4TTQA

Crystal structure of legionella pneumophila dephospho-coa kinase in complex with atp
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
201
structure length
201
Chain Sequence
MVYSVGLTGNIASGKSTVAEFFSELGINVIYADKIAKELTSKNTPCYQDIISHFGSSVVLNNGELDRKRIRDIIFSNSNERLWLESLLHPVIRKKIEEQLIVCTSPYCLIEIPLLFNKHHYPYLQKVLLVIAPLESQLDRIVKRDHCTKKQALAILATQPNLEQRLEAADDVLINESGLSELKAKVNKLHQKYLREAKIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dephospho-CoA kinase
publication title Crystal structure of Legionella pneumophila dephospho-CoA kinase reveals a non-canonical conformation of P-loop.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 74
structure length 201
sequence length 201
ec nomenclature ec 2.7.1.24: Dephospho-CoA kinase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01121 CoaE Dephospho-CoA kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ttqA00
1GSIA 3AVUA 3ZDQA 4BE7B 5FUYA 2ZRBA 3C7KA 4PAOA 1P2UA 2BCJQ 2WWFA 4ZCIA 1CU1A 3DOEA 1E2QA 5KDLA 2OCPA 4A8JC 1UKZA 5FH9A 1G41A 2Z0MA 5HE9A 1KSGA 1WXQA 3I8XA 1P2VA 3PEYA 2CNWA 4HAYA 3IIJA 4EPRA 4V03A 4JYCA 3DKVA 1VIYA 4G1UC 2G0TA 4PSVA 3X1WA 1Z2CA 2XNDA 1DPFA 1Z28A 4RVCA 1ZW6A 4LYHA 5C46F 4MKIA 4WXRA 4V02A 2ZRIA 1X86B 5BN5A 5KPDA 3I61A 3R8FA 4C7OB 3IO3A 2C98A 4QGAA 2WSSD 2REOA 3QXSA 1F2UA 3K8YA 1VCOA 3SJBA 5TMPA 3KQNA 1NN1A 2WKRA 4EKDA 2W58A 4ZDKA 3NEYA 421PA 5LPNA 1C4OA 2OAP1 3A36A 5F3WB 2IEYA 1CIPA 2IYQA 4MYCA 1ANKA 5KU1A 4DXAA 2ZJ5A 2ECKA 3UKDA 1E9DA 1Z0JA 3FYHA 2RB4A 2CJWB 5TY0A 3D8BA 1CR1A 2EFDB 4FCVA 4L8GA 4DDWA 3WP0A 2VP4A 5BN3A 1S4QA 3EIEA 4LJAA 4JL6A 1NG9A 1F60A 1KYIA 4OQXA 4PC7A 2YC4C 2CLSA 4TMVA 3RRNA 4QKQA 5KSYA 1HURA 4XOIA 3A1VA 3MFYA 5HR5A 4AKEA 4IKEA 5IT5A 1AN0A 2CL6X 4DCSA 1OFTA 1XEWX 3A1UA 1FP7A 3FDIA 4XWAA 4Z8YA 3W3ZB 1W0JD 5JCZA 2XGJA 2Q21A 821PA 3Q5DA 1AIPA 4CDGA 3T5GA 3BS4A 1U0LA 2JLSA 2ZJAA 2OFXA 1XTQA 1XMVA 1R8SA 5FOTA 2K5UA 3W8NA 4N3NA 2DWQA 4B73A 1XEXA 8OHMA 5JBQA 2CL7X 4TMXA 4X8MA 3UK6A 1IN6A 1DARA 4ASUD 2ZXUA 3MMPA 5GJCA 4QXAA 2WSSA 1N25A 4PTLA 2IF2A 4NYIQ 4BRWA 4PC1A 2FF7A 3T12A 2LKCA 4HEJA 3LD9A 1G4AE 1Z6TA 4O25A 2JAQA 1GFIA 1XD9A 4CT5A 4MGKR 3Q3JB 1RIFA 4M1YA 2C2HA 2NOAA 1OLOA 2VLIA 2CE7A 1W48A 2QP9X 2V8OA 2VF7A 2CMKA 1R4AA 4O2LA 3B60A 4A6PA 4Q1FA 3NWJA 4YDSA 2OLKA 5B58C 4Q4JB 1E9SA 2Z4SA 1NSTA 1W0JA 2IX3A 2N42A 4B76A 4A92A 3ZVMA 1YRBA 3B1WA 1ZM7A 4B3CA 1YJ5A 2FFQA 3NHAA 1T8TA 2PJZA 3WY9A 2XB2A 4RFSB 1G21E 1HQYE 4AG5A 1E96A 2F9LA 3RS3A 4I81A 1OB5A 2H1LA 2C78A 2OM2A 3VR1A 1JR3E 1IN4A 1X6VA 1XP8A 1JEDA 1XMJA 2A30A 2BM0A 1QVAA 5HPYB 4A0GA 4TLDA 1NNEA 4HAZA 4LI0A 4BLRA 4ASUA 1GG2A 3OIWA 4QOSA 4BWYA 3PQCA 5UKDA 5GADl 3FHCB 1CJKC 3BORA 4W5WA 1OKKD 5TXGA 2BBWA 4LHYA 2ZJBA 4Q1EA 4TQUS 1R10A 4LSGA 2KBFA 4IOLA 2CEAA 4TYPA 4DCVA 3A1TA 1XMSA 2ZR9A 4D81A 1K8RA 4BZXA 2EU8A 1YZLA 1VPLA 3CRW1 1G8HA 3EIQA 3FOZA 1HA3A 2WSMA 4NYMR 1BS1A 4MRNA 4TYQA 3W5JA 3ASYA 1AJEA 2ZU0C 1GL9B 2H16A 3CWQA 1SVLA 5CLLA 2WMNB 2AN9A 4HLDA 4HZUA 2D7DA 3K53A 4O2RA 4B75A 3FMFA 2VP9A 4OI4A 1XPRA 1FTNA 3CPEA 3SHWA 3L82B 1XCGB 2ZAOA 3PUYA 4RD2A 4NYJR 5F2EA 4PPQA 5FI0B 2P6RA 2FA9A 1LF5A 4HATA 4BECA 5FBVB 2ZIAA 2VH5R 3ZD7A 2QQEA 1TQ4A 5HZHA 2OCYC 1OYYA 4MDFA 1R5OA 1K5GA 2W6ID 1W36B 3FHTA 2ZR0A 5DI3B 5KNDA 1NKTA 4MITA 1ZMXA 2O8EA 3SNHA 3K0CA 3QF4B 3QPVA 1E2GA 3GLFA 1PVOA 3IHWA 2O0JA 1KKMA 3CR7A 4JT2A 1WA5A 5A4JA 2XTNA 1D5CA 1P2SA 521PA 3N2EA 4QGFA 1D8TA 4JJKA 1NVXQ 1SVSA 1E2EA 1AZSC 1OKKA 2R6DA 1XXHB 3NXSA 2ZRGA 4HAXA 2BKEA 1G19A 4GSYA 2ZRCA 4PHHA 3RS4A 2QPOA 3RDPA 1Z0DA 1PJRA 1FMLA 1PUIA 3G82C 3H1TA 3H4MA 1IHUA 3LLMA 4M9XA 4FI3C 2DHRA 1CF4A 3QENA 5JRJA 4WZAE 2VHQA 5CITA 3OZXA 1A2BA 1XWIA 3ZJYA 3IEVA 3AH8A 4PO8A 3AP3A 5AJYA 4OJQA 3WBKA 4JLVA 1GITA 4HUQA 5B57C 1VDZA 2RGBA 2A5DA 3W3AA 4KVGA 3THXB 2QMHA 5J4LA 1GRRA 3EG5A 4D0LB 1S1MA 4DT1A 1TAGA 2P67A 2Z43A 1DG3A 2BEKA 3THYB 1Z2AA 2YWFA 3X1ZA 1OXTA 2H5EA 3KL4A 1X8LA 1EWRA 1UF9A 2IYRA 4I1SA 4Q9JA 1TU4A 4EIWA 3C15C 1DG1G 4F93B 3RS0A 3BJIC 4US0R 4HZIA 2W6IA 1XDBA 1FNMA 4GZMA 3C5CA 1W2GA 1Z8FA 2DPXA 1JB1A 4PHTA 5IF9A 4TTQA 2WKQA 4B43A 1YR8A 5JRZA 2V1XA 2QMEA 3HU3A 4JBXA 4V0OA 1QHSA 1VG9B 2BV3A 2W00A 3FMOB 2QPAA 3AVWA 3KKQA 2G9NA 3JVUA 1JI0A 2ODNA 3GMTA 1WCV1 4LJYA 1E1RD 2GXAA 1S2MA 1R8QA 4HAVA 4IDNA 2XSZD 2EYUA 2FJUA 5H70A 5L3SA 1RRPA 2OLJA 4D0GA 1JPNA 1PLKA 3JZAA 4BEJA 4CRWB 1TNDA 3MCAA 2ZTSA 5DYGA 4LPKA 2F1IA 4RSGA 4DDVA 4R9UC 4IDQA 1GNRA 4PX9A 5BYJA 3R9XA 2NTYC 3ZVRA 2AKYA 1A5TA 4E03A 5AWFC 5FOXA 3WNBA 4TYNA 1BYIA 2XXAB 5FUVA 3SFVA 1WBDA 4W5HA 2RH5A 3NTUA 2V1UA 3CH4B 1G17A 4LJ9A 3T1QA 4O0MA 1G3RA 3SYKA 1EK0A 3MGCA 4NCJA 4B35A 1DBSA 5EE9A 2QN6A 2JLWA 3KTAA 4TTPA 1XPUA 1Q1EA 2QUZA 4TZ6A 2GA8A 4OK6A 2FV8A 3LRPA 5FTLA 4IVRA 2KI5A 4A9AA 4B3FX 5EE1A 1NY6A 4A4DA 4YDHB 1XTIA 4BEBA 3GQBA 1E2MA 2A78A 2ZS9A 5C18A 3SQWA 2ZYUX 1XTJA 2NG1A 5L8VA 4TQ9A 4A82A 3O8CA 1UFQA 3CM0A 3QUSA 1G4UR 2QP3A 2ZI9A 4LV5B 3CB4A 4C0LA 1YHNA 5L3VA 3SJCA 1COWD 1RKBA 2HJGA 2QE7A 2F43A 2J1LA 1NP6A 1KK3A 2OZEA 2R9VA 3A4MA 2WWGA 3PCRB 1U2RA 4A2WA 2JJ2D 4DSOA 2Q3HA 3LXXA 4TLAA 1E1RA 2IWRA 2QP4A 4G3XA 2GXQA 4DRZA 1DAGA 2XSZA 1IOZA 3H2YA 3L8ZA 3CW2A 2WM9B 3GJ0A 1VYTA 1Q1ZA 2FZLA 3TAUA 3D6TB 1QZXA 2QORA 1KMQA 1Z6YA 1G3UA 1IONA 4DWJA 1N0UA 1ZNYA 3EXAA 4HLQB 1RRFA 2QM7A 2XJ4A 3EA0A 3FKSD 3WYGA 4DIEA 1F5NA 3BFKA 2IYWA 4PZYA 4ESHA 3CWZA 2VHCA 3D3QA 1N0WA 3EWSA 4AI6A 2ZITA 1SVIA 5EE0A 3C14C 4Q1AA 1TQ2A 3A4LA 3OAAD 1JALA 3DL0A 1AGPA 4F4CA 1FUKA 1OXXK 2KJQA 1Z83A 1ZM2A 2GCOA 2OHFA 3G5UA 5CB6A 3GLIE 1EXMA 2PEYA 1MRNA 5DISB 1RFLA 2F7SA 4LPSA 4CT4B 3HPRA 2CHVA 1T8UA 4I1OA 1DO0A 3G0HA 4US2R 4LYFA 4LX0A 1IQPA 3TVTA 2XZLA 4I1UA 3TR5A 3O8DA 3U5ZB 3T61A 4NKRA 4KI0A 5GVRA 3TR0A 3K0FB 1KKLA 1LFDB 2B21A 2JJ2A 3AKDA 4B74A 1GL6A 3QY0A 3SR0A 3Q85A 2X2EA 1ZP6A 2DY1A 2QBYB 4EQ6B 2RHDA 1CBUA 1UM8A 2IS2A 3QIAA 3OEED 4HB0A 1Z08A 2IUSA 2ZRFA 2DFKB 3NC0C 3CO5A 5KSZA 1P7CA 4PANA 2BJWA 5LD2C 1KI3A 5DLQC 1E32A 4A2PA 4PXAA 2PLFA 3LX8A 5KOYA 3FKSA 3QKSA 4MKHA 4CF7A 1BYUA 1NL3A 2YJTD 3EARA 5EXPA 1GUAA 3U4QA 4CVNA 4WZ6A 1DVRA 1UDXA 1E2HA 2WV9A 3OAAA 3ZS9A 4OK5A 3KJEA 5G53C 2AWOA 3SOPA 1UBFA 2ZEJA 4IXNA 4JMPA 1SXJC 1JR6A 2ZM5A 3B5JA 3B8HA 3DM9B 3BGWA 1JBKA 2NPIA 1OXUA 2IYSA 3BD9A 1XX6A 3EIHA 1NBME 2AD5A 3KDSE 4Q4AB 3SDZA 2ORWA 4Q01A 1Z0AA 1H8HD 4HB2A 1UADA 4PHGA 1KO8A 2DR3A 1II8A 4OQMA 2DFTA 3P4XA 3QJYA 3TNFA 4ERNA 3BWDD 3MD0A 3BERA 2JASA 3BBPA 1ZJ6A 3RNLA 3BH6A 2GJ9A 4KLNA 1XMIA 3PITA 4TLCA 1OB2A 3X1DA 4EPYA 5BQ5A 2GDJA 5AUPB 3BK7A 4DSTA 3CX8A 1GILA 2YWHA 3CX7A 4OBEA 2FNAA 2QTVB 3BB1A 3OEEA 4Q4LA 3VR2A 4JL5A 4JT4A 1HY3A 4A0HA 5FL3A 3LLUA 2WBLC 2Z83A 2O8BA 1Y3AA 1US8A 4OJKA 1I2DA 5K8TA 1AK2A 3Q9LA 4KCGA 4LYAA 4F92B 2OESA 3QKRB 2ZSEA 2C9YA 3HYTA 2KWIA 5EP1A 3UPUA 4HSEA 4TQAA 4DBLC 3X1YA 4LJ5A 4QBFA 1Z06A 4B32A 4BGDA 3W8RA 4QFMA 2IXEA 1ZCBA 1XF9A 3U44A 4BPBA 1FP6A 1H65A 1OSNA 4MYHA 4UJ5A 4GFDA 2WVJA 4KU4A 1XJQA 2JLRA 3EPJA 3QXXA 3Q8XB 2MSEB 5J4VA 1H8HA 4LJ8A 4IXMA 1U0JA 1E2NA 1T5LA 1ZYUA 1JJ7A 2ZVQX 3LQRA 4E07A 2BJVA 5EUQB 3SI7A 3ZIAA 2OCBA 1ZC4A 3OF5A 1H8ED 2PLRA 2P5TB 3FE2A 4LBYA 4LY6A 1VKJA 5G41A 1A1VA 1VCMA 4KJZA 3AGQA 1SXJE 4KFTA 4BFYA 4EDHA 4D80A 3F0TA 1QF9A 4LBWA 4QGGA 1ZNWA 4QJ4A 4GOJA 3AVYA 4B33A 3NBXX 4QM6A 2H8KA 5JCPA 3GCGA 1QHHB 4X8LA 1KZ7B 4D4MA 2IS6A 2Y8EA 3DKPA 4OHYA 3AGPA 1Y63A 4A15A 2P5SA 1ZNXA 5E3HA 5KO2A 2WIBA 2V3CC 1E0KA 1U8ZA 4K46A 4U00A 1OFUX 2PZEA 1TF2A 3RC8A 4JLPA 3A4NA 4RD0A 3K0AB 4IHQA 3CF2A 1D6JA 4RZ2A 4BLQA 4PZZA 2Q3MA 4RFVA 4Q4HA 2ZSBA 3QOFA 1EX7A 3T5DA 2V6IA 1X8KA 3IBYA 2W83A 1E9AA 4IW3B 4WXPA 1M74A 1II9A 4HLCA 1N6PA 2C9CA 2CCGA 1FOEB 1NJGA 2XNDD 4HB3A 4MH0R 3RANA 3UMFA 3SN6A 1L4YA 2GJAA 2R6GA 1GIAA 1BKDR 3SJZA 2PJRA 2DWOA 4MGYR 4LHZA 5B2ZA 5TDHA 4EPTA 3L8YA 2HUPA 3CNLA 1MO5A 3ZH9B 4HI0E 1MOZA 2IF0A 2ZVPX 3K70D 4YMTA 2FN4A 2OXRA 1KGDA 1H8EA 4PC6A 1G291 4JLAA 4KO8A 4OI0A 1B23P 3I92A 2C04A 1G7CA 4M8NE 1W49A 3PEVA 4Q7MB 2XITA 1XCMA 5CJPA 1W44A 2W0MA 4XIGS 1ETUA 1YR7A 2X2FA 2HT1A 2BVNA 4DDTA 4NYIR 4EFMA 3LV8A 3AVXA 4FW9A 1G1MA 3CNNA 1VG1A 4FD2A 1ZM4A 1Z0KA 4TSFD 3FWYA 5HCIA 1F2UB 4URYR 3MLEA 3A37A 1C9KA 1HEIA 2DYKA 4M1KA 2XZOA 4HLUC 1OH6A 3OIVA 1SGWA 2YZ2A 5KSOA 4FWIB 1AGRA 3SFZA 4M1MA 4PAMA 2QSZA 1OH8A 3OESA 1AM4D 1OIWA 3BB3A 3LX5A 2JLUA 1G5RA 2VSFA 2FWRA 4WA7A 2XX3A 3T35A 3DZDA 3L43A 1KO4A 1ZVQA 2WWHA 1TPZA 4GPTA 3RRYA 4W9MC 4LZZA 5JMTA 4PPNA 1E2PA 3BIFA 5G3ZA 3C4JA 4PSAA 1CS4C 2GNOA 4JL8A 1OT3A 2ZI7A 4V0ME 4JLMA 4LDJA 1W4RA 3HYRA 5FPTA 1GRNA 2WICA 1KZGB 3TE6A 3ND9A 4TZ0A 1KI1A 4BZPA 3JVVA 4D82A 5CJ2A 1OXSC 3HP1A 2PZGA 3K1JA 1S9DA 3MSXA 3KUDA 3IKJA 5C1BA 1ZD9A 4OHVA 2FFAA 2JJ8A 3GJXC 4IJMA 5LDDC 3KJIA 1EG7A 2ZS7A 5FBQB 2F3TA 5JJKA 5J5CA 4KYIB 1AS3A 3ADBA 1G20E 1JQJC 1M34E 5F9FA 2DCUA 1E4VA 3KFXA 1WQ1R 4JJZA 1TEXA 4N0DA 4QNMA 4TN1A 4XVUA 4E09A 3QG5A 2IT1A 4G5OA 4TSFA 4XD7D 4HB4A 1BO6A 4URUR 4NMMA 3B1YA 4Q7LA 1XCPA 2FOLA 4R71A 2KBEA 1KJZA 2QSYA 2AXPA 2GWHA 2QEQA 5FUXA 1VYVA 2DBYA 4MKGA 1YZQA 2VP6A 2QI9C 2OCAA 1WRBA 5AJVB 3U2QA 4YQFA 2GEUA 2GETA 1LNZA 1P72A 2C03A 3HJNA 5CDFE 3TUJC 5TB5A 3CUEF 2VHUA 1ESMA 2D4HA 5JWHA 5DNYB 1DE0A 2OO7A 2W2TA 4YLGA 1SXJD 5EJEA 1ONBA 4V0LA 1D2MA 3AEZA 3EZ2A 1P4SA 5JECA 3GJ4A 1E2LA 2QY9A 2LCFA 2XB4A 3ZZ0A 4H1UA 1FTSA 4C4PA 2BIFA 3GEEA 2CHQA 5LD2B 2ZETA 1FX0B 5JLJA 1IXSB 1T91A 3RSLA 2ZE8A 1RVDA 3PR1A 3Q5EA 4US1R 3U6KA 2J7PD 1WB9A 1TL7C 3V00A 4C9BA 2OE2A 3AVVA 2Q6TA 5KNCA 1IY0A 3L2OB 1E9BA 2V54A 2ZSAA 3EW9A 1XEFA 3IIKA 1QBKC 3OEHD 2I3BA 2FMXA 3OIUA 3ND8A 4MUAA 2QA5A 4PPGA 1P9RA 5TVKA 4Q00A 4ACBA 1XBTA 1G8YA 4XD7A 4LWZA 3KFVA 4AWXA 1LS1A 3LA6A 2ODWA 3M1IA 4ZV4A 5J4HA 2VQSA 2XNSA 1BIFA 4EJSA 5K8UA 1NMYA 3KQHA 2EFGA 3K9NA 1GKUB 1I4TD 1KK1A 4DB2A 3PJRA 4BASA 4JLJA 1KO1A 4NCNA 1UBGA 5B64A 1UKYA 4QGHA 4PC2A 3VR3A 4RZ3A 5AUOB 4URWR 4CW7A 3W5IA 4M4SA 5JWRA 2OBNA 2CL0X 2KE5A 3B9QA 4C2UA 1W0KD 4IOJA 1CP2A 3KXLA 4OQFA 5GVSA 4HZUB 4OHXA 5AR1A 3BC1A 3R7WA 2CLDX 1SXJA 3OE7A 3VAAA 4KHZA 2E87A 2PT5A 4A1FA 4DSNA 4DUGD 5L3RA 3PIRA 4P4SA 2BBTA 1KAGA 4X8HA 2F3RA 3LW8A 4QL3A 2R6FA 4EPXA 3KQUA 2GK6A 3AF2A 4Q1BA 2BMFA 5CK4A 3W6PA 1VCIA 2ERYA 3FGNA 3QBTA 1NI3A 1J70A 3VU9A 1KNXA 1L4UA 4PQFA 4AK9A 3CRMA 3LBNA 5KSPA 1P61B 1M8PA 1NMZA 4NTZA 5LB2A 1U0HC 1PZNA 4WW0A 3LFUA 1DO2A 3GLFB 1S0UA 2J7PA 2FPLA 3ICEA 2GILA 1Q21A 1KDOA 1Z0IA 1GKYA 3N2IA 3R9IA 2BHRA 1X1SA 1J90A 5FFMA 1QHXA 1XFAA 3S1AB 4IVQA 3U6BA 3OEHA 4PQRA 1W4AA 5FTJA 1MRSA 1NLZA 1OW3B 1N2CE 2W2XA 2DWPA 3HPQA 3VTKA 4JKIA 2YV5A 3LW7A 2V7QD 1GM5A 4JLDA 2ZJ2A 4GI7A 5EQTA 2ZANA 5BYKA 1SKQA 3SYNA 1BH2A 1KI6A 3REGA 4EAQA 1Q44A 2WTUA 4D4JA 3AUXA 1LVGA 2LWIA 2NO0A 5E4FA 2VYFA 3CR8A 5HE8A 1DS6A 5EP4A 3GFOA 1W0KA 2R8RA 3ASZA 1JAIA 1KJWA 2NO9A 2BOVA 2ZE6A 1E0AA 2H92A 5TARA 2EVWX 3K9LA 4DT1B 2HV8A 2PX3A 4JBWA 2VA8A 4NDZA 1CKEA 4P31A 5FPHA 4MYUA 4DUGA 1RYFA 4ITRC 4BFZA 1ZD1A 3X1XA 4W7SA 1FMJA 1W47A 3SBDA 3VNVA 2ATXA 2FG5A 2VIIA 2W6JD 3VHXA 1RE0A 1VMAA 1P6XA 3U7HB 2AD1A 4S2EA 2Q9BA 2D62A 3AKEA 3FKQA 1XZQA 3QVUA 4C0JA 5FTKA 5EZ6B 1SVWA 4RZUA 1E2DA 4X8OA 2JATA 3U3KA 4B2IA 4TWZA 1XZPA 1Z63A 4GMXA 4CIDA 4JLBA 2B7BA 4HDCA 2RMKA 3AVOA 3LVQE 3ZD6A 1WDTA 4GOXA 2ODBA 3PV0A 4M9QA 4E22A 3U7FB 2WMOB 2XTZA 2P65A 2B8TA 1OIXA 4BFTA 1KTVA 3E1SA 2V4ZA 5D3MA 2A5FA 2P3SA 2ZRNA 5L3SB 2HT6A 2V7QA 4DVGA 1WP9A 3QNUA 1YR9A 4AD8A 1ZM3A 1KHTA 1G18A 2AFIE 4L4UA 1FQKA 2QENA 4JVSB 4L15A 4RKFA 3TJZA 1R6BX 2WAXA 4F7WA 3BFVA 4V0MA 4HYYA 3WP1B 3LNCA 3B82A 2MMGA 1MV5A 2ZPTX 4LJ6A 4Q48A 5EXXA 4KFRA 3RHFA 1ZBDA 1EX6A 4P4UA 1W7AA 3THWA 1G9XA 4D6PA 3EX7C 2RHMA 5KNBA 1OFHA 1Q12A 2QE7D 1MT0A 1S3SA 4CZ2A 4WIAA 5C4MA 4BQSA 1KMHA 4OQLA 1R0XA 2QAGA 1JEEA 2RKOA 4QJ3A 1E69A 6Q21A 2I1QA 2ZYTX 1Z6GA 2JJ1D 4LK2A 5FBWB 3KXKA 4Z8XA 1AS2A 2PZFA 4NU0A 2WJYA 4JBYA 4A8JB 4A0RA 2W6JA 4CGZA 1Q1BA 1TADA 3CZPA 1IJFA 1G16A 3IO5A 2OILA 3WYFA 4TL6A 2J9RA 1E9EA 1P9WA 4AKGA 1HUQA 5GJBA 3M0EA 5DHFA 2XAUA 2UKDA 5L3QA 4PC3A 2GJ8A 2F43B 2O0HA 4UNSA 1G3IA 1NVWQ 3B1VA 2F55A 5FOSA 4HDOB 4Y0VA 1KY3A 3HDTA 1Z0FA 1N0VC 1EFUA 2PL3A 4R2IA 5CDFA 3UMRA 1IN5A 1E1QD 2Z4RA 2ZJYA 4V0KA 1HYQA 1JR3D 4B2LA 3DZ8A 4RCYA 1AZTA 1YZUA 3GLHB 4HLUA 4RJLA 1N5LA 2ZE5A 1F2TA 5KYKA 4XWKA 5CM8B 4KXFB 1E9RA 4MQBA 3K70C 4UQOA 4LHWA 4C0BA 1N5JA 1FZQA 2X19A 4DHEA 4JLOA 3LXRA 4CEHA 2FFHA 1KI7A 3KKPA 4L9WA 2EQBA 4PHFA 4OYHA 2XOKD 3V4FA 3WNCA 1E0SA 3GFTA 4WOPA 3R8CA 5ANRB 3IDQA 5KDDA 2VP2A 1DAFA 2J3EA 5EE3A 4ESVA 5IK2D 2CDNA 2JJ1A 1Q0UA 2VHJA 5AUQA 4FMBB 4D0NA 1KAOA 2R62A 1XB2A 2JEOA 1T3SA 2BC9A 1GNPA 4ZO4A 4BZQA 3SC3A 4P3YA 3TRFA 5K8IA 1E9CA 1X1RA 2WHXA 2JDID 4KBFA 2F1JA 3A1WA 4DLVA 2QRZA 3LH5A 4JLKA 1W4CA 2O8DA 1DAMA 1VHLA 3GLGE 2GAOA 2XTMA 2J0SA 2OUKA 1S1CA 1P62B 2KB0A 4B6EA 4IOKA 1IY1A 3TLXA 3U7GA 1D2EA 3VQTA 3FMIA 2UZ3A 4L16A 3TW4A 4R7ZA 2VP5A 1QDEA 1E1QA 5JZVA 4AG6A 4KAXA 1JR3A 3CRQA 2E1RA 3AB3A 1VCNA 4DIDA 3BH7A 4QBIA 3PUVA 1NN3A 4NCIA 3WRYC 3PEUA 3QE0A 2O5VA 4C30A 4NH0A 2CK3D 1HV8A 2V55B 3CRVA 2BMEA 1TQDA 2OBLA 1E4YA 2QQ0A 2VTKA 1CULC 3AKCA 4JVLA 3FFAA 2FGJA 5J4YA 1JNYA 2C8VA 2IWHA 4MUBA 4HAUA 3RSOA 3P26A 4YXWD 2XOKA 4P33A 1YE8A 2H17A 2EFCB 4EPVA 4XSHA 1P3JA 1Z6AA 5JHHB 3W9YA 4FCTA 1QRAA 4Q18A 4KSCA 4LGMA 1VECA 3MJHA 5IK2A 1KY2A 4A6XA 2AFHE 2PCLA 2FFBA 3VKWA 3T06B 3TIFA 1JXOA 5FL7D 1ZNZA 2O8CB 2FGKA 3R20A 2A7QA 4LJ7A 2NQ2C 4IOMA 1VG0B 3K0EA 1J7KA 3T1TA 4EJSC 4LOAA 1HQCA 1KJYA 2JDIA 4Q9IA 5HTKA 4TLEA 3LBIA 3TMKA 1DAIA 1AKYA 2G6BA 4IRUB 4JS0A 1G8PA 1MABA 1KI2A 4B71A 2NO6A 3BAFA 5GJWC 3IBGA 4GP6A 3NH9A 1QHIA 4ACAA 4KLZA 2Q9CA 3VR4A 5LBIA 1FNNA 3RYTC 2L0XA 5H1YA 5JWOA 1EWQA 4R2HA 1VTKA 2BMDA 3EASA 2NMVA 4R98A 2VF8A 721PA 3AF0A 3IQXA 3B13B 3THOA 4LHVA 2BCGY 4IVPA 5F98A 2GXSA 1OHHD 1SQ5A 1U8YA 2HYDA 4Z51A 4NZYA 4YMVA 3TVDA 2ZRAA 3UWOA 2AK2A 4ZDWA 2QTHA 2NIPA 4OQNA 2CK3A 2YVUA 1U81A 3B6EA 2YOFA 2NO1A 3FFBA 3P1JA 4RD6A 3D7MA 3ZIAD 3ZZUA 1GZSA 3H0KA 3ADCA 4QHYA 1RJ9B 1G7SA 1A2KC 4BFVA 1YQTA 4RD3A 2IS1A 4YXWA 4ZDIA 2G3YA 2JGNA 3T1OA 3NH6A 3SU8A 1A82A 3U44B 3AKYA 1OH7A 4DJTA 4C2TA 4EQ6A 1TX4B 2F9MA 3DM5A 2GCPA 1P2TA 5KUTA 2BKUA 3IQWA 2ANBA 2J41A 4ZCLA 5BXQC 5HKKD 2ZRDA 1NIPA 5FL7A 4W5JA 4DLZA 1NLYA 5EXTA 2F1HA 3U3MA 1FW6A 3Q7PA 2WOJA 3JZMA 1DADA 5AJXA 1GP2A 1QG4A 2ZUBA 3MJRA 1CJMA 2KSQA 4IDHA 1XJCA 3M4YA 5JSZA 3AVQA 4LJ4A 4YMUA 1AQUA 4Z1MD 2WZQA 2IHBA 3MWKA 2IXFA 5HZKA 4LBVA 1KOFA 4M1SA 4ZCMA 1AQYA 2JLZA 4IEIA 3WHLA 2EFEB 4G5GA 2NGRA 2YC2C 2J0UA 1B0UA 1I4DD 4FXPA 2WJGA 1W5TA 3RLFA 2WWYA 4Q4AA 1NKSA 4NL4H 3TQFA 1OHHA 3ETLA 4I99A 5FOWA 2EYQA 3VR6A 1ZINA 1HT1E 4TMTA 4CEIA 1RYHA 2O8FB 4QNRA 2J0VA 4DZZA 1KO7A 2ANCA 3TSWA 3SS8A 4TTRA 5KDOA 2X77A 3I32A 2OV2A 3AQ4A 4Q21A 4Q66C 1HTWA 3P20A 4Q4HB 4DDUA 3LBHA 3PVSA 5J47A 1ESNA 1LTQA 1G3MA 2P6UA 1P60A 1XPOA 4KFSA 1O87A 3AUYA 2ZYWX 3TK1A 5EP2A 1HE1C 4LHXA 2DFLA 2CLCX 4H1VA 5DSZA 1NN5A 1DTSA 4ILEA 2ZJOA 5HKKA 1S3GA 1XD2B 2BDTA 3KKOA 1R5NA 3C5HA 1G5PA 4OI1A 1YZTA 4JSYA 1Q1QA 3T15A 4FMCF 3WHKA 2H57A 3QKRA 4TYYA 2QM8A 5JS8A 1DAKA 4QJ5A 1QHYA 3RS5A 3AF1A 4Z1MA 3B1ZA 1JECA 1D2NA 1WMSA 2JA1A 4LV6A 4AY2A 2YNMA 1GOTA 4D2IA 1TMKA 3A6PC 1CXZA 4ABYA 1T6NA 4ZIRB 3L0IB 3P4YA 1E9FA 4N0EA 1W5SA 2JLXA 3KUCA 2VRWA 2W0SA 2IYVA 3MAAC 3KZ1E 4JLNA 2QAGC 3U3JA 3UWKA 5BWMA 4MRPA 5JEEA 4WVFA 5DN6D 4FMCB 3BOSA 3SHFA 4PAQA 3Q7QA 3GFPA 3KXIA 1SULA 4LC0A 4RKEA 4TT3D 1E79D 1EGAA 3TSZA 4NPHA 3CIOA 1Q3HA 5FOUA 3QSYA 4FINA 3KKNA 4I4LA 3NVAA 3EPLA 1GAJA 4ZPXA 3IPYA 1CTQA 2YOHA 1S96A 4AIIA 3UMSA 3LVRE 2HF8A 1QHHA 1N6IA 1DAHA 4CEJA 3DOFA 2GESA 4UXIA 4UNRA 4YMWA 2G88A 2J87A 1G7RA 1SVKA 3TUZC 3TUIC 2WPDD 2OG2A 3CF0A 1KI4A 4ZKEA 3GLGA 1OYWA 4LUCA 1JXMA 2ATVA 2G1JA 2R6AA 3FHOA 4LCBA 4BLOA 3K09A 2R44A 3VX4A 1R0WA 2AL7A 3BXZA 1VHTA 3GLFE 4QBGB 1WF3A 5JFGA 3K70B 1CR4A 2HEIA 3B85A 1KNQA 2GEDA 2GF0A 1NLFA 3ZGXA 3WXMA 5FBRB 3EZFA 3NDPA 1Z3IX 1YRAA 3IHLA 3GLIA 1NBMD 1OE0A 4JSTA 2I4IA 4D4LA 1IN7A 2G0NA 3CONA 1KDPA 1VYUA 2JLVA 4GRAA 4MGIR 1YVDA 4Q02A 5FUWA 1OIVA 621PA 3KJHA 4F91B 1DEKA 2IL1A 2JCSA 4U7DA 3T1VA 4ARZA 3HU1A 1E94E 4KITB 1KSHA 1E2KA 3CNOA 1C1YA 4A0FA 1V5WA 4C0AC 4QBHA 3GPLA 2ZI4A 3MWJA 4D25A 3A58B 2RGAA 5DN6A 3EPHA 2FSIA 5CB8A 2IS4A 1OF1A 2V9PA 2FU5C 4TT3A 1M7HA 3PEWA 1E79A 3A8TA 1NVVQ 1TF5A 1O3YA 4DC9A 3VR5A 1PV4A 1IBRA 2OEPA 4MRRA 3WMFA 3ZQ6A 3CPJB 4TL9A 1ZAKA 2B7CA 3F5FA 2ORVA 3PUWA 1XXHE 2ERXA 2QMOA 4DSUA 2ASEA 2GAAA 2BWJA 2OFOA 1XEXB 4OHZA 2WPDA 1HT2E 3QXHA 3NIBA 3D31A 4UNNA 4I1VA 2CHGA 3AP1A 3EC1A 1YR6A 4Z54A 1N6NA 3B78A 1GTVA 3NBYC 1N6RA 3RWMB 2CXXA 3PENA 5D3QA 2WKPA 2QG6A 4XSGA 1SZPA 2ZI5A 3SJAA 5FPKA 3WMEA 4DEXA 2C5LA 1NBMA 1GL7A 4K8OA 4C0SA 4AKHA 4DKXA 2EFHB 1WE2A 2O0KA 5CYPA 1U98A 2GZDA 4Q1DA 4IEEA 2HLDD 1NJFA 4C7OA 1T4GA 3BE4A 2V6JA 3W6OA 4DLRA 3OE7D 1F3OA 4YMSA 1UDWA 1OFIA 5KHOC 2ZROA 4B3DA 1TQ6A 3WBJA 3ONWA 3T34A 2VBCA 5CYOA 1AKEA 5J40A 2N1BA 4EJSB 4LYJA 5SZJA 2Q0HA 1UJ2A 2AKAB 2HYIC 1MO4A 1R0ZA 1MO3A 4IDOA 3PFIA 4AYTA 4PFSA 2CJWA 2OAQ1 1MO6A 1Z29A 3B9PA 4G5SA 1NN0A 1P9NA 1LV7A 2HCJB 4WZBE 1T0JB 1BMFD 4BLPA 4KYUA 2IW3A 2R65A 1A7JA 3R7WB 4RZXA 2CBZA 1SXJB 4NHOA 1IAQA 1U90A 3OHMA 4M2LA 3VFDA 4URZR 2QGZA 5IRCD 3I1FA 3MWYW 1ZM9A 3IGFA 4P4SB 1TF7A 4B6FA 3W34A 1SKYB 3UANA 5B30A 4M1WA 4OHWA 3FTQA 3HR8A 2HJVA 2FSHA 3U7EB 3C16C 2BM1A 4BFXA 3VU9B 3B7GA 3K9GA 4II7A 3TBKA 3A1SA 3SYLA 4AYXA 2GEVA 1JPJA 5CM9C 5SZKB 3WYAA 1GWNA 1XD8A 2ZRKA 2WAYA 4M22A 1N5KA 2ZSDA 4JIMA 1TUEA 2ZE7A 4JKYA 2MMCA 4GT1A 2B8WA 1U94A 1P73A 3REFA 4EFNA 5K8LA 2J45A 3GLHE 4TLBA 1X8JA 2HLDA 2A5GA 1SHZA 1Z6XA 3UG6A 2IYTA 3V4RA 2FEOA 1ZU4A 1RRGA 2PH1A 1KDTA 1N6KA 2R6CA 2CCKA 1UPTA 2PMDA 3CX6A 4XTCS 2ZRMA 4KV9A 3ZVLA 3NDBB 5E7JA 1F48A 3I8SA 2NO7A 1CRQA 4DLUA 5E7MA 3UIEA 4L5BA 2PBRA 1FX0A 3DO6A 3EC2A 4ZI3A 2F1RA 4NONA 5HCNA 4DCTA 2NPFA 1MR3F 5FR2A 1XTSA 1KI6B 2RCNA 4PO1A 1FUUA 2ZI3A 4FN5A 3SBEA 2QT1A 5FR1A 1CJUC 1IXZA 3DHWC 2O8EB 3IILA 1BMFA 4TYWA 3N70A 1DOAA 1EFRD 1FL9A 1VIAA 3B2EA 3GEIA 3GJ5A 3GD7A 1S9HA 2BBOA 2ODEA 2DB3A 4Y0AA 1FQJA 5DHAA 3KJGA 4JYBA 5JJIA 2PX0A 3QKTA 2JLYA 2XEXA 3IUYA 4Q4JA 3VNUA 1M6NA 5EXSA 1J2JA 2HDNB 5FTMA 3I73A 4BUJA 5JHGB 2A2ZA 1U99A 3OIYA 1W4BA 2BEJA 4DCNA 4UXJA 3EAQA 4PQYA 2ONJA 1EESA 4RFSA 5FBLB 2FEMA 2Q3FA 3GJ6A 2GVDC 4XH9B 1W36D 4M9SA 4TMZA 1N5IA 3ZVNA 1YZKA 2JLQA 3GJ7A 4WAUA 2IEZA 1N6LA 4J0QA 3SEAA 4UJ3A 2G83A 1CEEA 4B2PA 1VG8A 3DPUA 4POAA 1CJVC 3LAWA 3CBQA 2REXB 3LDAA 2GJKA 3NG1A 4HUQB 1IJEA 2D3WA 2HCBA 3CLVA 3GP8A 1J8YF 1N3BA 1JAHA 2Z5FA 4N1AA 2IYUA 3AVPA 3FMPB 4XVQA 4JZKA 3Q72A 1G3QA 5D3MB 3MG9A 1LF0A 1UKEA 1R2QA 3KB2A 1YZNA 2RGNA 3MWLA 2C99A 2C77A 4JVNA 5CIWA 2IYXA 1JJVA 1V43A 3EZ9A 4E5UA 3LY5A 2ONKA 1U9IC 3SZRA 2CVFA 3KQKA 2R2AA 4Q9LA 3KKMA 3TQCA 1S8FA 3VKHA 3S1AA 1EFRA 3THWB 2MSDB 1T9HA 3U3OA 2HXYA 3W90A 4GNKA 4Q9HA 1T0HB 4A2QA 3VHLB 5IDVA 1KMHB 3NBFA 2QAGB 4DEYA 2BBSA 5JEDA 4PR0A 5FPSA 2IK8A 4NCKA 5DYIA 3C8UA 1P75A 2J59A 5A5GA 1J8MF 1YU9A 4DLSA 3C41J 1UAAA 1NF3A 5DI3A 4NCHA 2A3RA 4DB4A 4K81B 4TL7A 5CLQA 2YWEA 1MKYA 2QPTA 3QF4A 5GJVC 1UEJA 1RC8A 1XTRA 4D26A 5L3QB 2WJIA 3PUXA 2VO1A 1GDDA 3IEUA 2D06A 4MKFA 1E3MA 2RGEA 2RAPA 3L0PA 3KX2A 5A0FA 3O8BA 4Q03A 2GHIA 4B34A 2A9KA 2WWWA 2OXCA 5EZ5A 1XXHA 3IIMA 2PEZA 1EFTA 1NIJA 3BH0A 3KTAB 3BFXA 1CR2A 4TMWA 5J4KA 4LBZA 1NVUQ 2RGCA 3AF4A 4XTRA 1F2TB 3K09C 2NZ8A 1ZUHA 1K6MA 2QRNA 4P0TA 4ZI2A 3I3SR 3RVBA 5CIQA 1FFHA 3W6NA 2ZRLA 4GOKA 2IC5A 3EZ6A 4FCWA 2PCJA 1F6BA 1W46A 4CEHB 2J0QA 4NYMQ 1LS6A 2IYLD 2LKDA 4Q7KA 1CRPA 4PZLA 3CPHA 1KSJA 2ZQ5A 3THXA 1DAEA 2GBLA 4G01B 5BW8A 2AWNA 5JI2E 3H86A 4MA4A 5DIFA 2ZI6A 4GDFA 1KI9A 5DI9A 3J81k 3THYA 5FPYA 3EA5A 3NC1C 3OFND 3DMNA 1G8FA 2REBA 4AKIA 1ZD8A 4NYJQ 4G5RA 4B3XA 2CE2X 2FSFA 4P4TA 1Q57A 4BFSA 1Z07A 3UXMA 4EPWA 4U02A 3FB4A 3TSOA 2ZJ8A 2GF9A 3DVLA 2UZIR 5KTYA 4XVRA 1OXVA 3QBVA 4S35A 3ZS8A 1ZCAA 1D9ZA 5BN4A 2FZ4A 1KDRA 2O8DB 2SHKA 2YOGA 1J99A 1LW7A 5E7IA 2QROA 2FPKA 2GTPA 2Q9AA 5EP3A 3I62A 4Q7JB 4UXHA 1ZUIA 3H84A 4G0NA 3QF7A 3GJ3A 3HR7A 2AXNA 4A8JA 3EZ7A 3QVVA 5C4GB 3V9PA 3WNDA 1M7BA 3I5XA 1GVNB 5AK0A 5DO9A 2GCOB 1GRQA 1UEIA 3L0SA 3NKVA 5ELXA 1T3LA 1Q20A 1Q3TA 3CKLA 2D2EA 1QHNA 2H18A 4QG7A 2PMKA 3UG7A 3AV0B 2F6RA 2QZ4A 3QG1A 4C3ZA 4OKSA 1E2FA 3LQQA 3P32A 3QXCA 2XXAA 4UNQA 4MYTA 1ZU5A 1Z47A 2WWIA 1DELA 3F8TA 3UATA 5G40A 1LY1A 4A36A 3E2IA 3QXJA 4MDEA 2IXGA 4BRUA 1R7RA 3OFNA 3CRRA 2Z6VA 3N5CA 4TMKA 1UBCA 1Z5ZA 2EWWA 2VEDA 3GLHA 2ZAMA 3I72A 4Q1CA 3GJ8A 1LB1B 4MRSA 2J46A 2IA5A 4EFLA 1TEVA 4RY2A 5FOVA 3I5YA 4NP6A 2GK7A 4URVR 2D74A 5SZIA 3PUZA 2C96A 1ZIOA 2C9OA 2XJ9A 2GKSA 3VX3A 2FPMA 3QKSB 1PLLA 3RAPR 5EUMA 3GEHA 3QI2A 3ZLJA 1MABB 3LWNA 4GL2A 1UBEA 5E95A 4JVMA 3RRZA 2O52A 4RD4A 3TW8B 3R9WA 2ZRPA 3U4QB 2YINC 1RW4A 3O8RA 2X1VA 2J5XA 5JI3E 1X3SA 1ELOA 2YWGA 3IPXA 4NE2A 2GVZC 3I4LA 1EFCA 1N6OA 1CLUA 2QNRA 4IDPA 4M9ZA 4RCZA 4B47A 1RZ3A 3AVTA 3QEOA 2VSOA 4LRWA 4MGZR 2JIZD 4Q5IA 3EPKA 3CZQA 3CF6R 3BB4A 2ZR7A 1IN8A 3ICQB 3TGPA 1JQLB 4TL8A 4GP7A 1L2TA 1T5IA 4IFEA 1II8B 4PSKA 1COWA 3TAHA 4FWTA 1RPZA 4BLSA 4ZDJA 5FI1B 3CH5A 1L7VC 1P5ZB 4LC1A 3NBZC 2NZJA 5M04A 2MSCB 5P21A 1NY5A 2ZRJA 2X8AA 1GKIA 5LB4A 2WWXA 1TUIA 3SE0A 1E6CA 4UNPA 1WBBA 1II0A 1ZIPA 3VMFA 2QU8A 3U61B 5KPJA 3O47A 4QC2A 1FPMA 2I1VB 2ZS8A 2YKGA 1KI8A 2OBMA 2B92A 1K5DA 2VHTA 3P27A 2O8BB 1ZUNB 1US8B 1G8GA 1SVOA 5JSZB 1XJ0A 2A5JA 5TV2A 2RGXA 2GCNA 1Q22A 1D9XA 2W2VA 2IYYA 3K0FA 1QVRA 4DLTA 4HAWA 2ZJZA 3WMGA 4KVAA 3RABA 3NEJA 3RS7A 2FX3A 3F3YA 4UKDA 2J0UB 4M0LA 3RC3A 2QBYA 3RS2A 4CYMA 2DFNA 4L9SA 2AHOA 1YKSA 2E9SA 2WJHA 1QHGA 1U8AA 4YC7A 3QKUA 2O8CA 2JIZA 4CEIB 1E2IA 2YHSA 3ADDA 1QG2A 1ZC3A 2QT0A 1HE8B 1E98A 3FPAA 4OL0A 4KSBA 2IYZA 3QEJA 4Q47A 5AJWA 2AX4A 3E5HA 4MRVA 3QQ5A 2VPPA 2VSXA 1AA9A 1R5BA 1I4LD 1A4RA 2OFWA 3EWAA 1RRCA 3DEFA 4G5QA 4AYWA 1R0YA 1XEWY 4F38A 1E0JA 4QHSA 5SZHB 2ZYVX 121PA 1IXRC 1ZRHA 4DLYA 2ZUDA 2GZAA 4V0NA 5G3YA 5EE5B 2EW1A 1XNJA 2G1KA 2FH5B 2IUUA 3AF3A 4BFWA 4DLWA 4DLXA 3TH5A 5H68A 3ADKA 2ZRHA 1E2JA 2FE4A 1G6OA 2IHYA 2WIAA 4F4JA 2OT3B 3LO5A 221PA 3AP2A 3DDCA 1RJ9A 2YYZA 1W2HA 2RGNC 3KQLA 1AS0A 3L0OA 4PO9A 4QRHA 4FIDA 4B3BA 1KK2A 4QHTA 4LV8B 3VKGA 3K0CC 1KK0A 1NRJB 3AM1A 5IHPA 4M53A 1KSFX 4M21A 2D7CA 4HUTA 4M1OA 4AURA 4FMDF 3WRXC 1TTTA 5AJZA 5DGXA 2QAJA 1PLJA 4XJXA 2GRJA 3BRWD 4URXR 3M6AA 2EWVA 1T3HA 1HH4A 2N46A 2GJSA 2IUTA 3SQXA 1CR0A 1OH5A 2GZHA 1NVVR 1G6HA 3U60B 3B1XA 2VP0A 4Q19A 4ZKDA 4B48A 2AK3A 5JS7A 1U9IA 2H7VA 4BLTA 4QM7A 3ZYCA 2C95A 3PXGA 5F9HA 4B44A 3K0SA 2ZREA 4YONB 1W36C 4WBSA 5AUNB 3HU2A 1SKYE 1G7TA 2FSGA 4BFUA 4EUNA 4C0KA 4H9GA 4CEJB 1L8QA 1TU3A 4FMDB 1IY2A 1SVMA 2VL7A 4OI2A 2RGGA 3GLGB 2RGDA 4PPFA 2TMKA 4B3GA 2WJVA 3HWSA 4D4KA 4F4IA 1Z22A 4KFUA 2O8FA 4HDQB 1W1WA 1XRJA 2G77B 2QMUA 2CVHA 2OSBA 2PT7A 2CNWD 2GXUA 3ECCA 1IM2A 4GMDA 2P0EA 1E99A 3KB1A 2CCJA 3MRSA 3GLIB 3DMDA 4DCUA 1PUJA 2ZUCA 1GNQA 4M1TA 3E70C 1NMXA 1YZGA 4AC9A 1CJTC 2HXSA 3TKLA 4GZLA 1OPXA 4KBGA 1M7GA 5CK5A 4OK3A 5DH9A 3ZZTA 1ODFA 3NHBA 1MH1A 1NG1A 1NSFA 2D2FA 2GBLC 5FTNA 3FVQA 4ARZB 4C0HA 1XU4A 1KO5A 1XD2A 2HF9A 3QPWA 3RRMA 4C0QC 2WJJA 2A5YB 1M1YE 4P32A 1EFHA 3K9HA 2ZSFA 2FDCA 5DE3A 1OJLA 3QPUA 2ORIA 4KODA 3K0AA 3PG5A 1G64A 2IBMA 1G5TA 2B6HA 1KIMA 4ON9A 4Q9KA 1I2MA 3X2SA 3ZQJA 1UKVY 1M2OB 3U3RA 2P2LA 4NBSA 1SHKA 2P6NA 5H8WA 4U5XA 2AR7A 3RWOA 2J7KA 4GBMA 4XWOA 4ZIRA 4RD1A 5C2JB 4O3MA 2QGNA 1N6HA 2XZPA 2QTFA 1BOFA 2QL6A 1OV4A 2BMJA 2UVQA 1XTKA 3MUFA 5JJLA 2ZU6A 2WOOA 4IFBA
chains in the Genus database with same CATH superfamily
4C07A 5I9MA 3EY9A 1MOQA 2RFLA 2TYSB 2WSBA 3AFMA 4WACA 3GDOA 1SEPA 3TLGB 3HYSA 3WJ1A 2F8LA 1U3TA 4W8OA 3G8BA 3MBIA 3C7KA 4QOFA 3GOQA 4ZANA 2HRDA 3DOEA 4GVPA 3V2IA 3R5KA 4K6HA 5KKCA 1C14A 1JWBB 2W4QA 1BHSA 3G8AA 2IP4A 2OCPA 1MA3A 1UKZA 3DV0A 1F4PA 4WEQA 3IUNA 3NEPX 3VU3A 3A4YA 1TYCA 4CL2A 2AFHA 2PSEA 4HAYA 3FNRA 4JEIA 2Q4RA 2DP4E 2FKNA 4JYCA 4N6NA 4Q82A 1VIYA 4PSVA 2B36A 4H4CA 1QGDA 3Q41A 4LKOA 2JFZA 1R6VA 2GFQA 2HU5A 3HDJA 2FPUA 2HQRA 2ZBFA 1CNEA 2W8ZA 4GQBA 5BSGA 2NO5A 2FZVA 5ED0A 3ESQA 4Q3AA 4WK2B 2I6SA 3HHPA 4X1OA 1FB5A 1G2OA 3OO1A 4ZOBA 4UUOA 3U48A 2NVOA 4KYTA 4TSKA 1PSZA 3K8YA 2P77A 3RIHA 3KQNA 1YKFA 1NN1A 5LNK1 2I2FA 2XDQB 4N5LA 4EKDA 2NUBA 4Q12A 5HM8A 4GH5A 1RKXA 2VYND 2OAP1 5LPNA 3J80A 2VK8A 4MYCA 2IYQA 5F3WB 4PG7A 2NP6A 2VHWA 2YN0A 4DXAA 2ZJ5A 3EEFA 1UOOA 3HO8A 3UKDA 1CZNA 3K6SA 4J2HA 4JXJA 4KPGA 4RSHA 5IC6A 1XTZA 2EFDB 1VJ5A 4FCVA 4L8GA 4N9QA 3WP0A 1C3LA 4GE3A 3ZHCA 9ATCA 5KC9A 3QYPA 4YJFA 3JQ9C 3X2FA 5JXIA 2FSUA 2XIQA 2YC4C 2CLSA 4GG1A 4HC4A 5HS6A 3RRNA 4EI2A 5A6SB 4EW2A 2H2IA 1PWHA 2B5OA 3D3WA 3LCJA 4QELA 1QBGA 1BEUB 1WO8A 3PXAA 1SU6A 2XUZA 4IKEA 1AN0A 1YA8A 2CL6X 4GPZA 1SUSA 1XEWX 4AN0A 3H16A 4HDRB 1Y7IA 4O02B 5IBQA 4F71A 2B4YA 1AV6A 4DSOA 5JCZA 1RJEA 2AA3A 2Q21A 2ZSJA 2VDMB 3BK2A 2CDRA 3LUJA 5TQVA 1AIPA 3IE0A 1LLFA 5HFJA 3BS4A 3DLTA 1NJ1A 3OM9A 3EGXA 4F9TA 3EMBA 3MJVA 2BKXA 2Z8ZA 1Y8QB 2K5UA 4HWOA 4CR7A 2K2QB 3OHPA 1N1DA 5CUQA 5BPHA 2XCIA 4B6RA 4MHSA 2DWQA 1XT6A 2WQZA 3WOVA 4B73A 1HWYA 2F3UA 2HRQA 4Y1FA 4ALMA 5K6TA 7GPBA 5JBQA 4DA6A 3N76A 1SC9A 1T1SA 4BV8A 4ZO8A 1F1BA 4MV1A 3NIFB 5GJCA 3EDQA 3JWEA 4AROA 4XGRA 1WHTB 4BMSA 1PZFA 1K2WA 1JKIA 2IF2A 2R8BA 3GEPA 1FP1D 2GZSA 5LA6B 4PC1A 2FF7A 1W87A 4OLFA 3UMBA 4ALJA 2NVUA 4HEJA 3SP1A 1GZ3A 3UJ8A 3DO5A 3BZBA 1Z6TA 3I2IA 3KELA 3R24A 2ZBVA 4O25A 1GFIA 4PRKA 3JQ8A 3K2IA 2VDPB 4MGKR 3SX0A 4M1YA 2WB2A 4LVUA 5FO1A 1N8KA 2GT1A 2BDEA 3ETDA 2C2HA 2HWKA 2VAVA 2Y0CA 1ONPA 5EFOA 1EJ6A 1ICEA 2F64A 2H7XA 3E9YA 3NGMA 5HFAA 2Z8YM 5A3VA 5L7WA 1WXXA 5D51S 1YGYA 5B1IA 4DVJA 3R7NA 3ZWVA 4A6PA 1U02A 3SZGA 3NWJA 2WRZA 4BVFA 4F5ZA 3OJCA 3R4CA 4ZYYA 2IDJA 2WVHA 3CG0A 1QIDA 2JBWA 3IDAA 4WKCA 1CEXA 2J3MA 5LCXA 4CMKA 3R6WA 1YCHA 2AGVA 2G40A 4PEVA 2Y9MB 2C9MA 1XFDA 3GT3A 3B1WA 3JPWA 3NHAA 3K3PA 3AFGA 1HQYE 2GSWA 4AG5A 2ISQA 4U8HA 5KNDD 1GD1O 4BNLA 4C43A 2BEUA 2XGSA 3LUKA 1GFWA 2ENUA 4I81A 2VDQB 3GC6A 1ADFA 5IM4F 2RGYA 2F3PA 4ZOQI 1JR3E 1X6VA 4D3XA 4PVCA 4EUHA 3BEDA 1XP8A 3I2GA 4I4TA 3KU4A 4ZEWA 4FLMA 5CFOA 4HAZA 5I01A 5J2UF 3HKEA 4BLRA 3AEUB 3DZCA 3GZNA 2XR1A 2O50A 4TUYB 3RYHB 1QANA 5SY9A 5JT1A 4IPTA 1OKKD 1T26A 3EAGA 4L5IA 2YWXA 4GPIB 2IEBA 6CHYA 1N3IA 2YV4A 2V7XA 1SCUB 1UXOA 2ZJBA 5JVDF 2LXNA 4BNGA 1FDUA 2ZB4A 4KGZA 3PXBA 5H82A 3VHXB 4DCVA 1S2LA 1K8RA 1N9GA 2FQ1A 3B1KA 3C45A 1X7DA 4BZXA 4F46A 3KWFA 5IJ9B 2WSMA 4PZ0A 1MHPA 2UVDA 2OK8A 3MWEA 3ZCVA 2NWQA 2AF3C 1PGJA 3ASYA 3CWQA 1GL9B 1X7YA 4KO2S 1KU6A 1NXXA 2JGAA 3FZEA 4NMXB 3E48A 4Z7JA 2X0DA 3HXMA 1RIIA 1Z2PX 2OCXA 4RH3A 1RM5A 5JNUA 2UUAB 3JPYA 2RKBA 1LRLA 3A06A 1HDIA 1XCGB 2C2WA 1TJ3A 1UXGA 2H08A 3KFLA 2FA9A 4JKOA 1SQFA 2O1WA 1PDWA 4GUDA 3F9CA 1RNLA 5FBVB 1B8OA 1JAYA 2VH5R 4HUJA 1HOXA 4OJYA 5HZHA 1NR5A 2OCYC 4P22A 4AZSA 1CY0A 2G36A 5IUJC 1LSOA 1GUYA 4DLAA 4OYYA 2OG1A 2X41A 5KNDA 1DU4A 3N0RA 4I1RA 4H27A 1PR1A 3A2KA 3NT2A 1JA1A 1Z0UA 3K0CA 3QPVA 1AT1A 3UAGA 3GLFA 4YJGA 2HWUA 3PS9A 1I01A 3DC2A 3IHWA 4R9RA 1S2DA 5JLAA 1SK8A 2A1TS 2CWDA 1XZBA 5CVVA 3EDMA 3H1AA 5HWSA 4U3JA 3KR0A 1CZUA 2C83A 4QGFA 1D8TA 2ZAYA 1E2EA 1OKKA 1K8YB 2PY6A 3FYUB 3GRCA 3NXSA 3K4HA 2BKEA 4LDRA 3DZHA 4OB8A 3N8GA 3ZDXB 3H18A 5FNVB 3EY4A 4ZU1X 3LK6A 3GCZA 3ASUA 5HVNA 4REQA 5HUJA 1XQYA 1IHUA 4ENTA 5F35A 2DHRA 3CGGA 1CF4A 4M7OA 4PF1A 1T9ZA 1MGOA 1VLVA 2VHQA 4WZAE 2HREA 3QEMB 1AMUA 5EOVA 2N47A 2GAFA 1DTWB 1EM8A 2IHKA 2Q2QA 4HUQA 4F9EA 2POCA 3P2JA 3N6XA 2WZBA 3AYZB 2QMHA 4BV2A 4R69A 3UUGA 1T9BA 2C54A 3OZUA 4DR5B 3UGTA 1F20A 5K01A 1DG3A 1KL7A 2Z6UA 3SBXA 2J3DA 1OXTA 1XXLA 2Y1LA 4AY6A 3ROFA 1K7YA 3UOAB 4EIWA 1BVRA 1W4LA 1PQYA 1BCRA 5JPCA 1V96A 3ZU5A 4KXUA 2VATA 4F93B 5ITZB 3RS0A 3BJIC 2NXEA 2WD9A 1DT5A 2FPWA 4I55F 4Q3LA 3SZOA 3T9EA 3PXEA 3OHSX 2Y99A 3HO6A 1EZZA 3K9CA 1Z8FA 5IF9A 2IUEA 5CDUA 1B3RA 1JQDA 1X7WA 3TLMA 1TVKB 3HU3A 3PFKA 3OTWA 4UBJA 4JBXA 3RSCA 4FLFA 3R7AA 3ZOKA 5CT9A 4EJMA 3FMOB 2QPAA 2ETXA 1Z7GA 4NFHA 3KKQA 3KOZA 3MM4A 5CEFA 2ACKA 1C9DB 1KZ1A 3QFTA 1K8ZB 2Q3LA 3E22B 4J1TA 5DMHA 2JRCA 2ZAGA 4DMKA 2QW1A 5AVSA 1LCIA 2XSZD 1PFKA 2EYUA 1A9YA 2FJUA 4FNAA 4WTOA 4E21A 3DCJA 5HS4A 5LM3A 1RRPA 1QQBA 3WFZA 3JZAA 4TTSA 4YB8A 3RIEA 4GS5A 1KJQA 1TNDA 5TS2A 1R4NA 2JHCA 1Z0SA 2HCTA 4TV9B 3R4VA 3LA8A 4R9UC 1KVUA 1R18A 2OD9A 3VVBA 4E5DA 1M5RA 2DOKA 2DQ4A 3DQPA 5EHQA 5IKPA 2AKYA 4K6CA 4E03A 4G56A 3WL5A 1Z39A 4O8ZA 5AWFC 3ZX5A 1JIJA 4ZI7A 1XCJA 4PGMA 2F9FA 4YRDA 1GPLA 3SKYA 2ODTX 5JE8A 2XXAB 1W8DA 5ALQA 3FM9A 2QUIA 2GN4A 5FULA 3NTUA 3O7WA 3T1QA 3VSEA 4YP0A 5EWLA 3SYKA 5EJFA 4N8EA 5BWLA 4NCJA 1YULA 4GZ5A 3Q1KA 5KYYB 2QN6A 2E48A 3NUZA 1M6YA 3DDOA 2GA8A 2H1VA 3KYDB 1UZUA 1ZN8A 4OK6A 2BFAA 2WQ6A 2CL5A 1H3EA 4R8MA 4B3FX 5EE1A 3BWVA 4B3MB 3OPMA 4YDHB 3HB7A 3H3XA 5I8WA 3GQBA 4D1YA 3A6HA 2RHOA 1BWSA 3MJCA 3SQWA 2HMWA 2KS6A 2ZYUX 2CLFB 2I66A 3B9RA 3TDMA 1XELA 4TQ9A 4A82A 1CUFA 3B9BA 5TF4A 4H1WA 1SWWA 2O7QA 3ZK8A 4PG4A 1UJBA 3CV3A 3SJCA 3KUUA 2YIJA 1COWD 1RKBA 1Z5UA 3EVGA 2J1LA 2C92A 5FYDA 4D46A 2OZEA 1YB1A 3A4MA 4OREX 3QKWA 4LTDA 2WWGA 3CT6A 4YRCA 3JVIA 3UTCA 4CGYA 2JJ2D 1G59A 1Q0RA 2Q3HA 4A10A 1YMUA 1V3QE 4DRZA 4H0CA 3UO8B 2XSZA 4WFKA 4YAGA 1IOZA 4F9FA 3UPDA 4L5AA 2I9PA 3AINA 3TE7A 5DM4A 2QZSA 4WL0A 1R8XA 1PTJA 4KPFC 1VYTA 1Q7BA 4G4IA 4QOJA 4U2GA 4ZOLA 4U7JA 4LXUA 1A9XA 1G3UA 4LQDA 1U9YA 5AOBA 4HLQB 3EXAA 2P9GA 2Y4NA 4CL3A 5KYGA 2XJ4A 5EZYF 2PKXA 3BFKA 4PZYA 4ESHA 3WLNA 2VZLA 2UAGA 2VHCA 3D3QA 2DPYA 1EZ1A 4EEXA 1Q0HA 2RG7A 3H3JA 4OCZA 3GPDG 1T8YA 3MS7A 3EWSA 3SSMA 2VNHA 3BKXA 3V6LA 5EE0A 3C14C 2M1XA 3W05A 3PRJA 1B42A 1TQ2A 3OAAD 4OFXA 4OHKA 4XJTA 3V7NA 1YIAA 4JCOA 1LQ2A 3PFBA 1ZOOA 3P71T 4Y3UA 3VC3A 2E21A 3JYOA 2OQVA 3NWOA 2KJQA 3UJDA 5J58A 1G8KA 4RTOA 3DKIA 4NENA 4HBZA 1LWNA 4AZVA 3NYWA 3CPSA 4FSHA 4GSKA 2JHFA 2F7SA 4EGCB 3GEMA 1T8UA 2IXTA 1U3CA 4US2R 1WXGA 4LX0A 1IQPA 2Y71A 4RHYA 4WOJA 4AS2A 3O8DA 1A76A 3PCTA 3TZBA 3ZNNA 1FYFA 3A9RA 3T61A 4XIYA 1BN6A 2PTHA 2Q2NA 4QUBA 2J4FA 2TMYA 4O2BA 2PMEA 1OAAA 2ISSD 1LFDB 2D2XA 2B21A 5HQJA 2JJ2A 2JGJA 1VDMA 3NHSA 2JFGA 4BMPB 3BMQB 3Q85A 2X2EA 3BCHA 3EBPA 3QPDA 1K3UB 4XE5A 3GAAA 2EBWA 3UMMA 1J8QA 5BSRA 2YRWA 2IS2A 1CS0B 2PO5A 2PRSA 4MVYA 1A8QA 2OXEA 2IUSA 2QSUA 4A5SA 3A3NA 3GH1A 4JDUA 3REQA 4MR8B 2A1TR 3CUKA 1IZZA 5KSZA 1P7CA 3IAS6 5LD2C 1KI3A 1E32A 4PXAA 5KOYA 2WLTA 2WJPA 2VT6A 3QKSA 4UM9D 1Q91A 1BYUA 3EARA 2Z8YA 4FYXA 5AOVA 1NR1A 3N0VA 4FE7A 5DK4A 4UQLA 2AN4A 4YPVA 2GRUA 1J06A 3U4QA 1GG9A 4X64B 3H99A 2WUWE 3A3PA 1MEOA 1E2HA 2QMYA 4HADA 4XLLA 3ZDYB 1W75A 2GK3A 1KFBB 2XA2A 3OAAA 1PX0A 4DAEA 2XYPA 5BRAA 4LXIA 4IXNA 2WIFA 2GS9A 2QHXA 3F96A 2C2OA 4C7MA 1JR6A 3WKDA 3QVSA 2ZM5A 4FE3A 2NU9B 5I6DA 2OZKA 3BD9A 4C05A 2QQ5A 1NBME 4FSXA 4EMSA 1ILWA 1ZISA 4RMJA 1NYQA 2HK9A 4Q01A 4YH1A 1NJ8A 1I10A 1POXA 1Z0AA 3BE6A 2QAIA 3CKYA 3LF1A 1NRWA 2LNDA 2MR6A 3FYCA 1GU7A 1KO8A 2DR3A 1ST2A 4PHGA 1Y80A 3DH0A 3ESYA 3KPYA 4XM1A 2Q5CA 3L6EA 1VSUA 4KPUB 4OQMA 2A1IA 2J07A 1JLKA 1N0HA 2VJDA 3QJYA 4X1IB 4YO7A 5IJXA 3TNFA 2RJ3A 3D3EA 4XI9A 3BERA 3IA2A 3PYMA 3DSRA 4M8IA 3R5SA 1MXHA 1V4VA 3IVAA 5IM4A 4GZ3A 1V8PA 4C3OB 4LXHA 1L5RA 2ZATA 2VPYA 1T4BA 5AUPB 3BK7A 1JXQA 2BTQB 3KC2A 3C3KA 4MA5A 4Y8VA 1EYZA 3UYLA 3MPUA 3K1AB 4JB8A 2CVZA 3NGLA 2ADMA 4J1SA 1G98A 1TGVA 2FNAA 1FSZA 4LVCA 4J8PA 4P36A 4NU8X 3TTUA 4XVHA 3UC9A 4TS3A 3SX2A 4JL5A 4R84A 4MEBA 4B0OA 4Y30A 2WBLC 3TG2A 2O8BA 4JR0A 4OPMA 4FI3F 4BO0A 1JEQA 1XROA 1IHOA 4Q15A 3AR3A 3Q9LA 3MCTA 4KCGA 4L07A 4LEIA 4F92B 2EERA 2OZLB 3TRJA 3VYVA 3HYTA 3UK2A 3IUSA 1L4LA 2V7GA 5AVQA 2AOUA 4RVGA 1L4GA 4BO2A 2VP3A 2D0OB 1C30B 3Q0IA 1RYDA 5EHIA 1Z06A 1B15A 1RRVA 2EFYA 5ECDA 2SECE 4H7EA 3W8RA 2YBDA 4OFBA 2IXEA 3ONEA 2Z2IA 3TNYA 4BPBA 1YJBA 1H65A 4MYHA 3IQFA 4UJ5A 5HIIA 3ULKA 1A4UA 1ZMOA 4BJ1A 3R0QA 4KIWA 3RHSA 3C3AA 3MCZA 4QAJA 4R1PA 4JY7A 1VE1A 3D7RA 3L7AA 3S2UA 4BNFA 3EPJA 2UYOA 3OTQA 3Q0TA 3WAGA 3Q8XB 5J4VA 2I76A 1UDRA 2H07A 4LJ8A 4IXMA 3RG2A 1ZYUA 1JJ7A 2ZVQX 3AJ9A 1THZA 2YMLA 4YN3A 3EFBA 3S2SA 3LM8A 3A9TA 5EUQB 3SI7A 1RQNA 2OCBA 3F1LA 1ZC4A 3U49A 1PJ2A 2DLCX 1TZJA 1HBJA 4LY6A 5H5JA 1OWNA 1A1VA 5IVDA 5EJ9A 4KFTA 2I4RA 4O59O 1X7XA 4BFYA 4D80A 3DUFA 3F0TA 1ZNWA 3HUFA 1MAUA 4RA6B 2H7CA 2OQ2A 3NBXX 5IH7A 2WEKA 3G88A 1LPNA 2FP4B 2H1OA 1J21A 1WTAA 4JIGA 2IS6A 3IP5A 3DKPA 2O8VA 4HVAA 1EVEA 1W73A 5CB4F 2XZTA 1ISMA 1ZNXA 5C1DA 3I5AA 4F3CA 2PXAA 5KO2A 1V37A 3VU0A 4DNQA 1E0KA 4K46A 2BGJA 3AFNA 1OFUX 2TSYB 3FMGA 2EBHX 5B7GA 3A4NA 3QVGA 3K0AB 3CF2A 4RZ2A 4EY3A 4PZZA 3PNOA 4HKTA 1SBQA 2HADA 2RHRA 1BEZA 2H1RA 2JH8A 4NF2A 5KU7A 3T5DA 4NK4A 1C0LA 2O2CA 4GMKA 1TYDE 4JB3A 3PJDA 2BJHA 1Q0ZA 5JARA 1II9A 1LX6A 4MH0R 2C9CA 2H4WA 1H23A 2XNDD 2OGZA 4HB3A 5AKLA 4ZN6A 1U04A 3EW7A 1U6JA 3KUKA 3ROMA 4DY4A 4QVGA 2LIPA 2VF2A 3B38A 3MWGA 2PJRA 1J1ZA 3SJZA 2DWOA 2ZXFA 3T3NA 1H1LB 3CE9A 1GXSA 3DL7A 3ER6A 4CDNA 4EPTA 2OD2A 3I05A 2KM1A 3DMTC 1MO5A 2XGOA 1ZBQA 2P68A 3BRQA 3K15A 1RMYA 2GEFA 3ZH9B 2W98A 3DV0B 1KYTA 1XA3A 2FN4A 3NWBA 1S02A 1Y48E 4CKBB 5AFSA 2OXRA 2VPZA 3DGFC 2AFHB 2PH3A 4PC6A 1ZEJA 4LK3A 3CUVA 1DXHA 1K3FA 1Y3BE 4KO8A 5KCZA 1A5SB 1MMFB 1G7CA 2C04A 3P2YA 5EXDA 1W49A 4NK5A 3A10A 2P2YA 3G85A 3QLVA 4RK5A 4S05A 2OORA 2G8NA 2HF2A 3ZDCA 4EABA 1YR7A 1Z62A 1UR5A 2J33A 2XMBA 2Y27A 4NU6A 1SM4A 4WKBA 5AOAA 1Z13A 4LVNA 5CB4A 3LV8A 4QULA 2IEAA 3NTRA 1G1MA 2WA1A 3DP7A 3KJQA 1VG1A 4FD2A 1ZM4A 3IIIA 4R51A 5DOZA 3LIPA 3W3AH 3N9IA 5IH3A 1QFYA 1ZJ4A 4URYR 3RHZA 4BO5A 3A37A 4DSZA 1HEIA 1SCBA 2VN8A 2BL4A 4N03A 4AJ1A 1SKMA 1PVDA 3CYFA 2QTGA 1AB6A 4FWIB 4A0SA 3DE7X 4PAMA 2FSSA 5E2AA 3T3EA 3HEBA 3OESA 1JL3A 5KYTA 5HRCA 3S2ZA 4DDMA 3CLUD 5KEIA 5BWNA 1R74A 2JLUA 4NAUA 5H9WA 3A0RB 2VSFA 2IYEA 1JWLA 1VZ2A 5EJMA 4TTAA 3LVBA 1B8UA 5BRJA 2B61A 3JWIA 4MW5A 4D45A 1KO4A 4L08A 4RMIA 4YJFB 4GPTA 4GYWA 4W9MC 5B3KA 5JMTA 3NHYA 1E2PA 4JODA 2GKGA 3L1IA 3C4JA 3AL3A 4Z7QB 5C8ZA 1DQYA 3T95A 2HAEA 5B7PA 2VUSA 2X13A 2JGLA 1XKTA 4EYOA 4HRVA 4V0ME 4Z0HO 5FB3A 3EUAA 4QX6A 3FCAA 3HYRA 2Z3ZA 1GRNA 3I04M 3LC1O 4FHDA 4LDQA 5FPTA 4Z4CA 4TZ0A 4GD3Q 3PC8C 3VSBA 1LRKA 4BZPA 5B12A 5IBRA 1RWOA 1IMOA 2VPIA 4JA0A 4NE7A 3RAEC 2AUTA 1LLCA 4RTKA 2ZG6A 1S9DA 4TTJA 3EGXB 3KUDA 4DXHA 4TN5A 3OIGA 1RBZA 3H9QA 1Z12A 2FFAA 2JJ8A 1LBHA 2RHGB 3GJXC 1W1IA 2XUHA 5LDDC 5JS1A 3G68A 2F3TA 3ISTA 2D1FA 4GGPA 2I6XA 2RHJA 4KYIB 3ADBA 1USKA 2HRCA 4K2HA 3IR5A 4BKUA 3OFKA 1G20E 4MW2A 1JQJC 3GB9A 5D8DA 3R09A 1DDIA 1GPBA 3HJTA 3FZYA 3KFXA 3KQMA 2O7SA 3R1IA 4E46A 1TEXA 3HH8A 3ODGA 5K0CA 4TN1A 2PD6A 3HCPA 2CLIB 3QG5A 3MRVA 2IT1A 4G5OA 4GM1A 3BWXA 4IDDA 4MLZA 3V7YA 3JATA 1JIVA 2FUNB 4HB4A 2OD7A 3ORHA 4PONA 3EH1A 1SAYA 4FDAA 3LNTA 5ECYA 5AYVA 2NVUB 4NMMA 3IEMA 3GCWA 1YJ8A 4I8IA 4X7BA 5A4MS 2HA4A 4XIFA 4R71A 4FKZA 3JQ8B 4YGYA 1Q3KA 3W7VA 5LNK6 2PDAA 3ED5A 1YZQA 2VP6A 4Z7NB 3RYFA 1RJFA 4BX8A 1P9LA 4RACA 4G1MB 4C2BA 3RFFA 4YUWA 2BLNA 1WRBA 4QQRA 3RJZA 2CFIA 3S2YA 5JZOA 1M8JA 3QV1A 4GOOD 2FRVA 3DZKA 1YUMA 1M33A 3HJNA 5CDFE 1HYGA 2PS1A 1R64A 4YYZA 1ESMA 1XLWA 3ORRA 4G26A 1UOEA 5C8YA 1DE0A 3VVLA 4WCFB 1ZJJA 4YLGA 4MPTA 1SXJD 2NV6A 3NBMA 4R7TA 3OQPA 3IOCA 3OOYA 3WIVA 1LBQA 4TROA 3EZ2A 4JASB 4E13A 2VDRB 1HO3A 1NLMA 1Z7WA 3PPVA 3ZZ0A 1J5XA 4H1UA 4BO8A 4C4PA 2XVZA 5TEVA 4FKBA 2QTMA 4R0NA 4JOCA 1XZKA 3M33A 1IG3A 5LR6A 2ZETA 4FFPA 2KX7A 1YBMA 3SEQA 2CDCA 2FOXA 1R6TA 4DJAA 5IHXA 4P5EA 1MJGM 2QLMA 2A0XA 2E2WA 3ORFA 4BGEA 4DV4B 4U9UA 1IB6A 2GSDA 2BEUB 3T5CA 3U6KA 1QV6A 2Z6AA 4PWZA 3UJ7A 2VJOA 1W2WB 4C9BA 2ZB2A 4BNTA 1ULUA 2PAAA 2PSJA 4I4TB 4TKUA 3H2BA 2Q6TA 4LZOA 1E9BA 4P3KA 4YPOA 4S12A 2RJOA 1XEFA 3HKEB 3RIGA 3GZNB 2I3BA 3FVWA 4PPGA 4FYVA 5JAPA 4H31A 4LWZA 2A7XA 1YJQA 2FP3A 3G0GA 4HNGA 2QU7A 1U0EA 3EDOA 4R6XA 1QRTA 3MUNA 3VOTA 4IS2A 2JFOA 3LA6A 1KVTA 3BXOA 4HH1A 2YL2A 2VQSA 4U7FA 2JJQA 4EJSA 3ABRB 5J4HA 5K8UA 2RKWA 4R8VA 4AQDA 2HW8A 4JI5B 3HZRA 3L7NA 3N28A 2Q9UA 5FCDA 1UKYA 2AC2A 3Q3VA 2BGTA 4OMDA 4RZ3A 3RTGA 1XHFA 5B3JA 1HZZA 4ZVKA 2CBXA 3EEIA 4PIMA 1BGWA 1GA4A 2ICAA 2N3ZA 1ENYA 2X6TA 3MWEB 2OBNA 5IBCA 3AJAA 1W0KD 5ILGA 1BHJA 4FR2A 1CP2A 2PKCA 4AULA 4E6EA 3C7AA 2WU8A 2PU7A 1SXJA 3OE5A 2JHAA 3OE7A 1TW2A 3NB0A 1N5OX 1ZGGA 2BBTA 4H3KB 4X8HA 5FHQA 5JQGA 2OCLA 3KQUA 3G5AA 1UKAA 1JEJA 1VCIA 2ERYA 2YW9A 4A1OA 4E2WA 2ZWMA 3QRWA 1NI3A 1J70A 4P7KA 1YFZA 1KNXA 1SB9A 2IUFA 1F8UA 1U3WA 3N87A 3ROPA 2XCOA 5JATA 3LBNA 2CHEA 1P61B 3WGOA 1B6TA 1M8PA 1AKTA 4TRNA 4YUYA 1VLZA 2QD1A 1KPGA 1M2GA 3DT9A 4I3HA 1GUDA 4KXVA 1EFVB 3D0QA 4M46A 4RK7A 2PX6A 4EUEA 4YV1A 3K71B 1PZEA 1XGKA 3GLFB 4JI4B 3BHJA 3P9ZA 2GILA 1JG4A 1Q21A 1Z0IA 1Z5OA 1DLIA 2QN3A 1X1SA 4MZDA 1KDVA 1TM3E 1XFAA 5J2UB 2JHGA 3NWEA 3W4IA 2ARKA 2J9GA 1EUDA 3HVKA 1RYBA 1I32A 1K63A 4PHCA 4PQRA 1MRSA 5G2OA 4BQQA 2EBFX 1OW3B 3GELA 3O38A 2Q8PA 1TUBA 4U6QA 4UE6A 4WFIA 1NQUA 3DEIA 5HUQA 3EIFA 3VR0A 1MU0A 2V97A 3GMDA 3Q8LA 4G85A 3M1AA 5KKAA 3DOCA 4ZHQA 1VGQA 4R54A 5K3FA 1GM5A 2O3TA 3CXRA 4UOZA 3IEKA 5BYKA 2QZZA 4REQB 2J5RA 2GHTA 2Z9DA 1A8HA 3CO0S 5A05A 1Z68A 2GGSA 3TTSA 3W8FA 3F4LA 4D4JA 2COKA 2NO0A 3RWBA 2ENWA 3O9ZA 1R4MB 3G2LA 4IO0A 5E4FA 5CM2Z 3C87A 4E7OA 4YT5A 1W0KA 4YRSA 2HQBA 2R8RA 2G17A 3QX9A 4LMRA 5DXAA 3SC2A 1AN9A 1EM8B 1IQRA 2ZE6A 3FLBA 4FEYA 2H92A 3RTDA 3IOEA 4BTVA 3QPBA 1QX4A 4U5QA 4AZWA 2HV8A 2PX3A 4NDZA 4B4DA 1KYXA 3SR3A 2PQ2A 2DZDA 3HVIA 1YJCA 1ZD1A 3X1XA 2D00A 1FMJA 1NI4A 4KR2A 4KC0A 3L8CA 1Q92A 2XBUA 4MV6A 3SCZA 1JJAA 3CVUA 1MC4A 1WULS 1BCRB 1WB4A 2ATXA 2FG5A 2PK3A 3GGSA 2C5BA 4OYLA 4MVXA 4K8RB 3FYSA 3FKQA 2Y92A 1XZQA 2X1HA 3PNLA 1JHYA 3MELA 4KXNA 4Q9AA 4C0JA 5EZ6B 5JDCA 1Z3CA 2DPLA 1SVWA 1E2DA 1ZGAA 4X8OA 4RPCA 1X7WB 1A8IA 3WO0A 1SC3A 2QN9A 3EFOB 3DQZA 4QTXA 3MMSA 1XAGA 4TWZA 3WDKA 1RQ2A 2O06A 3AJRA 3ET5A 3X3HA 4U7PB 1T1RA 4B31A 2BGRA 1OBFO 2RMKA 2FR8A 3BICA 1MTOA 4BVHA 5GZ6A 2QX6A 1CJCA 1L7EA 4BJHB 4YDRA 3PV0A 3E9CA 2WMOB 1OYVA 4YTEA 5BW4A 1P8JA 3ZE7A 1RC0A 5G02A 4BFTA 1BROA 1SXGA 4GUAA 1PW7A 3DVRX 5D3MA 2FQXA 1WP9A 3QNUA 4D6XA 2REQA 1I8TA 1PO7A 4MUFA 2AFIE 1G18A 2FN9A 1DRKA 1R4NB 3HNRA 4BO1A 4D3SA 3PDWA 4L4XA 3HNOA 4L15A 3TJZA 4IIEA 1SC6A 3FUUA 3LNCA 1E5DA 4LJ6A 4UM7A 1JDJA 1K2VN 2F1OA 3DDZX 2H4XA 3CTPA 1FEZA 3EF3A 3ESZA 3P2OA 4Y2JA 3V97A 2YZ7A 5IWCA 4BMCA 4E08A 2R00C 5F1KA 4NE9A 2QE7D 5KCMA 5DMXA 5EWLB 4CZ2A 3QBEA 2COEA 4OIFA 5LUBA 1P4RA 4QTTB 2QAGA 3JYNA 2RKOA 5E1OA 6Q21A 1I94B 4ZODA 3S5UA 2X4DA 1Z6GA 2JJ1D 3AMVA 3OFSA 4IH4A 2RCYA 3KXKA 3KVNA 2ZBEA 4G5HA 4D9CA 5D1HA 4NU0A 4AUKA 1M34A 4JBYA 4A0RA 2HHJA 4N3CA 3DWIA 1C4KA 1V1RA 3GQBB 3QPCA 4WPGA 1Q1BA 3IO5A 3TPZA 3IP3A 1P9WA 3DTVD 1OBOA 1CUAA 1TJNA 3IUPA 4HXEB 2V7EA 2MYTA 1QM5A 1ENZA 1RZUA 1T5SA 2V0CA 1U28C 2VH2A 3Q6MA 2IOFA 1ZXBA 3C5VA 5CB0A 4PC3A 4FLEA 2ZVJA 2AYZA 2VJAA 4UNSA 3FETA 3OJ0A 1NVWQ 3EPRA 3F4KA 1YUBA 1KY3A 5T3UA 1QWSA 1Z4QA 2HTFA 2ZYDA 4IBOA 4XW2A 1OXMA 3V48A 1TTQB 2Z4RA 1AV7A 4WCDA 1K88A 1JR3D 4TRRA 4D42A 3DKRA 4S1VA 4AJOA 5KC8A 3WQHA 2YUTA 3GLHB 4OFZA 4RJLA 2O7NA 1BD3A 1N5LA 1NKVA 2ZE5A 2YV1A 3KZNA 3T0IA 5KYKA 4QFDA 1KFEB 2UU9B 2A0FA 3NAZA 4ZOLB 2XT6A 5JC8A 4D9KA 3FR8A 5F23A 3AONB 2D2VA 5CX4A 4MW7A 5FEUA 2X19A 2GFHA 4JLOA 3LXRA 2QJFA 4CEHA 2R0QC 1UQUA 1YH3A 3EIOA 3IEIA 1VKNA 2EQBA 2UYCA 4P1ZA 2XOKD 4K9RA 4PLCA 3V4FA 5HXAA 1AO3A 3NAQA 3P0IA 1DV2A 3C3WA 1NASA 4PCVA 3R8CA 4ALNA 1Y3HA 2ATEA 1IDN1 3W2TA 2J3EA 4DIBA 4MTCA 2JJ1A 2Z8XA 2XYVA 3DVAA 5LU8A 3A9UA 1TM2A 2UYGA 2FQWA 3I04A 4YT4A 4NENB 3ZIUA 3TB6A 3QYJA 5G1OA 5LLDA 2R62A 1XB2A 3HBAA 1T3SA 3RHFA 1A7AA 1GNPA 4PX5A 4D79A 3SC3A 1P17A 1L5YA 4IIJA 2I4TA 1GYQA 5K8IA 5DJ5A 4XFDA 2H85A 1O8BA 5TX7A 5KWVA 3DTVA 1XUOA 3OTHA 1J5EB 4RTLA 2CKDA 4KBFA 2BHTA 3ZXSA 3KSMA 4DPKA 4ETMA 1V5GA 3I6QA 1ABFA 3IPCA 1V9SA 4FFRA 3V8QA 3E0XA 1SIWA 3DMPA 1HI9A 2OUKA 2JCXA 3M4JA 4MV0A 2KB0A 4FCCA 4B6EA 2Q5FA 3FI0A 3PTLA 4IOKA 4YLEA 2OKGA 3A04A 3JQPA 3VQTA 2X3FA 2YQ4A 4AX8A 1JHVA 1W59A 2UZ3A 2ECQA 3TW4A 1O0CA 3R44A 4BVGA 1L4MA 2BONA 1GGFA 2JFXA 2XWSA 5AJUA 1O0SA 1JR3A 1MH9A 3E8MA 3LT0A 4OU4A 3CRQA 3LPLA 5FRDA 3FNFA 3U1TA 3TTYA 1VCNA 2QS9A 2YBEA 1OZGA 1HDRA 4FYKA 1E62A 3UJ6A 4IWYA 3PEUA 4B79A 2QLJA 5JC1A 3REQB 5EMJA 3QA9A 1X3LA 2B30A 2NUPA 5KQSA 1Q6YA 4X1YA 1TQDA 2YHIB 2OBLA 3KHUA 2QQ0A 1Q77A 3KSUA 4QDTA 5ESWA 5KREA 3IBSA 5B1YA 3R2JA 4ERXA 2QXTA 3V8BA 2R25B 5F2KA 2G25A 3NOOA 4Z9AA 4UU7A 1UXIA 1SU4A 1QK4A 4YXWD 1EGQA 2XOKA 3NETA 3F3KA 3BDAA 1FMFA 2EFCB 1BDJA 1ZI9A 3N39C 1GR1A 1NUPA 3HJHA 4FCTA 4KSCA 1MNAA 5ULLA 2I8AA 2P4QA 1MC5A 3A6EA 4J0CA 3O1JC 4OGLA 4X97A 4ENRA 2R3SA 1F3LA 4EG6A 4INAA 3OQOA 3DLBA 2MSLA 2HC9A 3BMOA 4ZQBA 1P6UA 2Z3WA 1K6IA 1N2CA 2NQ2C 4U3JB 5H80A 4IOMA 1MJGA 1TM4E 1J7KA 7ADHA 5AKKA 4QYIA 1FJGB 2AC4A 4G09A 4F72A 4JCCA 4TLEA 3CBGA 5F77A 1AKYA 5BUSA 3ETJA 1KXJA 1F8XA 4OHFA 5JANA 2B83A 1KQOA 1TFUA 1A72A 4GP6A 1QHIA 3TW8A 3GYBA 4EW3A 1EXNA 2K2WA 4JI6B 1EWQA 5DVZA 2HQ1A 1G42A 3B1JA 1JE0A 4R2HA 3JCZA 3L6BA 5L53A 3A2LA 2G1UA 1XG5A 2J6BA 3CY6A 4DCOA 4R98A 2VF8A 2NMVA 1NF8A 3O1LA 3AF0A 3ID6C 5EIEA 3THOA 2EKQA 2BCGY 6GPBA 1LKZA 3QLUA 4Z51A 1PT7A 4YMVA 5KAMA 1EIZA 5ALHA 2ZRAA 1ORVA 5IUKC 3TQOA 4ZDWA 2QTHA 3EQZA 4OQNA 2CUKA 4V3BA 1H69A 2VDNB 1I2CA 2CC2A 1W85A 1NNI1 2ZZMA 2PRZA 2NO1A 1Y1LA 3FFBA 4RD6A 3JAMA 4QTZA 3ZIAD 4UM9B 4P38A 2AQ8A 3U1BA 3BJEA 3SLGA 3ADCA 1RJ9B 3WYBA 3KOXA 5AI9A 2AJ8A 2AOUB 4BFVA 1U7ZA 1X74A 5JASA 4YXWA 3OZEA 3S4YA 4FFNA 2G3YA 2R4TA 5DBIA 3ZEAA 3ITNA 1A82A 3IXLA 2LTAA 1V16A 2H1SA 3X44A 4E5KA 1T0IA 1OH7A 1GZ4A 1NULA 4DJTA 4C2TA 2CXQA 3LPMA 1TX4B 3UGJA 2AZTA 3DM5A 4L85A 1P2TA 3HADA 2BKUA 4B82A 3MBKA 2O2EA 2ANBA 2EGGA 3WL4A 4TLMB 2HBQA