4TTQA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with atp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
b'MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 74
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttqA00
3BGWA 1RRPA 4O3MA 2E9SA 1P60A 2H7VA 3TVTA 5FTKA 3M6AA 4TT3A 4QM6A 1Z2AA 3F5FA 2Q0HA 1I4LD 1BKDR 1T0HB 3BIFA 4OL0A 3W90A 4BFTA 4JIMA 4MDEA 1BH2A 3K0FA 1NVUQ 3A58B 1TU4A 4JT4A 4RSGA 3ASYA 4A92A 2OCBA 1K5DA 4W5WA 1A1VA 3AP2A 2CXXA 3SNHA 2DFLA 2XNDA 3HPQA 1KNXA 4A15A 5JHGB 3EIQA 1WQ1R 4OK3A 1FNNA 2YV5A 3FMFA 2GWHA 2QORA 1E2QA 1ZUHA 3IGFA 5CJ2A 3U6KA 2ORWA 2ZUDA 1OXVA 4RZ3A 4MYHA 3QNUA 1I2MA 3OAAA 4FW9A 2VSXA 4A82A 3W6OA 3UIEA 4O25A 1BMFD 4LV5B 2WWYA 5TVKA 4DUGD 2QI9C 3HR7A 1AK2A 5G3ZA 1N5IA 1OSNA 2FX3A 4QJ3A 2GEDA 2IA5A 4EKDA 1CEEA 1KI9A 2WWFA 3O8RA 1OXTA 1G21E 1RW4A 3CW2A 3EPLA 1CR2A 1XZQA 5KYKA 2LCFA 3MWKA 4FCVA 2CL6X 4B74A 2BMDA 3IDQA 4OQFA 3DMNA 1D5CA 1P9RA 5IF9A 4TTQA 2WWWA 5EZ6B 4JVSB 4NZYA 2JDIA 1T5LA 1E96A 2CNWD 2LKCA 4D4KA 1KY3A 4ARZB 4JVMA 1JQLB 4RD4A 3AH8A 3CPHA 1DO2A 3LQRA 4HUQA 5AUNB 2XOKA 4NONA 4MDFA 3GLFA 1SXJC 4V0KA 1W49A 1Q21A 2F7SA 3V00A 1Q3TA 4WZAE 8OHMA 3O47A 1ZU5A 2EFHB 2GEVA 2NIPA 2ZU0C 2XJ9A 3HU1A 4Q01A 3M0EA 2FEOA 4C4PA 2Y8EA 3P27A 3QXJA 4IDNA 1NG1A 5EZ5A 2CCGA 1GNRA 1GL6A 2VSOA 2JJ2A 2VP9A 4X8OA 3R9WA 4Y0AA 2DPXA 2KSQA 1GKIA 5EP1A 6Q21A 4AY2A 3CWQA 1R4AA 4OHWA 2F1HA 5DI3B 1W0KD 5CM9C 2F1JA 3NEJA 3B8HA 1SKYB 1LV7A 1AKEA 1CR1A 4XVRA 3VMFA 2CJWB 1JEEA 3PUXA 4KJZA 3NKVA 2P5SA 3RWMB 2N42A 3WRXC 1CJKC 1TAGA 5LD2B 5FPHA 4URXR 1JEDA 2P5TB 3LFUA 3Q9LA 4NP6A 2W2TA 4Q9HA 1NN3A 3KXLA 2J7KA 1KDPA 4LJ8A 3BH0A 4L5BA 2ZS7A 1N6HA 3GJXC 3C16C 3W6NA 2HLDD 4GP6A 5DH9A 3PIRA 4G0NA 4JLDA 4ZCMA 5BN3A 1U8ZA 2W58A 2WIAA 3U60B 3RS2A 4XTRA 721PA 3O8CA 3G0HA 4FN5A 1SKQA 3VU9B 5EE5B 2GCOA 3UXMA 4BFXA 1P9NA 3U7HB 1E2GA 2KWIA 1NG9A 1KAOA 3QF4B 4Q1DA 1Z83A 2RHDA 4RCZA 4X8MA 5BN5A 2NGRA 1NLYA 4PHGA 3ZVMA 1YZUA 3A4NA 3CX8A 3RC3A 2IYZA 3GEEA 2YYZA 3QPVA 2RGAA 1G4AE 4JLPA 2ERYA 2H92A 1QVAA 1UPTA 4PHTA 1JB1A 5ELXA 1L8QA 2WTUA 2R6FA 3WBJA 3I92A 3ASZA 3IEUA 1TQ2A 3GJ0A 1XMVA 2GDJA 4HDCA 4F91B 1OKKA 5HE8A 4OI0A 4IOKA 4Q48A 1PV4A 1A2KC 2BWJA 2V6IA 2YINC 4LJ5A 2FGKA 3RABA 2VL7A 4RZUA 1XTJA 4JL5A 4L8GA 3LV8A 2B7BA 5EXXA 1VDZA 3LBNA 4JSYA 2FG5A 3IUYA 5JEEA 3U7GA 2JASA 2RMKA 3B9PA 4Q9IA 1P72A 1N6LA 3MCAA 3FMOB 4CVNA 3L43A 1E1RA 3LVRE 3TKLA 3PEUA 3EIEA 5AK0A 5FL7A 5BW8A 3QVUA 2O0HA 2REBA 1P2VA 1OFUX 1ZM9A 4MYTA 4ZIRB 2JLSA 5KNDA 2ZVQX 5J40A 1VCNA 4L4UA 2W0SA 3BB3A 3T06B 2DR3A 1CP2A 2O8DA 3EZ7A 2I1QA 4KYUA 5DISB 2AKAB 2VH5R 4EFLA 2O8CB 1J8YF 2JCSA 1ZU4A 4JL6A 2QE7A 2XB4A 5JS7A 1TTTA 1JBKA 1UEIA 4ABYA 3GJ5A 4B47A 3I3SR 4P4SA 2ZAMA 3OIUA 2GK7A 2FZ4A 4TSFD 3PEWA 4OI4A 1GP2A 1FMJA 3GLHE 3D7MA 4G3XA 1WB9A 5DI9A 4F4IA 1TNDA 1UBFA 1AA9A 3ZVRA 2C9OA 1OH6A 1GZSA 4QFMA 2JIZD 1WDTA 3CRW1 1E0AA 3K9GA 3FB4A 4K81B 1ODFA 3CR7A 4C0SA 2BMFA 4TQUS 2J0UB 4ZI2A 1TEXA 3E2IA 1WBBA 4CRWB 3GLHB 2QROA 4EJSB 1U0JA 3ONWA 2WJJA 4CEJA 3JZMA 4QRHA 3TNFA 1O87A 221PA 2A9KA 2IYTA 4GP7A 2DB3A 4JBWA 1W4AA 4MUBA 1E99A 4PAQA 4QHTA 4V0ME 1TF2A 3BOSA 2BV3A 1NSTA 1L2TA 5GVRA 3TAUA 4POAA 3UANA 1J70A 1RYHA 1OJLA 1XD2A 5JJIA 4DCSA 1KY2A 1KI7A 2OO7A 1E4YA 4KI0A 1EXMA 4B48A 3FVQA 2GVZC 2ZSDA 3CPJB 1NSFA 5JRJA 1W7AA 4Q02A 2AWNA 2GJKA 4D4JA 1WRBA 1K5GA 4DKXA 5FOXA 3C8UA 3VR3A 4MH0R 1KAGA 2VP2A 4JLVA 4ZDIA 4A8JC 1SQ5A 1KKMA 4MRNA 1N5JA 3PV0A 4EPTA 4HAWA 1DBSA 1R8SA 1YKSA 5C1BA 2VBCA 1XDBA 5HKKA 1GSIA 3P4YA 1NVWQ 1P3JA 1Z08A 3QE0A 3MWLA 4JLJA 1F2UA 3KQNA 4LCBA 2XZOA 3U7EB 2MSDB 3PENA 1JR3A 1DEKA 4PQYA 4US2R 2J7PA 4AI6A 2JLQA 2XTMA 2RHMA 1MO6A 3ZQJA 5H68A 2FFHA 4B71A 1ZVQA 1DVRA 5H8WA 5TY0A 2DFTA 3C5HA 4PZZA 3KUCA 1VCMA 1G41A 5A4JA 3REFA 2FV8A 3X1YA 2QA5A 5GJCA 1GITA 4O2RA 3ZDQA 4C3ZA 1DE0A 4LK2A 1XTRA 4NYIQ 4BFWA 2FSGA 4A36A 2XTNA 2ZROA 3W8NA 1SXJA 4N1AA 5JI3E 1WXQA 1Y63A 2F43B 4GSYA 2FU5C 2BCJQ 4JS0A 2HF9A 1CU1A 4M0LA 4M8NE 1CRQA 1U2RA 2G77B 3RYTC 4BLPA 2O0JA 4D0NA 2BCGY 4URUR 2CL7X 4C7OB 3OIWA 3GP8A 1SGWA 4TLDA 4P4UA 1ANKA 1Z0IA 2B7CA 2VRWA 2F9MA 3L82B 3MGCA 1U8YA 2IS4A 3GEIA 4CW7A 2A5FA 1W2HA 1HA3A 2C78A 5F9FA 4CEIA 1PZNA 2Q21A 2ZSBA 5CDFE 4KBGA 4KAXA 4M53A 1KDTA 4OHVA 4YONB 1FPMA 3MMPA 2IEZA 3LBIA 3SQXA 3CUEF 4Q5IA 2C77A 2QRZA 4NCJA 3CNNA 3CH5A 4PFSA 4QGFA 1EWQA 4DDTA 2KBFA 2YOGA 4MKFA 1Z0FA 2A78A 3QJYA 4Q4JB 3CRMA 1OYWA 4LHVA 2P65A 3BAFA 3C5CA 3QBTA 2O52A 4GPTA 3RLFA 1HV8A 4DEXA 5CB6A 2WV9A 5DYGA 3X2SA 3CH4B 3CF0A 1LF0A 2HYDA 5B2ZA 2H57A 5D3MA 3TH5A 4JSTA 1BOFA 1NJGA 2CHVA 3OFNA 4Q1BA 2ECKA 4KITB 1QHHA 5E7IA 4BZXA 1ZC3A 4M1SA 1IBRA 2WWIA 2V6JA 3KL4A 3TBKA 2X1VA 4PPQA 3RRMA 2HXSA 4R98A 2QSZA 2XX3A 2CLDX 4HZIA 4AYTA 1YZGA 4TLBA 5CM8B 4BLTA 5KDDA 4GOXA 5B58C 2C04A 1F3OA 2QSYA 3THXA 2ORIA 2IHBA 2IUUA 2GXQA 3W5JA 4LY6A 2A5JA 4XD7D 4C30A 1IHUA 1SVMA 5CLQA 3FKSA 3LO5A 4LPKA 4BFVA 5FBQB 3DMDA 2QTHA 5BWMA 3QY0A 1AZSC 2QRNA 2ZRMA 2CVFA 4ERNA 1OF1A 1D2MA 1VG9B 2K5UA 4M21A 2WJIA 1UBCA 1SZPA 2J0VA 2QAGB 4KXFB 2BJVA 1LS1A 4GOJA 1QRAA 2PMKA 4DRZA 3ND8A 3GLIE 1H8HD 1G291 2BBSA 3AVQA 1OW3B 3SOPA 1F2TA 3WNBA 3KB2A 1KYIA 2ZVPX 2Z0MA 4LBWA 4WZBE 5KPDA 1CBUA 1Q1BA 1E9FA 4QM7A 1XJ0A 4XIGS 2QU8A 4PO1A 1NBME 2ZRAA 1DAGA 3MD0A 3GLIB 3RSOA 1IAQA 4F38A 5KNBA 2WJYA 3SJAA 3FTQA 1TL7C 2OBNA 3NC1C 4RZXA 3PUWA 1UKVY 2ZYUX 1XPUA 3KJEA 2W6JA 3AVPA 4F4CA 1XJQA 1IY2A 1KKLA 4JLNA 3OEED 4R7ZA 2WIBA 4Q4HB 3D3QA 4UNSA 1W36C 1YQTA 2QMOA 1KOFA 3QXXA 4M1OA 3LH5A 3CNLA 1GRQA 4PHHA 2QGZA 3I8SA 3PITA 2AXNA 2ZRBA 1NLZA 3GJ3A 1Z28A 4PQFA 3AF2A 2QMUA 2J59A 4C9BA 4TLAA 3SYNA 2QTFA 4TQ9A 2VP4A 5CIWA 4C0JA 1OIVA 5FTMA 2PJRA 3WRYC 2ZJOA 2D62A 3LBHA 1ZRHA 3KQUA 5KUTA 1AS3A 1VIYA 3EPKA 1KO7A 1CF4A 1NKSA 1GIAA 4PX9A 3KKMA 4R2IA 2Q3FA 4BFSA 2GA8A 1HEIA 1OLOA 2FSFA 3EIHA 3AV0B 4RJLA 1CS4C 3W8RA 2ZI6A 4CEHA 4HLUC 4Q1EA 4QOSA 2PH1A 4QHSA 4A0GA 3IIJA 4PO8A 5CIQA 3ZLJA 4E07A 1CTQA 3THOA 4YDSA 4Q1FA 3RVBA 3V4FA 4DSOA 2VTKA 4N0DA 4A6PA 4FWTA 4TYWA 2GK6A 4A2WA 1AN0A 2FEMA 2ZREA 3MJHA 3T5DA 2XEXA 1BO6A 1D9XA 1NMZA 3AQ4A 5LDDC 5JHHB 5JSZA 4UJ5A 2D3WA 5SZKB 4LV6A 5FPKA 1IJFA 4A8JA 2R6GA 3LLMA 1HH4A 1XEWX 3L2OB 1J7KA 3F0TA 1BYUA 2QBYB 1TADA 4XH9B 3RS0A 2ZR7A 2ZRJA 3BWDD 4GZMA 1YHNA 4D81A 1XP8A 4XSHA 2REOA 4NCNA 3DO6A 2VF8A 4FMCB 2V1XA 2J0SA 3ZD6A 3QKSB 2RB4A 4KFTA 121PA 2FMXA 3S1AB 2BVNA 3NEYA 1TMKA 4FMCF 5FH9A 4ZDKA 4OHYA 4KFRA 4Q47A 1HE1C 1XMSA 2GHIA 2J45A 3FYHA 1E9AA 1XCPA 3B5JA 4R9UC 3U3OA 4AYWA 3EWAA 2V7QD 3CWZA 4A0FA 3GLGA 3EPHA 4MRPA 1LNZA 4P3YA 3V9PA 5BYKA 5CB8A 4DCVA 3KJGA 3EZ9A 2PEZA 2QG6A 3WYAA 1D9ZA 3TW8B 4RY2A 3TSWA 2RGEA 4WIAA 1EESA 1AQUA 3KKOA 4JVLA 3CX7A 2FPLA 1ZC4A 1ZIPA 2VA8A 3KTAB 4KLNA 1Z6TA 4FWIB 4NYMQ 5L3QB 2FNAA 2IXFA 2OILA 3CPEA 1UBGA 4MUAA 4DEYA 3RRNA 5JJLA 3LDAA 1QHIA 3GJ8A 4JYBA 2XSZD 4XOIA 2HT1A 1XXHA 3DPUA 1N0UA 1QHSA 2IHYA 5CYPA 4KYIB 2R6AA 4ON9A 1MR3F 5M04A 3QVVA 2IUTA 4JZKA 4LBVA 3VKWA 4OQMA 1CR4A 2VF7A 2NO6A 1L4UA 1DAMA 4AKEA 1G9XA 4BZQA 2MSCB 4ZKEA 1G64A 1RRFA 1OIWA 2OAP1 3TVDA 3CO5A 3B1VA 3G5UA 3HP1A 2FFAA 4LBZA 1T3HA 1A82A 1U98A 1G8FA 2JLVA 1YR9A 1XTKA 4B2LA 5GADl 3AKCA 3WYFA 2ZRHA 4N0EA 1Z6AA 1GILA 1R8QA 5CK5A 3THYA 1VECA 4XVQA 1KNQA 3DZDA 2G1KA 4E22A 421PA 3K09C 3QPWA 1AIPA 2ZE8A 3VTKA 2GJAA 4PXAA 4ASUD 2IYLD 1MOZA 5IRCD 4V0OA 4MITA 3EPJA 4EFNA 1OV4A 2PZFA 4DLXA 3FHTA 5L8VA 2ZJAA 4LI0A 3RAPR 2VPPA 1FX0A 4DLRA 2ZANA 2PJZA 2Z6VA 3VKGA 1J99A 4I1UA 2ZE5A 3EARA 4DT1B 4M9QA 1E0SA 5JRZA 1N6PA 1R5BA 5HPYB 4LZZA 5HCNA 2CE7A 2GILA 1E2EA 1D2NA 3IIMA 2WMOB 3NHBA 1N6RA 3L0SA 4QKQA 4ZKDA 3HYTA 2CCJA 3OEHA 3HR8A 4QL3A 1KO5A 4B32A 2Q3MA 2DY1A 5FFMA 2QMEA 1Q0UA 4M1TA 4I1SA 3LXRA 5KTYA 3ADBA 3THWA 2Z83A 3B85A 1VG8A 2BOVA 4RFSA 4FCWA 2RGNC 4D0GA 1MKYA 1ZCBA 2JA1A 2FZLA 1WP9A 4LBYA 2W83A 2QENA 2EQBA 4ZCLA 5C46F 3SZRA 1QHYA 4PHFA 1T91A 3SQWA 1SVOA 1VPLA 2WWGA 3I4LA 4G5RA 4NYMR 4QGHA 4B33A 2IYUA 2ZSFA 3HU2A 3NDBB 1TQDA 4D4MA 3B9QA 4TYYA 4M1YA 1NMYA 1W4RA 4HZUA 3X1DA 3QSYA 4KHZA 1L4YA 5K8UA 3UPUA 4WXRA 4QG7A 2QZ4A 1JECA 1RRCA 2OFXA 3K1JA 1CJVC 4F93B 2WPDD 4C0BA 4EPVA 3FOZA 1E32A 2ANBA 4PC3A 4TMXA 1Z22A 1XNJA 2FWRA 3RDPA 4Q66C 3DHWC 4NKRA 4TLCA 5A5GA 4L16A 5FPTA 4YMVA 3T15A 3I5XA 1OB2A 3KQLA 1B0UA 2WSSA 3K0FB 2XGJA 821PA 3KDSE 1ZD1A 3L0IB 3U3MA 1TQ4A 5TMPA 4HDQB 3IPXA 2IXEA 4KCGA 3F8TA 2DWQA 2FF7A 1MRSA 4LYFA 1VYTA 1QZXA 3IKJA 3QEJA 4LYAA 5FUXA 2GXSA 4DJTA 2G88A 2P67A 1XTIA 2YVUA 4MGYR 4QBHA 1S9DA 4DZZA 3RC8A 4MKGA 2XXAA 3H4MA 3K0EA 3T61A 1KMHA 3A4LA 4GL2A 2FSIA 4HLUA 4A0RA 4B43A 4DCNA 3RANA 2MSEB 1ZCAA 1MH1A 2R8RA 5DNYB 2DHRA 2Q6TA 4G5QA 1IN4A 1XCMA 3SYLA 5TV2A 5GVSA 2QN6A 3ZQ6A 1X6VA 4M2LA 3FFAA 2DBYA 1E9RA 1AS2A 1SKYE 1UEJA 1RJ9A 4XJXA 2PMDA 4GT1A 1KO4A 2GTPA 1IJEA 1CLUA 2QM8A 3ZZUA 4IRUB 4LJAA 4WW0A 3FHOA 2ZYTX 3FMPB 2CK3A 3H1TA 3K0CA 5CYOA 3CB4A 2PX0A 2CVHA 5E7JA 4B2IA 2EYQA 1E1RD 2OFOA 1G19A 1M7BA 4PPNA 3AP3A 1E79D 4KU4A 2IX3A 2AX4A 1KTVA 1E9BA 1H8ED 2OCPA 2B8TA 2ZSAA 3GLFE 4LHZA 3SJCA 4NPHA 1F5NA 1UKZA 2EYUA 1QHXA 1ZNYA 2ONJA 1MT0A 2GAOA 1MV5A 1PLJA 5AJZA 2EU8A 2KI5A 1E69A 4NBSA 5J4KA 3NBXX 1X8KA 4HUQB 2FN4A 1F6BA 3KJIA 3E5HA 4YXWD 2YWHA 1US8A 4UJ3A 5JCPA 3QI2A 3GLFB 3A1UA 1X8JA 4LYJA 1ZP6A 4AK9A 1NVXQ 1M7GA 1BMFA 1E2FA 5FPYA 4QNRA 4W5JA 4DUGA 5B64A 5B57C 3GQBA 4K8OA 4V0NA 4PC6A 1KK3A 3TJZA 1IXSB 4YQFA 1G3RA 2VP5A 4PC7A 2ORVA 4L9WA 2QAGC 3NBFA 1K6MA 2AK3A 2GJ9A 1EWRA 5LB2A 5JBQA 2BBOA 3RWOA 3SEAA 4BQSA 1XEXA 2EWVA 5L3SA 5EP2A 3EX7C 1O3YA 4EFMA 5HTKA 1S2MA 4DDVA 1G3IA 2N1BA 4OJQA 2AK2A 4PZYA 2WHXA 3AVYA 1EFRA 1KZ7B 1W1WA 2CNWA 2PZEA 2ZE7A 3P32A 3L0OA 2YHSA 1M74A 1KGDA 2ATVA 5EXSA 3QF7A 5AUOB 4G01B 1KI6A 4JYCA 5SZIA 5BN4A 5CITA 4ZV4A 3IO3A 5LBIA 4IXMA 5FBRB 2P0EA 1TEVA 3U2QA 1P7CA 3C41J 3GFOA 4B34A 2ZR9A 5C2JB 2D06A 2R44A 1YZQA 3TR5A 3NWJA 4FXPA 1VG1A 2ZR0A 4AURA 4US1R 1DADA 5JMTA 3K09A 5JS8A 1MO3A 1FP7A 2GCOB 4DDUA 3QKRA 1JPJA 2C96A 1U0HC 3K0SA 3GLHA 1KO8A 4F4JA 3K8YA 1II9A 3Q7QA 5TXGA 4DSUA 3A4MA 1W0KA 4LDJA 4AKGA 1CRPA 1R0XA 3UKDA 4TMZA 2ODNA 3GMTA 3VQTA 3K9HA 3A1TA 4OJKA 1OHHD 1VCIA 1EFCA 4YMWA 3SYKA 2QTVB 4IHQA 3WMEA 2AKYA 4A1FA 4OK6A 2FSHA 5FOUA 1G17A 2TMKA 2JATA 2QPAA 1X1SA 2R6CA 3N2EA 2R6DA 5HZHA 4B2PA 2J46A 1XX6A 3FGNA 4JLOA 3VHXA 1Z5ZA 2QPOA 3QG1A 1NIJA 5K8LA 1R6BX 2GVDC 4MGIR 4DLSA 3FWYA 2BKEA 3PR1A 2IYRA 4DCUA 2H1LA 5AUQA 5JFGA 5KNCA 1JXMA 2NQ2C 2HLDA 3LQQA 2IYQA 2GXAA 3BB4A 1B23P 1W47A 2BMEA 4MKHA 4FMBB 4AD8A 3W9YA 4XWOA 2IK8A 5J4HA 3F3YA 3NTUA 2IC5A 3QENA 5FTJA 1JXOA 4RVCA 5FTNA 4JMPA 4HI0E 4MKIA 3RRYA 3R9XA 2ZIAA 4KLZA 4CIDA 1COWD 2EVWX 2ZYWX 5L3RA 2NZJA 2FDCA 3B2EA 3BJIC 4Q9JA 1WMSA 4U02A 5P21A 4P4SB 3QUSA 4GDFA 2RGCA 4MRSA 5FBVB 3NC0C 4DB2A 3O8DA 3NBYC 4J0QA 5AJWA 3AM1A 2WKQA 1P6XA 2GBLC 3AF3A 3B82A 2HJVA 4QHYA 5H1YA 2BM0A 2YC2C 2R9VA 1FZQA 3A1WA 3QEOA 2HV8A 3OE7D 2QAJA 4TMWA 2W2XA 1R10A 3CR8A 2YOFA 3EC2A 4R2HA 1Z3IX 4QGAA 3AVXA 3I73A 4PR0A 2KBEA 2O8BA 2WAXA 4MYUA 5SZJA 1N6KA 4LJ7A 4YMSA 1GG2A 3CF2A 4TYPA 2F1IA 1RPZA 4CEJB 1VG0B 2P6NA 2IL1A 1JR6A 2GJ8A 3D31A 2XB2A 1W0JA 4NCIA 1T3SA 1GTVA 1Z8FA 2BEJA 5AJYA 5GJWC 2X77A 1PJRA 2D74A 1HE8B 5AUPB 3CNOA 3DDCA 1ESMA 2J9RA 1YZNA 5KPJA 3NDPA 5K8IA 1XD2B 2GF0A 3QOFA 5J4LA 3NHAA 4C0HA 3U44B 2OUKA 3VR4A 1RRGA 1II8A 2EFCB 1YJ5A 1G7TA 1IM2A 3LWNA 1VMAA 1E4VA 3ADKA 1C4OA 1XCGB 4QNMA 1NBMD 3TQCA 2KE5A 4DC9A 2OCAA 4GBMA 4IDPA 2GCPA 5TB5A 4Q9LA 3SR0A 1R7RA 5C18A 2VHUA 4KV9A 2A3RA 5UKDA 2BEKA 1P5ZB 3LXXA 4XVUA 1Z07A 1Z29A 1ZD8A 2JJ8A 4OK5A 3U4QA 3K70D 4C0KA 1BS1A 3V4RA 2JIZA 3VR6A 1W46A 3PXGA 1N6IA 3ZS9A 3TUJC 4Q4AA 1V5WA 4Q7KA 1F2UB 1XD8A 1ZM4A 3W3ZB 2OG2A 3KB1A 1RC8A 2YWGA 4Q18A 1S4QA 3P1JA 2Z4RA 3Q8XB 4CZ2A 4RD0A 4HLDA 1E9DA 2V8OA 4JL8A 4QXAA 3CZPA 1IONA 2W00A 2JLYA 1G16A 1XMIA 3SFVA 3R7WA 5JWHA 3CRRA 3UG7A 4DSTA 2ZI9A 4HSEA 1Y3AA 2FFQA 2R65A 1QHGA 2DYKA 4JJKA 1S9HA 1NLFA 3TRFA 2ZRFA 4JKYA 2GEUA 2ZU6A 2IS2A 1A7JA 3U3RA 4BLRA 2O8EA 4JLMA 1DAFA 3ZH9B 4L9SA 1DG1G 2BHRA 1N6NA 4BFZA 4WZ6A 4DLVA 1G5PA 4EQ6A 1Z6GA 1A2BA 4CT5A 1YR7A 2IS1A 2VP0A 1XB2A 4HAVA 2JLRA 3I32A 3TSZA 2FOLA 1F48A 3VR1A 2QAGA 4CEIB 2P3SA 3SBEA 5F2EA 1ELOA 1QG4A 3C7KA 1AKYA 3WNDA 4TMKA 1M8PA 4URYR 2HYIC 4KSBA 4DIDA 4IVQA 3CLVA 3L8ZA 4A2QA 2WAYA 1MABA 3SBDA 2PZGA 5G41A 2PT7A 4DDWA 4U7DA 4EPXA 1C9KA 2WKPA 1UKEA 3B1WA 2JJ1D 5FPSA 3C15C 5EE1A 1ZINA 2SHKA 2ZRLA 4DLZA 1MO5A 4II7A 2ZEJA 4EUNA 1T6NA 4IOJA 4RD6A 5DIFA 4CF7A 4HAUA 3ECCA 1IQPA 3K0AA 4AWXA 2AD5A 4XTCS 2ZRGA 3TAHA 5D3MB 5DN6D 4Z1MD 3A6PC 1FP6A 2ZI3A 2ZJ8A 4B3GA 1SULA 2AXPA 3RRZA 1QHHB 2BC9A 5EE3A 2E87A 4IKEA 3PG5A 3X1WA 2RGBA 1KIMA 1KI1A 4Q7JB 5F98A 1KJZA 4PC2A 2OT3B 2ZRKA 4Q1AA 2O8FA 1P73A 4Z51A 4LOAA 2UKDA 5FBWB 3THXB 5J5CA 4AG5A 2LKDA 4GOKA 4L15A 2BIFA 2FE4A 3HPRA 2W6ID 3LD9A 3AB3A 5BXQC 1R0YA 1SVLA 2I4IA 2C2HA 2JLXA 4BEBA 1R2QA 4JJZA 3IBGA 1Z2CA 3GD7A 2ERXA 5ANRB 1ZUIA 1UBEA 3K70B 2A5YB 2ZSEA 3Q7PA 3SHWA 4C2UA 3B7GA 3FE2A 4ITRC 4DCTA 4C2TA 3FMIA 1S3SA 2QT0A 1J90A 4HAYA 3ZIAD 1ZNWA 1GL7A 2P2LA 4P4TA 2Q9BA 1E98A 4WAUA 1F2TB 1NN5A 3BB1A 4QJ4A 4UXJA 1T8UA 5EE0A 4LPSA 5EXPA 2ZM5A 1DAIA 2FPKA 2PL3A 3E70C 1E0JA 3ND9A 4RKFA 1QBKC 1DTSA 4PSVA 3CRQA 3TUIC 2CDNA 1W4CA 5E4FA 1DG3A 3B1XA 2JLUA 3KXKA 1Z47A 3VNUA 1OXSC 4PSKA 1G8PA 5IT5A 1A5TA 1ETUA 1G5RA 4FD2A 5IK2D 1DAHA 1G3QA 2OLKA 2O5VA 1YZTA 1ZNXA 1KO1A 2G0NA 5LD2C 2PCJA 1E1QD 1JPNA 2GBLA 3DKVA 3L8YA 2REXB 3KUDA 3AKEA 2C99A 4CT4B 4UXIA 4F7WA 1YRAA 1R0WA 3J81k 5DLQC 1LW7A 3EWSA 3W6PA 4A9AA 1RVDA 4DLTA 1X3SA 1SVIA 4PO9A 1VKJA 2DFKB 4PZLA 2RGGA 1AJEA 3TQFA 4TL6A 3BORA 4C0LA 4AYXA 1AS0A 4M22A 4DLWA 3T1QA 3QIAA 2YKGA 1GWNA 2AFHE 3AUYA 1G5TA 4QJ5A 3KQKA 2J0QA 1G7RA 4CEHB 1KSJA 2ZQ5A 1QDEA 5JCZA 2C03A 4D2IA 4G5GA 3NBZC 4RKEA 2NZ8A 5HZKA 4Z54A 1GKYA 2XTZA 1G7CA 3EA0A 1Z0JA 4V0LA 4TWZA 5JLJA 1SVWA 3OEEA 3BXZA 5FI1B 3AF0A 4TT3D 5K8TA 2ZRIA 1QHNA 2QMHA 4A6XA 1TQ6A 1YU9A 5JZVA 4AIIA 1KDRA 2C9YA 2RH5A 5JSZB 4B6EA 2YZ2A 4D4LA 2F55A 1CR0A 3MG9A 3RS7A 3TSOA 4E5UA 1W5TA 4NYJQ 1U94A 1ZM7A 3IO5A 2AHOA 2XNDD 1X1RA 4EDHA 3QKUA 2B6HA 5DHFA 2QP4A 1F60A 2IEYA 4X8LA 2CE2X 4HB2A 2V4ZA 3N5CA 1R0ZA 4NL4H 2IF2A 1UKYA 3M1IA 4P31A 1N2CE 3OAAD 3M4YA 1E2PA 1NY6A 1M6NA 2VEDA 3D8BA 3P26A 1M34E 4KBFA 2VP6A 1VIAA 4NMMA 3ZZ0A 4BRUA 4D6PA 4BZPA 4JLAA 1P61B 4TQAA 4Z8XA 2DWPA 3DL0A 3LNCA 1UADA 3UWOA 3ZJYA 4LC0A 4BEJA 1Z63A 1M7HA 1TF5A 3UG6A 4B3XA 1YRBA 1ZM2A 3PCRB 5AJVB 3H2YA 2IYVA 4UNQA 5JJKA 2CEAA 4OHXA 3KFXA 2PCLA 1S1MA 1XMJA 1XFAA 2X19A 4IDHA 3KKNA 2IT1A 3I72A 4U00A 2F3RA 4ESVA 4EJSC 1XU4A 4BUJA 4WBSA 2X8AA 2DCUA 4ILEA 1T5IA 1U90A 2JDID 3EAQA 4C0QC 2ONKA 4B3FX 2GRJA 2OV2A 2P6UA 1E9EA 3HU3A 2QL6A 2AWOA 1U8AA 1Z0DA 3ZVLA 3MRSA 4ACAA 3AF1A 4GNKA 1P9WA 1II0A 1G6OA 5KSOA 2G3YA 5FI0B 3AVUA 4TLEA 1PVOA 2VLIA 2XOKD 2C98A 2BBTA 2IYYA 4M1WA 3G82C 5DO9A 3RS4A 3AVTA 4P0TA 3ZZTA 3Q72A 2MMCA 2VYFA 4I1OA 5JWRA 1ESNA 2V1UA 1E6CA 2RGDA 5LPNA 4JVNA 4MGZR 4RCYA 4PPGA 4NHOA 3THYB 3VR2A 3ICQB 2WZQA 4TL7A 2V7QA 1NP6A 1FMLA 2CMKA 1IXZA 4OI2A 1M1YE 2GAAA 4MYCA 5CLLA 2F9LA 2XNSA 3K53A 1OXUA 2G6BA 2JJ2D 4M9SA 4Q03A 4FI3C 2HJGA 1QG2A 2CK3D 2OZEA 2ZTSA 2WWXA 1GFIA 4IFBA 4JBXA 4NU0A 3SI7A 3ADCA 1UDWA 2YOHA 3IBYA 4H1UA 2V3CC 2FA9A 1FX0B 4US0R 1R5NA 3FPAA 1P2TA 2IWRA 2HCBA 3T1VA 4NYJR 2XSZA 3JVUA 3LW7A 5FOWA 1WBDA 3I5YA 2IS6A 1IY0A 1MO4A 1GAJA 1YR6A 3OHMA 1XEFA 4KO8A 4LUCA 1CULC 3IEVA 3QQ5A 2H16A 4EPRA 3U61B 2OCYC 4ARZA 2H18A 1CIPA 4KSCA 3BE4A 3TR0A 3ZVNA 1GVNB 3THWB 2ZUBA 1A4RA 4MGKR 1Q1ZA 1PUIA 5JEDA 4RZ2A 4RD3A 1RE0A 3RS3A 4RFSB 4LHYA 2YC4C 4PPFA 4CYMA 3MSXA 2ZRPA 3PFIA 5DSZA 2VHJA 5GJVC 2V9PA 1W4BA 3CM0A 2H17A 4M9ZA 2WOJA 2BM1A 3NIBA 4A0HA 3RNLA 4ASUA 2ZRNA 4OHZA 1KK2A 4A2PA 1IN8A 2QY9A 3QKTA 1G8HA 2Q9AA 4YC7A 3SU8A 1GRRA 1ZJ6A 1NKTA 4DWJA 4DIEA 2CCKA 2VHTA 2XZLA 2G1JA 5DI3A 1UFQA 3EW9A 4HZUB 4V03A 5G40A 1E2HA 3AGQA 2IYSA 2J3EA 2I1VB 2VSFA 5GJBA 1OKKD 3H0KA 3GEHA 2NO0A 2CJWA 2R62A 1UAAA 2KB0A 3HWSA 1OH7A 3R20A 1CXZA 4B76A 1EFRD 3IHLA 4PAOA 4B3CA 5KHOC 1X8LA 2WJVA 4O2LA 1W36B 5TDHA 5AWFC 2HXYA 1RYFA 5DHAA 2BJWA 4HAXA 3EA5A 5FOSA 3FFBA 3LY5A 1GL9B 2F6RA 1G3MA 1VTKA 5FL7D 4M9XA 4HB0A 4LWZA 2YWEA 1Z06A 4Y0VA 3Q85A 3PEYA 1KSFX 2ZETA 3PQCA 1XRJA 3AVWA 1LY1A 1EFTA 2XITA 4AKHA 2XJ4A 4HB3A 3VX4A 1DELA 3JZAA 2PX3A 1KI8A 1T8TA 4WVFA 1FQKA 3WHLA 2OLJA 1ZIOA 3P4XA 3VU9A 1GNPA 4KFSA 3MWYW 3NXSA 3B60A 3GJ4A 4FIDA 4E03A 3QF4A 1RFLA 1E2JA 2H5EA 2N46A 2QE7D 2BMJA 2CHGA 2XXAB 2V55B 3FDIA 4EPYA 1KMHB 4BLQA 5C4GB 2OSBA 2EW1A 2QP9X 3B1ZA 5EXTA 5E3HA 3WYGA 4BE7B 4C0AC 1K8RA 1YZLA 3WP0A 2J5XA 1JAHA 1HT2E 1DO0A 1KMQA 1RJ9B 2HCJB 2WPDA 3AKDA 4IOMA 4TZ6A 2ATXA 3N70A 2IYWA 1IN5A 4LJ6A 3CF6R 3A37A 3DOEA 5EUQB 4B35A 2DFNA 2GETA 1LS6A 2WWHA 4FCTA 4DHEA 2ZJYA 2AL7A 2D2FA 1KJWA 4I1VA 4PC1A 3VNVA 2GZAA 2IF0A 4Q7LA 1OPXA 1VHLA 3LX8A 3UATA 1RKBA 4EIWA 1IXRC 1GNQA 3SE0A 1E2KA 4IDOA 5EJEA 1IN7A 3QXHA 1Z0AA 3OF5A 3QXSA 3U3KA 4DB4A 1T9HA 1NY5A 4ZIRA 3IQWA 4IDQA 2FGJA 1VHTA 5G3YA 1VCOA 3MLEA 4JLKA 2KJQA 4O0MA 4RD2A 3VFDA 4RFVA 3KKPA 3ETLA 4NTZA 1TUEA 3BERA 1HT1E 1E2LA 2O8CA 1US8B 4LSGA 5A0FA 3K9LA 1Q20A 3BD9A 3ZYCA 2RAPA 4LYHA 3DM5A 1NI3A 3AP1A 4IXNA 4IEEA 3CKLA 4KODA 1J8MF 1FTSA 4K46A 4IFEA 3SS8A 4DLUA 1JJVA 1NVVQ 1WE2A 1N0VC 3RS5A 4TL8A 3DVLA 1G4UR 1J2JA 2UZIR 2BDTA 2G83A 2ZJZA 3I8XA 2BKUA 4LJ4A 3KFVA 4S35A 3TIFA 5HKKD 1Q12A 5KSPA 3K70C 1OH8A 3BS4A 1RIFA 4D25A 1ZW6A 2J0UA 2YJTD 1E0KA 1QF9A 2IW3A 3B1YA 2IYXA 4WXPA 1EG7A 1W0JD 1JR3D 1P2UA 2QNRA 4EJSA 2ZJ5A 4TL9A 1UDXA 2J7PD 2JLZA 1S1CA 1XEXB 2EFGA 3WMFA 1E79A 5CK4A 1KK0A 3BBPA 1H8EA 2FPMA 5L3SB 1QVRA 2AN9A 4DLYA 1S3GA 4LRWA 2E1RA 1EFUA 1G7SA 2PBRA 3CZQA 3KJHA 3KXIA 4HLCA 1Q3HA 1C1YA 1HURA 5J4VA 1S8FA 2OAQ1 3U6BA 3ZD7A 2C95A 1KK1A 1KI6B 1SXJD 2OFWA 1ZNZA 1N5KA 1FFHA 3IILA 4OBEA 4YXWA 3SN6A 3C14C 2W0MA 4DBLC 1PLKA 4V0MA 2OBLA 4KVGA 1D6JA 5IHPA 3R8FA 2WBLC 3ADDA 1KDOA 2RGNA 2Q9CA 3IIKA 1OE0A 2QM7A 1NJFA 1BYIA 2ANCA 2VHQA 2JGNA 5DGXA 1Q44A 1P62B 3QKRB 1P75A 1Z0KA 2OHFA 4HLQB 2EFEB 4QBIA 4GFDA 3DM9B 2X2EA 1ZYUA 2WM9B 4BLOA 1CKEA 2L0XA 3CX6A 2VHCA 4URZR 3BRWD 3REGA 3EZ6A 5IDVA 4MA4A 3QXCA 3LAWA 1PUJA 1NMXA 4TYQA 1E2DA 3LRPA 4NDZA 1NF3A 4CDGA 3BC1A 3B78A 3TK1A 4G5SA 4D0LB 4H1VA 1WA5A 2B92A 4IVPA 2X2FA 1ZD9A 1E2IA 2QT1A 2WSMA 4TYNA 2NPIA 4B75A 1KI3A 3U44A 1JQJC 4PTLA 4NCHA 4BWYA 1LF5A 4Z8YA 2CBZA 3TGPA 5FOVA 1ZUNB 4Q9KA 2ZI7A 2WKRA 3LW8A 5KO2A 2WICA 2F43A 2PT5A 3AUXA 3CONA 3OFND 4LHXA 5FTLA 1NVVR 1OFIA 2ZS9A 1V43A 2H8KA 4Q21A 1JI0A 2CLCX 3IPYA 4NH0A 2BBWA 4URWR 5E7MA 3BFVA 2WJGA 4LGMA 4C7OA 3EASA 1N5LA 1TF7A 5FUVA 1D8TA 3KZ1E 2NMVA 4LV8B 1GKUB 1KHTA 3EZFA 2PLRA 5H70A 4QBFA 3SC3A 3LVQE 1XEWY 4GMDA 3CBQA 1D2EA 3WY9A 4LJ9A 4UQOA 2P6RA 3BFKA 2IUSA 3FKSD 4TSFA 1YE8A 5FR1A 3AF4A 3GJ7A 5SZHB 4JKIA 2B8WA 1XD9A 5FBLB 2ODEA 5HR5A 1OHHA 1OYYA 5L3VA 1JR3E 1XTSA 4ZI3A 2UZ3A 2JEOA 4Q1CA 5CDFA 2O8BB 2WMNB 4B6FA 3VAAA 1G8GA 1DAKA 4Q4JA 3UK6A 1E9SA 1M2OB 521PA 4B3DA 1R5OA 3BK7A 3UMFA 3E1SA 4Q00A 5B30A 3LA6A 4M4SA 1U9IC 1W5SA 4BPBA 5J4YA 1FTNA 3OIYA 4P33A 1P2SA 3T5GA 1HY3A 1TPZA 5DYIA 4BASA 1NNEA 1XBTA 4M1KA 3T1OA 3AEZA 1Q1QA 2QEQA 1JNYA 1SXJE 4TN1A 3TUZC 1HQCA 2ZI4A 4ESHA 1G8YA 1UJ2A 2FH5B 3EZ2A 2ZE6A 4YMUA 1II8B 1PLLA 4V02A 2ZRCA 3L0PA 1XPOA 1COWA 2ZJBA 3N2IA 3SDZA 2W6JD 1BIFA 1SXJB 1IN6A 3H86A 3U7FB 2HEIA 1OXXK 5FUYA 1CJMA 1XF9A 3FKQA 3VKHA 1T0JB 4OKSA 2CL0X 4HEJA 3SHFA 1H65A 1TU3A 3VR5A 3WNCA 4BFUA 4TTRA 4UNRA 2UVQA 1E2MA 2OXRA 4HUTA 1DS6A 1E9CA 4FINA 3KX2A 3U4QB 1UF9A 2GCNA 3OE7A 2V54A 1YR8A 1NIPA 5EQTA 3RHFA 4Q4AB 4BGDA 2D7CA 2FJUA 3MJRA 2QPTA 2ZRDA 5EP4A 4AC9A 2HT6A 1YZKA 1VYVA 2GZHA 2A2ZA 1E3MA 2G0TA 1AM4D 1XPRA 1LFDB 2ZYVX 3MUFA 3H84A 4IVRA 5FUWA 5C4MA 3R9IA 5KDOA 3TW4A 2ZI5A 4I4LA 4N3NA 4D82A 5D3QA 4PANA 3VHLB 3PVSA 3ZS8A 3R7WB 1GOTA 1MRNA 1ZAKA 4EPWA 4OQNA 3GLIA 1ONBA 1HYQA 1CJUC 3Q5DA 2FFBA 4W7SA 1E94E 2D4HA 4G5OA 3NH9A 1DARA 1AGRA 2EFDB 1EX6A 2J1LA 2ZS8A 2MMGA 5JECA 4ZDWA 3R8CA 2CLSA 1NBMA 2NTYC 1WF3A 3CIOA 2GZDA 3HJNA 5HCIA 1WCV1 2O8EB 4Q4HA 3PUYA 4ACBA 4XWAA 1NN1A 1Z6XA 3IHWA 4ZCIA 1OFTA 2EWWA 4EQ6B 3QG5A 4YMTA 4Q7MB 1I2DA 3A36A 4B3BA 3W5IA 3GJ6A 2NOAA 1CJTC 4NYIR 3K9NA 5FL3A 4IOLA 3BFXA 1KSGA 3TLXA 5FOTA 2A5DA 3A1SA 1JJ7A 2J41A 3HYRA 4QC2A 3SFZA 3I61A 3U5ZB 2R2AA 1MABB 3U3JA 4WA7A 1OB5A 4PAMA 2I3BA 2GESA 5KU1A 3AVVA 2CHQA 3P20A 4QBGB 1XZPA 3WHKA 3OIVA 2ODWA 1T3LA 4W5HA 1DPFA 2GJSA 4BRWA 4X8HA 1ZM3A 4MQBA 1U0LA 3O8BA 1G20E 3RSLA 2LWIA 1Z6YA 1EK0A 3MFYA 3PUVA 4JLBA 1N25A 4CGZA 2A5GA 3K0AB 2NO1A 1HTWA 4UXHA 4QGGA 4B44A 3T12A 4W9MC 4B73A 4JT2A 1P4SA 2ODBA 3AVOA 4BECA 4IEIA 3WMGA 1NN0A 1G1MA 4UNPA 4M1MA 2GKSA 2HF8A 3MWJA 4RD1A 4BFYA 4YDHB 4P32A 4DXAA 4XWKA 2GF9A 1DOAA 5BQ5A 5KSZA 3HDTA 1UM8A 2O8FB 2O8DB 1XWIA 3CRVA 2QUZA 4TMVA 5J47A 3I62A 3PJRA 2ZAOA 3EXAA 4D26A 2QBYA 1SHKA 1ZMXA 2QGNA 2YNMA 3LLUA 2F1RA 4OI1A 1JAIA 1FQJA 2AFIE 1KSHA 3T35A 2C9CA 1GM5A 2B21A 3WP1B 4EAQA 5KSYA 4NCKA 4XD7A 1N3BA 3GFTA 3QKSA 4HATA 4G1UC 4A4DA 2VQSA 4LHWA 3S1AA 3AGPA 3W34A 1I4DD 2WJHA 1OFHA 1GUAA 1FUUA 2Z4SA 1HQYE 3BH7A 4I99A 4OQLA 2JJ1A 4E09A 1SVKA 1Q1EA 4IJMA 4XSGA 1TUIA 4LC1A 3B13B 2G9NA 1S96A 1U81A 2RGXA 4DVGA 1H8HA 5EE9A 4PSAA 5DN6A 4Z1MA 3UWKA 3KTAA 4DSNA 1EFHA 1KJYA 4TTPA 5L3QA 3K0CC 1Q57A 2ZITA 3QPUA 1N0WA 3TE6A 5F3WB 2OXCA 1XJCA 4JBYA 4HDOB 4U5XA 3Q3JB 1S0UA 2OBMA 3PEVA 4MRRA 3DKPA 1FW6A 2OE2A 2IXGA 5F9HA 1XTQA 1G6HA 2C8VA 3NG1A 5TARA 2J87A 3OESA 5EP3A 1I4TD 1L7VC 4OYHA 2F3TA 1LB1B 4ZO4A 3DEFA 4H9GA 1G18A 4Q19A 2NPFA 3UMSA 4S2EA 3GCGA 1JALA 2NO7A 3OEHD 4WOPA 3VX3A 4GZLA 4R71A 2PLFA 2VIIA 2W6IA 2OEPA 3IQXA 3KKQA 3Q5EA 4HB4A 1AZTA 4TMTA 2OM2A 4I81A 1IOZA 1G3UA 4A8JB 5LB4A 3A1VA 4GMXA 5AR1A 2IWHA 2ZUCA 1OT3A 2ZPTX 5AJXA 2D7DA 4MRVA 4FMDB 3UMRA 2JAQA 4KVAA 1U9IA 2GNOA 1Q22A 5JI2E 1W2GA 4FMDF 3ZIAA 3W3AA 3T1TA 3GLGE 3C4JA 3BH6A 2QQEA 3PUZA 1DAEA 1VYUA 4GI7A 4LJYA 1SHZA 2DWOA 3EG5A 4NE2A 3WBKA 2WOOA 3EC1A 5EUMA 3X1ZA 5JWOA 4LX0A 3WXMA 4D80A 5E95A 2ZJ2A 5BYJA 3KQHA 3GPLA 1AQYA 1X86B 4DT1A 2AD1A 5DE3A 2VO1A 3GLGB 4PQRA 2XZPA 5FR2A 2PEYA 4ZPXA 1KI2A 3I1FA 1RZ3A 4HAZA 3FHCB 1XXHE 5IK2A 2YWFA 2IBMA 2W2VA 3T34A 1EGAA 5KOYA 1W36D 2RKOA 3LX5A 3DZ8A 2Q3HA 2A30A 2WVJA 1W48A 2Z5FA 3SJBA 1E1QA 3JVVA 5HE9A 3A8TA 2QQ0A 2WSSD 4Q4LA 3NVAA 3GFPA 3MAAC 1FL9A 1KI4A 2GXUA 4UKDA 3AKYA 3D6TB 1XXHB 621PA 1E2NA 1OH5A 2NG1A 1FNMA 4GRAA 2HDNB 4TZ0A 1LTQA 3TMKA 1KZGB 1T4GA 2C5LA 4AKIA 1HUQA 1N6OA 2RCNA 1U99A 3B6EA 1NL3A 4IW3B 5CJPA 2OESA 2NO9A 1GDDA 1LVGA 1FOEB 4HYYA 2JLWA 1OIXA 2A7QA 2HUPA 3OZXA 1AGPA 1GRNA 2AR7A 3ZGXA 4UNNA 5G53C 3X1XA 3ICEA 4ZDJA 1SVSA 3DOFA 1NRJB 3SJZA 1W44A 2Z43A 3NH6A 4AG6A 1EX7A 2D2EA 4BLSA 1IY1A 2XAUA 4KFUA 1ZBDA 1TX4B 1YVDA 2O0KA 2QP3A 2ZXUA 4F92B 4URVR 3QBVA 2ASEA 1FUKA 4OQXA 4YLGA 5KDLA
chains in the Genus database with same CATH superfamily
5COBA 1RRPA 3M4NA 2E9SA 4G65A 3R5HA 5L7YA 5TVGA 5CXXA 3WYDA 3PF8A 2YN4A 3RASA 2P75A 3OZIA 4JHLA 4CKWB 3CSSA 1PW5A 4JGGA 3ZV6A 1NJSA 2PFKA 3BIFA 4NBNA 4OL0A 4F4FA 4JIMA 2XUGA 2QLTA 2FSVA 3VGPA 4JT4A 2CV1A 1Q84A 1SA0A 1XDDA 1RIIA 3Q10A 4M8SA 5CFNA 3ZTWA 2OCBA 5KNBH 4OHFA 3DD5A 2NZXA 4IDGA 4W5WA 3UT6A 1A1VA 5ED0A 1EHCA 4IXWA 4AJ4A 4I8DA 1PTJA 2J33A 3EUFA 2A86A 2AQHA 3QVMA 4M0DA 3X2EA 4A15A 3PHHA 4U8GA 1JXQA 3JX9A 1K86A 4QICA 3EIQA 3MWEB 4KX5A 4OK3A 1FNNA 2BF7A 2BFFA 2NSLA 3IMEA 3FMFA 1XVIA 2IDZA 3IGFA 13PKA 4FGKA 2HR1A 4KIUA 4V3CA 1MQAA 1ZITA 1GT6A 2GM9A 1I2MA 1Y4AE 1MW9X 2FWJA 2N3ZA 4A82A 5AKKA 3VA7A 1XO1A 2F3QA 4I4TA 4QQKA 2IVZA 4LV5B 2IOQA 3WLIA 5D8DA 5HS6A 4DUGD 1PJBA 1AQ6A 3EXG1 3DFZA 2JFUA 3AM3A 1OSNA 1ZONA 2MDTA 1SKMA 3ESZA 2FX3A 2YJZA 3E0XA 2PV7A 4CHTA 1NAIA 1OILA 4FE7A 1CEEA 1KI9A 1GY8A 2GAFA 2QZJA 3EVNA 4DC1A 1OXTA 1ACMA 4Q05A 4MEBA 5LYJB 2XGSA 3EPLA 3OUUA 1MC1A 1ZKDA 4S24A 1F7UA 1KYVA 2Q6OA 3KR1A 4U39A 1LPPA 1I51A 3MQ2A 3VPGA 1A5BB 3V3TA 1IVNA 5G0WA 5KHLB 2YHIA 4G86A 2C82A 3IDQA 1XLTA 3AX6A 3L02A 1PJQA 3DMNA 1WOMA 2HK8A 3LSYA 5ES4B 3H2KA 2XUAA 2VK4A 3F98A 4GU5A 4NZYA 5IYZF 2FG7C 3T3MB 1LSJA 2O2XA 2O8VA 3R3WA 3T9BA 3WFJA 2CNWD 2LKCA 4D4KA 3GP3A 1V7QA 2IW1A 3P19A 1XMQB 3ML1A 3F46A 1FDVA 1O54A 3CPHA 1L4KA 2CVZA 3G2OA 3PICA 4RD4A 3RARA 3WX0A 2AS0A 4KPUB 2O5RA 3GVPA 1DO2A 1ZHFA 1EGQA 4HUQA 3FETA 4RA9A 1GEEA 1T1GA 1SUEA 5L4SA 2AKEA 4QQ8A 1SXJC 3VTAA 2WTBA 1XCLA 2I6SA 1VJCA 1A8HA 3IV7A 2QV7A 4FDVA 4E5VA 5BV1A 1NONA 3IL2A 1UJ6A 2EFHB 2NIPA 3OUZA 2C00A 2FVYA 1ZN9A 1HTBA 2ETXA 1QRTA 2JHAA 3QU5A 4PXSA 2VZEA 4RWZA 2F3PA 2GPTA 5EZ5A 4X94A 2EJUA 2PMCA 1BX3A 1RRVA 4ZQBA 1YWGO 2VP9A 4P3NA 4KWTA 1RMYA 3BA6A 3M9WA 1MV8A 1GLNA 3T5CA 4ITUA 4RS4A 2F1HA 5DI3B 3T9AA 4MYSA 2CXRA 1W0KD 1FLAA 1JFLA 2H06A 3U4GA 1SKYB 4RY8A 3EOAI 4ALIA 1ZZGA 3DLIA 2HWYA 2A0UA 3FJ1A 2XA2A 2YV3A 2R87A 4J49A 4XVRA 3TNDA 4KJZA 2V8BA 4QTUB 4R5HA 3O6VA 3R9KA 3NWOA 1QS0B 4MAFA 1CJKC 5JPIA 3WIOA 2E48A 4Z7QB 3EZGA 2AEEA 3ZOKA 1NM5C 1U9JA 2H3EA 4RS3A 3G7UA 4URXR 5JNUA 1CUSA 2FY8A 2VNHA 3LFUA 1WZUA 2UZAA 3LC0A 4MVJE 4NP6A 3KXLA 3HJCA 3GDHA 3JQRA 1KDPA 4QUIA 4DIFA 3HCFA 1EDEA 2VHXA 2P6PA 1EWKA 3C16C 3W6NA 2HJ9A 5A7HA 2IP2A 4HR7A 4OATA 3WGZA 2WAAA 3AIIA 3PIRA 2NV2B 5EMHA 4EA7A 1QH9A 3ZTTA 4R83A 5BN3A 3DAFA 2Q1UA 4OQ4A 2FW9A 2C9DA 2OAEA 1XRRA 2DKOA 3PU6A 721PA 3RU3A 1HSZA 2GBGA 3MWDB 3DQPA 2GCOA 4R1LA 3UXMA 1H2ZA 1WEKA 1U7DA 2WDPA 3HVUA 5BN5A 3IYLW 4RCZA 2AG5A 4AAYA 2B2NA 2OCKA 2NGRA 4PHGA 2QD3A 3AR9A 1YCGA 4HJXA 1L4EA 4WDRA 2IYZA 2JFVA 3U7QA 2EGHA 2YYZA 3IQGX 4IDDA 2H92A 3PIDA 5BURA 1QVAA 1UPTA 3PQEA 1AQNA 3COVA 4Y7DA 4N76A 1DRUA 3WKCA 5EJ5A 4D8TA 1PHPA 1MPTA 3ASZA 1TQ2A 4B45A 4DS3A 5JO9A 4ZFNA 2GDJA 1QIMA 1OKKA 1QO0D 5B6JA 3AETA 4AKTA 3OTIA 1A2KC 3D64A 3V4PB 2V6IA 1TRHA 3LZDA 2VL7A 4AZSA 1PT7A 5HGXA 1XTJA 1QPGA 3LV8A 4F04A 2C5GA 2DE0X 3CUUA 5LXTA 3LG2A 1ZXXA 3B20A 3T7AA 4ZN6A 1P72A 2XVXA 4RQTA 5H80A 1K8YB 3DF9A 1X42A 3FMOB 2B3DA 4EX6A 3IP6A 4Y67A 4M0UA 1GG5A 3EIEA 3PEUA 1JIJA 3AWDA 5FL7A 4BU0A 1I5RA 1OAOA 2NSJA 3TKAA 2ZUUA 3I9FA 4HDMA 3RGGA 2W11A 1ZMBA 3B6JA 3DOCA 5CT6A 1HRKA 2I7VA 4MYTA 2JLSA 3ENNA 3G0OA 5KNDA 5L6LB 3L5KA 1TUBA 4GI3A 2W37A 3J7AC 4HEA1 1YIDA 2DR3A 3T06B 4D4IA 3SFTA 5K3BA 3HL0A 3N5KA 2I1QA 1BXGB 3J81A 4DMLA 4CKEA 2C1ZA 1AGXA 4DR1B 1J07A 1EFVB 2FX2A 5HWSA 2B2XA 4EFLA 2O8CB 1W93A 1J8YF 1GPKA 4RJKA 2XB4A 1P7VA 1DDOA 1U4OA 3GJ5A 4B47A 2Y1CA 2PGIA 2ZAMA 1QP7A 3LA8A 4GVXA 2FZ4A 4P5EA 2W2KA 3PEWA 1B6SA 1NVGA 4OI4A 3F6YA 3JQCA 3MWFA 1X7ZA 2Q07A 3D7MA 3O7MA 4UW9A 5FPPA 9LDTA 1ODKA 1QTIA 1H2FA 3ZVRA 2C9OA 1OH6A 1DBVO 2C8JA 4D6YA 5IJ9A 1CS0A 3LPDA 4YCJA 5JNRA 2GF2A 3AEKA 2F1KA 3NBQA 1CWUA 1OZFA 3CR7A 4WLNA 1LLFA 4AUKA 4TQUS 4MXDA 1NI4A 1NF8A 5FUQA 5FWXA 2BKLA 4CRWB 1IEVA 2QROA 4JB3A 4KQ9A 2H6EA 2JZOA 3PYMA 2WILA 4CEJA 3M6LA 5ENZA 4XDGA 3A9SA 4ZYYA 1QAOA 2I3ZA 2WFZA 1GZ4A 4QRHA 3TNFA 221PA 3UB3A 3DHNA 3P9CA 3GH3A 2NTVA 1FRFS 1YVEI 4ANFA 1KGSA 4G07A 4JBWA 1W4AA 5CXSA 4MUBA 1E99A 1NV8A 2FMKA 4QHTA 4DYDA 5LZ9A 1TF2A 3H8SA 3BOSA 1ZEJA 1NSTA 4I55B 4DA0A 3UGKA 1VIDA 4DM4A 1J70A 1Y8AA 3HMQA 1PR0A 2TYSB 2FPPB 1QJ4A 1RHUA 2YMMA 4DCSA 2HOQA 2YYSA 2PUDA 2FDRA 4KI0A 2BRUC 2F3SA 4PSCA 1D6SA 2GVZC 5B3AA 4N5MA 3L4EA 4WEOA 1L8OA 1NSFA 1PJ8A 3TIVA 4AROA 5JRJA 3IV9A 5K6RA 2CNBA 4Q02A 3PNPA 2AWNA 3EIOA 4R8KA 1DRVA 3PUJA 1J7JA 1TTHA 4BE9A 3QEBZ 5FOXA 1C8VB 5EI5A 5A4IS 2ZCVA 3D6FA 4IRXA 4OHUA 3UB2A 3RFTA 4WH0A 4ZDIA 4O4HA 4CMEA 3RIYA 2FN9A 3HR4A 5L6MB 3KSRA 1P6UA 4XQ0A 5DNDA 2JHPA 2VJCA 2AT1A 3PV0A 3B1FA 2KPOA 1R8SA 3HXMA 2WKWA 3L6OO 4NCAA 3PZRA 1NVWQ 3EOBI 3QE0A 4K6MA 4X44A 1W1UA 2M2IA 5ALIA 3U7EB 1DQYA 2Z8ZA 4G41A 1S2GA 4ZVNA 1U8CB 1JR3A 1SQ0A 3RVSA 1DEKA 1KR5A 1QGOA 1HEUA 2C54A 4S1VA 1TYBE 4PNHA 2RHJA 3ZQJA 1TW2A 3FPJA 5H68A 1ZVQA 4DCMA 3IMFA 1ESEA 2ACVA 4G23A 5HJ2A 3MTAA 1OFVA 1KHHA 1T4BA 5HEKA 1U1FA 1JKXA 1JLRA 1PGPA 2C20A 3PP8A 1YRQA 4R41A 3REFA 4E5SA 1GPH1 5A4JA 2WD8A 2AF4C 1A5AB 5GJCA 3UHAA 5C9ZA 1ZL0A 2W22A 3H2IA 5I3CA 1EGHA 4PRLA 1DE0A 4BFWA 4ZJYA 3GOHA 4MLZA 4E5YA 2XMSA 1EH5A 4QTZA 1IG3A 4L85A 4ZOBA 2H54A 2F43B 4C08A 5HG0A 3QVOA 5JE8A 3P2MA 3I30X 3ZCXA 4MPDA 1KYXA 3LL7A 3OZWA 1FDTA 2AOXA 2AI3A 3OZTA 4MUIA 1LJUA 3RTDA 4BXOA 2VJNA 4LZNA 4CQMD 3WVNA 3DP9A 2YIDA 5H83A 1WSBA 2QDKA 1WW2A 5LJIA 1Y7TA 1SGWA 2A9JA 3GP8A 1Z0IA 1RHKA 1RWOA 2B7CA 4RESA 3UJAA 4ZGWA 5I8PA 3M34A 2QMYA 4AJOA 3L82B 3V2IA 3AOEA 1GUZA 5IULC 1EP1B 2IS4A 1BOOA 2X0IA 4K2AA 2NXWA 3AJRA 3E9CA 5D1NA 4ZU1X 2HWWA 3SGLA 4X85A 3HRIA 4O4LA 1ATIA 4PQEA 1JDJA 2HCTA 5CDFE 2DETA 1Y5MA 2JI7A 3RI3A 3HA2A 1Z6QA 1U9YA 3L7LA 2PGLA 2P6MA 2G5CA 3HY4A 4YONB 3OCWA 3MMPA 2CLMB 3OICA 4ZAXA 5JJ5A 4IUBS 1B0PA 4NCJA 3WRXA 1S2LA 4UBMA 3UK0A 1O57A 2PO5A 3G8YA 1A71A 2NU7B 3CH5A 2AG8A 1H85A 4PAWA 4QGFA 4GYWA 4BV3A 3ROKA 1J06A 1EWQA 2ZBDA 4HKTA 4OQYA 1H2AS 3OUTA 3ESAA 1JJBA 2A78A 1NDUA 3RE1A 1OYWA 2KYRA 4LHVA 3C5CA 1DFIA 1K2VN 2FEXA 3AONB 3L1KA 4IKPA 3W0LB 2ZB4A 1ZD5A 2Q6KA 4FK8A 5CB6A 4M7RA 2I3DA 2OG1A 1C81A 2LZ0A 3AFIA 3BWXA 3BM5A 1I33A 4WASA 1GGFA 1EPUA 2IV2X 1OYOA 2H57A 4J07A 1OTHA 1NP3A 1BOFA 3I1YA 8ABPA 5KIAA 2CHVA 5BVGA 1IEQA 2IQIA 3RVPA 5DCYA 5F76A 4GRDA 2VPYA 1ZC3A 3L6UA 5KOJA 3K5PA 5KTPA 3AJEA 2X1VA 1GYPA 4WVLA 1U8XX 3FYUB 3FZYA 2HXSA 4UEKA 1NXXA 5DSTA 2XX3A 4BNFA 3I2GA 5E4YA 5JMOA 3FWKA 3ELUA 1JU3A 3KJZA 5CM8B 5EHQA 1W76A 2H1IA 3QKWA 3Q2KA 4E5MA 3ANMA 3V42A 1H0KA 2GXQA 2P91A 4WLOA 5HKLA 5K0JA 3PUKA 5EEGA 5BSMA 1X38A 2GN2A 3DL4A 2I2WA 1SVMA 3HM2A 5CLQA 4YPFA 4IX9A 3FKSA 4LPKA 4AN1A 2ZWOA 2YXBA 2QTHA 1NU8A 4CMBA 2HD4A 2IEBA 1MT3A 1MVLA 1XZIA 2OBYA 3BQMB 4Q3LA 4C2BA 4B3IA 1CSEE 4D4GA 4E4YA 3LQKA 4Z99A 2CVFA 2DUJA 3TQQA 1JI3A 2YCBA 2QTGA 5BPFA 1OF1A 1D2MA 4DLAA 1VG9B 2G9UA 4M21A 3RJ9A 2WJIA 3LT0A 1KOGA 1E5QA 2CYAA 1JEQA 2DQZA 1XCBA 5JTTA 3TEFA 1QIJA 2IU0A 3S27A 4DRZA 4FHCA 4BKUA 2QX7A 2Y76A 3TTUA 5BW4A 3AVQA 3V7NA 1ISSA 2H4XA 1KYIA 1CZRA 2Z0MA 3AY7A 4LBWA 4DANA 4IQFA 4MQLA 1T6YA 3B2NA 2EKDA 1Q1BA 1I9GA 4YJDA 1ICIA 3FX2A 4AICA 4H18A 2QL5A 4KYTA 4GZ3A 3RSOA 5JYCA 3JQEA 1IAQA 3DV2A 3PDWA 4HRAA 4F38A 4DV1B 2WJYA 3PUIA 2IU6A 3FTQA 5C53B 3UWSA 2P90A 3CN9A 1Q77A 3PUWA 3ZE7A 1UKVY 4CWAA 3F8WA 2ZYUX 2V7XA 2VFAA 2WMDA 3AVPA 3T5AA 1IY2A 3GPDG 4RHFA 1MTZA 1EAYA 4WNAB 3OEED 4N40A 1P4HA 2JL1A 4HDNB 4MHTA 5JY1A 1XYVA 3VOTA 4BOYA 3D3QA 1N5RA 1L7BA 4AX8A 4O2AF 3GNLA 4FKBA 4MQ4A 3DLHA 3GDWA 2REQA 1GU7A 1YNOA 4PHHA 3IIIA 3ACDA 3I8SA 3PITA 4ZYZA 4II3A 3R0QA 4TVKA 4TRRA 3W04A 2AXNA 4FC7A 1G59A 1NLZA 1Y6RA 2R3SA 1Z28A 4UAVA 2QMUA 4KWHA 2EAUA 4ZAZA 3P9KA 3TWOA 1WZNA 4C7KA 4DCGA 4DMRA 5DJ5A 3WL5A 3Q0EA 1B3BA 2ZJOA 3ZK8A 3LBHA 4DILA 5AVOA 2P1DA 5LP6B 3KQUA 4X6YA 4EABA 1Z3CA 2HTFA 2MSNA 3O9ZA 3BKXA 4LRXA 4XOUA 3TQHA 3UFXA 2IH5A 2H00A 1GIAA 1V1MA 3MTQA 3O26A 4PX9A 1ADGA 4YT4A 3E3AA 4ENUA 1PAUA 4BFSA 3VSCA 1DGQA 3UWMA 1MOQA 1OLOA 1GPYA 1YZFA 3AV0B 3EIHA 1HG1A 1UPBA 3PTZA 5IAKA 5IC5A 2NUAB 3W8RA 2ZI6A 3R77A 1YK0A 1LI5A 3G13A 4IIEA 4QOSA 3HDHA 3BICA 4KVZA 1SQFA 3FIJA 4G36A 3Q3EA 4U2KA 4WXHA 4AS1A 2XRMA 3IVCA 4HN2A 5D01A 1W30A 4YDSA 3RVBA 3V4FA 3VYRB 3DMTC 1C8BA 1DC3A 3DR5A 4A2WA 2ZSIA 3D6VA 2FEMA 2ZREA 4LOKA 4PIVA 3WLOA 3OI7A 2XEXA 3A6HA 3KYDA 4GVPA 1B8OA 4DQLA 3QPAA 1IUNA 3KQQA 3QWAA 5LDDC 5JHHB 4H08A 3I1JA 1O9GA 4MQMA 2X6TA 4UJ5A 2PGAA 2X76A 4LV6A 4AF8A 4FEGA 4XLLA 3GB9A 3PQ6A 4IIYA 4BBAA 3BHMA 2R6GA 2QTAA 16PKA 1SHUX 1A72A 2NUPA 1XEWX 1J7KA 4GE3A 2FE1A 3LK6A 2QRVB 2G8LA 1ZGZA 1E1CA 1W85B 4XH9B 3J80A 3RS0A 1JG6A 3ICCA 4NV0A 4WFQA 1QQ5A 1DAPA 4BBZA 1UR5A 1NGSA 1XP8A 1I2AA 2Q3BA 3TL2A 3AUFA 3E9YA 4L4SA 2HSGA 1SBHA 4NCNA 2AN5A 3HFSA 2QRHA 1I3NA 3JCZA 3NYIA 3R5TA 3TO5A 4YRNA 1D6NA 1TMKA 1ZJZA 4L8FA 3GFVA 2SICE 2N75A 1REQB 4Q47A 4RADA 3B5JA 4E46A 3DLPX 3SQOA 3AR4A 3ZZ1A 3R7FA 1NWCA 4A0FA 2MJLA 1ZW1A 2PVSA 3HA3A 3V9PA 3RVMA 1AQIA 4YP7A 5DHPA 3TGLA 2PEZA 2CSXA 1N2CA 2C5AA 2IGBA 2YJGA 4D0RA 1HOXA 1R9NA 3EVZA 3ZHBA 2CB0A 1AQUA 4RLFA 1YC2A 2EF1A 2WM8A 3OF3A 4GGOA 3LVFO 1ZC4A 1L7RA 1ZIPA 2VA8A 3KTAB 3ENZA 4AJLA 5C7OO 4DEYA 3RRNA 3NCHA 4XOIA 5DW3A 1AURA 2X15A 3DPUA 1LDGA 3NIGB 1H0SA 4L50A 5CYPA 1M2EA 3E15A 1ZA2A 4BAZA 5HHTA 1FFDA 4LTDA 3V8EA 4D5GA 5G1PA 1JW9B 1MR3F 1HL3A 3QVVA 2EIXA 3DZCA 5EHIA 1P3DA 1UIRA 2NM0A 2QTNA 4OQMA 1CR4A 2VF7A 3LT4A 1C1HA 2NO6A 3B70A 1DAMA 3E9EA 5CJJA 2HA4A 1G64A 1M1NB 4CCAA 4HN9A 4EUEA 3TVDA 1ZR2A 1MZVA 1IBKB 1ULUA 4L2IB 4AQ7A 1FFXB 2EG9A 2JFBA 3D2BA 1AHNA 4M89A 1XTKA 4GPZA 2JFYA 4GWLA 1A27A 3R7NA 4DLLA 5HSGA 5JC1A 4UBLA 3FOWA 3WYFA 3HL4A 5FIUA 1TM2A 5C31A 5KYGA 1Z6AA 2HIGA 2DWCA 3BG5A 3GPBA 3DZDA 4XVQA 1FZTA 2F1OA 2NUTA 4OYRA 1M6VB 5TNXA 2RC5A 3ZD9A 421PA 3KQSA 1AIPA 2ZE8A 1FBTA 2GJAA 1UXGA 2IYLD 1MOZA 1PYGA 3WGJA 3EPJA 4W9RA 3BCUA 3D3WB 4EFNA 3GWGA 1BZYA 2VNIA 5REQA 2ZJAA 4MWSA 1QRDA 5A6SB 4NI5A 4TLMB 5ISMA 2Z6VA 2UYGA 1J99A 1M1YA 2ZE5A 2F17A 1RJDA 3EARA 2UUCB 1XELA 2G28A 1ZH4A 3E4DA 2ONCA 4B3MB 1E0SA 1R5BA 3FI0A 3RYFB 4LZZA 1KPIA 2GILA 3IVMA 2FXVA 4UQPA 1O97C 1VB5A 2WMOB 4S1NA 2WE8A 1SBTA 3QFHA 1POWA 3ZHRA 4Z9XA 2JLAA 4HVTA 3P52A 4QKQA 4ZKDA 1IUKA 3HYTA 2CCJA 3IXMA 3HR8A 1G2IA 3NWPA 2I2CA 3PK0A 4QL3A 5FXMA 1CV2A 2GEFA 4I5FA 5JASA 1ABBA 1EMDA 4CXMA 4OKNA 1NULA 3BXFA 1TDJA 3LXRA 2WW8A 3SQNA 3O4IA 3E58A 3BPSA 4MWEA 4U2CA 3C97A 3L5OA 3C6YA 5C0OE 4C1NA 4L8YA 5KVCA 4XWTA 4P54A 2Y0PA 1W88A 3ONFA 3W4KA 3WYNA 5NLLA 4D3SA 3ANTA 2B36A 3O8QB 2JA1A 1H5UA 3GFGA 5C46F 5I9BA 1B74A 1U3GA 4WBNB 3QV2A 1J0AA 1Q95A 1USUA 2NU9A 1WEHA 3DCYA 4AP6A 2X0KA 3L8DA 3TOZA 5GGYA 2HK9A 4FFBA 5SYAA 1XAGA 4B33A 3LCJA 3RFCA 3FOCA 3HU2A 3SEZA 1TM7E 2HUNA 4UVIA 3CZ4A 3SVZA 5IM4F 3B9QA 3DO5A 5I4IA 4DCPA 3ND5A 1NMYA 1UH5A 3VPXA 2J48A 2WQ6A 4CNBA 1L4YA 1UC5B 5K8UA 3BF8A 4KXYA 2FTKE 4QG7A 3OPYA 4PBTA 4YAEA 1N9ZA 1U7TA 2QB5A 2QF7A 3ETHA 2OFXA 3LM8A 1MNQA 4W99A 1LSSA 3EGWA 4DCCA 3S2UA 3KCNA 3FOZA 1E32A 1JTEA 1XMXA 4QUBA 1IHXA 4WGFA 4TMXA 2IE8A 1XNJA 5I51A 1ZY2A 3I01A 4G2TA 4LOIA 2CHEA 2CYBA 3OO1A 1WLYA 4NKRA 4YMVA 1OB2A 5AVSA 2QQ5A 2D2VA 3MJSA 1N75A 4DBZA 4DMGA 1OTXA 1KS2A 3VBEA 1G8JA 4YP5A 1SA0B 1FLVA 4OQPA 2QYHA 1ZD1A 4EMUA 3HB9A 3L0IB 4L5YA 1KAEA 3IIEA 3HO6A 4LVNA 3EZYA 4XI9A 1GXSA 2FF7A 4FHDA 4JOSA 1VYTA 3V1UA 4DMFA 1QZXA 1Z8DA 3MTIA 3QGMA 4KQEA 5PNTA 5IN4A 3TG2A 4KZPA 1LZKA 2BFFB 3QEJA 1DO8A 2ZBGA 3FPHA 2G88A 3ZZMA 1P1RA 4DXHA 3OF2A 1VJ5A 4YACA 4W4TA 4AFNA 2XXAA 4N3GA 4LEIA 4GWGA 2HRCA 2VBFA 3A1NA 3T3GA 3U0BA 4B43A 1OFGA 4YR9A 2R8RA 1Y98A 2VLBA 2DHRA 2VJKA 4I4TB 5AT1A 3ZCVA 1A9XB 4LYYA 4YMHA 4J0JA 1ZGGA 5TV2A 2QVZX 4DHWA 2GKGA 1Z37A 2HA2A 3UUFA 1KEZA 1LGYA 5BWBA 4TRNA 1E9RA 4G63A 2COEA 4RPGA 4X95A 1SKYE 3TLBA 4R0NA 1EA7A 2XDYA 3QA3E 4DE5A 3F71A 3HV2A 2PMDA 4HMPA 4IJQA 3IQEA 2M98A 2QM8A 4LJAA 1Y1SA 4JV5B 2I4NA 1R3DA 3L7BA 1C29B 2PX0A 3MRVA 2EYQA 3ODGA 4ZT7A 1E1RD 3PFWO 4JB0A 4P5PA 1M7BA 2FWAA 4YWHA 3WJ7A 1NW7A 2YHIB 4RDHA 1L4NA 5EWMA 3GDFA 1CVLA 4UREA 1CNMA 2AQIA 2P4SA 3OPNA 1WMAA 2FWIA 3O93A 4XGIA 2C7PA 3GLFE 1ZVMA 2AH5A 2UXBB 4HS4A 3L49A 4LHZA 5IJWA 2H59A 2J09A 3SKVA 1F5NA 1TMGE 1ZNYA 3PGVA 4TTVA 1PLJA 3OPYI 3V1YA 2I6GA 3BIJA 3KAQA 1XJ5A 5AK6A 3V8VA 3WB1A 5J4KA 4M0CA 2FF5A 4JI1B 4RA9B 4HUQB 4YXWD 1F6BA 1HNXB 2XH8A 1RYMA 3TZ6A 3IAM6 3LDFA 5JVDA 1JPVA 1X8JA 2Q8NA 1QAMA 1G2OA 2AYXA 3GCDA 4LYJA 1W29A 4JR0A 1ZVVA 3GRFA 1NVXQ 4R1MA 4AK9A 4QOEA 3KHTA 1M7GA 2CL5A 1L0BA 1WCIA 4OYYA 4N01A 4DR3B 1TD1A 4W5JA 4DUGA 2WZDA 4XB1A 4C20A 5B57C 4MI9A 5B64A 4ZOLA 1KVQA 3TLGA 4AP9A 2DQYA 3FCEA 4WPGA 3S8MA 4UTVA 2WIGA 5FEMA 1RI2A 3T9DA 1SC4A 5HIMA 4QFDA 2DBRA 3BE6A 4P4LA 1IXSB 4YQFA 5JDIC 1PJ4A 3T6KA 3VU8A 2VP5A 2O1EA 1IFXA 2JFGA 4PC7A 4A8PA 1KYTA 4L9WA 3KK0A 1K6MA 1ONOA 5DLYA 1PFVA 2AK3A 4MPRA 3AKZA 3M6FA 2W4IA 4L0MA 4NG5A 4BQSA 3OQ6A 1D04A 2PXXA 4JDPA 1XEXA 4HWOA 5I5EA 4BX2A 5AFSA 3PT9A 5EP2A 1O3YA 1MEJA 4I3FA 2QVGA 3BWVA 5HTKA 4EFMA 5K3EA 4DDVA 2HGSA 2KLBA 3H65A 4OJQA 3CF4G 1RKVA 3A0RB 3I6MA 4PZYA 5MHTA 1KZ7B 3KOXA 4KR7A 2CNWA 3P32A 1PFUA 1YL5A 2ZE7A 3A6LA 4MIOA 2OXEA 2P3OA 5FBKA 4TWBA 4XCXA 4YRIA 3L0OA 5CX1B 3WHIA 3R6LA 2YHSA 2WKSA 3RFUA 3DUWA 4D0SA 1KGDA 5BN4A 3H5TA 2CXPA 4IXMA 1N4DA 5FBRB 5AKJA 5LZ7A 1P7CA 3WA6A 3GFOA 3NQ41 2QDXA 1DV2A 3W5DA 2G82A 3QE2A 4GQIA 2QRKA 3O4HA 1KE2A 2W5UA 4ALMA 2ZTUA 1G60A 1VXOA 4P4GA 4IZHA 2FKNA 1T1IA 2GCOB 1FP7A 4HXYA 4J4HA 5L7TA 5LA6F 1YD7A 3WK4A 1YSCA 1LNQA 5BN5B 2EERA 3LOPA 4D56A 1GG9A 5ALYA 3BSSA 4UUOA 1PWHA 2QHXA 2O1XA 3U7QB 3UWDA 2WHQA 4JN6B 1Z73A 5B4TA 5DWDA 3A4MA 1DZ3A 1W0KA 4BYMA 4AKGA 3PDHA 5JQGF 1ZK0A 4YUXA 5JSQA 3K9HA 1C9DB 2WTXA 3A1TA 2W2QA 2W2OA 1LK5A 3JSXA 4WERA 3V1NA 5CDGA 4IHQA 3AETB 3B36A 3C1AA 4OK6A 2FSHA 5FOUA 5K3OA 3NMUF 2WJAA 1RHMA 3N59A 4LX8A 4G8BA 5C3MA 2M6KA 3CLRD 4B2PA 1Q91A 2WZCA 3HJRA 3SLRA 2GCEA 1Z5ZA 2QPOA 3GBPA 3U3ZA 5LXTB 2CWWA 1SELA 2GVDC 2QZ9A 2BKEA 3E4CA 4MP6A 1GQYA 2GGSA 4DCUA 1DKUA 1XVLA 3TCNA 5CVTA 1I5EA 4YCLA 3MPOA 1IHYA 2ZATA 4RMJA 3ELBA 1WSWA 4J9VA 2IYQA 4NV3A 4IZIA 4WD3A 1H1LB 4HDMB 1B23P 2GM5A 3JPWA 1M6EX 2OKCA 5IDQA 2EJTA 1J2TA 4RM3A 4MKHA 1Y1TA 3W9YA 5J4HA 1TT5A 5A3QA 1TUBB 3ZH2A 3RRXA 1JXOA 3HB0A 2VYCA 3GUZA 4CKEB 4KLZA 4KBYA 1KA9H 1WPXA 3DEYX 3SLGA 4B7AA 1GO2A 1HTTA 4GLFA 4R3NA 5L3RA 3FTPA 2NZJA 4GPAA 3VXKA 4DGQA 2CNDA 2H1FA 3BJIC 1DFGA 1Z7YA 1T5HX 2H0AA 3O4FA 3OZAA 3R3YA 4FIZA 3IR7A 3QUSA 2CC2A 3S8EA 4DR4B 5A9SA 3RBVA 3NBYC 2PRSA 3BCSA 3I12A 1PI3A 3S0JA 1BGVA 1P6XA 1X7ZB 3A06A 1NZJA 1TO6A 1A69A 2R9VA 2YC2C 1P2DA 4H1TA 1J8VA 1G63A 1KFBB 5AVUA 1FZQA 1QO0A 2VDRB 3A1WA 3QEOA 4EI7A 4TMWA 1R10A 5IJ9B 1CS0B 1NJ2A 5BMOA 4R2HA 4TS3A 1Z3IX 3AEKB 1AUOA 4QGAA 4M46A 1RPNA 4MYUA 5CDYA 4ZI7A 1N6KA 1VDMA 1NI4B 5D3ZA 4LJ7A 1M2OA 1HEYA 2F67A 4FI3F 5FWXB 1XT6A 5JYDA 2FHSA 1GG2A 1UDAA 4TYPA 3GNTA 4WXYB 1RPZA 4CEJB 1VG0B 5KYVA 3ZQKA 1EXNA 2IL1A 5B3LA 1JR6A 3AT1A 1YL7A 1T3SA 3VTFA 2IZOA 3OCUA 3NUGA 3CX4A 3HDQA 4LZPA 1PZHA 4GZ5A 4MDYA 1OR8A 1PFGA 1WLSA 3ROTA 1EJ2A 1Q1NA 1YA8A 1DXHA 3NDPA 1EQAA 3U44B 2Z1NA 4EUSA 1RRGA 1RYBA 2HLPA 3RSGA 4FU0A 4JP1A 1ZNQO 1IM2A 3L6CA 3LWNA 4D5EA 3ADKA 3I01M 5DBIA 4H1HA 4QNMA 4D99A 5IT0A 2BGWA 4DC9A 5CG1A 2JIQA 4YRDA 1D7AA 4GBMA 3R5KA 2V3WA 2WYVA 4NK4A 3OVMA 4Q9LA 3ZQUA 4KIGA 1MB9A 1V5FA 1ITZA 1ZN7A 1P5ZB 1LKZA 4W7HA 4XUDA 4OK5A 1ZD8A 2I4OA 4B0PA 1QQAA 4O4HB 3U4QA 2IEAA 5K09A 3VDNB 3CY6A 3KPUA 4XLTA 2J3QA 3V4RA 3VR6A 5K0CA 1W46A 1XE3A 2QQGA 4Q4AA 1GQOA 5E2BA 4Y1FA 3FMGA 5G1OA 3S2YA 2LBPA 3W3ZB 3F1KA 3EWIA 4NE9A 4RABA 2R7KA 3OY2A 5ULLA 1IYZA 1VA4A 4YDQA 4NZMA 2NU8A 3TSCA 1PK7A 1W5FA 3A6GA 3OP4A 3IQIX 1DXQA 3CZPA 1IONA 2W00A 3NAQA 5HRUA 2OTCA 1XMIA 5JLAA 1U2ZA 2WWRA 4EZIA 2HNBA 4JP3A 2R65A 1GA4A 1QHGA 3CXUA 1KF0A 4P35A 5CPBA 5KC9A 1K4YA 4BATA 1ECPA 1C30B 3WA7A 2HU7A 3OCVA 2QUBA 4OJMX 3VUEA 5L45A 2O3TA 2GAIA 1GVHA 4RVFA 4JFRA 4DTIA 1RPJA 1NFQA 1A7JA 1PVDA 3U3RA 5A5DA 5KZMB 3V1MA 5TPWA 1ID1A 3C3AA 4QVIA 2JHFA 5ILOA 3AY3A 5K4HA 4KQIA 3HZOA 4L95C 4UCWA 2P2ZA 3HA7A 1G5PA 1ULHA 3PUHA 4QWMA 1U8UA 2BZGA 4AY3A 4Z6KA 1GQSA 4CT5A 1AVTA 3C7TA 2VP0A 1XB2A 1XZGA 3TSZA 2FMTA 2E3JA 4O4LB 2FOLA 1F48A 4W8GA 2ERCA 3SBEA 1AQLA 2RI1A 1NZDA 3C7KA 1AKYA 1P5JA 1SVUA 2WU0A 3FUVA 4TMKA 2EQAA 1B6RA 5JNWA 3CE9A 2O19A 3TE7A 4K28A 3PHLA 4C4AA 4DIDA 4F2WA 2B4KA 4PLZA 2VYND 4WFIA 4WRRA 5LMNB 5A02A 2RHCA 2IEGA 2ORED 2WKPA 4EP1A 2JJ1D 4MOWA 5FPSA 2OP0A 3NVKI 1NX9A 3BMCA 3I34X 1NQ5A 4PRKA 3JSAA 5EE1A 1A8IA 3BFPA 4KGVA 2IOFA 2W6QA 4II7A 4BNGA 4IOJA 5M5BA 1VE9A 4J1SA 3TKYA 4WZBA 1RHQA 4Z86A 3KIPA 3COJA 3SS9X 4CF7A 3UCEA 4G25A 1GARA 1JU4A 1GNLA 4CT4B 4RC9A 3MOIA 3U31A 4RMHA 4Z1MD 3ZU2A 2ZI3A 5BVGB 3B6MA 4GXTA 2E87A 2PXAA 5KNDH 5KOJB 4CQMA 5JSUA 1NC1A 4JOBA 1J9GA 1O6GA 1KIMA 5DMXA 4CPDA 3ILXA 3BQ9A 2FSVC 1ZCJA 4B6PA 2H4HA 3E2MA 1MC8A 5IVDA 3JQAD 5HF8A 1UDBA 1TI7A 1UEXC 2ZRKA 2O8FA 1P73A 4FP9A 4MW6A 5FBWB 3PD7A 3K73O 4XX0A 2J9YB 2EKQA 4C6TA 1SXGA 2LKDA 2O2IA 2VKQA 3GUCA 4GOKA 2G9QA 1ORRA 3LYUA 3PPIA 5ALFA 4EHJA 1VPEA 1D1TA 4EI8A 1EFDN 2FRXA 4FJ2A 2EV9A 1QYCA 4BKPA 4ZRDA 1R0YA 1JQAA 1SVLA 2YZ7A 2C2HA 2YJ5A 4M7PA 1J8QA 1VSBA 2UVPA 1SOWA 3KWFA 1PNOA 4BEBA 2FR8A 4Z4CA 5KREA 1S89A 1W5EA 3IBGA 3GD7A 2Q2QA 1BAPA 1K4KA 2VXOA 5ANRB 3V1LA 4DL9A 3K70B 2ZSEA 4C2TA 4ITRC 3FUXA 3IERA 4KEAA 2OP1A 1R4MA 3D7LA 1JEQB 4FQ5A 1R0CA 4QOFA 4HDAA 4GH5A 1U3DA 5CVJA 3U5TA 3VJKA 3W3AD 3UUWA 5HTOA 4C88A 4N9WA 3KQVA 3OC0A 3QLUC 2Q7OE 4Q3BA 5EXPA 1T8UA 5EINA 1E59A 3HSSA 1DAIA 4C3OB 1PKXA 2D5LA 3AQIA 3N2GA 4MVJP 2BKAA 3E70C 1E0JA 3B51X 1TD9A 4N41A 2W98A 3OQJA 5HX7A 1ZI9A 5B36A 3IDZA 2Q29A 3F2VA 2H9YA 3PPVA 4DR2B 1DTSA 4YUYA 4KXWA 3W8DA 1HYBA 1RMTA 4Q9DA 1NQWA 2PUJA 1J20A 1YS1X 3N74A 1NRXA 1P1JA 1W4CA 2JLUA 3F7TA 3KXKA 1R3UA 2GO1A 4L8VA 2DPYA 4MV5A 1W87A 5HGJA 1XYYA 3EXHA 1G8PA 1L7AA 5B2EA 4BWGA 4EBFA 5B2FA 1ETUA 2GAJA 4N8SA 3VHQA 5IK2D 1DAHA 2I6UA 2C4WA 3N6XA 3SBXA 1YZTA 2X8WA 5AW2A 4JI2B 3UNXA 3L05A 5LD2C 3W2EA 1CRWG 1WUIS 4JAVC 2ADFA 3BMNA 1S2DA 3L8YA 2AMYA 3LPMA 4FYJA 4M49A 1NOIA 1HYGA