3NATA

Crystal structure of conserved protein of unknown function ef_1977 from enterococcus faecalis
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
163
structure length
156
Chain Sequence
SNAMKKATMLTYLEEQLEKHLGDYEVGLDWDRKNHTIEVIVRLYAENNEQVAIDDVEFIEFEDGLLFYNPQKSVVDDEEYLVTIPYEGKKGLRKAVLDGFIHYLKVVLDEGQSDLLDFLSDETAEVFELHWEPADFEAMIKKVAETEKEQWIAYPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Conserved Protein of Unknown Function EF_1977 from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 37
structure length 156
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11217 DUF3013 Protein of unknown function (DUF3013)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11250 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3natA01
3NATA
chains in the Genus database with same CATH superfamily
1QP4A 4ADSG 5FTKA 4IZIA 3LC7O 2QTLA 3BF8A 4P6VF 4RHTA 5JDIA 2V7WA 4FW9A 4XYLA 1NJFA 2E3JA 3GJ5A 3QXCA 3NT4A 3LY9A 1IZ9A 4GUAA 4MV7A 4BGIA 3KR1A 4X8OA 1JIVA 3GJ3A 4AXXA 2PZJA 2YQ5A 2JFPA 1B43A 1FP2A 1VJCA 3M1AA 3A11A 3CWCA 2R7MA 3L7AA 4G4SO 4GGPA 1NW7A 2H52A 5KCZA 4GG1A 4G89A 4KI7A 4PLCA 5J5AA 5IMSA 3GP5A 1XZ8A 3KKMA 3VHLB 2J41A 3U6BA 3CKMA 2HWUA 3KLPX 5U9CA 1BNCA 4UUAA 1VB5A 4FBGA 1TVMA 3AUKA 4UARA 5K09A 1PTKA 5GM1A 3R3WA 3MTBA 5F5LA 1BHJA 1J22A 3UJ7A 1QMGA 2XB4A 1AV6A 1T6BY 1FP4B 3ZPXA 4PC1A 4HQRA 4YLGA 1JYSA 2AFIB 4GX0A 5AKHA 4DY6A 3TRIA 1YB4A 4EITA 1KEVA 2H1IA 2Q1XA 1AT1A 2BFAA 2H3EA 4BTLA 3QU4A 4S2EA 1VG0B 2FW8A 3TL3A 3ZU6A 1QH1B 4WL0A 1N0VC 3FPGA 4XDZA 1CEYA 2I71A 2V6FA 3TB4A 4FHFA 4X64B 4PEVA 2INGX 2Y77A 2Y68A 3M6IA 3I8OA 3IUSA 3UNXA 3GWZA 2WR8A 5DI3A 1RZRD 3V33A 3ZCRA 3DZHA 4EBFA 1WMAA 4UMVA 3S2ZA 1CEEA 3HR4A 4DJFC 3QF4A 5I3CA 5AM0A 3FSJX 3PTZA 5CCBA 3SC6A 4ZZ0A 3QWIA 1TIPA 1AZSC 2GVZC 4CT5A 1L7EA 3EC7A 3SYLA 1RWQA 1UK9A 4RDIA 5C81A 1PL6A 4GWKA 4H0NA 5E3IA 3W4KA 3X1YA 2GF0A 2A9OA 3DTVD 4EHBA 4CDGA 3QPWA 3I53A 2PX3A 2EYQA 1PNVA 2RHGB 2VZLA 3DWGA 4NOLA 5DISB 2HW8A 1O3YA 1TAHA 4IUBS 4UU0A 3EY9A 4H17A 3I0NA 1UQTA 5A6SA 1KY4A 2BFFB 2V4UA 3USZA 3ZQJA 4DVGA 2A6PA 4C4ZA 3JAKA 2JAXA 2XTNA 4LQCA 3THYB 1NLMA 4QHYA 1JEJA 4BEVA 1Z7WA 2QUZA 2ZJZA 3NUQA 4ETWA 1IFXA 1S2MA 3DFFA 3V7NA 2XNDA 2DB3A 1BWSA 1KJ8A 5GGXA 2G5GX 3C3EA 5IKOA 4DNOA 4JA2A 3EGOA 1N8NA 1ZM3A 3LRXA 1DQYA 2NADA 1WP4A 3KQMA 4N54A 4RF3A 3B1KA 5A0TA 4UDOA 5EMMA 4EI2A 2J4FA 1WG8A 2C4MA 1S2DA 1AA6A 3E3OA 4LIPD 3PHJA 1B6RA 1G3QA 2N1MA 1CY0A 3KVNA 3OM1A 5BSVA 3NWBA 1MIHA 1MQAA 4LF5B 4NENB 2JIZD 1ECFA 2WLTA 1TA9A 3D4PA 3R7AA 1A7KA 4BVLA 1UM9A 1KJNA 1KZ4A 3DL4A 1KI1A 2D54A 2WMNB 3KZ1E 5BW6B 2IHJA 4QG3A 2H2DA 1FNMA 3AFNA 1T1JA 2HMWA 2YRWA 3T3MB 1JF8A 1FU8A 4ABYA 5HYVA 4WFKA 5KYVA 2WMDA 1H65A 4QGSA 1RACA 4QOSA 2X0JA 4J75A 4HTFB 4Q1EA 2PG3A 4TV9B 1NLUA 4AZ0A 3WAGA 3N39C 4TSFD 1RWPA 5ANRB 4Y9SA 5CX4A 1DE0A 2JASA 1U5BB 4D2IA 2BISA 4S2UA 5KX5A 5JJCA 1IOZA 3EB9A 3LYAA 2I3ZA 4YEDA 2FNAA 3FSRA 5HMMA 3KOXA 2G6TA 4EEKA 5DCYA 3TMAA 4GPIB 3OLCX 4F3RA 4ZTUB 1Q0ZA 3U61B 2EJUA 1FRNA 1WZEA 4FOTA 3S5JA 5JSUA 4Q7JB 4EARA 1EGMB 2J32A 4K9OA 2P5SA 1I51A 3DB1A 1DBVO 1IDN1 2ATVA 3ESCA 4IKPA 5E9AA 4NMXB 3ZYCA 5COBA 4N7RA 5GGYA 1YASA 2HA5A 4QQKA 5B36A 5JNSA 4YXFA 1T4GA 4G81A 4Y2HA 1RQRA 2CXSA 4PZAA 4ZTBA 3UT6A 1QSGA 2YZNA 4B7UA 4ZHQB 2QLMA 1X8JA 1P91A 1W4RA 1WMSA 3W8RA 1IOVA 4LTMA 4Q02A 2GERA 3Q9LA 1HORA 5DPMA 3RTAA 3S99A 1QHYA 4OV6B 1ZONA 2IYPA 3T95A 2KQUA 3GGJA 3QUCA 1UCFA 4U00A 5IUKC 2BAGA 2QU8A 3IP8A 3KS9A 5DNEA 4DLWA 1DP4A 4XUGB 1E1RA 3N3AC 2RGXA 1XYGA 5TJHA 2QRHA 4D98A 1PEKE 3BF7A 1XEFA 2PTGA 2YXEA 5FWDA 3BVPA 3Q8WA 1P1CA 3R4CA 4LXGA 3RYCB 1V6AA 2YXBA 3AP2A 1XLUA 1ZNXA 3EIQA 4F4CA 4AY4A 5GADl 1FTQA 5SV2A 3ZWAA 4BFWA 4DWOA 5IX8A 2Z2JA 5K3AA 1UBJS 2VLIA 1XMJA 3EGCA 5A03A 5JARA 5JZBA 3N2YA 3ZHRA 3FPKA 3IT2A 4GI1A 4IXNA 1LLFA 3ZCQA 4O33A 1C3LA 3WYFA 5C7OO 1KO4A 2ZJFA 4ZI3A 1XXHE 1RI2A 3HDQA 3Q8XB 3ZWYA 4JVOA 2YWEA 2HA3A 3DF7A 3KQQA 1UZMA 3H0EA 3BRQA 4NK5A 4DJJA 2YJTD 4UNQA 5DDIP 4HQ0A 5HHTA 2NXJA 1GYQA 1JPUA 3M70A 4V03A 4XD7D 4E70A 3V32A 5LQJA 3OICA 1K6IA 1RCTE 3LD9A 3HN6A 3L77A 5KWVA 2XRZA 2ZTHA 1S8OA 2OCBA 4LHWA 5KHAA 4LJAA 4UHHA 5LCXA 2NUAB 5B3AA 4BB9A 3A4YA 3GNTA 2ZTUA 5EJFA 1U0RA 2VPWA 1J99A 2NT3A 5EPUA 3G9ZA 1KEPA 2DCMA 5BP7A 3NHZA 1UR5A 4B3HA 3LDUA 1JR3D 2I6XA 2BHLA 3JQCA 1Y3HA 5AOAA 3BTSA 4R8SA 3SEZA 3D31A 1EWVA 4KDFA 1J8DA 2WSLA 3L6RA 3QV1A 3F7NA 2NSJA 3VAAA 5C35A 3ZYZA 1G8GA 2I7DA 5IBCA 2O8BA 2BLNA 2VZEA 1C3XA 2R8BA 1XRMA 3BD8A 4MH0R 5IXYA 3U3KA 2P65A 3TIFA 3V8VA 1G3IA 3I32A 1DHRA 2I4RA 4XB2A 4G5SA 5KI6A 1G9SA 5AHOA 1J90A 5BWOA 4Q9KA 2BFCA 1RWKA 1YBMA 2OAP1 3I9V1 1B42A 1G291 2RB4A 3FHLA 3R5KA 4XM1A 3H8SA 1CB0A 2Q6IA 1M8FA 3IVRA 4ZCIA 4UM8B 1V48A 3KQWA 4MVJE 1UBUS 1OX5A 3D0OA 1YL6A 5KTPA 2BKXA 3UT5A 2QMUA 1IPEA 3I92A 3IFSA 5JY1A 3LA6A 2KI5A 3DZKA 3VDNB 4TWIA 4U2DA 4LX8A 2IV2X 2QQ5A 4PM4A 3JZDA 2CD7A 1OXBB 3A6HA 4IVQA 3LY8A 4CLXA 5BV7A 1CF9A 1TM4E 1BJTA 2IE0A 3FWNA 2G8NA 4RC9A 1LTKA 3PD0A 5IK2A 1PEYA 1NURA 5K6TA 1U7OA 4M36A 5LM3A 2VTVA 4ALMA 4OGWA 4YDQA 4KTVE 2CSUA 2IPXA 3E9CA 3EPRA 1BOFA 2I1VB 3EDQA 4XE5A 4BNVA 1QG6A 5ADUS 3T5TA 2VYND 4N7JA 3GR6A 4V0MA 2FPSA 1O5TA 4FONA 3IQWA 1T2VA 3WK8A 4ZZIA 1ZNQO 5FLYA 4DMFA 3O90A 3IOMA 3UKDA 2I29A 2UUBB 4GYJA 3GVPA 1I3LA 4GPZA 1MB9A 4XIYA 3W2HA 2YOGA 5KSYA 4Z7NB 1L7OA 3DDUA 3L93A 4WKGA 4HH4A 2R8ZA 1GJRA 4B2YA 4YXWD 5LMUB 3WLLA 4N7BA 4TSKA 1WCIB 1FNDA 4RPHA 2H4FA 4BNFA 1Z2AA 3C3KA 3HDVA 2ZR9A 2SNIE 3QX8A 4M0PA 4NZOA 2CNDA 5E0KB 1UPXA 3HBMA 3OIWA 4B0PA 2OEPA 3GLQA 2ZUTA 1H4SA 3K20A 4EB6B 2JFQA 1TPZA 1X8XA 4QWWA 4Y6LA 1LK5A 1NXQA 3R6DA 1N2IA 1U7ZA 4BNLA 2O3UA 2VT2A 4F56A 3CE6A 3DLIA 3KL4A 4P98A 3PRYA 3HEAA 2RJOA 1MV8A 2J9YB 2Y6UA 4LNUA 4OHKA 1ESEA 1G42A 1UBFA 1X9GA 1ZUNB 1AZWA 1DDIA 2A9RA 2DPXA 2RCNA 3BH0A 4HX2A 4L9AA 4WXHA 3RIMA 3ER9A 5HP4A 1YE5A 4HUQA 4F9TA 3VU0A 1GG8A 2F3TA 3M1IA 3V6MA 3HCNA 2BI7A 4NX2A 3KWLA 1FXWF 3C48A 3BWYA 3WWZA 4Q4DA 2XUFA 4ZWNA 1TF7A 3HCFA 3WBKA 1WY5A 5HRUA 1QQ5A 2D1QA 4DBZA 2BEVA 1YI1A 3T15A 4ZPXA 5KJCA 4RIIA 4N6NA 4DQLA 4D3ZA 1JXQA 3N8GA 1RKVA 1RPAA 1U3VA 1O57A 2AA3A 1LV8A 4RY9A 4N4AA 1X74A 1GZSA 1GG5A 3EASA 3G3EA 2WA2A 4JK3A 4R71A 1WDLA 1BU8A 4BX2A 4KIWA 3P0FA 4S04A 3LHDA 1P1FA 4R84A 4S1VA 2O7QA 4NPCA 2WVGA 5LYYA 3ZCTA 4ENUA 5ICEA 3OY2A 2BM1A 2YY7A 1PL8A 4F4DA 4EKIA 1P39A 1MEJA 1QIGA 4LYGA 4CFZA 2A94A 2VXBA 4L07A 1Z8DA 2FPOA 3FZYA 1ECJA 1W85B 2QTRA 3TCXB 2P2LA 3CUTA 1OFHA 1MG5A 3ICOA 1A8UA 5EJMA 5I7AA 3SJZA 1U1DA 3WK4A 5M5BA 2A3RA 2W6NA 4CT4B 2YZ7A 4NR0A 3OT1A 2F1OA 2YBEA 3LLVA 5G0SA 3UBMA 3K7EA 5AVSA 1P74A 4F04A 3GGCA 1E59A 1E9FA 2Q5HA 3GFSA 4N3BA 1CETA 5BMVB 1FLNA 3UF0A 1FFXB 1JEYB 5JNTA 2FP4B 4LJ5A 2RGEA 4JI3B 2J6IA 1UPBA 2GK4A 5KVVA 1N1EA 4ER5A 1VL8A 1VKRA 3UV3A 4CEJB 2CL5A 1GG9A 2ZYHA 2AWOA 3P2JA 1X3SA 5DIFA 1XAJA 2XMCA 2QTNA 1UFOA 3ADDA 2PY6A 4BJHB 2R1TA 5E0OA 4MV5A 1EK0A 4OKIA 3T7TA 4OMDA 5L3SB 3FKQA 3M5CA 1OI2A 1YZKA 4Y2GA 3ESDA 3R3ZA 5GJVC 3MW8A 4BEWA 1O7JA 1XK7A 4XJTA 3WIVA 1PCXA 3NATA 5JH7A 3RWOA 3CRMA 5G3ZA 1U2ZA 3MJVA 1P81A 4WIAA 3VC2A 4ZEVA 3AF2A 2B98A 1J4AA 1G9XA 1U6JA 2X7HA 4NEQA 5EWJA 2PZGA 1LPMA 3NHSA 1HTTA 4YWHA 5FL7A 1F14A 1L4NA 1Q91A 4FSXA 5EIHA 4DCVA 4DYDA 1XN4A 5CYFA 821PA 5KAMA 1DAKA 2BGJA 2QY6A 4IIYA 2HO4A 1TYBE 2XH8A 4L8LA 4XRRA 3W8NA 5CB8A 5IM4F 2B5VA 2OMKA 2CLDX 4F6CA 4ZDKA 2F9LA 5CR9A 4ARSA 1PE0A 5JT1A 4MMXB 3A4VA 5TGDA 5KQSA 4E30A 4MKGA 1GGKA 4YBRA 3GLFE 4ETMA 2OLJA 2IS2A 1AGRA 1G5PA 2GJSA 3AL2A 3VZBA 2XSZA 3AERB 4IRUB 4LISA 1SJ9A 1KU6A 3A1EA 2QD5A 3CRVA 3ILSA 3DKIA 4PR3A 1BMQA 1K5GA 4HFJA 2IYOA 3LFTA 3PNOA 5DGIA 4EUSA 5B4TA 4YQZA 3GB9A 1PJ2A 5AVUA 1WETA 2VNHA 3W90A 3E3AA 3WDKA 2GJ4A 5BWCA 2IS6A 1T8PA 1JDTA 3R6LA 4AP5A 3MMSA 2HWKA 1FTSA 4KOEC 5EZQA 3IVGA 1UJCA 1A72A 2B21A 1ESNA 2WJPA 1UANA 1KOFA 3FD8A 3CUVA 3T38A 4YJ3B 3TYXA 2XX3A 5LR6A 2JLXA 2I6UA 2ZBQA 2C77A 3TLXA 1XMVA 4OG2A 3ZH9B 4LI0A 3K96A 4DR6B 3WKCA 3RSCA 4I6JA 1KRXA 2HWXA 3B3GA 2W6PA 4RPJA 3S44A 4FZ5A 3T9EA 5K8CA 121PA 5C7LO 4OL9A 2QQFA 1KBZA 4L28A 1VLZA 1M2VA 5G53C 2IWHA 1EFRA 4PHFA 1P0FA 3WYNA 5CDSA 3I2KA 5HK8A 3AJAA 3L1HA 3MCZA 1A97A 3NKFA 3TSCA 1M2EA 3UG7A 3VVBA 4CM7A 4HVLA 3U1BA 4E51A 3SBOA 3P32A 3R3VA 4RZIA 1PNRA 3JQ8A 4XQCA 3KCNA 4U2BA 1QRDA 4PN7A 1JYEA 4GBED 4B31A 2FZ4A 1U8ZA 3E0QA 5F2KA 4BWGA 5AKKA 1E1QD 3AVTA 2P9EA 3IC5A 3KLOA 3UGJA 1WIWA 4FOLA 4AKGA 1EESA 1YCHA 4QOIA 2C3UA 3EZLA 1NMSA 2NXEA 4N7MA 2QL7A 4C0JA 2LKCA 1JG4A 1NQWA 1X1DA 2H00A 2MINA 1KZGB 2Z3VA 3NBUA 5CGQB 4ZAWA 4B8ZA 4BKUA 5KNCD 4A36A 4ZJUA 1E18A 4CLHA 3GUHA 4DRYA 2ZRMA 3QX7A 4DIDA 1SKBA 3OCXA 2X40A 2EFEB 3QTTA 4WW0A 2WZCA 4ENVA 2GMWA 2YHUA 4M1KA 2FW6A 1NV8A 3DOEA 3FNRA 4AW9A 4BE9A 1JDZA 2QQ0A 4A8PA 4FYMA 1A2QA 1UMBB 5CX1A 3UFXB 3GMTA 2AFHB 1JAIA 4LV8B 2NZUG 2Q3EA 4EHDA 4A16A 4U2EA 3LLUA 5CG1A 5DI9A 2ADFA 5CNJA 5KREA 1KDPA 1VYTA 4O2BA 2DBQA 3VJMA 2Q4EA 3PX2A 3QVGB 4YAGA 1XE3A 3M3DA 4HV4A 1E3SA 1XR3A 1SEVA 2G0AA 1XU9A 3PDIB 2PSJA 3BMOB 3I42A 4QXQA 4Y8VA 1QHSA 2O0JA 3ELWA 1YI0A 4OQYA 4BNXA 4C87A 2IXGA 4DMCA 4A15A 1Y63A 1R18A 1YTLA 2QZPA 4GRIA 5B2ZA 2E85A 1OFUX 4QM7A 3EGDA 1FF9A 3GZNB 4ARZB 2JAPA 1T3SA 4HRAA 1XZIA 2EC5A 2V98A 2FXIA 3S1AB 2WU1A 5KOJB 1QGDA 2FY8A 1U9JA 3FI9A 1L4GA 2PGLA 3F71A 5G4LA 1GCAA 2PRZA 4MJ7A 4P7GA 4CLEA 2BT4A 2P5YA 4X3OA 3FWYA 4NI5A 5H70A 1OD6A 5F2NA 2GPTA 3ZZTA 3UWDA 3AIIA 1LPNA 4H59A 3T1NA 3AL0C 1M0WA 4Q1FA 3I9LA 3I01A 1BRMA 1N5KA 4QE3A 5CD9A 1TZJA 3C97A 4V39A 4JYMA 3RBXA 3ZVRA 5AM3A 5JXIA 3BIWA 2C98A 4NK4A 3T1TA 1LQ2A 1I6LA 4L08A 4QNMA 2EFGA 4L51A 3SQXA 2QSYA 2ZR8A 5B58T 3RPEA 2VDPB 1CY1A 3AXSA 3CX3A 1XD9A 2D62A 1ISFA 3BCHA 1VE6A 1R0ZA 2HSWA 1HYEA 3LT4A 2GHQA 4M1YA 3Q41A 3UWOA 4C3UA 1GCOA 2D1RA 1JMYA 1NW8A 1DFHA 2I4MA 2GFIA 2ID7A 3DFUA 3N70A 4W7IA 1W36C 5DX0A 4X3CA 4RACA 1T26A 1OLXA 3DAYA 2BF7A 4MV8A 4XIGS 4WXYB 4YJHB 5EYPA 2C2MA 3QBTA 4DXHA 4HB4A 2VL7A 1Z5GA 1CRQA 2PSHA 2O2JA 3JATB 3FYUA 4GECA 5GZ1A 1LI5A 2AVDA 1TMOA 2Q5IA 1CR1A 3GK3A 4FEGA 3ILXA 1SU4A 4MV0A 4EECA 1NMZA 2MT9A 4ME6A 5C80A 4EG7A 4HC4A 4Y2JA 1OW3B 1QQTA 2Z8YA 4HP8A 4XGQA 2I9KA 4EO4A 3IT1A 2XGSA 4HNSA 5IVKA 1C80A 3JASB 2DSNA 1GKUB 2SCUB 4FNOA 5AI6A 1HG0A 4IFBA 3PR2B 4DDMA 3UUWA 1FX1A 1VZ2A 4ER3A 1E9RA 4INAA 4JGGA 3O8QB 1SVUA 2NTVA 4P0PB 4RJLA 2NU8A 4MCAA 4A0GA 1TFUA 3CRQA 3B5IA 4HNTA 1GUFA 2R3SA 3GPIA 4B6OA 1JRLA 1OJ7A 2DWCA 1CEXA 3AR3A 3U26A 4CHGA 5A06A 1AH2A 2E9SA 2HMYB 4CV0A 3HWSA 2BFPA 1TVCA 4TUYB 1T5BA 4CFSA 3TMKA 1ABFA 4I1RA 2HF8A 4JR2A 4UDXX 2R8EA 3OZCA 2IPMA 4QX6A 3VKGA 3B3JA 4RV5A 4O4JA 4Q1VA 5AW0A 2FMXA 3HJGA 4YB8A 1J0AA 2WU4A 4GYWA 4AN4A 5H68A 2BKLA 3GQBA 1RC1A 2C5LA 1CUDA 4PAOA 3U3ZA 1DG1G 1QNFA 3AF3A 3DFMA 3HJBA 2FLKA 4B44A 2LCFA 1ADFA 2K87A 4G5OA 3WGJA 2Y1EA 2R84A 13PKA 2HEIA 2H2FA 2GCOA 2HJSA 4HWRA 1CRPA 1DMSA 1GRNA 1B14A 3G0IA 3NR2A 2H92A 3WHLA 1NR5A 3PEFA 4P3PA 3TR5A 4RCYA 2XQFA 1HDGO 1JSCA 4GIBA 4KXNA 4TMVA 5AM4A 3R7BA 4E2XA 5K0GA 4Z3DA 2ZE6A 2AKEA 2RB5A 2GH1A 4HQKA 4UCQA 5GONB 3D7RA 3S2SA 1KJIA 2ZJOA 1NXOA 1UJ6A 1HDRA 1NV9A 1X1EA 1BMTA 3WG9A 4N39A 5EKUA 3MHPA 1X7HA 1G8FA 1FFEA 2V9CA 3VTAA 3U1VA 2C1EA 2Z30A 3OQVA 3CZ4A 3CZPA 5E2IA 3TINA 4EY8A 2WE7A 3AERA 1XCGB 2VJKA 4EQ6B 4K9KA 1O6BA 4UFNA 3ZK7A 1JA1A 3DUFA 3DDOA 3F7MA 3H9JA 3SG0A 1OPXA 2GJAA 1R4MA 3OURA 4YH1A 5ALUA 3URMA 4DPMA 3U4CA 3KTOA 3RRFA 3K2IA 1UBKS 5K45A 2I3GA 1C1YA 4EHHA 3KZMA 1J49A 1URPA 3ZHQA 4D4MA 2VNKA 4OU4A 2UYCA 3GLUA 4LHVA 4IGIA 1AHPA 2YMMA 5EXXA 4HL6A 4KV9A 2PGNA 3V6LA 1L7AA 2H1RA 2XGOA 3T61A 5CDUA 1V25A 1L8QA 1CYDA 4JHLA 1HZZA 4FMCB 5LZ5A 1T4MA 4LJKA 3TDMA 4XX0A 3ZHSA 4U7TB 1RYBA 4MI1A 5DCUA 5EZSA 3LOQA 2VDRB 1TADA 2WKPA 3C70A 3AF5A 2E1RA 3EE6A 4JFRA 1Q0QA 3F3SA 4U39A 5IS2A 1I4WA 5ICGA 1JSZA 4ZARA 4YUAA 4LF8B 5AWFC 3OFKA 4G5RA 3J80A 1I01A 3F6RA 5DYWA 3CIOA 3R5XA 3VYWA 5AVXA 1DU4A 2H3HA 2C29D 2P30A 3ORFA 2B37A 3PU6A 4J0EA 3T3HA 2H9YA 3QX9A 5EFOA 2IHTA 1L7XA 2C4KA 2NAPA 3EVAA 3JVUA 3RUCA 3ZW8A 4IIHA 5EPEA 5EIEA 2RBGA 3LL7A 1SA0B 4HFNA 4E3WA 9GPBA 1JN0A 3SR4A 1I24A 4DIOA 3IESA 4GMXA 1Y1KE 1PO7A 3SZUA 1E9BA 4JASB 5CG2A 3GLIE 3FNGA 3PQEA 4HRVA 2QUJA 3FKSD 5JSHA 1ZJZA 1I3MA 2EX0A 4ZDIA 1Y7HA 4DLPA 2FEKA 1IY0A 1EK5A 3D7MA 1KDVA 5D3MB 1N9KA 2X6QA 1IHPA 1A5BB 1Z25A 3LWZA 4L8FA 1UKEA 4QXMA 3TG8A 3DMNA 4F7WA 4LBVA 3ZDFA 4BFXA 1Q3TA 4HDQB 4P2BA 3CMMA 5HEKA 3C6QA 4KJXA 3RU7A 3RGWS 3RSFA 3QSGA 1CVRA 3P2YA 1M2JA 1UZLA 4BNJA 2YMLA 1I8TA 3D9QX 1P3DA 1UBLS 5F2EA 2HN9A 4RVGA 4WJLA 3D6VA 2V03A 4AIRA 4RU1A 1KARA 4HZUB 5CU7A 1I5EA 1ZOPA 1O6GA 3CURA 3OEHA 2IV3A 4C05A 5LYJF 4ZV9A 1OHHD 1QRAA 3GCZA 3RS0A 4E33A 1KOGA 1JJ7A 3AUJB 1PK8A 2QYOA 2O2XA 1NQOA 3A9SA 4I99A 1Z34A 1FVHA 4OQDA 1J7KA 4N65A 5BN4B 5I01A 4OM8A 1Z4LA 4WD3A 1USGA 3I1FA 5J2UA 1NIPA 4MKIA 3PNYA 4TZ0A 3N6XA 2IE8A 4ZVTA 3X1WA 4KVFA 4PYJA 4QNRA 4ZT7A 4MAFA 4NG4A 5J40A 1QGYA 3IQEA 3WYEA 3CRZA 1MBZA 1RZUA 3D8HA 4IWXA 1XRNA 1IM8A 1YCDA 3VPHA 3CUSA 1PT9A 2GZ2A 3KX2A 1T5SA 2VS1A 3PA6A 4XKJA 3RS8A 3WAKA 3Q88A 4A5OA 4FR2A 4D7AA 4DV2B 4P4NA 1XDDA 3L06A 4JSTA 2DJ5A 4V3BA 1U8XX 2HJGA 3K6JA 5F7ZA 1K0FA 1KY5A 3UOWA 4TKUB 3K8ZA 4BRUA 4ETIA 3LRPA 2JK1A 3AW9A 1DNPA 2QAJA 1GR1A 4QBKA 4X8HA 4MDFA 4WDQA 2B6HA 3MS2A 3PUYA 5I9SA 3SR3A 1YOVA 3T1OA 4S3MA 2G1KA 4EVQA 5A2GA 5IBQA 2FWIA 3WXMA 1J8YF 4WOKA 1Z3CA 2EBWA 3MGGA 4IAOA 1TYCA 1BJKA 2PK3A 4J91A 2PCLA 3V2HA 1ZEMA 2ANCA 4X1OA 3H84A 3QBVA 4A8JA 5BR7A 5L8VA 3H5IA 3NH9A 3CRRA 4D9IA 5CM2Z 1EX6A 4QNNA 1T5IA 3P9ZA 3KR9A 4CL2A 1GXSB 1BU5A 3GRUA 2I99A 3WGQA 3EPKA 3LF2A 1F7VA 1CQZA 2AT1A 3A10A 3BL6A 4BNHA 5HFNA 1V1JA 1P0PA 3UHOA 3G5TA 1E6WA 3WOHA 3O95A 4NBKA 3R5HA 3KPUA 4I1IA 4N5IX 3SJAA 1EVLA 2I5PO 2IYZA 1XTPA 4BV2A 4G0VA 5KINB 5LP1A 2WBLC 5JH7F 1B23P 1EFUA 4Q4HA 4D99A 4AT1A 2YWGA 2WYVA 3JQ6A 4IJUA 4MW0A 4EQZA 2H1WA 3G2JA 3G79A 1ACJA 1S8FA 3AR6A 4YPVA 1OXXK 4CMCA 2HDOA 1C5KA 1U2DA 1ZGHA 2W2MA 3TIIA 1VHDA 1N3LA 1OLUB 2OCAA 5I6DA 1B8VA 2I2XB 1YHNA 3KKLA 1TM3E 4BPRA 4EDHA 3EPLA 3DC2A 4G9GA 3J81k 1QLHA 4GOMD 5IPFA 2I6GA 3AEUB 4Z5XA 1AQJA 3SIWA 3OZTA 2JLWA 3HCEA 3CW8X 2P69A 3QOFA 5ECDA 2IX9A 2MDTA 3O9ZA 4S35A 3TQFA 4CLDA 1ZGBA 1M10A 2GM9A 3I23A 4O4JB 1TK3A 4WNYA 5CDGA 1Y1RA 3MSXA 2NVUB 1JIQA 2ZREA 3H9UA 4YPFA 3RJMA 4CDNA 1YKGA 1GZVA 1BYUA 3A1NA 3BKXA 1EVQA 4BN0A 5JYCA 2IP2A 1C1HA 2VYNA 2XA9A 3A1FA 3LZ6A 2RGAA 4LWPA 4NU5A 4A2PA 5HTKA 2VOJA 3KT6A 2GCOB 1X1BA 3FTNA 3ROTA 3TWOA 5IWAB 2O8BB 2GLTA 2QD3A 3BH6A 3REFA 3FTFA 4AP6A 4IOMA 5LU9A 4IIUA 4NBNA 5C5IA 2EFJA 2ZT5A 3IVXA 2HV8A 4WK4B 2XUHA 1P7YA 1A95A 2YWJA 1UOEA 3IOYA 2IPOA 1TDJA 1XL0A 3LKDA 3KYCB 5LYJA 4BNKA 1CFJA 1V7QA 2QGNA 1YQXA 2XT6A 3F0TA 4J1TC 4PXYA 3CZ9A 4FYYA 4QUEA 4V0QA 1KJJA 3IPRA 2ETVA 2EKZA 3RYIB 1P0CA 1LPOA 2GVNA 3EUEA 3HG7A 3PJDA 4LE1A 1JA9A 1Z6XA 3WNVA 4EB6A 5FDFA 1EX7A 1QDEA 5KSWB 1XZJA 4D0LB 3TUIC 4AD8A 1JQKA 1HNZB 3KJHA 1I1NA 1HDCA 5K8JB 1WZ2A 1W0KA 3I64A 2P9QA 2ZIEA 4FFBA 2G4VA 2NM0A 2ET6A 2A33A 1C8KA 2P6PA 4TZ6A 2F1KA 1B73A 2VPTA 2ZAIA 3A7EA 5CW1A 2FRDC 3NS7A 4LWOA 2CSXA 2UXDB 1QZTA 4FI3C 4LBZA 1I1HA 1USWA 2CL6X 2JAUA 3ROKA 5CIQA 4ZQCB 4RESA 3E61A 5D5PA 5H3LA 3K8OE 4KNYA 3SS8A 2OLEA 3DEHA 5T41A 5FBZA 5CVDA 4RVOA 3AQIA 1F5SA 2FK7A 4LBYA 1W29A 3RVOA 3WLFA 2W90A 3GDHA 2PUTA 2VJBA 4KR6A 1B4DA 2AG1A 3D6TB 1T6ZA 3MWGA 1H1LB 2WUDA 3PNPA 3IMCA 4JQSA 1WMFA 4R0MA 4L4ZA 1ISIA 2FFBA 2YRFA 1TW2A 4DSNA 3RU3A 4EMSA 2YWFA 2BD0A 2IU0A 2G25A 3TW6A 2RHJA 3IXLA 3JAKB 4XSHA 2HK6A 1NBOA 3KSZO 4GC5A 1DQNA 3MTEA 3KJGA 2H7VA 4GM4A 4ROSA 1WSDA 4YRFA 2X2EA 5HUHA 1YK0A 2WFLB 3R7LA 5LL6P 1E1KA 1KI9A 2ZR7A 8GPBA 2I2BA 1Z75A 1M72A 3HDGA 5KJEA 2QVCA 3RAJA 5ENZA 1X2EA 3JQAA 1G64A 4LECA 3PXBA 3O1IC 4BE7B 2XDAA 4B09A 5BMVA 1TUGA 2IUFA 3FAZA 3IAM1 3R3XA 4BYMA 3ZD6A 4F11A 2A2ZA 4R2LA 3PD7A 1QTQA 1P73A 4Q7KA 1DKOA 1M6EX 1FC0A 4RDCA 4U9UA 4UE2A 4AJ1A 1VRVA 4RKWA 1ZOLA 1W6UA 1J5EB 5EUMA 4NXMB 1UBGA 1H6BA 2HIHA 3KC2A 2BCGY 3V1UA 2RHOA 2WTEA 5AW3A 3DE2X 3GJ8A 5IJ9A 4LDZA 2PRIA 3ZIUA 3CR8A 2Q0QA 1A7AA 3WLNA 1UPCA 3AINA 2GZ3A 3NJRA 4H77A 1RFGE 1ZJ6A 2ZWVA 3MCAA 4P3OA 1Q16A 4WUVA 2Q6LA 1KAGA 1PJQA 4H31A 4M7RA 5EIWA 3ZKAA 4AROA 1P1JA 1UJ5A 2Z5FA 1ONBA 1FFWA 1MQ9A 1TKAA 3ENNA 5JZOA 1KR2A 1LFAA 3A0UA 1FRQA 2ZFUA 5KNBD 3DV9A 2DPMA 2QE6A 3U49A 5IT4A 2C83A 3R8CA 4E4TA 3IKVA 3STWA 4HNVA 3AYXB 2VDOB 1RQNA 4F92B 3TTXA 5B58C 1DHTA 1W1WA 1T6YA 2X86A 3QHQA 1N0WA 1XFDA 3K4HA 3KJZA 1VHQA 2MMGA 5LZ4A 1C4WA 1KK1A 3FY4A 221PA 1R0WA 4ZV4A 3IXMA 2A0XA 1THZA 2A67A 2YW2A 4WASA 5E7JA 2F8LA 1UMCB 2LIVA 3KJFA 3PYMA 2C78A 2GBFA 4YACA 4JQOA 3OF2A 4PSVA 4RY8A 1KEKA 3NHRA 3OZBA 4EK9A 2A9FA 3RYTC 4J76A 4A4DA 1HDIA 1YUNA 4ZCRA 1QV7A 4QOGA 1EEHA 4OAOA 5EZYB 3ZHYA 4URHA 3VUEA 3RABA 3GEDA 2F90A 2PQ6A 1DOHA 2V7PA 3TTYA 4OH7A 3M3HA 4DXAA 3RU2A 3F6CA 4EGAA 1SBHA 1W52X 3GROA 1GPH1 2PT7A 1QONA 3KE8A 3N0RA 4WJZA 5CAEA 3GH1A 1PWYE 2PL1A 1ILEA 4IOKA 4E7PA 3HCOA 4IEFB 1LRKA 2A4KA 3FFWA 3GPDG 4Q9AA 4C07A 1L5GB 3KIPA 1IN8A 3LP6A 3EPHA 3L0IB 3ZR4B 4IDEA 5HF9A 1GZ5A 1Y3FE 4EB3A 5KZMB 5KOIA 3MGCA 4G1VA 4KPYA 2EATA 4UM9D 1GGHA 2L17A 3O6VA 1R9NA 3AP3A 3RIXA 4X24A 1UBTS 3AF1A 4MVYA 4QPDA 5JHGB 2J08A 3V1YA 4JYCA 4U7PB 4CM6A 4EY6A 2QRVA 4X00A 4CM3A 3QA9A 2Q2OA 4LYEA 4F72A 6ADHA 3M6FA 3OO0A 4BY9E 5C46F 2PRKA 2C59A 2QEQA 1JDBB 2YXDA 3EN0A 2OVBA 1E2MA 1NBAA 2YIDA 3H2JA 4RQAA 2QSZA 2FW0A 1CG6A 3FUCA 3IHTA 4IX9A 4DLKA 2J7PA 1T43A 2XWPA 3AT1A 2QZJA 4MROA 1DC7A 1FRZA 3UB2A 2HIGA 1QVAA 1XBTA 3ZC3A 4S24A 1G55A 2CVHA 4OHRA 3P26A 3DONA 2DWUA 4JYBA 4QGFA 1TXGA 2FQQA 2QQGA 4FN4A 1M2FA 3FCYA 2XUDA 2CXPA 1JQEA 4YFVA 4YRLA 2H1HA 4WCVA 2H08A 1DV1A 1QHIA 3RW9A 1DX9A 1L3CA 1XZGA 4MIOA 4UD2A 2JJ2A 1RXIA 2OP1A 1X0XA 1DC6A 3E05A 2RE8A 2IHNA 1NW3A 2WJAA 5FR1A 2JFOA 1FA9A 3R0IA 3II6X 2DH6A 4JY7A 2VTBA 2IHVA 3GAMA 3TSZA 3W5VA 4QFDA 2BZ1A 1ZR2A 1IN1A 1P1HA 1QAQA 2YICA 1QG2A 3C2QA 4H3HB 4TXJA 1AGXA 2WIBA 1CJUC 1CVIA 4EFDA 4NCNA 5JUWA 2JFVA 4KLRA 2PKWA 1ORWA 3KO8A 3Q3JB 4KXUA 3BT7A 5KU1A 1JA0A 1Q44A 4HDSA 2KBFA 1O9GA 3IV6A 1NN3A 3LAWA 1VLJA 5ALHA 2V5VA 2GWRA 3CEMA 4B4UA 1FPMA 3UXYA 4Z1OA 4OBXA 4LOAA 4OD0A 4PIVA 1KP3A 4IIXA 5LN1A 3FRJA 4F1WA 2F1JA 5JWOA 4TV8B 1EK1A 2YJ5A 4EA7A 5AVOA 3HE3A 3TXXA 4RJTA 3E15A 4FI3F 5B7NA 2XZPA 4Z8XA 3E7XA 3EQ2A 3BS4A 1CIPA 3FVQA 2D74A 4YR7A 4N48A 4L7QA 3RKSA 3VR4H 1IWOA 1V95A 1CZKA 4MP8A 4GE0A 4F6RB 4WBNA 1P18A 4D9FA 1SXJA 1MJFA 3RTCA 2AMFA 4CIAA 4Q1AA 1UEJA 2VDMB 1R4ZA 4KWEA 2CBGA 2J3JA 4BLRA 3IEIA 1KEZA 1VZ3A 4JEIA 1TZKA 3O4RA 1O87A 4H2DA 5FOUA 3ZHBA 4CM4A 3KQKA 2PUDA 1G8JA 2W2TA 4GMFA 3BGIA 3EMDA 3O3NB 1VE9A 4LZJA 2IF0A 1LNZA 1MIOA 4FZJA 4LF6B 2VDNB 1JFTA 1S3GA 2BC9A 4ZVRA 3GG2A 5AVWA 2IUUA 2B99A 3ME5A 9ABPA 4KN8A 4KGDA 2QP3A 3LDAA 1U0SY 2W2XA 1EIWA 3H2ZA 2SHKA 4X60A 3I61A 4K6MA 4CG0A 2ZUFA 2BMAA 3ZDBA 2ZYDA 1AUQA 3A6ZA 2H1OA 3HCCA 3EJ6A 1XHFA 3FVRA 3K3PA 4G67A 1FZTA 1YDFA 1K08A 3ZLJA 3H1BA 1D2GA 2JJMA 2KWIA 4R7ZA 2JKZA 3LGSA 2XZDA 4M99A 4NOJA 4G07A 5ALIA 1O6CA 2BZSA 4NMMA 3V8QA 5DIZA 2VPPA 3IR6A 1R5BA 2XMGA 4L3OA 2EDAA 3FFXA 3N7UA 1E2IA 4HAUA 1EA7A 2CXHA 2JJ8A 5KOJA 3IAM6 3OUZA 3QEAZ 2JA2A 2WMYA 5CA0B 5DN6D 3IUQA 4FM9A 1M2WA 5REQA 1SCJA 1WULS 3ZDXB 2FSPA 3ZWNA 1NA5A 3S5UA 3QQ5A 4JEUA 3EA0A 4YRKA 1ZIOA 1MX5A 4LZNA 4XWGA 4AYWA 2IYEA 2QN7A 1R8JA 1USUA 4A82A 4KCGA 4I55B 1B3BA 1RQXA 1ADCA 1TT5B 2H2GA 4HYYA 2ZUCA 4WN9A 4YDRA 4M0LA 3W05A 3RUEA 3WYAA 4B6EA 5DOVA 1TJ3A 4QT0A 4LNHA 3WO0A 3T4UA 3F73A 4DV4B 1PNOA 5IZ4A 4YJ2F 1KTIA 3C8MA 3GW8A 1U2QA 2OXFA 4OBBA 3K1AA 3R76A 4DJAA 1YT5A 3AIMA 3B70A 3D8SA 3Q7IA 4IH4A 3NGLA 4Q21A 4LK2A 1XKTA 3UMSA 1Z45A 3OTHA 4PYNA 3LV8A 5FF9A 4ALLA 3MMZA 3SBEA 1EXMA 1MABA 3MM4A 3UOGA 2AJTA 3LKZA 3WLHA 3Q5EA 2B8JA 2IXEA 1ZGJA 3AU8A 3CLUC 2WWVD 3GJ0A 3C3BA 3STXA 4OF4A 4A1OA 4L15A 4DUGD 3VO8A 4OFZA 5JMOA 1B00A 4G56A 2R7KA 4KXXA 4WI1A 4B0OA 2D6FA 1IY1A 1X7DA 1DARA 3IILA 1JVSA 4R98A 3EXFA 2JI6A 4KR7A 3GRVA 1XEWY 2J0EA 2PKQP 2PS9A 2Q5CA 1E99A 1DIHA 3CUKA 1AMUA 4HRXA 4CRWB 3KJEA 1E0JA 3OLXA 4OAPA 3IMKA 3DDZX 4FKMA 5E4YA 2AZMA 3M83A 4URXR 2BZGA 4I4IA 5I4IA 2E4UA 4LVOA 1TNDA 1X7ZB 4JLUA 4UZFA 3UT0A 2YJ6A 5T6BA 1T3ZA 1NYLA 1P29A 3SYTA 4KKXB 2PFGA 5JS7A 1KRHA 2FEMA 4PIPA 4L85A 5A9RA 1HR0B 1PQPA 3TXYA 2PGXA 4RMHA 4PZYA 1WUTA 3ORHA 5FI1B 1NF2A 5HZGA 1JIJA 4MS3B 3WC4A 4COOA 1O5IA 1PWZA 2YWRA 3BD9A 3KHTA 3GHHA 4KQFA 2J4CA 5DGDA 2PWAA 5T57A 5B3JA 4GPBA 2NU8B 3UK2A 4AN0A 3PE4A 3RB8A 1ZEJA 3OEEA 4XCQA 4CF6A 2D0DA 4UM5A 1G8PA 5M3BA 4D8YA 2QMYA 5IULC 3FNEA 4MV9A 4FDLA 3RNLA 4IR7A 2X0FA 1YD7A 4JLBA 2OV2A 2VDWA 3UJ9A 4JNKA 4IL5A 3ZGVA 4EQ6A 1NUAA 3WS7A 2C96A 3FG9A 4M1ZA 2CMDA 3RC9A 1EZ4A 1RQLA 2C9OA 3OBIA 1SD1A 1P5JA 2PYIA 3BULA 2ZB4A 5ALQA 2Y2UA 3FCAA 4W6QA 3L7BA 4HWTA 3VH2A 4ZICA 3ACCA 3MWYW 2K2WA 1Q7RA 4W9NA 1SOAA 3PWSA 1FOEB 4G5QA 4ICIA 2I91A 4MGYR 1DKPA 1KA9H 3E0XA 1YO6A 2X3YA 2RK4A 3GX1A 3V8PA 4ESOA 2CNKA 1E2EA 2XYPA 1ZVQA 3L7MA 3I2JA 3NB0A 4QJIA 5ER6A 5K99A 1M1YB 2H7CA 1IXZA 1TW3A 3DXZA 2CMFA 5BVHA 2ZIAA 3BE4A 5TV2A 2J07A 4Z0PA 3Q5DA 1ETUA 2BFOA 2X41A 1U0HC 1YR1A 2AZDA 2BUCA 4LJYA 3QA3E 2BGLA 4FC7A 1V39A 4XLTA 2ZR0A 2ZYAA 2JKVA 5E4FA 1UMDB 3T94A 3CVXA 3U7GA 1Z0ZA 1XWIA 3PLRA 3VV3A 3IEKA 2GLUA 1YFJA 4LSMA 2RH8A 3WP0A 4J16A 1Z0KA 3JQFA 1F5NA 1GHTA 1NFRA 4ENRA 1FLDA 5IFLA 3JYHA 3SVTA 3PLAE 2PMCA 5DCWA 2FPPB 3LGAA 1G8YA 4ZU6X 1B7GO 3NHWA 4F93B 1Y9ZA 2Q4OA 1H2EA 3SX4A 3KELA 1TM1E 1KO5A 4BP8A 1K5DA 1OWMA 1YR6A 1G8KA 1U3CA 4NNOA 1BMDA 1P1RA 2BDTA 3GDGA 3CVUA 2ACWA 3K05A 4NZMA 1GARA 2C1XA 2I7VA 4P3YA 3VSDA 5A4AA 1JDSA 4LPKA 2P2YA 4WWHA 4YAIA 1E9EA 2ACEA 5HFAA 1JHPA 4DA0A 2CZQA 2XGMA 1GQFA 3MTAA 1KFEB 2YJ3A 1V8OA 3B85A 4MCIA 4RMNA 5F78A 5K6AA 1BE0A 1A2KC 1JB1A 1JU3A 2FPRA 1HLFA 2W6ID 1B0ZA 1XVAA 4JKIA 3VHXB 3J7AC 1UM9B 2C4UA 3R41A 2ZITA 3GEIA 4YV1A 4Q6BA 3P9KA 3HFGA 1PHPA 4MV6A 3O94A 1BCSA 2JZOA 3WLEA 2H0QA 1Q5PA 5FPQA 1NXSA 1K27A 4XZ3A 2FU5C 1LA2A 3ZG6A 4YX9A 3JU3A 3EXIA 3V1NA 1RC0A 5FPYA 3EYAA 3IP1A 2ZUSA 4DCNA 2D2EA 3DLCA 3F47A 4C4SA 4KUHA 1VKOA 3SQMA 1O1YA 5TJ9A 2VJPA 2D5BA 2WF6A 4C1NA 4KGXA 2VRNA 3OZIA 4HYTA 4UPVA 5ITWA 1T5OA 2DFVA 1FRVA 3OOWA 2J0UB 2NG1A 3W8FA 2CDAA 4MRAA 4EG4A 2R79A 2Z3ZA 2PVSA 5C1DA 1V5EA 1NMYA 2HZBA 4LWZA 1QOQB 2AKYA 4U6SA 5IMBA 4OUDB 3H4TA 2RHLA 1MX3A 3MT7A 3VR6A 2IYLD 1P44A 3AGPA 3TFQA 3R2JA 1TM5E 2MSDB 2P7HA 4K0RA 1QJ4A 3DKPA 1RXYA 3IO5A 3GPCA 2RD2A 1R4NB 3LCVB 3CG4A 3H3FA 1R6VA 2OFOA 5EXTA 4ZT4A 3CH5A 3CKKA 3D3WB 4JVMA 3DL0A 3P1JA 3VR0A 1VIDA 3M5WA 1EB9A 2NN3C 3PWKA 2Z6AA 3EEBA 2VSOA 4Y1RB 1NWHA 5T64A 1XRLA 3D81A 1GKLA 1I3NA 3R3JA 1O0CA 2DFLA 1A71A 2WHQA 1P45A 3KV1A 2QIOA 1CKEA 3N2EA 4O25A 3URKA 3ZGLA 5KTNA 1Q17A 4FFMA 1LVUA 3FOEC 2FF5A 5AP9A 1DJNA 3PHCA 3EGIA 3WQSB 2QW1A 4JXXA 4YALA 3ZCVA 2AD5A 4PY2A 1PL0A 3K9BA 1G8SA 1OLSA 3E1GA 3R6GA 3BCUA 3L7YA 1BDJA 4Q5IA 3RIYA 3DMGA 1SGWA 4QRDA 4B9AA 4P1ZA 3KWMA 2NAFA 2GA8A 4IQ4A 2VP2A 1N2OA 4L8GA 3VKFA 3WMFA 5HE8A 4E5VA 5DJ5A 5JI3E 3JTMA 1RXVA 1BMFA 3H9EO 4HXFB 4PZ9A 3PVCA 1XAGA 2CFOA 2Y6VA 4YI3A 5TB5A 1RRPA 1FS6A 4GGMX 5K0EA 4EY5A 2EP5A 1T8TA 1JFFA 1G21E 1BKSB 1DAEA 3EXG1 3IOEA 1IATA 3QLVA 4MW4A 1HKUA 3NX4A 3ZLVA 5ALRA 1QRRA 3WGTA 2AL7A 4YJHA 3E9EA 1JI3A 1FU7A 2FX5A 1LKZA 1DAGA 3RKUA 1GSAA 4A0QA 4OXNA 1XRJA 1O97D 2IS4A 5CTJA 2OHOA 5BOSB 3GRZA 2VWHA 1H2HA 2IOHA 4NL4H 5T8KA 4A3SA 1JR3A 5AKZA 4EHJA 1QRTA 3BL5A 3DCYA 1LBSA 1FYVA 1P72A 2Z56A 3H6GA 3QELA 5DEOA 1ZKDA 1DZIA 5HJEA 1RYYA 1W7AA 3R8FA 2GM4A 2OZKA 1Y3DE 4D3SA 1PSDA 3FTPA 2HA6A 5A3VA 4JQCA 1P4HA 2G0NA 4M9XA 3PFBA 3B3QA 4O4IA 2CBZA 3OF5A 6NULA 3WBJA 3LY5A 3ZD9A 3KDAA 1RMQA 5KYTA 2JIMA 2ZWMA 3OCCA 4KXLA 1IHDA 3LA8A 4MVCA 3ZX5A 4KRFA 3AUAA 4WE3A 5AICA 3G6KA 1QP7A 4Z4GA 3W1WA 5KKNB 2G8LA 2JRLA 3BCRA 5LDDC 1O8CA 5IVHA 5BSHA 1X8LA 3CF4A 2XB9A 1Y89A 5IBRA 3MWDA 3D6UA 3I5XA 1B6GA 1Z5NA 4PAQA 1DELA 2R11A 4DMLA 1QF6A 2O8EB 3ED5A 1V8BA 5BPHA 3AOEC 1C3JA 4HRYA 4EPXA 4ZJPA 1TQDA 4EJ2A 5DBIA 1NVFA 1NXXA 4CMEC 4OYRA 2JK0A 1I0IA 5EE5B 5FULA 1P6UA 3ML1A 4FWTA 2WD9A 4R81A 4DT1A 4X1YB 4BJ6A 4DBVO 1G59A 2HT1A 4PRKA 1V6CA 5B30A 4HY3A 2EGGA 4GZLA 3S70A 1E3JA 2PD3A 2VRCA 4K2AA 5GONA 3DEIA 2XUOA 1UPTA 5AR1A 1M1NB 1R0BA 1RM5A 3LH5A 1IBSA 4R1OA 5JAPA 1N1MA 3KLBA 3A14A 3CEJA 2HDNB 2ZUEA 3OEED 5JD6A 1NJ1A 5LC1A 5C5EA 4EUEA 3QJGA 4HTAA 4LHXA 1PV1A 2PU5A 5JPCA 5HWSA 3TJZA 2XDQA 1C30A 1XCLA 3L79A 4U8GA 3V8EA 3QX3A 5KWEA 5KO2A 2XIQA 2ZE7A 3H9GA 3AHFA 2FLVA 3E82A 3UYLA 4PLYA 3C6YA 3WTCA 1QIMA 4PIMA 3EIUA 5GJCA 3SSOA 4P35A 1MC5A 2VDJA 1R4MB 5UKDA 4DTIA 3S8YA 1ENPA 2Q3JA 1HEYA 4IGEA 2ZQ5A 5AHRA 2A5DA 3DLAA 1QPZA 1LTHR 3DT9A 3ZOKA 1M6YA 1XEXA 3BBLA 3M0EA 5FPPA 4ZYVA 5DYNA 4PRYA 1HFJA 1BMFD 1HLPA 3W5CA 2JS7A 2V7GA 5G0WA 4A27A 3WYBA 2P75A 4B6FA 3I72A 2HCJB 5KDDA 4RY2A 4QYIB 1H1DA 2JGNA 4EB0A 3QXSA 1XTKA 1U80A 2EW8A 2IGBA 2VPZA 2WHRA 3VR4D 3TRDA 2WB4A 4S05A 3U5ZB 3U7RA 4GKJB 5JSFA 3TNJA 2FOLA 2A1UA 1WNFA 4YCBA 3AHCA 3D4LA 4CMKA 2JKYA 1RXUA 1SXJC 1RJ9B 2PLFA 2CJPA 3DVSX 4YHBA 4ZOAA 3DBHA 1MC8A 1NHWA 3EGVA 1MB4A 5KNDA 1CJCA 1HE8B 1KAOA 3F8TA 5BW5A 4OY3A 5I3ZA 4G84A 4UUQA 4Y9TA 4ZMRA 4PX9A 4MHTA 5DHTA 1JEEA 2XECA 2XOEA 3UVEA 1NN5A 4GHWA 4XFDA 4UBJA 4M49A 5J58A 3BZBA 1JKIA 1Z4IA 1ZD3A 3O83A 5KQPA 4PYKA 3RVBA 4ZK6A 1YBHA 4EKYA 2Q62A 4JI5B 4PO8A 4AP9A 3DHWC 10MHA 3NEYA 4B32A 1AG9A 4TRRA 4L8VA 2FFJA 4Q1DA 2V7XA 1LC3A 4PXAA 2JFFA 2IUTA 3KRTA 5IAOA 3PT5A 3RF7A 2WFAA 3I9NA 1N3BA 1R8XA 1VHTA 2R86A 4ITRC 1DEXA 2OWEA 4QUHA 2YL2A 3MRTA 4I66A 5JS1A 5DU2A 1OUMA 2PX0A 1L4KA 5ELMA 1YJ5A 1NXTA 4H4CA 4OBWA 4EHAA 5H9WA 3JQ7A 5KTOA 1PFVA 2LXNA 2Y0CA 3QU2A 4PPQA 3CEHA 1M1UA 3H5AA 1MVOA 3DNPA 2WKRA 3AEZA 2FN7A 4ZDJA 4R6XA 4HYEA 3GLKA 5TPWB 2O23A 4DNPA 1H2RS 1ZY2A 2HQSA 3QY9A 4RD1A 2FF7A 2VO1A 3TJMA 5ITVA 1CY2A 2PBFA 4RM3A 2P6NA 3O92A 1S6YA 3AV3A 1GAJA 3LFUA 2VDUE 2CL7X 2Y93A 5J2UB 1U9YA 2EV9A 1O94D 5FAXA 3MAAC 4Q4JA 3H1FA 5JFGA 4XIIA 1KO8A 4W9RA 1XN1A 1PX0A 1RHQA 2QOEA 4ZXPA 3BGVA 1KI3A 1NJ6A 1YL5A 4IF4A 3GRYA 3EXIB 3T54A 1VL0A 3L6OO 4CKBB 3VYVA 2DT5A 1UBOS 3L9WA 1NNUA 4C76A 4CDRA 4JQZA 4QGGA 2CF6A 4QFBA 2X1LA 4V38A 1QE0A 1KSJA 4BC1A 4CCYA 4CF5A 3HR8A 3GJZA 2V54A 3P71T 2QR5A 2Y1WA 3K70D 1ZK3A 4C43A 1G6OA 3H0KA 3IODA 1NVAA 1OJLA 4S1NA 3ZTWA 2JIQA 4R1MA 3FTEA 1OZGA 1TMYA 3KB1A 2YXPX 1GPMA 2YJGA 1S96A 1IQRA 4N5HX 3KQLA 2AE1A 2HMUA 5JZMA 5IEBA 4QULA 4WEQA 3R9WA 3JYQA 4FE4A 1OV6A 4NULA 2HA0A 2YHBA 1O6ZA 2C03A 4G3XA 2D5LA 1HNNA 2GZDA 2V4ZA 4E2WA 2QRNA 4XJVA 3REQA 5F2OA 3CEAA 3K73O 1XHEA 2ADMA 1E89A 3L8MA 5B4UA 2VEOA 5HQTA 4DYHA 3BFKA 4GT1A 3LQQA 2ATCA 4J2OA 5ILOA 1E2FA 1R10A 1TK9A 1ZSNA 3G02A 4JR0A 3HWRA 4MW6A 2IXBA 3PFWO 4RBNA 4YUVA 2Q29A 2R8YA 4WT7A 2TMDA 2Y4NA 1H0HA 1GL6A 2F6RA 2M32A 2NTJA 2P68A 2WHXA 1XTRA 4WFQA 2VHQA 3BK7A 3TCNA 1PNQA 2WT9A 3NQ41 4DLXA 4DW8A 5JYEA 2GRAA 4R54A 2CXUA 3L43A 3ODGA 1FP7A 1CD5A 2CKDA 1WW8A 4EYKA 1QGUB 4N76A 2MU1A 4B7CA 2JLRA 2BGGA 1F3OA 1GRQA 3AUSA 2MINB 4ZVOA 2GM3A 1UFQA 1QBGA 2WU0A 3K0EA 1LW7A 3FDZA 2DWOA 2B2NA 4NY1A 5EMJA 3WLOA 1MRZA 4FNMA 3G7NA 3IT0A 4EGJA 1OI7A 4L5JA 4ENPA 3TGLA 2FG6C 4DLSA 1KXJA 4BPBA 16PKA 2VPXA 4KODA 3TCKA 1Z8FA 3FCSB 1BEEA 3V8RA 3WNZA 4TV8F 5FFFA 1QTIA 3FZQA 4PTZA 1WSBA 3EFBA 2HPHA 3Q3HA 2EIHA 3LHFA 1TM7E 2ISQA 3JQBC 4AY3A 2ONCA 4B46A 2QRUA 4RFVA 2XYQA 4Y2YA 2E4ZA 4HXGA 3K16A 3V5NA 5GVRA 5J2TB 1L5LA 4MVJG 2X8JA 2EFHB 4NATA 2HB6A 3MAGA 4BDTA 4OFXA 3B1VA 4GX2A 1L5ZA 3UXMA 4FGKA 5EQFA 5JJLA 2NO9A 2V0CA 3RSGA 3NP9A 1VLHA 3FPLA 4ZO4A 1YZNA 3LQ1A 1E20A 2YVUA 1EDOA 3UY4A 5DM60 4D8TA 1I7QB 2C1ZA 1PJTA 1Y9EA 4IM7A 3VBCA 2M6SA 2QLTA 3EQ9A 4LMRA 4TLAA 2ZRAA 5GP1A 1T9CA 4P4GA 4XVQA 4EA8A 5L3QA 2RBKA 3GLHA 3TVYA 2GPJA 3TOXA 2JBAB 2Q9BA 4YVFA 2X9LA 4R2JA 2ZXFA 2E2WA 3ISVA 5CFOA 2JIZA 4E5MA 4PZLA 1CR2A 3ZHOA 2ZU0C 1KJQA 2PM8A 4KG7A 3SI7A 4UTNA 4LAFA 2ZBFA 4P54A 4YASA 4N3NA 2PAFA 2VOEA 2WP8J 2GN8A 1NVEA 4G41A 3HZHA 3KJXA 3M6LA 1RYHA 5AJXA 2GXSA 1W88A 3DZGA 1IBRA 4ZYWA 5BSRA 2GHRA 2OBFA 4F96A 5C1IA 4DR1B 2CK3A 2EARA 5CA0F 4KQKA 1SHKA 4QDZA 3I58A 4UHJA 1KFBB 1CSEE 4FQ8A 3VOTA 4J3FA 3UKOA 2VJLA 3BORA 1DDGA 2OXIA 3Q72A 5EE9A 1F8GA 4TN1A 1CY8A 4N47A 1ZN7A 4XJXA 1WLYA 2W22A 3QLUA 4GXQA 4MIYA 4QUAA 1YS7A 1A9SA 2X9QA 4II7A 2L0XA 3MG9A 4RJKA 5DBOA 1T2AA 2YBDA 1L5KA 4CIXA 5HX7A 3EHDA 5EQTA 5B55A 5HKKA 5JDIC 5KUTA 5F73A 1UXKA 1GU1A 3CUWA 4MUHA 1B8OA 1XU7A 5JAHA 2WD7A 4LZOA 1E2UA 1JLLB 1MOQA 3NGMA 3ORYA 3ZGXA 1Q20A 3D1VA 2WABA 1A69A 3K53A 2FR8A 3H19A 1PG2A 5GV8A 3TTWA 3LX4A 2Q5LA 2WHYA 3EAFA 3RYFB 4Q03A 1MTZA 2AIRA 5JLAA 4BZQA 2GBCA 3OJCA 4UQOA 2IBTA 5KKCA 4JYPA 4OGLA 1YJ8A 3FCXA 2H17A 2JJQA 3D4IA 3L49A 3PX7A 1L5FA 2XRFA 1J8VA 3R6TA 1ACMA 4FXPA 3TE6A 2IXDA 2CYCA 3JVDA 1E6CA 4R2IA 1XZEA 1FYXA 3LKVA 4H4EA 2G4CA 4JB8A 3S55A 1UFKA 2LTAA 3EXFB 4W5OA 1T25A 1FQJA 2JJ1D 5JCOA 1W49A 3SS7X 2Y1XA 3FYHA 3NW9A 5E7MA 2A5FA 3NBXX 3PC8C 2D8AA 1J0DA 4G5XA 4JCOA 5G1NA 5KMGA 3EWIA 4YT2A 5J4KA 4HH3C 3ENKA 1M66A 1VCOA 2QTHA 2YS6A 4X65B 2DHCA 2R1UA 1JVNA 4O2BF 5B1DA 3PXDA 4RF2A 1USIA 1T36B 3FR8A 1Y1SA 1UIRA 2FGJA 4QUKA 4WGGA 3TW4A 1YKFA 1ZCAA 3HKBA 4H7DA 4Y0AA 1ES9A 2QUKA 3D1LA 4EZIA 1PSZA 1K9SA 3NM6B 4G0OA 3BJZA 3QNUA 4AX8A 2YR0A 4IQFA 1YIAA 2VUTA 3FFAA 4NMLA 4PN3A 1EUQA 3T4XA 4EZBA 2FE1A 2ACVA 4L4YA 2LD4A 4BMNA 4QRHA 1ZM9A 2V96A 2O14A 2WT8A 2WUGA 3CNEA 1ZW1A 3BK1A 3NM4A 5F7JA 3MJHA 4BO1A 4LHEA 2HNKA 4XM2A 1I1QB 4RULA 4Y2QA 2GTIA 4AJEA 3RU9A 1P31A 1WO8A 2GD2A 2GN4A 5F9HA 1TK2A 2EZ9A 2DHEA 2R8PA 3D7SA 5IKPA 5KQLA 4JJAA 3T35A 3RHZA 1NJSA 1W4ZA 3NRCA 1NFQA 2IA5A 4HNRA 3WGYA 4FYKA 1G0NA 3W2TA 4WY2A 4CTNA 4MWGA 2WB2A 3NC0C 3THSA 3I1IA 2IBSA 2B92A 1QC5B 3TRJA 1IRXA 5IDYA 3ABSB 3DZ8A 5EJ8A 4RFSA 4YIKA 3KAPA 3KOOA 4KB5A 5IWCA 5A4MS 3CPSA 3G7SA 1W48A 1PZMA 4FJ2A 1U8TA 4TVKA 2Y1GA 2AXNA 4MVJI 3RAGA 1Y9JA 4JEMA 4QJ4A 3AYZB 2N1BA 3DLPX 2WK1A 3A1SA 3FPFA 2ERYA 3LC2O 1MO2A 3BGWA 4HVCA 4NCIA 1XQVA 3FPAA 4MVJD 2FSUA 2PMBA 2R8OA 5EIBD 5HRAA 5MN4A 1UEIA 4V1CI 1C9NA 2A5LA 4ZKEA 4BQPA 4C21A 2I54A 1A5TA 4RKRA 4D8UA 4J0CA 1KYXA 2RGNC 1IIBA 5CNKA 4BO4A 4F9EA 2QENA 3UMVA 4KE6A 1RTKA 1SBIA 2D3TA 2IH4A 1C0IA 5TPZA 1V11B 1NDQA 3M6WA 4JC5A 4OREX 3TW0A 4IMPA 4TSFA 4H3VA 1B8UA 3CCFA 4ZXFA 3ZZ0A 3L7LA 4HLCA 4ID3A 1FDTA 5TT1A 3TPCA 1AZLA 1R3UA 3CG0A 2P2GA 3NBYC 4QLOA 5FD8A 5DNDA 5FUQA 1PJBA 4E5YA 1BVRA 2UYHA 3VR5H 3IJRA 5FWXA 1MAHA 3R74A 2FW7A 2OMEA 2DJIA 1J7JA 2AJ8A 3ON5A 1SOMA 2CVPA 3H8JA 3K94A 1I0ZA 2ZJ8A 3A3OA 3FMFA 4FSHA 4L22A 3TLGA 1V43A 4BNDB 3LNTA 3A9WA 1TKRA 1RKUA 4IGAA 3TSOA 2F8MA 1KKMA 2ZDHA 3F1LA 3OA0A 1PWHA 1UDAA 3OOJA 3TQIA 4C08A 4Y67A 3U4IA 4D26A 1ZG3A 1NC1A 1UXGA 4MYSA 1P80A 3K9FC 4TQ9A 4HEA6 5G4KB 3QEOA 1GV0A 1W93A 2VK1A 1XELA 1H85A 3PXUA 4XIJA 5A4DA 3HM2A 4IJMA 1BVYF 1MV5A 1ML4A 4I50B 2ZE8A 4YUYA 2YCBA 4NOMA 2VF8A 2WU8A 3QSYA 2XBMA 5D51S 2IEGA 1FNSA 3T06B 5DN9A 4BTVA 1TQ8A 4JUFA 4NEGA 4CKWA 5BWMA 2OXTA 1QIHA 4ZC1A 3PV0A 1KH1A 1JBKA 1JGTA 1OE0A 1UDRA 2I65A 2NO0A 2OT3B 2OTCA 3COWA 3Q11A 3VU8A 4B8YA 5JASA 5KPDA 2DBVO 2II6A 4DREA 1VP9A 3FDZB 2X5JO 4P34A 2ATXA 3LK6A 1GEGA 1GU0A 3SKXA 3TX2A 3AJ8A 3BZWA 4NBRA 4OM7A 2ODPA 3WV4A 4BQRA 3I8XA 4S1WA 2XAUA 1B16A 3SJCA 3H5WA 5C32A 2P1DA 1U28C 2X1HA 3EBLA 2MSNA 3F3KA 4LZAA 9LDBA 2AZTA 3T3PB 5TR9A 4LCBA 5FFNA 5JAQA 3FRHA 4DEXA 1RBYA 3PJFA 4M1WA 3TEFA 1TX4B 3FWHA 3ILVA 4M2LA 4UHDA 4Q15A 3HGTA 3PNBA 5AHKA 5A2QA 1NKSA 3SLGA 3VR2D 4LY6A 4RK7A 4XSVA 1W4AA 3KYJB 3TR6A 3IDQA 1AMOA 4GYKA 5IDXA 1WZCA 3OJLA 3E27A 1VQ1A 3RSQA 5K03A 1Y1QA 3H8VA 1UFVA 1I9GA 4GXNA 1EWTA 3Q7SA 4RJJA 5A0FA 1QXSA 1YBVA 3I09A 1X13A 1BGXT 2HNBA 4CUZA 3EIHA 2V58A 3OCUA 3OWHA 2XBLA 2DOKA 1FBNA 4G1EB 2JW5A 3AUYA 3L0BA 2QTMA 1WUKS 2VC2B 4MKZA 1WRBA 2H0RA 5AW7A 2NO4A 3OOSA 1XVUA 1Z7YA 2FVXA 3LOUA 4GBJA 3AF4A 4PLVA 3QPCA 4CM5A 1ULUA 4DJDC 3RS4A 1DLIA 3FKSA 1ZJ5A 2FETA 1N6OA 3E58A 3A1CA 1G18A 1RZ3A 3EDMA 4JWTA 4V0ME 3A58B 1Z82A 1PF7E 3OCWA 1KYZA 5E4TA 2E7ZA 3L7KA 4W82A 1GKIA 4W1RA 1SY7A 5I9TA 3VZPA 4RAQA 2I76A 1RPJA 1LF0A 2LP4Y 4O4LA 4Q01A 3KLNA 4AG3A 1G1MA 3FHJA 3QE2A 1QFSA 2QF7A 3MRVA 4F45A 2E55A 4KPEC 3BXZA 2VPIA 2AOWA 3DTVA 4OQEA 1N2BA 1RWOA 3IO3A 1JMVA 4L2IA 1HL7A 1KOLA 3RRNA 1TZCA 1C2TA 3SVLA 1T4CB 2GCPA 1S02A 2DE0X 1KQNA 1TVKB 2BR5A 1D3AA 4ZOLF 2BEVB 1AQ6A 1R12A 3U3DA 1YZFA 1E79D 1KI2A 2FPIA 3BMCA 3IAS1 4TMKA 2QU7A 2VBGA 5JHHB 3C7AA 3A9TA 3P52A 2H59A 3T5GA 1OX4A 3VO1A 4WGFA 3P20A 3EK2A 1GT6A 2X5NA 5DK6A 4GPD1 2OYRA 4B3JA 5BQPA 1SUSA 2PVCA 1OH7A 2B34A 2PHZA 4LFAB 1IAVA 4CLRB 1IWBB 1GN8A 5H02A 3TF5A 1OFGA 2BGMA 4AY6A 3JALB 1H2YA 1BXRA 2BR3A 3DBRA 3GJQA 1VG8A 2KLBA 3GLRA 4NIMA 1G8MA 3NPAA 3NHLA 3A32A 5EESA 1LS1A 4JZYA 5L6MB 1AK1A 4AS3A 2EQ5A 3WIDA 4CMJA 4A8JC 4M1MA 4ZGWA 5KB3A 1SKQA 3OCZA 4MI6A 3HUFA 4Z54A 3QEKA 1IUPA 4C0KA 3P0EA 2J3DA 3WVNA 1E9VA 3L1UA 4KQ6A 2WYUA 4DDUA 1RDFA 4B6QA 2WWYA 4IHAA 5F35A 4UE6A 5KSOA 1IG3A 4F97A 1QQ6A 1YZYA 4Q7QA 2HMVA 4NBVA 1XSEA 2R4TA 3HPRA 5TXGA 3U3RA 4D1YA 4MRMB 3K2QA 4I5FA 4DAEA 3ADBA 1MT0A 2VDLB 2FZ5A 3L6CA 4QTZA 3A2MA 3PQ4A 5JATA 3SYKA 2YMPA 2CYBA 3HCDA 3QVUA 1A3CA 3FJOA 2P91A 4LZPA 4R3NA 3QYPA 2GN9A 3NBAA 5JISA 1Z5VA 2QJOA 1ORIA 3AVPA 5DB4A 4PSAA 3DE5X 4C78A 3C5VA 3F5FA 4HBZA 4XIFA 3RD5A 3V8BA 1XB2A 2C92A 2PO7A 1C4OA 1U7UA 3Q3GE 3LC0A 4HGOA 4MUEA 4QHSA 3TUJC 3UAWA 3ZOZA 2QTWB 3DAHA 3WSWA 1MRNA 4HT3B 3NC4A 4B85A 2HEGA 1IEWA 1B15A 1Q6YA 2WFMA 1X7WB 2ZI6A 3BRWD 3DFZA 3KAKA 4KAJA 2WUWE 1A9XA 1SG9A 4NMHA 2XNHA 2GYYA 3WAJA 5ALZA 2FWJA 2J45A 1HWYA 4EG1A 1CZOA 2PSEA 3A6GA 3NYIA 3RVSA 2LRHA 1T15A 1LB1B 4U02A 1HG1A 4HCJA 1DEHA 5M04A 3OT1B 3U4DA 5F23A 1QFYA 5AM2A 1JZTA 2BEWA 3OLVA 4D56A 3KTAA 3NI2A 4CE6A 2CUZA 2O57A 1BEUB 1L9KA 3PKIA 1MFZA 4UUPA 2GX6A 4ZPJA 5FTNA 2GAOA 2D1SA 2PQMA 4ZIRA 3ZDRA 4Z2AA 2GPYA 2XNDD 5IANA 3NAQA 4MUXA 1RP7A 2ZJ2A 4ERNA 2WAAA 4XWWA 2W2KB 1TECE 1D2NA 3L8YA 3AW8A 3OPYB 4HN4B 5AESA 4RF5A 1JQ5A 1YS6A 2V8OA 3AETA 3OPMA 4FUQA 3ZJ5A 4TOIA 4FYHA 3DOUA 4BX0A 2D4HA 1Z6YA 1HLGA 1NAHA 3SXUA 4YAEA 3KFVA 3IDSA 2OORA 5CURA 3EGWA 1DX6A 2QNBA 3TXAA 2VUUA 3V7YA 4BZPA 5CCXA 1VTKA 4O3FA 1TT7A 2W4MA 4A23A 4Q12A 3TECE 3F78A 1U8AA 4L5IA 5CYPA 5HIAA 3GJ7A 2ESRA 1OH6A 2C95A 1WQ1R 4IZ6A 4YGYA 1ETHA 1J2TA 5A7HA 4DRZA 4L1KA 2CF5A 3EZ7A 4Y30A 2FQ1A 1JFLA 1AKVA 2XITA 5JE8A 4ZREA 4RVFA 2IT1A 4J4BA 5AXCA 5K3FA 1W75A 1DCMA 1M8GA 1RM4A 2VCEA 1SXHA 4JJ6A 4M88A 5GQSA 5G1OA 2YZKA 3E9NA 1D2HA 4FYXA 3THYA 1L6RA 2GBPA 1PFYA 2Q5EA 2XB8A 3F6SA 4RLSA 3DWFA 1NQVA 2AUTA 2H18A 3FYUC 4J1QA 4RENA 3T3IA 1KC1A 1YZHA 2F9MA 1N6HA 3G8DA 4EUKA 5K5EA 3U37A 2NYUA 3SYRA 4P7JA 3OQMA 2ZYSA 3NHKA 3WGUA 4IO1A 3EARA 4HDKA 2QLNA 3I1JA 1ZNYA 2B4KA 3OKAA 4Q4LA 2EKDA 2XDYA 4TKMA 2EQBA 1XRRA 4I1YA 5H3HA 4BZZA 1X3LA 3QVWA 5ES3A 1XYYA 2QE7D 1P4GA 1JHAA 1JXMA 1X2BA 4MUMA 1GTG1 1LXCA 1GLVA 4FLEA 5FUXA 3EWNA 1N5IA 2NPOA 1P4AA 2IH2A 1H93A 1O0SA 2A78A 3JRWA 3ZQUA 2VF4X 3BK2A 3K1ZA 3M89A 1FTWA 2YW9A 5F7OA 4J7CA 2GD6A 3VGJA 1PVVA 1EVIA 4J03A 3HXMA 3PX3A 2MMCA 3JARA 2J6BA 1OGJA 4DLZA 1GUDA 3R9XA 3MXOA 4CVNA 1TJYA 1ZWKA 1EVJA 2V6MA 5D5QA 4A2WA 3U7HB 4I1SA 4E2ZA 5G40A 2RH5A 1X7XB 2AN1A 4HFMA 4D9MA 5B3JC 4DWWA 4EGCB 2OC4A 5P8WA 4EO7A 4NZYA 4GOXA 2AK2A 1XFAA 3QVSA 1NI5A 1M2VB 4CCYB 2ECOA 2C0PA 3WYGA 4F2DA 4OA8A 1AKRA 3CINA 1H5UA 2YWBA 3HI6A 3LDHA 3RAEC 2WU3A 2I9PA 4I5IA 3VO2A 1BA3A 1MP0A 2EWMA 5FOSA 2BH9A 3ZJYA 3IDOA 3PPWA 4TVBA 5HIJA 4GQBA 4H9GA 3BB1A 3OEHD 4KNVA 3A3KA 5EHZA 1VE3A 3RRYA 2OK8A 3D4NA 4QXOA 4KREA 1E2BA 3U7QA 3KPWA 3C5HA 3MT8A 4RMIA 1IAQA 2QKYA 3J7TA 1ZX1A 3QY0A 4J8PA 1JG7A 2FCAA 1QHHB 4PTYA 4JI6B 3GF4A 3NDRA 3O84A 3VU9B 2BM0A 1N7IA 4LGCA 3CUUA 1XD2A 2ZBPA 1NXWA 1IK4A 1RU3A 3B36A 3DE4X 2G71A 3GAAA 3NORA 4LN1A 4PZZA 3PIDA 3T7EA 1N2CA 2XUZA 3ZCUA 3HKCA 1L4UA 4MLPA 3KU4A 4K6GA 3W6OA 4E1BA 4AJ2A 4QSHA 3AU9A 2XLCA 5IM5A 2R25B 3F3MA 4C4RA 2KJQA 2NU6B 4JSRA 4EFNA 3PFIA 1X87A 5C8DA 1K8QA 2J3MA 2W6MA 3K0KA 5JNRA 2IPAB 1LSJA 3IMFA 1C4KA 2IY8A 3L0ZA 5DTJA 2F4NA 1DJOA 1F2TB 4KXQA 3A2LA 4CQLB 1J09A 4CM1A 1Y4ZA 5KQMA 5DKFA 2ZEJA 4KDRA 4OQLA 4NNJA 1TQ6A 2VJMA 3WKDA 4BTEA 4E1VA 2JAQA 4IFIA 4WBSA 1DTSA 4CNBA 5EJ9A 1MR3F 4WFIA 5NULA 3PEUA 4RIFA 4WX2B 2PGIA 3O47A 2WMOB 5K7SA 1D1PA 4P82A 4WXEA 1G4UR 1Q84A 4LQDA 4POOA 1EBUA 1E9AA 1XU4A 3V9AA 1E3QA 1VA4A 1LSUA 4TVSA 1SXJE 3TZHA 1O2DA 4OXIA 1IJBA 1M7HA 3CZAA 3FNBA 3ILHA 1FVFA 4AJOA 3K70C 3REQB 1WPXA 4BASA 3X0DA 2VQSA 4AMVA 1U3GA 2G88A 3QP9A 1K7YA 4NABA 1OZHA 4CTMA 4OGGA 3R7DA 3B78A 1SG0A 4IJVA 3AEQA 1MU0A 3RYCA 3G9QA 5JVDA 1SZJG 1Z83A 1DC4A 3BHIA 3H16A 4DCJA 4XB1A 1A82A 3HB0A 4HEJA 6LDHA 5HKLA 1VKJA 2I0FA 1G98A 3E3NA 5ECGC 2YZMA 3QKWA 1MAUA 4D9NA 2PV0A 3WK6A 5JDCA 3GLFB 4TKVB 3NWJA 2NV6A 4DGQA 1WXIA 5LD2C 3HLKA 4IDQA 2G9QA 2ZZKA 4TRNA 1CW2B 4ERXA 4FP9A 2PQ2A 3A4TA 1AKWA 3DNFA 3ECCA 2J9ZB 2ZSKA 3Q7TA 5JC1A 2J7KA 5FADA 3WLSA 5DRYA 3U6KA 1QOZA 3EDYA 4CYMA 2CHGA 5LLDA 3KEMA 5A4JA 2NLOA 2V1UA 1UC9A 5HGXA 1UWKA 1AB6A 1WXDA 2G07A 1Z17A 3ET4A 3MPOA 4PQGA 4WH0A 4EW6A 4LVCA 2P6MA 2P9CA 4P84A 4MEBA 4L50A 1H1TA 2AF4C 4S0ZA 1W87A 2C04A 2CWWA 2EJCA 2OHGA 1D2MA 1M2GA 3E8MA 3NHPA 3UAZA 4C0SA 1BXRB 4EGQA 4PE5B 4D82A 2AN9A 5LBIA 4CCSA 2ZRNA 3AY3A 5I9IA 1BVHA 1PJCA 4MYCA 1A9XB 2PEYA 3C4VA 3UUGA 1LSSA 2CK3D 2H2IA 4K3UA 3UQZA 1YS4A 4W5NA 1ZIDA 5SY9A 3PDCA 4L75A 4K6OA 4TM8A 2PMDA 1PFUA 2B30A 3TQHA 4M55A 2VJCA 3IBYA 1R5NA 1JHQA 3RTEA 2ID8A 2UU9B 1T0IA 3LBAA 1LPBB 4QATA 1WXXA 3ZEAA 1RFLA 2WWWA 4DMHA 5BW4A 3THOA 2MYPA 3D2CA 1D6JA 4FIZA 1UUFA 3O8RA 3Q0TA 1BQ4A 3DOJA 3N0TA 4BVBA 2PH1A 4HNQA 1Q0LA 3JQBA 4RGYA 4IEEA 2R8XA 3TEJA 3K0CC 3OPYA 1H2ZA 2ZRCA 4L02A 3IKTA 4ITVA 1PDOA 5FUYA 4ZVLA 5IEJA 1SBYA 5IVDA 5H83A 5ADWA 5CDFE 1BWRA 4YT5A 4W7HA 1D1QA 1L5VA 3NO4A 1E0SA 4ZVPA 1FEZA 4R31A 5LZ8A 4YT4A 2FUCA 4LDNA 1DUIA 2X23A 3PITA 621PA 3QIAA 3ZXYA 4BFUA 1HEIA 3ISJA 3V4SA 1N1DA 3C0KA 2A9QA 4PX5A 1JHRA 1FSSA 3DGEC 3CF4G 3AZOA 1TTQB 3V8MA 4DWVA 3V34A 2J3EA 5BW8A 5JWRA 4BRWA 6GPBA 4G1UC 2O7NA 4DF3A 1RD4A 3LRTA 3Q3CA 2JEYA 3THWA 3V8NA 2QBYA 4UHBA 4X1IA 5LNK6 3P97A 3F5DA 4M22A 1SU7A 4Z3OA 1QIJA 3A4LA 1VGVA 2JIDA 3K1TA 2BMJA 3WLJA 3AKZA 3N5KA 3QLEA 3M3PA 2WTNA 3L4JA 3WK7A 1HURA 3E5NA 1ZH8A 4DQKA 2FN4A 3AOGA 4M87A 1Y8RB 3RVLA 3S4YA 4DV3B 1N32B 4R05A 3L8FA 1TKCA 1ADJA 5D1NA 1XTTA 2VVTA 3NALA 5D84A 4UULA 1NVVQ 2ZSIA 1JTFA 4DRXA 1W5AA 1USVA 4ANFA 1TUBB 3HP7A 2AG5A 3KL2A 2A4MA 4Y1FA 5IJ0A 5TMDA 4TWAA 3HNOA 5A04A 2X2OA 3E3LA 2G76A 4XYMA 3B6ZA 1FFGA 1P9NA 4KRYA 1ID1A 2XI4A 3G2QA 4KN6A 4B71A 2QP9X 2B7CA 3L0PA 3WJ2A 1ST3A 1KZ7B 3QKSA 4BGVA 3QWFA 4XVHA 5EE1A 2HADA 1Z15A 3DM5A 3AVQA 4XQ9A 4BCCA 3HFRA 3DWEX 1B6SA 5L9AA 1YDEA 2QRZA 4X7BA 3USCS 4JUBA 1T3TA 3FHTA 2QD1A 2J67A 3RSLA 3DBIA 1A8SA 2CXTA 4DQVA 5KC9A 3BSYA 4MNTA 3VJKA 4FS3A 2CBXA 1X92A 3NM5A 2BEUA 4M60A 3U7IA 1M1XB 4HWGA 5A9SA 4EYEA 4EJ6A 1GR0A 3G89A 4OSOA 3VVCA 4K81B 4OJMX 4EFKA 4NYIR 3FXAA 4JC8A 5GZ6A 1NHGA 3DH0A 3KVRA 5JU6A 3KVOA 3DLBA 1SCUA 2JHGA 3TLZA 2O5EA 1R15A 3HUUA 1ECBA 1G7TA 4NFYA 1HV8A 2P40A 2EF1A 3RVKA 3BMXA 1GLGA 4HDKB 1BXGA 1CDDA 1T5DX 3FHOA 4W63A 2IYRA 3G2OA 4M89A 2Q3LA 5DLYA 1Q22A 5LA6A 4A10A 5JLJA 1SUWA 4GP6A 5AKXA 5HS4A 4CXMA 1TU3A 3OUUA 4II2A 1KPIA 1TCBA 1RE0A 3AR7A 3OKFA 2V59A 3VMMA 1Z29A 4MARA 4IDBA 3VDXA 1JZSA 3PFNA 5JAOA 4J4TA 4M0KA 2W70A 2R6JA 4MWBA 1TA4A 2O2GA 1N2ZA 5EHQA 3BHNA 4HGZA 2HF7A 3G2PA 2RGCA 3Q6IA 1I9CA 4ND6A 5FIUA 1HDZA 4HHEA 4HQLA 2JZNA 1B76A 2B8WA 2NZXA 2VSNA 4J3JA 4TWBA 3B82A 3I0ZA 4O59O 2DBRA 4F5ZA 1BFKA 4B80A 4DAOA 4XPIB 1A76A 2GRJA 4UEKA 1E9DA 5F33A 3QVVA 1BOOA 2VRWA 3OTIA 3ZV6A 3G7UA 4EPYA 4F9FA 3ZHCA 2QD2A 1YACA 3IBSA 3LSTA 2XVYA 5GVSA 5DYGA 2CZGA 3BAZA 3CNLA 5DWQA 2IVZA 5DCLA 3CHYA 2RI1A 3IP3A 1SVNA 1FUIA 1NZDA 3WNCA 2BE7A 5EKSA 1OKKA 2GHIA 2QT9A 4HMPA 4U5XA 1W36D 5FNVF 1HDOA 2J31A 1GFZA 4J6FA 1TZ2A 1JPJA 4IPTA 3RRMA 3ZNNA 1AURA 1KP9A 1VM6A 4QVKA 3RJ5A 4Q9LA 4ZCLA 4C4XA 2GO1A 4FN5A 4Q4AB 2QXUA 2R48A 1AM4D 1XZFA 1IHXA 3PPYA 3ZN2A 1KR5A 3P96A 1RAHA 1N2GA 2Q28A 1CUAA 2IEBA 3EA4A 4UPEA 2ZQYA 5AT1A 4PLZA 3WISA 3TBFA 4FTWA 1TC2A 1YVDA 2Z09A 5KHOC 2QY9A 4I3HA 1P7WA 2Q2QA 4UNSA 1QBKC 3GIDA 1OAOC 1QYWA 2N47A 2QPOA 3FOCA 4HEQA 4QO7A 1IJFA 1LQUA 2HRCA 4U63A 3WHKA 2QZ4A 3ZDEA 5T3UA 2KMLA 1J07A 3I05A 4TZTA 4DILA 3NOQA 3TVDA 4RWZA 1QIDA 1G6HA 3V4VB 1C3VA 1P62B 2R00C 1EFVB 2YFQA 3JRNA 4YJGB 1CUSA 4MUKA 1A2OA 3HCAA 1Y4DE 4P7FA 2A1IA 7ABPA 3AJ9A 2I3DA 3ZV7A 1NJ2A 2AX3A 1Q7CA 1F9AA 5HM6A 4D0GA 4D9EA 1UF9A 3GY0A 1POWA 5FX2A 5K0CA 4A26A 4HQ6A 1EFCA 2V4MA 2D5IA 5BMVF 4CEIA 3REGA 3HDYA 3FVTA 3GL9A 3HY4A 3L4BA 4OQ4A 3A9VA 2C5AA 4L27A 1ECLA 2AXPA 4JQYA 3D5TA 2G09A 1V16B 4JI4B 2P77A 4M1QA 1E1LA 1NULA 2RMKA 2JCXA 3FMGA 3JQRA 4QBTA 5IRCD 5BRNA 1JKJB 4KQ2A 3G8AA 1B2RA 2X0IA 3BB3A 3GLVA 1F2UA 4JCCA 4RS3A 3WO1A 3NWPA 1O0BA 2JVJA 3C7DB 2V8BA 3IHWA 3D8RA 2C3OA 4OQQA 1CUZA 3M34A 2FSVC 1AV7A 1CS4C 1RHUA 3DVAA 3L8GA 4XVCA 2L2QA 4NHOA 4YQEA 1F3LA 4GX5A 1G21A 4Q4HB 5KKAA 3SIXA 3PFCA 5J47A 4ZCQA 2DLCX 1DJMA 1JT9A 1NVXQ 3IB6A 3MWJA 3U3MA 3EIFA 1GNPA 2OORC 1KAQA 1JKXA 3SYMA 1CNEA 1O9BA 3R09A 3KXLA 4E6EA 4GSKA 2JBWA 4KX5A 3UPUA 1EZZA 1AA9A 1ZH0A 3MWLA 2JI8A 1D2AA 4BQNA 4ER0A 4GMGA 1JFSA 3C3PA 4X8LA 1EDBA 1NNSA 5JG7A 1XMOB 3OWOA 1V7ZA 2R60A 3O8OB 4MKFA 4Q82A 2YOFA 4D42A 2OESA 5EE0A 3I2GA 4UQLA 3O0DA 2G9ZA 1II8A 1Z8NA 4EIWA 4DA4A 2IYXA 1TRKA 3MMPA 1U2PA 2RC6A 1P9OA 2Z58A 1GQSA 1OI4A 1XJ5A 1AN9A 4QASA 4KFRA 5CLQA 5IVIA 3IMGA 4UEWA 4CTOA 3LUHA 5CCDA 2CLSA 1CJKC 1A5SB 4HAZA 3SU8A 2XA1A 3GVCA 2P9YA