1KKUA

Crystal structure of nuclear human nicotinamide mononucleotide adenylyltransferase
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
253
structure length
216
Chain Sequence
b'EKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDVPKVKLLCGADLLESFAVPNLWKSEDITQIVANYGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWFANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE
publication title Structure of human NMN adenylyltransferase. A key nuclear enzyme for NAD homeostasis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 68
structure length 216
sequence length 253
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1kkuA00
1H3FA 1K4MA 4HJRA 4L2IB 1WZ2A 4UZEA 1O95D 1J20A 4ZCRA 1MRZA 2A7XA 4MQ6A 3ELBA 1OBCA 2A88A 2J4DA 1LW7A 3H99A 4R2LA 2TS1A 1N2HA 3CLTC 3CR8A 3ZUGA 5TEWA 1QTQA 4CDMA 1EFPB 1O94D 1YULA 2PZBA 1OWNA 1Q15A 4ZCTA 1EJ2A 3DO8A 5DASA 3N9IA 2H2AA 1GAXA 4MUIA 1O95C 1YUMA 1NUPA 3QE4A 1QU2A 2HGZA 3CLUD 3FH0A 4MUJA 5TGTA 3SYTA 4CT0A 1WXIA 4EG4A 4MVWA 2VXOA 1N2JA 3H05A 3A05A 4HK4A 3TZEA 4MW0A 5EKDA 1F9AA 5J59A 1DNPA 1TYCA 4KR9A 3SZ3A 1IQUA 4OUDA 4ZT6A 3IDFA 3IVXA 3H9BA 3SEQA 4EFKA 1F7VA 2A86A 2YY5A 1JZSA 2DLCX 4K03A 2VTBA 4KR6A 3AKZA 2ZP1A 2X1LA 1J09A 3HL4A 4ZT7A 3HGMA 3CVYA 4EG8A 3U1VA 1Q19A 2R5WA 2QTNA 4I6EA 4RPIA 1ZH0A 1QQTA 2AG6A 2O8VA 3QTTA 1FYDA 4DLPA 3HFJA 3IMCA 2IP1A 3FOCA 1JIJA 4G5FA 1V47A 4X0EA 1I6LA 1EFVA 1OWMA 2DETA 4YBRA 5IJXA 2B7LA 3IOBA 3PNBA 2J07A 1HYBA 1M8JA 4DDMA 3LOQA 4FZJA 3PNVA 2OQ2A 1O96A 4MUFA 2QJTA 3M5WA 5DB4A 3NBAA 4UZFA 1MOPA 4HPWA 4EG7A 1QNFA 1MBZA 3MMXA 1T9GR 3ZJVA 3H97A 4MWEA 4G6ZA 4EG5A 1U3CA 2A84A 2DPLA 3MLAA 4ZCQA 1G8GA 1KP3A 1QRUA 3TS1A 2XRYA 4I6GA 1QRTA 1I2DA 1WXGA 1JMVA 5FNZA 1IRXA 1O97D 4ZT2A 3X1KA 2WQ6A 4QREA 3NV7A 1WKBA 1XJQA 2JA2A 3D6VA 1ZUNA 1WXEA 3L93A 2QUHA 3SDBA 5LM3A 3A04A 5HUJA 4MUNA 2C5SA 1JHDA 4MWCA 4ND7A 1T6XA 2CV0A 3IOCA 1GZUA 1BS2A 1WXFA 2NZ2A 1JIKA 1H1TA 3COVA 1N2GA 1U7XA 1O97C 3RBAA 4AQ7A 3FI0A 3A4IA 3COWA 3FG9A 1IQ0A 4KPUB 5KCMA 2PXHA 3F3MA 2J5BA 2CV1A 3K32A 3KT8A 5BNZA 5J58A 4DE5A 1IVSA 1K4KA 1N2OA 2DUMA 2QUKA 4AS1A 1NUQA 1VBMA 3IVCA 2PFSA 1Q11A 1TQ8A 2IELA 1KQOA 1M8PA 4E1AA 3AG5A 2ZUFA 4MUGA 1PG0A 1YUNA 3FIUA 1MAWA 1PFVA 1FFYA 1KORA 1U3DA 3QTBA 4YP5A 2X0KA 3RHSA 3G6KA 3TQOA 3FNRA 1N3LA 3OTWA 2J09A 1I6KA 3VU8A 4PBTA 2PZ8A 1OWLA 1PFYA 4MUEA 3CLSD 1KAMA 3SZGA 4PY2A 3UY4A 3MLBA 3DPIA 1O94C 4DDKA 1N75A 4DNXA 2QTRA 3ND7A 4U8HA 5KWVA 1G8HA 4L2IA 4ND6A 3CA8A 1G59A 4EG6A 3SP1A 2CYCA 4P2BA 1KQPA 3SEZA 1JECA 2X1MA 3ZJUA 4WSOA 4ZCPA 1ZJWA 2AKEA 2A1UB 3CLUC 1NURA 1RQGA 5J5AA 1Q77A 1N2EA 1EFPA 3TZLA 3UOWA 4EG1A 1KH3A 3HMQA 3AL0C 3AFHA 1JGTA 3E27A 4MAFA 3KFLA 3I05A 2CYBA 1TYAE 1VL2A 1H3EA 2D13A 4EGAA 3RFFA 5JBNA 1GTSA 3ZJTA 1JEDA 1F4LA 3ZXIA 3ZIUA 1IQRA 1J1ZA 1X6VA 4A91A 3N8HA 3G5AA 3KT6A 2JAXA 1ULHA 4TS1A 3CVWA 4MW2A 1I6MA 3D6UA 3AG6A 2D5BA 1KH2A 1EE1A 1WXHA 2EL7A 1F7UA 2CSXA 1GPMA 4NZPA 1H3NA 2PIDA 1GLNA 4MUHA 4ARIA 1YI8A 1YIAA 4XSVA 2CV2A 1NI5A 5IHXA 1U0BB 2WB2A 5F23A 1LI7A 4Q93A 1Y42X 1PFUA 2IJGX 1JZQA 4PBRA 5H7XA 1WOYA 4MW1A 2Z3VA 4MVXA 4QRDA 1TYBE 3Q4GA 2V0GA 3X1MA 1G8FA 1NUTA 2J08A 1VBKA 1N2BA 2QJFA 4YP7A 3A2KA 1WQ4A 3PNYA 2E18A 2A1TS 2YWCA 1TYDE 1J1UA 5HUHA 1OWOA 1KKUA 3IMEA 5LLTA 3CVUA 3FHJA 1ZH6A 1IH8A 3GLVA 5HG0A 1M1ZA 3P52A 5AHWA 1TFUA 1PG2A 3P0HA 4QBTA 3IH5A 4YP6A 2O5RA 4CDNA 3LCJA 4J76A 3RJZA 1P7PA 3CVXA 4MVCA 5FO1A 1QJCA 1NP7A 3JXEA 3CLTD 2CUZA 3COZA 2G36A 3OP1A 4JZYA 3N2YA 2CYAA 1K92A 3DLAA 4KPUA 1XNGA 4Q16A 5FO0A 1KR2A 4U63A 4JXXA 4NAUA 2X3FA 4OUDB 3UC5A 1MB9A 3C8ZA 3ZXSA 5K0TA 3TQIA 2GKSA 2EJCA 2V0CA 4ZCSA 4OJMX 1T9GS 3PXUA 2VTBB 3IVGA 2YWBA 3P0IA 4GRIA 4ARCA 4ZT4A 4G5YA 4JXZA 3CVVA 2RD2A 3FWKA 1NYLA 4MW5A 1GN8A 1M83A 3UMVA 3ISJA 4WNYA 1MB2A 1NZJA 3Q10A 4KKVA 1COZA 3PRHA 3N05A 5K0SA 2WSIA 2DR2A 4PBSA 2CT8A 3AIIA 4JFAA 4NAHA 4RUKA 3CLSC 1T6ZA 2DERA 3L92A 1EFVB 1N1DA 1QRSA 4XFJA 2Z08A 1OD6A 3IUBA 2A1TR 4S1OA 1ILEA 1JIIA 4R2MA 4EF6A 5DK4A 2PZAA 4F3RA 4MWDA 4NX2A 1MC1A 5LFAA 2BTEA 1JILA 3TNJA 2DXIA 1O96B 1R6UA 3FETA 1R6XA 1GTRA 3S3TA 2YXNA 2I1LA 1JEEA 3GUZA 1PFWA 1LI5A 3LE8A 3IMGA 1KH1A 4K0RA 1KQNA 1XNJA 4H3SA 1EUQA 3IUEA 4ZT5A 1M8GA 1A8HA 2E0IA 1T6YA 4MUKA 1B6TA 5H16A 2QUIA 1N77A 1KP2A 1MAUA 2A1UA 3ND6A 2HZ7A 3KT0A 4J75A 1MJHA 3RK1A 4NDAA 1TEZA 5KHAA 1N2IA 3ILVA 4DJAA 3FY4A 1YIDA 4XFDA 3G59A 3H9CA 4HJXA 4CQNA 4MWBA 3MUEA 2OV4A 4BWVA 1WJGA 4MW7A 2NSYA 4MLPA 1VLHA 1XNHA 5TS2A 3HZRA 1IHOA 2QUJA 1NUUA 2CFOA 3MXTA 4NATA 4MULA 3X1JA 2E21A 3VRHA 5DEOA 4MW6A 3DV2A 1J21A 1R6TA 1WY5A 3GMIA 3CLRD 2D54A 1J70A 2AZXA 4MW4A 3ND5A 1NSYA 1NUSA 2QTMA 3IOEA 4MW9A 1WQ3A 1V8FA 2PG3A 3ZGZA 3KT3A 2GM3A 3COYA 1O0CA 1O0BA 1VBNA 5TEVA 2ZUEA 1O6BA 1M8FA 2XRZA 4JYZA 3FDXA 4EG3A 4F4HA 3NBKA 2BYTA 1K97A 4R0NA 4ZT3A 4I6JA 1IFXA 3CLRC 2QJOA 1S4MA 3HV0A 2JANA 3K9WA 1EXDA 2A4MA 1M8KA 1QU3A 3IODA 4GU5A 4U7JA 1OWPA 4MVYA 3Q12A 2HMAA 2Z09A 2E89A 1UFVA 1D2RA 2DEUA 1O5TA 1N78A 4YMIA 1SURA 4DDHA 1CT9A 3P0JA 1OBHA 2GOYA 3BL5A 3INNA 2WQ7A 4KR7A 1U7DA 3UK2A 3VGJA 3RK0A 1EUYA 1X8XA 2RE8A 2H29A 1KAQA
chains in the Genus database with same CATH superfamily
3QKWA 4ENQA 3WDLA 3KYBA 1TLFA 3AH8A 1JJ7A 4W9RA 5C1IA 4O4IA 1QP0A 1WZ2A 1O95D 4RMNA 1E6UA 4QPJC 2E4VA 2VAPA 5IP5A 3ESRA 4HGZA 4L5BA 1J1IA 4J2OA 3UAYA 3D6HA 1RAHA 2A9JA 1KJJA 4X44A 3PC6A 1CRPA 1QX3A 2W37A 2HEIA 2QY6A 3FXAA 4DYHA 3L1JA 2B35A 4M7PA 2AJTA 3WIVA 4KXYA 4DMGA 4R51A 5JS7A 1JALA 1FLNA 1GRQA 1NQ5A 4G8CA 5BUZA 1Z25A 1U2GC 4CN8A 3ZZMA 3VKFA 3NP9A 1J0AA 5DASA 1A9XA 4JVSB 2I6TA 4RTSA 1AF4A 5LUAA 3OF2A 1GPNA 2PZLA 2R8EA 2RHRA 3DV9A 2VYNA 2NSLA 4S3MA 1QU2A 1LSUA 5FL7D 5D5QA 1ISJA 2XLCA 3DONA 4V0OA 4Y1RA 2QXUA 1WXDA 2G8LA 3GZNA 4Z1MA 4BMSA 1YR8A 2H5IA 1XZQA 3NU1A 4YO8A 4GKAA 2GPNA 4BJ1A 2W2TA 2XUKA 4MW0A 3M33A 5G41A 1XLUA 4G07A 3H7IA 4QQFA 2AOTB 4P4SB 1LJUA 2FFJA 3FWPA 3LHFA 3R5FA 2QD3A 4JA2A 3WWPA 3GLRA 4F5DA 3T1HB 1O4VA 4NXMB 4O4LA 5TF4A 1P7YA 4DVGA 4LHSA 4QVGA 3ANTA 1II9A 1X70A 1M6NA 1ZK1A 2V7GA 4IEEA 2IYSA 3LZDA 3T99A 5KQSA 4ISBA 3L8YA 4H4EA 4BCBA 3ZDRA 3W9BA 4KREA 2BHSA 4MPDA 4UCWA 1UWLA 3ZVRA 4DA7A 1XTPA 3IGFA 3KE9A 1TKRA 4NCIA 4D8YA 5F33A 5FI3A 2FWRA 3SN6A 3ED1A 2O8FB 1G7SA 4CCAA 5FHRA 5KTRA 3GT0A 2PX4A 3FDFA 2H1WA 4UBKA 1CUZA 1E5DA 2LV8A 4RABA 3IV7A 5FBZA 1E3QA 1FDRA 2OK7A 3A9UA 4RL6A 4UFPA 2WHEA 1X2EA 3IT1A 3S70A 3V1MA 1FYEA 3GC6A 3A25A 4BCDA 4JOQA 3V3KA 2F6RA 4ZANA 3SR0A 3THSA 1T3TA 3OC0A 5ALMA 1JR6A 2OBXA 4DLYA 4O25A 2R4TA 2Z1MA 4S04A 4XXHA 1FUIA 3RODA 5FLXA 2R6JA 4S1TA 4WECA 1W2GA 3SBEA 4BMYA 4TLCA 2BFEA 4ESVA 4Z6KA 3DDZX 5HUQA 5G4KA 4RTPA 1EBFA 1TW2A 2MYNA 2G1AA 4HWKA 3B89A 2H06A 1MCZA 3JQDA 5EP3A 1WU8A 4S1VA 3WLRA 2NXWA 4ZCQA 3H3FA 4H6WA 5AJZA 4TTSA 5M5BA 2ZYDA 4BP3A 4FPXA 2BEJA 1OTXA 1O97D 4WE3A 2Q4TA 3X1KA 1N0VC 821PA 2GLTA 2VWPA 2WJIA 1NBEA 2D74A 2QAGB 4J16C 4TQUS 3KL2A 4D02A 4ND2A 1U2ZA 1XC7A 1KDOA 1IVNA 2W7TA 1YE5A 4CLDA 2J5XA 1WXEA 4TRMA 3CINA 3WRXA 5BR4A 3H2JA 4P36A 2J0VA 3MOIA 4B7UA 2WUDA 1GKYA 4DUPA 1FF9A 2XB2A 4GR5A 4HR7A 4JP2A 4W5JA 4MV3A 2Y0PA 4ND4A 3TTXA 4FU0A 4EF5A 3VA7A 2NXJA 4IQGA 3DSRA 3EMVA 3FSJX 1TK2A 4HB0A 4P08A 1GRCA 4L15A 1P3DA 4QPPA 5G4LA 3R76A 3VDMA 1GG5A 4GI3A 2P2YA 3WBKA 2I2BA 2FUCA 2GZRA 3P9RA 5AWFC 3A4IA 3EXAA 4B3BA 2YYAA 3VR5A 1XVVA 2QT9A 5LSAA 3PNOA 4BV9A 2FW1A 4D26A 3H11A 3EJWA 3ADBA 1D1PA 2IU6A 3BXZA 3F0TA 4G0MA 3ZDFA 4ZCMA 2QF7A 3K53A 3L77A 1QV6A 4CM4B 5IK2D 2R25B 1P44A 3NETA 3QNWA 2A1IA 5EWJB 5DXJA 1EXVA 1K4KA 3MK31 4FEGA 4HAWA 4KQ9A 5FDFA 3TX6A 2IHKA 1PGQA 4EUKA 4E2YA 3SFVA 1QIIA 3Q7PA 5BW5A 1NBMD 3RAPR 5ERXA 3WGKA 1TQ8A 1XZHA 4B47A 3EA4A 4EEXA 1EK5A 1USGA 5JCPA 3SQWA 3DYIA 3FNFA 3HYRA 4GM0A 1MEEA 2FPIB 3DS8A 1AVTA 2EX1A 3TZBA 4OJQA 4ZOBA 4BPRA 1ZJJA 4Z0HO 4P80A 4AW9A 3PJEA 3C16C 4P3KA 4GKJB 1P1FA 1YUNA 3KLPX 1KIAA 1NZFA 3X1ZA 1CDDA 5EJ8A 1Z37A 3KEMA 1KRHA 2C8KA 2RHMA 4HNTA 3T7TA 1B4DA 1ICIA 4DWJA 1JQAA 2NV6A 2I6SA 1YJBA 4P22A 4Z9FA 4OXRA 3HS3A 1RBYA 3AU9A 3ITNA 3O3CA 1JIUA 4Q9AA 3U1TA 4G1BA 1EJ6A 4C4PA 1Z0IA 1Z75A 1WP9A 4KAJA 5AIAA 4AO7A 2PZ8A 4ILEA 3UNXA 2XCTB 2PLNA 2ZJZA 3THXA 2BTOA 5AI0A 3TQQA 3EDQA 5JQGA 4HH3C 1DOAA 4XUCA 5EZYA 1X7XA 3QEMA 3ROTA 4AIIA 2IYQA 5AXDA 2FQXA 3GN1A 4J8PA 5TVKA 4WJLA 1P0PA 4JJ7A 1NIJA 2WMDA 3ND7A 1M0EA 3RRZA 3MWEB 1MJ5A 4L2IA 4YMLA 5EHXA 5C53B 3KOXA 1FW6A 3PNQA 1B8UA 4FS3A 4OHBA 4C88A 5K8CA 1BQ3A 4KYTA 3BBLA 4LJ9A 1QS0B 3SDZA 3UMSA 4OKNA 3RIYA 2B9EA 1WV0A 3PR3A 1VMIA 1XXHE 3SZMA 5FNVA 5E7QA 3UOWA 4YRAA 4IZHA 5JTUA 5DULA 3ZCPA 1IPEA 4MI9A 3RARA 2YQZA 4OPMA 2O3QA 1XG5A 3NP7A 1YRAA 2DX7A 3WA7A 4FYWA 3GPBA 2VHTA 2ZJBA 3LKVA 4NMXB 1MOZA 3ECSA 1I80A 1ODKA 2CYBA 4A8TA 4DB4A 1VL2A 5I9IA 1O6CA 3ROQA 1H3EA 3UMRA 4FGZA 4LHXA 4CIWA 2O8CA 1E1CA 3OHSX 2GHIA 3HCOA 4R81A 3V7WA 2FWAA 3KPUA 1E3SA 3PKIA 3UATA 4D45A 1SAYA 4LW8A 1K5PA 3R9WA 3UV3A 2XBMA 1WE2A 5FLYA 4H9GA 4LYJA 1Y1SA 1LRLA 2B21A 2PYDA 4HYYA 4WLEA 3KT6A 4GP6A 4NV1A 5FWXB 4BEWA 1JXAA 1VI5A 4Z3DA 1B6RA 3IDSA 1OGYA 4IDBA 2XWBF 2C8VA 5TGDA 5JDCA 2OZKA 3SF0A 2X6QA 1M2NA 2OVFA 3DZCA 3ZG6A 2I71A 3TL2A 1JU3A 3HCEA 3EUFA 1WHSB 2VUSA 5D7NA 2QVGA 3WDMA 4Q39A 5B30A 3BJRA 3KXDA 1GPMA 3CIOA 1V41E 2GWRA 4C0AC 4DG5A 5A9TA 1F5SA 3ZGVA 5B7GA 1NJ8A 3W34A 5K0CA 5TPWB 2W6QA 1ZZGA 3THWB 3GGCA 1C4OA 2F1KA 4IQ0A 1YI8A 4V0ME 1CTQA 2I8LA 3T0FA 1YIAA 3D4OA 2H9AA 1JTFA 4YT2A 2ESRA 4H35A 1ECFA 4HUTA 1FK8A 4GPIB 1Y8QB 3BYZA 3JY6A 4EWLA 3TFWA 3CO5A 4N48A 5I51A 4DV3B 4REQB 5ES4B 1Y42X 2A14A 1XRSB 2OBFA 4E2XA 5BQ3A 2JHGA 4P98A 4CEIB 1DZIA 1FY2A 5B7NA 4N65A 1XEXA 3SQNA 3KD2A 1O58A 2CNWD 3D3NA 3SZRA 5KNCD 1XZPA 3MIZA 3AIKA 1VE1A 2AZ4A 3PTZA 4UMFA 4RV4A 3C7AA 1Z6QA 1POWA 4DRXA 5CFRA 3FCYA 3GXBA 5BT9A 1WCIB 1XP5A 3EEIA 4ALMA 2CVZA 3OQ1A 5CD1A 4YYZA 1JKXA 1H5UA 2AKYA 3B1JA 3MRXA 4MRRA 3H7AA 2OFFA 4X1OA 1XRMA 3KQSA 4J43A 1ZAKA 3N2NA 1ONNA 1TO1E 3VC7A 1V16A 4V3BA 1CJVC 3UV6A 3UK0A 3FFWA 1ZOPA 1OX6A 4O4IB 3ZCXA 2QI9C 2RGBA 2YRXA 1V48A 3KAPA 2R6DA 1QVWA 2PSHA 3HRHA 4IGKA 4BAGA 4PGGA 1FP4A 4U2DA 2IWRA 3SBDA 3ZHCA 3U9SA 3W9YA 1LQ2A 5TS3A 1I01A 4BQSA 4YRJA 3S27A 3V97A 4AKTA 4EDFA 2BFFA 2H31A 4RVUA 3SKYA 4LTDA 3KJEA 4QAQA 2E6UX 3Q40A 5BNFA 3EFEA 1OXMA 1HDRA 1A9XB 3T0GA 2QROA 3LYLA 3U7QA 3AF5A 4XUDA 3C3AA 3D6AA 4DUYB 2QENA 2PN1A 1U02A 1UPCA 1V39A 1WWKA 2FZLA 3D0OA 3UMCA 1ZGCA 1HM5A 3IEMA 1CUWA 1Q7BA 1K5GA 2CUZA 5IU6A 2X76A 2DQSA 2FRDC 3BL8A 3GK3A 3MGKA 4QG7A 1Y5LA 4Y1RB 5IKEA 3CTPA 3GZNB 2G5CA 3L7BA 1GG8A 4Y6OA 4CN9A 4LDNA 3V00A 2VN8A 3EZXA 2ADFA 4KE6A 1XTIA 3QENA 3TLYA 1GLVA 3EUEA 2IL1A 2IKSA 3PL5A 1K27A 5IASA 4G26A 2DCMA 3GLSA 1VHLA 4BO4A 3C8ZA 4WY2A 1OFIA 3N76A 4D3YA 4Z1OA 2GCEA 2A6PA 4O4LB 4LXQA 1D1QA 1JT2A 4Q48A 2NO5A 1HYHA 2V9CA 4Y2YA 5F64A 4IW3B 5ITWA 1M54A 3V1NA 3TSWA 1QGOA 4IVPA 3B6KA 1YL7A 3KJQA 5HCIA 1OREA 2XNCA 1LQUA 2PGOA 4C7KA 1U8XX 5REQA 1ESNA 2VF2A 2QVBA 2VHWA 3AHGA 2W2KA 3LMKA 4OFZA 4LF8B 1G8PA 1U99A 3F71A 3SEFA 3U26A 5IDYA 1W29A 3PRHA 4L0QA 3ZV6A 3CB2A 5EZ6B 4U0JA 3AIIA 2X1VA 2CL0X 3HU2A 1F2UA 4L5IA 4TYNA 4K3VA 4OB8A 3ZWQA 3CLSC 3G68A 1E2EA 2FZVA 3M9LA 1MZVA 3FZQA 2GZAA 1G21E 3JQBC 5BUCA 2GH1A 5KREA 4ZV7A 4RY8A 5KU7A 2VPIA 3K9CA 1AHHA 1OV4A 2O3SA 3DBOB 4DLZA 1RM0A 4IRMA 2BFEB 1JZTA 2VC2B 3P8ZA 4J0DA 2FE1A 2I7TA 2QQGA 5G4KB 4XH9B 3KJNA 3FTNA 1R6VA 1TADA 3IMGA 4ALNA 1AK9A 1P9RA 3NPMA 1VPDA 3TH5A 3O9MA 3SJZA 3UAXA 4UTNA 4H3SA 1PZEA 1ZD4A 4JEMA 3OUZA 3Q9UA 2IYZA 3H42B 1FSFA 4J94A 1XO1A 5C46F 3UK7A 5DM1A 4PO9A 1Y6JA 2GCNA 5U4QA 4J0QA 4ER3A 3NDBB 1ZK4A 4JI5B 4BV8A 4B4WA 2IZ7A 5I7RA 2V4UA 2PMFA 3NH9A 3RK1A 3OE1A 1CZNA 1JG4A 3VOAA 4V2IA 1SUIA 3AQ4A 3DMTA 3RD5A 3FY4A 1A7UA 1YRWA 3BFVA 4U00A 1I7SB 1YRQA 2FPWA 3FTFA 2X4DA 1KE1A 3OURA 1WBJB 4RJJA 1WJGA 2BPOA 1GPBA 5ENDA 1EGQA 5TS2A 1OA1A 1IN6A 1GDTA 1G7RA 2ZBQA 2NADA 2UXDB 1E9BA 4UVGA 2NIPA 1QWSA 3IO3A 4LXYA 1T5HX 3H11B 1P7VA 4GR9A 4KI0A 2Z83A 4OHVA 4Q03A 4W8HA 5DEOA 4I36A 4YAWA 3ZHTA 1UZNA 3KVRA 4ZEWA 4AY2A 3IBTA 1MGPA 2X0EA 4MA0A 2D1FA 4FB5A 4ENSA 1TM4E 3N8DA 4N6GA 1RLOA 4GLJA 3R1IA 2I62A 4N03A 4CIAA 1J8QA 5ALKA 5IG2A 5FTLA 1PEYA 3DBIA 4PRZA 4FDLA 2P6RA 4Z8XA 4TWAA 3AHHA 4MV7A 2W98A 2RK6A 3ZI7A 3UTCA 1A69A 3LQFA 4BBZA 5K8VA 1TJNA 4UFNA 1YR3A 4JJKA 4C21A 1UBSB 1E2LA 4K6MA 1M8FA 2JDIA 3MB5A 1GNPA 5HXAA 3I4CA 3PD0A 1ZZEA 1LBEA 3KO8A 4FYXA 2AOVA 2VF5X 4KR0A 4YRQA 1X14A 4UXHA 3L0IB 4F4HA 1R64A 2GNOA 2OLEA 5CB4A 2FWNA 3T6KA 3ND9A 2I76A 2QJOA 3L3BA 4R1MA 4ZO9A 3WLHA 5J1SB 5ALWA 3VNAA 5A3QA 1DX4A 3LF2A 3OVMA 4RMIA 2AXNA 2CHQA 4WPGA 1WSAA 4IF6A 4R68A 2FK8A 3IC5A 4E2ZA 1EB8A 4HGQA 3VZCA 2O0HA 1YDEA 2HMAA 3DJYA 3BK2A 3U7EB 4CMBA 1QQ7A 3WADA 4CKCA 2FPGA 4N40A 1HEYA 3QJYA 1WMDA 4JQOA 4MCJA 3BZBA 4GXRA 3JTEA 3WGQA 3PHBE 4GZ3A 2RGUA 1CZOA 3THXB 5JQGB 3CCBA 5EZYB 1X7XB 3QEMB 4I4TF 4I3HA 4PYNA 3HWSA 3M3PA 4RIHA 5E7IA 3RUAA 5B6IA 5IF3A 3GP5A 5L45A 3ZBTA 1R0BA 1K9SA 1MZPA 1M6VA 3R8XA 4A6EA 2XQGA 1JQ3A 1GGVA 4L2IB 1FRFS 2OO5A 1YDFA 4Q7LA 5HKKA 1P2GA 2Z8XA 1HFEL 3RBXA 1U3WA 3SICE 4JODA 2QTCA 1UAGA 4Q02A 4RZSA 3H99A 4LXGA 3LG2A 4JP8A 5K3SA 4WESA 3JQAA 5KAPA 1GSAA 1KKLA 1VPVA 1A3CA 2CHVA 4M21A 1UJMA 1NT4A 3AF3A 5FNVB 4BRSA 1X1SA 3KHKA 4WCDA 1BGWA 1E2MA 3FTEA 5B4VA 1CVRA 4MAAA 3BB1A 2R6HA 3N75A 4MVJE 4Q3EA 4U5QA 5JNSA 2OHXA 5ALNA 3W6PA 3HG7A 1TLTA 1Y5IA 3H75A 4Y7DA 3QFRA 3JYPA 4YROA 2MU1A 2DAPA 4BNDA 1B41A 2O8CB 1E1CB 4E2FA 1ZJYA 3Q11A 5FEMA 3ZJ4A 5KBYA 2HHLA 2XTJA 1PEDA 4MUAA 5A04A 4YAOA 3C6MA 5KVVA 1PR2A 3HXTA 4FFMA 3C2QA 1WW3A 3CC8A 3LLCA 1JR2A 4OB6A 4W7HA 4MI6A 2XYHA 5F2KA 3ZGXA 1TYCA 2QLFA 1IQUA 3CURA 1RRGA 4XRRA 2Q8PA 1TE2A 4AU1A 3FPJA 1TM3E 1HG1A 1Y5RA 4UHJA 4XYBA 3T7KA 1LK7A 4GP7A 4IIBA 1ELOA 1LBIA 2O50A 3TWOA 5JSZA 1ULSA 4LBVA 4X60A 2CXXA 3WLOA 4TXNA 2GAOA 5YASA 1WETA 5K45A 2XGJA 4OGKA 3CEAA 2WAYA 1F12A 2AD1A 4M0LA 1K6XA 1LDMA 3ECCA 3Q5GA 3Q72A 4W9NA 4O29A 4DRYA 5KEIA 3ER9A 4RGQA 1VOTA 3G2MA 1UIMA 2XAUA 3KL4A 2VZ9A 9ABPA 4C0XA 2K7FA 3COJA 3PX7A 2VTVA 3H2ZA 1DO8A 2D3WA 2IU3A 2VF8A 5EZ5A 2MT9A 4HQLA 2IXEA 1JIJA 4J0HA 2D1SA 3RBVA 4XAQA 1DAMA 2WY2D 3I9MA 4OU4A 2JIRA 3AW8A 1XEXB 5A05A 4ZV9A 2PUCA 5AK0A 1NC3A 4B34A 2JLAA 1X7YA 1F5NA 3VU1A 5C5CA 2Z6AA 1R0WA 5KSZA 1XPUA 4DRXB 5DFAA 3PQFA 2NTNA 2B4AA 1N3IA 2R5FA 4FK8A 4JQSA 4I3FA 3MMSA 2FW6A 3ITEA 5KJ1A 1H0RA 4UTOA 2QRVA 1BWSA 3I30X 2CLSA 4EG5A 1SU7A 1V16B 4QXRA 1Z0SA 1KP3A 2ZI6A 2YZNA 3Q9LA 3F6YA 1L7MA 4FUQA 4HWRA 4MYSA 4OLHA 5BQOA 1R15A 5AJXA 3UG6A 1M1NA 1YBHA 2LKCA 2GF0A 3NEJA 3S55A 1IRXA 2WQ6A 1E7SA 1FP4B 3BCSA 3GFBA 3U4AA 3BTUA 4Z4EA 4PTYA 5AUQA 3WK5A 4PG8A 2BFFB 1NIPA 5HBRA 5HM8A 1HY3A 3NYWA 4M88A 4WLNA 2OYCA 2FUKA 1IHPA 3K9NA 4OOFA 1MTOA 3A4LA 2QMQA 2UYGA 3NBFA 4FX5A 3U7QB 2IA5A 1QKIA 2FW7A 5K8UA 3MVEA 4JJGA 1GFWA 3P0EA 4HWOA 1WSBA 3CVJA 2G72A 3UCXA 3HUEA 4ZZ2A 4QG3A 3T9DA 2H51A 2AQHA 3N0WA 1FX0A 1LCIA 1SVIA 3R44A 3VC1A 3VI3B 1XN4A 4CFYA 3AR7A 3B70A 4H1WA 3BAZA 3MBKA 4IIYA 1IK4A 2QGFA 1QB7A 4KVZA 2P4QA 4GBJA 1OFUX 3PIDA 5HE8A 3SKXA 1K63A 3KUUA 2JBHA 4TLAA 3A3NA 1IJFA 3RC3A 4KWEA 3ZH9B 3L07A 5T8KC 3NNNA 2H1SA 1ODTC 2P4EA 4Q9JA 2FWIA 4BGIA 4OF4A 4RS3A 3PEUA 4D4HA 3E7XA 1UANA 1JEJA 4EJSA 2DUMA 3TTSA 3FZNA 5BSFA 1KYVA 3SS8A 1SBZA 2JH3A 1N9KA 3IVCA 121PA 2PFSA 1AM4D 1Z4MA 2MYTA 3C1TA 5K3CA 2Q5HA 2E2WA 3L1IA 5MDHA 4FBMA 5REQB 3MFQA 3QPUA 2W2KB 3ZS9A 1P0QA 1ZAYA 1T8YA 3QEAZ 1HBJA 1O0SA 1WKVA 3CG0A 3F8WA 4ID3A 1MAWA 3KPVA 1VHDA 2WFLA 5AW8A 1O94A 1XFDA 1E64A 1DAOA 1PS9A 1U3DA 4NBNA 1F2UB 4WOPA 4X6YA 1C9DB 3V8BA 4ENWA 5J5CA 3OF3A 2JGKA 3H0CA 5TXGA 1GKUB 1XJWA 4N9WA 2HYDA 2A30A 1QFMA 2PRJA 3K0AA 4NCNA 5CUQA 5HMLA 2VKQA 4XIGS 3WRWA 1JSRA 1WPGA 5ALTA 3Q88A 4ZEOA 2YN2A 2Y1DA 4H15A 4Q1CA 4U6QA 1OX5A 3ZTYA 1SZJG 4MQEA 5JO9A 2WA1A 3AI1A 3L0BA 3PR1A 4IFBA 4JIGA 2B25A 4OD0A 4OQFA 4GWGA 5TB5A 4B2YA 1BQ4A 2CLMB 5ER6A 2VAWA 3IUNA 3VNRA 3DE6X 3MLBA 2OV6A 2Q3HA 3B1KA 4DDKA 2B37A 3TEFA 2PX5A 1V8BA 1ADJA 3B7GA 5LYYA 3LRTA 2FOIA 4JLDA 1XTUA 1S01A 1AHNA 2P90A 3S2FA 2ZANA 4GOMD 1AQUA 4M8IA 1YZLA 4R1UA 1W4LA 3K20A 1CR6A 4UBOA 5EIXA 3MT0A 4IIVA 2DBRA 2H7CA 4QOEA 1SEVA 3KQUA 1Y8CA 3S1SA 5KX5A 2CLDX 3CLUC 3CLVA 1Z5WA 2QTLA 1PTJC 3QWHA 5DGHA 1E20A 4AIRA 5IVHA 3ML1A 4M0EA 2R00A 4P92A 1IBRA 4U0KA 2R6R1 4WAUA 5DXFA 3IQIX 2GAFA 4MAFA 1NVVR 4Z2AA 1OX4A 1QK3A 3QPVA 4DV2B 4WD3A 2GEBA 1QR2A 1H4SA 2D13A 1QO9A 4ZV4A 2PZKA 3RFFA 1CZUA 2WFAA 4YB8A 5M29A 1V7ZA 4M7WA 4CF7A 8ATCA 3IR5A 1YZ3A 1X2BA 1MXFA 4NOKA 1KAHA 1YBVA 4OYRA 4JLWA 3L9WA 1YFKA 2AG1A 3HKEB 3R0ZA 3TNYA 2XD4A 3EWAA 4B4KA 4RL4A 2H0RA 4XGRA 3EARA 1VI6A 1E89A 4CVNA 4YRNA 1B2RA 1QGUA 4PEVA 4CNQA 1ULHA 4ESHA 1UBEA 5J2TA 1XEWY 4LZOA 2AR9A 4XASA 2W2QA 4O0MA 4BX9A 2B94A 4MB0A 1XQ1A 1LTHR 2QR2A 2ID7A 1L1QA 4BJHB 2B4TO 1EE1A 4C6HA 3OJEA 4XJSA 1UL1X 2HRZA 3IEUA 3IUJA 4CEJA 2YS6A 1MJNA 1QHGA 3OQMA 3ENKA 2EEPA 4HATA 1MB3A 1NT2A 2HQBA 5CB4B 3EC1A 5IBRA 4KFUA 3ZI0A 5C8XA 1NX9A 1ZRSA 3U0BA 4TWIA 2AMYA 2ODQA 1NNI1 4HKTA 2CBXA 3F8SA 2BKXA 5CYOA 5GV7A 3AWIA 3VYVA 4EM6A 1I5RA 2EGGA 2PUVA 3QUQA 3GARA 4JVMA 1LI4A 3PT9A 1KE2A 1YACA 5A2GA 1IHYA 1DKPA 2GGSA 2Q46A 3KTAA 4BLVA 1FYXA 4DIMA 4CKCB 3A3OA 4KOEC 4AJ9A 2D1TA 3U4QA 4B3SB 4MVXA 3MBOA 1TEVA 2HKIA 2WPNA 5DXAA 5EJMA 4BBJA 1XVLA 2Y4OA 2PD6A 1R74A 1FS6A 4RZXA 3R7LA 4MDYA 1GZ7A 3PNYA 4PHTA 4BB6A 2VTEA 1E9EA 1JAIA 3V8NA 3RTCA 1B8PA 2DJ5A 1XK7A 4IG9A 1M6VB 5K2OA 1BJRE 3JSXA 3G0OA 5DLDA 3BT7A 3PQ3A 4YRFA 4LVNA 3L0CA 3VHQA 2HT1A 2EV9A 1A9ZA 4LGCA 4EKDA 2VUIB 4DA4A 1ACMA 1NUHA 1C3XA 2XSZA 3A2NA 2H1LA 4QASA 2NV2B 4WESB 3DL4A 3JQAB 1ZP6A 2PM8A 1CCWA 2ZIGA 3I1FA 4KGZA 4LRQA 3EQZA 2PUAA 2M6KA 2G9QA 1PG2A 2BLLA 4QBTA 3WGUA 2JATA 3C5EA 2H1CA 2AN5A 5I9BA 3U80A 1V8ZA 4JD5A 4PM4A 3SS7X 3RJZA 1YR6A 5CPBA 3CVXA 4HBZA 3I58A 1DSSG 1U1CA 1U28A 3WLMA 2Q9BA 1TZKA 1AURA 1P1JA 4IV0A 5A3VA 4C1NA 4ZWNA 5JD4A 2O1XA 3EIHA 4RDCA 1F20A 3OZRA 4BNDB 1WMBA 4O2BF 3UGKA 5IDXA 5JS1A 4JZYA 2CLCX 2OB1A 1G20A 4WIAA 2MSWA 3QG5A 3NASA 1JKJA 2QLJA 3C70A 4IMPA 5I48A 3T1YB 1NNEA 3ZWNA 5EJ5A 1BROA 2GCIA 2QLNA 2OP0A 2GBFA 1XTBA 1JW9B 2ZR9A 4MP6A 2OL4A 2RCYA 3KJHA 2ONYA 3K1YA 4PV7A 2XCQA 3ROMA 1IZYA 3UTDA 4D44A 2XITA 3ZXSA 3NANA 2IH5A 3BD7A 4G1MB 4D8WA 2FHPA 3EPKA 1KFKB 2WG1A 3DT6A 4LC1A 2JLYA 4F8JA 3O26A 5JSZB 4U02A 4GPBA 2BF7A 1VP9A 2BHLA 4YQZA 3Q8MA 1UP4A 5HFAA 3M4ZA 3ZHYA 1JXOA 1IHUA 3E9NA 4C04A 2GEVA 2C3YA 1A5AB 3OFNA 3GAFA 4B79A 4WY5A 1AT1A 3QU5A 4HPJB 3ID6C 4QUDA 2J6HA 2HHAA 4L4ZA 2Y1GA 5LB2A 1VFPA 3MGBA 2IOFA 4KBGA 3DZJA 1USUA 4WFJA 3KZ1E 4HN4B 1SXJD 2JVKA 3L0PA 5G1NA 3V8PA 2Y1XA 4AROA 2ZDHA 1J2JA 3H1BA 4PSKA 2BAGA 4MWTA 4DIDA 1P2VA 1T6ZA 3SLGA 3DHNA 1JDZA 4RSRA 3ZWCA 3WFJA 3VI4B 2PXXA 3GCWA 1JJFA 3AR5A 3NTRA 2QRHA 4C4XA 5ARBA 1X7YB 1IEXA 4QVKA 4AJJA 3TK1A 3HB0A 1QOZA 3O4FA 3GD7A 2DXIA 1J25A 2J1LA 4CW7A 2NNLD 3BRWA 4AJKA 3WGJA 1Y37A 1MVOA 3KJIA 2PR2A 1G41A 1M6EX 3LC0A 4HQKA 5H68A 3RHZA 3A6DA 4D1YA 1Q1NA 1C0KA 1K6IA 1RWXA 3LE8A 5ADVA 2QRVB 3FKQA 3L8ZA 2Z3ZA 1YASA 3LGXA 1LSSA 3KVYA 5E9QA 4AZ0A 1KQNA 4H7KA 4V24A 1HT0A 5BPFA 4GLFA 4AG3A 1T9AA 1NAHA 4GSKA 4Q1EA 2V8OA 4AJ4A 1M1NB 5LPNA 1LSOA 3A1TA 4G8DA 4BC0A 1AV7A 2BEKA 2E85A 5EN4A 3ND6A 1RKBA 5IVIA 4BFYA 3H86A 4DR2B 2C77A 1N7HA 3DAFA 5IWCA 5C4IA 2H07A 3AV3A 4XD7A 4ES6A 1KWGA 3G59A 4RD1A 3K5IA 1EZZA 4MWBA 5U4XA 4B5LA 4LY6A 5EPEA 1E0JA 3BMNA 2PGAA 4K6GA 4EY5A 4ZOLF 5MFPA 2XE8A 3JQEA 3RUPA 5LIPA 3IL2A 1FX0B 1ISIA 2PHZA 3U4GA 1T3LA 1F2TA 1T3HA 1PL0A 3OCZA 3QU4A 4JEHA 2FMFA 3D7LA 3K30A 4MULA 2HBQA 4IY1A 2G8NA 3QVOA 2B7CA 5D01A 3ZDZB 5I4CA 5LP6A 3N6RA 3GF4A 2AZTA 5HQJA 4JT4A 1RS0A 2QHXA 2C4VA 2FUNB 2G17A 4HX9A 3ETNA 3WWEA 4OL9A 1KDTA 3G9ZA 3LX8A 4EKIA 1SQ6A 1BNCA 5GJBA 1HKUA 4B6FA 1S2DA 1Y81A 3QBTA 3Q3EA 3KQTA 5EJEA 2MINA 3LFTA 4EJSB 1WQ3A 2YZGA 3I12A 1JFFA 3OLXA 4HX5A 2VEOA 3SOPA 2OESA 1KHHA 4GM4A 4HGPA 1A7AA 3BXFA 3HY4A 4RU1A 2N3ZA 3NC0C 3AFMA 4DEXA 2WDZA 4DTIA 1ATZA 1PX2A 2QRLA 4X91A 1S8OA 2HJVA 4NCBA 2NYVA 4GI5A 3QVJA 2OPHA 2H2HA 3WTBA 5AW4A 4FS8A 4HP8A 5JR3A 4PGHA 1MAVA 1GTG1 4NPAA 2ZKLA 3RC8A 1IMJA 4JI3B 1E6CA 2FW8A 1WPXA 2WFLB 3ONEA 5HK8A 1EAMA 5KOIA 1TTTA 4X7RA 3IODA 1TX4B 2WJPA 2RAFA 5M04A 3E22A 1QNLA 3E15A 3STHA 4MVYA 4XE5A 4QAJA 4C01A 2I3BA 4NKRA 5AJVB 3VYRB 3EWNA 3ZGLA 2OD7A 4PAGA 2DEUA 1O5TA 3K0AB 3AB3A 2H57A 2FF7A 3WRXC 4EFNA 4KQJA 4WNIA 1RQLA 2ZYHA 2OA0A 1IIRA 3UKJA 2QM0A 2FF5A 1H2RS 3L46A 3DHVA 4JP3A 2AI2A 1X7ZA 3EZLA 1B3RA 3GP8A 3G5TA 4HQRA 1AK2A 2FPPA 4MQEB 2JHFA 3B2NA 4BNNA 1WUHS 1F1BA 5DBHX 1Z6XA 3PXXA 4QJBA 1QTNA 2NT3A 4BVFA 3D0KA 3IIMA 2RE8A 2NP6A 3R6GA 3OLCX 1R00A 3TCNA 5CLIA 4P35A 1SXIA 2EKDA 4HJRA 5EHGA 2DWCA 3O95A 4FI3F 2IX3A 4M37A 4O4HB 3E81A 2QZ4A 5AMXA 1DQSA 1GNSA 2UZ3A 1DLIA 3ANMA 3G9QA 3HZZA 3VHLB 5EMHA 5K0FA 2J4DA 3UOGA 1GGMA 4NICA 2ROQA 4OREX 4R2LA 1W30A 2Q29A 1R4AA 2ZRKA 4G4SP 3QEKA 4Y0NA 1NJFA 5KX5B 1J23A 1QTQA 2FEXA 2ZTUA 1VECA 3OJLA 5SZIA 2IE0A 1KS9A 2SECE 4C05A 5ANRB 1J99A 1PZMA 1TPZA 4RK0A 4PO8A 4ESOA 3QV1A 4ETWA 4EUNA 4F56A 1OX4B 5BQPA 4G5XA 4M22A 2I6GA 3PWKA 4LCJA 3LUAA 1NUPA 1NI4A 1UBOS 5IPFA 3N8GA 1FVFA 2VT7A 3AFOA 2C4KA 1R9NA 2ZB2A 1U1FA 1H1DA 3EA5A 2M9MA 3GXOA 4FEEA 4KQXA 4CT0A 3BXGA 2F67A 3WLSA 2E4AA 1NOJA 3GJTA 3MSCA 1Q0QA 5BQ5A 4I1PA 2P2LA 3MJ4A 2XAAA 4K9MA 4X54A 2CDCA 2PGIA 2ZTLA 1QGUB 2OAGA 2YCBA 2ZI3A 4UOEA 2ZB3A 2AFIA 2UYOA 5I5GA 2N47A 5J2TB 4QSMA 1SBTA 1XZFA 2Z9CA 5JWRA 4EFKA 1D4OA 2A86A 3AO0B 4UW9A 3OOSA 4JAVC 2J3HA 2V59A 3HLKA 2P8JA 3AI3A 4ZARA 4K03A 1WUJS 1EPUA 2PH1A 2WA2A 3EXIA 3M2TA 3WSWA 5KYKA 1QO0D 1XTTA 2JLQA 4CEJB 1XSEA 5J4YA 3A58B 2O2YA 2GZ2A 3CU5A 4N47A 4EHJA 4F86A 1PR1A 1A1SA 2XE6A 1JI0A 2VJNA 1BG6A 4PFSA 2WSMA 3TDMA 2HIHA 4CTOA 1HDCA 4GZ5A 1OASA 2DTEA 4QFDA 1JDSA 3N7AA 3F4KA 4B9AA 3IEXA 1NMSA 1EBBA 1RDFA 1X38A 4Q4LA 1FYDA 2VDNB 4IKOA 1I4DD 1J24A 4OHYA 3TXXA 3G17A 1Y80A 3IURA 3KTAB 1ISSA 3PITA 3AM4A 4XWWA 2QPTA 4GG1A 3EDMA 3IOBA 1OBOA 2WBLC 3U4QB 3MS7A 3PS9A 1JDVA 5DRYA 5BW6B 4TL9A 3EXFA 1N6RA 4UDYX 4FJ0A 3GL9A 1ST3A 5AM2A 5B3LA 4UZFA 2HUPA 2BGLA 5KVAA 1NKVA 2ZJ8A 4B84A 2NTJA 2CNNA 3T5CA 4XQ9A 4EECA 2ZZNA 3K35A 3CZ4A 4NEQA 4G6ZA 3F4BA 4GPZA 5E9JA 1UBTS 1BJKA 1OV6A 3E23A 1YI1A 3O74A 5KOYA 1TQ2A 1NTRA 5TNXA 4F21A 1DIRA 1ZVKA 1GCGA 4I9UA 1JIXA 2A4KA 3OCWA 3FMGA 3ANXA 4PWZA 4H4CA 1GPDG 4IM7A 5JADA 1W6UA 1KC1A 2UZ4A 3O94A 1XQVA 2EX4A 4X3OA 5DBFA 4YXFA 2ZE5A 1NJ6A 3TPFA 2N75A 2Q2VA 2C5SA 3DL7A 4PC2A 4R84A 3SJAA 4ND7A 5EIHA 1GUZA 4BGVA 4QFCA 1Z62A 1PP4A 3KSDO 4ZVTA 4ABYA 1QE0A 2DF8A 2E5LB 3SVLA 3COVA 1UK7A 5BSVA 1DPFA 1RI3A 2R60A 1G20B 5BSKA 1Y3FE 1WEKA 2IHJA 3QITA 1C7ZA 1D04A 1JKJB 5AKLA 5JDIA 5LQUA 4QM7A 2I2XB 4ALLA 4BIIA 2WU3A 1EUCA 4WA8A 5KCMA 3ZPXA 5BWNA 2V97A 4K9SA 5DYGA 3UENA 5IYZF 2HF2A 5FTMA 4I7EA 1BRMA 3MNFA 2H1OA 1BZYA 2J9YB 5BNZA 5J58A 2VBCA 1GYRA 2YMMA 4W1PA 4Z7QB 1B0UA 4BV2A 3T9EA 2ZU0C 3ZNPA 1V5WA 1OU4A 2DT5A 3GJSA 4GOKA 2QUBA 4DNPA 4UAJA 4E7PA 1TIKA 4WY8A 3QWFA 4GMFA 3BSWA 3KSZO 4CR6A 1E4EA 4XR4A 4AY6A 4OQPA 5CLFA 4V0KA 2LXNA 1JDNA 3CB4A 3OJCA 4E1AA 5KWEA 5H80A 3F98A 1SD2A 4EA7A 4ER5A 2BBOA 4MUGA 1PG0A 3RUDA 3OMWA 1E1KA 2QRUA 3WYEA 5BW4A 2C2OA 1H4VB 3SC6A 1ZD2P 1X3LA 3G6KA 3QMPA 3VVLA 4DY4A 4LOHA 3KVVA 5KDOA 1ZH4A 3H65A 3QXSA 4PLPA 4LZWA 5I7HA 2PZFA 3LKBA 3A7DA 4H3VA 5ENVA 3N0VA 1AA9A 5GONF 4QJ3A 1M2GA 3F97A 3HVIA 1BN7A 3COSA 3KKLA 4F3KA 4W9MC 3B5IA 5AD1A 1KGDA 4XQEA 2CXPA 2XADA 2G09A 3I37X 5A02A 1GAQA 3DM5A 4RTKA 3G0BA 1OXVA 3H5NA 5C35A 4XIFA 2HJWA 1S2OA 2P0EA 1LGYA 1KI3A 3PKJA 4U8HA 4AZ0B 1O6FA 1JV2B 2WZBA 4RGYA 2ZIZA 3FMIA 3TO5A 2X6RA 2AZMA 1CP3A 2ZJ3A 4GI1A 1H8HA 3AVVA 1DWQA 1KQPA 1TGYA 2F43A 2G7MC 5JI2E 4DV1B 1AK1A 4HLUC 2R62A 4EKYA 3V1UA 4QOGA 2WF6A 3BH0A 5K0BA 4W8OA 2WTMA 4B7CA 1GOTA 4WKGA 1E0DA 4HDKA 2HMYB 1HNZB 1KH3A 2H7VA 3OTGA 4ISCA 3RVKA 3WHIA 4DBZA 3AFHA 3VBEA 4JN6B 3HEAA 5DKFA 1K7SN 2O0MA 1BDJA 2I91A 1CX9B 1U0GA 2C82A 2V96A 2WAAA 2GD6A 1BHO1 3BMNB 4KG7A 4UPDA 3RRJA 1OIXA 4BVGA 3BF7A 5JAZA 2XNSA 1UOOA 4JBXA 2HRBA 3OIUA 1DG3A 3HP7A 4AQYB 1F2TB 5AI5A 2A0FA 4LOJA 3RKSA 4XSGA 3D0RA 1PEKE 3D2CA 1SHZA 4L8GA 2Y05A 1R66A 5LP6B 4FMCF 4M54A 5K1ZA 1EGMB 2WOJA 1FVHA 1WD7A 4RD0A 2FDCA 3AZPA 3L5KA 4E08A 5LXTA 2WZDA 2R65A 4MQMA 4Z7NB 2WSSA 1R0SA 4X7MA 4TSFA 1QANA 4NG5A 4EMUA 4DANA 2MINB 3TOZA 3GFTA 1I6MA 4Y0AA 5FCDA 1TZJA 2Q1TA 4EB8A 1JFFB 4X71A 3SQXA 3ADDA 3ZJYA 1BCRA 1WUYA 4ZDJA 1M73E 2M1XA 2GF9A 1G7CA 4MV9A 4IFTA 1Q0PA 4NONA 4MPJA 5CYGA 5F78A 3CH4B 3HSSA 5CFLA 3W2IA 1A9RA 2PSJA 2ZRHA 4FE3A 3VKUA 2G1UA 1RJ9B 4FOOA 4LS3A 5JJIA 4I5EA 2QX7A 3JZIA 2RG1A 3HXLA 3N2EA 4M1EA 1KQGA 1P5ZB 2ZVPX 3I39X 3LHDA 4KDEA 1QCCA 5G0UA 1PJQA 4CL3A 3EGDA 2A57A 2WTAA 3UANA 5KU1A 4ESEA 2IUFA 3F6EX 5HIJA 5BN1A 4LJRA 1W581 1VKZA 4DLRA 5KHOC 3J81A 1YJ8A 2B8EA 3KKPA 3NIGB 5FPHA 3FPEA 3UA4A 2B4RO 3Q4GA 4IUYA 3ZHZA 4BLTA 1R8QA 3DMTC 1X7ZB 4ZAYA 1VBKA 2FPPB 1OYVA 2RC5A 1RAEA 4RVDA 2XRFA 5JRZA 1CUUA 2FMKA 1X3SA 1LJLA 3MCUA 3D1VA 2CXTA 3EXHA 2ZYIA 1EVEA 3GDWA 3NTOA 4QNRA 3IT2A 4PCAA 5DCYA 8OHMA 5ALIA 1NMEA 4GO1A 3DKVA 2PYZA 1POXA 1V1JA 4NBLA 4CQMA 1H94A 5T64A 1VGRA 4EPTA 2JEZA 4QODA 4F92B 4EYQA 1B2LA 3TI9A 3S7TA 4ZFNA 4NH4A 1K7YA 2AN9A 4GE3A 2XB6A 4JEUA 4M0FA 3LYUA 4NBVA 4AFNA 3P52A 3QXHA 4I2NA 4TKVA 1SUBA 1OH7A 1DE0A 3G2NA 1TJ5A 2XA9A 5NULA 2PUGA 3P9QA 2FLVA 1D2EA 3EPRA 4JJAA 1ZRMA 3BWVA 3R5SA 4HWPA 4NPCA 4WACA 4ZVSA 3UC9A 3X1YA 4ANFA 4MITA 2YV3A 4CDNA 4Y2SA 4BTLA 1ABBA 1RJEA 3ZHUA 2PNFA 3WIOA 4EYGA 1LPNA 1RRMA 1XYYA 2PH7A 2ZRQA 1I4LD 1A8IA 4DUZB 5HIKA 2VF7A 2XV1A 3TPCA 3DD5A 5JAMA 1CUHA 2ZRPA 5IFLA 3TGPA 5D3MA 4ZVKA 1NI4B 1NR5A 4MYCA 3BICA 2SICE 3SK0A 2D06A 1OZAA 4MUXA 2GTPA 4F06A 1XTZA 1V7PC 4N7JA 3AJAA 3RTAA 3UT5A 2QV7A 4C0JA 3RADC 4R9VA 4QUEA 3VO8A 1MXHA 5A2QA 1FMJA 2LPMA 1SBQA 5G3YA 2XZOA 1EFUA 1QQAA 2AFIB 5K0EA 1WKCA 2K2WA 4X24A 1GG2A 2R1UA 1DAIA 2VHUA 4R2HA 5FL7A 2JLXA 2F8MA 5DHTA 3KJFA 1YL6A 3GMSA 3P2IA 4B3FX 1PAUA 2DBQA 5EHZA 4GC5A 1GA6A 4I8IA 1B0PA 2V7PA 4QYXA 3SVZA 1N5LA 3IVGA 2JKYA 3EXIB 2QS9A 4FHCA 3K05A 3R77A 5H8WA 4ARCA 3JWJA 2IIVA 4ZYLA 3AL3A 3R3HA 2CWDA 2BFPA 2CF6A 3AQIA 3U19A 4EUHA 5IHPA 4F2PA 1DEHA 3JAMA 1RWWA 1SXGA 2HZBA 3DAPA 3SWWA 1SIOA 1Z0AA 4XB6B 3CR7A 3TLAA 1QPGA 4U7PB 3WNQA 2OO5C 1AKUA 4GRDA 2QM3A 1PL8A 1WR8A 4HZIA 4YK7A 3SX4A 1K6MA 1Y3HA 1LEHA 4DY6A 2C03A 1NULA 1P45A 1D2GA 2J5QA 4OYLA 2GJ4A 1MN6A 3UJ8A 3JR3A 4JI7B 4Q9LA 2VLIA 2OE2A 2FVYA 2JK1A 3MWJA 1UWCA 4EF6A 4TMWA 2JKVA 4RELA 1E9DA 2EC5A 1AN9A 1YONA 2W90A 3EXFB 3G0DA 4J7CA 4NSNA 4NX2A 5EJGA 3TNJA 4C1BA 2GZHA 3WMEA 4F11A 4HFNA 5C5EA 4ZVUA 5IKMA 4KNWA 2OV1A 3ROPA 4M9UA 5HKAA 1PFWA 1QKJA 3VVMA 5L3VA 3CH5A 2RGAA 4H2DA 4M7RA 4X9XA 1NG1A 4CV0A 3GJ7A 2JFWA 4H3KB 3U3ZA 4K6HA 6CHYA 4ZT5A 3ZQ4A 1BKDR 4RIIA 3U5TA 5IBPA 2NUPA 3EAQA 1EK1A 4C3UA 3KOWA 1T2FA 3A1CA 1E7QA 1NG9A 3PPVA 3V4SA 2CCGA 5SZJA 4Y9SA 2IWHA 2IXAA 3IDOA 3FCEA 4YI3A 1DBIA 2A1UA 3WLTA 2RBEA 4DIOA 1QIHA 4A15A 3CN9A 2GN2A 4UUPA 2QN3A 3VXKA 1WUIS 5ALOA 3ILVA 1GR1A 3RIGA 4XD2A 4UU1A 3W9UA 4ZI7A 3P9YA 3DR5A 1EMDA 4OFWA 4JOSA 2WFMA 2FE4A 1BU8A 1MH1A 1SO8A 2OV4A 3EBPA 3MUEA 3ZY6A 1FDUA 5DYNA 2ZSJA 3U1BA 2DBYA 2DQKA 3ETGA 4GOJA 3EGWA 1AHIA 1PVVA 2IF2A 3NQ41 4JKOA 5CTJA 1V6SA 2VHEA 4JGGA 1QRDA 1MC4A 1G3IA 2I67A 2XVAA 4NHEA 2G08A 2V4ZA 1XRLA 1J90A 1U2TA 2YIDA 3O9VA 4FHZA 5CH3A 3WI7A 5FQNA 1EUCB 4IICA 3X1JA 2JA1A 5EESA 2XMQA 1HFJA 1RTKA 4I2VA 2UAGA 3KUXA 4C7BA 3KZKA 1QPBA 2HO5A 3BK1A 2F3RA 2WJHA 4BYGA 2EP8A 3WTCA 1IJKA 1GIAA 3PGXA 4M8LA 1YJAA 1ODSA 1ZWLA 3M6LA 3UCEA 2WZCA 1NUSA 2QTMA 1GAEO 2BDEA 3HEBA 4IH9A 3WWCA 4CDGA 4WQMA 4DLLA 4Z4GA 4MTLA 2GK6A 4YUZA 3QPWA 1VJRA 2EYQA 2GQ0A 3V1LA 4UC0A 1G42A 2X0JA 1E4EB 4YHBA 3FLMA 2FSIA 5C8YA 5LBIA 2UDPA 2ZTSA 2BMWA 4UUMA 4CUJA 5K3EA 1V4NA 4X20A 3NJ8A 3WYAA 5A4IS 2A94A 4TKMA 4DA9A 1KEKA 3CWCA 4IWNA 3NWEA 5B6JA 1EU1A 2JK0A 1IFXA 1MAAA 1JPNA 1UBJS 4NU5A 4QGGA 1PJ4A 3WL5A 4BQRA 3I6IA 5IWAB 2GK3A 4GD3Q 1T2NA 4J7UA 1PZHA 3ZE6A 3IEVA 3O6VA 1J7KA 1Y4SA 4BKRA 3H9EO 3HI4A 2NUTA 3MMZA 1G5RA 4BX8A 2ZUSA 4ENVA 4UU0A 1O2DA 1H23A 2J45A 4XVUA 3SD7A 4N5NA 4RVCA 4F9TA 1QIKA 2XTMA 4C6TA 5GM2A 3FYHA 4TXJA 1YQDA 4XX0A 4LRWA 1R0LA 2D4AA 9LDTA 3Q2KA 3QELA 1KEUA 4GT1A 1F9EA 3UK2A 1VJ5A 4D96A 3RK0A 1EXMA 4AD8A 4WK4B 4BWYA 1UXJA 3A37A 5CCBA 1U8CB 2RAPA 5FI5A 4FP9A 3VJLA 2R44A 2BKVA 2EZ8A 1FXWA 1DCMA 2L0XA 2PSEA 3LV8A 4FDAA 1ACJA 3JD1A 3F6CA 4X92A 1BA2A 5EY5B 3IAS1 5H3LA 4UZEA 1AKNA 4TLEA 4YN3A 3L7MA 5IXSA 2IIPA 2AF3C 1H5QA 4NCKA 5IKPA 1YHYA 3HVHA 1TT7A 2B9VA 2BONA 4UUOA 2PV7A 1ZITA 3CZMA 3I92A 1PJZA 1Y7LA 1YS1X 2IYFA 4U8GA 2JD2A 4HDKB 2JAUA 3MW8A 1Q0SA 4L3OA 1PW5A 1C3EA 2OO7A 4KSBA 4EMSA 5AVXA 4FEYA 3VNVA 3STVA 3QE0A 4FFLA 3BHMA 4EJSC 3EGOA 1RYMA 2P91A 3ADCA 3ASYA 5K3OA 3JQ8A 5LIRA 1ML3A 2X8WA 5JNVA 5LLSA 3PJDA 2IBMA 4FWTA 2JEYA 3P2MA 3CZQA 1OBFO 3QPBA 2X9GA 4KH1A 4BE4A 4KIFA 3U44A 1ZCJA 1ST2A 1X7HA 3I6ZA 3OFKA 4MVWA 5FTKA 5JI3E 2JFFA 4IXTA 3I5YA 1E3EA 4MEBA 3LBAA 1MDBA 1M1XB 3GRAA 5IKXA 4MMZB 3SZ3A 5LXTB 4BFWA 2K87A 4ZI5A 3D8TA 4QARA 1ORTA 4AN1A 1GNLA 4Q3BA 2CL6X 2VXBA 3C43A 3RFXA 5HZGA 1QVZA 4QEZA 2P7HA 2VHQA 2AEFA 3BUSA 3SDSA 2C1XA 2DLCX 1DQPA 3QYPA 3UMMA 1BCRB 2I2DA 1TLLA 2IXGA 3AKZA 3KUKA 3A06A 3HL4A 1DFHA 2JLCA 5AI8A 2VYVA 4MS4A 3WMFA 5BURA 5KNLA 1Z7WA 2DUNA 2X14A 1RNLA 3IPRA 3R20A 4AM8A 3A8TA 2WB2A 3LM8A 2YJTD 1WZNA 4QLOA 3EPJA 5TQ2A 3VH1A 2ZAYA 3EDOA 1U0RA 4HADA 3EGDB 2B99A 2WV9A 1QGDA 2ZSFA 4QYMA 1UKCA 1RAFA 1I7LA 2FU5C 1LBHA 2E4XA 3ZHOA 3ESZA 4BFCA 1SB9A 2VTKA 1OGJA 1QG0A 2LBPA 3ABZA 4XPIA 3EEQA 5C2JB 1M8JA 4NIMA 2R00C 2AQKA 4US2R 3CFYA 3H2HA 1O96A 1Z7YA 4E5PA 4EPXA 2VKTA 4EHKA 3AP1A 4O3MA 5CG2A 2FZKA 1EM8A 1FYWA 3RWMB 3EXHB 1EGVB 3OJXA 3KQHA 4RKFA 2CNWA 1M67A 3D4LA 1EXWA 4FMDB 1AOXA 2DPLA 5ESRA 3VQTA 4CQMB 2HJHA 3KZXA 1TUIA 2YZKA 3AMVA 1SPBS 3HC7A 2H4YA 3NALA 4FW8A 4I6GA 4IOKA 2ACVA 4KAAA 4NBTA 4B31A 3A6EA 1IOWA 4TKVB 3E4CA 3B1FA 5GV8A 2B1JA 1RFGE 2ZBGA 4KQGA 4II2A 2Y76A 3TI7A 1EVQA 5JROA 1NF3A 2J9GA 3I01M 2MDTA 2IZ6A 3MOSA 3Q98A 3V2UA 7ADHA 3KYDA 3RC9A 1RYFA 2JFZA 1E58A 3VYWA 2H7YA 4NK5A 2CDNA 4M1OA 2BI7A 5F12A 2FYTA 5D3MB 3UB4A 3G0CA 4F4JA 3ZD7A 1Z28A 3BH7A 1VKJA 1ZVVA 3RRFA 3QLUA 2NAFA 2GD1O 1SVUA 1V3TA 4M1YA 3COWA 1ISPA 1N5MA 2GETA 4QM6A 3DNFA 1SHLA 2BM0A 3UT5B 1CS4C 1SU6A 3RIMA 4C0LA 4GUDA 3E9ZA 4BNYA 1Y6GA 3DTYA 3ESYA 1YQTA 2R6FA 1FTYA 2ZM6B 1UXIA 4N0QA 4C87A 2FI1A 4RHUA 5DLQC 5EIAA 2BDTA 4MGIR 3RCBA 5G3ZA 1XE3A 5KNBH 1II0A 3IBSA 1B0AA 2DP4E 3LGAA 1RM3A 4PFKA 3RU2A 4C43A 4WT7A 4DMMA 5A5GA 5G1PA 1QUEA 5B58C 1I0ZA 2P35A 2V65A 4LRXA 5I9NA 2NQTA 5D2CA 4KBFA 1M8PA 3RS4A 4MVJF 2VNIA 3F49S 4JC0A 1LKZA 4CMHA 1HNXB 5EUQB 5BSEA 3CKKA 1Z2EA 2HO4A 2BIFA 2GN8A 2EZTA 2WILA 1DO2A 4IDOA 4KLCA 4I5DA 3FWNA 3C6YA 3GDGA 3TUZC 3KSBC 4N1AA 3HLYA 1TC1A 3P0RA 2KI5A 1PDWA 1VE7A 1FFYA 2XGOA 2ZJ1A 1DMSA 2FY8A 2ZUUA 2Z98A 1B6GA 4YP5A 4B3XA 2VUHB 1H6CA 3GU3A 1WU7A 5DHSA 5JYCA 4CKEA 1E9CA 1N3LA 2QXYA 3V4FA 2WTEA 1QHIA 2H52A 4NE9A 4MV8A 4Q3AA 1JHUA 1ENYA 3LXMA 3QUBA 3VU8A 1K2WA 2SNIE 3M6FA 5K9ZA 1HSZA 2FZEA 1R2QA 4ZHQA 1BE1A 1JX6A 4MQFA 2P9HA 1U28C 4G67A 3VR2A 2O7NA 4CKWB 1BVYF 1VMKA 1SG0A 3ODPA 2O54A 1D09A 1Y1TA 2F59A 1T26A 5D6NA 1SHKA 5AW5A 3G82C 2JAPA 5CVDA 1EVJA 1YQGA 4JK3A 3D5QA 1HPLA 2V5AA 4LZJA 2HIMA 4M9SA 5D6OA 1APBA 4AS1A 3E9DA 1EP9A 4HY3A 3WVNA 1QHFA 3ROFA 2AOWA 3HWWA 2CYCA 4P2BA 2IBSA 4B4UA 1K08A 2P41A 2NUPB 4KIWA 4NEHB 1JL3A 1YJXA 1OZFA 3TTTA 5T7BA 1CQPA 1X94A 4X3PA 4ZCPA 4BVKA 1U7TA 3FVRA 4LYDA 2A1UB 4MRSA 1WW8A 4PZLA 1PSZA 5DPMA 3VJRA 2GBGA 2XUQA 1GPKA 1D0SA 3MM4A 3A14A 4F4CA 1QPZA 4LKRA 1OF1A 4OP2A 4YCCA 4ZI7B 5ICMA 3E27A 3UJHA 5K3FA 3DCYA 2R5NA 3I05A 3S99A 2IOFK 1O6ZA 3O2SB 1YRLA 1TIBA 3OU2A 4MEAA 3FKSD 4X1KA 3CRZA 5EE9A 4MS1A 5KWSA 4JNCA 3WK8A 1BXRA 4FGJA 3DKIA 1TK3A 3WK7A 1JEDA 3GPLA 1CEEA 5DO9A 1NPYA 1G8YA 2J85A 3T5MA 3HKDA 2P75A 2P9QA 2P9EA 4EHAA 4X5OA 4RADA 3TB6A 2PKWA 4F6RA 1FDVA 2I03A 1G60A 4HAXA 4EY4A 1NYTA 1XU4A 1MB4A 1N7IA 3MRTA 4FN5A 3ZCSA 4ZPJA 2BELA 1B1AA 1FNDA 1UPFA 1IN5A 1PIWA 1UEIA 3FFBA 1DCKA 3NI2A 3CRNA 5MN4A 1JRLA 3G9UA 1ZOSA 3LP8A 5TMEA 3W7VA 2C7OA 3KC2A 3OE4A 3T5PA 3O8CA 4XWOA 4IFIA 5K6RA 1N5DA 1D9ZA 1VKRA 5K6TA 3VR3D 3AVUA 2P79A 5AM1A 1CJUC 1FSGA 1YRHA 4ME6A 3ICPA 4YUAA 1SFRA 3AEKA 4LHVA 2ODAA 5C8YB 2FPOA 3DBLA 4X20B 2JFQA 2X41A 2FXIA 1W6RA 2QSZA 2YDYA 5HQTA 1H2XA 1N0WA 3VPHA 3PNKA 2CV2A 1U0BB 4HDOB 1V43A 4QBFA 1NJ1A 2OUKA 5DCLA 2NU8A 4EUEA 3HR4A 1EQ2A 5EINA 3ZKWA 4Q93A 2QZPA 3LOUA 2P9ZA 5GADl 3OX3A 3W79A 2NUTB 3CX8A 5FD8A 1DC6A 5IJZA 3NHLA 3F4LA 3MD9A 2ZRBA 1L7VC 4AKGA 1AMNA 2Z3VA 4C6TB 1EP3B 4WKBA 4XX0B 2WD9A 3RIHA 1ADCA 1XQYA 2O2ZA 3CX4A 3N74A 3RM3A 1HRKA 2PEZA 1UBKS 3QELB 3KQNA 1O9HA 2RHOA 3BGSA 2YVKA 5JHHB 1WQ4A 5TLSA 3J7TA 3NONA 1YD7A 4NZZA 4A2CA 4LVCA 1XEAA 4ZAXA 4DJEC 5FX2A 3GGGA 1HDIA 4BNUA 1CYDA 3TLBA 1WY7A 3W8EA 5CHYA 4KFRA 3EBLA 4YDHB 2OHHA 1SY7A 2R6CA 5WRFA 5LP6C 2PU5A 2BFAA 5G53C 5LBTA 1IH8A 3IAS6 3EPPA 3DHWC 1Q22A 2FZ4A 4WV3A 3FSEA 2FLWA 4HRVA 1M1ZA 4YLGA 1P5HA 1QZZA 2YYYA 1KDYA 3OIFA 3DR3A 3FPKA 4PLZA 2QP3A 3EH1A 3ZHRA 3KAKA 4IO1A 4J76A 2GXQA 1ETHA 4WN3A 2R8OA 5JZVA 2Z30A 2X86A 1BA3A 4Z0PA 3F7NA 2IPXA 2J30A 1CFZA 3JQ8B 4LYEA 3D6MA 1NKSA 1RC1A 3H3XA 4FLEA 4KZPA 5DWVA 5T41A 5CB8A 2OLJA 1N5JA 4Y6SA 3PL1A 4UUQA 3VOBA 4BGUA 2CFSA 5EQJB 4AJNA 4NYJR 3U44B 4HVTA 3OP1A 3EDRA 1ZUD1 1NSTA 2QYSA 4B71A 4C0HA 3EYWA 3Q0TA 4HNAA 4KPUA 4QGFA 4REMA 2KLBA 3W1EA 4RGBA 1XNGA 2I54A 3O4JA 1MO2A 3QKSA 3TRFA 1PJAA 1DG9A 3ZGYA 1ZLXA 4G4JA 3U09A 1M0SA 4GZ6A 1V2HE 4O2AF 4Q3OA 4MJ3A 1JQJC 3HCRA 1USWA 4EYEA 4OVKA 1G3MA 3BWDD 4XARA 1XB2A 2FEOA 4ZCSA 2V74B 1ZINA 2G88A 5GIOE 3ACBA 3B1WA 1ZJ5A 2FW9A 3HCWA 1EWVA 1GRNA 5F21A 1U8EA 4G5YA 1JBKA 3K0CA 1E6WA 3GWZA 3FFXA 1XTQA 4CIVA 1ZGGA 4QXMA 4MS4B 3NMUF 4CHTA 1TTPB 1X80A 2JBWA 4JQCA 3EEOA 1E7MA 2V6GA 1OHHD 3TBKA 4D9GA 3N05A 4K26A 4LWPA 4QUJA 4DUGD 5TQ2B 3KTDA 2L42A 1G8JA 3WKCA 4JBHA 4ZJPA 1FYVA 2VJOA 1PR5A 5FFNA 4REOA 4R5HA 3AI7A 4DDVA 3DP7A 3QH4A 3B3QA 4HDSA 1Y48E 3PEVA 5DU2A 3TM5A 2PV0A 5KB3A 4TX1A 1TAGA 2EW8A 4XPIB 5HMMA 3X44A 1FXUA 1XKQA 3ZKAA 1CQIA 1OPXA 1XD9A 2YWXA 3H84A 2JARA 1FP2A 2QB5A 4NH0A 5LFAA 5I9SA 4B73A 1JDUA 1O96B 2AOXA 1VSUA 2REBA 2WF8A 2WPDD 1H2HA 3OCUA 3BF8A 4HH4A 4N3AA 1EM8B 1RHRA 1YTLA 2FJ0A 4INZA 5IX8A 4N76A 1ECBA 1NQWA 2B6HA 2WU8A 1KSGA 4QBKA 1GA4A 2QSJA 1XRNA 2B30A 1DARA 2O4CA 1PJBA 2C54A 3GFFA 4PZDA 4WXPA 3T9BA 3ZE8A 4F9GA 5HGXA 2A5DA 4FYYA 1NR1A 2O2DA 3NUQA 3TZKA 2PJDA 3OG9A 2G28A 3TNFA 2QWXA 2B82A 4UHBA 1PHPA 1XZ8A 2XVZA 1Y33E 1N77A 3M6VA 1CETA 4ASUA 4K9KA 4Z53A 1RKUA 1G6HA 3JYQA 4LN1A 3DW3X 3ZI4A 2G9ZA 2ZSHA 5E8RA 5ESWA 1BD4A 2P3QA 1JQBA 5EHQA 4DMHA 5FLEX 1Z47A 2W6IA 3HO8A 2ZSUA 1EK6A 3ICCA 3H9CA 2PRSA 3KYDB 3IULA 3RUCA 5DNYB 3WR5A 1V2GA 2GX6A 2PFGA 3PHGA 3KR2A 5HYVA 4QNMA 3WZMA 5KTOA 1FJGB 2C42A 1P0IA 4B0OA 5JJCA 1XEFA 3B51X 3TQHA 1EEHA 1F17A 2PZGA 4OAPA 3QF4A 3WB0A 1V5FA 10MHA 1A5SB 2OCPA 3OPXA 1ZL0A 3LY7A 1RP7A 1G9TA 5CMLA 4R69A 4BWGA 1GHTA 2ZSAA 4QOSA 2O8NA 2G67A 3R7AA 4FJ1A 1RWNA 2RKOA 3GJ5A 1UT6A 2P2GA 2HM7A 1KS2A 1KU0A 1LVGA 1VL0A 2ZIWB 3KV1A 3RC1A 2QG6A 3WBFA 1BC5A 4DXAA 2VTDA 4AC9A 1PR3A 4RQAA 5IDWA 2X77A 1XA0A 4N0EA 2XPCA 1FMTA 5KC9A 3VDRA 5JMOA 4WL0A 2ZJOA 4YQEA 5FWAA 4YH1A 4JCCA 4S12A 3U9TA 3QSGA 2WJ4A 4LIPD 4AS3A 5LOVB 2X2FA 4L51A 1YJQA 1S96A 3RE1A 1VXRA 1I3KA 1B26A 2XRZA 1U0HC 3TTVA 4NZNA 1PO7A 4O5AA 4MYHA 1SH7A 3B85A 3DKKA 4E4RA 5JSHA 4U9IS 3D3QA 4YFYA 3KEGA 3K9WA 1Y7TA 2C88A 3KZVA 5IAAA 3GMDA 4E94A 1KTVA 4IJMA 1QU3A 1XVTA 2Y2VA 3N6VA 2VRCA 3TNLA 1M2WA 2B4YA 3DUWA 5C0OE 4UBLA 4CKEB 4NLLA 2OSVA 1E3LA 2GMWA 3MBIA 1JE1A 4FT2A 2I6UA 4WZBE 1E4OA 2Q6VA 4I19A 4PYJA 3TZ6A 1GTL1 1L4LA 1PQUA 3P0JA 3Q3IA 2G7ZA 4JS0A 4ZHQB 4UM9D 2HA7A 3UMYA 1XHEA 1R0CA 1XDGA 2VWQA 3INNA 4KPGA 3GVPA 4MQFB 4QD3A 1X13A 3K1AA 3LQRA 4YRRA 1FQOA 2HXSA 4YXWA 3RKUA 1DOZA 2ZJ0A 2PYIA 2YQ5A 3UJ6A 4B6OA 1QWOA 4URVR 3BE6A 2Q7DA 3SBOA 3HRKA 5HKBA 1I14A 2SHKA 3CEPB 1BVUA 2IV7A 1DKQA 5JECA 1FUKA 1Q84A 4W1QA 4L5YA 5JY6A 3I53A 5HDQA 1E1QD 3OZEA 3ELBA 4TV9F 1KFEB 3EK2A 2OXIA 4CM6A 4N0MA 3Q5DA 1KTIA 1KR5A 3IE1A 4DXDA 2YC4C 4KXMA 3MMNA 1XLWA 4M55A 2Z6VA 1QHXA 2X8AA 4CDMA 2Y1LA 2QU7A 5JHGB 1JI3A 5CVVA 4J0JA 2FUEA 4CF4A 3R0IA 6ADHA 4KXXA 1BX0A 3OSUA 1XVAA 3QJGA 1JAZA 1EJ2A 4KRYA 3LL4A 5K3FB 3NVKI 2NOAA 4IIHA 3BA6A 1PN3A 4BZWA 3Q9SA 4PNEA 3NVMB 1DRJA 1Q0RA 4X1KB 5C7IO 4MS1B 3K92A 4F93B 3GUCA 2Y0BA 2X0DA 2FWJA 4BL5A 1TYEB 5FPQA 1BXRB 3ANNA 2CXRA 4M8SA 1NU6A 1TO6A 5C9ZA 4WOKA 1T13A 2H11A 1SC3A 2VXOA 3A2MA 3E03A 3H05A 3HKDB 4UHCA 4O2LA 1N8TA 2WUEA 3T5TA 2YN0A 3REOA 4I50F 3DEJA 3SOZA 5CW1A 5LZ4A 2HR1A 3F9IA 4MAMA 5TR9A 3W2TA 1T9DA 1DNPA 2IYUA 4PCVA 5J59A 3L8CA 3VAYA 4CV1A 1GV1A 2ODBA 5AESA 5JQGF 4OXNA 5EZYF 4KVAA 3W3ZB 2EDAA 2BJHA 2QMHA 4Q05A 4AUNA 5I5EA 3BK7A 5NLLA 4RPLA 1KMMA 2HLHA 2DH5A 4CF3A 3NCHA 1M7BA 2O2GA 1M66A 1LV7A 3HO6A 3JAWA 2UVDA 2YY5A 1QAQA 2ASVA 2DWUA 1L4GA 4W4TA 1E2UA 2K4MA 4TMKA 2C96A 3L0DA 3CRQA 3IHLA 2QSYA 2V6BA 3AEKB 3L04A 5GGYA 2X9NA 4P1ZA 1TU4A 3AR3A 3I28A 3NOQA 3DBLB 2RFLA 3E58A 3PWSA 3QOFA 4JJ6A 1K2VN 1K89A 2C3UA 3AR8A 1WZEA 4I66A 4UCXA 1RQ7A 2WNIA 3TW8A 1NVFA 2XD9A 1O9BA 5J43A 4Q4JA 1AIPA 3WNCA 2ZROA 2NU8B 1QZTA 3QLVA 3Q6IA 2E4YA 3ZKWB 1ILWA 2MSKA 3W9SA 1JFLA 1QFXA 2FP4A 2WUWE 2FSSA 3A2LA 3C5WP 1LTQA 1CU1A 3EIWA 4WOBA 1BHJA 1M1YA 1K68A 1MEJA 1M9NA 1XU7A 3FMOB 2B7LA 3OI7A 3PNBA 4BLOA 2LVBA 3ZX5A 4JJ4A 5JMTA 1KQ3A 1U0FA 2OD9A 3JZDA 3NAZA 1XRQA 1T0JB 1JJAA 2DHEA 2PS1A 5AJHA 1YSCA 1OE0A 3VNSA 5F3DA 1BMQA 4B83A 3GLFE 3V7YA 1N5RA 2B8TA 3MMXA 4PC7A 3RWBA 4WLUA 4DIKA 2V7UA 2ZCJA 2AI1A 1TM7E 1CP2A 3HJGA 4OHWA 1U3CA 3IAXA 1LK5A 4MUMA 5DI3A 3WX0A 1G1MA 4TTAA 4CKZA 2LDXA 3QEOA 1YU6A 4FC7A 3SLKA 5DM4A 3T3PB 3Q0EA 1EZ1A 2APJA 4IDHA 3QVXA 4BMXA 4RENA 3A1NA 5MGBA 3AUFA 4V2UA 1AD2A 2KYRA 4G97A 4WFKA 3B3FA 5KJEA 1F0NA 1E32A 1ZUNA 1G6Q1 5DYYA 3I8SA 4D43A 3MT7A 2P1ZA 3OQHA 2H6EA 1CUBA 3HCCA 2OHJA 3A04A 3PDJA 4PX5A 2IHNA 3GO4A 4XWKA 4O1IA 3ZCRA 1ODFA 4JR0A 4WGFA 1R0ZA 1XDBA 2DYKA 2MIIA 4C2AA 3TD2A 1XELA 2GUGA 4MWSA 4UTRA 1ZHHA 2BGKA 3QF7A 2BSQA 2VPWA 1IL0A 1T29A 2NQ2C 2IYTA 3ICQB 2XVYA 1YO6A 2ZI5A 1Y9AA 4DWOA 2ZQ5A 4HNAB 2E87A 4KPUB 4Z2YA 3KJGA 4Y9RA 4ARZA 4DOMA 4E5SA 1TMOA 3F9RA 1NQAO 3QKSB 2YOFA 4D74A 1KEVA 1QIGA 1VSTA 1UOPA 3RSHA 4IDDA 3ELDA 3DMDA 3EZGA 4EENA 3TZHA 4HLCA 1ZSVA 1H93A 2P6UA 4ND5A 5C7OO 4TYQA 4FKBA 2PUEA 1IWBB 2BUBA 2TRSB 2YWEA 3QK7A 4GWLA 2QORA 1KIFA 2WVAA 2ZS8A 3ANSA 3MN1A 1BU5A 4MJXA 3T8YA 3VJKA 2J0SA 1TC2A 2A7QA 1P6XA 4M53A 2C9MA 4MNTA 1DBQA 2XY4A 1FNNA 1YHNA 4YT4A 1XKLA 3EXHC 1GT91 2I7VA 2XDAA 3D4IA 3IOYA 3TRDA 1X80B 1H9BA 1P8JA 1XU9A 1TDJA 2ZYTX 3FMPB 4L8WB 3VDNB 4B7XA 5JTTA 1XMIA 3AG5A 5B2ZA 1ISMA 1R9JA 1ZJ4A 1NW7A 3I1YA 3X1DA 4BECA 4I8XA 3W3AH 4IJ5A 1PLKA 1DLJA 1T5DX 1WMSA 2GN9A 4A27A 2IPMA 3A1UA 3ESXA 4MHSA 2HA2A 4RM2A 1E2QA 3O8OA 1WVGA 3TVDA 4HDSB 1JVNA 2QAIA 3AXTA 2DTDA 1DJQA 4LZLA 4YRCA 3T3GA 1OZGA 4E07A 3SC4A 1R7RA 3JW8A 3DVQX 1CQIB 4BEJA 3D4BA 1JMKC 1SXJA 3F5FA 4Y9UA 3A31A 3AESB 3U13A 4G63A 1OWLA 4QU9A 3WO0A 4CM1A 1K06A 4JLOA 4YFVA 3V4OA 2H8KA 4AKHA 2NVOA 3QFFA 3T7DA 3GEDA 4EY6A 2GYWA 3K2IA 5IMBA 5T4EA 3DKPA 4ZO8A 1L1EA 4PY2A 3W1VA 1RCFA 3NWPA 1PQYA 3JV7A 3KSUA 1NMZA 1XZCA 1G2PA 1NVTA 5D7BA 4BU0A 4YCJA 4PN3A 2QJWA 3DDWA 2PGXA 1I4EB 2OILA 2AFVA 2AUTA 3CUYA 3I6BA 2WTBA 3D02A 5JEEA 3SC2A 4ZJZA 1DIBA 3TX2A 3TGLA 2J7PD 1IUKA 5TT0A 4KHPB 3AK4A 1E4YA 2XF2A 4A23A 1XQXA 3V2GA 3O03A 4OK5A 4ENTA 2J0EA 1HKHA 3GZ4A 1F2DA 4MIOA 4N5MA 2ACEA 1N3YA 1PR0A 1UOQA 1KPHA 4FMPA 4PR0A 2QMYA 3FNGA 4ZYUA 1Z4IA 2R6AA 3AR4A 3IP3A 3KFLA 2DB3A 2FG7C 4AI6A 4E4TA 1TYAE 4H59A 3PXBA 4OMCA 3PP8A 2IV3A 4DL9A 3OIWA 4FCTA 1YZTA 5JD5A 3QF4B 3HB4X 1MVNA 1PRYA 1U7PA 2H5JA 2I99A 2R1TA 3AERA 1AKYA 4FGLA 1WX1A 1G63A 1SULA 2E5WA 3WL4A 3UWMA 3DTVD 2HRCA 3OQOA 2EYUA 2QE7D 1QH9A 2OO3A 2JZOA 4JUIA 4RXMA 5T3YA 3AEZA 3TNDA 4B85A 4L76A 1OH5A 2XMBA 3KKOA 4NV3A 16PKA 1CDEA 3EASA 1IY8A 3GT4A 1YK1A 4UVIA 1CLEA 2BMFA 4IHQA 2NVWA 3NX4A 2R84A 2FSPA 4Q1BA 2JVIA 3OKPA 2RBGA 3IT3A 1IZ0A 2XMRA 4EIWA 5BMVF 1F7UA 2LZ0A 3T61A 2HCTA 3FHOA 2GCPA 1WB5A 2C98A 3A1FA 4PSCA 4P6VF 3L43A 1GLNA 5F77A 3R6LA 2QTTA 2Z58A 3PUVA 4CYMA 3OT1A 1GZHB 1OYYA 5SICE 2BFNA 1Y82A 2ZJ2A 3A6ZA 3ZWDA 1YZFA 2V7BA 4GNRA 3D31A 3RSSA 1TIPA 3ZDCA 1BO6A 2OFOA 1CSEE 3IAM1 4DJTA 5JZMA 2W11A 3D1LA 3S68A 3I6YA 4FONA 2ZEJA 1CUCA 4CZ2A 4K6KA 3RREA 3A3YA 1ZD1A 2BZSA 5B2FA 4FUTA 1N2BA 1E3IA 4IHJA 3T7RA 3K1AB 4LCBA 3C14C 2XT0A 3L0OA 4PIMA 2NSHA 1EFCA 2QZZA 3K0BA 4EFMA 4Y9TA 4IDPA 2FX3A 4B8ZA 9MHTA 1DELA 3GV0A 1VE6A 2F2TA 1ULAA 1ZU5A 4L0MA 4C20A 3K9BA 3AETA 2ECOA 1RC8A 3D64A 4L0CA 3IYLW 2IOYA 1IN8A 1TA0A 5HG0A 1V5EA 4YRZA 1U81A 3KWMA 1DQNA 1KZYC 1JVBA 2HBZA 1NWCA 1TFUA 3GCZA 3LHKA 2Q1XA 5ER9A 4M8NE 3W06A 1JXQA 1E2DA 3UHAA 4D98A 4KITB 5FWNA 1JEOA 2O3JA 5F73A 5I9TA 4ROSA 4OP1A 5THXA 3ETJA 4GWKA 4R54A 3V6LA 4NBSA 1WCXA 4NL4H 4YCAA 4KO1S 4C7OB 3MINA 1UKVY 2O2IA 4JSTA 1K86A 1CZLA 4DBLC 4IJWA 4RD3A 4BB5A 3DE4X 2BV3A 1PFKA 1U8UA 3E5RA 3HRIA 5DNAA 3SBXA 4AURA 4DC9A 2ZSKA 4YRLA 1UBGA 1UEJA 3BEOA 1SKAA 1TFRA 1M7HA 4U63A 1NYRA 3OZDA 4FVTA 4Y30A 5EUBA 5KTTA 4P4TA 4JYCA 3UC5A 5DBGA 2CVQA 2FX2A 2FSFA 3RROA 1PBNA 3JAWB 1G17A 4BTEA 4DSAA 3L8FA 1D1TA 2DE0X 3WJ2A 2WW8A 2PFKA 4DA8A 4P0TA