4TTQA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with atp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 74
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttqA00
3M6AA 4LHYA 1E2DA 4POAA 3GLHA 1NJFA 5JECA 1WQ1R 1S2MA 2CNWD 1RRGA 3CRW1 1E9RA 5CK5A 2A5FA 3EIEA 4BFTA 3PUVA 5ELXA 2ZE7A 1DTSA 2VQSA 5FOWA 5TB5A 4XWOA 4PSKA 3ZLJA 2CL7X 4GP7A 3SFVA 3MLEA 421PA 1FUUA 5G3YA 721PA 1K5DA 4B3GA 4IDPA 4URWR 2QAJA 2VHTA 5DGXA 1ZJ6A 2OCAA 4LJAA 2A30A 2VHJA 4R71A 1EFRD 1KDPA 4MYCA 1IN4A 4Q18A 1XMSA 1UAAA 1KJYA 2F43B 4I99A 1XMIA 3CNNA 3TUIC 2FEOA 3BORA 4M22A 4OHZA 4OHVA 4DUGA 2EU8A 3FWYA 1A4RA 1F2UA 1F3OA 1OH7A 4B3XA 5LD2B 2DWPA 2P2LA 2J0UB 1XXHA 1GL9B 2QRNA 3CZPA 1QZXA 1T3SA 1IJEA 3LBNA 3Q3JB 4LHZA 4BECA 4II7A 1BMFA 3T12A 4EAQA 1E2QA 4TQUS 3GFPA 2AR7A 4DXAA 2JLUA 2O0HA 4XOIA 1XD2B 5F98A 3FKQA 1KI1A 4YMVA 2GF9A 4N1AA 1HT1E 1P9WA 1G3IA 1PVOA 2O8DB 4BZPA 4DSTA 2WZQA 3AVUA 3TSWA 5EZ5A 5G3ZA 4B3DA 2P5TB 2HJGA 2EQBA 3RC8A 2WOJA 1XD8A 2YOFA 2FNAA 1W2GA 2O8CA 1AQUA 4M1TA 1CULC 4R7ZA 4LWZA 1E2HA 1OLOA 4TYPA 1FNNA 3SJAA 1L4YA 2DCUA 3GP8A 3IIKA 2WWXA 1V43A 1CR0A 1COWA 3TUJC 3ZZUA 1P2TA 1ONBA 3W5JA 3NBFA 3VX4A 2FDCA 1DVRA 4NYJR 4C0BA 4CGZA 2ZYUX 1EGAA 1G5TA 2W83A 2CLSA 3PUYA 4DCNA 1CTQA 3EZ7A 5L8VA 4L4UA 1JR6A 4MKGA 4M0LA 1KK2A 3G82C 3EPHA 3SHFA 4BGDA 2GILA 1IXSB 2CLDX 3IO5A 3P27A 3VR4A 3I1FA 4A4DA 1YZKA 4OHWA 1L4UA 1TU3A 1G7SA 2EWWA 4QJ3A 4B3CA 2XSZD 1QG4A 1G3QA 3QOFA 1OT3A 3BB3A 3VQTA 2QNRA 4YC7A 4XSHA 2ZU0C 4GPTA 2C04A 2MSDB 5HKKD 2OFOA 4O2RA 1E9BA 1N3BA 4EPWA 4IDHA 1KSGA 5FUVA 1NBME 1B23P 3UWOA 2OO7A 2QAGB 4NE2A 3F3YA 5AK0A 1VCIA 2G6BA 4IDQA 3RWOA 3I62A 4NDZA 3QKSA 4TQ9A 2V54A 4BQSA 1YZNA 3A1SA 3QKTA 4B76A 1U0LA 1ZM3A 4OI2A 2V7QA 3U7HB 1VYUA 2NO1A 2ZJ5A 2WSSA 1WE2A 2GJ9A 2OCBA 4BLSA 2GJAA 3WP1B 4DDVA 4H9GA 1HURA 3X1XA 3B2EA 1OFTA 4PPNA 5H1YA 3VR1A 1X1RA 2BM1A 1IQPA 4KVAA 4NCIA 2ZAMA 1DO0A 1KZ7B 4FMBB 3LW7A 5FBQB 2AX4A 1U2RA 2V6JA 5DHAA 2C8VA 1XTKA 2R2AA 3VHLB 3I8SA 3GMTA 5CIQA 4Q4AA 2DWQA 2VP0A 2NO6A 1CP2A 4UXIA 4GRAA 4CYMA 2OILA 3CNLA 4DCVA 3AF2A 1VKJA 3MRSA 4PX9A 4XH9B 5JJIA 5J47A 1WCV1 2GJSA 2WKQA 2RCNA 4NCHA 1Z0KA 2Q3HA 3FKSA 4IOMA 3FMIA 2UZIR 1WBDA 2C9OA 1W4RA 2P6UA 1KI4A 2A3RA 1FOEB 3KFXA 3CBQA 2BV3A 2OZEA 2WWIA 2GAOA 2LKCA 4KBFA 1KMHB 5DI3A 3W5IA 4JLVA 3RRNA 2RGDA 4P31A 2W6IA 4I1UA 4PPGA 3RDPA 3WHLA 4HAUA 5DISB 4ACBA 1BO6A 3ZVRA 1OE0A 3A6PC 1S4QA 4WIAA 4C2UA 4QGHA 5IHPA 2NPIA 2CVHA 4Q4HB 3KKQA 2X1VA 1ZCBA 2JJ2A 2HCBA 2ASEA 4C0QC 2IYUA 2A5JA 2IYLD 1FMJA 1JECA 1F5NA 1M74A 1XMVA 2W00A 1TL7C 3IO3A 3SQXA 4AI6A 3PIRA 4Q1FA 3T61A 1NKTA 3EIHA 2ZS7A 2JDIA 3V9PA 2GWHA 3GEIA 3SQWA 2VP9A 3C5CA 4URYR 1OFUX 2F43A 2VIIA 5DIFA 1OXVA 3I3SR 3GFTA 3N2IA 1CJTC 5L3VA 1E9AA 4C7OB 1LW7A 4FXPA 4HLCA 4L9SA 1G9XA 4UJ3A 5C4GB 4YMUA 3BERA 3HWSA 4TLDA 4S35A 2J0UA 2JJ1A 2H5EA 2BC9A 3P4YA 1P75A 4JLJA 1P2UA 1NBMA 1CJMA 5EP3A 5IK2D 5JI2E 3C5HA 2ZJBA 1A7JA 5FI0B 1KI9A 5D3MB 2D4HA 4JBWA 4B6FA 3FTQA 3GJ5A 4NZYA 4S2EA 2WAYA 3B1XA 1OKKD 3C15C 5DE3A 1N5LA 2QZ4A 3FMPB 4XIGS 3PUXA 2BEKA 5F9FA 2ZRLA 5DYGA 1XTSA 2OBMA 1DAGA 2VEDA 1ODFA 2CDNA 3QF7A 4W5WA 3AF4A 1JXOA 4LDJA 2G1KA 4FCVA 3JZAA 2E9SA 2P0EA 2G0NA 1G5PA 1L7VC 1XBTA 4BEJA 4N0DA 1N6OA 5FTLA 2XXAB 4M2LA 2A2ZA 2FV8A 4ARZB 4US0R 1M7HA 4FINA 3C7KA 4KVGA 4OQFA 2UKDA 2IF2A 3UKDA 2IEYA 2WJYA 1TTTA 3RWMB 3W6PA 3WMGA 3E5HA 4C0LA 1BIFA 1AS0A 1AM4D 3OHMA 4QRHA 3NKVA 3RRMA 3M4YA 3VMFA 2R6GA 3TUZC 3QG5A 4HAZA 4YXWD 3V4RA 1ZUNB 3A36A 1Z0IA 3GJ3A 4IXMA 4PAMA 3J81k 2J7PD 2VP2A 1XMJA 4OJKA 1EFRA 4K46A 1E2FA 1PZNA 5TARA 5A4JA 3REFA 5KUTA 1HE8B 2VHQA 1MRNA 1IAQA 2QTFA 2XITA 3ICEA 2X2FA 2Y8EA 1X8KA 3A1UA 2PL3A 1RRCA 4HI0E 3X1WA 1NRJB 1AIPA 1H8HA 4PQRA 4JZKA 3D8BA 4PO1A 3V4FA 4D2IA 2PH1A 2QAGA 2ERYA 4RD6A 5FFMA 4GOJA 4HDQB 4LJ4A 3ZGXA 3HDTA 3FFAA 4XTRA 1AS3A 2DYKA 4M21A 1IY1A 1QBKC 1XP8A 2PZGA 1BS1A 4ILEA 4Z8YA 4DSNA 4MGYR 4EFMA 3U7GA 4HLUC 3FMOB 1Q0UA 4K8OA 1KOFA 3EC1A 4DJTA 4US2R 1MO5A 1QHSA 3SJZA 3I72A 5FBLB 1LY1A 5K8UA 2QUZA 2NO7A 2FFQA 3NBZC 5DO9A 2ZE6A 2FZLA 3K70D 1XEWX 5CYOA 1R4AA 4W5HA 4Q9LA 3WBKA 5IRCD 1ZC4A 2XJ4A 3HR8A 3FHOA 1AA9A 2FMXA 3MG9A 3QBVA 4OI4A 3RSOA 4BRWA 3THYB 1UBEA 3SR0A 2QORA 3H2YA 2IHBA 2CL0X 3KFVA 4H1VA 5KSOA 3AQ4A 2CCKA 1O3YA 2YWGA 4QM6A 5B30A 3THOA 5FI1B 5KDOA 3UPUA 1ZRHA 1NKSA 4M1OA 4CVNA 4HAXA 5KDLA 2YV5A 4IDNA 4EQ6A 1M8PA 1ZIOA 5GJVC 4IEEA 3TAHA 1Y3AA 2O8EA 1NN3A 3QXSA 4D80A 5L3SB 3MWJA 2ATVA 1NSTA 1M6NA 2LKDA 1Q3HA 4YMWA 1IN6A 1KMHA 1ZU5A 3RS7A 3FOZA 3ZDQA 1Z22A 4L16A 5EP1A 2VPPA 5CDFE 2V3CC 3B82A 3NVAA 4K81B 1E2JA 1Z6TA 1ZU4A 1QHGA 1N5JA 4LYFA 5AUPB 1KDTA 3QQ5A 4OYHA 4PC7A 5DSZA 2FG5A 3ADDA 4MKFA 2AWNA 2IYSA 3CRQA 2BCGY 5H68A 3MUFA 3A8TA 2NO9A 3F8TA 2G9NA 4Q01A 2ZUBA 4X8HA 4XSGA 2QQEA 3WXMA 4PANA 1E1QA 4JLNA 1WRBA 3EASA 5C2JB 2DB3A 1W36B 4C30A 2WJIA 2ZQ5A 4AURA 1E96A 1Z0JA 2PJZA 3AP3A 1EWQA 4D0GA 3JVUA 2HT6A 3CRRA 5LD2C 3RNLA 3PEUA 1C1YA 1KK0A 5KPDA 2VH5R 2VO1A 4RY2A 2IXEA 1E0JA 4DUGD 2H57A 2G1JA 1Q12A 3K09A 4O0MA 5DNYB 2IA5A 4BEBA 5D3MA 3LLUA 4R2IA 1BMFD 1GL6A 3IHWA 5KNCA 1TX4B 2G3YA 4F7WA 2IBMA 1X6VA 1QHXA 3C41J 4C4PA 2EFGA 2JLRA 5FL3A 2JJ8A 2Z83A 1IY0A 1GDDA 4LOAA 1ZM7A 5KNBA 1JAHA 5SZHB 1Z28A 1J99A 1II8B 1TQDA 3C16C 5FTJA 2OLJA 4C3ZA 2VLIA 3PUZA 4TLAA 5HCNA 1DELA 1BKDR 4MRVA 1PLJA 4G5RA 4TL8A 4B73A 4LUCA 3K9HA 2XXAA 3PG5A 4TT3A 1ZP6A 2ANBA 4B2LA 4DLSA 3A1VA 4ARZA 4KFRA 1R0YA 4UNPA 4UNSA 3QXHA 1FZQA 1ZVQA 4UXHA 5LPNA 4JMPA 2I1VB 3U3MA 2HV8A 1COWD 1NL3A 5LDDC 3GLIE 1RW4A 3MFYA 2GK6A 2QMUA 1N6KA 2C95A 3KKPA 5TDHA 3W8RA 1A1VA 2Z4SA 4ZCMA 4PQYA 1FUKA 3UWKA 3ND8A 3U2QA 3RS4A 2GXSA 2BEJA 4MYUA 4HUTA 1JB1A 3S1AB 1X8LA 2GTPA 4HZUB 1Z5ZA 3ZVLA 3BBPA 1DEKA 4B71A 4C0KA 4NYJQ 1E2MA 1DBSA 1O87A 2D62A 3HU2A 4NP6A 5CDFA 2J9RA 1FP7A 2QPAA 4LPKA 4UQOA 3T1VA 5GADl 2GETA 1QDEA 2R6FA 3VR6A 4IVPA 4KLNA 4LYAA 3AH8A 3EZ9A 3I8XA 4LI0A 3AKEA 1QHIA 4DHEA 2GCPA 2XZLA 3EA0A 4EIWA 1AGRA 3LA6A 1ZYUA 3EAQA 2FFBA 4PC6A 3LO5A 5FTKA 2IYRA 1OF1A 1XXHB 3LDAA 5EUMA 4FI3C 4B44A 4R98A 4P4SB 4OK3A 3VAAA 1TAGA 1JQLB 1NMXA 3AVPA 5AUNB 2JLWA 2RGGA 3B78A 3NC0C 3L2OB 5BXQC 4N3NA 2XEXA 5B2ZA 1UKEA 1T5IA 2ODBA 4DCUA 2V7QD 4DEYA 4PSVA 4OKSA 3U4QB 3A58B 1RKBA 2WSSD 5CJPA 3NXSA 2B21A 2ZRHA 2ZR7A 1SHZA 1NVWQ 2ZUCA 3ND9A 3THYA 5J40A 2O8CB 4ZI2A 2OV2A 5K8LA 2YWHA 5BWMA 1G7TA 3UMSA 2ZSBA 3WMEA 1KTVA 4G5GA 2PX0A 3VX3A 1G291 2IWHA 3GEEA 2ZRPA 5BQ5A 2QI9C 1M1YE 4E07A 1KY2A 2VRWA 1UM8A 3P26A 2ONJA 2PCLA 4ESVA 1XCGB 1G4UR 3EWSA 1E32A 4NYIR 4TMXA 5FH9A 2EVWX 1W48A 3U3KA 1FTSA 3T15A 2FWRA 2EFDB 4KSCA 5L3SA 1ZNXA 3FKSD 4E5UA 3G0HA 1Z06A 1KJWA 1CJVC 1OH8A 2KI5A 3NBYC 3H84A 5HE9A 1R5OA 5HE8A 4RJLA 4NL4H 4M9QA 3LRPA 2QL6A 2IS4A 2XAUA 2IW3A 2ZRDA 4BLTA 1G3MA 4JBXA 2YHSA 4QOSA 3T5GA 2W6ID 1JR3E 1CS4C 1NVVQ 3B60A 3ZVNA 3ZYCA 3VR3A 2RGNA 4RFSA 4EPTA 4URUR 3RC3A 2MSEB 4G1UC 2JJ2D 3PJRA 5CJ2A 3QNUA 1WF3A 3O8DA 4BWYA 1ESMA 4LYHA 4A82A 1EX6A 1R7RA 2VP6A 4ZCLA 5JLJA 4RVCA 4OK5A 1AKYA 1J8YF 4NBSA 1GZSA 1N0VC 1T5LA 2FX3A 3A4NA 3RAPR 3UMRA 3BH7A 2JDID 3LH5A 1ZW6A 1HUQA 3I5YA 2IYXA 3IIMA 3NHAA 4F92B 2ZRAA 3P4XA 3I4LA 4DCSA 1VTKA 3Q72A 3GPLA 4GSYA 3SEAA 2ATXA 1U94A 1UFQA 2WWHA 2ZRGA 1Z2AA 4MRNA 1QHNA 5FR1A 2IEZA 2GHIA 4PPFA 1FQJA 1W7AA 2JJ1D 1UADA 3MD0A 2ZXUA 1NBMD 4Q9IA 3FMFA 3RLFA 4EJSC 5FOXA 3WMFA 3RANA 4BPBA 2R9VA 2P5SA 1HYQA 1P73A 4L5BA 3WY9A 2ECKA 2ZPTX 2MSCB 4XVRA 3K53A 2HDNB 4M1MA 2P6RA 3CR8A 1II8A 2F6RA 2BBWA 1E1RA 1RE0A 1P5ZB 4JLBA 5JEDA 5DHFA 1R6BX 2YYZA 2HXSA 3BB4A 3FFBA 2BJVA 2QP3A 3OZXA 2FE4A 4IFBA 1CLUA 1FX0A 4LK2A 1KSHA 3U44B 5FPTA 2OM2A 1GNRA 3E2IA 2H1LA 5J4HA 1RYFA 2V9PA 3IKJA 2UVQA 2W0MA 2CLCX 1G6OA 4D81A 2DHRA 2GCOB 2V55B 3DVLA 5TVKA 1ZINA 2CHQA 1S9DA 4XVQA 1NI3A 3B1ZA 1YRBA 2QSZA 1PJRA 2AD1A 2GESA 2GVZC 4ZDWA 2B92A 4HUQB 3GLFB 4B3FX 2NOAA 1NY6A 3S1AA 1LF5A 2I1QA 2TMKA 3KJHA 4HZUA 2N42A 4P3YA 1GITA 1KHTA 3WYGA 1XJCA 3PQCA 2A5YB 1WXQA 3X2SA 2CHVA 4NYMR 2R44A 1Z0AA 5H8WA 3QKUA 3KKOA 3N2EA 1T6NA 3SOPA 2C96A 1JR3A 4HAVA 4B2PA 5HZKA 2ODEA 3MJRA 4FMDF 4HB0A 1FP6A 2D7CA 1H8HD 3QKRA 3F5FA 3HR7A 3L8YA 3K8YA 2C98A 4WZAE 3VR5A 4B35A 1R0WA 4P4SA 3SU8A 2OXCA 3ZVMA 2AD5A 1S0UA 4A8JB 5B57C 1W47A 2Q9AA 2QPTA 1SVLA 1CXZA 2WWYA 2GVDC 4JT2A 1Z0DA 2EFCB 5GJBA 5HPYB 4Z54A 3TR5A 5JJLA 4KYIB 1FFHA 4LRWA 2JEOA 5B58C 1DS6A 5JWRA 4TSFA 3AM1A 3U4QA 2XNSA 3AVOA 5SZJA 4AYWA 4MYTA 3CPEA 1GIAA 3KQHA 1E4YA 2BBSA 5JRZA 5JRJA 4JVSB 4V0LA 1DG3A 2DFKB 4WW0A 1Q3TA 5EZ6B 1GNQA 1Z29A 3CH5A 3K9LA 2HLDA 5ANRB 4UJ5A 3AP2A 5C4MA 2GNOA 1RRPA 1TQ2A 4JVNA 2IL1A 1Q1QA 2JLSA 4Q00A 3VR2A 4PC3A 2G83A 1HA3A 3PEWA 1NLZA 4AG6A 3DL0A 4JBYA 3BRWD 2MMCA 2NIPA 2YZ2A 2NO0A 4MKIA 3THXA 3TK1A 3BFXA 3GLFE 3NH6A 1U9IA 2E1RA 5FPKA 4BZQA 1XTRA 1YZUA 2QMOA 1E79A 4DZZA 1EWRA 4A9AA 1Z63A 4PAQA 2AKYA 2OXRA 1KZGB 4EDHA 2DWOA 1OFIA 1CEEA 1UPTA 1LNZA 1OPXA 4OQXA 2WJJA 3REGA 2PCJA 2JLQA 1VDZA 1ZC3A 1Y63A 2BDTA 1OXSC 1T8UA 2XOKA 4A0FA 1JI0A 2J59A 4JYCA 4GDFA 1I4DD 3IGFA 4EPRA 2QSYA 2JLYA 2RMKA 1KKMA 5FBRB 4URVR 1BOFA 4IKEA 3RRZA 2ZI5A 5GJCA 1KNXA 1LS6A 3KX2A 4PFSA 1MKYA 3BE4A 4G5SA 1R2QA 4TTPA 5BN4A 2J0VA 5LB4A 4W5JA 4UKDA 1R8SA 1F48A 221PA 1E0KA 1D2NA 1Z0FA 2FH5B 4YDHB 1E1QD 3K70C 2F9LA 3IQWA 3CB4A 3AV0B 2RAPA 1KO5A 1RRFA 5C46F 2QP4A 2ZROA 3KB2A 3OAAA 1NY5A 2OAP1 5EXTA 8OHMA 1OV4A 2Z0MA 4D6PA 3HP1A 1DE0A 1JALA 4TYNA 3KXKA 3H4MA 1SVKA 3NDBB 3TBKA 1NF3A 4LHXA 1SHKA 2BMEA 4DLWA 4IRUB 3ADBA 3HYTA 3RS2A 4HB3A 1EXMA 1OW3B 1DPFA 3ASZA 3CF0A 2I3BA 4J0QA 4ERNA 5E4FA 1G1MA 2CK3A 1ZM9A 3AVQA 4I1SA 2VTKA 4AKEA 3K0CC 1Z08A 2PT5A 4XJXA 2BMFA 2ZM5A 2VSOA 1N6LA 5FBWB 5A0FA 5IF9A 4IVQA 1OHHA 2JASA 3CRVA 1GFIA 1G64A 3CWQA 4EQ6B 4RCYA 3O8RA 4YLGA 3Q5DA 2GF0A 1C9KA 5J5CA 2JLVA 2O8EB 3U44A 5CITA 4TL9A 4Q66C 2EFEB 4TLBA 2V4ZA 4US1R 1ZNYA 3AVWA 3QEOA 4LHWA 2FPKA 4TMZA 3ZZ0A 1MV5A 3CPJB 2QRZA 5KSYA 4TT3D 2ZI9A 5K8TA 1W1WA 2GCOA 3CX7A 3UIEA 2VP5A 4OQMA 1CRQA 3BFKA 1RFLA 4UNNA 4PC1A 3ETLA 2ZUDA 3IQXA 4Q21A 4WOPA 1P62B 3QF4B 4JKIA 4QNMA 3C8UA 4EFNA 3I32A 4PZYA 4BLQA 1GG2A 1R10A 4HUQA 5AJZA 3GLFA 2Z4RA 3EW9A 4QC2A 2FGKA 4QGFA 1NIPA 3DZ8A 1IBRA 2J46A 2QQ0A 3L8ZA 1Z6GA 3ZJYA 4TYWA 4AKGA 4FWIB 1GP2A 2ZVQX 3EARA 3D7MA 1XCPA 4Z1MA 4E09A 1G8HA 2QT0A 1VCMA 2ZRBA 1YKSA 1IOZA 4ZIRB 1AGPA 4O3MA 4A2WA 1J8MF 2QU8A 5KSZA 1GL7A 5BW8A 3ICQB 4DCTA 4OJQA 3SS8A 3R9XA 1A82A 1IM2A 1FPMA 1Z3IX 3QJYA 2IYWA 2W2VA 1B0UA 4GFDA 3UG7A 5JCPA 4JJZA 2J5XA 4IOLA 5FTNA 4TL7A 4A8JA 4B75A 4DLXA 3TQCA 4OHYA 3WYFA 4MGIR 3RS5A 3BH6A 2YWEA 1OIVA 1RPZA 5BN3A 1Z47A 2X8AA 3CX6A 1TUIA 1G16A 1DAIA 1E9SA 4DVGA 2ORIA 1VYVA 1WP9A 4LBVA 3CKLA 4LJ9A 6Q21A 2ZRNA 3W9YA 2ORWA 2N46A 2ZETA 4A0RA 4QNRA 4F4CA 1G8PA 1GWNA 2ERXA 1LF0A 4A6PA 4CW7A 3B1WA 4BZXA 2BKEA 2GDJA 1XZPA 3MSXA 3AF0A 4HDCA 4EKDA 5FTMA 4LJYA 5BN5A 2AK2A 1QHHB 621PA 3QE0A 1UDWA 1XX6A 1U8AA 3RS0A 2FFHA 2FJUA 1XD9A 3GJ8A 3M0EA 5TMPA 1SXJE 3QBTA 4LV5B 4DBLC 3QI2A 2QGNA 1JPJA 2IYZA 5DYIA 3EPLA 5E7JA 1E94E 2Z5FA 4PAOA 2FA9A 2F1IA 1VG0B 2AWOA 5CLQA 1E9FA 2J0QA 3QY0A 3PVSA 4QBFA 1E2GA 3FGNA 2ZI3A 4JVMA 4PZZA 4QL3A 1OXXK 5EP2A 3X1YA 1J90A 2OE2A 1MRSA 2BM0A 1OB2A 3QIAA 1KI3A 1OH6A 1G7CA 4BFSA 2F55A 2Q6TA 4GNKA 1NN5A 1RJ9B 1G17A 3Q5EA 2YINC 1U8YA 2RGBA 1XPUA 3KUDA 2W0SA 4HSEA 4B33A 3ADCA 4A0GA 1G7RA 2HJVA 2PX3A 1VHTA 1EFHA 5CLLA 1VG8A 4FCTA 3MGCA 5TXGA 5HTKA 1U81A 1IHUA 3WBJA 1XCMA 3L0IB 1QHYA 4WXRA 3EWAA 1MO3A 4M1YA 4PXAA 3DOFA 3LQQA 2HUPA 2IWRA 3NBXX 1GKUB 4HB4A 2JATA 4RD3A 4F38A 4TMWA 4DEXA 1W36D 3UMFA 3FHCB 4FIDA 1C4OA 4DSUA 1KO1A 3IDQA 3THWB 5E7MA 3U3OA 5KTYA 3HPQA 3PR1A 1P7CA 2QBYA 2YC4C 2ZR9A 1HEIA 3RVBA 1YR8A 3WHKA 3PCRB 3U7EB 5F2EA 3HJNA 2BIFA 1XEWY 3DKPA 4TZ6A 2FZ4A 3OIYA 4N0EA 5EXSA 2D2EA 1IN7A 2F1HA 4JL8A 3NWJA 4X8OA 3ZH9B 4AY2A 4FWTA 1I2DA 1GRQA 4M9XA 1YE8A 1YR7A 3P1JA 3W3AA 4Q19A 1TEXA 2JLZA 1RZ3A 4LC0A 3SC3A 4ZDIA 5UKDA 1K8RA 3SYNA 1EG7A 2GBLA 3PXGA 3IEVA 1E1RD 2YOHA 4FCWA 4A2PA 1HV8A 1R0ZA 2PMKA 5AR1A 1CJKC 3C4JA 1A2KC 1KSFX 4Q7LA 4AD8A 1XTJA 4JT4A 1VG1A 1JEEA 1JBKA 4IJMA 1RVDA 4Q47A 2WVJA 2W2TA 4JJKA 2ZJ8A 5AUOB 2VSFA 1QF9A 1IN8A 2GXQA 1SXJA 2GZAA 2CJWB 2ONKA 2O0KA 4FN5A 4AWXA 1ESNA 2IXFA 5G40A 1UBFA 4NONA 4KXFB 4PR0A 2BJWA 3QF4A 3VKGA 4I4LA 3WRYC 2ZYVX 4ZDKA 4KO8A 1XPOA 2RGAA 1S1CA 3GLIB 5JWHA 2ZS8A 2C03A 4LJ5A 4RFSB 2B8TA 4V03A 1X8JA 5G53C 3IPYA 5K8IA 2ZJOA 1ZNZA 1ZD1A 1T0HB 2IC5A 5JEEA 5AJYA 1WMSA 1K6MA 4A92A 4JYBA 4V0KA 3R8CA 2CE7A 1DAHA 1CRPA 1M7GA 4IOKA 4ZIRA 3ADKA 3LY5A 3W6OA 1G20E 2G77B 1KMQA 1W0KA 3CF6R 4HYYA 5AJVB 1YZTA 4B48A 2PZEA 4Q03A 4BFUA 3NG1A 1JR3D 1N6PA 5TV2A 3R8FA 2QA5A 4Q9JA 2AFIE 3QPVA 3KKNA 3NIBA 4OI0A 1GAJA 3GJ4A 4NYMQ 4TTRA 3QPUA 1KK3A 2NG1A 1GKYA 1VMAA 4DLVA 1EFCA 1Q21A 2XZOA 1TQ6A 4E03A 2ZJZA 1SZPA 4CT5A 5J4VA 3ZS8A 4Q7MB 1AN0A 2BBTA 4Q48A 2EWVA 4JS0A 4PHFA 2Q21A 1OIXA 4DLUA 4AKHA 3T1QA 3WNCA 3DDCA 3WYAA 1T3HA 3DZDA 1VYTA 4TSFD 4DDUA 4C9BA 5EXXA 2SHKA 1QVAA 4Y0AA 1GNPA 1N6IA 1HY3A 1QHHA 4P33A 1CKEA 3LBHA 3PITA 2BOVA 1DG1G 3VU9B 1DADA 2NQ2C 1FX0B 1CJUC 2OBNA 2ZRKA 2AK3A 3U6BA 3CW2A 4B34A 1MH1A 2DR3A 2ZI6A 4P32A 2HLDD 3OF5A 1TF7A 3TSOA 2OEPA 1W4CA 4ITRC 4XVUA 5FUWA 4IDOA 1HQCA 2QPOA 1KO4A 1CF4A 2GXUA 2WTUA 4LPSA 4H1UA 5FOTA 5CB6A 1D2EA 5H70A 3Q7QA 2BCJQ 4MUAA 2QMHA 1DAKA 3BD9A 1W2HA 4D4LA 4IW3B 4LCBA 1LB1B 1WDTA 4V02A 2OBLA 1NMYA 3EG5A 4M1WA 3IBYA 3E70C 1E79D 3ZQ6A 2DFTA 2NMVA 1RJ9A 1PLKA 5IT5A 1H8EA 3B6EA 3CWZA 3A4MA 3QVUA 4P4UA 3DEFA 2R62A 3FPAA 3BB1A 5EJEA 5KOYA 4EPXA 3GJXC 2QAGC 2XOKD 1CR2A 2RGCA 1JXMA 1IY2A 4KV9A 2NPFA 5GVRA 1TF2A 3OEHA 4JSYA 3QKRB 4CEIB 2IS6A 5B64A 4LJ8A 2YVUA 2IF0A 3AF3A 1T8TA 4LC1A 4Q4LA 3LVRE 1XDBA 1YVDA 1VCNA 1AZSC 5E3HA 4TMVA 1NVXQ 3UANA 2PMDA 1U99A 1P9RA 2ZVPX 3THWA 1P6XA 1Z6XA 4ZKEA 2VSXA 2PJRA 3PEYA 4KBGA 2B6HA 3GJ6A 3OAAD 4MUBA 4MRPA 2PBRA 3AEZA 4TWZA 4IHQA 3PUWA 1Q57A 4JLOA 2V1XA 3D31A 3OE7A 2D2FA 4GP6A 1KGDA 2VF8A 5A5GA 2WJGA 3B13B 4OBEA 4Q4JB 4CDGA 5J4LA 1G8GA 2YNMA 3W34A 4HLQB 1T9HA 2FFAA 2X2EA 5LBIA 1ZNWA 3A4LA 1NN1A 3A37A 3KXLA 4UXJA 5JJKA 1D2MA 1KI6B 2CK3D 1G5RA 2HXYA 4LJ7A 1XU4A 4M8NE 2OFXA 4QG7A 4YMSA 1YQTA 2GEDA 1OB5A 4HLDA 3NEJA 2E87A 1J70A 1W44A 1OHHD 1G18A 4FW9A 3THXB 1KSJA 3BWDD 3U3JA 4A6XA 2N1BA 2R6DA 4GT1A 2ZYWX 1Z6AA 2KJQA 5F9HA 3PFIA 4ON9A 3ZD6A 5JFGA 3E1SA 1XEFA 2AXNA 3W8NA 2CJWA 1OSNA 5JCZA 4IOJA 4M9ZA 1ZM4A 2R65A 3TJZA 1TADA 1H65A 4ZO4A 4KI0A 2IYTA 3GLIA 2D7DA 4JLAA 3CNOA 1JEDA 1YU9A 5EQTA 1XTIA 4B3BA 3KQKA 3RRYA 2XTNA 5AJWA 4DLTA 1E9DA 3NTUA 1MR3F 4GMDA 1VCOA 1FTNA 1TNDA 2CBZA 3KXIA 2WHXA 2RHDA 1G19A 1Q1EA 4M9SA 3VTKA 1N6RA 2YC2C 3I73A 5EE1A 1D9XA 3R9WA 1P2VA 4Q1BA 4Z1MD 3Q9LA 1ZM2A 3K1JA 2LCFA 4GBMA 5KPJA 2FSGA 4Q7JB 5FOVA 4OK6A 2RB4A 4A1FA 3K09C 3ONWA 1NN0A 2ZJYA 2IYQA 5J4KA 4JSTA 4U7DA 4HATA 4KLZA 3KKMA 1ZMXA 1MO4A 3ZS9A 3AKCA 2VF7A 2EW1A 3FE2A 2F3RA 1UKVY 4GL2A 2O8BB 4RZ3A 4PHHA 4A2QA 2P3SA 2BVNA 2HYDA 4RFVA 2XNDA 5JHGB 3VKWA 1KDRA 2WKPA 3EZ2A 2MMGA 3O8BA 3CR7A 5CYPA 3UG6A 2ZSAA 3B1VA 3L0PA 4B74A 2IYYA 4C0JA 3FHTA 4PHGA 1P61B 3MCAA 4R2HA 4LBWA 3AVVA 1E0SA 4TL6A 4JKYA 1G6HA 3U5ZB 1KY3A 4Z8XA 1X3SA 3VU9A 2VP4A 3TSZA 2C78A 1N25A 2QY9A 4MGZR 2HCJB 1N5KA 4QJ4A 4BASA 3VFDA 3U60B 2REOA 4NH0A 2WIBA 3AUYA 1U90A 2FPMA 3BJIC 3I61A 3KQLA 2WV9A 4HZIA 2OFWA 3TH5A 2IUUA 1GRNA 3HU1A 2QTVB 1OYWA 4HAYA 3DMDA 2AXPA 5KYKA 4NCJA 4CF7A 2GEUA 2VBCA 2LWIA 1KAOA 3KL4A 1I4LD 2G0TA 2ZITA 1FMLA 1LVGA 3QENA 4YONB 2D3WA 1TU4A 3AVTA 3A1WA 1X86B 2BKUA 2OG2A 3IHLA 2J87A 3HYRA 2ZAOA 3W3ZB 1QG2A 3DOEA 4XTCS 4DT1B 3I5XA 3LD9A 4KITB 4NTZA 4F93B 2ZSDA 2H7VA 3U6KA 2A7QA 4I81A 2Q9CA 1XTQA 2DPXA 3CO5A 4QBGB 3KQNA 3UK6A 3QXJA 3HPRA 4NKRA 5DN6A 2HEIA 4A0HA 4CEIA 3NH9A 3EZ6A 4FD2A 3RS3A 1NVUQ 2PEZA 4W9MC 3W90A 2ZR0A 4C0SA 2GJKA 3PENA 3SI7A 2JAQA 4B32A 3DHWC 2P67A 1AKEA 2JIZA 3LFUA 3CX8A 3CIOA 2CVFA 2CEAA 2AFHE 1E2IA 3QXCA 3HU3A 3VKHA 1KO8A 4TYQA 821PA 3BH0A 1M34E 3V00A 1AJEA 3CLVA 5L3QB 1UJ2A 3BIFA 4D26A 4QJ5A 4HEJA 4OQNA 4ZI3A 1XFAA 4Q4JA 2QEQA 4OL0A 2WOOA 4PTLA 3BFVA 1UEIA 1ZIPA 5KU1A 4R9UC 2QT1A 1CR4A 1NG9A 3LX8A 1N6NA 2L0XA 1KI6A 4ASUA 1NLFA 1W4AA 2WWFA 1XPRA 2YJTD 4LJ6A 4XD7D 3EX7C 1KI2A 1KKLA 3R9IA 3KJIA 3RHFA 4KYUA 2WKRA 5EE5B 5FPHA 2CE2X 2W2XA 3SNHA 3H0KA 4KU4A 5AJXA 3SDZA 3QPWA 3JZMA 2WBLC 2WM9B 3SFZA 4JL6A 4I1VA 3IBGA 2UZ3A 2ZREA 1Q1BA 3TAUA 2CMKA 3SJBA 3QVVA 2XB2A 4KFSA 2WWWA 4RZUA 4D0LB 2RGNC 2IK8A 1G8YA 4QFMA 1NNEA 1SXJD 2RGEA 2ZJ2A 4AIIA 1F6BA 1YR9A 4TMKA 3K0AB 1HE1C 1OFHA 2IXGA 2ORVA 3TR0A 3KQUA 4DC9A 1A2BA 5HR5A 2FGJA 3Q8XB 4JIMA 3GLGB 1W0JA 2B7BA 2H16A 3IPXA 1W36C 3CZQA 3OFNA 2ZYTX 2NTYC 4HDOB 2AHOA 3RABA 3LBIA 3AVXA 1LTQA 2J41A 2XTZA 1OJLA 4Q02A 2OUKA 2FSFA 4UNQA 2VA8A 4L15A 5FOUA 1UKZA 4RD4A 3IUYA 4Z51A 4TZ0A 4IFEA 3WRXC 4GI7A 2WPDA 4TMTA 1SQ5A 1G21E 5CM9C 3QUSA 5AUQA 1U8ZA 3AUXA 4V0NA 4Q9HA 2J0SA 1E6CA 3IEUA 1W0KD 2QBYB 3SZRA 4BUJA 1N0UA 1PUJA 2WMOB 3ZZTA 1YR6A 1UBGA 1K5GA 2O5VA 2A5GA 4G0NA 4B6EA 3OEEA 4NCKA 3T5DA 2IT1A 2W6JA 5G41A 3TGPA 2O8BA 1J2JA 1ZUHA 4BLPA 3EPKA 2F1JA 5SZKB 5JBQA 3KZ1E 4LYJA 2QENA 1EFUA 4M53A 3TIFA 5KDDA 1OXUA 4AC9A 4P4TA 1KYIA 4HLUA 2V1UA 4TN1A 3SBDA 1FW6A 1VPLA 4MKHA 5GVSA 1GOTA 5SZIA 4CEJB 3BK7A 1SGWA 3AB3A 1MO6A 4G5OA 3MMPA 2RH5A 1AS2A 3O47A 2FSIA 1LFDB 4RD1A 3R7WB 3GD7A 4DDWA 2XZPA 2ZE5A 1D5CA 3AKDA 4LY6A 3B85A 4MQBA 4AYTA 1NSFA 1SVIA 2Q0HA 3BXZA 3BAFA 1E4VA 3ZIAA 2GZDA 5JHHB 4ZV4A 1V5WA 1KIMA 2C9CA 3KUCA 4KCGA 1SXJB 4TYYA 5JZVA 4F4JA 5CIWA 4LX0A 4Q1AA 1TMKA 3U7FB 2GAAA 3CM0A 1E2PA 5IDVA 3GLGE 4LSGA 1UEJA 2V6IA 2ZANA 1NVVR 3EPJA 5JWOA 1S3SA 1DAMA 1VHLA 2AKAB 1NJGA 4KJZA 2IYVA 3TVTA 3MWYW 4EUNA 3K0EA 4DLZA 4DT1A 1UBCA 4XWKA 3TW4A 2OCYC 2ZU6A 4QBIA 1DOAA 1NP6A 2R6AA 1M7BA 2WSMA 1PLLA 4D4KA 2KWIA 1H8ED 1TF5A 1F60A 2F9MA 1ELOA 4ZKDA 4PQFA 3QG1A 1JJ7A 4I1OA 1JNYA 1XNJA 3BGWA 1AK2A 5E95A 1KNQA 4AKIA 4D4MA 2WWGA 1D8TA 1TQ4A 3OEHD 3GJ0A 2ODNA 1N2CE 3Q85A 4Q1EA 5FBVB 5FL7A 4ZDJA 2KBEA 4HAWA 5DLQC 2H8KA 1S1MA 1T4GA 3AP1A 4QHTA 4G01B 1W46A 1NMZA 3CUEF 1KAGA 1E3MA 1XF9A 3H1TA 4ZCIA 2R6CA 3X1DA 2IUSA 5L3QA 4LBZA 5CM8B 2GRJA 4E22A 1T0JB 1P72A 2CHGA 4KAXA 1TEVA 4U00A 1ZBDA 1YJ5A 5EP4A 1X1SA 2HF9A 4IEIA 1XD2A 2OHFA 4FMCB 3OE7D 1SVSA 1EFTA 1L2TA 4IXNA 2H17A 4Y0VA 3OIUA 1VG9B 1XJQA 3DMNA 2ZRJA 5KHOC 3D3QA 2QE7A 3Q7PA 1FL9A 2JLXA 1GM5A 2O8DA 3A1TA 3MWLA 4EJSB 2FPLA 3KB1A 1Z2CA 1HQYE 1UDXA 2NZJA 3W6NA 4BFVA 4C0HA 3ECCA 1U9IC 4DRZA 5L3RA 2QM7A 1SULA 2Z43A 4JLKA 2EFHB 3DKVA 1G8FA 4PSAA 4BFYA 4UNRA 4BFZA 1P3JA 1W5TA 5HCIA 4JL5A 3BS4A 3LV8A 3MWKA 1CU1A 3IILA 5BYJA 1E2NA 2BMJA 4MYHA 1JPNA 2FSHA 2ZRIA 1CR1A 3CONA 1IN5A 5C18A 2ZEJA 4GZMA 1G41A 2CNWA 3AVYA 4NYIQ 521PA 1RYHA 4X8LA 3TVDA 4DB2A 1ZAKA 4O2LA 2OT3B 4AK9A 1P60A 1MOZA 1PV4A 5CK4A 2XB4A 3BC1A 3K0AA 3PEVA 4PC2A 1QRAA 2B7CA 4RZ2A 3DPUA 3GLGA 4F4IA 4TLCA 1W5SA 4X8MA 5BYKA 4WA7A 3DM5A 1AQYA 2O8FB 2GCNA 1OH5A 2QN6A 1KI8A 4RZXA 2DY1A 2Z6VA 1I4TD 4MDFA 4Q9KA 4RCZA 3EA5A 2ZRMA 3AGQA 1VECA 3B1YA 1AZTA 4DSOA 2R8RA 3N5CA 5KSPA 1WBBA 2BMDA 3GEHA 4ABYA 3FYHA 3GJ7A 4Q1DA 1Z6YA 5C1BA 1UF9A 1PUIA 2ODWA 4V0ME 1Z8FA 1Q44A 2CCGA 4Q1CA 4YQFA 4KHZA 3P20A 4DLYA 1R5NA 4BRUA 1A5TA 1US8B 4MITA 3AF1A 2OCPA 1GKIA 2J7KA 4URZR 4V0OA 3UXMA 1NG1A 3OIWA 1ZUIA 2REBA 5M04A 4G5QA 3MAAC 4Q5IA 3TNFA 4WZBE 1MABB 4XD7A 2HF8A 3U3RA 1SKYB 2VHUA 4MRSA 1TUEA 2XNDD 3T06B 5CB8A 5HZHA 3CF2A 1WA5A 4CEJA 4JLPA 4CIDA 2WMNB 3KTAB 3TMKA 4MA4A 4IVRA 5FUYA 4OI1A 3TE6A 1YRAA 1R8QA 1S9HA 3R7WA 1D6JA 2QTHA 2ZRCA 3SN6A 3OESA 1VIYA 3GCGA 3L0OA 3D6TB 2F3TA 4PZLA 4ZPXA 3TRFA 4GOKA 3B7GA 4B2IA 1ETUA 3EZFA 5D3QA 5JMTA 5JS7A 1YHNA 5GJWC 4YDSA 3SHWA 2CCJA 2B8WA 4OQLA 3KJEA 3NHBA 3UATA 4EPYA 1U0JA 3LW8A 1Z83A 4WAUA 1P9NA 2P6NA 1Q1ZA 1E69A 2C77A 2O52A 3CH4B 3TLXA 3X1ZA 1RC8A 5F3WB 2NGRA 121PA 2Q3FA 5FUXA 2GXAA 2KE5A 2XSZA 2JGNA 2KSQA 2PZFA 3SJCA 2OAQ1 4Q4HA 2H18A 4CEHB 5HKKA 2V8OA 4CT4B 1N5IA 1BYIA 4JVLA 2IX3A 3WP0A 4A8JC 4DDTA 3K0FB 5DI9A 5KO2A 2ZSEA 1R5BA 2WJVA 3SYKA 5DN6D 4QHSA 1EX7A 1SVOA 3PV0A 4A15A 3QEJA 4GZLA 1E9EA 2ZTSA 3EIQA 2IS2A 5TY0A 2IHYA 1SKYE 4C7OA 2VHCA 2GK7A 4AG5A 4D25A 4QGGA 1M2OB 2JIZD 2ZIAA 5EE9A 3K70B 2RGXA 3LWNA 1GTVA 5EUQB 4RSGA 3DO6A 4V0MA 2ZJAA 2K5UA 2IS1A 4KFUA 1FQKA 1FNMA 3LVQE 4DKXA 4FMDB 1E0AA 5KNDA 2REXB 4LV8B 4NCNA 4RD0A 5JSZB 4TQAA 2YKGA 3MJHA 2PEYA 3CRMA 4NHOA 4EJSA 3VNVA 2QG6A 1YZQA 1L8QA 2D06A 1KK1A 3NDPA 4PO9A 2DFNA 3ZD7A 4U5XA 3KJGA 2OLKA 4ASUD 1XEXB 1XRJA 1HH4A 2F1RA 1F2TB 1JJVA 2ZSFA 3AGPA 3SE0A 4NPHA 1P2SA 4RKFA 4L8GA 4AYXA 1RIFA 4G3XA 1KI7A 3WNDA 2PT7A 2BHRA 3SBEA 4LHVA 4RD2A 4WXPA 1HTWA 4TTQA 4F91B 1EESA 2ZI4A 4LV6A 2QGZA 3RYTC 5FR2A 2W58A 2FU5C 3GLHB 4MRRA 5EXPA 1QVRA 3TW8B 2O0JA 2WIAA 1IONA 4B43A 4LBYA 2KBFA 4XWAA 1R0XA 2GJ8A 2H92A 3JVVA 4U02A 1J7KA 4WZ6A 4CZ2A 3LXXA 4HB2A 1BH2A 1XWIA 2O8FA 4O25A 4KSBA 3NEYA 4QGAA 2AL7A 1DO2A 3AKYA 1OYYA 3LNCA 2J3EA 1P4SA 3SYLA 1W0JD 2AN9A 1E2LA 1KDOA 1W4BA 3LLMA 3OFND 4DIEA 1NIJA 1YZGA 2HT1A 2QP9X 1NLYA 2XX3A 1VIAA 1D9ZA 1DAFA 3N70A 4W7SA 1II9A 2WPDD 1SVWA 2CL6X 2DFLA 1Q22A 3RSLA 3LX5A 1F2UB 5IK2A 1YZLA 1E99A 4QHYA 4BLRA 4FMCF 2WICA 3LAWA 3M1IA 1US8A 2J1LA 3QSYA 4NMMA 1HT2E 3VNUA 4P0TA 4D4JA 3WNBA 1GVNB 3VHXA 1OKKA 2GEVA 2A9KA 1BYUA 1MABA 2JCSA 1ZCAA 2Q3MA 4OHXA 3OEED 4DWJA 5DH9A 1S3GA 1ZD8A 2W6JD 3GQBA 4ACAA 1T91A 1U98A 4B47A 1IJFA 2YWFA 5P21A 2GBLC 2GA8A 1Z07A 1I2MA 2EYQA 3T1TA 2ZI7A 4QBHA 2NZ8A 3KTAA 4URXR 5JI3E 4C0AC 3R20A 5FPSA 3OIVA 1MT0A 1UKYA 1G3RA 1U0HC 3L82B 2C2HA 1W49A 5E7IA 3L43A 1XZQA 2YOGA 2GZHA 3IIJA 1SXJC 1G3UA 2G88A 2FN4A 3B9QA 2XJ9A 4Q7KA 4EPVA 3GLHE 4BFWA 1SVMA 2ZE8A 3G5UA 4GMXA 3ZIAD 4D0NA 3K0SA 2WJHA 2BWJA 3H86A 4L9WA 1KJZA 3LXRA 1N6HA 3ASYA 5LB2A 4YXWA 4PHTA 4QXAA 2ANCA 2D74A 2J7PA 2P65A 1E98A 3O8CA 2XTMA 2OESA 1GSIA 2WAXA 5FOSA 2XGJA 2GKSA 2C5LA 4DIDA 2JA1A 2EYUA 2KB0A 2Q9BA 1TPZA 2X77A 2X19A 3TKLA 5EE0A 4QM7A 4KODA 3CPHA 2VYFA 1JQJC 4M4SA 4CEHA 1ANKA 1OIWA 1II0A 2F7SA 3T35A 4BFXA 4BLOA 3I92A 4MGKR 2BBOA 5FPYA 5J4YA 1IXZA 1GILA 1XXHE 3K0FA 4JLDA 3B8HA 1G4AE 4KFTA 1E2EA 3QXXA 1IXRC 4M1SA 1DARA 1OXTA 2IUTA 4JLMA 4NU0A 4MH0R 4DB4A 3QKSB 3DM9B 1GUAA 1S96A 1E9CA 3B5JA 1SKQA 4C2TA 4WBSA 5FL7D 1E2KA 3NC1C 2OSBA 1EK0A 3EC2A 2RKOA 2C9YA 2J45A 2FF7A 1CIPA 2PLRA 3LQRA 4GOXA 4CRWB 1XJ0A 4LZZA 4ESHA 2QROA 1LS1A 2A5DA 1LV7A 2VL7A 3P32A 4PPQA 4WVFA 4TLEA 1KO7A 3C14C 1GRRA 1XB2A 2ZRFA 1N0WA 4DLRA 5JSZA 2HYIC 4MDEA 4EFLA 2QMEA 3TQFA 5JS8A 4YMTA 2PLFA 2ZS9A 1T3LA 2FEMA 3ZQJA 2RHMA 1WB9A 3T1OA 4Q4AB 3L0SA 4BE7B 1DAEA 2QE7D 3K9NA 5AWFC 3K0CA 1S8FA 2FOLA 1ZD9A 1CBUA 1XEXA 3FDIA 3U61B 3T34A 3FVQA 1F2TA 1Q20A 3KDSE 4PO8A 1JAIA 2CXXA 3B9PA 3F0TA 2C99A 2I4IA 2A78A 3EXAA 5EE3A 3K9GA 3GFOA 3BOSA 4D82A 4QKQA 4A36A 4LGMA 2DBYA 2QM8A 4M1KA 5DI3B 4RKEA 3FB4A
chains in the Genus database with same CATH superfamily
1PZMA 1TU0A 4LHYA 1BJKA 1E2DA 1QO0D 1VMEA 3DBHA 3H2BA 3K2EA 5CGQB 4Z4HA 3DZKA 4XB2A 1U7OA 5JECA 1S2MA 3BIWA 3JU3A 4HDSA 2PYDA 4K9LA 4WFIA 4M9CA 2YHIB 3ZNQA 4P5DA 2A5FA 4BUZA 5IXJA 5BYAA 1WZ2A 1HNZB 1PX2A 2A94A 1MO2A 1O9HA 3EXIB 3P9PA 5ELXA 2XB8A 3I12A 4YO7A 4J4TA 1DTSA 2VQSA 3UAOA 4NR0A 4XQCA 2Q07A 2BF7A 2EBFX 2IZ0A 1P2FA 3PI6A 2GCIA 1NXVA 1K5DA 5G1NA 5IJXA 4CIAA 1QLJA 4IDFA 3UJ8A 4QE3A 1DRJA 1UBLS 2F00A 3AT1A 2VHTA 3QLUA 1WPGA 2IZOA 4BFCA 1R16A 2XUHA 3NYRA 3SYTA 4LJAA 2A30A 1E8MA 4A6EA 2LRHA 2VHJA 5F23A 4L95C 2I66A 4Z4FA 3VR6H 5J2TA 1VB5A 1R9JA 3EEIA 2Z09A 1ZGCA 3TB4A 3LP6A 1Y4AE 1CP3A 1W29A 2O5CA 3WL8A 2FEOA 3BORA 3KYIB 3AW8A 3AJAA 1ZGZA 3FWYA 1NI4B 2ROQA 2J3QA 4LOLA 2E4VA 4O6VA 5AHWA 1F2UA 3PNSA 4EK9A 2PUFA 1OH7A 4DA6A 2WDPA 3IDAA 2RAVA 2J0UB 1XXHA 3F96A 4N3CA 4PCVA 5PGMA 4A91A 2ZOSA 2CGEA 3BE5A 3T12A 3KB6A 2WM8A 3UT5A 4TV9F 4A23A 1NW8A 3LZCA 1J9GA 2XT6A 5CBKA 1P5RA 1GCGA 4PXSA 3S27A 4UHBA 2AOXA 3FKQA 3GP3A 2WI8A 4YMVA 4KR6A 4PGGA 4IGEA 1RRMA 3CLUC 3ZCTA 3QLVC 1WXEA 3ZHBA 1P74A 3AVUA 1PL0A 4EUHA 3I83A 3WIOA 3FWNA 1NNLA 2BKAA 2HJGA 3LUKA 2EQBA 1GAXA 2WOJA 2IEAA 5HUHA 16PKA 5DLPA 1WCYA 3C8DA 1AQUA 4M1TA 4I55B 1RMQA 2QD4A 3VC3A 2ZBGA 3BK2A 4EATA 3HBAA 3IBFA 1VJ0A 2VYCA 5DGTA 4BVFA 2IYPA 2NX2A 2H29A 3BL6A 4TKVB 1V43A 3G8BA 4J2OA 4B3TB 5DLDA 3TUJC 2ZT7A 3C3CA 3PD0A 2FQYA 4M0CA 3W5JA 4YAGA 1VZ3A 3GX1A 5E7QA 2IDZA 1DVRA 1J0XO 2H07A 3JRWA 2ZYUX 4I50B 4PFQA 5B1EA 3VDRA 3P0HA 4CGZA 2CLSA 5L8VA 2P8JA 5CURA 2I3AA 3IT1A 4M88A 5T4BA 4BWFB 1Z5NA 4EA9A 1KPHA 4MKGA 3GT3A 2YWBA 1TAHA 3CG4A 4BGDA 2GILA 1JFLA 3MB8A 4CMHA 4P92A 3I1FA 2Z56A 5HIKA 1T6ZA 5CRIA 1X7XB 3CURA 4M7OA 1ZRSA 4JJEA 4U6NA 1JRLA 5GP1A 1OT3A 3PGJA 4DCGA 3O5AA 3VQTA 1EDEA 1M2JA 2QNRA 4MPPA 4XDYA 3QHAA 1JLSA 1XALA 4R16A 4XSHA 3ZDYB 4F0JA 2C04A 4U7JA 3AYXB 1NVTA 1DMSA 1MGPA 1T3TA 3SQDA 2GN9A 2NTEA 3S0JA 3F3YA 4AULA 4ER0A 2G6BA 2FKNA 4IDQA 4N8DA 2X8JB 1W93A 1NXQA 3G8YA 1FMTA 3P9IA 4LVNA 5EINA 3O84A 4EM6A 4D4IA 2V54A 4MVJE 2J33A 1GTG1 3FOCA 4OLHA 1ZM3A 2B37A 4DR1B 4R1SA 1AZWA 3W05A 2Z6UA 3U7HB 1UPXA 4RQBA 2K87A 2HREA 2W9XA 4H1HA 1F7UA 1FRZA 1YVEI 2ZJ5A 3ODPA 4EUEA 2OCBA 1HEUA 2GZ1A 4OQDA 5DTRA 3L7JA 1OFTA 3EOZA 5HW0A 5H1YA 3VR1A 2GYVA 3HZRA 4YV0A 5HJEA 3PFFA 4MP3A 4KVAA 5D00A 2ZAMA 1OLSB 1R66A 3PL1A 4B7CA 5FBQB 3VDNB 1XI2A 5JATA 2O3JA 1JPVA 1TB4A 3CXRA 2C8VA 2R2AA 2B20A 2FUKA 3VHLB 3IP8A 3LUFA 5LSAA 3DP7A 2W2QA 3I8SA 3KV3O 4IR7A 5CIQA 3YASA 5KNDD 4JYPA 4J0DA 2WJWA 2ZUTA 1KE2A 2Y3IA 4HY3A 4K9OA 1BN6A 3ZHSA 5E1BA 4CYMA 4FHDA 4DLLA 5JBNA 3MRSA 4DA7A 2I78A 3R5FA 2QL5A 4KRYA 1UPBA 1Z2NX 2RCNA 4NCHA 1Z0KA 4L74A 3FKSA 3BCSA 3R7BA 2FW0A 3WA7A 1L7PA 4M55A 5CDSA 3RSQA 3DWIA 3B8EA 3P9RA 4ALLA 4BVBA 4JI8B 1K92A 1SCBA 3MUNA 4OD0A 3VI3B 4AZSA 3QBEA 3VZCA 1FOEB 3JQ9A 3O3MB 3RU7A 3LVFO 2ZVDA 2GAOA 1D4FA 2AHRA 3IAS1 4HUJA 2UZ0A 4Y6GB 3B1KA 3RRNA 3WI7A 2WF6A 4P08A 4EX7A 3OE4A 4UEOA 1BO6A 3OX2A 2FSVC 3JYNA 3NJ8A 4KRGA 4KN8A 4RF2A 4Q4HB 5BR7A 5DLYA 2DQ4A 2PRJA 5ALQA 3U13A 4MIKA 1ZHOA 3QVXA 1YS1X 4G1CA 4DNPA 3I52A 3PUHA 2IYUA 2ZUVA 1T8PA 2VDOB 2IYAA 4BNMA 5C0OE 4JUIA 4JQCA 5AI0A 1U7XA 3TZCA 5HRCA 1M74A 3L7MA 2H4FA 3SQXA 7MDHA 2G9UA 3PIRA 3N28A 5TMDA 3RFVA 5ERXA 5DM4A 4DMUB 1OX4B 1V1RA 3EIHA 4Q3LA 4E30A 4IQGA 4KJXA 2Y0DA 1R18A 5TPZD 3V9PA 5EL0A 4EENA 3J7TA 2I8CA 1C0IA 1M2EA 3JYHA 2F43A 4TXLA 3K1ZA 4YQEA 3OZVA 1V8OA 1OXVA 3I3SR 4LK3A 3W4KA 5L3VA 1E9AA 1E0DA 3HUTA 4BOYA 4HLCA 4BB6A 4RMJA 3PFBA 5C4GB 3R74A 4YMUA 1DI0A 2YMQA 3DSRA 1CS0A 1J97A 4PYLA 4YBRA 5ADUS 1NX6A 4D8YA 1IHOA 5EIHA 2WYVA 3ZHOA 2JJ1A 2EEZA 4LEIA 4CI9A 5JADA 2H5EA 1C5KA 1P75A 4JLJA 4JSRA 2VPTA 3ZXIA 5EP3A 1VGQA 2K7FA 1BMTA 1HEYA 4O8CA 3IJEB 3PKJA 2ZJBA 3RTDA 4AN1A 4CLOA 1QX3A 3IP9A 4N76A 3HO8A 4TYMA 3OKCA 1TI7A 4RDIA 4HN2A 2OBBA 1Q0LA 2QIOA 4E51A 3GDWA 4EHHA 1I7PA 2WAYA 2X2PA 2HSJA 1YC2A 3C15C 3UGQA 1KWGA 5EI5A 1VDMA 1L1QA 2VOJA 2WT8A 3ANYB 4AW9A 4E2WA 5F9FA 1JSXA 1G4HA 1MF7A 3K6KA 3UJAA 1EX1A 2CUTA 3PI7A 1DAGA 2YMPA 2VRBA 3PF9A 2GA9A 3QF7A 1W0CA 2Q4OA 5AK3A 3SIXA 1GZ4A 4LDJA 1H3NA 1T9GR 2IIVA 1JIIA 1Q1GA 4Z53A 3RKUA 1FS6A 4WNAB 3HCBA 1OTHA 3C5VA 4LXXA 2VJQA 1UMDB 4NI5A 5AVOA 4BP8A 1L7VC 4BO1A 1PR3A 3LYUA 3QVJA 2PL5A 3G5AA 3V1UA 4N0DA 3PNLA 2OO5A 5DN9A 1OVMA 2VC2B 2XXAB 2A2ZA 4RL6A 3R09A 2OP0A 2VF4X 3DCYA 3BMOA 1VKRA 5C5EA 5C81A 4QSMA 1P2GA 4EVIA 1CY8A 2IF2A 1SK9A 1RLUA 1BGXT 2IEYA 3GPCA 1XZKA 2FRXA 1JIXA 1BAPA 2WC1A 3JQGA 3L0ZA 3LIPA 5HFAA 4P4GA 3TLAA 4YRIA 1I94B 2XI4A 1TTTA 2MOKA 3WK6A 1JWBB 1AS0A 1AM4D 4GNRA 3LDFA 2HDOA 4WDRA 3URKA 4MKXA 3CKYA 4Y3UA 2HX1A 3AG5A 3QG5A 4HAZA 5DLEA 3SSNA 3V4RA 3AG6A 1Z0IA 4AY4A 3VYSB 2AOTB 1V9LA 1C7QA 2YY5A 3HH8A 1WNTA 3HMQA 1Z6PA 3QX9A 4K46A 4QGBA 1Z7GA 4KNVA 3REFA 4CKXA 2CLHB 3H4VA 4TTSA 2VHQA 5FNVB 1HQDA 2Y8EA 3LK7A 4KYVA 4YVFA 1NZJA 3FM9A 4CMGA 4GHWA 4B8ZA 2IIBA 4RO0A 4D8VA 2PL3A 2OCXA 3WLMA 1RBZA 2YJZA 2J5BA 4HI0E 3X1WA 1AIPA 1H8HA 1ZSVA 4RHCA 3AOGA 4YAWA 4C1NA 1E5DA 4GQIA 3CRZA 3D8BA 4UBJA 2PX5A 4XCVA 4D2IA 2PH1A 2VRCD 1X70A 2ODAA 4HDKB 4GOJA 4UHFA 1NTOA 4OJTA 5ALZA 3DVSX 1JW9B 1FA9A 1UT8A 3GBPA 4FNAA 2IRWA 3FFAA 1LRLA 1W85B 4FZ5A 5BR1A 1OBHA 2FPPB 4XTRA 4ZU1X 2SECE 1IY1A 4Z8YA 1D4ZA 4F86A 5DGDA 4EI2A 5CVCA 3NZEA 5AM4A 5IABA 5FUQA 1J0CA 7REQB 4PYIA 2OXTA 4DJTA 4YGYA 4NE9A 4UQPA 5JS1A 4R54A 1GNTA 3H8WA 4XFKA 5IEJA 2QUZA 1N2HA 4YJ3F 2FZLA 1RWPA 4BV8A 1XEWX 1X7ZB 2OQRA 5IG2A 1M6HA 1R4AA 4JBIA 4Q9LA 3WBKA 4NNPA 2BEWB 2XJ4A 5ALXA 2PZAA 4ZQHA 2PSHA 3CEPB 3E35A 4CQMA 3EZLA 1UBEA 3SR0A 2BFOA 3H2YA 1TCCA 2IHBA 2VXBA 3TD9A 4ZAFA 3TTUA 4M7WA 5JAZA 2V0GA 3INGA 2DJIA 2QDXA 2XUGA 4DR3B 2NYVA 1O3YA 2YDXA 3NCTA 3KLNA 3BRWA 4Y9DA 3EGEA 5AW1A 2EV9A 3T38A 3UPUA 3A6FA 2R1VA 1MOPA 2QYHA 3V3TA 2OFFA 4CVNA 3TCKA 2H5LA 4NHEA 4FYHA 2ZZMA 3CSSA 4IDNA 2BUAA 4EMUA 4FYIA 4EQ6A 4X65B 4IEEA 4KSYA 3OSUA 3TAHA 3PD1A 3SFTA 2D5AA 3JASB 3OOSA 2IOYA 4G0YA 2ATVA 5AW3A 1NSTA 3LGAA 4OM8A 3ZKWB 4DF3A 2C5AA 3WDLA 1HXHA 4C6TB 1IN6A 1KMHA 4HWOA 5CD9A 4YRCA 2QRGA 1C7RA 1DKNA 1USUA 3D7SA 3OURA 3HL0A 3VDXA 2ETXA 4L16A 2ENWA 3KP1A 3VC7A 2VPPA 1DOZA 5LQMA 1Z6TA 1ZU4A 3GV0A 4P3NA 2COUA 3PDHA 1KDTA 1OMOA 3E9CA 4HJRA 1PFQA 2AH5A 4Z0HO 4OYHA 4PC7A 1MZVA 4AO6A 4B7UA 1TT5A 2FG5A 4ZYXA 5HM8A 5CB8A 4MKFA 1ZIXA 5EHXA 5JVDB 4CV1A 1FXWA 3H87A 1A7AA 4XWTA 5HIIA 2NO9A 4JHXA 3F8TA 4Y6SA 1NHWA 4F5WA 3DLCA 3OT4A 4FKBA 3FOBA 4G37A 4XUCA 3ZCPA 1R4MB 1AK1A 5WRFA 1Z8HA 2QQEA 3WXMA 1NC3A 1E1QA 4JLNA 4X1KB 3R7LA 4Q37A 1JDUA 2IP4A 4W6QA 1QS0B 1RXYA 5K05A 1MHTA 4R5HA 4YT8A 1W30A 4CIBA 1E96A 1Z0JA 4FSHA 4RPHA 1TAUA 1DWQA 2JIBA 4D0GA 4XVHA 3PQ4A 2CNDA 2EOAA 3L92A 2C5BA 4CLRA 1E1MA 2G5GX 3AIKA 2JFBA 3N8KA 4HQ6A 2VO1A 2HBRA 2FZVA 1E0JA 2IXEA 2GHQA 2WYIA 3IXLA 1R0KA 3JR7A 5DM60 3I1YA 2OZVA 5D86A 4CF4A 3OOHA 5DNYB 1EP2B 2IA5A 4IRMA 3TINA 5D3MA 3LLUA 3QX7A 5HUQA 3IVMA 1XMQB 4BXOA 1GL6A 4OBXA 1LXCA 2CWDA 3BIOA 5C35A 5KNCA 1TX4B 1KFBB 4F7WA 1J00A 1F06A 2IBMA 3ORFA 1DMRA 3AZPA 4WD3A 4YRFA 2IOQA 2AVNA 4DQ0A 1AUQA 1GPYA 1YL6A 3AR3A 3MUOA 5L4NA 4O3FA 1RLIA 4BO4A 2F1KA 2PPVA 3VNAA 3ZWDA 4G2NA 1XVLA 5NLLA 1Y9JA 3OH8A 4N0PA 3PPWA 1J99A 1II8B 1KQPA 1TQDA 1IOVA 1QSGA 2YZMA 3GUYA 5E3IA 3V34A 2GN4A 5AXAA 3PUZA 5HCNA 1XLUA 3PDCA 1D1TA 1BKDR 4MRVA 3T94A 4X6XA 1UC8A 3NWPA 2AE2A 2OKCA 3GT0A 5K0GA 1LUAA 1T2AA 3K9HA 4B2LA 1J8VA 4DREA 3A1VA 5JE8A 1GU0A 1FFGA 3RFUA 2HNKA 4DABA 5LUAA 4DLBA 4O59O 4UXHA 2CNNA 2VPXA 6REQB 2WD7A 2G80A 5E4JA 4AF7A 3ENVA 4MSUA 2D2VA 1NL3A 1WLSA 2YFQA 4G1MB 5LDDC 3GRZA 3U4CA 2ZIEA 3IDFA 3MFYA 4EGAA 2GT1A 4ALJA 1GUDA 2K2QB 3KUXA 5TDHA 4BQPA 3K5IA 3P0RA 2VTVA 4A0SA 4EHIA 4PQYA 1NVKA 3TOVA 3AEQA 3OTQA 5IHXA 4W1SA 4QFBA 3LC7O 3K16A 4QAJA 1K6EA 4MYUA 1DC5A 3EK2A 2H1IA 1QGDA 1TDJA 1Z5ZA 4QECA 1DFHA 4RVFA 1T8YA 1JTFA 1H6DA 4YRAA 1HGXA 1KY5A 3T7IA 1WABA 1E2MA 1DBSA 4PCAA 1NUPA 5CH8A 1PFYA 3MJSA 1U02A 4GLOA 3V48A 4CWAA 3DEKA 4IVPA 5TGDA 3EZ9A 3BG5A 1L4FA 1KGSA 3AKEA 3HS3A 3GARA 4IO0A 4X61A 3AHFA 3TWOA 3PRKE 4EIWA 3LA6A 5BRJA 3HYNA 1CUDA 3VKUA 4P6VF 4XSVA 1QLHA 1YASA 2BE9A 5EJMA 1IZYA 1HDXA 1SOMA 1OF1A 3KOOA 5EUMA 5BUCA 1Z5GA 4BO5A 2X4LA 2DPGA 4JI5B 3UMJA 1VI6A 1DWOA 1OASA 4R98A 3OOYA 4MTLA 3N58A 2CLEB 1TAGA 3ZBTA 3ZK8A 1SG9A 3AVPA 3VYWA 2Y2VA 5JCJA 5AUNB 4YLEA 1ZS9A 4GX1A 4IGKA 1DKUA 4EABA 1XLTC 3VH1A 1H0HA 1NXPA 4N3NA 4NIMA 5B2ZA 3X2FA 1UKEA 3WGMA 3PE3A 3UAWA 2PRSA 2V7QD 2C0PA 1PFKA 4JGIA 4F3TA 1A77A 1RKBA 1UZAA 2NXJA 5CJPA 2BN4A 3V42A 1EMDA 2ZRHA 3R0JA 3FBTA 2WFLB 2ZUCA 3HHPA 2H1WA 4OF4A 3STHA 4ODIA 5JW6A 1HE3A 5TPWB 4PN7A 2O8CB 4R81A 4L8LA 1PHRA 2YWHA 4FFSA 1ODTC 2WZCA 2ZSBA 3DKRA 5FWYA 4LYDA 1X1EA 2PGLA 1GTL1 1Q0HA 1U1CA 3JZDA 4J6EA 3MJVA 3U17A 3GEEA 2OSVA 3W3AH 4MWZA 2YWRA 3ANNA 1YZVA 1TVCA 2O4CA 1UM8A 1ZKMA 2VRWA 3P26A 5G0WA 2CZGA 2FWJA 3UGTA 2X58A 2XUOA 4AJ2A 4ZI7F 1XCGB 3E9MA 5JRDS 1OYOA 3Q5GA 1R50A 5KVQA 2EVWX 5FH9A 3UENA 3U3KA 4ETWA 5HOQA 1P8JA 2FWRA 4KSCA 5L3SA 1PEDA 1U3CA 1BHJA 3G0HA 4YRBA 1KJWA 3HY3A 1OH8A 2BKVA 4GLJA 1IBKB 4DQXA 4KWTA 1R5OA 3J7AC 1YULA 4M9QA 2QL6A 4DSAA 4HFNA 1LJUA 3O7WA 4RS3A 4JT8A 3QEMB 1G3MA 2H2FA 3FJYA 4JKOA 3T5GA 2W6ID 2J3MA 3BQMB 3MS4A 4V24A 3CLHA 1PS9A 3DYIA 4EO4A 4RQUA 3BMXA 3FUWA 3I45A 4LJLA 4O4HF 2RGNA 5AHXA 3R9KA 4PRLA 1T36B 2JJ2D 3NBQA 3PJRA 4ZANA 5DNAA 3CUVA 2H7CA 4LYHA 2EP8A 5JLJA 2HJSA 1UAYA 1Z2PX 3PC8A 4KO4S 2P77A 4XI9A 1AO0A 3GF4A 3OJWA 3EAFA 2TRSB 4NBSA 4WFJA 2FX3A 5BN4B 4GXQA 3RAPR 1PR0A 4N3GA 3IVGA 1KJJA 2C7RA 1UJ4A 3NRCA 1K7CA 3L7KA 4WN9B 1YS9A 2NTJA 1SC4A 2HAEA 3ASUA 3V1LA 1GPAA 1I3OA 1DBRA 5AKHA 1JFSA 2YJGA 2ZRAA 3GL9A 4F92B 5KHLB 3P4XA 2PZBA 2X42A 3RRFA 3U16A 4DCSA 3Q72A 5ALWA 3GPLA 2PD3A 4F56A 2V7VA 3K6SA 1QYWA 5BNIA 4JC4A 3MK31 4Q12A 3ZDDA 2ZRGA 4MRNA 2AZDA 3KEGA 3PU6A 4PPFA 3JAWB 1ORHA 1UADA 1KOLA 3UV7A 2XNHA 4OV6B 4RH3A 3STUA 3OQ1A 1L5RA 1ECBA 2DGDA 2FN3A 2PGOA 1Y80A 2WG1A 3ACBA 4WXHA 2ZXUA 3WGZA 2QLFA 2HHHB 2EDCA 3V8QA 3TS1A 4XXHA 4BPBA 4J3JA 1VP3A 5D5PA 3MMSA 4HAIA 2P5SA 1QYXA 1P73A 3C3MA 4MX8A 4Q39A 5C3UA 3WY9A 4AT1A 2ECKA 3MWFA 1ARZA 2WTAA 1FC0A 2MSCB 3OF3A 5BV2P 2W2PA 2HDNB 4ZD6A 4A2CA 2G7ZA 2BBWA 3TQSA 4BMDA 3W8NA 4YRGA 1UJ5A 4GGOA 2ZJ4A 2J48A 3EGWA 4KO1S 2YYZA 3JQPA 1YQQA 2HCRA 2VS1A 5IYZF 4RGQA 3WB1A 1IHXA 5BV0A 1FX0A 2O20A 4LK2A 5EIXA 1Q0RA 3R7FA 3KU1A 5FPTA 1TUBA 4KQ6A 3ZJUA 1ND6A 2OM2A 3E2IA 5IVDA 1DB3A 3CMCO 5J4HA 2V9PA 4L85A 1MJGA 3B9RA 3JQ7B 1AHIA 3NW9A 1M1YA 4D81A 2DHRA 2X2OA 1VL1A 4DPMA 2YJ5A 4E32A 1E7RA 5J9FA 2VHVA 4PYOA 4WCVA 1BDJA 3FPFA 2EGGA 2H2HA 2VAPA 3JRNA 3O8OA 4RV9A 2GESA 3BMCB 1KU6A 1ZRNA 4X63A 2B92A 5IF3A 4BU1A 1P18A 4IJUA 4B3FX 1NVGA 4CI0B 1QAMA 1M67A 2B0JA 2ZAYA 4HZUA 3DP9A 4P3YA 4JOCA 1P1BA 4PZCA 2FE1A 3ZZ1A 5EN4A 1YDGA 3WYGA 2ONZA 1WXQA 2WIGA 5TE9A 5KSWB 3OWHA 1JR4A 3QKUA 2RGWA 2VR1A 3KKOA 4R8KA 3JZFA 2GNAA 1MMFB 1N3IA 4EY6A 1AZLA 2IYEA 2PWZA 2EQ5A 3NNSA 1JYFA 3CW9A 5LA6F 2ODEA 2DT8A 2BPOA 2DZDA 4FFMA 1YRYE 3IA2A 2FHSA 2O14A 3N74A 4HB0A 1K2WA 4RHUA 2HA0A 1F8YA 1VI5A 2GTIA 2ZDGA 4RJIA 3TXXA 3HR7A 4GM0A 2HQOA 3WWEA 1ZMOA 2C42A 4P4SA 4ZOCA 4IDEA 3SKYA 1LBHA 5YASA 1SVLA 2XQFA 3SF8A 1A5AB 1CXZA 2PH5A 2EFCB 5HPYB 1R0SA 4WCDA 4XR4A 3TR5A 5JJLA 1FFHA 4YV7A 1YS2X 4LHEA 4IX1A 5EJ4A 2BGIA 1QCDA 4HNHA 4Q4CA 5JJIA 4FX5A 2CYAA 4JHLA 4PGFA 4QDTA 4CMEA 1DUSA 1PWZA 2P7IA 2YMLA 2WSYB 1GIAA 5J2UF 1TECE 3BCRA 3OVMA 1T6BY 1ZQ1A 3ENNA 3KYDB 4NE7A 1Y7LA 2BJHA 1IY9A 4WW0A 2DFKB 5EKTA 4ZT7A 1Q3TA 1NVDA 1ULAA 3S2UA 1GNQA 3CH5A 1GA1A 1CNFA 3NONA 1CQIA 1J1IA 1TRKA 4YEDA 3AP2A 1U80A 1VL8A 2GNOA 4MDHA 4QQNA 4D45A 4YT4A 4EB6A 3W7BA 4Q00A 3VR2A 5B3LA 4PC3A 3E8SA 1OTXA 3DD5A 2G83A 2OHGA 3P45A 2XKKA 3W1EA 1LBQA 4JBYA 2FUG6 2MMCA 2NIPA 2Y4NA 3HKDA 2ZBPA 3T7RA 3T4UA 1L7XA 1PFVA 1NXXA 4N01A 1QP0A 4YR9A 3W4JA 2YFKA 3RTAA 4BZQA 2PUTA 4WLEA 4ZAXA 3IEMA 1KVUA 3NETA 4HRAA 4PIMA 2QB5A 4QEDA 4DZZA 5HF9A 3C5EA 1V9SA 3F6CA 3Q9NA 2OXRA 4EVQA 3O94A 4AM8A 4CQMB 3BMNB 5E9JA 4K6HA 4C4OA 4RTPA 4EDHA 1N4DA 4CCSA 2QTAA 2AMJA 1GTJ1 1L7MA 2WQZA 3KC2A 3EFOA 1OPXA 2VF5X 4DQUA 2WJJA 3REGA 2JLQA 1VDZA 4MVJG 5M2QA 5IZCC 3PE6A 2BDTA 4YRZA 2P9ZA 1FX1A 3H2HA 4MI9A 1D2CA 2J5RA 2JNWA 4HZGA 2P0AA 2VVTA 1X1QA 2FW7A 2XA2A 3KDPA 4OPMA 4ZREA 4BL5A 4EPRA 2V4UA 5JDCC 3K72B 1U63A 5C5IA 2DFPA 4H35A 2E4YA 3S40A 1R8JA 4L0CA 1GNSA 1W2WB 3BE4A 3S8EA 1VMDA 2XODA 5CNMA 1BCSA 2QN2A 3R3HA 4O2AF 3II6X 4UKDA 5JQWA 2M32A 5KVSA 2P90A 1E0KA 1Z0FA 1T2DA 4FYXA 1CT9A 2PANA 4YP7A 4PAGA 2H4WA 2VPIA 3LMKA 1WW8A 4K40A 1KO5A 1NQUA 1RXEA 3MCWA 3D0RA 3PFHA 2OAP1 2Z8YA 4HH1A 3Q3CA 5DYYA 1OV4A 3HSKA 5EXTA 1O0CA 1YMUA 3T3GA 4CKCB 3OY7A 4Z0NA 4DCOA 2EKBA 3DAHA 4D02A 2UUAB 5K3CA 2QTWB 5GWXA 5KNLA 3UAZA 2VNJA 1BRMA 4A26A 1GZ3A 1C3OA 3DZFA 4CUKA 4BATA 5L4LA 3KIPA 2ISCA 1X38A 4X95A 1LVHA 1V1JA 2XHZA 4IVNA 1OW3B 4J0QA 3JYLA 1WU8A 2PX2A 1HDCA 3OX4A 1F0KA 1ZM9A 3QV2A 2GPBA 3PJDA 2PT5A 5ENDA 3C24A 2V97A 3AI7A 2BMFA 1OAOA 2B3DA 2VSOA 3OLCX 5IF9A 4J2TA 2GD0A 5DGHA 2JASA 3HB4X 1GFIA 1XQYA 3LQYA 1EQUA 3W2IA 3X1JA 3PPXA 2P91A 5IH3A 3GOQA 2YIMA 2IQ5A 4UMVA 2UUCB 2GF0A 1DT3A 1IVNA 5J5CA 3LPMA 5CVEA 2PVPA 3DTNA 1CCWA 2QRQA 3BRQA 4TLBA 2Y0PA 3HN2A 1QYVA 1TJ5A 5DCWA 4RE5A 3GLTA 4JXJA 4LHWA 5CLIA 2JS7A 5J3JA 4EI8A 3PC7A 3AR2A 1REQB 5KSYA 2EBHX 2X6QA 4TT3D 4PBSA 1W1WA 3D5QA 2X8LA 1NQXA 1WOMA 3I04A 5KJEA 3E5NA 1N9GA 2J6CA 5CVVA 6LDHA 5HP4A 2OYCA 1QANA 4DQVA 2BGRA 3F8SA 4G9GA 4ZVLA 3TNLA 1Z7BA 2C20A 1HMYA 1Z7YA 4KACA 4I4IA 1I7NA 1E18A 1W6RA 3H2SA 2BZSA 2P35A 2VZ8A 3LSTA 3H1BA 3NHMA 1GG2A 3GELA 1R10A 4PZYA 5AJZA 3GCXA 4FSDA 2QQFA 3O0DA 4QC2A 3DC2A 3VJMA 1NIPA 1IBRA 2FRVA 3B3QA 1HX7A 4CNBA 2AF4C 3QVGB 4E2YA 1GP2A 2ZVQX 1V5FA 4O02B 4X91A 3EARA 3WFJA 3CH7A 1XCPA 4Z1MA 1G8HA 3TJRA 3W4IA 2ZRBA 5JQGA 4DV3B 3DUFB 4CETA 4RENA 3VYTB 1GFZA 3K20A 2BSXA 1IHPA 1YQ9A 3E53A 3C5WP 4H1WA 2OZPA 2IXAA 1T9CA 3AEUA 5IPFA 3N0XA 3D2AA 4DCTA 4OJQA 4QZVA 3PQ8A 1UMBA 1GXSA 5CAEA 3VR6D 4H3KB 1IM2A 1FPMA 1EGMB 3BL5A 4GFDA 2N1MA 3CT4A 3HE3A 2AKEA 4NU8X 4IOLA 3M6VA 1I33A 2Q4TA 2Z08A 5DWQA 4B75A 1PS8A 1Z8DA 4DLXA 4B3SB 4OHYA 3UCXA 1OIVA 1PWHA 1XCJA 2GN8A 2J3DA 2RIRA 3F7NA 1DAIA 1E9SA 3DXYA 4GXRA 2AN3A 2ORIA 3BUSA 1D1PA 4MV4A 2NQTA 1NJ2A 4OFWA 1JHYA 3L6RA 4J4HA 1IFXA 1EFPA 2E4XA 3E48A 3O90A 3WYEA 5GTDA 3FAZA 4KOAA 5FYDA 1FSPA 2ZETA 4A0RA 1GLGA 3QUQA 4BMSA 5TEVA 1W5AA 4F4CA 2VPYA 2Q1SA 3HJCA 3A26A 3HKEA 3RIGA 4BZXA 4EKDA 4RIEA 3AF0A 4WLUA 3I0MA 3U4GA 2AK2A 4CL0A 4CKWA 2QRVB 3V5NA 1FFCA 1QE3A 2V5VA 3CVJA 5H82A 3RS0A 3UAGA 3UMCA 1SNYA 3QFSA 4UEKA 4BDSA 1VHJA 2AV6A 3H4IA 3QI2A 5BSEA 2QGNA 1JPJA 2IYZA 4IJKA 1KIAA 3IB6A 3E2MA 3GXBA 4ARAA 3DDSA 1FFSA 4PAOA 1XKQA 2AWOA 2YTZA 5CLQA 1F17A 1T5SA 3HJUA 3SLRA 3PVSA 1SM4A 2YX1A 4QBFA 3WIUA 3ER8A 2VT2A 1J23A 5B3JA 3X1YA 2BM0A 4BRZA 1OGJA 4XDHA 2YV4A 2ID8A 5FLEX 3SY8A 3COYA 3ZLUA 1OH6A 3W5UA 2F55A 2Q6TA 3MJDA 1P45A 1RJ9B 3Q5EA 3S29A 3FFTA 3UXEA 5BW4A 4D8XA 3H2ZA 2RGBA 1PG5A 3RG8A 1XPUA 2AOWA 4M8SA 3ZE0B 4DDMA 1G7RA 4WWHA 2PX3A 2QW8A 2XCRB 1VHTA 2FYTA 1EFHA 3HRKA 5ISMA 2GAIA 3EVCA 4AUKA 1WVGA 2WV7A 2QM3A 3CEHA 2RHOA 4GPEA 5D84A 3VR3D 4WVLA 1XZAA 5L6MB 3LQQA 4LZNA 5JAQA 3VAYA 4MVJF 3NBXX 3QI7A 2JATA 4RD3A 1W9HA 3CNQS 2D1QA 5KOJB 1YS6A 4AAYA 4DEXA 1W36D 3UMFA 3FHCB 1QO7A 1VA4A 3OJLA 3GUZA 2ZUUA 4FXOA 3EYWA 3KEQA 4EECA 3WSVA 4HCJA 1LK7A 5E7MA 3UYKA 3U3OA 2PZLA 3FZGA 1P7CA 2PY6A 3IEIA 2A33A 3GGOA 3G5MA 3JTEA 1O77A 3DMHA 4I55F 1K9SA 3HP4A 1USVA 2BGKA 2VCYA 3OPMA 4PQGA 3ZHQA 1J2YA 1JEYA 3E9EA 3PCRB 2DKFA 4K9SA 1KAQA 3HJNA 4HNRA 1XEWY 4IS3A 1NE7A 3DKPA 3E18A 4V2UA 3F7OA 1C7EA 2FZ4A 1SUCA 5JCOC 3EIXA 5AKXA 1T2UA 5CFMA 1Q77A 4JL8A 3JCZA 3NWJA 4H16A 3C43A 3KRTA 2XPCA 4I50F 5LP1A 1B43A 2ECFA 1U3VA 1WXFA 1GRQA 3GRPA 4KIGA 4MS4A 4BX9A 2D4AA 2JI6A 3SC3A 1QU2A 5UKDA 2NXEA 1VPEA 2H0RA 3ORYA 4B2YA 4ZZ0A 1KBOA 3VYVA 2F3UA 1E1RD 1IDOA 2YOHA 4FCWA 5K1ZA 5AW2A 1Q19A 2VK1A 3V1YA 1CJKC 4WOCA 1ND5A 4UOZA 4HT3B 2E18A 1C3LA 1JEEA 3I9V6 1OAAA 1Z7WA 1CE8B 5ALJA 3E6AA 2DT5A 4KVFA 5EEHA 3A4VA 2HMTA 1GPH1 1SKAA 1SXJA 2CJWB 1JHAA 2O0KA 3PQEA 3WK5A 5JMWA 4BKQA 2BJWA 1VLVA 3HB1A 3QF4A 3OFKA 4I4LA 3VVLA 3WRYC 2QTTA 4S04A 3UBMA 2RGAA 3HCDA 3GLIB 4R6XA 3LBFA 2F48A 4RFSB 2WUFA 4EO7A 3KPUA 4N7JA 3EWNA 1PZFA 2DG2A 2I7TA 2RI0A 2GPNA 3EIWA 3VGJA 1TFRA 2PBLA 1WMSA 4MVYA 4YCNA 4N5DA 1JKJB 1O4WA 5L7YA 1DEXA 1HLDA 1W94A 4IOKA 4ZIRA 2Q3JA 1QF6A 1G0NA 3AI3A 5D6NA 1KMQA 3PSHA 1JJIA 1SHJA 4FBLA 5KKAA 1AA6A 2CVOA 3TX6A 1ORIA 1UZUA 2PZEA 3SQOA 1DL5A 3IAS6 3SZ3A 4BFUA 2JRCA 4R2JA 2H1OA 1MB3A 2P9EA 3KQTA 2OBXA 2QXYA 3DCIA 5KCZA 1FLDA 3R4CA 3HV0A 1DX9A 1MFZA 1UKCA 1GAJA 2G82A 2PDAA 4TTRA 2EQAA 5D51S 3H1EA 3Q3GE 1UR5A 1KK3A 2E4ZA 3AB8A 3L6DA 3QPUA 4FFBB 4HC4A 4JZYA 4LJRA 2PUGA 4BVKA 2HA7A 2XZOA 2FLVA 2PD6A 1KKUA 2ZJZA 3CCFA 4YV1A 1DRUA 2VJBA 1PSWA 3E22B 3SM3A 2AC4A 5AO9A 4K0RA 4NNOA 3RVRA 2Q3DA 3DR5A 5LYJF 4G5XA 3G79A 2Q21A 5HS6A 4DLUA 4YWHA 2DX7A 4EB0A 3C39A 5CH5A 5B6JA 1O03A 1QUEA 1Y3HA 1CRWG 3LLSA 4IIFA 3VOAA 2E5LB 4TLLB 1Z73A 2SHKA 3F9RA 3ZY4A 1GNPA 4B3RB 1HY3A 4WKGA 2Q5JA 4P33A 1YBMA 1X77A 3LBHA 3MLBA 4MV8A 2V9CA 2NQ2C 2XUKA 3A05A 4ND8B 5ALOA 2AG1A 4CUJA 1GDHA 5EIBC 2XBUA 4I5IA 3MT8A 3U4IA 4P32A 5IT0A 4YPVA 1Z35A 4ITRC 5JD3A 2NM0A 3ND7A 2YVQA 3M83A 3P9ZA 2QPOA 3T0IA 1ISGA 1KO4A 5F7OA 2FQXA 2GXUA 1T43A 3TTYA 4G8JA 2GPAA 4W9NA 2WTUA 5FOTA 2QUHA 2V7GA 1NC1A 4JOQA 2V45A 3AONB 3P94A 3Q7QA 5DGCA 3SF0A 1XMXA 5CXQA 3QZUA 3IP7A 4MUAA 3RD5A 4EGJA 3BD9A 1W2HA 1YC5A 4H18A 4I9UA 5F3RA 4GYYA 3IP3A 5TX7A 3U48A 3OICA 4LCBA 2OBLA 3Q2OA 6AT1A 3DO8A 1T2EA 1BA3A 3TOZA 4PYQA 4F3NA 4QXOA 4PSDA 1XC7A 2O3SA 2R86A 2OZLA 2VJMA 3RJ5A 3ZGYA 2ZBUA 1G2QA 1VFNA 2W22A 5J1SB 5HFJA 1YR2A 3GUHA 2X1HA 4LMAA 1R00A 5JIBA 2R84A 2HWKA 1XJWA 2HJRA 4GLBA 1KQ3A 3MXOA 4H27A 4NG4A 4KH0A 5EJEA 5ALDA 3BWVA 4L2IA 4EPXA 1U9CA 5H3HA 5G02A 3GJXC 3D3JA 3G13A 1P7VA 1SEPA 1ORRA 4QUEA 2RGCA 1V4BA 1JXMA 1VM6A 1Q7TA 2YXLA 1IY2A 4MPJA 5CT9A 4CIWA 4KV9A 5GVRA 1SXQA 3BE8A 5H3LA 2VJOA 4OA8A 3Q1KA 4CEIB 1A1SA 3VI4B 3QA3<