1WABA

Platelet-activating factor acetylhydrolase
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
212
structure length
212
Chain Sequence
b'ENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRRVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE
publication title Brain acetylhydrolase that inactivates platelet-activating factor is a G-protein-like trimer.
pubmed doi rcsb
molecule tags Platelet factor
total genus 74
structure length 212
sequence length 212
ec nomenclature ec 3.1.1.47: 1-alkyl-2-acetylglycerophosphocholine esterase.
pdb deposition date 1996-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1wabA00
4K9SA 1ES9A 5CD9A 1BWPA 2WAOA 1ESCA 2APJA 4K7JA 4RW0A 4Q9AA 1U8UA 1BWQA 4JHLA 4JKOA 4JJ4A 5B5SA 3RJTA 1DEOA 3BZWA 3PT5A 1IVNA 1ESEA 4DEVA 2HSJA 3DT6A 2WAAA 2VPTA 3DT8A 3P94A 5A4AA 3W7VA 4JGGA 1ESDA 1JRLA 3HP4A 2O14A 4K3UA 5BN1A 1ZMBA 1J00A 3C1UA 2W9XA 1V2GA 1BWRA 4H08A 4Q7QA 2WABA 1WABA 4OAOA 4NRDA 4XVHA 1FXWF 4S1PA 1YZFA 3SLRA 1VJGA 2Q0SA 2Q0QA 3DCIA 3SKVA 4TX1A 3DC7A 5HOEA 1PP4A 3KVNA 4M8KA 4I8IA 4K40A 1VYHA 1DEXA 3U37A 1Z8HA 4HF7A 4PPYA 5JD3A 4IYJA 4JJ6A 1K7CA 4HYQA 4RSHA 1FXWA 4OAPA 4LHSA 3MILA 3DT9A
chains in the Genus database with same CATH superfamily
2IZ5A 3TL2A 3QUQA 5E3IA 3PQFA 3C3JA 3QLTA 4JU9A 1YBHA 3GMTA 5T8KC 3P8ZA 3RVOA 3H3FA 1WPRA 4X1YA 3R23A 2WYWA 4HZUA 5CR9A 3BMQB 3G9XA 1H0SA 4CIAA 1JEEA 2NYUA 2FZVA 3DO6A 4OXQA 4QDKA 2XHEA 3F4BA 3F96A 3HACA 3TLBA 1UC5B 2HQSA 2XCOA 1LLUA 1M0SA 1VPDA 3TRHA 2R7NA 3A3PA 4BNHA 3O9VA 2FP3A 3ZKWB 1GZUA 1K6MA 1XZCA 1WF3A 2NTYC 3OZCA 1IUNA 2C8LA 3CRW1 1UP6A 2H2AA 3ZV5A 3B8EA 4I5DA 4QYIA 1IPFA 3C41J 5CIQA 1Q7RA 2FPLA 2DRIA 5EPOA 2LRHA 4MUMA 4EG7A 5LQDA 3D5QA 2OC4A 4NSNA 1I7SB 2ZT6A 5IF9A 1UBLS 4O8CA 2FYTA 4H1HA 1SIBE 4MB0A 5I8PA 3SJBA 1RYZA 2QRUA 1DC4A 1U99A 3QKRB 3A28A 4X6XA 2GOYA 3T1QA 3FTPA 2QN8A 4DLNA 2VZ0A 1Z08A 3W2GA 2ES4A 1X86B 2W48A 5TR9A 1M33A 1Q0PA 3Q1KA 2Q5CA 4NI5A 1M8PA 5A71A 2WMNB 5TQ0B 4EUSA 5KTRA 2GA8A 3IDAA 3AVVA 2W6JA 2IWHA 1EVLA 4IZHA 2V6JA 3W2HA 4KR2A 4JP1A 1HEYA 4QG3A 3BXEA 3HBMA 3VA7A 3OQMA 3EZ2A 4KFCA 5IYZA 1YVUA 4ZAXA 5DHSA 1NMSA 3SHVA 1ZCAA 1BOOA 1X94A 5G0TA 1PR5A 2Z56A 1Y33E 1DVRA 1H6AA 2J9ZB 2Q2QA 2XA1A 3OJEA 4LRXA 1DKNA 2D1RA 4QWWA 5ES3A 4ZVKA 1OH8A 2C9MA 2XE4A 2VRCD 5BQFA 3LT1A 2XSZD 1QO0D 4V0MA 3QBTA 3CTMA 2XXAB 4DIEA 4G41A 1UPUA 5LPNA 1HBJA 1AMOA 1W0KD 5L45A 1Z74A 1J2TA 4NPCA 2NUAA 2G82A 2QDXA 4NH4A 2FOIA 4ON9A 5JD6A 3KPJA 3ZC3A 2Z5GA 1A9OA 4UUAA 3MJCA 4YBZA 4PLWA 4MKHA 5DX0A 4RY9A 4PYNA 5IC6A 2YTZA 4TWJA 3CF6R 2NUBA 3M81A 4PV7A 5EY5B 3UZUA 2C82A 3QBDA 2FNAA 2ZRPA 2WUDA 1U80A 3KWFA 4I7EA 1S8NA 3LX5A 2HXYA 4J0HA 4LS3A 4IUBS 4P54A 3V34A 3ZDDA 5DJ5A 3ROXA 2D1TA 1R6TA 3CN9A 1VCIA 3EW9A 1SC9A 4FWBA 1FIUA 1E1QA 1EXMA 1U5BA 2B92A 3N8NA 5DCLA 3B6IA 1ITZA 1Y3CE 2BKLA 3CS3A 3A1CA 1V6AA 3MS7A 4UUOA 1SU4A 4G5QA 1KAEA 5JSUA 3PGVA 3DBLB 2Q4DA 4C4XA 3GLIA 1H9BA 3HBFA 2REOA 5A2QA 2BFBA 1R3UA 3H18A 4GICA 5JVDA 3O6VA 4ASUD 1IMJA 4ZAFA 4YT5A 5HNKA 4X3CA 5KC8A 3T0FA 3O1HB 1P1KA 3B82A 4TSFA 1E9DA 4UXIA 3JRWA 3L77A 5EIHA 3FYUB 3I6ZA 4IG4A 2HRQA 1L7EA 4PAGA 4W1PA 1O08A 5HFNA 1ZRMA 3OF5A 4XRRA 4CIDA 3FOBA 3LE8A 4YACA 4ODIA 1LRJA 1XQ6A 3ZWOA 1D09A 3O38A 5IBRA 3LF1A 4JBGA 2F3RA 3ZVNA 4MHOA 4MIKA 2V6IA 3FJOA 2B1IA 4NVRA 4E2WA 4OH7A 2WFLA 4GR9A 4BBAA 4E32A 2W42A 3NHBA 1ZBQA 2H8GA 2AOWA 5F1KA 3OIYA 4JJAA 2ZB2A 4CLHA 1ZD4A 3L2OB 4U7FA 3DGFC 5AK3A 4KN9S 2AE2A 3SDSA 1J9GA 1ZMOA 4HQOA 1EK6A 5D7BA 4BDSA 4F7DA 1S9HA 1ZK3A 3LCRA 2I6SA 4MS1B 4BX9A 2GFQA 2REXB 1SBNE 2JAOA 2V3WA 3BILA 1BC5A 3E82A 2RAPA 1UQRA 1S3SA 4ZYTA 4HDRB 4ZV7A 5IARA 1ECBA 2FW0A 1FNBA 2GM5A 3AL0C 4MUNA 5BN5A 3OZAA 4U3JB 4UPVA 4WNAA 2HNAA 1KI9A 1GCAA 2GNOA 3LUFA 1BMQA 4DJDC 4F5YA 1JIQA 4H18A 1I3MA 3C7DB 4ZTZB 3CKKA 1RZRD 1AZSC 3P9XA 5HGJA 4DABA 4HS4A 2X2FA 4IWXA 4L6AA 3CH4B 1F38A 5GM2A 1UJNA 4JBNA 4X7PA 3DVRX 2IHYA 5DTEA 2PL1A 4GVPA 4URYR 3TKLA 1VI5A 1V7ZA 4AY5A 2J6HA 1OWLA 4KQ9A 1ZJJA 3RT1A 2NOAA 4OQPA 4YDSA 121PA 3UTDA 1YNOA 2YNMC 3WA6A 1LZKA 1NQ5A 1QM5A 3NCTA 2RH8A 5F52A 1NT2A 1LB1B 3FLEA 4YB8A 1IBLB 2IT1A 4EG4A 2NVOA 3F1KA 1T4MA 4RZIA 2WE8A 4MRVA 3VC3A 4MUXA 5C5EA 5DLYA 1N2CE 1RBMA 2FI1A 2VDUE 4Y3UA 1EEHA 1HZJA 1V8DA 1MZPA 4CW7A 3C24A 1BFKA 4AFNA 3B78A 4BVLA 3FVRA 4Y7CA 4L5IA 4B31A 1P1FA 3NT5A 1ECJA 2Q6KA 3MWDA 4X54A 5HJ5A 3LA6A 3NETA 2MCFA 4Z5XA 4JMPA 3A32A 3GGJA 4B6FA 2FEKA 3N6VA 4URHA 2A1TS 1WUHS 1OFUA 3FUXA 4D8XA 3G49A 1PV2A 3AX6A 3EH2A 4JYPA 1NLYA 1Z5VA 5JY6A 3R8CA 2EP5A 1H1DA 4KRXA 1R0WA 1IBRA 3W5JA 3V8EA 1IBKB 3CH7A 3MJEA 3SKYA 2WYUA 3IEIA 4P80A 3TMYA 1VCOA 3K8ZA 3RI3A 4E94A 4OD0A 1ZR4A 5HUHA 4D3FA 3LI2A 3PF8A 3HE3A 4TSRA 3KL2A 3JQ7B 3FWZA 4LA4A 4DG5A 5GAJA 1JHMA 3V97A 2I7DA 3HXKA 2YZ7A 4AMBA 5L4LA 3T4UA 4DCTA 2H1VA 3AHCA 4Y9SA 1AV7A 1P3Y1 3ZWMA 3I9FA 4N54A 4BO0A 4F0JA 2FRXA 4G5XA 4N5DA 3GJXC 1SUWA 1YUBA 4B6PA 4XTCS 1JL3A 4RTOA 4YJFB 5JAHA 3U80A 3NI2A 3ZHZA 5JIBA 2JIRA 5T4FA 3W2FA 5DOVA 3TSYA 4ACBA 2PBZA 2XZTA 4BFUA 3QVJA 2DM6A 1ESCA 2ZFUA 3KYIB 1N1MA 3KVOA 3NHMA 1W5SA 4Y0VA 2QN7A 5LP6F 4PIVA 1FRZA 4CM1A 1LNQA 1W35A 4QOIA 1RYNA 1EVZA 5B64A 4X1OA 2B21A 2X9VA 1J20A 3ZEAA 4QSHA 1IZZA 5K3BA 2XMZA 1OE0A 3QENA 4HSGA 1H6DA 1WF6A 1A71A 5BRJA 4US2R 3S2UA 4O4HA 2GEFA 1UBEA 4YRLA 3L84A 4G24A 4I9FA 2IUUA 1T0PA 2XV1A 2YW9A 3KEMA 4QOGA 1PNVA 1CY4A 1UBRS 4BVAA 3HKCB 1M76A 2A78A 2CLSA 4MNTA 1V3VA 2W6ID 2R68A 3IXLA 4QTZA 4FEGA 4DDMA 4L3VA 5ISMA 2DLCX 2IP4A 4Q18A 2JIOA 4GMFA 4ZYUA 1TF2A 5CVTA 5EWLB 1VSVA 2QZZA 2HCTA 1WIWA 1M1YA 1XEWY 4W7IA 1XZNA 5AO9A 1R8SA 2AF3C 2R6FA 3AT1A 3NB0A 1N7HA 3ONEA 4FN4A 4R68A 5GPBA 3CR8A 3RV4A 1ZU5A 3UPTA 4UBIA 2B2CA 2GM3A 1D2AA 1KARA 3L8YA 3OPYA 2DZDA 4LFBB 3PQEA 3AMVA 3NDPA 2FE4A 2FSVA 2YIJA 3PICA 4MR9A 2FQQA 2X1VA 3P9RA 1PR2A 4MWCA 2BRUA 1BWRA 1Y6QA 2C5SA 2EL7A 3LA8A 3SXUB 3TIFA 8ADHA 1YZUA 2BZSA 3RSQA 2YUIA 4PX5A 2BP7B 3Q11A 4HRXA 1NMEA 1P3JA 1PFUA 5AVTA 2L19A 5BSEA 2OM6A 3R0QA 3HLTA 4MKXA 3TQTA 4ETIA 4NYIR 4IHJB 1S7CA 2OXFA 2QU7A 3HA7A 4D74A 2QG6A 2D2EA 2Q45A 1U1IA 3M9XA 5AJWA 3WBFA 2O2SA 3A2NA 2J3DA 2IXFA 2ODEA 5IXYA 2J0QA 3SYRA 3GDFA 4BVKA 1GKUB 2JZOA 2XUFA 1IN8A 5CFQA 4UW9A 1U11A 3A6KA 3ZU6A 2VBGA 3K4QA 4BQQA 2OQ2A 3N9IA 5BOVA 3V2GA 2P6RA 2JJ1A 1E3JA 3FYHA 5F1OA 3ZE9A 4X62B 2YWXA 3B9RA 1FDWA 1BS9A 5LWQA 3E48A 3U4QA 1R3DA 3IMFA 1FTWA 3NIFB 3B8HA 2OY0A 2XOXA 4L27A 1O5IA 2ZWMA 3BH0A 4QC2A 4XX0B 5JAQA 5KVAA 4EAAA 3KNZA 2L69A 4PF1A 1HYBA 1ZOPA 2V98A 2GA9A 3TL3A 3JS5A 4HH0A 3GA0A 5BY2A 3SZLA 2IXDA 1XZ8A 4NH0A 2NAFA 4JI8B 3IT0A 2ICAA 4FIDA 3MUFA 1SXJB 5CW2A 1MCZA 1V2HE 1GGKA 2A92A 3RB8A 4Z51A 1X8XA 4QPNA 4LJ5A 4DMRA 2DJ5A 3RBXA 1VIDA 1SD5A 2CYAA 2V7BA 2J48A 3DXFA 4F71A 2EQ5A 1Z0ZA 4IIJA 4QKQA 1DIRA 2ZIEA 3DDUA 1XOIA 5DBFA 2C7PA 1A2KC 4QO7A 3NOQA 2WJAA 2ONKA 2Y0CA 2HQBA 1UT8A 3STHA 2DAPA 2VYQA 3C3DA 1Q1NA 3UB3A 2ZRAA 5BV1A 1PGNA 3NOOA 2QPAA 4D8YA 1M7BA 3V8QA 4AS3A 2O8NA 1FDOA 1QGZA 1DBRA 1LXCA 1KC1A 1XVLA 3H9CA 4M38A 4XFDA 4EARA 1QQ7A 5CB4B 1KZGB 1FW8A 1KP3A 1X6VA 5I01A 1J0EA 4NCIA 3RS3A 4D7AA 2C3YA 1GG9A 2HZBA 4U2CA 3D7KA 2ADOA 4MPTA 5AD1A 4RK5A 2LDXA 1N2BA 1L1FA 1D0VA 2EIXA 2MYPA 3CTPA 3L7AA 1W36B 1H0HA 4G2NA 3TLAA 1AHIA 1Q21A 2NPIA 2YYZA 2ZSBA 5T3YA 1GZ3A 3C1TA 2IPNA 1FZTA 1L9XA 3AR6A 2J45A 3ZIAA 3FSGD 4G0NA 3UMBA 1IEQA 2FH5B 5SY9A 1G5HA 2IBMA 1DJMA 4RVFA 5H59A 1GPH1 1SKYB 5BMVB 3F8WA 4B5KA 2B3DA 3G8AA 4F9TA 4HWKA 3ZXUB 4CN9A 1BDMA 3GDWA 1V5EA 2H54A 5LDHA 2XF2A 3MCUA 4KN8A 1WLSA 2GD2A 5FLXA 2WZCA 2ISQA 1AZLA 1EM8A 3AHEA 3QNUA 4QTXA 5EQDA 2IDJA 5YASA 4NX2A 2UYYA 3MCAA 1P7WA 3ELUA 2FPIB 5BN4A 1AA6A 4FONA 3LX4A 5A4MS 1ID1A 4WESB 5JV5A 2ZUFA 1NI5A 4BCCA 1EX1A 5IAKA 4FYMA 1J8QA 1E7YA 2GKGA 2IXGA 3T3GA 2R62A 3I9NA 4YXWA 4UE6A 3FKSD 2G63A 1ECFA 4MW4A 3VJMA 3E8MA 1DBPA 3CRVA 3IBYA 2XRZA 1WHTB 3L5KA 1ORWA 1QC5B 1A8PA 4Q02A 2DETA 5I9IA 2O8EB 2G1UA 2VRBA 3B3JA 1SKBA 4P38A 2HQOA 3DDWA 4BGVA 4P31A 3R3XA 4HDMA 4TWZA 1M2WA 1YVDA 3AKCA 1IY1A 2FZGA 3MGCA 3T35A 2PL5A 2P4UA 4RVNA 1FP1D 4ALLA 4OG2A 2J9FB 3FSEA 3KUXA 2QVCA 1C3JA 2NU9A 4Q7KA 3A1NA 5BSMA 1HFKA 2GFHA 1UMCB 3L8ZA 2D74A 4R9VA 5LOVF 1V7CA 2DKNA 4L0MA 2Y05A 1FQKA 2PLFA 5HM8A 2W2QA 3BK1A 5IKPA 3L0YA 3PDIA 3T4XA 4NPHA 3P2KA 4QZVA 4P5DA 1IQRA 1D5CA 2JJ8A 1L8LA 4XSGA 1PX2A 5JYDA 1MT0A 1M8FA 1W88B 1WS6A 2H7VA 3FDXA 1VHWA 3KR2A 3NALA 5U1PA 4EOGA 2HREA 3SIRA 4P3NA 4ALKA 3ROTA 1AA9A 2Y76A 1KI1A 4KGVA 4S2UA 5DBHX 3QNMA 4KE7A 4AYTA 3GZ4A 2GJ8A 5AW8A 4IDPA 3FFXA 1JKJB 2GEVA 1BXZA 2W83A 1G5PA 2WAYA 1BS1A 5D7NA 4E1VA 1XZEA 4QSMA 1C0IA 1KAGA 3DTVA 1JECA 2JFUA 2QE7D 2X9GA 1JHRA 4Q7LA 1TK3A 3LT0A 3MWYW 4L4UA 4KXVA 2X19A 1UFVA 4YI3A 3I5XA 2A4MA 2WSBA 1PKXA 3K0KA 3K9GA 5U9CA 2B37A 2JIZA 3W5BA 4OA5A 3M4JA 2X5OA 1PNOA 1KFEB 1T9KA 1E2QA 1JDZA 2VT7A 5LLDA 4EMTA 1RJWA 4AJPA 2ZWIA 4ZC1A 3IR7A 2P3OA 1N6PA 3R5FA 2MOKA 2VQDA 1POXA 3OLYA 4BB6A 1QYCA 3WGZA 4ZA2A 1Q74A 5THQA 3VPCA 4RTRA 2C0PA 2IUSA 3KZCA 4QELA 4HNTA 5K0JA 4DM4A 4TKVA 1GEGA 3VOBA 3CH5A 1TFRA 2PIDA 1LLFA 3ASYA 4EY4A 3BT7A 3DZKA 4PQFA 4UMEA 2GERA 5ECGC 1JIVA 3ZGLA 5ELXA 5IKOA 4YH1A 2YRWA 4GSYA 2P11A 3WIUA 4QDZA 3WXMA 2PFGA 3PTAA 1OLXA 1X39A 2Z9DA 1H69A 4S2EA 4HK4A 2RC5A 3DEIA 4PTZA 5TEWA 1OI7A 2C61A 2D0IA 1RR6A 2E4AA 3ZW9A 1SKMA 5DASA 2E6KA 2X9QA 2O0LA 1QKIA 3DM9B 5CMLA 3SHQA 4QXMA 2WJYA 5FPTA 5CA1F 1Y1KE 2IYVA 4DLPA 1DAHA 3L1KA 3QY0A 3E5MA 1JQBA 3HRHA 3BPSA 3B52X 5L3SA 1CDZA 1TO2E 2EAUA 4ZTUB 3L6EA 2HT6A 3MBOA 3CG4A 4FGJA 2I4LA 3V55A 6Q21A 4B48A 3G8DA 3D2AA 3GU3A 3EA5A 2GJKA 2H11A 1JT2A 1ZJ4A 2A9VA 3KV3O 3LUGA 2AW3A 5ENZA 5MGNA 3WHKA 2WFLB 1CE8A 2EDCA 1NVMB 2K6GA 4KQWA 1E3SA 1QHHB 4WCFB 4CNBA 2JAPA 4Y2SA 1UJ2A 3VR6H 4I50B 2VPWA 5DB4A 4YT4A 1US8A 2JASA 2QD3A 3IQFA 4NBTA 1W7AA 2IDKA 1OCEA 3E9ZA 3HKBB 4JLUA 3BJMA 2NU6B 1OLUB 3HI6A 3O8BA 3L7YA 4IPTA 1RKQA 3ISTA 5BSUA 3T1YB 4Z4FA 5HIMA 4KXNA 3BMCA 4LJ9A 1UZNA 1DFHA 2PSDA 3QVGA 3JASB 1QB7A 2I54A 4LV5B 3KHUA 1DXOA 4GKJB 5KWJA 4C89A 4NBWA 2QS9A 4UDNA 3IE1A 3OBIA 4X6LA 4XGQA 3AUUA 2A33A 3O0DA 3H9UA 2PWAA 4OBWA 4QASA 4TL8A 3RAJA 4G01B 3TSAA 1TEZA 2PBLA 2UXCB 3MHPA 2VC2B 4X90A 3TXAA 3MQFA 3UMRA 4TVBA 2FPUA 3P19A 2RGCA 4LYDA 1CZNA 1Q19A 2QXTA 3HN2A 5G1NA 2ZU0C 5KSYA 2NVUB 2HGZA 3HFJA 3L6DA 1YCFA 4CF3A 3R7NA 3GJ0A 1KPHA 1M34E 1LNSA 3RVBA 3QKUA 2PWYA 4OTZA 1N1DA 1FFYA 1J1IA 2NZWA 1E1RD 1PNTA 3CF4G 4FW8A 4W99A 3HUUA 4KQMA 4B8YA 4C0JA 4QPJC 2WYIA 3JQAA 2GZMA 2WFZA 4KVGA 4KGXA 1TMYA 1KSJA 3ICVA 1VI2A 1XYVA 4MAFA 1YHZA 5C3UA 2YV1A 4I1VA 4DM3A 1ZK2A 3HY3A 2OP1A 4NENA 1XMJA 4X91A 3UAVA 4FFOA 4BZXA 4KQEA 2Y4OA 4KLZA 3A1UA 2WTUA 3MWDB 3BRSA 2YCLA 5U4XA 4L95C 4JT8A 3AF3A 1KAOA 3LPNA 5FBKA 4BVJA 3I0MA 3R24A 3VHRA 2XWSA 3P0FA 4OK6A 2Z98A 5CYPA 4JI3B 1QK4A 4B45A 3ZDQA 2H5EA 1GPLA 1M7HA 2XR1A 4TTPA 3IVCA 1P31A 1YFZA 3QFHA 1H23A 2B9EA 4NCAA 3JYLA 5LIPA 3HUFA 4Q3CA 2WU1A 2FJUA 3IDFA 3KKMA 3HA3A 5ELLA 3UKOA 1XEXB 4G65A 4JC0A 3JCZA 4G23A 1QZXA 5DM70 3NBUA 3I0ZA 3LLMA 2CHEA 1Z0DA 4R8MA 3D3NA 3UBMA 3HJHA 4BUCA 1FMFA 1MA3A 4ML3A 1VHLA 1XI2A 4LQDA 5FH9A 4R7GA 4IXMA 1JSLA 1NN3A 1SMKA 1U3VA 1L7QA 1JLHA 3ZK7A 1QLHA 4QYMA 4NYIQ 1VJDA 2C96A 2A57A 4R3NA 3U7JA 3USES 4EEXA 4ZIRB 4P3KA 4XGRA 1KGDA 3NW9A 3L8EA 1PR9A 1WZEA 4XXHA 3ZWNA 3CUSA 1JFFA 1PTKA 4RKFA 2CKDA 4Z4QA 4Q9NA 1AGXA 3M9LA 1R4NA 4INPA 5LJIA 4GMDA 4K03A 3MERA 4X1IA 3C6ZA 3MUOA 4PAQA 4X7MA 4ED9A 2BE9A 2QGNA 3EQ9A 2W9XA 4GOMD 4K9PA 4QDUA 4QX6A 4QJ4A 3R20A 3TLGA 4A2CA 3T3EA 4U2BA 3K7EA 3H2SA 1JZSA 2VQFB 5CH8A 2O2DA 5IK2A 2PXHA 4II7A 4EZBA 4OXRA 4JQOA 5IXSA 1V16B 3BMNA 5JY1A 1MEJA 1VGVA 2J3HA 2NO6A 3JWIA 5E0OA 3G1TA 1YB2A 4MV0A 1UH5A 3EIWA 3JR3A 4G4SP 1UK7A 4A6EA 1M6VB 3V3TA 2ZE5A 4QYWA 3O8RA 3IUPA 4MW5A 3N53A 4Q15A 3ZBQA 4IQGA 2W2KB 1EXVA 1DX6A 3FLAA 2XMPA 3GBPA 4N49A 5JH7B 1BH6A 2PH7A 1LQ2A 3CLUC 2D5IA 1Z4PX 3IMKA 4FGKA 4MVWA 2NSHA 1OXKB 1GQFA 3GC6A 3FRHA 1M1YB 4PO3X 1DKMA 5EHQA 3M4YA 4ZYZA 1TCUA 1Z22A 3AO0B 2YVAA 2GCGA 1ORDA 1ICIA 4B3DA 3WTBA 4DYHA 3PLNA 1RWVA 2EXXA 1LPPA 2I67A 1KDTA 1X14A 4LE0A 3OPMA 2M6LA 2CXQA 4W8HA 3QUCA 2CDAA 3TAHA 2H2GA 1OB5A 2ANBA 3BJIC 3NS7A 1XU7A 5ALHA 5C4GB 1IEWA 2BBSA 4KUEA 5F3DA 1LPSA 2D2VA 4A8PA 1DEAA 1CD5A 3FCCA 4AZSA 4QQKA 1H3EA 5DHPA 5BYKA 2RIRA 2GVDC 1KMQA 2I7CA 1EB8A 1Q7EA 2LR0A 2XA9A 1YXMA 3PDUA 5CBPA 5IEJA 1PFVA 1JMKC 1YMQA 4J4BA 3UFBA 3MUEA 3L4BC 3LHIA 4C29A 5F2EA 3SVLA 3DUFA 3WADA 2ZYVX 1RWOA 2HD4A 5H83A 4YCLA 2EBFX 4OJMX 3PRKE 3UMCA 4QHTA 5C1OA 3U19A 4AKGA 1U3CA 2XCQA 1EWQA 2CVPA 2XYQA 3AETA 3EVTA 4HAUA 1N2CA 4LWZA 3SJAA 5K0TA 1NLUA 3PS9A 2W8ZA 3PGKA 1MGPA 4ICIA 1XKXA 1Z56C 3MFQA 4O2LA 2EFCB 3WGQA 3JQPA 1REQA 2ECPA 2R2GA 1I2CA 2O0HA 4L8YA 2PY6A 4QUJA 3U4HA 1R18A 1NJ2A 2OWEA 1U4SA 2RHMA 2VYCA 3NASA 3QY9A 2V0NA 1L7BA 1GXSA 2XJ4A 1L7MA 3UHPA 4OJQA 1Y4AE 5CLQA 1D8AA 2ZDGA 4ARCA 2DHQA 1RSZA 5T3UA 3PRJA 4IVRA 5JWHA 2GDJA 2DR2A 4QPPA 1BXKA 4QEDA 2Q21A 2JS7A 2VWHA 1WNTA 4RYLA 4BFTA 2H57A 2YWHA 4Q16A 3S1AA 4BLSA 1Z4LA 5HUQA 4FGSA 2KMLA 1YACA 2ZEJA 1MB3A 4GRDA 4HDOB 2F6RA 2VDVE 3RCBA 5DSZA 2UZ4A 3OO1A 4YJ3F 4DDKA 5HQJA 4RCZA 1W2WB 3I30X 4MUBA 2FG7C 4KWHA 3RGGA 3TW8B 3OX1A 3SQOA 4TLLB 1E2LA 2DSNA 3SJZA 4BNUA 4FDUA 1ELOA 2W6CX 4DMGA 4D25A 3D6NB 3N39C 4E22A 1DO2A 2YYSA 1Y7HA 2Z30A 3KQVA 3TAXA 3GRUA 2H2DA 4AT1A 2IYLD 1B1AA 2JIBA 3QUAA 3QSYA 1XD2A 1N3BA 5F2OA 2OD2A 2I65A 5K6RA 1RKXA 1DS6A 1GZVA 1C9YA 2O0KA 4WRRA 4X1KA 4YO8A 3X1WA 5DWVA 4E6EA 1UZLA 2EBUA 3LBIA 2PLRA 4O4JB 3RYFA 3SBDA 4QFBA 1XMQB 3A14A 1PSWA 1EUQA 1YIOA 4B9AA 1QHYA 3GL9A 3IJ5A 4TKUB 2YJNA 5KNCA 2N47A 5A6VA 4C2UA 1HLFA 2WABA 3KQQA 3LM8A 2RI1A 4KMSA 1IL0A 3INTA 4MMXB 5DSTA 1NQAO 1QGDA 3LJKA 4MVJI 1O9BA 4XASA 1ILWA 1M2HA 2A1TR 2CEAA 1IJFA 5G4KA 2BH9A 1EQAA 3DWIA 4ENQA 1AS0A 1G9XA 1U0FA 2VZEA 2WYVA 4YREA 4ZT5A 3AERA 1YTLA 1ZD1A 1E4EA 5G0UA 3SEFA 2OLKA 2ZQ5A 4CFZA 3OWXA 3HWX1 3PFKA 3K09C 3PXAA 1YKSA 5GJWC 2CNKA 2VP5A 2F7SA 4J94A 1IQPA 4KW7A 2FEWB 1IONA 1PWHA 1ZMTA 3S2IA 5HP4A 4WUTA 3ZHTA 1JIUA 2P67A 1KY3A 2ZYUX 4MMZB 5B53A 4NESA 3C3BA 1H9AA 3E0QA 1ETUA 3HCEA 1TAHA 1IEXA 2FPPA 3OWOA 2DCUA 5EA2A 4RHEA 4C22A 4W8OA 3UK1A 3ECCA 2EX0A 4Q21A 3T7EA 3V2HA 2R1TA 1NJ1A 2ZYIA 3WV4A 4DKXA 2RI6A 2O8DA 4JXKA 4ZXPA 1JEJA 4M89A 3TB6A 2ATIA 1VBMA 3OPVA 1HKUA 5AJUA 2YV3A 1XTPA 3EYAA 4BGUA 5GTDA 1KMCA 3AOEC 3VYTB 4FI3F 1Y9DA 2ZKIA 3S5JA 4O2RA 3V1LA 1NHGA 1K08A 4J6EA 5AW0A 5AJXA 3IKMB 4ZVVA 2H4XA 3LPCA 1X38A 3TLKA 1FDRA 1N2IA 3VSEA 5TMPA 1TM1E 4FEEA 4QYTA 1YI0A 2XZOA 4EGCB 1JE1A 4I19A 2IP1A 2X41A 4ZXFA 1IY0A 3WK9A 4FC6A 2BY4A 1SO8A 2HDOA 2PT6A 1WW3A 2ZUCA 4KO4S 3WMRA 1I01A 3NEAA 4B74A 2NU9B 4CM4A 4BECA 2QM7A 4DA0A 1A9PA 4ZHQF 1E89A 3PHBE 4FGZA 3EZGA 2CSUA 3F6RA 4JC8A 4MV5A 3SXJA 4AJ2A 1Z6XA 2ZBEA 2UUCB 4PR0A 4QU0A 2OORC 4OB7A 2M6KA 1TTTA 2ZRBA 4OQDA 3FUCA 5FFMA 2J4FA 5JS6A 1PWEA 2NO4A 3EGWA 2QI9C 2D6FA 2DCMA 2NQTA 3AKYA 1EA7A 3QV2A 4BNGA 1UUFA 1DHTA 3L0DA 4BBJA 3O8QA 4JDPA 1ZQ1A 1HUQA 4TTVA 3VC1A 4KQIA 4ZAZA 4OXXA 5C4IA 2V9CA 2A9RA 3UJCA 4YRTA 2W2VA 4E2FA 4UBLA 3FIJA 2JLYA 3E8SA 4NFLA 3I2JA 3NKFA 3WGKA 3VHLB 4BAZA 1Q7TA 3WNCA 4MYTA 5JE8A 4JKYA 1RYFA 1T34A 1IQUA 3DVQX 1AUVA 2GDZA 3WRXC 5K03A 1ESEA 4EMBA 1TVKA 1HWYA 2V8BA 4F3TA 2ECQA 3AB3A 3QMVA 5D5QA 5FI5A 3GUZA 4NDNE 1G55A 2AOXA 4HBGA 4HWSA 4B7XA 3ER9A 5AKZA 3LUBA 4LF9B 3HU3A 4N5HX 3CZMA 2ID9A 4U6NA 4CG2A 3OJFA 4E5SA 1DUVG 3LHDA 1F60A 1X80A 1DQSA 2BC9A 2QSJA 2ZETA 2C00A 3KDAA 3LMKA 4WFKA 5EIBC 5B1HA 1RDFA 3KKPA 5D86A 2H3EA 3SFVA 3GVCA 4KWEA 1M2JA 1SVKA 1D7OA 2ZTLA 1KVTA 3OFVA 1N9ZA 2DTEA 1W5EA 3DXXA 4RLFA 4TZKA 5LZ4A 2JI7A 1QRUA 2I4MA 1PWZA 1XSEA 4KIFA 1WZNA 4JLBA 2PD4A 5CW1A 4EG1A 2Q5FA 2JLVA 3EG9A 3PSAA 2VTEA 5FHQA 2GKSA 2X13A 5T8KA 4MHTA 5KOIA 1KORA 1NZFA 4EF5A 5J58A 1S8AA 1E96A 2P77A 4O4IA 4D9MA 3KFLA 1LK5A 3C6YA 3IXMA 2YJZA 2GRJA 4KUGA 1NNI1 2ROQA 2VP2A 2R6HA 2HF9A 5GINE 5HR5A 4JEMA 2H2FA 1PNQA 3EMKA 3O3OB 1B2RA 4JR1A 1JW9B 1ZP6A 2HIGA 2ZJFA 4EUHA 4DR7B 2FW8A 1GTZA 4E09A 5KWIA 3D7NA 5KNDH 4DJTA 1NMYA 3J81A 4MB6A 1KHHA 4DMHA 5FADA 1DJLA 2WF8A 4OLAA 1K89A 5G1OA 2FFRA 3LZDA 2AN3A 2BTQB 5JI3E 3QEJA 3I32A 2HMTA 2BHSA 3DAGA 3OZEA 4HG2A 4BQSA 2VRNA 3KSBC 1N77A 2D2IA 1BS2A 2GT1A 4LJAA 1FPMA 3ZHCA 2LCIA 3V4VB 1SHKA 4TUYA 1M0TA 2OECA 3RODA 4OK5A 1OTXA 1G20E 3C5VA 3PD7A 4PLGA 1RTKA 3P71T 3S27A 5IAOA 5LB2A 2OFXA 4IS3A 4CV0A 2IL1A 3CWZA 2I2AA 2MSNA 3JQ8A 5DGXA 4HQNA 1TU4A 2H17A 4ZODA 2A9FA 2W2LA 3B1WA 3TIGA 3VU9A 4Y8VA 4P7KA 1AQ6A 2PT7A 3ID6C 4K88A 2QRVA 3AESA 3QVGB 3STTA 4H17A 4R5HA 3IR6A 3UFXB 3C43A 2CJFA 4GG1A 1S2DA 3TQRA 4LGVA 3D2CA 4M0LA 2VHQA 4U9HS 4G0XA 1AKNA 1IN4A 3VPBA 3G9QA 3EAFA 4E03A 3HDVA 3D6TB 2O2HA 4G85A 1OASA 2F43B 4HQKA 3GQBA 3ZVMA 4KMRA 2QN1A 2BUAA 5F78A 4F3KA 2O3RA 4JWKA 2HWXA 3UK0A 5K2OA 3JARA 4ZZ0A 2BGWA 3B89A 4IO1A 3KOZA 3T9EA 5D1NA 2Y99A 3L7KA 1VSQA 2P35A 5KTYA 3N2LA 3HHPA 3DFMA 4M60A 1MABB 3OZTA 4PNHA 3SR4A 3U31A 2JJ2A 2PV7A 3DZCA 4BQEA 1W87A 3L0ZA 2AX3A 1PR0A 4AJ4A 1TEXA 3DR5A 5JDCC 5HRCA 1FEZA 3K0BA 4BMZA 4UEOA 3UENA 3KQWA 1YRWA 4CL2A 3OUUA 3OM9A 1PZHA 3EHDA 3D0QA 1CZLA 3DMFA 2X15A 3KTAA 3NAGA 1J0XO 2R8BA 4LE2A 1IBSA 5AHKA 3B2QA 4JHXA 1D6NA 1QUFA 4PZEA 1C9JA 2HSGA 2WG0A 2ZRGA 3BOSA 5EVCA 1VG1A 1E18A 2WVHA 3SPXA 3USZA 2C3PA 4J1TC 2VP0A 1CZHA 5BMOA 3WL7A 4K28A 1ZXLA 3RVJA 4UFOA 1L7XA 1QH9A 3E9DA 3IQZA 4A82A 5LZ8A 1P3DA 1PL8A 2IIQA 2OAP1 4YV7A 4F93B 4W63A 2GPSA 5DBEX 2J6BA 3WIBA 1QOPB 2HSEA 1ESMA 3IBSA 3PL5A 5ALXA 3CEPB 4I1IA 1KEPA 1C7ZA 3NWOA 1J33A 1E99A 4TVKA 4WNIA 5B1SA 3O8LA 1Y8ZA 5A05A 4PYKA 3SSAA 1FFXA 4MW9A 4D56A 5AKXA 3LVRE 1VE3A 2PH5A 1WUKS 3JATA 2OV8A 2VJYA 3VC2A 2VAWA 5L40A 2G9NA 4EY6A 2G6BA 2OXEA 4PLCA 1M1NB 1D2RA 1O4WA 5DM0A 1E6WA 3ROFA 1GNLA 1QCCA 3WO1A 1IVSA 4OHMA 1QP8A 3H2KA 4M87A 1Y9JA 1JFFB 2B7BA 3ZWAA 2B8NA 1CEQA 5M5BA 4G8CA 4PNEA 2B3TA 3KK0A 1PJCA 3BHNA 1PHPA 4X1IB 4E3WA 3DE4X 2Y1GA 1N8SA 3BWBA 4WIAA 2G70A 4XCQA 4MQBA 1ZNQO 2RHWA 2GVZC 3TLGB 3OP1A 1M0WA 2WJWA 3IH5A 2VDKB 3P2JA 2UUBB 4J16C 4A27A 2VOEA 3TPZA 1FSGA 5AXCA 1LDBA 1TL7C 3TO5A 4EEKA 1IYZA 3TRIA 2YIVX 2XX3A 5GONB 3J81k 1OKKA 3UKJA 2ZCVA 1A7JA 3H2HA 3MOSA 3I53A 3I6MA 2PUBA 4RKRA 3ZY3A 4FYHA 2C1ZA 1LW7A 3WAKA 1OHHA 3L6OO 3N2YA 3MXOA 3R74A 3SX4A 3W5VA 4AXBA 1Z34A 3ROMA 1KFKB 4OUDA 1Y80A 1MENA 1S2NA 3AM3A 5FV4A 1B76A 2R6JA 3DUWA 2EJCA 2H6EA 3D5EA 1ISGA 2PKQO 3GCXA 1XROA 2C7GA 4RIGA 4B6GA 2R00C 4HQLA 5DXAA 5KZMB 4TN1A 4QL3A 5DPMA 2BGTA 1QHFA 2YNMA 5KYVA 4B4UA 2VLBA 1P6QA 1ZCJA 2CY0A 3LUKA 4RK6A 5HBRA 1NU8A 1CQWA 4MITA 1SVSA 1TF5A 1ZGBA 2UVQA 3KC2A 5IX8A 4YV0A 1K3TA 3KKEA 1FUUA 4V0SA 2O7NA 3HP1A 3GDGA 3BDIA 2IZOA 3QKSA 3WJ2A 5AVRA 3DC2A 4KXUA 4BWYA 1JPJA 2QVYX 1OOEA 2V6GA 4XI9A 1KHTA 2JK0A 3HPQA 4JKOA 3AKEA 1M34A 3NAZA 5TGTA 4BB0A 4B6SA 4M1EA 3UCXA 1PN3A 3BSFA 5BN3B 3I8XA 2ZT7A 3E84A 5J2TA 1WMEA 1ORTA 3TL6A 4BGIA 4XPZA 5K0CA 2CXTA 1ULSA 1Z2AA 3W5AA 3EMDA 3GCWA 2OV2A 2HRZA 2V7PA 3EIXA 1A7AA 1IZYA 2RB4A 4UNNA 4H9GA 3KSDO 2V5VA 3FNQA 2A6PA 4J6FA 1XZBA 4YP9A 1H42A 1IXSB 3BZBA 4CQMD 1REQB 3WV5A 4POOA 1HLPA 4PWYA 1RXYA 4ZO6A 3TK1A 4L1KA 2CWWA 4OJNA 4GOKA 4JX9A 5EQJB 1H2XA 1G7CA 1TA9A 1FVFA 4GE3A 1ZEMA 3VR3D 3CONA 4CT5A 1CQZA 4RUKA 2QW0X 2ZB3A 1KBZA 2R4QA 1W34A 4YRDA 2JLRA 2NZYA 3PV0A 4F04A 2A4KA 3JQBC 5IXJA 1SCDA 3HVHA 1XDBA 3GW8A 4TRJA 2VSOA 2V65A 4HUJA 2J3JA 2FKAA 3FXAA 5MDHA 4P9NA 4TT3D 2EHJA 5TGDA 3QNWA 5KTSA 2JCVA 4DLAA 5B1EA 1AKYA 2G04A 1SHTX 1VBKA 4R2IA 1IQ0A 4ZWNA 2JFOA 3S8MA 1EU1A 3ROQA 1MD9A 2D0PB 3G82C 4LCBA 2J3QA 2A0YA 1F2UA 3VTKA 8OHMA 3T5CA 4MXDA 1LS6A 1I1NA 1EK5A 1Y8QA 2Z5FA 3GIDA 2EJUA 4JY7A 3QTBA 5KSPA 1WPGA 4FMCB 2GYVA 1Z5UA 4OCZA 4NQRA 5DM2A 2O23A 2REQA 4BXOB 1F48A 2JD1A 4FGUA 1XMXA 4MR8A 1YFKA 4Q03A 1H94A 4AECA 4MDFA 1H2ZA 4X1KB 3WGYA 5E9JA 2E49A 3DZBA 2X5JO 1SHZA 4JZYA 3VR5D 3BERA 1XAGA 3WKBA 4CDMA 5CTJA 1TZCA 3PVZA 3DCYA 3OCZA 1RAHA 4OFZA 2Z83A 1I7QB 1VB5A 4P92A 3VH2A 4MI3A 1SOVA 4EPRA 2UVDA 4PONA 3VKUA 1QRTA 1IWBB 2ATVA 1BQ3A 3E3NA 3ZI4A 2PDAA 3ZNQA 1QSGA 5KJFA 4EGFA 5E6SA 3A6FA 5F2KA 4JJ6A 3QX8A 3QA9A 4OAQA 2HCFA 5AOCA 3KJIA 4WOKA 3FJYA 3NV7A 1FB5A 2GZ2A 4IGKA 3TQIA 1CUBA 4X45A 5TQ2B 3QLEA 5FWXB 5DK4A 5KJEA 1I0ZA 3K0HA 3C16C 4BE4A 4K8RB 3REOA 4O3MA 4PFKA 5HDQA 1LX6A 3GRKA 2OQIA 3UMVA 4XDHA 4OQMA 4E08A 5FWYA 4WY2A 3DT9A 1RVV1 4PGMA 2OKGA 2ZR9A 4L0CA 2ZIWB 2B61A 5KS2A 1HQYE 1L1RA 1T3ZA 3OT5A 4YV1A 1THTA 4ZCQA 5JJKA 1QTRA 4RFLA 2GD6A 3HCCA 1EAYA 3U44A 1OIXA 1NM5C 2GXUA 3Q40A 4V0OA 1Z2OX 3I28A 2IQ5A 4XWTA 4DCVA 3OM0A 2HQRA 4BEWA 3CMMA 3DV0B 2ZRLA 1Q0ZA 3B20A 1G4HA 3IUEA 1V96A 2VPZA 2P6OA 5IYZF 4NCBA 2IWRA 4TTQA 3A4NA 2VSFA 4I55A 4P4GA 4N7BA 1H5UA 3R7AA 1YDFA 3HXOA 1TM3E 6YASA 1T9ZA 1GAJA 4L6IA 1P2TA 5DGHA 2X6TA 5FNVA 1KEUA 1W93A 3KKNA 4E11A 3QVTA 4J91A 5AT1A 3OAAA 1AO0A 2IPAB 2QT1A 1UK6A 1V37A 1IIBA 2PWBA 2PZMA 3D5TA 3EXG2 3GEEA 2BMAA 2J5RA 4RMHA 1J0DA 2N9UA 3TCNA 4E2XA 1NW4A 5C1PA 5EQTA 5CCDA 5IASA 3S2YA 1CC1S 1PR3A 1UWLA 3O1JC 3GAZA 3ENWA 1C4XA 4R0NA 3HM9A 1X1DA 3K15A 1DZIA 5H8WA 2I6GA 3ZS8A 3DP7A 3CF2A 5NLLA 4HEJA 1IZ7A 4WL0A 1J8VA 1HPLA 2VAMA 2OFOA 8AT1A 1GO2A 2R5NA 1KGSA 2I2FA 3ZY6A 1XRRA 2WUGA 3GJ5A 5B3KA 3D6MA 3NATA 4NV0A 1PJAA 2QM3A 3A3YA 3W5UA 1HDYA 1HQDA 4KL8S 3U7EB 1ODIA 4MPRA 2ZQZA 2ZT5A 3OUTA 3S81A 3IOEA 1V1MA 4R1QA 1P2UA 3KLMX 3M6VA 1IY8A 4TLCA 3PPYA 1SH7A 4KR3A 1I2MA 4DMCA 3DKRA 3U5ZB 1MORA 4DA6A 5CVUA 3TLJA 3OZXA 1YJXA 4R2JA 4JBWA 2QMEA 4AQYB 4EKIA 3AEUA 4O0MA 3I1JA 5A2GA 4ZRNA 3QXSA 2AG6A 2VDWA 4S0XA 5DMXA 1AGNA 1YRAA 1I80A 2YXLA 4Y2YA 3VH4A 4UEKA 5JVDF 1PR6A 2ZE7A 1M2GA 3EASA 3GPBA 1FW6A 4EI2A 1QYVA 2Q3BA 4X8LA 4UCFA 3VZQA 1D2MA 1GG2A 1XJQA 4Y0AA 3KHTA 4AURA 3PVSA 1CJBA 1UKVY 1E3TA 2P5UA 4IYRA 4R84A 5LMNB 3R09A 1E77A 4JX8A 4JVOA 4UJ3A 5DW0A 1SHJA 1W5BA 3C8UA 3LL7A 3D0RA 1ZUD1 4OQEA 1BEEA 4YRNA 1S4MA 2ZLBA 4UVDA 4R9RA 4Z0HO 5CBKA 4ZYWA 5JSZA 2JGAA 1FRFS 1OV4A 2YIDA 3P52A 4MLCA 4AMZA 4CRWB 1P80A 5AVWA 4YUXA 3IUBA 1H2BA 2FZCA 5JS2A 4B33A 1TPYA 1CUGA 4JMLA 3E1GA 5CHEA 3QRWA 4N12A 1GGVA 2PGOA 2YS6A 3VVLA 1PT7A 4C4RA 1NDUA 1XAJA 2CDBA 3F46A 4BWVA 4L9WA 1GRNA 3FR7A 5BSFA 1FVOA 3KU4A 2JLXA 5EE1A 4E5NA 3EGXA 3G5UA 1LSOA 4M86A 4BYGA 1KU6A 1Z18A 4V02A 2QRHA 2WHQA 1J9ZA 4DA4A 4GPAA 2FFQA 5GOTA 4X85A 4Q3LA 3OZ7A 1G3RA 4D9IA 1X7WB 1YJCA 4QEZA 4K9SA 4BAUA 1CFJA 1SCUA 4X24A 3UKDA 5IUJC 1Z8FA 2B0JA 4BQRA 1HYQA 4KQHA 1FFHA 2H1HA 3ZD7A 1TK2A 2WA2A 1QLWA 2ODBA 3KYDB 3LLCA 3PXCX 1QVZA 3WNDA 1YHNA 4D9GA 1W52X 3URMA 1XBTA 3A4YA 3G7SA 2HPZA 2I6TA 3TMKA 1E64A 2C3UA 3TOXA 1OC2A 1GNTA 3P9SA 3K9NA 3RVSA 1L5GB 1SQFA 3TZCA 3D8SA 2VT2A 1V6SA 3G5MA 4ERNA 2YOFA 1B43A 4E0BA 5JZSA 4JODA 3AESB 3IP1A 2GEKA 4GKKB 1HI9A 1PTJC 2IYTA 5H16A 3ZHVA 1G8FA 3QKTA 2C7QA 2PLNA 2EFDB 3U1VA 1XA3A 2DLNA 1S3GA 3KBOA 3JRNA 2ZZMA 1P0MA 2OYSA 1XMPA 4FE7A 4OL9A 1ZH0A 3TQOA 4P7JA 2ZJ7A 1MAAA 2OB1A 3PGA1 3VBEA 3R7LA 3OCCA 2AWNA 2DHEA 2HRDA 1KEEA 4UCXA 4G4IA 1L0BA 1X7ZA 4Z9XA 2ZZNA 2NO9A 1LDYA 2PLAA 1JAHA 3LOPA 3R8FA 2JFFA 4IHAA 1MPTA 3WIEA 5HIKA 3DMRA 3D3JA 3GJZA 1W581 3EQ2A 3OF2A 4G9BA 1UBOS 3RUIA 3SIXA 3VGJA 1UKAA 2AXQA 2YQ5A 4HB3A 5EZQA 5K4HA 1YRQA 4D5GA 2R5FA 1A98A 5C5CA 1IULA 3BIWA 4QGFA 1DTWB 4AM8A 1IXZA 1GR1A 3L7OA 3JQ9C 1OZGA 1NSYA 2RC6A 3Q8XB 5K99A 1WE2A 3PUYA 4JBXA 3B13B 3PL1A 1TTPB 4KLRA 4ZGBA 2PZAA 4NKRA 1JQEA 4C6RA 1PGOA 3KTAB 1W76A 3A1WA 1M6NA 4S0ZA 1BCSB 4V1CA 5KYWA 3TECE 4BO1A 1NIPA 1NN1A 1WOYA 2FTKE 2WT9A 1G8KA 2WAMA 1MU0A 2XUKA 4NZZA 3A4TA 1YONA 3HZOA 2JFNA 4YXFA 3V6MA 2ZRDA 3G5LA 2WYOA 3YASA 4C3OB 3I39X 3MN1A 2P2ZA 2E4YA 3AL2A 2FFAA 3W2IA 3UV3A 1KZ6A 4D9KA 4EHLA 1B26A 2PUEA 3AI7A 3NVDA 1R10A 4O4HF 5KTOA 1KZ9A 2Q46A 3P20A 3OX3A 4LXUA 4U7HA 1V25A 4LXGA 5EIFA 2W22A 3QELB 1Z4IA 4WI1A 2H4HA 5BNFA 1WW8A 1YA4A 2ZIXB 2HSDA 3QVWA 4ER3A 5C8XA 1FFXB 1T4BA 1JB1A 1DXYA 1U7WA 4MJ7A 4QNMA 4NCXA 1E1KA 3EDYA 3TPFA 4DPMA 4RZQA 4UVHA 4YBRA 5A3SA 1H93A 3GLVA 1MLDA 5D00A 5KCMA 2AQHA 3BHMA 2VXYA 1U3WA 2P0EA 1XZKA 1Q0UA 1KWKA 1KY2A 2PKYX 3CZAA 3D4PA 2WV9A 4YCMA 1R0YA 3R6LA 5HIAA 2WSIA 4I9NA 3FLBA 4RA6A 2WE7A 3IBGA 2V9ZA 3N0XA 1ZD5A 3LCUA 4LK2A 3WLNA 4GD3Q 3OE5A 4JVLA 2A58A 4YMLA 4PQGA 2VHYA 1DHRA 3JQ6A 4ALIA 4L5CA 5IULC 1GAXA 3AF1A 1X7HA 5BR1A 1X1AA 2WWRA 1NUTA 2ZUTA 1BMFA 1HE5A 1RPJA 1BX3A 3KZ1E 4BCDA 1GAQA 4KXXA 5K6TA 3CEHA 1EUDA 1T3TA 1G20A 3ZOZA 4CWAA 4MYCA 3X1YA 1JALA 2AFHE 5FJIA 1UM8A 4CKWB 5K1ZA 1EZ1A 3FOEC 2YZNA 1RC0A 3LL4A 1IHDA 3PDCA 3RVQA 4IDOA 2FLKA 1FRNA 4Q1CA 4AJEA 5B7GA 1EFCA 2OCYC 1SUPA 2X2OA 3AU8A 4NECA 4C0WA 1ZFNA 3NFRA 2CVOA 1QZZA 1WKBA 2AFRA 1U7OA 2IHZA 4JS0A 4LNUA 4LOAA 4RIFA 4F84A 2CVFA 5AVVA 5K3FB 4BC0A 5FA6A 1T5LA 3FGNA 3QE3A 4J0QA 1RMTA 1U2QA 2O14A 2VSYA 4BIMA 4EB8A 4QAQA 4KVZA 4ANFA 4W9MC 1WO8A 4QM7A 3IEVA 3D6JA 2OYCA 3C3XA 1Q11A 3ZZNA 1Z0FA 3EWSA 3IODA 3AUAA 3CPHA 4NJEA 2V6MA 3KDPA 2JBWA 2VHJA 4GDFA 3NUZA 4AMYA 2AFVA 4PX2A 1WXQA 4C3VA 1L4GA 2Y92A 1QIEA 1OVMA 1FLDA 2WD8A 4FKMA 3AEYA 4C0LA 1NXOA 1FXUA 3LWNA 4Q24A 5ALLA 1W94A 2XBUA 4EUKA 3Q3EA 4YMWA 3S3TA 2POCA 3H2IA 3MF4A 3A6PC 3HJAA 2BEVB 1FYXA 1MX9A 5TQJA 1KEKA 1HFWA 4V39A 4WNCA 5SZHB 3RRJA 2W90A 1AMUA 5CX1A 5TVGA 2VCYA 3A58B 1AUQA 1U2PA 3NFYA 4OXYA 1CYDA 3CUWA 4LDRA 3QPBA 2P5YA 5E6RB 4TL6A 3FGZA 4FCVA 1POWA 1EFPA 1VPVA 2JGDB 5JAZA 2PH1A 1B0PA 2RG7A 2Z2IA 1O95C 2CE2X 3O7WA 1DAIA 2CXXA 4E51A 1RQ7A 3L05A 1WXEA 4TTJA 4C6SA 3F78A 2DOKA 4XIIA 3FNFA 1NOKA 1QO9A 3EUEA 2MYTA 2Q5QA 3KE8A 5AW9A 1ADFA 3L0SA 2ZR8A 2HA3A 5JXGA 2RAUA 1NNSA 2YL2A 2B4AA 2Q6IA 4LBZA 2QTZA 4EHFA 1VJ0A 3NKLA 2NXJA 2OXIA 5FWNA 1UJ4A 2PX3A 2H5LA 2PA0A 1TUBA 3OQ6A 3PYLA 4HBZA 2B83A 4CQLA 2DQYA 5BWLA 1SNYA 5JTTA 1XDSA 3CEMA 3RBVA 3WYBA 1CSEE 1YB6A 4OBXA 3HXMA 1TZBA 3TAUA 2YXBA 5JNUA 5FF9A 2XZPA 1ZPDA 2FR1A 5KKAA 4E7PA 1P8AA 3IBTA 3LVBA 1E2MA 3F6CA 3U4CA 4DSZA 1N2HA 2OZEA 2WWIA 4LHZA 4PPNA 2X1LA 3W1WA 2X0RA 4GW3A 4CMCA 3PPXA 3KZKA 3CE9A 1EE9A 3HYSA 4P53A 4DB2A 5CM9C 2BD0A 4AWXA 1OVGA 3ZZ0A 4EQZA 5DLDA 2D5LA 3GARA 2VHEA 4H77A 3SFTA 1XAHA 2E6UX 2A35A 2R6CA 3LUHA 4ID3A 3ZE6A 3G0IA 1FX0B 3UBTA 4BC1A 3ZW7A 2H1OA 1P9NA 3LCCA 1WBBA 4OMUA 2F3TA 2C3OA 1NG1A 2BJWA 3ENKA 2X3YA 4CIBA 1RI4A 2ISSD 2A0KA 4HUTA 2Q5OA 3P9ZA 4DXDA 3GUVA 4EFDA 5HZKA 1HDEA 1YJ5A 4IOKA 1KL7A 3LQRA 3PNQA 5CA0A 4YPOA 3GEIA 1DO8A 3OEYA 1U4OA 4UCWA 4AICA 3WGUA 1K8XB 2C58A 1L4KA 3I83A 4EW2A 2XIQA 3OIDA 1Q84A 4WINA 4D45A 2PKXA 3ESBA 3MJSA 3PPVA 3SQNA 5IDXA 1DI0A 5DHRA 3ETGA 5ILQA 2VP9A 1GKKA 2IW3A 2QAGA 2BR4A 3UJNA 3GRYA 4LOKA 1ML4A 5TS2A 3Q15C 4GPBA 2ZJ0A 1FFWA 2FVYA 2CXRA 1XQVA 2WIKA 4FINA 4ZQBA 3AUFA 4KXWA 2DXIA 1PD1A 2VS1A 4E46A 3IEUA 4KQXA 4D6XA 3WL5A 1T3SA 5AJYA 4AO6A 2YJ4A 2RHRA 3DBRB 2WAXA 3HDGA 3M6XA 2OAQ1 1XKQA 4L7VA 4B1FA 1OH6A 4HTFA 5FNVB 1BXGB 2JGKA 1PK8A 2IV2X 1RS0A 1ZD3A 1QRDA 2VDNB 2HBRA 4Y2TA 3RABA 3RFVA 5C7OO 4XQ0A 1XCOA 5M3BA 5EZSA 5FB3A 1P1CA 2P78A 3FYDA 4R4JA 2P4EA 5AK4A 2ZROA 2G1KA 1OC4A 3S6JA 3WZ2A 1SWWA 3ESAA 4CMAA 1A2QA 1LJ8A 4IOLA 3RANA 3KELA 4N8SA 5ALKA 5EWMA 4W4TA 1NQUA 2F4VB 2BGLA 2AKEA 2CNLA 2WIBA 4K6OA 1KFJB 4PRZA 3RREA 3K31A 2ZVQX 2RG1A 1FMJA 1UBJS 2O7VA 3H05A 3K5HA 5I7HA 1UWVA 2FDXA 2FGJA 2IF2A 3X2FA 4FE4A 1WSDA 1D1TA 3GLGE 3STYA 1AC5A 3HN6A 3SE7A 1C1XB 2QTAA 3ZE2B 5KKNB 2XUHA 1S1CA 3PLRA 4L08A 1E60A 3UXEA 1V1MB 3E1SA 4HAYA 4YASA 1JDVA 3TX2A 4BQIA 1H85A 4U0JA 5L3RA 4JI2B 3CJQA 1AS2A 2QLTA 3LQKA 4FZ5A 3Q9UA 4G89A 4XM2A 3WWYA 1C29B 2AEFA 2Z08A 4QQNA 3GJ6A 1CQJB 1Z62A 4GOND 1ECGA 1N0IA 5EUQB 1EHCA 1R4MB 2QQ5A 4J0EA 1WXHA 4BZZA 4RANA 5LBTA 1NN0A 3RS4A 4BQNA 1TUGA 2VDWB 1FU7A 3FZYA 4M0UA 1KO8A 1ZX1A 2W2NA 3BL5A 3GT7A 5JZVA 4II3A 3T54A 3HY6A 4UHBA 4AL4A 3PQ8A 1ECCA 2ISCA 4PZYA 3K3PA 2HJWA 3OFNA 5CPFA 2BFEA 1ENZA 1RVDA 2OO7A 5DXJA 2YWRA 3IKTA 1ZA1A 4S1TA 1YWGO 2ZBFA 4KQKA 3N7UA 4P4LA 1MVNA 4C4PA 4F96A 3RUCA 1Q1AA 4YYZA 5LMUB 3I5UA 4D8TA 3I2YX 4RW0A 1EK2A 4JJEA 5AVYA 3K09A 1G21A 1TJPB 3M6WA 3RNLA 1K2VN 4Z0TA 4YUVA 1HEUA 1W19A 4IVPA 5D85A 5EP1A 5L53A 1GL7A 1XD8A 4AAYA 3BD7A 3W4IA 4Z9BA 1S6YA 3RRMA 3DD5A 3PXDA 3QQPA 1G8AA 5GVSA 2V7QD 5KDDA 1SXJD 3U3OA 3LQ2A 4OYLA 1RJDA 3TZKA 4CZ2A 3CGWA 2FW9A 3GF4A 4GVXA 3H4VA 5ADHA 4WTOA 4GPZA 5KOYA 1I4DD 4MTLA 2Z6AA 3UK2A 1Z5OA 1VL5A 1WMAA 4KOEC 2JB9A 3GT0A 1TDJA 5G0SA 2Z9CA 3KAQA 3RPEA 4BLRA 3EFHA 3K4HA 4ZMSA 5KNBA 2CJWB 2RCYA 2ZUWA 4BRUA 4O6VA 5HFAA 4MX8A 3TQCA 3AOEA 2O2JA 4YRBA 1L6IA 1OFIA 3ZK9A 2ATEA 3AF2A 4P4TA 5HXAA 3VPFA 5AVSA 5AXDA 2HMYB 2QD1A 4BEVA 1T1EA 3HKDB 3OMWA 3MGBA 3CU5A 2P2YA 4F4IA 2W2PA 4ZAVA 4AP9A 1T0UA 4MKRA 5K4GA 1XTBA 4F5EA 1ANKA 1I0LA 3S2SA 1K8YB 1EUYA 5GM1A 1W36D 2WM3A 5JAMA 3FE2A 1E32A 1L3IA 3EAQA 2OORA 2WWVD 3GNLA 1H3NA 3WYFA 1ND6A 1SQ0A 5LB4A 1ISHA 1DBWA 3OTIA 1FNCA 5KREA 4G97A 1OJLA 2F9LA 4Q12A 2Y68A 1KYVA 1L5HB 1RXIA 1G0OA 3KXPA 1ZUNB 1JEYA 2GAOA 3FGOA 4PZLA 3SVZA 3ZJVA 3C1OA 2DBRA 3MTEA 4KYVA 2IC5A 3U48A 1ZD8A 4BLOA 2XQGA 4WZBE 3L6BA 5IVPA 5EJAA 4Z49A 1GRRA 4OOFA 4AG6A 2AR7A 1E2EA 3FLMA 3KAPA 4HR7A 4V24A 5GZ6A 1DPFA 4YJGA 4E07A 6NULA 1SXQA 3WRXA 1I51A 2XNKA 5H5JA 5DHTA 1Q92A 5EYPA 3X1ZA 3U7FB 4EHAA 1UDCA 4FDTA 3GPDG 4UNRA 1WZIA 3G02A 1UPXA 2XAAA 5DVZA 5KVQA 5I9LA 4GZ3A 2VDMB 5KSOA 2FPRA 3SE0A 2GXQA 1H4QA 3DOHA 2AQ8A 1WR8A 4WZAE 1C1DA 4UQLA 3R76A 4IJMA 3K2EA 1JEQB 2IODA 3TGWA 1Q50A 2F59A 1AH2A 1TF7A 3QVVA 3IUSA 3U3ZA 4Z6KA 1IBMB 2IIVA 2NQ8A 1W30A 4AKEA 3MWKA 3K92A 1J0CA 2FK8A 5FL7A 1XJCA 3PRYA 1WVGA 4NS1A 4BGEA 4EPTA 5J2UA 1XP5A 1D2HA 4EY8A 2CFSA 1P44A 3WB9A 5J4VA 4FJ2A 3EDCA 2L82A 2RCNA 3O9ZA 1XZDA 4PZPA 1ZK1A 1SG6A 3E53A 3ZH2A 3VX3A 5HVNA 1KI2A 2MSEB 3F73A 4EY7A 3WYNA 1OWMA 4LTDA 4BZPA 2WUWE 2P1DA 4B6JA 1S2LA 3Q3GE 3V4RA 5C1DA 1LDEA 4N7MA 3HGQA 5CCXA 5EIXA 1UIMA 3M3PA 4OI1A 5JZOA 1RE1A 4JLJA 4B8WA 4AX4A 1V3UA 5LC1A 3V8NA 1FDTA 1A27A 1SCJA 2I7VA 4HT3B 3FHTA 1P1JA 3SXPA 5HJEA 4O25A 3VNSA 4W7HA 3FG9A 4NLLA 1U8YA 3DTYA 3KM0A 2QRNA 3E27A 4CEIA 4JU8A 1GDHA 4KXLA 1XN4A 1NF2A 4YCSA 4PC2A 1Y3FE 4YY3B 1DB3A 2O2YA 1LF5A 2AOTA 4WLOA 3H5AA 3R5TA 2OILA 2RGRA 1UP7A 2OBBA 4FFBB 4MWTA 1K7XB 3P2OA 1WOMA 4G36A 2GLXA 2EFGA 3TJZA 2AHOA 3IP5A 4MWDA 2ECFA 3SYMA 3DT8A 3H9JA 5CG1A 4G4JA 1MNAA 1XQWA 2A5DA 1Y5NA 4RD2A 4C6TB 5FLEX 4F1KA 3RIYA 2C4VA 3OQPA 5EVJA 5G0WA 3NM5A 4G8BA 4GXRA 5LR6A 3PUJA 3OBBA 4DCCA 2G76A 1RKUA 3ZWXA 3VOTA 4JXJA 5BPHA 4CEJB 5LBUA 3TNYA 4YR9A 1JTVA 2FX2A 1BQEA 4Z9YA 2ZZKA 3DLCA 3UAOA 4HPXB 2WU4A 4BKUA 4GOOD 1PAUA 1WXGA 2J09A 1UAYA 1KR2A 3GCGA 1HOTA 3QX7A 4BP8A 1LJUA 4MWZA 1U0OC 3AJRA 5IT4A 3KQPA 2JFPA 4JLOA 2JLWA 2ZYWX 1Y37A 3O5AA 1NXQA 3EWAA 5F98A 4H7JA 3ZD8A 4MW2A 3GO4A 2V4ZA 3HA5A 3HVUA 4ZCTA 4X7BA 5A9TA 1SUFA 3NONA 4RQUA 3UK7A 4Q4HB 1YBVA 2AOVA 5JQGB 1HKHA 1TK9A 2XB9A 5CEJA 1M5UA 3Q5EA 4HX9A 5DIFA 5IJZA 3HB1A 2WJZB 3E22B 4RIEA 4V3BA 5KOJA 5H3HA 2I5PO 4DCNA 4Z3KA 3GP8A 1T35A 3PFIA 3PI7A 2AN4A 5M34A 2QX9A 2YHBA 4XQEA 4BRSA 1SCKA 3DPIA 1L4FA 2KPOA 2EL9A 3GZNA 1KZ1A 3HLKA 3ILXA 4H6WA 4RCVA 5DOZA 3RYHB 1RCUA 3MB8A 3R7WB 4DQLA 3O2JA 1YF3A 1Q17A 1PQUA 3T41A 3BGVA 5I9BA 2GN1A 4AJLA 2CJPA 4K46A 1CJSA 4F21A 1YULA 2QRQA 1R27A 1IJBA 1KH1A 3EOZA 1OILA 5K3EA 2VZ8A 3KFVA 4EAQA 1CPYA 3ZDZB 1FDUA 1P75A 1SUAA 3FCSB 4K1LA 4JD5A 4UHHA 2W70A 3EX7C 3PQ2A 4A8JC 4DNPA 2BYTA 3MTQA 1BSVA 3HM2A 3DZHA 3DMNA 2OCIA 3GELA 4MPJA 3I8OA 2R8YA 1T5HX 4LFAB 2VHTA 3EJWA 4YRFA 2G8NA 3MSXA 1UMBB 5KCZA 4BATA 4DTCA 1GTSA 4J1TA 1PNRA 4A91A 4DLWA 2G40A 1J8DA 1XTKA 2HW8A 5K2MA 2V7UA 9ATCA 4MVJE 1I3NA 1TADA 2PQ2A 2BEWA 3C98A 4RZSA 3R7DA 1KU0A 1ZA2A 3EXEB 4HVLA 4UVEA 3CSDA 3KR1A 1EGHA 1WG8A 2AFIE 1V9LA 4N5MA 4ZEVA 1ZH6A 1H4SA 2BM0A 1R15A 3NDIA 1ZK4A 5K6AC 5D3KA 4PNZA 2NVBA 5TSDA 1NG9A 1GN9A 1W1UA 2PAAA 3GEBA 4M1WA 2DUWA 5FAKA 1UFOA 2PUGA 1NGSA 4K5QA 4B71A 1TT5B 1YI8A 3A9VA 3PSHA 1QP0A 1WUIS 3CY6A 1XLUA 4BTLA 2OCAA 4IFEA 5EHZA 1TO1E 1HH4A 5F9FA 3BJZA 1JHUA 1KMHB 1SZCA 4QFDA 1TQDA 1QG4A 4DQVA 2F3SA 3H1PA 1OXMA 3H0CA 4JIGA 2PJUA 4B43A 3I61A 5EMNA 2IS2A 3KQHA 3BIOA 1XRSB 2FMKA 1BFUA 3NKVA 4OSOA 4QODA 5JOQA 5KYNA 1PL0A 2D5AA 2DFKB 4MRRA 4IVNA 4OGFA 1R5BA 4ZU1X 4FZJA 3II6X 1T36A 1IHXA 5ECWA 3HKEB 5DXFA 3CVYA 4J16A 1AVTA 1PZFA 2GRUA 4G5RA 5CT4A 4DNFA 4GPEA 2VTBB 4ZOLB 1TM5E 3WBKA 1PV4A 2B20A 2C2WA 3OLXA 3W6ZA 4B6EA 2RMKA 5EHXA 1N34B 4ZTBA 1HDRA 2EATA 3PK0A 3SM9A 2AD5A 1QZTA 2EBWA 3TNFA 1WL8A 3FZEA 4NYJQ 5H68A 3AEKA 2DERA 4MO9A 1DL5A 4IV8A 3GJ4A 2A5JA 3EPRA 3WB1A 3J80A 2PO5A 3ZU2A 1WRBA 1Q1QA 3TTVA 2BFFA 5BRAA 4IF4A 5DDIP 3RIGA 1L5KA 3K5IA 3JQGB 2SBTA 3FCYA 3GEDA 4LJ6A 1KH2A 1SVMA 3RC7A 1LY1A 2R00A 3A27A 3FDJA 4P4NA 2AFHA 2YWJA 3IVXA 4RIHA 5JPDA 1FC0A 2YHIB 3W8DA 1V11B 2YFYA 2ODQA 3HCRA 4L72A 5CA0B 2CGEA 1IUKA 2BN4A 1RRKA 4L3OA 3K70C 3H4MA 1E5TA 4Y6OA 2VDQB 2PBRA 5ALRA 5ALOA 2ZUBA 2XBMA 1HGXA 3W5HA 3KSUA 1NW5A 2HO4A 1DDIA 3CIFA 1NW7A 2QAGB 5AW2A 3NP9A 2JLCA 3DC7A 1PUIA 3R6WA 2ZWVA 4Q1EA 3RYCB 3G2PA 4DR3B 3LP8A 1L4YA 4OQQA 3EZ9A 2BGKA 4EY5A 3WKDA 4PEVA 2IZ0A 3BX1A 3NXKA 5HKLA 2QD5A 4Y6RA 3INYA 1QONA 4I8IA 2O2EA 1VZ3A 3KXIA 4FYJA 5EERA 2VTKA 5ILOA 3KXLA 1YUNA 3K9QO 1EP9A 5IDQA 2ZAIA 1U94A 2A8YA 4YDHB 4DV0B 1D03A 3K9BA 3A1FA 4TXJA 2BJHA 5IM5A 1Y5RA 3NC0C 4KO1S 4HTFB 4IXDA 4DCGA 2Y1CA 3OEED 4M9RA 1T29A 5KOHA 2I71A 2TRSB 4TL7A 3EAGA 1Z25A 3G79A 4TMVA 5T57A 3UWDA 3WWOA 2I78A 4EJSC 3A2LA 5J5CA 4N8EA 4O2BA 1P2FA 4J7CA 1PW7A 1TIBA 2VKQA 5FQOA 2HDNB 4L5YA 1NX6A 3CZRA 4PYRA 3JQBA 2X3FA 3UMJA 3A3NA 5K05A 4LYFA 3EA4A 2JGFA 1Y98A 3SR0A 4PICA 5CDGA 4II2A 3TZQA 4DF3A 3NHUA 1ECPA 1P0QA 2DU8A 2FG5A 1NC1A 4RX1A 1UKCA 4L22A 4FFMA 3UUFA 1ZCFA 2VUSA 1NSFA 2SCUB 3NCHA 4JK3A 3OIVA 4EUEA 4HEA1 5BQPA 1HYGA 2O0JA 3HUDA 3RRZA 4S1NA 2W6PA 3C4VA 3DAYA 4IQFA 4LISA 4X44A 4E4RA 2B98A 5TQVA 2OHVA 3RO7A 4B3MB 3O4GA 5IBQA 3TRDA 4C07A 1X92A 1H65A 5BW8A 4BMSA 4DY6A 4E31A 4TTSA 5IJ0B 5MGBA 2O4CA 1ESNA 4AIIA 1U9ZA 2QD2A 1L5FA 5IWCA 1IRIA 2DPXA 1TCBA 5TT0A 5JRZA 3RLIA 4ZZ2A 1TTQB 4R01A 4X97A 1DT3A 1NUAA 1SBCA 2Q3JA 2H07A 4BX3A 3EA0A 4O4IF 3HEMA 3FDZA 4AKHA 1NXVA 5TY0A 2VCHA 1Q16A 1V4NA 4ND4A 4RVUA 4UHCA 2IHJA 2ODPA 2YJTD 2Z2XA 4TZTA 3DFKA 4WKNA 4JIMA 2EW1A 1LF0A 1PK9A 2GZSA 4HNHA 3LX8A 3GA7A 4HPWA 2BFDB 4RF5A 2GPJA 4TXMA 2HR1A 3TTWA 1R37A 1Z7BA 2Y27A 3B6MA 1G6KA 4G1BA 3FPSA 1ISSA 1NOJA 3HJUA 1VJ5A 2CZQA 4RDCA 4WPGA 5L6MB 2H4WA 2SHKA 5C1BA 4FS3A 1MDBA 2TYSB 4G9GA 4EPXA 3X2EA 2O3JA 1TKCA 2B35A 3N2NA 4EHJA 4URVR 3TYXA 2FZLA 5BN1A 1CY6A 5I7RA 5C80A 1KP9A 4H3HB 5E7QA 4TV8A 1JWLA 3QHPA 3UH0A 1G21B 2AMLA 2X4IA 3Q0EA 3WSTA 1YL7A 2HSZA 4PRKA 4ZKDA 2CBXA 4TUYF 3TSZA 2NTNA 1WDLA 5CK5A 1YDEA 3LLVA 2AMVA 1AV6A 4EX7A 1KJYA 3CXUA 2ZS9A 3KKKA 1YRHA 4C14A 1FY2A 2LV8A 3DKKA 3T5MA 2HRBA 1M7GA 2V9PA 1JP7A 4P5PA 1F6BA 4S24A 4U6QA 1ZW1A 1NBAA 4G86A 3SLRA 1NM5A 1K6JA 5IC4A 3JVEA 3F6PA 5DCWA 1LVHA 1H9CA 1IB6A 4WX2B 3GXOA 4MW6A 1Q14A 5DN6A 9GPBA 4C87A 1OLOA 3I3OA 2HJSA 4Y2VA 2NYAA 3KLPX 4R98A 5C8DA 2ORIA 3DOFA 3GGGA 1FMLA 4YP6A 3GT3A 2H08A 3D8NA 3ND8A 4YCJA 1JWBB 3ZHOA 5KKCA 2FZKA 2IY9A 3LKVA 3ORHA 5CEFA 1PFQA 1TZ2A 2A9PA 1D1QA 3G5TA 3KJXA 4L8GA 1PYGA 1SBZA 2VR1A 2YOHA 5FUBA 3V4PB 5HKAA 2X6QA 2A1UB 4N0PA 2CL5A 1MX3A 2C54A 3C14C 1KBOA 1DUIA 4C78A 3NX4A 4ZVTA 1IB0A 4QXRA 4DWVA 4DLBA 2JGJA 3ZIAD 1CRWG 3A9WA 3GFPA 4IIBA 1KI3A 2GARA 3ABIA 3NBKA 4P22A 5IPFA 5DNDA 2WSMA 1O54A 1X0VA 2XYVA 2EZ8A 4I3GA 3JAKA 1M6YA 1PS9A 5AXAA 2XKBA 3GY0A 1JPNA 4B09A 5CFMA 5K0EA 4IICA 4KUHA 3LCJA 1AM4D 2NP7A 5D5PA 4ZVNA 4W5RA 3K0CC 2EP8A 1TW2A 3T9DA 3DFFA 2IDZA 1XLVA 1G3QA 2VHUA 3H42B 4NYMR 4R0VA 1N32B 3PC4A 2HOQA 5FTWA 1YZKA 1K6EA 1QX4A 3ASVA 2EWMA 5JMPA 2P4HX 3AY3A 1JSCA 3GLGA 3E9NA 4ZVLA 3CW8X 1N2SA 2CF6A 3DVAA 2TMGA 2Y77A 3EFOB 4AMGA 5P8WA 3A6HA 4YXWD 3UY4A 1CBUA 2PGJA 4HMOA 3VR4D 4L5BA 2CVQA 3KYCA 4BJ6A 4G6ZA 4EHBA 1AHNA 4CYMA 2WSLA 4LPSA 4N39A 4UQOA 1FP4A 2Q62A 1DXHA 3HQ4O 3WB0A 1FP6A 4HGRA 3MJHA 4M9QA 1PYOA 4OJYA 4EELA 4WBNA 2YXPX 3MCWA 5IJXA 2QAJA 2R7AA 2DT8A 2Z2JA 3NAQA 1DIHA 3GA5A 1JYFA 4MPPA 3FFTA 3WBBA 2CBGA 2FSUA 1W2GA 4G5HA 4BKQA 3ETEA 4NTZA 1YZLA 3KE9A 2G0NA 2P3QA 5C9ZA 2R65A 3G88A 4HB4A 1JI3A 1F8UA 1VC2A 2P68A 3ILYA 4ND1A 4UVIA 2ZBVA 2E21A 3L0PA 4H6VA 4KYUA 3CO5A 1NZJA 1FF9A 1P77A 3JSXA 2NU7A 2VF2A 4WHMA 1NBMA 4P4SA 2QTVB 4YTEA 1RHJA 4N3BA 3EXFA 5TJHA 5C8YB 5TT1A 1Y7TA 2J0UB 3IOMA 4WEQA 3QF4A 5JLAA 3RFFA 5I48A 2VN8A 3O2NA 3IPYA 4IR7A 4RH3A 1A97A 3MWEA 4CUJA 5JNSA 4YJ2B 2AVNA 1YL5A 4EG0A 3FUVA 3CUTA 4RHYA 1FFDA 2Q5JA 1MQAA 3QLJA 3ICCA 3L3BA 4HI0E 4HJXA 1F1JA 6GPBA 5EZYA 1A9SA 3GJ8A 4QBKA 4GAEA 1NY6A 1VZ2A 1T4GA 3DTVD 4BLWA 5DZSA 1DLIA 1JH8A 3EIEA 3HADA 3UIEA 1RU3A 2EG5A 3GG2A 3RUEA 5D3QA 2JIZD 5KTTA 4FE3A 1Z28A 3E15A 5AI6A 1NQVA 2J08A 3BMOB 3PEVA 3T6KA 4ZVUA 3NBMA 3QI2A 3OLCX 2R11A 3ND5A 4HDNB 2B6HA 5HF9A 4B73A 2R85A 3DL7A 1A8IA 3AC0A 1GHTA 3MW8A 3RK0A 4CF4A 4W5TA 3K30A 3W90A 4DLXA 4J0DA 5DYTA 1PTJA 1VLJA 1OF1A 1XJ0A 2JI8A 3BWVA 3HB0A 2I2DA 1RYMA 4IH9A 3CW9A 2HX1A 4UCQA 1F3OA 2P2LA 2NUPB 2M6RA 3KQUA 1QFYA 2C9DA 3VKVA 3IAM1 3HO6A 4NL4H 1D4ZA 3MMPA 1JEOA 4K9QA 2LGJA 5AJZA 1I32A 3JD3A 4NK5A 3HYNA 4UHDA 1GRVA 1UQUA 1YOVA 5JC1A 4KJZA 1UBGA 5CAEB 3DNMA 3OOWA 2PA3A 3OH8A 3MT9A 1T3LA 3W8RA 4C2BA 3VYWA 4FX5A 3P9IA 4RFVA 1KQ3A 2XF8A 4WZBA 3CVXA 4L9SA 3TIVA 2V59A 2EJVA 1T5BA 1WEHA 1XRQA 2Z2KA 4BMYA 3S55A 2JIDA 5FTKA 3FCOA 5AFSA 1A9TA 4MGYR 4HGOA 4BN0A 2CK3D 5TPWB 4MUGA 3JQ9A 5D2CA 2O6LA 2JIMA 1XC7A 4YEDA 1DG9A 1T8TA 3O1LA 2OD7A 2OO5C 3K0EA 4LCJA 3T7KA 4UTVA 4RJJA 1S02A 3F6EX 1UR5A 1E0KA 3FMGA 1JDSA 1K0UA 2BDUA 3GRZA 2PS0A 4WZAA 4J4TA 2XCIA 4YJDA 4L9AA 5ECDA 2Q3FA 1EX9A 1Z0UA 3OA2A 4KTVE 4XJSA 3KKQA 4Q1VA 1XJWA 2EGUA 2X0JA 1JLRA 2VNJA 2WPDA 2IX9A 3VPDA 5F9MA 4LDJA 4I81A 2EIHA 3OLQA 3URKA 5KYGA 8MHTA 2HJRA 1IN6A 3CKLA 2DE0X 2QB5A 5FR2A 3SHFA 5JBNA 2JLBA 2FX3A 3NUGA 3WDKA 1DBSA 2Q8QA 2CBZA 5GP1A 4YUAA 3C70A 4XDZA 1PQ4A 5FFFA 3U60B 1RWXA 2GUGA 1S96A 2H3HA 3RKRA 1ISMA 3QU7A 1R0ZA 1XXHB 2DEUA 2FSIA 5ESRA 2FUCA 1Z0JA 4MW0A 4Q01A 4M1MA 3TJRA 1GPMA 3RS5A 2FFBA 4PCLA 2JD0A 4TV9B 3MMNA 4P5EA 1ZH4A 2VDLB 1WDWB 4HGNA 2H63A 4NWIA 2PKRA 4Q4JA 2DBZA 4B87A 3K0AB 2E4XA 4CDGA 2X0FA 4UOEA 3QVOA 1QQBA 1GNSA 4ITUA 3CWCA 3OD1A 1HL3A 1T13A 1YC2A 3T7TA 3WLPA 5HILA 4S1OA 4ZQHA 1IXYA 5FTLA 2FQ1A 4IKOA 4LRYA 4RZ2A 5CG2A 2EW8A 5C8VA 1J2UA 4FYWA 3DBVO 2MINB 3ZDAA 1K75A 4WJLA 4XQCA 2FSPA 4CLRB 1DTEA 4FYVA 1Z33A 4H0NA 4HFNA 5LQRA 2JIPA 3TRKA 3W5SA 4NHOA 3OURA 5CH5A 1NT4A 4DKJA 3G6KA 3HCFA 1EYZA 3PEEA 2RHLA 4HADA 3B60A 1X7XB 1VL6A 5EPEA 3B7GA 4S04A 4RF2A 4YCAA 3CCBA 1P39A 4LQ4A 1JDBC 3HY4A 2GN9A 1U7UA 4AF8A 5IAAA 2Q1SA 1MW9X 5BV8A 3KPUA 4IUYA 3GP5A 1XZJA 3WMEA 1A1VA 1ZXBA 2OXRA 1EPUA 1SU7A 4OHVA 1N25A 4H7FA 1B3RA 1ZSVA 4I55F 5C53B 1UPBA 3N2GA 1II8B 2LWIA 1LUAA 2AJ8A 1XCJA 5DCUA 5DNUA 4I4LA 3AOGA 4EQ6A 3H87A 2TECE 5FPPA 5FNVF 3RUDA 2AD1A 3PNBA 3QEMB 2QQEA 2AX4A 3KTFA 1O6ZA 3ZV7A 2J8ZA 3L0IB 4PYIA 1JFRA 4UBNA 1KQPA 2HU5A 4Z4GA 1NC3A 3SQDA 1QCDA 2ATCA 3HV0A 3MTBA 4GDMA 1QNFA 4KKXB 3TNDA 3WJ1A 4ZCMA 4RD3A 3DBOB 4E33A 1QIHA 3U3DA 4YUYA 3WLHA 1UQTA 1KI6B 1RJ9A 1TU0A 2I6QA 4B7UA 3GLFE 1EX6A 1WDTA 4ADSG 2V55B 4N0MA 4H0CA 3B3AA 4NBUA 5BSHA 2O2IA 4R71A 1WUJS 2C92A 4BDTA 5C2JB 2YY6A 1NURA 1GD1O 1DKOA 1U2SA 3KPYA 4DBZA 5L7TA 1VRVA 3P0RA 4RZ3A 4WERA 4YRAA 5H3LA 4FGWA 4D46A 5JISA 3B3QA 4EG8A 1JAXA 3F2IA 2YQZA 3E2IA 1G7SA 2FWIA 3MNFA 3QOYA 4IV5A 1DWUA 2ZU6A 2BONA 1TGVA 4UEWA 3O8NA 1T10A 1SC3A 2YIMA 2AH5A 2EW2A 1Z2NX 4B85A 4DR6B 4G5OA 3EHEA 2YRXA 4HTAA 3DKIA 3K1JA 3PR1A 4GKBA 4M9XA 3T94A 1O95A 2XDYA 2PWPA 3IEKA 3EFEA 4X20A 4ZQGA 5EJIA 1SA0A 4YUWA 1NJ6A 5AM4A 3AIOA 3GD7A 2H9IA 4HLNA 1MW8X 1DEOA 4K8OA 2P2CA 3SWWA 2E5FA 2D5BA 3AZQA 1GL6A 2NWQA 1SEVA 4WJZA 3ZHSA 5C37A 1NVGA 1YRBA 2EC5A 4GM4A 2H06A 4MVJA 1GCOA 4O63O 3VI4B 2CL6X 5JBIA 4U6SA 4CMGA 2EEZA 1U9IC 4JI5B 3TMAA 1RWMA 1QH8B 4ZN6A 2AFIA 2ON6A 2ZRQA 3KUCA 3ABQB 3HCBA 4MS1A 4ZK6A 4ZT7A 2O8FB 1FXSA 3OOJA 2R86A 2ZYTX 1NXWA 1WD7A 4P0TA 1K7YA 4XD7D 1E62A 4XFJA 4Z2AA 4XVRA 2FEMA 1HFEL 5LU8A 3DHYA 4NMMA 4IINA 4QXOA 1L5LA 3ZIDA 4CF5A 1UM9B 2FDRA 3BZUA 3IRVA 4HAWA 5AP9A 4CG3A 2NNWB 4GU5A 4MVJP 4D4KA 4ZO9A 4A23A 1MOQA 1D3AA 1Y8AA 5IKXA 5HKKD 2HIMA 5KHOC 1TT7A 1AGRA 2WINI 2AL7A 3GBSA 4OHBA 4YR7A 3ME5A 1NUUA 3HR8A 1SPXA 3FPGA 4XB6B 5JCJA 4BJHB 4AG3A 5JPCA 2WKWA 3QWIA 3VJLA 5CDHA 3UPDA 2NSLA 3MJTA 4I99A 2C4KA 2GZHA 2HEIA 2Q6TA 3HL4A 2BH2A 1U7XA 1QDEA 3IUNA 4P83A 2PYIA 1LSUA 2VJNA 2AG1A 1XRNA 4LRUA 2RARA 4I1UA 1KOLA 2B34A 2BI4A 3U9SA 3DMGA 4I4TA 3P9QA 4F3RA 4FP9A 1ODCA 3W04A 1Y1RA 1Y8RA 1G5RA 2Q1WA 4UM7A 1G3MA 1DKRA 2ZW9A 4NYMQ 2R5WA 5MN6A 1P4AA 3FCEA 1ONBA 2I1VB 3SYNA 1NATA 1W59A 4P36A 3TZLA 4LQCA 5KJ6A 1PG5A 2HMVA 2VWPA 5B4UA 3DEKA 1KXJA 5JNWA 1IG3A 5LIRA 1J2RA 1VQ1A 3UWOA 1CEYA 1NX9A 1GAEO 4ZOEA 1X15A 4DVJA 2NXCA 1MR3F 3ICPA 3JWHA 4DXHA 4HGZA 1SOAA 3KX2A 3N8GA 4AWAA 1C9EA 1W6UA 1CUZA 1E5LA 2XNHA 3CMCO 5EEGA 2VNKA 5IP5A 2K7FA 4R8SA 3T1NA 1I9CA 1ONOA 1G60A 3DE1X 4F4HA 5CT6A 2XUIA 2D59A 3PQCA 2VCEA 1HF3A 1GNRA 3OJXA 2KLHA 4I66A 4IKEA 2G9RA 4US0R 5B55A 5J43A 4ZCIA 1QE5A 3ISJA 1J5EB 1V1RB 1TPZA 3L93A 3DD1A 4IDHA 2RBKA 4LWQA 3ZY4A 4CI9A 1NBWB 2AYXA 2IHBA 5BR8B 2YMLA 3EVDA 4RSRA 3PCXA 1AKVA 3ESQA 3GLHB 5BW6B 3VU3A 5KHLB 1MBZA 1QVRA 5FO0A 1G6Q1 2DFVA 4MYUA 3HL0A 3RTEA 4ZDIA 1TYEB 5KNCD 2F8SA 1Y7PA 1OT3A 3VNBA 2FMHA 4DCUA 5JJBA 3DR3A 1P74A 5DLEA 2M1XA 1K4MA 3EIUA 1RHKA 3AEXA 4X5OA 1Z38A 4PFJA 2Q7OE 5AHXA 4C4ZA 2AEJA