5HFNA

Crystal structure of a loop truncation variant of thermotoga maritima acetyl esterase tm0077 (apo structure) at 2.75 angstrom resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
280
Chain Sequence
AFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGRGFPHDWLFWPSMGYICFVMDTYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Hydrolase
molecule keywords Cephalosporin-C deacetylase
total genus 98
structure length 280
sequence length 296
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hfnA00
1XZGA 3FSGA 3IB3A 4IO0A 4DLNA 1EDBA 5ALLA 4K5QA 5EHNA 1CUCA 4LIPD 2BCEA 3C6BA 1HKHA 5DYWA 1ZI9A 1EXWA 5DTJA 1WOMA 2OCGA 2FJPA 2JGKA 2H7XA 2Y2UA 4P92A 4F60A 1J1IA 2E3JA 2GZRA 1XZCA 4A16A 4AZ3A 5ALKA 4Y2TA 3D3NA 5CT4A 4UBJA 2C5FA 3QM1A 1RP1A 3R3ZA 5A2GA 4ARAA 3KOOA 5AOAA 4BVKA 1E89A 4XVCA 3SC2A 3FOBA 1CUSA 4EY8A 3PF9A 1XZAA 1F8UA 2WFLA 3C6ZA 3ZV7A 5A62A 3ILSA 4XIIA 1AURA 4Q1VA 1ZIYA 3OOSA 3VISA 2PPLA 5JIBA 3S8YA 3A2MA 5D3ZA 3WK9A 4UHEA 3G0GA 2XUQA 4QA9A 2XMSA 4CG2A 5IKXA 3BIWA 5A71A 1VKHA 4KE8A 4Q82A 4GBGA 2WHQA 4JUIA 5AKHA 1K4YA 4BDTA 5K3FB 5T4FA 4G4IA 5K3DA 3G9UA 5ALHA 1EDEA 4E14A 3FVRA 4ZGBA 3AFIA 3O4IA 5FUMA 1E3QA 2O2IA 3TRDA 1CUXA 1R50A 4AO6A 1LGYA 2HU7A 5AKGA 5AKZA 3WIOA 5EI5A 1IMJA 2J4FA 2QXUA 1R88A 2XMRA 5LZ9A 3HC7A 3GROA 2YYSA 1CUGA 1EH5A 5HZGA 3RK4A 4J0JA 4EZIA 1EHYA 5ALJA 4GEGA 3ICWA 3ZWQA 3H18A 4IH9A 3IUMA 2V97A 3UMJA 3G02A 4LXGA 2C4HA 4WFKA 4X6YA 4OB8A 5ALEA 1EI9A 1QFMA 3C45A 3DKKA 2DQZA 2XQGA 3WWOA 2XUAA 3G9XA 3QBJA 4X71A 4AN0A 5JD6A 4BDSA 5ALRA 1NX9A 5ALGA 3BXPA 3GUUA 3V9AA 4C87A 7YASA 4J0KA 1EINA 4J0DA 5AH0A 5E4TA 4B0PA 5F4ZA 1W52X 1X70A 1UKAA 5AM4A 1Y7IA 4LHEA 5E2IA 2PBLA 5ALTA 1QIKA 1S8OA 4QDTA 1XZHA 1K6EA 3STYA 3WKDA 1CUWA 1SOMA 3D59A 2WFLB 4L0CA 4CI9A 4AQDA 1DX4A 2HHAA 3UUEA 3G9ZA 3C70A 4PSUA 5LIPA 3WZLA 2JIDA 1TKRA 1WB6A 4Q3KA 2QS9A 1CUDA 2LIPA 2WUEA 4M0EA 5FPPA 4Y2JA 5A7FA 4GHWA 4EY6A 4Q3LA 3FLEA 3WI7A 4BB0A 1YB7A 1MNAA 2RIPA 3E3AA 4J0IA 1GPLA 1T2NA 3WK5A 3ZLTA 1IUOA 2GYWA 4BAGA 3H2IA 2CB9A 3BDIA 2WIDA 3A70A 2XMQA 5JADA 3NGMA 4DYHA 5JAUA 4BATA 1QLWA 4HTAA 1A88A 3MUNA 5EIEA 1PV1A 3BF7A 3EF3A 5SYMA 4B84A 4MQLA 3H1BA 2WUFA 4ARBA 4BE9A 4BZZA 2XE4A 5IVIA 2G63A 3AZPA 3H04A 3C6YA 5HCUA 5AK5A 2WJ6A 4X85A 4BC0A 1F6WA 1DU4A 2VA9A 3FAKA 2WFMA 2I03A 1XRPA 2H1IA 1J07A 2WTMA 1XZBA 4LXIA 2BKLA 5CT6A 1WB4A 3QMWA 3O4HA 2AJCA 2QUBA 2WILA 1RYYA 3DYIA 3AINA 1TK3A 2XI4A 4WDRA 4KAAA 5LZ7A 4OYYA 3RM3A 3I2HA 1ACLA 1K63A 1QIEA 2BGNA 1P0IA 2R8BA 5AKYA 4HVTA 1QJ4A 1F0PA 4V2IA 4F5ZA 4BBZA 5AOBA 2GYUA 1QGED 3R40A 3O95A 3OURA 1N5RA 4F0JA 4MYSA 3TEJA 4KYVA 1A7UA 5CBKA 4X94A 1WCYA 1WB5A 3AILA 2C5GA 3BJMA 5D7BA 2WHPB 3EQ9A 4DNOA 4FNMA 4QDUA 4L9AA 1ZJ5A 4LYDA 2PX6A 3PUIA 1XQXA 3CXUA 1XLUA 3ANSA 5FKJA 1AMNA 4A5SA 5AHXA 4WY8A 4AB1A 3FYTA 3R3YA 5ALYA 4QEKA 4G9GA 2RHWA 5JATA 1A8SA 3SK0A 4ZV9A 3WWCA 1EK2A 1B41A 3BDVA 1IUPA 3QH4A 1UK6A 1FFDA 1ZD4A 3C43A 1CLEA 3ZLVA 2VJBA 2WTNA 1U4NA 4ZI5A 3D7RA 2WG1A 2PVSA 1Y37A 4H7EA 2VJCA 1JKMA 4JEIA 1HQDA 1BEEA 4EBBA 5HFAA 2YXPX 2I3DA 1XROA 3LLCA 3WL7A 2O7VA 1N5MA 3W06A 2HM7A 2OPHA 3H1AA 5LLSA 1MU0A 1YASA 3W2TA 4Y2RA 2V9ZA 2G5TA 2WQZA 5HQ3A 4RGYA 2V98A 5I7UA 1L7QA 2XLBA 4KAFA 1ISPA 1CUAA 2R11A 4H77A 1YS1X 2QUAA 1CIJA 2JGFA 4FKBA 3W9BA 5DNVA 3I6YA 5C81A 1ZJ4A 2PM8A 4KJXA 4WY5A 3WL8A 4GW3A 1UK8A 5CT8A 2OCIA 4I3FA 4QZVA 3QMMA 1XZIA 1QIFA 3K6KA 3BJRA 4J7AA 4ETWA 1Y7HA 2W6CX 5EGNA 1H2XA 1ODTC 4B81A 4JYPA 4H18A 4CCWA 3I1YA 2DR0A 2AJBA 3F9CA 1KU6A 5I8PA 1QIGA 2VJAA 4PO3X 2B9VA 1FFCA 4CIBA 2YH2A 4HXFB 5EFZA 5AM1A 3T52A 5CURA 4BCDA 3GBSA 3R0VA 3OPMA 2BUBA 1UOOA 1AC5A 1YSCA 4UUQA 4XJVA 2WU3A 3STTA 4DIUA 5KWIA 2OGZA 3VDXA 3G0IA 2ZJFA 2QZPA 3WIBA 4Q34A 5H3HA 4KE7A 2XUDA 3QYJA 2OCLA 3KXPA 2VTVA 5AI9A 4W1QA 2OXEA 4P93A 1CUUA 3CCBA 4GDMA 2ONCA 4RE6A 4IHAA 2FX5A 1THGA 3VVMA 1ODCA 1LPSA 4FTWA 3H19A 2HFKA 1OCEA 5CW2A 5AKLA 3C8HA 1XFDA 1DT5A 1BROA 2H7CA 4FLFA 2VAXA 5IVHA 5AKEA 4H35A 4UBNA 2AJ8A 2XMZA 4U2DA 1NU8A 1J06A 1CUBA 4MWSA 2DHEA 4UPDA 2VT7A 3HJUA 3WYDA 3PI6A 5EHXA 5K3BA 3R3VA 3ZI7A 2BUCA 4W63A 4YPVA 4XX1A 2HA3A 5CT9A 2XQIA 3KDAA 3LCRA 2PKYX 2PL5A 5LZ5A 5AKXA 1QO9A 3I28A 3WA7A 2P8SA 3B12A 4Y2QA 1GZ7A 4AZ0A 3WA6A 5ALNA 1QIHA 3STXA 4QE3A 5FRDA 1MT3A 2OQVA 4FMPA 1USWA 5BOVA 3AUKA 4B9EA 1G5FA 1XRNA 5HFNA 3DOIA 5AI6A 3SWWA 4QWWA 4UFOA 4OUKX 4B83A 1VZ2A 1YAHA 4B6GA 1CVLA 1Q83A 4H7JA 4Y9SA 5CT5A 2JEZA 4UHDA 4PSCA 4AN1A 1QE3A 4FDMA 1EX9A 4W9RA 4WJLA 1MN6A 2W22A 2V96A 1VLQA 1YR2A 3O9VA 3DS8A 3L1HA 4QWMA 1GT6A 3IIIA 3O0DA 3I6ZA 4ZXFA 1ZIXA 1IZ7A 1GPNA 1P0QA 2QRUA 3EQ7A 2XUKA 2OAGA 4G8CA 5ISMA 1E8DA 4HXGA 4BE4A 1VOTA 3STVA 4HS9A 4FBLA 1JFRA 1YB6A 4NS4A 1H2YA 1AX9A 1CUYA 3I2FA 4X7BA 2J3QA 5AM3A 2WJ3A 1QFSA 2RAUA 5AI0A 2UZ0A 3ESAA 2XUOA 5ALVA 3WJ2A 2VSQA 4N8SA 4BYMA 3QVMA 5LKAA 1BU8A 4GLBA 5HKAA 2OAEA 5AM5A 3BWXA 1MO2A 1MTZA 3ESBA 2JGEA 5CH5A 4O08A 3DCNA 3I2GA 2DQYA 1QO7A 2J3DA 2C7BA 1L7RA 3FYUB 4IH1A 2WIKA 1MJ5A 1U2EA 4GWLA 4HXEB 4B7ZA 4XWGA 3DDUA 4Y2XA 1W76A 2WSLA 4J0GA 1GQRA 4U2FA 5DTIA 3JYHA 4FLMA 5A7GA 1QTIA 2QJWA 2ORYA 1CUJA 1X2BA 4JYMA 3O4GA 4FBMA 4M0MA 2XUGA 2PSDA 4MXDA 3IUNA 5JANA 3M81A 4X97A 3T4UA 1MAHA 2JGMA 4Z49A 2AXEA 3FSGD 4H7IA 1ETHA 2XUPA 4ZRDA 2D0DA 4Y7DA 4N8DA 3H2KA 1HBJA 5BWBA 2WJ4A 3NWOA 2VQ6A 1MX9A 2QT9A 3C8DA 1LPBB 1AQLA 2OCKA 3DLTA 2HL6A 3PFCA 3DNMA 3KWFA 3E1GA 4N8EA 4FFWA 2DCMA 2WIFA 3M82A 5ALDA 1G66A 5DWDA 4EA6A 3AIMA 1DWOA 1WPXA 1CRLA 4C89A 1J2EA 1GGVA 3A2NA 2HRRA 4UBOA 1SCIA 2ZYIA 4EUSA 3WYNA 1P0PA 4Y2UA 1UFOA 4QDOA 1THTA 2B20A 5ALSA 1ZOIA 3WKBA 1UK7A 3VKFA 1GQSA 4DMHA 5JAOA 2OGTA 2XLCA 1E8MA 1UOPA 1SFRA 5JAPA 2BGRA 4BRZA 4DSZA 5CRIA 5FP0A 2HA4A 4NVRA 4QDXA 2ZJ6A 4A23A 5HF5A 2I3ZA 3LIIA 1DINA 1TIBA 5T4HA 1U8EA 2K2QB 1CUVA 1JMKC 2HU5A 1DT3A 3F97A 1LNSA 4K6GA 3FYUC 1EDDA 5K3AA 4CG1A 5KBYA 4MEBA 2ECFA 5CMLA 2WLSA 1BN7A 4N5IX 4B9AA 1TCBA 3AIKA 4P08A 4CFSA 5BWCA 4JNCA 1XRRA 2GZSA 1R9MA 3AJAA 2XQKA 4ROTA 1LBTA 4FLEA 3MGAA 1CQZA 3FNBA 1HL7A 5LP1A 4OU4A 5K3CA 4W1RA 5HK8A 3WWPA 2X76A 4H7HA 5AKIA 3B3QA 1QOZA 3VVLA 1XQYA 3N0TA 5ALPA 1XZLA 2QVBA 4AMZA 5FOQA 1E8NA 3E0XA 2GBCA 4FNGA 4QNNA 5LKRA 1EB8A 4Y2PA 3WK4A 4C01A 3ANTA 3AZOA 1PFQA 4K2AA 4H7FA 3QITA 2ZJ7A 3F96A 1JJFA 1Q0ZA 4EB0A 2DSNA 4OSEA 2JGJA 3RARA 1GPKA 2XMCA 1LBSA 4FFVA 5J3JA 3EQ8A 1LPMA 2CEKA 1YA4A 5C7YA 1KEZA 4GXNA 3C6XA 1ACJA 2I78A 4P9NA 2ES4A 1TCAA 3DKRA 3U0VA 1CEXA 4B80A 2VJDA 4QLOA 1ODSA 3FVTA 5FV4A 1W75A 1BS9A 4KACA 5AI4A 5HF9A 4C4YA 3K2IA 5EHZA 1R1DA 2JF0A 1EVEA 3OTQA 1E66A 4MWTA 2G5PA 4U2CA 2ZSHA 3RKSA 2PSHA 3L1IA 3KSRA 2BAGA 1WPRA 3WLAA 2XMBA 3X3HA 3FWHA 5LYYA 4J0CA 5CH3A 1VXOA 3W9UA 3VJLA 1SCKA 3D2CA 4ZV7A 5C8XA 1XQWA 1XQVA 4J03A 3WK7A 2PU7A 3DEAA 1ZI8A 5AKKA 5BV7A 3WZMA 2AJLI 1HLGA 2HA7A 2J4CA 4X90A 2GYVA 1YAJA 4TGLA 4JH0A 4W1PA 3HRHA 3GA7A 1ZGBA 1AUOA 4KE6A 4BAZA 3QPAA 1DQYA 1AGYA 4AMYA 3ESDA 3DQZA 1RWQA 2OG1A 1UXOA 4AXBA 2WG0A 4DNPA 1ZI6A 4Y2YA 3BF8A 5DYTA 2C0QA 2NW6A 1K8QA 2ZYRA 3F8SA 1UKBA 3IUJA 1XRLA 2HRQA 3A2LA 4UBLA 3K9BA 1JU3A 4INZA 3VJKA 2XDWA 3H0CA 4X95A 4G5XA 3DJYA 1DWQA 1JI3A 3GFFA 2XB6A 3LS2A 3LP5A 4B85A 1YA8A 3HI4A 4I19A 4BC1A 1MX1A 1CQWA 1O6GA 1P0MA 5YASA 3VXKA 1CR6A 3IUQA 4OB7A 2JGLA 4KRYA 4OD0A 3CCCA 1SCQA 3I2IA 3N2ZB 3DYVA 2PUJA 3L1JA 2Y6VA 3F67A 4CCYA 4MEAA 2FUKA 4E46A 4CG3A 5IVDA 1QTRA 2VEOA 4I4CA 4ZREA 5DJ5A 3ICVA 1PJAA 1AZWA 3NUZA 3DD5A 3WJ1A 1C7IA 2WHPA 5K3FA 1GXSA 5AKJA 3G0DA 5IH7A 4DMCA 2WIGA 4KR0A 1JJIA 2Y1KA 4LKOA 4K6KA 2ZYHA 4DNFA 3R3UA 4UHFA 4K6HA 2WUDA 2HA5A 4YK7A 2OGSA 3HEAA 1N1MA 3QMVA 1MPXA 5ALWA 1JMYA 2QJRA 5AIBA 3HACA 2EDCA 2JEYA 3EBLA 1H22A 4UHHA 1XKTA 2ACKA 3A6ZA 3D0KA 3DL7A 2Y2VA 3HZOA 4YASA 2EDAA 2WG2A 5AK3A 3PF8A 4DMKA 2OQIA 1BRTA 3JW8A 3H2JA 3MUOA 1GKLA 5HF8A 4BP8A 3PICA 5AI5A 1NU6A 4PV7A 4KAJA 2XT0A 4PW0A 5ALUA 1UK9A 4RPCA 2QOEA 4UFNA 1O6FA 4C88A 3KWJA 1F0NA 3I2JA 1EK1A 1VA5A 1CUZA 2ZYSA 2GBGA 5EIHA 3I2KA 2QMQA 1A8QA 1JJBA 1QIMA 1QIDA 2XMGA 4WCVA 4RE5A 4ITVA 4N5HX 1Q84A 5T4EA 2G4LA 1W6RA 3YASA 2HA0A 1L7AA 3G8YA 2PSEA 4H7KA 2ZSIA 2WFZA 2AJDA 5AI8A 4WFJA 1C4XA 3WKAA 1TRHA 2ROQA 4FWBA 1I6WA 1YS2X 2YASA 4AO8A 2HA6A 5KREA 2PSJA 1H23A 3G9TA 1X2EA 1BE0A 2C0PA 1VZ3A 2PUHA 5AO9A 2GBFA 1CV2A 4E11A 5HQ3B 2CMFA 2HADA 2BFNA 1QONA 3C5VA 2XUJA 1QIJA 4TVKA 2CJPA 4ZWNA 1JT2A 2CZQA 3FCYA 3R3WA 3WK8A 4G8DA 5DYYA 1M33A 4X6XA 5E4YA 1UKCA 5KWJA 2ZVDA 5FDFA 3DL4A 3KD2A 1FFAA 5A6VA 3BE8A 5AM0A 1DQZA 2WHRA 4M0FA 5DLPA 4NZZA 1HPLA 3V1KA 3AZQA 3C87A 1K5PA 4FOLA 5LZ8A 4J3JA 2IX9A 3E4DA 1N8SA 2XQJA 3V1MA 5FPQA 1TCCA 3F98A 3TJMA 4S0XA 4OB6A 3W05A 4DMFA 2DHDA 2PU5A 4B82A 3H2HA 3WKCA 3FLAA 3PDCA 4BZWA 3R3XA 3PUHA 2EEPA 3AIOA 4Q3OA 3HLKA 4QDZA 4G9EA 1XZFA 3W04A 4YX9A 1XZMA 3TGLA 1VA4A 3FBWA 2HDWA 5ALQA 4BCCA 4UHCA 3CN9A 5ALZA 4IH4A 1W1IA 2X5XA 1QIIA 1Z68A 4MJ3A 2JBWA 3G0BA 1BCSA 3LIPA 5EIAA 1XZDA 4EY7A 5JALA 4DSAA 3STUA 3FCXA 4OPMA 1XZKA 2XMDA 3BIXA 1LZKA 5DNWA 5T4BA 1R3DA 1XRQA 1ORVA 2H7YA 1CUHA 1XKLA 2H9YA 4GI1A 1DWPA 2WM2A 2CUTA 4MYDA 1ZICA 4Q05A 3O4JA 1C7JA 4BVJA 1KU0A 1EVQA 4BTLA 1FJ2A 2DHCA 3D2AA 4J0HA 3FLBA 1VXRA 4OCZA 5JARA 1UWCA 3ZPXA 3Q8WA 1ZD3A 4DTCA 4AO7A 2DFPA 1CFJA 3RLIA 2D5LA 2VAVA 4BVLA 1DX6A 3C5WP 4IQ4A 5JAHA 1EA5A 1LLFA 3EIOA 5JZSA 4CCYB 4EY5A 1LPNA 4G8BA 1WM1A 4UBIA 4X91A 3M3DA 3D2BA 2Q0XA 1WHSA 4DNQA 4Y2VA 2HIHA 3IVMA 2QKYA 2XUIA 4DGQA 5DNUA 1VJ5A 1CUIA 4UFPA 2GBIA 3HSSA 4CIAA 4U2BA 2WKWA 1SC9A 1ZGCA 5JYCA 3S2ZA 4HAIA 3QPDA 2QTBA 2WIJA 4L3WA 3IULA 5HK9A 1UZAA 4RNCA 1DTEA 1QZ3A 4X92A 5LZ4A 3D4LA 1HDEA 5AJHA 5IVKA 3QPCA 5CXXA 5FXMA 5HF6A 3WMRA 2CBGA 4UBKA 3V1LA 5AM2A 5JZ9A 5ALXA 1H2ZA 1E5TA 3NOXA 2HA2A 5JASA 1IVYA 3V1NA 1ZD2P 5K5EA 5ALOA 1XLWA 3H2GA 1EB9A 3U1TA 2FJ0A 5JZBA 2WUGA 3Q0TA 3I6MA 1OILA 1TAHA 4DM7A 5K3EA 2HFJA 1A8UA 5ESRA 4BAUA 1FFEA 3IA2A 1UOQA 4H7DA 1ZD5A 3P2MA 2O2HA 3WKEA 2Z3WA 4LYEA 4G4GA 4KEAA 4HRYA 3JWEA 5AK4A 5CXUA 3FYUA 4BCBA 1YCDA 5AIAA 5D6OA 1U65A 4W1SA 1XRMA 2IITA 4BTVA 2Y6UA 1CUEA 4BP9A 3G0CA 4D9JA 4X00A 1GKKA 4B0OA 4AX4A 4NMWA 4PNZA 5ALIA 5AOCA 2B61A 4KRXA 5A7HA 1OXMA 5HKBA 3H17A 1CPYA 5ALMA 3WWEA 2Z3ZA 1CUFA 4EY4A 1LZLA 1G4HA 1MNQA 1VE7A 5LZ2A 1FFBA 2VATA 5D3KA 5AK6A 3ZLUA 2O2GA 3MVEA 1IUNA 3HYSA 5EHQA 1VE6A 4X93A 4KE9A 2OLEA 2XUHA 3QZUA 4G1FA 2QR5A 1LPPA 4U2EA 5JD4A 4PF1A 2QM0A 1BCRA 6YASA 4BRSA 3GELA 5FLKA 4L72A 5AP9A 1MAAA 1ORWA 2B4KA 3M83A 1B6GA 1T4MA 2Z5GA 5E4JA 4WFIA 5I9IA 5JD5A 2HU8A 3OM8A 3OG9A 1XLVA 2BJHA 2Z8ZA 1H2WA 2O7RA 3WWDA 2CKMA 4Y2SA 3V48A 3CN7A 2XQFA 1AKNA 2BUAA 4QLAA 5C8ZA 3WQHA 2PSFA 4UHBA 4HZGA 3OC0A 3PFBA 4X3CA 3IDAA 2Z8XA 2QXTA 3I1IA 4PQEA 4C4XA 4F21A 4OYLA 4PSDA 4UBMA 1D07A 5C8VA 4WDQA 3ED1A 5AICA 1BN6A 3SX4A 2RHTA 5SYNA 1G42A 4C4ZA 4TPKA 1W4LA 2WU4A 4MQMA 2JGIA 4H0CA 2ACEA 2IIVA 3IBTA 4GECA 4U2GA 3WK6A 4FHZA 3ESCA 1MX5A 3PE6A 4OU5A 1UT6A 5CH8A 1LPOA 3WL5A 3WL6A 3IURA 3VJMA 3D5EA 3O9MA 1LPAB 2RGUA 2X8BA 2VT6A 1FSSA 1XZJA 3B5EA 1WHTA 3BL8A 4X6UA 1IZ8A 1BEZA 3HXKA 4E15A 5CTAA 4LXHA 3G7NA 3GZJA 3DOHA 3UUFA 1TQHA 2C58A 2XUFA 4C6HA 3R41A 1XZEA 2RONA 1Q0RA 4G4JA 4HRXA 3STWA 3HABA 5ALFA 2RI6A 1R4ZA 1JU4A 1R9NA 2VF2A 4EHBA
chains in the Genus database with same CATH superfamily
2VH1A 4L7VA 2XKBA 3M1YA 4FYYA 1YVRA 4FKZA 5CVVA 5GADl 3UKOA 4MP3A 3ESXA 3LVFO 3FSGA 3GLHB 4LZOA 4UTPA 3IB3A 4IO0A 2IK8A 1TM7E 1HE3A 3O74A 5E6SA 4P2GA 5A0VA 3FI0A 1Y7TA 2YXBA 2H00A 3JZAA 1Q74A 4IZOA 5KNDH 5JNTA 4LIPD 1OIWA 1NY5A 1ZH2A 4ZODA 3KQWA 4GMGA 5HPYB 5DYWA 3I1JA 3JPWA 3QXGA 3UKDA 1ZI9A 4AUNA 4ECEA 2C94A 1U9IA 2OCGA 4G84A 3RB8A 8MHTA 4HH3C 4Q37A 2JGKA 1DQNA 2BIFA 1E1DA 1KVSA 4DLLA 4NMHA 4DQ0A 1AK1A 4OVKA 4DRYA 1SUWA 5KJEA 3LECA 3ZWMA 1HZZC 4EJMA 1N6HA 5KHAA 3COSA 1RLMA 2JPDA 1REQA 2FPUA 1DIAA 1J1IA 2GNAA 2CNDA 2GVNA 3JARB 4G1VA 3DL2A 3I61A 3UVEA 4Q9NA 3NHZA 1PS9A 4XYEA 1K8XB 1S0UA 1DAGA 2FG5A 5B58C 4RX1A 4M0LA 5BNFA 1XQ1A 1HORA 2FFHA 2AFIE 3NPAA 1XRSB 4GWKA 3DOCA 1TK2A 4QU5A 5G3ZA 4Y2TA 1G7CA 5LBUA 3ZKWA 5C51B 2OL4A 1H2BA 4R7GA 3AJDA 3RCBA 1Q11A 3AX6A 3CLTD 4KQWA 5CT4A 5E7IA 1IWOA 4R0VA 2B82A 3VI4B 2QK4A 2M6RA 5FBRB 3D3EA 2ZZNA 1AUQA 2O59A 1E6KA 3VHLB 4EO7A 1PK7A 5A2GA 4M8NE 1JF8A 3U6BA 2IEAA 4EYSA 1R0XA 4L8FA 1LVUA 4RJTA 3MUEA 2G71A 1KZ4A 4W9NA 2WMNB 4JKYA 3E03A 4D56A 3RNLA 4IQ0A 1RCUA 3FOBA 4X1KB 4E1BA 2G1PA 4JI2B 3VR5D 3GJQA 2ZP1A 4R40A 4FDUA 5LJLA 1KKMA 2H2AA 2OORC 2MSEB 1F8UA 3CUVA 2GGSA 4YWHA 4BKPA 2FRXA 3D54D 2XDYA 3M70A 1MJGM 3ZV7A 3MF4A 3MT7A 1DJQA 4IMRA 3BRSA 4X7PA 1T10A 5A4AA 2VF5X 3PK0A 1QVVA 3EXG2 4XLTA 3TAUA 1QG0A 1D7AA 3MJCA 3S8YA 2PT5A 3A2MA 1YS9A 3PQ2A 4UHEA 2CD7A 3RYCB 3DFMA 5LBIA 1O5IA 1XYYA 3H3JA 2ZATA 3Q3HA 3P9CA 3OUTA 2XGJA 4DQKA 3W7BA 3Q3EA 3SMVA 1DQPA 1SZJG 3OM9A 3BIWA 4CNQA 1EZ1A 1VKHA 4W82A 5JU6A 4Q82A 1JX6A 5F1YA 4JC5A 4ZJUA 2NU6B 4YJ3B 1DCKA 5TVGA 1AO3A 2X86A 1OAKA 3L5OA 2LP4Y 3IODA 2H52A 1BKYA 3AHCA 4WD3A 3CJTA 2V7PA 5AKHA 5H3CA 3JSXA 4JBWA 3W6UA 1H1DA 1SGWA 3EQ2A 1QQ7A 3G7SA 1ORHA 2H1VA 1JQBA 3QFTA 1BHJA 3GUZA 4ZVKA 4BDTA 1AQJA 3OEEA 5G1PA 4M38A 3I09A 4X54A 3LK6A 3RLFA 3STHA 2ZT8A 4REQB 3E48A 3G9UA 2XW6A 3TN7A 2CVQA 2V74B 3FVRA 3UT0A 1TQ8A 4ZGBA 3ROTA 5HIMA 1N9GA 3O4IA 5EL0A 4DV7B 4WBSA 3AHIA 1A4RA 4BASA 3NM6B 4BNUA 4CMEC 4QPZA 3S1SA 1CUXA 1SVNA 2AD5A 1Z34A 1OTXA 2WE7A 1GRNA 2P7IA 4FGZA 1OH5A 1KWKA 2DUMA 3MWKA 8ABPA 1XPJA 2JHGA 5KX5A 4MYTA 4EO9A 5KDLA 5TV2A 2VJMB 3CRMA 5TR9A 3U9SA 4E3ZA 5DBIA 3ER9A 1NVEA 3DMRA 3OT5A 1NXOA 1NUUA 3HADA 4KQXA 1Z73A 1FU4A 1TM1E 5EI5A 3WL3A 4ZJZA 1EDOA 4DZRA 1IMJA 2J4FA 3U56A 1R88A 1N6KA 3MS7A 3F6RA 4LJRA 5HUHA 2XMRA 1KXJA 3HC7A 2XT9A 5E1OA 1OH8A 1PLJA 4G1CA 2HJWA 3GROA 1MIHA 3LDAA 1DDOA 2R68A 1X0XA 5T3YA 3TTVA 1VBFA 4UEQA 3TUJC 1EH5A 4KLZA 4YT8A 4YQEA 3DBOB 3HVIA 3B7GA 2XYRA 1LBHA 4TMYA 3C1AA 3RK4A 1KAEA 5KS2A 1YE5A 3B13B 3CLTC 2AZMA 3WYGA 4EZIA 3B9RA 3T06B 3X43A 3IUPA 4AJHA 1GEGA 3ADOA 4LNAA 2VNIA 3GC6A 1JR6A 2ZBUA 4FJ1A 4BEVA 3ELDA 3ICWA 4QRHA 5K20A 3P0FA 2UUAB 2BJVA 3H18A 3WBFA 2F62A 1SU4A 2P9BA 3MYRA 3AONB 2MYUA 1T6NA 4HK4A 4RZIA 1OH7A 1E4YA 3G02A 3D7LA 2J3JA 4F2HA 2RHHA 4YJGA 1IEWA 5DB4A 3DHWC 4M83A 4BNXA 4DA9A 5BQOA 5JPDA 5C9ZA 5CB6A 4Z53A 1RKVA 4IDBA 1Z7EA 1EI9A 1QFMA 1UZUA 5DGIA 3DKKA 3PQ5A 1JBKA 3ABSB 1UDXA 3BMQA 3O92A 5JDCC 4EENA 1CETA 3BYZA 4G56A 2WJAA 1ESEA 3G9XA 1BJTA 2AEEA 3KUKA 1I51A 1PBNA 1ZWLA 3MPUA 4KJZA 4RL6A 1KQFA 4BDSA 2HT1A 3MS4A 2NADA 2NU9A 3I83A 5CPFA 4FEGA 4LK3A 5F9FA 1S2DA 2O0JA 5ALGA 4DYDA 1JKJB 5KYYA 1D2AA 1E2IA 3BXPA 1KWGA 1UMKA 2WKPA 2GAAA 4U1RA 4IJVA 4QUGA 3RT1A 4BNWA 3K9GA 4XFDA 2QW1A 3BDAA 3NTVA 3T94A 4C87A 1AM4D 3C5HA 1JEYB 3LV8A 4HNQA 2Z43A 5AW6A 5IT4A 5K3OA 2QD3A 4O2BB 3PNBA 1CCWA 4ECAA 3NG1A 5AM4A 1Y7IA 4KVAA 1SQ5A 4IFIA 3NBKA 1H93A 3INRA 2H06A 1G16A 2ZUBA 4RK4A 3T5DA 2GN0A 2PBLA 2BBSA 2ZSDA 2PLAA 1JILA 2P9QA 4XQCA 4I3HA 3W5VA 1QIKA 1V3QE 3SJCA 4RK7A 1H1LA 1S8OA 5BVHB 4RFSB 5EKUA 4QDTA 2P9FA 3R0IA 4KNVA 4RV5A 4JI0B 2A57A 5DGCA 1GAJA 1RBQA 1TEVA 4JB2A 1SOMA 2Y1GA 4KVGA 3T1OA 3W8DA 4PC6A 3ROEA 2PRJA 3D59A 1UBCA 3EFHA 3KX2A 1NNSA 1XAGA 2BHTA 5SZKB 3RYIB 2P2YA 5E6UB 3ZW7A 1E4VA 1XMOB 1M1YB 1M2EA 2ID9A 1JEAA 2AS0A 2CYAA 5T6MA 1AKWA 5EZQA 2IF2A 3QX9A 4JUCA 1RBZA 2HHAA 3UUEA 1U7UA 3G9ZA 3R9IA 3TFWA 4A6XA 2XRZA 1MO4A 5LIPA 2FSPA 2PL1A 2HYIC 2V1XA 3BB1A 3QLUA 4HRAA 1IG0A 2QRMA 5E2BA 2LCQA 2IU0A 2YKGA 1SCAA 5B30A 1FFSA 4Q0MA 4NAHA 3MQ4A 3F0TA 4OXXA 4BWYA 2FPRA 4HHEA 3FGZA 4JV5B 4FYHA 3MFQA 4NPAA 5AQEA 1U2QA 4EFDA 4YXFA 5F5LA 2IYOA 1HF3A 4HDSB 1FLAA 2CXPA 1YZUA 1UQUA 2H5EA 5FPPA 2BC9A 4S35A 1AF7A 3A9WA 4Y1FA 4BLUA 2YNMD 5A7FA 4HYTA 4KPUA 5HS6A 1GDTA 4Q3LA 1NN0A 1PD1A 3FLEA 1CEEA 2YVKA 1T25A 2O5EA 1MNAA 1ULZA 3ACCA 2G04A 2QRGA 2BEWA 3P9SA 1W5TA 3PDWA 2I9KA 1Y3DE 3E3AA 1W88B 4LX8A 3WK5A 1TM2A 3V1TC 3W78A 3TZLA 3F4LA 2GYWA 1UWVA 3HUTA 3EEOA 2QTCA 1R6UA 3TOZA 3HSKA 1T0PA 3UMFA 4JBNA 5FI1B 4KFTA 1ZO8A 2CB9A 4R69A 4ILKA 2ZBFA 3LVBA 4JLSA 3GARA 4QOSA 1DXHA 2V4UA 3UY4A 3VOSA 3FOZA 1SXQA 2NZ2A 5JAUA 3UTDA 3LT1A 1FXWF 3LX8A 1Y4AE 4AY3A 4BATA 2CUKA 3I6QA 3F5MA 5IJWA 5CBPB 2WWRA 2CJYA 4BX0A 1O5TA 2BV3A 1RU3A 2IHBA 3TTXA 3VPGA 1W35A 2P27A 1IQ0A 3OZRA 4MJLA 2I8AA 3GR6A 5SYMA 1Z2PX 3C15C 2IYWA 2JFVA 3GVPA 3IJ5A 4MQLA 1Q50A 1I4TD 2Y8EA 2ZRBA 3ROKA 3QE9Y 3H1BA 4YJDA 2QRVB 2PX3A 4XOIA 2Y0CA 2HBRA 1EGMB 4BZZA 2XE4A 2RBEA 5IVIA 4XWOA 4CNBA 2G63A 1Q7CA 3N9IA 1UXJA 1F0YA 1FXWA 1JAZA 1SQ0A 2IY7A 3PHCA 1G7RA 4R4JA 4FQ5A 5CAEA 5AW1A 3FDZA 5AK5A 4KDEA 3VSBA 2YZGA 2WJ6A 5GOTA 4PE5B 4NC9A 1Y1TA 2GS9A 4BC0A 1F6WA 1T34A 3FPGA 4V0MA 1COWD 5EXSA 3V7NA 3NYRA 4HWPA 4UCWA 4BX9A 1GGEA 1GQQA 1ZRHA 4DEVA 4CIWA 5FBWB 4QYTA 2FPGA 3MJEA 4HRVA 3EC2A 4EJSA 3MCZA 3N2EA 4JYCA 4LY3A 4PRYA 1XTPA 1L7BA 2QRNA 4G26A 4UZFA 4KR2A 2A0FA 3NB0A 4EY3A 4XVHA 2HF2A 1C4KA 3A4LA 2IZOA 1U7HA 1IY8A 3AUTA 1TEZA 3PC6A 1XEFA 2W4IA 3BK1A 2QUBA 2HREA 2HCFA 2WILA 1EJ2A 3F74A 3DZCA 1RYYA 2GHQA 2Q8NA 3TM4A 1OX6A 2CD9A 1RADA 3AF2A 4DA6A 1AY0A 2V45A 3AFGA 4RIEA 1RQGA 3WAKA 3QEBZ 2EV9A 4OHKA 3ZIDA 3ANLA 4JEMA 1Z2OX 4LEIA 5J2TA 2ZI5A 3BD6A 1U8AA 2Q3HA 3Q0IA 1A4UA 5D5QA 1CJBA 1T2UA 3F49S 4I4TB 3CW9A 5DRTA 4CBVA 3I2HA 4FIDA 4KX3A 4WECA 2I6SA 5AK6A 5K6RA 1HE8B 2XT6A 4FB4A 5DNEA 1QQAA 1BMDA 2YYYA 1P2GA 1P0IA 2J32A 2XAAA 4H3HB 4IYJA 4WK0B 2PPVA 4XTCS 3ZU5A 2C7PA 2DBYA 4H6XA 5AKYA 2CVFA 1EFUA 3UB3A 4RBNA 4TLMB 4EAQA 4OSPA 1F0PA 3KEQA 5C1IA 1C9DB 1QHNA 1VRCA 4K9LA 4Q39A 2I6QA 4F5ZA 4TUYF 3ZIAD 4BZPA 1WIWA 3L4BA 4UAJA 1AQUA 5KYWB 4IJKA 4R0MA 2Y27A 2YJTD 2OHXA 2GYUA 4GICA 4R1LA 3O95A 5E95A 3PE3A 3IOEA 1F60A 4Z9BA 3HCEA 4F0JA 4L4RA 1A9PA 3T3IA 5A6SB 2G36A 2ZCVA 3TO5A 5CBKA 4OHYA 1QANA 4MR9A 6CHYA 3UBTA 1KAQA 5CVJA 3IKVA 2PAAA 1PX2A 5G0WA 4E5YA 4ER0A 5KCZA 2C5GA 4I7EA 4J0FA 4DCCA 5D7BA 3L7YA 2WHPB 4ED9A 4RKFA 5AW9A 1C9JA 1A97A 2XNCA 2GEFA 4DUGD 1OX4A 1L5SA 3Q41A 1HNNA 2AOUA 2OSBA 3RRXA 2ZAYA 3DE6X 3FR8A 4L9AA 4QDUA 4F3KA 2K7ZA 3VDQA 4BBAA 1JHMA 2UYHA 3N2GA 1XQXA 4QOEA 1Q44A 2V6FA 4ZJPA 3PEWA 1TC1A 1PJZA 3D4NA 5CFZA 4BFSA 3VV2A 5AVJA 1E2BA 5CB4B 2VCYA 3CPJB 3CVOA 5EZYF 4JR0A 4LHXA 3ZVMA 4I5EA 5FKJA 1CY1A 4H1TA 2DPXA 2Q2WA 1SHJA 3O0TA 1YQQA 3L0OA 3NW9A 3R5JA 4QDKA 1SVLA 1FJXA 1S6YA 8ATCA 1WPGA 3NBAA 4Q18A 4WY8A 3E9NA 5AHXA 5K01A 2HC9A 4YRFA 3B6ZA 1GKUB 2JEOA 2PH7A 3EXAA 4FYWA 4KQHA 5I9TA 4BEWA 3DE4X 5CDGA 5SY4A 4PPYA 1BX0A 3R3YA 2VUIB 3SOPA 4XDGA 3L0SA 5HKOA 1QU3A 3CUWA 2C5AA 3UK2A 1E0DA 1XTQA 1B41A 4O2RA 4ZGGA 1XMQB 2LCIA 3P4XA 4Q1BA 5B7QA 4U8HA 4PG8A 1BCRB 2FV8A 2GPNA 3ECCA 1CLEA 5I7EA 3ORSA 1EBBA 4MQFB 3WADA 3PXBA 4W7SA 5EJ9A 4DSNA 3LBNA 2Q5EA 2J67A 3IP8A 3KJZA 4LJ5A 3ZH2A 3ZHBA 4BJ6A 1NVGA 3G3EA 4FN4A 4O25A 2HIMA 4ZI5A 1JIKA 2WG1A 4HPWA 2PVSA 5FTNA 5H81A 1VGVA 2VJCA 1GKIA 3JASB 1JKMA 1O9BA 3KUCA 4N7BA 1QGYA 1HQDA 3OT4A 1N7GA 4I5GA 1J8MF 4F8YA 2CV1A 3KKKA 3VC7A 1EUQA 3CMMA 1P2TA 1XROA 5KOYA 4IVPA 5MHTA 3EVEA 2VAPA 1PZEA 4Q1FA 1SBCA 3ZEAA 3D43A 3I73A 4Y6OA 3H1AA 3O3NB 3LC7O 1A4IA 1Z06A 4MV1A 5LLSA 3EZXA 1MU0A 4B1FA 1QHHB 3ET5A 2A1UA 3LNTA 4CMIB 1RLJA 3W2TA 3H4IA 2XKKA 1YVUA 3KAPA 2DULA 3D3WB 1RJ9A 3AUAA 1RABA 4S1WA 4L74A 2V9ZA 4V39A 2O2YA 1NWCA 3L79A 4ZT4A 3AHJA 3ZBUA 1FIUA 2O3SA 2ZFUA 1QCCA 2ZVJA 4RCZA 1ZA2A 3HUDA 3A28A 4HGOA 4R81A 5I4IA 1LBQA 4HBZA 3L8CA 3WGOA 4CF5A 8LDHA 1YOVA 1TAGA 4IJMA 4D41A 3QFRA 1A98A 2XLBA 2ZIUB 3EVFA 1ISPA 3OZBA 1JDZA 1CUAA 1V6CA 1VE5A 1DUVG 2CNOA 4JIGA 3VVCA 1GFWA 1M1NA 2EW2A 5CLJA 1KQOA 1HR0B 4NXNB 1BJRE 1IULA 2Q2NA 4CMAA 4B74A 4JXXA 1E2NA 2YNMA 3KNZA 3K3PA 3T1NA 3OWHA 2I7TA 3DVAB 3AVWA 4G5OA 3TNJA 4O4IB 2TRSB 4EF4A 3C8ZA 2OFFA 3T95A 4J7UA 3K2EA 5FL3A 1XYVA 5JC8A 4CF3A 1CIJA 2EYUA 2JGFA 1RVDA 3CRRA 4S24A 3VZPA 2CXOA 3DTNA 5CVDA 1TGYA 4R05A 5H0IA 3TXAA 1ZJ4A 5A2QA 4YAUA 4WGFA 2I1VB 4B7UA 1QF9A 4LV8B 2IXTA 2W90A 3WB9A 3IX7A 1FPQA 3HN2A 4UCXA 3B52X 3WL8A 4AZWA 1E1LA 3LT4A 2AYXA 2OOSA 4K81B 2XJ9A 3LT5A 1K86A 1ZOOA 2COEA 3OF5A 4M8KA 1FNMA 4JYBA 1GPMA 2Q07A 3SCZA 4I3FA 4DV5B 1D2CA 4QZVA 3E27A 5IJXA 3UAOA 4IV0A 1Y98A 3A36A 3C1UA 4NBKA 3SM3A 2PY6A 1XZIA 1JDBB 1NW8A 1ZVQA 4G25A 2OAQ1 2Q46A 2VNJA 4CYMA 4JIMA 4DUGA 2UU9B 1NUTA 1XN4A 4GZ3A 1XMSA 4AL4A 3DMTC 3UN1A 2BTOA 2XCUA 4PLGA 3FDJA 4DCNA 4NYJQ 3EPPA 4B3TB 1MC1A 4GQBA 5IXYA 4Y9RA 5KYXB 1H2XA 1T9HA 4XLZA 8AT1A 3JS5A 4DR5B 4X65B 2CWWA 4K9QA 4JYPA 4H18A 4QVKA 1ZU5A 2A67A 4FILA 4YCBA 1M0EA 1VFPA 4HTFB 1N8TA 2NO6A 1BYUA 3C3JA 4WW0A 3ENVA 5K05A 3KB1A 3RVPA 3NTUA 3SU8A 2QIOA 3DNPA 2GTHA 2IYXA 4WH0A 2IL1A 5FI0B 5DTEA 1C7RA 4LZLA 4NNPA 5I8PA 5JY1A 4FQ7A 5BN4B 2O50A 2VXOA 2ZWOA 1FMLA 1M34B 3OEYA 2IUEA 2PUBA 1U5BB 1ZL0A 2JZNA 2VYND 1Y5LA 1EQUA 1T5OA 2GHRA 1FQWA 4M6WB 2JAUA 4ZKEA 2DKFA 3RO7A 1JVNA 2R7MA 4CIBA 1NDQA 2YH2A 1QZUA 4S1PA 4Z51A 4ER3A 4N40A 4R2JA 5CURA 3CH6A 4ZHSA 2CYCA 1T0HB 2P6NA 3HO6A 1JVBA 2BUBA 2DHQA 3PD7A 1WDKA 4FYMA 4JHXA 4PVDA 4UUQA 4K9DA 5EA2A 1HM5A 2MWMA 2O2DA 3GVHA 3VDXA 1K6MA 4DMUB 1E3TA 4F9GA 1AHNA 2BFFA 1EGHA 3EDRA 3EXG1 4Y9DA 5CUQA 5ICSA 2BEUA 3ASVA 5IM4F 2EZTA 3TE7A 3AR3A 4RVUA 3WLKX 1C9MA 3W7VA 1NXWA 3PIDA 4R6XA 2D74A 2C5HA 4KE7A 5CJ2A 5KAPA 4CCSA 3G88A 2IBSA 2PGAA 3KLOA 2DWQA 4WLFA 2D3TA 1LF5A 3MWYW 3PD0A 2ZBQA 3QEKA 4MUIA 2M1XA 2YXEA 4B09A 2HWWA 1KSFX 3ESZA 1NLMA 5F3WB 4JXZA 3E9MA 4QBTA 3A9TA 5IARA 4D42A 4GX2A 4D96A 1Q7BA 4YUXA 4QG7A 1XPUA 2MSDB 5JQGA 3SE7A 1GL9B 1MCZA 3EZGA 5JS7A 4QRIA 4W1QA 5FWXB 2BTEA 1P9OA 2WJIA 1EG2A 4UDXX 3DF9A 2PG3A 4Y7CA 5KSZA 1W4BA 5U4XA 2FZGA 3RE1A 4P53A 5CA0F 5K0ZA 3NANA 4IHAA 2FX5A 1CRZA 1THGA 3OECA 4NZMA 4RACA 1OFUA 2CY0A 4NCXA 1ODCA 2GWHA 4YCDA 4DG9A 5JFGA 3DEKA 4YAWA 3OOEA 4Z5XA 3C4VA 5CFLA 5JDIA 2QRPA 2HX1A 2H65A 2VF7A 5L6MB 4OHWA 5B3KA 3QIVA 4MGEA 3PGKA 1M34E 4IJUA 2X9NA 4RKWA 2ZSEA 1V1RA 1DBQA 1ZGJA 1V5GA 1NXSA 2TMYA 5JSYA 2WBLC 1JAXA 4WJZA 4RQAA 1YFZA 2PUCA 4OO3A 4RZUA 4B3GA 2ZRDA 5CDUA 4L07A 4FLFA 3IEKA 4UVIA 3TBHA 4B6OA 5AKEA 3LNCA 4H35A 4JLWA 4C4RA 5ES4B 4EG7A 2REBA 4DUZB 2AJ8A 3PDHA 5C3MA 3N74A 3B85A 3HJBA 4IGKA 4ENQA 1BX1A 1Y4ZA 1QVRA 1A9YA 1U3DA 2NTYC 3EIXA 3QPVA 2POQX 1GRRA 2JIZD 4TM8A 3OU2A 3EPKA 1GL7A 3KTAB 2DHEA 4UPDA 3WYDA 3JX9A 2R2GA 4OXRA 1N1GA 2PUWA 5EHXA 3SYKA 5ADHA 2QRLA 3HFSA 3OKPA 1WNTA 1VPDA 1PEYA 3QG5A 2D1TA 4TKLA 2Q3FA 1G8JA 2BMFA 2FOXA 3FI9A 2XF8A 2IS1A 4CTJA 2PHZA 2HHLA 2XQIA 1G5PA 4LZNA 4B46A 1CRPA 2FMHA 4HADA 1FPMA 4D9EA 1VG1A 1IAVA 2PKYX 2PL5A 3FIUA 1CDOA 3JVDA 5LZ5A 5CDFA 5G0VA 1QC5A 2P35A 2YICA 6GPBA 4ZAZA 2XDAA 3C7KA 4YUWA 1W48A 3GQBB 4HYYA 1VBMA 2OWDA 1C9KA 2R2AA 4PLWA 3PGMA 1ANKA 1R0RE 1GLVA 1KZ1A 1VMAA 2QQFA 2RH9B 2VJQA 3GT3A 4U9HS 5GINE 1G60A 5JPIA 3WA6A 5LQRA 2C4NA 2N3ZA 3STXA 2FN9A 4L50A 4IRXA 1V9SA 3NDJA 4LBZA 4BNDB 4QE3A 3MHPA 1U0NA 4DABA 4GGOA 4FN5A 3INGA 1EXMA 2AMFA 3HSYA 3ZHTA 1P8JA 1WKVA 3T61A 4J75A 5BOVA 4YJ3A 1ZONA 3AUKA 3SLKA 1RJEA 1CU1A 5IF3A 1T9GS 2G5GX 3KVVA 3I3SR 2LKDA 3PYMA 4QFMA 4AJ2A 4GOMD 2NSLA 4PTZA 3QVWA 5KDDA 4A8JB 3HB4X 2PH1A 1LTHR 3EXEA 1L5LA 3AK4A 3WLFA 1T9BA 2ZW9A 2IUTA 3BILA 4PX2A 3JALA 4HEA1 5KTOA 5JY6A 1YAHA 2Q5QA 3PPVA 3H9JA 4BQIA 1BMFD 3H1TA 1PHRA 2J41A 4UUOA 4DJEC 2PKRA 3O4VA 1K75A 2JEZA 3PFIA 5A04A 1R0WA 4IV5A 5HE9A 4BLTA 1IM5A 1I4DD 3U44B 4BO4A 2GJ4A 1OT3A 3AHFA 1T1EA 3DUFA 2PX0A 3F78A 1FSPA 4GRAA 1QE3A 1RWXA 4HN9A 4U0KA 4V0OA 2JFWA 3L4KA 1QV7A 2W22A 1YKFA 4JL5A 1U9ZA 2IUSA 1GGNA 2LIVA 4YAIA 1ULHA 1A7AA 2RHLA 3C98A 1D5CA 3ABOB 1ITZA 1KK1A 1QSGA 1WUHS 2QE7D 1N9GB 1RC8A 1OXBB 1Z5ZA 4YAFA 4ETIA 3S2YA 4V0ME 4YRCA 3THXB 1D9XA 2BMEA 1IZ7A 2O6HA 4PGGA 3ONNA 1P0QA 4ONEA 3EQ7A 4B3DA 3VH4A 1EAMA 1RI2A 2OAGA 2OZLB 3C6MA 3DDSA 4MW2A 1FNDA 3WGQA 3ZCRA 1F2TB 2M1ZA 3IAXA 4EHKA 1MV5A 2K4MA 3UG7A 1C7FA 3RT9A 5A3RA 2DEUA 2PYDA 4PYOA 4FBLA 1CF4A 4R8SA 4NS4A 1M2VB 1S3FA 3UM9A 2YWEA 3VNQA 4B6PA 1O7JA 7AT1A 4X7BA 2J3QA 3T4EA 4AMBA 4JR2A 3R7BA 4YRSA 5IC4A 3T9AA 1DUIA 3K9HA 2QX8A 2CYBA 3I23A 1JA0A 3VRHA 3ESAA 1OGJA 1PT5A 3ILVA 3SICE 3FZQA 1NNI1 5DW3A 3QMPA 5JVDB 1UFKA 2QPAA 3VYTB 4TMXA 4IJWA 4RZXA 3INNA 2XUOA 4AP9A 2ADMA 1H1TA 1PNTA 5D86A 3TQSA 3P5SA 1BTOA 2VSQA 1LUAA 5LKAA 3K6RA 1OGYA 3BZWA 2ZI7A 4CQJA 1FOEB 4YV0A 5ELLA 4GLBA 2W8BB 3RVKA 2KBEA 3O73A 3TLBA 3TZKA 2PUAA 3MRXA 2OE2A 3BWXA 2RGNC 1V4NA 3EASA 1N2CB 3GT0A 4WZAB 5B2ZA 1KJ8A 2OB1A 3QVKA 2JD2A 1NHGA 1YVEI 4XDYA 1YRBA 2YYZA 3WNQA 3DFZA 2V65A 3EC7A 1YZNA 7MDHA 4R98A 3LRPA 4MULA 2DQYA 4WUTA 1T6YA 1T13A 1QO7A 2NO7A 4RKEA 4BB5A 2C7BA 1L7RA 2RAVA 3URKA 4B33A 4M1QA 4GOKA 1A7KA 1J97A 2YZNA 4TWBA 3K16A 5FWNA 2Z2YA 3SZRA 3BC1A 1I2MA 1XDZA 1IN8A 1PU2A 1OH6A 5IF9A 4NZNA 3AYXB 3P0RA 1GQRA 4R1PA 3WP0A 1X1BA 5DTIA 4EKDA 3WIEA 1E3JA 2NU7A 4E3WA 5BSWA 4MGKR 4AKSA 2YWCA 3PC8C 4K7JA 4Q9IA 4B32A 3VOTA 3HE3A 4DHWA 3HH8A 1L5WA 1PDWA 4D4IA 3VR4D 3I8XA 3Q5DA 5JG7A 1LD3A 1NI4B 1SCBA 1F14A 3FRHA 3G2NA 4NCIA 3VMFA 3B1FA 3KLNA 1YD7A 2XTJA 3RC8A 4LHZA 4UMVA 2ZI6A 4ZVTA 3HXOA 3NC1C 2QROA 1QUEA 1GSOA 4F9EA 2PSDA 4I55B 4CEHB 4IAOA 2NLOA 3MTIA 1FUIA 4IHQA 4JN6B 5HCNA 4DYVA 1VPLA 2BFEB 5IAGA 4HVCA 2A9QA 3F1KA 3OHPA 1EFLA 1IM2A 4AJ4A 1U3CA 2WA1A 2H0RA 3FTQA 3NFYA 3JVEA 3P9XA 4OI4A 2HCJB 1G3UA 2BT4A 4YP9A 1IBCA 4QU0A 5TT0A 5A1JA 4MWOA 4X97A 2XEXA 3IVAA 2YIJA 3T4UA 3G5LA 1MAHA 1R3UA 3E82A 4XYLA 3F6CA 2AXEA 2PWAA 5BYBA 4ZGWA 4TYWA 2VPZA 3FSGD 1QB7A 4JX8A 1U0EA 4JNKA 5JVDA 4JLBA 4ESOA 1M73E 1ETHA 2OUIA 1X3SA 4JP8A 3X1DA 1M1NB 4Q47A 2X15A 4Y1RA 2I2AA 2K6GA 3GIDA 3MUFA 3OX2A 3HYCA 4YUVA 5L7WA 4TN5A 2Z3VA 3O1LA 4IOLA 1FX0B 1SEVA 4O2BA 1PVDA 2VRCA 1P6QA 1KMIY 1VSTA 2WJ4A 3GUCA 5CDSA 2VQ6A 3RI3A 3RANA 2PN1A 3RIYA 4URVR 1F17A 2UZIR 3DHVA 5JW6A 2P0YA 4LA4A 4P1ZA 2VK1A 3KEMA 2C4KA 4PVCA 1B15A 1V35A 4V0QA 4UQLA 3CZPA 4BE7B 1AQLA 2ZYWX 4FYPA 1CERA 2CMDA 3CZMA 1UWLA 2DCUA 2HL6A 4Q4JB 3RC1A 4QFCA 3DNMA 2GCPA 4R9RA 1ZKMA 4KIUA 3A32A 4RY8A 1LDBA 3NEJA 5H7XA 4ARCA 1J5PA 1Z26A 4RJKA 4AWXA 1PTJC 3I42A 3RHZA 1BGVA 1AXRA 2A0UA 2GEBA 4GBMA 3RSGA 5LD2B 2DCMA 4G5HA 1W5EA 1E4EB 1Y4SA 2X9QA 3C5EA 3M82A 5FBZA 4WXYB 5CR9A 3OLXA 3VC3A 1LI7A 4EG8A 4JI1B 5ALDA 4EF6A 4LJSA 4C20A 1T4DA 2X8AA 5AMXA 2OP1A 2P91A 1NPDA 4HWTA 5L3RA 4AJIA 4BYGA 3AIMA 1DWOA 1JH8A 2JB9A 1J2EA 3IE1A 2VNAA 3AEQB 2XADA 1T1IA 2BMJA 3EARA 4MQUA 3OM1A 3OPYB 4Q9DA 4WL0A 1W9MA 4BTEA 2HRRA 2Z2JA 5DT2A 2XHZA 1F5SA 1Q14A 3GJ0A 4EUSA 2GTIA 4NBRA 3VA7A 1M76A 3WYNA 1P0PA 3CT4A 2NSYA 3T5PA 4Y2UA 3RV3A 1U7XA 2IOQA 3ZYCA 3ZXSA 1ID8A 3BZBA 3HB0A 3V8PA 1THTA 1Z08A 2AE1A 3QXJA 2O07A 2FN7A 1ZINA 4JJIA 3WKBA 1UK7A 1R6VA 1N0IA 2BI7A 2FE4A 5DCWA 1GQSA 1UL1X 1TQ4A 1NSYA 1L3BA 4MARA 1WCXA 3VKFA 4CW7A 1Z7BA 4DMHA 3A7EA 4HB0A 2QP4A 3HDHA 2X1LA 3BSWA 5LYJA 2XTMA 3GFQA 2HWKA 3K0HA 4V0SA 3N70A 1IFXA 3JWPA 1JEOA 4IMJB 3VJRA 4DDHA 1Z8FA 5JH7A 1PWYE 1S8FA 4JLKA 2R6GA 4NATA 3GJZA 2IWHA 1M6EX 3L6UA 5HOEA 3D5TA 4PX9A 2B1JA 3LY8A 5CHYA 5CRIA 2OT3B 5FP0A 1G59A 2FN4A 1W1WA 2JLZA 1ZM3A 5JCJA 3HJAA 1AHPA 1ZN7A 4MV4A 3M34A 4A23A 2DFLA 2YCBA 3DZGA 3G68A 2GKGA 1XTIA 2QZSA 1TIBA 2WJYA 3IYLW 1BMQA 1T8YA 1RC1A 4LZJA 1H0RA 4TMKA 4QXQA 3MLEA 2C2OA 4O8CA 1EU1A 4K6GA 4JQCA 5J4VA 3AR9A 2YJ6A 5E3HA 2OILA 2ZIXA 4YEDA 3ZD7A 1FL9A 3OCYA 1ORDA 5DWQA 4CG1A 4MEBA 3RJMA 5HVNA 2L69A 4F3YA 5CYOA 2J3EA 4N3NA 3P5BA 1YS6A 3JSAA 1AZTA 4QUHA 3NZEA 1WG8A 2OFWA 1Z0ZA 3CIOA 3EVZA 1I0IA 4NZ9A 3PL5A 3H75A 5FORA 2JI7A 4GX0A 3WAGA 1P6UA 4P32A 4YCAA 4JMPA 1J9ZA 1RQRA 2X58A 4JBIA 5KNDD 4P08A 1ZEMA 2FSFA 3TAHA 1P1HA 2E6UX 4D4JA 5BWCA 2PBFA 1XP5A 2QRJA 2Q8QA 4D45A 2NXCA 3K5IA 4C29A 1AMUA 3CQ9A 3AJAA 4MWBA 4V02A 1CQXA 3ER8A 1ZW6A 4DIKA 3MGAA 3FPBA 2VK2A 4LW8A 4MIEA 1I2DA 1XJWA 5ADUS 5KKCA 4I2VA 5EP2A 1FTQA 1QX3A 3NBQA 2ZULA 4JGBA 4RPGA 4DTIA 4B71A 4F12A 4MQ6A 5KQSA 5E0KB 3E6AA 3QLEA 4OU4A 4EK9A 1YI8A 3HU2A 4YFVA 4WESA 3RSHA 5K6TA 4EPXA 3TF5A 3GFBA 2IV7A 1B16A 2BDTA 3NEYA 2QUJA 3RIMA 1YJBA 2FY8A 3N8DA 3G2HA 5B3JC 4FIZA 5KYNA 5IYZA 3GLIE 3BSFA 3PWSA 4JBHA 4RM3A 1Z4PX 2WY2D 4YMWA 5AUQA 3VHXA 3BGVA 3EMVA 3IBFA 5JZMA 2FW9A 4LZZA 1T24A 2AI1A 2PD6A 3EYWA 4GPIB 4B4OA 1WQ4A 1K97A 3MW8A 5ALPA 3ZC3A 1CR2A 3C3DA 5BN3B 4Z8XA 3THYB 4U3JB 2DUNA 2E1PA 1TXGA 3DE3X 1ZSNA 1E8NA 3E0XA 4OGLA 1UIMA 3LL4A 1FRZA 4QL3A 5BN1A 2PE5A 3EA5A 1EEHA 2I4LA 2X8LA 4XFJA 4KOEC 3PPIA 3VTAA 1EB8A 3OFJA 4NFHA 3WISA 1KEVA 1RQNA 3WK4A 2COUA 1E5QA 2C2XA 4PGHA 3WLLA 2ZYUX 1CR1A 4YLYA 5ITVA 4K2AA 5GJWC 4R9NA 2IKSA 1DAIA 4OGGA 5TT1A 3WS7A 1ESMA 1L5GB 5KPJA 1LS1A 2F7SA 3Q85A 2VHYA 1VPVA 3F96A 5JBNA 5JCJD 4Q1DA 4KMSA 3VC1A 1TB4A 2DSNA 1ISMA 4UC0A 4ZVOA 4BNMA 1D2MA 1LF0A 2O8BA 4MWZA 3SHFA 3CF4G 3MJRA 3CRW1 4MMXB 3BXEA 5I8WA 1TU0A 3HPQA 2I80A 3FTPA 1DJMA 2XMCA 2AE2A 5BSUA 3OZFA 1DO2A 3LQRA 2R66A 3BHIA 3LYLA 3P9NA 1JPVA 4K28A 3TL2A 4DV4B 4GR4A 1C1XA 3FFTA 1U8ZA 4QBHA 1EESA 4L2IB 1G5TA 2GK6A 4FP9A 1PNQA 2GKOA 4YJFB 1YDWA 1UT8A 3LJKA 5SZHB 3NIBA 4G1UC 1MQAA 3D3WA 4B7CA 1ACJA 3R3HA 4P9NA 4I36A 2ES4A 3TR0A 2QEQA 3U3KA 2CXQA 3GJ3A 1T8SA 1A5AB 1JHVA 3C7CB 3S27A 4ZIRB 2NU9B 4HLCA 4FFLA 3SQXA 2OBFA 4FPXA 2PANA 1JN0A 1IHUA 2JGRA 1OB2A 1NOJA 1ODSA 1U28C 4J8PA 2X4DA 2P8JA 1UAAA 1W75A 2QNIA 3N07A 2JH9A 5BSMA 3WDSA 4H1HA 4RVDA 1H0HA 2PGNA 2D1QA 4Q1EA 3K9WA 1OLXA 1P1CA 2J08A 3AG6A 3BRCA 3JQGA 3K2IA 4HAYA 4BNJA 5K8CA 1SXJB 3MD9A 3AP1A 4MKZA 4YP5A 5HWSA 4EI9A 4RTJA 3M89A 5JC1A 3E9RA 1P5HA 4L6CA 5NULA 1N6NA 2FPSA 4KSYA 3VNSA 2ZK7A 3D4OA 2FXVA 4I50F 4MWTA 4U2CA 4BLQA 3Q6NA 4MV5A 1T4CB 2IEBA 3LUBA 5FUBA 3U3XA 2PSHA 3SDSA 2BFCA 1NM5C 1R9GA 2GPYA 1LI5A 1G64A 1XC7A 3ADBA 1DELA 1DZ3A 1L5MA 3WGMA 4JCCA 3ZE2B 2XMBA 1NKVA 3HBLA 3IR5A 4H6PA 3RUPA 1CNMA 4JSTA 4DRZA 4X1IA 1V41E 2P5UA 1J49A 3LBYA 3OZIA 3B1VA 1E5VA 1RNLA 2WF9A 5F3RA 3H9CA 1NQOA 4X45A 3ZWOA 2NV0A 3VU8A 1PV2A 4G1BA 3EF1A 5CTJA 3N05A 1M1YA 1XQWA 1EP2B 1JIJA 1XQVA 3I9V1 2PU7A 4JEHA 1KC1A 4PLVA 1NF2A 4TYMA 1IJBA 5CP8A 3BM5A 1W73A 3QGMA 1TM4E 5BV7A 1UBNA 2C4VA 2IUYA 3AU8A 4J76A 4Q3DA 2IZ5A 3OFKA 4LGVA 3SG0A 1NRJB 2N1MA 4PCVA 3TB6A 2J5XA 3PNKA 2AUNA 1QH8A 4JH0A 4NV0A 3T7TA 1G8SA 1D1TA 3DSRA 4BP3A 4ZVSA 3DPIA 4KQFA 3C8UA 1JDPA 1PI3A 4BMZA 1T0JB 4WACA 4F3CA 1MH1A 2YQZA 3R77A 1KJWA 1AUOA 5I9LA 3B2EA 4U7GA 5T6BA 1PEAA 4KE6A 4BAZA 2BZGA 4ES6A 1E69A 5BMVB 4KGXA 1E2EA 4MW0A 1COWA 2EQAA 1EZ4A 2VJNA 4EJFA 3AVTA 3FTNA 4AYTA 1CYEA 1OW3B 1W4CA 3DQZA 3WIDA 4IF6A 2B94A 3BGOS 3RIEA 1Y5RA 3LQYA 5B36A 2CJWB 2OG1A 4AZ3A 3PPWA 4F97A 5C4MA 4YJGB 4B3BA 1QNLA 1V5FA 4D1YA 2HHHB 1OV4A 4BKQA 1Z0IA 4RV9A 3W90A 1W0JA 1QTNA 4P86A 4TT3A 3IFSA 2H2FA 1ZI6A 1UIRA 3BF8A 4TL6A 4Y2YA 2UAGA 3I6BA 4WCFA 5CNJA 3L6EA 3Q7PA 5H80A 5KYGA 1QYDA 1TMOA 4D98A 1M8FA 1KH3A 4WEOA 4H59A 2PMKA 4U8GA 4FGLA 5F78A 1KDZA 4FZJA 1VC2A 2LW7A 4FEYA 3RU9A 2XBLA 3KEGA 1N5DA 2QVXX 2CXTA 2QSUA 3A2LA 3IP3A 4FR2A 4MP6A 1Z07A 1CEYA 1PR5A 2CXXA 1L2TA 4KIFA 1V16A 4DLVA 1JWAB 3ZLBA 3KTFA 4IZIA 2GM5A 1AA6A 3VJKA 3TLMA 4GDFA 3GK3A 3H0CA 1Z29A 3DJYA 1DWQA 3C3CA 1H8HA 2CUNA 4HLUC 3RKRA 1Z5UA 4XUDA 2WVAA 2VJMA 3HI4A 4S1TA 5AJYA 1TPZA 1U0GA 1WP4A 1Z2EA 2WHYA 1RYBA 5FTKA 1DARA 3EZ7A 1WJGA 3ISTA 3FDIA 1O6GA 1GG5A 4LTNA 1OBOA 3VXKA 1NBIA 1X1DA 1I8TA 1O6ZA 3AI2A 2E48A 1H3NA 1ZBDA 4BB9A 1NZJA 3LDHA 1CR6A 3AUFA 2GA9A 2J6CA 4OB7A 1KTVA 3HWX1 1OREA 2W83A 1I9CA 1Q19A 3KTAA 3LGSA 3A4IA 1U9IC 5JQGB 1BWRA 4JOQA 1KFBB 3I2IA 1W29A 1UMBB 4CL3A 4V1CA 3F67A 3PNPA 3N76A 1R8JA 4CKCA 2FUKA 3CSUA 5DLQC 3LHKA 4BMOB 4CL0A 3SJBA 3ADKA 4MW5A 3THSA 4CMCA 1AQYA 3ZDZB 1NOIA 2VEOA 2QRQA 5KYUA 3OO1A 3O3MB 2QLNA 1SVKA 1X87A 1K88A 2YN2A 5HUQA 2W6OA 1I7PA 1FVHA 1XMPA 2C2HA 3SF8B 5F33A 4GWGA 4GI2A 1FDTA 4M6WA 3DD5A 1QDLB 3BQ9A 5F5NA 2Q6KA 2JZCA 2MR5A 3NKLA 4LI3X 2HRCA 1DKLA 4C6SA 4CLXA 1EWQA 2WHPA 1ZPDA 4YDRA 4DKJA 5K3FA 1Q0QA 2EKZA 2ZRJA 4QYMA 5AKJA 4F7WA 5IH7A 5M04A 3AFNA 1SBNE 3GMTA 2YHBA 4KQ9A 1JG2A 5L3SB 2Y1KA 3K5PA 1IY2A 2IZ0A 4JY7A 3G1TA 1VYTA 1ZP6A 1F12A 2ZYHA 3A1WA 3M4XA 3PE4A 4K3UA 1YMUA 4PLPA 3R3UA 1GLNA 4MMYB 2KMLA 4JBGA 4JLNA 4UE3S 3BEOA 2WJPA 3HEAA 4J7CA 1F48A 1MPXA 2IEZA 2PS1A 3SYRA 3HACA 3I0MA 1YB5A 4L8WB 1WD7A 4KO1S 1T6BY 2B2CA 2JAWA 3R7DA 1SBHA 2F3PA 3EBLA 4KXLA 1UBOS 1H22A 3MHTA 2BM9A 1MEJA 3AI7A 2X7JA 4FFMA 2CMKA 1YC5A 4MV6A 3ZKAA 3NAGA 4R8KA 1Z83A 1W6UA 1HQKA 4BO7A 2QT0A 5IKMA 2ACKA 1P3DA 4R41A 1QHIA 2AWOA 2Y2VA 5JLAA 4EGCB 2Q4BA 1PJ8A 3O8NA 1S01A 2B78A 1ZVJA 4PGAA 3HZZA 4YASA 1OR8A 4QOHA 2E37A 2EDAA 2WG2A 2QY6A 5CX1A 5AJZA 3LTNC 1FTYA 1NJSA 2P3OA 4LF9B 4BJ5A 5HZKA 3HY6A 4ZCQA 1G20B 4M1TA 3WOHA 3PF8A 1OFIA 3TW0A 1BRTA 3JW8A 4EG0A 1SWWA 5J59A 3MUOA 5KJ6A 4PFKA 1L5YA 2FGKA 3MOIA 2XE7A 5HF8A 2RCYA 5AW8A 5A4DA 2OD7A 4RPJA 3VV3A 1AIPA 4UPEA 3M6AA 3Q7SA 3OFNA 2NPOA 3T1TA 3AY7A 3HUUA 2XT0A 5LXTA 3BWDD 3H83A 1RJGA 3D6MA 3GAZA 4KLNA 3TAXA 3VOBA 5ICEA 4HAVA 4C78A 1I3MA 2QOEA 3N2YA 3MBIA 3B1WA 1JEDA 1X1TA 1TUBA 1GPAA 1AA9A 4B7XA 4C22A 3Q6IA 4PYLA 1EK1A 5DDIP 2VK4A 2X0FA 4YREA 3VPSA 2OXIA 4Q4HB 3WV4A 2ZYSA 5J4KA 3TGPA 2GBGA 4CT4B 1WP9A 3AUSA 1OT5A 2OZVA 4EAAA 1Z12A 2WU1A 3LPLA 2ZBEA 5EXDA 3ICQB 1PZHA 3IPXA 4MVJE 4XFKA 3SHTA 4KZPA 3AEKB 3UJCA 3ZN2A 1XK6A 2VF4X 1HQYE 3QEOA 4HWGA 5DCUA 5BW8A 1KRWA 3ZGOA 3ZV4A 1GNTA 6Q21A 1W19A 3SSNA 5JV5A 1Q3TA 4ITVA 2NO4A 4UXHA 1B1CA 2E55A 3AG5A 2VHQA 1I7DA 3FHTA 1KO8A 4QUDA 4Z7JA 3YASA 2NTVA 4OHUA 2CB0A 1L7AA 4YJ3F 2BEVB 4TXHA 4KP7A 4N65A 2WFZA 4INJA 1W5AA 3E7DA 2AOTB 4R71A 2VZEA 2HYDA 1RXYA 1FUEA 1VRVA 1QTQA 2O3TA 1ZZGA 1INLA 1V37A 2J33A 2JFZA 5GP1A 1QFZA 2FG7C 2FP4A 1S5PA 5KNBD 3UKJA 4CTNA 1UJCA 2ROQA 2RK4A 2X77A 3IP7A 2CBZA 1ZVMA 3X1XA 1VLZA 4NU6A 4DADA 5DH9A 3UJ3X 1EWTA 1S1CA 3L8ZA 1NVAA 1VIAA 1FLDA 2ZPAA 3KJQA 3CKYA 2VKTA 1E1QD 2WZQA 3DP7A 4NBNA 5DX0A 2XSZD 1PNOA 3PEVA 2ON6A 4RAOA 5CFQA 4CKZA 2AW5A 1IXZA 3ZCXA 3IGFA 3ZYZA 2OGWA 2FPMA 1G20E 4X7MA 1BE0A 5ILQA 3FF1A 1Y8QA 3PXEA 4UE6A 3N2LA 4YT2A 3AC0A 3ANNA 1GCGA 2XZLA 4NEQA 2Q9UA 1O97C 4OQEA 2HMWA 3ONDA 5E3JA 1N6LA 1LC0A 4YLEA 3ILHA 2CHVA 5FBVB 4GYKA 4E09A 2GLTA 5HYVA 4MS1A 1KIAA 1NVVR 3NP7A 1Y9JA 1RXEA 5EPEA 5BSEA 3ADCA 3GRKA 4E5SA 1NXXA 4JOCA 4LOLA 2V9PA 4N5MA 2PRZA 4PZ0A 5A4MS 3MSXA 1I4EB 3QYFA 1BE1A 3LWNA 2CJPA 5TMEA 4ZWNA 2XCIA 3LKVA 4RHFA 1WUJS 1WW3A 3ISJA 3B78A 5TQJA 3CWZA 4BLOA 1EUDB 1ICIA 3FCYA 3LCUA 4PG5A 5IM5A 4CT5A 4F5EA 3WK8A 1RBYA 5T7BA 1YQWA 2EHJA 3EDMA 1NBMA 5D85A 3BMCA 1LQTA 4LYYA 5E4YA 1CY6A 5H3LA 3ZBQA 3WDMA 2OSVA 1QGUA 1JG4A 3ZE0B 3ZD6A 4Y0NA 2B8TA 2BE9A 3AB3A 1EVLA 2OOKA 2QYOA 5P8WA 2G6BA 4ZA2A 1FFAA 1USIA 5G40A 3BE8A 3D1JA 4Q00A 5HG0A 1I13A 1WXXA 4ZAFA 4G63A 5FL7D 4TV9A 1SR8A 5C34B 3RVDA 1QC5B 3FFXA 3SHQA 1R2QA 2PV7A 4ND6A 2JFOA 1PR3A 2QDKA 1KMHA 3KQSA 3PC2A 4XGQA 4DV1B 1HG0A 2I4IA 4FGKA 1J0BA 2RGYA 4L8LA 2AIRA 2P77A 4G5GA 4HQNA 4G07A 5ECDA 3SJZA 1XMVA 2YWJA 1IXKA 1K5PA 4CDNA 2B2XA 4HJXA 3TMAA 1GNLA 4BHTA 4NMXB 3G82C 1V3TA 4J3JA 4JI6B 4HN2A 2MYNA 4TLAA 5IUKC 2OZKA 3WQBA 1NXTA 1O0CA 3K6JA 2OR3A 2AXPA 1VIDA 5ERYA 2JLUA 2IRWA 3PWTA 2UVPA 4GC9A 4FMBB 4IQ8A 5E4FA 1S7CA 4P5PA 5FPQA 2R6CA 4U7DA 3X1YA 2CVPA 1ZISA 4QEZA 2XNJA 1KFCB 4OB6A 1MAWA 3WBBA 2AKAB 1NM5A 3IALA 4F4HA 2XYQA 4HLQB 3JXEA 4PGFA 3KZCA 2DZDA 4CM6A 2BDUA 3LD9A 4WN9B 3V7UA 1TVEA 3OZVA 4BGIA 3H2HA 1ZNYA 2GN1A 2Q7XA 4II3A 5JMPA 1LU9A 1T91A 1ULAA 4ND4A 4IIEA 4RZQA 4HZUA 1E6EA 4BZWA 3FUWA 1CD5A 1R4NA 4JSRA 3RFVA 3SYNA 3PUHA 3PU6A 4CLHA 1E1YA 1Q91A 3AIOA 4Q3OA 4RJIA 3HLKA 1UQTA 2KLHA 4G9EA 4P4TA 4HNTA 2Q4RA 3B7PA 3WY9A 3TGLA 1XZMA 2XX3A 2ID4A 1VA4A 1CK4A 3CNHA 2O8EB 3GRRA 2PKQP 2Y1XA 3AEXA 3IT1A 1AF4A 1M5TA 2J0VA 4GM4A 4JWKA 4UHCA 2DECA 3FPJA 3GH1A 3NQ41 5ALZA 1Z4IA 521PA 2YC2C 3ZCTA 2CL6X 1J8QA 4PC3A 1SULA 1L4NA 1A69A 2X5XA 3PVCA 4PYKA 5E7JA 4ND5A 1AGPA 5TVKA 1VG8A 5DU2A 2QAGC 1HYQA 3HKCB 3O26A 4M9SA 4UHJA 4DR1B 4BLVA 5F76A 3LIPA 4Q01A 4AT1A 4FOPA 1XZDA 4WKCA 1KYVA 1NMEA 2EJWA 4QYWA 4WNYA 5H83A 2VP5A 4RU1A 1PWEA 4D3DA 4BL5A 1Q1AA 3GUHA 4OHFA 5JBQA 3ITNA 3T1QA 1Y7PA 4XCVA 1P5FA 1UJ5A 2WJHA 1URPA 4OPMA 4X3OA 1WX1A 2XMDA 2YV3A 1JYEA 4OHVA 3CO5A 4QQFA 3UAGA 4MVJF 4CM9D 1R3DA 1L7NA 1QAQA 2EERA 1XRQA 2H1SA 4GX5A 2D1SA 4MRMB 3UT6A 1QQTA 2H7YA 1CDEA 3WRXC 1CUHA 4G6ZA 2C29D 1PNVA 1XKLA 4O02B 3PJFA 2VDNB 1CB7A 1QWOA 2CUTA 4MYDA 1LFAA 3B1ZA 5DO9A 4MUAA 5C18A 1KA9H 1PYGA 4Y3UA 2G7ZA 4CLOB 2H2GA 5ARBA 1Y34E 3FLMA 3EGCA 5F52A 4X24A 2J7PD 3W3AD 5BW5A 4X5OA 1P77A 3D2AA 3DLAA 3E8SA 1U0JA 1ECCA 3MRTA 4RTMA 3WYEA 1UWCA 3GVIA 1U0RA 2QPLA 5DEOA 3ZPXA 3Q8WA 1KJJA 1U8UA 3DFFA 2UVPB 2W6NA 2DFPA 3OBBA 4ZVUA 1UDRA 3BK7A 2IFTA 1X7WA 4Q4AA 1U9JA 1PR9A 4U2KA 3GJTA 5FOTA 1FVFA 4TMVA 1ADGA 2B1GA 1JB9A 3B6EA 3GG9A 3L4EA 3R7FA 3A1DA 1R8YA 1DX6A 1CS0B 3ICCA 2R7LA 3NO4A 1DMSA 3C74A 4LE1A 4KFUA 2W00A 3FWPA 4MW7A 1ILWA 4JXJA 3QK7A 4P3NA 4FD3A 3VVBA 4DPMA 5I47A 1SUFA 2G4VA 1L1EA 2F59A 4G8BA 5DZSA 2R7AA 2G67A 5EIXA 1ODKA 1UKZA 4GQIA 4WASA 3A26A 1WWKA 3MELA 4C2BA 4CMIA 1Q7EA 4GOJA 4HOYA 3AR6A 4C1BA 2WQ6A 2XH8A 1AUVA 2I5PO 2JLVA 4O63O 1DO8A 1PK8A 3LGXA 3KQOA 4X44A 3T0FA 1GGFA 2GPWA 3OZSA 3X1WA 10MHA 4P3PA 4ZDKA 1Z8NA 3BMNA 4ZQEA 1HT3A 4B6QA 1JPUA 3P7MA 1V7CA 1UC8A 4DNQA 3GLFB 4RGVA 1HFJA 4Y2VA 4EG5A 1MORA 2HIHA 4XWAA 1BFUA 3EFOA 4IYRA 5EKTA 1GG9A 1GA1A 2NO1A 4H0NA 1QYIA 4O2AA 5DNUA 1X7YA 2Z4RA 4B7AA 1CUIA 4BS9A 3D6VA 1O2DA 2IV2X 5KQGA 4UFPA 1HDRA 1YACA 2DT8A 2GBIA 2JLWA 4U7HA 4E31A 3ENNA 1SAYA 3M7IA 3KB2A 4NFLA 2WKWA 1QH9A 1OXVA 3FX2A 1SC9A 2H8GA 1U7ZA 3OETA 4P81A 3LCJA 2NU8B 2V6MA 2ONYA 3OLZA 2VP0A 4PICA 5C4GB 4W8HA 5IKEA 3LT2A 2ZB3A 1RJFA 4IFTA 5L4LA 2C3YA 3K0AB 1HDIA 2Z2XA 4B4WA 2GM4A 4Y0VA 1Q1GA 2QVGA 2R8OA 5CA0A 2QTAA 4NECA 1B8UA 4W6QA 3R7WA 2F1OA 4CRWB 4HNAA 1I0LA 1SMKA 2LBPA 4AMUA 3OA0A 3PGJA 2QTHA 4DR7B 3AJ9A 1A5ZA 2WLTA 1WMAA 1RFGE 1YMQA 5DBGA 4ETMA 4K1LA 5AJHA 4M0PA 3TIIA 2VP2A 2ZAOA 3B5JA 1U81A 1XP8A 2QLFA 1YR9A 1Z0DA 5KYVA 1VMIA 5CXXA 2IY8A 5FXMA 3QKSB 5HTKA 2IDJA 3VI3B 4R68A 5JZ9A 3DMNA 5KNCA 2A5JA 1H2ZA 3BS4A 4TTTS 1RWOA 5EESA 4PZCA 2VDRB 1KI4A 3RUDA 4AQ7A 1OFVA 1XHFA 2X6RA 3AQIA 5IEJA 1GUFA 4WINA 4K9SA 4L5IA 4XQEA 5EKSA 3DEFA 4M0CA 4ALMA 4KQGA 4D3ZA 2O2XA 2O8VA 4FYXA 1W44A 3BJIC 1FDOA 1IXYA 4TZ6A 1QCZA 4RMHA 5J40A 4IIHA 4QUAA 5K45A 2EATA 2GXAA 1XLWA 3DM5A 4J6EA 5CD9A 3EHDA 4AKEA 3IAEA 2ASVA 1UODA 4MB2A 3LWDA 1THZA 2IPXA 1VPTA 2NZYA 3N39C 5HIJA 5T5QA 2O5RA 1USKA 1S96A 1MJHA 4XB6B 1ZGZA 3KCNA 1OVMA 3ZLJA 3CNBA 5E7QA 1OILA 5K3EA 4Y6LA 3H8WA 3IL2A 1V3UA 3C6QA 1CVRA 3SX0A 4A0HA 1X7GA 1LK7A 1Y3BE 2PXHA 5ESRA 5FULA 3ZGNA 3OJEA 4JJ4A 4MLPA 4LPKA 4GMFA 1T2FA 2BKUA 5TY0A 5HZHA 3SS8A 4TV8F 3IQHX 1FFEA 2NUAB 3KPJA 3TTYA 4YDSA 3KAQA 2J8ZA 3ZZNA 4XUCA 4GMDA 3Q9UA 4PAWA 4IIJB 2RKBA 4EF5A 1N5KA 1JQ5A 4H7DA 1ZQ1A 1ZD5A 3P2MA 5C7IO 1U63A 3ROPA 1L1RA 2Q1YA 5E9JA 1IN6A 1UPBA 1S9HA 2FEXA 2A5LA 2QJOA 4KEAA 3LOUA 2J7PA 1HRDA 1LSOA 3QELB 3W3AA 4Q3CA 4D0LB 3BKXA 3PG5A 3PNSA 1G5HA 3TQOA 3PEFA 4DREA 2PS9A 1E18A 1YE8A 3R6DA 4JT4A 3ZY2A 1GTVA 2YHIB 5CJPA 3KQPA 1YCDA 2HXGA 5D6OA 5PGMA 4BNFA 4DC9A 3DBHA 3DBRA 3RYFB 5FWAA 1I2BA 3ZWNA 2NZJA 4ZI7A 5CYFA 2SECE 1NASA 2IITA 1A4XA 2Q9BA 2PFKA 1JLHA 2Y6UA 3AB8A 3N6RA 4JWTA 4Q15A 2IYYA 4BPBA 1GN8A 2IKQA 3ZS9A 1TVKA 2Z5VA 3FYDA 5BSVA 3FZNA 4OHCA 1UPXA 4ZRMA 3FRJA 4HC4A 1G38A 2XD4A 2XWQA 1S2IA 4LDRA 5JRZA 2W8BA 1GKKA 3K09A 4B0OA 3LL7A 5MFZA 1RM3A 4FWTA 2DETA 1BWPA 5ECGC 4XTRA 5KYTA 4PNZA 3H13A 5AOCA 4M1EA 2ETVA 4GS5A 1OXMA 1YHZA 5J5VA 4UUPA 3F3YA 4BQOA 1M6WA 2BH2A 1CPYA 3E53A 3OCCA 3WWEA 2KX7A 2Q0SA 4CIVA 2RHRA 3IAAA 4W5RA 4B35A 4ZAGA 5JZVA 3PNOA 1IN7A 3NCHA 1AH2A 5JJCA 1LZLA 3HU3A 1LJ8A 4KBFA 3E84A 2ZRMA 1IVSA 4RGBA 5KWSA 4IQFA 2C2YA 2IH2A 5LZ2A 4AF6A 1RS0A 2GHTA 1FFBA 3DKPA 2YTZA 3OJXA 4HDKA 1II8A 3JZMA 4WV3A 3ZLUA 1RM0A 3COWA 4X1IB 2NG1A 2AA3A 2XV1A 2Z8YA 3OC6A 4JQSA 4MRNA 5IDVA 5TMBA 3ZK9A 3GCGA 1NFQA 1AKRA 3TBKA 1NW7A 3F8WA 4Y2HA 3CFYA 2HIGA 1IM8A 1RP7A 2IYNA 3IV6A 1D6JA 3DL0A 4RA6A 3UJHA 3C24A 5IHXA 1RTKA 4ALLA 4IIUA 4KPFC 5FLYA 2OLEA 2IYVA 4ZCMA 1TQDA 2ZETA 1XDGA 2BE7A 3DLIA 4XD7D 4YRIA 1WRBA 3WB2A 3PDJA 2JIPA 2O0HA 2YQ5A 2VQDA 3BXZA 2F9LA 1CRQA 4K87A 3GW8A 3M49A 1U7WA 3LBAA 5KOHA 1SH7A 2R47A 4PF1A 3DDNA 3MGBA 4GE0A 3WQSB 4AROA 4EB8A 3GELA 2QE7A 2YRFA 1W5SA 2PZ8A 5DCLA 1U2PA 2D00A 4MKXA 3V46A 4BGUA 4HBGA 1UOEA 1WULS 2D7CA 3DWGA 4D8TA 5LL6P 2B4KA 3UBMA 1OFTA 1QYXA 4EHAA 1PBTA 3IRUA 2Q2OA 4MCJA 1JRLA 3T9DA 3KQHA 4NF2A 2C9CA 4OBEA 2RGWA 4I1IA 4OIMA 3DW3X 4L4YA 3RTDA 2DMRA 2VFAA 5C5EA 3DOEA 1NVDA 2GK3A 4CUJA 5KQLA 4QULA 2F8TA 3DBVO 2BJHA 5EVJA 1L4YA 3WWDA 1ENOA 3V9AA 1JQKA 1VJTA 3DKIA 3FPHA 3OMWA 3PC4A 1KERA 4JP2A 4NBLA 4H1VA 4XEUA 5TNXA 4KMOA 4D5GA 4PQFA 2BUAA 2ASEA 2HSGA 1PN3A 4QLAA 1ODJA 3N7TA 2F8LA 1E7YA 1HYHA 4Q4LA 5TF4A 1B0PA 3FPSA 2F8SA 3EMBA 3DFUA 4ARSA 4WSOA 4X3CA 3RVJA 2EGGA 1N36B 1ZJ6A 2Z8XA 3KKEA 3HKEA 1N25A 1TTPB 3GPCA 3FZEA 4AKGA 3ZTTA 4W5OA 4A9AA 1MJGA 1TQ6A 4LMBA 1SCJA 4PQEA 2IZ7A 1XEXB 2IUUA 3VH2A 4PSDA 4CCAA 3HO1A 4B47A 3Q5GA 3E2PA 4KO4S 4RYDA 4WCFB 3GLQA 1XTRA 3EVBA 3PQ8A 1KDTA 4WDQA 4EJ2A 3PGXA 1C3VA 1NRIA 1OBVA 3C1OA 3JD3A 4L78A 2R84A 3SX4A 1PQYA 2YYAA 1FF9A 4OMFG 1MIOB 2I2DA 1D1QA 3JQ6A 2F43B 1QAMA 4YLGA 2B5WA 5IAKA 2WU4A 5HKKD 5KWEA 4MQMA 4CKEA 1E6UA 5K8TA 2GN8A 4GKKB 1OIVA 3NH6A 3IBTA 4GECA 3A1TA 3UXYA 1MR3F 1DX9A 1HMYA 3ESCA 1RXSA 3JQFC 2ZZKA 4FHZA 2P6MA 4P7FA 3PE6A 3VSCA 2AOVA 3DW1X 2IODA 4UM7A 1UT6A 1E1CB 1VM6A 2YWHA