1WABA

Platelet-activating factor acetylhydrolase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
publication title Brain acetylhydrolase that inactivates platelet-activating factor is a G-protein-like trimer.
pubmed doi rcsb
molecule tags Platelet factor
total genus 74
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 1996-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1wabA00
2APJA 1FXWA 4JGGA 4H08A 4RW0A 4JJ6A 4IYJA 3BZWA 1BWPA 3SLRA 4RSHA 3U37A 1DEOA 2VPTA 1ESDA 4K9SA 1V2GA 3DT6A 4OAOA 1J00A 1WABA 4NRDA 4M8KA 4K3UA 5BN1A 2WAAA 4HF7A 5HOEA 3SKVA 4S1PA 1BWQA 4Q9AA 4TX1A 1VJGA 5A4AA 5CD9A 4XVHA 4JKOA 4Q7QA 1ZMBA 4JJ4A 5B5SA 3DC7A 3DT9A 4K7JA 1JRLA 2WAOA 3RJTA 1ESEA 1VYHA 3DCIA 2HSJA 4OAPA 5JD3A 2Q0SA 3PT5A 2O14A 1BWRA 3KVNA 4K40A 1ES9A 1FXWF 3HP4A 1IVNA 2Q0QA 4PPYA 3C1UA 2W9XA 3P94A 3DT8A 4I8IA 1DEXA 1ESCA 3MILA 1PP4A 1K7CA 4DEVA 1U8UA 1Z8HA 2WABA 3W7VA 4HYQA 4JHLA 4LHSA 1YZFA
chains in the Genus database with same CATH superfamily
1UMCB 3URKA 1PZXA 4QT4A 3NMUF 1Q3TA 4G8CA 3RREA 3V8QA 1XFAA 1Z6AA 4JU9A 2IV2X 1OKKA 1JQAA 5M29A 4CEIA 4KAAA 5DEIA 4MDYA 3SYNA 2W2LD 3MCUA 3EXG1 3NOXA 4N1AA 1ZX1A 2VHQA 4QAJA 1ZBDA 5EMHA 1UH5A 4RF5A 3AOEA 3OVMA 3M9XA 4FLMA 3RK0A 3WGVA 1QPZA 4JWKA 3IMFA 3UN1A 1D9XA 2VUHB 1Y3IA 4HSGA 5LD2C 4G1CA 5CM9C 2VBGA 3KT6A 4FHCA 4C30A 3N3BC 1L3IA 2KB0A 1OROA 2KI5A 1SU7A 3A6GA 2NZJA 3EC1A 3GCXA 4OP3A 1AN0A 2UZ0A 3IQXA 3QXHA 4ND4A 4RF2A 1Y9ZA 4ZV7A 4EQZA 5KTSA 3BL5A 2Q49A 3SEFA 1CZRA 2XYVA 4H4EA 2CC2A 1BCRA 1KS2A 1Y3BE 2IYZA 1Z62A 2ZS7A 3O0DA 1T8TA 5LQJA 2II6A 2WJ6A 3BL8A 3WP0A 2NP7A 3U40A 1GL7A 1KAEA 4WZZA 3V7WA 4Y1RA 2O8VA 3DEZA 3U4DA 1ISIA 1DAPA 4HDAA 1GCUA 1XEXB 4FMBB 1F0YA 4UOZA 3M6XA 4C4AA 5A4AA 2UZ3A 4ZAGA 1YMVA 3IXQA 1JP7A 3O4HA 3LBFA 1GD1O 5C9ZA 4DRZA 4BKMA 2DQKA 4WZBE 3WMEA 2DUJA 1LX7A 2KBEA 3MIIA 1YR9A 1XGKA 2RJ3A 1SVSA 1XTRA 4LF8B 4PYJA 3WLLA 3TLZA 1CUAA 3C1OA 5TT1A 4WBNB 1T2NA 5EUCA 4OA8A 4U6NA 2O8BB 2G82A 2QG9A 4IJ5A 2XYGA 1RNLA 2XUAA 3I34X 4WZ6A 1R6VA 3ZWXA 3E9ZA 1M2HA 1RI2A 2FY8A 2CD9A 1T2DA 4GSYA 2G36A 2PLAA 4OI1A 4AJIA 1QF7A 2QSZA 2J3KA 4LNHA 3F9IA 4TXLA 1VLVA 4U2CA 2OFOA 3SY8A 3FTQA 1UPBA 3IP1A 3T1YB 4EPWA 2O8NA 1XROA 4DCVA 2RGWA 4WLVA 3VOBA 2FK8A 2B6NA 4PC7A 2VNJA 3PDIA 4HFJA 1ACMA 1CRZA 1GU7A 2XF8A 3EDCA 3MT0A 4Q9NA 4ETMA 4B5LA 4DPLA 1V4VA 4ZGBA 2K7FA 1AXEA 1N33B 1F1JA 2GJSA 4MVJE 4N3AA 3T0IA 3PHIA 2HCRA 4GMGA 2RFLA 2OORA 3Q0TA 5AW3A 5JZSA 1W7AA 3HFSA 1R88A 4H2DA 1OVGA 1WCXA 5L6MB 1FLAA 2WSBA 2FF5A 4NYMQ 4RVOA 2I2CA 1CJSA 1NG1A 1O0SA 1XDZA 3CZRA 2R44A 4UUNA 5FCDA 1S2LA 3AR6A 3RS3A 4DPMA 3FPJA 2G1PA 4P3PA 3VGJA 1IDN1 4ZZ3A 2OCXA 3A70A 1ONOA 1EG7A 5HDQA 2C2BA 2RD2A 1YU6A 3GY0A 3U7HB 2G3YA 1RFLA 1V41E 3P2EA 4MRVA 2GAAA 4DVJA 4EDFA 1DBSA 2V7WA 4HFRA 1K9VF 5F1PA 3IEIA 3X3HA 1P18A 3H9QA 1MQ9A 4RTLA 2EX0A 3ORRA 2YXLA 4MQMA 1H8EA 2VUIB 4IRUB 5IJXA 1PJ2A 3RROA 3HN6A 3HN7A 3I0MA 1YQTA 2FETA 3PSAA 5B1HA 1MLDA 1R0RE 4M0MA 4QPDA 2QRVB 2F67A 2YWXA 3M4NA 1H2RS 3LQYA 4MS3A 3UKDA 4C14A 3CVWA 1GQOA 1N77A 2QTFA 1CS0A 3C45A 1L4GA 2GK7A 1XX6A 1ZOLA 5DRTA 3RNLA 2HIGA 2V03A 2WA2A 1E62A 2C1EA 3TTYA 1VPEA 5I7WA 4WRRA 5GOTA 3F98A 3E7XA 4X8MA 1E89A 2W2QA 1W4AA 4HZIA 3KSAC 1QVRA 1D6NA 1SA0A 2EWMA 4MR8A 2P6NA 4ZODA 4BO4A 1JZTA 3EVDA 4AL4A 3DBHA 3B3FA 2O3UA 5ALOA 3GT7A 4FQ5A 1LTKA 2EP5A 1E18A 3MS2A 1PYGA 4Q7MB 4A36A 2ZVDA 1L7XA 4WOPA 3ER8A 3WGGA 5ALGA 4LXUA 3GYGA 4HUJA 1ECCA 3KDSE 3NEYA 4MIYA 3H11A 2VJLA 1SK9A 2BKEA 2I2XB 4ZQGA 4N4AA 3MWLA 4ZALA 2IX3A 1CY4A 1GNQA 5F7ZA 4UPDA 3RFFA 2HUPA 2XW6A 2Z1NA 3IV9A 1XAHA 1QORA 5CT6A 3R76A 4EI7A 3Q12A 2VPZA 2ZT7A 4Z4HA 4REQB 1JAZA 5LIPA 2H3HA 3T3OA 4RD0A 5C80A 1FFCA 3GL9A 2JS7A 5KNCA 1YKGA 2R8XA 3I6IA 4ZVPA 1AQNA 5CITA 3K94A 1KXJA 1R5NA 1F4VA 3F6YA 2ZJ0A 3AEQA 2ZVJA 3LA8A 4NU8X 1GL6A 4MWBA 1MHTA 2I1LA 2POCA 3H2HA 4ZO9A 5JFGA 1H23A 1O5TA 4N41A 4M53A 2QPAA 2KJQA 4LHVA 1VYVA 3MGGA 4LX0A 3T3MB 4C0LA 2PUVA 1U4OA 2QK4A 1C7JA 1F2TA 3SPXA 3ID6C 1IRXA 2BFCA 1RPNA 1E4EB 4N9QA 4BYGA 1N2EA 3H0CA 1KRHA 3OJEA 1CUXA 4N5LA 5EWMB 3TXAA 3V8BA 4BKQA 1VSBA 4LXHA 3UHAA 2A67A 4ZV9A 5AVZA 1XKLA 4K81B 2I62A 3CZ9A 4KSYA 4LJKA 4QA9A 5C46F 1Q83A 1JQDA 5A4DA 1U7XA 2A7XA 1Q0QA 3OE7D 3DVLA 4LSGA 2V45A 3MLEA 1B6TA 1JHYA 1UZMA 1KGDA 1VLQA 3ANSA 4E5VA 4GU5A 4B17A 3W0LB 2AN9A 3B60A 5EIAA 4TV9B 1V48A 2ZRHA 1Z6PA 1ZGGA 2KSQA 4XLZA 1Y48E 5CLIA 4BX8A 3RF6A 1MEEA 4HL6A 2DKOA 4MW2A 1PO7A 1X1CA 2OPHA 6YASA 2YV5A 1LW6E 4IIXA 1IEQA 3SZGA 2QIPA 3K8OE 2REXB 4HLCA 4EI8A 1GUZA 1EFUA 1EVLA 2J8ZA 2WE8A 1I2DA 3F9RA 3GJ8A 3ROQA 3VZQA 5B4VA 1PDVA 2PZ8A 2X14A 1XKXA 3KQUA 1UKAA 4GG1A 1K4MA 3KYCB 2H0QA 4ZYZA 2OCGA 4I8XA 1W0CA 4KUHA 2VHVA 3A1FA 5SV2A 2I4NA 3NT2A 1T6ZA 1WUKS 2IXFA 5ALFA 5A7GA 2Q62A 2P9YA 4ZT6A 1E9EA 1KFBB 2Z9DA 5EMKA 2VS1A 1LPMA 3MWYW 1CDEA 4RC9A 3F7MA 5A9RA 1YA8A 3R6LA 1TK2A 4HUQB 4F5DA 5IXSA 5E8JA 2D8AA 1YIOA 3HKCB 4UUMA 1XRMA 4F6CA 1F0KA 3K32A 2XF2A 3H5WA 1YS2X 1ZK2A 3HLTA 2CHQA 3PG5A 2I4OA 4O63O 5A7FA 1CQIA 1PD1A 3H9BA 1SIOA 4MW7A 1GPUA 2WF5A 3PDUA 3UTDA 5DHTA 2QM7A 1XJCA 1FU8A 3RT7A 1QH8A 4ZAWA 1WW3A 2GMWA 2RHRA 4PGGA 1GVNB 4A1FA 3JQEA 1RPTA 2BFDB 1F4PA 1YB1A 2FRVA 1SQSA 1XCBA 4NBTA 1F2UB 5FTNA 4LJRA 4MTCA 4Q6WA 1L5RA 2QZJA 2D5CA 1UDRA 4TQUS 2BFFA 2EEZA 4QSHA 3MCTA 2J30A 1SCAA 4OQPA 4TMWA 3D4NA 2OHJA 1I9CA 3ASYA 3L1UA 1QDEA 4RE6A 1KMCA 1P9OA 2QTNA 3V9AA 1Z7WA 1GKKA 5LYJB 2HW8A 4JJGA 2WG2A 2Y4OA 5D5QA 4O2AA 2WYIA 3NBZC 4PZCA 4QD3A 4ABYA 2HJVA 3NIBA 4P3KA 2YXEA 5C51B 2VSOA 4O4HA 4X20B 1P0MA 2PS3A 3IODA 3LXMA 8LDHA 5EHIA 4Z9XA 2XZOA 3STVA 3GVIA 5ALMA 1GA6A 4HQ6A 4RADA 3CM0A 5FBKA 5J4VA 2ZE5A 1RZ3A 4WKCA 4QGAA 1EWQA 2V7UA 1BEUB 1RP1A 4PLFA 1OX4B 4RY8A 1OLSB 3KZOA 5FPHA 2IX9A 5C37A 3OX2A 1H93A 4QJ5A 3GLIB 2FZEA 2JGJA 3KQTA 1UCFA 2ZXFA 1IU9A 1GCGA 1I4WA 1Z74A 4CODB 3ZV3A 1FW8A 2E4YA 4EA7A 3TSYA 4E0BA 4OJTA 4AT1A 3PUJA 1KH1A 1SOVA 2N9UA 3E8MA 1BYIA 2WIJA 3HV0A 4D9IA 4ZVNA 4HVAA 4LDPA 1Q1GA 2D7CA 3DUWA 4Y3UA 3RSCA 2JI7A 4HK4A 3QU9A 4QGHA 5BN5A 3IUMA 2WM2A 2VBIA 2YDXA 1ECLA 1YI8A 2H4XA 1Z15A 3USCS 3GLUA 1UKEA 1W94A 2C61A 2L42A 5JT1A 2Q1WA 3DJFA 4R3WA 4JBYA 2HQRA 2XXAA 4KGXA 1GPWB 2XA2A 4Q4HA 3PJFA 4XYLA 3NZEA 3D8TA 2FPSA 1NN5A 1DUSA 3DHWC 4FJ2A 3WK5A 3ADOA 1KVQA 1BE8A 3FFBA 1CDZA 3NBAA 4JYMA 4MHOA 2PWAA 3G68A 4AP6A 4U0JA 3ABIA 1J0EA 4YMHA 1XN4A 2HSGA 3O93A 1KQOA 1CUZA 3JZMA 1EAYA 3R6DA 4TKMA 5HKKD 4O3MA 3UV7A 1F8YA 2PQ0A 3OOWA 4YMLA 4YAEA 3U7QB 2O48X 1MGOA 1MX5A 3Q5GA 3KKPA 4IKPA 2OFXA 2GTPA 1CBUA 3H1FA 2R6JA 3ILVA 3NXSA 1PLLA 4IRXA 1B76A 4GEKA 4CMCA 4H6XA 3NW9A 2F8MA 3WB9A 4J1TC 1M5UA 2PDAA 4GDMA 3AI2A 4ROTA 4EELA 3I5AA 1JAHA 4GXRA 5HILA 4ZCTA 2C7RA 2J0SA 1RJDA 4DARA 1HKUA 1I5RA 1TQ2A 2GFHA 1E6EA 1OMOA 2WJ4A 4WESB 1XMSA 2Y2UA 1ZUNA 3WJAA 5BPHA 3PLAE 3TW6A 3X1ZA 4D6PA 4D6XA 2DBRA 1XA0A 1FK8A 1QR2A 2I0FA 4QRIA 4UHDA 4L08A 4WPGA 5G0VA 1LLUA 2IIQA 5AVOA 2PSEA 4CM3A 1P1JA 1E6CA 1XCGB 2C7BA 3FAZA 3L49A 4ID9A 5L40A 3MT7A 1UBOS 1R9MA 2ZPAA 1FMCA 3OM0A 4O4LA 2ID4A 2FMIA 4J0FA 4O0LA 1JPUA 1A7JA 1NN1A 4MO2A 3LPCA 3GHYA 4DDMA 3ZH2A 3VHXA 2OCDA 1K7FB 2BGIA 1NPYA 1ONSA 3P9CA 3KAQA 1FNSA 4A91A 3QWAA 5B3JC 3MFQA 4RAQA 2YYZA 3AIOA 4IDOA 3CB4A 4OY3A 3EFOA 5CLJA 1TYBE 4QG3A 4W99A 4D42A 1G2IA 1UOEA 4YACA 4CYMA 1USUA 3B2EA 5G3ZA 5LR6A 1X9GA 1GA4A 1RAIA 3BA6A 4RSRA 5ENDA 2J9YB 3AUFA 4Q3DA 1ISSA 1C7FA 1VRCA 3GMTA 2FGKA 4LCBA 1GQFA 2P6RA 1G20B 2FR1A 1QZZA 3AUXA 4Z0NA 2FWJA 1A7KA 1HTWA 1PWYE 2Y0PA 4P4NA 2FP4B 2CUNA 4TV9F 2YICA 3AHCA 1MW9X 1N5MA 1YVRA 2KHZA 4N12A 4FEAA 2FPLA 1UDCA 3BD9A 3OMLA 3TOXA 1B1CA 1WDLA 1I6WA 3VM6A 4WEQA 5CLGA 3WK8A 3ZGVA 1NI4B 1V39A 4BGIA 3KR0A 4QFDA 4GICA 4XGNA 1BDBA 2C7VA 2E0IA 4LJ8A 3TX2A 4DY4A 1UF9A 1KYIA 5EJGA 1QOQB 4L57A 1T1JA 2VSYA 3F47A 4LOJA 4G84A 4IY1A 4ZCIA 2YMQA 1ECPA 5CD9A 2A92A 3LLVA 3O9ZA 1IEVA 1A1SA 1YQ9A 3FSJX 5IX8A 1W59A 1ORTA 4URHA 4G86A 4IH9A 2G5TA 1YJBA 3FNRA 2JLXA 3IUQA 4MYCA 2XRZA 2PQMA 2QVXX 2XCTB 3N0RA 3LVRE 4DSZA 3IOBA 6LDHA 2XUHA 5JCXA 3QF7A 4MKHA 4HZUA 1RBYA 4AY4A 3U4CA 3JWPA 2ZQZA 1VIVA 2VA8A 3QNWA 4QIHA 5DB4A 3P27A 5BORA 4J1TA 2WINI 3U49A 4BNHA 1DELA 5JRZA 1HEIA 3PNVA 3IHLA 1D5CA 3CEPB 1I4EB 1KEUA 5IEBA 3UGQA 1EHYA 3QBDA 1WZNA 2ZWPA 1L5HA 3OQ1A 4G41A 5EE0A 1RAAA 4DMRA 2RBKA 3JS5A 2QT1A 3R0XA 5TB5A 3WWZA 1V71A 3LUCA 3I6YA 2DB3A 4B4DA 2ERYA 4FT2A 3NCHA 4FI3C 4YRKA 2GJ4A 3WLMA 2ZI6A 3EE6A 4KE6A 3CZ4A 1E9CA 3BB1A 3V1YA 1BDIA 3EOZA 1XCJA 4NFYA 4Y2JA 1QGUB 2DPMA 3AGQA 3DTVA 4M7OA 1T8RA 2Z3WA 3L9XA 4OYHA 2H5JA 2BTQB 1AQIA 4Z99A 2FEAA 4MWTA 1TCBA 4P4SA 2UYYA 3GDOA 3UBTA 1O3YA 3HYSA 3O8QA 7GPBA 4NXMB 2R9VA 1C1DB 2Q0QA 1G60A 2YYSA 1N8KA 2E85A 4E09A 1IONA 2WD9A 4TSFA 3BXPA 4X1KB 1I2CA 2X6TA 1WDTA 3ADDA 4QUBA 3PVCA 4L2IB 3EVTA 4PPYA 5BV8A 1G6HA 1RWVA 2OMEA 3KQOA 3P94A 1XRPA 1G8MA 4I8IA 3K6SA 3N2LA 4D2IA 1XZPA 3OQIB 1BRMA 1ESCA 3PTAA 4ER0A 4XDGA 3C6BA 4QYIA 3VZPA 3BIFA 3A3YA 2OHIA 3PVZA 1D1TA 1RLIA 3UMMA 2PY6A 1YH3A 2QI9C 4WCVA 1NW6A 2J3DA 3GAFA 4TKZA 1MNQA 721PA 3KBOA 3BE4A 3P2KA 5AW5A 3NDJA 3KR2A 4F2GA 2AH5A 3CU5A 3E8XA 1O9HA 2A1TS 2RG1A 3O9VA 4S1OA 1BQEA 2GEJA 3ZI0A 1ZUD1 5L3SA 4R8VA 3HYTA 4WIAA 4B33A 4YJHA 6REQB 3RIXA 3ZDEA 1WZIA 3DF7A 4M9XA 1N4DA 2BFMA 5DXJA 5GZ3A 1ESZA 4ZI3A 1F6DA 3ESQA 4PVCA 3RC2A 3KKLA 5IYZA 3UJNA 2X0KA 1ULZA 5EN4A 3WL6A 1AM4D 2BP7B 5FV4A 2JKVA 1E1RA 1SHKA 1MFPA 2Z6UA 3EGCA 5JNUA 3CWQA 3MB8A 1INLA 1NX9A 1VKHA 2B5WA 1MDFA 2IEDA 2QOEA 2BM1A 4HNSA 4RETA 1JE0A 1SQ0A 4BIMA 1XRJA 1LSJA 1Z0KA 2ODPA 2W6QA 5AVSA 4DIBA 2HJSA 2ZE7A 2QN6A 4RPLA 4WKGA 4RQAA 3DMFA 3EMBA 3PUZA 3WYAA 4DJ5X 5LU9A 3EC7A 5LLSA 2C07A 3V80A 3PGA1 1U7ZA 2J5QA 2XGOA 3TLGB 3ROMA 4EY7A 3SX2A 4RJKA 1XTJA 4HS4A 3OLCX 4EJSC 2I6QA 4F7WA 2C4NA 2Q5OA 2V74B 4L5YA 4MVXA 3N75A 4Q4AA 2YJ6A 3R3JA 4B75A 5KYWB 2CDCA 2D2XA 3L0SA 2JLSA 3OJWA 4UW9A 1OYWA 5M34A 1A5ZA 1Q2UA 3K9LA 5JS2A 4E5PA 2QTVB 2GZSA 4PHHA 3SJZA 4FGJA 5E38A 4DDHA 4ZQEA 3TECE 4IOLA 3ERCA 5IJAA 5HJ2A 5JS1A 3VR4H 1G9TA 2H4ZA 2GCGA 1MC5A 1PR9A 1EG2A 2QU7A 2VF5X 3AI1A 3IDOA 4HVTA 4V1CB 3F5QA 4TWRA 3OIDA 3HB9A 1A9RA 1A9YA 3HVJA 4MPDA 2FN9A 4R2WA 5H7XA 4LDAA 5ES4B 5KQRA 5CYOA 3ABSB 1BZYA 2VIIA 1EHIA 1ZKDA 3F74A 4LXYA 5JYDA 5EUMA 2B0JA 2DBVO 4MP6A 5L4SA 3TM4A 2GCNA 2PE5A 4KGDA 2ZJ8A 3WJ2A 4FDUA 3DEYX 1DG1G 3O83A 2XWJI 4FC6A 1RXCA 4OUDA 4IIHA 5DWVA 3CX3A 3UJBA 1AGRA 1KPIA 4MITA 4GQAA 3RBAA 5BSEA 5ELXA 1DFIA 4K0RA 1VMIA 2O2HA 3CLSC 3ZKWB 3RNOA 5CW1A 3L6OO 3EBPA 4YLGA 2V7QD 3ETHA 3COZA 2A9JA 5A71A 1EPUA 5A4JA 3FKQA 2CJXA 3KLNA 1GZ5A 4L5IA 4OFXA 5AHRA 3UYKA 2EZTA 2P2LA 3UMCA 4XLLA 2UZAA 1FDIA 2W71A 1TECE 1XVAA 4KH0A 1L5KA 2E49A 2C2WA 3VAZA 1XRLA 1YS9A 2ZIXA 4HNTA 2LP4Y 2K2WA 1DKUA 1UPCA 4PX2A 3T7RA 1BHQ1 3CE9A 4WADA 2CYCA 3TZLA 4OXNA 4CI0B 1XD2B 1KFKB 1EFPB 1G4UR 3OIUA 1NMYA 3FPHA 3PDJA 3SHTA 4FMCB 3SM3A 4XVUA 5U9CA 4L4UA 4HQRA 2ZSUA 4LBVA 2VYVD 2XIJA 3D6TB 2GLTA 4AZWA 3PCXA 4HFNA 3ZLJA 5A5FA 3ISJA 4MV7A 1O77A 4EUFA 4GWGA 1N34B 4IPTA 1Z4QA 5DULA 5E2IA 4FNOA 2R97A 4JODA 5HMMA 5REQA 3FPKA 2IVZA 1RPJA 3G0IA 3I2YX 3CR8A 5L45A 4IZ6A 3RAJA 2ETVA 4L8YA 3DE0X 1XCMA 4PHFA 1AQLA 3H1TA 4EOGA 2FX3A 1E58A 1I5OA 1V3VA 4EY5A 5LA6A 1HDCA 4Q12A 1Z16A 1TJ5A 4LZAA 2I7VA 1EFCA 5LWQA 1NZDA 3F6SA 4Y1FA 2G63A 2QAGC 3PVSA 3FFTA 2NN3C 4HX2A 1ZPDA 4GKBA 4MLPA 3DZCA 5JBQA 5CBKA 4CETA 3PGVA 1F8UA 2J1LA 4BMYA 5TQJA 4D0RA 3ROZA 5FBVB 4HI0E 3RTBA 1E1CB 5IZ4A 2GVZC 3IAUA 4P3YA 5JNSA 3VA7A 5CEEA 1RLOA 4OAOA 1E9FA 4EO4A 1ZSVA 4CN9A 4BZWA 1F12A 2YC2C 4X66B 1K5GA 2ZM6B 2OWDA 4IJWA 1DXHA 4IUDS 3RIEA 4I55B 3JQ7A 2HJHA 1T9CA 4QRHA 4QVKA 1PD0A 4MKZA 5I7HA 1U4NA 2HRZA 3G1UA 4RULA 1CTQA 5ALJA 2VO1A 2JFUA 5LZ9A 1KMHA 3IP8A 4IDCA 4LJ7A 4UHKA 3VKUA 2OZVA 5L6LB 5AJYA 1FFYA 3HU5A 2IHTA 2HDHA 2D2FA 2ZFUA 4RQUA 3G2MA 1CIPA 2PO5A 3UHPA 4R0MA 2X42A 5JSFA 1BKDR 2O2ZA 1NMXA 3F6PA 4K2HA 5TGZA 2ZI9A 5HUHA 3PE4A 2EF0A 2JZOA 2AUMA 2RONA 3CE6A 3FSGD 3OU2A 5FEUA 1JL3A 1OXXK 2JLBA 5HIKA 3GUUA 1T9HA 1ZNWA 3MTJA 5LUAA 2WAOA 3OZDA 4CMIA 1PR4A 3KWFA 3MS4A 3PS9A 5JNLA 2E87A 5L51A 1RJEA 4GPEA 3PNLA 3TYXA 3SNHA 4JY7A 3JQRA 3T9CA 5K9ZA 1DXQA 1U0EA 1QRSA 3A7EA 3AEKA 3QKRA 2J33A 5IRCD 1NWHA 3WMXA 1COWA 2E7ZA 2Y3IA 1YR6A 2VYNA 1C9NA 1PL8A 3FVQA 3OCVA 5F52A 2X0IA 4BKPA 3TUZC 3I58A 3C14C 3RAGA 5K6TA 4Q1CA 1XTKA 3DFUA 2HGSA 2QIOA 1G9XA 1Q12A 2FZGA 1OIWA 4ZOEA 3LQFA 3P2MA 1FSZA 3ITNA 3R77A 4PLVA 2OYCA 1R0BA 1XTVA 4IW3B 1U28A 4NC9A 4CNBA 4NPHA 3PPXA 3W2TA 3RRXA 2F1KA 1F06A 2BEVA 3QLTA 4TSRA 4FOOA 3ROFA 3ZDZB 5K0GA 3OQVA 2JANA 3LM8A 3GZNA 4X54A 1PF7E 1CNEA 4DGQA 4NPAA 5DIFA 3IP3A 1E77A 4V0RA 5GJVC 4E46A 5KVVA 1Q7EA 1Z63A 4BWVA 4EBBA 2W2KA 3F49S 2ZT8A 4QGBA 1UL1X 1ZRMA 3QWHA 2NOAA 4NZ9A 4K86A 2A9OA 1W4CA 3GFPA 4ZOBA 3T9BA 4A2PA 1RTTA 1SC6A 5ETJA 5B7PA 2VZEA 5IBCA 2FMXA 4Y98A 4BNZA 3TGLA 1O08A 1OC4A 1RM4A 4Z1OA 3RASA 2W6JA 2EV9A 3GLKA 4C06A 1SC3A 4H31A 4ZQCB 5EE1A 4EW2A 3ZBQA 1NRXA 1WLYA 1EZ1A 4BBPA 1Y3HA 2QUHA 3QV2A 3TN7A 4BX9A 1J0DA 1E20A 1O6GA 2VF4X 2XE8A 4DSUA 1FFXB 1YE5A 1DJMA 3TTUA 4WKNA 1EVZA 1KK1A 1XC7A 1DRJA 3EZXA 3IXMA 1CNMA 1TC1A 3PIDA 3CRRA 4RTPA 1ECBA 1Q1BA 1ORVA 4HLQB 1AUQA 4BAZA 3FFAA 1NVEA 3FCCA 3WLJA 3WY9A 3NTRA 4D98A 4E1AA 4AN0A 2Q4TA 5FI0B 4NZPA 1N2BA 2OG2A 1T1SA 2V4UA 5A03A 1YIDA 4E7OA 4MR9A 4EITA 3WNVA 1DTWB 3PV0A 3G85A 3JQAA 1ZKMA 3PZRA 4W1SA 2B6HA 3KEMA 3VV3A 3ZV5A 1XTIA 2A30A 2JNWA 3M7IA 2PLFA 4GVLA 5CEJA 1FC0A 3Q7EA 2QZSA 2HOQA 4G5YA 1AJEA 3PI6A 3MT8A 4KREA 2Y1EA 4EMBA 2QLBA 3HSYA 4YO7A 3RDPA 3UO8B 1XVUA 4WNIA 3HKBB 3PFCA 3T5DA 4AIIA 5C5DA 5FHQA 1A9OA 3B5EA 2DHRA 4O6VA 4GI3A 1KYYA 3VU9A 1M0TA 5EZSA 3AX6A 3V4OA 1SB8A 3GROA 5HQJA 2ISQA 3VKWA 1RI1A 3GZ4A 5J4KA 4K87A 2ATIA 4QWWA 5I48A 3OKAA 3WNZA 3FOFC 3W5JA 1S6YA 4J9UE 5FO0A 4EHNA 4HQOA 3FX2A 1EJ0A 1NM5A 3GWGA 1DIGA 2RKBA 2WJGA 4FMCF 2GKOA 3RSHA 4A8HA 1Y8RB 5H3CA 1T6XA 1YR3A 2CVOA 2V7XA 1HG0A 3CKYA 1UBJS 3WMRA 3MINA 2O5VA 1DWQA 1VL0A 2QTMA 3FLMA 4QSMA 4WXRA 3EEOA 1AKTA 1PV1A 3EXG2 1Q15A 1OFIA 4UM9B 3MJFA 2J9RA 1LDNA 1N6IA 5EP2A 1YQQA 1T29A 5KX5F 4FIZA 3KBBA 2NWQA 5K0LA 2YV4A 4G3XA 5BNZA 3U4AA 1GZ3A 1GL3A 4RGQA 1MUUA 2IOHA 4MUNA 1YSCA 3CRNA 4UVHA 1SVNA 3ME5A 3QH4A 2BDTA 1H8HD 1J5EB 4TQ9A 5EHNA 2GEUA 1VC2A 2E4XA 4DCPA 3AVWA 1JT2A 2YS6A 2EBWA 1XNQB 1UJ5A 3CUEF 3HXQA 3U4MA 421PA 2MSKA 1L5ZA 4AY2A 1IEXA 1ULHA 1KYVA 3GZJA 2DLNA 4NJOA 4NJMA 2P6OA 4TROA 4XEHA 5IM4A 3F3KA 2P8SA 2R48A 4G5SA 4BQNA 3B7PA 2L69A 4Y9SA 3WHKA 4NCBA 1K63A 1LQTA 2R66A 2XCQA 1KDZA 2BAGA 4YJ3A 3M5CA 1JQBA 3GW8A 1NI3A 2BZSA 2F3SA 3VR6A 5JARA 3HZHA 4MLCA 1T9ZA 1V16B 1IM2A 1CJKC 2DUUA 2ZS8A 5KB3A 1T0JB 2Q2QA 4M1SA 4KCGA 1WIWA 4BNNA 4TLEA 4Z4CA 5BNIA 1Z5GA 4FC7A 4HX5A 4UPVA 1CJMA 4CKZA 2AJDA 4V0LA 4F6RA 1TMYA 4XM1A 3RYCA 3KPWA 4E2ZA 1RAFA 1U8UA 1YAJA 2KMLA 3ETCA 4WUTA 1AVTA 4JU8A 4UMDA 2GJAA 3MHPA 1YC5A 4LOHA 1YO6A 1Z83A 3ZK7A 1H65A 2DM6A 4LOAA 3PUKA 3BWCA 1QO9A 3DYVA 4JGGA 2GXSA 3KHSA 3ACCA 3E2MA 4MPRA 2ZUWA 4P54A 5DX1A 1L7VC 1IZ0A 1NVUQ 1B6GA 3A1TA 4KV7A 3DTYA 5SZHB 1TL7C 4LG1A 2CXQA 3PEYA 4UCQA 3OSZA 2PFGA 3FBTA 2VDQB 1II8B 2WPNA 5FWYB 1Q6YA 5HF5A 4YH1A 3Q41A 5FD8A 1RWNA 1DIBA 2QNIA 2RBEA 3QPBA 1U94A 4PCAA 3SBOA 3L4EA 1HI9A 5DX0A 3W1WA 4DT1B 1XQWA 3RS4A 1CE8B 1EGQA 2G9UA 4LJ4A 2IPNA 1RWPA 3NM5A 1FP4B 2V5UA 2YDYA 5H9VA 3ZVKA 4EFKA 1G17A 3JVEA 1DOHA 2WUDA 4Q9HA 1U2ZA 2I29A 3TRJA 2WSMA 4HGRA 3WA6A 1W5SA 1I24A 4CCSA 3IXLA 1EBFA 3EAFA 4Q21A 2OYRA 1HE8B 1E2QA 2ZSIA 1FDRA 1GR1A 2C0QA 5H83A 3VMFA 5HKBA 2CXRA 5JBIA 1E3WA 4RGVA 4DA9A 2QAJA 5HG0A 3U1VA 2A3RA 5G0TA 1LKZA 4HDMB 3H5OA 3JQ8A 4J2TA 1Q84A 4RMIA 1SEVA 1MJNA 1VGQA 1UBKS 4KH1A 2VP6A 2B5VA 2IY8A 2JFOA 1XTTA 2YN0A 1W29A 1N6HA 3PNSA 4WK2B 1A8PA 4XOUA 2FZWA 1CUHA 2QTLA 2DH5A 2EZ4A 3ZKAA 4J0DA 3WLOA 3SZRA 4X44A 2X58A 3BZUA 4Q9JA 3UMRA 4LMBA 3D02A 2BEJA 4DG9A 4JX9A 5A9SA 1H2HA 4BFXA 1GDHA 1XPRA 4Q02A 4CMAA 3FDIA 2C4WA 1CQPA 2XQFA 2GTHA 1U3UA 2VRCD 2BFAA 2JLUA 4OP1A 2K4MA 4JH0A 3VSBA 4BMVA 4E1BA 3L4JA 5BN4B 3AEXA 3R0QA 2F8LA 3FHOA 4GECA 4DBZA 1A69A 5HA5A 4MWCA 1QV9A 4YR9A 1NBHA 2NO5A 3C7DB 1PYOA 4G0MA 3WTCA 3KQNA 2Q5QA 3IALA 3L0OA 3RIMA 3SXJA 3V7NA 2DTEA 4CF6A 4HWTA 4Z2YA 1P5HA 4W7IA 1MTOA 2ZIAA 5CHYA 1NXQA 4BE4A 2CBXA 2XMBA 4LKOA 4F71A 2RE8A 3SVLA 1UFKA 4QUDA 4DGSA 1RP7A 5CFZA 2MU1A 3H84A 4D79A 1JN0A 3ZPXA 2H4FA 1Y89A 4B4UA 3PEWA 3DCYA 1ZIYA 1Y37A 2P2ZA 3HCBA 2IITA 4KO3S 3RSFA 1P2SA 3RFTA 3AY0A 3KHUA 4LYHA 5J1SB 1WMFA 5FI3A 3JAMA 2EL9A 3K70D 4I5FA 2DAPA 3IMKA 2M6SA 4OCZA 4UM8B 5CIYA 1DADA 4IINA 1IBRA 1VA4A 3TE6A 1NY5A 4R4JA 2HHJA 5K3FB 1SKAA 5LBUA 3MMXA 5CFLA 4RDXA 1RYHA 2QRKA 1AKNA 5KNBH 4KFUA 5L3RA 3RVPA 3WIDA 4CLXA 4B3RB 4X1YB 5HMLA 2W93A 2Y1LA 3BREA 1XCPA 3RODA 1QHFA 1SVMA 3QQPA 4KXNA 5IAJA 3GLGA 3FOAA 1IZZA 4IEIA 4C4OA 1Y3FE 3JATB 2C83A 1SD1A 3OJFA 1PW7A 2N46A 3AFIA 2D1FA 2DBZA 4MRNA 1ZA1A 5HWSA 4TS1A 2ADOA 1BN7A 1E2EA 4KIJA 2JZNA 3UT5A 1T15A 2CLSA 4R1NA 2BSQA 1EB9A 4K9SA 1TRHA 2C00A 4LF7B 4QLOA 1K86A 1WBJB 3LBAA 2A4MA 5TPWA 1EVIA 4S3MA 1G1MA 4Q3CA 4PLPA 2XQVA 4I9NA 4MCAA 4F5WA 3GRVA 4M1WA 3FCAA 1NRJB 1Z2AA 1KQPA 2D1YA 2HPHA 4HEJA 4NECA 3BTUA 5KAPA 3UGKA 1S7GA 4IDNA 4C3ZA 2FWNA 5CTAA 2CXNA 2R6ZA 2D74A 2JEOA 4ABTA 3I1IA 3UMBA 3KQYA 4P0TA 3A3OA 4DR6B 3QITA 3DD1A 4DZRA 4X6YA 1ZL2A 2FSPA 2VH2A 3F6EX 3VC2A 1FBNA 5DN6D 3V6MA 3GU3A 4X1IB 1Y63A 4UHEA 3EWSA 4AZ0B 3GLVA 2RC5A 1CRPA 4FYJA 1HNNA 4F4IA 3PKZA 5J4LA 2JK1A 3GLQA 2FWIA 3PEFA 4XPIB 1LBSA 1T25A 3UY4A 2X5OA 2HK9A 2D54A 1UKYA 2JGFA 4J43A 1O5IA 4Q3NA 4RL4A 3JD2A 3MHTA 4JLDA 4ZKDA 4KSCA 1ZK1A 2J5RA 3V8PA 3VAAA 1EMDA 1VCOA 1JSLA 2JEYA 3LVFO 5F21A 5FYQA 3TRDA 2JBWA 1JYEA 3QEAZ 1Z9BA 1LBEA 2IP4A 1AC5A 2PX0A 4BHTA 3OPXA 2QVZX 4G4SO 1LSUA 1VI5A 5DXAA 5JD3A 2HBZA 2DWCA 4XQEA 1IXYA 1XJWA 3UB2A 2FYTA 5E6UB 1OXSC 3MYRA 5BSUA 4R8RA 3STYA 3OCWA 4FQ8A 3WLIA 1FVXA 4AO6A 4S0XA 3RK4A 4IVQA 2R4UA 4JSRA 3MIZA 2PSHA 4F11A 4OHPA 4KQEA 2VYQA 5EJAA 4QBTA 5JDIC 5M2QA 3B20A 1ZU5A 4J4TA 4OQQA 4U6QA 1DZIA 1N9GB 2WUFA 4D57A 3DBOB 2P7HA 1FA9A 3FMIA 1LPOA 5LVAA 1FRVA 1DAIA 5KOYA 2HR1A 2XOXA 1L4HA 3M6FA 3FR8A 1G98A 5GINE 2CK3A 2H63A 3SSMA 1G8JA 3MWDB 1IH8A 1PKXA 2Z8XA 3SJBA 5IEJA 3SR0A 3RSZA 1WP4A 5J1TB 3LA6A 4KLNA 3UV6A 4KLRA 5TXGA 4PYNA 5EJMA 3DBRB 4XH9B 2OB2A 4B0PA 3I12A 3LC1O 1KI6A 2XHZA 3X1JA 4DIKA 4C87A 4FZ5A 2KLHA 2QN8A 4Q3BA 3UAGA 2HSWA 1QHHA 2QL6A 3NH9A 5THQA 3TLMA 3ZZ0A 4AYWA 3ZU4A 3AUTA 1UMCA 3L1KA 3MELA 2J3IA 3ND9A 4J16C 4JS0A 4G63A 1FTGA 3D2AA 5D6OA 2WABA 4DJAA 4H27A 2WYOA 3H8JA 1O8CA 5DTEA 4L5BA 5BYBA 3HBJA 2GZDA 3CPEA 4UNPA 2YQ5A 4LY3A 2NO0A 5E6SB 4E4YA 2OHHA 3LF2A 3T7SA 3RTDA 5H81A 2X5JO 2QV0A 1HE2A 4FX5A 4HTAA 2IYTA 3CF4G 1AKQA 3A1DA 1K9SA 2XZPA 3R23A 1R6DA 4RSMA 2EKDA 1RIIA 2YWEA 4UVDA 1ACLA 2WMDA 3NATA 3ITEA 1DEOA 1VG8A 1JEEA 1XQYA 4BO5A 5FLXA 1GRRA 4H7IA 4KN5A 5T5QA 3VR2D 4DMGA 4MMZB 3ZS9A 2AN1A 4HMPA 1VKJA 1T26A 1WR8A 2QROA 2NU8B 3VNSA 4F96A 1AGXA 3EXIA 4EVIA 3VDQA 1RVDA 1N6RA 3CLUC 1J8FA 2ATXA 2Z95A 3EXFA 3ABQB 4BASA 3MUEA 2IZ5A 5SYMA 1XEXA 3B36A 4PLGA 3ZY6A 3QE9Y 5MN6A 2ZRIA 3NUGA 1ZOSA 2YJTD 4KMRA 3WWCA 3CV3A 5F1YA 3OUUA 2BN4A 3M1AA 4QPZA 2OEPA 3HJNA 1JAXA 4A4DA 3M1YA 3BGWA 4LXQA 5H0IA 1IN1A 2V6IA 2CB0A 4ZDWA 2C5EA 3GAZA 4JAVC 3VH4A 1YBVA 2VJMB 3EG5A 4XUEA 5DKFA 3OBBA 3ZHVA 4DSAA 1MB2A 3VZCA 4CU2A 1WO8A 2QW0X 3DEFA 3HJTA 3IPAA 2O8BA 1AX9A 1VMAA 4MA0A 5ED4A 5K3CA 4D56A 4KAXA 4UHHA 2WF8A 4UTXA 1US8A 2FFJA 4ETNA 3JASB 1WB9A 3B6KA 5B2FA 4CKCB 4BO1A 3EAQA 2VP3A 5BY2A 5FPYA 2AXEA 1XQ6A 2OA0A 4JI2B 4MWOA 1N5IA 1RRCA 3N2GA 3VBCA 4OP2A 4L16A 5BMVB 4BFZA 1QRUA 4Q3AA 4I9FA 1OIVA 1YB6A 4KI0A 3FPSA 2QJFA 4YNBA 5EMLA 4Z0HO 3COSA 4OIMA 1U7DA 2QENA 1K3FA 1XRQA 2BFEB 3RKUA 5LIRA 4TV8B 3ZTYA 3UZUA 1ZHOA 1XJ0A 3LPAA 3WDSA 2ZUDA 4Y2UA 1HYGA 4Z3OA 5KO2A 4F45A 4WNAA 4XYMA 2AJCA 3N0WA 4OYLA 4UBOA 2X8AA 2Y1KA 1GSIA 1Y5NA 4W8HA 1I01A 3EYAA 1N6PA 4IIGA 4RF4A 4UXJA 4CM5A 3AF3A 5LQKA 1PQ4A 3HPQA 3RHFA 4DRXB 1MABB 2N1MA 3EZNA 3V2UA 4W5RA 3FCOA 1Z75A 3EW7A 1C2TA 4WZBB 2HFKA 1HTTA 3ET5A 1W581 2GK6A 4NAUA 1R0XA 2ZBVA 3D3QA 2H92A 4JZYA 4LBZA 4TYQA 3OO1A 4V0SA 4WKBA 4EVQA 5HX7A 4GL2A 3CF0A 2VTBA 2AVNA 1FS5A 1QB8A 1X9IA 3EULA 3FLEA 3JPWA 1GDDA 2XBLA 2AUTA 3G5TA 4HLUC 4Q3OA 2F4VB 1S96A 1UIMA 3MXOA 4DCSA 5FR1A 3Q8XB 2JIDA 3AP1A 3HCOA 5ANRB 4LYAA 2XAAA 1QJCA 4AUNA 9LDTA 2JHGA 5KYXA 4KYTA 1ZP6A 4OLHA 1WD7A 4XGQA 1NKTA 3O3MB 1YTLA 3D3KA 3I1JA 4FYYA 4HEHA 4A3SA 2JH8A 1ZYUA 5AXBA 4YMVA 1JYFA 2H1IA 3DLCA 4RW0A 3IIIA 3ZWBA 1E2GA 3LUDA 3RVBA 1K0FA 1U98A 2P6UA 4CKXA 1GNRA 4ML3A 5I9LA 3ZGZA 1Y9AA 5CK5A 2YNMD 1YR8A 4GVXA 2WQZA 1UBUS 3MLAA 2J41A 3R75A 3VC1A 3TXYA 1MV8A 2GBIA 3U7JA 5C5EA 3PR1A 3AF0A 1D6SA 3DZDA 4OHBA 5BWOA 3LBIA 1EXNA 2P5TB 5FUYA 1O89A 4BNDB 4CWAA 5HF8A 3GCWA 3PXCX 5LLTA 4E94A 1IHXA 1P81A 4REQA 5CYPA 3SF0A 4UU8A 4IV0A 2UZIR 4AG3A 1P19A 4RZQA 1EVEA 4JYPA 1T9AA 4MJXA 2XITA 3WRYC 1EBUA 2KPOA 3DEJA 3K5WA 4ZD6A 3W79A 4E70A 4QGSA 1CUBA 2PUAA 3RADC 4B6JA 3GRRA 2IUEA 2RAUA 4NFLA 3ZDYB 1PN3A 3GT4A 3CLRC 1HEYA 3L6CA 5DBGA 4PNPA 2VT3A 4AZVA 5I8PA 1WXEA 3ZHYA 3L02A 3ES9A 2IBMA 2VK4A 3TMAA 2ZIFA 3JWIA 4OQNA 3VISA 1J33A 4H3VA 1DXYA 3BWDD 1XZNA 4MPJA 4YEDA 5FUXA 2PYDA 3DPUA 1YUNA 4MV4A 5CGZA 5A3JA 1FX0B 1L4EA 3ZIUA 1L7DA 1LNSA 2ORIA 2ZBQA 3NRJA 4TKLA 4QUEA 5EE3A 3UJPA 3DMRA 1XDBA 5DSXA 1J0BA 2ETXA 4QOJA 2FPMA 4B8ZA 2WJ3A 2J0QA 2MINA 1G7CA 3CX7A 3EFEA 4RLHA 4G07A 3T8YA 3TZKA 2FXIA 4IJMA 4TV9A 4UCFA 1L6IA 3HFRA 5AVWA 1SVWA 1U3FA 1RABA 4XGRA 4CM9A 3HMQA 1I4OA 5AM1A 4WJLA 5EZYB 2XCIA 2PLNA 1VHJA 2Y66A 1VCIA 3JAKB 4GYJA 4YFYA 5A05A 5K0SA 1MVLA 2B36A 1TX4B 2WSYB 1M10A 1E60A 1E1QD 2OENG 2QSYA 5CX4A 1V1JA 4HDKB 4M0LA 1UEXC 2J0UB 1DRWA 3OPNA 2DULA 3BGDA 1V7PC 1Z82A 4JBXA 3TBHA 4KP7A 4JZKA 1TA9A 1J56A 1M6VB 2CD7A 2WJPA 3KKMA 4U6SA 3S2GA 3LCUA 5SY6A 4ZCMA 4OU5A 1EUZA 3C3BA 2WV9A 2X9NA 1NL3A 1JA0A 3G9ZA 1JDJA 4S35A 1HXHA 4XA8A 1SWVA 4RZXA 1EUQA 4F1KA 2D7DA 1Z6QA 3LLSA 4A8TA 3FWYA 4FKZA 5KSWB 3ZNQA 1RJWA 3PQDA 1BEZA 1RVV1 2XSZA 4PIPA 5FRDA 3LAWA 3RVJA 5A5EA 2XE4A 3RS5A 4BC0A 3GYBA 3QIVA 4CLEA 3GLFE 3GELA 1H69A 1VGVA 2PN1A 5FXMA 1IBCA 2QMOA 3A32A 1PP4A 3G2JA 3ZHZA 3GOQA 3AQ4A 5FTJA 2EXXA 4OSOA 4YLEA 2HPAA 4B6FA 4FIDA 2BFDA 1B15A 1ZH8A 2DF8A 3WGQA 2JFZA 4LHSA 4U7GA 1NNI1 1I30A 3IKLA 4XUDA 3UXEA 2Q4EA 3WRYA 3D6FA 4F5EA 1AHNA 3D43A 2W5UA 2C4MA 2Z4SA 4X61A 4S1TA 3T9EA 3BL6A 5D00A 1ZOOA 3KJXA 2VXYA 2PUDA 3CUSA 2ZJ1A 2WJAA 4H18A 1CZUA 1GRQA 2YX1A 5TIIA 1QIIA 1TYDE 4X20A 3CNHA 2B1QA 5K0FA 1JKJB 3WB2A 4ZVKA 2NU9B 4IXNA 3ZGYA 5K45A 2YMMA 2AJBA 2F48A 3RS0A 1HTBA 1RQPA 5ECDA 2YWDA 2WTBA 3O4JA 4M8SA 4RVNA 1S2NA 5HF9A 4EI2A 4X97A 4Y2VA 3SVTA 2D8MA 3KE8A 5KYUB 3C5EA 3E82A 1W5BA 2JA2A 4XQ0A 4RGBA 1OX4A 2BOVA 3EA0A 3SIRA 2IELA 3HYCA 2C29D 5F76A 4BB9A 1W87A 1W4ZA 4AZ3B 3KJQA 4ZYVA 1FYFA 1UKVY 1IIRA 2VPYA 3E9NA 3LPDA 3K72B 3NC4A 4BPRA 4F4JA 5I7VA 3UGJA 3HCWA 4BFWA 1GQQA 3C97A 4B09A 4I5EA 4QBIA 4WCFC 3K9GA 2H1OA 3E81A 3QY9A 2AOVA 2OWEA 5KU7A 2VP5A 4MWGA 3DEIA 2PL9A 4UEWA 3NBMA 3NHPA 3NG1A 4I1RA 4IL5A 4ALMA 9LDBA 3WNBA 5KIAA 3JPYA 4G1MB 2V0CA 3I64A 1VLZA 3DOJA 1XYVA 1FMTA 1NRWA 5DBFA 3OZWA 2BE9A 2XMZA 4YV2A 3ZCRA 2QM0A 1EB8A 3FTPA 4ETWA 2R1TB 1P45A 1HL3A 4CV2A 5DK4A 1I9GA 2HLNA 1K7EB 2IDMA 2ZBGA 3DNFA 3HKEB 3QEMB 4MIEA 4ZVVA 3WSTA 4F8EA 3TRIA 3DNMA 1C8BA 3GP8A 1IUPA 2WU3A 3JRNA 4HD8A 4C3OB 4GC5A 1JT9A 2Z5FA 4GUDA 4E7PA 1USKA 2JGNA 3RTAA 4CL3A 4DTIA 4V39A 2VTKA 1UAAA 2Q7XA 2WFLB 3GOHA 1DX9A 3JQ6A 4ED9A 2GAOA 3O4GA 4R31A 2EW2A 1B26A 4BCDA 1ZD2P 2GN6A 4L02A 2NO1A 1A04A 2NX2A 4QARA 1EVKA 4YTEA 4E51A 6PFKA 3DR5A 5K0CA 1VA5A 2VF2A 4NNJA 5KCMA 3TAHA 1UC5B 4N6OA 3EPHA 3ZY5A 2IHKA 3LNTA 2O2DA 4Y2SA 2V8BA 2NUAB 3RW9A 3M83A 2NTEA 1WNTA 2FUKA 3PYMA 2CT8A 2BKLA 2QJOA 4II2A 5KYXB 2ZUBA 2PV7A 2SECE 4QECA 1L5NA 3LH5A 3R7WB 3W05A 3REOA 4WESA 2IYRA 1XZFA 4S1WA 4G0ZA 1ONNA 3DFIA 4EGAA 2P6MA 3WDMA 3HO1A 2NP6A 4CDNA 4NBVA 3KJEA 3R3YA 1WPGA 4ZGWA 3P4XA 3NIWA 3AHDA 3VYTB 2FPXA 4CMBA 5KUTA 2X9QA 1A9ZA 2HU5A 4FD3A 4O4JB 3ML1A 3OZXA 3Q6NA 3N05A 3MGBA 4WFKA 5IF3A 1U2RA 2ZPUA 3UJDA 4RQBA 2B8WA 5EIFA 3SC3A 2VDRB 5LMCA 2PMFA 4G5HA 3TLJA 2IH5A 4LJ6A 5ALEA 1RC8A 1VXRA 4HTFB 3ZOZA 3L41A 1UANA 3O91A 4DTCA 1PR6A 4D9JA 2G4CA 1GHTA 4NE9A 1IHDA 2PAFA 4FR2A 2PWYA 4XWOA 4KQ6A 3A6ZA 1LI4A 1N0IA 1PG0A 5IUJC 3C2QA 2PUGA 4YCAA 4KTVE 4OXRA 1O97C 2PKYX 4QFCA 2ZBRA 3NTVA 4B48A 3Q3IA 2IPXA 2GBPA 1N1EA 4UD6A 3GZTB 4Z0TA 2MMCA 3BF8A 2ZT5A 1KY3A 2AI2A 5E3HA 3THYB 1EDBA 4YAIA 3BH0A 1G20A 1U9IC 2AJLI 2GCOB 2W6CX 1J24A 1BJRE 3EJWA 5E7MA 1LUAA 1KVSA 1XVTA 1HPLA 2FP4A 3FZGA 3OCXA 3CQ9A 3RYFA 4Q1DA 3P2OA 2HH9A 1O0BA 4RV9A 5ECGC 2DE0X 2WT9A 1S9DA 4RK4A 2J5XA 2Q6OA 1I14A 2Z2ZA 4K9NA 4DJTA 1U8AA 1AQ6A 4RLFA 1ODFA 4AKTA 4M9ZA 4EHBA 1RZRD 3HDQA 5IU6A 4EBFA 4RZUA 1KH3A 4DLBA 5AYVA 1L8OA 3NHZA 1WWKA 4C4TA 2B7LA 1PQUA 4H1VA 5ICGA 5T4BA 1KBQA 2DRIA 4BMSA 4QBGB 4AJOA 5DT9A 2X7XA 4HH1A 4YVFA 3Q4GA 3QOWA 2I66A 5I7UA 3PHGA 4IG4A 1EFVA 1Y34E 1ZEMA 5JSZB 1X80B 4IQ8A 1QFJA 1PUIA 1TU0A 1FSFA 4XIJA 4A6DA 2ZSFA 4QHSA 2AG8A 1CR0A 4GOND 1VIYA 5LL6P 1LPNA 3W7BA 4YRBA 1G0NA 1Q21A 1KDOA 2EJUA 3R44A 2XYPA 3GA7A 1X3LA 4GSLA 2B7BA 1G8GA 4I1UA 5CM2Z 1Q77A 1J2TA 1Q7GA 4JLNA 1KP2A 2RGCA 4W5TA 4D1YA 1XTZA 3BFVA 4G2NA 3RJ5A 2R6CA 2JLZA 3LDFA 2AEEA 1LRLA 4X84A 1EK2A 5HJ7A 3O4VA 1DKOA 4AJEA 1DOZA 3DC2A 3BOSA 1NVKA 2BGLA 5I7SA 4MDHA 2EQBA 1F7VA 5K5EA 3TUIC 3PHLA 1TYAE 3BIOA 5BWNA 5DT2A 2BMAA 1F2DA 4F7DA 4FDTA 1TM2A 2BTQA 2WZCA 4L9RA 1D04A 3K16A 3ZW9A 2IYWA 2EQAA 3H8WA 1G3IA 4OQYA 1IAQA 3FAKA 3BRCA 3MUFA 4MUFA 1CX9B 3U48A 4BBJA 3BK7A 4W9NC 4YT4A 2JI4A 4WKOA 1OIXA 3AY6A 1IVNA 2X0NA 1D09A 1QCCA 3ILXA 2OP1A 3JD4A 5COQA 2QPTA 4PX5A 1J06A 3OQIA 4D81A 1QLWA 1TZJA 3KPJA 3OPYB 3QKSB 4L15A 1Y81A 2FW8A 2Z5LA 3BRSA 4FR5A 2NNWB 3W6NA 2YZMA 4MW6A 1EWRA 3Q9NA 5KNBD 4Z7OB 1JHRA 4U9IS 4I66A 1V8OA 4WN9B 4ECEA 2WSSA 2POQX 5K51A 3SVZA 1UEJA 2C20A 2O2GA 2P77A 4JXKA 4MQ5A 1GKLA 4UOQA 4RKYA 1P2UA 1Q14A 2CUTA 1S3IA 3JTMA 3T7CA 1KZGB 4PY2A 4YCBA 4J3NA 4NCHA 3UV3A 2RCYA 6REQA 1D2RA 5TQVA 4KGVA 1SKUA 3QXXA 2PMWB 1AS3A 1WMBA 2W8BA 3L92A 5ALVA 1MENA 3VR3D 3U17A 3WNQA 4BP8A 3ZEAA 3CVUA 1AV6A 4EUNA 3HGMA 2CLLB 4LW8A 2BP7A 5ARCA 4HDQB 2O6LA 2QX6A 4I4NA 3DTTA 3OESA 1E5VA 2P9CA 4Q19A 3U4QA 1E2MA 1GWNA 1Z5WA 2DPLA 1NE2A 2FK7A 2FZVA 2QRJA 5CB4F 1N0VC 3DOEA 3BJMA 4R9VA 2WG0A 3QIAA 2I80A 2ZE8A 3I37X 1FNCA 1K2WA 4NCKA 1ESNA 2OXIA 4QRDA 3V1TC 1AUVA 2FSUA 2WP8J 3IDQA 3ONDA 1DC8A 1NTRA 4MW0A 3V4SA 2Z8YA 3G2NA 1TCCA 3DAFA 2Y67A 1S8AA 3SYRA 3RAEC 2H1CA 1WPRA 3MMPA 1B93A 1VIAA 4I4TB 2QR3A 2JGIA 2JVJA 1XDGA 2P78A 1PR3A 3AUSA 3FKSA 3ISVA 4PEVA 5KYWA 1H66A 2QRHA 2ZKIA 3H2JA 3RVDA 5IG2A 1C0IA 4YI5A 1WUTA 2AR7A 5GGXA 3ZGLA 4DLTA 4E5KA 1ID1A 1YRYE 1ZS9A 2H2DA 3VX3A 1HLDA 3GXBA 3I9NA 2HMAA 1XZJA 3MZ0A 3O74A 4TGLA 1IVSA 1TCUA 4GPZA 3NTUA 5EXPA 5I7RA 1PS9A 2PUHA 1FDWA 4DCGA 1PR2A 3Q7QA 4L7VA 2QM3A 3WK7A 2G70A 3D8RA 5HRUA 2FEWB 3JD0A 1A71A 4UAJA 3BFPA 3QYAA 2WB2A 3K1YA 4GGOA 3QI2A 1W35A 4PG4A 2X8JB 3I9LA 5BNWA 5EI5A 1Y9EA 3HNOA 4FFDA 3SR4A 4U39A 2C5SA 2X0RA 1FL9A 1R4MB 1RE1A 2R62A 3KOUA 4RTNA 1CC1S 4ARZB 5KKNB 1E8MA 3S2FA 4RCYA 5T6BA 2WYVA 1TJYA 4AVYA 2HO4A 4EX6A 1RYDA 5BQ3A 4B8WA 1F8GA 3QW4B 4YRRA 4C6TB 3E58A 2RBGA 1WU8A 2VTDA 3L0YA 3U3DA 1WB5A 2QYTA 3AKDA 4P2BA 3KFXA 3NHUA 3EZ7A 3V97A 5IN4A 1W36B 3FGOA 2HA7A 1WX1A 1F6WA 2BZ1A 1G41A 1VRVA 3K0AA 1HBJA 2FR8C 1WQ1R 5FBZA 1XDWA 221PA 4P93A 2IYXA 4YP0A 4PAOA 3KDPA 4AURA 1B41A 3V4LA 2VP2A 1O58A 1XD2A 1EFPA 2CDNA 2O1SA 2QYHA 2HQBA 4JLJA 4AB1A 3JY6A 1DWPA 1W73A 4FHDA 5BSVA 2BKVA 5JNTA 3TTXA 1E3DA 3NLLA 3IBFA 1Z25A 1O94C 5TEWA 2BISA 1EFKA 8AT1A 5ALUA 1JXQA 3E2IA 3CRVA 4A6XA 3PC7A 5KX5A 3A3PA 1FSPA 3OJCA 1JZQA 4W5NA 2XNDA 2AEMA 3LUBA 1BGVA 4YALA 5DWDA 3GB9A 3ITDA 3KZKA 4M9UA 5TGTA 3V5NA 4RHXA 1KAOA 1GXSB 3H5LA 4WVLA 2R7NA 2Q99A 1L4LA 2HAEA 4IHJF 1J70A 1JKXA 5AVKA 2PGNA 3UCEA 2YS7A 1XZMA 3ZVRA 1PVOA 2GAJA 1L5SA 3EUAA 4U2GA 3L1JA 1KEPA 4J94A 2HWXA 4NCXA 2CB9A 2J59A 5F7JA 1OXMA 1O95A 3E3MA 3ELBA 4J3JA 4U3JB 4R81A 4XR4A 5FNVB 5KDLA 3S1AB 4B3CA 4C7OA 3KZVA 3FROA 5D5HA 1DAFA 3VVBA 4JYCA 3OEEA 3V4RA 1E1CA 4NABA 2DEUA 4BP1A 2QV7A 4CLDA 4TZ6A 4B45A 2MJLA 4BQEA 3BM5A 3DUFA 3K5PA 5KNDA 2F2TA 2DPYA 3DPSA 3GT0A 3TSZA 3ZI7A 3SS7X 4DM7A 4QJBA 4P2GA 1R9GA 2DYKA 3IQWA 3LZCA 1LC0A 1P72A 1II9A 4MV5A 3PBKA 4PRZA 4M38A 1AS2A 4YY3B 2O2EA 1COZA 4HSEA 3OIFA 4R5HA 3WRWA 4R98A 1JV2B 4ALJA 3HVKA 3SG0A 4B80A 1H2XA 4F0JA 4CR7A 2G09A 2ZR7A 1M2VB 1OGYA 1Y0BA 2WMOB 3HI4A 4IVRA 4QT0A 3UA4A 4TLMB 2OV4A 1U6JA 1XZDA 4ITRC 2WIGA 3KSDO 2D1SA 1M33A 3UWSA 3ODGA 4XI9A 2C5HA 4DV6B 2EDCA 2WWXA 1P2DA 4DIUA 2IXTA 4ND7A 4I4IA 3A9VA 2X76A 3LIPA 4JA0A 1JWLA 2FLVA 4EO9A 1U7TA 4W1QA 3E9YA 3PXEA 4R9SA 4EK9A 5KQPA 1WHSB 3NBUA 4N7BA 4NARA 4WY8A 3MOSA 2HK7A 1O54A 4FCCA 4KSBA 1XP8A 3RYHB 4C5BA 5AM5A 2VUUA 5AHOA 2DBQA 1G8FA 3D54D 2VJDA 4DA7A 2FFRA 3A6KA 4CR8A 1IJKA 5J2UB 1SULA 2CEAA 4BCBA 4KQ1A 3TRHA 2GA8A 2BHTA 3AHEA 2X5XA 3RSSA 4I6EA 1SKBA 4MULA 2OBFA 2A88A 3BIJA 1IWOA 3I2IA 4UVEA 1SGWA 1ZBQA 2QGNA 3GH3A 4YAUA 5HJEA 5LKRA 1M0WA 4AU1A 3O0TA 3P9PA 4UDXX 3NTOA 5FF9A 2FWMX 3B2QA 3DKRA 4CIDA 5CB4A 8ATCA 2VJYA 1PG5A 2ODNA 2Y6UA 4KN6A 3TFQA 1OFVA 3B9BA 2G7ZA 4CM4B 4JLVA 3OIGA 3V34A 3VJLA 2FRDA 2ODEA 5HFNA 2PMKA 3HNPA 4DKJA 4P86A 5CTJA 5DMXA 3RVKA 3D4LA 3IP7A 5GIPE 3BQNB 1QIMA 3NBXX 4Y18A 4I8DA 1M8FA 4NV1A 1QFMA 3JU3A 3PD0A 3OFVA 4D4IA 5DK6A 3THXB 4FOPA 4NKRA 3GFFA 4ZHQB 4Q1FA 2QUKA 2EOAA 4GMFA 5LMZA 4BXOB 4I3FA 5SYAA 4I4TF 1SKMA 1WY5A 3BE6A 3RRJA 2CL5A 1EK6A 2ZOSA 5LP6B 2Z8YM 2DCUA 4PG5A 1YZHA 4LRXA 5GOZA 4GAEA 4RA6B 3BAFA 4KMMA 2PL5A 3E23A 3K0HA 5LQCA 4CEJA 2YHIA 3QU2A 3RARA 5E9AA 1FFXA 2W2LA 1H85A 4TL6A 3LSTA 4X0EA 2O3TA 2Y0DA 3DKPA 4JJ6A 4WOCA 4DLPA 2E9SA 4I50B 4LISA 5TX7A 1L5LA 1CETA 3NKVA 1PT8A 1P1KA 1JA9A 4J2OA 3X0DA 2ZU0C 5JNRA 4B3TB 2XTMA 1MG0A 4I1SA 3HU1A 3WYFA 4KNWA 3THOA 1L7MA 2UVPB 1X70A 4X3PA 4CR6A 1L5QA 2J3EA 3LO5A 3WGUA 1DTWA 2GBGA 2ICAA 4UTRA 2Z0MA 4BJ3A 5F77A 1D2GA 1LTHR 3A05A 2XKAA 3KV1A 2XUJA 2R7LA 4XCVA 1FU7A 5ADWA 2ZB3A 4JWTA 4OLFA 4GRAA 1ZVJA 3PU6A 4GT1A 3S2SA 4JXJA 4M0KA 3X1DA 1YDHA 4XDHA 1JWBB 4AP9A 3PHJA 1FUEA 1K27A 1JQ5A 5A2QA 1TTPB 4NG4A 1TQ6A 3HKBA 5CK4A 3X43A 5IH7A 3K53A 1H05A 2TS1A 2Q5LA 1SBNE 2GF2A 3S70A 3ZGOA 1E0KA 3LQ4A 4UVIA 1WL8A 1WTAA 1SU6A 3GUZA 1NUAA 3LG2A 3FUVA 4TLAA 2LCFA 2RAVA 3LP5A 3T7DA 2R8ZA 4OH1A 3P20A 1YV9A 5I7FA 4FEYA 2QR5A 3KAPA 1IY2A 1H5UA 2CFTA 4A6PA 1YB5A 3T12A 1XL0A 1PZMA 4GS5A 5H59A 5I4CA 4M6WA 4MQUA 3K5HA 1B00A 1N5OX 4MV3A 3CVYA 1GCAA 2CEKA 1HDEA 5IVIA 3NDIA 3CTPA 3G2QA 4F2DA 1ILWA 4RTOA 1O57A 4MKFA 3OZEA 5I4IA 1IJFA 3ROTA 3ZGXA 2OHFA 4WQMA 2V7PA 3TR5A 5JC1A 3HVRA 2B1JA 1PGNA 1E6LA 2D3TA 2IP2A 4PFKA 3KO8A 4YXFA 1UPXA 4PYMA 2W0MA 3OZUA 2OCLA 3SEZA 3BMXA 4DG8A 2NZVG 1DKQA 3ILYA 1N4AA 2KM1A 3QUSA 1MG5A 2V5VA 3HP1A 3U3ZA 3EHDA 3F2IA 1ZSNA 1V3UA 4L85A 2FOLA 1Z5NA 4D9FA 4EF6A 2BC9A 1ZM4A 4ENRA 5BUZA 2GUWA 1D4FA 1X94A 1H0RA 1YK1A 3B13B 4HWSA 3WIVA 1W5FA 3SYTA 2C8JA 3R5HA 4U7PB 2FUNB 2AE1A 1P1BA 2H9AA 4Y6QA 4PLWA 2DT5A 3B6EA 2O3JA 3ZOKA 3HPRA 1FFHA 3ENQA 2G6BA 3W2GA 1E2NA 2ZRFA 2V96A 1JDPA 4OL9A 4LKRA 1JFFA 4LRUA 1USIA 4ND1A 2NO6A 1U8EA 4AY5A 1NJFA 2YZ2A 1PWZA 2VN8A 1M6EX 5IKPA 4BVHA 3VPSA 1EJ2A 1PAUA 1XDUA 4QFMA 1BDJA 1BOOA 5CA0F 1DJQA 1KSFX 3B6IA 2I6TA 3R6WA 3WG9A 5C1DA 1V37A 2ACEA 2OBMA 2VVTA 1K6XA 3K7EA 2EZ9A 2ZTUA 2Q1UA 4UD2A 1TKRA 1WV0A 1FP7A 2WI8A 1U0LA 2X0JA 3LPNA 3CT6A 3MF4A 3QMVA 4J49A 3EIFA 4ARVA 5MHTA 1T9GS 2BI7A 3GX1A 4QASA 3WYEA 4B73A 1P4RA 2PJRA 1UKCA 1NXTA 4MGIR 4NE7A 4TKVB 3WGOA 4RMGA 3S3TA 4GR9A 1X1DA 1GGMA 4G9BA 4NCNA 2ZI3A 1FMLA 3A4IA 3A4TA 3G5AA 1C9KA 5K09A 5ICSA 3RK1A 3GFQA 4CUZA 1R16A 1IZ7A 2PH7A 1L8QA 4GC9A 1N6KA 3BBPA 2FFAA 2NQTA 2R5NA 4YV1A 4JELA 4RHFA 2BCJQ 3MJ4A 1GAJA 3DB2A 3L8ZA 1II8A 2PO7A 4G6ZA 4MV0A 5FJJA 1BWPA 5HCIA 5FWYA 2JB9A 1ZD4A 3UOWA 4C08A 3ZE2B 2D1RA 2O0HA 3FKJA 4DT1A 3PC6A 4P1ZA 1VCMA 3C1TA 4QL3A 4CMEC 1JH8A 1T8YA 2EFCB 5ALZA 1LZKA 3LE8A 3LYHA 5LQAA 2O8CA 1FP4A 4FB4A 3ESRA 1DKPA 3L7BA 4I6JA 2ZRJA 3R7AA 3VZSA 3NHKA 3IDZA 4FD2A 5BPFA 4PQEA 2H3EA 2WU0A 4W1RA 3VU8A 3M6LA 4K6HA 3IUNA 3IULA 3CBGA 2GJKA 1GQYA 3OQNA 5ITZB 3TTSA 4HAUA 3A58B 4BVJA 3CF2A 3GO4A 3ZS8A 1OBOA 4QOSA 3A1NA 2XB2A 2HU2A 4HDMA 2ID9A 3TXXA 4OHKA 2BBSA 1M2EA 5ILQA 4M7PA 3EUWA 1QUEA 2W2NA 3GC6A 2XWQA 3NHRA 1THMA 4Q05A 1KF0A 1J2YA 1BXZA 2OZLA 4KDFA 3KALA 2R4QA 3PF9A 1BVUA 2JA1A 4K28A 2GBCA 3LOQA 5DNAA 3HK2A 2JJ1D 2TMYA 2D5IA 3W2EA 1E7YA 5CB6A 5F78A 3QE3A 4LVCA 4HN2A 3V8RA 3IC5A 3HJCA 4UUAA 4ENTA 3GCZA 3UUFA 4ZHQF 1GG5A 4OD0A 1CFJA 4CDMA 3H16A 1AV7A 4ILEA 1MJ5A 5C31A 1BE1A 3OE7A 5F2KA 1Z08A 1MB4A 1MNAA 2GD0A 4FTWA 5HNKA 2Y9MB 3T38A 1I0LA 2C57A 3BWYA 3KQLA 5CXSA 1N9KA 3NCTA 2DU8A 5BN4A 621PA 2ZCJA 1GG2A 1JEQB 1FX1A 3KKQA 2GO7A 1TCVA 2Z58A 2R8EA 5AT1A 4GRIA 3DFMA 2Q3EA 3KKZA 5AKJA 5K2OA 5CT4A 2YH2A 3LV8A 2WNSA 3KP1A 4RAOA 1KJYA 4I50F 4GM1A 2BFBB 4I36A 2J4CA 3BMOA 3CEJA 4GMKA 4LTDA 1WB4A 4R9UC 5EY5B 5AUQA 5IC4A 1RI4A 1JIQA 3HB7A 2WZQA 3H13A 3OBIA 3CO5A 3GUYA 1F4LA 3MW8A 2GS9A 4X9XA 3W4KA 3TIXB 5CDFA 4EARA 2O19A 2PZGA 5K7SA 4MHSA 1BTOA 2C9YA 2AUNA 2X2PA 4TN1A 4JCOA 3C3EA 4NYIR 4QDXA 1JU9A 4JQZA 1LBHA 1QLJA 4IXWA 4K3VA 2UZ1B 3FN4A 1T5LA 3NB0A 4GXNA 4OHWA 4FPXA 3WWYA 1AGYA 1NUHA 5FORA 1MVOA 4PZ9A 1FJHA 2P9FA 2QD5A 3QE2A 4C6SA 1DT5A 3RLFA 4CMEA 1Y8QB 3JVVA 1Y8CA 1C29B 1Z2DA 4I5DA 1GGNA 3NTXA 4PICA 1NXVA 1K7SN 2C9CA 4AK9A 1XPUA 4PIMA 2FG7C 4L8WB 4R1LA 4UMVA 1WETA 1U63A 2XNCA 5A4FS 4KG7A 1NF8A 5B57C 4OQ4A 3IJEB 1W75A 2JHFA 3DHEA 5KQGA 3EDYA 5HM6A 1QE5A 3L6RA 2JHAA 5KJFA 1PNQA 1KNXA 4LE0A 4TTTS 1C50A 2JLWA 2VDKB 5JBNA 3R09A 2OHXA 1CF9A 5CT9A 1DO2A 2JLAA 2UV8A 5HOEA 3A0RB 3A27A 3R7FA 4E22A 3EB9A 1OPRA 1UK9A 4XB6B 2D0PB 4D80A 5FOXA 1LBIA 1NN0A 1TAGA 4RPKA 3BGVA 1CZLA 2H7XA 4IIBA 5IDVA 4DW8A 4P34A 4B2PA 2VK2A 2G67A 3K15A 3L2OB 5SY9A 1THGA 4PGFA 4KBFA 2HBQA 5TV2A 2M32A 1RWOA 2JCGA 3BRWD 2QRNA 3DXFA 3T41A 4ARBA 3EZ9A 2KW5A 3QMWA 1JTFA 2B25A 3ZWCA 5JJBA 2R00C 5KTPA 1OH6A 5JUWA 2ILVA 3DZKA 3BE5A 5AKKA 4B7XA 1X7WA 2HNAA 2EGHA 2SHKA 2HSZA 1N78A 4KZKA 1W4RA 4U9HS 1UK7A 3KB6A 4N18A 1HE3A 4CIWA 1DINA 2GPAA 1UDWA 4ND6A 2OD7A 3D3WB 3EFHA 1WPXA 3DR3A 3OIVA 1D03A 3L7KA 1VJGA 5A1JA 5JEEA 4UTOA 3ORFA 4URWR 4ZWNA 5DGXA 3N1UA 3TI9A 1SCDA 3WO0A 2Q9AA 1A8IA 1TIPA 2AXQA 2XB9A 3OCJA 4DR2B 1RSZA 1QIDA 2BGTA 4MUKA 5ER6A 4IV5A 2WOOA 4RK7A 4FEEA 4DQLA 4JOBA 5D2CA 4Y2HA 1AMOA 3KOWA 2X3UA 1IHPA 3V4FA 2WKPA 3TVDA 3GIWA 3MK31 1DV1A 2ZSDA 2ZRPA 4KX3A 2CFCA 5JQGB 1Q3HA 1ODIA 4RO0A 2D00A 2EBUA 2F9MA 4QNNA 3G5UA 2C97A 2H48A 5L53A 4JB0A 4MK4A 4ALNA 5HKKA 3U16A 2ZIWB 5T64A 1NAIA 3UT0A 1JSXA 5DI3A 1PV4A 3C3JA 2CXUA 1VHWA 2G8NA 4AJHA 2YY7A 3EDMA 2FEXA 4P6VF 1N9GA 4HWKA 2ZT6A 4MWSA 4E4TA 4UCXA 4ZJYA 3VTFA 4ZMBA 5IZCC 3A28A 3U9LA 3CNLA 2NADA 4Y2GA 1UK6A 4PQFA 2BWJA 3WRVA 4R40A 4RD6A 1BNCA 3X1KA 3MWDA 4JROA 3VI4B 5EIBD 1UBCA 3H9UA 1AKEA 1ZG3A 2SKDA 2GPJA 2QLJA 2WICA 2Z98A 4JMLA 4V0ME 3HY4A 5GY7A 2WRZA 5F2NA 4DXHA 3BQMB 5AK4A 1IBKB 4R69A 1C4WA 1VZ3A 1DKRA 4CEIB 5B3KA 1CEQA 1JDSA 3C1UA 3I4FA 2SCUA 3IUYA 1FFDA 1I3LA 5EWLB 2PBRA 3NYWA 3N8IA 4BTVA 1A2KC 4E4RA 3QWBA 2FUEA 3NWEA 4IQGA 3Q3GE 1I80A 4EECA 1MIOB 3MILA 3CXRA 3OAAD 4LZWA 3U3XA 1RBZA 3FVWA 3IOEA 3BB3A 1NQXA 2PRZA 4V38A 1WG8A 2CFIA 3KJZA 4R7GA 1LDYA 4IUCS 5DTQA 4CDRA 5KREA 1YL5A 2ASVA 3PWZA 3HVUA 3O7WA 2G9VA 3QJGA 4IQ4A 1KS9A 1T2VA 1IULA 5DHQA 3UW1A 5C8ZA 1BCRB 2DOKA 1U2DC 3DVSX 2IUSA 2GK3A 1MQAA 1U2PA 2Q46A 2XD9A 3OTWA 4OQMA 5EQDA 3TZEA 4ENQA 4RD4A 4BO0A 3GLTA 2PA3A 4Y1RB 5F5XA 3QYJA 1PW5A 1SCNE 5KYYB 2VQEB 1RACA 2NU8A 2HXYA 4Z4EA 1W6RA 1XP5A 4FX2A 3Q87B 1FDUA 4QDKA 4ZANA 3WHPA 1IN8A 1OYYA 2XMQA 2BTOA 5G41A 2EZUA 3QXJA 2I91A 2AB0A 2C0PA 1FNMA 3RD5A 4OIFA 3V8NA 1R64A 3GVPA 3TM5A 4KPUB 1SWWA 4D3XA 3RIHA 3VH1A 1NVTA 4AMVA 3TG8A 1NYRA 3FYDA 3GG2A 5EAIA 4OO3A 4B79A 4DJEC 2DSNA 4EPRA 4MROA 1U3GA 1XF1A 2XVYA 1MC8A 3BD7A 3DXYA 1LBTA 2XNSA 3IAHA 3PNQA 2ADFA 4TWZA 2JAPA 1U3VA 3KT8A 2G0NA 4WXPA 2GOYA 3ZXYA 1JFVA 3E3LA 2QNRA 3E5NA 4TM8A 4IJKA 2WU4A 4N65A 3F96A 4D0NA 1TO6A 1H1TA 5KC8A 2VZ0A 2H2GA 4CCWA 4DCMA 5IS2A 3FPEA 4AO8A 2LIVA 2JGKA 1RIFA 1PJAA 2B94A 4ICIA 2PXAA 2O2IA 4IVNA 5AKLA 5DSZA 4A2QA 3R9XB 3K9FC 1ODTC 3JASA 1QE3A 1JA1A 3PDIB 5IZCA 2AV6A 1WXHA 4N5DA 3W8NA 4A0QA 5CBPA 5B4TA 1UFOA 4PFSA 3RUEA 1CEEA 1ZJ6A 1OYVA 3IE0A 4L8GA 2B3DA 2BMWA 2GPNA 2IEIA 3CCCA 1M2OB 4CKWB 2Q3HA 1N0WA 1O1YA 3T99A 1ZGHA 4A8PA 3GJXC 4UBIA 1UKZA 2O3RA 3WISA 4DIFA 4UUBA 3R0JA 3VTKA 2JRLA 1Z6ZA 1QRDA 3FLBA 1ZH2A 5A02A 1SCKA 2HCBA 3EIUA 1VLHA 2GXAA 4EUKA 1QP4A 4EDHA 2YY5A 3FVTA 1GTMA 1CF4A 3P45A 2CKDA 1ZM7A 5ENVA 2ZYTX 1AK1A 2WKQA 5PNTA 4QUKA 3V32A 1E7RA 1VMDA 2PT7A 2Y4NA 4KQKA 4W5QA 1EUYA 3BSFA 3JRXA 3GNQA 3JQ9C 2X0EA 1B4DA 3P9IA 1NURA 3ZE8A 2QLFA 3W8DA 2N1BA 4XJXA 3NEAA 2QTTA 1M6NA 1Q7BA 1D3AA 2DC1A 3B3AA 2Q6KA 3RWBA 5FBHA 1P7YA 4UDYX 4BGEA 2HRCA 3CVVA 4TL8A 3PEEA 3O4RA 3A6PC 2YMLA 4U1RA 3TTWA 1R0YA 1CJVC 3DDHA 5DBHX 3K9BA 1IWPB 1W85B 1HEUA 4BO7A 5LZ8A 1Q0PA 2W9XA 1U8TA 4AF7A 1HRDA 3AF6A 1OGJA 1UJCA 5EPUA 4P3OA 1SBIA 5H80A 3T9AA 2P68A 2LWIA 4YDQA 2I9KA 1TZCA 2H59A 1SA0B 3AF4A 4O25A 1CR2A 3HXOA 1P6UA 3CX6A 1O9GA 2C31A 1M1NA 2RSLA 4BWFB 1LDGA 2YMPA 1K6EA 1NJ2A 3SZMA 4DNFA 2Q8NA 3TSAA 2Z2XA 3AEZA 4X7PA 3Q40A 4ZREA 2I9PA 1DNPA 3H11B 3LT0A 3PCRB 2WLSA 1G4AE 3WKDA 3G2PA 2PWPA 3KLBA 1FEZA 3DBIA 5K3SA 3URMA 3ZVLA 1N5LA 3NXKA 1X92A 4K26A 4ZQIA 4EHKA 5KTTA 2PX2A 1HQDA 1NNUA 1TD1A 3BKWA 3ND8A 2DX7A 2ZQYA 1VG9B 3DMTC 3MGAA 2R7AA 1XOIA 1JTVA 4FYXA 2JLCA 3THSA 5FTWA 3MTGA 3N9IA 2VI5A 1FVFA 1SXJD 1YDGA 5CGQB 3AEQB 1EXWA 2VAPA 3E15A 3K8ZA 2NM0A 1X7DA 4K9QA 4K46A 4MAAA 4MS4B 3DKVA 1E3MA 4JN6B 5M3BA 5FULA 1M74A 2WZDA 1V11B 2H85A 4OQEA 1MQSA 1XZHA 2P1DA 3I9JA 3OF2A 2Z9CA 1TTHA 3ZWMA 1F2TB 2NU6B 4IKOA 1T5DX 2BFCB 1DRKA 2H2FA 1T2EA 1RKVA 4G8DA 4P4GA 3LS2A 2J5BA 1APBA 1U0JA 1WSBA 5MGBA 4XR9A 1X38A 3M6VA 4DCJA 1X7ZB 2XNHA 5EMMA 2O23A 2ZETA 1L5MA 1KZ6A 1PK8A 4FZRA 4MNTA 1NR1A 1R4NA 3DMDA 2EJWA 4LFCB 4HRVA 3KQSA 3S5JA 1I36A 3BFXA 1FX0A 2PD4A 4MGZR 4XSVA 1QCDA 4PBRA 1CQJB 2QP9X 3IVAA 4ESOA 1QYXA 2P41A 1U8YA 4IYRA 2DWOA 4HB4A 1C9JA 3L7CA 3G0CA 4BOYA 1RE0A 1C4XA 3JQ9A 4N40A 3DDOA 3H7IA 3JWHA 4EGQA 1YS6A 4DXDA 1G5PA 3P7MA 3LMKA 3LFHA 4CIYA 3RSOA 3H0EA 1Q5PA 2OMKA 4C0BA 3SFTA 3LKBA 4DJFC 2DH6A 3R3SA 1GU1A 1Z3IX 4DWVA 1G6KA 2YOFA 1IHYA 4CT4B 3QVWA 5EUBA 4HDKA 4P3XA 4AY3A 3O26A 4DHEA 3VOAA 1DJLA 2BGJA 4DWJA 3UMSA 2GZMA 2V7QA 3CC8A 5EKTA 5IVKA 1LFAA 1LB1B 2CV2A 1XVIA 3IUEA 4R1MA 4GE0A 3WAKA 4K9LA 5AVYA 1XI2A 3H8VA 3VUFA 4ATNA 1CIJA 5AKEA 3UK0A 4D8YA 4PZUA 4ZRDA 1G21A 4LFAB 1A8SA 3GJYA 4N8DA 2YVQA 1CQIB 2WWGA 1P44A 3IIKA 3A7DA 1ZJ5A 1B8PA 5JSHA 1OI2A 5KYTA 1HQYE 1AF4A 4BAUA 1BAPA 5A5GA 1ZSYA 1YQXA 5BSMA 2CMFA 5FAKA 1MHPA 5AKHA 3CBQA 5T7BA 5D6NA 7MDHA 2G71A 1LLCA 4QVIA 2AIRA 1N5KA 1P3Y1 3HA5A 1U0TA 2PG3A 2VYVA 2X8BA 3N0XA 5L4LA 3DT8A 3JQBC 1EXVA 1YZKA 2BFFB 1KMQA 2JZCA 2ZSAA 2HU8A 5G4LA 1G8YA 3D7NA 4CIBA 4N0EA 3P97A 3OT1A 4V0OA 2XGJA 3KZCA 3N8DA 4O2AB 1TM5E 2ZULA 3CLTC 2PYIA 1Z29A 3NRCA 4ER6A 1KAQA 1MA0A 2PQ6A 1V47A 4ZDIA 4O4HB 1XT6A 3UJ6A 2F90A 1B43A 3EOAI 3CEMA 3NWJA 4O29A 1VL6A 1TU4A 3FXAA 3RANA 3OM1A 3RO7A 1B1AA 3PGLA 5LLDA 3B1VA 1XTBA 3G9QA 2Z5VA 5IAGA 5FR2A 3ZLBA 1S2DA 1EFRD 2YVLA 4HX9A 4MGHA 2H51A 3SOZA 1JKJA 1RM3A 4FYPA 4YCSA 1FYWA 3CS3A 5AK0A 1ZI8A 1QNFA 2SKCA 3ZLTA 3CJTA 1ADCA 1Y7IA 3WIEA 2XZDA 4EIWA 4M1ZA 2QQEA 4HAIA 4CL8A 2YWBA 1IN7A 1U90A 1AU9A 2C2XA 2VK8A 3CMCO 3CTMA 3GCGA 4WK0B 2ZPTX 5CYFA 1DO0A 4Z4FA 3FI0A 1JQLB 2IYSA 1PFUA 1W46A 1C9MA 1J90A 1Z4NA 2X4DA 3AR8A 3G6WA 3K9NA 3O82A 4G4JA 2BGWA 5HM8A 2IPLA 3ZV7A 4AZ3A 3DZFA 5DNCA 3V7YA 2K7ZA 4BNIA 1YFJA 2AE2A 1Y4SA 2GM9A 4HRYA 5CAEB 4TTPA 4AMZA 4S24A 3PB3A 2B2NA 3MERA 5BN5B 5KSZA 4HNQA 4RGYA 2OB1A 3HLKA 3SIWA 3DB1A 4J76A 3N0VA 1GPBA 3BXHA 5P8WA 4H1UA 3T54A 1SUEA 4MCHA 3KQPA 3QEKA 4I3HA 3ZC3A 5JDCC 3GLFB 4IF6A 4EVRA 2G1JA 4QQKA 5IDQA 1G2QA 4BVLA 3U44A 5JSKA 1ZC3A 1T2FA 2XADA 4OQZA 3SKVA 1X1QA 3V33A 2ZSJA 1GPKA 1IQPA 4PSKA 1IYZA 7AT1A 2EBHX 1CY8A 1REQB 2WOJA 2DGDA 1V6CA 3C15C 4GX5A 1TUIA 1F2VA 4US0R 4BMCA 1KI2A 4DEYA 1D7AA 1LSOA 2WM8A 1VL1A 3OZVA 3Q11A 5A5DA 1PFGA 3FSGA 5AVRA 1R9JA 4MUBA 5IKMA 3HKEA 2YWHA 2R7MA 3QPDA 2C82A 1U9CA 4NOMA 3WKAA 2J07A 2IODA 2VJKA 4ERXA 3COJA 2EAUA 3M4JA 2FPUA 3N39C 2JF0A 2V8OA 2L0XA 2WFLA 4QE3A 4DA4A 4DMUB 1O9BA 1NXSA 1HY3A 3CRW1 3LQRA 2XR1A 3IELA 3L8GA 4CQMD 2P9QA 5HYVA 4IF4A 2FN8A 3LO8A 4DLKA 2QT9A 4UTNA 2C0CA 2CKMA 1H2FA 2H52A 2IE8A 1UBMS 1FXUA 3QVUA 4YT8A 5KQSA 5GJCA 1S3SA 4ZTZB 2D7JA 3COVA 3TQHA 1ZUNB 4TWJA 1R50A 1RM0A 4U7HA 3ZJUA 1B6RA 2O0KA 1IPEA 2FHSA 4W5HA 3M1IA 4TLDA 4MWZA 1SZJG 3ZWNA 1X39A 2JLRA 2VLIA 2I6FA 3AFHA 3T7IA 1NV9A 2XUKA 2CNLA 2IYNA 3D3NA 4NBUA 1AIPA 2VZ9A 4LXTA 4ZCPA 4PGAA 1NVWQ 1KJJA 1J07A 3LLCA 4L3OA 4D6YA 3CVJA 2IUUA 4QC2A 1Z38A 4I5GA 1FRQA 2WJJA 3PFHA 1WE2A 4JVMA 2BMJA 3AEYA 4DIMA 1P7VA 2X3FA 3VUEA 4F46A 3AF2A 5I3ZA 4JT4A