4LX8A

Crystal structure (2.2a) of mg2+ bound chey3 of vibrio cholerae
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
ANKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDFDFVVTDWNMPGMQGIDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Barrier of CheY3 and Inability of CheY4 to Bind FliM Control the Flagellar Motor Action in Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Signaling protein
molecule keywords Chemotaxis protein CheY
total genus 41
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4lx8A00
2BGGA 2GKGA 3O74A 3FMVA 3NNSA 1ZHHA 3LKVA 5EWJB 4JASB 2KYRA 4MS1A 5IBQA 1P6UA 5DKFA 2JK1A 4TN5A 1JYEA 1USGA 4DADA 4G0ZA 1DCKA 3T95A 3SAJA 2FMIA 1DP4A 2CHEA 2IKSA 2CWDA 4MS3A 1E6KA 4UHKA 3QEMA 2PUCA 3QX8A 4ETNA 4W5QA 2HQOA 5EWMB 1NATA 3CG4A 4LZLA 3EULA 4H60A 3Q41A 4ZMSA 2IDMA 3RVLA 1SXHA 2F8TA 2FEWB 3JPWA 3KS9A 1A04A 5BRJA 3JPYA 2M1ZA 2FXIA 5DCLA 1YK1A 1FSPA 1YK0A 3HSYA 4WXEA 4E7OA 2QVGA 1Z2EA 2YHBA 3I09A 1QP0A 5KQLA 2WWVD 5KQMA 2IPNA 3OM1A 4RK5A 5TQ0B 5ED4A 3M9XA 6CHYA 3IP7A 4YS6A 4HNSA 3RVQA 3LUFA 3OQMA 3A10A 1D4ZA 5JNRA 3HVRA 2JCGA 2GX6A 3M9WA 4KMRA 3A3KA 4Z99A 2MYUA 3NNNA 5JNTA 1DBQA 2I6FA 5KC8A 5BRAA 1C0EA 2X7XA 4FE4A 1M5TA 3E61A 1L5ZA 3OLXA 3GYBA 3K9CA 1JDNA 1QNLA 2WB4A 3VNBA 1ZN2A 4N0PA 4OLBA 3C6QA 2A9RA 2JB9A 4F8JA 1MB0A 3HZHA 2NZVG 3T8YA 2W42A 1SXGA 5GQSA 3HJFA 1ZH4A 4YLEA 4MR7B 3GV0A 3LUDA 4YGXB 4G0QA 4Y9TA 4RK7A 3TB6A 1M2FA 2WMYA 4N03A 2OENG 2A9OA 2QR3A 1DRKA 4S04A 1Z15A 1JFVA 2IOYA 3RVSA 1AB5A 2HJ9A 3JVDA 3TX6A 1ZESA 1RXEA 1D1PA 5TQ0A 2L18A 2NT3A 5TPZA 1D2AA 5FWXA 4JA2A 3URMA 3QELA 3VNAA 4MS3B 3EODA 1NXWA 3DLHA 4FB4A 1EHCA 1BDIA 4N47A 3O1IC 4MR9B 4Z0NA 1ZITA 1RPJA 4G0YA 1DCFA 1BVHA 3IDOA 3IPCA 5IEBA 1Z13A 2PL1A 4F12A 2QV0A 3M6MD 1ISRA 3BILA 4RWEA 4OG2A 3RVNA 1GCAA 1P8AA 1MAVA 1U04A 2ID9A 2OQRA 5TE9A 3SNKA 1GUDA 2PL9A 4ZYLA 4PYRA 1LBIA 3CRNA 2IPLA 2RJOA 1DC8A 1JF8A 4L4UA 4MRMA 3DLBA 4MLDA 4YV7A 2A9QA 4W5RA 3EDCA 3O21A 4MS1B 1QO0D 4S05A 2TMYA 4P98A 4JP1A 2FEKA 3I42A 4MR8A 2NZUG 4IMJB 2FQXA 4LRQA 5DTEA 5EWLB 2FLWA 2FMKA 4HNQA 4JAVC 4MS4B 3H6HA 3CU5A 3H5TA 1J56A 5TQ2A 9ABPA 1PEAA 1CEYA 4N76A 3HM9A 1DG9A 5C5EA 2PJUA 1A2OA 2L17A 4D6XA 4HYEA 4XFKA 4Z4HA 3HDVA 2MYPA 4LE1A 3H5WA 3IP6A 4KQ9A 1QMPA 4OTZA 3N0WA 4KK4A 3KKEA 4GPAA 4Q7EA 5HQJA 3LMKA 3H5VA 4G0PA 4ZJPA 1QP4A 1NXOA 1SD5A 2WJWA 4Z4CA 3DZDA 4Z4EA 5TQJA 3CZCA 4LE2A 5B3JA 2WJAA 4RXMA 2FMHA 1RNLA 3BBLA 5TPWA 2M98A 3CLKA 3EQZA 3GRCA 4O5AA 1U8TA 4D74A 3DBIA 4IRXA 1C4WA 2ZWMA 1Z16A 4Q6WA 4XAQA 1JH9A 1EFAA 3LUAA 4RK6A 5T7BA 3FFXA 1CYEA 2QXYA 3KSMA 4FE7A 1TMYA 4MS4A 3K4HA 3ROTA 4ETIA 4F3TA 1JWLA 3IPAA 2R47A 2RGYA 4L85A 7ABPA 2IYNA 2MYNA 3OMXA 5CNJA 2PLNA 3CTPA 3UK0A 2FMFA 3H6GA 4Q6BA 4W5OA 2O20A 1JLKA 2R48A 3FFTA 4NQRA 5CHYA 3F73A 1E2BA 1R8JA 5E3JA 4KV7A 3F6CA 4PZ0A 2FVYA 3HXMA 4EVSA 3Q15C 2FN8A 2H3HA 2FKAA 5CNIA 3TMYA 3IP9A 5IEJA 5KQGA 2HSGA 3NHMA 4QPJC 2QSJA 3RVPA 4LDZA 3N53A 3OO0A 3A0RB 5FWXB 3GT7A 5TPWB 3DGEC 3F6PA 3T38A 4G0OA 3G1WA 4JOQA 3CG0A 1F51E 4MYRA 4RK0A 1M5UA 1YTUA 2PUFA 5IUNC 1QKKA 3HO1A 1UDRA 1DRJA 1FFSA 3HUUA 1ZAYA 1YMVA 2FW0A 3N8IA 2PE5A 3C3KA 3E3MA 1PNRA 3QEKA 4MRMB 1TLFA 4NCAA 3H5OA 5BQ3A 1OXBB 1YVUA 2E4YA 3LUCA 5EWJA 4MR8B 8ABPA 4EGSA 3LKBA 3OLWA 4IGAA 4RKQA 4RV5A 1B00A 3B2NA 1P6QA 4RK4A 3HS3A 3W9SA 3S99A 3HDGA 3IP5A 3OO1A 2E4VA 4EVQA 3QX9A 1BA2A 4XARA 3Q7TA 3JTEA 3OLYA 4EVRA 1F4VA 4KZKA 2QVCA 1NXPA 4TLMB 1BAPA 3QLVA 4YWHA 1XWWA 2JVJA 1W25A 2VK2A 3GWGA 3SQNA 2FEPA 3TD9A 3O2QB 2R25B 2V0NA 3RH0A 4EYGA 2LPMA 3FDFA 1DBWA 3GA5A 2LP4Y 3O2SB 3FFWA 1D1QA 4QYMA 4ZMRA 3KHTA 1NTRA 2PAFA 3GBVA 2FQYA 3QLTA 3SY8A 3BRQA 3Q7RA 5KI6A 4MR7A 4JB0A 3N0RA 3QLUC 3O1HB 1GLGA 3QLVC 1ABFA 4M88A 5IX8A 2N9UA 5EWLA 3N6VA 4QICA 3OQOA 2F8SA 2MSLA 1YIOA 1DBPA 1VLZA 3LOPA 4OBBA 4RSMA 1FFGA 1ZDMA 3Q7SA 4KRFA 4W5NA 2FSPA 5JNVA 3LUHA 4RY0A 2GI4A 2JRLA 3A0UA 3EGCA 4WZZA 1A0OA 2MYTA 4JB2A 3O75A 2VUIB 1Y1LA 2R4QA 1SRRA 1P2FA 3C3MA 3KJXA 4G0MA 5FBHA 4O1IA 5JS2A 2QZJA 2A9PA 3OLZA 3CKMA 3KLOA 5TQ2B 2DRIA 4Z4GA 3L49A 2WY2D 4RK1A 3C3WA 2PMCA 2FQWA 3I45A 3G85A 4RU1A 4XLTA 3LUKA 4QYWA 1JFSA 1GCGA 3JS5A 2PUDA 5DGCA 3LUGA 1VPWA 2JVIA 3DGFC 5HSGA 1PHRA 1BDHA 1RZRA 5FWYB 3EJWA 5CNMA 5BR1A 4KREA 4EUKA 4MGEA 4KQCA 2VYCA 1FFWA 4OATA 2QW1A 5KQPA 4YO7A 4MAAA 1QP7A 1RZRD 3MYYA 3BREA 3HUTA 2H0AA 1TJYA 1KGSA 2ID7A 2AYXA 4KPYA 1E6LA 4MLCA 4MQFA 4XASA 1JFTA 3H1EA 1Z25A 2PUEA 4KK3A 5I4CA 4YRZA 4IMIB 5HM6A 2B1JA 3Q9SA 3CNBA 1ZY2A 2L2QA 4WXMA 4XXHA 1APBA 3CZ5A 4MR9A 1EWTA 4DN6A 1PEYA 3H5LA 1URPA 3KTOA 3QEMB 1I3CA 5ABPA 4RY9A 2P9HA 2LIVA 4OLAA 2MSKA 1Z2DA 4KNYA 5JNUA 1Z17A 5TPZD 2GWRA 3MMNA 5HKOA 3GBPA 3D02A 4EYOA 2PUBA 3N0XA 4EYQA 1U2PA 3H1GA 6ABPA 3C97A 1NXTA 1BDJA 2PUGA 2E4WA 5T3YA 5DLEA 4NV3A 5JNWA 4EY3A 2HPHA 2JBAB 3O1JC 4G86A 3F7NA 4LE0A 1Z26A 4D6YA 4H3KB 1MIHA 3H1FA 3HEBA 4EYKA 3MF4A 5IULC 4G97A 1JDPA 3CFYA 1KRXA 2WRZA 4F06A 2CHFA 3L6UA 4B09A 1S8NA 5B3JC 4MQEB 3RVJA 2PUAA 1DJMA 1YMUA 1T34A 3O2JA 3OMWA 3HCWA 4LX8A 2J48A 1YS6A 3EQ2A 5KC9A 1QO0A 2PKXA 4TMYA 5F64A 1K68A 1WETA 4YCSA 3T6KA 1AB6A 1DCMA 3H75A 3LUJA 1TVMA 1GUBA 4DQDA 1ZVVA 1NXSA 4ZPJA 3P9YA 4O1HA 4H3HB 3QELB 4WWHA 2P4UA 4RDCA 3SM9A 4Z4IA 2LBPA 4Z9AA 1RXIA 1ZGGA 1IIBA 1NXXA 2FLKA 4N41A 1DC7A 1JBEA 3KG2A 4TLLB 2QU7A 1VKRA 4ETMA 4MQFB 3CHYA 4Z4FA 1LBHA 3NHZA 1XHFA 3LTEA 3QLUA 4UHJA 1ABEA 5D2CA 3N75A 2FTKE 2RJNA 5IC5A 4GNRA 1MVOA 1HEYA 1NY5A 3JVIA 4CBVA 1ZH2A 1QPZA 4HNRA 4WUTA 2E4ZA 5FWYA 3RVKA 1EAYA 1KMIY 3ILYA 1W9HA 2HQRA 4MQEA 1OXKB 2HQBA 4YR7A 4PEVA 1FQWA 2FN9A 3MA0A 3HK2A 4NICA 1LJUA 3MM4A 4P1ZA 1VRVA 1Z12A 1E6MA 4WT7A 3LFTA 4W5TA 2ZAYA 2JVKA 2B4AA 5PNTA 5FBKA 3BRSA 2JBAA 3RVRA 3UUGA 3KYIB 2AYZA 2CD7A 4RY8A 1NXVA 4E7PA 3FGZA 3RVMA 1QQAA 4IF4A 3RQIA 5C5CA 1JL3A 5KWSA 3CS3A 4F11A 1M2EA 1EWVA 3I5AA 3QK7A 1L5YA 2VUHB 4NCBA 4RZSA 1D5WA 3TO5A 3OM0A 4LDAA 1MB3A 2IPMA 3OQNA 4IILA 1USIA 3UKJA 3OLVA 2RDMA 3KCNA 2L19A 2Q5CA 5IUKC 1XHEA 1QQBA 3ILHA 2YHAA 1JHZA 1ZGZA 4KVFA 4PICA 1H9CA 1SXIA 1JYFA 1PUXA 4RXTA 3EAFA 2GBPA 2NT4A 5EWMA 5GOTA 1U0SY 3HV2A 2NUBA 4RXUA 2XDYA 1YS7A 1CHNA 3KLNA 2MSWA 2IPAB 3H5IA 1EWKA 4ML3A 1JX6A 4N0QA 1ISSA 3D8UA 3R0JA 2LUOA 5CNKA 4KFCA 1Z18A 3MIZA 1TM2A 4YP9A 3NNDA 4RS3A 3ROFA 3KYJB 3NBMA 4RKRA 4Z9BA 5JNSA 3JY6A 4MPTA 3MQ4A 3RVOA 4PE5B 1DZ3A 2E4XA 1KRWA 5JS1A 1U2QA 2E4UA 4G0XA 5IUJC 1USKA 1LJLA 3SG0A 1LK0A 1K66A 1PNTA 3GL9A
chains in the Genus database with same CATH superfamily
3BWXA 1WCYA 2DFLA 3QU9A 1QZUA 4Y2SA 1WNTA 2ZR0A 3OTIA 2B36A 2FOXA 2GRUA 4HLUC 1FQKA 2PWAA 3CB4A 3GEBA 3JQBC 3CEJA 3GUHA 3KXDA 4FDUA 5KO2A 5KZMB 1J1ZA 2GYYA 1Q77A 3K0FB 3LIIA 5FYDA 3RK4A 1VCIA 2QUAA 3GDFA 4CIWA 1E4VA 3BXPA 3FPGA 1UQUA 2QTVA 4DR3B 1JDUA 2HJGA 1HT2E 3H18A 1DP4A 1A4UA 3GEGA 2V4UA 2GDJA 3M83A 1L7PA 1TADA 4PRKA 1JSXA 2RGDA 4DLAA 4E13A 3ZK8A 1BU5A 5DPMA 1Y89A 2A9VA 1P7WA 1RHQA 2OMEA 3PDIA 3RF7A 4CNQA 3IH5A 1S89A 4RVOA 2GHTA 3IEXA 4GGOA 4X1YB 2EFHB 2J6BA 4QG3A 3Q41A 5LVAA 2EFCB 2JHAA 1CUAA 1NN0A 4A0RA 1EX1A 2GFIA 2XUFA 4IJMA 4V0ME 4HZUB 1V5WA 3E1GA 1TTTA 2CVZA 2BCGY 1XD2B 2FGKA 3IHWA 3LY5A 4ITUA 5KU1A 1D2GA 2N75A 2R8XA 1RMQA 3EXIA 4BZWA 1L9XA 3VSEA 5FP0A 5KQMA 1OT3A 2QN9A 4YAFA 2VH1A 3ETCA 4FONA 2O23A 3ANLA 1TVEA 3TNDA 1LV8A 1TEXA 1T8TA 4DC9A 1LQUA 2PV0A 4ZYTA 4DANA 5F52A 3B8EA 1ARZA 5DTIA 1FUKA 2ERCA 3M9WA 4ZU6X 3ZYZA 4Z99A 4DIUA 5BNZA 5JRJA 4HOYA 5HZKA 4RC9A 4R3WA 1PBTA 2I6UA 3B1XA 4L22A 5F5LA 5JQGF 2XYPA 3RJ5A 1S2LA 3IP3A 3RNOA 3IUSA 3WAKA 5AI5A 4U4AA 4UMDA 3FCEA 4RD2A 4MQUA 4NBKA 2WR8A 2YWEA 3IIJA 1L1RA 4F8JA 3WGVA 1ZC3A 2CV1A 2IH2A 3HO6A 3GA0A 4HVTA 5FNVA 4OK5A 4PXAA 4FOLA 1SXGA 4HPXB 5REQB 1CS0B 3REFA 1ST2A 4B4UA 1OTXA 1F0PA 2JA1A 1C1HA 3DHEA 3FBWA 4DG8A 2OM2A 5ESWA 2DQKA 3ABQB 2OENG 4BB6A 1A9RA 3JYHA 3D0QA 4XPZA 5B7NA 1ZCJA 3KTAB 4PQFA 2P0EA 3TQHA 4F4FA 3BORA 5F77A 2X4DA 3EISA 1Q1BA 4IQ4A 2IOFA 4TUYA 5KPDA 1OJ7A 3NRCA 4YP0A 2WM2A 2I34A 3T99A 1VMIA 3VGJA 1ONPA 3C41J 4PC2A 1TK3A 4AL4A 5EESA 1I3KA 2F7SA 1XQ6A 4TTVA 1BDIA 4G4SP 5AVTA 1X94A 2GF2A 2HZ7A 1NR7A 2O2GA 2ISSD 3GEPA 4FFLA 3N28A 5H82A 1IAQA 2JK0A 2IXAA 3T9AA 2Y1CA 4LSMA 5KU7A 3KZCA 3I83A 4BFTA 1S0UA 2HTFA 3IDQA 3L04A 3NT4A 1IQUA 2ZBVA 3EQ6A 3TRDA 3LBAA 1IU9A 4GPTA 2R6DA 3TRHA 4D8WA 1X77A 4JBXA 4NKRA 4O4IA 4K9MA 2XGGA 1Z5NA 4B83A 4BVLA 2VN8A 4QWWA 4KWEA 4BBPA 4YV7A 2VBGA 2F90A 3WQSB 5TJHA 1W5SA 4FKMA 1XWIA 3S1AA 4S05A 2RIRA 4PX5A 1KZYC 2J0UA 2XMRA 4PSUA 5BVHA 1U1EA 4M1KA 3RUPA 1TMOA 4U6NA 3R9KA 3GFOA 4H6WA 2UXDB 1V71A 3OP4A 4LRQA 5K8CA 3E0QA 3NTUA 1Z08A 1TKRA 1X7YB 5ICMA 1W75A 1OILA 3CU5A 1J56A 3OFKA 4II3A 3UB4A 4LXIA 2CNDA 3EB9A 4O2RA 2YMQA 4RS4A 5KEIA 4QTXA 1U63A 1Z0ZA 2UYOA 4ZT5A 5KCMA 2IUFA 1NPYA 1ZM9A 1R0YA 1ZIYA 2FZGA 2HNKA 5A62A 1ORHA 2R8EA 3CBQA 3ROMA 2GNOA 2UZ3A 4YRNA 2Y99A 5BPFA 3W4IA 1HR0B 1ZNYA 2DQ4A 2XE4A 4I6GA 3PICA 3VPDA 1KK3A 2GPWA 3B1JA 1SUAA 4EHIA 3U4CA 3E22B 1T9AA 1R3DA 4RSHA 4E21A 2WJWA 1OIXA 4UATA 4BZZA 4E51A 3G1UA 5ALFA 2ZYIA 2JGDB 1QIJA 2VKQA 2VSFA 1KZGB 3OA2A 3ZV6A 3AVVA 2O8BB 1F0YA 2Z2IA 3EC7A 4CLXA 4X8OA 2I7VA 1PYDA 5CVEA 3U3OA 5TPWA 4XCXA 2E37A 2BI4A 4Q24A 3QEBZ 1FTWA 1VLHA 2M98A 4TWBA 4B46A 3WKBA 2GZAA 2ATXA 2B4YA 2G3YA 4KPUB 4S0ZA 4LMRA 5B30A 2FZWA 3PEYA 4DDKA 4HAOA 1EFAA 2DPHA 3NHWA 1J25A 2A6PA 2FYTA 3MCTA 3BAZA 1NNI1 1TMYA 2EJVA 1A7AA 1Q6YA 2Q6KA 2XTMA 3G7NA 3KJEA 4DMUB 1W48A 2R47A 3ZBQA 1QYCA 2EV9A 2G6TA 4DQKA 5CNJA 2A57A 1BW9A 1D3AA 2HU5A 2WFAA 2WPDA 1BWPA 3H2IA 4FX5A 4LIPD 4WFQA 3UK0A 1AT1A 4JUIA 4MVXA 1SCJA 2UUBB 4I6EA 4Q7MB 1L1QA 4OQLA 3RHZA 4N01A 4AZTA 3UA3A 4YRPA 4R2KA 4NMLA 1OC2A 3FWPA 3CXUA 1GRRA 5HBRA 4JV5B 2GB4A 4M6WB 2NNLD 1C2TA 2QAJA 2O2ZA 1FMCA 4NQZA 2ECPA 2BFBA 1HA3A 2RH9B 4GM1A 4L3VA 5F2OA 4X94A 5KQGA 3R9XB 1JDBC 2Q1YA 4WZAA 3CX7A 2R6GA 4C30A 4IDOA 4JCOA 4KSYA 3A0RB 5CVJA 1H1LB 4LOKA 1AO0A 1ESDA 3G8AA 3QHPA 4HQFA 1U8EA 3RGGA 3WGJA 3D6AA 4TL8A 3CBGA 1EQ2A 1SU6A 3TLEA 3C8HA 2SBTA 3AXTA 4GM4A 2CV2A 5B1IA 3SC2B 5H8WA 4BPRA 3AC0A 5BOSB 3Q6NA 1W96A 2HK9A 2J45A 3CE9A 1DRJA 4WDQA 4DUPA 1SQGA 2C8KA 1WUIS 2GD0A 3JALA 3CUYA 3K92A 4L78A 1GV1A 4V0LA 2DQSA 2QAGC 2Z3VA 3HJHA 5BN3A 3KL4A 4EJFA 1XQYA 3EEYA 5KX5A 3UCXA 3IVGA 1CUBA 1HLDA 1ZRHA 2PR2A 4HX5A 2OYRA 4BJ6A 1R6BX 1LNZA 3UG6A 4C03A 1LBEA 1C9DB 4ZCSA 4PZAA 2EKLA 3EZGA 4KRGA 4JQCA 4FFRA 1J0AA 3E58A 4EK9A 1ILEA 1VJGA 1L7AA 2LXNA 4G63A 5J2TB 1N4AA 4QJ4A 2ANCA 4Q1BA 4Q0MA 2GHIA 1GG9A 2OGUA 3A31A 3Q7TA 4EA9A 4FR5A 4ECEA 4YCNA 4HDAA 3JYPA 3STXA 4BDSA 3V7YA 4EEXA 4WINA 4ONEA 3EVFA 4UAVA 3T1TA 4AYWA 3N5CA 4YWHA 3WIDA 3ICOA 5IK2A 3MXTA 5TEVA 3IL2A 2GCGA 2Q6OA 3BQ9A 3OIUA 1PDOA 3O73A 3QG1A 1JG1A 1XKXA 1AIPA 5EKXA 3BWBA 3QPUA 4LTMA 1L5KA 1T0UA 1LPSA 2LPMA 1NP7A 2E55A 5EXPA 1WHSA 5HIIA 5JC8A 2NZYA 1QC5A 1ODLA 5K3FB 2PZKA 1LPMA 4Q3CA 5B7QA 3ZD6A 1JAXA 1F4PA 1NLMA 3Q7RA 1U2DA 4K88A 4C4YA 4RIFA 2YVAA 3B53X 2FWAA 3AKZA 3EZXA 1GXSB 3LQ4A 1EBBA 1PDVA 3OEEA 3WMWA 3AG5A 1VLZA 3L7CA 4D8YA 3GGGA 3DHWC 4CL8A 3IVCA 4G24A 1UF9A 4A0HA 1SVWA 1ZVQA 1RP1A 1SU8A 3RS2A 1K7EB 3OJFA 2J5KA 3IYLW 5LJLA 3GLGB 1AZWA 4MI1A 1XRMA 1ZLXA 2Y6UA 1FF9A 2GI4A 1O8BA 1JB1A 1HKHA 4QHTA 1SCAA 2V1UA 2P77A 4PBRA 3T4XA 2CJYA 3NR2A 3WK8A 3PFFA 2EQBA 4BNHA 1ZVMA 4EY7A 4YLYA 721PA 1ABBA 3NGLA 4Q34A 2R4QA 4GX0A 2OZLA 4X6XA 4INOA 4BFVA 1FXWF 2NU8B 4EKGA 1RJGA 2GARA 1KYYA 2DRIA 1Y5RA 1ZMTA 3AZQA 4RK1A 3C3WA 1S3IA 4Y2TA 2EWWA 3P0IA 5FUYA 1FVOA 5LZ8A 2GNAA 4LJ7A 3QXXA 4F9GA 1RS0A 4J7CA 2H18A 2WJIA 4R8LA 3SLGA 3AM3A 4EUKA 4F5YA 4FGKA 2CCGA 3RS8A 1PS9A 1XDUA 3BEOA 1UC9A 2IHBA 3L7DA 1KIFA 3C5EA 3QKWA 1EMDA 3N1UA 3P5BA 1KGSA 1JXOA 2ID7A 4NATA 4MROA 3EMBA 4Q1DA 4R9UC 2HHAA 5K4AA 2YVLA 5CT9A 4C1BA 4ITRC 2DOKA 2C1ZA 3CJRA 3U44B 4FJ0A 3L0ZA 1XAGA 2G25A 2B1JA 5HGJA 4DCTA 3FNRA 1M6VB 2Y9PB 2JIBA 1G8HA 3QTBA 1WWKA 4GSYA 1SH7A 4DIEA 4FMDF 9LDBA 1ES9A 3DBLA 4J0HA 3T5TA 1G2OA 4KAFA 5BMVA 2ZIFA 1PJLA 4INAA 1ZK2A 4U2DA 4YJFB 3U2QA 4EYEA 1CXZA 3SYKA 1CDOA 3TIGA 1P5ZB 3A1VA 2WWFA 4GI7A 3KTFA 3VC2A 5KMGA 2DHRA 4DIFA 3JU3A 2GCNA 4OXYA 1VYHA 4E2ZA 1NW3A 3O3MB 4GO1A 4IKOA 4X66B 4MJ3A 3VPSA 3AIOA 1XTVA 2C92A 4R1UA 4P3KA 2KPOA 2X8JB 1E66A 1NXTA 1BDJA 2IF0A 3PQ3A 1NW9B 2CLCX 5DMHA 3MS7A 4EY3A 2PKRA 4FYKA 3BCUA 2HT6A 4DFDA 2QVZX 3EXG2 4FDVA 4IIGA 4LXXA 1GD1O 2UYHA 4L4XA 1VL1A 4JYZA 1AK1A 3BX1A 1IG3A 2WPDD 1KI4A 5AI8A 3GJQA 5A5FA 2VQEB 1NQUA 4TZ0A 1PVDA 4O4IB 2EDCA 1NF3A 1RJ9B 3ZWAA 1BCSA 4K9NA 4P84A 5F3RA 2PUAA 1KH3A 2V7QD 1FDTA 1V39A 4MRAA 5DK6A 3BXHA 3MD9A 2GHQA 2FLVA 1C0PA 2ZYRA 5AKYA 4M0FA 2QVYX 1HRKA 3RSHA 1S3GA 3P20A 1N3IA 3FPEA 5LP6C 3KC2A 2Z6VA 1PT9A 2QTCA 1Q7CA 1XZDA 1K27A 4H4CA 4MW6A 3SR0A 1GNQA 3E9EA 3LUJA 2NSLA 3ZW7A 3E0XA 3OFJA 1P1FA 2ZRBA 4OUDA 4EAAA 3OCZA 4WLOA 2ONJA 2FZ4A 2R4TA 1WUTA 1D09A 3RC9A 5I4IA 4K6KA 3IR6A 5I5GA 2A88A 4JJ6A 2Q5IA 3VJMA 1MN6A 2HU8A 4HB3A 1Q83A 1V7ZA 4K2AA 1CKEA 1E3EA 4DCNA 3LDGA 5JHGB 1Z4MA 1YIDA 3CJQA 4NOJA 3IEMA 2AJBA 2VXCA 3RGWS 3ZU2A 4Z4FA 3VZQA 3A2KA 1WJGA 3NWEA 1OA1A 4AZWA 5E2IA 1OFUA 2I2DA 1WHTA 2V3WA 3K1JA 1HEYA 1C7QA 1NY5A 2CK3A 1TT7A 2QDXA 3T4EA 4I5DA 1SR8A 1I3MA 2E4ZA 4X44A 4XVRA 4ZARA 3IIEA 1YL7A 4BCBA 4BQQA 3ILYA 4HLCA 2DETA 5KYUA 4TWJA 1IB0A 1BWRA 4YFVA 3QQ5A 6YASA 1A8IA 2LV8A 4CQMB 4JEUA 1V1JA 3ODPA 3E9ZA 1N2HA 4WD3A 3IDAA 1XFAA 1Z68A 1PFVA 3EZ6A 4IXTA 4E5PA 1GRQA 1E96A 2NNWB 4F4HA 2N1MA 1F2VA 1Z07A 3C87A 2OMKA 1JAIA 3LNTA 3L4KA 5PNTA 4DILA 4LF5B 3TLMA 3IT2A 1SQFA 1BC5A 1GFZA 4Q93A 5THXA 1KTVA 4WFIA 4QOGA 3WTCA 5LCXA 5DBGA 7MHTA 4QNMA 1PZEA 3MT7A 4EPVA 4PPYA 1V1RB 2YV5A 2P6UA 3RIHA 1DNPA 1YGYA 3C4JA 3QIAA 2C00A 1U0GA 2ZR7A 2H5EA 5EKUA 5IJAA 4LBYA 1INLA 3V3TA 4BNDA 5B12A 3PXBA 4B76A 5LSAA 1AA9A 4X8HA 1NC1A 5BORA 2Q6TA 3B51X 4UBNA 5FFMA 4EAQA 121PA 1KVQA 2OILA 3L8YA 1E6EA 1YKFA 3CRW1 4IDPA 4O8CA 5G40A 1U80A 3WKDA 4YB8A 3FAZA 4A8JA 1AQYA 1BMDA 3ENNA 4BO1A 2QTAA 3DFIA 4Q4AB 1FW8A 3OE1A 1PT7A 4QDKA 4UVDA 3LYUA 5IUKC 3OEYA 3HWX1 1H9CA 2IXEA 3F8TA 3HKCB 1GPLA 1RKQA 3ZDBA 2WVJA 2I2CA 2GBPA 1JMVA 4G9EA 5HXAA 1XP8A 1V8FA 1XTSA 3TFOA 2XT6A 1M8GA 2NUPA 4OU5A 1OC4A 2I4TA 2IPAB 1JLHA 1JX6A 1U11A 4D4GA 1AD2A 2JLCA 3TLZA 2LUOA 5B1DA 2GH1A 4JJZA 3PHLA 5K0LA 4BO2A 5HWSA 3A1FA 1VE1A 4HYQA 3V2UA 1RXCA 1EUDA 1U9JA 5A1TA 4PE5B 1MT3A 3N07A 3H2SA 4PM4A 3S5JA 1C8BA 1MB2A 2IDZA 5EQFA 3SG0A 3B8HA 1PJAA 3GL9A 3HJTA 4DJTA 3NC4A 3FH0A 4MX8A 4TV8F 4AQDA 1YRQA 4O33A 4DUYB 2H1WA 1SXJA 4NARA 4YVFA 4MV6A 5ALXA 5BT8A 2OBLA 2EBHX 3ZVLA 4GRDA 4GYWA 5I7SA 5JI2E 2AK2A 3R3UA 1AKWA 1ZUIA 5CVUA 3N0VA 1T10A 1MTOA 1RZVA 4Y6LA 2BFMA 3VKGA 1NLYA 2RBKA 3G2LA 5JTTA 2XQVA 2JGLA 1S2NA 3NCTA 3V4LA 1R9MA 2EL9A 4WN3A 2OCPA 3QX8A 1RWOA 3R7AA 5KSYA 3RYIA 2PQ2A 4RIIA 1AUOA 3TQIA 2J0VA 4X54A 5C81A 3ENQA 1KAHA 3RUDA 1XNQB 4HLUA 1W5FA 3U4MA 4LHSA 2V55B 2J7PD 3CKKA 3O8OB 1PL8A 2R62A 1T5SA 3HFJA 2BFDB 2YASA 2YJNA 4YTEA 4WXEA 3SIRA 5HKAA 2FWBA 3DCJA 3UHPA 4HH3C 1JS1X 5K8IA 1ECCA 3T1YB 3G79A 5A4FS 3IP7A 4YS6A 1U8YA 2Y8EA 3A1DA 3EVNA 4F6RB 4LV6A 5JXHA 2J3JA 5U4XA 4KMRA 3DAOA 4UU1A 1CZHA 1HF3A 4JIGA 3V9PA 1GG8A 2Z9BA 2A5JA 2CE7A 5LDHA 1CDZA 1ZM2A 2G1UA 3K0AA 1DBQA 3GRRA 1A4IA 3K1ZA 4K1LA 3MLEA 1JI0A 2XMGA 4RKYA 3WLJA 1C0EA 1ZOOA 4GOKA 4N5DA 4MHOA 3MUEA 3FNFA 4ZHQB 1Q44A 1QDUA 4NC9A 2H17A 3EOZA 2CXPA 1M76A 3BSSA 3DZKA 3Q6IA 3CWZA 1QANA 4PC3A 2XRFA 1C3EA 5GQSA 3ZGNA 4KDFA 1U5BB 1CNEA 1ZOPA 1TKCA 3KELA 4BRZA 1RU3A 4MR7B 1G41A 1GPH1 4CKEB 3DZJA 3NYQA 1SBQA 1B0ZA 4XQ9A 1HG0A 1RYFA 3EY9A 3KJGA 1JHOA 3KHKA 4X61A 4JC0A 3IC5A 1F5SA 3LO8A 3ZWMA 2JFZA 3PHGA 5AW6A 5K3OA 1NN3A 4PSDA 4AI6A 2XA9A 1PR6A 1KF0A 3ZKAA 4ERXA 2RGWA 3HACA 1H9AA 3BDIA 3D1JA 1O94D 5EMMA 3UC5A 1MABB 3IR7A 1T4BA 4FSXA 1OT5A 3KWMA 3LRTA 2H08A 1LDBA 2FZLA 1W5BA 1WVIA 3C6XA 3X1XA 5CBKA 1SMKA 5G4LA 4E03A 3O8BA 5JVDA 2DE0X 2WA2A 3PQ6A 4JP8A 4MW4A 3TTTA 4B6EA 2BSQA 2Q1XA 5DGHA 4YPFA 1I94B 4LF6B 3EFHA 3KL2A 1QMGA 4PHTA 1VHDA 4RENA 3PF8A 1Y8CA 1A95A 3RK1A 3VHRA 2W2KB 3DMDA 4H7EA 4DG9A 1XQ1A 2CE2X 4G0VA 3MFQA 4IJWA 3QTTA 2WE8A 1MAVA 3KJNA 3VX3A 4IRUB 3OCXA 4ZYLA 3CSUA 2VRNA 1C7EA 4X1KB 3WBKA 5JJIA 1KI8A 5JADA 1DBIA 2VCYA 4QVGA 1DC8A 1ZU5A 2GJ8A 2I33A 4HDRA 1IZ9A 4JLKA 4EVIA 3NWBA 4CG1A 4DDHA 3R09A 3AUSA 1SXJB 2QXTA 2R7KA 3HM2A 2PSEA 4GX2A 4HN9A 4LVNA 4MI3A 4Q1EA 4WLNA 4BFLA 4ER6A 2V0GA 3ZHOA 4LGMA 4FMDB 3GLHE 4DWWA 2XUAA 1N4DA 5IYZF 4J49A 1GCOA 1F2TB 3R44A 3T3EA 1F9AA 2QNRA 4MS4B 3RYFA 2HNAA 4O4LF 2OYSA 3D7KA 4WAUA 1G8AA 3NBKA 1G5PA 5SY6A 1T6NA 4PVDA 4W1QA 1ZNWA 3RSFA 3A9VA 5JSYA 3U7QA 5E7MA 4LJRA 3DLAA 2DUUA 1BJRE 2J9YB 2A9KA 3LK7A 4HVCA 2K87A 1DJPA 1FYXA 2EW1A 1I36A 1P3DA 1L5RA 1RHRA 2I6XA 3GJ7A 3IKLA 2JLYA 2Q4DA 3AUXA 3ZGLA 3RG2A 1QHEA 2JIZD 4JLWA 2Q9CA 4KQ9A 4DCGA 4ZWNA 1CDDA 2IV7A 1P5JA 1DKQA 3ZU4A 5ICGA 1ZUHA 5CMLA 2FXVA 4ZJZA 1AHHA 2OZPA 4DR1B 2B25A 4BWVA 5KQSA 3CVWA 2XBMA 3AOEC 1EFVA 3S27A 2X1HA 3VU1A 2HWWA 1HMYA 4OXKA 3M3DA 2EX0A 2Q0QA 1HUQA 2PZGA 3WL7A 1E59A 2PLFA 1DJLA 4RD3A 4OJTA 4HNUA 3HRKA 3AVXA 4IDHA 4OXRA 1M8KA 1ORWA 1W36D 1I7NA 4JBYA 2YN4A 5K51A 5T57A 4CMCA 3K4HA 1WMSA 1JYSA 4BP1A 3QX3A 2EP5A 2AOTB 1YR7A 1XSEA 2NYRA 2CN1A 2Y71A 3IE0A 3Q3CA 4MQ5A 2ZRFA 4N49A 4QU5A 5DP2A 4F3CA 1KEKA 1OLUB 1OYWA 2V45A 1LWOA 4GXRA 4K6FA 4TS1A 4A15A 2TMDA 1A8SA 2QR5A 3MQ2A 5CG1A 5JMPA 2AL7A 5HFNA 2Q99A 3FFTA 4X6YA 4FFBA 5CHYA 3X1WA 4CEJB 1YVPA 5DSZA 2RONA 5FUBA 4DLTA 4U9UA 3QA9A 3OUZA 2P9TA 1XPOA 3K9NA 3RS0A 3DAYA 2XUHA 2OHHA 4LSZA 4PC1A 3WWYA 3A70A 4KL8S 3DFFA 1N6PA 4W7HA 5DYNA 1MB9A 3C6KA 1R8YA 1I4OA 1AQNA 4FEGA 4LYHA 3WMEA 5DLQC 5HDBB 1WUJS 4G3XA 5FBZA 1I4WA 4C7OA 1YU9A 3ZCRA 1GFSA 2H7CA 2IUSA 1K5HA 2PZFA 1SQ5A 3DGEC 3RQSA 3W5IA 4Y18A 1NZFA 3U3KA 1Z4NA 3CUWA 3FI0A 1NWCA 1EZ1A 3DOHA 3EOBI 3IQEA 1WLSA 5CK4A 3SZ3A 1PFGA 5J47A 3KVVA 2PE5A 2P2YA 1HC7A 2D1RA 2PGIA 1NBMD 4Z86A 3PDUA 2GBLC 4LF9B 5LZ9A 1XP5A 1SB9A 5H5JA 3T9CA 5JQGA 2PR7A 4HRYA 1JIQA 5T4BA 2VJAA 5CIWA 3T4UA 4IZHA 4RV5A 4EHJA 1JEAA 1Z28A 1GQRA 1UZUA 2KBFA 3HS3A 2VCEA 1WZCA 3EIHA 4TTIA 4B8YA 5BV7A 1NF9A 1RMYA 2Q3JA 3B6ZA 4YMHA 3OO1A 3U7GA 1ZJWA 3R7BA 1WO8A 2X6RA 4NESA 4LEIA 3KKKA 1WSBA 1KEEB 4LYJA 1EVQA 1E79D 4M7WA 4WTOA 5GPBA 1FXSA 4A5OA 1MO6A 1UAGA 1K0UA 5I9SA 2O07A 2OHJA 3Q9UA 1UBFA 3G02A 2WYUA 4E6EA 1K6JA 3L8FA 4QSMA 4AO8A 3EGIA 2QXUA 5EZSA 4AYTA 3RH0A 2ZI9A 3BCSA 4E30A 1ZXXA 2EBFX 3GA5A 1ELOA 4C6RA 3LX8A 4D3FA 2ZR9A 2CMHA 5C8YA 4UTNA 5CYPA 1GG2A 4GMGA 3B3AA 5KTPA 4GI5A 2JHCA 3WJAA 2H51A 3ZBPA 5JS8A 1KJQA 1GZDA 3B12A 1TJPB 1E64A 1DKNA 4E2XA 2NU6B 2XE6A 2Q3BA 4B87A 3DC2A 2SICE 4FK8A 3JASA 1J9ZA 2BELA 2C9CA 1ZDMA 3QUTA 4GQAA 3GFGA 2AXQA 3MW8A 5EJ7A 1VP3A 4RFLA 4XRRA 2NU9B 4MKGA 2P3OA 1A0OA 1NUPA 3JQDA 2DFDA 4KODA 3LC2O 3PCRB 4P7KA 1TZCA 5KNBD 1HETA 3TVTA 3CVYA 5B58T 2EATA 5JS2A 4TSFD 4YRIA 3FTCA 4D0RA 4MGZR 4URXR 1E3JA 3S8EA 3OHSX 1NIJA 2FQWA 4BN0A 5FB3A 5ICCA 1FDWA 3NUGA 1S2IA 5AM3A 1W94A 2Y3IA 4QRDA 3TW8A 5EE0A 4ZVKA 2DCMA 4R9SA 4TQUS 2GKOA 3PFKA 3TTVA 3AERB 2F1JA 3T0GA 4KQCA 1QF9A 4PGGA 2FF5A 3U1VA 1UBHS 2RHWA 4YO7A 3R0QA 3BREA 1UM9A 1K8RA 3B3JA 5JRDS 3EIQA 1JHVA 2HRZA 2WU3A 4R1MA 4RX1A 3B5IA 1L5GB 2D62A 4MLCA 1N2ZA 4R16A 4JVLA 4XASA 4AJ9A 3RFUA 3ETNA 1UJBA 4NBWA 3CN7A 3DPUA 1VDMA 4PQEA 1Z6AA 5C32A 3R7LA 3U48A 1IUPA 3Q9SA 4MIEA 1Z5VA 4IXMA 4RPKA 2A5DA 4RELA 1APBA 3AR2A 5KKNB 4PONA 2WIFA 4W7IA 5DWDA 4RQBA 3FYUC 5HP4A 3LF1A 3CZ5A 1IN7A 2WJJA 1KI6A 1O3YA 4RTMA 4KTTE 2VDVE 1IRIA 1YZQA 1DAHA 1E69A 3B7GA 3ZPXA 3RK0A 4AZVA 1NDHA 4OY3A 4EJ6A 1I3CA 3LQQA 4ZDJA 2H48A 3HEMA 1DC4A 3MZ0A 4WN9A 2X8LA 1T5IA 3WLLA 3OAAD 1Y8ZA 3A27A 3SR4A 1UM8A 2GWRA 1JSZA 5DCYA 2PZLA 1NJ5A 5IP5A 621PA 4LI0A 4BJ5A 1H0HA 1P1BA 2GK6A 1NRWA 4MVYA 1T6BY 2VNHA 1VG9B 4FGWA 4NMXB 3TOSA 3MGGA 3EDOA 4HAYA 3IIMA 1Z82A 4PLTA 2HPHA 4G86A 1GO2A 5JNWA 2D2XA 3L02A 2D4AA 5JSUA 4GM0A 1GTRA 2PYZA 1QCYA 4D6YA 1ZSVA 2QIPA 4E94A 1A5TA 3GRKA 3FVTA 1E89A 1T4CA 1TT5B 1YZUA 4E5NA 3PR1A 1U7DA 1MP0A 3KKMA 3LD9A 2CL5A 3WQRA 1K97A 2O8NA 3A1UA 4MP6A 1ICEA 1W6UA 2PGJA 2JFWA 3FKJA 4L95C 5FPQA 3TCKA 2HRBA 2J48A 1RFLA 2OT3B 1RWNA 1XJWA 5JDCC 3FGPA 4F9TA 1Q6ZA 3NIBA 2RK3A 3JAWA 4M9XA 1JQAA 3BWCA 2IUEA 2UVPB 3ER8A 3S1LA 3TZBA 4FR0A 4I55B 3T6KA 3VR3D 3C6BA 4X91A 4DJEC 5JZSA 1VPLA 1PZHA 2Q9UA 3ZQJA 4W8HA 4WA8A 4CLDA 3OQJA 3PD0A 2JI6A 5KOHA 2SKDA 4TXNA 1Z5PA 1RE1A 1AUPA 2P0YA 5F9MA 3RRBA 1QDLB 2VF7A 5KX5B 4IIVA 4UXJA 5AW2A 3E9YA 3F5DA 1DC7A 4BO7A 1I7SB 2PQMA 3ENVA 1Z0UA 4NPAA 4LFCB 3A4TA 5J43A 1TYZA 1HWYA 3ZE8A 4NFYA 2F4NA 2VCHA 2O3RA 1QS0A 2GDZA 5J5VA 3MEQA 4Z3DA 3W05A 4QC2A 3LTNC 1CY7A 2DUJA 1VJ0A 3O3NB 4IY1A 5FR1A 5L51A 3QMWA 4QKQA 2IK8A 2MTBA 1TM3E 4FNMA 5FA8A 5A04A 1EHYA 5BWNA 5IZ4A 5J23A 2VNSA 2XQKA 3KQMA 1OZGA 3WIVA 1CLEA 4N3BA 4DKJA 2J9FB 4IBOA 1JVBA 3RF6A 4AP5A 1C4KA 3JQEA 5KTOA 5ESXA 4F2PA 1GP2A 1RPTA 2FG7C 3GLHA 4X45A 3CIOA 4QEDA 4BNJA 1Z39A 3PUZA 1Q84A 2EGUA 2HK6A 5JCJA 1THGA 2B4AA 2RB4A 2X0RA 3THWB 5ECWA 2A86A 1QHYA 2QR2A 1MFZA 3F7TA 3FMOB 3N2LA 5H3CA 3MJTA 3LHFA 1TMKA 2ZYUX 1ZS9A 2YWRA 2RC6A 4TOIA 4A8JB 3W2TA 4YWJA 2JJMA 2Z5LA 3JRXA 1GTVA 1NG1A 2G63A 3NASA 5GADl 2VP3A 1MV5A 3HYCA 2HK8A 3G2KA 2RC5A 3ECSA 4MDEA 3O8OA 4XYBA 2BMFA 1KP9A 4QO7A 1OU0A 3Q0TA 5JWOA 1ZGHA 1E9SA 3IVXA 2WUFA 3DM9B 2MWMA 4QL3A 2ZTVA 3IMCA 1HZZA 4KXYA 4YAIA 3A04A 3OICA 1AQLA 4RHYA 4QDZA 1II0A 2VSXA 1E4EB 1M2VB 3HGQA 3KU1A 3TR6A 5K4GA 1DJNA 2YFQA 4CCYA 4FD2A 1JJ7A 3ZY6A 1G5QA 3ESXA 3CPJB 1ZGZA 4WOCA 2JGNA 1KDZA 2V5VA 1PUXA 4TT3D 1DU4A 5M04A 1F20A 5AVYA 1IXSB 4LVOA 4E5VA 1S2OA 3SZMA 5HGXA 4BOYA 4ADSG 1SVOA 1ZM7A 1W2WB 1Z0DA 2I80A 3IIKA 4JJFA 4KIUA 3TW0A 1NVAA 3I37X 3LLMA 3SLKA 5JYCA 5KNBA 1PTJA 1ZONA 3N3AC 2Q2VA 2TMGA 3KUXA 3NH6A 2QPAA 1B23P 3MIZA 2CV0A 4DBLE 2W6JA 1NNLA 1WL8A 3D6TB 2XF8A 3IT3A 3ZI0A 1PZXA 3C3BA 3JAWB 3PLNA 3RVDA 1UDBA 1ZGCA 1V5EA 1TA9A 1JIIA 5AW1A 1DEOA 2VQ3A 4G0XA 4XVHA 2WZBA 2KMLA 1SVNA 3DVSX 3EA5A 2HRCA 3ZQUA 3EXFB 3K8YA 4LRWA 5JASA 1Y9AA 2R1TB 5DI3A 4BX3A 5ECDA 5EP1A 1GZ6A 3PGJA 3RKUA 1GUYA 1WCIB 3ETEA 3G17A 4LVUA 3MUOA 4DADA 4WHMA 1KRXA 3H4VA 3HPRA 2ZSFA 2X0KA 1N5IA 3DEZA 3T7TA 3JQ6A 1DSSG 1GYRA 3BMCA 1E1QD 2BHRA 2XGSA 2UUOA 3AEQB 3ZDRA 2JIOA 3O92A 1HQKA 4XPIA 3FDIA 2R1VB 4GOJA 5LNK1 5TGTA 3P71T 2QN3A 2HCFA 2I55A 4E31A 4OBXA 3CG4A 1P60A 4OMDA 5GIPE 4IEEA 4TYNA 4DCUA 1YMQA 3DXZA 4C3VA 2G82A 3VTAA 5C4MA 5E7IA 4HWSA 3U4HA 1XO1A 1UFQA 2BFOA 5JFGA 4ESOA 2NZ2A 1Q74A 3U7JA 2D3WA 1HEUA 2WWVD 1ACMA 2ON6A 5ESRA 2VLIA 3OPQA 4C3OB 3SVLA 3RT9A 3WIBA 1E94E 2WOOA 1L4YA 5E4YA 1SCDA 5HBGA 3TIIA 3U3XA 2PGLA 3R3SA 4K5QA 4A82A 4CV3A 4C7XA 3VH1A 5G4KA 1ESEA 3AHJA 4V38A 4Y6OA 1F8XA 4FKZA 4YDRA 3WLTA 3L7AA 3PKIA 2GZSA 2QG9A 4N0MA 4C01A 5JNTA 1YT5A 1DUIA 3I6MA 3JV7A 1JECA 4G4JA 1NM5C 3KUKA 3IODA 3PQFA 4MUNA 4OIFA 3SXUB 4D9KA 4EZIA 3V1UA 2P9YA 3L07A 4U5QA 3VR4A 3M6WA 4RLHA 3RHSA 4DC1A 4HQRA 5TLSA 5B2FA 4Y6SA 4LY6A 4BQRA 4ZODA 1AKQA 1EP3B 1R18A 3OLCX 2W48A 3Q5GA 5DHQA 3VR5A 2H92A 3Q10A 3R3YA 2YUIA 1TQHA 1ISMA 4Z3OA 2CSXA 4J8PA 4NZOA 5B4VA 2XHEA 2FHSA 1N2SA 3LWDA 4RHXA 2YIVX 1PX0A 5AW7A 4HQ6A 1Z6QA 3KM0A 4KIWA 4MAFA 3K2IA 3NONA 4EW3A 1Z15A 4RLSA 1JIXA 2MMCA 1KTIA 2FEMA 4ZV9A 3EBPA 1GZ7A 1B8NA 3FCSB 3H0EA 1YR8A 4NOMA 2A0FA 3WLNA 6PFKA 1NMEA 2ERYA 4KKVA 3U16A 1FFXA 3IB3A 2CHQA 2DJ5A 2VSYA 5LA6B 4DCPA 5IXJA 2G08A 3UVEA 2I8LA 4CEHB 1C81A 2HEGA 1V2HE 2H9YA 1VJ1A 2QP9X 5KKAA 1DKUA 4CKBB 3SOPA 4DW8A 1ISJA 3HXKA 1K8QA 3DFKA 1RPJA 5TJ9A 3SFTA 3KOYA 5G53C 3NW9A 3VYUB 3K09C 3DO8A 2BI8A 2GF0A 5ALPA 3AZOA 1SBNE 1TAHA 5HIAA 3EA4A 2WMDA 3JD0A 1NJ8A 2OV8A 1AMNA 4O08A 2FFAA 3D8HA 3V8VA 1EVJA 4REQA 1L4LA 3ET5A 2X0EA 5JQWA 3EJ6A 4PYRA 1SKAA 3JZFA 3FXAA 4J4TA 4IIUA 2IHZA 1P2SA 1Y6QA 1G8PA 1JPJA 2JAHA 2QRVB 3E8SA 3LQKA 4W5JA 2QQGA 4K05A 4AQYB 4J1TA 4F86A 2DBQA 3DBVO 2OPHA 3RUEA 1SBYA 4F93B 2OOKA 3KKQA 1WZUA 5JZMA 2NQ2C 1SCIA 4JAVC 4D9EA 5AOVA 3V33A 2QYOA 9ABPA 3ASVA 4M0UA 3IPXA 1YE8A 1D9XA 3B89A 2EERA 3QYFA 4IYJA 4IZOA 1PG5A 4XDYA 1M1ZA 5JXIA 2DWOA 2OGWA 3AR4A 3KYBA 1NJFA 3LX6A 4L6AA 5JYEA 1FVXA 5GJBA 2YDXA 3EXEA 1ND6A 3LDHA 2XB4A 3E9MA 1Q21A 4IUCS 1RTTA 4D92A 4ROSA 1EFPA 1UBNA 2ZJ1A 3HO8A 4RF3A 3N0WA 4WY2A 1JBQA 5TB5A 4UBKA 3HDYA 3VHXB 5CA1A 5JAPA 4Z4CA 3O1LA 1VBKA 2FE1A 4LE2A 2AN5A 5DU2A 3PJDA 1A9SA 3LPCA 4G25A 4GOXA 3M2PA 4TRRA 3X1DA 3C1TA 3RJMA 1P91A 3A4IA 5I5EA 3VR6H 1JRLA 2ID8A 3KVNA 4I9NA 4EELA 1PIWA 3T3MB 4RH1A 2CLEB 4YQEA 1KR2A 1PZMA 3HNPA 3TBHA 2NLOA 4OFBA 3AV3A 4EF6A 1XLUA 3DXXA 5CFOA 5DXFA 1UKYA 1T36B 3EFBA 4U8HA 2X0DA 1FVHA 5IMBA 1Z8DA 2LNDA 1HZZC 3FLEA 4M1TA 1NM5A 3EWNA 2H0QA 5BN3B 3NLLA 4YP7A 2ZB7A 3FTDA 2QQ0A 3CTPA 2SNIE 2QD4A 3GFSA 4UHHA 5GGXA 1VYVA 3GLSA 3N05A 4LRSB 5EMHA 3D0KA 5FA6A 4UBMA 3T41A 4B2YA 4DUZB 3BD8A 4FNAA 2W00A 1I1HA 2I6TA 1E99A 1JEDA 2PAAA 2X5KO 3EXG1 3LS2A 4LUCA 3S5UA 2GJ4A 2DBZA 2XAUA 1GZ3A 1Q91A 5AI9A 5FADA 5C3MA 1T4DA 4JBHA 3ASUA 4MO9A 5IF3A 2LDBA 5I7UA 3ENWA 1I5EA 4TS4A 3RFXA 1HK7A 3RS5A 2CDNA 2QGFA 3I2YX 4FZRA 2JG3A 4EG8A 2TECE 2DHDA 2P9CA 1J2TA 1GVNB 3DVLA 3WS7A 4E5SA 5DBHX 5BYKA 2EL7A 3TQFA 3KSDO 5ENVA 2Y4OA 3WKEA 4BLPA 2PZBA 2DJIA 1P5RA 1N2CB 1V3TA 4IFBA 4XPIB 3L06A 5EKDA 3WRWA 4RM2A 1WHSB 2OCKA 5CFLA 4V2IA 3DO6A 4KZPA 2IS4A 4K9PA 3S2YA 2PUFA 3GLGE 1QKKA 4CWAA 1WW3A 2I65A 2R00C 1FFSA 2B21A 3BQNB 4GQIA 4ND7A 5H9VA 3WDMA 3CB2A 4C4TA 1BKDR 5KSOA 4B3IA 2ZJFA 1AO3A 1IHYA 1PV2A 3H5OA 2IXGA 4KVZA 1YVUA 3OZRA 4KQXA 1CQIB 4JOBA 4ZALA 2P4QA 4XJXA 2BHSA 1EBFA 3KZOA 3TPZA 3FCYA 3CA8A 3K4PA 1U9ZA 3NVDA 3TQOA 4EG0A 3BUSA 2G1PA 4X71A 4HI0E 1B00A 1U4NA 2IYWA 4NV0A 5EVJA 4D7AA 3KBBA 4AG3A 2QLJA 2XAAA 3SI7A 1B6RA 3ZH9B 1BS2A 4MDHA 3CRZA 4Z9YA 2YJ4A 2X0NA 4RQUA 3T54A 3SQMA 5K6AC 3CKLA 4FBMA 4R51A 1S1CA 3QLVA 1OAOC 4ZZ0A 4AG6A 1DTWA 4Q1FA 3GEHA 4BBZA 2VAPA 4MMZB 4U7PB 3IMEA 2VBIA 4HHEA 2V7PA 4TWAA 3RRZA 3SS7X 1I7DA 5D51S 1IBSA 3AI2A 4NWIA 3VZBA 3F5MA 1CY4A 2IYLD 4FBGA 3BWYA 3SC2A 4BZQA 3TXXA 4GLOA 5BQOA 1DBWA 4RKWA 3ZKWA 4HVLA 3K70D 2VJCA 3FFWA 3GZNB 1P1HA 2OHVA 1ULHA 3ZV7A 5H0IA 5EE1A 1LZLA 1XCBA 1ZUNB 4NG5A 2O3JA 3G8DA 1GLGA 3QWAA 4DA0A 1E7MA 1KYVA 2AS0A 2FJPA 4P32A 1Q95A 2WG2A 2PO5A 3WBJA 2JGAA 1NC3A 2YXDA 3ICVA 1CETA 2GLXA 1BROA 4BS9A 1IHPA 4AC9A 2QU8A 3ROPA 4PANA 1AKTA 5K3CA 2J3QA 1MCZA 3Q8WA 1T4CB 1TT5A 3NOQA 5CB8A 1IY1A 3FNBA 4YJ2F 5GAJA 3BRWD 2IZ5A 4LZNA 3O75A 2KLHA 2QX8A 4PSKA 1GR0A 4EPWA 4UBOA 2JLVA 2WSIA 3KQSA 1TYBE 3HY4A 3KYDA 3HNOA 3UIEA 3AUJB 1DX6A 1WA5A 1H8ED 1A9QA 1KIMA 1XZNA 5ECGC 1AGPA 2CCKA 3LUKA 8ATCA 2ZVPX 5TS2A 1BWSA 1QV6A 4Z0HO 1S9HA 2WAOA 2WM9B 2CFIA 3D8BA 3E15A 3F4KA 1XDZA 1JG3A 3K2BA 3E84A 4LF4B 4F46A 3C8DA 4ZT7A 2HWYA 4DCJA 4BNZA 4XQGA 3CZ4A 5EPOA 1KEZA 5B6JA 2RE8A 4YXWD 3R7FA 3D5EA 4EJ0A 1E9BA 3FYUB 3TRIA 1AF7A 1LDNA 4LFBB 3MCWA 3JWPA 3WMXA 1AMUA 1E5VA 2ZVJA 3H9GA 3KTDA 3H1EA 3E22A 2PVSA 1QTNA 3A1NA 5E3IA 3U19A 1ZCAA 1TM1E 2CLLB 4WXMA 3NHUA 3AB7A 3HBFA 4PS0A 1C1DB 2Q4EA 1W88A 4KIJA 3WRVA 2AC7A 4WVLA 2OGSA 2R1ZA 4IGKA 1V3UA 821PA 3KTOA 3OPMA 4EO7A 4RLFA 2DG2A 2PGDA 3PPYA 3SYLA 1E2HA 5EN4A 3K16A 4RQAA 2IV2X 3JWIA 4PIPA 3F5QA 1E6UA 2PTGA 3UT5B 4ZFNA 1G0OA 4FIZA 3P9KA 5JNUA 4LHEA 4S1NA 3VC1A 4JIMA 3I61A 1NZDA 1CT9A 3EGDB 3JWEA 1XAIA 1YJQA 3N0XA 4L9RA 1ODKA 3MLBA 4UCWA 3FR8A 1DWPA 1M2HA 3ANSA 2B3DA 5LQRA 2HHHB 1J24A 2AMYA 3WXMA 6Q21A 1DDIA 4PS1A 2OA0A 3F7NA 3SEAA 4F96A 2XRZA 5FJJA 4EB0A 1C7FA 3HEBA 2PKQO 1MW9X 4UBLA 3VJKA 2C5FA 1KEUA 1JDPA 2Z2ZA 3AUYA 2FOLA 3Q12A 2REQA 3PUIA 4U2KA 3SBOA 4RYLA 2CHFA 1G8KA 4B09A 5B3JC 2R97A 5BWBA 2W9XA 4LKRA 2HCBA 1FRVA 3J80A 3RU7A 3MS2A 3LCJA 1T35A 1Y1TA 1XL1A 4H0CA 4XQEA 3W9BA 2IT1A 2O7QA 3VDQA 1AGXA 3B60A 1EUDB 2PKYX 5J5AA 1C41A 1X3SA 1P7CA 1U8FO 1N9KA 1YQEA 3QRWA 5JSZA 5ALDA 1JG4A 5C80A 5HX7A 3FAKA 4P2BA 2UZ4A 3HFRA 1LRKA 1IEWA 1ZVVA 2C4VA 3D3KA 1T5TA 4N3CA 1ZN9A 3QW4B 3CEMA 4NAUA 4EMBA 1F1JA 1SCQA 2ZANA 4RDCA 3UV6A 1EUZA 3VA7A 2QNIA 4A0GA 5CJ2A 4TZTA 5EERA 4OVKA 1NXXA 5B2ZA 1JBEA 2X9NA 2W8BB 2ZRKA 3OD1A 4FN4A 4RZ2A 2J87A 1UUFA 3VBCA 4M49A 3VR2A 1JFRA 1V47A 1N1EA 1UK9A 4N8DA 3WISA 4CKWB 1K6XA 1FX0B 3NHZA 1XHFA 3NV9A 4OHRA 3ORHA 4R5HA 2JI9A 2C03A 1MZPA 4GUAA 5CPFA 4BEJA 4BKMA 1VE3A 5FNVB 5FOSA 1U0EA 4KQMA 2Z3WA 4IV0A 3SM3A 3SQXA 2HCJB 5LYJF 3QTLA 5BV0A 5E6UA 3IQWA 1A8QA 2HJWA 4Q03A 2Z04A 3BD6A 1F38A 5P21A 3G9UA 4UARA 1DO0A 1NI4B 4FVTA 4U8GA 2XWPA 1UEXC 3JQPA 3LFTA 1ODTC 2PFKA 3B6EA 2Y1DA 3NXKA 1ADFA 2JVKA 1YULA 1DC5A 3OJWA 3UAWA 3QXGA 1MC1A 3EIUA 3GNTA 2KQUA 3UTDA 2C3YA 1YIAA 5JLAA 5IJZA 1IWOA 1QHXA 5EZ6B 2WJYA 3DBHA 4KQEA 3RW9A 1IK6A 3H9UA 3VC3A 2AYZA 2IYVA 2NTJA 4FLMA 1T9DA 1M2NA 4JLPA 3A7DA 3R2JA 5JY6A 3BIFA 3RQIA 3VV3A 3MERA 5A6SA 4KXLA 3Q40A 1L4KA 3PC8A 3R24A 4C7OB 2X0JA 3PLAE 5BMOA 1JQLB 1VSVA 2MJLA 3KR2A 3QK7A 4UKDA 5HRAA 5E95A 4D1YA 2J3HA 1W76A 4KC0A 4TTRA 4MVJH 1TYAE 3AL0C 3ZCXA 4LDAA 1PSZA 3PUWA 5HOQA 5FOWA 2OKGA 4HXFB 2PGNA 3U4AA 1IXRC 1OGJA 2HPAA 3HVJA 1XDBA 5CLGA 3KCNA 2OORC 1RKUA 4XVCA 4WERA 3BAFA 1N34B 4BKRA 2C2KA 1KJJA 1MVLA 3DJFA 1A76A 3L7LA 1H2BA 5IDXA 5KNLA 4NMWA 5AKIA 1OVMA 4RXUA 5KWSA 3H5IA 1HE4A 2R8YA 1TCVA 4DBZA 2QQ5A 3K53A 1KRHA 3MNFA 4PC7A 4ABTA 1R5OA 4KFCA 1SG6A 1TM2A 4UZFA 5AJVB 4PLCA 3UH1A 1WPXA 2BH2A 2O19A 3GGCA 4X60A 1BDMA 1ZZGA 2X5XA 3K0CA 4KX3A 4KXWA 3WGNA 1A9XB 1O96A 3IMGA 2M6RA 1FYFA 3QPDA 3TL6A 1J5EB 2V7VA 2OAEA 3HHEA 3E5RA 3L84A 1X0VA 1TKBA 4XIFA 3LFHA 4Q4HA 2NUPB 4DY4A 3DQQA 4UASA 5K8JB 2RGBA 4ZVLA 1EP2B 4IM7A 2Z5GA 5LKRA 2PJDA 2FMIA 3DL0A 3ZV4A 5LOVB 5L4SA 5KYKA 2LW7A 2WIBA 4BLTA 3U7QB 2WWYA 5CH5A 4ZP1A 1YNOA 4FUQA 5E2BA 4CU5A 3R3XA 4ZMSA 2XXAA 3B13B 1PQWA 1JKXA 3R77A 3KFXA 1WB5A 1ZCFA 3FGNA 3PBKA 2X3YA 5BRJA 3FLAA 1ZNZA 4JP3A 1WSDA 2WFLB 5DCLA 1MDBA 3CNLA 2PANA 1GQOA 4QDOA 3NKLA 2QVGA 3I09A 2YHBA 2JJYA 2WP0A 4ER5A 4K6HA 3GVPA 1S8FA 5BPHA 5CFMA 3OA0A 2QUBA 3IT0A 3E48A 2IEYA 3C7KA 5H9WA 3OQMA 1YB6A 4P4SB 1I6LA 1DADA 1Y8QB 4PTZA 1B8PA 4ND3A 4C9BA 3KK0A 1SHLA 4QJ3A 4Q19A 1VBFA 2QT9A 5KYWA 1WSWA 2Y1WA 3TW8B 2I6FA 4JUDX 5A5GA 4YCDA 1M34B 2PS3A 5KNDH 2YKGA 4DZRA 1FDSA 1YDFA 3MINA 4F5EA 3C6YA 1JDNA 1OLSA 1T6ZA 3OWHA 4J16C 3ZDDA 4N0PA 2YWHA 4TL7A 1NQWA 2A2ZA 4OH7A 2GAAA 4LWZA 4PC6A 2W42A 1JJVA 5CAEB 4BO0A 4KACA 3BSFA 1AZSC 3PV0A 4N9QA 1ZK0A 2CJPA 3PP8A 1DWQA 1L5OA 1QG0A 3MHPA 4YJ2A 1QZXA 4Y9TA 3GVIA 3MPUA 3ZE2B 4ZDKA 1EWQA 4CIAA 3HKCA 4UD6A 1EVIA 1YQQA 2QT0A 3AFOA 3GELA 2QR3A 5BR7A 2IOHA 1UPCA 3KSUA 2WFLA 4JFRA 5AHWA 3M70A 4RJLA 1YVDA 1VA5A 3N2IA 3JW8A 1HDEA 1BXKA 4DEVA 2HW8A 3ZJYA 1ECJA 3PNKA 3W9YA 4AJ1A 1CLUA 4HN2A 1XK6A 4A6DA 1KZ7B 5E1DA 2PG3A 3ENKA 1K88A 4M8SA 5BN5B 4DTCA 2F6RA 3A9CA 4Q16A 3CLSD 5JFTA 1NR5A 1EJ2A 3O1IC 4MR9B 4I8XA 3RUCA 2CNWD 2VHCA 3C98A 4FZJA 5LBIA 4PFJA 3DMTA 3M34A 2ALJA 3IPCA 3KHSA 5BMVF 2ZYVX 1AM4D 1T4GA 5I47A 1ISRA 3UAXA 4BMCA 4D6PA 4RWEA 4UXHA 2H2HA 3OAAA 1P8AA 4DMHA 3DDNA 2ID9A 2UVQA 5BQFA 3W5AA 1Q19A 1BVUA 1N6KA 1YA4A 3JQ9A 3PENA 1Z37A 2D0OB 4EFNA 3OC6A 1B43A 2IY8A 1XX6A 4EI8A 3CZRA 4QYSA 1XMVA 2HHJA 3UXYA 3ZQ6A 4MLDA 1D04A 1VE7A 3JQ7A 4WQMA 5T6MA 2XUGA 2EZUA 2CD9A 2ZRDA 1CEQA 4MK4A 1TF5A 2AOXA 2QKYA 3OCVA 1HDRA 3SMVA 3M5DA 1EBUA 4R1QA 4K2HA 1SUBA 1B73A 1WUYA 2AUMA 5EWLB 1LVUA 3QEJA 1N1DA 3K70C 2X58A 1BA3A 1WX1A 1CDEA 1XU7A 4D98A 3OMLA 5T4HA 6REQA 4PZLA 1SXJC 3TSYA 4D9FA 5J2UF 3LY9A 2FSGA 4N76A 3UC9A 2VO1A 2FMTA 1OKKA 2YZMA 1E18A 3BFKA 3UMCA 1LXCA 2PJUA 2XMSA 5B3KA 3G2IA 4HLQB 3I9V1 1NF8A 4Q9IA 5ALOA 4LE1A 3EBLA 3M1LA 1Z5UA 1GNRA 1ZI6A 2VHXA 2PEZA 2GT1A 1ZMBA 1JLSA 2W98A 4ZT6A 4OKSA 3I72A 1HEIA 2WWHA 4AO6A 2YDYA 2CUNA 4TTSA 3W7BA 3QPAA 4L4ZA 4H7IA 2G72A 4JL8A 2VZ9A 4PCLA 2NOAA 4J94A 5KTKA 4ZT3A 3BBLA 5F1KA 2RHHA 4JBNA 4DQVA 2QN6A 2C2WA 3AJDA 1G7RA 3HWRA 4WXRA 3UFXB 1KJIA 1TUIA 1U8TA 2GK4A 1FNBA 1FRZA 2IHVA 2OE2A 4IRXA 4ALMA 2I91A 2C99A 4H3VA 5FUWA 1E63A 3UMFA 5T7BA 3CRMA 5JOQA 4XUEA 4CCWA 1PN3A 4LZAA 3NBYC 5F3DA 3ANMA 4B5LA 1NVKA 4LMAA 4O2BA 3BHNA 1L7RA 3UXEA 1F2DA 4G07A 5G1OA 5K0NA 2PLNA 1K06A 1V4VA 2AI1A 3A6ZA 1CQXA 1VRWA 2HMSA 2G9RA 3H99A 2QUHA 2UYGA 3PQEA 4REQB 4BQPA 3GVHA 5I8PA 1CQZA 1P77A 2V74B 1OXTA 2AFIA 2C98A 3O4RA 3V8EA 1CV2A 2UYQA 4HCJA 4AKGA 3EHEA 3ROKA 4UTXA 3THSA 1KZ6A 4QODA 4LYAA 4RJTA 2WJ3A 3IP9A 4JUCA 4XJVA 4BMYA 4IO1A 1QVVA 2CY0A 4QPJC 1B14A 2OXFA 1U7OA 4NX2A 3TAXA 3ZZTA 1ZG3A 2PQ0A 1VTKA 4RHFA 5IH3A 1SBCA 2DGDA 2FA9A 3MSXA 1TW3A 1H0SA 5K01A 3SKXA 4DHWA 1CY0A 1CRWG 4C5BA 4ZQFA 3GRVA 2BFWA 2ECKA 2YVKA 2J4FA 4L4YA 3K20A 3BMOB 3HKEA 4H0FA 5F2EA 5ADVA 1ZXBA 4KH1A 5BV8A 3F97A 3D64A 1Z0JA 2YXBA 3H2JA 1KU6A 1ITZA 3G9QA 3ASYA 4NONA 4IGAA 2VJMA 4J1NA 1QDEA 2BKUA 1WCV1 4NYMR 4YQYA 3VDMA 1VHLA 2GD1O 5A9TA 3RANA 2NXEA 5LR6A 2PXCA 1X74A 4BATA 2ZZMA 4JEHA 4NRDA 3I04M 2E4VA 4OHKA 4OL9A 2AUNA 4YMWA 1TFUA 4ICIA 1SUSA 3HEAA 1SZPA 5E38A 2JKVA 4C14A 2V7XA 2H4HA 4N18A 1TCBA 1XVUA 4IHJF 5JO9A 1QCZA 2JW5A 1YL5A 1M75A 1QBGA 2P3LA 3I2IA 4L5IA 4CT4B 3UT0A 1K89A 1L4FA 2E21A 1VMAA 1VSBA 4HGQA 5GV8A 1QYRA 2XMZA 1WDWB 2Q3EA 4UDYX 5EP2A 2RKWA 2KE5A 2A1UB 4MINA 4BN4A 3TDNA 1UXKA 3W5UA 3T9FA 4KQIA 3ZK7A 1Z0KA 5AM0A 4RTJA 2N42A 1XMXA 3KEOA 2YRWA 4QT0A 3SJUA 2YXNA 1QB7A 1PZFA 2QTZA 4LJAA 2ZKIA 3T7JA 2DU8A 1DX9A 1QP8A 3CQ9A 4OGLA 4BQOA 2HSJA 2VSNA 4IYRA 4E1VA 2H9IA 2WC1A 3HYSA 2G5GX 1DL5A 1GA1A 2N9UA 3G2MA 1NXQA 3OPNA 1L5VA 5IX8A 2F8SA 4FYWA 3KQLA 1CPYA 2QMEA 2Z56A 5FR2A 4NZMA 2PNFA 3QX7A 1U1DA 1PK8A 3G82C 3Q7SA 4HP8A 4MCAA 3TNYA 4CIBA 2H2AA 3JQ8A 3TRJA 4KRFA 5JNVA 4TQGA 1PSDA 2P2SA 3A0UA 3RADC 1PJTA 5MDHA 3L1HA 2D7CA 3IO3A 3CURA 2NTEA 3U37A 4DM4A 4UM9B 4ZHSA 1F1BA 4B3RB 1U4OA 4G09A 1SHTX 3P5SA 1UOEA 2NADA 2D13A 4WASA 2QZJA 1XRNA 3AGPA 3FDJA 4QXPA 3F71A 3L7KA 2A94A 4XYGA 3DE5X 3L49A 3W5HA 2SCUB 5L4LA 4RU1A 1CZNA 1LD3A 1X1SA 4MCIA 3ZWPA 2ZBPA 5L40A 5LQUA 3UXMA 4G8BA 4LF7B 3LPLA 1Q22A 3MYRA 3X1KA 1C9EA 1KHHA 1P4HA 3IAUA 4QPDA 5CNMA 3U60B 1LB1B 2B1RA 4N5IX 1FFWA 4ALIA 5K7SA 1PR4A 3WZMA 4ARIA 2ZQYA 3AXSA 3CY6A 4JNCA 1TTHA 1E5LA 4IMRA 1PWHA 1W19A 2GVDC 5EL0A 5DBIA 1FYVA 2GYVA 2OXEA 4GUDA 2XCIA 5EHIA 2ZT7A 3AESB 3BGDA 4C0KA 2FFHA 2QF7A 4IDDA 4LGYA 1H4SA 3R7WB 4GQBA 2ONKA 3GOQA 1EQAA 3CWQA 4YRZA 1L7VC 1OVGA 4HUQA 4XXHA 2L2QA 2NU9A 1GLVA 3CH6A 3S2FA 3UM9A 2D06A 1UBTS 2B8WA 1UJ4A 2P75A 4QA9A 1V4BA 2VR1A 3GMSA 3RUIA 3H5LA 3THXA 1XAHA 2B5VA 1SG9A 5KWJA 1F12A 2ZJ2A 3HB5X 1W4CA 1NMSA 1M2OB 3I04A 3LIPA 3CV3A 3EGXB 2RHDA 3R5FA 3ZCPA 1XMPA 1XZ8A 5I7WA 3C7DB 2XXAB 2YJZA 1I2BA 1HBJA 3AKYA 2AFHB 2CLDX 3DL4A 3FKSD 5FUQA 1II9A 1Z47A 3VO1A 2PUWA 1SXJE 2DWUA 3I28A 1I4TD 4L7VA 3E3AA 3X2FA 2QBYA 1J33A 2P3SA 3PK0A 6AT1A 1RBZA 4W9NC 1YUNA 4UQOA 3TLKA 3O0TA 2AFIB 2JLAA 3PCXA 4O63O 4L57A 3QVXA 4I9HA 3REQA 3TOCA 4F06A 2VTBB 2QLLA 1YVEI 2G7ZA 2PUHA 1Q7TA 4YUAA 3KXKA 3VVLA 4GZ5A 3BD9A 3H42B 1N8KA 2QD3A 3OZVA 2WI8A 4EW6A 1WVGA 3UH0A 1D07A 2ZCVA 2Q5JA 5FAXA 3K09A 5KC9A 4M1QA 1TEHA 4P7FA 4BGIA 4YT4A 3H2BA 3INTA 4ENPA 4RTQA 1LPNA 2C5HA 3HU3A 3KNZA 2GAIA 4S1OA 3R40A 5EIEA 1ORVA 4E0BA 2XVAA 2GM5A 2P4UA 4M53A 3UN1A 5JSHA 2PFSA 1JA1A 1HRDA 1IEXA 1NBME 2IYQA 1RXIA 2LBPA 3R5XA 2O3TA 4RVFA 4TVOA 2AG5A 3IP8A 4LISA 2RGNC 3SQOA 2Q0XA 1GEEA 5JJBA 5F4ZA 1P1JA 1AX9A 1GGHA 1Z63A 4RCYA 4BFXA 3AKEA 3QY0A 1PNOA 1FRNA 5FTMA 2HTEA 3RWOA 2JCVA 1YV9A 1JN0A 4M36A 4UHJA 5D3KA 3FWYA 3NPMA 2RCYA 1O6ZA 3LG2A 3N75A 2FTKE 1Q0UA 5IC5A 4DB2A 1DBVO 1GPBA 4KYVA 1QPZA 1DIGA 4QTTB 2I87A 3HN2A 4E3WA 3MC1A 1CQJB 2ISQA 3ESBA 4NOLA 4X64B 1KMIY 2E7ZA 2QPLA 2JD2A 4EKNB 4TYYA 1TJ4A 1OXKB 4MVJF 4ZVTA 2HR1A 1E0DA 1ZCZA 3BH7A 3MTQA 4QQNA 4ZVUA 3TD2A 4TQ9A 2Y77A 4QLBA 4NICA 4I3GA 2TS1A 1T4MA 1AMOA 2AI3A 2G7MC 2XJ4A 3D59A 1PTKA 5KTMA 2XLBA 4OA5A 1RT9A 2XUIA 1R5NA 1TMGE 2XD9A 4AWBA 4AZ3B 2IE0A 5DGXA 3IQIX 1KIAA 1CNFA 2VTKA 2C4NA 1PHPA 1DT3A 1UJMA 3DE2X 4ZAVA 2POCA 4LJSA 4DYHA 2NXWA 4E7PA 1FDUA 3O4VA 1NI4A 1RQLA 4EGJA 3VHQA 4DWOA 4E09A 5KHLB 2Q8NA 3M5PA 2H2FA 2R6ZA 2ZUBA 3EF0A 1FSSA 5EE3A 3I5AA 4O8ZA 1NQXA 4ASUA 4QQFA 1W4LA 4C0XA 5F7JA 1CJSA 1ONNA 2JFBA 4LYDA 2FW8A 5CA1B 2X13A 3N9IA 4Y2VA 4J0CA 4JUFA 4F84A 1VLJA 3VVCA 3SVZA 3C85A 3AJEA 1U7XA 1CJVC 4DNFA 4FP9A 2F3UA 4UBJA 4WECA 3PJRA 2VJKA 2Y66A 3W78A 3JWGA 4IILA 4PYQA 1Q50A 3IP1A 2C20A 5AI4A 5C8YB 2LKCA 5G3YA 1UH5A 5HYVA 4OUDB 5AKGA 5JPDA 2AVNA 4KVFA 1QAMA 1U2GC 1SXIA 2CCJA 2BM9A 1ULUA 2HBRA 3AR5A 4YEDA 3TSOA 4PY2A 4RZIA 1FTNA 3A1WA 1UAAA 4QOFA 2VT6A 4R8MA 1UL1X 4J03A 2O1SA 3N2GB 4MGKR 3T1OA 2AGVA 2ECOA 3P9RA 4L2IB 9MHTA 2DKNA 1M5RA 5ECYA 1PCXA 3JD2A 4KEAA 4Z7OB 1YDGA 1FVFA 3I3OA 2XQGA 3PRHA 1Q12A 4BC1A 1KAQA 3KQWA 4BVHA 3WGKA 3C74A 3ZZUA 4CMKA 2G4VA 1TJ3A 1ANKA 2E4UA 4PLYA 3AW9A 2CHVA 3D4PA 1Y9JA 2VSOA 2ZIAA 1MJ5A 1B6GA 1RI3A 1AGNA 1ENPA 2ZJ3A 4I46A 5LP6F 3FMVA 3D9QX 2Z9CA 3LKVA 3NTRA 4QATA 2C29D 4KO3S 1RQPA 3CNNA 4WZBA 3LM8A 3V4ZA 4UHCA 2X8AA 3ZV5A 1DCKA 4ER0A 5DZSA 2AR9A 4MVCA 1XF9A 5HMLA 1PK7A 1VKNA 2NO9A 4RO0A 3F1KA 4LZZA 5BR8B 1YI1A 2DC1A 1M2KA 2H63A 4IV5A 5H4HA 5JSZB 1EFRA 3WK9A 4QGFA 2FPSA 2I3GA 2A78A 1WXQA 3HP4A 4DGQA 2QRUA 5CYFA 1HSOA 5DNWA 5BR4A 2BKXA 2HF9A 4QTUB 4FXPA 3SVTA 3R9XA 1F5NA 2C4HA 4EKEA 2WE7A 3CPEA 1PFUA 1YVRA 3ZI4A 1K8XB 4F6LA 2JH9A 3KWFA 1P3Y1 3L77A 3Q0EA 2IPNA 2BH9A 3IDFA 3SF8A 2OXIA 4IDCA 4H7HA 4CR8A 4N39A 4FUTA 3TLJA 1KH1A 1PFKA 2JCGA 1VMEA 3U7IA 2WEKA 5C7LO 2GEDA 2NXCA 1Y7PA 4XE5A 1JVSA 4ZEVA 1Q5PA 3NJ4A 3HH8A 3P9IA 4BYGA 3FYUA 2P8SA 2L82A 2VUSA 1J8YF 3BVPA 3RABA 2WKPA 1N5JA 1RCUA 2X1LA 1QU3A 1D4FA 2G9NA 1RRGA 1X1CA 3HKBB 4ZDWA 4R0VA 4OLBA 1YZNA 1J0EA 5DYIA 3T5MA 4CM4B 1A8HA 1TOAA 3CW8X 3GW8A 2AA3A 2OVBA 4PRZA 1VJ5A 2Z58A 1OY1A 3FPLA 1VHQA 2Q5EA 5EXDA 4Q7KA 5IZCC 3GV0A 4YGXB 2OXRA 5JECA 4G0QA 1DT5A 2WDZA 2HJRA 3PUHA 2L0XA 2WMYA 2O52A 2W6QA 2P30A 4XDZA 1Y6FA 4LI3X 2JPDA 3UJ3X 3ORQA 1OYYA 5DNEA 3A3NA 4D9HA 3V4OA 2Z6AA 5EAIA 3GX1A 3U40A 3JVDA 1AXRA 2VA8A 5F21A 3ZEAA 5A03A 3CH7A 5KNCD 1FZTA 1DXQA 2AWNA 4L16A 3FZEA 5K3FA 3ULKA 1ACJA 4MS3B 4FB4A 2E6UX 4N47A 1WW8A 1II8B 1JZSA 3COYA 1AS3A 4AKTA 1ZW1A 1KC1A 4TKVA 2QW8A 2M32A 1K8ZB 1MC8A 1XMIA 3O8NA 4KU4A 3VUFA 3RS7A 4EABA 3K8ZA 4Z8XA 5J4HA 1IOWA 1OIVA 3ESCA 3OFNA 4RD6A 3BILA 3WLOA 2QV7A 3CH5A 5FOXA 3WQBA 2OCBA 4NJOA 5AKLA 5K9ZA 4EJMA 2R66A 3ESYA 2FEOA 3EZYA 3IJ5A 3MWDB 5SYNA 3SSOA 3K0SA 3MTGA 3ZD7A 1E1YA 1QFMA 1BEZA 4XUCA 3M1AA 1RWMA 1NKSA 3PQ5A 1LBSA 2WHPA 4EG7A 2VPPA 1UMDB 3L8MA 2O7VA 2B9EA 4RCZA 3IRVA 5IWAB 3M81A 5ILOA 1GKLA 2I29A 3L8EA 5DTJA 5JAOA 3UWDA 4Y6GB 2I76A 3OZGA 1SUIA 1OQAA 1IQ0A 4TTPA 1TK2A 2AWOA 1BRTA 3QSYA 3DOEA 3RSCA 4HZUA 2FMKA 3IULA 4EJSA 1ETUA 3CEPB 3ELUA 3KVYA 3L1JA 4UMFA 4XR4A 2PX5A 3FF4A 2O8CB 1Y5LA 4A3SA 4KQ1A 3FCOA 2NQ8A 2XVZA 5DYGA 2J09A 5SYAA 3JAKA 2PRSA 3X2SA 1LF0A 3T3HA 2QTRA 2A14A 1DG9A 1GPDG 3CLUC 4RPIA 2VHVA 3F90A 3QH4A 4Z2AA 4XOIA 3D6NB 1NLUA 2ASEA 5LMUB 4DLKA 3CKYA 2NSHA 1ZRMA 2ZYAA 2R7MA 1WMDA 4OTZA 3A4MA 3FMFA 4CKWA 2O8FB 4ZCRA 4L28A 3HRHA 2BE7A 5IC4A 3PC4A 1DIHA 1V8DA 1Z83A 4G65A 1SIOA 3MTDA 4WZAB 3VXKA 3JQRA 3NVAA 3FPKA 5AHKA 5B3JA 1XPRA 5F78A 2FMHA 1G55A 4KIGA 3B7WA 1Y4ZA 3UWPA 2FWMX 1FIUA 2BUBA 5CU7A 3BEDA 3QXCA 4PXSA 1U3UA 2O0JA 1COZA 1JQKA 3GDHA 4LECA 4RMGA 3N8GA 4WKPA 2VF4X 4S0XA 4GLJA 1Z8NA 3ZX4A 2BRUC 1CEXA 3ZXSA 4EENA 1ZOIA 4AD8A 4EJSB 5A06A 2ZI7A 3AR3A 1GT91 4MUFA 4NZPA 3UJHA 1JWLA 1RAIA 3FVVA 4CVNA 3RB8A 4V3BA 1XA4A 3B38A 3JD1A 1F6WA 3TGWA 3AFMA 1SXJD 3EQ7A 2VJOA 3NKVA 5A9SB 1M74A 3GCGA 2W2OA 4W5OA 2R48A 2ZS7A 1EXDA 3F73A 4MPRA 3W1EA 4YRSA 1HE1C 4DSOA 1T2EA 3IXLA 5JTUA 3LBHA 3N3BC 5C35A 1MAUA 2H3HA 1BCRA 2QA5A 3AVQA 5CNIA 2BBSA 4CKBA 5U9CA 1W35A 5KVCA 3QLEA 2ORYA 3LRXA 3P52A 1DO2A 3LE8A 4MI9A 4OHWA 2H2DA 3GYBA 5ES3A 4CEHA 5FO0A 3PFIA 4G41A 3PNYA 3IQZA 4QBHA 1OKKD 2N47A 4TWZA 1LDGA 3QMMA 3WSTA 1FK8A 4E2FA 4CKCB 4EB3A 3CGWA 5ELXA 2YH2A 1A7KA 5FTJA 1RC1A 3LBFA 1HLFA 1XA0A 4D41A 3BB3A 2YV4A 4ZQHA 3UQYS 1LQ2A 4BMXA 2H2WA 3WYFA 1KE2A 2XCUA 4DIKA 2OFXA 1V3VA 4J3NA 1CFZA 3RC3A 3DE7X 1SHUX 2ODTX 3C3KA 1R8SA 4MKIA 2ZK7A 2EU8A 2E5LB 3OCCA 4NCAA 4EY8A 3OQ1A 4JJ7A 2VWQA 3DLIA 2F3RA 3G2HA 4Y2QA 2Y1XA 5F76A 3WJ2A 2YRFA 4IVRA 5FNZA 3IAXA 1NV9A 1QLHA 1COWA 2CNOA 1E62A 2XY4A 2H57A 1U5BA 1RWWA 2AMFA 4CKZA 1EGHA 1SZDA 2WHEA 3IP5A 2Z2YA 1KKMA 5FA5A 3NV7A 1YJBA 5FRDA 1W30A 2IU4A 2V9ZA 3CR3C 4LAFA 4LXUA 3ECCA 1MOPA 4TXHA 4FFPA 5EQTA 4P35A 5CA1F 2JLUA 5KOJB 1QRTA 1W4BA 4ZAZA 1IH8A 3ZDCA 3M6UA 4HNGA 3GJ8A 1NRXA 2HPZA 2CXRA 2JVJA 2X15A 3EVBA 3GUVA 3PD1A 4OJYA 2VK2A 2VK1A 3EIFA 4CF6A 4EF5A 4J29A 1J97A 3FETA 3N6XA 2FEPA 4WNAB 1EE9A 4KPEC 1VMDA 3GNQA 1V5IA 3VH2A 5F7OA 3A6LA 1GTSA 2NN3C 4PO1A 4AY6A 4R3NA 4KXFB 1O1YA 3J81A 3QV1A 3WLPA 2YWCA 1G0NA 1TUBA 2H5JA 5FPSA 3FPHA 4ZMRA 2K7FA 4UM5A 1R50A 3OVMA 2A58A 1MX9A 3GBVA 1POXA 4GL2A 4F71A 3ONFA 4ZQBA 5ERYA 4GT1A 2OFPA 3V4SA 3EMVA 3FNGA 5BV1A 2R85A 4XD2A 4GKAA 1ABFA 3NPAA 3DB1A 2ZE7A 4MUMA 3WG9A 1KVUA 3PWSA 4X1IA 1L5HB 3ZDQA 4NDNE 4AN1A 2ZRLA 3GNLA 3TDMA 3DPIA 1X7ZA 2HWXA 3LOPA 5EXXA 3ZHZA 2HUPA 3RWBA 2I22A 3IBGA 1UC4B 3BB4A 3UV3A 3DBLB 2GCIA 1SZCA 3HLKA 1AA6A 2FSVA 5BW8A 1TRKA 1T29A 1U0OC 1Y82A 3D3NA 4JB2A 1THTA 4OHBA 3RAJA 3K05A 3DOIA 4CFZA 2PUCA 3CRRA 3H2YA 2PZMA 3OJLA 4OLHA 2OD9A 4O4JF 4E70A 3HXOA 1DB3A 2HA2A 2QM0A 2VPTA 4G0MA 5GVSA 3THYA 3R76A 2R5WA 1E3SA 2RG1A 4J0EA 1JR6A 3VYVA 2J59A 2GR9A 3H9CA 3S2IA 4INPA 1FNCA 3AETB 3AKCA 3DUFB 1QWSA 3CF0A 4UNQ