3NATA

Crystal structure of conserved protein of unknown function ef_1977 from enterococcus faecalis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
156
Chain Sequence
SNAMKKATMLTYLEEQLEKHLGDYEVGLDWDRKNHTIEVIVRLYAENNEQVAIDDVEFIEFEDGLLFYNPQKSVVDDEEYLVTIPYEGKKGLRKAVLDGFIHYLKVVLDEGQSDLLDFLSDETAEVFELHWEPADFEAMIKKVAETEKEQWIAYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal Structure of Conserved Protein of Unknown Function EF_1977 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
total genus 37
structure length 156
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11217 DUF3013 Protein of unknown function (DUF3013)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11250 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3natA01
3NATA
chains in the Genus database with same CATH superfamily
3QGMA 1K98A 1WQ3A 2VLBA 2C5AA 3EBPA 2PA3A 1KNQA 3P5SA 1G16A 2NO6A 1XRNA 4NWIA 4PZ9A 4RZQA 3ICCA 2A9JA 4P58A 2VSQA 4JH0A 4ZK2A 1J20A 2WSSA 4EPRA 1Q91A 3OLCX 5EZYA 2Z2XA 5I8PA 3ZGLA 4KDEA 1BYIA 2DBYA 5E4FA 1W85B 3TF5A 3GRYA 2OV8A 3N87A 3CF0A 1U7TA 2A1IA 3OKFA 2J5RA 1HOXA 4NIMA 3IIMA 3G3EA 1R0BA 4B87A 4QDUA 4BRWA 4UC0A 3AVXA 1ACJA 1JHRA 4DMKA 4DY4A 4KCGA 3UUEA 1QE3A 4ZEMA 3ZHTA 3PQ2A 4QOIA 1WXWA 4ZALA 4I3FA 4TTRA 5FPYA 3G5MA 4MCAA 5IHPA 4EYKA 3BMCB 1U81A 2RAUA 1IIBA 1TK9A 2HK9A 3R0JA 3H11A 2F67A 1TQHA 1M7GA 1EK6A 1ZMTA 2X2FA 2NQTA 1GU0A 3C39A 3IT1A 4G5HA 5CJJA 4YLEA 4D9EA 2MSKA 5JYCA 4ER7A 3K9FC 5F5XA 2Q46A 2QU8A 2P9CA 3BA1A 3HDGA 1U0GA 1G20B 1NJGA 3F6PA 2WPDD 4WBXC 3IP1A 2OCDA 1AMOA 4RO0A 1WU7A 2AC4A 5B2FA 3FHOA 2CVOA 4DCMA 1TRHA 1QLJA 2ODTX 4R1MA 4YRSA 3MGBA 2J3HA 2XWSA 4AAYA 5C4MA 5EHNA 5MGNA 5JSHA 3ICPA 3KPVA 4RFSA 2A7XA 3BIOA 1OX4A 3VR1A 1SXPA 2PS0A 2DEUA 3WFZA 3ZGVA 4NFHA 2FA9A 3EGIA 1AB6A 3E5HA 3ON5A 5LXTF 2WG2A 5DO9A 3PTLA 2ZJOA 3UATA 1NQWA 5GADl 4OG2A 4BXOA 2NSDA 2VPQA 3GLGE 2PH7A 3NVDA 1FUKA 3JAMA 1ZK1A 4YAUA 5DHUA 1OGYA 1QHIA 1ABBA 3HXQA 3DP7A 2R8EA 3NPMA 2WOOA 1U7HA 2QN2A 1DKRA 2YWHA 3NBZC 4PSVA 1U3GA 3FWZA 2AI2A 4M9QA 4Z0PA 1G6KA 2OYSA 3LQKA 2FE4A 1L4HA 1O89A 2DLCX 3L3BA 1MIOA 4QBHA 4AS2A 1Z3IX 2V7TA 2XWBF 1ULTA 3HA7A 3MYYA 2WNHA 1WPQA 2WG0A 4DKJA 3AX6A 3LY8A 2V5VA 3URMA 1CS0B 3I34X 1JKFA 3R9XB 2OV1A 1W7AA 3WYDA 3UB2A 1FVXA 3KKOA 3PC4A 4DJFC 5I45A 2E37A 2VNIA 1G4UR 4AZWA 3OQHA 4OIMA 5K20A 4TWAA 4EHNA 2WSYB 3IHKA 3DQQA 4EKGA 3B5JA 1ODTC 2PX6A 5AM1A 4MH0R 3UGTA 3ZBQA 1XTUA 3HZRA 3IP6A 2YASA 3OETA 3JR7A 4R1NA 4L4UA 1T0HB 4HLUC 1YAJA 5KYVA 3WL7A 1GRVA 2F3QA 3K09C 3A1FA 4O4HA 4EY5A 3MG9A 3BMOA 5LMZA 1PL8A 3ZWNA 3FPCA 4BMCA 5AK3A 3W2FA 1U8YA 3EGEA 3RWBA 2OWDA 1G9XA 1NVTA 2DR2A 1WR8A 1P29A 4H7FA 4P98A 4AJJA 3CXUA 4ZVKA 4H9GA 4AZ3A 1D2AA 3WLRA 3VPCA 4E3WA 2SKCA 2YV2A 4QULA 4YCDA 1W88A 1JVSA 2RGNC 4W5NA 3LKVA 4WEOA 1VB3A 1IQRA 2OHGA 4JV5B 3MM4A 2BJHA 2XADA 5K05A 5GONF 2V7VA 1X86B 3DONA 4G4JA 1NJ2A 3BULA 5DYGA 5F77A 4TTJA 5C8YB 3RFUA 1N4DA 3ZCUA 1RYMA 4DY6A 5JQGF 4MLCA 4JQYA 4TPKA 4F2HA 5K8CA 1W4CA 2IIQA 3GRKA 1FY2A 1LK7A 5LQNA 3S7TA 3WTBA 2QNBA 3O2NA 5EHXA 2HTEA 3ZWVA 1E20A 2GRAA 5TARA 1K89A 1G2PA 1YH3A 3RYIA 3MGKA 2JAOA 1MABB 3KALA 4DUPA 4J0DA 2DUNA 4OTZA 4TLBA 2FW1A 3H1FA 3A3OA 4B3SB 1NQTA 5CR9A 1RLOA 3GP3A 4TMZA 3MZ0A 2Z58A 5HM8A 3AW8A 5HRAA 1GKKA 3R3HA 3CRQA 2WIJA 1YC5A 4KQXA 4DDHA 1N5DA 1U3DA 4RK0A 4QOFA 2G4VA 3NOOA 1JFRA 3H9BA 1BC5A 4ZIRA 1ZH4A 3H2ZA 1E98A 1JKIA 1PBNA 2EQBA 3ETEA 3GJ6A 3QVJA 2VRCD 5LZ4A 5HJ2A 5TLSA 3B6KA 4LJ8A 5FLEX 4EX7A 3KXDA 4IVNA 5LMUB 4EKIA 2AUTA 4BIIA 2QN6A 2K87A 1RTTA 1I5OA 4YMTA 2H92A 4MPRA 2EBUA 5LDGA 1VPWA 4E31A 1IBCA 3EF3A 2R1ZA 1X7HA 3D64A 3MOIA 3TQCA 3DB1A 4Z0TA 3OD5A 3CUEF 5E3JA 2G70A 3X1ZA 2H2HA 4RTLA 1L7BA 2VXOA 5T8KA 3PXEA 4BQQA 3DLPX 1EQAA 4PHCA 1MFZA 1WO8A 2B4TO 2AFHA 2ZANA 2X0DA 4YTEA 2W42A 4ZCRA 5BQFA 4QKQA 1K88A 2B8JA 3C6ZA 3K8QA 3RODA 1W48A 3UPTA 1X77A 5B1HA 3DEIA 5FULA 2MR5A 1ISMA 1H9BA 2JH9A 2FUG1 2I4TA 1Q1GA 2FPUA 2QZ9A 3L07A 1IHDA 4G1UC 4L0QA 4U2CA 5DI3A 5H70A 3SKVA 4XDGA 10MHA 2ZQ5A 1MV5A 2ZYIA 3IAAA 1R4AA 3MWKA 4QJIA 1ZGJA 2R65A 4D0GA 1FPQA 1AHHA 1M7HA 1VE9A 1JR3E 2O3TA 1J39A 3ETGA 3O31A 2RIPA 4IJVA 2OLKA 3UMFA 3WDKA 4O0LA 3CLUC 1KJYA 3PJDA 1KZYC 3VBCA 1I4TD 1QIJA 3L40A 3LOQA 4OSOA 2XJ4A 3CZPA 2EWVA 3FRJA 4G0UA 3BF7A 3ZZ0A 4AXXA 4RWEA 1GARA 1HZZC 2J41A 3BMQA 3EIQA 1B00A 4FPXA 3R5FA 5KSPA 1AF4A 3VV3A 4CQMA 1DEHA 1EXMA 1K2VN 5IDXA 1VDZA 1ZG3A 3FNGA 4UMEA 4CE6A 1Y0BA 3MA0A 5FA6A 4BBAA 5CDFE 3NVKI 4MX8A 4ER6A 4F4IA 3PICA 2F64A 2LIVA 3T7EA 2IV7A 4GF5A 1WVGA 2WHQA 2A5FA 1E5LA 1GL3A 2WAAA 3PYXA 4G63A 1U2ZA 2FN3A 3BG5A 3V8BA 1UPXA 2LCIA 4RWZA 1XZHA 3VC2A 5IM4F 4LYJA 3RVNA 1E5QA 3D3WB 4X1IA 2PMCA 2O8DA 4NS4A 5FNVF 5B64A 1TC1A 3INRA 3UWDA 2GBFA 1LDNA 3FLMA 3AHJA 1SD1A 1RQRA 1U65A 4IW3B 4KAFA 3S7ZA 3RPEA 4F5EA 4Y2GA 3GZNA 4PVDA 3HHPA 3KFLA 4FS8A 5LDDC 3OE4A 2HKIA 1U5BA 2IEGA 2ODBA 2WIGA 3I4FA 3M5DA 4OATA 1Z6ZA 4HN9A 1GCAA 1P39A 3BWBA 5CFZA 4BNFA 4PQRA 1BSVA 3ORSA 4U7DA 2GA8A 4F92B 1QYRA 5E1BA 1OI4A 1EFPA 1Z4LA 2IYUA 4FLEA 3LTEA 3KLMX 3TLGB 1EP3B 3F5DA 1E2GA 4E1AA 3U5ZB 3ZKAA 4LRUA 1FXWF 3NTXA 3DCYA 1PTJC 2PLAA 1J24A 4GPAA 4M8NE 3OY7A 2BE7A 1I3CA 2XE8A 4BZPA 3R8XA 1Z4NA 2VDNB 2ZOSA 4UW9A 3VH2A 3G8BA 4E30A 4EZIA 4QFBA 4I1VA 1DBIA 1LPOA 2H7VA 3LUHA 3EGXA 4QTXA 2IEDA 2X6TA 1N1GA 2R5FA 2W7TA 4G9GA 4UNPA 5DMHA 5GWXA 5BN3A 4TSKA 3EF0A 4EPTA 1T9GR 3LFUA 4ID9A 4DC0A 3ILVA 2Q7DA 1AG9A 2WJPA 3AEQB 1GCUA 5AJZA 5E4JA 4GDFA 3ENVA 3BGIA 4O4LA 1PT7A 4CL2A 2O06A 2ZBDA 1UM9B 3UPDA 2EKZA 1XFDA 3KLPX 1LTKA 3R3JA 4GLBA 2WJZB 2D0PB 2QENA 5C4GB 3SLKA 4EUKA 3QU9A 3QYJA 4F5YA 4TKMA 2X2EA 2V9PA 3L5OA 4R3UC 4Q3OA 2QG4A 2CHVA 4FEYA 5AK4A 5IABA 4HXEB 3A2KA 1NI4B 5AWFC 4UVEA 5FPQA 5DT2A 4N12A 4RULA 1DIOB 3BD6A 3OZWA 2R1VB 2VHEA 3ED5A 5E6UB 2J6CA 2XR1A 4CQMB 1DBVO 2DFKB 3QOFA 1GPNA 1Y5MA 4EY7A 5IG2A 4ZAYA 1Q57A 3EWAA 3RARA 4A2CA 2AHRA 4L8WB 2CV2A 3P94A 1BMTA 1G2QA 1Z22A 3IIKA 3MSXA 3UAWA 4GFDA 1AJEA 1KMNA 2AK3A 2HBRA 2OORA 2R85A 1PNQA 3U56A 4OMUA 5CLLA 2V6GA 1GVHA 5LA6F 4BO2A 2CFIA 3ILHA 2UUBB 1NVVR 3HL4A 4KSYA 2XBUA 4N3GA 1JDVA 1NJ1A 2FH5B 2I4MA 2R44A 3EK2A 3CH4B 1LS1A 2QEQA 1PR5A 3HB9A 2HHLA 1O6FA 3MBOA 1EAYA 1P2UA 3AI2A 4KBGA 4QBKA 4H4EA 2JBAA 2R4TA 4QG3A 4UQPA 1CY8A 5LQAA 1YULA 1IY2A 4A36A 3M4YA 4HXFB 2MIIA 5LC1A 2SBTA 4WE3A 1T8WA 1LJLA 4O29A 3PENA 4NMHA 1E4VA 4ZRNA 3O3CA 3V4ZA 5DOZA 4D97A 4QJ3A 2WKQA 2R1UA 4ZANA 1HWYA 4AG3A 3C7TA 4P5EA 4UXIA 2OZLB 2XKAA 2X1MA 3BE8A 3KSRA 3LAWA 1HYHA 4YCSA 1J2JA 1QP8A 3HB5X 4BKUA 4L28A 1E7RA 2PX8A 2JD0A 4HZGA 3E9EA 4M1SA 4NBLA 1ABFA 4YJKA 2CFTA 4UVDA 4CMJA 5LN1A 1KEKA 1BVHA 4LSGA 1W8DA 1IMOA 1YB1A 2R8BA 3E48A 3JQAD 5FI1B 3UEOA 3ZD8A 1JEYB 2A3NA 2HJVA 2UZIR 2E21A 4PZCA 2O14A 7AT1A 2ZIUB 3KTAA 4ENSA 1CF2O 3VDXA 2DUUA 2DUWA 3E9MA 5CEFA 4AJOA 1F8XA 5HJ7A 2QRKA 5CXSA 2XYVA 3KZNA 1DQPA 1MRNA 3ETNA 2ZJZA 3IBFA 4PPGA 2F8SA 2GEKA 3OU7A 5BT8A 5H3CA 2GKSA 2QW8A 3NTOA 1HNWB 1MH1A 2R8PA 3OZUA 5AVKA 1E2BA 1CVRA 1J90A 1OCEA 1L1FA 4C0WA 4EW3A 5BQXA 3Q40A 1CDZA 2C20A 2BFWA 2JGFA 1OXMA 2XYGA 2VKTA 3CB4A 4AZTA 1ILEA 1RMYA 4JI8B 1T4CB 3JPYA 2XJ9A 3LC7O 4JX8A 1W75A 1LPNA 4JEMA 3FNRA 5FYDA 3R6DA 3T1TA 1KHTA 1E0JA 1K5HA 1EWQA 3IBTA 5CDUA 2QYHA 1F38A 3OC6A 2BZ0A 4FYJA 4A0QA 4N0DA 4MP8A 4ZICA 2DP4E 3H2YA 5I8WA 3TOCA 4X1KA 3VR2A 5CDHA 2ERCA 3BBLA 1M66A 1F8FA 1N8NA 4TGLA 3HJNA 1OFGA 1M6EX 4O0MA 3PEFA 3SR4A 3SS8A 2BBOA 1ODJA 3PNKA 1E2FA 3LDGA 4BS9A 1GU7A 1RZ3A 4IJQA 4DLZA 2I2FA 1MQAA 3L4SO 2QTRA 1UK6A 1WEKA 4Q4JB 4RPJA 4RSMA 2BMDA 3KDAA 3R5TA 4DCNA 1RRCA 1WMAA 1YQXA 3TTTA 2YWJA 3PYLA 4CL0A 2HZ7A 1QTQA 1CUZA 1TEHA 2J9XB 1C9NA 3ND9A 4RK5A 3UFXA 3LQQA 3V7NA 2CXHA 4BVAA 1P0QA 1WF6A 3DHWC 4REOA 3BIJA 1R6TA 1E2NA 4XUEA 3L7YA 2X4DA 2ZAYA 3EFOA 1YDEA 3QLVA 1V8OA 4FDAA 4TTQA 2ZAOA 1ZR4A 1L7DA 4RZUA 4F4CA 4YBRA 1WIWA 2GO1A 4LY0A 3KKNA 2PXAA 1WXHA 4LOJA 2VJAA 4BAGA 3BICA 3DWGA 3H0KA 2BFCB 3SKYA 1PR3A 3VV2A 4R0MA 1KI8A 1LQTA 4EA8A 3Q6NA 1KE2A 4DIOA 3ER9A 3FFWA 4D25A 1Q16A 4B6EA 4BLPA 5HUQA 1GUAA 1U8XX 4ZYUA 3OEHD 4FJ2A 2CDBA 3H2GA 5HE9A 1TT5B 4U7JA 2PCJA 4J2OA 2FFHA 1CUJA 1X9GA 3A3KA 2ZJ8A 4QU5A 4YECA 1SKUA 2SKDA 3A11A 3KUCA 4RE6A 4EZBA 2G71A 1UP4A 2OD2A 4PZLA 4M89A 1W0JA 4REQB 2C2GA 4K87A 4IDBA 4MPDA 3VJMA 4D9BA 3DEZA 1VL6A 1Y82A 3OFJA 1RWKA 3GJYA 1M7BA 4LBVA 5ALKA 4JJGA 5A7FA 3Q7EA 3T34A 3DVSX 2G0AA 1A5ZA 1LH0A 3QKSB 4Q21A 1C3OA 3LLMA 2N75A 4N1AA 4TQUS 2WMNB 4C5CA 4DV2B 3UYLA 1JMKC 3I4LA 5KNBD 1M2OB 5U4XA 2PKYX 3KAPA 4ZOLB 3D6AA 2ZSBA 3NEJA 1ZVMA 1XL0A 4QBIA 5HJ5A 1C8LA 3A4MA 5BUCA 1DAIA 1GN9A 1Q84A 4JP1A 3T3HA 1MENA 3B3QA 3FNHA 5HW0A 2L19A 1JEQB 1N6NA 1TZCA 1V2HE 4GLJA 2PTHA 4BMVA 5JNSA 4JT4A 4KGDA 4R2HA 3RBZA 1R6BX 4WHMA 2J3KA 2OL4A 3CT4A 3EAGA 3IKVA 4BLWA 2WYIA 2FPIB 2I3ZA 4M9SA 3DZJA 2JLXA 5F78A 2W58A 5KTMA 5E9JA 5T67A 5JVDA 1NMQA 1ZN2A 3PD1A 4OQEA 5EIAA 3DOUA 1EJBA 1ZIYA 3F4BA 4MVWA 3WS7A 1DINA 1QTIA 1V2GA 1ZGCA 4NARA 2ZU0C 2ISSD 4TUYA 4RCVA 4NPCA 3D8HA 1TQDA 3EPKA 2WFLB 1U8ZA 2AG6A 4C7XA 4CGZA 1I2CA 2OHIA 3HO1A 1POWA 1C5KA 2JFFA 2P9QA 1PV2A 4L9SA 3GIDA 3V4LA 1I6LA 4N03A 1T6YA 2O0HA 3CJTA 3OEYA 1IWOA 1G5RA 2A5YB 2GTPA 4GIBA 4UM9D 1MRSA 5JCJA 2ACKA 2P3LA 4OB8A 2VHTA 4XTRA 4GECA 3CJRA 3L9XA 4F5DA 1BFUA 5HPYB 1CTQA 2Z4TA 3WB0A 3F6SA 3HADA 1U8TA 3NTLA 3Q7PA 4P93A 4N5IX 1G9SA 4PC2A 4YAGA 5JXWA 2HR1A 3O3MB 4IDCA 2ZQZA 1OFTA 4RSGA 4ACAA 1AGRA 4MKGA 1AUPA 4U02A 4IHJA 2W71A 3BCUA 1TMYA 1O94D 2VPXA 3D4LA 2QA5A 3DLIA 4XJSA 4M0CA 3RTCA 1Q12A 2WILA 4C4YA 4C88A 1X7XB 4LHXA 4DGSA 3F6BX 3ECCA 3EDMA 3HDYA 1F3OA 4KGVA 1V35A 5SYMA 4A1OA 4GPD1 3GLHB 1RHUA 4WKOA 1QDLB 1HEIA 2F1JA 4J43A 4D4LA 5YASA 4EGCB 1KO8A 5JOQA 5KAMA 4PHFA 3K20A 1Y6RA 2ZWIA 2RI0A 5B1IA 5SY9A 2I66A 2IU6A 3UQYS 3AHDA 3TTWA 1MCZA 4JBLA 5TNXA 1PS9A 1YWGO 3MHPA 1RXYA 1C3XA 2VHXA 3IAEA 4LTNA 4BNTA 1MDBA 3B2QA 4CTKA 5AXBA 4BO6A 5IKOA 2QXYA 4L50A 4UM5A 1SVIA 2WSSD 1CQJB 5DF1A 4CQLA 1BWRA 3K2BA 3GNSA 2VXYA 2V98A 3GNLA 3D8SA 3PE3A 4FBGA 4UUPA 4HNGA 5BSTA 5BW5A 5IU6A 1UWLA 2C1EA 1TEVA 2YY5A 1Z28A 1M2FA 1NJ6A 4LNAA 4LC0A 1IEVA 3CH6A 3UAXA 1GLGA 3DAFA 1JV2B 1JHAA 3TLJA 1TEZA 1VIAA 4HTAA 1GCOA 1T3HA 2FMUA 2JJYA 2DE0X 2NO5A 3FSGA 3IIIA 4HAOA 5ALEA 3ZGYA 3HFJA 3U6KA 1K5GA 3PJEA 4N7MA 1XF1A 1Z5WA 1B4DA 2A4KA 4B83A 3DOJA 4WOJA 2WVGA 4PPNA 3L7JA 1WUJS 4F38A 3DDNA 2GCOB 2QRPA 2D3WA 3GO4A 2OBFA 5AJHA 1Q11A 1SWWA 2WINI 2W2XA 4GOJA 3QMWA 4BQFA 4IMIB 3HYNA 3X1DA 1Y7TA 3GJ4A 3MJRA 1QAQA 3FPKA 2IOQA 3GPIA 1QKKA 1UZLA 4EYEA 4Y7CA 1UKZA 4U63A 4MS1B 2X0RA 4KLZA 4HS4A 3TE6A 3HEBA 1POXA 1DIRA 1E6WA 3IPCA 4OQNA 5B53A 5K2OA 3THXB 3T1QA 3IAXA 1YZKA 2DYKA 2H06A 3DNMA 3IQFA 5BNZA 4EQ6A 3ACBA 3IAUA 3U9TA 2E49A 2BHLA 1NV8A 3DFIA 5EQJB 3CW9A 1ONBA 1I1QB 4QXPA 1C0KA 1T2VA 3A9CA 2V5UA 2QR5A 1BW9B 2ZJ1A 3PXUA 2FKAA 4OYYA 5LXTB 1FX0B 4IIGA 4QASA 5ES3A 3OP4A 1M72A 2V9ZA 4GP7A 3H8SA 2W2TA 3CNEA 2IDZA 4EI7A 3DLHA 2RDMA 2QAGB 4YUXA 5HZHA 3N8DA 4UOEA 1ZD9A 4FSHA 3TTVA 1GLVA 2W4MA 4UTZA 4DEYA 4ND8B 1OOEA 1GUYA 1S4MA 1AA9A 2NUBA 4R6WA 1JXAA 1FSSA 3I5AA 2E3JA 4HDKA 1QGZA 4AX4A 5F4ZA 1QF7A 1SB8A 2ZI9A 5LZ8A 2YFQA 3M5CA 2XUPA 2PUVA 1RPZA 2GFIA 3IBYA 2OPBA 3VR0A 3MWGA 1OYWA 3HCEA 2O4UX 2GXUA 3FDFA 3IEMA 3C3CA 4RW0A 3FLAA 1UAAA 5EMKA 1E1NA 3QV2A 1VJ5A 1TZJA 1YE8A 4G1CA 2UZ4A 4Q1CA 2F4VB 5CM2Z 1XZBA 4Y9UA 3DR5A 1KORA 4OEHA 1TADA 3MW8A 2NPFA 1OAOA 1TYCA 3G0GA 2C98A 2V74B 1N8TA 2BE9A 1F06A 2D4HA 3HBLA 4LK2A 2BCEA 3EAQA 4OBEA 1CY1A 4JBYA 3SHOA 1VSVA 5TEVA 2DPMA 5IVKA 1XPOA 1LBSA 3QTLA 4DAEA 1XWFA 1ORVA 5A4FS 4M1YA 1IYZA 2VK8A 3NM4A 2AI1A 2Y1XA 2I4NA 4NJOA 3F67A 4QLBA 2GXAA 1MNAA 3ZDRA 4RHFA 1U3VA 1EK2A 1XVVA 3K2IA 1K75A 4JR0A 4DYDA 4MW5A 2Q07A 3C6KA 1B74A 4LECA 2CVFA 1YACA 2NYAA 4P1ZA 3OFSA 3WMRA 1NW6A 3H9EO 1IONA 3DWIA 3F8WA 3K0CC 1D03A 2CSUA 3L5KA 3LLCA 4HYTA 4QNMA 4WVFA 3TW8B 4ZVUA 4BWGA 5AW8A 2DFNA 3OKAA 1NLUA 4FDVA 2ONJA 1S1CA 1VI2A 5AKHA 1E9BA 4YK7A 1UBCA 1XYVA 4F3YA 3DEJA 2WDPA 2VFAA 3CNBA 1S8FA 3N6VA 1XZCA 4Y18A 2C99A 3C5VA 3RIEA 1WXQA 2J3EA 4EIWA 5K5EA 1SC1A 3GLGB 5JQGB 2ZAMA 1LNQA 3BIWA 2FLVA 4QBFA 1UJNA 1EUCA 1NX9A 1PUIA 4D9KA 3OMWA 3BQMB 1HQDA 1CCWA 1V8FA 1WXXA 3MILA 3UCXA 4GEKA 4CETA 3UGJA 1R4MA 1V7CA 2BEKA 4LYYA 3NDBB 1O3YA 1I6MA 3S2YA 5ADWA 2Q3EA 3EN0A 3N8HA 2DWCA 3BL5A 3O92A 4P5PA 3AV0B 4INPA 4JJEA 1V5FA 3SIWA 5CFOA 2C2XA 4DIUA 2D3TA 3ND7A 1URPA 3A6EA 3NC1C 1EFRD 5BSKA 1A9OA 4TOIA 2EATA 4RQUA 2VP2A 1YQEA 1CUCA 1N2SA 1XMVA 4UMDA 1BA3A 1KXZA 1V6CA 5HGJA 1JA1A 2GXQA 4PBRA 1FTQA 2CUTA 2UYHA 1YIAA 2FVYA 3SX2A 2QMYA 2AUNA 5SYNA 3A9WA 5E3IA 2FQQA 4FFDA 3LKDA 1KA9H 3ZKWA 5A6VA 1QC5B 1UXOA 5HWSA 5I48A 3OOHA 4AJ4A 5KPJA 3WKAA 2X42A 4S12A 3WRXA 5EWLA 3I2KA 1VSBA 4PFJA 1VJ0A 3K5PA 4EHLA 3OO0A 3CIFA 4EI2A 5BVHB 3FWHA 4C1NA 3TGLA 3QOWA 1YZHA 3L2OB 4IY1A 3T4PA 3R23A 5EQDA 5I7FA 4F5ZA 3B7GA 1RQLA 1MAHA 3EHDA 4MR7A 3TZKA 3AONB 1T3SA 4P6VF 1IULA 3AOEA 4US0R 1GZ3A 4N4AA 4FMDF 4OHXA 5DW0A 3IURA 2FPOA 4C7OB 1KZ9A 4R41A 4HEJA 5JJBA 3ZLBA 1Z15A 4NCAA 5AKYA 1JWAB 3PWZA 2CXRA 4XYMA 5H02A 1KJZA 2IPLA 3RU2A 2MMCA 4QM7A 1IXKA 2JW5A 4OB7A 1A9YA 1G8KA 3GPBA 2JBWA 3GFVA 3NHUA 1WQ4A 3AF5A 4OXXA 4EH1A 5GJCA 4DV5B 3OOJA 1AXRA 5DPMA 3RK0A 3ZWXA 2RK3A 1RC8A 3QOXA 1GM5A 2IOYA 2HPAA 1Z2DA 4B9EA 4J4HA 5KTTA 1QHHB 1SUWA 4BJ5A 4DR1B 1TRKA 4CQMD 3OCXA 3BL6A 4X84A 4J75A 3G2KA 5CPFA 1LI7A 4CEIA 2YV3A 3N2NA 4KIGA 1XXHE 4M99A 1M6YA 5E7JA 4H31A 4AJIA 1BE1A 1R6UA 2EYQA 1PJRA 3O8RA 3PLRA 1LX7A 3MWJA 5SZHB 2PUFA 5IC6A 4MQ6A 1W29A 2W6MA 4JLUA 1OLUA 3VKGA 3EULA 2PIAA 1WS6A 2D1SA 3KAJA 3COJA 3L0BA 5FA8A 1R9JA 2PKRA 2IC5A 3ND6A 5KYYA 3RGGA 1HDEA 3PGJA 3C1AA 3RADC 4MUMA 1KJ9A 1U80A 3BN3A 3M1LA 1AGYA 2GO7A 3B1FA 2OY0A 1YCHA 2RGEA 2BH9A 3OT5A 4R83A 4LIPD 4EG1A 1BZYA 3OECA 1G8SA 4RK7A 3OICA 3I73A 3EZ9A 4AIIA 3BDIA 1C7JA 4GQIA 1NNEA 3LIIA 1W1UA 1KI1A 4Z4QA 5IJWA 4CUKA 4C89A 4J3NA 1A2BA 2G1JA 1W46A 2XE4A 4A6PA 4B3CA 4FFSA 4ZCPA 4QUGA 4D41A 2IHNA 2FFQA 5DHFA 2E82A 2H1LA 4NVRA 1PWYE 2Q1YA 2GLTA 4RIHA 1TTPB 3RF6A 1OB5A 1RC0A 2X8JA 1SCQA 2JJ2A 1LWNA 1XAJA 5IASA 1IG3A 2GPWA 4BEBA 1HUQA 3ZY3A 5GJVC 2HQOA 3BSWA 2J8ZA 3JATA 1KO1A 4R1TA 4AJEA 4AUEA 5FD8A 2PPLA 3PDIB 3GYBA 4U2GA 1PP4A 4OA8A 4H08A 2NZVG 2Z6VA 4XSHA 5DDIP 1DJNA 4D3ZA 4PHGA 2PGNA 4JMLA 4CM8B 3OQIA 2NX2A 4C76A 2ZCJA 2Q8PA 4UVIA 1MRZA 2X8WA 1XVLA 5A5GA 5IJ9A 2GEFA 1Y4ZA 1ZPDA 3DYVA 3HHEA 2TMGA 4ZI5A 4YUWA 3DTVA 1S0UA 1J49A 3RUFA 5I8ZA 1S9HA 4BX0A 2D7JA 2X3YA 4FFVA 1X7WA 2HCJB 2Q99A 3IAFA 1SU4A 3B82A 3KJEA 4Z3DA 3T41A 4DUGA 3IEIA 1ACMA 3JVVA 2XF2A 4UM8B 5C1PA 5CG1A 5HOEA 4V0ME 1SCIA 1Z83A 3D3EA 3MB5A 1NP6A 3IH5A 5CB0A 3F6CA 3R5HA 4OP1A 1O8CA 4D9MA 3HJTA 4B6GA 4CFZA 1ZITA 3MCAA 4U5XA 3VU1A 2HLPA 3A14A 3T9CA 3HLTA 3IOCA 4G0OA 3IKMB 4V1CB 4CBVA 1KDZA 1CD5A 3L7CA 3A06A 5L95A 1CQZA 1A5BB 1I1OA 1EFDN 1C41A 1E5VA 1GPKA 1R4ZA 5B1DA 3W5CA 2O6LA 3WKCA 4U6QA 1RAEA 1UJ5A 4Q66C 5TY0A 4B81A 1FS6A 1RBYA 5I7SA 3J7AC 1US8B 4PXAA 5LA6B 3I04A 3KV3O 2E1PA 3O7WA 1M1NB 3KEFA 4GC9A 4BDSA 2P65A 2PL5A 4CEHA 2C9CA 1KI3A 1OXXK 3PQ7A 3L6CA 4H0NA 3CRMA 2HHHB 3S8MA 1JFFA 3BJEA 3BTVA 2JGAA 5F52A 4DCVA 1R9MA 1I10A 3E5NA 2Q8NA 3USES 3VR5H 4UEQA 1CYEA 5TR9A 3R6GA 3F90A 2V6BA 1HYBA 4INAA 1AQLA 1UBFA 1IN1A 4MRNA 1VBMA 3DNFA 3ZGNA 1SU8A 2OK7A 1UJBA 2D1RA 3M4XA 4F93B 2QBYB 1EDOA 2JI8A 4AFNA 1SIUA 2DPXA 2E48A 3OOSA 4P2GA 3UM9A 3ZE0B 2AIRA 1XMQB 4NBNA 1A9ZA 5KYGA 1VTKA 2KJQA 3LDUA 3AR9A 4YMUA 1U4SA 2J87A 1NOJA 1UQRA 4AULA 3Q3VA 4ZAXA 1J0BA 2VHQA 5G02A 3THWB 1DTWA 4Z9AA 2QQGA 2VJQA 1I0LA 1NXSA 5KC8A 1K5DA 4ARBA 1ML3A 3ZH9B 3M6FA 4ZI7F 2VATA 3NHJA 4IDPA 4I50F 1XRQA 4QDKA 2II6A 5L7YA 4DB2A 3SX4A 3AHFA 4X6LA 1XRRA 1A27A 2K7ZA 4LRWA 3Q87B 4BO5A 5KIAA 4PX5A 4C0LA 2GNOA 2DBVO 3L04A 3B9PA 4AI6A 2QLNA 4EOGA 3ULKA 4QPDA 1IQ0A 2XCRB 1TEXA 4URYR 1W5AA 4U7GA 4B3RB 1PKXA 2OZKA 5TF0A 1U11A 2QQFA 3EIFA 3ZIUA 2JFPA 3UF0A 4GRAA 4KYTA 1E60A 2ZI4A 1EP2B 1MPXA 1J21A 4FKBA 5ALFA 2AXNA 2XWJI 4D56A 8LDHA 2FWPA 2ZRDA 3VKFA 3M9XA 2GWRA 2OQVA 4LVOA 2CEAA 1XZEA 2EWMA 5KYUB 3VR6H 1SMKA 1L4FA 4HDRA 4F8JA 5BWNA 2HJGA 4QPNA 5ALXA 4KYIB 4YIHA 3CCFA 3LX8A 5AM4A 2AN9A 1MQSA 3RK1A 1QMGA 4R2LA 1XJ5A 1S02A 5F9MA 1FFWA 5A5VA 4G56A 3LRXA 1NT4A 3UB4A 3CONA 2XUFA 2YJTD 3ZI0A 4E5DA 2VBFA 3DFKA 3MUFA 3ROPA 2W4QA 4UPDA 4GOKA 1Z8HA 3S2EA 3VR2D 3BL8A 4IIJF 4M7PA 1NYQA 2BF4A 4URUR 3WL4A 3K1JA 1W4RA 3QVMA 2XKJE 4BBZA 5JASA 3NNSA 5D1HA 3GIWA 4ARZA 4OBBA 3QHAA 3NFYA 2CHQA 1UMCB 4KAXA 5DLQC 3NATA 2B37A 2P2YA 1GTSA 2C2BA 2BGUA 2QM8A 2QAGC 1XA0A 4HLCA 4QODA 2C03A 2GD1O 3RIMA 1YQWA 4MZXA 5ETJA 3VU3A 4YJHB 1H2RS 1XDDA 2RHBA 1PUXA 1P4JA 3E03A 3ZTWA 1LLUA 3IAM1 4KYUA 3D4NA 3MWDA 1ZGZA 4R69A 4BMOB 2QDKA 4BVJA 3KQNA 4DJ5X 1SU7A 2BT4A 2ZUDA 3CGWA 5A6SB 2H0QA 1EBUA 1P0FA 2OO5A 3PDHA 3RVLA 4EDFA 1IJFA 1USUA 4PFKA 1NJFA 2OBNA 3IQXA 3OQMA 3E82A 4KIUA 1FSGA 4US2R 2FEXA 1ZJJA 2O0LA 4G8BA 2ZS8A 3AJ8A 3FPAA 1L5QA 4WUVA 4JVNA 1MTOA 3IKLA 3RBAA 4CKEB 5LIRA 1GOTA 3VNQA 3M33A 5BVGB 3JARA 2QR3A 4B6SA 5FADA 1MJHA 4PPQA 3KVVA 1G8PA 3FHCB 3KT3A 4MUJA 3I5YA 4PEVA 2B82A 3HVJA 4PAMA 3STHA 1J2TA 1XZGA 2LV8A 3PCRB 4B3IA 3Q5GA 4AJPA 1XCMA 1S3SA 1E94E 3UBTA 4J1SA 1JA9A 2CNDA 2FG5A 3Q5DA 3LHKA 3OE5A 1W0JD 4TRJA 5EE0A 2GQ0A 2XMCA 4OXIA 4ETNA 3LCRA 3ZGXA 5A4KA 3VDNB 4PSKA 5TMEA 4B7ZA 2I1LA 1Y4UA 2H29A 2BGTA 3TZ6A 5HG0A 3NDRA 2ZWAA 3JQQA 2C8KA 4OQZA 1UPAA 4L0MA 5TB5A 4JA2A 2MSWA 3CVYA 2D1FA 1JZTA 5BN1A 1DEKA 3A27A 1DO8A 1JQKA 3ECSA 4B7UA 1U99A 3RKRA 3FFTA 1Y3FE 2IWHA 3RHZA 4C4OA 4J7CA 4JIMA 2X0NA 3TXXA 5B36A 3VNVA 3E23A 5ALNA 5LIPA 4Z3KA 2Z6UA 3G0DA 3FWNA 4GPBA 1Z9BA 4LF9B 5EMHA 2AOTB 3HI4A 1I2ZA 1QTRA 3ONEA 5DGCA 1T0PA 3AY0A 4POAA 3HEAA 5FTWA 3E58A 3DE2X 3PX2A 2CCGA 4LFBB 3IMKA 2ORWA 3PTZA 4DLVA 2YW9A 1NQOA 2YY6A 3LQFA 3RRNA 3U17A 3ZWPA 3PGXA 2IE8A 2PGIA 1UMBA 2G9QA 4H1UA 5BWMA 1DE0A 1LU9A 2VH5R 5D84A 2YR0A 1WF3A 3AETA 3K6JA 4KWIA 1DAKA 4H3SA 4U2BA 4C5BA 4EX6A 1Q0ZA 4EVQA 3HN2A 4BZWA 5HOQA 4W7IA 3EA0A 1H5QA 4AYXA 2W8BA 3OHMA 4Y2RA 5DRYA 4CT4B 5K8JB 5HA5A 3G2PA 2JCSA 2HJRA 2CLMB 4OUKX 4TSFA 1SG0A 3OOYA 1CEEA 1N9ZA 5HQ3A 1QK3A 1UBEA 4JGIA 1ZMXA 3AB8A 2XQJA 3CFYA 5GJBA 3IJPA 4HWRA 2HADA 2P4QA 2Z83A 5JCJD 2J4DA 1BROA 4P4SB 1HNZB 3OJLA 3QBEA 2NXEA 2W9XA 1GRQA 3EPRA 1LX6A 4K9LA 4D98A 2ZRQA 5DNEA 4E3ZA 4OF4A 1E66A 3KHUA 1YRAA 3FDIA 3THSA 4II2A 5AJUA 3ZCXA 1ID1A 1EVZA 5CEJA 2AB0A 1S2DA 5DXFA 5K3FB 1FRVA 3HABA 3LQYA 4G1EB 4Q7MB 1XMPA 2HK7A 4PZYA 2K4MA 2WG1A 3VNBA 1A77A 1LCIA 1K7CA 4N7JA 4DLXA 3G23A 4GOXA 1N75A 2JJQA 1ZY2A 5CIYA 1AXEA 2W2KB 4K6CA 4B0PA 1C8KA 1HQKA 1BQEA 5E6RB 4ZAWA 3LPCA 5IP5A 1V5GA 1Y1RA 3KUKA 1DOHA 3JVIA 5FKJA 4LHZA 5DVZA 5A4JA 2WZQA 2ZIVB 4DMGA 5J4HA 1R4NB 3D0OA 2FSHA 4D3XA 1YA6A 3CG0A 3WISA 3TVDA 3IMFA 3WSTA 1L0BA 1GFSA 1JTVA 2AVDA 4TROA 1BXGB 2DWUA 4CMEA 4XVHA 3EZYA 1DPFA 3D6FA 4HRYA 1JTEA 5DSTA 3TI7A 1KEEA 3T3MB 3EUFA 1YB2A 3TXYA 3EC7A 5C32A 4PGAA 4LHWA 1P45A 4DABA 3I09A 2AOUB 1W4ZA 4B31A 1RRMA 4D1YA 3TZQA 4YAWA 5IRCD 1XRMA 1UDRA 4WCVA 1U7ZA 4C4ZA 4MMYB 1CF9A 1W73A 2Q2WA 3A6LA 3RFTA 5JDIA 3VR5A 2E7ZA 3GGGA 2A88A 2RGAA 3NOVA 1K86A 3R3SA 4A10A 3BILA 4A16A 1EHCA 4EJ6A 3OT4A 3ENQA 3ILSA 4IYRA 4BFXA 3EXG1 2JFYA 1ORIA 5B55A 2WQ6A 1UEIA 4GX2A 5KNCH 3FSGD 1D7AA 5DFAA 4D26A 1OI2A 4URWR 3ET5A 3RH0A 2OTCA 7MDHA 1AH2A 5F21A 1I3NA 3G0OA 3PKZA 3DDHA 1YJBA 1AUVA 1Z8NA 1KYQA 3JQ7B 1OZHA 4JFAA 3WZLA 1ZNZA 2B6HA 3I9NA 5G0VA 3EEIA 3TLAA 1DQNA 2NU6A 1BDBA 1F2UA 4EAAA 2CLFB 5CVTA 4TMVA 3P0RA 4OHCA 2JIQA 1QLWA 5DX1A 1EE9A 3E2PA 3TFWA 4DA7A 1ZIXA 1CT9A 4XJVA 4FR5A 1IB0A 3N2KA 1UDXA 4F4JA 2RGUA 3ZVRA 5KKNB 4D9GA 1XT6A 1P1KA 3SQXA 3GF4A 1R0SA 1Y34E 2GN2A 1YFZA 3TYXA 2QD1A 1E3WA 2ZSEA 3O74A 4B6JA 3BE4A 3Q7TA 1GTG1 3NWBA 4PSUA 4WLUA 3B48A 3GVCA 1JJBA 1EXDA 1GYQA 2Z9DA 5DHPA 1TMKA 1QPBA 3B8HA 3HVIA 4XFKA 1IN4A 2QVGA 3G1WA 1F9EA 1YJ8A 1Y9ZA 1ZK0A 1TFUA 1W49A 5C1IA 3SZGA 5DNYB 2DPHA 3PPYA 3VR6A 3L6OO 1WSBA 2WU3A 2BUCA 3IPRA 3HDHA 3TQQA 3S4YA 5CCBA 1MOSA 3RSZA 4GXRA 4MW2A 5HKBA 3MT8A 3VGPA 4Y2XA 3G89A 3LU1A 3DF9A 4J0JA 2VSNA 4L4SA 2ZUTA 4DVGA 1JPUA 4YAKA 5DM70 1SXHA 2P30A 1JFLA 4MIYA 4XVQA 1DQRA 4BPBA 4P84A 5CM8B 3V33A 5JR3A 3PNLA 5JPIA 1DEAA 4P3KA 5EKSA 4AS3A 4A3SA 4O2BA 5BN4B 1NATA 2PIDA 1LBHA 2JAHA 4EB3A 5LOVF 2JIBA 1QYCA 4M0DA 3M9LA 3NH6A 3DL4A 1P4HA 2Q5FA 2NUTB 3HZHA 2QMZA 3I1JA 3VVBA 4ARAA 4M7RA 3QFCA 1HRKA 3VSDA 3ZK9A 1U0HC 1PQ4A 1LC0A 3AUFA 3D7LA 1TZ2A 3U7QA 4Q4CA 1VHTA 3G0IA 3NGXA 4BN4A 2WAMA 2ZUSA 4QU8A 4R6XA 4XIJA 4XIGS 3RGWS 3A1TA 1VP9A 4CG2A 2EFYA 1XD2B 2WM9B 2YFYA 3HUTA 5TJHA 3CURA 3T7IA 3SG0A 3NS7A 1EUYA 4YO7A 4ZVRA 4ZEWA 1J8MF 3HYCA 3IJRA 5KDLA 5C18A 3NG1A 2WHPA 2N3ZA 4N47A 4IGIA 3OTWA 5KQPA 1TM3E 4OXKA 5CAEA 3C3EA 5I9TA 4G23A 2ZRLA 4XOUA 3LSTA 1UFVA 3BGVA 3KD2A 4FU0A 3AF6A 2FSSA 1L7VC 1AIPA 4BP1A 2CKDA 3LDFA 1NBIA 3E70C 3EDOA 3QXXA 5LB2A 4BMNA 1FTNA 2AC2A 2Y05A 3MJTA 2YDXA 1R0KA 4PY2A 5PNTA 3DQPA 3F73A 4PZUA 2JGIA 1IE3A 3H5IA 3T06B 4EUSA 2GKGA 1AMUA 1KXJA 3LBFA 4JJKA 1MH9A 2F59A 1T2DA 1YASA 2JZNA 1P75A 3ESQA 4UUQA 2XNDA 1X7GA 5HEKA 1RYBA 2PV7A 3ZK7A 2X40A 1IXRC 4E2FA 2B20A 3ETCA 3HLKA 4ZJPA 1GAEO 1P0PA 3A25A 2KS6A 3AEUB 3FTEA 3W6OA 1HA3A 3A4NA 4ZCIA 1FXSA 5CP8A 1IK6A 3NAZA 1FL9A 2HT1A 2P2ZA 1XQWA 2SECE 3AZOA 4BLQA 4WBSA 2XYPA 421PA 5KTSA 1PX0A 3K3PA 3QLTA 4KWTA 2M1ZA 3X43A 1T9DA 4NCBA 1WL8A 3KVNA 3STUA 1KI6A 1ISSA 2J5XA 4YVFA 5KYNA 4XGIA 4KR7A 4BGIA 1G8GA 3HA5A 4YS6A 3AR3A 3IKTA 2GJAA 1XEWY 2QGZA 3FZGA 4Y7DA 5TS2A 3GUVA 5CB6A 2FMTA 2DU8A 2QIOA 3FCSB 4F9FA 4RY9A 1Y1QA 1E58A 1AY0A 4MEBA 4R98A 3NUZA 2I22A 1F6BA 1T9BA 2ERXA 2ZCVA 3CYFA 3C87A 3LA6A 3MRXA 1KSGA 5REQB 3VNUA 1J7KA 1E9AA 1SVWA 3L84A 1U7DA 4UTPA 1DB3A 2H4ZA 3TZBA 2HW8A 1SBIA 3OUZA 1P7VA 2RHHA 1A76A 1EM6A 1W4AA 2WIFA 3B7WA 4CPDA 5GIOE 1CQIA 1D2RA 3HV2A 3WLKX 1Q14A 1GPBA 1EYZA 3RC1A 2DKFA 4GMFA 3VZRA 2HREA 1FFXB 5C1DA 1W5SA 1SVUA 4H3VA 2HGSA 1DOZA 2CUKA 3WRYC 3CM0A 3E22B 2H00A 2XD4A 3QPAA 5H68A 5T57A 4AX8A 4UASA 1OFHA 4XIYA 1KR2A 1WP4A 4LRTB 2QUKA 2W70A 2D54A 1VYUA 3AM3A 3K0AB 2BSQA 3JTEA 1NC1A 1RPNA 1ZJZA 3HCBA 3PQ3A 1LWOA 1M8KA 2J32A 1S8NA 3HKBA 4JEUA 2EGGA 4F8YA 5CDTA 5K8VA 2REBA 2NV6A 4Z51A 4IH1A 2QKYA 4OCZA 4Q4HB 2Y67A 5DYIA 1G41A 2G4CA 2HDNB 1J7JA 4UNIA 1QG4A 2HUPA 4B85A 4LDAA 1YR1A 4YRIA 2I6SA 3L18A 3T7CA 1GAJA 4GVPA 2X9GA 4JBNA 2EHDA 4FILA 4A9AA 4M0MA 1SUAA 1LTQA 4HAIA 2HLHA 4JVMA 3QLJA 1T6ZA 3DBIA 3GP5A 1P19A 4RD2A 3GDFA 4HZIA 2FUCA 4X7MA 3OZEA 5IEJA 3SS7X 4RH1A 4HZUA 3BQNB 4IKOA 5F1KA 4HNQA 5AD1A 5C8XA 1U2DA 1KRWA 1COWA 1DI0A 2QD4A 4N39A 3L1VA 4MV9A 3U80A 4XUDA 4WNAA 4OI1A 1Z74A 1EWKA 3JQ6A 1T8TA 1AK9A 1QIKA 4GXNA 4YLGA 4BEJA 2P41A 3KOUA 1BCSA 3N86A 4A5SA 2NU7B 2X8BA 3OBBA 1DUVG 1HKUA 3R40A 5GM2A 4R0NA 2RH9B 3MINA 1ZOSA 4O2AA 3DVLA 3T7KA 4R9VA 3W2HA 5IX8A 2XNKA 2AZMA 2E5FA 5HCIA 3RLFA 3WB9A 1NN3A 3NAGA 3O8NA 1SJ9A 3A28A 2Z9CA 4MRVA 4NZ9A 3ML1A 1C3JA 4IDDA 5L3ZA 3SC6A 2J9GA 4MUNA 1XV5A 4AY2A 4FDLA 4L3WA 5ESDA 2X23A 2Z43A 3QEKA 3UANA 4MS3B 4CCYB 3H19A 1NMZA 3E7WA 4YRRA 4OREX 1VGVA 2WKRA 2JJ2D 3G85A 4MUYA 2C9YA 4OBWA 2GSWA 1QQBA 1UIRA 3IS3A 2RCNA 3FTNA 3UK0A 1MAWA 1KEPA 1NY5A 2PU7A 1XCBA 3KHKA 5JMPA 1Y81A 5KNCA 3ETDA 2ZBPA 2PUWA 3A3PA 5DIZA 3N2IA 3FA2A 2PQMA 2A9QA 3CLRD 1CIJA 4LW8A 1J33A 1JKMA 1O1YA 2PQ6A 1Q0RA 2C5EA 4DIMA 4ER3A 3MWLA 5I47A 5MFPA 1BEZA 5IZ4A 5DGDA 1BE6A 3IJEB 2J9ZB 4HQOA 5AHRA 5AW0A 2D1QA 2QX4A 1SEPA 3F49S 4Y1RA 2YV5A 2WV7A 3D4IA 4BNDA 2AH5A 2RGCA 5LBTA 4F1WA 2ZRAA 4HDCA 5A9SA 3AKEA 2HSJA 3DTVD 4DE5A 4DA4A 3Q41A 3FDZA 4L22A 4K6HA 3MLBA 2VH2A 3H6HA 1R0CA 1QNLA 2R5WA 1Z35A 4DUGD 3T3OA 1JDBB 3DVQX 2HIMA 3QU4A 2X5XA 1Q50A 1CUEA 3LX6A 3JQFA 4EEZA 3N53A 2VRNA 3A37A 2RJ3A 5GJWC 1XXHB 3P0FA 3WYCA 3IP3A 3G2LA 1I0ZA 4K9QA 2DHQA 4PC6A 3U3MA 1BCRB 4HAUA 3ZLVA 1FW8A 3H6KA 2GEJA 3OUTA 1T10A 1KC3A 1YZLA 3AFMA 3GDWA 4GZ3A 4QJBA 1JECA 4U0KA 5DCYA 4TS9A 3UWSA 6Q21A 4P8RA 4FHCA 3K72B 1YZVA 2QK4A 3QYFA 3W5VA 4OGLA 3LOPA 3SU8A 5KVSA 4KP7A 2FF7A 5CNIA 4HATA 5J5CA 1PVVA 1M6NA 5IF9A 2XXAB 1PYDA 3M1IA 4WBNB 2WKWA 4RFLA 3RJ9A 1IEQA 5FCDA 3MJSA 1R3UA 5CJPA 2AN5A 5DHSA 1HETA 2AMJA 4RIGA 4YRGA 5U9CA 3JAWB 3NXKA 1BG6A 4AUNA 2Q5CA 1CR1A 3DFFA 1NA5A 5B5SA 3BH7A 4UBMA 2ZYUX 5FR2A 3Q3GE 1Z5OA 2XDQB 2FRDC 1NIPA 3LH5A 3LHDA 4WZAA 4C4AA 2GVNA 1ID8A 3I9OA 4XGKA 5JJLA 3P9PA 3U44B 1N0IA 4CR7A 5DYNA 4RJLA 1NJSA 3W7BA 1EZ4A 2VTBA 2VZ0A 1QH1B 4IZOA 4UUMA 5IYZA 3LS2A 1FVOA 1M0WA 3AIKA 2OENG 4OD0A 4CQNA 1DKNA 3M4NA 4Q93A 4U1RA 5L4SA 1G98A 1QGDA 3JYPA 1OC2A 2M1XA 3OZVA 4HHEA 2RFLA 3PLNA 3E3NA 3A7EA 1QZZA 1OIWA 2GUWA 3L92A 1P5HA 3NUGA 3O4FA 3UKDA 4FYHA 2EW1A 3QTTA 2W48A 4QGBA 4BMZA 1WZEA 2ICAA 1JIVA 4X90A 1PZNA 5EGSA 1IZ9A 4R5HA 1F0NA 1VHWA 4E21A 3WWPA 1SPXA 4YC7A 1PGJA 4XVCA 1DBSA 1JMYA 3BKXA 1KFJB 4G09A 3LCVB 1ODKA 1P1HA 2J09A 1LKZA 2F9FA 3WZ2A 4ZYWA 1SK9A 5TXGA 4I8DA 3QEAZ 1VLLA 3G8AA 4V03A 3RYCA 3L4JA 2OXCA 2IBSA 3BVPA 4N7BA 2RHOA 4OYLA 1WZCA 1X92A 3OQ1A 1AKUA 2G80A 4KZPA 2KB0A 4FJ1A 2CXOA 1YS9A 5ALHA 3M8KA 3VO9A 1TU3A 4BECA 3OIDA 5LQDA 1KGDA 1OVGA 2CLKB 1JKJB 1NWHA 5CLGA 4CKCB 3G7SA 1B8VA 1T29A 1AK1A 1C7FA 3ZR4B 1MB2A 3SDZA 4CLRA 3PUHA 3UPUA 3HJRA 3ZN2A 1E9CA 4G1FA 4EBFA 5HZGA 1NE2A 1U9IA 2JCYA 3KZVA 3AUYA 2BISA 4NHEA 3F4LA 2VBCA 4LG1A 4RZHA 4V0RA 3KOZA 3P9QA 3P2KA 5AVRA 5HIAA 3I5MA 2DPYA 3GAZA 1IAVA 2PXXA 3SDBA 2I8LA 3ANNA 5LNK1 3WL5A 1GTL1 1QAMA 2VK1A 3EMDA 1KMHB 5H59A 4CDGA 1CUFA 2DBQA 2GBLA 2YV4A 5BQOA 3OQVA 1Z18A 4FB4A 2X5OA 1WPXA 1CR0A 4BWVA 3WL3A 2P6MA 1XP8A 4QU9A 5ILGA 4DLRA 4RM3A 3GFFA 2RHWA 4ND6A 4U9IS 1WB9A 2IYVA 1NG1A 3GN2A 3WQRA 4UTVA 2MOKA 1DEXA 4R0VA 2XAUA 3RS5A 5A0TA 4I14A 2GTIA 1I3MA 2Z98A 3ASUA 2P9EA 3B13B 4MKIA 3RTDA 3ZQ6A 2Z6QA 2NU9B 1BEEA 2QDXA 5BOSA 2YHIA 3HLYA 1RCFA 3GP8A 4NK4A 2NNLD 2V0NA 3QE4A 3R77A 2CXQA 2O2GA 3KD3A 2OO7A 3N2ZB 1USKA 2I8CA 4JYAB 3TRFA 4R71A 4I7EA 2BM9A 1R8JA 1VBKA 4KI7A 4B45A 1HDRA 5SV2A 4MGZR 2BFDB 2B5WA 5TGTA 3ABRB 1XD9A 4IP0A 4GC5A 4BVHA 1RYDA 2V8BA 3DZ8A 4WMLA 4CV3A 2IDMA 3VDMA 1AOXA 2Q62A 3KR1A 3ANLA 3T5BA 2BL4A 1XZNA 2LD4A 3OLYA 4UAUA 3MCUA 2Y3IA 3TRDA 4JEIA 4PIPA 3NBXX 4B6RA 2OVBA 4HR7A 5L3VA 4MWEA 3L05A 5M34A 2Q5QA 1YRHA 3D0RA 3LWDA 5DW3A 2CLDX 5CVEA 3LXXA 5FWYB 3TSCA 2Q9BA 4AZVA 2PX3A 3W2GA 2GCPA 3FYDA 3PUXA 3PJFA 2FPMA 4XDZA 1JQLB 4Q7KA 1X1QA 4WK2B 3VO1A 4ZVOA 4D6PA 5KBYA 1PV4A 2VCHA 2G82A 3M83A 2GFQA 2H3EA 2PZAA 3NTVA 3S8EA 3OE7A 3RM3A 1HT0A 3U2QA 1ILWA 3E8SA 4UJ3A 1UR5A 5JNTA 1Y6GA 1LW7A 2R48A 3TQOA 1QFXA 2NSHA 5I9LA 1RABA 3CVWA 3WYBA 1YU6A 4JOBA 4GZ6A 4FEEA 5KQRA 2GHIA 1B14A 4MCIA 1AHNA 2ZT6A 1XAHA 3P4XA 2LZ0A 2QI9F 3KYDB 4C43A 2X77A 1KAMA 3GGDA 4I9HA 3GJTA 4MWDA 1NW9B 4MRRA 3UNXA 1VYVA 4KPUB 1XLUA 1UDBA 4NDAA 1KQOA 4PAWA 4DSOA 5LQRA 3PXDA 1LTHR 4KXWA 1TDJA 1IXYA 1SURA 4IEEA 3HV0A 3FCEA 3PUVA 5J2TB 5JYBA 5CVDA 3IEUA 2FPRA 1XGKA 3N8IA 1ZOIA 1Y7HA 1TM2A 3T1HB 1TVCA 1C7EA 2C5LA 5JROA 3CUUA 3N7AA 4LTMA 4JUBA 1Q1AA 2Y4OA 4KE9A 5DYYA 3GT3A 1CNEA 3EZ7A 3T4UA 4ZDJA 3WL8A 4YJDA 1FRZA 3HSKA 5DM4A 1U04A 7REQB 3EDCA 2AKEA 3ZWOA 1FJHA 3M6MD 2AYZA 2JRCA 4KRYA 4AKTA 1TU4A 3MERA 4YFVA 4YMLA 5IAAA 4DA6A 4X1YB 5BPFA 3ACDA 1ZRSA 1R8SA 3EIXA 3ZYCA 2H48A 3CRVA 5EQTA 4NZYA 1SXIA 5TEWA 3H86A 2J4CA 2O3RA 4AJHA 5HVNA 5HNKA 3E05A 5TQVA 3UMBA 2Y71A 3ROZA 1B8NA 4YT8A 3HVKA 1Y8CA 3TTUA 1NNUA 5EIXA 4UKDA 5FNZA 2R7MA 2ZTLA 4YCNA 3H7AA 5CVCA 3S81A 1JHOA 5HDBB 1RKVA 3Q4GA 1ZUNB 1L5HA 2IS4A 1I7DA 1S2MA 1OWLA 3ZE2B 2IS6A 5A0VA 4J16C 5CDSA 1TJ5A 1RXCA 4NMLA 3IALA 1L5WA 3MT0A 1ZR2A 3C3XA 4CL3A 3LD9A 2O57A 4TV8F 3G0CA 1KQGA 3UA4A 5I7EA 5JPDA 3ESAA 2OLJA 1M76A 3D1JA 3G59A 3H9GA 3DMGA 2B1JA 3HJAA 4GBJA 3D7SA 3TL3A 5EJ9A 3D2BA 5CBPA 1T0JB 4DF3A 3HCPA 3KIPA 2D0IA 4PG7A 3U4QA 2NNWB 3KXIA 5K8UA 2R7NA 4BVKA 1SOVA 1D0IA 1NRWA 1X14A 3EVAA 2KMLA 1WMSA 2BEWB 1XTJA 3KQVA 2WD8A 4I55A 4BGVA 5L53A 5M7EA 4IS2A 3SQMA 3WGOA 2F1RA 2A1UB 1NASA 2ZIXB 2O2EA 2V5AA 4L4YA 2ZBUA 4YJ3A 4F6LA 4F4HA 1JYFA 4RF3A 1UJ4A 4F9GA 4LISA 2PZKA 2JH8A 2WPNA 3I9V6 3MRSA 2A2ZA 2QR2A 1XWIA 1BO6A 1JG1A 2P4SA 1R1DA 3H84A 4MIOA 1DLIA 3QV1A 3VR5D 2IHKA 1C8VB 4HWPA 4TT8A 4WH0A 5I01A 3I1IA 4K88A 1HYEA 4DDKA 1C1HA 1I13A 4ZQCB 1FZTA 3MGAA 5A02A 1UODA 1YZQA 2EV9A 1U0OC 2NV0A 4JT8A 4U00A 2LDXA 3LWBA 5FPSA 4UFPA 2VEDA 3GRFA 1QRTA 2I6FA 2PYIA 2VHVA 3EBOA 4OIFA 2PHZA 1S1MA 4HDNA 2BFAA 2DAPA 2IA5A 4HRAA 5JVDF 2RMKA 2JLAA 2Z08A 2YRFA 3AM1A 4CDNA 1IM2A 1RYNA 3P9KA 4MKHA 3EJ6A 3SZRA 1NV9A 3GLVA 5E7QA 5FTLA 1ORTA 3QHQA 1B6GA 4IJUA 3ZHXA 3AU9A 3KJZA 2PZGA 1JDNA 1R16A 4XEUA 3E9QA 5ALZA 3TMAA 4COOA 4ZRMA 1KBQA 2PS3A 4JENA 1VOTA 5C53B 2XT9A 3PX3A 4B3MB 4HN4B 2C7RA 1EGQA 1D0VA 3E15A 2C8JA 2BM8A 3RS0A 3CX4A 1OLSB 1UDWA 1A8IA 1H05A 3U0VA 4QVGA 4HQ6A 1CZRA 2HHAA 3FOBA 3QFTA 2YMPA 2BGLA 3VTKA 1LQUA 4CIVA 1E3DA 4ECEA 1MAAA 1FXUA 1VPVA 3COSA 4ZU3A 4BMPB 1CETA 1YL5A 2FRXA 1SM4A 2WM2A 3HY4A 5KHOC 5DLYA 1ECPA 2AKAB 2MTBA 1VRWA 2ZAGA 4HDSB 1ZEMA 2ANBA 2AR9A 3VHXB 3VR6D 4I4TF 4RTJA 5K8IA 2ZKLA 4X44A 2JC3A 1DRJA 3CF6R 3TPFA 3V1NA 1JDBC 4TVBA 2FPGA 4FE3A 4G4IA 4EGFA 2VOEA 4YAIA 1YOVA 3WAGA 1A5TA 1X8KA 2Y4NA 3CRNA 3HN7A 1ZQ9A 1DDOA 1D4AA 1L5OA 2HA7A 3WBFA 2B3DA 4KQHA 4OLFA 2CHUA 1GWNA 3EYAA 2HNBA 4JNCA 3TS1A 1C8BA 5ELXA 5CMLA 3CE6A 5AI6A 1C4OA 4ATNA 1M2VB 1P1BA 3OIFA 5JS1A 1B73A 3AU8A 3HBFA 3HKEA 5LL6P 1BJTA 3KKQA 3HMKA 2C2KA 4ZAGA 2CJXA 2Q3CA 4BE9A 1DWQA 1OYOA 1T5TA 3NP7A 5LOVB 4OK3A 2CUNA 5G40A 1A9TA 5AVQA 2RARA 3RNOA 2GJKA 4PZDA 1O0BA 2E0IA 3RLIA 3RU3A 3PJRA 3RJ5A 2QF7A 1EBFA 3RTEA 1WULS 2YICA 3WQQA 3M2PA 4D44A 2CLHB 1X7ZA 2JCGA 3UUGA 3FIJA 4OV6B 1Z7GA 3NVAA 4D8YA 2HCBA 1WW3A 2G3YA 1D5CA 4G24A 3T7JA 3QYPA 3HXOA 2GF9A 1V7PC 5SICE 2IKSA 1Z0KA 2VJOA 4H27A 3D7RA 2YWRA 2PL9A 2YXNA 2Q21A 1LDYA 4MHTA 1FK8A 3A0UA 3DHYA 4QSMA 1Q15A 1YZ3A 1M2HA 2OXTA 3QVLA 1T43A 3T54A 3M6IA 4RVNA 2UUOA 1K7FB 4D3DA 2BTQB 4EA9A 5J2UF 4M7OA 4OM8A 4FR2A 4N0EA 3A6HA 1ZCJA 2UVDA 3R3XA 2IV3A 4FDTA 3U39A 3QXJA 3G68A 4BFVA 1YZFA 4BNUA 4LBWA 3RAPR 2AFRA 3AIMA 4NENB 2CNLA 4QDZA 2ORED 3AOGA 4DRXB 1YFKA 1USVA 1V9SA 2OBYA 2WHXA 3D5QA 3K5WA 4JLOA 5CDYA 5H4GA 4LKRA 4ZZ1A 2G67A 2XNDD 3IEKA 3SXUA 5G4KA 4CCSA 5BN5A 1WB4A 1WUIS 2JJ8A 3NBQA 4LZNA 1JH9A 3VI4B 1UKYA 1X15A 4KQ6A 2VDOB 3PPVA 2JLVA 1X42A 4XGRA 3CR3C 1U7WA 2B99A 4O08A 1TE2A 1RWOA 1S89A 2H4WA 5C7YA 3R5XA 3WYNA 2UVPA 1TF5A 4W5RA 2RB4A 2JLBA 4UBLA 4P38A 3JQ8A 4EABA 3A9VA 3WGVA 2Z2YA 1CC1S 2P2NA 1IY1A 2C94A 3L8YA 2J9FB 3GUUA 3OIUA 1FIUA 1W76A 4ARCA 2QTZA 4QA9A 4A91A 1KIAA 1I51A 4G4SO 5D3QA 2OGZA 3OTQA 1FMCA 1IN6A 1RBMA 2OFPA 1XKXA 2ZVJA 2NADA 3D3JA 3RS2A 4M0KA 4RZXA 2FHPA 1PN3A 4EG0A 4I08A 3T94A 3P2MA 1V16B 2IPOA 1T2EA 2X0IA 3DUFB 3K9GA 3ME5A 3MYRA 4WLFA 4FINA 5CXXA 4CDRA 1TB4A 3AHCA 1Z0SA 5JRJA 1R5NA 2ZLBA 1U0EA 3OEEA 3HXMA 3BB4A 1RJFA 3AP2A 4HLUA 4KYVA 1H3FA 3BE5A 3K09A 2CBGA 4GRDA 4K9SA 1H6BA 3RS8A 3PTAA 4E2ZA 1ZM7A 3KT0A 1I1NA 4EMTA 4JZYA 4CU5A 1KO5A 4CLXA 5KTOA 1CRLA 2BP7A 4NU5A 1C9EA 4G0YA 2QAJA 4JI6B 3CEHA 1KP9A 4KR0A 4OHVA 4JQOA 2R6FA 3JZIA 4IQ0A 2ADMA 2WUDA 2ZUUA 2RGNA 1K6JA 1EVJA 4XQGA 5EFZA 5G0WA 3X2EA 1ZH2A 1KDOA 4J0CA 5D3MB 5K0TA 1BD3A 4NL4H 2IUEA 1RLIA 2CNNA 2CXSA 2XVXA 4QUDA 4CM7A 3KELA 4Y2HA 2JBHA 3TD6A 5IDQA 2WW8A 1SQSA 3TRKA 2JI4A 4PR0A 2QRVB 3JALA 5COQA 4IV5A 3PT9A 5K3EA 2B4RO 1EGHA 4L0DA 1R10A 4V02A 3SY8A 1GNPA 3Q8MA 3AYXB 1BS9A 4D8TA 1J9GA 2OQIA 2H9YA 4D9CA 5HUHA 1IY8A 5IXJA 2HC9A 5FIUA 1C7QA 3EW9A 4OAQA 4DKXA 3L6EA 1D7OA 2H7YA 3WICA 2CVQA 3MTQA 3GUCA 3JYLA 1NUQA 2FW9A 2CFRA 2HWXA 2Z09A 4Q1AA 1K3FA 1COWD 1L8QA 2O8VA 3K4QA 4MCJA 1L4BA 1W6UA 1B41A 3QMVA 2D62A 3B3FA 1NIJA 1XDBA 5IUNC 5F12A 1XZAA 2E85A 5IXYA 4WINA 1J0XO 2OCKA 4ETIA 2WTMA 4J07A 3BD7A 4LV8B 2ODEA 1NBHA 3BBPA 3T7AA 3TO5A 5IJZA 1U8EA 4N82A 5CK5A 3TJMA 1O0SA 3IVAA 1UT5A 2WHRA 3RG8A 4ZHQF 2AEFA 2XLBA 4ZIRB 2MINA 2UUCB 1HV8A 2Q6KA 1M2EA 5EPUA 3NB0A 2EEZA 4YJ2F 1ANKA 2FUEA 3C74A 4UHBA 3W5BA 5DISB 1WHSB 4FXOA 2C2OA 2LBPA 3L4KA 2TS1A 2VHZA 3K15A 3Q9LA 2I4IA 3DNPA 3JASA 2OUKA 2R8ZA 4KVZA 5GMOA 1DBRA 4IL5A 5KYWB 2JFHA 4U2EA 3EXEB 1UXJA 2ISCA 1PGPA 1EVEA 2CFOA 2PK3A 4GKAA 4YDRA 1QNFA 2VDQB 1W2GA 5LWHA 4YRTA 4BVBA 4L7VA 1IHUA 5AVTA 4G4GA 5KNCD 4JS0A 3DMHA 4JHXA 4EL5A 1B1CA 3PYMA 3SM3A 2JIDA 1XEWX 1IDN1 4GHWA 3QKRA 4MHOA 2VQFB 1IRIA 1NBMA 1Q7CA 2JKYA 3AESB 4MW9A 3G49A 1Y1KE 4WK4B 1BS2A 3F6EX 2BGIA 3U7JA 2I54A 1DAGA 2RHDA 3PGVA 1CIPA 1E2UA 1NRXA 2JIMA 2Y27A 4MVJH 1DKMA 5T4HA 4G0MA 3T0IA 3RSLA 1UBKS 1HORA 1HZZA 1DS6A 4N3NA 4BV9A 1QFJA 5AVJA 2IYFA 2FSUA 4Y2VA 3D8BA 3KQYA 3FIUA 5CU7A 5AJXA 5H83A 4LF5B 1TPYA 1QO7A 4FSXA 5C31A 2J3MA 3WA7A 1C3LA 1L8AA 1CE8B 1UWCA 2FPKA 3FW1A 1UPCA 1T24A 1PS0A 1U3TA 3H0EA 3WNQA 1YRQA 4PONA 4ALLA 4GP9A 4YA6A 2G5GX 3T1OA 1BFKA 2W6IA 3QUCA 5DM60 1Z2PX 2I7CA 1R12A 2XODA 5KTYA 4Z4CA 4FMPA 5EE1A 3CCBA 3N39C 4TMWA 4YDSA 4D3YA 2XCTB 2RBEA 1MG0A 1CZHA 1SKQA 2EGHA 1RMQA 1P61B 3KSDO 3Q85A 4C1BA 3KQHA 1A4IA 2HJSA 1QFZA 5IVDA 1R0XA 1PVDA 1HDCA 3P9XA 4PXYA 4ZO6A 4YJGB 1XJCA 2G40A 4MV1A 1RAGA 4RD6A 1R6XA 1F2VA 4Y98A 5DK6A 4EGAA 1UMDB 1MGPA 2NUPB 4KACA 5CX1A 5D5PA 3CF4G 1M34A 5D6OA 1YS4A 2K5UA 2QD3A 3GD7A 2VHJA 1YBAA 1MDFA 2NSJA 2CB9A 2I2CA 3B3GA 4XLLA 3CZQA 4PX2A 1W6RA 4XAQA 1JLLA 2Q6VA 2GM9A 4MYDA 2H1HA 4P0TA 3ZVMA 1RXUA 4PGMA 1FDVA 1V1RB 3O8DA 4O3MA 4KWEA 4AXBA 2H1SA 2NZ8A 4MZDA 1P44A 1ZN7A 2Y1DA 4WOBA 3WB1A 3WGJA 2EKBA 2G36A 3QE3A 2B4QA 3KZKA 5IUKC 1U0BB 2CBZA 4W82A 5ALJA 3CWQA 4J1TA 4LJLA 4OUDB 1H42A 1ISPA 2DT5A 2ZIEA 3ZCSA 4GXQA 1P9LA 2D5CA 1ZINA 4KNVA 4A8JB 2Q4DA 4XFDA 4B80A 1PFUA 2MHCA 3Q0EA 4M6WA 4W8HA 5AKKA 4DMHA 1XPRA 1PEKE 2HH9A 3IDOA 3PQFA 3A31A 1JSZA 1DIGA 1OKKA 3DM9B 4IWYA 5MN6A 1SN7A 4QJ4A 4UTRA 2ABWA 2IEBA 2ZI6A 4IXTA 5H9WA 3K0SA 4RUKA 1UJMA 2E89A 2I99A 3OFKA 4OJKA 1ADJA 1CNMA 3SQDA 4D57A 1B26A 1L8OA 1JLSA 2FOIA 3MTAA 3GGPA 3VU8A 1U5AA 4GX1A 1OYYA 3PF9A 3EQ9A 4BNWA 2FMKA 1GU1A 4YLYA 3C3DA 3FBTA 4CM5A 1QP0A 1ZHHA 1Y8RA 1RACA 3GVHA 5ICGA 5FJJA 3VHRA 2GRJA 4C20A 1WJGA 2FP4A 3QBVA 1YNSA 4P7GA 2MYNA 3KRTA 1XDUA 4BQOA 2C4HA 2IZ7A 1BWSA 1JSXA 1N0VC 4P3OA 3IPAA 3DXZA 1QGOA 3T9DA 4AJ2A 2P2GA 3NO4A 3GUHA 4AJKA 3GQBA 3QW2A 5JAQA 5B7NA 3STYA 5FBZA 2C82A 3ZV6A 3PCTA 2OCPA 5C34B 4IGAA 2A4MA 4IKEA 4HN2A 2ODWA 1XALA 3DUWA 3DOIA 3KOYA 4FC7A 4LXQA 4R1UA 1ZVJA 3CPEA 3B8EA 3CC8A 3EZFA 3NALA 4RPLA 4F96A 3GCGA 4DDWA 2VTDA 2FOLA 4KXUA 4R1OA 4RMNA 4GRIA 3WGUA 1Q0LA 1IUNA 3V6MA 4YMSA 2PZBA 1L5SA 3A70A 1D6MA 1AKTA 4R68A 4Z5XA 2AOXA 2NXJA 3I92A 3W8RA 4LDZA 5B7PA 5BQ5A 3CX3A 1T13A 4K9RA 3V1TC 3K6SA 4B2IA 3OX4A 4P5DA 4Y6PA 5CT8A 4FT2A 2Z1DA 3LGAA 4DEVA 3WNBA 2YJ5A 3N2GA 1JDUA 3VNSA 3ESZA 4CU2A 1TVKB 3FI0A 1KI4A 1VSTA 4QQFA 1MB9A 4A0HA 1CWUA 3E9ZA 1N0UA 3GDGA 2W2LA 3L4BC 5AOAA 1SVMA 1OI7A 2OK8A 4EG7A 4G8JA 4NYIQ 2I4OA 1NE7A 2XA2A 1T6BY 3EWIA 1LF5A 3PUKA 4NAUA 5GPBA 4PN3A 1W85A 3DW3X 1N3BA 2HSEA 1GTRA 2ON6A 3F9CA 1C3VA 1I7PA 2P7HA 3QP9A 4IFBA 4DV3B 4CKXA 4QIHA 2PKCA 3W3AH 1QRDA 1P81A 2OP0A 2WVJA 3GLIA 3NHRA 2B1QA 4MUKA 1X8LA 3H83A 2FG6C 1ZGAA 1RXVA 3O2SB 2W6ZA 1N5LA 3GJ8A 1R6AA 3GRZA 2B7BA 2P67A 3FI9A 3CLKA 4GYYA 4MHSA 4W1PA 5AHXA 3CNQS 2H51A 3QW4B 3JQAB 1QIDA 1N9GB 3JVEA 2P6RA 1FDRA 1R18A 2ET6A 3G7NA 1LUAA 2ZTHA 4E6PA 4F04A 1G20A 2JGLA 2MYTA 3KQTA 4LMPA 4L9WA 2Z30A 5DNUA 2V6MA 1R0ZA 3VOBA 4ER5A 2XGMA 4RC9A 5EUMA 5AJYA 1RRVA 3ZZNA 2IYPA 5FV7A 1BD4A 2PD4A 3C41J 3AL0C 1V8ZA 2RHTA 4XFJA 3H87A 1SQ0A 1HTBA 2IW3A 4MYHA 4TKZA 4X54A 3TOZA 2B8TA 4KXLA 1V9CA 3OE7D 2ZI3A 2P6PA 4KPGA 3RAFC 2F7SA 3TWOA 2EJBA 1YVRA 2HJWA 5T41A 2IUUA 5ADHA 1D2EA 2HWWA 4YRLA 1T15A 1FSPA 5JJKA 1OT5A 4RVOA 3GMDA 2EQ5A 3SE7A 1YCGA 3L02A 1O96B 4LRXA 5ALMA 2QROA 4PSAA 4AG5A 3NQ41 1TUIA 3CH5A 5ER9A 3ZI7A 5AM3A 1AB5A 3M3PA 1I9CA 4MO2A 1WA5A 3CNOA 3V3KA 1RWVA 4B47A 2XCLA 5KTPA 3EYWA 2HMVA 5DASA 2FW8A 3AV3A 3GK3A 3R24A 3GWGA 3EIOA 4RTPA 1OILA 4KIWA 5THXA 1OXTA 1CS0A 1QG2A 2H9IA 2JVIA 1C14A 4K2HA 4Y6OA 3R9XA 1B93A 1NC3A 3E53A 3GJSA 4M9RA 4ND7A 2ROQA 4EP1A 4HJXA 3D0KA 5B6JA 1VE5A 1BXRA 1X2BA 3DMRA 3LQ1A 3PI7A 2ZBRA 1JS1X 1W19A 3FCYA 3JRWA 1RHJA 5IC5A 1MIHA 3KU4A 3ETJA 3WKBA 5A1JA 3GLFE 3IVXA 2C4TA 1C4KA 2XMDA 3H2BA 1XD8A 2BMAA 1JQBA 3KT8A 5DX0A 2COEA 2KBFA 1IPHA 4RF4A 4ZZ0A 1XMJA 1D9XA 5JI2E 1P2VA 5EJ7A 1Z6TA 3I8XA 3ZCQA 4BEWA 2JFOA 3GH1A 3PUWA 2GB4A 1CEYA 1O95C 2HMSA 5DLPA 3U81A 1Q44A 2Q3FA 1LLQA 1ML4A 4UUAA 4MVJA 5GOTA 3WG9A 1TGVA 1GSHA 3MCVA 4Y2JA 4ZTBA 3FR8A 3SIPA 4MVXA 2QT0A 5FP0A 1F51E 1XZQA 1H2YA 4ZEVA 3MLEA 1ST3A 5IBCA 4KEAA 4XB2A 2C2HA 2ZIAA 2FZWA 1P8JA 1UAGA 2J3IA 3RT1A 2GM3A 4W5OA 4M83A 4G5RA 3WQHA 1UK8A 3HNOA 3TPZA 3I52A 4NJEA 2JRLA 4AMYA 1M1YE 3RKUA 1O5TA 3ICVA 1MG5A 3BYZA 3O26A 5H1YA 4L8VA 2C7VA 5C8YA 4DDVA 5LLDA 3C6BA 3THWA 1EX9A 3V7YA 1N2OA 2AFIE 2EW8A 3HI6A 2C7GA 4TV8B 4V39A 2BELA 2YVUA 2NV2B 2YH2A 4FD3A 4AKHA 4M22A 1N9KA 4KQMA 4NDZA 1DAFA 1I32A 5C8ZA 3IP8A 4PC7A 1YRLA 4MJ3A 2PLNA 4NOMA 4Y2SA 1EX7A 2WEKA 3RJTA 1K3UB 2QUJA 3I30X 3T5CA 1SOMA 1W581 4OBXA 4KLCA 1YAHA 1SXJE 1MABA 2JCXA 2W90A 1HI9A 1JQEA 4HNAB 3SJBA 3TTSA 1NVMB 3ZVNA 5JTUA 4FW9A 5CT4A 3TIFA 3DVAB 4FWTA 1EK0A 1F4LA 3MF4A 3DT8A 3MMZA 3R44A 2J3DA 3DBRB 1Q95A 4P4NA 4WESB 3TOXA 1OIXA 3U4IA 4D99A 5FTMA 1PNRA 2QL6A 4TTPA 5HQJA 2KYRA 5K4AA 5KYXB 3S8YA 1TMOA 5D3KA 5FYQA 1YFLA 1NSTA 3IBCA 1N0WA 3WO1A 2GF0A 5FUMA 3GJ5A 4KU4A 2GHQA 1XX6A 1OTYA 1NDUA 3PDJA 2B3TA 2G8LA 5CW1A 4D45A 4R9RA 1NKVA 5KSOA 5AK6A 4OHYA 2AYYA 3FN4A 4LX8A 4MVYA 2PSFA 1EK5A 3QA3E 5ARCA 1Y1TA 4FFOA 2WHEA 2ZJ0A 1YIDA 2GUGA 2H8GA 4XR9A 1GO2A 4B4KA 5AOBA 1D4ZA 1MBZA 5LZ5A 2XKBA 3FWKA 2WD7B 2Y99A 3K4HA 1ZA2A 3PQ4A 5E9WA 4FWIB 3P2OA 1APBA 3RVRA 3D6UA 1JQJC 13PKA 3ZI4A 3J81A 1D8AA 1A7AA 1U0SY 4RKRA 3U3ZA 3IAS1 4X97A 3T15A 4BCBA 5LKRA 4HQRA 4FGWA 4C29A 1W9MA 3ZY2A 4E88A 2P1DA 1VCHA 1U2PA 4ZZIA 3SSAA 1QRSA 1GGHA 3KTDA 3N8GA 5AKEA 1E59A 2P35A 3O1HB 4ZVMA 4G67A 1JHMA 4U8HA 5AXAA 4KSBA 2NO0A 4F97A 1Z4KA 1E2HA 2XTZA 3BWMA 2HQSA 2QT9A 3UB3A 2SNIE 2IV2X 3QVWA 4OHUA 3ZU4A 3TR5A 3KJXA 5FA5A 1XVAA 2D0DA 4TWJA 3IJ5A 3OY2A 4TV9F 2JLYA 3L8DA 3LVBA 5B4UA 1DG1G 1TK3A 2QVLA 2XZDA 4I4TB 2EWWA 1PJSA 4K46A 3C0KA 1NLYA 2ZVPX 2MSCB 4EENA 3B6IA 4M37A 4WL0A 4DM7A 1I6KA 5FQOA 3WMEA 3ZTYA 1C1XB 3CW2A 3VTFA 3T12A 2EDAA 3LRPA 2I1WA 1R8XA 2QV7A 4YCJA 4PLPA 1YGPA 3OQJA 5C0OE 1HOTA 5EEGA 2H07A 1J8VA 1NN0A 2XHEA 3I8SA 3P20A 4IRMA 1SD2A 3D3WA 4NEGA 3GZ4A 2FF5A 3MRVA 5A71A 5JECA 3TEMA 3D4BA 2QM3A 3R6TA 1IVNA 3DBLB 2IE0A 2QJRA 3PE6A 1ACLA 3UAOA 4OL0A 1HO3A 1AKEA 3UV7A 1C30B 3OMLA 1D9ZA 2V1XA 3QMMA 1RZVA 2HK8A 3W90A 5CB4F 1E3MA 2ZATA 3KKMA 5EZYB 3COZA 1XTSA 4ERXA 2Q3HA 2JLRA 1XMOB 4POOA 1NPYA 3HPRA 1JQ3A 4EMUA 4DWWA 3EEYA 5HTOA 5ENDA 3H2SA 3HFRA 3HSSA 1ZJ5A 2GK6A 3PHCA 3W34A 2PWZA 3UJ7A 2PUBA 4R2KA 1QVWA 3CUTA 3TLGA 4DJDC 2JD2A 3RSOA 4EMBA 5A05A 5ALYA 4Z0HO 2QUHA 3BSYA 4KTTE 5BMVB 3QE9Y 4PS0A 1NT2A 2VNSA 2WJ6A 4YAJA 5GZ1A 1G8YA 1GCIA 4X5OA 3PQ6A 4NEHB 5K51A 2ZBQA 5AK5A 5FUQA 2FSPA 2HA3A 2BWJA 1TD9A 2VP3A 3W3AA 4UNQA 3LMKA 4X6UA 4UE3S 3B85A 4D81A 3LW8A 5BR1A 5G41A 5KMGB 3T3NA 3B3AA 5J2UB 3EVEA 1EZZA 3TBHA 3HJBA 4RZSA 5FFMA 4B44A 4E4TA 2WIAA 1ECBA 1E18A 1LBEA 4IJMA 4Q3KA 1U1DA 3TZCA 2VYVD 4MV8A 2XYHA 3AEQA 2OOKA 3LXMA 4RA6B 4BGUA 1E2JA 4EI9A 3W5UA 3IUYA 1VLHA 1K1EA 1H9CA 1KMIY 1AGPA 1UM9A 4L07A 4QRHA 3VKHA 2XOKA 4PXSA 4WCDA 2DQYA 4W8OA 4J3FA 3W8FA 4FYIA 3AVOA 3CIOA 1GZSA 2X6RA 1NI4A 1SVNA 3VXKA 3TW6A 2C58A 1PJTA 3QBJA 5KJCA 5KQGA 2VCEA 4Z2YA 4O4JA 1NOIA 2FQ1A 2GT1A 2R1VA 1A2KC 2WMOB 2EBFX 3OJFA 2OGTA 3QBTA 5E6UA 5G1PA 5BRAA 5IJXA 1ZD3A 4EHIA 2QZSA 2HZBA 2IDKA 4G36A 2VZ9A 1K68A 4WA8A 1GQQA 2GN8A 4OP2A 5EIOA 4DC1A 4M7WA 4HWKA 3VYWA 4KG7A 3C4QA 5J4VA 5K3BA 3OTGA 1CPYA 3SZ3A 1CR6A 4YQZA 3FWYA 4TN1A 3H2JA 2V3WA 1SU6A 3MSCA 1UBNA 2B0CA 5B7QA 3IV6A 2ZROA 4TRMA 1X74A 3OEED 4EA7A 2REQA 3FSEA 4MUAA 1OH7A 3AUUA 1YBMA 3DD5A 2BEVA 1N2HA 4PC3A 5IKXA 2ZYVX 4EKNB 2EJTA 2YOGA 3GELA 5MHTA 3LBNA 4BTLA 3VR3A 2BMFA 4B6QA 4X61A 5TX7A 2GLUA 1DIAA 4JSTA 3OCCA 1L5YA 4FYMA 4E22A 4MYCA 4DR4B 5J47A 1NI5A 2CHEA 2DT8A 3KKKA 1QBKC 3FYUB 3E18A 5K1ZA 4D8UA 3OBIA 2O59A 2RH8A 3BRSA 1NR5A 1I3KA 2O3UA 1PZGA 3Q0TA 1MP0A 1TTTA 4EF6A 1Q2XA 3O4JA 3VOAA 2KLHA 4O4HB 4OXRA 4P4TA 2VNJA 2O1EA 3EOAI 1TLFA 1KK1A 3SOPA 3IOMA 2HD4A 3K0CA 3ISJA 2OZLA 4PYLA 2WMYA 2GJSA 1NOKA 1L8XA 4F6CA 1VIMA 4MW0A 4Q1DA 4NHOA 1F2TB 2ZIZA 1QIEA 4D8VA 4MRPA 1E63A 2ZE8A 2BGMA 4JQZA 2E55A 2VUUA 4BBPA 5BV2P 1YJQA 1JEYA 1ZAKA 4BQIA 4C2UA 3GEPA 3WB2A 4AY6A 5F2NA 1CB7A 2WYWA 2AF3C 4P3NA 4Q1FA 2X19A 5FLXA 2JLWA 4IXNA 1THMA 2WA1A 4BJ3A 4LMRA 3E0XA 5HK8A 3V9AA 5L3QB 1WUYA 2ID9A 4WJKB 1OAKA 1H6DA 3OPYB 2C8LA 5KOHB 1IEXA 3O3NB 4Y2TA 3A58B 4IS3A 2JEZA 2DHEA 1X1BA 5B58C 2YV1A 4JQCA 4LV6A 4NAVA 1G64A 2LWIA 1TAHA 2LP4Y 4U9UA 3WIBA 1J9ZA 1VGRA 1ZC3A 1XU4A 2SKEA 3D1LA 4NAHA 3GROA 3SHTA 4XVUA 4ROSA 6PFKA 2FPLA 3ASYA 3VNAA 2C04A 4FOOA 5FUVA 2GEDA 3DZBA 4C07A 5C7LO 2AOVA 4LMAA 2FWNA 2XDYA 2RB5A 2VQ6A 3FPGA 4EECA 1NUUA 5DNAA 4ZHQB 1ZIDA 4PM4A 4L76A 2C5SA 3Q9SA 1R66A 5BO5A 3AW9A 4KXQA 4YJ2B 4JLPA 3C97A 1FFBA 1SZCA 4B82A 4MVJP 1CZOA 3MQ2A 3IDFA 1ISGA 4S1NA 4K6MA 5BV0A 2ZSKA 3CT6A 1QAOA 5ALLA 1J5EB 1P4GA 4MP6A 4F5WA 4EVIA 5THKA 5LZ7A 2HEIA 3H16A 3H1GA 3EGDB 5FBHA 1LXCA 2HM7A 3RV3A 5IH3A 4GSLA 4ZOQI 3I2JA 1GKUB 2GVZC 3OZBA 4GAEA 4Q4JA 4M9CA 5CD1A 3OD1A 4S0XA 2QI9C 2VCYA 3Q3HA 1ZJWA 1NBMD 1OIVA 1GQYA 2DLNA 3IO3A 2XTJA 3NIDB 4NK5A 3TXAA 4RHEA 2BFMA 3FTQA 2XEDA 3CLUD 1X19A 2WZBA 4DR6B 2FMIA 4O25A 2QP3A 1THZA 2LTAA 1FRNA