4TTQA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with atp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
b'MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
molecule tags Transferase
source organism Legionella pneumophila subsp. pneumophila
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
total genus 74
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttqA00
4OHVA 3NHBA 5JFGA 1M8PA 2OHFA 4C2UA 2CEAA 3E70C 1L4YA 4JT4A 3MGCA 5KSOA 4B33A 1R6BX 1W0JA 4G0NA 5FL7D 5KSYA 5K8UA 1EGAA 2JASA 2JJ2D 2ZI4A 4M4SA 4KLZA 1CKEA 3EA5A 4WVFA 3ZVLA 1NMYA 1Z22A 3GLFE 1EX6A 2IF0A 4FINA 2R9VA 1XX6A 1GWNA 3RYTC 3U61B 5FTMA 1W4AA 2B6HA 2GCNA 3C5HA 2O8DA 4LBWA 2ZI6A 3TH5A 1ZNYA 2IT1A 4ZDKA 3DOFA 3RS3A 1PJRA 3W6PA 3ADDA 1VCIA 2QL6A 4KYUA 1WP9A 5EQTA 5HE8A 1QBKC 2EFHB 1HV8A 1MO4A 5EP1A 2C98A 4XD7D 3VR2A 2B8TA 4DLXA 1RW4A 2RGBA 3I8XA 3QEOA 2ZRHA 3QKUA 2VSOA 1KDRA 2CVFA 2CL7X 4NONA 1ZD8A 3DHWC 2P2LA 5SZHB 1AZSC 4B3DA 2W6JA 3L0SA 4HUQA 3CNLA 4OK5A 2OFWA 2XXAB 2QAJA 2IXGA 4PPGA 4RCYA 3EZ2A 4PC1A 1Z8FA 2JDID 1TF2A 3L0PA 1FX0B 1F6BA 1SHKA 4TSFD 3SC3A 2O8BA 1XTKA 1CR0A 5P21A 1J2JA 2LKDA 4US1R 1OB2A 5L3SA 2A5FA 4Q66C 2RGAA 3CR8A 5KU1A 2C99A 2IHYA 4A6XA 3QXXA 1YRBA 3NEJA 1RZ3A 4DLTA 4GOXA 1Y3AA 1G8GA 4MDEA 4D25A 1OLOA 4B75A 4MUBA 2ORIA 2WBLC 3PQCA 4PZYA 3CRW1 1YVDA 1NSFA 1X86B 3EZFA 1IN7A 1ZBDA 3WYFA 3B6EA 5AJZA 2GBLC 1DVRA 1K5DA 2MSCB 2QG6A 3QXCA 1HT2E 4LHZA 4K81B 4P31A 2R44A 5KPJA 2VP9A 2NZ8A 3W6NA 1W36B 2IYUA 1NSTA 4LC0A 1OIWA 1H8HD 2RGXA 4HATA 1Z0KA 3O47A 1E1RA 3SFVA 1GNRA 3A37A 4Q1DA 1JAIA 3WRXC 4B6FA 5JS7A 4NCHA 4DLZA 3SS8A 4TWZA 3AF4A 4E09A 2I1QA 3HU1A 2BMJA 3WP1B 4AYWA 2MMGA 3RSOA 4AG6A 4BZXA 5CIQA 2FGKA 1G1MA 1T3SA 2ZRAA 4V0LA 3GFOA 5DLQC 1RRGA 3LDAA 3RWMB 5J4VA 4PC6A 3TW4A 2I4IA 2W00A 5DHAA 2BVNA 4BFSA 4PQFA 421PA 2JJ1D 3LX5A 4EFNA 1FP7A 3AVPA 3VX3A 4MRNA 4EKDA 2PLFA 4JVMA 4RD1A 3BC1A 4G5SA 2F6RA 5L3VA 3P4XA 1W0JD 2AN9A 2PH1A 3TSOA 1OH7A 4ON9A 3RSLA 4Q9HA 3HU3A 3SJCA 2H5EA 3L8YA 1R8QA 1NN5A 2FSGA 3IUYA 3OHMA 1R5NA 3U7GA 2OFXA 4DLWA 3TR5A 4EPYA 3U7EB 4C30A 1ZM4A 5DI9A 4RZXA 2V6IA 5L3SB 4JJZA 1OXVA 5G41A 5FBQB 1G5RA 1KO1A 3CW2A 1E2MA 3DKPA 4DIDA 2ZJYA 4G5QA 2NG1A 1SXJC 4OHWA 3RS2A 2F43B 3CH5A 1QZXA 2WOJA 4PC2A 1OXTA 2R2AA 5FTNA 3IO5A 3KJEA 3BB3A 3JZAA 3I5XA 2AD1A 2BMEA 1UBCA 5LD2B 2QBYA 3UMFA 1W5TA 4PXAA 1NVXQ 3C4JA 1M6NA 1XEWY 1ZU5A 1X1RA 4TMTA 1TAGA 2ZAOA 1NBMD 3E5HA 4A9AA 2P6UA 2V8OA 4F93B 4I99A 5JHGB 2ZSDA 4M53A 2ZEJA 1VHLA 3ZIAA 4BASA 2VPPA 3G5UA 3TNFA 3TVTA 2WWGA 2XOKA 1R5OA 2XX3A 2FPLA 1G16A 5IRCD 4NYJQ 2EW1A 1GIAA 5DHFA 3N70A 1P73A 3SEAA 4YDSA 1W48A 3B13B 5JJKA 4C0HA 4B43A 4QOSA 4JLOA 1KAGA 3ETLA 2F3RA 1S3SA 3OF5A 1AN0A 1JR3D 3PIRA 4OQXA 4Q4HA 3CNOA 3C7KA 4PPQA 3K0CA 5JCZA 4A2WA 4QM6A 1S9HA 2GILA 2AFHE 3WHKA 5JEDA 2OAP1 2WIBA 2VBCA 3K70D 5B30A 5AUQA 2OO7A 3KJIA 4U00A 2KE5A 1E79A 3TAUA 3K70B 1ZVQA 4QNMA 1U0LA 1XFAA 1VYTA 5EE5B 4D26A 4OHYA 1WXQA 3U6KA 3VX4A 1WQ1R 2FPMA 4NCNA 2EWVA 3W8RA 1ETUA 4PANA 1G21E 1S4QA 5FPKA 521PA 4Q03A 2EYUA 3Q85A 4HLCA 2CK3A 1SVOA 4Z1MD 3O8DA 3SBEA 2CE2X 3DVLA 3L0IB 5JMTA 4G5RA 3BXZA 2VSFA 1G9XA 2WSMA 4BLSA 2A5GA 3TUIC 1N6RA 4DCSA 4BEBA 4I1OA 4C0KA 5C18A 3HYRA 4KSCA 2W0SA 4Q5IA 1G19A 2QPOA 3MUFA 4IVRA 4M9XA 3U3OA 3RANA 5TB5A 3UMSA 3ZQJA 3IPYA 4QHYA 1OF1A 2OLJA 3A4MA 4LHVA 2PMKA 2EFCB 2QSYA 1LS1A 2CHVA 3FYHA 4NKRA 3VU9A 1KI4A 4QRHA 2ZM5A 3QIAA 2V4ZA 4DLVA 4DDWA 2DHRA 3AH8A 1GG2A 2ZUCA 3R9IA 4HAUA 2X19A 2JLQA 2RGNA 1LV7A 2X8AA 2FJUA 3RRZA 1T6NA 2D2EA 3BFKA 5LPNA 3NIBA 1AQYA 1R0ZA 1ZIPA 3K9LA 4JLNA 1O3YA 2AK2A 3QBTA 4DXAA 3EWSA 1W4CA 1BOFA 4R2IA 1Z29A 6Q21A 4CEHB 3OFNA 1P9WA 3Q5DA 3A4NA 4TTRA 3AVXA 2XNSA 5FR1A 1COWA 4CVNA 1X8LA 3AVWA 4TL9A 4BRWA 2JCSA 5FPYA 4IW3B 1SKYB 5DN6A 5CB6A 1E2IA 2OM2A 1Z2AA 3W8NA 1WB9A 2QN6A 3FE2A 4TTPA 5FBVB 2RGNC 1KI9A 1ZU4A 4A1FA 3TE6A 2CCJA 1CJMA 2QNRA 5KOYA 4DEYA 2ZRMA 2QA5A 1RRCA 1EWQA 4ZKEA 4N1AA 2A3RA 2B7CA 4XWOA 2J3EA 1MRSA 5D3MB 2O8EA 2ZI5A 3GLGE 4DT1B 2FEOA 3U4QB 1M1YE 2WMNB 2ORWA 4AYTA 4EPVA 3JVUA 2GEDA 3RS0A 4D2IA 4IOMA 1KDPA 3OESA 2QP9X 2PX0A 2HF9A 1E2DA 5DO9A 4B6EA 1H8HA 1KSFX 2OCYC 3AVTA 1TTTA 1VKJA 1JAHA 4JT2A 4MQBA 3CR7A 4C0LA 1Y63A 3WP0A 3UK6A 1Q3TA 2QU8A 1TADA 1T8TA 1S0UA 1D8TA 1FQKA 2VH5R 3QPUA 4FCWA 4ZDJA 4DLRA 4XWAA 5CIWA 4DCTA 3OEHA 2OT3B 1NBME 3WHLA 2OUKA 1IXRC 1KI2A 3FGNA 4QJ3A 2J5XA 4JKYA 3BOSA 3BE4A 3SU8A 2B8WA 4B2LA 2QEQA 1KK3A 3ZVMA 4HLUA 4Z1MA 3THOA 1Q21A 3WMFA 2JJ1A 3EC1A 4DDTA 3QI2A 2WWYA 2BJWA 1XNJA 4BEJA 2FH5B 2OBMA 4DUGD 2QE7D 1QHNA 4JLMA 1Q1EA 3AP3A 1Z06A 3C8UA 3QPVA 4CT4B 4Y0VA 1Q1QA 3THXB 2CJWB 2IYLD 5TV2A 3RC8A 3L82B 1XJCA 2GJKA 4JLBA 1UAAA 4MYHA 1OFHA 3ZZ0A 3ZQ6A 4KAXA 3T5DA 1IM2A 1UDXA 3RNLA 1KJYA 2DR3A 5JSZA 3VR5A 5K8LA 2W2XA 3EIQA 4BZPA 3CBQA 3DOEA 1E0JA 2WJGA 4PHFA 3TSWA 5BW8A 2Q0HA 3UKDA 3H2YA 1YZUA 2BEJA 1K8RA 3U7FB 1DO0A 5JBQA 5J4HA 1DTSA 1NN0A 1Z83A 2QMEA 4D4KA 5BXQC 3VFDA 1Z5ZA 1SHZA 2NO7A 4KU4A 3K09A 1JR6A 3SJBA 2ONKA 2C77A 1QHSA 2QM8A 3N2EA 4KVAA 5EJEA 1UDWA 4MYCA 3OAAD 3QBVA 1TPZA 2EQBA 2GK6A 5KDLA 1HEIA 2EWWA 2FFQA 3QKRA 1DAFA 4UXIA 2WKRA 1NVUQ 2OBLA 5TY0A 2JIZA 4B73A 2XOKD 4G01B 1G5PA 4NTZA 4US0R 4GNKA 4P4TA 1U81A 3C14C 3QKSB 4OI4A 5FBRB 5CM9C 2C95A 3T35A 3K09C 3LW8A 4IEEA 2V7QD 1EG7A 1E2JA 1R4AA 2IYYA 1CR4A 3R9XA 2BMDA 2Q9AA 3GJ4A 2IS2A 4FI3C 5FTKA 4J0QA 4LC1A 1CF4A 1KI1A 1G7SA 1A2KC 3BIFA 3UIEA 2XZLA 4F4CA 2BMFA 3TUZC 5AJXA 4QGAA 2QENA 3SZRA 4LSGA 1HE8B 2XITA 2ZROA 1A4RA 3LH5A 3ASZA 4OI0A 3GJ5A 1US8B 2O5VA 2ZS8A 1YU9A 1WMSA 4LDJA 4TLEA 1G64A 3D7MA 1EESA 2EFDB 3K9HA 1DO2A 1LY1A 4A2PA 3U7HB 3PEUA 1G5TA 3ZD6A 3AV0B 2HUPA 3H86A 2IUTA 4PFSA 2ZRKA 4DEXA 4LBVA 1F2TA 1DAIA 2V1XA 1N6LA 1YJ5A 1OYYA 4L4UA 2C96A 2OXRA 3LLMA 4HB4A 1LW7A 3K0CC 3GJ6A 2ZRBA 1W0KA 3U60B 2HF8A 3LO5A 2QMUA 3EPJA 5IF9A 1ZD9A 1BS1A 1TF7A 3NBFA 2ANCA 2IYQA 4M1SA 5JI3E 1H65A 3HP1A 2ZREA 3AVOA 3BK7A 3U2QA 4NMMA 3QVUA 4LHXA 4IDPA 3NBYC 4Q4LA 1KZGB 2J41A 1RJ9B 2OLKA 2PJZA 5HZKA 1ZNXA 1U8ZA 1BMFA 1JNYA 2BJVA 3MJRA 1CULC 1KI6A 3KKOA 3PUWA 1NN1A 1OXUA 3MLEA 1IN6A 1OV4A 4PC3A 3RVBA 4LJ7A 2G0NA 2IBMA 4TL6A 1RYFA 1VCOA 4GDFA 1JEDA 2Q9BA 1ZM3A 4PZZA 3EPLA 3B78A 1P60A 4B2PA 1TQ2A 5DE3A 1SVLA 2H57A 1GZSA 4EDHA 3GLIE 5CJPA 2GXAA 2N1BA 4JVNA 5J4KA 5A0FA 4Q1AA 1KDOA 1KTVA 4AC9A 1OSNA 2D3WA 1GFIA 5GJVC 4UKDA 1E1RD 221PA 3IHWA 1G3QA 1S2MA 5DYGA 2PEZA 3C16C 4LV5B 1WA5A 3ICQB 1R0XA 1YZQA 1E2KA 5UKDA 4F4JA 4RD6A 1XTSA 4EQ6B 4ZCLA 3KKNA 2ZSAA 3ASYA 4CIDA 4LX0A 4LYFA 1E4VA 2ZSFA 4B76A 4YMUA 1OFUX 3QSYA 3S1AA 3VTKA 4EAQA 1KSGA 5DNYB 3VU9B 2ZE6A 2IXFA 2A5DA 4DVGA 4AY2A 2XSZA 2VHUA 5LB2A 1NIPA 2ZI7A 2RH5A 1KI3A 4ZDWA 4PZLA 4CF7A 4V0ME 3AVUA 1RIFA 3M0EA 3QPWA 4BFYA 3LFUA 5FTJA 1P6XA 1T3LA 2H8KA 1QHYA 1Z08A 4W5WA 2PEYA 4E22A 3PEWA 3X1YA 3THWA 2V54A 4LJAA 3CO5A 1MABA 3MWJA 2WJYA 3AF1A 3EX7C 2ZQ5A 1YR6A 1GTVA 2GEUA 4IEIA 5FR2A 4E07A 4GZLA 1PUJA 4CEJB 5E3HA 1SKQA 1SXJB 1T91A 1A2BA 1W46A 2PLRA 3NH9A 4URUR 3GLHB 3RS7A 4M8NE 5FOVA 3UANA 4BZQA 4NU0A 3AUXA 1NY6A 2JGNA 1Q3HA 1GL6A 2R65A 1RYHA 2WHXA 1E4YA 4LJ9A 4KXFB 4YMTA 3VKHA 4IOLA 5D3MA 1RRPA 4DLYA 5JZVA 3I62A 4D0LB 5JJLA 2PZGA 4A8JB 4MGZR 5L8VA 4O2LA 4EFMA 1UF9A 4KYIB 1RC8A 3P20A 4LJYA 2VF7A 5JWHA 3PG5A 5K8TA 3OFND 1TNDA 1VYUA 1HYQA 4BE7B 2CDNA 1XBTA 1P75A 2ZANA 2IW3A 3O8BA 4QBIA 2QE7A 5FOWA 3I61A 1W7AA 2V6JA 1W36D 2ODWA 4LCBA 3QQ5A 3K0AA 4IHQA 4JKIA 3ZS8A 3KQKA 2XGJA 4B3XA 2DWOA 2RB4A 1YHNA 3LBIA 3WMGA 2GEVA 1ESMA 2AXNA 1R7RA 2ZRGA 5DI3B 3GLIB 2Z4SA 4DCUA 1XCMA 4H1UA 2GJ8A 4ARZA 1VHTA 2YZ2A 5EP3A 3HJNA 1K6MA 4TLDA 1JR3A 3LAWA 3T15A 1YE8A 1U94A 5FI1B 4LBYA 3THYB 1J7KA 4DT1A 1Z6YA 2XB4A 5KDDA 2R8RA 1FUUA 4E5UA 3E2IA 4EJSC 5DH9A 3Q7QA 1J90A 2X77A 1E79D 2RGEA 1JJ7A 4I1UA 5AUPB 2KBFA 2Z0MA 1CJVC 1ZC3A 4TT3D 4TYYA 4RKEA 1GKIA 2GKSA 2VF8A 1SVMA 1N3BA 2QM7A 2FF7A 1XEXA 1KY3A 1NJGA 3RS4A 4NCIA 2BC9A 2BEKA 1XXHA 3M4YA 3OEHD 3ADBA 4C0SA 1N5IA 2CK3D 3X1WA 1NL3A 2GWHA 4XTRA 5JSZB 1IONA 4UNSA 1DE0A 4ESVA 1N6KA 1NRJB 5B64A 1IAQA 4L5BA 4Z51A 2PCJA 4QXAA 1VPLA 4HDOB 2ATVA 1E2NA 4GP6A 3KKQA 4F91B 1P2VA 2QQ0A 4OHXA 3SYLA 3WXMA 1Q20A 1ZP6A 3Q8XB 3T06B 1E9FA 4IDHA 1W2HA 2WVJA 1E0KA 4HUQB 5KNDA 3DM9B 4C0BA 2ZJ2A 4A15A 1EFUA 4XIGS 5KUTA 3PVSA 2CJWA 4KO8A 2GZDA 4EIWA 3CF2A 3QF4A 3R8CA 1TEVA 3P32A 5TXGA 4LRWA 2LWIA 4AKGA 4RY2A 4FMCF 4M1KA 4TMVA 4AYXA 1II8B 2ZRPA 3FDIA 4NYMQ 2JLVA 3PEYA 1ZUIA 1BIFA 1MOZA 2X1VA 3VAAA 3LLUA 1D5CA 2ZAMA 1CR1A 2PCLA 1Q1ZA 3NWJA 1OB5A 2PBRA 4Q7LA 4NCKA 2ZRCA 3KQUA 4P33A 2WJHA 3T1TA 1OHHA 1XRJA 5AK0A 4WBSA 2GCOA 3CX7A 3SNHA 2NPFA 2NPIA 4HLDA 2OZEA 3N2IA 1OIXA 1XTRA 1Z63A 3CWZA 1RRFA 4LY6A 3FTQA 3B5JA 4MRSA 5CK5A 1QDEA 3THYA 2ZJ8A 2H18A 1F3OA 3AUYA 5FOUA 1YQTA 2GA8A 1P62B 3K53A 3QKRB 1DG3A 2AR7A 3D8BA 2AHOA 2XZOA 2A30A 5FUYA 3U6BA 5G3ZA 2GJSA 2FN4A 4N0DA 121PA 5AUNB 1XPUA 1N5KA 2WM9B 3UXMA 2V7QA 4BLPA 2FGJA 1ZCBA 3LD9A 2G83A 5EXPA 5C1BA 3ICEA 3AGQA 4UJ5A 1XEXB 3C41J 1OE0A 1JALA 1MO5A 4GFDA 4LV6A 3PJRA 2CNWA 1M7HA 1CXZA 4NYIQ 2GF0A 2QTFA 5H1YA 2CCKA 1RFLA 1WCV1 3B9QA 4FXPA 1LS6A 3ZYCA 4DHEA 4MGYR 2REXB 1US8A 3IGFA 1R0WA 1QHXA 1XTQA 2O8FA 5FTLA 1P61B 2ZYTX 1D2EA 1RJ9A 4I1SA 5FPHA 4LJ8A 5JRZA 1Z2CA 2CLCX 4CZ2A 4EPTA 4C7OB 3VNUA 4TYWA 5B2ZA 1KI6B 3K9NA 1C1YA 1I4LD 3BJIC 5FH9A 2ZXUA 5KHOC 3A1SA 4MRVA 4ZKDA 1BO6A 4PO8A 2QAGC 1W0KD 4NYMR 2AFIE 4LYHA 1FP6A 1XD9A 2FG5A 3GJ7A 4QBFA 2WAXA 1NLYA 4MKHA 4JBYA 3MFYA 3A6PC 1SXJE 5G53C 2ZI9A 3CIOA 4WIAA 1CIPA 4AG5A 5CITA 4GL2A 2REOA 4A0HA 1K5GA 1VECA 3G82C 4Q7KA 3LNCA 1VG0B 4TQ9A 4A82A 4BFTA 3L8ZA 3U44B 5GADl 1E32A 3FMIA 1C9KA 4QHTA 1UEIA 4FN5A 2G88A 3IEVA 3RWOA 3X1DA 4HI0E 3KX2A 2QI9C 4QJ5A 1FMJA 1KDTA 3BD9A 2NO9A 4B47A 4PSAA 3MSXA 1KO5A 1ZM9A 2ORVA 4WXRA 5HCNA 3IKJA 2QP4A 1G20E 2BBOA 4JBWA 3W3AA 3U3RA 1S96A 1E99A 2D74A 5GJCA 3J81k 2IS1A 3W3ZB 1GILA 3E1SA 2QPTA 3P1JA 4KLNA 821PA 4XVQA 4DSUA 3QG5A 2GDJA 4HB2A 5IK2A 4KITB 4MA4A 3BRWD 4ACAA 1E96A 4YC7A 2YC2C 3OIVA 2BV3A 4FCTA 4RJLA 4HZUA 5CLLA 3PCRB 5C4MA 3K8YA 3Q9LA 4DIEA 3U3KA 3LQQA 3H84A 2ZSBA 2ZR0A 3CZQA 2ODNA 2WV9A 1Z47A 2VLIA 2AKAB 5FUWA 2W2VA 1S9DA 3GJXC 1Q22A 3TR0A 2PJRA 2L0XA 2P3SA 1XCGB 4M1WA 3HPQA 3FB4A 4KCGA 2ODBA 4CEJA 4LWZA 3TQFA 1NJFA 3TK1A 2R62A 2PX3A 1KI7A 2W6IA 3EZ7A 5AJYA 3FMPB 3DDCA 1G8HA 2FEMA 4NPHA 4O25A 3WNBA 3ZIAD 4Z8YA 2F1IA 2XAUA 2ZYUX 1TX4B 2OFOA 3P27A 1E9CA 3H4MA 4RVCA 5BWMA 3QENA 4M21A 2J7KA 1N5JA 1LF5A 2ZJ5A 3O8CA 2ZVPX 1DPFA 3KUCA 4B71A 1OT3A 2VP0A 3CH4B 5FUXA 3RDPA 3WBKA 3CKLA 1SGWA 3DMNA 2QRZA 1XJQA 2VHCA 4Q00A 4U7DA 4Q1BA 3GMTA 3IILA 2AWOA 2BHRA 4OKSA 4Q4HB 4NBSA 4XOIA 4NL4H 2HDNB 2EVWX 3KXKA 1F60A 2JLXA 2ZRJA 1KIMA 4JSTA 2F7SA 1UBGA 3UPUA 4IFEA 1UKYA 4XD7A 1N0WA 3AVQA 4URVR 4ARZB 1M34E 4IKEA 4OBEA 1W44A 4EJSA 2YJTD 1MO6A 2GETA 2DBYA 2HT6A 1OIVA 1XJ0A 1PZNA 2FOLA 4WXPA 5J40A 2V1UA 2FX3A 1SVIA 4F7WA 2VP2A 4GSYA 3EPHA 5J4YA 4B3BA 4ACBA 1FUKA 1FZQA 5H70A 5HKKD 2RHMA 4MKGA 1U90A 4CEHA 4TQAA 5KNCA 3K0FB 4PHHA 4AKEA 4TZ0A 3KQHA 4EPRA 3RRMA 1YZLA 1G3MA 4MITA 4IDOA 1KAOA 4LGMA 4A2QA 1ZIOA 4EPWA 3B82A 2WJIA 1X8JA 3CPJB 3HU2A 1QG4A 4W9MC 2J0QA 1LB1B 2ZJAA 2N46A 3VR3A 1OKKA 1XD2B 3CNNA 2VL7A 4M9QA 2DCUA 4P32A 2Q3HA 2R6FA 3GCGA 2P5TB 4JVLA 1TQ6A 4NHOA 2NO0A 2GRJA 2GK7A 4TLAA 3SOPA 2WAYA 4JMPA 3EZ6A 4URXR 2XEXA 5JECA 4XWKA 4H1VA 3MWKA 2FE4A 4L9SA 4DLUA 3BH6A 1NBMA 3QF4B 5DYIA 3TSZA 2ATXA 3PV0A 1E94E 3D31A 1HY3A 2VO1A 3FVQA 1KJWA 4LK2A 1CP2A 1KI8A 3EARA 5L3QB 4TMWA 1TQ4A 3D6TB 4UNRA 1DAEA 2P5SA 3IDQA 1AKEA 4KJZA 5FBLB 4TLBA 1N6PA 1P5ZB 1TUEA 2JLYA 1TU4A 3PUZA 2HJVA 3HR8A 4KI0A 3SHWA 3PENA 4Q18A 1XXHB 2IYRA 2JAQA 2PZFA 3OIWA 2W0MA 4OQNA 2YOFA 2W6ID 1ZC4A 3RC3A 3NC0C 1E9SA 3BAFA 3QOFA 1SKYE 5F3WB 1XTJA 1Z3IX 1EFCA 1BKDR 4UNPA 4GBMA 1D9ZA 4FWIB 1YZNA 3K70C 2BCGY 4ZIRA 1EFRA 2WKPA 2YWGA 3GJ3A 1E0SA 2GCOB 4EJSB 1DADA 1QVAA 1H8ED 4B44A 4ABYA 4N0EA 4XSHA 4DZZA 1B23P 1KMHB 3QKTA 5GVRA 5KDOA 1NI3A 1LTQA 4TMZA 4DSOA 2D2FA 2REBA 2ZI3A 5GVSA 2PZEA 3WRYC 4IFBA 4M0LA 1J70A 1ZNWA 5F9HA 1NMXA 4F92B 1CJUC 1PV4A 3THXA 3ZLJA 4Q21A 4MYTA 1ELOA 1XEWX 3KQNA 3TRFA 3TAHA 4I81A 1XDBA 1E2LA 3X2SA 5AWFC 5JRJA 5HPYB 1VIYA 1NG9A 1W5SA 5BYKA 1RVDA 4LBZA 1N5LA 4KV9A 2WOOA 2O0KA 2BCJQ 4BLQA 5GJWC 5CM8B 1QHIA 2H92A 2RGGA 4FIDA 3QG1A 4GI7A 2FPKA 2IYWA 1M7GA 1ZUNB 2JEOA 3W6OA 2OILA 3AGPA 3QXSA 4W5HA 4B32A 4C7OA 1R2QA 2V55B 2YINC 3H0KA 2O8FB 2ZYVX 1G4UR 4S35A 5FFMA 4TZ6A 1NMZA 1IY2A 3W90A 4M1OA 4JIMA 1G291 2BKUA 5FOXA 2J0SA 1E98A 1QHHB 4LYJA 2OE2A 1I2DA 4MYUA 4BECA 1BYUA 1E9BA 4TTQA 5F9FA 1HTWA 3KXIA 1OKKD 3VR1A 3TMKA 2P6RA 2DWPA 4N3NA 1IY0A 1IY1A 4OJKA 1OPXA 5BN5A 1CBUA 1NVWQ 3AQ4A 3X1XA 2VHQA 2HLDD 4WOPA 4KFTA 4MDFA 1P4SA 4Q47A 1GNPA 2GVDC 4LJ4A 2YNMA 4O0MA 1XEFA 1GKUB 3KZ1E 4ZIRB 2ZITA 2ERYA 3DO6A 1VCMA 3KJHA 1P3JA 2KWIA 5H68A 3KXLA 2DPXA 1NG1A 1UKVY 1A82A 1E2EA 1E2PA 3FFBA 4JS0A 4G5GA 1MKYA 2B21A 1I4TD 3KJGA 4RZ3A 3N5CA 1QRAA 1FX0A 1U98A 4U5XA 2CLDX 3HDTA 3GFTA 5SZIA 4IDQA 1JI0A 2Z83A 2O8BB 1UBFA 3V9PA 4DJTA 1O87A 2PT7A 3AKYA 2GXUA 3AKCA 4O2RA 3K9GA 4XH9B 1KO7A 3ZZTA 5E7IA 3QF7A 1EFRD 1Q1BA 2BOVA 3CX6A 4M9SA 3CRQA 1M7BA 3CRRA 3EIEA 1GRRA 4KODA 4QGGA 4Q4JB 5SZKB 3WNCA 5JCPA 2RMKA 4LJ5A 2B92A 3EC2A 3SHFA 5J4LA 3TKLA 3U44A 1KHTA 4HUTA 2HCJB 3EZ9A 3SI7A 2WWFA 2P67A 2FZLA 2KB0A 3I72A 3WY9A 3EIHA 2WWIA 1M74A 1Q44A 5EE3A 3V4FA 2C03A 4Q48A 3VQTA 2DFKB 1N2CE 1B0UA 1E2GA 1VDZA 3TQCA 4IXMA 3EPKA 1C4OA 2SHKA 2YV5A 3GJ0A 1HUQA 4JSYA 4KFSA 1N6IA 4KHZA 1LFDB 2IWHA 4URYR 4ZDIA 2QZ4A 3D3QA 2ZTSA 2IYTA 4HYYA 1W1WA 1CJKC 2W83A 3IIKA 2ZRNA 4DLSA 1IXSB 5FL3A 2FV8A 3NC1C 1XB2A 2UZ3A 2GJAA 1DEKA 4AKHA 4Q4AB 1V43A 4LPSA 5EE1A 3GEHA 2WTUA 4NH0A 4AD8A 1A5TA 2ZR9A 4IXNA 2O0JA 4LI0A 2NO6A 1QF9A 1RKBA 1FMLA 2G77B 3B60A 4M22A 4DUGA 3I1FA 3FOZA 3GD7A 2YC4C 3I92A 1G3RA 1MT0A 1W36C 1FPMA 4POAA 3CPEA 1T0JB 3EW9A 1A1VA 3ZZUA 2KSQA 3UWKA 2Q9CA 4ZCIA 5D3QA 1E69A 5GJBA 4YMWA 2A5JA 5LDDC 2CLSA 1GRNA 2JDIA 3BB1A 4RFVA 3LBHA 4LV8B 1YR8A 2XJ4A 4EQ6A 3RRYA 3UMRA 2W2TA 1N6NA 4OQFA 1G17A 5CLQA 1P9NA 3JZMA 4FCVA 2AWNA 3TUJC 1X6VA 3ZDQA 2IYXA 3AEZA 2QORA 2KBEA 1G18A 3CB4A 3CUEF 5IDVA 1E2HA 1JR3E 5EE0A 3F5FA 2VIIA 3KL4A 2CL6X 2JJ8A 4IDNA 4A0RA 3CX8A 3Q3JB 1DS6A 1AS3A 3LY5A 4YQFA 3PITA 4QJ4A 5TDHA 3R8FA 1QHGA 1QG2A 2ANBA 3VMFA 1XF9A 2W58A 3BFVA 3B8HA 4WZBE 5KNBA 1L8QA 1KSHA 1UKZA 2JIZD 2WSSA 1M2OB 3DM5A 3TJZA 3FKQA 3UG7A 1Z0JA 3CRMA 2ZR7A 1XD2A 4BFZA 4D6PA 1XZQA 1ZJ6A 5C2JB 1QVRA 1D9XA 1ZW6A 5JEEA 1G8FA 3RRNA 4BGDA 3AP2A 1P72A 3DEFA 2ZS7A 1IHUA 3H1TA 1GOTA 4V0KA 4WW0A 1P7CA 4NCJA 3V4RA 4NE2A 4M1MA 1R0YA 3LXXA 1X1SA 4HAWA 3AB3A 3B1ZA 1TU3A 1ZYUA 4AIIA 1W4BA 1DARA 1KK1A 4PAQA 1AA9A 3L2OB 1KO4A 2ECKA 3A4LA 4W5JA 2AL7A 4ZCMA 2O8CB 2QQEA 1NKTA 2NTYC 3A1VA 1NLZA 2JJ2A 1DAHA 3CPHA 3NXSA 3THWB 4D82A 3IQXA 3HYTA 3K0FA 1WE2A 3LWNA 2JLUA 1JXMA 2IK8A 3HPRA 3AVYA 4Q1FA 4OL0A 1Z0AA 3WNDA 3R7WB 1I4DD 4CRWB 3FMOB 4YMSA 3QE0A 1HURA 2CVHA 5L3QA 2C2HA 5IHPA 2G1KA 1ZRHA 1MABB 1T8UA 5FL7A 2ZRIA 1FL9A 2R6DA 3GLHA 4HAVA 1OH5A 4A6PA 3LA6A 4Q19A 4B74A 3HWSA 4DB2A 4YXWD 5IK2D 3SBDA 5G40A 4A8JA 2O8DB 4RD3A 4B3GA 4Q7MB 2HXSA 1F2UA 1E1QA 3AVVA 2WZQA 5H8WA 3MWLA 4MH0R 1EFTA 1UFQA 3VKWA 3ZJYA 4GMXA 4RFSB 3T1VA 1AIPA 2JLRA 2WWHA 2TMKA 4HDCA 4M2LA 4FMDB 2CBZA 1YZTA 3FHTA 1YR7A 1EWRA 3A1WA 1S8FA 4G1UC 5HTKA 4OHZA 1WBBA 4ZPXA 2N42A 1W2GA 4RSGA 4PQRA 3TLXA 2GHIA 2AK3A 4HLUC 1UM8A 4ITRC 1TQDA 1KYIA 2ZE7A 2RHDA 2J59A 1YZKA 3OZXA 5FI0B 4RKFA 2IC5A 4TQUS 1N6HA 5ANRB 3QEJA 2OCAA 1AS0A 1N6OA 1GUAA 1XD8A 1L2TA 2PL3A 2E1RA 2ZU6A 3Q7PA 1UBEA 1DAMA 4QBHA 2ZUDA 5TARA 1N25A 2QT0A 2CXXA 2QGNA 2I1VB 2P6NA 3T61A 1G6HA 5K8IA 4Q01A 1IOZA 1XMJA 2A5YB 3SN6A 3T12A 3B2EA 4QKQA 1VCNA 2IYSA 4K8OA 1HH4A 3V00A 3SYKA 2AX4A 2XB2A 2EYQA 1NF3A 1JPNA 3CZPA 2WICA 4RD0A 4WZAE 1P2UA 3KQLA 2GZAA 4LPKA 1ZM2A 1QHHA 1D6JA 3I4LA 1AQUA 5KSPA 1SULA 3TIFA 3T34A 4DWJA 1Z6TA 3SR0A 1T5LA 4C0QC 5CJ2A 4AURA 1VIAA 4QG7A 4TL8A 3F0TA 2ZRDA 4LUCA 1MV5A 3NDPA 2C04A 2PMDA 2XSZD 4G3XA 5JS8A 4A0FA 3IQWA 3MD0A 4AWXA 3UG6A 1HQCA 1U0JA 3QY0A 3NG1A 4LZZA 3TBKA 2NO1A 5CYPA 1XXHE 2F3TA 2F9MA 2X2EA 1R10A 3TGPA 5HKKA 1UADA 2FWRA 2BBSA 2QSZA 4MGKR 3LBNA 4BFXA 2XZPA 4BWYA 8OHMA 2FSIA 3LRPA 4F38A 3GPLA 5HZHA 4NP6A 4DDUA 4BUJA 2K5UA 4HLQB 2C9CA 2WJVA 5A4JA 3M6AA 1W4RA 3BERA 2HJGA 1UEJA 3I3SR 1PLLA 1IN8A 2IXEA 4B34A 2IS6A 1T3HA 1GSIA 3ZGXA 4C0JA 3KFXA 1WBDA 1W49A 4K46A 2QTHA 4HEJA 3EWAA 4PQYA 5EZ6B 4LHWA 1EFHA 4BLTA 2QPAA 3EASA 4PC7A 2J1LA 2WIAA 3CONA 2IA5A 2YYZA 3SE0A 2MMCA 2P0EA 5LB4A 4BPBA 4L8GA 2G9NA 4FMBB 5DISB 1UPTA 3ZH9B 4PHGA 3WBJA 1SQ5A 4NDZA 2A2ZA 1VMAA 3BS4A 4ZV4A 2YWHA 1XU4A 4GT1A 5KO2A 4MKFA 4PHTA 3GLGA 3DZDA 5DGXA 3PXGA 1T9HA 1AGRA 4CW7A 1Z28A 2OEPA 4DSTA 3EXAA 5E4FA 4PSKA 2ERXA 2MSDB 2ZYWX 4PR0A 4OJQA 1GKYA 2KJQA 621PA 2J0VA 5CYOA 4F4IA 4YLGA 5AUOB 1ODFA 4LJ6A 3ZVRA 1CTQA 4Q4AA 1DELA 1VYVA 1YZGA 3GLHE 5B58C 2C5LA 1DOAA 2O52A 1Q0UA 2JLZA 3B7GA 1CLUA 2Q6TA 5HCIA 2ODEA 1OYWA 1E2FA 2NGRA 5FBWB 721PA 3CF0A 4LHYA 2GAOA 1ZNZA 2ZPTX 4C0AC 1GP2A 2BKEA 1KKLA 3FKSD 3I32A 4V0NA 2F1JA 2CHGA 2J87A 5E7JA 2GVZC 1OJLA 2D7DA 2EFGA 3I73A 4ZI3A 4NZYA 4TT3A 4I1VA 4GOKA 3A36A 3MAAC 3OE7D 3PUVA 4LOAA 5EXXA 3VHLB 1TL7C 3P26A 1P2TA 2V9PA 4D4MA 5C46F 2ZJZA 2R6GA 2WSSD 1KNQA 1OXSC 1PLJA 3VKGA 2D62A 1KK2A 1MH1A 2NQ2C 3GQBA 3ECCA 3UWOA 2CMKA 5E95A 4JL6A 4JYCA 3KDSE 4PTLA 2VHJA 2VRWA 3L43A 1CRPA 2F1HA 2IL1A 2QT1A 4GMDA 2Q21A 3WYGA 2EFEB 2AKYA 4XTCS 3R9WA 1VTKA 4P4UA 1L4UA 2QAGA 1NN3A 1U0HC 1G7CA 2G1JA 2OAQ1 4D81A 5KYKA 3GJ8A 2FNAA 2P65A 1PLKA 1ZINA 2AD5A 2GESA 2XNDA 3VR6A 1JXOA 4Q9IA 4LYAA 4ESHA 1GL7A 4Q1CA 2RGCA 1CU1A 3IPXA 3CWQA 4QL3A 4WAUA 4XVUA 1D2NA 3LXRA 4TYQA 2D7CA 4IOKA 4B35A 1E9RA 3VHXA 4JZKA 2OCPA 1AGPA 1KO8A 1ZM7A 5LD2C 3ZS9A 3DMDA 5B57C 2A7QA 5IT5A 1G4AE 2RGDA 2Z43A 2ZE8A 4HB3A 4X8HA 3KTAB 3W5JA 2J0UB 1OH8A 3O8RA 4OQLA 3GLFB 1OHHD 2H7VA 1R8SA 4JLKA 1G3UA 3AKDA 1E1QD 3U3JA 5AJWA 5BN3A 2UKDA 4DCNA 1GAJA 4B2IA 2CCGA 1E9DA 1G8PA 2FSFA 3LVRE 4HZUB 2BBWA 3NKVA 1NVVR 4A92A 2Y8EA 3DZ8A 2WMOB 2VYFA 4M1TA 5DN6D 4D80A 5KSZA 5EE9A 1N0VC 3KKMA 2C8VA 4XVRA 1SVWA 1TMKA 4R9UC 5EXTA 4EPXA 4KFRA 2ZJOA 1XWIA 3Q5EA 3F3YA 3NVAA 1GITA 4A8JC 1COWD 1Z07A 2F1RA 1IN4A 4RD2A 3OIYA 2G6BA 3B9PA 3B1YA 2NZJA 1IQPA 4RZ2A 1WF3A 1E9EA 1MR3F 1JQLB 3NH6A 3MRSA 3LV8A 2HEIA 3U4QA 5HR5A 1U9IA 2ONJA 4HB0A 5KPDA 2QMHA 4ASUD 1ZCAA 4BQSA 1JBKA 1ESNA 1FNMA 2IX3A 5G3YA 2OV2A 4DCVA 1WDTA 3AM1A 3AF3A 1NLFA 3BGWA 3SDZA 1BH2A 3FKSA 1NKSA 5HE9A 3IBYA 1VG8A 1GRQA 2HYDA 4UQOA 1DG1G 3ND9A 4AK9A 4PO1A 2IUSA 4XSGA 3T1QA 2HYIC 3NHAA 4YDHB 1AK2A 3OE7A 1G7TA 3WMEA 5A5GA 1II8A 4X8MA 2D06A 3QNUA 5JI2E 2ZVQX 3SYNA 2FFAA 1OXXK 2OCBA 1GM5A 1IN5A 5E7MA 3GEEA 4L16A 2J7PD 1OFTA 1U9IC 1S1MA 2J9RA 3EAQA 1JJVA 2QROA 2BM0A 3ONWA 1EK0A 2WWXA 4HAXA 5FPTA 4CEIA 4V03A 3MJHA 1CS4C 1I2MA 2ZUBA 1PUIA 1AZTA 1F2UB 4JVSB 4YMVA 3RAPR 2BDTA 1FOEB 2OESA 3LW7A 4JL5A 4DSNA 1DAGA 1E9AA 3B1XA 2QGZA 4FMDF 4QGHA 3S1AB 5J47A 2O8EB 3KUDA 3GLFA 3IEUA 1A7JA 4FWTA 2H16A 1TEXA 3W34A 4TLCA 4UNNA 4KBGA 2O0HA 3OIUA 5M04A 1CR2A 4D4JA 4XJXA 3F8TA 1CJTC 1FNNA 2RAPA 4QM7A 2IUUA 4QNRA 5FOTA 3T1OA 3ZVNA 2VEDA 4KVGA 4E03A 2HT1A 1G3IA 4PPFA 1J8YF 2GJ9A 4TYNA 5FPSA 2FDCA 2ZSEA 3VR4A 3SQXA 1IBRA 4Z54A 2LCFA 1J8MF 2Z5FA 5TMPA 3K1JA 1OFIA 3NDBB 5EXSA 1EXMA 2CNWD 2QMOA 1KSJA 4GZMA 4P4SA 4X8OA 2OXCA 2RCNA 3LQRA 3QUSA 1N0UA 4R2HA 2KI5A 5JLJA 1GDDA 1KJZA 4EUNA 2FSHA 2C78A 2XJ9A 4HSEA 4JL8A 4JLJA 1SVKA 1FTNA 4NYIR 4RZUA 1CEEA 1EX7A 3SFZA 4GP7A 3PEVA 1TUIA 2DY1A 1U99A 2J46A 4Q7JB 3WYAA 4UXHA 4QHSA 2NIPA 1NIJA 2DFNA 1FW6A 4MKIA 3IIMA 4BFUA 3VNVA 4AKIA 3MCAA 1KMHA 1KNXA 4IRUB 4BLRA 3SJZA 2VHTA 5KTYA 1Z0FA 2IEZA 1S1CA 4ERNA 2VTKA 4TL7A 1DAKA 3OAAA 2IWRA 3A58B 3REGA 1LVGA 2HV8A 3KKPA 4GPTA 5FOSA 1MRNA 3QKSA 5LBIA 3REFA 3W9YA 2CHQA 3K0EA 3C5CA 2J45A 2OG2A 4TSFA 3GP8A 3OEED 1T0HB 2FZ4A 2E87A 3UATA 1ONBA 2ZIAA 3AKEA 4TMKA 4DC9A 2DWQA 3KB1A 4CEIB 4IVQA 3MMPA 3QXJA 4A36A 3C15C 2IS4A 4JJKA 2DB3A 4KFUA 2AXPA 2G0TA 1XPRA 1XZPA 2VP4A 4ILEA 4G5OA 1Q12A 2GNOA 2JATA 3A8TA 5EP4A 5AR1A 5CDFE 3SQWA 1W47A 4JBXA 2BM1A 3M1IA 5F2EA 3GLGB 1SXJD 4II7A 2BIFA 4MRPA 4BFVA 3ADCA 4TMXA 1H8EA 1YR9A 1ANKA 3PUXA 4P0TA 1E2QA 4YXWA 4Q02A 4PPNA 2DYKA 2J7PA 1XCPA 2QY9A 3X1ZA 4B3FX 1HT1E 1JB1A 4JYBA 2R6AA 2ZRLA 4CDGA 1JQJC 2ZJBA 3TVDA 3HR7A 1JECA 2GXSA 4HAZA 1BYIA 1V5WA 2BWJA 4IOJA 2FFBA 3U3MA 1OW3B 4B3CA 5JWRA 1XTIA 1BMFD 2FA9A 4PO9A 1T5IA 2HXYA 2I3BA 3DKVA 4JLPA 4OK3A 3R20A 2OSBA 4Q1EA 3G0HA 2FFHA 1E0AA 1LF0A 2XNDD 2W6JD 4OK6A 1IXZA 2YWFA 4I4LA 5EZ5A 1ZAKA 5ELXA 1AS2A 4IJMA 4KSBA 5DIFA 1XP8A 2ASEA 2GBLA 1ZD1A 2XTZA 1G7RA 2ZE5A 1IJEA 1F2TB 3P4YA 3ZD7A 2Z4RA 4PAOA 4RD4A 5JJIA 4CGZA 4TYPA 2VSXA 1DBSA 1XMIA 4OQMA 4IVPA 5EUMA 1OH6A 1RE0A 1KY2A 1NP6A 3U5ZB 5C4GB 4TN1A 4HDQB 4KBFA 1F5NA 4QC2A 1SZPA 2JLWA 2Q3FA 3FHOA 4FMCB 4URZR 4P3YA 4Q9JA 4W7SA 4QGFA 4BRUA 3RS5A 1Z0DA 4DBLC 3EG5A 3IO3A 2EU8A 2WJJA 5DSZA 2H17A 2VP6A 5J5CA 1SVSA 4Y0AA 1XMVA 5BN4A 4C4PA 3IIJA 1AKYA 3I5YA 1G8YA 2RKOA 2WKQA 4V02A 2VP5A 1X8KA 3KTAA 5EUQB 2UVQA 5F98A 5CB8A 1AJEA 2VA8A 4HAYA 2H1LA 1KGDA 2IYZA 3OEEA 4GOJA 1GNQA 4NYJR 1HA3A 2D4HA 3DL0A 2QP3A 4V0OA 3AF0A 4A4DA 4DRZA 1E6CA 2J0UA 1TF5A 1II9A 3ND8A 4Q9KA 1U8AA 4C3ZA 2PT5A 3AF2A 1J99A 1KZ7B 3IBGA 2GCPA 3LX8A 4M1YA 3CM0A 3FMFA 2GTPA 2HCBA 4X8LA 2MSEB 2QAGB 2WPDA 3RLFA 2F43A 2R6CA 2IEYA 4Q4JA 2ZS9A 4O3MA 3NBXX 2X2FA 2QBYB 3CRVA 2UZIR 2QUZA 3A1UA 2GAAA 2FU5C 4CT5A 4B48A 4MRRA 1NY5A 1JPJA 2C9OA 1SXJA 2DFLA 2GZHA 5CDFA 3NEYA 2WWWA 4Q9LA 4CYMA 2FMXA 1VG9B 1S3GA 1Z0IA 4PSVA 5JHHB 4R71A 4URWR 1FFHA 5BQ5A 4Z8XA 2OBNA 2F9LA 3AP1A 4MGIR 1WRBA 3B1VA 4R98A 4UXJA 2CL0X 4GRAA 4AI6A 1ZUHA 3QXHA 1G41A 2XTMA 1L7VC 2GXQA 4MUAA 4DKXA 3PFIA 1LNZA 2GF9A 4M9ZA 3PR1A 1VG1A 1D2MA 4US2R 2G3YA 1R5BA 1FQJA 2NOAA 3TW8B 2V3CC 4JLDA 2DFTA 4C9BA 3I8SA 3RHFA 4ZI2A 2IYVA 4BLOA 2XTNA 4QFMA 3LVQE 4U02A 2YHSA 2QRNA 1KK0A 4OI2A 1CRQA 1T4GA 3MG9A 1UKEA 5BYJA 4A0GA 4HZIA 3K0SA 2YOGA 1XPOA 5DI3A 4R7ZA 4JLVA 4L9WA 1RPZA 4D0NA 1G6OA 1NNEA 2F55A 1AM4D 2VQSA 1GVNB 1P9RA 3GEIA 3CF6R 2IF2A 4V0MA 3GFPA 2YWEA 3L0OA 3PUYA 3QJYA 4H9GA 4RCZA 1KMQA 1MO3A 5SZJA 3GLIA 1II0A 4C2TA 3FFAA 5AJVB 4S2EA 1UJ2A 4ASUA 4PAMA 3RABA 2HLDA 2C9YA 4OI1A 2Q3MA 1P2SA 2A9KA 1GL9B 4WA7A 3A1TA 4D0GA 1JEEA 4BFWA 2XXAA 1E3MA 1X3SA 3BB4A 1KKMA 2ZRFA 3BH7A 3BBPA 3DPUA 1YRAA 2LKCA 2QTVB 3Q72A 3NBZC 5FUVA 3EA0A 3NTUA 1U2RA 2IHBA 1ZMXA 4UNQA 4QBGB 5EP2A 4FD2A 3FWYA 3SJAA 3BFXA 3BH0A 1Z6GA 2ZETA 2ZU0C 3ADKA 3K0AB 3R7WA 4ZO4A 1IJFA 1KOFA 5TVKA 4P4SB 1HE1C 4L15A 3KFVA 4FW9A 3W5IA 4DDVA 2B7BA 1PVOA 2YKGA 4PX9A 1U8YA 3B1WA 3BORA 4OYHA 3MWYW 4JLAA 5CK4A 2Z6VA 3CLVA 3JVVA 4YONB 5JWOA 2YOHA 5L3RA 3B85A 3FPAA 2E9SA 1Q57A 4DB4A 4WZ6A 3KB2A 4UJ3A 1XMSA 2JLSA 1NVVQ 2WPDD 1HQYE 2NMVA 2O8CA 2BBTA 2CE7A 2JA1A 4EFLA 1Z6AA 1FTSA 3IHLA 1F48A 1Z6XA 2A78A 3FHCB 1YKSA 2YVUA 4RFSA 3BWDD 3T5GA 4D4LA 3QVVA
chains in the Genus database with same CATH superfamily
5KAMA 3DXXA 5BUZA 7MHTA 2PUFA 2OHFA 2EQAA 2BELA 5KSOA 3PEEA 5JMPA 4D9CA 1Z4MA 1R6BX 5ICCA 1F6WA 1A0OA 4MYSA 5CFNA 3I42A 3OQPA 3IXLA 5T5QA 3ROFA 1J0CA 1BHQ1 3D2AA 2FMUA 2P2GA 3EA5A 4R8MA 1BSVA 1JDZA 3KYCB 2Z5LA 4H7EA 4LDPA 4WVFA 4CQMB 1NMYA 3JTMA 4RC9A 1R9JA 1UPBA 4XYEA 4A0QA 1QGUA 3IMGA 3F8WA 4GXRA 3SBXA 4E51A 1GWNA 1QPBA 3RYTC 5ES4B 3FF4A 4DLKA 4XYLA 3ICVA 2GCNA 1KEKA 2BRUC 3GVHA 3TH5A 1NFRA 1TDJA 1VFNA 5D8DA 5ECYA 3DOFA 4ZDKA 5A4MS 3ADDA 4CTMA 1VCIA 3MS2A 4KYUA 3C6MA 2DPHA 2EFHB 1MO4A 5EP1A 3TL6A 4XD7D 1R4ZA 4WBNB 2B8TA 5LLDA 1JIUA 1RW4A 2RGBA 5DULA 4PCLA 3DNPA 1L5VA 5TEWA 4BVAA 5GOTA 2NO4A 5CEEA 2CL7X 4NONA 5MFZA 3NHMA 2PX4A 3P7MA 2CXSA 2J3DA 2Z2XA 3I34X 4HUQA 4BKRA 4HAIA 4FGSA 3R9KA 5ECGC 1TF2A 1FX0B 3FPCA 4RORA 5DGIA 4D3XA 2P1ZA 4OA8A 4XJVA 1SHKA 3ETDA 4TSFD 3S99A 4X63A 1VSTA 4IG9A 1CR0A 1UAGA 4D92A 3EDYA 4TOIA 5CLGA 3HFSA 3CR8A 3TNJA 1PR4A 1U7UA 3BF7A 1TTPB 5C4IA 1M1ZA 3W5AA 4B3JA 1NPDA 3LDFA 4QDZA 1GQQA 4F71A 1FFBA 3AESA 3V5NA 3P19A 3DL7A 4YUVA 4OBBA 3PF8A 4FVTA 1LPPA 1OLOA 1IH8A 3AUSA 4EABA 4DNOA 3ABQB 3S2FA 1EP1B 1YVDA 1UFOA 1W30A 1IVYA 3EZFA 4WKCA 5TQJA 4J1TC 2GBLC 4D45A 4DWOA 2GPWA 5H9WA 1TFRA 2QG6A 4MO9A 5DYYA 5CYGA 1TT7A 3RD5A 3I39X 1CERA 2X8WA 2X14A 1VJ1A 3FHLA 2VP9A 1AKUA 2AYYA 1X1EA 1KJ8A 1L8XA 5HJ5A 1NULA 3X3HA 1Z0KA 2PRKA 2ZUVA 5FYDA 5A5EA 2ZKLA 1WSBA 4ZRDA 5LQNA 2XVZA 3TLBA 3INRA 4JQZA 4CM8A 3GZ4A 1I0LA 2IUYA 3A37A 3FF1A 3QNMA 3UMVA 5C1OA 4A91A 4W9NC 3UY4A 5JS7A 4AWAA 3OKPA 3L6RA 5C34B 1G42A 2MSKA 3HU1A 4NJEA 5HF5A 2WWTA 5AHOA 4AG6A 2NZVG 4CCAA 1JEYB 1HDIA 1NDQA 3NAGA 1T1EA 4RAQA 1T3SA 3CLSD 2ZRAA 2D5AA 3GFOA 1ABBA 3LUHA 4CLXA 2V7TA 3TW4A 4KQJA 4ZAYA 4PNZA 5GY7A 3C45A 3SSOA 4BQFA 3R5FA 4BFSA 2XQKA 4DUYB 2A1UA 3DUFA 4UE6A 1FP7A 1CS0B 1ZNQO 5LYYA 3VTAA 4CI0B 4MRNA 1OWPA 2B4QA 4JVMA 3DS8A 4EKDA 4RD1A 3R7SA 1U7DA 1J2TA 2Z56A 1LPBB 4GMHA 5CD1A 1EU1A 1SXHA 1SUSA 2AN9A 4PHCA 2P9BA 4Q9DA 4JI7B 2I3GA 3DVAA 3ORHA 1PJTA 3GLTA 4NFLA 3FKJA 1JN0A 5TF0A 1RQXA 2IIVA 2R66A 4B9EA 3ZX4A 3I6IA 1HQKA 1R5NA 2YFYA 3OWHA 1GPUA 5IAKA 3U7GA 3RK0A 2QY6A 2NZWA 4EPYA 3W5UA 3CNQS 4QOGA 3OIWA 4C7VA 1AKVA 2FDRA 1KQNA 3UQYS 1VMIA 3ZTTA 4TLMB 4Q15A 2HWYA 1C7RA 3M33A 1ZUWA 1OXVA 2V7PA 4N6NA 5JPIA 5B12A 2HWUA 1G5RA 1KO1A 3AM3A 2HAEA 3CW2A 3R3UA 4DIDA 2NG1A 1RHJA 1PWXA 1K9VF 3O3CA 4IWNA 2F43B 3CH5A 4OHWA 2WOJA 4PLGA 4WNIA 5TGTA 3RS2A 1E3DA 2BZSA 1E0DA 2W8ZA 3IO5A 1RKVA 3KQQA 1L4LA 3I5XA 2AD1A 4PFJA 3AYXB 2OQRA 3B2QA 1TJPB 4QPDA 5BN4B 5K45A 1T3GA 4DBVO 5CH5A 3BMNB 4Z3OA 1NVXQ 4L4RA 4MLCA 1SC3A 2AEJA 3C4JA 1M6NA 3Q9UA 4FR2A 2K2QB 4P4NA 4G81A 1TAGA 2ZAOA 1NBMD 3DFUA 2BUAA 3E5HA 3EODA 4V1CB 1ZEMA 4DXHA 1GNLA 4I99A 4WXMA 2VUHB 1G1AA 3FWKA 3DZIA 4Z9XA 3JQBA 4L72A 1VHLA 2VDOB 4BASA 1UJ6A 2OAEA 3EIOA 4IGFA 1GXSB 1GLNA 4D9BA 3TNFA 4CL2A 2WWGA 2Y1FA 5DBOA 1H3NA 4U2BA 2VPWA 4NOLA 1W85B 5L4LA 1R5OA 2XX3A 1CZHA 3M49A 3UW1A 3I4FA 4R9SA 4NYJQ 1KWKA 5DHFA 4WERA 2EWMA 3PQ6A 3L7DA 2I33A 3ON5A 3WAGA 2CHFA 1K7XB 2OXIA 2FZEA 2VG8A 1KAGA 1Z5GA 2BFFB 2NP7A 3QVTA 3U9SA 3OWOA 3SC2A 1K7FB 1JR3D 5CLFA 2ZYDA 2Q0XA 4H0NA 4HQ0A 1M83A 3CNOA 3C7KA 4PPQA 2PS3A 4V24A 4QM6A 1S9HA 2GILA 2AFHE 4J16C 4ZVVA 4LK3A 4OFBA 4GGMX 3WHKA 4BKPA 3CLSC 2OAP1 4OQPA 1G20A 1HT0A 3MB5A 3N8DA 5C51B 2XB6A 2IBSA 1JVNA 2Z3ZA 1N92A 2KE5A 1ZLXA 1E79A 4C7JA 4DM7A 1D6MA 1U0LA 1J8FA 3DMHA 2RK3A 4GD3Q 4WFQA 4OHYA 4D26A 4CKCB 2CDAA 1ECPA 1UWVA 2I7DA 5AKJA 3B1JA 2EWVA 3BWCA 5FWDA 3W5VA 4F04A 2PUGA 4OUDA 4E2YA 3HJGA 1S4QA 3QLVC 5FPKA 3NBKA 4Q03A 5E9AA 1IOLA 3Q85A 5JE8A 1VPWA 1JHOA 3R4CA 4HLCA 1ID8A 2CK3A 2HUNA 4L7QA 3U80A 4XUCA 1GTZA 2J4CA 4LZNA 3SBEA 1T2UA 2OXEA 4PO3X 2CYCA 2YWJA 4JENA 4EQZA 1Z37A 1SY7A 1UXHA 4G5YA 5JDIA 4D8TA 5ARBA 1PVOA 1M2FA 2WSMA 1LBTA 1MAUA 3T9DA 2P3LA 4J7AA 3PFNA 1BD4A 2G08A 3SBOA 4DCSA 4I1OA 4C0KA 1GAWA 5HUHA 4B09A 2O7NA 3R6LA 1DMRA 1YIDA 1VZ3A 3O4RA 1T1JA 4P80A 3WGGA 1EFLA 2GBFA 2IYPA 3MUFA 4YTEA 1HF3A 1F1BA 3DO5A 2EIHA 4IVRA 4LRXA 3U3OA 3WGIA 3UMSA 4N7JA 1SELA 5CW1A 2VDWB 1OF1A 1W6UA 2XBUA 3A4MA 3LPAA 4QHYA 3ADPA 3R24A 4ZV9A 1Z5VA 2H2GA 4L78A 3FYHA 4NKRA 1XKTA 2OQ2A 2HA4A 2RDMA 5JQGB 4GNRA 3OA2A 1BEUB 1GG2A 1NHGA 1DKPA 2ZUCA 3CGWA 4FR5A 4HAUA 4ITVA 4J6EA 2X19A 5CJJA 3ER8A 1N8NA 1JE1A 2FJUA 1SA0B 2ONYA 2X8AA 3ES9A 3UGJA 2GD1O 2NUTB 3DULA 5LPNA 2VZEA 3KQVA 1WOMA 3K9LA 4P82A 2Z5GA 3TUZC 1A27A 1UANA 3QOWA 1SN7A 1U1CA 1UKBA 2CWDA 3FPKA 1OBOA 1D4AA 4DXAA 1DGQA 1BOFA 3OFNA 3JS5A 1N1DA 2QTBA 4M76B 4E14A 3IDSA 3Q5DA 1V1MA 3AVXA 4CVNA 3R3HA 3DW1X 1XQ1A 2QLMA 5LYJA 4QD3A 4BCDA 4BRWA 1JHQA 2JCSA 4IW3B 1SKYB 2ODAA 5DN6A 3IR6A 1YQGA 2JGKA 2JK0A 2Q7XA 4D0RA 1WB9A 3FE2A 2EARA 4BX8A 5HA5A 4UU0A 2BHLA 2DULA 1XNGA 3PFCA 4R1QA 1XDSA 2CCJA 1VM6A 4ZWNA 1DEXA 1EMDA 2P9HA 2Q2OA 4BYMA 4UHFA 4ZRNA 2O1WA 2W6NA 5J58A 2YXNA 1ISGA 2VHXA 2C3YA 3EDCA 5B5SA 1DQPA 4KQFA 2RSLA 2NUAB 5D3MB 2HHCA 3IRVA 3JALA 4WJZA 2YFQA 3GLGE 1IWBB 3PX2A 1EJ0A 1HE3A 4CNQA 4DT1B 1M1YE 3FTFA 2WMNB 1PFWA 4HV4A 4IJWA 4IWXA 1ESEA 2C5BA 2DU8A 3VC1A 2PA3A 1W25A 3TB4A 4UHJA 2C83A 3OTIA 1R4MA 3OESA 4RL6A 2QP9X 5AJTA 1NE2A 1X80A 2PX0A 3HYNA 4B6EA 1J00A 4Y6PA 3DEIA 8GPBA 4AJ1A 1TTTA 5B7PA 1VKJA 2B30A 2HMSA 4ZC8A 1TRHA 4JT2A 2J3IA 2MTBA 2NV0A 1SQ0A 3CR7A 4OQ4A 4U7HA 5KINB 2R4TA 4P7JA 4E32A 3ILXA 3VJKA 1AMNA 5EFOA 3SDSA 2QU8A 1QV7A 3DOHA 2ILTA 4PPYA 2OV6A 5CTJA 3WQQA 5KB3A 2XXAB 1FQKA 4DCOA 1E1MA 1Q2UA 4DLRA 1RCFA 4KXNA 5CGQB 2VSNA 1NASA 2XUOA 4DCTA 1B0AA 2PO7A 3OEHA 1GQ2A 2OUKA 1IXRC 1J1IA 3DAHA 3FGNA 5KYGA 2IY8A 1IXYA 1HDZA 4DS3A 4PYJA 3L1KA 4Z1MA 3WMFA 1A9YA 4HNUA 4JVOA 3S68A 2BJWA 4C5AA 1Y98A 1UJCA 2FH5B 3QHQA 4KACA 3WJAA 4DLBA 2ZBDA 2WFMA 3S44A 1WY5A 3P2YA 5EJ8A 1Y82A 2DQKA 3QPVA 3RVPA 4CT4B 1Y4AE 3WGMA 1EM6A 3DEHA 2WE8A 1DCTA 4JLBA 2XQJA 1UAAA 3UBMA 2QDKA 3MN1A 3A6ZA 1W2WB 2JD1A 1QFSA 1KJJA 1SCQA 3NFRA 4FSHA 1IM2A 1U7TA 3K96A 3RNLA 5IVKA 1QKKA 3FYUC 4E0BA 3EIQA 1ULBA 1WVGA 1H69A 2ACKA 4OBWA 1E0JA 4NECA 2YNMD 3HCDA 3OSZA 3PGA1 4X94A 4WOBA 2Q0HA 3ITEA 4UTZA 3UKDA 3G68A 4OFXA 3REOA 3KD2A 3WSVA 4D1YA 1Y8AA 3OF3A 3PQ2A 3QK7A 4DDHA 1Z83A 2QMEA 1H93A 3A3PA 3VFDA 5F33A 3L6DA 1M6YA 3ADOA 3LQ2A 3A3OA 3FPJA 2CUTA 2AHRA 4TYWA 2ACWA 2AIRA 4AAYA 3N2EA 1ZGZA 1FCJA 3KHTA 1UDWA 3BEOA 4MYCA 1X15A 1OV6A 3LHDA 4AUNA 2MINA 2PO5A 3OAAD 4XYMA 2K7ZA 1FMTA 1L3IA 2GK6A 3T4PA 3VDNB 5KDLA 3SZGA 4E1AA 3O5AA 3LBYA 1QUFA 3OUTA 1TK2A 2FFQA 4D9HA 1Q7BA 5JAHA 1PSZA 4LYYA 4ESEA 3S27A 4UXIA 2PGOA 1R4MB 3UT5B 3W5DA 1UDCA 3EMVA 3WWYA 4R3WA 2R79A 4KP7A 4HMQA 4QBKA 1KMCA 3EUAA 4RACA 3U48A 4G01B 4HXGA 1CRWG 4Y0NA 5EHGA 1IJBA 1YF3A 1ENYA 1CVRA 1DHRA 2AG6A 2VS1A 3C14C 5DHUA 1ZZGA 5KYXB 3T35A 3K09C 4GOLD 3I01A 1KYYA 1R4AA 1HYGA 1MNAA 2E5FA 3R0ZA 4JLUA 2BMDA 4E33A 4I1PA 1HFEL 2X3YA 3KYJB 4FI3C 4XOUA 5FTKA 3U3XA 1O96B 1A2KC 1UMBA 2FW6A 2BI4A 1NVAA 3BIFA 4F4CA 2XZLA 2BMFA 1VGVA 4KIJA 3H42B 3RFTA 4YRSA 1XRLA 3KQYA 3JY6A 3QOXA 1H2FA 4HC4A 3WQSB 2WYHA 5C5IA 5JYDA 1T6XA 4HQ6A 3OH8A 4ZOCA 3SZRA 1DXOA 4QOIA 4D8XA 2ZROA 2EL7A 3ASZA 3RHSA 1QTQA 1Z0UA 1UP7A 4NATA 4DR1B 2O5VA 2ZS8A 4B8ZA 4D8VA 4MMYB 3UMBA 4P5DA 1HR0B 1NR5A 4FFMA 2XBLA 3W1WA 3TL3A 2EFDB 1KWGA 1DO2A 1LY1A 4A2PA 1EESA 3PEUA 1G5TA 1WW8A 2VDLB 3AV0B 5EJFA 1RKUA 1CJBA 2H4XA 2VT7A 3L18A 2ZRKA 4C29A 4CF3A 4LBVA 3BWEA 3FB1A 1ODLA 3IBFA 2JGDB 5DV9A 3GN2A 5FNVB 4H6VA 1KP2A 1N6LA 3N53A 1QPGA 4KN5A 3JRWA 3ZNNA 5CRIA 3FNRA 2IXTA 4MDHA 1LQTA 4RM2A 4X7MA 5AKKA 2OXRA 2GEBA 2BFCB 1N9ZA 2R84A 2VT6A 3QJGA 2WLSA 3HWRA 3K0CC 1A9RA 4I5EA 4V2UA 3KVYA 1HTTA 2HZBA 3BCHA 3LO5A 2NU7A 4N9WA 1S8NA 3H9QA 3NHJA 5BSRA 3T3HA 3ZKWB 1BS1A 1TC2A 4K8RB 1QZZA 3ANNA 1HDXA 1QLJA 4ZYTA 5JI3E 1JU3A 1X7DA 2DUWA 4JR0A 5GWXA 4EBFA 3M9XA 1SD1A 3QVUA 1UBJS 3ORSA 4IDPA 3X1KA 1MC5A 3NBYC 4G4SP 4Q4LA 4C4TA 2J41A 4P7FA 2QTLA 2VOJA 4QPJC 4B31A 4HVLA 4MUYA 2JCVA 2I03A 1W9MA 5HZKA 1ZXBA 2WMDA 4L8LA 1U8ZA 3UZUA 4V1CA 2I3DA 5DRYA 3MJRA 4YLYA 1BFKA 3NHWA 4WN9B 1NN1A 5CCDA 3MLEA 4EYGA 2AJLI 4I8DA 1Z5UA 1PGOA 4L07A 4PWZA 1K2VN 5JUWA 2EKPA 2UU9B 3SFTA 1D2HA 3A4VA 3AERA 2I9PA 3H5OA 1DJPA 4J1QA 2IHJA 2YMLA 1DCFA 1ZGHA 2PM8A 1E3LA 1C9YA 1ZCZA 3DYIA 3ZY6A 5JC1A 1P60A 2IY9A 4HPJB 5I5EA 1MDFA 2HK6A 5A3JA 5EIOA 4EDHA 3GGPA 3W2HA 2N1BA 1A9QA 2X1HA 3FYDA 3HXTA 4JVNA 4Q1AA 5A0FA 4DGSA 2D3WA 3E1GA 4RH1A 5LWHA 2Q0QA 3IHWA 4MHOA 2H4ZA 3SS9X 1G3QA 4EGFA 1WEHA 2C07A 4GYKA 4DE5A 3SGLA 3GGCA 2EKZA 3NHFA 3ICQB 1OJ7A 4GR9A 3HHPA 3WQHA 2MWMA 5K20A 1YI0A 3ENZA 4F5EA 4RVNA 1Y89A 1X1QA 1WPRA 2O2EA 2ZSAA 4LWOA 3I30X 4B7XA 4ZHQF 3TPCA 5B7GA 4LYFA 5ADVA 3NVKI 3DBHA 5DNYB 4UFNA 1ONNA 5H3HA 1DRKA 4G5XA 2HJ9A 4DVGA 4AY2A 2VHUA 1NIPA 3L84A 2RH5A 4B80A 1KI3A 2GH1A 4MI1A 4XX1A 3AVUA 1BS2A 1N7IA 3S5UA 3QMWA 1YKGA 4OP2A 1SKBA 4NBKA 2I34A 5EJAA 3LFUA 1P6XA 4P7KA 4ARBA 4B7CA 3IL2A 4MPTA 4LNUA 1FDTA 2CYBA 3JASA 1FXSA 5HK8A 2Q0SA 1RYYA 3THWA 1YDGA 2D4AA 4QAJA 1E2BA 4YCNA 5JD4A 1UPXA 1TC1A 4AZVA 2J3KA 1FY2A 1QF6A 2GSDA 1NNUA 2H59A 3I5AA 3K32A 4N8SA 1X2BA 1L7EA 3W5HA 2Z6AA 4CEJB 3B6MA 4RX1A 1SXJB 1A2BA 1VJDA 1W46A 2PLRA 1L7AA 1OLSB 2Y4NA 4URUR 4M8NE 1TM3E 3UANA 1P80A 2QF7A 4BZQA 1XTZA 1GR0A 1XK6A 3AUXA 1HSZA 2R65A 1TO2E 1KZHA 5FBHA 4IOLA 4KR2A 3I62A 4DADA 4YWJA 3LL4A 4HN9A 3ZWPA 4R16A 4EFMA 4BX0A 5KKAA 3OZGA 1CHDA 3DV9A 3JQ8A 1JLLA 2XEDA 1TAQA 4QG3A 1TTQB 5K8JB 3P20A 3D0OA 4IQ8A 4TV9A 5GONB 2F9FA 2VF7A 2X8JA 5JWHA 3PG5A 3HBNA 2FWMX 2R0QC 1HYQA 4RVSA 3UYKA 4BE7B 4WFJA 2ZP1A 5G4LA 4DBZA 4GE0A 1U5CA 1XWFA 4OIMA 5JISA 1GQYA 2CDNA 2GZ1A 4BKQA 5CFRA 2AMFA 1T1GA 1PJAA 4PFKA 2PJDA 3VYWA 1CDOA 3WKAA 1QIIA 2WAMA 2FPWA 5IM4F 4DJFC 4IHQA 4JKIA 1VLHA 3KQKA 2XGJA 1Y7LA 3GFRA 1H3EA 2RB4A 1YHNA 3LBIA 2WC1A 1TKBA 2HEGA 3H2JA 3Q6MA 4QSMA 3VGJA 3LP8A 5FI3A 2O6LA 4JXKA 1HMPA 1UWLA 3ZLBA 1ICIA 1CUDA 2ZWOA 3M4XA 1C2YA 1JSRA 2GJ8A 3GNTA 2IPOA 1V8BA 2G04A 3QW2A 4UTOA 1VKOA 5EC8A 3T9CA 4ALJA 1DC6A 5LZ5A 3UAXA 1JR3A 4KN9S 4EM6A 1EK1A 1HZZA 1Y3BE 3EUFA 4DM3A 1YE8A 2SICE 1NXQA 5FI1B 3KZVA 1B14A 3GJTA 3CKYA 1ZWLA 4EYKA 1PKXA 1PL8A 1VI5A 2I0FA 2J6CA 3K2EA 5EIFA 3SX4A 4HYTA 4XDGA 1NTRA 3E2IA 5ITZA 1U8FO 4RESA 3ZV6A 2A58A 4XRGA 5CG1A 3BSFA 1LQUA 5AUPB 3KJZA 4UZEA 4MUEA 1J2UA 4IF6A 4C6TA 2HN9A 1Z4IA 3D3KA 4OLAA 4RIIA 4TT3D 3LUKA 5HXAA 3ABIA 1U1DA 3H5AA 3CVYA 2DXIA 2ON6A 3A6KA 2F3QA 1XN4A 2GKSA 2VF8A 3GDGA 2QM7A 4CQMA 4O4IB 1ULUA 5EWLB 4MQ5A 4NICA 1KY3A 2YY5A 4QUDA 4CMEC 4GLBA 1M5RA 2JFGA 4JV5B 4IUBS 2QG4A 4JMLA 2CK3D 4KRYA 1U80A 3AF6A 1KA9H 2GWHA 4XTRA 2WY2D 3IB3A 2YS6A 4BVBA 4ESVA 3V2UA 4Q3NA 1D7OA 3TD6A 5HKLA 1KBZA 2XT6A 5DBEX 4E88A 4D9NA 2PUJA 4F7DA 4Z51A 2BGNA 1Q0PA 2ATVA 2H1OA 3ONEA 3GD5A 4GP6A 5IU6A 2WYWA 3FRIA 3K92A 1V7ZA 5G0UA 3WV5A 2Y0PA 1P2VA 4HFMA 5GP1A 3P52A 3OP4A 3CQ9A 5EOVA 4C21A 2BFWA 3HMQA 1KETA 2WINI 1GL3A 3KLPX 1W2HA 3OCWA 5IABA 3HCNA 2P9ZA 4LVCA 3ACCA 2OFPA 2YRFA 3BYZA 2GN8A 4HUQB 3DM9B 4IILA 4C0BA 5EZYA 3GRRA 1UXKA 3E5RA 3R4VA 4XIGS 2JEYA 1JFTA 1KVRA 4EIWA 3CF2A 2QYHA 4OX9B 2JS7A 3R8CA 1TEVA 3GC6A 1FUEA 1NGSA 3P32A 4XCXA 1H05A 3GIWA 4KDCA 2YV3A 4E15A 4CKWA 4LRWA 4HGQA 1RQ2A 3EXEB 2FRVA 4AYXA 2ZZNA 3FDIA 4NYMQ 3DZFA 4OLHA 4X5OA 5AVYA 2FPGA 1MOZA 3AETA 5T4HA 2V4MA 2ZTVA 3QVWA 1MIOA 1D5CA 1UP6A 5DDIP 3DZHA 3KEGA 1TM2A 4D3FA 2VYND 1NXVA 1Q1ZA 2Y1KA 3EVCA 3I9OA 3NWJA 4NHEA 4QO7A 4JI6B 5K6AC 1YB7A 4NCKA 2ZRCA 2C9MA 2QD2A 4P33A 3Q7EA 1NQWA 4PRLA 4B3SB 3NBUA 1SK8A 3TPFA 4I9UA 7REQA 1M10A 4UBKA 1ZOPA 2WD7B 2NPFA 3IQGX 1U7ZA 4OFZA 1P4GA 3ZDAA 4AXBA 4B46A 1C9DB 3DYBA 2CHEA 1S2OA 2J3JA 4FILA 4HXEB 5DXJA 1C8BA 1QDEA 5ENDA 4ZJYA 3THYA 5F78A 1Q1GA 1F3OA 4ATNA 1GGEA 5HGXA 2GA8A 3IPAA 5AKEA 5KTNA 1ZR2A 1J6UA 5JS6A 3D8BA 4XR9A 4KXYA 5FUYA 2NSHA 2GJSA 3PL5A 4E1VA 2YJNA 3CZMA 2Z9BA 1YMQA 5AICA 4UW9A 1F20A 3KT3A 1VMEA 2GBGA 2WM9B 2YZKA 3HXPA 4UMFA 1BAPA 2B0CA 1JHPA 4PLCA 5G0TA 4IZHA 1J39A 4IQFA 3AGQA 3H2KA 3GUHA 5DBGA 4WNAA 4CN8A 5LOVA 2X6RA 3R7FA 4DG5A 4UJ5A 4ZQCB 4DNPA 3IEIA 1HDEA 3QUBA 2O2HA 1MO5A 1P17A 3IVXA 5U1PA 2R5WA 3FPBA 4PLYA 2QTMA 3JAKB 1BKSB 3AESB 4IS2A 5EMNA 5HOEA 2FR1A 4DIOA 1Q0SA 2QTFA 3T3IA 1TRKA 3AEUA 1RFLA 2BP7B 4C1BA 3B9QA 3RE1A 3F8SA 5JPCA 3L7NA 2OG1A 2QX4A 2BDEA 1US8A 4HAOA 4PLVA 1O03A 2J4FA 4EUKA 5I6DA 1XTQA 5B1DA 2UYQA 2HA0A 3QE3A 1O1YA 1P61B 4BNKA 4HFJA 3NGXA 4EUHA 4BO9A 4L76A 1V71A 1P0CA 3OLCX 4EPTA 4ROSA 5KQRA 1X3LA 4M0CA 3KOOA 1KI6B 5B2ZA 5KTMA 1CF9A 1JLHA 4I6EA 5COAA 5FH9A 1I4LD 2ZXUA 1BROA 1RIIA 3JWGA 3ERCA 1GZ6A 1BGXT 2XWBF 3GCXA 2X5OA 3ZXIA 4H7KA 4F12A 1Z6ZA 4C7BA 1W0KD 4NYMR 1E6LA 1JIKA 3C3PA 4UAGA 3C7DB 5CA1B 2AFIE 4IQ4A 1O9HA 1HL3A 2HK7A 1WMBA 1WW3A 2H3EA 1GA6A 2A0YA 4ARAA 1NXSA 1T5BA 1XD9A 2HPHA 4GVPA 1N57A 2WAXA 1M0TA 1RM3A 4LCEA 3PGJA 2G17A 1RHUA 1T4MA 3G7NA 5HG0A 4GXQA 1SXJE 3UJ6A 3QVSA 3W8EA 1ISIA 1Q15A 1GPYA 2REOA 3N2YA 5LLSA 1SD5A 4F11A 1U04A 3HZOA 1RRMA 1VG0B 1QJCA 1L8AA 2CF5A 3LNCA 2QTWB 3P9RA 3B9RA 4J0EA 4Q82A 4QU9A 1P1JA 1Z5OA 2CLFB 3A4IA 3NIFB 5DHPA 1C9KA 5IAGA 5L9AA 5GADl 4RMGA 4YRJA 1NFQA 4FN5A 1K3UB 1O7JA 4E6EA 3B3JA 3KM0A 3PUJA 3RRXA 3AM4A 3V8BA 2VHVA 2YNMC 3KX2A 1PVVA 3TLKA 3BD9A 3CLRC 2CNLA 4K87A 4R7TA 4E5MA 4W5QA 2WZDA 3FCYA 1EJBA 1KJNA 2CXPA 2X9GA 3BGOS 3MSXA 3Q1LA 5AOAA 5HCNA 2IU6A 4PS1A 2QP4A 1G20E 5K3EA 4RPGA 1BQ3A 4UEQA 4JBWA 2VDPB 3A6EA 4LQLA 3TOSA 3LDUA 1RAHA 1E99A 4DMCA 4EO4A 1DI0A 2YMPA 4LVNA 5FFFA 5HUQA 4GDMA 3ET4A 3HMKA 3P1JA 2QPTA 3M83A 4HX5A 4XVQA 3QG5A 2GDJA 4QTXA 3O1JC 1QE5A 3OIFA 3K94A 1H1LA 3PI6A 1T24A 4FCTA 2IYOA 4RJLA 5CLLA 3KQTA 2BPOA 3K8YA 4YA6A 2BTQB 3LQQA 1E3EA 5AXAA 5H3LA 5EMKA 4IMJB 5KWEA 1INLA 4I6GA 2CLMB 4GMFA 3C24A 3QVXA 2CXQA 4QUHA 2UYGA 1SEPA 2VLIA 1KEPA 2AKAB 3TINA 1GPMA 1LI7A 1S9DA 3N8IA 3NKFA 4DQXA 5GIPE 4K6OA 4G0UA 3F3MA 2P3SA 4IZIA 4ZYVA 1QYVA 4D4IA 5BMVA 5J3JA 5C8YF 4C01A 3IODA 3W5BA 4NU8X 2P9GA 3FB4A 3OHPA 4KCGA 3WLFA 1MC4A 2VTBA 2ODBA 3JRXA 1PWHA 1EGHA 4HDSA 1Z0SA 2P5YA 1KQPA 1U2ZA 2GCGA 2ZYHA 1QR2A 1QCZA 1A7UA 2P4EA 2TMGA 1X92A 3VU8A 3C1UA 2PX3A 3NP7A 3M6FA 1KI7A 2YHIB 5DLYA 3K6SB 3EZ7A 4J94A 3FMPB 3DDCA 1G8HA 2FEMA 5AJYA 1GZ5A 4NPHA 3P9QA 5LZ8A 1GXSA 3KPWA 1GCUA 2F1IA 1H1TA 2YBEA 3FCCA 3A9VA 3OJCA 3IJEB 4GGPA 2A59A 4FN4A 4RVCA 2HHHB 4B3RB 3E53A 3RODA 4XB6B 2E4UA 1UC9A 3G2LA 4FS3A 1OA1A 1N5JA 1DPFA 3JASB 5INTA 2QV0A 1OT3A 1U6KA 3AC0A 2NZ2A 3D3JA 3WBKA 4BNZA 4R9RA 1L7XA 4Q00A 1G98A 2IOQA 1FP1D 2FW0A 3IILA 4N7MA 2BHRA 3BE5A 2I78A 2YWRA 1EX9A 5C7YA 2K4MA 3IIIA 4NBSA 4MI6A 3TL2A 2F4VB 4NL4H 4EG0A 1RC0A 2ZAIA 4MPDA 1C0LA 4XFDA 5ALGA 1DBVO 1YVPA 3OBIA 2AV6A 3AONB 2Q1UA 2BGGA 1FYEA 1AQLA 1OOEA 1H0SA 4Z4FA 2F7SA 3AIIA 3KBBA 2XLCA 3LLSA 2QS9A 3L8DA 4XARA 1N0WA 1AB5A 4ETIA 2CD9A 4TTAA 4E7OA 4H15A 1M34E 4OHMA 4QZVA 4IKEA 3PQEA 1W44A 2HDWA 1EK5A 4CCWA 5I7EA 3L1IA 1SCIA 1YCDA 2DBYA 3BRQA 3EBLA 4G26A 3DB1A 5E38A 4BUZA 1XJ0A 5ADHA 1LGYA 3N28A 4HQLA 1GLVA 3U26A 2CNKA 3EPHA 1VHQA 1RD4A 5DXFA 9ABPA 1Q0TA 4NFHA 2JIQA 4H7JA 1FUKA 1A77A 1FZQA 2ISSD 3C4QA 3DB2A 3ED1A 3T0FA 1U90A 4JCCA 3ZD9A 5KNCA 3E4DA 2PNFA 3K0FB 4PHHA 4AKEA 2HGSA 3NIWA 3ETGA 1O58A 3LPCA 4RWEA 1D5WA 4UHKA 3RRMA 4I5DA 1CD5A 3LHFA 3A70A 3KEOA 5ALPA 2VR1A 1WCWA 2LTAA 1NAHA 1KAOA 4LGMA 3JQ7B 1ZIOA 3OO0A 4HEA1 4OCZA 2WJIA 1X8JA 4Z2YA 3U4HA 2HO4A 4LDAA 4XIYA 1AMOA 5TNXA 1WHSA 4EL5A 4LZAA 4MPPA 4CIAA 1D6SA 3CNNA 4YUXA 4JC0A 2DCUA 1JI3A 3L1HA 4XD2A 4JC8A 2AI3A 2BGKA 4RTPA 1BDHA 3M70A 3RVSA 1D1TA 2WSLA 5F7JA 2RHLA 4UTPA 3MFQA 4MVJM 4BNNA 3JR7A 3LWBA 3LZDA 5AVOA 1NM5A 2ZKIA 4YT8A 4ZEMA 1EFAA 2BR5A 2H1FA 3R1IA 3MWKA 1J20A 4XJSA 3NCHA 1DOHA 3VTFA 1RI2A 5BQPA 2IU0A 4GH5A 4TRNA 3D31A 1I2CA 4N48A 1KJWA 3JWPA 4G86A 3JD0A 1Z4LA 1TQ4A 4UNRA 4IH1A 1BGWA 1ISHA 5IJ9B 3Q41A 1N6PA 1P5ZB 5FV7A 5LJLA 1QIHA 3PUZA 2Q3DA 3I5MA 4KI0A 3U4IA 2ZVDA 4O4JB 4Q18A 3ANSA 1GZ7A 1RSZA 3E7DA 5BY2A 5DNCA 3HJBA 4YFVA 1LWOA 3I9V1 1Y3HA 2W0MA 1N2BA 1Q14A 1ZZEA 2RHTA 2W6ID 3AHHA 3CE6A 4IIJB 4ZVMA 2IHTA 1XTJA 3IR7A 2IS4A 3LDHA 3T8YA 4UMEA 4K0KB 4UARA 4NV3A 2QL9A 3H6KA 1D9ZA 2WHPB 4GLFA 3K70C 1H2RS 2FN3A 4EF5A 1PZXA 4KDRA 4ZIRA 3EZXA 1O0SA 2YWGA 3GJ3A 1E0SA 1E7RA 1AV6A 1KVTA 2QLFA 3TZQA 2IXDA 2NWQA 4MJLA 4B44A 4J6FA 4M8LA 4DZZA 1V2GA 4RHCA 5LA6B 3WA6A 4O2AF 2VATA 3GT4A 4BNTA 4ZGWA 1LTQA 4TMZA 1YTLA 5JMWA 2Z2YA 1T9AA 2G1AA 3C3XA 1CY0A 4BX3A 3Q5GA 4PN3A 4IFBA 3E9QA 4M0LA 2FX2A 3HLYA 3WYDA 5JNUA 5FLXA 2NU6A 1NMXA 3VU0A 1CJUC 3ZLJA 3AUFA 3DTVD 3EXEA 2AVDA 5SYNA 3TD2A 4C6RA 5CX4A 3V4VB 2VKTA 3PWTA 3KQNA 1JHDA 3TAHA 1DBRA 5T64A 1E2LA 1QTRA 5AWFC 1T0IA 5JRJA 3Q8MA 5BYKA 3HG7A 3JQ7A 1VHWA 3OEWA 4N65A 3EVBA 5JLAA 4YUZA 2BCJQ 1HDOA 2YW9A 4W9RA 8LDHA 1QHIA 2H92A 2KQUA 3H1FA 3K4PA 4NH4A 2OBFA 4LF8B 1ZGGA 2A0KA 5K8CA 1ZUNB 3G23A 2BGLA 3KQPA 4U4AA 1XZAA 3WWZA 1M9NA 5CB4F 4UEWA 2FUCA 4P22A 2V55B 1ZK1A 1H2AS 2JFZA 2YINC 4LSZA 1D0VA 2JBAA 4BO8A 1WP4A 4HNHA 2FR0A 1CUUA 2O8FB 2PGDA 4S35A 3W90A 4D9IA 3SAJA 2I4MA 1YT5A 5DOZA 5IM5A 3LOUA 4HWPA 5JASA 5A03A 2OE2A 5D6NA 2PIAA 1JIJA 4BECA 3DTNA 1Q95A 3OM9A 1P1HA 4RIEA 3YASA 4CTKA 5F9FA 3MMNA 1HTWA 4ILKA 1T9CA 4TKVB 1OKKD 3ZI0A 3VR1A 2X9NA 2Y4OA 3VOBA 3E48A 3TMKA 1MAHA 3GO4A 4GBGA 5DNEA 1SHJA 4WKGA 3KOMA 2HBYA 4IHKA 1Y1RA 1ZUD1 3FCSB 4X95A 3L8HA 1JIVA 1SQGA 1VLZA 1YJAA 4A16A 5BN5A 1NQTA 1CBUA 1YC2A 3AQ4A 3C7AA 2VHQA 2CZGA 3CU5A 2QZ9A 4M83A 3V3KA 2B34A 1UOEA 3DGFC 4Q47A 3S0JA 4DA4A 4MDFA 2GVDC 3KIPA 2YNMA 4NEQA 4RTKA 2O8VA 3HXLA 2Q8PA 4YACA 1DX4A 1GKUB 3CF4A 2QRMA 1DV2A 2C4HA 2ZITA 4AY4A 3NETA 2CUKA 1DT3A 4W8GA 4G8CA 3DO6A 4RVDA 2WTBA 2ZTLA 3DEYX 3KJHA 2KWIA 4DABA 5H68A 2RAVA 2OV3A 3L4KA 4QQFA 1NG1A 2JB9A 1UKVY 4JS0A 1E2EA 1E2PA 3A6LA 3QA9A 2ZWVA 3G2QA 5LM3A 4BNIA 1SCJA 3N5CA 1QRAA 5C1IA 1U98A 4ZZ0A 4U5XA 2CLDX 6NULA 1GAEO 5BNZA 4LGYA 4IDQA 1F9EA 4MEJA 5KQMA 5LQKA 2PZLA 4W99A 2E2WA 2D0IA 1HL7A 4WK2B 3AKYA 2GXUA 1TD9A 3AKCA 1MX9A 1SBZA 3ED5A 4D42A 3K9GA 3OQIA 1QG6A 2BF7A 1V1JA 1VL8A 3ENQA 1T5DX 4R8SA 3TGWA 3ZZTA 1A9OA 3IE1A 1VBFA 1MXFA 4YMLA 3QF7A 3AL0C 1NVDA 4V3CA 1N3IA 1IY9A 2I7TA 2CFIA 2LZ0A 2X8BA 4KLCA 4M9SA 3DVQX 3ZJ5A 4Q4JB 4OEHA 4R0MA 1Y34E