3NATA

Crystal structure of conserved protein of unknown function ef_1977 from enterococcus faecalis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
156
Chain Sequence
SNAMKKATMLTYLEEQLEKHLGDYEVGLDWDRKNHTIEVIVRLYAENNEQVAIDDVEFIEFEDGLLFYNPQKSVVDDEEYLVTIPYEGKKGLRKAVLDGFIHYLKVVLDEGQSDLLDFLSDETAEVFELHWEPADFEAMIKKVAETEKEQWIAYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal Structure of Conserved Protein of Unknown Function EF_1977 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
total genus 37
structure length 156
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11217 DUF3013 Protein of unknown function (DUF3013)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11250 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3natA01
3NATA
chains in the Genus database with same CATH superfamily
4RF4A 1ZESA 1T3LA 2XAAA 2GNOA 3DV9A 3LDFA 4K05A 4RKEA 2WTNA 5A9TA 1R74A 1P3DA 1JR3D 5C80A 4KFRA 5HNKA 2JRCA 1JR3A 3CV3A 4MW7A 3HXPA 4Y1RA 4CT5A 2J9RA 1JG1A 1OLSB 1Z17A 2C8LA 3G2HA 4JT9A 4M2LA 3BMXA 3AU9A 1VL8A 1OYVA 5CT8A 2IYNA 3RKUA 3MW8A 1BFUA 3KZ1E 3VHXA 5JMOA 3ZHVA 1WRBA 2Q3EA 3D1VA 3RF7A 1U3GA 1AGXA 1PG5A 3KR2A 4G07A 4TWZA 3PDHA 3ZE9A 1CUYA 1GSIA 1KH1A 1CZUA 3FAKA 3VKGA 1N2JA 1VKHA 2DFPA 3S8YA 2WM9B 1LNZA 3PDIA 1ZBDA 3KCNA 1BKDR 1SU8A 3NH9A 4QPDA 3SIWA 1L0BA 4HQOA 2NZVG 2P9ZA 2QNRA 3MM4A 4PY2A 2G5CA 1YB1A 2ET6A 1I4TD 4QTTB 5E4YA 3FZNA 2X6RA 2BFWA 5DT9A 3W6ZA 1KWKA 4Q16A 1TL7C 1XP8A 4HNSA 3ACBA 5IVHA 5BWMA 4GZ6A 2P3OA 2A5GA 3PK0A 1H66A 2FX5A 4KIJA 4NY1A 2ZAYA 4EW1A 5J2UF 3KTAB 3QLJA 1RXWA 3KZXA 4BMYA 3ETNA 4ID9A 3TUIC 3CQ9A 4C03A 3FDXA 4JQZA 1AURA 3LUFA 2PZGA 4M9CA 5KNBA 1HPLA 2EKQA 1VTKA 3ZBPA 1RVDA 1NXPA 4Z4GA 2JGIA 1ZIYA 2ECFA 1D6SA 1GGFA 2FUEA 3JWEA 3MS4A 1VYUA 5F7JA 3GLHA 4CM1A 4UTVA 5AVQA 2HRZA 1P5ZB 3DSRA 4KQ1A 3Q15C 4BLWA 5DLEA 1SIOA 1VKRA 3R5FA 4YUZA 4LJ5A 5FXMA 1RWNA 5CTJA 4EPRA 3TO5A 2HF9A 3UMVA 5I01A 1HO3A 5B4VA 1VA4A 1I1HA 2J3DA 1CUBA 3GY0A 2PMFA 1J00A 2EFGA 2X2OA 4WK2B 3S2EA 4KNYA 4UTZA 2MSKA 4Q9HA 3AF6A 2FWRA 4IV0A 4Z4IA 4A8JA 1SXJB 1Y3IA 2CJWB 1QS0B 4XWAA 3B78A 4IRXA 3RHSA 2EW8A 3MUFA 1N2OA 3RVMA 2C29D 2BE9A 3WXMA 5C5CA 3CVXA 4HNUA 2JGMA 4GMXA 4TQUS 1ZD2P 1EP9A 1T4GA 4PZ9A 4Q9KA 5G1PA 1CE8B 1E2HA 5EGSA 3RBZA 4EAQA 4RFLA 2XMGA 3KXDA 3LCVB 5ADHA 1NATA 2JZOA 2VYVD 1P2BA 1DEHA 4DGSA 2BFBA 3I92A 5FH9A 4R2HA 3PWTA 1T9DA 3Q3CA 2VYVA 4EX7A 2FQQA 5KYWB 1HG1A 4M3NA 3WISA 1QO7A 4D96A 4YJ3A 3JD1A 3I73A 2X77A 3V55A 4OGLA 3UJ8A 3KSBC 2XGGA 4PCUA 4FB5A 3PEYA 4P4NA 1I6KA 3W5UA 1DKLA 3G0DA 4PLYA 4RV5A 4FYYA 3R9IA 1RRGA 2IPOA 4R3NA 3WY9A 4DYDA 1K27A 2D5CA 4V38A 2XUIA 4NBUA 2HV8A 2ID7A 3F9RA 3VPGA 4NK5A 5AM4A 1K06A 1E3WA 3PGJA 1ODCA 4JFRA 4C6TB 1D2NA 3KB2A 2I2DA 4N6NA 4P5EA 4M0EA 2CT8A 3KSRA 1I7SB 2JI7A 4R05A 2H57A 2FKNA 5FQOA 3ND8A 4AKSA 4F2PA 3S81A 1FTSA 4NU5A 4GI7A 4JVOA 1XJWA 5AXDA 3QXHA 4AWBA 3PD1A 1KO4A 4RV9A 4IIJA 4IDPA 1CWUA 2OTCA 4Q9IA 2Q5IA 3EZ9A 3R0JA 3HY4A 1M67A 5TQVA 3VGPA 3RYCA 2YN0A 1NXWA 3MJCA 4HDMB 4QDZA 1T6YA 3DE3X 3IEPA 5IVPA 1ECFA 2PVSA 2V7BA 1U28A 2B83A 3OY2A 4UUOA 3UQYS 3OFKA 3MYRA 3MS7A 4DJAA 3WQHA 4DPMA 4BJ3A 3A7EA 3R44A 1XZFA 4D4KA 1DP4A 3L7DA 3DHEA 1OGYA 1IQPA 2N9UA 4MVCA 2Z8XA 1WSBA 3HKDA 3JQ8B 3VR6H 5BSKA 1U5CA 3G0IA 4MVJI 5AICA 3A1VA 4FFWA 1ZM3A 3TLYA 1N9GB 1WTCA 2QI9C 1XRSB 2A9FA 3LDGA 3SI7A 3N1UA 4OXQA 4AMZA 3DF7A 1TEZA 2VK4A 5FYDA 4QDTA 3UHOA 2HC9A 1P7VA 3N8NA 4RA6B 4REQA 3BEDA 3STWA 3ETGA 1FFXA 1MRNA 1W4BA 1G2OA 3ZJVA 3T1HB 1KVTA 3PENA 4FUTA 3LX6A 5DXFA 3WWEA 2WW8A 4AZWA 1M2OA 1HZJA 2A35A 3OTHA 1W0KD 3ORYA 4RLQA 2QD3A 4HDNB 4TTIA 3IIJA 4TWJA 5BQFA 4B47A 1W0KA 3FLBA 1VPDA 2ZBGA 1YBFA 3PDJA 2HQBA 1RWMA 2IRWA 2XUOA 1C9NA 3AUYA 3I52A 1M2FA 2BZGA 3BMCA 2UYOA 4XFJA 3QYPA 4ZT2A 3M9LA 4YT8A 5INTA 1FJGB 1CY1A 3QMMA 3R5TA 1E6EA 2QY6A 1LPSA 1HKUA 2R9VA 2ID9A 3MWYW 3FUWA 3RTAA 2QD5A 5AHRA 3QX3A 4BFVA 3O2JA 1OAOA 1FZTA 1DHRA 4IS3A 2A9QA 5AOVA 4PFKA 1Z16A 3GMDA 4CNBA 2I1WA 4MKHA 3E9DA 3K71B 4U9UA 5K3SA 1GPBA 5MDHA 2D00A 4BX9A 4FSXA 4HCJA 5BORA 3AM3A 3C85A 3QUTA 3RRYA 3WYCA 1QFXA 4EECA 1JW9B 2RHCA 3HB9A 2WIGA 3KT6A 5LLSA 4CQMD 2ODBA 2WA1A 2HQOA 5IBCA 4CQMA 4DCSA 2C2YA 4FBMA 1JJVA 3HUDA 4YYEA 3KQOA 1LF5A 2V6FA 4Y1EA 4K6HA 1ZKDA 2LBPA 1DBSA 2B4YA 3GUYA 2WWGA 4NCHA 4ZOCA 3PV0A 3UFXA 4AYXA 3AGPA 2FR8A 3H9CA 1E2UA 3ZOZA 1AKYA 1XZKA 4EGAA 2GK3A 1B1CA 1SR8A 1FPQA 1H5UA 1OCEA 3LUCA 3AI3A 5JD3A 3T5DA 1SC1A 3I6QA 3IUQA 4MW0A 3D0QA 1IK6A 1S2OA 2GEBA 2JLAA 4IQFA 3ZVLA 4FEYA 3SR3A 1NRXA 5IABA 3IVAA 4KNWA 2X0KA 5D1HA 1ZM7A 5TV2A 5AW0A 4C4SA 4KXLA 3C1AA 4BFCA 3R3XA 4HGPA 4FYWA 3HB7A 4IVQA 5T3UA 1Z7WA 4GQIA 1NR7A 2JRLA 1P0MA 2GJKA 2WEKA 4RYDA 5CH3A 5FTKA 3U3XA 3VU3A 5JAQA 4CTJA 3OT1B 3PDCA 3U39A 2JAPA 2P90A 2Z4SA 3W5DA 3HK2A 2O8BB 1H9BA 3ZWCA 4B6RA 2ZBFA 8AT1A 2ZBDA 3TIXB 3A2LA 3B9BA 3GJ0A 3LLSA 4PVCA 3K9FC 3O83A 4JELA 4MZDA 2V7GA 5EE1A 2DWOA 2QVLA 5JMPA 4O6VA 4IY1A 2AOUA 4UD2A 4DSNA 1DXYA 5B37A 1MG0A 4OATA 4M86A 5C8ZA 2VJYA 5E8JA 2IWHA 3VX4A 1ZC4A 3D7LA 1FVOA 3L8ZA 5HJ7A 5JCJD 1K08A 1WZUA 4GR9A 2WKSA 4R2IA 2VYND 4C1BA 5J1SB 3K35A 4NENA 1W1IA 3GUHA 2YXDA 5JCJA 4CQLA 3FBTA 2VYNA 1K97A 2BSXA 2JB9A 2OP1A 1PFYA 2Q50A 2ZVDA 4IYJA 1XRRA 2OCBA 2PD4A 4N5NA 5GAJA 3MWJA 3RLFA 5JDCC 2DERA 4WNIA 2VPPA 2NU6B 5KNLA 2CUTA 3TK1A 1V25A 3SZMA 3GJ3A 2X14A 1XB2A 1ISJA 1K6JA 5C4MA 2P7IA 3EPKA 2R1TA 1L3BA 1NBMD 4CMHA 1BGXT 1W88B 4RQBA 1NBMA 3TQRA 2XBMA 2WR8A 1Q7BA 2ENUA 2I8AA 2KM1A 2ZJOA 3KFLA 2VPXA 1FVXA 4OHBA 2VUTA 2Y77A 3ICCA 3ECCA 2FR1A 2XUKA 3BF7A 4TYPA 1QC5B 3PA6A 5JARA 2P6UA 3NYWA 3PFCA 4DCJA 1SKYB 1Z73A 4URHA 1E79D 2AK3A 2Y92A 4NYMR 2WINI 5KDOA 5JPDA 3GRRA 1YHNA 2XYRA 1QO0D 3KBBA 1J0DA 1E79A 4EPVA 2CF5A 3T5AA 3VKHA 5LBIA 2G4CA 3TI7A 1SH7A 1JG7A 3QNWA 3FPJA 5D00A 3SMQA 1QQ5A 5C8XA 1TEHA 2O3TA 2R8OA 2XLBA 4D0GA 1S0UA 1Z83A 2QR5A 2VL7A 3BGSA 4PZPA 1A5BB 3FLAA 5LC1A 3TSYA 3UKDA 4DR7B 3EGEA 2ZRFA 4R41A 3SYMA 5A2GA 4D25A 1JQKA 2VPZA 3EDQA 1O94C 4HHEA 4Y0NA 2ZI6A 2OKCA 4DR1B 1WZNA 2BIFA 1NXXA 3OZ7A 4UXJA 1MORA 4I8DA 2IELA 2Q5QA 4TM7A 1YR6A 5BQPA 3TOSA 2OG1A 5DYTA 1F2UB 3VZDA 2YINC 2H63A 3IPCA 4MUHA 2AR9A 2EP7A 2ZRLA 3AINA 3W4JA 2CLKB 1T3SA 1ZUHA 3QTLA 5GY7A 2J5XA 2VYQA 1GA4A 2JLQA 1FLDA 1AY0A 3VU8A 4TYNA 4BNVA 4XLLA 3EIFA 1Y6JA 5K0NA 3B3GA 4I4NA 3DJYA 4ECEA 2W9XA 5EWLB 5CVTA 4JNKA 4NULA 5EMKA 2PWYA 1MGPA 5EEHA 2YWEA 1BN6A 4N5LA 2ZM5A 3CH5A 3AR3A 3SZ3A 5KPDA 4RTPA 4RVUA 1DKQA 1ZMTA 2GJ9A 4EY7A 3PIDA 1YFJA 3HCFA 5FBWB 3THYB 1UDBA 1V3TA 3OF5A 3BCUA 2G4VA 5DBFA 4PS0A 2B1GA 3TLKA 3BIJA 1I3NA 2HX1A 1MR3F 3VQTA 3LCRA 1CLUA 1GD1O 3SHFA 4R1NA 1Z56C 3EFOA 3OX2A 4U6SA 4B34A 5BPHA 2WTUA 5BSWA 2SHKA 1EVLA 3DLCA 3SYRA 3COWA 3OQNA 4C07A 1E1DA 5IBRA 4C3OB 4ITVA 4DA0A 3GEDA 1YHYA 3UJPA 3URMA 3P4XA 1ZXBA 1ZOPA 4RHCA 2FQXA 4Y1RB 2YJ6A 3BHNA 2H06A 4EHKA 3K9LA 3MTBA 1SQGA 4IIYA 4BX2A 4DZTA 1UP4A 1WXWA 1BE0A 4GE0A 3FCCA 3SBDA 1JGTA 1NJ6A 2XXJA 3M2PA 1YGYA 2NQTA 4HWGA 2ONJA 3VHXB 9MHTA 4RENA 4CUZA 3EHDA 1R9GA 4ZCQA 1KFEB 2IXDA 2PL1A 2PSFA 3W4IA 5K8IA 3TKYA 4I1YA 3RREA 3ZHXA 5KINB 1SQ5A 2IBMA 2VT6A 3PDIB 4XDHA 3EPJA 2YX1A 3QI7A 4Q37A 4CIBA 4YECA 1BCRA 3NGXA 4KVGA 3GMIA 3H4MA 3V42A 3BIXA 2FMTA 3T5TA 2AZTA 2BDTA 4XRRA 1KJ8A 4A8JC 3KUCA 4DCVA 4EVIA 4DDVA 4CKZA 4H7KA 2ADMA 3F1KA 2V4MA 3O6VA 5FUWA 4B4KA 3UV3A 2OFOA 3WGGA 3BILA 1WNTA 2I7VA 3LOPA 3NUQA 3L04A 3O3OB 2WF9A 4L0CA 3I01A 2FWJA 3K9BA 4NMMA 4FP9A 3O3CA 4HEHA 1VPVA 5I5EA 1DAPA 2XDYA 3O1HB 3IUEA 5C46F 2C4MA 1T0JB 3M6UA 4DV0B 1OROA 3JQ9A 5BOSA 3UCXA 4O1MA 1EVKA 2DUNA 2EJCA 4ER3A 2Y2UA 1P74A 1IQRA 2PRIA 3AF0A 3CS3A 3JVIA 3WDMA 2PXAA 2VSFA 3MAAC 4B4WA 1L7OA 1GUZA 3MCWA 5K3DA 2D1YA 4CLRA 3NT4A 1J23A 5HX7A 4A8JB 3K0KA 1JSRA 1VM6A 5ER6A 4N9QA 1OFTA 4JVMA 5DMXA 1P7ZA 3VI3B 2NSYA 2WPDD 2ZOSA 2A5LA 4TXJA 1ULSA 3P0EA 2JGJA 2VP2A 5BQ5A 2WPDA 3MWFA 4C4OA 4KQKA 3A4IA 4Q82A 5AMXA 2LWIA 1X7XA 1QFZA 1LBSA 1W73A 3LPMA 1HXHA 5EZYA 5F5XA 1YQWA 1G3MA 2G8LA 2HCRA 1NPTO 4YJ3B 2V7EA 3GVIA 4AKEA 1JR2A 2UVPA 3GEEA 3KSZO 3NBUA 4PLGA 1SHUX 1YI0A 4JL5A 4RVFA 4RZ2A 1F12A 5T6BA 2IS1A 1DBRA 1SUSA 3T5CA 5F77A 2VZEA 1U28C 1PL7A 4OSEA 5AKZA 4KODA 5CFQA 5ALGA 4EUFA 1UPUA 5AW5A 2PUTA 4UBLA 2BOVA 3SVZA 2AW5A 1Q1QA 4ENRA 5K6AA 1JAZA 2IY8A 2WG2A 4P35A 4UM7A 5AM3A 2AW3A 4V3BA 2LZ0A 1E3WB 1FFYA 4EO7A 4TRJA 4YRFA 4FMDB 4AIRA 1QM5A 3GXOA 5JAOA 1B8VA 2CNLA 3SN6A 2X2EA 2YMPA 5E9WA 2NX2A 1QIEA 3R0IA 4IJ5A 4IIJB 1L5VA 2O05A 3K53A 1A4RA 4P7KA 3SCZA 3O4FA 2WFMA 2DQ4A 3WLAA 4F7DA 3B5IA 2W58A 1OY1A 1VPTA 1K4KA 4F56A 3D5QA 3LCMA 1UFOA 1LQUA 1Y1LA 3LLUA 4IQ8A 4RH1A 5COQA 3RYCB 5EE0A 4GVPA 3ZZUA 1OXBB 3DLAA 1I3CA 3CPSA 3RGWS 2BGIA 1ZJ4A 1N2BA 4QHYA 3WB1A 4JDUA 1WCYA 2VH5R 4W1RA 1Y42X 2JAWA 4UXHA 3HKDB 4GX2A 1MO4A 4WY8A 2O7SA 3HJGA 3FX2A 1OAOC 5HF6A 1SKAA 2FHSA 2QSUA 2ZJZA 3LBIA 1ISHA 5GVSA 1Y9JA 4X6YA 3KKKA 3QJGA 5A05A 4REQB 1F7UA 1GAJA 3TB4A 2H65A 4D9IA 1FFXB 1SUAA 1Z68A 5HS6A 1JBKA 1IQUA 3GRCA 2WNIA 2XNSA 1J2RA 3UHFA 4NOLA 2ZUWA 1EFCA 2IH5A 3D0KA 4PG6A 2KLBA 3FYSA 4Y6SA 3EEYA 1MABA 2PGOA 1TYZA 2PT7A 1ADYA 1WXQA 2XXBA 3A4VA 3VR4A 3KXPA 4GQAA 1VJTA 3ORQA 2X8BA 3QH4A 4R0VA 4XCQA 3S2SA 1Z8DA 4DHEA 3IEKA 4BU0A 2YVKA 3KD2A 4KAFA 4BVAA 2PUVA 2H1SA 4G0XA 3VR0A 2FR8C 2ZZKA 4O4IF 1H4QA 1HFEL 2ZYHA 3M9XA 1V8FA 3CVOA 5KU7A 3OI7A 4AC9A 1RAGA 1WSDA 4U8GA 4WNAA 5E1MA 5C52B 4YRSA 3AVOA 1LVUA 3DQQA 3BRQA 4JC8A 4OLHA 4C0JA 4MW5A 4H0NA 2VCYA 1NW8A 5HMMA 1KDRA 3I9FA 1ZMBA 1PDOA 4QYIA 3QVSA 4Z8YA 4Z0NA 4DXHA 3S1SA 2ZR7A 5CFOA 2NP7A 2A7QA 3K0CA 4U2BA 1YUBA 2WICA 4CQMB 2CN1A 1Q0LA 5ALWA 1C5KA 5C7LO 4C87A 4U8HA 3WBKA 4DN6A 1ZH2A 1KAMA 1X42A 4B31A 1BWPA 3DR3A 4YUYA 1FSPA 1KY3A 3WIDA 1SC4A 1N75A 2R6HA 2VCHA 2PZMA 2X9VA 2IYAA 1AZSC 1XGKA 2I29A 2J85A 1CJCA 5LWHA 4N0DA 2G25A 1RBZA 4OXIA 1U0HC 1XVIA 5HIIA 3KKLA 3AY0A 2A0XA 4NDAA 3CXUA 4OHWA 2IHNA 3VTZA 4I9UA 3L1KA 4LOIA 4JB2A 3RIEA 5LFAA 1ZNQO 1XNGA 2QVBA 2X4GA 3DQZA 3LQ1A 5DSZA 3T41A 5L3VA 2J0EA 3BXOA 2MIIA 4UEJA 4ZPJA 3WOVA 1QAMA 1KJZA 3VC3A 4EYGA 4GP9A 3BB4A 4Q4AB 3DBRA 3CE9A 2QN1A 5LWQA 1PGOA 2F7SA 3B9PA 3FFXA 4INPA 2WTAA 4AQDA 2Q8QA 3TZKA 4KBFA 3IEVA 4PIPA 1K3UB 3BTUA 3KBOA 1GGKA 2JFBA 3OG9A 3I62A 5HKAA 1WZIA 4IFBA 4J1NA 2DQKA 2GJ8A 4CIYA 4LMPA 2FZGA 4IIDA 3KQUA 4EUKA 1GCGA 1UOOA 2ICAA 3BOSA 3Q7QA 1RW4A 1OGIA 2ZJ6A 3FUXA 3IR5A 3UNXA 4HRXA 4NENB 3GO4A 1Q74A 3HLTA 1TEXA 2FRDA 4Y2UA 5JQGA 1A5TA 2QLJA 3VYTB 2O2CA 3EXIA 3KWJA 2JLYA 3ULKA 4HFJA 1ZVKA 1CS4C 2H17A 4N5IX 2BYTA 1KKUA 3CTMA 3QKRB 4O02B 3C3PA 2R1TB 1YACA 2R11A 1JB9A 1H2EA 1A4UA 1HT1E 1HDCA 1E9VA 4JROA 2E1RA 1IRIA 1ZK0A 4AZSA 1XROA 1QZ3A 1SVNA 3CLHA 2QQ5A 3QFTA 3UMGA 2Z2ZA 1O6FA 3VA7A 2JIQA 1X92A 4WFKA 3SAJA 2V45A 4REOA 3VOBA 4QLAA 2EZ4A 2NSJA 1A8HA 3L0ZA 4XQCA 2XQGA 1SUPA 3I9MA 3R0QA 3OPXA 4RM2A 3G8DA 4DJ5X 5CDFA 4AJ4A 1NXSA 2DXIA 3V8QA 2PX5A 3GNQA 3GXBA 1OX4B 3MCUA 1JR3E 1NR1A 2TMGA 5EVCA 4LHVA 3RARA 3HA3A 1T6NA 4C05A 2RD2A 4RY0A 3OE7D 1G64A 1TU0A 2FUG1 2OV4A 3MAJA 3INRA 4YRRA 1JAXA 4ZAYA 3UAGA 2BJHA 4QKQA 4YI5A 3OE7A 5LQJA 2ETVA 1YE3A 4MVJM 2AXPA 2J9FA 4OGWA 5I9MA 1SG0A 3O73A 4RS4A 1P5RA 1A95A 2W6JD 2Y76A 5KTKA 3RU3A 5CEJA 4HFRA 4XYLA 1DC6A 4I50B 4YRMA 1M5RA 4GKKB 3LKVA 1YONA 2W6JA 4RCVA 5DX0A 4RY8A 4XUCA 2HA7A 3PUKA 2D5IA 1AO3A 4MVJP 4RKRA 4UPDA 4LXUA 4CODB 2GEUA 1UAGA 3GEGA 4ND7A 2QVZX 4RDHA 1AMNA 1KP3A 2FWPA 3TEJA 2NVUA 3V48A 4COKA 1B73A 5BRAA 4YNBA 4ZARA 1FW6A 3JWJA 4ZCIA 3FVRA 3LPAA 2C5HA 4ZCTA 5KWVA 3AR2A 5KPJA 3OLZA 3RSGA 2X8LA 3CHYA 5B1HA 5KMGB 1ZK2A 3TRFA 1RP7A 1DQPA 2YCBA 4TXMA 1EA7A 4B9EA 2O0KA 3A4YA 1F8YA 1T1JA 3KLOA 1P3JA 1GRQA 1QF7A 3QY0A 4J8PA 5IS2A 1K8RA 3UXHA 2PO5A 5IAGA 2YWFA 1ID8A 3GLHE 2C97A 3F1LA 1P5JA 1UCFA 3K9WA 4KQJA 4MYSA 5TJ9A 3T1VA 4JLWA 3F49S 3RSZA 4ZVOA 5FADA 4X7MA 2EU8A 1GZ7A 4X92A 3BN3A 4Q39A 4KU4A 5JAHA 3FTDA 4BE9A 3U4AA 1M66A 4PFSA 3O4RA 4BMSA 2OECA 3EFOB 4QGSA 2VUSA 2QRVA 4FZ3A 4JX9A 3MTJA 4PZYA 5K4AA 5DIFA 4B48A 3ETDA 4JU9A 4LAFA 1PR2A 2ZTMA 4FCTA 1J39A 1T4BA 3RWOA 1X86B 1IXSB 1Q0UA 3PQFA 5UKDA 2BGUA 1A9TA 1C9YA 3IBGA 4I5EA 4RABA 5AJHA 3RVOA 4CETA 4G4GA 3BCHA 4B4DA 3TPZA 1W44A 2MWMA 5IXSA 4XWYA 4BMXA 2QR3A 1ZP6A 4M6WB 5IDXA 1EPUA 2O9JA 1NOKA 3O8BA 3HR7A 4XX0B 5DNDA 1NP6A 2ZXUA 3WK7A 2ATXA 1BNCA 1PHRA 2W71A 1MXHA 1AS3A 1RLOA 1GARA 3OM9A 5AH0A 5BNTA 4F4CA 3JQDA 2WSMA 3L7CA 4WA7A 2BMWA 1WMEA 5THKA 2CL5A 1ZN9A 1Q7TA 1YJAA 4Q66C 5DGXA 3OQ1A 2IQIA 1HEUA 2C2XA 2WF5A 1ATIA 3DW1X 3ND5A 2FZLA 1BCRB 2ZE5A 4HWTA 1Q95A 5ALIA 4DIUA 4IHJF 3BWBA 3QE0A 4URZR 1IWPB 5DVZA 1WJGA 2FZEA 2YTZA 3AB8A 4LQLA 1QG6A 2DH6A 3PYLA 3ZHOA 4YRZA 1C1DB 2OCXA 5HK8A 5C35A 2RKOA 3CVUA 1KH2A 1LUAA 1Z47A 4QA9A 4ZHSA 4QODA 2WVGA 2FPOA 4NV1A 4YVFA 3WA6A 4MEJA 3C7CB 3WMEA 2H59A 1DELA 4EYKA 2F55A 2B4QA 4W7HA 3ROXA 4A3SA 5HTKA 1UK8A 3KTOA 1A8UA 3Q9SA 4B80A 4A36A 3JZIA 2GN9A 5L9AA 1VG1A 2M6RA 5AJWA 4RFSA 1PQUA 2I33A 3DWIA 4V0NA 1I94B 3WIEA 2BUAA 3LZDA 3ZE7A 2BM8A 3EZ2A 2AXEA 1Z3IX 3MERA 5E4TA 3IH5A 3K5PA 4NARA 3AM1A 2BGJA 1VRWA 1QZTA 1U0NA 2JIBA 2VBGA 1KPIA 1XWWA 3HRKA 3KG2A 4J7XA 5ALTA 3TOZA 2A9KA 5DNUA 4YBRA 2G36A 3W8EA 3KALA 5K6AC 3GU3A 5AVYA 2P2YA 4CIVA 3SOZA 1HYHA 1FJ2A 3E3MA 5I9LA 1KI6A 1JHVA 2YHAA 3LYUA 2IYUA 4KGVA 3O47A 3LWBA 3A1CA 3HNPA 4PGAA 4ZU1X 2ZIUB 3RANA 2GO7A 3ROQA 1X7XB 3GN2A 3R5KA 4YV7A 3T3OA 2A78A 1CEQA 3QKUA 2OO7A 5EZYB 5B1SA 3DZJA 1E4YA 3RR2A 3QBTA 4OD0A 3IV6A 3M34A 1UIMA 2JKYA 4HAXA 3F3KA 4AZVA 5G4KA 2UVPB 1ZG3A 5L95A 4MP8A 3CCFA 3UT5A 1QLJA 1NN5A 2W98A 4ZGGA 4J6FA 4AWXA 1G17A 2G40A 3IBYA 3PPXA 5T6MA 4LDAA 4OXKA 3JXEA 2D59A 3AI2A 2OBBA 1R27A 2WYHA 5J47A 4V24A 3F8WA 1W5AA 4P3OA 1J8QA 4BC1A 1QZXA 2Z08A 3PB3A 1Y1SA 2ECOA 4RPIA 1AKWA 2P8JA 1FFAA 1WA5A 5BNWA 1ZITA 1TYDE 2XCUA 3DB1A 5I51A 4FD2A 4OQDA 1RAIA 2I3AA 2OLKA 1XU4A 4S35A 4ZCLA 3SS9X 2QG6A 4BCDA 1WCIA 4CTNA 5BXQC 2BJVA 2WPNA 3R6TA 1U0FA 4W7IA 3GRVA 4X8MA 3QYJA 4LDQA 3MXOA 4Z4HA 5IJZA 1C4KA 1Z4KA 4ZVMA 2Z6UA 3NHFA 5KQMA 4C3UA 4HB3A 5SYNA 4IX1A 4DA7A 3WYNA 2VNKA 1VLJA 3IQDB 1RM0A 3T8YA 1OPXA 1VG8A 4QTXA 2HJGA 1CEXA 2AWNA 2IXBA 3C3DA 1FJXA 3DKIA 3MS2A 2NACA 1KS2A 3FR8A 3IQZA 3KL4A 1PSWA 1IOWA 4D26A 5DEIA 1KJ9A 2QSJA 3NNDA 3NT2A 1XXLA 4HNVA 3NKLA 2R3SA 1QYCA 1E9DA 3VR1A 3GJTA 3HKCA 3OU7A 2CBGA 4D8YA 4ZK2A 1HFJA 3M3PA 4LOJA 2PR7A 5CRIA 4W7SA 1KDPA 1YCDA 2XYHA 2Y1XA 3EH1A 1GFWA 3PHLA 1HE1C 1ZH8A 3C7KA 4EUSA 3KR0A 4CM7A 3K0CC 1NL3A 1DG3A 3L6EA 4PV7A 3IPRA 4QULA 2O3QA 2Y66A 4PSCA 4V0LA 4AXBA 4E46A 5JBQA 2QRKA 1Z06A 1H2YA 4QPCA 3T38A 3UF0A 5LA6A 2R84A 5B3AA 3THSA 2GAIA 2VTBA 1NHGA 5K2MA 1XJ5A 1WV1A 3LDHA 1S02A 3K4PA 2XYGA 1RRMA 2XDAA 1LWOA 2EQ5A 2R1UA 1PUIA 3N8HA 3G2KA 3PQ2A 3D59A 5EXPA 3H4VA 5JCOA 1ESZA 2ZWOA 3IOEA 3MGGA 4X7PA 2CJXA 1EJ0A 1K7FB 3ETLA 3NVDA 4QBGB 5FA8A 3RW9A 3H9EO 3EISA 1JA1A 3D4IA 4TKLA 4CM6A 4ZYUA 1A50B 3AVQA 3L3BA 4RIGA 2P5UA 4WNAB 1VBKA 4OB7A 3A6FA 4Z7QB 1MC4A 1CFJA 4ENPA 2PWZA 4RW0A 1VI6A 3A06A 2QTVA 3ZZNA 4LJSA 3DFFA 2EWVA 3DOHA 4Q47A 4C0QC 4YY3B 3E0XA 1GU1A 4X8OA 4IHKA 3I5YA 5E4FA 1CVRA 4GGMX 2D1QA 4JOQA 1P73A 1Q7EA 3UOGA 3QNUA 3BJRA 1CZOA 1TF7A 1GUYA 2HIMA 5LZ9A 4XIGS 1E7RA 2UYGA 2WJJA 3IALA 1GPMA 4G5XA 3LQYA 2IYVA 4QT4A 1IYZA 3I2GA 5B30A 2XQVA 4RK1A 4XB1A 1T35A 3VU9A 1I8TA 1A8QA 4RJIA 2VPTA 4NP6A 1PZNA 1MU0A 1R0SA 4JT4A 4RL6A 4C0WA 4EFDA 3A26A 4PLVA 1S96A 3TECE 4HEA1 3ZDAA 4FT2A 2R8ZA 2WSLA 2D1FA 3D3WA 1P75A 4HKTA 1A27A 4QEDA 4TSKA 5NLLA 1C9KA 5KYXB 1WXFA 4I4CA 1IHUA 2WE8A 1PK8A 4HSGA 2FRDC 4Z1MD 1C1HA 3IUYA 3D8TA 5B1YA 2GR9A 1IRXA 1YBAA 3MB5A 3M5CA 4Z1MA 1GA6A 3AERA 3SG0A 4KPYA 3QVMA 4XUEA 3GAAA 4PG5A 3QFFA 5M7EA 3Q3JB 4UJ5A 2IODA 3ADPA 5LQSA 4J4BA 4EB3A 4RS3A 4D41A 2E37A 3EJ6A 4ENTA 3FHLA 1U3UA 1Q0RA 1O54A 5H3HA 3S68A 2B6HA 2O5VA 3OJ0A 4M1SA 4P83A 4D6PA 4JA0A 1PR0A 2WE7A 4ZI7A 4FEAA 1I9CA 3HU1A 3EQ7A 1QHSA 4LOLA 3AW8A 3PC8A 3FPHA 3F6BX 1ZCFA 4FZ5A 1Z2CA 2V0CA 3FH0A 3H5OA 1QPBA 4CGYA 1J2UA 4OFZA 4I3GA 1JN0A 5JQGB 2Q2QA 4JR2A 2QQFA 4LNUB 4FWBA 1MO3A 1NVBA 4MTCA 3WJ1A 5K8LA 5KSZA 2FW7A 4MA5A 4DCTA 2YVUA 1OMOA 1H8HD 3PIRA 3HYSA 4JOSA 1EYZA 4QT0A 4RPGA 4JH0A 1R6BX 3ENVA 1H8HA 1XD2A 1T26A 3ZCRA 1XYGA 1EFLA 1HA3A 3CW9A 3IVGA 4O8CA 2VSQA 5TGZA 3ABQB 3GLIA 5FQNA 4HF7A 2VRNA 2HT1A 5HW0A 4D99A 2VDUE 2WWHA 1YQGA 1U1FA 2IS4A 2WAMA 3UAZA 4WERA 2GB4A 1Z0KA 3FGOA 3R5XA 1JHZA 1MVNA 2WIBA 4IIHA 4URXR 1KJQA 2DBRA 2R7LA 4LWQA 1ZKMA 4P98A 3CISA 1KMNA 5I9BA 3GJZA 5HQ3A 4IVRA 1TKAA 1YZKA 2CHEA 5IJ0B 4OP3A 3TG2A 2IUUA 3ZNOA 2IBTA 4M8IA 1U6KA 4H27A 4AJOA 2ODTX 3AJRA 3GA5A 2HTFA 4NH4A 4U7JA 2IUFA 1AXRA 1F51E 1QK3A 4FKZA 2PKRA 2VWPA 4ZVNA 3HB1A 1ODIA 3DPSA 1HEIA 2J9FB 3E2MA 2W43A 5K0JA 4L6IA 2ZRBA 4NAVA 4MI6A 1XZIA 2QNBA 1YJXA 2J9XB 1CUGA 2YWBA 2IUYA 1IY2A 4JUAA 4QGBA 2QN2A 1GOTA 5J2TF 1YK1A 2B21A 1WXEA 1KNXA 2OMEA 3F3YA 1OWLA 3QK7A 1TUBA 4S1WA 2P3LA 1KE1A 2AC7A 5DO9A 3VPAA 3HDJA 3S27A 1GT6A 3CF0A 4YPOA 2LIPA 3D81A 3E48A 3IMCA 1V45E 2NVUB 3EEOA 3KZOA 1QJCA 3RYHA 3BJZA 3O1LA 4RD6A 2ZDHA 2HF2A 3PUZA 3WGYA 4XW2A 2Z1DA 3TOXA 4GYKA 4C30A 3ONNA 3X1XA 4GLBA 4UOQA 1P77A 2PTHA 5FPPA 1WABA 5C8DA 2P9TA 5A06A 2WMOB 4J9UE 3E3AA 3LHFA 4PYRA 3RTGA 5IEBA 1YVUA 1ZI9A 2JIPA 2WF6A 4NCJA 1U1DA 2Q3MA 2ZE7A 3DVRX 4QUIA 3NJRA 3TSCA 2FWBA 3T7IA 2ASEA 2O1WA 1NMYA 4GXRA 1C0LA 5JNTA 2YY7A 4D9NA 3PRHA 2F9MA 1BH2A 3ITEA 2P68A 4NLLA 4OREX 3N8KA 4EWLA 2ACWA 3QYAA 4ALMA 4BQNA 1AX9A 2PS0A 1N1GA 4EI9A 4HV4A 4A7PA 4TXLA 4MUXA 3C48A 4DDUA 2NPIA 5JISA 1RZRD 2DYKA 1UF9A 4N3GA 5IKXA 3QPWA 1MJ5A 3WLHA 3UAOA 1OFGA 1YAHA 4LZAA 2X7HA 2QZSA 3MUEA 1RZRA 2QRVB 4LF5B 1UT6A 2EV9A 3O4HA 4J3NA 4F97A 2C4HA 3V2HA 3GPBA 2GDZA 4IJQA 4WKGA 1RHMA 1ZSNA 4ZHQA 1M6NA 4ZEWA 3MOIA 1LDBA 3ZQKA 1XMQB 2LV8A 5AXCA 3B1JA 3QXJA 3OKPA 3D8UA 4LISA 3TLCA 1JKFA 3BA1A 3N2EA 3P8ZA 1GL3A 1W4LA 4KEAA 4JD5A 1QYVA 3CNNA 1VA5A 2AMFA 3V2IA 1GPWB 2AOWA 3QLUA 1L4KA 2VH1A 3CO0S 1QLHA 1PZFA 4EITA 4L8FA 2ECQA 3AF3A 1JLLA 1M2JA 3I6IA 4IIEA 3AVUA 4AF8A 3PEVA 4BCCA 1YWGO 2RIPA 5C81A 4BWFB 3LK6A 1XCOA 5DGIA 1IM8A 1MD9A 3NGLA 3U13A 4EELA 1NULA 2EERA 2BC9A 4B9AA 4ZI7F 3N8GA 4CEJA 5JE8A 5TXGA 3RQSA 2HCFA 4ZA2A 4IH4A 4MQEA 5HZHA 1AF7A 3D6TB 1OAAA 3LM8A 5E2AA 1XQXA 1W5EA 2Q6LA 2RBEA 3MD9A 3ENWA 2COEA 3OTIA 5GV8A 1BW9A 4LZWA 5C3MA 1A77A 2WJ4A 4CEIA 2EP8A 3N86A 4ZAWA 3GDWA 1T6ZA 2J33A 3C7AA 2V97A 3STTA 3BAFA 2XCIA 1U0LA 4H3KB 2WWYA 1N5OX 4AUNA 4R01A 1DPGA 1GEGA 3LYAA 5DCYA 4DJDC 3G59A 4EA7A 4JC0A 2XVXA 1NMEA 5HM6A 3ZU6A 2PZJA 4F8EA 2LCQA 3KVOA 5TGDA 5K01A 4MLDA 1QGDA 2OZPA 2PWAA 5I7WA 1Z4IA 4V0QA 2DETA 1LS6A 4NZPA 4ONEA 1K5HA 4LGVA 3BDVA 2AOTA 1U9CA 4ZRDA 4U02A 5DHFA 4CF6A 3WK9A 2DUUA 2PRKA 3U7JA 3CZPA 5BSVA 3G85A 3BREA 3HDTA 1FK8A 4GI2A 4O4LF 1J42A 5AM2A 2B6NA 4KI0A 4RTJA 3E2PA 5TS3A 4E88A 1KI6B 2MSWA 4FNOA 1F17A 1Y3DE 4FYKA 1U7OA 2WU3A 4JKOA 5LDDC 1KIFA 4Q3LA 1SRRA 5J59A 3A3NA 5IBQA 4OQPA 2OLEA 3OPYA 2SNIE 4I99A 2G6TA 1P1IA 2E9SA 4B5KA 3R0ZA 2PR2A 5ALSA 2JFXA 3AUXA 5LUAA 2VK8A 5D3MA 4BLUA 4MPDA 3H2JA 2HNAA 1TTTA 1QRTA 1UPTA 4UBKA 5L51A 1VIYA 2IP1A 1TAQA 2H11A 3B1ZA 2FSHA 3SIRA 4E6PA 1E1YA 1JJAA 2OQRA 3D8RA 4UTRA 3UT5B 4D9MA 3WSTA 2J3JA 3PNPA 3P20A 1GPDG 1E2KA 4BGDA 3IAUA 2UXBB 4LK3A 3GLFA 1WXGA 1LD3A 2IZ7A 1L1EA 3PD0A 3DYIA 3IPXA 1HF3A 2ASVA 4CW7A 1G4UR 1XLVA 2XUGA 1TUGA 2WFLA 3GELA 3PF8A 4FGJA 3NM5A 4PHCA 4DNFA 1E2BA 4A2QA 1ZU5A 1I2DA 1G21A 1M5TA 3H0KA 3N0RA 1ORHA 4FHCA 2YICA 2BMJA 4MO9A 4IJKA 2LDXA 3UM9A 1E1MA 3RJ9A 1T5DX 3DZ8A 3TWOA 2I4NA 3F2IA 3ID6C 3BT7A 5CVJA 1WCIB 3RK0A 1S9HA 5EHNA 2ZAMA 4RIIA 1NJ1A 1R12A 5FFFA 2IHZA 2DJ5A 3Q7TA 3K1YA 2HJWA 2F9FA 2GOYA 2WAAA 4RZUA 4XSGA 4XGRA 4E3ZA 5KSYA 5JQWA 5CW1A 2ZYAA 1EHCA 4BCBA 4ZXPA 3SGLA 1GPYA 4BO0A 1TQ4A 3ZEIA 4U2CA 2CFCA 3QVKA 3CVYA 4IV5A 2H4JA 3WNDA 4UD6A 5JCOC 1GTRA 1XPRA 1YBHA 3P2IA 2XQIA 2YDYA 4TV8A 3GWZA 4PWZA 1G8YA 9ABPA 1LV7A 2HK7A 3LXMA 4TV9F 5JEDA 4XYEA 3THWB 3AVXA 3PQ6A 5SZKB 1NX6A 2ZVPX 1FS6A 2BCEA 3L8FA 3PSAA 1CQZA 3EF3A 4F38A 3ELDA 3L7IA 1PR3A 4QPPA 1EM8A 5C1IA 3O4JA 4G0YA 1CUXA 1E7WA 2VEDA 3ANNA 2FN9A 4XCVA 1ZUD1 1GRCA 4IXDA 2OUIA 5A5GA 5LA6B 5HYVA 1BVUA 1I10A 3D3EA 3R6GA 3DD1A 4RCZA 4FFLA 2VTBB 4LV6A 4R2KA 3L0CA 2JCSA 2A57A 2QW1A 4KHPB 2YRXA 3HEMA 1L5WA 2A8YA 4TLDA 2HSZA 2G9QA 1BXRA 3SHWA 1YL6A 4K9LA 4MB2A 4PO8A 2ZJ2A 3H87A 4QYWA 2C2GA 4N3AA 3SP1A 2C3YA 4XH9B 1H85A 4UOEA 3SKXA 4HP8A 3MHTA 3BFJA 3GDGA 4J0JA 5TMDA 4QOIA 4ZAXA 1J07A 5KQSA 4RNCA 5CCXA 3NBFA 1H22A 1ODFA 2Y9MB 3V4SA 3PFNA 3AYXB 1WTAA 3OQVA 1L8XA 1CJKC 4J16A 1ORWA 1ZZEA 4E13A 2YJ5A 3EGCA 3UUWA 4PYIA 4G5FA 2INGX 1VIVA 2ZIGA 1J06A 3E0QA 3V4LA 2GLUA 3BB3A 1USWA 2YMQA 3VU9B 3OKAA 3OOSA 1N5JA 5FNVF 1GL6A 2JLVA 2G82A 1KDYA 2ZRMA 1GV1A 4P0TA 4QSMA 1KMCA 1EM6A 2XWQA 3SQNA 1F38A 2R87A 3ESRA 1WW3A 2AMJA 4QOHA 2SCUA 2KQUA 3QENA 1PQ4A 3PC8C 2FSSA 4ZOBA 4TOIA 3CUEF 3D3WB 1U6IA 1QRDA 4HLUA 1YMVA 5HFAA 3O8NA 4X94A 1YXMA 2GFHA 1JMYA 2HWXA 5DYNA 5JECA 4LCJA 3WKEA 4AF7A 3VJRA 1QVRA 3S2ZA 4NX2A 5E6RA 5FBVB 4MKZA 5JFTA 2B7BA 2WUVA 3OIDA 3Q11A 3PEEA 1G3IA 4J7UA 1YA4A 3ASVA 3AERB 3ZE1B 1DV2A 2ZIVB 4FYJA 1M1UA 2GPNA 1P4HA 3OZEA 2QTLA 4QQNA 4KO2S 4ZEXA 5JZVA 1H69A 4UUBA 1I7QB 4ND1A 3DE0X 2A1IA 2TSYB 4HGOA 4JU8A 5JROA 3EGDA 2C7QA 1ZGGA 1AUOA 4CKWA 3F5DA 1PX0A 4DJFC 3WGNA 2MTBA 2PS3A 4C0HA 4Q7MB 1KNQA 2QVCA 1AGPA 1G5HA 2UDPA 3HP4A 4RSRA 3ZJ5A 1D6NA 2XWBF 3EZXA 3SHQA 1SHTX 4NF2A 1NBAA 5HMLA 1TKCA 4DHWA 5BPFA 5JNLA 5HCIA 4LRXA 4IFTA 4U7GA 2Q2NA 3CNOA 2R5WA 2VZ8A 1CS0B 5JS8A 5J1TB 3CH6A 3NEAA 2I2BA 2G9RA 2JFGA 1N34B 2F4VB 2PBLA 2G0TA 1UMCA 1N3BA 1N6HA 1CY2A 2DFDA 4Q1AA 4U3JA 1Q5PA 1DDGA 3TAXA 2QA5A 1ZHOA 4KLCA 3WGMA 1YQQA 1GL7A 2GVNA 3B20A 3B3AA 1TO2E 1Y9EA 5HRCA 1G8JA 1PNOA 1W75A 5A62A 1TJPB 2C95A 1XD2B 3ZKAA 4S1TA 5I8PA 1W29A 1N7JA 3U4CA 3DCYA 2G77B 4GSYA 1DCMA 4KFTA 4RE5A 1QORA 2X7XA 3F67A 3PCTA 5FLEX 3GGGA 4DRZA 1N6LA 5E8RA 2XCSB 1WXDA 2BUBA 5JS7A 1XU7A 3G0CA 5DMHA 2IS6A 4UMDA 4PRZA 3ZXXA 1U8UA 1VMDA 1T1IA 2G5TA 2A84A 1JSZA 3C4JA 3TGLA 4A16A 3I05A 3QFHA 1EWTA 4F71A 3HU5A 2AFHB 5HQ3B 4AO8A 4DL9A 4LUCA 2RG1A 1XELA 5F1PA 1IWBB 1QHIA 1NDUA 1GZHB 2B8EA 4H6PA 3IPAA 2XRZA 1ANKA 1ODJA 3H2KA 4BO7A 5FUMA 4C01A 3CF6R 3GUVA 5SZHB 5DW0A 4WJLA 5JDIA 5ES4B 3ZGOA 2R7MA 2XBUA 2HSEA 3K0FA 1DWUA 3A05A 1K7EB 1LZLA 2HWKA 4NU0A 4NNJA 3SMVA 3ZPXA 2RHBA 5AW4A 4HK4A 3P0RA 1QWOA 4NPHA 1CERA 1X8KA 3H65A 4WXRA 4BTEA 5LQRA 2GZSA 1V5GA 2EZ9A 4NDNE 3RRNA 2PUJA 3TRJA 2FNAA 4B2LA 5KTPA 1A5ZA 3AV0B 5IDVA 1KXJA 3WAKA 4RLHA 1YRWA 1X94A 1LBIA 3B9QA 1TUBB 2Q9CA 1WDTA 3C24A 4POAA 1EH5A 2GD1O 2D6FA 4NR0A 1A98A 2F1RA 3EA4A 1UBOS 3QUCA 4TWBA 1E61A 1RXYA 2GH1A 3L9XA 4FFBA 3WSWA 4RIEA 3RYHB 9LDTA 4UQOA 2ERCA 3RS2A 2PT5A 2XGOA 1KOGA 5CUQA 2O4UX 1J8DA 1GQSA 5L45A 2Q41A 2FZCA 4CEHA 2ZULA 3I83A 6LDHA 4AYWA 4E2WA 1LK7A 1VQ1A 2BF7A 3QKSA 2JLRA 5ALYA 3ND9A 1M34B 1IIBA 4TMXA 3CM0A 3NOXA 3JZFA 3WYFA 1ZW6A 2FWMX 5FBRB 3H0CA 3NCTA 1S3IA 2GCOA 3EX7C 4YO8A 2VUUA 4IXWA 1RD4A 1XEFA 2A59A 3MTQA 3QLUC 4C4TA 4YYZA 4X6UA 3IDSA 2RE8A 1N5MA 5A0FA 3JYOA 2OAGA 2FMUA 2Q6KA 2O54A 3AUFA 1DJMA 5JANA 2O0MA 3EAQA 1GCIA 3KQYA 2OVFA 2PCJA 2YRWA 2ZSHA 1PZMA 1R5NA 3DMNA 4G1BA 3GG2A 5D84A 2Z1NA 3KUDA 2XITA 3NQ41 821PA 1TU4A 5JQGF 2NIPA 3G82C 1J6UA 1X19A 3GFQA 1ZWLA 3RFTA 2PSJA 3BERA 2FYTA 1U3WA 1Z0FA 4XVRA 4BUCA 5KWIA 1ZUNA 3A9RA 4G8DA 4Y0AA 1P60A 5DWDA 1Y82A 2J4CA 3WBBA 4ZHQB 5JCXA 4RD1A 5LD2C 2A9JA 1LLUA 1ADJA 2QZZA 2F00A 2VDWA 3TAUA 4UHKA 5HZKA 2G1AA 2QZPA 5AI5A 4G37A 1G9XA 3IEXA 4LDZA 1OF1A 2C7BA 4HH4A 4BMZA 2QL5A 4M0DA 4UAUA 3CUYA 1W34A 1I80A 3DC7A 1AKTA 1KSHA 3QMVA 3LWZA 3LC1O 1J25A 1THGA 3BRCA 2GRUA 3NAGA 4FLFA 2BKAA 3GBSA 3ACDA 1XKQA 1LJ8A 2EHJA 4BUZA 1Z5UA 2FGKA 2HREA 4IMIB 2X2FA 4DIDA 3S8EA 2OT3B 1H5NA 1TCBA 2V98A 4JWTA 4ESOA 3I12A 2FG6C 2WNSA 3G7SA 3U4GA 2X4DA 3ETHA 2IL1A 4FB4A 4J43A 1DEOA 3WTCA 3AOGA 4MQEB 3GQBA 1AB6A 3T1NA 5AO9A 1OH8A 3H1GA 1KEEA 5LD2B 1CHDA 1N2GA 1RVV1 4EENA 1BW9B 1D2MA 4CEIB 2DT5A 1Q0QA 5FORA 1CF2O 2P2CA 4R7TA 13PKA 3K15A 4UM9B 2YW9A 1QYXA 3PXAA 4ZEOA 3DKRA 3B5EA 2G9ZA 2NPFA 4JJGA 4ASUD 3IEMA 1G5FA 3MXTA 4E1VA 5LQKA 3ZYCA 4JA2A 2YZ7A 4ASUA 4EKDA 1OB5A 4MMYB 3S44A 1WMSA 4XUGB 3UXYA 2RGRA 1JRLA 4E7OA 3H9GA 4B6JA 3DAYA 2RDMA 5M3BA 4RNDB 4PLCA 1RKBA 2DVMA 3PE6A 3KJEA 5K9ZA 2PK3A 5REQA 3ZE8A 4D42A 4EJ6A 1T9ZA 1Q2UA 2YC2C 1N1DA 1H5QA 3I30X 1BJKA 3BIFA 3OMLA 4UU1A 4C3VA 2C57A 2EL7A 3LZ6A 1BDHA 4KOEC 3FCUB 1S3SA 4BZXA 1Y4SA 2B3TA 3EVTA 2VEOA 1N6NA 3QIAA 1QB7A 4INZA 2PMEA 2IU6A 2WJIA 4LWPA 5FD8A 4GDMA 3V80A 3VOAA 3X43A 2QX4A 2ZQZA 3WKCA 4RKWA 1KXZA 3TD6A 2HNBA 5E2BA 5GM2A 3HY3A 2PKQP 2XOKA 3I9LA 3T34A 3K8YA 3DCNA 2PQ6A 3B6IA 5BWOA 1N5IA 1ZJ6A 2GN6A 3NTVA 4M4SA 2EJTA 3I6MA 5KTTA 3OQBA 1I2ZA 3LBAA 1I4LD 1XVAA 3MRTA 3RTCA 3GLFB 1MRSA 4YCJA 2W42A 3Q8LA 4WBXC 3AVTA 1XI2A 1E5QA 2QLFA 4B3BA 3V1KA 3GA0A 2BI8A 1G21B 2X3UA 1JTFA 1WEHA 3ZD9A 4TN5A 1R6UA 3DV2A 2JIMA 2XE6A 3S2YA 1SGWA 3TNYA 1B6TA 3FNHA 1U4NA 4RQAA 1D0VA 1E7YA 1I1OA 5K05A 1JF8A 4PBTA 3RK1A 2CL7X 3LY5A 1Z2AA 3B6KA 1L7DA 3N0XA 1N7IA 2UAGA 4Y2HA 1UDWA 2HLPA 1C0PA 1OW3B 2I4RA 2NUAA 3CZRA 1SIUA 4JS0A 4D44A 3BL6A 4Z0TA 2P30A 2BR5A 4TSFA 3EXG2 4UHBA 2VA8A 5DXJA 1OBOA 1Q21A 4ACAA 5LJIA 1I0ZA 3L41A 1EWYA 2Y05A 5ALUA 1G60A 5TRTA 2FFJA 3E84A 1WPGA 4QUKA 2XNCA 3C5CA 4IDDA 4GC9A 5AHWA 4B4UA 1KJYA 1XJCA 4EFKA 4QEKA 1MAWA 3PXUA 1C29B 1SCDA 4NNPA 4LRTB 4GKVA 3N58A 4CU5A 5L4NA 1YL5A 4TV8B 3PBKA 3PTAA 1XCBA 2VXYA 4WX2B 1EX7A 2I22A 2H1LA 3OJXA 4AIIA 4J3FA 4B5LA 4KMOA 1SQ6A 3ZW8A 4H4EA 4Z9FA 1NP3A 2RHMA 2YUTA 3KVRA 2XW6A 3WTBA 4PZUA 2I4TA 3C41J 4A1OA 1RLJA 3IR7A 4MJ7A 4WOJA 1ENOA 3LO8A 1LK0A 3CUSA 4PG7A 5FOSA 1EM8B 2R1ZA 1IMOA 1OFUX 1YSCA 2O2EA 4M8LA 4J16C 2YY6A 4U5XA 1RWWA 1MQ8B 1QO9A 2D8MA 2ZGVA 2VDVE 2PX3A 1H1TA 1NQAO 2VJAA 3RFXA 4INOA 2WB4A 3U3DA 1AHIA 3TJZA 4WBNA 1FCJA 1SFRA 1GAWA 4QXAA 4B46A 1YCHA 3KZMA 3WDKA 3WYEA 1HX7A 1BS1A 3I5MA 3SVLA 3S5UA 4MV3A 3QWFA 3BWDD 4QX6A 5B3JA 3OD1A 3WX0A 3BUSA 1BXRB 2IOFA 2EHDA 3CG4A 1S4QA 3G0GA 3OQPA 3PI6A 3DOEA 3M5DA 3K6KA 2WTBA 3WNCA 2JI6A 3I5UA 4HLUC 3SD7A 2BTOA 2IHTA 5E9JA 3VYSB 3W2GA 4OHVA 1RXVA 4KP7A 1GNSA 2AZ4A 4Z3DA 4G0PA 1X80A 3TX6A 3KQKA 5BSFA 1A7AA 1F2TA 4HJXA 3FHCB 2ANBA 4IR7A 1JYSA 1P2DA 3K0SA 1AUPA 3K92A 5LMUB 5TLSA 1AKMA 2IOFK 1YB2A 4TLLB 1NLYA 3JSXA 2IYFA 4LNAA 4LRSB 5ED0A 3SM9A 4MLCA 3KSDO 1ZHFA 2X1LA 5IMBA 3TXAA 4MYUA 3U37A 4P93A 1EGVB 4PGMA 1UBTS 3GLIE 1BE6A 1V9LA 3TRKA 4U7DA 4RXTA 5I7UA 1KZHA 2I4IA 4CT4B 2WJYA 1X1CA 1DE0A 4X6LA 2QBYA 1Z2EA 2SCUB 2WIJA 2A33A 4PTZA 2P78A 4TUYA 5LB2A 4IXMA 2QEQA 3K32A 1QCDA 3GGSA 3V6LA 3ZBUA 5BMOA 2Q2VA 4OQEA 1EUZA 2GN8A 2PD6A 2ZJAA 3LDUA 4HB4A 5EP4A 4E33A 1UKAA 1BMTA 5D5QA 3F4BA 5E6RB 5CFLA 4BYGA 2AVDA 1L7VC 3PA8A 5CH5A 4V0MA 2YXLA 3N2NA 3PNKA 1ZO8A 1PD0A 3PHHA 4K9DA 4JI7B 1ABFA 2GNPA 4QYMA 1HDXA 1DJNA 1Q1BA 1Y8RA 1ZMOA 2P0EA 3GH1A 5L3ZA 2B8TA 3NRCA 1XZLA 1IC6A 1T6BY 2COKA 4O5AA 3EGDB 3M3HA 1L5LA 1BA3A 5IN4A 4HQFA 4CKWB 4P2BA 1ZJWA 1NJSA 1U9ZA 4B35A 1VE5A 4B3JA 3G8CA 3D0RA 3ZCVA 5C8YF 5A03A 1G8PA 4NQRA 5CBPA 2P4UA 3D2CA 3VJLA 1L7PA 5J5VA 2XEXA 1EU1A 3PHGA 2IYZA 3L6RA 2FZVA 3IMFA 4Q48A 4G5RA 1FTGA 3SLKA 3C8HA 1HUQA 2EKLA 2R7KA 1NF9A 1MV5A 4N40A 5J43A 1H0HA 5DNWA 3KZCA 4L5AA 5I7OA 2GN4A 1CCWA 2ESRA 3Q9UA 1IEQA 3EPHA 4PW0A 1DXOA 1EVZA 2YJNA 3SLRA 1RZUA 1Y1QA 2F1JA 2EX0A 1FMTA 5JDIC 1FSGA 1WP4A 1NXTA 1YIDA 3KB8A 5EGNA 1NAHA 4TYMA 3CF4A 2CV0A 5BNZA 1NSYA 3DL0A 1KR5A 4KIUA 3CNBA 1KETA 3Q5GA 2GDJA 4UZEA 1VB3A 2FV8A 4D56A 4IIUA 4DLNA 3EN0A 5AKKA 4PICA 5F9FA 3EUWA 2FZ4A 1C7EA 2IOYA 2A3NA 1RYNA 4EM6A 3ZWXA 2NVBA 4GL2A 3LU1A 1QGUA 2ZR0A 4FOLA 1SEVA 1DAMA 1B0PA 1LBHA 4UCQA 4AS2A 4ARBA 5EE9A 3Q7PA 4GLOA 1TVKA 1PZXA 3C5HA 5DNEA 2GPJA 1QPZA 1GDHA 1A88A 1L5MA 1OE0A 2DFVA 3UJ9A 2G70A 1ZWKA 4JGBA 1GU7A 5F21A 1T25A 3D7KA 1Y3BE 1Q14A 4D1YA 1KYTA 3IHWA 4FZJA 3ZI7A 2CB0A 2WTXA 1W49A 2F3UA 1C1YA 2GHQA 1UPBA 2Z2XA 3CJQA 3DEKA 3IAM1 3OC0A 1I51A 2Z3VA 3K0FB 3EMBA 3WNZA 1E2FA 1X7HA 3BFPA 1WQ3A 1G5TA 3GYGA 1JDSA 1NI4A 1RWVA 4KXVA 3ZDQA 2LGJA 4NZZA 2O59A 3VRHA 4EY8A 2TYSB 2XNHA 1QX4A 2XPCA 2Z95A 4DQVA 2OESA 2WSIA 4WKPA 2YVQA 1DCTA 1FNMA 4MP6A 4E11A 4RPLA 1UXJA 2EZTA 4S1PA 4FFBB 2CHUA 4U6QA 4PYKA 5DLYA 1H6AA 4Q3DA 2V7VA 4U7WA 5HF8A 3PXGA 2BAGA 3AWDA 4LJAA 1U0TA 5JT1A 5L8VA 3K7EA 2XTAA 2CMKA 2W2KA 1OSNA 4JLOA 4MOWA 4CEHB 3ZQ6A 4DTIA 1RHKA 4QYTA 4YAGA 1KK0A 3QKSB 1BEZA 1ZGAA 2RGEA 5TVGA 3QHPA 2IPLA 1ENYA 4K8OA 2J6CA 4O1HA 1P2VA 1K8YB 3PYMA 4IIVA 4Q9NA 3T35A 2CJYA 5LQMA 4X95A 2Q49A 2CBXA 1WWKA 4MSUA 2GCOB 4BDSA 1OYOA 3L0PA 1W46A 1FMJA 4GWKA 4R51A 5ILOA 1H4VB 1U8AA 2QTAA 4IZ6A 5E95A 2IYLD 3GZJA 1VGVA 3AJEA 4LY0A 2QF7A 2VRCD 3DBHA 3ZWPA 1E20A 1C7RA 1PJZA 3D4NA 4LVCA 3W3AH 1H0RA 1YTUA 5GJBA 4MWZA 2JFVA 2VRCA 3COZA 5LYYA 1YZFA 4AX4A 3L7NA 2X76A 1ZUNB 1M72A 2G9UA 2K5UA 4DQDA 5JSHA 5BR8B 4GZ3A 5H5JA 4EGFA 4KOAA 3OO0A 2UZ3A 4I55F 2VDWB 3LP6A 1BE1A 2VNIA 4V39A 5KAMA 4G1UC 2BTQA 5TNXA 1N6PA 2DT8A 2VDMB 5DI9A 2VF2A 5DDIP 4LF4B 1NA5A 1SU4A 2EOAA 3EOAI 4HFNA 2JGDB 5A3RA 5I5GA 3OICA 2OXRA 2QROA 3D7RA 3PKJA 2H51A 2NNWB 2VBIA 4EOGA 4R71A 5A4DA 3L0SA 2QJFA 4BJ6A 5AIAA 3QI2A 5C8VA 3H1AA 3AFNA 2OVBA 3G49A 4QXMA 3W5IA 1PGQA 1UPAA 2BBWA 2NN3C 3G9UA 3IBCA 4LC0A 3RRJA 2Q5HA 3RV3A 3OFJA 1IJBA 3EDRA 1R0LA 1X38A 1HSZA 2OD7A 2OO5A 3ZR4B 8MHTA 2P4HX 2FVXA 4XDYA 4KHZA 2ZUCA 2GZHA 3DO5A 3IKJA 4UVDA 5TY0A 3SDBA 2KW5A 3GVHA 1JFFA 4FN5A 3TW8B 3UGKA 4EMSA 4K46A 1LX6A 3FPKA 1RKXA 3GQBB 3BXEA 3Q98A 1AKVA 1PLLA 3F6YA 2P9FA 3M6IA 2IIPA 2OO3A 2RH9B 3EIXA 3RRMA 4CKBA 7YASA 2REQA 3C3MA 3M7IA 1L7BA 4KSBA 2O5CA 4PLTA 3H8JA 5FV7A 1SBZA 4LOAA 3EA0A 2SKDA 2OBFA 1SVUA 2CL0X 1QCCA 3GRZA 1NYTA 4RY2A 1UBLS 5IANA 2QTTA 1N6RA 3FPAA 1B00A 2FRXA 1JKJB 3DO6A 4MEBA 4B3CA 2A58A 4I36A 4ND6A 4X60A 3ZJYA 1MW9X 2XTMA 3DDUA 3PCXA 3DE4X 1SA0A 4ZVLA 2QP3A 4QASA 1KVRA 5D3QA 1JEYA 1PSZA 3V7UA 4G56A 5TMBA 3DV0A 7GPBA 5JJIA 1NZJA 3G7NA 4AJLA 5REQB 4F45A 3JARB 4LFAB 3KQWA 1M73E 2GZAA 2VLBA 2EJBA 2IP2A 3GRAA 3K05A 3CW2A 3MCVA 4TKUA 2XRYA 1B3RA 3JYQA 1C0EA 2F64A 2FSVA 3TTSA 2WY2D 2ZJ8A 2AT1A 3JALA 4TYQA 1EDZA 3IR6A 1F7VA 2LRHA 1O87A 5FL7D 3HEBA 3E58A 1KPHA 2ZXFA 3T5PA 3WJ2A 4K9OA 2XV1A 1DRKA 3ONFA 4MV9A 3HFSA 2VDKB 4O2BA 2V0GA 5KC8A 1L4GA 1X1BA 1BFDA 3D0OA 3PRYA 4GOOD 2C59A 2H1VA 1HE2A 2ZFUA 4G8CA 5BR7A 1N2CA 3V4FA 2AJTA 2PX2A 3OKCA 3J80A 4RHXA 5LIRA 1XKLA 3CO5A 3KETA 4EG6A 1G55A 3MEQA 4JYZA 1RYHA 4L5BA 2E1PA 4FVTA 3UTDA 3IP3A 1RABA 3UPTA 4OGKA 1GRNA 4H7DA 4Y2GA 3WLEA 3IJRA 1CDEA 2C2BA 2ZRIA 3A1EA 4IIFA 2OFPA 2RIRA 2WSYB 3HMQA 1OWPA 4LSMA 5JXWA 1Q50A 4C29A 1APBA 4EPTA 2F3TA 4OHZA 2EXXA 3FVQA 3R3HA 3AW9A 3OHSX 3Q6NA 4LF6B 3IVXA 4BNKA 4BGVA 4U9IS 4M76B 5AK3A 5K2OA 3II6X 3JZMA 3R7BA 4RPJA 2P6RA 1NMXA 3PQDA 2HM7A 1J0AA 1PVVA 2CBZA 2DHRA 2NUAB 3VSCA 4AAYA 5CBKA 4KPEC 3CZ4A 1U0EA 1G6Q1 3HL4A 3G5MA 1KA9H 3QE9Y 3CXRA 2ZYIA 3K2EA 4YRBA 4N82A 4EB8A 3H5AA 3E9YA 4ZT4A 1OLUB 1U0OC 2RHLA 1XNJA 2JS7A 3UVEA 3D6NB 4KDEA 5CDHA 4TKMA 4BLTA 5C3UA 3KT3A 4OLBA 3OE5A 3EXAA 3IQIX 1ML3A 5HIJA 1C2TA 3T94A 3UPUA 4G9EA 4IXTA 3FOZA 2L0XA 4YMSA 5B3JC 4DR2B 1ZISA 4MW9A 2RB4A 5JFOA 5H9WA 3ROKA 4HL6A 3FPGA 4O59O 1IG0A 1D1SA 2V6MA 3SS7X 2ZUVA 1NQUA 2CFTA 2LXNA 1D1PA 3OIWA 3PGXA 1Y3CE 3AJAA 4IMPA 4Y30A 1CETA 3QA9A 4MUYA 4IJ6A 5HKLA 5SY9A 3CIOA 2XMBA 3N0VA 2PUGA 3COPA 4NECA 1L8AA 2AUMA 3FYDA 2OAQ1 4NNOA 3OEED 4EB0A 2OYRA 2OEPA 3M2TA 2W2NA 3G17A 3E4DA 2JZCA 1YJ8A 1IAVA 3HBNA 2ECKA 3OEEA 3DAOA 5KJCA 3VHQA 2Z6QA 4IUDS 2V4UA 1JFRA 2RCNA 1WSAA 2O2YA 1GFIA 3A70A 1HQDA 2NXEA 3WGLA 1TCUA 3CNLA 3MUNA 4WBNB 3HBJA 2A86A 3IOBA 2FLVA 3WGZA 1WW2A 1R0BA 2FF7A 3RPEA 2FSIA 2PBZA 2BRUA 3DOIA 3DQPA 1CY6A 4YMLA 1SXHA 3CRQA 3L18A 2V7TA 3SC4A 4KFCA 4BB0A 5J4HA 2AXQA 2WWTA 3AP1A 3K96A 1RYDA 2QJWA 3BZUA 3KJQA 4G1VA 5DH9A 3AX6A 4PC7A 1QE3A 3FF4A 1UQRA 4LJKA 5BW6B 5IN5A 4FR0A 2CV1A 4NBTA 5EI5A 3H13A 3SJBA 1Z0SA 1Z22A 1U0SY 1X80B 3JASA 1F2TB 4UBMA 2DKNA 1RPTA 4MRVA 1X70A 1QIMA 3FB1A 3RDPA 2JKVA 3E27A 3U1VA 3VKVA 1AXEA 4KYIB 3X1WA 4A92A 3HABA 1EFVA 1T24A 5A4MS 1UC4B 1Z0DA 2WIFA 1KI1A 2PS1A 3EGOA 3TTUA 4EY5A 5C5DA 1LSOA 2GK4A 2IW3A 5FBKA 3T9AA 4ECAA 5C37A 1UZAA 3NHLA 4XIJA 4RBNA 3K09A 4PAMA 1DBPA 2WOJA 4GOND 3U40A 3TFWA 3BICA 3W34A 4RHEA 2C4NA 3RFVA 1SBQA 3S7ZA 1X7YA 1PG2A 1G8SA 1KJJA 4TUYB 1IY1A 3MLAA 1N2SA 4NV3A 2MCFA 4AD8A 5HJ5A 3SJAA 3C8ZA 1HT0A 4XQ9A 4G5GA 5BV7A 1K6XA 3OZFA 4CVNA 3MMZA 5ADUS 2NT4A 1TIBA 3DKPA 3IVRA 1XHEA 2RBGA 3L8DA 3OECA 4LYHA 1Z63A 1TVCA 2O3SA 3B52X 3HADA 5F2EA 4N5HX 3FROA 2B8WA 1Y8RB 3ISTA 2C4TA 3AV3A 3KWFA 1U1IA 2RGXA 3BD8A 2HRDA 3IC5A 3ODGA 2X5NA 4DSAA 5I48A 5IG2A 4LXHA 3SLGA 1DRUA 1NI5A 3ZCTA 1BQ3A 4RPCA 1L5ZA 2AOVA 3A6LA 2WAOA 2P0YA 1XKTA 4JODA 5KWJA 5D3KA 5CBPB 5KOJB 2Y3IA 3OLWA 4YJ2B 5F3DA 4AJJA 4G01B 2I91A 2GSWA 5ICFA 3BBPA 3KSUA 1J4AA 2CLOB 3L7KA 1PLJA 3UOAB 1DIOB 1JIKA 1W30A 2B5VA 4L9AA 3VPXA 4EF4A 3PVSA 3GLTA 4IKPA 5TT1A 3OP4A 3W5CA 5ERXA 2QL7A 2IGTA 4RAQA 4TZ0A 1GP2A 2QLNA 3G9QA 2B34A 3EG5A 4UJ3A 3L8HA 3UY4A 4BN5A 4D82A 1GPNA 3T9CA 1H3FA 1KZ9A 1Z7YA 3P2JA 4JQCA 3UJBA 4B2PA 4E51A 2IYPA 1Q1NA 5BQ3A 3NP9A 1NVEA 4Q4LA 3CMCO 1XZAA 3HGQA 3CH7A 3LNCA 3NHZA 4RL4A 3UMJA 3LUKA 5C0OE 1CJTC 1N4DA 1QZUA 3ANSA 3ESXA 3INGA 4UC0A 3R77A 1WF6A 4IQ0A 1D6MA 4B09A 1DU4A 3DXFA 5HPYB 3HS3A 3VZPA 1KZ7B 3QVWA 1QGUB 2AJBA 2QYTA 3PQ5A 4KIGA 4OVKA 5T57A 4R2MA 2H5LA 3WNVA 4BLRA 1LPBB 1VE3A 4W5WA 3SZGA 1I30A 1TVKB 2GCNA 3L0YA 3QKWA 4KB5A 1DHTA 4RC9A 3VYRB 1BE8A 3DMYA 1OH6A 1FFDA 4MKIA 3VNSA 4XYMA 1HE3A 1CG6A 1TT7A 2BMVA 2C9OA 1ST2A 3M5PA 1NV8A 4KQIA 2O19A 1PZEA 4ROSA 2J30A 4YREA 2NXWA 3LBHA 5ILGA 5AW1A 2P2GA 4C89A 5CVUA 4L5JA 3IDZA 4WAUA 4F84A 3I4LA 4FYIA 1N5KA 1PU2A 3BGOS 3Q8KA 4KWIA 1RWOA 3T6KA 4EI7A 3P2EA 4JOCA 1NI4B 2QAJA 5E1BA 1P61B 1QTQA 3KELA 3WO0A 2OZLA 1KOFA 1FTYA 5LZ8A 2C1EA 5AVSA 1NMQA 3M6WA 4REMA 2YOFA 3G68A 1ZH0A 4K81B 4WVFA 4DLZA 5K8VA 4Y2SA 3QQPA 4DOMA 4R0MA 5ECDA 1VJCA 3SM3A 3E22A 1KMIY 4KJZA 3TTYA 3L02A 4Z0HO 4H1WA 3QIVA 4EZBA 5EJ6A 1M8JA 3W0LB 5AW8A 2J07A 2EW1A 3D3NA 3M1YA 3Q10A 3UJCA 2XUPA 3O9MA 3EVCA 1QP7A 3EZ7A 1BZYA 4LHYA 4PPFA 2V7PA 5DM60 2XTZA 2XWPA 4FW8A 4BAGA 4DDHA 1H8ED 4FM9A 3VO1A 3TYXA 4KKVA 4BO8A 2C00A 2ZEJA 1H8EA 3WGOA 1U7TA 1QK5A 3BWVA 1X1DA 4FFRA 1IJFA 4XEHA 2OORA 1GXSA 4GPTA 4NYIQ 4A6PA 1ZDMA 5CLJA 2ZB3A 3CLVA 3ILXA 4HYQA 3W78A 1T4DA 2XT6A 4B44A 3T1YB 4KR2A 2OO5C 3DBHB 3UAWA 1R37A 2CXRA 3EZ6A 1Z4LA 4UUQA 4YRAA 4ZT7A 4OMUA 1R8YA 2FEPA 1A9YA 2Q3FA 2WLSA 5I4KA 1LJUA 3OOHA 4PSKA 1A69A 3DZIA 5FOVA 4MAFA 2BT4A 3BWCA 2AK2A 3ZIAD 3R4CA 1XDGA 5BSUA 1RJEA 1VMEA 4L3WA 4X62B 1I36A 1DBQA 1RE0A 1ABEA 4L8VA 4LW8A 2FPWA 5ENDA 3ZIAA 4C9BA 1F9AA 2BTQB 4JVSB 3GIWA 1ECBA 1V2GA 3NAQA 4Z7NB 1U7ZA 2ISSD 2UZ1A 4EMBA 1EP1B 2O8CA 1NNI1 1T8WA 2BHNA 3FWYA 3PUVA 1KOLA 3HUUA 4MQLA 3ZV6A 2PU7A 4DYVA 1E6UA 1EQAA 3CUKA 4MRSA 2BFAA 2ZRGA 3OOWA 1M7HA 3H4TA 4LIPD 1XIVA 2ZK7A 2BKUA 1DBIA 2ATCA 2RGCA 3E8XA 4WRRA 5LP6F 1NRWA 3IIIA 4BNWA 1CQJA 2IUEA 3ZLJA 5KKNB 1RXIA 1A4XA 4FK8A 4XASA 1G7CA 1W48A 4C5BA 2P9JA 1MVLA 4YLYA 1H93A 3HN6A 3H2SA 4HUQB 3K1AA 4ZD6A 4F4DA 4O2AF 3PQ3A 5G3YA 2Z5VA 2GWHA 2PXHA 4CMCA 4YT4A 4HO1X 1N2XA 2FSVC 2Y1GA 5FI3A 2Q21A 5I9TA 4CKBB 2YWHA 5IT9A 2QK4A 2REQB 2Y1WA 4JXXA 4KBYA 2D5AA 3TL2A 1KP9A 3V5NA 5I8ZA 1U8CB 4QFBA 4WD3A 4EFNA 1ODTC 1K3FA 3H1BA 1SPBS 1S2DA 3I2YX 4KTVE 3BHMA 3L79A 2R6AA 1WMFA 2BFEA 4IG9A 1EXMA 2AWOA 2PD3A 3A9VA 2GZMA 3HVIA 3PQ8A 5FBHA 1AM4D 3HUTA 1VPWA 5KTMA 1U11A 1H94A 1SBHA 1FYDA 3HCRA 3RSSA 1BWQA 1SA0B 3BRWD 3I4CA 4FFPA 4ZV9A 3RODA 3FWPA 4WOCA 4RACA 2PRJA 5CB4A 3BRWA 3DV0B 4CYMA 4MS3A 1VGRA 2C2HA 4LJ8A 3A6EA 2BY4A 5BR4A 2KJQA 2A3RA 2R62A 4HNHA 4TKUB 3QXSA 3VV3A 2TMKA 1NY6A 4MWCA 3PNOA 1MUUA 3IB3A 3A1UA 3E53A 3JALB 3T3DA 1FDSA 4FWIB 3SJZA 5H16A 3OTWA 2AE1A 4MRMA 1LVHA 4DQUA 3PTZA 2VF5X 4TS4A 2WHEA 4G67A 4JR0A 4PO1A 4YP0A 4DWVA 4JZYA 6REQB 2RAPA 4LNHA 3L4KA 1FNBA 1C7QA 3JQBA 4O2BB 4NS4A 1XTBA 1PNRA 3Q3IA 1YI1A 2COUA 1SNYA 2JIZD 3TVYA 1C9DB 1N2CB 1UBGA 2QB5A 2BFOA 4IGKA 5BVGA 2JIZA 4HNRA 4DXAA 2HSGA 3PXXA 2TS1A 1IPFA 2CLCX 3WHPA 1FC0A 3KAKA 1ZH4A 5BP7A 3PGLA 1KY4A 4R1PA 4QZVA 3RGGA 4XM2A 4JT8A 5GZ1A 4F1JA 3QOFA 4ALLA 2JAHA 2WQ6A 3AF1A 2IWRA 2P62A 4CM8A 1SQSA 3OM8A 4L78A 3SSMA 1FOEB 2OHOA 1Q7GA 2PIDA 3DLTA 2GCGA 2VT7A 4Q4HA 2JAUA 4C4XA 3CPJB 4N3NA 1CUHA 1P39A 2AE2A 2VHVA 3NANA 5IWCA 2AQIA 3T7TA 3R9WA 2FMKA 3X2FA 4JP2A 4AY3A 3WOHA 3A8TA 4JK3A 4FFNA 4LI0A 1YI8A 4Q9AA 3UT0A 1AHPA 3T4EA 4CTOA 3T0FA 2CZCA 4IP0A 4LTDA 1NJGA 4R98A 2X8WA 2PUAA 1O9GA 1UODA 1WLSA 3KAQA 4BIIA 5CW2A 5IYZA 1YU6A 1NG1A 4X1KA 3RFUA 3WLPA 10MHA 1OZHA 3OEWA 1XD9A 4PZEA 2BRUC 3CUWA 3HG7A 5DOZA 1DOZA 4PVDA 4X97A 2E5WA 3TLBA 5G1NA 5D51S 3KLPX 5HRAA 1E3TA 4IFEA 1GPLA 1T5OA 3EW9A 2C3UA 2W5UA 1Y81A 3I2KA 5TR9A 1Q1ZA 1G1MA 3BEOA 1WIWA 5IC4A 3MJHA 3GHYA 6PFKA 4QDXA 4QDJA 1UFVA 4CIWA 4L22A 2QENA 1JDTA 3I64A 3LLVA 1XEAA 3PQ4A 2AD1A 4FMBB 2W2MA 4Y2JA 4ND3A 5EIHA 2L82A 2UVQA 1P0IA 4PPNA 2BONA 2IYRA 3KKOA 1TIKA 2WM8A 3BORA 2NZXA 4XX1A 5CVCA 5LL6P 1QSGA 3TW6A 1G9SA 1H2WA 5A71A 5IVDA 4U2DA 1P0FA 3K09C 4RF5A 3WWPA 1SOAA 5CLHA 1II9A 1ITZA 1UFRA 3A58B 1DRJA 1XXHE 1L8LA 2CLSA 1EFHA 1GN9A 4AG5A 1LB1B 4ZANA 4B3FX 5DTRA 4N65A 4JLJA 3W5SA 1SZPA 4H4DA 3M4ZA 4RGQA 1Y3HA 1KC1A 3GCGA 3JR7A 3K5WA 4NABA 1DKPA 5DTIA 3WWDA 3TQQA 3D6MA 5J63A 5HWSA 1JDZA 3AP2A 1PEKE 3AO0B 4F3RA 4EBFA 2J0QA 2UYQA 3JASB 2VN8A 1E2IA 1NSTA 4TL7A 3BMOA 1UFKA 3ZU4A 3DTTA 1EFVB 5BV1A 1YQEA 2PT9A 4BASA 2WYWA 3OSZA 1XVTA 3AOEA 4ISBA 4BO1A 2C7OA 2XUQA 3CR7A 5ICMA 2Y0CA 2YKGA 2H1IA 1JJBA 3AEQA 1L8OA 1TF5A 3TEFA 2PTGA 3JWIA 3DVAA 4RD4A 1ZD5A 1TLTA 2CWWA 2Y4OA 4EKEA 3P4UA 2JFWA 2ODEA 2Q1SA 1J8FA 2ZR9A 2AFIA 2FE4A 4RMJA 1X7YB 1KQNA 3LF2A 2PO7A 5KX5A 1J9ZA 4F12A 1U9IA 2XTNA 1TJ5A 3C45A 1OJLA 1KQPA 2CE2X 3OMWA 4HN2A 4RTQA 3B60A 5IF3A 3C39A 1OH5A 2ZT7A 2G7ZA 4I6EA 4N7RA 2BBOA 4ZVQA 1VXRA 4DQXA 5F76A 1O8CA 1DAKA 1CKEA 3Q85A 3FE2A 3O75A 2CVOA 1YO6A 3FGZA 3TIVA 3GJYA 1CLEA 3HCCA 3P26A 5TQ0A 1E9SA 2ZYVX 4EX6A 3IT0A 4FMCB 3OQMA 1F0PA 3F97A 1G8HA 1PDVA 2NU9A 3EC7A 5DHQA 4HQRA 1GQQA 2FFHA 4IKEA 1SUIA 4PSUA 3FN4A 5IHXA 5KOHA 1Z3CA 1F0YA 1TC1A 4OHMA 5IM4A 5I6DA 1QKJA 2IEYA 2QRMA 4EKGA 3DXYA 1WMBA 1SB9A 1U7PA 2J3HA 4ZOLF 2C98A 3KJHA 2H54A 3OCXA 1TIPA 4KQ9A 2K87A 2O52A 1X1EA 4QFMA 4BWVA 1JFTA 2XCLA 4ON9A 1HI9A 3ZVKA 2Z5FA 5DV9A 1L4BA 2RK4A 4BQQA 4TTVA 1UOEA 1YCGA 1QGED 3FJ1A 4QQ8A 5COAA 2YS7A 5KTYA 1OFUA 4E5KA 2NAFA 4HUJA 4MH0R 3L6CA 4ZYTA 4LXIA 5K1ZA 3U4HA 1LRKA 1RYZA 1YB5A 2ZETA 4RQTA 3K6RA 5ULLA 3UCFA 5E4JA 2XD4A 3I9OA 1MTZA 5KVSA 3O0DA 1QU2A 1QDLB 1PRYA 4XVHA 1DQSA 4L15A 4BO6A 3FR7A 1P4RA 1VOTA 3QA3E 4J2HA 4KI7A 7ABPA 4YPFA 1GGMA 1E1CA 4NICA 2Z0MA 1IOZA 2FCRA 3HCBA 2DMRA 2G9NA 5IZCA 2WDZA 3LS2A 2JDID 4FGSA 4ZC1A 4ZCRA 1VSUA 1YFKA 3OHMA 1FDUA 4M1KA 1SULA 1U1EA 3RYFA 4JN6B 2OV3A 1F9EA 1YDHA 3HCPA 4W5OA 1KGDA 2GSDA 4EJ0A 4NPAA 3G23A 1MAVA 2D3TA 2H7YA 3QKIA 1WV0A 3ZWDA 2ZJ0A 4X41A 2P5TB 2FQ1A 1LPNA 1KEUA 3QEMA 3CKMA 3HRHA 1Z2OX 4P4UA 3V4VB 1YDMA 2B1JA 4Z7OB 2BDUA 3L8YA 4NESA 1KEZA 1ZJJA 2B35A 1X77A 1FU4A 3B3QA 2YRFA 2G1PA 4OOEA 1P1HA 2AZDA 1J8VA 3OEYA 3VMMA 3ZGNA 3N76A 2WU0A 1QK4A 1LQ2A 1I01A 4WZBA 1Z88A 2G04A 1V7ZA 2PV0A 4OK3A 4YH1A 3R74A 4ZI3A 3FMFA 4J4TA 1PWHA 1NXVA 3OZCA 4FOTA 5ESXA 3WVNA 3CCBA 3EAGA 3CSDA 4YRCA 4XD7A 3IMKA 1XNQB 1T3HA 1TMYA 2OZLB 2OORC 1Q91A 4YLGA 2C20A 4FDMA 1C9MA 4MWSA 3FKSD 2OPBA 1IWOA 3LRPA 4ZGWA 4R6XA 1Q0SA 5CFZA 1DAIA 2TRSB 4LI3X 3FKSA 5JSUA 5A4FS 2VSYA 4L7QA 3JQRA 4M0MA 1KDZA 1Q7CA 4NCBA 4U39A 4ICIA 3E22B 3WICA 1RPZA 1XZCA 1ZS9A 2IHVA 4A8HA 3RHZA 4R69A 1YRHA 3I1JA 3WGTA 4X90A 1DZIA 3MBOA 3KPVA 1ETHA 2JGFA 1NVKA 2DHDA 2CYCA 2WHQA 1G20E 2V5AA 4DNXA 2J3EA 3USCS 3OE1A 4N18A 2ZRJA 4FQ5A 2DLNA 3WKBA 2ODQA 4XDZA 2ATEA 2WVHA 3UB4A 4EA6A 1NZFA 2XRMA 1GXSB 2GTIA 4XYGA 1LPPA 3NUZA 4OQNA 4WVLA 3H18A 3O8DA 3N2KA 3ZV3A 4CLOA 3FOFC 3I04A 3QRWA 5EP2A 1K7YA 4URUR 4Q1CA 1QFMA 1V96A 2Z1MA 2UYYA 4JEHA 4C7BA 2I03A 3O4IA 5KU1A 5EIXA 5KX5F 1GG8A 3G7UA 1HM5A 5DGHA 4ROTA 3V4ZA 1KMQA 2GF9A 4M1ZA 4Z99A 3U9SA 3CX7A 2H4XA 1YD7A 2D8AA 3LQFA 3PXBA 4I1OA 4TS3A 3FOEC 1CD5A 4CWAA 3WIBA 2CD9A 2Q9BA 3EWSA 1XMJA 2UZ1B 4NJOA 1MVOA 1CRQA 4FFSA 4A8PA 2O8CB 3DYBA 4Y9SA 1F2DA 1ATZA 3CT4A 3VSBA 3QTBA 3OUZA 1IM2A 1EZZA 4HGYA 1F5NA 5D7BA 4D45A 2ZPUA 5HCNA 4EJMA 4NU6A 4BV3A 1Z6GA 3MPOA 1XEWY 3MWDB 4RELA 4NC9A 4AY2A 3T4XA 1VMKA 1CQJB 3KEFA 2FMHA 1Q15A 2RH5A 3MCZA 4AM8A 2OD9A 2ZS8A 3H9UA 2GI4A 1DPFA 1JV2B 3E3NA 3OTQA 3FCEA 4PU0A 5JYEA 1NQ5A 3VGJA 4AK9A 5K8JB 4GX0A 4I1PA 2W00A 2ZPTX 4D43A 4MYHA 4ZOQI 3OX4A 3LA8A 1PVOA 1Q84A 1RQLA 2HJVA 5HVNA 3JZDA 4MWDA 1BXGA 3N2ZB 1MOSA 4ME6A 3ZVRA 2GCIA 4Q6BA 1M75A 5BWCA 1T0IA 2QM7A 3T9EA 1PFKA 3M1LA 3C6XA 4DY6A 1XK7A 3LKZA 4Q02A 3JQBC 4GQBA 3C3BA 1D1TA 2EGGA 2BFEB 3RTBA 5LQDA 2FTKE 4MS4A 3OU2A 5FHQA 721PA 4YXFA 2IZZA 1ZRSA 2ZJ4A 1IM5A 4AO6A 2BEWB 5AUPB 3IP1A 3AMVA 4D5GA 1LI5A 1GYQA 2AHOA 1Z5OA 2YOGA 4OA8A 2QPTA 1WVIA 4X00A 5F64A 5CB4B 2QMZA 2EGHA 3E05A 4MS3B 1F0NA 1ZVVA 3R9XA 2VG8A 3GT7A 3MJTA 3MT8A 3EXHA 4OLFA 3FYUA 3AHIA 1FVHA 5BNFA 3B1YA 4M9ZA 3DBLB 2BI4A 3P97A 4PYNA 3OZAA 1KEWA 5IVIA 4MRMB 2OK7A 3L0BA 3ME5A 1V1JA 2FEOA 5IT0A 2WJZB 3NEJA 1TZJA 3DR5A 3A6ZA 3C8DA 1Z38A 1XL1A 4ABTA 1NIPA 4R1TA 2H08A 4OL0A 1RQRA 2XB4A 2P9QA 3T9BA 3BWXA 2WUDA 4JLNA 2J45A 4YS6A 4F91B 1HK7A 3A0RB 1DJOA 3X1YA 5BVGB 5JZ9A 1L5QA 3V8BA 2PGIA 1GT91 1HY3A 4CPDA 1GIAA 2X0EA 1O5IA 1RTTA 4LE2A