QYIA 4HVLA 1V6AA 4NPAA 4R9UC 5DTJA 4RNDB 3T54A 3H4IA 4EZEA 3MWJA 3OFVA 5C5CA 1L4YA 4WNYA 1GOTA 1R0XA 4IKEA 1GQOA 5TV2A 3PJFA 4AKSA 1BAPA 2CDRA 4L6IA 1NNUA 1UK6A 3ACBA 4PCLA 1NR5A 1UMDB 1Y8CA 3WNVA 1C0KA 3BMCB 1BX3A 4JJKA 4JP3A 4IV8A 1QP7A 2QRZA 3ZVLA 2PRKA 1U0HC 1HKUA 4WGFA 2OO5C 2IYFA 3O4RA 4BFCA 1F7VA 1XE3A 2ONCA 3EGWA 3WHPA 4W5NA 1WHTA 4LF4B 1IG0A 1YDMA 2P0YA 5LP6F 2BDUA 3E4CA 4MR9A 5EPEA 3CBGA 4EJFA 4COKA 2DT5A 1UBFA 4DIFA 3EVFA 1M74A 1RLOA 1G16A 1I0LA 3DFKA 3OKFA 2VZEA 4BECA 1I5RA 1RXWA 4BO7A 1FL9A 2HJWA 2OHIA 2YHBA 5DSZA 4BXOB 3GXBA 3KQMA 3SC3A 4Z7NB 3FA2A 1NLMA 4QECA 4EJSB 4M6WB 3N2KA 2C2HA 1ZJJA 2P9EA 3A14A 5FNVF 4B7UA 1I3MA 1M8PA 2A8YA 3FCYA 3CF0A 421PA 5ESWA 4CVNA 2XWJI 4LXGA 5YASA 2CJWB 2BLNA 2VA9A 4YAOA 4KWHA 3SSAA 4P1ZA 1JT2A 2J0UA 3D6JA 1N2HA 1XA0A 4JLAA 2PNJA 2XBMA 3UOGA 3MGGA 4IQ0A 4RS3A 4E33A 3EQ6A 2X9GA 3DYBA 4LI0A 1V5EA 2ATEA 2P40A 2XMRA 4O2LA 4BDTA 3TVDA 1BDIA 1UPCA 1ZMTA 1G0OA 3H9EO 4PNPA 4Q7MB 4XGIA 3V33A 3OURA 4B3MB 4ZCMA 1G7TA 2EGUA 2FV8A 2A4MA 4KUEA 4D0LB 4YRNA 2EBWA 3MZ0A 1FP7A 2NVBA 2YS6A 2WR8A 3KTOA 5F4ZA 5JO9A 4X7MA 1TT7A 1WB6A 4FEAA 3UAGA 5L4SA 4HK4A 4UTXA 1ZKMA 1HQYE 2R87A 4M0MA 4KQCA 5DBGA 1GUYA 1YONA 2ORWA 2W11A 2G9VA 1P4JA 3UANA 3NHRA 1PK8A 2FPUA 1JKXA 3CH5A 3P4YA 1NRIA 5DHTA 1SCUA 5CLJA 3U5TA 1U2GC 2GGSA 4R1TA 2CCGA 4ZI7B 1Y34E 2JFYA 2JJYA 1QE0A 4UEOA 2QMEA 2UYYA 3THSA 1BS9A 2WB4A 4XGRA 4EQ6A 2P41A 4PSUA 2YIVX 1WEKA 1VSUA 2KE5A 3NWBA 1Q57A 2JA1A 2W0MA 3PCTA 3LHSA 3R6DA 4O1HA 3A9CA 4O4LA 5JWHA 5CJPA 3UYKA 3ZW9A 4N5HX 2HXGA 2QBYA 2VWHA 3HS3A 1O57A 3KT8A 4W6ZA 4Y2PA 1JE1A 4FFMA 5JDIC 1E6EA 2DMRA 3EZXA 4L27A 5JDCC 3ZLVA 4B46A 5KU7A 1OC2A 5JVDB 3ZCXA 1FXUA 1JQJC 1QX4A 2IBMA 3I6YA 4QDZA 1IU9A 5L3RA 3TPFA 3V7YA 1B43A 1C5KA 4NYIR 3GGPA 4PO3X 1WY7A 4ROSA 4A6XA 4R9RA 3DM9B 5TS2A 1KU6A 4BNLA 4NSNA 4ID3A 4PQGA 1DELA 4DT1B 2O5RA 3ZS8A 1HQKA 1D4OA 2E4YA 2G7MC 1NLZA 1XZJA 1N2CA 3LL4A 1JHQA 2PX8A 2JIDA 3ZK8A 1KO4A 3ZJUA 2FR8A 1E3WB 1K7SN 4RA6B 4DM4A 5CPFA 2Z58A 1OASA 2C2KA 3D64A 3NOOA 2JPDA 4G09A 4ZMSA 2FN9A 2DEUA 5DNDA 3ONVA 4KXXA 4PLCA 5FRDA 3I0NA 1AN0A 1E66A 1Y6QA 1KA9H 4AZTA 1F60A 2QN1A 1JKMA 2ZXEA 3LXXA 2YV5A 1XRSB 2Q3FA 3ZV7A 2VBCA 1YQUA 1VDMA 4XOUA 2DR0A 2BKEA 1R15A 1TAHA 3L01A 3D1JA 5E4YA 3S2YA 5IN4A 4CQMD 5HOEA 3DC7A 5AK0A 4D9MA 3SI7A 3GJ7A 4EM6A 4EYKA 4I1VA 1E2NA 1Z0UA 2H85A 1L8OA 2OWEA 3DB1A 3WDLA 4DA7A 1U4SA 2ACEA 1NI3A 4RGVA 3Q41A 1ADCA 2DBYA 1CY4A 2Q2QA 4C7BA 3IODA 4XUDA 3WK6A 3MXOA 1JIVA 2J5BA 2E1RA 5HIMA 3U7GA 1U2RA 2N46A 4OLBA 1FU7A 1RJFA 4YRZA 3I5MA 2IH2A 1XZDA 4IHKA 2QQEA 3OJEA 5HUQA 4L4RA 3EUAA 2RGBA 4J94A 3GLIB 2CFTA 4RV4A 3S81A 2HO5A 1A76A 2HDHA 3IAXA 1KJWA 2WWRA 1OXXK 1HZZA 1MXFA 1PZHA 1VMDA 1ZP6A 2XJ4A 3D3EA 3MM4A 4XFDA 4AP6A 3OZIA 4IJQA 3LP8A 5IVIA 4W7SA 3W34A 2G80A 3WRVA 3IT0A 3P27A 2ZYIA 1WABA 1L3IA 2J0VA 1NN1A 3D0RA 3FRJA 4QFMA 4IMIB 4KUGA 5EUQB 5BN1A 3JTEA 3ABIA 3LF1A 3MWEB 5LZ7A 3VYUB 4MKRA 5L9AA 1ILWA 2XVYA 1BMFA 4EHBA 5JYCA 2J30A 3PWTA 3T5DA 2FWPA 1HSOA 2ZRPA 3F2VA 3RM3A 3WADA 4KQ9A 4FDMA 1YTUA 3EBOA 3VPFA 3QA9A 1LDBA 4UXHA 5B4UA 4M1KA 2PGOA 4GW3A 2CFOA 1GGKA 5EWJB 4D3ZA 5JBQA 3UNXA 1B16A 1UDXA 4RKWA 4R9NA 4FZVA 1K3FA 4HWGA 2LD4A 1OWMA 1X7ZA 1QK3A 3A25A 1K0FA 4ZGBA 5CBPA 2FUNB 2JAXA 4OTZA 2O3TA 1GSIA 2FW9A 2JGEA 3KE9A 4ZHQF 3CCBA 4NV3A 4BP3A 5BMVB 2YHSA 3JZDA 5HQ3B 2NTNA 4NMHA 5FNZA 2OOSA 2QRLA 3NBZC 4HATA 1QFSA 3B3QA 3CE9A 5CB6A 2GZAA 2F55A 4Q7LA 4CEJA 1EHCA 1UAGA 4LC0A 4QLBA 1LDNA 2M2IA 3Q4GA 1T4CA 1T1SA 2G9QA 2W2OA 3LUGA 4YJ3A 3WZ2A 5A4IS 3CLVA 2VSOA 1SOUA 1VL6A 2XHEA 3TYXA 5L6MB 4MXDA 4WEQA 3HJAA 1VBFA 1WHSB 2EF1A 3CT4A 3LAWA 4PR0A 1JG4A 3HWSA 5FPPA 3VZDA 4JP2A 4QOFA 1HRKA 3BRWA 2AMYA 1X7HA 3EZGA 3ORFA 4G0XA 4P3YA 5IMBA 4DCNA 3GFGA 4F3TA 3ENZA 4UM5A 1OFUA 2WV9A 3I73A 3R8XA 5JMPA 1L6RA 3EW9A 2FUG1 3L49A 2ZZMA 2OD7A 4M1ZA 5A62A 4KXQA 3UPTA 2R1TB 2NZ2A 4XI9A 1RC8A 3VDMA 1M7GA 2VF5X 3R0VA 1CDOA 4KOEC 1VHTA 3TXXA 1ZPDA 3DEIA 5HG0A 5K3AA 3FNHA 1A1SA 2DBQA 4S05A 1P0PA 1K97A 3RYFA 1E7QA 3C74A 3E9NA 1E61A 4NI5A 4N3CA 3LUCA 2HL6A 3A32A 3NKLA 1VHQA 2P79A 4PZLA 4V3BA 4W8GA 5DRTA 1OBOA 2YJZA 3IJEB 2Y71A 3HRKA 2HA3A 8ADHA 3AKZA 2J4DA 1MVLA 2PXCA 4LOLA 2ZIXA 3LT4A 4DMRA 1Q0RA 4GDMA 3HJHA 3EF1A 3GLHB 4AY4A 3ZCUA 2BFAA 1VHLA 1WP4A 2VRNA 4R8SA 5DMHA 4IXNA 3K0KA 1B42A 1E60A 2J08A 1BX1A 4PYJA 3KAPA 2P77A 5AESA 2VDVE 4MB6A 4XASA 5K6AC 2XUPA 2I6QA 3OOJA 4JYCA 4N0MA 4MR9B 2XT0A 3KXIA 4TLEA 2BHSA 4RCZA 1K66A 5J2TA 4V0SA 1P1HA 1JA9A 3M1YA 4X1YA 1VSVA 2AVNA 3EAGA 2PWZA 1M1NB 1WBBA 3KYBA 5GVSA 5G0WA 3EWAA 3FAZA 1U3FA 3D1LA 1F8GA 4GEKA 1A4UA 2AF4C 3I1YA 4RADA 4DQVA 2PZMA 1E8MA 4X1OA 3AVOA 4BJ5A 1LU9A 1HMPA 1VYTA 4TQUS 5H5JA 4PCVA 5EJ9A 2P9YA 2CL6X 1E3JA 2H7XA 2ZZNA 5DVZA 4E4YA 4BFVA 1T4DA 1YJQA 4LX0A 3R9XB 1L4FA 1PQWA 3CG4A 3V4PB 2XB2A 5H1YA 1THTA 2JVJA 3C3WA 3AHJA 4BVAA 2HHAA 5FOXA 5GONF 3IS3A 1ZA2A 5JMOA 2WOOA 1QDLB 5A0TA 3KEFA 1FYDA 2CHGA 2Z4SA 3CSSA 5ALXA 3HXOA 4PFKA 2XRMA 2F62A 2QX8A 3LUJA 4D6XA 4OBXA 2RB4A 3JASB 4PYOA 3TZHA 3FPBA 3R0ZA 1KHHA 1KH1A 4Y1RA 4QOJA 4OJMX 5CNIA 3UJ7A 4I5DA 5G1OA 3U3ZA 2H2FA 2DY0A 1BH6A 4LZLA 4CDRA 5FL7A 2OP0A 3W1EA 4MW9A 3CPSA 3LQFA 1ODLA 3C8ZA 3WICA 1CUYA 4FLFA 4RM3A 1Q5PA 1BA2A 2GN6A 1AA6A 4RU1A 3OPNA 4R41A 3JD1A 1Z4NA 4UBJA 5LU8A 5GM1A 4IV0A 2ACVA 4HXYA 4PZZA 3UT5B 4YX9A 1ZLXA 3FTEA 3WMXA 1OREA 4CTKA 2CL5A 4QQFA 4PZEA 2H52A 1W0JD 4EGSA 5AKGA 5AT1A 4B4UA 2R1UA 1PUJA 2YS7A 3R3ZA 3C6YA 2NAPA 2ZPUA 3TZCA 1PR0A 3JSAA 3Q9SA 3V34A 4F3NA 4LZAA 1IHXA 5GP1A 2MYUA 1T8PA 5EJFA 5I8PA 4ATNA 4DXDA 5FUVA 1IQRA 3AX6A 1TM5E 3EZYA 4HWKA 1KAOA 1CQIB 3GUUA 3KB8A 3H87A 2JNWA 4ZVLA 2L17A 3RYTC 4Q4AA 1O87A 1N7JA 1R8QA 2Q41A 2DLCX 1V5WA 4C7OB 1JKIA 3LXUX 4P84A 1A8QA 1RE0A 1FDSA 4FGKA 4HLQB 1JR3E 4FPXA 4P38A 5JTUA 3TS1A 3KUDA 3S4YA 3T35A 2D4AA 2C4WA 4E2WA 1Y1QA 2HHCA 1VG8A 2VXCA 3TE7A 2YWFA 1JSCA 1M1YB 3QVMA 1UWCA 2CY0A 2R6R1 1L4GA 4MUBA 1GA1A 1QQ5A 3DLAA 2XTMA 1NUQA 5BOSA 3BTVA 1VSQA 2P3QA 2BL4A 2QN6A 3A7DA 1QYCA 3K1JA 1MAWA 2Q3DA 3UWDA 4CTNA 4PTYA 3SOZA 1DBRA 3UK6A 1H42A 3Q0TA 4LW8A 2ZR8A 3ZZNA 2AH5A 2YHIB 4O4HF 4RTNA 1BXRA 1XAIA 1JSRA 2G1UA 3N53A 2XIQA 3TEMA 2HK7A 1EWRA 5JEEA 4E2YA 2H1WA 3KFVA 4UUBA 5L3ZA 4P5PA 2O8DB 4OQMA 3FWHA 3PYXA 3KDSE 3MPUA 4G9BA 2X9NA 4FOPA 1GTRA 3OLWA 4RSMA 1T3HA 4LXYA 3G02A 4U2FA 4WZBE 4V0QA 2ZUBA 2QTZA 4RD1A 1GVNB 3NORA 3OQBA 5K3CA 1EB8A 3FLMA 2H8GA 3H7IA 4JYMA 3RHFA 2H2DA 5T4HA 2OM6A 1CUAA 1KNQA 2EGHA 3GXOA 3TR5A 3H7AA 3W0LB 3WRWA 4O63O 1S2MA 3G1UA 4PRYA 2XNDA 3AEKB 3PD7A 3TXYA 5EMHA 3SXJA 1ZAYA 3DKPA 4J0FA 2PH7A 3BH0A 2W2LD 3COSA 5DBIA 3UC5A 1SUCA 3ZD9A 4BAGA 4Y2YA 5JNTA 3FZQA 1DGQA 2VXOA 1ZI8A 5IEBA 4OBEA 1OFIA 4Z3OA 2AOUB 4EP1A 3MCVA 5K0TA 1RAGA 1TYZA 4FYXA 2Y66A 4FR0A 3ZCPA 2I91A 1FTNA 3DS8A 5ALVA 4JYPA 4DPLA 3TLGA 5IAOA 3EEFA 1XK7A 3H4VA 3NGMA 3AH8A 2AVDA 4GI1A 3HYCA 2RAPA 4FC6A 2WG1A 5CGQB 4ZVTA 1NY5A 2DHEA 2VNHA 5DCUA 1FFXB 2FG7C 3Q6NA 4B6EA 5CBPB 3Q8LA 5MFPA 3DSRA 1RWXA 1DLIA 3K0EA 3TPCA 2Z2JA 2B4AA 3N74A 5AHKA 1YNSA 2FMTA 5BSVA 3DMRA 1WD5A 4TKMA 1KYVA 4LZNA 5CCDA 1TKBA 5JCXA 1CQWA 1QDEA 5CPBA 3SQWA 3W90A 2FZCA 2C7BA 4Z0HO 1P9NA 4OLHA 4HXEB 3BJMA 1JDTA 5EFZA 3D6TB 2LE0A 1AURA 4WLFA 3NVKI 2BTQA 2Q3EA 1OZAA 1VCIA 4EO9A 5KYNA 5F1YA 2HAEA 1IHPA 2HCFA 2N42A 2XXJA 4KGVA 4LQLA 3WXMA 4G0VA 1JEOA 2QMHA 4EH1A 4WASA 5C46F 3A1TA 1XZLA 2I29A 5CVVA 2J85A 2PKWA 4RVDA 2WWXA 3QRWA 5ALLA 2MYNA 3FYUC 5K0BA 4BGVA 1HLDA 1OJLA 1ZRHA 1AVTA 2Q4RA 5CLIA 1WMSA 5DM70 4J6EA 1ZA1A 2IHUA 4PWYA 1QLWA 4ZD6A 4WBNF 1WTCA 2BP7A 4C78A 1GRQA 1BXGA 2Q2VA 1UWVA 2C7VA 3RYFB 5IPFA 2ZGVA 1TJ4A 2ZS9A 3ROKA 1E4VA 2HH9A 4Y98A 2IUFA 1QF9A 2YCBA 3S1AA 1QS0B 4NJMA 1C1DB 3S2ZA 4RTKA 3FFWA 1J6UA 4LJSA 3DTNA 3FPSA 4O4JA 5EIEA 2XVAA 3TIFA 5K20A 2JGRA 2W8BB 1GQSA 5IKEA 2RKOA 4RV9A 1D8TA 1U81A 3ABSB 2Y0PA 3DQQA 3PFIA 1TTTA 1Z0SA 3ISJA 4URYR 4JIMA 3OKPA 4BNNA 4M0LA 4CLEA 2OG1A 4RVGA 3CZPA 1L7XA 4NDAA 4P31A 5K4AA 4TS3A 3P20A 3QV1A 4S0XA 3TVTA 3VR2A 1ZH2A 4DS3A 3VO9A 2VFAA 2QR2A 5FBWB 4YACA 4YR7A 1XZBA 2WSBA 3UY4A 1HUQA 1ZCAA 1HE4A 2WIJA 2PS3A 4QAJA 4F5YA 1EU1A 2WI8A 4K8OA 3H8VA 4B75A 5HF8A 5IT9A 2YIDA 3Q6MA 5LWHA 4UBKA 1AC5A 4ECEA 2WSYB 3OLYA 3R0JA 3IVGA 2E87A 3CIFA 3CJTA 3RUIA 3LMKA 4DCOA 3EEOA 1E1RD 1VPLA 3LPDA 1YFLA 4IRMA 3V7WA 1RQXA 4M7RA 1ZUNA 1JQLB 3SK0A 1NVXQ 5I47A 3A9RA 4A10A 4BP1A 3QX8A 1Y4AE 5E2IA 4M83A 2C4VA 4C5AA 2YJNA 1AKVA 2OAEA 2WKWA 4ZU1X 4IAOA 4R98A 2VHYA 3ETDA 3B48A 4LZJA 1P31A 3ZJYA 1GQ2A 4HYTA 2R7KA 2EXXA 3UW1A 1Z6ZA 3FSRA 5IDVA 2J9YB 2PG3A 3VTZA 4ZJZA 2FLVA 4LY3A 5CX4A 3BFPA 2HBZA 2MT9A 4LYFA 3B9PA 4ENWA 2OCKA 2IC5A 1GNRA 2QRGA 1FVOA 1TLLA 2XYQA 3P5BA 3T5MA 2O6HA 1RYYA 3KFLA 2VXBA 4N7JA 1YKFA 2OSBA 3AB7A 1NVDA 1XTZA 3A9SA 1XLTC 3LNCA 2FWJA 4OQPA 1BTOA 4I3HA 5A02A 4MS4A 5CXUA 1T5TA 1ISGA 4IIGA 1F48A 1X70A 3QBDA 3QEBZ 1AXRA 2PPLA 4O33A 2B2CA 4XH9B 1KE2A 2OMKA 4CM8B 5C9ZA 1NVBA 1FMFA 3R5JA 4M9QA 5CB4F 3H84A 3TW8A 2ZUSA 3IDOA 2CKMA 4RWEA 4Y2VA 4MO2A 4RA9A 4LGCA 1Z6TA 3AR7A 4M7WA 3KOYA 4BVLA 1SA0B 1ZZGA 1FYXA 4DZZA 5ISMA 2PZEA 4BQIA 1OBVA 1V96A 2NV2B 3A6LA 3CX8A 5CB0A 3IEUA 3NLLA 4EATA 4O8ZA 4N5MA 5HK9A 1RQGA 4MUJA 3DOUA 4WN9B 2FMXA 3DV0A 3T3NA 4UULA 3N2EA 4KNWA 4ISCA 4EELA 4FB5A 1R0SA 1ARZA 1OZGA 5JXGA 3I05A 4U7TB 4L4ZA 3E8MA 1DFGA 4ER3A 1CZUA 1EFTA 3BWCA 4EJSC 3PQEA 3DL7A 5CMLA 2IHBA 3VBCA 3GV0A 3DYIA 3HY6A 3RSFA 4PLTA 4LBZA 3QHPA 5B3JA 4B47A 1FX0A 1E7YA 1ZVKA 1HMYA 5TMPA 1P5HA 2EP8A 2ZTMA 2UZAA 2QRVA 4GBED 5DI9A 1L5HA 3IIEA 3D7KA 2P75A 1VLLA 1C7ZA 2HMWA 2X4DA 3A4YA 3PNQA 5BWNA 1YK1A 3DF7A 2VEOA 3HDTA 5J4YA 3QF4B 5FUBA 1A7KA 1QIFA 3O3CA 3A9UA 4BWYA 2C88A 2IVZA 3MK31 1PAUA 2WFMA 4LN1A 4KYTA 3ZI4A 4IZOA 2CUZA 3G0OA 3EXEA 3L02A 1XOIA 4G4SO 1ZGBA 4P33A 5BNWA 1J9GA 1GUDA 2CFIA 3PFFA 3A1NA 1XMSA 3VV3A 3C7CB 3ZE2B 3QUAA 4J0QA 2PUTA 2XLCA 1QIMA 1NUUA 2QKYA 4IIEA 3SYRA 4WXRA 4MWOA 4MW1A 2E0IA 1CQJA 2I2BA 3RCBA 4R1PA 3A28A 3M70A 1DAKA 4QRDA 3VH1A 1SXGA 1UKVY 1TQDA 5L6LB 1ZUIA 1V11A 3R09A 2VVTA 4PSAA 4TYQA 2A59A 1Q0SA 1TQHA 5L3SA 5KYKA 3LQ2A 3WGNA 5HILA 3DXZA 1NQUA 3DZFA 3ORYA 5DYGA 3ZD8A 2A92A 4D3FA 1BKYA 1Z6GA 2DQ4A 2GCIA 3A05A 3IBCA 4FCVA 4MGKR 1HNXB 2FB9A 3SKYA 3FCSB 2N75A 1U7PA 5IN5A 2ZUDA 3V1UA 5FPSA 4C3UA 2ZBUA 1ZX1A 3KG2A 4M87A 3UJAA 2Y1GA 1N1GA 3GRVA 2O2EA 3BJEA 4FZRA 3HVHA 4K26A 3SHQA 5F7XA 5LZ2A 1X7XA 2IYQA 3H6HA 3ORQA 3EK2A 3KYIB 5JU6A 4MYTA 2WVJA 4Y0VA 4CCYB 1EG2A 4RD4A 1HQCA 2AW3A 2Z0MA 3TK1A 1XVUA 3WS7A 1KERA 1Z88A 2AMFA 1Q44A 2CLEB 2B78A 3LX8A 4K28A 2IDJA 2P6OA 4CG0A 3RSSA 4WCDA 4JR0A 4ZEVA 1ZIXA 5J1SB 5K1ZA 4RAOA 1YCDA 3HO6A 3ORRA 3LUBA 1AHIA 2CF6A 3BGWA 2P30A 4MMXB 1UPUA 4I81A 3ZX5A 3WOVA 2WF5A 4XEUA 3PGLA 4D8XA 4IDHA 2V7XA 4ZV9A 3FVTA 2BGMA 4HZIA 1JBQA 4FKMA 3G2JA 3MELA 3BL6A 3QE4A 1KMIY 1QB8A 3STHA 2R7AA 3PXEA 1ZL0A 5I48A 5F5XA 2BGGA 4Z9XA 1I4LD 1PD1A 3AFGA 5B64A 1EVQA 1Z18A 2JL1A 3PNVA 1C8KA 4OU5A 4P4NA 1P91A 4NXMB 4CLXA 5K9ZA 1A71A 1NUPA 2C8LA 3SJ7A 4X3PA 2WNSA 1QO0D 5KQPA 5IVHA 4W63A 2ZI5A 2X6RA 5ALWA 2YMMA 4R01A 1LEHA 1NPTO 2J9XB 4N3NA 1A8HA 3H6GA 3GYBA 3IAHA 4XUEA 3THWA 1X8LA 3BKXA 1AV7A 3PPVA 4ZCSA 1PN3A 3ZR4B 1X8XA 4CIVA 3VPDA 3GG9A 1DOAA 1VJ0A 1J97A 4MVJI 5G3ZA 2LGJA 1E5LA 3ITEA 3KKKA 1KEKA 2OFFA 3P9YA 3VXKA 1C81A 1GZ7A 2P9ZA 6CHYA 1A0OA 3L7AA 4FWBA 3WC4A 2XV1A 1TA0A 3G2NA 4XVHA 3WNDA 3WRYA 3E15A 4ZU3A 5BN4A 2FE4A 3UB3A 3FGOA 4MEAA 3W2IA 4KXLA 1JEJA 3EZ6A 3LHKA 2A5JA 1UPBA 4M2LA 4F04A 1UM8A 3HU3A 5JQGA 4AY6A 2XB4A 3FTNA 2WT4A 1J0CA 3LFTA 3HBJA 3NRJA 3EH1A 4L08A 4IO0A 3KQKA 5AVRA 2PJUA 2DC1A 2MHCA 3K2QA 3GGOA 2QP3A 2V8BA 2ZXFA 3O4HA 4QQ8A 3UH0A 5DGCA 3VGPA 3A2NA 5EXPA 1EIZA 1RDFA 1WG8A 1S02A 4L7VA 3WV4A 4AMVA 3T52A 1H2XA 2UDPA 4XVUA 1OU0A 1C1YA 4OATA 2YOFA 1TUBB 5JD5A 4L3OA 1P5FA 3O5AA 5IAJA 3UMBA 3UM9A 3OQHA 2NG1A 1R0BA 3HO1A 2IWHA 1E2FA 1TVKB 4HLUC 1NN0A 3LCJA 2COEA 4DDKA 4X7BA 2HLDA 1U8TA 2QT0A 4JY7A 2XVZA 2BBTA 2O3JA 1OXUA 3E7FA 3NEYA 1V47A 1Y5IA 5CRIA 5H70A 2G0AA 2QAGC 4CLOA 4Y1FA 1I3OA 2AYZA 4U9HS 4U7PB 1RI3A 1T5LA 3BXGA 3WLSA 2FZKA 2BFMA 4KRXA 2N0SA 4HSEA 2F1HA 1CF9A 1ML4A 2XUZA 4FS3A 4TGLA 5H80A 1GJRA 3BBPA 3Q7IA 2XMSA 4H3VA 2OZLB 2O5CA 3EOBI 1VSTA 3EEBA 1R0KA 3G68A 1S8FA 3EARA 3DL2A 1TT5A 3BGDA 1OI7A 1JLRA 2O0HA 2IPLA 1N5JA 3IFSA 2GJ8A 1XZAA 4D4GA 2JEYA 3FYSA 2Z8XA 3E9CA 1Q83A 2QVGA 4Q7QA 3AQIA 4D8UA 3IUPA 1U2EA 1EFLA 1BZYA 1CY2A 1J9EA 1L8QA 2UV8A 5FQNA 2JD2A 4C0SA 4CL3A 5K0JA 3KUCA 1P7YA 1KDZA 4LHSA 3GLFE 4QJBA 3F7OA 1KO1A 4RMNA 3ABQB 4AUNA 2P2CA 1ZIDA 2I71A 2QN9A 2X7JA 1I32A 4TL7A 3DB2A 1KZYC 3ZK7A 3BMOB 4O25A 5CA0B 4N54A 1M34B 1PGJA 3H8JA 2A5YB 4M0DA 3J81A 1JMYA 4QYXA 1ZD9A 3E61A 3PLAE 5ELXA 2WD7B 3VJRA 4B4WA 2AHRA 3COZA 4DA6A 4AMZA 4BNTA 4YRSA 1KOGA 1J8VA 4OY3A 4Z7JA 4RKRA 4BQOA 4E13A 5IZ4A 3VTKA 3K05A 1OX4B 4MYCA 2Z9CA 3N2IA 2CMDA 1DVRA 1N5OX 1XA3A 2W6OA 3I9LA 4EDFA 4E30A 3UT6A 2CCJA 1CULC 3R7NA 1QGZA 2GFQA 2XIJA 1NTOA 4JMLA 2ZSAA 3MJVA 4ND4A 2OP1A 2BHNA 3T7SA 5ELMA 3HSSA 3C1AA 3QUQA 4R84A 1OW3B 1N0VC 2P2NA 2WFLB 3VRHA 3N05A 5BPFA 4K3VA 5L45A 1IRXA 2QW0X 4H77A 4KE8A 4IS3A 4YP6A 3T99A 3BGSA 4JXXA 4KO2S 4MTCA 1V39A 4MGZR 3M8KA 4CEHA 2OV1A 2A84A 5AWFC 5CDFA 3ZBQA 2CXPA 2OBYA 4MK4A 4B6SA 1NYRA 4NV1A 1EP9A 1PBNA 2QRUA 4JLSA 1WR8A 5C18A 4KIGA 4BO8A 2F9FA 5JAUA 3KAQA 3SZMA 3GJ3A 1I7QB 1KAHA 4LXIA 2CK3D 2BMFA 2DQZA 3W2HA 5BV0A 3L8MA 3K20A 2IZ0A 2QJRA 2VCHA 2NQ8A 3H5NA 3NZEA 3OCZA 5JS2A 3URMA 3ZHBA 3RBAA 5LC1A 3LHDA 2F1OA 4ZEOA 4PZUA 5B6IA 4AT1A 2RGDA 1Y5RA 4WRRA 3K0FA 2F64A 1ONSA 2JHAA 1Y1KE 2QTFA 4S1WA 2CV0A 5SZHB 3COJA 2B1QA 2QQGA 5HDBB 5BNZA 2IPAB 3EC1A 4INAA 3CNLA 3WLLA 2O05A 3ZQJA 4N39A 4DUGA 1UBOS 4X66B 3KR0A 5LFAA 1SHTX 4OMCA 1GLVA 1Z7EA 3Q3VA 3WK5A 1SFRA 3CLSD 4D9KA 3EPJA 4C4AA 3DHVA 3L7JA 1PTKA 3MIZA 3OE1A 4LBYA 2X2EA 4C5BA 2VDJA 4EHFA 1C8VB 2G5TA 1ZM9A 2VHEA 4XDHA 2JG3A 1XHFA 2M1XA 2FA9A 7AT1A 4QPNA 1L5OA 3O3NB 1XP5A 1KP9A 5F1PA 1ZR4A 3F96A 4RMIA 4LOHA 2X0RA 1X7GA 4JJ6A 4WXYB 4BNUA 1SCKA 5KYXA 1NATA 4OKNA 1DZ3A 2VDKB 3I72A 3V8VA 2O3SA 1Y6JA 3O1JC 1DTSA 2A9KA 1RQLA 1YQWA 1NZJA 2Q8QA 3M1AA 3OUUA 3F7MA 4INJA 1Z0IA 2HCTA 3GMSA 4JI6B 2XCUA 4TOIA 1DBVO 1N34B 3OTGA 1H3EA 1FRNA 1CUXA 1FNBA 3I9V1 3KZMA 1XQ1A 2NQ2C 4OMUA 4UE6A 4MV9A 3E27A 1A5SB 1WZUA 5AJYA 3WMGA 1RCTE 1U9YA 1P0IA 2FR8C 1R8JA 1YHZA 3FHOA 4XGNA 5FOVA 1JS1X 4ZCTA 1FYEA 2Z6UA 5KO2A 2D1QA 4FMCB 4HVCA 3RJ9A 1X92A 3IR7A 1PWZA 3N7UA 1EGVB 1TNDA 2YFYA 4LXTA 3HFSA 4MPRA 2XUOA 3TZKA 3GJTA 5FO0A 3CKYA 1C7IA 3FCCA 2PS0A 3BCRA 3EEQA 4IXTA 4TMKA 3SNKA 4E46A 5ALYA 1DC4A 4Q9KA 3SEAA 2QMZA 4OQXA 4ZYLA 4B45A 4FFWA 1XTVA 2KMLA 1W5EA 1UJMA 4WKGA 1A69A 1C0PA 1GYRA 2ADOA 4QUBA 4N76A 1DKUA 3OX1A 1GPUA 1QNFA 2BM0A 3HBFA 3KWMA 4GLLA 1JXQA 5GIOE 5LP6B 4QRHA 3NDJA 2JI4A 5KYWA 1BGWA 5E4JA 4Y2QA 4NC9A 3EOZA 2C5SA 1BFUA 3K6JA 4UVDA 4X8HA 1J0DA 2IZ1A 3RRBA 5CJJA 3S2GA 3PDJA 4FQ5A 1E2LA 5CNJA 3JQPA 1E2QA 3O94A 4X62B 2NTEA 2Q21A 3FPGA 1LDEA 3W5CA 1HZZC 2HDNB 3G0GA 3ENVA 3VU1A 3GEHA 2RHRA 3I9FA 3IE1A 1UZMA 3DJFA 3L8FA 3O84A 3PCRB 4FFNA 4X20B 1UMCA 3GHYA 2BVNA 221PA 4ZTBA 4E14A 1SUPA 2V96A 3EYWA 1N2BA 4NFSA 2ORYA 1AZTA 5ALRA 2CUTA 3ZD6A 3EGCA 4TVKA 1OKKA 3A6EA 2QPLA 3TOVA 5IT4A 2W8ZA 2YRXA 2CLMB 1J00A 3FX2A 4HNAA 4KDCA 4MS3A 1L4NA 1OLUB 3OCVA 1J2RA 3OT1A 2EDAA 1E7MA 1UDRA 5FNVA 1T3ZA 4KGXA 1OIWA 2EARA 3BFVA 3NOQA 4X60A 3R6LA 4B5LA 1YULA 2VF8A 4O4IF 5FI3A 4N8EA 3GD7A 4ESVA 5FYDA 3V4RA 2O57A 3K09C 3UPUA 1S2LA 3N07A 3FDFA 1HF3A 1SVWA 1DJMA 4JAVC 1AQUA 5HYVA 1P0MA 1YFZA 2FMKA 3A4IA 3B3FA 1IZ0A 2VL7A 2P68A 5F1KA 3UAYA 3GP8A 1IE3A 5HM8A 4XARA 3UH1A 4MQFA 2AN1A 2CXHA 1CRWG 1NV9A 3TQFA 1VJCA 1Z12A 4CLOB 1FDRA 3F73A 4ZU6X 1P2UA 2W37A 3ESQA 4IM7A 4KREA 3NH6A 5C8YF 3WO0A 5EPUA 1YA8A 2VRWA 1HEIA 1T36B 4UVGA 3U1VA 1E2IA 1V1RB 3BE6A 2AUMA 3G59A 1BEZA 4OX9B 3DOEA 3HR7A 3RHZA 1NJSA 5JWRA 2RAVA 3I6ZA 2WIKA 1W6RA 5BN3B 3ZGOA 2NXNA 2Q1SA 1SHJA 4QTYA 4UTVA 2W6IA 5KBYA 3VNUA 1DQSA 4ALIA 1WOYA 4GG1A 4MGYR 4XQ0A 3RH0A 3M1IA 4BE7B 1N1DA 4DIKA 1G291 1MVOA 3AV0B 2GKGA 2W6JA 2Z6VA 3NANA 3P4XA 4O08A 2ZRGA 4D2IA 1PIWA 1CZKA 1M2OA 3QWBA 4LPKA 3G2KA 5FJIA 1V3UA 2A88A 2GD6A 3FR8A 4YBRA 4JI1B 1WS6A 1HNZB 2PK3A 4JNKA 3ZWNA 3DWIA 2BONA 3Q7QA 2H0RA 1MV5A 4PRKA 1T0JB 4D9GA 5EXEA 3QLTA 4OXYA 3S5UA 3CF6R 4E07A 3TOXA 1KI3A 2OV8A 1KAEA 4MVJG 5KNBA 2IPXA 3P9PA 2XE7A 1XZCA 1EFVB 3K9WA 2VDUE 5ESDA 3ZKWB 4ZICA 1P7WA 4PR3A 5BN5B 1W93A 3CRW1 3ZYZA 2IDMA 2PUJA 3CLRD 4Q19A 1QU3A 1FFGA 1ZU5A 1AG9A 4YRLA 2QTTA 4WFJA 4ARCA 3FSGD 5BR4A 4HADA 3QHQA 2CNLA 3HEAA 2BI8A 3K9CA 4KNVA 1W0CA 2FPWA 2QX7A 3AHFA 4MPDA 4N01A 4EGJA 4WJZA 4YIKA 3NASA 4TYYA 1SR8A 1G9XA 1SD5A 4IJKA 1KGSA 5JAOA 3KQTA 4DLSA 3R7FA 5D1NA 1F1BA 1I24A 2QRHA 2VJCA 3KBOA 4G0NA 1E3TA 2QWXA 4PIVA 5DP1A 2I6UA 3VDQA 4CLRB 1OX5A 3RFFA 3KXLA 5C8ZA 3B9QA 2IBSA 2CNNA 3A70A 5EJ8A 4RFVA 4AECA 3PGMA 1I5OA 1VIDA 1GA6A 2P6UA 1YUBA 3K70C 1NW3A 1KYZA 2ZKIA 3UV6A 2C2XA 1O4WA 3WRXA 2YKGA 2XMDA 4IDPA 5JRDS 2E85A 1AK2A 4BLPA 1CUZA 4F71A 3D8BA 2VJYA 5FTWA 5BT9A 1NWCA 3IQDB 1P0QA 4N7BA 3SX0A 3C8MA 4CQMB 1D09A 3DE0X 4GX2A 3GB9A 4UHEA 2DT8A 1V8FA 4B3JA 2C3MA 2CSXA 3NNDA 1ESDA 2FP4A 4Y6SA 3RYHA 4WIAA 4MUFA 1FLNA 1FFDA 1BGXT 4X63A 1ULSA 1W73A 2VHXA 1R74A 4IGAA 1TM1E 5A3QA 2ZSBA 1IBLB 3DWEX 2C4MA 2PZ8A 3K0FB 2B2XA 4DOMA 1OB5A 2O2XA 2E1PA 4L1KA 4X90A 1VLQA 4ZQFA 1EG7A 5CT5A 3PEFA 2O3QA 2JIRA 2ZAOA 4N12A 4QASA 1ORDA 5AW0A 3B8EA 3EZ9A 3NT5A 5C7OO 2I3AA 1BOOA 4DLNA 3PL1A 2WLTA 3LQ4A 2V54A 4LJ5A 4MWCA 5D2CA 5DX1A 1NM5A 2OBMA 4EDHA 2QN7A 2R6JA 3IMCA 5EMKA 4RKYA 2ASVA 3KSBC 4ZAFA 1ZVQA 1FJHA 4BX0A 1L4KA 2EP5A 1XDSA 4DANA 2R8PA 4KMMA 1PDOA 2FSIA 1TDJA 2SKCA 1T5HX 4RGYA 2YY5A 3VDNB 1JLKA 1YL5A 3HJNA 1W59A 3SOPA 3ND7A 3UF0A 1JZQA 3ETHA 3AP2A 3GRRA 1JA1A 4Q9DA 2VP0A 3EUFA 3WSWA 1M7BA 3HB0A 4NE2A 3AWDA 1TVCA 3N2GB 1SCNE 2QPOA 3AUYA 1ABFA 1TIKA 4UFPA 4LS3A 1GXSB 2OVFA 4OM8A 4GT1A 2UYGA 2X22A 1L4EA 3DJYA 4H9GA 4W9NA 4WBXC 1FNSA 3SJZA 5A5FA 1RWNA 2W2NA 3DMDA 5BV2P 1W4RA 8OHMA 1IOVA 5EJ2A 2VWGA 3MJTA 5DHRA 5F3WB 2JFBA 3S8MA 2XVXA 3E48A 2OVBA 3E0XA 3O3MB 2I4RA 1PW7A 2C31A 4R68A 4HDQB 3WFZA 3ND6A 1U0JA 2YQ5A 1N2CE 3CX3A 1XP8A 3IB3A 2FG6C 3P9QA 4BQSA 3T7DA 3MRXA 3AJRA 4C7VA 3OU7A 4R3NA 1YTLA 4QREA 3PNBA 4P86A 1JEYB 1SKMA 3KO8A 6YASA 4GXQA 4EL5A 1KWGA 4YRAA 3K4QA 3L82B 4PE5B 5DLPA 4IHAA 3CZ4A 2JGLA 5EP1A 1CHDA 1QHEA 5HOQA 4CMIA 5SYAA 3KQNA 4NZOA 2QY9A 4PX2A 2RI0A 2ZT7A 3GNLA 4A2PA 1KFKB 1U98A 4M0CA 1UBKS 5EXXA 4JENA 3BXXA 1T26A 4AW9A 5HZKA 3E4DA 5SZJA 3W3AH 1MENA 1R0YA 4LV6A 4W8OA 3SXPA 1MA0A 1HE3A 4EMUA 1QC5B 4M1TA 3HO8A 1UC8A 3LO8A 4UEWA 5TPZD 1N9GB 3FJ1A 3GJQA 3JQAA 1B0UA 3C7DB 3KVRA 4X3CA 5KDLA 4B7ZA 1G98A 4P3KA 1A8IA 4ILEA 1P60A 2ZYDA 2WWGA 4GNKA 2GPSA 1CP2A 5FQOA 4JQYA 4JASB 5SYNA 2ZS7A 4RM2A 2FPGB 1RQRA 5KVQA 2IUSA 2X76A 3RFCA 1Q1AA 4R1LA 1J8MF 4C4PA 1UMCB 2EX4A 3NFRA 4DAEA 3LFUA 4JP1A 4R1OA 3MTBA 1CY6A 3U37A 5CDHA 1TM7E 1PNVA 5TMBA 2OECA 1DX9A 1TQ6A 3GA5A 5LCXA 3SC4A 3SQNA 5C37A 1JW9B 4FFRA 3VYRB 4EW1A 4INPA 3AKEA 2OL4A 3MD0A 3FZNA 4QFDA 5CVTA 3DDZX 5CFNA 2K7FA 3GPCA 2RH4A 1ST2A 1QH9A 1ZJYA 4XTCS 4E21A 4EA6A 5HKLA 2J5RA 3VPCA 3OI7A 5BYJA 1TTQB 1ZNQO 4RZ3A 2HU8A 2A57A 2G06A 5TS3A 1T6NA 1KPIA 2YMLA 3EVCA 4E5MA 3C16C 1ZL2A 3HPRA 1EXNA 3I83A 4TWJA 4K40A 4UOEA 4A8JA 1UBLS 4EKEA 1IONA 5E6UA 4FD2A 2B2NA 3F4LA 1HK7A 4C30A 4ZAWA 1FVHA 1HETA 1U3DA 2PZAA 3D1VA 3U5ZB 3ZWPA 1XRPA 3MJFA 4FHCA 3H9BA 2VJKA 1V8OA 1YR7A 2AEFA 4JQSA 1E1RA 4GWLA 3KL2A 2X8LA 1YBFA 2GI4A 1M6HA 2XA2A 2GVDC 5JECA 1MH9A 2ZSUA 1DEOA 3GDHA 3PD1A 4DV5B 2IEDA 3UIEA 5JPIA 1I3CA 1Z25A 5JS1A 3OFJA 2YZ2A 1PL7A 2O1XA 2AUTA 4QDUA 1X77A 1BHJA 1XTTA 1O6FA 2GFHA 2HEGA 2WQZA 4DV1B 1OAKA 4MO9A 2WF8A 1I51A 3EF3A 3QG5A 2FXIA 3IKJA 1M6VA 1MD9A 2CXQA 1SPXA 2HMVA 2YIJA 3K0AA 4ZALA 4MDHA 4OQLA 1CSEE 2BHLA 4JSRA 1U0SY 3VR3D 4W99A 2ZE7A 3E53A 1E0DA 3EG9B 2HZBA 2VP4A 2CZCA 2H9AA 1FPQA 3INNA 2I2XB 4MGHA 3TX2A 4BHTA 3HMQA 1Y5LA 1EJ0A 4QUIA 4E6EA 3CT6A 1EXWA 4BNVA 4RHXA 3IP7A 2FUCA 2BGWA 2FETA 5EJ5A 5BQOA 2CYBA 3EFOB 3GCDA 5ALEA 4DQLA 3BF8A 4IWNA 1SBHA 1YB4A 4AX8A 4E5NA 2G5PA 2E9SA 1IM2A 1CJSA 2OZEA 2W5UA 3G79A 3NIGB 4BV8A 2VQFB 3PGA1 1XPRA 4JI8B 1RZ3A 1S6YA 4NCAA 4WESA 2XOXA 5HUJA 1LD3A 5IHPA 3KDAA 3DKRA 1QK5A 3Q9LA 2R3SA 1JSLA 4IS2A 1H93A 2BGIA 3UGTA 3HI6A 1AGXA 2G5CA 1Z7WA 3GEDA 4FYPA 4I6GA 4J4HA 4NQZA 3FUVA 5DM1A 4V0RA 1HFEL 2D5IA 2OK8A 3O03A 4W1RA 5G1PA 1GCIA 4HQKA 2L82A 3H1AA 2GARA 1J07A 2GZ3A 1XJ0A 1JQEA 3LIIA 2XUIA 2EKPA 4GSKA 4QNRA 4NS4A 3AVXA 4O4HA 1L4LA 4ZYZA 4TWAA 1T9CA 3QGMA 2WE7A 4M1OA 3TLEA 2TS1A 3UMVA 1ECBA 1XTKA 4LHXA 4LNHA 4I46A 4UHHA 4D9BA 5LPNA 1USGA 3LPAA 3O47A 1BE0A 1XDWA 2QJFA 1RLUA 2QGFA 3D7SA 3M6WA 3CF2A 1PKXA 2ZQZA 2XADA 3NWOA 5LYYA 2QLMA 1CKEA 1Y1PA 2NYRA 1M10A 1B8UA 2J3DA 2TMDA 2Y4NA 1P80A 4MVXA 1JAZA 2VYQA 3S29A 4ENVA 5CFRA 3TCKA 4NOMA 4PBSA 4HNQA 4L02A 1JA0A 4V2IA 9LDBA 1J5EB 2YX1A 3VU8A 1PS9A 1II0A 4C3ZA 2HLPA 3RLIA 2AG6A 5DTMA 3I6QA 1U0OC 4OEHA 2WABA 4I14A 2RSLA 4AULA 3UKOA 3IA2A 4N9QA 3X43A 2SCUB 1Q3KA 2D8AA 4HGYA 2O8EB 1RAFA 5I4KA 3I4FA 1DKPA 3MJCA 4NY1A 4A26A 1DDIA 3SIWA 3U3XA 4OHKA 3PEVA 1UIRA 1NP7A 4YH1A 5E1MA 2DGDA 2V6GA 3G5TA 2ZIFA 3JALA 3O2NA 4P80A 2ZWAA 5IMSA 2OFWA 1T91A 4CUKA 1UBEA 3M9LA 3MJ4A 3N2LA 4TSRA 1LDGA 2XOKD 4I9FA 3K72B 3K8YA 5I7VA 4GC5A 3TD2A 3VC3A 1ZK0A 3K9QO 3TRJA 3QELB 4MQEB 3LHFA 3IQFA 5AM2A 4BLTA 3UV7A 1ESNA 1TYEB 2D62A 3GLUA 5B2EA 5IX8A 2FZWA 1JX6A 2IV7A 3VR0A 3IT1A 3T1VA 4TYPA 1VI2A 3A3NA 3RARA 2QD3A 3W5SA 3WL7A 4C0XA 1Q0LA 3GL9A 4HAXA 4ZHQB 1NN3A 1PFVA 2AC7A 2ZJ7A 2QTAA 3LSTA 3CEHA 2QAIA 3B52X 3UATA 1UBHS 3EFEA 4OJQA 5T4BA 1YOVA 1R4MA 4PLZA 1IXKA 2UZ1B 3C6QA 4GBGA 1NUAA 1P5JA 1V3TA 4LYEA 1I30A 4J0IA 3HKCB 1SXJA 3UMJA 2R44A 2QNBA 4GPAA 1G21E 2BEWA 1QIHA 4JSTA 4WZAA 1TCUA 4HZUB 5EKDA 4HRXA 3BGVA 4G5RA 1KS9A 4GI7A 3DKKA 4MLDA 2VSXA 3PRYA 1HORA 3F8SA 3OO0A 4XX1A 4YP1A 3FE2A 5GY7A 5KSPA 1VP9A 2XWBF 4IJWA 4QXMA 5B3JC 1E99A 4HGOA 2LWIA 2CWDA 1ZMBA 5IJZA 1OQAA 2P5SA 3QVXA 3HKDB 4YDSA 3EBPA 2QU8A 1APBA 3MCAA 1LCIA 3LY7A 4LWOA 4X71A 3S2EA 3WZMA 2PBRA 2CLSA 3EC7A 3O4VA 3MWDB 3OEHA 5BNFA 2HQ1A 2IODA 3LCCA 1L7PA 4BGDA 1C7RA 4H6WA 1ZRNA 2HBRA 1VIMA 1G2PA 2WJWA 4QRIA 4QUEA 3QG1A 2AZTA 1YHNA 2GJAA 3OQ1A 4NOKA 2IYSA 3HXPA 1B0PA 3NEAA 1EX6A 4GXNA 4RLFA 4CRWB 1NP6A 2QR3A 1NA5A 4M0KA 3RASA 4OD0A 5DM4A 4XGKA 1KMCA 1ZWKA 2FG5A 5EWMB 4LXHA 4KXVA 4Q1CA 4HDCA 2OGUA 2Q0QA 4C29A 2IS1A 3TNLA 2NO5A 4GM4A 4HFRA 4MVCA 3U2QA 3UK7A 5CHYA 3LLCA 3SR3A 2I4MA 4KWCA 1BA3A 4HRAA 3U81A 2JDID 5JATA 2YWRA 1P6XA 2CUNA 3LOUA 4BVBA 3QTLA 4H2DA 1RM5A 4QGGA 5LBUA 2HXSA 4FFBA 1CZOA 2MOKA 1NN5A 4FGSA 3FPHA 4G81A 5EGSA 1OTHA 2FX2A 5AVXA 1G5IA 1Z29A 3QU5A 2J3IA 5AP9A 2H3EA 1J2EA 3R3YA 1NVUQ 2ZI6A 3EX7C 2NZVG 2OAGA 3KXPA 4KE7A 4YMSA 1UBRS 1CX9B 3WLQA 5T5QA 2YZKA 3EOAI 4HJRA 2LVBA 4MV3A 5GONB 1EM8A 4HB2A 1I0IA 2WDZA 4NLLA 3D3KA 4Q24A 3REQB 1NDUA 3WB2A 4V0MA 3EZLA 1C0LA 2I55A 3N0VA 3Q3GE 4GOXA 1F0YA 1AMUA 3J7TA 2GPTA 1Y1SA 1CS4C 1VRVA 4ZEXA 2RKBA 4BX8A 4EYGA 3HDYA 1YIOA 3U4IA 1ONOA 5DLQC 2Q50A 5EJIA 2J07A 5FBRB 4AG5A 4BV2A 4WBSA 3PVSA 3H1BA 4W8HA 2P5TB 1G63A 1BVYF 1KVRA 2GK3A 4PSDA 3H0EA 1GKUB 1F7UA 5JWOA 4ZGWA 3VU9A 3P0JA 5BNIA 3W05A 1QZXA 3HY3A 1E1QA 1S2OA 3GK3A 3OQJA 1WCYA 5AK4A 2RD2A 1J24A 1WP9A 3PKZA 1ISJA 1P2SA 2J9ZB 3TTXA 1TAUA 4N0DA 1IZ7A 2ANCA 2NO9A 3GLQA 3H4TA 2XQJA 4HTFB 2A1IA 5E3IA 5T6MA 8ABPA 1Z8NA 3KETA 3K0CA 3J80A 3IOMA 3LNTA 3QOXA 1B15A 2JRCA 4AD8A 5JS7A 1ETUA 1I80A 3OPVA 3G6WA 4E15A 1KMNA 2QTVB 2X4LA 1QBGA 1ZCFA 2P5UA 2VK2A 3W4KA 3NXSA 4G8DA 3WTBA 2C7PA 1SG9A 1KI7A 1MIHA 1P2TA 1IIBA 3WQQA 1NW9B 4NENB 2XGMA 1T9BA 2XB6A 1K8QA 3IR5A 1TVEA 1RADA 4N0QA 2E3JA 3TMKA 4IJVA 4ESOA 5CFLA 2O8FB 1BE6A 1N4DA 3NTLA 1SHUX 5JC8A 3K0SA 4L4XA 3T94A 2XJ9A 1LI7A 3QA3E 1S1CA 4G63A 5U4XA 2WNIA 4ZARA 3P96A 3DZKA 4V38A 3HFGA 3BMQA 1GL3A 2QRNA 3I4LA 3SMVA 3WRYC 5C1PA 4XCXA 4DMHA 1FCJA 1LS1A 2R7LA 1OH8A 4UZFA 1TPZA 1KVQA 5LXTF 3CR7A 3SF8A 4EKGA 2VJAA 4KXWA 3FVWA 5DFAA 4JXZA 2IW3A 3L18A 4M9XA 3PXBA 4EG0A 3FNQA 4GOOD 3EGEA 1HR0B 2EYUA 4ZAVA 4WESB 4OJNA 1E0AA 4C01A 3G88A 2CB0A 4LMAA 5IK2A 5L40A 2JHCA 3DGFC 1TKRA 3T1HB 1T1JA 2PMDA 1TI7A 2BISA 2FF5A 2GTPA 3DAYA 2VPXA 3LYAA 4KB5A 4U39A 5CFQA 5J58A 4R54A 5JTTA 2V9CA 3BWXA 3ROMA 4B43A 3NHYA 2VUIB 5FULA 2I66A 4BQQA 4P93A 4E7OA 3VNQA 4UNIA 1PLLA 1CJBA 1RJ9A 1HURA 3VISA 2G76A 1RZRD 5FB3A 4IHQA 3WGIA 1IUKA 2VEDA 5BSTA 2R0QC 2JGMA 4G5QA 1BDHA 3GBPA 4MI1A 3T7KA 3HLYA 1NDHA 1RFGE 2PX6A 3NO4A 2HSGA 4I99A 3E70C 3H0CA 1F0NA 2WKRA 5ARDA 2JLZA 1XJCA 2VLIA 3HXLA 4GR5A 4EPXA 4NZYA 3PR1A 4FINA 4QEZA 2GNOA 3EIUA 4OREX 4U5QA 5IC4A 1XMPA 1QU2A 1Q3HA 4TRJA 4JB8A 3IKVA 2IIPA 3NFYA 4HDKB 4OQYA 5JSYA 2NZXA 5JUWA 1QOZA 2YV3A 3SKXA 1STOA 5DI3A 3SPXA 3MBKA 1VMEA 5A9RA 4XXHA 4GOJA 2ENWA 2NO7A 4D80A 1NJ1A 4Z9AA 1JTEA 2GR9A 3FN4A 4IDQA 3PFGA 4HO1X 2KM1A 3L6OO 4LBWA 3L46A 1GKKA 1IB0A 4MYDA 4P8RA 4CV0A 1VMIA 1S9HA 2VJOA 3H5IA 3PYMA 3ROZA 3DBLB 2Q5QA 2IF2A 3C5EA 1AM4D 4ZVVA 3IV9A 3DVQX 5HX7A 1CF4A 3T5CA 2RGNA 4JB0A 4IFBA 3ZC3A 1W4BA 1A97A 2O8NA 3B6IA 3B60A 3WGZA 3UWOA 3SU8A 3ZCVA 1NWHA 4MA0A 4DARA 4JJIA 2ONKA 5EUBA 4N48A 3E5MA 3KHTA 2VHZ