3NATA

Crystal structure of conserved protein of unknown function ef_1977 from enterococcus faecalis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
156
Chain Sequence
b'SNAMKKATMLTYLEEQLEKHLGDYEVGLDWDRKNHTIEVIVRLYAENNEQVAIDDVEFIEFEDGLLFYNPQKSVVDDEEYLVTIPYEGKKGLRKAVLDGFIHYLKVVLDEGQSDLLDFLSDETAEVFELHWEPADFEAMIKKVAETEKEQWIAYPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal Structure of Conserved Protein of Unknown Function EF_1977 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 37
structure length 156
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11217 DUF3013 Protein of unknown function (DUF3013)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11250 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3natA01
3NATA
chains in the Genus database with same CATH superfamily
3NORA 3OLQA 1OPRA 1A27A 3QEOA 5DCLA 4B3MB 3GLIA 1KC3A 2H2GA 2VQSA 3SC3A 4BX3A 5LA6F 4JNKA 3URKA 2A0WA 1E1RD 1FUYB 1CRWG 1PFGA 2GLTA 4N8EA 4XYMA 3VSBA 2GN9A 3K9BA 2NGRA 4IXTA 1CZRA 3PXDA 1AKMA 1D1TA 1Q92A 2JIPA 5D5PA 4BO0A 1XK7A 3DFUA 4FZJA 4C5BA 5EHZA 1KA9H 5BURA 2EJBA 4JHLA 1LI5A 5D84A 1H5UA 2DH5A 2ZYUX 3TSOA 3ONDA 3LG2A 1P8JA 2G1AA 4LF4B 3I09A 2QRUA 2BFOA 4WK4B 3QF4B 4ZU3A 4F3RA 1YRHA 3UPDA 4NPHA 5FI5A 3CH7A 5LP1A 3AL2A 3F3SA 3I0ZA 1F2VA 4B48A 3H5WA 2BEVA 3A9CA 3KQVA 3QUBA 2HJSA 3R3WA 1EWYA 2HJWA 3KEQA 4KQXA 4OHKA 4UMVA 5IAOA 2WYVA 4OU5A 4MI6A 3U3MA 4CGZA 1K8RA 3CJTA 5E0KB 3R9XA 3ZJYA 4BWGA 1ZN2A 3MQ4A 4ZPJA 4HGPA 3AB7A 2NX2A 1YJAA 4CNQA 4D0RA 1KERA 1FMTA 1K6JA 3RRNA 1KAMA 1GSAA 4CL8A 4ZZ0A 3AEUB 1PJ2A 1G5IA 2OCLA 4CI9A 4ESEA 2ZRAA 1LH0A 3OE1A 1H3FA 2REQB 1FLDA 4RO0A 4QLBA 4JL5A 4L8WB 4BJHB 4DCNA 2QJOA 2QMYA 3TSAA 3WQHA 1R6UA 1J9GA 3EQ8A 1AHPA 3SIPA 4DV6B 5C5CA 4A15A 2HSEA 1R8QA 2E37A 3ILHA 4IRMA 4YQEA 2RHBA 1TKBA 2G8NA 1PT9A 3PZRA 3WA7A 4RD1A 1VZ2A 1EP2B 3PNMA 1RRGA 2X7JA 1CR0A 3W6NA 2FSGA 1CR1A 4OHWA 4BY9E 4PAGA 4UNQA 4YH1A 2E18A 4ZODA 2WIAA 2LPMA 4TL7A 3ENVA 4DARA 4B8YA 5GJVC 5JAIA 3GHHA 1GL7A 3VHRA 4ZI2A 4Q82A 3T7EA 1UMDB 2HPAA 4AUMA 3OCJA 5HM8A 5JQGB 2R1ZA 2F67A 2BBOA 5KTRA 5JTTA 2JS7A 1RS0A 2IYFA 1G7TA 1P4SA 2C7VA 2G9ZA 4C03A 1X9GA 2ZE6A 1ID8A 2VJMA 3AVPA 4FK8A 3DOJA 4RKRA 1R6TA 5DP2A 1NMYA 3T4UA 1TCUA 4RIFA 1KYQA 3DLTA 2NO9A 2Q50A 1O7JA 3GAZA 4OJYA 1EFKA 4C01A 3AEYA 4PTYA 3TD2A 4UPEA 3UK7A 2UUPA 4BLQA 3U1VA 3N0TA 4GI3A 1EUCA 4WCFC 1QC5A 4C4XA 5IF9A 2ZYSA 4YEDA 4ZT7A 1CZUA 3NLLA 4L4ZA 5F7XA 4QU9A 3I2KA 3OZTA 1Z13A 1YOBA 2BGJA 4M86A 1J1ZA 3PYXA 1A8SA 1JQAA 1YRQA 2HWYA 3IVAA 3VU9B 1YS9A 3JD3A 5KX5A 2YINC 3CNHA 3GGPA 3A4MA 2EX1A 1XGKA 4YJKA 3REQB 4LBYA 4RY8A 3HKBB 3LHKA 3JQFC 1VJDA 2YR0A 1B0UA 4YAEA 3RFUA 5F9MA 1FJXA 3UHOA 1EHIA 3IOMA 4BN5A 4I9FA 2DHQA 4ISCA 4DNPA 1DCTA 1JHPA 4A73A 3PNYA 4PE5B 1IEXA 4UD6A 3OE4A 3H87A 5E3JA 1AHIA 1C7RA 4PLZA 3TOXA 1NF9A 3WLJA 3R7SA 2ACEA 1GP2A 4PLWA 3F7NA 4S35A 2CVPA 5KC8A 1F9AA 1NC1A 2ZSFA 2Q9AA 1FP1D 4J0JA 3REGA 3TGWA 3WGIA 4D8UA 3INYA 4FIZA 4H7KA 2CF6A 1VRWA 5TX7A 5KYXB 3AILA 4MJLA 3IKVA 3RIMA 2GF9A 1J6UA 1FNDA 2NXNA 5CDSA 3AY0A 3T7IA 1I9CA 5LB2A 4FZ5A 4AMVA 1GY8A 2JBWA 2Q1TA 5B64A 1H0SA 4N18A 4R41A 1B6TA 4GP9A 1KTVA 1P1BA 2HR1A 1SCNE 1DIHA 1PE0A 4BTLA 1HZJA 4M1MA 2CEKA 2P40A 3GJXC 2Q7XA 4HXGA 4OB6A 1DIOB 1KK1A 3E2PA 1L7NA 2OOSA 2W4QA 3N6VA 1JJ7A 3HU1A 5H81A 1QYVA 1NBMA 2VSFA 4E09A 1DRJA 4QL3A 4FDLA 3U5TA 4G36A 4NBKA 3I4LA 5IZCC 1MNQA 4UREA 3UW1A 1DX9A 3W9BA 5JY1A 1USIA 1CIPA 3PEVA 4II3A 4YRKA 5JD4A 5EMHA 2FYTA 1D2AA 4MR7B 2AMYA 4K9NA 1MC4A 4CFYA 4OI0A 4PPFA 2K6GA 2X41A 4HGYA 3E23A 4TMVA 5BYBA 5HK9A 4L4RA 5EIWA 2VJCA 3ZV6A 5LA6A 3E7DA 3NBMA 4PSDA 4GX5A 4HADA 1CJMA 4IICA 5KS2A 3AXSA 4K9RA 4F6RA 1I4EB 1DXHA 4J0QA 2GCEA 5DW3A 2WYWA 2JAXA 3OY2A 4PHFA 4B3RB 1MNAA 3W78A 1R10A 1PLJA 3P9SA 4G23A 5CB8A 4MX8A 1TAGA 4KQIA 1GV0A 2D54A 1UQTA 2F1RA 4RZXA 2AI3A 2O0MA 2F59A 4UHKA 1L5LA 5DISB 4ZEOA 1NIPA 3B2QA 1P1FA 3JATB 4JC5A 5I9MA 4GECA 3C45A 4PPQA 3TZHA 1Z7WA 5IKMA 4DBLC 3PVSA 1Z36A 5LC1A 1AQJA 2C9BA 2YVKA 1YKFA 2PDAA 2OHJA 5KU1A 2P2NA 1H1TA 1N2GA 3O7MA 1DEOA 2LIPA 2XWBF 2GBFA 2JAHA 4PQGA 1W2HA 1RI3A 2HCRA 5LQCA 3OX1A 1NY5A 2BFCB 5HUHA 1R6AA 5DHTA 4ONEA 2FHSA 4ZAVA 4YI5A 3RT9A 4CU2A 1E69A 2AEEA 4CLRA 3O2QB 4ZGBA 3GCDA 1SQGA 3NDJA 4U2CA 4ZTZB 2H11A 3E9DA 4YDQA 3HCOA 5EIOA 3WK4A 1E99A 1K4MA 5AK5A 2QM7A 3WBBA 1Y6GA 3FNFA 2OSVA 4UE2A 1DBSA 1JQ3A 1FPQA 2QHXA 3O92A 4D02A 1YB6A 3HCBA 3KAKA 2EG9A 5J5VA 2QTTA 1G3QA 2I7DA 2J9GA 3O8LA 3PPVA 4BEBA 4IDDA 3RVNA 1FRFS 4LIPD 3T1VA 4L16A 3BS4A 5CA0A 1XZAA 5KREA 2UU9B 4X92A 2OYRA 1N33B 4EPWA 1RC8A 4WAUA 3FDXA 2WMDA 3KNZA 3OURA 1QOPB 2B2CA 2Q9BA 3PTZA 5IPFA 4YRCA 1J20A 3NMUF 1LPMA 1C14A 2PK3A 3VTZA 4WCFB 4BATA 4M0LA 4URFA 1EPUA 1NR5A 3GQBA 5DXFA 3GLHE 4HN2A 9MHTA 2YMMA 4X1KA 4BNFA 1JZSA 1B8NA 4G1CA 1DBVO 3VR5D 4FFPA 1L7DA 5K51A 2QNIA 3V7WA 3BIWA 1BD3A 1QIHA 3LBYA 5BVGB 2GCPA 3VNVA 2RGNC 3AERB 2EGHA 3B2NA 4OSPA 2WOJA 5DBFA 2W2OA 1DC7A 2BE7A 4LVUA 2ZROA 4XJVA 3RAPR 4KXUA 4ZEXA 4A10A 5CLIA 1DX4A 2QVXX 4Q4HB 2X0KA 4R7TA 5CA1B 4QEDA 2JAUA 2ZCVA 4RELA 4JBIA 1U4NA 4UU0A 4M37A 3VQTA 4XX0B 1U2PA 1JECA 4ZAGA 5TQVA 3RTGA 1ODSA 1T6XA 1Y9DA 5CDFA 2ZCJA 2NO7A 4FEYA 3G6WA 3D0OA 1LZKA 3WHIA 4A03A 3RCBA 4U5QA 1XPJA 2DE0X 2ZS7A 3LX4A 3KX2A 2NADA 2EEZA 4PYIA 3N2LA 2C92A 4DC1A 3EIHA 1IXYA 5FWYA 1LUAA 1A82A 1R18A 4P08A 1U0GA 4KFUA 4MIEA 3F8SA 2IQ5A 5JXGA 1TW3A 2H0AA 1RCUA 4FWTA 1TA9A 1CCWA 1NULA 2BFDB 5AVKA 5JY6A 3OZCA 2VP5A 4BLVA 4YUAA 4W7IA 2B1RA 4HAYA 4PRLA 1X1RA 3P32A 1WEKA 4EHAA 5T4BA 4AW9A 4O2BF 4G25A 4YS6A 5HTOA 5B6JA 2BPOA 2HHJA 2YN2A 4R0NA 2GLXA 1Q12A 3QEJA 3THXB 4MCIA 4BO6A 4RFLA 3E9NA 1NR7A 1WKVA 4JT8A 2WR8A 1JJFA 1XP8A 1KVTA 4GPIB 2FR8A 5ERXA 2WWGA 3IA7A 1XP5A 1NJ1A 3UJNA 4M22A 5CR9A 4HWKA 5GZ6A 4FOSA 5HUJA 1JP7A 5FL7D 1WIWA 2ZTHA 1HLGA 4HLUC 5LQSA 5U4QA 4ZJZA 4AY2A 4ZGWA 3FF4A 4PBRA 4GKKB 3RBZA 1E9SA 4MQ6A 4ZPXA 3JQ9C 4XWWA 5JVDA 1A4UA 1PRYA 1Z2DA 2VPXA 5DVZA 1AUVA 1IYZA 1DQZA 1Z3IX 3IGFA 3SMVA 5K3FB 4IGAA 3R0QA 2ZQZA 2JJYA 3ESXA 2R00C 1KFKB 1PT6A 1W5EA 4TSRA 1V11B 3SR3A 1JXOA 2GXQA 3IRUA 4NYJR 2ZIVB 3LYAA 4UZEA 2HLNA 4ZP1A 3WKEA 2D0PB 5K8CA 3QJ5A 3ABQB 1BKSB 1AHNA 2JIMA 3H05A 4WL0A 4L8VA 4EO7A 2BGKA 5E2AA 4WFJA 2TSYB 1X86B 4LF6B 4L1KA 2ZJ1A 3BBPA 4C0AC 4QRDA 4Y9UA 4YAJA 5ES4B 3CVXA 4BS9A 1M10A 4NULA 3AFGA 5JDIA 3AVWA 4NE2A 4DV4B 3IP9A 4C6TA 4EW6A 1OKKD 4NFSA 4QG3A 3AX6A 3DQZA 3V48A 2AH5A 3CUWA 4MQBA 3RTEA 3GT3A 2VYND 4DB4A 4P22A 3WRVA 2G71A 2VYVA 4KE6A 2AGVA 5BOSB 1TI7A 5CG2A 1W25A 1WXDA 1P2SA 2DBVO 2IF2A 2PGIA 5HZGA 2J9FA 2ERYA 2PJDA 4MWTA 2NW6A 5IAGA 2RE8A 1VOTA 2AC7A 4WD3A 2D1SA 3AV3A 3QPAA 5JEDA 2V6JA 1FK8A 4UDXX 2CHVA 5LOVB 2TMGA 2YV2A 1LBEA 4OA8A 2KMLA 3NHPA 5JG7A 1AN0A 1U0FA 4DMFA 2DR2A 4F0JA 2FPIA 5ANRB 5G0SA 1A9XB 3BAZA 1COZA 1U7TA 4AD8A 1ICIA 3L01A 4BO7A 4MULA 1BXGB 2J4CA 3MCUA 2ZBEA 4YUVA 1XZJA 4XGRA 3RBXA 3SMQA 3TOSA 4CV3A 2JG3A 3CVOA 2ADOA 3KV3O 3QBDA 5AT1A 1ZJZA 1W5AA 4ANFA 3NHBA 1WD5A 1HETA 3DTYA 4EEXA 4X6XA 3RJ5A 5FUXA 4ZQEA 4CKEB 2I2WA 4DJEC 3RU2A 5DHQA 3AFIA 1Q7BA 5JO9A 4J0HA 2FUG6 3HZRA 1ZM7A 1DQRA 4LJAA 1NX9A 1EMDA 1NVMB 2H2WA 3G7NA 5C34B 4BLTA 4BVLA 4DDTA 3VUEA 1GKKA 3P2EA 4Q1CA 5EWLA 5B4TA 4FFDA 5KDDA 4YJGB 4AZVA 4TLCA 4B4KA 5IT4A 3BF8A 2WWFA 4LG1A 5IU6A 1E8NA 4Z86A 3SXJA 2Q7DA 2A5DA 1O9BA 3U4QB 4ZZ3A 1COWD 4MKGA 2ISSD 1M6NA 1X77A 4IDCA 2C2YA 2IYOA 4U7HA 1A0OA 1G98A 4FGSA 5IDWA 1E2QA 1E4YA 3KUUA 5BSRA 1KU6A 2WWYA 4WESA 1CS4C 4Q4AB 3K9NA 1QQAA 1MT0A 4DQVA 4ZI3A 1Z38A 3GDHA 4TQGA 1TADA 4JOBA 3ROTA 2XQKA 1TEVA 1C1XA 2AJDA 4S12A 4OQFA 1UAYA 1UOQA 1JIXA 4CI0B 4J1SA 2E82A 1BHJA 1XDDA 2VWPA 1E5LA 3RM3A 4FKBA 4IFEA 1AO3A 1FZTA 3BE5A 3EVCA 4INPA 1DAMA 1UBTS 3T1NA 3D4NA 3KEFA 2JI4A 3BGIA 1XWIA 2W9XA 5F33A 1LK0A 1KR5A 2CJWA 3NAQA 5JISA 4W7SA 2RH8A 4X1YB 5ECYA 2X19A 3PU6A 2P2ZA 4KYUA 1TYDE 4FYYA 2Z09A 1T3ZA 2BTEA 2CXSA 2OZKA 1AF7A 1D0VA 4G1EB 3E8SA 3K9GA 1CYEA 5JWHA 2A5LA 1H93A 4PAMA 1KYTA 2J6HA 3H1TA 2FSSA 4CLEA 2B6NA 1DKPA 2Y1EA 4CKCA 1U9JA 2J3EA 3A31A 1LNSA 3BJMA 2BKUA 2BEVB 2X2EA 1SIWA 4L6CA 1LLQA 3WB1A 4EHFA 2RD2A 3L0OA 4GR5A 1TKAA 4HOYA 2IPXA 2AXEA 2QTMA 3MEQA 4KRYA 3TFWA 4U00A 3I30X 3R9XB 4DPLA 4OHVA 2Y27A 1BC5A 3QLEA 2R5WA 2BW0A 3U4MA 5ICFA 5BPFA 3AM1A 3NTVA 4MW1A 2XJ4A 4E1AA 2IYRA 5HKBA 3P27A 4R5MA 2VQFB 3NATA 2VH5R 2ZVQX 3GOHA 4FS8A 5CFOA 1T9CA 3KSZO 4KIUA 2PUBA 3DOEA 3FOBA 5JU6A 1ZK1A 4MW4A 2EQAA 1QO9A 3ZEIA 4BP8A 1IDN1 3HADA 1TX4B 2JLCA 4B3DA 4ZZ1A 3VNUA 1B6SA 2BR4A 2Y76A 1BNCA 2R9VA 4RA6A 3I37X 4UEQA 3BCUA 1E6CA 5DU2A 4QXMA 2VPQA 3Q9SA 3CZ9A 4F2HA 3FKSD 5KTYA 5CCBA 2PGOA 5CB6A 4LXQA 3K0AA 1HTBA 5CVUA 3KQQA 3IL2A 5IZ4A 1MVNA 1Z4KA 5C8DA 2I2BA 3HFJA 2WYHA 2BDEA 3ZZ0A 4D8WA 1P4HA 3RADC 1O3YA 4IUYA 1RM5A 1T2NA 4RLQA 4Q05A 2CBXA 5EI5A 1MQSA 4UD2A 3U3DA 2WP8J 3RUCA 1SGWA 4EDFA 1F8YA 4H3KB 4BLWA 2VJMB 3OIWA 2XXBA 5DT9A 5FLYA 1WZCA 3AJRA 3MBOA 4JUDX 1CQJA 1L3IA 1NZJA 1W0KA 3NHSA 1MOPA 3ZBPA 2E4UA 4EYOA 5BT8A 2CHUA 1I5RA 1PYOA 3W8FA 5KDOA 2R6GA 5IJXA 1EUCB 3LCJA 1QC5B 1XBTA 5E1DA 1ZSVA 2NUTA 3W2FA 3D6AA 3X1DA 4JVMA 3UB4A 3RW9A 3OOWA 5FYDA 1A50B 3T0FA 4E4RA 4LY0A 3KJHA 1MQ8B 3CRZA 4MUAA 1DKQA 2ZQYA 3L6OO 1GCOA 2C97A 1M0WA 2RB5A 3KT6A 2CHEA 2EFYA 3LI2A 4JQSA 1T8YA 4WIAA 5SV2A 4YXWD 1JIKA 1F51E 3OT5A 3UA3A 5KX5B 4QASA 1GTSA 1H2YA 1ZHHA 3JYHA 4TTPA 5A05A 3LT0A 2ZUEA 4IVPA 3VJMA 3A9RA 4PSKA 4EJ6A 4IF6A 3RYTC 3S2IA 3OLWA 3ECSA 1R6XA 4CF6A 3NT5A 3VMFA 2IYQA 2Q49A 3HCRA 5LMCA 5B1YA 1LEHA 4X7MA 4GBJA 1SD2A 2YIVX 1BMDA 2VKQA 1MRNA 2Z08A 3QH4A 4IKEA 3SGLA 3TI7A 4FNAA 5JS8A 3RAFC 4W5WA 1J2EA 1F8GA 2O59A 4QU5A 1CUHA 2O9JA 3LNCA 1NVUQ 5E1MA 2FRDA 4P31A 1I2CA 3B48A 2I6TA 3TTWA 2O3QA 4WCDA 5DT2A 4I81A 1G5TA 4RMHA 2PPLA 2XYPA 3EDOA 1Q83A 3FFWA 3IVGA 2KI5A 1DKUA 1P5RA 1Y1SA 2A86A 3IEIA 3N6RA 4XD7D 5E4YA 3DZGA 1T2FA 5LBTA 4ON9A 3OPYI 3VPDA 4EVIA 5HF6A 4A23A 2P4UA 4HPJB 1YAHA 2DF8A 2HK8A 3K70D 1JDUA 1RW4A 5MGBA 4MDHA 2GYWA 1NATA 3IPXA 1AXGA 2B0JA 2V4ZA 3PWTA 2V4MA 2EW2A 3OQPA 4LMAA 4V03A 1FBNA 1Q14A 2A7QA 2C54A 1POXA 4G8CA 4NCBA 4MGZR 2VXCA 4R8MA 2D06A 4KOEC 2FEKA 1Z9BA 5TPZD 4AO7A 3NUZA 1BFKA 1JAYA 2X1LA 4LEIA 1WXQA 3WV4A 3ZEAA 4ZANA 2F4NA 2W2XA 4QJBA 2FR8C 3P9RA 4GPTA 1XF1A 3UG7A 1EFUA 3D6NB 1PHPA 3WHPA 3ZHRA 5HKAA 2HHCA 5HMMA 1NBWB 1SVOA 5F51A 4LE0A 1FY2A 2QOEA 2IOYA 1U5BA 4QHYA 2EATA 1D2RA 2ZT6A 2EZ9A 5FPKA 3LZDA 2XGMA 1I7PA 3PNSA 5LNK6 2B1QA 1G6KA 4MJXA 1TA0A 5LA6B 1HDEA 3WB0A 3EPRA 4FFVA 2NG1A 4PN3A 1TQDA 4IOJA 4QUKA 4F6RB 1OFIA 2HQBA 2BMEA 2PFSA 4O4HA 4P33A 5HJEA 1GQOA 3AHGA 4ZALA 1PJLA 2XNCA 3A2NA 2YS7A 2WZQA 1ABEA 2WNHA 1AUOA 1GPWB 1OY1A 3AIKA 3BCSA 2ZT7A 1NXSA 3Q2KA 3V3TA 3FUUA 1OYWA 4H7JA 3FSGD 3NXKA 4QDXA 1JTEA 1IHYA 1S3GA 3N3AC 3NYIA 4UCWA 2FMKA 1NL3A 5KNDD 2R6ZA 4NH0A 4TVSA 3KTDA 2O4UX 3D8SA 3QLVA 3CUYA 1PK9A 4IL5A 5CM9C 1KDTA 2IL1A 2C5AA 4RENA 5CH3A 2LCFA 2HYIC 4KQWA 3MS2A 4Z7JA 1RRFA 3AFNA 4EG6A 2CFIA 5JDIC 1VGRA 2GN1A 3K2BA 3KT8A 4ZWNA 1V2HE 3NUGA 1WL8A 1AZWA 2CMDA 2R1UA 2W6MA 1KL7A 3QFRA 5J5AA 4JWTA 1GGVA 5FTKA 3GWGA 3IXQA 1LGYA 1M2JA 4L28A 3U9TA 3V80A 3DHNA 4CLRB 1YK0A 4KPFC 1CIVA 1AT1A 1GPMA 1EE9A 3VM6A 1NKTA 2WV7A 3VV3A 1ZK4A 4RKFA 4RJTA 3LQ1A 2I4MA 1VL2A 2P68A 1TT5A 3CO5A 3TWOA 3GNSA 5DIZA 3D5QA 2ZE8A 1R64A 2JATA 3GLSA 1S89A 2YHAA 3IMCA 1E8DA 1RRMA 2F8MA 5JSUA 3RAEC 2PHZA 2ANCA 1H2EA 5CA0B 2WVAA 1R4MA 1BD4A 2B98A 4KZPA 3P7MA 2CUZA 5DGIA 4TRRA 1R12A 4QECA 2PG3A 3U40A 2HZ7A 3M5PA 2J1LA 2ZR7A 1CR6A 1BYIA 1U2ZA 1DC8A 1AURA 2OENG 3B6IA 3IESA 3PC8A 2VUSA 4LVCA 3QEKA 4OKIA 4OP1A 1P33A 2GF2A 2WNIA 1P3DA 1FVOA 3F6YA 3QPVA 1C4KA 3A1FA 4UUOA 3V46A 2IYLD 3L4BA 1P0FA 1OJ7A 3HCEA 3GQBB 3LT1A 4HWSA 4M89A 1HV8A 4YAGA 2PMKA 3Q3JB 3TLKA 4X1KB 1QQBA 3R77A 2ORYA 2R85A 3T5DA 3TEFA 5BQ3A 4NRDA 4QYMA 4DZRA 1ZGBA 5AIAA 3ZI7A 2A5YB 4M1OA 5TGZA 1UINA 1UM9A 1UP6A 4Q9NA 3AHDA 4PVDA 5DX8A 4N3AA 5JSZB 1C9EA 3TZLA 4YCSA 4R68A 3Q0TA 2AQHA 2ZSDA 4PM4A 3OJFA 3AEQB 4LF7B 4ZQFA 1D9XA 3GA7A 3O74A 3CPJB 4F5ZA 1YS4A 2C2BA 2EXXA 2WHYA 4FYHA 2P3QA 3K9HA 1O1YA 1V43A 3MTIA 5EC8A 2M6RA 1Z8HA 1F3OA 1LBHA 2IEIA 1CSEE 1SG0A 4JVLA 2BHLA 1SHJA 4O63O 1JXMA 3DAHA 4QDUA 4XTCS 4ZVTA 1V71A 4RTLA 4WV3A 2AQKA 2I4NA 6REQA 2OCKA 2OB1A 2IS1A 2C5GA 1PYDA 1J8DA 2I76A 3Q98A 4PSCA 4WA7A 3U09A 1C8KA 1MIOA 3P52A 4D3FA 4URXR 2Z95A 4XUGB 1ZG3A 1TQ8A 5EJAA 5FWYB 3G2MA 4A82A 3KOOA 1PGOA 2R3SA 3E22B 1O94D 4A16A 3HO1A 1T9GS 5FQOA 2WIBA 2GSDA 3CB4A 1EQUA 5F1YA 1OKKA 4RPLA 3HDYA 3U4AA 2QTVA 4F8YA 1E5VA 2YYZA 3S99A 4E5KA 3VH1A 2I6QA 2VYNA 4P98A 3H9EO 2FUKA 3GYBA 3MWYW 1NBEA 4HLNA 4XQCA 4CM4A 3VR6H 1VB3A 3C15C 3I9V6 1SY7A 3Q2OA 4OHYA 3EAGA 5B7QA 4DDKA 4ZYUA 1K97A 4HLQB 1JLRA 1I9GA 2I5PO 3EDRA 3QV1A 2FFHA 2BM1A 4W1RA 2O2IA 1PQUA 5B2FA 4ZCMA 1W0CA 5E4FA 4RFVA 1P0IA 2WJJA 4GZ6A 4L07A 4Y98A 2O1SA 1W30A 2I2FA 4MV5A 4DN6A 2PZGA 1YS1X 2H5LA 2J0EA 1N2JA 3E8XA 4QVIA 3OEHD 1N2ZA 3FMPB 5JVDB 1Z5WA 2W37A 4OQEA 4RGVA 4B87A 2RBKA 1NI3A 4DV1B 2XEXA 4F60A 1A04A 4DDVA 8ABPA 3L1KA 3QFCA 3D81A 2I62A 2HDOA 5DI9A 4YN3A 4KX5A 1BEZA 4CPDA 3D1JA 3CVWA 3H9UA 5AKJA 4KJXA 4LYGA 5CVVA 2HA4A 5FR1A 5KTOA 4ZYYA 2CKDA 2QSUA 2XNHA 3LZCA 5G1PA 2XVXA 4GIBA 4RKEA 1FDIA 5AVQA 3FPHA 4LCJA 4Y9RA 3PDWA 2PVSA 1EDBA 1P4RA 2E2WA 5F1OA 3T9EA 3JYOA 5ELXA 1C0LA 1COWA 3KQOA 3MS4A 4N01A 5CTJA 5ALPA 4REQA 5CFRA 1IEVA 2HNKA 2QJWA 2R8YA 3W5BA 4CEHA 2GBPA 3R5KA 3T3EA 1BOFA 1H94A 1JHXA 2PGJA 3N70A 4BBZA 4C6TB 4AY6A 4R0VA 1D1PA 4CFZA 1M6EX 4KE9A 2C2OA 4M36A 2TS1A 1E3SA 3ACBA 3K05A 1FXSA 1C7FA 3DE3X 3KSRA 1ZM4A 1FRVA 2PE5A 3ZGVA 2VNKA 2C9YA 4X7PA 3RTAA 3QPBA 1ZMTA 4LBZA 2Q62A 4TKLA 2C57A 2J9FB 3AU8A 5U1PA 2IBSA 1XWFA 2OBFA 2F3SA 2C42A 4H77A 3L40A 5DYNA 2G77B 3CWCA 3RK4A 3AK4A 3NHZA 3TLCA 3WJ7A 5H82A 2ZRBA 1CEYA 4D3SA 3AKEA 3SEQA 2ZRGA 2IZOA 2WWIA 2VDPB 4UBJA 1QIJA 4BMNA 2FPIB 4HO1X 5KU7A 2JFHA 2W48A 4Y7DA 4YXFA 3FZQA 1T1SA 4QGHA 4CM5A 3G8BA 1FEZA 4BU0A 2EF1A 2V4UA 1XHEA 1UBOS 2HPZA 4LHYA 4MNTA 1O9HA 2UZ3A 2XVYA 3DOIA 1HMYA 3GEDA 3AVQA 3O21A 1XVVA 5JD3A 3HM2A 2P1ZA 4P4SA 4ZDJA 1LTKA 2EQ5A 3OICA 3DMGA 1FFDA 2XTJA 4E94A 1LBSA 1U8TA 5LQKA 1WW8A 1WHSA 1TO1E 1QMGA 2PLNA 2ECPA 1Y8QB 4US1R 1Q57A 2DLNA 1AGRA 1IQUA 3G0BA 3PFNA 4TMZA 1TZ2A 2ES4A 2NQ2C 2ONKA 2B4YA 3HJCA 2FG6C 3L7IA 1DDGA 4KK4A 4V02A 5CVCA 5EWLB 2CFCA 4M60A 3TZQA 3AHFA 1QHEA 2O3JA 3I39X 3PDCA 2QB5A 1YSCA 3HO6A 3LC1O 4G5OA 3N2EA 4HTAA 1CEXA 2NTYC 5LPNA 2CLHB 1RJ9B 1PGPA 2FRDC 2VBGA 3C4JA 1Q7TA 1PJTA 3HBFA 4UHEA 3TL3A 1I33A 5CYOA 1JIVA 3RE1A 3GCXA 2BRUA 4P2GA 1IG3A 3PR1A 3Q7QA 1V5EA 3K32A 1M7GA 4JMPA 4WESB 4XH9B 2LE0A 1FSGA 3LXXA 5TMPA 4Z51A 1C1XB 3DHWC 3H97A 3DPIA 5AW4A 1VL0A 4BNWA 4ZQGA 1U0HC 3IQZA 2AQIA 4CIYA 5ALXA 6Q21A 2CXQA 3RVJA 4H0CA 2RSLA 1TEXA 3BREA 3FKSA 3ONNA 4O8CA 1CY2A 1FDUA 3FPJA 1D4AA 3WWOA 4GKVA 1GVNB 5BSTA 2ZIEA 1P6QA 3A4LA 1OXSC 3CWQA 3Q0EA 3ZV7A 3C6ZA 1K8QA 2Q3DA 5JWOA 1THTA 1Z6QA 3C6QA 3LQFA 4UVEA 2HX1A 1IVNA 2QRNA 4G5YA 3MWLA 1CEQA 3ZS8A 1GNLA 1CUXA 3PEUA 4MQUA 3S68A 5EJ5A 3BULA 3H2SA 2HQSA 2RAFA 3EF0A 1NAIA 4RVNA 2VQDA 4AZTA 1CDDA 2BBSA 4JY7A 5EP4A 2RGRA 1DMRA 3JPYA 4NJEA 3CA8A 5GQSA 2I78A 3WL4A 3W5AA 1KY2A 2PQ2A 3BCHA 4C30A 3PX7A 1ZY2A 2UUAB 2GPYA 1JMKC 2BCEA 4KP7A 4PG7A 3A0UA 1R9NA 1SCBA 2C29D 2VJKA 4PQRA 4C78A 3IBSA 4MRNA 4CKCB 3O95A 1RWKA 3KKKA 2FI1A 4IDOA 1Q0UA 1HUQA 2HU8A 2H0RA 4KHZA 4JI6B 3UMMA 3C3CA 3JQ6A 4JLDA 3OLYA 4LV6A 1C3XA 4X91A 3X1JA 3AF4A 2PH1A 4YXWA 2WF9A 4KFSA 2DPXA 2R79A 2R4UA 3Q3VA 4ZOQI 1N7JA 4OF4A 1TYAE 4CUJA 2VHEA 2BTQA 4AJJA 4EB6A 9GPBA 4WKCA 1PX2A 2QRGA 4HWRA 1OA1A 4QUBA 3K0HA 3TTSA 5HXAA 1CUVA 3A6FA 2QAGA 3OY7A 3I4FA 5JAHA 2XCSB 2QZ4A 2EFEB 4G0YA 2MSNA 2PL9A 4OFXA 3UY4A 2JFQA 1MO4A 2DRIA 1SCJA 3BMOA 1Z34A 1X74A 1JEAA 2BCJQ 2YJ3A 3GIWA 4MR9B 3LDGA 3GRUA 4BVBA 3DL7A 2HCTA 4B82A 5LDHA 1V6CA 3MRVA 1XEAA 1IB6A 2HU7A 3IQWA 4RA6B 4XDHA 3SZLA 3IKMB 4P8RA 4Z4GA 5JXJA 3QPWA 2JJ2D 3EC7A 1OAKA 1A95A 3K9LA 4GL4A 1UBNA 3MT9A 3TIFA 1NQ5A 1YQTA 5AI5A 2AOUA 3KQMA 3K0AB 4FS3A 4XD7A 1B93A 2QI9F 5FL3A 1OSNA 2HWWA 1HMPA 2J9YB 2Z8YA 1P6XA 3U7HB 3CUSA 3F3KA 4CF4A 2ZB4A 1FQJA 2NTNA 2PQ6A 3ELBA 2AFVA 2HK7A 3SJ7A 4AX8A 2RAPA 4HK4A 3RQIA 1GUDA 5LJIA 4QUHA 1N9KA 1E0SA 2F3QA 2POQX 1F6DA 4K6MA 2BGMA 4DIKA 5TPZA 4CNBA 5ICGA 1CQJB 5DM2A 3CU5A 3PC8C 4NFHA 4N6OA 2QX6A 3FDFA 3K5PA 2V7WA 2V59A 3PX3A 3EPJA 1AV6A 3DEFA 3UK6A 3FLMA 3WGGA 4JENA 2NUTB 2FG7C 3L4BC 5FA6A 2OM6A 5K0TA 5KYGA 3P1JA 3SS8A 2GXUA 4Y2HA 3BWYA 3ZU5A 1VLVA 2PS0A 1SUIA 2HU5A 4R69A 1RPJA 3I52A 1PK7A 1WBBA 1UBRS 4I5IA 5DTRA 1NUQA 1KETA 1EP1B 3BBLA 5G0UA 3VDXA 4XVQA 1W8DA 2JAQA 4PIVA 2ZEJA 2VJAA 2HREA 4Q01A 5AI6A 1ZVQA 1CERA 4R1MA 2VSQA 3T7RA 3QU2A 1RACA 3E7WA 1VJ5A 3O0TA 3WLMA 4PZDA 2CYAA 4J2HA 4BNNA 1MENA 4H1VA 4R1NA 1X7YA 3BHNA 4B33A 2XXAA 2FXVA 2R6HA 2BBTA 3HDTA 2XAAA 4Z4HA 4CDGA 1CFZA 1H3NA 1R50A 2XD4A 4LRSB 4X6YA 4YGYA 3PC4A 4RGBA 3R3HA 2OV3A 1JBKA 3QELA 2R7KA 1HNXB 2ROQA 1LBTA 1ZFNA 2QLMA 3FSGA 1DAIA 3OZGA 4REMA 2XHZA 2QUZA 4Q1BA 821PA 4HUTA 1J00A 3BA1A 3NR2A 3NP9A 4AO6A 5KNDA 4ZIRB 3LKDA 1WDTA 2YJNA 2P3OA 4R2IA 3R7WA 4NZ9A 3T0GA 2V6IA 5TXGA 5AMXA 4RWEA 4YYZA 3TXXA 4E51A 3OECA 4D9CA 2CFOA 2WZDA 2OXEA 2V45A 1QR6A 3R1IA 1OD6A 5DM70 1UKVY 1X42A 4B47A 3HWWA 1S1MA 1VI5A 3BPSA 1E2PA 1XALA 1C7JA 3QK7A 5G1OA 3IHLA 2IDZA 4LF8B 1H5QA 2GVNA 4Q93A 2Q3FA 4WNAA 3K30A 3AL3A 4BE9A 3RRJA 1DRKA 1QJCA 4TYNA 1LLCA 3BDAA 3R7BA 4F1JA 2HAEA 1U7HA 1ZQ9A 4GU5A 3P9ZA 1OZGA 3GMTA 1PVOA 1N92A 3GBSA 3OU6A 3SU8A 4R51A 1KE2A 4K1LA 4RHFA 5EIHA 2ADMA 4KPYA 4GSYA 5D5HA 3OUUA 1Y6JA 1HT1E 3KKOA 3A2LA 4FX2A 4WLUA 4CM8A 4DLSA 2V54A 4E5DA 4DCPA 4KIGA 2XYQA 1Y8AA 3CLRD 3ZVNA 5EA2A 1U5BB 5FEUA 2IP2A 1KKMA 2QBYA 3ORQA 1PZXA 2Q5EA 6GPBA 2CC2A 1XL0A 2XV1A 1T1GA 1QBKC 1WBJB 1Y34E 3D3QA 4LJ7A 4QT4A 1UC4B 2AFHE 3DBVO 1Z47A 1IC6A 1WSWA 2W6CX 4TLBA 1NVVQ 2BKEA 3HA2A 2X7XA 4MVJE 2EG5A 1RPTA 4FQ8A 4O4HB 4YMSA 4AIIA 4D3XA 4QOHA 2H1LA 3JWHA 5E9AA 3SQWA 4MYDA 2R25B 3NVAA 3EFBA 3TAHA 3U7RA 2PZKA 2OO5C 1LI4A 4A6PA 4YRRA 4RF5A 3F67A 2FMHA 3UTCA 4LRUA 3A6HA 4WBNA 3DYVA 3FOWA 5IH7A 2PUHA 5HM6A 3ZV3A 1KPHA 1ZN8A 3C3XA 2XMZA 1ZWLA 4PLYA 2BMDA 2Z2IA 4QYWA 1HOXA 2B36A 2MR6A 1IN6A 3PUZA 4MUBA 4NZOA 5I7OA 4NFYA 3PUWA 3RG2A 1EUDA 2WWTA 3BL8A 4DGSA 4F4IA 2PZMA 1HG1A 3IDFA 3M4JA 4MKXA 5IS2A 5T41A 3HB0A 3GJTA 5M34A 4PHTA 4QPJC 4RNCA 1SK9A 4RZIA 1QV6A 4R3NA 4XIYA 3SJUA 4CM6A 4PAOA 3FOEC 2O8EB 4EECA 4F5YA 3SJAA 3UAXA 2Q6VA 2C4UA 4EARA 2CHFA 2DQYA 1O94A 2J33A 1ZU4A 3RTBA 1FLAA 1YBHA 3N5CA 1RQ2A 1TT5B 4QQNA 2DFLA 3QVLA 4ZDIA 1X1EA 1E2GA 1CTQA 1M1XB 1MAAA 1HYQA 3KE9A 1J22A 1ZRMA 2OMEA 1S7CA 4JGIA 2AKEA 2GD0A 2ZG6A 4OHXA 4XA8A 2YN4A 2DU8A 1QRSA 2VH1A 3IAUA 2ENUA 1O6ZA 4C0WA 2X4LA 1PLKA 1R4MB 4MYHA 1QTNA 5K3DA 4S2UA 1MXFA 2FQXA 4RXUA 3ROPA 4XLTA 1VI6A 3CRMA 4EB3A 5L3SA 2JJ1D 1M7BA 1OVMA 3M3PA 5K8UA 3PNOA 3CKMA 3HKCA 5FPPA 1NFQA 3GXBA 3GPCA 2GQ0A 2IPMA 3PQ4A 4PCLA 4QQ8A 1YQQA 2WKWA 1F5SA 1RE1A 1HFWA 3D7RA 1XA0A 1UM9B 3WMRA 3I1YA 4CMIA 2OHFA 3LDUA 3HLYA 3IAXA 4ZT2A 3E7PA 1GVHA 1ZIPA 2GEDA 4HDKB 2FPGA 3OEHA 3AUAA 1M2HA 1ZEJA 4DR2B 4E2XA 5JPCA 4Z0PA 3VU8A 3E8MA 1QHGA 4P7BA 5JNTA 1GQQA 2IJGX 4HQFA 3T7KA 4RTMA 4KNWA 4LKOA 3DKIA 4BFSA 5ALZA 2PBLA 1UIRA 4KDCA 1Y7TA 3A36A 4WZBA 4OJKA 6REQB 3L9WA 3NHRA 3BH7A 1JNXX 3BEDA 5EE5B 3ICOA 2UUBB 1QO7A 4MWEA 2DWPA 3L6DA 1MIOB 5JYEA 2AYXA 1BGXT 1T5IA 2WDZA 3SZOA 3TFOA 3O47A 4PQEA 4AP6A 1U3CA 5AW8A 5FKJA 4LX8A 4FBMA 3MINA 1Z2NX 1TTTA 3QBJA 4GXQA 1M2GA 5MDHA 3DW1X 1TO6A 1CQPA 2WMNB 1QE5A 3ENZA 3GT0A 3O31A 3QMPA 1KPGA 5CRIA 5LXTF 8ATCA 1S8NA 1RPZA 2QG6A 1MX1A 4OAQA 2FLWA 1ZJ4A 2QTVB 3E3MA 3PUKA 4M8IA 4X44A 1NV8A 1KQNA 4YMTA 3C70A 2ZT8A 3PDUA 1G8KA 1ZD5A 2BLLA 4CM4B 2O19A 2W70A 1VBNA 1RM4A 2EVWX 3L6UA 4Q34A 2M1XA 5H59A 1GJRA 2H2AA 2VOEA 3ETEA 5IBRA 4TLEA 2ZSHA 5JS2A 5WRFA 5M5BA 3F5QA 4ARIA 4AJLA 4YMHA 1WWKA 3I62A 1RQNA 1K27A 2EU8A 3G49A 1YZFA 4Y1GA 5T3UA 2IPAB 4Q4DA 2VDOB 1QYXA 1ZXBA 2CJXA 3AHHA 4JQOA 4CIDA 2EZ4A 1EH5A 1U65A 4JD5A 4D56A 2ZDQA 3ZWVA 3QNUA 1RADA 2OXCA 5LP6C 4FXPA 3Q8LA 1E3IA 2GZMA 4HDMA 4NX2A 3AVTA 2ZSEA 4EJ0A 1OV4A 3BWBA 1DS6A 2P11A 1ZJ6A 2QAGC 5CXXA 3L0SA 1NU8A 4ZTUB 1RJWA 2F6RA 3TOCA 5LBIA 4RSHA 2UAGA 1QYCA 2FJPA 2W2KA 3L04A 3QLUC 4HH3C 4AMGA 3OZSA 1O5IA 2ZB7A 2GXSA 4IJ6A 4JBGA 3T99A 3TXYA 3TVYA 1TMGE 2EGUA 3F6EX 4IDQA 1KQFA 1NWHA 4OUDB 2ORVA 3CTMA 2XVMA 1GQFA 2C9CA 1JG2A 3C3BA 3DTVD 2B94A 1N1GA 3F7OA 3PQ5A 4M9SA 4PR0A 4HGOA 4AJEA 1D7OA 4DSOA 2AC2A 2FZ4A 2PWBA 3AB3A 3LYHA 4CEHB 2Q3JA 4REQB 4WACA 4ZI7B 1DNPA 1PFWA 1R2QA 3UA4A 2G28A 3VZRA 1VXRA 2VDRB 3OG9A 3UFXA 3NGMA 2WJZB 3BKXA 3CT4A 2LUOA 4JQCA 3W2IA 1AGPA 1H65A 4D4JA 2YJ6A 4DQLA 3K70C 4MP6A 2VJOA 2O8VA 2O05A 3KOUA 5FHRA 2DUUA 4C43A 5F64A 4BMDA 3I6BA 3QYJA 1JPNA 1TMOA 2APJA 4IY1A 2HJGA 2V6GA 3BE8A 2WKRA 2YXDA 3BD9A 1E6EA 4TKUB 4TXMA 4LMPA 2AUTA 2FN4A 4EGJA 2F64A 1O0SA 2ECOA 3CPEA 3A6JA 3EMDA 3NTOA 3QXCA 3LQQA 5B4VA 2HK9A 2DPMA 3EA0A 2R1TA 3O2SB 2JAOA 2G9RA 4EPYA 3V8MA 1EZZA 3IAAA 3VR2A 5B7PA 2X9QA 5A3VA 1Z5NA 3NKLA 2D3WA 2HO5A 1JEJA 2M98A 2GCOA 4R3UC 1ODFA 1P17A 3D4LA 3RLFA 4B6JA 2P90A 3UJPA 3RASA 4HNUA 3TQFA 3EQ7A 4GQBA 2JIDA 3ETLA 4M7OA 4G2TA 3ZCPA 1DEAA 1Z6GA 4P4SB 5L4NA 1UZUA 1YFJA 3E4CA 2OBXA 1R3DA 4FMCF 5FOXA 1N3BA 1P31A 1D3AA 2IODA 5H8WA 1E2BA 1ZKMA 2FK8A 1QB7A 2PA0A 3ZIDA 4ESOA 1WHSB 1SKYB 1YR3A 2E4YA 1QPZA 1GILA 2PGAA 3KOWA 1U8EA 2IYNA 5A4MS 1M2VA 3JVIA 1JZTA 1ZCFA 1XAGA 4Q1DA 3RYHA 4Z9AA 5TMDA 1ECFA 4CTKA 3A3OA 4Y2QA 3VR0A 2F4VB 2A1TS 1JYFA 3I8XA 5ITWA 4TX1A 5F7JA 3G85A 1NUHA 4IFIA 3CWZA 2G63A 3DMPA 3Q5DA 1L7QA 2Y4OA 1GU7A 4R9SA 4EUHA 5IKPA 1M66A 4WFIA 4L5JA 2HMVA 5I3ZA 2P65A 4MUFA 2WWHA 4KVAA 4LYFA 4RADA 2WC1A 3UH1A 1A72A 4OL9A 3WQSB 1Q95A 1KJ8A 2IYAA 3K7EA 4GGPA 3KELA 5EWJA 4ATNA 1ADGA 3EGOA 3UAVA 1T3HA 3BGWA 2OEPA 3C7CB 2CFRA 1KY3A 3CX6A 4CN9A 5DX0A 1ZGHA 1V48A 2FJ0A 4K86A 5E38A 2XE8A 1JPUA 3TL6A 3V2UA 3DLBA 3HWRA 2JJ2A 5EFOA 1DT3A 5JT1A 1J5PA 4TUYF 3BQ9A 4P6VF 1PV2A 4UUMA 5EJEA 4TRNA 4F3CA 4WSOA 2DETA 1Q0PA 3L02A 4TPKA 3WGMA 4HFNA 3MCTA 9LDBA 1VMEA 3PL5A 3VNAA 4DAEA 4KGDA 4GSLA 4HAVA 4NQRA 4A0QA 3GLFA 1Y48E 3SYTA 2DHCA 2ZAIA 3IVRA 4QUJA 4UE3S 3LUKA 4GO1A 5FUVA 1DX6A 1JHOA 2N0SA 4EY5A 4LF5B 3HA7A 3NJRA 1DO8A 4Y2UA 3HDVA 3VTAA 5B1EA 1K6EA 4IIJA 4QT0A 5JXIA 4RTQA 4GOKA 4JASB 2ORIA 3A3PA 1O9GA 1WMDA 1BU8A 4XIGS 3EEFA 1N8KA 1QH8A 4I19A 1V5FA 1UPTA 1N6IA 2O2SA 4JXJA 4NJEB 4PZ9A 2XNJA 3Q8WA 2B30A 1KU0A 5HA5A 1X1AA 2RHRA 2Y66A 3ZVLA 1S02A 2FPLA 4XGNA 1PZFA 1A5BB 2QTAA 3SHQA 3FFBA 3DLHA 4Y8VA 3F9RA 1ZZEA 2MU1A 4YIKA 1K75A 1MBZA 2C1EA 3RI3A 4G0XA 2XSZD 5ALNA 4L27A 1NUTA 2JLUA 2R8BA 1L8XA 5K3CA 3ZDYB 1I01A 4FNOA 1VBKA 2LCQA 4RD6A 1F4VA 1T8TA 2QSJA 3GEMA 3T9BA 4B4WA 1RAHA 4ZARA 2BTQB 2C2WA 4EB6B 4ZJUA 1IH8A 3C7DB 2DT8A 2WRZA 5H7XA 4QTYA 2QAGB 3C4QA 4BP9A 1TU0A 1YZUA 4OX9Y 1SOUA 1WB6A 2L19A 4KWHA 5FBVB 1E7RA 4LSMA 1SZCA 2C59A 3JQAD 1J8FA 3BMOB 5EJMA 2PMFA 3FPFA 1U11A 2PTHA 1JQBA 5TE9A 4O4LF 5SICE 2JLBA 3DOFA 3G0CA 3MMNA 3FF1A 4L85A 3WLHA 4XYLA 1RBYA 1QUFA 1L5MA 4WK0B 3CIOA 3RHTA 4OYLA 1J8VA 1GTJ1 2QTLA 3VTFA 5BSFA 2Q4EA 1O96A 2H9IA 4FM9A 1UJBA 2ZTSA 5A62A 3D2BA 5AHKA 5C7IO 2AOUB 2Y8EA 4NVRA 1O94C 2Z8YM 3WL8A 5HZHA 5C7YA 2AEFA 1VHJA 3DFFA 3QHQA 1AY0A 3C14C 1FUKA 2QVYX 2FZKA 2ZSKA 3GDGA 2ATVA 2FR0A 2QRLA 1UXOA 4Q7KA 1KWKA 2IU0A 4G0QA 4O6VA 1E66A 1T6YA 3FR7A 3C6KA 4WK2B 2IV7A 1IOLA 3T7CA 4BMCA 4RHEA 5LYJB 1WUKS 3NKVA 5DYYA 2WF7A 5ER6A 2VJBA 1C3OB 1G41A 1BQ4A 2WSIA 121PA 1ZSYA 2BMWA 4MWOA 5ICCA 4G0MA 1RBMA 1T0PA 2HLPA 2LVBA 3FRJA 2QI9C 4ENPA 4UC0A 5EERA 1GTZA 3IHWA 4NBNA 1MEEA 3T3IA 2R44A 3MUNA 4QGGA 4OXNA 3RJ9A 3ETHA 1XEFA 1GDTA 4KO3S 1Z0IA 4KSCA 1S2IA 1QDUA 1U3DA 2X8LA 1EFTA 1MB3A 1I4LD 2IH5A 1X9HA 1CZOA 4XCXA 1EXDA 1QNLA 1YD7A 4LY6A 3ZQ6A 2NU7A 3QXSA 4CBVA 5AJWA 1TEHA 1EJ6A 1GU0A 3IE0A 4ND8A 3T3PB 4DMGA 3NWJA 4TSFD 2QORA 4E5UA 2Q5HA 4GFDA 2ID8A 5T5QA 5EIFA 2W2PA 4AECA 3EF1A 3MCZA 1X7YB 2Z1NA 2X9LA 4P54A 2DCUA 3PWSA 4QO8A 3IBYA 2H5EA 1UEIA 3L77A 3ZD9A 4DVGA 4RC9A 2HSZA 3QELB 1T29A 3OE7D 2CNDA 1ISGA 3SDSA 1WUJS 1B7GO 3F8TA 3ZOKA 5A2GA 4W9MC 1KS9A 4BAGA 2QR3A 3JQBA 2AN4A 4BASA 2OMKA 1U5AA 5KMGB 4UM5A 3KU1A 3PJGA 1C9YA 5H5JA 4IHJB 1DTWA 2AMLA 3OF2A 3R7WB 1FTSA 4Q02A 5FBWB 1UBSB 3Q6NA 3ZHBA 1YBVA 2AC4A 3M4ZA 4IMJB 3RSLA 4WWHA 3GJ8A 4FHCA 4GQIA 2OAP1 1SHLA 2WAXA 3H65A 2B7BA 3A8TA 3A9WA 4DC0A 1V4VA 3COZA 1H4QA 4U0JA 4KN9S 3TMKA 5K4HA 3EGIA 2E48A 2YWDA 1UR5A 2FSHA 3FCEA 2GYUA 2XQJA 4WNAB 3T5PA 1YHZA 3LLUA 4A0HA 2B8EA 3UICA 5IM4F 4XEUA 3KQWA 3H18A 2BLNA 4AJ4A 3GI1A 4BMZA 2C03A 3FLBA 1ULHA 3DEHA 1LPOA 1DIRA 1EAMA 3PL1A 2DECA 1YNSA 1RVV1 1W4LA 3NM4A 2E5WA 4HDAA 3ND8A 2GWRA 2Z04A 2ATEA 3A7DA 1NONA 1EWKA 1KY4A 3LPNA 1GGMA 2FWPA 3EPPA 4J76A 4DUYB 4WFQA 4ZVMA 2GILA 1YJQA 3LUGA 2BD0A 3QVXA 3A9VA 3EXFA 3QKWA 4TUYA 1E6KA 2QBYB 3U1BA 2PGDA 3O8DA 2P4HX 3E9EA 2JJ1A 3WIDA 1II0A 4WZAE 3DDUA 5BXYA 3FWPA 1TOAA 4CV2A 4DEYA 3NIGB 3UH0A 3WR5A 1JDJA 1K2WA 5KNBH 4YC7A 2QD4A 3OZ7A 1CQZA 1MO6A 1DLJA 3AVUA 2VH2A 3LLCA 5C1OA 1X1CA 1QTQA 4K40A 4PBSA 4U5XA 1JVBA 4JJKA 2A9KA 5I8ZA 2GFQA 3NAMA 3TM5A 4WBNB 5A2QA 4CF7A 4Q19A 2H17A 2XDAA 4KI7A 1G7RA 3JQGA 2DUNA 4KR3A 2QRHA 3U0VA 5LQAA 4LCBA 2NMVA 2LWIA 4IIBA 2IGTA 4EGQA 3NIDB 1JU3A 3WAJA 4ZT5A 2OOKA 1Y37A 2PBRA 1DEHA 2YASA 4OQ4A 4IQFA 2R62A 3CINA 5DSZA 3MTEA 4ISBA 3WS7A 1M83A 1EUDB 5AK6A 4NOJA 1XTTA 3L8EA 4AJ2A 4BU1A 7MDHA 1NBAA 1SVWA 2P9QA 2Q1WA 1RI5A 3DL2A 3PA6A 3R3SA 3FYSA 1L5HB 1UDAA 3H2JA 4DLVA 4UMEA 1VHQA 4A27A 1XDBA 3ABIA 2I03A 3ZXYA 2RHWA 1ZH8A 1EX7A 2ZRMA 3DE4X 3DR5A 3X1XA 5ELLA 5CDHA 1FNBA 1HURA 4GUDA 3W4IA 2H2FA 4Q9DA 3WLLA 8MHTA 5D6NA 1R9GA 2YH2A 5CT9A 2UYGA 1U2SA 2BISA 3NAGA 4NMXB 4WECA 5FIUA 2J07A 3AR4A 3PC6A 4YAWA 5LM3A 5F9FA 2R6FA 5D3ZA 1NLYA 3S6JA 3WL3A 1U8CB 4K3UA 3T1YB 3K8ZA 4N41A 2AUMA 4JI1B 4CZ2A 3UOGA 4F7DA 4W5QA 1GNQA 1OX6A 3CH5A 2G80A 4PRKA 4PYOA 1ELOA 4S2EA 2RI6A 9ATCA 1U3TA 3BN3A 3QVMA 4KFTA 1WVGA 2E6UX 4KQFA 2BIFA 3HKCB 4RJIA 2QN1A 1UBUS 1NVAA 4BJ3A 2C5FA 1PHRA 4H0FA 1ESEA 4NLLA 5K8JB 1YS7A 2F1OA 4P7JA 2XMGA 3CUVA 4B2LA 1JSXA 2FZEA 2YDYA 3UKJA 2WU4A 1NW5A 4UM7A 5ALIA 4KUHA 4ZI5A 2JH8A 1M74A 2O7NA 3QUCA 3W7VA 3G89A 4FMPA 3ZHQA 3JAWA 5KYVA 4FJ0A 2RC5A 3WWYA 2FPGB 2NN3C 2PSEA 3V4VB 3PA8A 3PNLA 5J9FA 1T26A 2RMKA 2Y1DA 4BIMA 1GYQA 2Q4BA 2DOKA 4V0ME 1KJNA 3D6HA 4DR4B 5C2JB 4EKIA 1XMIA 3FRHA 1Z25A 3TLYA 1L5OA 2PTGA 2Q3HA 2I8CA 4EABA 4WZBB 1CXZA 4EA6A 2RHLA 2F8LA 4IVNA 2AYZA 4XVRA 3WGVA 2D13A 4HXFB 1YJCA 5BW5A 3UJCA 1BDIA 3G9UA 1K5HA 3DTVA 3EZNA 3QQ5A 3SS7X 3G7SA 3DLIA 2YVLA 1Q6YA 4KEAA 4B6PA 2NZUG 1YRBA 4CW7A 4MDEA 4UAGA 1KRXA 3A2KA 4PICA 3MINB 1HM5A 1L5GB 2ZR8A 1Q44A 5DYWA 4LW8A 8OHMA 1JHRA 4Q48A 3T5MA 1RYMA 2VDVE 1HZZA 3OT4A 1S8OA 4BO2A 1XXHA 3Q10A 3C74A 1J0EA 4RZ3A 3TO5A 2DC1A 1VC2A 1H6CA 1FS5A 2GNPA 3C0KA 3EC2A 3QVTA 1UKEA 4JYBA 1PG0A 4RABA 1M1NA 1WXIA 4PY2A 3UNXA 1FS4A 1W87A 4H27A 2OA0A 1NSTA 3DBOB 4Y1FA 2YBDA 4UVHA 3ERCA 4YCNA 2EX4A 1N6LA 4U63A 4G41A 4DYDA 1E2HA 3Q72A 3ZCVA 3AUXA 5UKDA 3BG5A 1X0VA 3K4QA 1DFIA 1K9SA 4HDQB 1C0PA 3IOBA 3KVRA 1IBLB 2JFGA 4BKPA 3JZFA 1Y7IA 4FYIA 6NULA 2IUTA 4NPAA 5M7EA 5TNXA 3ZTTA 4B3HA 4P86A 4JB0A 1DE0A 3V8EA 1HQCA 3SKXA 1ISIA 1ONBA 3W5SA 3F74A 3ZS9A 3Q7TA 5A3RA 5LQJA 2D6FA 4HL6A 1XKQA 3FNGA 4OGFA 5E3IA 1GFWA 3N3BC 4HDMB 4A26A 1LV7A 2AWOA 2AN9A 2OBLA 1FF9A 4FMBB 3QWBA 4XIJA 4ZXPA 4F97A 3ZE1B 2VHUA 1RYEA 1UEXC 5IKOA 2LDXA 3RUHA 2W2KB 1OCEA 2WMOB 4IV8A 3X43A 2CXPA 3C7AA 3GEIA 4P5PA 1IONA 3CLVA 5FADA 3OKAA 2AE2A 1H2BA 1SXQA 4MRAA 1TQ6A 2ILVA 3G79A 3KHKA 5FLKA 2A4MA 3TBHA 2QT1A 1N2EA 5B7GA 4LXYA 4RLHA 2GXAA 1GQSA 2A67A 1ML3A 5KCZA 2IDMA 3OU7A 3RSGA 4ECEA 1QR2A 1U8XX 4FKZA 3EVFA 2BJWA 1RLUA 1FP4A 1K5GA 2PSFA 3UFXB 1N5DA 4LXIA 1EBUA 1TM7E 4M0MA 2AF3C 7AT1A 3K4PA 4JKYA 4DIOA 5AVUA 3LDFA 2FTKE 1S7GA 2G0TA 1M2FA 3I42A 5FV7A 4BPRA 1JE0A 3ELYA 1RRKA 4NE7A 1KK0A 2Z4SA 5D8DA 3A4TA 1U8YA 4R54A 1DWQA 1GNPA 1VG1A 1ZKDA 1WVIA 2JLYA 1Y3CE 2XNDD 2VL7A 4TTSA 2F00A 1KKLA 1QTIA 2VTEA 1ZM3A 2Q0QA 3PFHA 1KI9A 2IEGA 1G17A 4ODIA 1LC0A 1GDHA 2R1TB 5E7JA 1O5TA 1Z07A 2GPNA 3IERA 4TLDA 5K0BA 2HMWA 1SU8A 3NALA 1E92A 1XV5A 3OEED 4KXVA 2FK7A 1YAJA 5AM3A 1OIXA 1PS9A 4CXMA 2AFIE 3FMIA 4FFNA 4HH4A 3SEZA 2DH6A 2GCOB 1AIPA 1TE2A 3PC2A 5KSPA 3IT0A 3ZHXA 4ASUA 1TMKA 2DJ5A 4W7HA 2WBLC 4B4VA 4BB0A 4ZK6A 5LQNA 4JUIA 1TUGA 5F4ZA 5F23A 1NW4A 1UXIA 2P67A 1V95A 2WHQA 2WM2A 3NHLA 4O5OA 1FIUA 1UDRA 3BWCA 5EZYA 4ZAYA 3T54A 1MC8A 2P2LA 1VP9A 1LC3A 2P30A 3LPDA 3IOEA 4XPIB 2IWHA 5KQMA 3HTXA 1RT9A 1ANKA 4YP6A 4GX0A 1L4MA 3AJEA 3H99A 1M2VB 5JS6A 1FYVA 4IVRA 5H3CA 3RYHB 3EVDA 1AK1A 1FE8A 2O5CA 2WAMA 4DB2A 3CG4A 4PNPA 3C3EA 3HNPA 3V1YA 4JI2B 1RWOA 2G4VA 2GD2A 5C9ZA 3BUSA 2VK4A 1BRMA 3V4ZA 4ZMBA 4H7DA 2EQBA 1ORIA 3DMDA 2WTXA 5KYWB 1MKYA 3JQAA 1TJ5A 2EV9A 1EUYA 3FZYA 4DSNA 2PO5A 1H2RS 1V8BA 3GCGA 4DDMA 3MPUA 1Q7GA 3M6FA 4KO1S 5EWJB 2HY7A 2JI7A 2GGSA 3KC2A 3SF8A 1GL6A 3W9SA 2ZUFA 1ZS9A 2GHIA 1F6BA 4RS4A 3KQPA 3LPAA 1OV6A 2IXFA 4KCGA 4LJSA 1YVPA 2CNLA 4XJXA 1T9ZA 4DM4A 3K8QA 3NHKA 2RKBA 4OI2A 1PGJA 3IAS1 2BF4A 5G4KA 3SSOA 2AI1A 1SUWA 4J16C 2QYOA 5J4YA 1M8PA 2TMYA 3GLTA 1J99A 2YQ5A 4RZQA 4C06A 3GLFB 4QGSA 2IEDA 3VGPA 4BC0A 1QGUA 4W9RA 1H9CA 4E1VA 4L9SA 4JQYA 4LJ4A 3BXXA 1SN7A 4LZWA 4WOPA 3BJRA 4FOLA 3TNLA 3ZE7A 4IIJB 1W19A 4KPGA 2QLNA 1OI7A 3KIPA 3N2KA 4EYQA 1VLZA 2QTGA 2GJKA 4LUCA 4ZQBA 1E98A 3AKCA 3DDNA 4XFKA 5IVHA 3HJGA 4KLRA 1TJNA 4ESHA 3K0CA 5LXTB 3LRPA 4UBMA 1GR0A 1P61B 3COSA 4ERNA 3JQEA 4WA8A 2JEZA 2WLTA 3HQ4O 2HNBA 3EWSA 3GPDG 3T4PA 3WGNA 3GFQA 5JYCA 4GPD1 4I4TF 3W5VA 3CPHA 4H1WA 1G5PA 3L93A 2A92A 3R5TA 1IK6A 3B1WA 3PHIA 3SVLA 2C9ZA 4RPJA 3R6GA 3R24A 2XUGA 1DOHA 3SFTA 3BXFA 3GDFA 1QP8A 4TSFA 3CMCO 1VYUA 1DKMA 1P5HA 2H4JA 3CXRA 4M49A 4IVQA 4WNYA 4YRNA 1NR1A 3WJAA 2KE5A 1KEEA 3DWIA 3FETA 3G0DA 1N0VC 1I6MA 1ZBQA 2YWCA 4JWKA 1R8XA 1KXZA 1NVDA 3VSAA 1AA9A 3DHVA 2RJNA 4EI8A 1AZLA 2CF5A 5KTTA 2Z1DA 2F55A 1ZCZA 3OE7A 2ZDHA 4Z5XA 2LDBA 3IIJA 4TRMA 4XM2A 1OTYA 1GG5A 1RLOA 4BKQA 1BDJA 3NQ41 1O96B 5KJEA 5DHSA 7GPBA 2Q2NA 4IPTA 5JBQA 2W2MA 5FTMA 3FAZA 4HR7A 4HDNA 3DKRA 3HY3A 4J29A 1GRVA 4CU5A 4S05A 3AKZA 2WVJA 3DEJA 1RM0A 3DMHA 3PEYA 1FJ2A 2PEYA 3BA6A 2GBLC 3EZGA 4EX7A 4LJ9A 2PJUA 1EHCA 2HD4A 1NVKA 2O07A 3DDWA 1C8LA 1HE5A 3K2EA 4KBGA 2YHSA 5E9QA 4UBNA 1QK4A 3ROQA 5JRDS 4FBLA 4YRSA 1EEHA 2VPYA 4QODA 1Z6AA 2QUJA 4A1FA 2C31A 1KEWA 1QK3A 1ZZGA 3WLIA 4R6WA 4UHJA 3IMKA 2GJ4A 4QICA 5B3JA 1DRVA 4J9UE 5HWSA 4P0PB 1Q16A 1IBCA 1CT9A 1Q7CA 2ZJ6A 3H1BA 1A5AB 3CT6A 4MEBA 1YDHA 3WGJA 2O2HA 3Q0IA 1E79D 1SH7A 5LBUA 2O06A 1FJGB 1ZSNA 2H0QA 4JLPA 4X85A 5IKEA 4NMWA 3VI4B 1QZXA 4U7PB 5IKXA 4JJEA 2OCXA 1E3MA 1NN0A 2G67A 1LVHA 3DM9B 2X58A 1FP7A 3FA2A 4AYXA 4NI5A 2B9VA 2CJFA 2NU7B 4J03A 4ND8B 1SUCA 3PNKA 4IDAA 3LUJA 1N6OA 5CD9A 5CVTA 5FV4A 3V97A 1F4LA 2QN6A 3TKLA 5I7FA 5FT9A 3EVZA 3EH2A 3TBKA 4HTFA 4B76A 2ZBVA 3L8FA 3G8YA 1MFPA 2PMCA 5CK5A 2VSOA 1AQIA 2NNLD 2RGBA 5F77A 1Q91A 1Y1QA 1M2WA 5CH5A 3IEPA 3HBNA 1JWLA 1AXEA 1XK6A 5K05A 3CNLA 4UBIA 1FVFA 1W46A 3FNIA 1V96A 3CW9A 4C1BA 4RJKA 1XKLA 2Y0BA 3PC7A 4JDUA 1O0CA 5JYDA 1U3WA 3STUA 1TEZA 1DTWB 5KZMB 2AXPA 3ZGYA 3M1AA 4DLRA 4D3YA 4MV0A 2XDQA 1PT8A 2B78A 1YZLA 4BFLA 4DIFA 1X70A 2V7VA 1VJCA 2N1BA 2NZYA 3IUSA 1E2LA 2DPLA 3QXJA 4RD0A 4YT2A 3C3WA 2VP0A 4HGRA 3O83A 1D7AA 1GRRA 1XQ6A 1OAOC 2B61A 3R5JA 4GPAA 1OH5A 2GA9A 2GT1A 3FROA 2ISCA 5FEMA 5C80A 2D1FA 3SYNA 3OMLA 4MIYA 3QVSA 4DXAA 1UK8A 5JARA 3P2MA 4G1UC 2ZYTX 2A0KA 3AFMA 1TJ4A 5GZ3A 4I66A 1K3UB 2EP8A 2XMBA 2VG8A 3ESDA 4FLEA 3WKCA 1INLA 5A4DA 4BVEA 3L8HA 1R1DA 4B6GA 5EJIA 3LXMA 3TLJA 4TT3D 1VLQA 4IQ8A 1E6UA 4MCAA 3E3NA 5CYPA 4AJKA 4DR1B 3E4DA 1BH6A 3TH5A 3PPXA 2QN8A 3EXFB 4C5AA 3UK2A 4DBVO 4TUYB 5EKUA 1BHSA 4RVGA 1Q74A 4NBLA 3NRJA 4K7JA 1IL0A 3NJ4A 3AM5A 3T0IA 2WJAA 3I6QA 3NB0A 1PR1A 1G9XA 4G6ZA 2J3HA 4BMPB 5FPYA 4IJWA 5L3QA 4JEHA 4ZEMA 2WYOA 4MMZB 3AY3A 3NHWA 4X95A 3VAYA 4CLDA 3VMMA 1XQ1A 1HNWB 3VPGA 1T9AA 4I1SA 3A1TA 3JD0A 4QGBA 4JVNA 2NP6A 1UZMA 3AHEA 4TS9A 5JROA 1LXCA 4AMYA 1XIVA 3RIXA 5LMUB 1QQTA 5ER9A 4JA2A 2QL6A 1D4ZA 4YDHB 4DCVA 2G7ZA 2XWQA 3DVAA 4J1QA 4WHMA 3U37A 1XYVA 4M0DA 3LPLA 1E64A 3JQGB 4FLFA 5IVIA 2FMFA 2J3KA 5KQPA 5EG5A 2ZJ7A 1JKJA 4IIHA 1PKEA 2WAOA 4C04A 1IOZA 1AX9A 1JJAA 2A84A 3KE8A 1CUCA 2J5KA 2G7MC 4I99A 4H2DA 4HNHA 1YS6A 3LLSA 3ZK8A 4LZPA 4DR6B 1OT3A 2E0IA 5DIFA 4I4TA 5IYZF 3SKVA 5JNLA 4ZVVA 3TN7A 2RK4A 4U7DA 3ZXUB 1F0YA 1F0PA 4DKXA 4I4CA 1PGQA 3CZMA 4U9UA 4CF3A 4IRUB 1JEOA 2FH5B 2QKYA 3TZ6A 3LAWA 2J7PA 2XRYA 5EUMA 1R0RE 1YJ8A 1UMKA 3W8DA 1SOAA 4NY1A 1WZIA 1M1YE 1UDWA 5HF5A 4DV2B 1JJVA 1KO8A 4XARA 4O5AA 3MGAA 5BQ5A 3LY9A 4NV3A 4QPDA 2FSPA 4ZVPA 3FGPA 2VK1A 5JSQA 1GFZA 1M2KA 4H9GA 4EFKA 4MQMA 1YI1A 3O4IA 2V98A 3GAAA 4C4PA 2GRJA 3LCCA 5FX2A 3IQXA 4KYTA 4QAJA 2X5XA 4BFVA 1Z08A 2A9RA 3SBOA 2BTOA 1B26A 5IM5A 2WA1A 3T3GA 3CTPA 1IN1A 4PX5A 4ZZ2A 4EG1A 3NNSA 1DOZA 5JMPA 5F76A 1E3QA 1FCJA 4AYTA 1ENPA 4KQ9A 4I3HA 3MWJA 1QYDA 3S81A 5K7SA 1I8TA 3Q6IA 4QARA 2OQVA 1W1UA 2OG1A 3MOIA 3IUMA 4KWCA 1X2BA 4OB7A 3WDMA 3EPKA 4Q9AA 2Q99A 4D26A 2P78A 1IHXA 4D3DA 4POAA 1X15A 3W6ZA 4K9OA 2VOJA 3QI2A 2XB6A 3JAWB 1FPMA 4CHGA 5FOQA 2X8AA 1L1QA 3RU9A 2X14A 3HJNA 2VJLA 2VHTA 2DUJA 3R44A 4DIUA 1Z3CA 5H83A 1IZ0A 3OTHA 3ANLA 2A9VA 1KK2A 2GD1O 4AZ0B 2ASVA 2CE7A 4H3HB 2F2TA 4ER3A 4P92A 1EVLA 2VPWA 5FI0B 3GVIA 4RVDA 4JK3A 1G2OA 2GEKA 2AZMA 5FUQA 1ULBA 3HXPA 3L4JA 3RSSA 2J31A 3EOZA 3OC0A 4MK4A 3WGTA 4KLAA 4C88A 5JZSA 4IH9A 3DTVB 3ECCA 2LNDA 4DLXA 1B1AA 1ZRSA 2CLDX 4N47A 3FWZA 3OOEA 3OQJA 4YQFA 3C3DA 1UKZA 3HFRA 1EBBA 1W4ZA 4MI9A 1H6BA 2ZIFA 2ETXA 4PGHA 1ONPA 4IKOA 1F5NA 4K6CA 2OUKA 3I1IA 4UXIA 2E87A 2FPKA 5DM1A 3RU3A 2IU3A 3P0HA 4FYWA 5SZHB 1XXHB 3I4CA 3KOXA 4JJ8A 4AWAA 4DMUB 1WU7A 1ZOPA 2FQWA 2GKGA 3B6EA 1L7PA 2HDHA 2O3RA 3JQPA 4GXTA 4JLBA 3VC7A 4AN0A 2JDID 4ZTBA 1CUSA 3V7UA 4JC0A 4O2LA 1M1NB 4YPFA 1CV2A 2XNDA 3RS0A 2IKSA 1VBMA 4LTNA 1A8PA 4B73A 3UMGA 3LQ4A 3DFKA 3TOZA 4P3PA 3K0CC 1X80A 4E03A 5J1SB 2XT6A 3OEEA 5B2ZA 4DTCA 5JCXA 1AGNA 1TCCA 4OQDA 3KKPA 4HBGA 4IGKA 2QE6A 1RR6A 1T5HX 3HDQA 2PSHA 2PS9A 2BZSA 1W4CA 3ASZA 2PD6A 3SVTA 4CFSA 2B6HA 2CLMB 2WTMA 3HU2A 4B6FA 5K99A 2OKCA 3X1MA 1FA9A 2OXFA 1ISSA 3M6WA 5K45A 1WHTA 2RARA 5ECWA 1XCOA 4H4DA 1AKQA 4G0VA 2WTEA 5C31A 3VSEA 2Z56A 3ETJA 4B2IA 1U8AA 1HK7A 1G2PA 4IGFA 5AR1A 4N3BA 2V3WA 5JZ9A 1OWOA 4XE5A 2O54A 1U7XA 4HN9A 1O8CA 1T34A 2ZIZA 4LSGA 3PI6A 4URVR 5HZKA 3I28A 3ORHA 2FW6A 2H5IA 4H6PA 3RTDA 1AJEA 4UXJA 5FWXA 4S3MA 1EHYA 1E6WA 3B89A 4HXEB 5C81A 2O2DA 4MVCA 5ALJA 5A03A 1FP4B 1XA3A 4UOQA 4BO3A 2IHNA 3KBOA 1EJ0A 2G25A 2POCA 5EZ6B 2O2JA 2GM9A 1N2CE 4G26A 5KPJA 2B9EA 4I08A 5I5GA 3RJTA 4B31A 4DRXA 4U2FA 2HT6A 3D6JA 4I3GA 4CMJA 1XSEA 1R5BA 2AG8A 2H9AA 3PQCA 2NPFA 4BX8A 3VA7A 3OTIA 4DA8A 1PNRA 3FI9A 2C3YA 2WEKA 1SQ5A 4LJKA 5COQA 4L15A 3VPSA 4B6EA 4AAYA 4D9BA 3HP4A 3F2IA 2LKDA 4B6OA 3QU5A 3DZFA 3ONFA 3IKLA 4XJSA 2ZUBA 5AJUA 4DT1A 5FWNA 3B1FA 4O02B 2UXBB 1SZPA 1PUXA 1EX9A 4QJIA 3OLXA 3E3OA 4MGHA 4MUJA 5BOVA 3X1ZA 5B3JC 4UTNA 5KJCA 1LJ8A 3TVTA 5CGZA 1SU7A 3LUBA 3N0RA 2Q8QA 3QNMA 4Z9YA 1T9DA 5B3LA 1ZM9A 4RTRA 4MV1A 5J4VA 4UAVA 2HA5A 3KCQA 3ZYZA 2RGAA 1L4KA 4JUFA 2OVFA 3KZCA 1PJ3A 5M3BA 3WYGA 4HV4A 1TL7C 3B12A 4KKXB 1MN6A 1MTOA 4UM9D 1LVGA 3AO0B 4J49A 5EZYB 1AKUA 2KBFA 4RE5A 4ZVOA 4A6DA 2ENWA 2PX4A 3BXGA 4EX6A 4NKRA 3U60B 2F9FA 3BJZA 1CZLA 2PRYA 4HGNA 2BM0A 3O91A 4OGGA 4OK6A 3K9FC 2VF5X 1U98A 5ALEA 5KOIA 1PL8A 3NOOA 1EZ4A 1UADA 1LDMA 2O48X 3VPCA 1PR5A 4GR4A 4BPBA 2Z5FA 3ZCRA 2BFNA 2B4RO 1A9QA 2BI8A 1WZNA 5EEGA 3A05A 2RKOA 4RZUA 1Z4IA 4UVDA 3VH4A 1TJPB 4J0CA 2OPHA 4HEHA 2BEWA 4GI5A 4XM1A 1IHDA 1KAGA 3DBLA 3L82B 1RYNA 3K0KA 2MSEB 4N7RA 5GJWC 3Q7RA 2QE7D 5CBKA 3EN0A 1ZGZA 2CUTA 2HRDA 4XWYA 1WQ3A 3OMWA 5KWIA 4N0PA 2CSXA 4RV9A 3WK6A 3JQAB 2DAPA 5FULA 3FIJA 2NXCA 1SJ9A 3AIIA 5E8JA 1QMPA 3L6CA 1KDZA 1K68A 2ET6A 3JD4A 4H6XA 3SF8B 3PIIA 4DG5A 2JGDA 1P4AA 5BPHA 5I4KA 1RP7A 3MFYA 5A3SA 4HQOA 4BB9A 3AM3A 1PFQA 4HEQA 4G85A 4UJ3A 2R84A 4MQFA 4NV0A 4P4GA 1BCSA 5ESRA 3VYUB 4UHBA 2YV4A 2W6ID 3NPAA 4CEJA 3WYFA 3ZLUA 1FS6A 4F4UA 1W29A 2BFFA 1WXFA 5SY9A 2XKAA 5BT9A 1QGUB 2QVLA 1RQ7A 2IYZA 2YWFA 1D6NA 3NBUA 4IZHA 4EOGA 4S0XA 5LJLA 1X1DA 3L4SO 5LL6P 1QZZA 3AJ8A 3TR6A 3QWHA 4UNRA 2CB9A 4M0UA 3PGKA 2ON6A 1QGED 3N2KB 4I36A 4DZZA 4HB0A 2PT6A 4FHEA 4B2YA 4GSKA 1HX7A 1JT9A 4OXRA 4Y6OA 1GZ3A 3GFVA 1AN9A 4IMPA 4IX1A 4JBWA 4L4UA 1NRXA 1E1LA 3HKEA 2W11A 4Q16A 4QO7A 1BO6A 3VH3A 3W5JA 4AJHA 1CJUC 1E7QA 1ESCA 1E79A 3OQIB 4QD3A 4DLZA 1ITZA 4TTVA 1N1MA 2BGIA 3D4OA 4B32A 4DM7A 2A8YA 1KYYA 2F17A 2EIHA 3M9WA 3FFXA 1D07A 2ZUUA 2QTZA 3ONEA 2NSJA 3PP8A 2CLFB 3VFDA 1DWPA 1VRVA 1Z0FA 3WGQA 421PA 3F2VA 3VZQA 2XQVA 1XXLA 1QIMA 3AT1A 4F5EA 2NO5A 4AQ7A 2BF7A 5DWVA 3TQCA 5BUZA 4CCYA 1JIUA 1P73A 3JSAA 2WDPA 3GZTB 4UDYX 3VNQA 5DK6A 2ZT5A 1JEDA 2HQRA 2QSYA 1NP3A 1Z35A 4M1KA 3AUTA 4EJSC 1XN4A 2KYRA 1F0KA 3QE0A 3MWKA 4BBPA 2BHRA 3N39C 3ND7A 4GHWA 4U2KA 3KFLA 1YS2X 2V7BA 4Q3NA 5KAMA 2JGNA 1X7XA 2ZSAA 3QP9A 2Q6KA 4YRPA 1PR0A 3B78A 1DXOA 1CKEA 1LI7A 2QTRA 4HNRA 3OJCA 4JOCA 2C2MA 3RS5A 2PJZA 1XI2A 1RLIA 1T0UA 3CN7A 4E2FA 3AQIA 1RQXA 3FPAA 3RVKA 1PJSA 4BQOA 5TT0A 3ZDCA 3QKIA 5B37A 2FZ5A 2VNAA 2NUBA 4HDNB 4JZYA 1BYUA 1NXPA 2F1HA 4GC5A 2IXTA 2QX8A 3BB4A 4EG7A 1KFBB 4PIPA 3DAYA 5E0OA 3MJ4A 2R6DA 3W79A 1W1IA 2WJ3A 1SPXA 2GZ2A 2G70A 1QFJA 3ASYA 3CNNA 3I05A 4HMPA 1T5OA 1JB1A 3KXLA 3NHUA 5A4IS 3W5DA 2VF7A 2AUNA 3LGSA 5LUAA 1VPTA 2J6CA 4ZOBA 1P81A 3LUPA 3WSWA 2QUHA 4G09A 3ULKA 4C3OB 1UBGA 3U16A 1WU8A 3CKLA 5JADA 1IUOA 1YB7A 1I3OA 4U02A 3WGYA 2QDKA 4Z3KA 2IKQA 1NJ5A 3HDGA 2I6XA 3PUIA 1AS2A 4GBGA 3ZWDA 3THOA 2FFBA 1N32B 1K8XB 4GI1A 2I67A 2OXRA 2IK8A 4BVHA 4TT3A 4ERXA 1CY1A 1ISMA 2J46A 1QGAA 1LD3A 4IYJA 1WR8A 3UMVA 2HFJA 3ZHCA 4MB6A 3CUUA 1AZSC 5DW0A 3RU7A 2EFJA 4Z7OB 3L49A 3V4RA 3QWIA 1J0XO 1EUZA 3CEMA 3DMYA 3STTA 2XF8A 2XWJI 3NC1C 3IPYA 4BVKA 5A1TA 3NCHA 4ZAXA 1QGDA 2J5BA 4HTFB 1KDPA 5I9BA 3HJHA 5A5FA 1MLDA 2R5FA 1Z5GA 3I5UA 1L4HA 2Y9PB 1TU3A 2NPIA 4QSHA 4AKSA 2OCGA 1I7DA 4G2NA 2H1FA 4F56A 1K06A 3GV0A 4QUGA 2X15A 1ZH2A 1PSWA 1XJ5A 1VM6A 2RCNA 3VDQA 1RXCA 3SHWA 4BTVA 2Z3VA 4OLAA 2XDQB 3I9JA 3D2CA 3LTEA 3TZKA 3FCOA 3OX2A 3N2YA 1DWUA 2J7KA 2XB8A 1V25A 3F5MA 1E7SA 1N2IA 4OV6B 4D8TA 1WX1A 1SG9A 3NVDA 2GPTA 3GFTA 4QXOA 2EWMA 2JCYA 5K09A 4AJIA 3AVVA 1SCAA 3WNCA 4E21A 4CKBA 2WIDA 4IRXA 4LVOA 1Z45A 1L5VA 2DX7A 2OORC 2YHUA 3G0IA 3BMCA 3ZI0A 5TLSA 4YO8A 2CVHA 4FOOA 3CB2A 3CR8A 2IYXA 3TYXA 1O95D 4EIWA 1U8FO 3LBIA 2ZRKA 1F06A 3OJXA 3ROKA 5BXQC 3IEVA 4D2IA 1UJ4A 2H5JA 5B1DA 5HMLA 3UXHA 2XXJA 5BV1A 1NW7A 4PS0A 4QXAA 4BJ1A 4L4XA 4OGWA 4B4OA 5CT6A 3AGPA 4YBRA 3U26A 5CFZA 3GNLA 4DHEA 3NJ8A 1Z39A 3HVHA 1IJEA 3PD0A 4QTXA 1WM1A 3DAFA 2GCGA 1YHNA 4XRGA 2VWQA 3PWZA 3ROXA 4X64B 2GCIA 5BWCA 1EKXA 3VXKA 5A7GA 1M3SA 3FNQA 4LTMA 3F6RA 5AKYA 5L3QB 1T4CA 1SG6A 4QHTA 3I6IA 5ILOA 1FP6A 1V47A 4Q3CA 3FOCA 4F3YA 4G89A 5I47A 5EYPA 3QOWA 4ZAFA 5YASA 3TQRA 1UXHA 1SUSA 3E35A 4WBSA 3L5KA 4ZCLA 3W3AH 4DSUA 3ADBA 3PQFA 3H8JA 2B3DA 3LUFA 2QLBA 1ECCA 3MWGA 4OYHA 3DVAB 4WUTA 1UMCA 1CNMA 1R0SA 2PS3A 1KVQA 4WT7A 2YMQA 4NK5A 2PIDA 3DBRB 2CYBA 4QRIA 5GY7A 1GZ7A 4CODB 1UJNA 1JKJB 2YL2A 2QU7A 2ZJFA 3R40A 4GMHA 1NUUA 1XCPA 1QTRA 4QJ5A 1K4YA 3W6PA 1I32A 4P5DA 1Z2PX 4YR7A 1UANA 3QKTA 1I24A 4PC2A 1RLMA 4I4TB 1QHIA 3LV8A 4Q1AA 5IAKA 2CLCX 1CLUA 1HE3A 3L7DA 4R1SA 4RNDB 5B12A 2C99A 1VMIA 2DFVA 3D4BA 4X97A 4BB5A 4PNHA 2OP1A 1WKBA 4J1NA 5EJ6A 5J58A 3GZJA 1GTVA 1MAVA 3MD0A 5FORA 3USES 2VXBA 1SVMA 3A9TA 4TN5A 3ZGLA 3VR5H 2B8TA 4KRGA 3HG7A 3EIFA 3X1KA 4G0WA 5HSGA 1ZONA 4B81A 4G84A 5I4BA 5FNVA 4OBXA 1QHHA 3MHPA 4ITRC 4FEGA 1MEOA 2C8LA 4LZNA 2ZWPA 4QLOA 4AKEA 4X6LA 3R09A 1N36B 1Q20A 4CCSA 1UJ2A 2DKOA 3DMRA 2GJSA 3KPYA 2QL7A 1RAIA 3EC1A 3Q7IA 4DJTA 1NYTA 3T4EA 1XMQB 1YBAA 3HV2A 4KXXA 1NQVA 1U2QA 4INZA 4E31A 2REOA 4RX1A 3DCJA 3L06A 4N54A 4E3WA 2D2XA 1CETA 1FJHA 2FF7A 4GOOD 2YJTD 3GFBA 3PGVA 1PNTA 4KE7A 2PPVA 3B38A 2ZU0C 3K73O 3LOQA 3RO7A 1PQWA 1NSFA 3QSGA 4V0NA 3H84A 1PCXA 1C50A 3V7NA 2G9UA 1GSHA 1OI3A 4E4TA 3HO8A 2PLAA 1Z0DA 1IBMB 3TW0A 2INGX 3H11A 2PLFA 3L3BA 3TRIA 1LQ2A 1PZHA 2VT2A 4DR3B 3L7CA 1HG0A 1JR6A 3IQDB 4K9PA 2HIGA 3E82A 4GE3A 4TWIA 1E9AA 5A4JA 5LQRA 4KOAA 1IZ7A 4A91A 4A9AA 3R6TA 3KAPA 4FZRA 1JLLA 4MGEA 5HVNA 3N8KA 1PU2A 4YJHA 3O26A 1VHDA 2Q28A 3O1HB 1N2XA 2FRXA 3Q3GE 3KUKA 3QE9Y 4HB2A 3T3NA 1GRQA 5CGQB 2MIIA 1L7RA 4Q9IA 1M34E 2C96A 4OA5A 1RYFA 1XEWX 2O2EA 3SXPA 2CXHA 4I9NA 4LXHA 1OFUX 2Y68A 1XLTA 2NSHA 2ZYHA 3UMCA 2EKQA 5CPBA 4GNKA 1EK0A 1T5BA 4F12A 4MDFA 2HPVA 2RGYA 4QRHA 1XDSA 3IP6A 5E4JA 1YDEA 2ZDGA 4G9BA 4H6VA 5HS6A 2R8ZA 3EULA 3Q11A 5A7FA 3BOSA 4FYXA 1JR3E 1LA2A 1K88A 4UNPA 2ZI7A 4AVYA 2Q4RA 1SMKA 2WM9B 1Y3BE 3HJAA 5K0GA 1JFTA 4KACA 3JVDA 2FFAA 2X9GA 1GA6A 1IAVA 3LQYA 3I61A 1Y42X 2OL4A 3JY6A 4FYVA 3KYCA 1GPNA 1Z4OA 4DWVA 2V0CA 1C2TA 3P4UA 3VOAA 3R3XA 1X80B 2VHQA 1YC2A 2C5BA 3I45A 3UJ3X 4LHEA 4IFBA 4K05A 3ANTA 3KTFA 2ZKLA 3PNQA 1PQPA 1PYGA 4BZPA 1KTIA 2FWRA 3Q9NA 3UJ7A 1XNQB 3COVA 1Z88A 1S1CA 3OZDA 1DCMA 1BWRA 3H9JA 1J7JA 2FWNA 4B4UA 4EBFA 1ECPA 5A5EA 1E58A 3MTBA 1POWA 1WHTB 5F98A 2SNIE 3VUFA 4YHBA 1NURA 4C0XA 3EX7C 1W59A 3E5NA 4RVUA 7MHTA 2AV6A 4J7XA 2WQ7A 5EQDA 2PZFA 4Y2JA 2FA9A 3OTQA 5KKNB 5EP2A 3J80A 2VRWA 3WI7A 2VHZA 1WZ2A 5L3SB 4FMDF 3DD5A 2YWBA <