5HFNA

Crystal structure of a loop truncation variant of thermotoga maritima acetyl esterase tm0077 (apo structure) at 2.75 angstrom resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
296
structure length
280
Chain Sequence
b'AFFDLPLEELKKYRPERYEEKDFDEFWEETLAESEKFPLDPVFERMESHLKTVEAYDVTFSGYRGQRIKGWLLVPKLEEEKLPCVVQYIGRGFPHDWLFWPSMGYICFVMDTYYRRVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRAVQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNICPPSTVFAAYNYYAGPKEIRIYPYNNHEGGGSFQAVEQVKFLKKLFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cephalosporin-C deacetylase
publication title An extended loop in CE7 carbohydrate esterase family is dispensable for oligomerization but required for activity and thermostability
pubmed doi rcsb
source organism Thermotoga maritima (strain atcc 43589 / msb8 / dsm 3109 / jcm 10099)
molecule tags Hydrolase
total genus 98
structure length 280
sequence length 296
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.41: Cephalosporin-C deacetylase.
pdb deposition date 2016-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5hfnA00
4UHHA 2HFKA 1G66A 4PNZA 3MGAA 5JASA 1QOZA 4C01A 3I2JA 4H7KA 4WCVA 1LPOA 3EIOA 4RPCA 4DYHA 5FKJA 3VJLA 4DIUA 3GBSA 3AZQA 2AJLI 1SC9A 2O2GA 1ZGCA 3PI6A 3U1TA 1FSSA 2JGMA 3FLAA 5CXUA 3WYNA 3GZJA 4FFVA 1XZIA 5AK6A 4OYLA 2CUTA 1HQDA 2HIHA 5ALQA 4X95A 4E11A 1HL7A 1EDEA 3WI7A 4QLOA 3W05A 1RP1A 2I03A 4J0IA 1Q0ZA 1YA4A 1FFBA 3H0CA 4G8BA 4ZREA 5CH3A 2PPLA 2GBCA 4Y2XA 3DYVA 4DMFA 2PSEA 3B3QA 3KWJA 2QXUA 5DNVA 2B4KA 3SX4A 1FJ2A 3BE8A 3C8HA 1JI3A 5KWJA 1CUEA 3CCCA 2WJ4A 4DMKA 2JGLA 2JF0A 3T4UA 5AOCA 2PSDA 3KWFA 5K3DA 5AHXA 4C6HA 1MTZA 4FNGA 2XMBA 2DHDA 2WKWA 1BU8A 2WU3A 1CEXA 4BP9A 1GGVA 4QEKA 2WLSA 5AKLA 1DX4A 1YAJA 5EHQA 2JBWA 2GZSA 1DWPA 1CQZA 1LPSA 2C0PA 2OGSA 3TJMA 1YA8A 5SYMA 2OCGA 3STYA 1W76A 3C6YA 1R1DA 2VSQA 4L3WA 3K6KA 5ALYA 3VJKA 1EB8A 1XZEA 4X97A 1XLVA 2DR0A 1H2WA 4GLBA 4EY4A 4Y2SA 3LIPA 3ZLUA 3R3XA 2OAEA 4UBKA 1ZICA 3DLTA 2H9YA 3EQ9A 4MEAA 3LIIA 3AUKA 5I8PA 4QDXA 3F97A 4Y2VA 1DQZA 4EZIA 5DYTA 1PJAA 4KAJA 4BC0A 2WHPA 4OB6A 2JIDA 2QJWA 1BROA 2ZYRA 5K3AA 1XZGA 3M81A 3STUA 1R88A 1HLGA 3DD5A 1D07A 3FLBA 4X7BA 1XZBA 1CLEA 1G4HA 2HM7A 4ROTA 1ZJ5A 1LPPA 3PFBA 5CW2A 4X90A 4B0PA 1DU4A 5LP1A 5LIPA 1QTIA 2Z3WA 2WQZA 3HJUA 5AKXA 1ZJ4A 1XZHA 5FLKA 1C7IA 2VJCA 1F6WA 2CB9A 3DEAA 1EK1A 1E8MA 3AIKA 1XZLA 2DQZA 1VA4A 4BVJA 1L7RA 5JAOA 4G4IA 2XMZA 4WY8A 4QA9A 5FRDA 4AO8A 3D2CA 5LKAA 1OILA 1HDEA 3R40A 4K5QA 2VAXA 4U2EA 4E15A 1ACJA 2ZJ6A 4G9GA 5AICA 4DSZA 3FYTA 4ZI5A 4FBLA 5ALVA 2BGNA 3A2MA 3O9VA 2BUBA 3F67A 1BEEA 4H7IA 4BDTA 4HRXA 1QIEA 4AQDA 2I78A 3A6ZA 4NVRA 3I1IA 3X3HA 5DJ5A 2WUGA 4OD0A 2PUJA 5D7BA 4Y7DA 4MWSA 2HA6A 1CUIA 3G9UA 1ACLA 1EVEA 2RIPA 1ZIXA 2XUPA 5ALFA 3C6XA 1K4YA 4EY8A 1GT6A 3OM8A 4U2BA 1TCAA 4FHZA 5CRIA 3DQZA 2K2QB 5DYYA 1O6GA 2O7VA 5AKGA 5ALXA 1CIJA 4UHFA 1XZCA 4QDOA 4A16A 3W2TA 4B80A 5HFNA 2PUHA 3IDAA 1QO7A 1OXMA 1E8NA 4P9NA 3DKKA 5T4EA 3O9MA 3DDUA 1UZAA 1XRQA 1P0IA 2Y6UA 1BCRA 3QBJA 1UKBA 1T2NA 4C89A 5KREA 4OB7A 2X8BA 3HRHA 4AN1A 1ZD4A 4XVCA 4WFJA 3G0BA 6YASA 3QVMA 4LXGA 4B6GA 3G9TA 4AN0A 5EI5A 3FBWA 2YASA 3I28A 4PSDA 5T4HA 3G0GA 4RE6A 1MU0A 2WG0A 5CMLA 5DTJA 5CH8A 3WMRA 1P0QA 1R9NA 2JGJA 3EBLA 3B5EA 3HZOA 4U2FA 1CUVA 4J0HA 3WWOA 3STVA 2Y1KA 2OGTA 3WZLA 2PSFA 5AKYA 2RONA 1CQWA 1W4LA 1W1IA 3U0VA 5AKHA 2WILA 5BV7A 1C4XA 1EI9A 5A62A 4W1RA 3QPAA 4DMHA 1R9MA 2ZSHA 5A7GA 3IIIA 4ARAA 3AINA 3H2HA 4BYMA 3F98A 3BDVA 3G0DA 1DT3A 4QZVA 3ED1A 1EINA 2C0QA 3BIXA 1QIMA 3IB3A 1C7JA 5AKKA 4F5ZA 4CCWA 4U2DA 4UHBA 1QGED 3WK7A 4Q3OA 1F8UA 2C4HA 5JAPA 1GXSA 5AO9A 2D0DA 1GKKA 3WL6A 4H7HA 4KACA 2B20A 2WG1A 4OU5A 4L0CA 1Y7IA 4KJXA 1CV2A 2EDCA 1IUNA 2P8SA 3AIMA 5IVDA 3A70A 5KWIA 2DQYA 3FWHA 1ORVA 1JU4A 4C4ZA 4GBGA 2XUJA 1CUGA 2XQKA 3QPCA 1ZD3A 5AP9A 2GBFA 3DL7A 1OCEA 3C5WP 1TKRA 4HAIA 4KYVA 4IHAA 1CFJA 2WU4A 3LLCA 4G8CA 4QDUA 5AI5A 1U2EA 4BVLA 1KU0A 3DOIA 4M0MA 1CPYA 5AI9A 3LCRA 3RARA 3O4JA 5D3ZA 2HA7A 4ZXFA 5T4BA 5ALZA 3DJYA 3I2GA 2BKLA 4W9RA 3R41A 4AB1A 4OUKX 1Q0RA 3WJ1A 5JADA 2WIGA 1CUCA 4H7DA 1EK2A 2OGZA 1N5MA 5CT6A 4C88A 4EUSA 4UFPA 2JEZA 4EBBA 2RHTA 2PM8A 4FDMA 5C8XA 3PUIA 4HXGA 4D9JA 2WJ3A 1NU8A 1U65A 4BCBA 5A2GA 4W1PA 1YS1X 4BVKA 3G7NA 1QZ3A 3UUFA 3A2LA 1ZD2P 1H2YA 4X6XA 2DHCA 2B9VA 2BGRA 5E4JA 4Q05A 1E66A 5DNWA 4BAZA 2WFMA 2WFLA 3D7RA 3H19A 4Y2UA 3G02A 3L1JA 4BCCA 1QLWA 2QR5A 4N8SA 1WHTA 2H7CA 2XUGA 2VF2A 3WWDA 3CN9A 5LYYA 5JARA 4O08A 4EY6A 3FAKA 2PU5A 4WFKA 5A7HA 2C5FA 1YR2A 2BFNA 4YASA 3GA7A 1CUJA 2PSJA 3G0IA 2WIJA 4Q1VA 4OU4A 2LIPA 4F60A 4MYDA 3VDXA 3WQHA 2C5GA 1AZWA 2FJPA 3R3UA 2XI4A 2H7YA 2CKMA 1XFDA 3AFIA 1JJFA 3Q0TA 2NW6A 3R0VA 3DOHA 5ALNA 4AX4A 3HYSA 5F4ZA 1UFOA 4J0CA 3STWA 3H04A 4MEBA 1GKLA 1WCYA 1ODTC 4OPMA 4K2AA 2HL6A 2IIVA 2XMDA 5I9IA 2XUQA 5HK8A 5LZ2A 4B84A 4XJVA 4XIIA 3E3AA 5J3JA 2ROQA 3H2IA 3IUMA 4LIPD 1XZJA 2QZPA 4BAUA 1A8SA 4KAFA 4CIBA 4BE9A 4LXHA 3BDIA 3C87A 5AI6A 5C81A 3CCBA 3L1IA 1DINA 3QMWA 4X00A 4IQ4A 4M0EA 3ESCA 1VXOA 1XZFA 5FOQA 4UUQA 2Q0XA 4PF1A 4TVKA 5T4FA 4B83A 1KEZA 5I7UA 2HA0A 3O95A 4G4JA 3MVEA 2GYWA 3ICVA 1WPXA 1VE6A 3ESBA 4FLEA 4HTAA 1AC5A 1L7AA 4GEGA 2RHWA 3LP5A 1CUSA 1VOTA 3RLIA 3D2AA 2XUIA 4OB8A 5AKZA 2OCLA 2PL5A 5CXXA 1EDBA 2IX9A 3ZV7A 4BE4A 2D5LA 1LZKA 1J2EA 2RI6A 5AM4A 4GDMA 2WTMA 5ESRA 1XZMA 1VE7A 5HF9A 1FFAA 3DCNA 4GWLA 2HFJA 4X6UA 4KE7A 4N5HX 1E8DA 4WDRA 2QRUA 4H18A 4UHEA 1DTEA 3R3WA 4K6GA 4G8DA 4L72A 2QMQA 2FX5A 3UMJA 4TGLA 2G63A 4Q3LA 3D4LA 3WL7A 4IO0A 5AIAA 3PUHA 2RAUA 1LBSA 2ZSIA 4U2CA 3P2MA 5ALHA 2VJDA 3BIWA 1M33A 5EHZA 1ZI6A 5K3FB 4QWWA 1DQYA 4CCYB 4IH4A 1WM1A 1IZ7A 5FPQA 5D6OA 5ALJA 3NWOA 3AZPA 4J0DA 1LPBB 2HRRA 1FFEA 4DNPA 3HLKA 1CUBA 2PBLA 3ZPXA 4X91A 4NMWA 3D59A 3BJMA 1EXWA 1ZI8A 1ZD5A 5K3CA 1CUDA 1U4NA 5H3HA 3WKCA 1THGA 1MT3A 4Y2TA 5JZ9A 2XB6A 2G4LA 4H7FA 1S8OA 5JIBA 1LBTA 2QS9A 4PW0A 3NOXA 3F9CA 3JWEA 2Z8ZA 5CT5A 3W9BA 1H2XA 1ODCA 4LHEA 1AGYA 2O2IA 4Q34A 2VTVA 1XZKA 2XMCA 4PV7A 3V1LA 5EIAA 4JUIA 5BOVA 3QH4A 3JYHA 1J07A 4YPVA 3HI4A 5ALMA 2HA4A 1H23A 3NGMA 5JAHA 1ORWA 3H18A 1UWCA 1QFMA 3CN7A 5ALIA 4BTLA 2BJHA 5HZGA 3BJRA 3EQ7A 5AI0A 4GI1A 5IH7A 4MQLA 4Y2YA 1PV1A 1AURA 4J7AA 5IVIA 4FTWA 3CXUA 1B6GA 1LPAB 3V48A 1MO2A 5DWDA 3OURA 2HRQA 3IULA 4H0CA 1LLFA 1IUOA 2XLBA 4N8DA 1LGYA 1MNAA 4G9EA 4ZGBA 4DTCA 5ALWA 3JW8A 1HBJA 1LZLA 2G5PA 4OCZA 2XUFA 3FYUB 1YAHA 4U2GA 5CT8A 5A6VA 3EQ8A 3WA6A 2Y2VA 3RM3A 3WJ2A 1JMKC 1TRHA 1G42A 4NZZA 1UK9A 5AIBA 1PFQA 1UT6A 5LKRA 1X70A 3BF7A 2OQIA 1VLQA 2CBGA 1XQYA 5HQ3B 5JANA 5FV4A 5AM5A 1XRLA 3IA2A 3IUQA 4G5XA 1R4ZA 4DNQA 5FP0A 3BXPA 1GQRA 5ALUA 1BRTA 4RGYA 3HABA 3HSSA 1LNSA 3RK4A 3I2FA 5HF6A 2ZJ7A 4ZWNA 2E3JA 2Y2UA 3E0XA 3ESDA 2DHEA 2BCEA 4WY5A 4X92A 4W63A 5A7FA 1B41A 3H1BA 3WK5A 5CT9A 4FNMA 1FFCA 1QONA 1ZIYA 2JEYA 3RKSA 2OLEA 2HA5A 1IZ8A 5EHXA 4GW3A 4QDTA 3MUOA 4UBJA 1DWOA 1EX9A 5AOBA 4Y2QA 5DNUA 2WIDA 2CMFA 2QM0A 2UZ0A 4EA6A 2JGEA 2XMSA 1BCSA 3I2KA 2OCKA 3G0CA 2YH2A 2R8BA 5AM1A 1QIFA 1XRRA 3C6ZA 4FBMA 1J06A 2PX6A 4AO7A 1LPMA 1QIJA 2OXEA 4UBIA 5DYWA 3GROA 2WIKA 2QT9A 1JJBA 4UFOA 4P08A 3ZI7A 4OSEA 2EDAA 5DTIA 1P0MA 2GZRA 4I19A 3KOOA 4JYPA 2J4CA 3HC7A 4BZWA 2JGFA 3WWCA 2ACEA 2XUOA 4H35A 2QJRA 1P0PA 1YASA 3NUZA 4J03A 1AX9A 2ZJFA 4BP8A 2ACKA 3ZLTA 2VQ6A 3AZOA 3OG9A 1LPNA 2Y6VA 5AM2A 1CUWA 1TQHA 5HF8A 4X3CA 3PICA 4YX9A 3SK0A 2WFZA 1MX5A 2Z5GA 5ALOA 4PSUA 1QIKA 1TIBA 4K6HA 2B61A 1SFRA 3S2ZA 3QZUA 4KEAA 1SCQA 3M82A 3WL5A 3C70A 3HXKA 4UFNA 3FOBA 2W6CX 1BS9A 2XQJA 2WFLB 3B12A 5AH0A 2ORYA 3GFFA 4KE8A 4EB0A 1SOMA 4WDQA 4HS9A 2H1IA 3AIOA 3DNMA 1JJIA 3EF3A 4BC1A 3WLAA 4AMYA 4I3FA 3KD2A 5JYCA 3WK9A 2XUAA 3M83A 3ILSA 4PSCA 3WKDA 2IITA 2J3DA 3IUNA 4HVTA 5AM3A 4FOLA 4C4YA 1A8UA 1F0NA 2XDWA 2Z3ZA 3FVRA 5JALA 5EHNA 3D2BA 1Q83A 2WG2A 4QE3A 4A23A 4XX1A 5ALKA 4N8EA 2DCMA 4BAGA 4CI9A 2WUEA 3H2KA 2WHQA 5E2IA 5LZ8A 3WWEA 4L9AA 1NU6A 3S8YA 2WTNA 5HKAA 2CZQA 5ALLA 1QE3A 3I1YA 3C45A 2WUFA 2VATA 1Y37A 2R11A 3I2HA 5AK5A 4LYEA 1K63A 4X6YA 4KE6A 3BF8A 4ITVA 3ANSA 5SYNA 1UXOA 2PSHA 1EB9A 1U8EA 5BWBA 1Q84A 3H1AA 5ALTA 1MNQA 4BRSA 1VZ3A 1USWA 1VZ2A 1QIIA 1CUAA 1XROA 4JEIA 2XUKA 5AOAA 4JH0A 2JGIA 4EY5A 5LZ7A 3FCYA 2XQIA 3ESAA 5K5EA 1UOPA 2GBIA 4E14A 1MX9A 1E5TA 4FFWA 3TRDA 1UOOA 1UKAA 3V9AA 1MAHA 1SCIA 1GPLA 1EDDA 5K3BA 1H22A 2X5XA 4X85A 4ETWA 5HFAA 2W22A 1Z68A 3GELA 3HEAA 3DL4A 5BWCA 1HKHA 3TGLA 1XRNA 3IBTA 3UUEA 2WM2A 3K9BA 4CG3A 1JT2A 3KSRA 1K5PA 3O4IA 4GXNA 4A5SA 3GUUA 1FFDA 5HKBA 4AMZA 3PFCA 4DNOA 5LLSA 2XLCA 1RWQA 1CVLA 4JYMA 1UK6A 3I6MA 4DMCA 4CFSA 4INZA 1JFRA 1VJ5A 2C58A 1R3DA 4KE9A 3WIOA 4ZV7A 3VJMA 3PF8A 4B7ZA 1CUXA 2OCIA 3C5VA 3I6YA 2WUDA 3E1GA 4BDSA 4FMPA 1CR6A 2WHPB 2FJ0A 3H2GA 4QLAA 3SWWA 5ALRA 3PE6A 4KRYA 1TAHA 4WJLA 1XRPA 2V9ZA 3WYDA 1AQLA 5JD5A 1DT5A 1BEZA 1QFSA 2GYUA 3VXKA 1UKCA 1BN6A 1UOQA 5DLPA 1ZGBA 5HCUA 3OC0A 3QPDA 3N0TA 4Q82A 3M3DA 1IVYA 1SCKA 2PVSA 2AJDA 3MUNA 5FDFA 3QMVA 3F96A 5CURA 2YYSA 5FXMA 3STTA 4P93A 3QYJA 4FKBA 3FSGA 1ISPA 2XMRA 4YK7A 4IH1A 2QTBA 1O6FA 2OQVA 3O4GA 5CBKA 2G5TA 1CUUA 4KRXA 3ZWQA 3PF9A 1QIDA 2PKYX 2BUAA 2BUCA 5JD6A 1ETHA 5AK4A 1DWQA 3N2ZB 5E4TA 3F8SA 2XUDA 1X2EA 2PU7A 3WL8A 4AO6A 1WB4A 1XKLA 1XZAA 1XQWA 4Q3KA 3OTQA 3AJAA 3WK4A 5AKEA 1YS2X 2ECFA 2DSNA 1HPLA 2QXTA 5EGNA 4AXBA 3FYUC 3V1NA 3WIBA 5HK9A 4QWMA 4HXEB 1AMNA 4Y2PA 4F21A 4ARBA 3IVMA 3STXA 2VA9A 1XKTA 5AKIA 5AM0A 3R3VA 1Y7HA 5ISMA 4Z49A 3OPMA 5K3FA 4CCYA 2VJBA 5AI4A 1CRLA 3DKRA 3H17A 2VEOA 2OAGA 2XT0A 5AI8A 2OPHA 3PDCA 1XQVA 5EIHA 4BTVA 4MYSA 1NX9A 4PQEA 1WOMA 4HXFB 1N8SA 4UBMA 5ALGA 3G8YA 4XWGA 2V98A 1VA5A 1QIHA 3QITA 2AJ8A 2AJCA 5KBYA 1XZDA 4Y2RA 4B82A 3C8DA 3K2IA 2ZYIA 1E3QA 1YB6A 3D0KA 2XE4A 3FVTA 5AJHA 3TEJA 4EHBA 2QOEA 4GHWA 5JATA 2QUBA 5D3KA 2HADA 2DFPA 1ZI9A 1XLWA 4B9AA 2V97A 2XQFA 2WHRA 3IURA 4KR0A 2JGKA 1CUYA 4UBLA 4S0XA 1XRMA 4V2IA 4F0JA 2AJBA 1I6WA 2WJ6A 4IH9A 2QVBA 4WFIA 4CG2A 3O0DA 1W75A 1QJ4A 3C6BA 3AILA 3R3YA 5JZBA 3VISA 1MJ5A 4LXIA 1WB6A 5K3EA 2VJAA 3G9XA 1TCCA 1YCDA 3HACA 1WB5A 2ONCA 4W1QA 5EIEA 1T4MA 4OYYA 2FUKA 2I3DA 3YASA 3FCXA 2QKYA 1MN6A 3BWXA 2BAGA 3KDAA 1W6RA 2GBGA 2V96A 4CIAA 3KXPA 4W1SA 2VAVA 5ALPA 4BCDA 5IVKA 2CEKA 2HDWA 3WK6A 1IUPA 1YB7A 4J0GA 4G1FA 3SC2A 4UHCA 1QO9A 2VT6A 1EA5A 1JKMA 4PO3X 1ODSA 5LZ4A 2Z8XA 2XUHA 4HZGA 4DM7A 2XMQA 3FYUA 5AKJA 4FLFA 5E4YA 4CG1A 4GECA 3WK8A 3C43A 2AXEA 2O7RA 1R50A 4FLMA 5IKXA 4Y9SA 3D3NA 4EY7A 5HQ3A 3W04A 4ZV9A 3L1HA 4H7EA 5ALDA 4BBZA 4AZ0A 1WPRA 1UK8A 1J1IA 5JAUA 4BB0A 1TCBA 2O2HA 4C4XA 3R3ZA 3WWPA 4E46A 3I6ZA 3OOSA 1G5FA 1A7UA 2GYVA 4RNCA 3W06A 5LZ5A 1GPNA 4BRZA 3WKBA 4DNFA 1RYYA 1JMYA 2CJPA 2WSLA 4UBOA 4RE5A 5C7YA 3LS2A 5ALSA 1MAAA 3IUJA 4J0KA 4B81A 4BZZA 1THTA 4M0FA 4AZ3A 1CUHA 2ZYSA 4H7JA 3QM1A 4TPKA 1A88A 2C7BA 1QIGA 2H7XA 1CUZA 2ES4A 4NS4A 5HF5A 3WKEA 2HA2A 3BL8A 4MQMA 1BE0A 1GQSA 3VVLA 1GPKA 1MX1A 1KU6A 1A8QA 1K8QA 4LKOA 3WA7A 4MXDA 5CH5A 3Q8WA 1EVQA 4J0JA 1WHSA 1JU3A 2HU8A 4DLNA 4FWBA 4H77A 3FSGD 4DGQA 5YASA 3A2NA 4G4GA 2YXPX 3FNBA 4QNNA 5C8VA 1H2ZA 2HA3A 2RGUA 2EEPA 2VT7A 5LZ9A 3G9ZA 4B0OA 2ZYHA 1IMJA 5EFZA 1QTRA 3D5EA 3VVMA 3H2JA 5FPPA 1DX6A 4UHDA 4C87A 2I3ZA 4J3JA 3ZLVA 1N5RA 4DSAA 1L7QA 2HHAA 4B9EA 5A71A 4UPDA 5FUMA 4MJ3A 3WZMA 2WIFA 3T52A 4JNCA 4QDZA 5CTAA 4K6KA 4X71A 1AUOA 1GZ7A 5AK3A 3W9UA 1N1MA 4LYDA 1EHYA 1X2BA 1W52X 1K6EA 7YASA 3DS8A 1XLUA 1EH5A 3V1MA 1AKNA 1BN7A 2J3QA 4I4CA 1ZOIA 4P92A 4HRYA 2HU5A 4B85A 5CT4A 4X94A 2XMGA 4N5IX 1YSCA 4Y2JA 4UBNA 5JZSA 1VKHA 2HU7A 1XQXA 3DYIA 3VKFA 5JD4A 3WKAA 3E4DA 2ZVDA 4KAAA 1VXRA 3FLEA 3QMMA 3V1KA 4ZRDA 2QUAA 2XQGA 3ANTA 3I2IA 4MWTA 2J4FA 2X76A 1F0PA 5ALEA 3O4HA 2OG1A 1UK7A 1E89A 3ICWA 1TK3A 5C8ZA 1MPXA 4X93A 5IVHA 1CUFA 4BATA
chains in the Genus database with same CATH superfamily
4RTQA 3DUFA 4HAWA 4E09A 4RTRA 1EHCA 2X0EA 1RRFA 3K05A 2JVJA 1Y9DA 2FFJA 3PT5A 2V9CA 5A5FA 1N4DA 4MLDA 2FGKA 1U5BB 5E9AA 2I76A 2IP4A 3I2JA 1FX1A 1EZ1A 2Y77A 3EIOA 3OHPA 2TMGA 2PMBA 4MV4A 3DXYA 3HWWA 1JV2B 2OZPA 2QYHA 3AHDA 4US1R 5IJXA 2AXQA 4MHTA 4I9GA 1P9RA 4RIFA 5FKJA 1NE7A 2R7NA 3G79A 3UW3A 3VJLA 2QBYB 5E6UA 2P9GA 3OM9A 2AG1A 1SC9A 3D0RA 4L8FA 3RVJA 3U5ZB 1Q11A 5LP6A 3S2FA 3IBCA 1SBNE 3S8MA 1E0KA 3FLAA 1P7VA 2O2YA 4U8GA 5FADA 5DM70 1EFDN 1FLNA 5AK6A 4E03A 3IB6A 3SSOA 4OYLA 2H54A 3EVEA 1LI5A 4F38A 5C80A 1FY2A 4ZDWA 1XCLA 1GUFA 1XJ5A 4P0PB 2GJKA 1K7EB 1YK0A 4HLQB 4E11A 4UQLA 3A6PC 3KLBA 4NDAA 1S02A 1BHQ1 3TPFA 4A92A 4MS3A 3ZBTA 1LLQA 3QHPA 1YQDA 3B1VA 3UNXA 4J0QA 3TVDA 3JD1A 2JZOA 3ULKA 1XCOA 1YTUA 1TEZA 1NHWA 4YMWA 1VPLA 3NRJA 5PNTA 1RP1A 4RZQA 4REMA 2G09A 4I1IA 3SPXA 4ECAA 4V0RA 1P80A 2CXXA 1SOAA 2EWVA 1XTTA 2PMDA 2OLJA 1I9CA 2A1TR 3KC2A 4YTEA 2X0JA 2PKWA 4ZREA 4LBZA 5EPEA 4W82A 3B3QA 3LP6A 4JJGA 5F3WB 4LI3X 1RC1A 3GCWA 3KWJA 5JSFA 2B7BA 2QXUA 5JAMA 3FKSD 1KEVA 5DHSA 1X1AA 2B4KA 1PFUA 1CZNA 3SX4A 4TKLA 4CF4A 1H4QA 1AU9A 3OCVA 4D42A 3SC6A 4L4YA 3BCSA 1RKVA 2EKQA 2YXDA 4RX1A 3D8UA 2NO0A 5JCOA 3BE8A 5LUAA 3C8HA 2OWDA 2PUGA 2VO1A 4K1XA 4R4JA 3L92A 3VAYA 4Y9TA 3B3AA 3HMQA 3INTA 3WB2A 3CCFA 1J9EA 3L8HA 4G23A 5HYVA 4AF7A 4ZALA 5FUBA 4MUYA 3AR7A 4DCPA 4EP1A 2JGLA 1DG3A 2JF0A 1VLHA 2CNDA 3BICA 4IBOA 5AOCA 1MENA 3V34A 2PSDA 3U31A 4RC9A 3T61A 1Z6YA 5JJBA 4QBHA 1DUIA 1MTZA 2J9YB 3LQRA 3TI7A 1MZPA 3V4PB 3WL4A 1TKAA 2WKWA 4XXHA 1ZBDA 1L4MA 3PXDA 1NUTA 1CEXA 3D0OA 1ZHHA 1HDGO 5B58T 4QEKA 1S1MA 4EUKA 1G20E 1XN4A 2IBMA 2AN9A 1S7CA 4DUGD 5AKLA 2XYRA 1YAJA 1NBMA 3EGEA 3EPJA 4FYVA 1CULC 4F8JA 2GO7A 1CQZA 1LPSA 1YHYA 3TR5A 1SMKA 3D3JA 4IWYA 3RJ9A 5FOSA 1FP2A 3AEKA 4BLWA 2ZR9A 1UKZA 2AQ8A 1VJGA 5EZYF 4IIVA 3C6YA 1F51E 1JHMA 4XTRA 1IQPA 3KJQA 3FDFA 4H31A 4HLDA 3E53A 3K6KA 1FLVA 4RKRA 2E5LB 1DPGA 1PT8A 1U7UA 2CUKA 1LQUA 1ILWA 2YHAA 3D4PA 3KQOA 4BV3A 4E2ZA 3AVVA 3VJKA 4W7HA 1XZEA 2EL7A 1OIXA 3H7IA 3FN4A 1WP4A 4ZIRA 2FRDA 3SLRA 4EY4A 4Y2SA 4YMVA 1FNSA 2OORA 3OIGA 2AGVA 1I6KA 3R3XA 4GICA 2FUEA 1JYFA 4MI1A 1BXGB 4UBKA 1N3LA 1LJUA 3DLTA 3L41A 2J3JA 4LISA 3VNSA 4N5NA 4ZDJA 4MEAA 1N2JA 4HFJA 4II3A 3OIFA 2F8TA 3IUPA 5B30A 2IYNA 1AUXA 1LU9A 3FSJX 3AR2A 5JJLA 1QGZA 2Y27A 3A4IA 3AUKA 2ISCA 3LXRA 3FOCA 3I45A 5FOUA 4A6EA 4PZUA 4BS9A 4F92B 3WIUA 4HEA6 3TSZA 2ZS9A 3F97A 4EZIA 4PLWA 3OU6A 2WU1A 4RDCA 4BQIA 4C76A 3KCQA 3KUDA 1OBHA 3NAGA 4YO8A 3QA9A 4YCCA 2PX5A 1JIIA 1GSIA 1VECA 2WHPA 1QH1B 2HK6A 4FI3F 4OB6A 1EK5A 3ZV6A 5ITZB 3PRJA 3AR9A 4UM7A 1P0FA 2ZYRA 1JKJA 1X8LA 2AG6A 4ZT5A 5KC8A 3AFOA 1XZGA 1W2HA 4LHSA 3FY4A 4R8KA 3TM5A 1A7KA 4NEGA 4JXKA 3LU1A 2LCQA 4LJLA 3R7FA 5EZYA 1E98A 2G6TA 3BK7A 5BWOA 4CLRA 2XZPA 4CEJA 1SU4A 2X4LA 1QLJA 1GQYA 3DBOB 4WJZA 1KO5A 1T1GA 1RLTA 3DD5A 2NM0A 1N3BA 1OX4B 1WEHA 1XTUA 3DMPA 3OOJA 3EFBA 1T8WA 4PG7A 2AYZA 3FLBA 3NWJA 1DKOA 1Z36A 1TA0A 1CHNA 1P74A 3ZCSA 3AVQA 5KTTA 1E4VA 4X7BA 2CXPA 4R05A 1XZBA 1KVSA 4EIWA 1GLVA 1EFUA 2ZRNA 1G4HA 2HM7A 3QUCA 4INOA 5A3RA 4ROTA 2E4AA 1FDRA 1S1CA 3GY0A 4ND1A 1KYZA 2JAWA 1ISMA 3VAZA 3PYXA 4RY9A 4LNUA 1I2ZA 4EUHA 4ZZ1A 5FAKA 3KAJA 3N2KA 3KKZA 5LIPA 2GN9A 1RSZA 1I30A 2C31A 4HV4A 1HK7A 1BFDA 1N2OA 2IA5A 3VU9B 3HJUA 4X8OA 5AKXA 1KE1A 4W8HA 4Y6RA 1XZHA 4PANA 1BFUA 2BI7A 1N2XA 1NW6A 4NDNE 3OOYA 5BO5A 1XVIA 5C35A 3ELUA 4CM8B 4HSGA 4QULA 6NULA 2NZUG 2ZRHA 2WV9A 4ZAGA 4EFNA 1Y3IA 2Z2XA 2ODAA 2QN6A 3OJWA 5IN4A 4RNDB 2PTHA 1MR3F 4TLLB 2Q1WA 3UM9A 3UKOA 4I4IA 1P77A 2XMZA 1C0PA 3FGZA 5A5DA 2NG1A 2JAXA 2NYVA 1I9GA 2YRXA 5ITSA 3L6EA 4QUEA 2O4CA 1N2GA 4IOJA 4EGCB 3IT1A 1BJTA 3V4ZA 3ANYB 1OFTA 1HDEA 4WZBE 1B43A 1CJMA 2VAXA 1N6HA 4PYOA 4RADA 4X65B 2OV8A 4LXUA 1RLUA 4TYQA 8ABPA 3DZ8A 4QTTB 2FWPA 3OOWA 4O4IB 3R7WB 1Y5LA 1PUXA 3PNBA 4IZ6A 4BNFA 2QR3A 4QXPA 5AICA 2BISA 3GFRA 4QG3A 1F4PA 3CF4G 3GB9A 4LPSA 4YRNA 2QVGA 1SBQA 2AHOA 1UXGA 3FYTA 2JDIA 3DR3A 3M33A 4BEWA 2BGNA 4UCXA 3DZCA 5ALVA 4LBVA 3GFQA 3C7AA 2PCLA 1BEEA 1TEHA 3FUCA 4H7IA 5CX1B 5TMBA 4BN4A 1JDTA 1X1RA 4JI5B 2FSGA 1NBAA 1ZIOA 2DPHA 2L42A 4NK4A 4CIXA 3DE4X 3A6ZA 2JH9A 2I34A 4R98A 4I7EA 4D4GA 5KYXA 3BMNB 2HF7A 2V6BA 3L4BA 3V2IA 4HPJB 1SG9A 1EP2B 3A31A 4W8OA 1V5IA 1XA3A 2H1WA 4MUJA 4QQFA 3SZMA 3T7KA 4DC9A 4OQDA 5DJ5A 2WUGA 4WNYA 4F9FA 3HRIA 2WSBA 2V1XA 1YQXA 2HK8A 4OD0A 2QY6A 4L50A 4KVGA 4O4LF 3KYIB 3NH6A 5D7BA 4LX8A 4Y7DA 5IJ0A 1X7XB 1OFVA 1YU6A 2Y0EA 1L5VA 1KJIA 2GRJA 1FTWA 2R44A 2WRZA 1RU3A 2XEXA 1ZM9A 4C3ZA 2OO5A 4DY4A 3P4UA 3ESQA 4XA8A 4J16A 3F78A 2OK7A 4HN9A 1L5NA 1EVEA 4A0QA 1PZMA 2RIPA 2W5UA 4I0WB 4BKQA 2QRVB 5A4FS 5EL0A 3ND9A 2XUPA 3AKDA 3FE2A 1Y3AA 1CZLA 1M2FA 1MEJA 3BXFA 3N6XA 1RRPA 4G0ZA 3SXPA 5A06A 1SIWA 5KOIA 4JI0B 2LUOA 3BE5A 4QASA 1RXEA 1WUJS 3U3OA 4EY8A 2MSEB 3EEOA 1WP9A 2ENUA 2QL5A 3FPLA 2WVHA 3OM8A 3VH4A 4C0LA 5HOEA 4U2BA 3OKCA 2OVBA 4K0KB 3BTUA 1FJGB 4KQGA 3Q7QA 4JJ4A 5CRIA 2YMPA 1IM2A 1V1RB 2PRYA 2VCEA 3DOFA 5DTQA 5E95A 3RVLA 1EFCA 3NHFA 5IHPA 2IS2A 5AKGA 3BWBA 1DC3A 1N6RA 1CIJA 3IMEA 2YICA 2FPLA 1NI5A 2CSUA 3JASA 3N58A 5H4HA 4QVKA 3AEZA 4RS3A 5F2OA 1O5TA 3HBMA 4LHYA 4A16A 2VJMA 2W6NA 5DO9A 3HVUA 3W2TA 4BBPA 4FSDA 1Q6YA 3H5TA 4B80A 4ZCPA 1QO7A 1LDNA 5IC6A 4BNJA 1NFRA 3H6GA 4UDXX 4LRYA 2KE5A 4O4LA 3RUIA 3SEQA 5FH9A 4ZTUB 1U0BB 2BEVA 3GJ6A 3O8QB 3PWTA 4Z0HO 2O54A 2WQ6A 2VCHA 1LLCA 1NJ6A 4JROA 5I7RA 5IKEA 3TG2A 5HWSA 1EFHA 1KZ1A 3BIFA 2NVBA 4RZIA 3TKYA 3VDMA 1XU4A 2I7XA 3P9RA 4EX6A 3IUEA 2PZLA 3OIWA 4BHTA 4GZ3A 4C14A 4HYEA 1XZ8A 3BEDA 1M34A 1QK4A 3Q2KA 3N7AA 3V7NA 2QRMA 4LJ5A 3BGSA 4ALIA 1TUGA 4WXMA 4MCHA 1XZNA 4TRJA 3MGBA 2GAAA 1OYVA 4KNWA 1ZD4A 5KHAA 3HKEB 2FSVA 4AN1A 3V4VB 1KJ8A 1CDEA 2YR0A 4C20A 5AYVA 1FW8A 1LUAA 3BE6A 1U2TA 4LXGA 2X0DA 1ZJ6A 4QBIA 1ZRHA 1IBCA 3S1LA 3WIDA 2BMWA 4B6GA 5EE1A 4U7JA 5EI5A 2V7UA 5D00A 2YW9A 3IHLA 1ZD1A 1X1BA 4ZO8A 1HQCA 1AK2A 1SXHA 5DNEA 2QTGA 1ICIA 2FN4A 4K81B 4EGQA 4NEQA 4AQYB 5T4HA 4ZCMA 4MTCA 3UK0A 1GUAA 1K8XB 3LFUA 1VMIA 5CMLA 3TAUA 4YONB 5LU9A 5DTJA 5CH8A 1T9BA 1P0QA 2R7KA 3WMRA 3HKDB 1XTJA 4GL4A 4RJJA 5DX0A 1Y1SA 5TQ0A 2ZREA 1X14A 4J4TA 1E18A 4B74A 2GCNA 3EVCA 5H4GA 1TJ4A 1TD1A 4A0RA 1G60A 1TTHA 1BYIA 2O2CA 4XLLA 1YZQA 2LIVA 2Q8NA 1N0WA 2OUKA 4MCJA 1HM5A 1NVEA 3F9IA 3NAZA 2VH5R 3CB2A 3LHDA 4TS4A 1U8ZA 3ASYA 5JR3A 3GUHA 2P35A 3TG8A 2XXAA 1CQWA 3HXTA 1CZKA 1ULUA 1W4LA 3FNQA 1QAMA 3OBIA 4LF9B 4I4LA 1SKAA 4F1JA 1SULA 1YDGA 2WILA 1O08A 3IXQA 1WS6A 1C4XA 1N75A 1RNLA 2WB4A 2Z9DA 3PL5A 4KX5A 1KI3A 3PDIA 4OOFA 1D04A 2DM6A 2OKCA 5A62A 1V43A 2YBEA 1FMJA 3KT0A 2NUTB 4LYHA 4ZQBA 3LCVB 5A7GA 5D5HA 3V7FA 3Q7IA 5JSQA 2CXSA 4ARAA 2GBLA 2O7QA 3Q72A 2YIDA 1L5YA 1H65A 3F98A 3BDVA 4L6AA 2ZLBA 3ELBA 1MB2A 3TXYA 2PT9A 1DP4A 3E1SA 4NYJQ 1EINA 4EZBA 2PH7A 3ISVA 3W2EA 4L3VA 5TY0A 1PEKE 3VU1A 2NTNA 3EGCA 3OZEA 4LV5B 5UKDA 3IPAA 4BFWA 5AKKA 1IEVA 2LDXA 3N87A 3UFXB 4AYWA 4CCWA 4F5ZA 4K9OA 5CVCA 2IYFA 2R5WA 1K9SA 4GBED 2I4RA 1W34A 1LK5A 2OBBA 1YOBA 4G0YA 3KPUA 4QGGA 3UK2A 4EB6B 3I01A 5CB4F 4MRMA 4WGFA 1ODKA 2ZUSA 1IVNA 4QTYA 4Q3OA 4R0NA 4MQEA 3RC3A 2F43A 4OG2A 3ELYA 4QYWA 4MGIR 4RYDA 2O4UX 5JAPA 1VRVA 2IYZA 5DN9A 5AO9A 2LD4A 3PNOA 4ND8A 3ED5A 4TL9A 3SD7A 1Q74A 3WL6A 3RF7A 1PGJA 4KACA 2WG1A 3NM6B 3PKIA 2R6DA 2B7CA 3IIMA 1A8HA 5DXJA 1Y7IA 3CW9A 1R4NB 3RQSA 4TWAA 3TQHA 5FAXA 4EFDA 4XR9A 3TBHA 2GLUA 4UHKA 7AT1A 3Q8LA 3AIMA 1E3JA 5BV0A 1RYNA 3OX2A 3SIRA 3C8UA 4QOIA 2CJFA 2WWIA 4XD7A 1PQYA 3O8OB 4BEBA 5JXIA 3TB4A 5KWIA 1YB5A 3FWHA 2IU0A 5JJKA 2WE8A 3PC4A 1OD6A 5K0SA 3LFHA 2YWDA 4LJAA 3JQCA 4NCAA 4G24A 4A2CA 2RI1A 2GBFA 1EWVA 1IU9A 1E79A 1QMPA 2JANA 2NADA 1DPFA 2H1CA 2FI1A 2IYTA 3D7LA 4YCLA 3I61A 3HUDA 3WL5A 1XC7A 4X20B 3KU4A 4HATA 2OC4A 4JJ8A 2D2FA 4QPJC 5F2KA 2UZIR 3O2SB 1IHDA 3ZH9B 8LDHA 5FTLA 4C1BA 1ORRA 3WMGA 1A5SB 3H4VA 4IIYA 1KJNA 1IVSA 4ZGWA 5CB4A 4Y8VA 3LLCA 3GEIA 4F71A 5HIIA 4REOA 5AI5A 2NPOA 1R9GA 4WI1A 1U2EA 1IJEA 1JA9A 3AHCA 4LNHA 1VJDA 1DBIA 2QZJA 3LCRA 4JFAA 1KOFA 3GQBA 3FNGA 4RMJA 4D82A 2KHZA 4URVR 3BD6A 4YJHA 3U2QA 1XMSA 3CX6A 1O94D 1RZUA 2X15A 4R2XA 2ZDHA 4DWVA 1CRWG 2E55A 2LDBA 1W4CA 4KQCA 1XPRA 3M6AA 3ZWMA 5DKFA 4C08A 1LXCA 4WKCA 5D3ZA 2HNBA 4DKXA 2GPJA 5IZ4A 2A5JA 1EKXA 1YJCA 2CJWB 2VXBA 3IRUA 4JJEA 4CMGA 3DE3X 4QELA 3HVKA 4GAEA 3WRYA 3HPRA 3K72B 3T3HA 3HB4X 1GAXA 3EK2A 5ALZA 1S6YA 2A94A 3N39C 1U7PA 2P5SA 3DJYA 3I2GA 5DWVA 3W78A 3CRRA 2BKLA 4AB1A 5TE9A 1EWYA 1RXCA 1TM2A 2QW0X 2WIGA 3ZW9A 4CQMA 4EKDA 1CUCA 2WZQA 4H7DA 3IE1A 1EK2A 1E1YA 1V41E 4B6PA 2A3RA 5ECWA 5H3CA 1DIAA 4HAXA 4C88A 2PXAA 4IL5A 3L8YA 2JEZA 1EIWA 4NI5A 2RHTA 4O2BF 2J41A 3TLGB 2QTFA 4A8JB 3Q85A 5ANRB 5K3SA 5C8XA 1RPZA 5KSWB 2FFRA 5GIOE 4O1HA 4DBLC 1Z8HA 2WDPA 1RJGA 4XB2A 1G6KA 1U65A 2YWFA 1WULS 4E22A 2J31A 4BRUA 1KSHA 2JFYA 5FL3A 1UXJA 2JI9A 2Y99A 3CMMA 1CEEA 2JJ1D 4KK3A 3GNQA 5FT9A 1PQPA 5LOVF 1ENYA 4BVKA 1GNVA 2IZZA 2ZBQA 3GRPA 3LPMA 5IPFA 3DSRA 2DLNA 3K0HA 1Z3IX 2Q5LA 2Q6VA 3K9FC 4FMBB 2A9FA 3UATA 5KS2A 1TD9A 3AK4A 3FCAA 1QAQA 1GTRA 3NMUF 2G71A 1GQFA 3HH8A 2R87A 3I39X 2DQ4A 5COBA 3K4PA 2QVYX 4MB2A 3VH3A 1P7ZA 1ZD2P 4X6XA 4OLAA 1Y9ZA 1T91A 2BGRA 2IYUA 3ZBPA 4N6OA 1HLDA 1E66A 3LX4A 1Q20A 5HPYB 2BEUB 3DZHA 2WFMA 2RGCA 2WFLA 4PQYA 3ZU3A 1GZUA 5JXWA 1G20B 3BXXA 1KBQA 3GAFA 4MW9A 4UUPA 1KO4A 2ASVA 2C2YA 4A6XA 4O2BA 5BOSA 1Y81A 4CKEB 3AL2A 1TK9A 3G02A 4N7RA 1DWUA 4HP8A 3FWPA 4INAA 4NQRA 4MHOA 2FPSA 3ZQJA 1SUCA 4GSKA 5KNBA 1N7HA 1I6MA 1PFGA 1VFNA 2GD6A 2PLFA 1QLWA 1P9WA 4BCCA 2EJWA 4N8SA 2XUGA 1K6XA 4R69A 2XTJA 5DB4A 4GXRA 4YCAA 2BDUA 4MKXA 4P81A 5EMJA 4O08A 4EY6A 2TYSB 1AE1A 1TZMA 3GFSA 1Q21A 3HYLA 4NU0A 1DOAA 4BNWA 3A4VA 5LOVA 3Q8KA 4WFKA 4I8IA 3BWVA 3CZPA 4MQUA 4QGAA 4CL8A 2AHRA 1U0RA 4DIOA 4KNYA 2MOKA 3O38A 3A6FA 1XCBA 1CUJA 5ADVA 1XHLA 3TW6A 2R8XA 4B75A 4ARSA 4G5SA 3G5LA 3ZHCA 4UTPA 4B3JA 4C4PA 3HO1A 3G0IA 1MH9A 3UT6A 121PA 1MUUA 2E85A 4Q1VA 2P9TA 3AFGA 5ES4B 2AFHE 3CLKA 4D9CA 4EYQA 2IH4A 2F9MA 4N03A 3IV7A 3MRTA 3TL2A 1F4LA 4MAAA 1JHZA 3JD3A 3RJTA 4ITRC 5CIWA 1ZNQO 3WQHA 3GLSA 2C5GA 1AZWA 4KITB 1B16A 5G1PA 3MILA 4FVTA 5T3UA 3RU3A 2CVOA 1M7HA 4MUNA 3PSHA 4DKJA 2H7YA 1AO0A 3CNOA 4HQLA 3W8DA 2ZYDA 2HF2A 2XJ9A 4MKIA 4PSVA 1C3OA 4ZQHA 1NMZA 3PUKA 4BUJA 4RD6A 3RHSA 5BN3A 3DBHB 1MAWA 3ZJYA 4YRBA 4HG2A 3HZRA 1BQEA 4G89A 1JJFA 2V45A 4DABA 3JQAA 1E61A 3IO3A 3PGJA 4ZQGA 1CJSA 3GAZA 2ZGVA 5T64A 1G5HA 1IY8A 3NATA 2O2DA 1F0KA 1GQQA 4HFNA 1WPGA 2W58A 3BB1A 4Y3UA 3DXFA 1EFRA 1GYRA 4JEUA 5I8WA 2DX7A 1J0BA 4J0CA 2YOGA 5J5AA 1IK4A 4O4HF 4RPJA 2OM6A 5DK4A 3ROTA 5HGXA 3H5IA 2BGWA 2YN2A 1P2BA 3EZNA 3UO8B 4AW9A 1ZXBA 4C4OA 1Z6PA 3RSFA 4CF3A 1EE2A 5TXGA 4K2AA 2HL6A 1BKYA 1DLJA 2F59A 1E0JA 5IS2A 3CO5A 1NP7A 4OFXA 5I9IA 4R40A 1U3WA 4NZNA 1KDVA 5ICEA 4ER0A 4XIIA 3ND7A 5DM60 4IIFA 2K5UA 2CFSA 4UEKA 2CYBA 2Q3JA 2VS1A 3RPEA 2ZBUA 5J3JA 3RDPA 4BQPA 3QUAA 3I8SA 3LC0A 2NO9A 2V65A 2W4IA 3IUMA 4INJA 3GLGB 2XTMA 4BKMA 3MW8A 2GO1A 1THMA 5KOYA 4LIPD 3LHKA 4WXHA 4H6WA 3V97A 1AT1A 2ADMA 1Z7YA 5ICCA 4JR1A 4YMTA 2VHXA 3TOXA 5IAOA 1H9BA 2HWXA 4LXHA 3P9KA 3AJ9A 3KXIA 2Q6KA 3GYBA 3ITNA 2OHVA 4RJLA 4PIVA 4H1HA 3G8AA 4QNMA 5E1MA 1B2LA 2BE7A 2I4NA 2VSFA 4JLJA 3CCBA 3NJ8A 5EIXA 1I4EB 4NICA 1WVMA 2C95A 2OP0A 1GFIA 3EQ2A 4CM5A 3KPWA 4FGJA 4MQ5A 1DC4A 1VXOA 1XZFA 4O4HA 4CDNA 4CNQA 4UUQA 4W5QA 1DCFA 1TVEA 2OBXA 4XYBA 5EYPB 4FGWA 4GKKB 4QBGB 4AZSA 2IP2A 2ZUCA 3MVEA 2GYWA 2XNDA 1WPXA 3EW9A 5H81A 1Y6GA 4JY7A 3TQFA 3PUYA 1QRSA 1TZBA 3SM9A 3DCJA 1G8AA 3QX9A 3KL4A 1FFWA 3B20A 1WW2A 4JP1A 4KVFA 3REOA 3TLEA 3AKYA 3LPAA 5HKKD 1L7AA 1ONNA 4JLWA 5F2NA 5JXHA 2PDAA 4R2KA 4R1OA 1E5VA 4UE6A 3DEKA 3OZIA 1I3OA 3TR0A 1CUSA 1VOTA 3TW0A 3C6MA 3UTCA 3QWBA 1GA1A 4XCVA 3DMDA 5CX4A 1MQ8B 1D1SA 1O9BA 3MTQA 1FDTA 3D2AA 1JFFB 4PCAA 9LDTA 1FFYA 1QRAA 4L4RA 2XUIA 5HIKA 2RK6A 3MFQA 4OB8A 2D1RA 2XAAA 3PTZA 3T38A 4KBFA 5AKZA 2B1QA 3EOAI 2DPLA 4HR7A 2BGIA 2QU7A 3AVPA 3CRNA 4FD2A 4CCSA 1VI6A 3IEVA 1U5BA 3NIGB 2GJ9A 3IE0A 5IFLA 4GDMA 1VPWA 1TADA 5EZ5A 3KKMA 4GKJB 2WTMA 4JENA 1RZRD 1GN8A 1PS8A 1WVGA 3G7UA 3RTEA 4J6FA 4JWTA 3UPDA 1N5JA 3ZHYA 4ER5A 2BKEA 3DKVA 5C7IO 1UMKA 3ZWDA 3COVA 4TV8F 5IJAA 2V0GA 4PX9A 1V25A 1FSFA 2QBYA 3KSBC 3HJFA 2LV8A 1EM8B 1F20A 3Q3GE 821PA 3WGVA 3MERA 2EQAA 3RFVA 2YDXA 3X0DA 3D6HA 1NXQA 2R6FA 3SYLA 3K0FB 1MC5A 1GQOA 4QPCA 4X6LA 5ELXA 1W96A 1PYOA 4GBMA 4H18A 1WF6A 4KXXA 1NZJA 4RVUA 3JQ9A 2NO4A 3L79A 2IKSA 3GR6A 1DNPA 2IL1A 1T24A 1T9KA 1V45E 3WRWA 1GUZA 1JDZA 1LH0A 3RC8A 3SFTA 3O74A 2PX4A 3JD2A 4W8GA 3DE0X 4IO1A 5ARDA 2X3FA 3V3KA 2B3DA 1W4RA 3CURA 3Q9LA 3R4VA 4TGLA 2G63A 1M72A 3M1YA 2NZWA 1TYZA 3P0RA 1IXKA 3LCJA 2Q5FA 2X0IA 1XDSA 2D6FA 2IYSA 4NOKA 2OCXA 2EKBA 3ISJA 3NTUA 3MXOA 1TTQB 3AI1A 3PUHA 4EF5A 4TTQA 3P2MA 1ZVJA 1G8YA 3I5UA 4IHQA 2IPXA 3MCVA 4BGEA 1P60A 1AS3A 4ETIA 3BA6A 4UTRA 4A4DA 3V6MA 2VJDA 5CDYA 1DXQA 1KSJA 2PR7A 2ZU6A 1PNTA 1NN5A 3LX8A 3M4XA 4TV8A 1DQYA 2HRCA 1JIVA 1U02A 4FJ1A 1G6Q1 4IH4A 3KQWA 1TGYA 1WM1A 2OP1A 1N34B 3V80A 1RBMA 3HHEA 2F6RA 5D6OA 3LX6A 4V0ME 2MCFA 4F8EA 1OGYA 3EWNA 5I7EA 2ZZNA 5I01A 1CE8A 4OHFA 4I3HA 5FA5A 1K86A 1CY2A 2WP8J 1U99A 2KM1A 2R00C 1O6BA 5F7ZA 3IAM1 4H1TA 3N70A 3PNMA 1U7HA 3SJBA 1DJNA 1I2AA 4NNJA 1LW6E 4OXKA 1E3MA 3KB2A 4LRQA 5AESA 2BFBB 2BEKA 3BZUA 3MELA 1GDDA 2VDNB 4MQBA 3ZPXA 3SJUA 3CNQS 4X91A 2UXCB 4C5BA 2C57A 4D9FA 4HPXB 2BEJA 4CRWB 1GOTA 1GUYA 2GPTA 4OMFG 4WGGA 2NVWA 4DLLA 4ESVA 1EXWA 3JU3A 2GWHA 4EQ6B 3VU3A 1ZD5A 5K3CA 3S70A 4TZ0A 4X8MA 4AAYA 1DUSA 2JA2A 2NU7B 3HN6A 3TSCA 5B4UA 3UOAB 5I7WA 5H3HA 3I9FA 1THGA 2JLAA 4JDPA 4BMDA 2WA2A 4NNPA 2XB6A 4IJKA 5DVZA 5DM0A 1JXMA 4JCOA 3G2HA 3JAWB 3QFRA 4NAVA 4YH1A 2ZYWX 5JS1A 4UAVA 2G4LA 1XEXB 3BRQA 1KZHA 2ATIA 2QL6A 3UTDA 1O95A 2BBOA 1ZVQA 4PW0A 2P9FA 3NOXA 4IDGA 1M6EX 2VNJA 1NG1A 3FFAA 4Z5XA 5IAAA 4LI0A 1SXPA 1G3IA 2GLXA 3THYB 4LJYA 2VSYA 1E1RD 4OBXA 1H2XA 1Z7EA 5LN1A 4AZTA 3RSSA 1NQWA 4U7FA 2AZTA 4LHEA 1PK7A 1T2CA 3GVCA 3JRWA 1FK8A 2GT1A 4ZO9A 2VJQA 3CLSD 1BXGA 1Z17A 3NORA 1T9ZA 4YAUA 4MARA 2JFXA 2VTVA 1T3ZA 4PWZA 4IIJB 3WFZA 2X7JA 4DSNA 2XGSA 1G5IA 1PWZA 1RTKA 2YVAA 4B6RA 2XVMA 4DUZB 4JUIA 3WE7A 3V4RA 1JECA 3JR3A 1XYVA 4LF5B 4D4JA 3K32A 5DPMA 1DKUA 1GLNA 2OGWA 3EXEB 3L7YA 3MOSA 4X45A 3AR5A 3LC1O 3O4FA 1KZ9A 1UP4A 4OGFA 2YUIA 4S1NA 1H23A 3PDUA 2D1YA 2NO5A 3NVAA 4K7JA 3P9QA 2YC4C 3RAFC 5E3JA 1ORWA 1QH1A 4YRPA 4H16A 2B3TA 1J22A 3AHGA 1QFMA 2VRNA 3CN7A 3R5HA 1TGVA 3WSTA 1JIUA 5CDSA 2PYZA 1L2TA 1TJYA 4OMCA 5HZGA 3HWX1 3CNEA 3BJRA 4DMUB 2DOKA 2EZUA 2QTZA 3EQ7A 4PG4A 2AUNA 2WOJA 3J7TA 8MHTA 4AT1A 2Q0HA 1ECJA 1X1TA 1PTJC 4B5KA 3ETDA 4RIGA 3IEKA 1OX4A 5IABA 4NOLA 1M9NA 2P2SA 3G23A 4KU4A 3MWYW 4Y2YA 5HE9A 1KPIA 1PWEA 1LFDB 2OPBA 2WF9A 3DZJA 4ZD6A 4D6YA 2ID4A 1L9KA 3C48A 3HBLA 1I7NA 2PGDA 2G5CA 4ND2A 4OV6B 5A3QA 4GRAA 4ENQA 3M0EA 1KDPA 4O4IF 3NTRA 1E59A 3BFPA 4QGSA 2FDXA 4N5DA 1BCRB 4FZRA 3V48A 1HDXA 3KWLA 2B5VA 3CBGA 3F4KA 5DWDA 2OT3B 2HRQA 3IULA 4JQCA 1QVZA 1U8XX 2I65A 3ETNA 2EBUA 4FINA 1L7NA 1JG6A 1VB5A 4O29A 5FTKA 5M34A 4QYIA 1LLFA 5H02A 2QRKA 4PAWA 3URMA 1IUOA 4OYHA 3VU9A 4JOCA 4XVQA 1II0A 2IBSA 3EXG2 4N8DA 4NU8X 2LWIA 1E96A 2PIDA 3NBQA 4CM8A 1ZA1A 3HDTA 2J3IA 1ABFA 1MNAA 1NMEA 2BGTA 2BY4A 4QJ3A 3RH0A 5ALWA 1KJWA 3AUTA 3BTVA 2ZP1A 2XKKA 1NVWQ 1T26A 4KPUB 3FGNA 5AWFC 2F1KA 5EJEA 3CLSC 1IPFA 1T9HA 3PUXA 2P8JA 4XRGA 3COYA 1Y9EA 2OG2A 5HDBB 1LKZA 2H63A 5DSXA 2XUFA 3VZSA 2PMFA 3RWMB 4WAUA 3U7JA 4U2GA 1JHAA 5CT8A 1B0ZA 4P86A 2YV5A 2P3LA 2VZEA 1YJ5A 3S2UA 3P9SA 2F1JA 3LT2A 5A05A 2LZ0A 4JODA 1XHEA 2XA9A 1JPJA 1U1EA 1QZXA 1DQPA 3OLCX 4FGKA 2BMEA 4O4IA 1JAHA 1G42A 1O58A 2FWJA 3PQ8A 4TTPA 3RVSA 4HAOA 4NZZA 4GLFA 3O92A 3VNBA 4L7VA 1Z4IA 5HKLA 4Q4HB 3AJRA 3P0HA 4W5HA 1U8YA 2OQIA 4LXYA 5LQJA 1D8TA 2CBGA 2VRBA 4TMWA 1H85A 2OCYC 1VL5A 3C3XA 3IUQA 4G63A 5CX1A 3BT7A 4MYUA 4Z1MA 5FOTA 1WOYA 3B48A 4OHXA 2MYPA 2VQ3A 1T9GR 1NYRA 3IEXA 4U7TB 5TVKA 4PO8A 3BMNA 2IOFA 2JJQA 3SOPA 2JI8A 4TL8A 4BV9A 3E4CA 2X0FA 2GPWA 1Z18A 2NMVA 1XDGA 1P1BA 3RD5A 4J94A 1USVA 3SR3A 2GEVA 4RGYA 2D74A 2R65A 4IVQA 2ERCA 4PVDA 1LNSA 2YY5A 2WYUA 2J46A 2GPSA 3OEHA 1Q1ZA 2GJ4A 1IM8A 1ZH4A 1SC6A 2A0FA 3FJOA 3LM8A 5BVGA 1WY5A 5HF6A 1UBEA 1Z0UA 4M0UA 4ZWNA 2SKCA 4DV1B 1PRYA 2UVPB 2QRVA 5I6DA 2E3JA 1XD2A 2D2XA 2Y2UA 3DEZA 3HFGA 2GWRA 4TSRA 2M1ZA 1QNLA 4M1EA 1I5OA 5CLHA 5EXXA 3ZDRA 1QHGA 2YOHA 3LBFA 4MWDA 1DRUA 2IHJA 1XJ0A 2X2OA 3TNYA 3HDYA 3K9LA 1U8TA 1EHIA 5FPHA 4NPCA 1UBKS 1M10A 4HGOA 3N0WA 1KAQA 1NSTA 2EL9A 2XHEA 2BM1A 3HK2A 3E9NA 1BSVA 1CJKC 1T5IA 5CT9A 4FNMA 3LC2O 3UKJA 5KHOC 1KFBB 4JVOA 2BDEA 1V1RA 3A32A 2C5SA 2R1ZA 3AF0A 2OV2A 1T25A 1TOAA 3AM5A 3CG0A 3V8QA 1TCVA 4GW3A 2IEIA 1W73A 2SBTA 4IQ0A 4L73A 4RMIA 1J99A 3OE5A 3VPFA 3GRUA 2FEMA 3H2YA 3MUOA 1BA2A 3G5TA 1MTOA 4Q03A 4XFJA 5HG0A 5JBNA 1O54A 4YAKA 1VGVA 2GJAA 3VR4A 4AMBA 3UB2A 5KKAA 2C4UA 2J4DA 2EZ8A 1ZONA 1POXA 1TQDA 3ROEA 3W5CA 1YQQA 3IAXA 3O8QA 5AVVA 1R8XA 3HXQA 5A0FA 4HZIA 3A37A 5BQXA 1ZY2A 1KZGB 4EL5A 4KIUA 3M1LA 4X3OA 1XHFA 4L5AA 5IANA 2WIBA 3LUFA 3TDNA 4CV3A 2ZQYA 4P36A 1QQ7A 1VHQA 1Y3FE 2Z2ZA 2Q1YA 2GA8A 4ZOAA 4I1PA 2JPDA 2HCJB 4NZYA 4MLPA 5DHTA 3RSGA 1ZA2A 1NBWB 3ILXA 3ZXSA 4YMHA 3UJNA 3C6ZA 1I24A 1J06A 2JC3A 2PX6A 2JFOA 3DQQA 3BMQB 2ECQA 2FPOA 1PZHA 1LPMA 2PUFA 3HKEA 4GXQA 2Q49A 4UBIA 2J0UB 3DR5A 4EARA 2A9OA 4JI4B 3HP7A 3GROA 4JLVA 3D6JA 5HM6A 3X1ZA 2A4KA 1OREA 5F1YA 5HBGA 3WGGA 4C0AC 4LOLA 1SA0A 1T8YA 2BC9A 3H9GA 3RV3A 2QN7A 2AQKA 1TNDA 1YD7A 3IQGX 4I1OA 4YLEA 1W85B 2BRUA 5ECGC 5IHXA 4LGMA 4J2OA 5DYNA 3I12A 3FMFA 4TM8A 2MMCA 2OQ2A 1GTMA 1V5EA 4OP1A 2IHNA 4YRMA 1Q3KA 1GNSA 1YCGA 3H8WA 4HH0A 4QXOA 4BZWA 3SZUA 3NBXX 5JZOA 5REQB 5M04A 4IGEA 3ZVRA 2YVQA 2FOXA 3NWEA 1QF7A 1Q92A 4BIMA 2VZ8A 5LQCA 3JALB 3HKDA 2I4MA 4H35A 4RKFA 4TTIA 4C7OB 1P0PA 1YASA 4YJFB 4R1PA 4BFXA 2WNIA 2G4VA 3LUDA 4OAOA 4ZJYA 2C5HA 3I05A 4PPNA 1NMQA 1S96A 3NUZA 3N3BC 1E2DA 3OFVA 4CV0A 1MA0A 1RJWA 3ECSA 1LDEA 1GU7A 1GPJA 2MTBA 3KYDB 5T67A 4DG8A 4ARVA 1U98A 2Y6VA 3UMFA 3FKJA 1VYHA 3GV0A 2JARA 5H16A 4K9DA 4N6NA 4OFWA 4DLWA 4EAAA 3DAFA 5DIZA 5F64A 3QKUA 5HF8A 4JI3B 2JNWA 1TU4A 5JANA 3B8HA 5HIJA 2Y71A 4LUCA 3KPYA 4HGYA 2NUTA 3K2EA 4MRNA 2KLBA 2QLBA 3S55A 1IWOA 1IN8A 3NG1A 2CLFB 4KO3S 3S2SA 4D9MA 3HRKA 4D97A 3PNKA 1H0SA 4GZ6A 2RHOA 4C29A 3VR6D 4R84A 5ALOA 1O0SA 5DT2A 3ZV5A 3PNLA 4AY6A 2BFEA 2PMCA 2W2NA 3C3AA 4JITA 2MMGA 1QIKA 2FHPA 3B2EA 4RK5A 4D79A 2W6JD 4MCIA 2DULA 1AGXA 4IWXA 5B1EA 5J4VA 5JZMA 1YK1A 4G5RA 1AXRA 3UFXA 3H75A 3P2EA 1SCNE 4UHEA 3CBQA 3MIIA 1E4EB 2NUPA 3N2YA 4IMRA 5T6BA 1Y8CA 3DA8A 4BNKA 4EG8A 3EDQA 4JSRA 4FM9A 3EIEA 1A7JA 1RKUA 1HT2E 4G2NA 1L7MA 3FF1A 4WHMA 3SEFA 1ADYA 1K6MA 3Q0EA 1XA0A 4EB6A 2CHFA 3OQJA 5L3QA 3R9WA 1EESA 3O47A 1U7OA 3PTAA 1KY4A 1GR0A 2EW8A 2FPGB 1LB1B 3H4MA 3NDJA 4GZ5A 4J29A 1U2GA 2FE1A 4G1MB 3QEJA 3CV3A 1KI2A 4P58A 3NQ41 3EGIA 2H1IA 5JO0A 5C8DA 3COJA 1ZMTA 1PGOA 1UT5A 3DNMA 3F9RA 3R1IA 5DOVA 3UCXA 1LRLA 5JS8A 3N2NA 3EF3A 3GCXA 5F1PA 4L08A 4JBIA 4BC1A 4FOTA 1SZJG 1YR7A 4B45A 4MV1A 1C30B 3SM3A 3TQIA 3BMOA 1PS0A 1R4NA 1UPFA 3H2BA 4AMYA 1BJRE 3TE6A 3I09A 5B53A 1W19A 1E6WA 1Q3TA 3O3CA 3F47A 1RLIA 4NU5A 2IZ1A 1SVSA 1SXQA 3O8OA 1BMQA 3QPVA 3CX7A 3DKIA 4IZOA 4F3CA 4GKVA 2XUAA 3LHSA 2YFKA 3EFEA 5TJHA 4FEEA 1IONA 1Z0FA 4PSCA 3ZYCA 4CLOB 5MN6A 3DT8A 1GZDA 1OR8A 1US8B 4HVTA 4D8VA 2OB2A 1YJXA 1G63A 2P0YA 3FHOA 5CPBA 3WB0A 3KYBA 1U3GA 3CO0S 4JC4A 4X20A 2BH2A 1SZDA 3GEEA 2BZSA 1P7WA 3JVEA 1G7SA 3AL0C 5JALA 4XWWA 5EHNA 3D2BA 5JAZA 3B3JA 2WG2A 1WDKA 3P0EA 1O4VA 1UJ6A 4ZVOA 4XX1A 5KCMA 5U4QA 2Q4DA 3T35A 2EXXA 4N8EA 3CISA 3NZEA 1P9OA 2ZIUB 1CNEA 3HY3A 4DQXA 1P5HA 3DMYA 2DCMA 5E9JA 4XGQA 5TGTA 4D9IA 3HA2A 2ZBGA 1NXPA 5CDUA 1FYVA 2BE9A 2WUEA 3H2KA 3IE2A 1ZIPA 3MUEA 4IIGA 4NH4A 3WLEA 2WHQA 4QKQA 1NL3A 5A4KA 5A9RA 5LZ8A 3WWEA 4L9AA 1NU6A 1Z25A 5JEEA 5HRUA 3HM9A 2JFUA 1HKUA 3HCDA 4KYUA 4UMDA 4LTDA 1ZVMA 3DMTA 1IIRA 1COWD 4W9NC 5HKAA 3U4GA 2C2GA 2ZRIA 2ODPA 2QIOA 4JL5A 3ZU6A 2CJWA 1QE3A 1KL7A 1GPUA 3JRNA 4KGDA 4PAQA 4LGYA 4Q66C 5G2OA 1DSSG 1YMVA 2QROA 3A36A 2RG7A 2IPOA 3QKSB 4WK6A 4C6RA 2PGIA 4HH4A 2HZ7A 1V1MB 4LJKA 4LN1A 3AL3A 5TGZA 1YVDA 3IEPA 4NAUA 3VBEA 1C7RA 421PA 3C3DA 4JJ6A 1ZH0A 3NV9A 1QVWA 3ROQA 4C4TA 4CTKA 2ZJOA 3D6NB 3CVJA 3LUPA 2QUJA 2P2ZA 1IG0A 2FMHA 3TLGA 4KE6A 4A8JA 1CRQA 1JPUA 1E4OA 4FYIA 3TO5A 1V2HE 4A8TA 3OC6A 5SYNA 3K5HA 2W48A 3N75A 5EFOA 4G3XA 4DW8A 1KFCB 3PA8A 1EB9A 1FNCA 2PGXA 3VO9A 3DUWA 4ILKA 2I3BA 3FM9A 5BWBA 1SZPA 1VYUA 1ISRA 2H5IA 2Y05A 2ZBEA 2PV7A 3OFND 4HDSB 4P83A 2GNPA 1IAVA 5ALTA 1WB9A 2WMOB 4J07A 2IF0A 3C8ZA 4DUPA 1ZL0A 4P7JA 3UQZA 4CGYA 5L45A 1SXJD 3B5JA 4YDRA 3OT1B 3ZCQA 5FWXB 1UWVA 1J5XA 5TIIA 2CMDA 4CMCA 2R7AA 1JFSA 1CUAA 1OJLA 1XROA 4YPFA 5H5JA 2VDWA 1RC8A 2XUKA 2BGMA 1IN7A 3AUXA 2OQRA 3BM5A 1YWGO 2ZRPA 3H0EA 3EIFA 1E64A 4HNSA 2VYVA 4Q02A 1PJZA 4DRXB 1R0XA 4PYRA 3IILA 3OA0A 3PLNA 3W5SA 3FCYA 2ONKA 4CMKA 1HEYA 4DLAA 2BEUA 1IPHA 2XQIA 2JLVA 1G20A 3T4XA 4WT7A 3R7NA 3T3GA 1UOPA 1Y98A 3E9MA 2GBIA 2IX3A 4CKEA 1RXVA 1MX9A 4L5BA 3Q9NA 3SIWA 4FFWA 1EJ6A 3ONDA 5C5IA 4GM0A 1WXXA 4R7GA 5EXTA 3BWCA 1WZUA 3L8GA 4GSLA 1Y7PA 2AA3A 2ILVA 1TE2A 1MAHA 1ZNYA 2JFPA 4TLCA 3PE3A 4WKOA 1DBPA 4CZ2A 2R6CA 3QYFA 5CNMA 2XRMA 2YX1A 1IATA 3L8EA 2QSUA 4KDRA 5K3BA 3AF2A 2I62A 4FD3A 1OB2A 2XDAA 2I4LA 4FPXA 5L3ZA 1Z68A 2ZYGA 3HEAA 1FXSA 5BMOA 1SKMA 4IZHA 4H6VA 2RBKA 3IAEA 3OJ0A 4Z9AA 4NC9A 2I91A 4F3TA 1QDUA 1DHTA 2O07A 5L8VA 3UV7A 4UCFA 3EF0A 4WADA 1XDUA 4RLSA 3M7IA 1GGEA 5JXGA 5J23A 4XWTA 2YW2A 4YRDA 3RGGA 1ENZA 3E0QA 1AKMA 3I5AA 3L8FA 3G2OA 4TWJA 1V0JA 4LRXA 1FFDA 2XNHA 4HNAB 3TR6A 4X64B 1DXYA 4J76A 4IHJB 3DLAA 4GG1A 2QD2A 2UYYA 6GPBA 1M2GA 3WMEA 2HYIC 3QE2A 5COQA 5LLSA 2J3LA 2CD7A 2AMLA 2XLCA 1Y3DE 3NIFB 4E1BA 5LPNA 5FYQA 1U5AA 3TEMA 4E5VA 4U7DA 2BR5A 3LCUA 4P33A 1SXJC 3ONNA 1QPBA 2X4GA 3DBHA 4NBVA 4P7GA 1DEXA 2QRPA 5E38A 3ZOZA 1FL9A 4BU0A 4UNRA 2P4QA 5C2JB 1AKWA 1BEUB 1I1NA 4JYMA 3OZWA 1NVAA 3R77A 2C9OA 2P0AA 4KXQA 3UY4A 4AKTA 5ITVA 5B1DA 2HQSA 4BNTA 1JHRA 2HC9A 2WAXA 2HUNA 4XUEA 3S99A 1W8DA 5DCYA 2IHZA 3TM4A 4INZA 1O2DA 4X63A 4CFSA 2QVXX 3OTHA 1JIKA 5TMDA 1E9VA 3RQIA 3ZHZA 4Z7NB 1RKBA 1JDVA 3AX6A 3JZDA 3WQSB 1FUKA 3R5FA 2A35A 1RKXA 4ZVPA 2QQ5A 1W5FA 3KQTA 3IOCA 3WIOA 4FDTA 1ZS9A 1ZM3A 3WHPA 1QU3A 3P1JA 1CUXA 3A6EA 3C5VA 3CM0A 3K16A 1Z7WA 4NL4H 4PZPA 4D99A 5A1JA 1IULA 3LKDA 3V7UA 3O2QB 2ZB2A 3FFWA 4NJEB 2ONJA 4D57A 2IHBA 4YCNA 4HMQA 3OF5A 1UFRA 3PE6A 2NXNA 3BXOA 3B38A 4KRYA 3SQDA 1XRPA 1W1WA 1VSQA 4TVOA 1BH2A 3CZ9A 3C5CA 4RENA 4B8YA 3GLGA 3KB8A 1I3KA 1Z73A 3KOMA 4FBGA 1U8AA 4OQPA 1G291 2WWGA 4NFHA 1G64A 3IQXA 3CQ9A 3V42A 1QFSA 2VAMA 3L7CA 3QVLA 3HCOA 1XEWY 5J59A 1FRZA 1VHLA 6ADHA 1AG9A 1BN6A 2AMJA 5HHTA 3VV3A 3KQQA 3TTUA 3E61A 3SJZA 1ZOLA 2RHLA 5I45A 5JTTA 1IQUA 1V6CA 4DIFA 1GTG1 2RKBA 1IVYA 1SB9A 1SCKA 4QD3A 5F7OA 4EI7A 4G0XA 3AVUA 4RJ2A 4B47A 4RHTA 4OI2A 2P6OA 3GOHA 2CD9A 1TPYA 3KU1A 1SBTA 3BAZA 1MGPA 2FEKA 4O4JF 2VNIA 2Q3CA 2LE0A 3QE0A 3NCHA 4P93A 2QUHA 1SHLA 1WU8A 1ZN7A 1Y5RA 3HGMA 3OZDA 3KE8A 4V0QA 4FKBA 3LVRE 3GT4A 2AL7A 1ISPA 4ZDKA 4EPRA 1FFXB 2EEZA 1FTGA 2IZ6A 3EIWA 1B4DA 3I23A 4MKGA 5AJZA 1CQPA 3DO8A 4JL6A 4EI2A 3AC0A 1KAMA 4NG4A 4OXIA 3U81A 4A1FA 1WDLA 1W59A 3KXLA 1OX6A 4RTSA 3PQDA 4EBFA 1JAXA 2OQVA 1MPTA 1QP0A 4HDOB 2NUBA 4XCXA 1IY9A 5L3SB 4DV0B 1NBHA 3NJ4A 4LJ9A 2J7KA 3DZDA 4DQLA 2R48A 4MUGA 3Q9UA 2RHRA 2IXBA 1XLTA 4YUVA 4B34A 4KRXA 1TPZA 4BNYA 1YOVB 1QIDA 2VWPA 4UNQA 3PC7A 5C46F 1DL5A 4N47A 5KJEA 3VKVA 5JD6A 2JFHA 1QANA 3B8EA 1A5ZA 4BO7A 5KJFA 4QM6A 5AXCA 2AB0A 4YAOA 3L7LA 3SDZA 2CDRA 5E4TA 1TT7A 1PVDA 3MA0A 4OXNA 3SQWA 3LQQA 3THRA 1E5LA 3PNPA 3F8SA 3WB1A 2XUDA 1X2EA 2ZEJA 3ZHSA 4A8PA 1BMFA 2DWQA 4OLJA 3WQRA 1EM8A 3LPNA 3OOHA 4KRGA 4UU7A 3JD0A 3RC9A 1XMXA 4Y6PA 1U2QA 1XZAA 2PH5A 4DBLE 1FFHA 3FPGA 4O4JA 1OXXK 1VKOA 2EFDB 4RK7A 4UM9D 5FOWA 4DPMA 4YV0A 1EFAA 5FOVA 2QLTA 3UYLA 1ILEA 2AE1A 3OQBA 1Q7BA 1WX1A 1CWUA 3D43A 1YS2X 2GHQA 3CZAA 4FHGA 4OJNA 5CLGA 5DDIP 5FWYA 3PNQA 3R5TA 4G09A 3EVZA 4PX2A 1YGYA 2VJNA 5CK4A 4AXBA 3FYUC 3D81A 1CQJB 4NZPA 1HDIA 1I1HA 4GKAA 3FDZB 2OBNA 5DHUA 5U4XA 1N36B 3IELA 3QVKA 2ZUVA 4YP5A 3WIBA 5HK9A 3O7MA 5JTUA 1C7QA 2GDZA 3L3BA 3IUBA 1TZJA 4LSGA 3L7MA 1JA1A 4ZP1A 5SZJA 1VDZA 3FB4A 3IVMA 2VA9A 5AKIA 3STXA 1SVIA 5AM0A 4P3PA 3ZCXA 1YZKA 1QB7A 2PAFA 4B6FA 1YNOA 2BJVA 1NNLA 1Y7HA 2QPTA 2SKEA 1AF7A 1K7XB 3T7EA 1JDNA 2Y92A 1OVMA 1T1JA 4HJXA 4JBWA 4PGAA 4XB6B 4Z49A 3FUXA 5KTMA 5ISMA 2VRWA 1XNQB 4NHOA 4QGBA 1TDJA 4ES6A 5AI4A 2PGAA 2CE2X 3UANA 4EFMA 3T7IA 1RLJA 3BREA 2I8LA 2HSEA 4ZYZA 2MR5A 5E1BA 4X66B 3RFTA 2H2WA 3NX4A 3H6HA 1CP3A 2FQWA 2XT0A 2PZGA 4FGLA 5AI8A 3ZCRA 5J58A 2HB6A 1WD5A 4OA5A 4AKIA 3ORQA 2HH9A 4XPIB 4LSZA 1CTQA 2VBIA 2Z2KA 3I58A 4QYXA 3S27A 5HZHA 3UKDA 2ZAOA 3U56A 1PKXA 3GW8A 2I1QA 3AY7A 5EP2A 2OHGA 2BFBA 4LY0A 3PDCA 1U81A 1ZFNA 4IIJF 3ZIAD 1IXRC 2GZHA 1P4JA 4EKEA 1NX9A 1OH5A 4PQEA 1KO1A 3GJXC 3R4CA 1WOMA 2NZ2A 3CTMA 1TYAE 1WUTA 2PH1A 2RK3A 4Y6LA 4EG7A 1M7GA 1O5IA 1SD2A 2IT1A 2J87A 3WDSA 4EQ6A 1CY8A 5ALGA 2P3SA 5JI3E 1N1EA 4DR6B 1HL3A 2NU7A 1CC1S 2V98A 3OQ6A 5D8DA 3OUZA 4F93B 4MO2A 1W87A 3AP1A 4WASA 3QITA 3TNFA 4D9EA 1YHZA 1B7GO 2CDCA 4Z6KA 3VX4A 4MVJF 4ZCTA 3HO6A 1NHGA 2H16A 3JAWA 1VKZA 2J3MA 3L6RA 3T3PB 3ZWKA 1XZDA 3BGIA 1XEXA 3OLQA 3TJZA 5L9AA 2ATEA 3PR3A 1D2CA 1GGHA 3K20A 3LZCA 2C9DA 2AG0A 1WA5A 5G53C 4HUTA 2XE4A 1OWNA 1F4VA 1YZVA 3ABIA 3WY9A 3K53A 5AJHA 3W5JA 4ABTA 4TLAA 2J09A 3E18A 4WXEA 4HLUC 2H3HA 2GBPA 4QRDA 2VPPA 1TA4A 2G07A 1KDTA 1B23P 1P45A 2QOEA 3A6DA 1G1AA 5DULA 4DLSA 4YAJA 1QMGA 1PJSA 2DFPA 4B9AA 3ZJTA 2A0UA 4C7XA 2EHDA 4TVBA 4DA8A 2IS6A 3G2NA 3G2JA 4IIJA 4O1MA 1OH6A 1I7LA 1PR1A 2XQFA 2B83A 1Q50A 4XWAA 4B3FX 3B1FA 4U7HA 2WHRA 1MC1A 4MUBA 3I9JA 4TYWA 4KR0A 5AUQA 4B6QA 2JGKA 4KX3A 3D8RA 3FVWA 2Q9AA 1EVYA 1W5TA 3FJ1A 3TPZA 3ICQB 2JFWA 4MUAA 3HUTA 5B64A 4S0XA 1LVUA 4QUHA 1XCPA 5ILQA 3HEBA 2PXCA 2YXBA 3M4JA 1T2AA 1J5PA 1JJVA 2BFWA 1KOJA 1YDFA 2O20A 5SY4A 1I6WA 4F0JA 4IH9A 2ODQA 1HFWA 4MS1B 2V0CA 2B0CA 4WFIA 1WZ2A 3O0DA 3C6KA 4MVJA 2ZW9A 2FVXA 2RAFA 2FSPA 1CS4C 2VTBB 1NYTA 2XVAA 1FMTA 3A7EA 3E7FA 4OQYA 4CMIB 5KYWB 3R3YA 3JQBC 4JOQA 4ANFA 3NKVA 3CLVA 3SC4A 1A9ZA 1WB6A 3GDHA 4LXIA 2QSJA 1SPXA 3CKLA 4GC9A 4RELA 1SHKA 3S7TA 1M1YE 3B5IA 1JAIA 3G9XA 4AURA 1TCCA 1P81A 2PYIA 4HDMB 3KZXA 1X13A 3VZCA 5CVDA 4KQEA 1YCDA 3W6ZA 4H6PA 3TLBA 2J1LA 2BGJA 3DZGA 3TZBA 1T5TA 4YCDA 4DWJA 3WDKA 3SXJA 2XCOA 3RRJA 3G8CA 1T4MA 3OBBA 1YXMA 2FUKA 1JG1A 2DHQA 1NJSA 1DCTA 1JE1A 1NV9A 1WXHA 3L0IB 1GSOA 4PLHA 3YASA 3EQZA 3GMTA 1YVPA 1MKYA 2QG9A 1ZOOA 1EWRA 4GX0A 3EC1A 2PSSA 5BV1A 5DHAA 3Q8XB 2NO1A 4IWNA 1SUWA 1K06A 2GN4A 1DIRA 1YMUA 1PEDA 3EGXB 3JYOA 3AI7A 1TM3E 1E2QA 4C22A 4JFRA 5IVKA 2A84A 3E48A 1I2DA 1P31A 4QSMA 4PNHA 1AMUA 5EP3A 1E99A 1YB7A 4J0GA 2C2KA 5A04A 4EG0A 2K2WA 4ZK2A 4BMZA 1OTYA 2A5YB 5CYGA 1J9GA 1GXSB 4D96A 3ASUA 2V7XA 3CRQA 2W93A 4EKGA 1QFZA 1TJ5A 4KPUA 1ODSA 4PO3X 1OT3A 2V3WA 2FMIA 1AQUA 4KWHA 1E69A 1KI9A 2PY6A 5T57A 1VJRA 2XUHA 5G1NA 4HZGA 2VPIA 3DFUA 4Z99A 5L40A 1ZM2A 1SC3A 3DTVD 2HO4A 5BYKA 4CU2A 4HF7A 1T34A 1YFLA 2J7PA 1XQ1A 1RYFA 4BLOA 2XOXA 3IKLA 3L0PA 2QD3A 3NTVA 2IEDA 3A9UA 3W2GA 1GCOA 3T94A 3QVJA 4Z4GA 1H2RS 2D4HA 5JO9A 5EJ5A 3WYAA 1NOIA 3OP1A 5DFAA 2IODA 1UBLS 4RF3A 4HGRA 3UJCA 1PQUA 2EGHA 3MCAA 1XG5A 4HDNA 4Q4HA 1JU9A 3D3NA 3NTXA 1EGQA 2X5JO 1MLDA 3K4HA 3MD9A 2XWSA 4OQ4A 2X23A 4EY7A 3W04A 5ALDA 4BBZA 4DDVA 1F1JA 2FUG6 2ORWA 2PWZA 4OHPA 1WIWA 1UK8A 3UXHA 5DMXA 1J1IA 2GK3A 3OUUA 2VH1A 3FDXA 1FQWA 4YECA 3TSAA 5BRJA 3QKRB 2RGBA 3KHUA 1JQJC 4ZMBA 3NT2A 3GPLA 3A0RB 1E94E 5K99A 1V4BA 2BTEA 2VXCA 4E6EA 2OBLA 3WZ2A 3CE6A 2B94A 3K9CA 3PFKA 1MW8X 3DFMA 1JB1A 1MC8A 3D7NA 3MJHA 4AS1A 2VOJA 2CLLB 3HJNA 1QUEA 4TX1A 1OV4A 2GSWA 2NXEA 1PIWA 2I6TA 3RSLA 1OW3B 2ZSEA 4RTLA 1J2JA 3L1UA 4HNUA 4ZV4A 4ME6A 2COKA 4B7AA 2OUIA 4YT2A 3DMHA 1NN0A 1MB4A 2GEDA 2H52A 4LJ4A 1B00A 4FYHA 3RB8A 3RVPA 3W06A 3WLOA 3WWZA 5CFZA 5EXDA 3ZDDA 1JPNA 1FDOA 2R68A 4WOBA 2POCA 4AZVA 4BB6A 1LLDA 3RRXA 4DNFA 2YN4A 1J1UA 2C00A 1JMYA 1PSDA 4H1VA 2CK3A 2VDOB 2IEBA 3BCUA 3EZFA 4X84A 1KVUA 1W46A 4DA0A 1U2DA 3HJTA 3LS2A 3LY8A 4PHHA 5EXSA 2B5OA 4ZVLA 3SHVA 1EU1A 4J0KA 4A2WA 2O0KA 2FPWA 1EQUA 3SN6A 2ZYSA 4EG5A 4R9VA 1MXFA 3ZYZA 4TPKA 1BTOA 1L7PA 3D7MA 2V7EA 3AKEA 4G26A 3VC2A 1YO6A 4F46A 3KETA 3QEBZ 1R37A 4BWFB 3OLVA 3Q8MA 2BFCB 4BLUA 2GZDA 3JTEA 1IXYA 5THXA 3H7AA 1C2TA 1JILA 2HO5A 4ZVRA 2J5BA 4HMOA 2Q21A 5L3VA 3UAXA 4AP9A 3FBGA 2PL1A 1QX4A 2N1BA 4MYTA 1RMYA 2XCIA 1TKCA 1GQSA 2XQVA 3VOAA 4F86A 4NBKA 2NQ8A 1FNNA 1K8QA 1ESCA 4F3KA 5KWVA 4Q6WA 4YP7A 2XZOA 1XTPA 3FZGA 3GJ3A 1UM9B 2P5TB 3NBUA 5FHQA 3WADA 4ND6A 3WA7A 4L9RA 1V8PA 4D0LB 2W6MA 1QRRA 1YFKA 4M21A 3ZWVA 5C1BA 1Q7GA 4HWGA 1OJ7A 2J0UA 1ZUHA 4OYRA 1W4AA 4F1WA 4NV3A 3CEJA 1Z0JA 1C9NA 1U9CA 3GVHA 3LJKA 2JHGA 4L9SA 4X0EA 1ZK2A 3K2BA 4E2XA 3D5TA 4CODB 4ON9A 3PGVA 2HU8A 4AJ2A 3AVYA 4G4SP 1TRKA 4CMJA 1J20A 4F6LA 1W85A 3HFRA 2FOLA 3VGPA 3FSGD 1RPJA 1U7DA 2GGSA 2W8BA 4NECA 3A2KA 1AA6A 1AF4A 1ZITA 5LMUB 4L5IA 1XK6A 2Q9UA 1KE2A 4G0NA 2YZ7A 4TKMA 5REQA 4EECA 4BQQA 2Y1WA 4V39A 3RU2A 3F5QA 4Z51A 5D3MA 5C8VA 2LR0A 1C8LA 2JRCA 2RGUA 2ZCVA 1NTRA 3JALA 3N8IA 4H0FA 4ZA2A 5LZ9A 4C7OA 2CMHA 4YJFA 3SYTA 2XF8A 1EVZA 2KS6A 5GWXA 2DECA 3D5EA 2WSYB 3MBOA 2YFYA 3R74A 5DTRA 3VVMA 2WNSA 3UF0A 2GJ8A 4UAUA 4OHBA 4I5DA 3VKUA 3VTZA 4C7VA 2HGSA 5I7HA 1R0WA 2B7LA 3KYDA 3E8MA 2P9YA 2J08A 3E22B 2CF6A 4NE2A 2O8BB 4AKEA 3VH2A 2M1XA 1H0KA 1PT7A 1G4AE 4MUKA 1UR5A 4OFZA 3USCS 2BMAA 1W5BA 3ZLVA 3FWZA 1T8TA 1N5RA 1QBGA 1G6OA 1N6IA 1RRVA 2OV6A 2VSNA 4D80A 4N1AA 4B76A 5INTA 3U49A 1GPDG 3ZE7A 4BFVA 1R00A 3VUEA 5LJIA 2XXJA 4MGEA 5G0SA 3S2GA 1QM5A 3S0JA 5KQGA 1VLLA 4NG5A 3MRXA 5A71A 5DBFA 1WCIB 2VXOA 1M2EA 3UMGA 5CVTA 4PGGA 2WIFA 3T52A 4JNCA 4H15A 4FONA 1T43A 3N6VA 1F60A<