3Q9UA

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
138
Chain Sequence
ATRPIDGLTDEGIRETLTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKIEVVDLFVNPAKAWRFVAYAIKKGAKVVWFQYNTYYPLAARQAGLIIVANRCMMREHKRLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
total genus 38
structure length 138
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q9uA00
3RUCA 1F12A 4TVOA 1A4IA 3R3SA 1EE9A 4U0JA 4DMLA 2GR9A 4IQ8A 4JNKA 4Z0PA 4RVUA 3R1IA 1E0DA 3DZIA 4PCVA 3PVZA 2NVUB 1Z6ZA 3TNLA 1YWGO 5T8KC 4B4OA 1ZCJA 3ICCA 3AM5A 4YTEA 3GFGA 2ZCUA 3S55A 4BMNA 4CLOA 1LDMA 1R37A 4RVDA 4MIEA 3JQ7B 3KYCA 5EJ2A 5THKA 2C07A 4XDYA 1DHTA 3H3JA 4TRRA 1U3WA 2OGUA 4ZQBA 5BNFA 2X0NA 4Z0TA 4QQRA 2UUOA 2O3UA 4LVCA 4PLCA 1JKJA 2Y1GA 1DC5A 2ZATA 2D0IA 4Q3NA 2C5EA 1GQQA 1OZAA 4RZIA 3E9QA 1X13A 5L51A 3S1LA 1P1KA 4CL8A 4OM8A 2ZB7A 4ND1A 3PZRA 1CETA 2AG5A 3RVDA 2C59A 4CM9A 2OBYA 3M2TA 5KJFA 4XIYA 1ZJZA 1PJSA 3W1VA 3ICPA 4H16A 1OAAA 1WPQA 5HA5A 5JDCA 3NX4A 5KKAA 5HBRA 3TRIA 1GV1A 3FI9A 2HJSA 2HMWA 5B4UA 3QSGA 4BNXA 4UUOA 4IDBA 3HUDA 4DQXA 5COBA 1Y5MA 1O9BA 2NUAA 4EBFA 1VE9A 2WMDA 4Z9FA 2VUTA 4YJGA 1PZHA 1AE1A 4BB6A 2VCYA 3LC7O 3I5MA 3VH2A 3RUIA 3FWZA 4XA8A 4B8WA 1FF9A 4YBZA 1PGNA 1J5PA 2G17A 1CRWG 1DIBA 1I24A 4LW8A 4TZKA 1KIFA 3JYOA 3GEGA 3MEQA 2QHXA 3HHPA 4IGEA 3JQCA 3UVEA 1JN0A 3NYWA 3AI1A 4DLAA 5H81A 3C24A 1XHLA 3JQGB 4XB2A 3W6ZA 5TGDA 1PR3A 4PG4A 5L7YA 4MIYA 5F1PA 1N7HA 5FFFA 4FSHA 4NR0A 1OFGA 3BMOB 7MDHA 3OM9A 3RKRA 1BVUA 1F14A 3CXRA 2NLOA 4FBGA 2O3SA 2DT5A 1MXHA 1Y8QB 2OZPA 3L9XA 3SJUA 4E2WA 3LZ6A 1UP4A 4A7PA 1LRLA 5JPIA 3A4VA 4U8GA 2PZKA 3WBFA 3HB4X 4IY1A 2HK7A 2Y1FA 3V2GA 5DBGA 4BO0A 4YRBA 3K8ZA 3PRJA 3PJDA 4R69A 2VYNA 4FJ0A 3MJSA 3KRTA 3KYDB 2E49A 1H2HA 3DBRA 5IZCC 3H4VA 4HV4A 2R2GA 2AE1A 2NVWA 5T5QA 3AUUA 4IZHA 2AQ8A 1P31A 3ANNA 3UCFA 2JFFA 3P2OA 4QUKA 5G4KA 2PNFA 5BNTA 1HE5A 2HMVA 1VJ0A 3L6EA 1D8AA 1Z73A 2GERA 2ZIZA 3ENKA 4GBJA 1X1EA 3PWSA 4NHEA 4NU5A 5HM8A 2OP0A 1ISFA 4KMSA 4QX6A 1QLHA 1PEDA 2JAHA 5IAAA 3WYEA 3AU9A 5CDUA 4EJ0A 1ISHA 3BTOA 3ZHBA 2C7VA 4L4SA 3AUSA 1Z82A 2IYOA 3VKUA 5DDIP 2NVUA 3W4KA 2E82A 5KJCA 5BSHA 1HE3A 4BIIA 1GEGA 3INGA 3ZWVA 3I9JA 4II2A 3M6IA 4NBUA 4EUHA 1N1GA 3CPSA 4AJNA 1V6AA 3OEYA 1YQDA 3EVNA 3L07A 3JQ7A 2GZ3A 3E9MA 4W99A 3GG2A 2Y66A 2HAEA 3VDRA 1E3EA 1PQWA 2DFVA 4FOSA 3KSZO 5IDYA 3F4LA 5KVSA 2NSDA 2FPPA 4CMHA 1ID1A 4EYEA 1EVYA 1SB8A 1RWBA 1GEEA 3WICA 4E30A 3K96A 2VZ8A 4XWYA 1P3DA 4MVJA 3FWNA 4AJ1A 4CQLB 2WM3A 4R16A 5JLAA 3JYQA 1SO8A 5I9NA 1HSZA 3NGXA 4OOFA 4R01A 2IRWA 2IZ0A 5CG1A 3RD5A 2X23A 3GFBA 5DN9A 2YDXA 1GADO 4DMMA 2GF2A 1PIWA 3PPIA 2WD8A 3CH6A 4QT0A 5EMHA 2P9EA 5TJ9A 2P9CA 4DPMA 5JYEA 5F1KA 3HNPA 5T6BA 1A7AA 2PY6A 5K9ZA 5GZ3A 3HB5X 4RVGA 1UP7A 2CDBA 4YRAA 4M8SA 3MJ4A 2OUIA 3IDSA 1LSJA 1KBZA 1LQTA 1GUZA 4N18A 3MOIA 3FRJA 3LF2A 4HWKA 2YV2A 1K6IA 3PFWO 3RFVA 4DQVA 2FWMX 1W6UA 1JDJA 2QYTA 4WPGA 2AQHA 1BXGA 4OIMA 4OJNA 4E2YA 4TROA 3O8QB 4F46A 3UAGA 5GMOA 4ZVVA 3JQGA 3QQPA 1QSGA 3FCOA 2Q45A 1B0AA 4NZ9A 3BMQB 1E3LA 1QYCA 2JAPA 3RSHA 4OOEA 2FR1A 5A5EA 4YR9A 4NBTA 5CPFA 3BMOA 2D3TA 1W73A 4L76A 4M49A 3HDQA 2B0JA 1F17A 5KVVA 1IE3A 1T1RA 1Y8QA 4FFMA 1VKNA 4RF3A 1NFQA 2NADA 2GN9A 3ROQA 3PTZA 3MJVA 4B3HA 4BNTA 2Q50A 1HSOA 4OH1A 2B37A 3GVPA 3FR7A 1FDUA 3GRKA 2E6UX 3LQFA 1MG0A 1PGOA 4CMEC 1ZK2A 1CYDA 4BNUA 1W4ZA 1PJ4A 2UVDA 3K2BA 3WJAA 1JLLA 5C5IA 4ITUA 1ARZA 1U5AA 1X14A 3PJFA 3ASUA 3JQ8B 1IHYA 2PZJA 3ZGYA 3JCZA 3ZWYA 5F1OA 1B3RA 3PJEA 1I3LA 1Q0QA 5TQVA 4CLEA 3L77A 3OH8A 1Y81A 3DMYA 5EESA 1BHSA 5JDIC 5AXCA 5IFLA 1E77A 2J6IA 3VAZA 2O3RA 3IUSA 5IN4A 3QWAA 4RVHA 3X2FA 1UXHA 5FEUA 1IPFA 3HFGA 5IXYA 4FOOA 2PKRA 4ZQHA 2B69A 3F9IA 4KWHA 4XJSA 5A06A 4P4LA 4IDAA 1Y7TA 4AJKA 5ILOA 4HFMA 2HRZA 3M2PA 2WE8A 3ONFA 2W2LA 4R51A 1ZNQO 4YT5A 1Z45A 5T8KA 4Q39A 4O0LA 1VPDA 1X1TA 3ZHYA 3DO5A 5BNIA 3IIEA 3A28A 4WOKA 2NWQA 5G0SA 1UH5A 5KJEA 2GCGA 3KETA 2CDAA 4II3A 2DUWA 4DLLA 4KUEA 3PLRA 3BHIA 3WFIA 3PHHA 2J8ZA 1I3NA 2D2IA 1EZ4A 3GGGA 5ILGA 3TPCA 1ONPA 4M87A 5TLSA 1XR3A 1P45A 3JQAD 3FTNA 4LMRA 3QWIA 4AJHA 2CVQA 3NT4A 4ALLA 4CQLA 1UDAA 5L7WA 2PLAA 3DOOA 1VKOA 4O1MA 1XGKA 3JV7A 3EW7A 4BGVA 1GY8A 3ZN2A 1LBEA 1T4BA 3TF5A 4Q3DA 3AK4A 1CJCA 4BO6A 2NACA 4EDFA 4CV2A 1HZJA 2DQ4A 2OFPA 2EG9A 3LDHA 3I9LA 3KYBA 2ZYGA 1EFKA 2HLPA 1LU9A 4LMPA 3VKVA 2FOIA 2P9GA 4PZDA 4BNHA 4A27A 1Y1PA 5B4TA 1K6JA 1C0IA 1NQAO 4MDHA 5A03A 3WGQA 4CLDA 3GVCA 4KTTE 1HLDA 4PVDA 1K5HA 1NXQA 3NTQA 3JYLA 1RYDA 1H9BA 4HKTA 2CNBA 1P74A 1V8BA 1ZH8A 4LSWA 1I0ZA 4CMGA 4AJLA 1WW8A 4I08A 3O8QA 2BHLA 1K0UA 1T24A 3DTYA 3WB9A 3BMQA 5TS3A 5L45A 1C14A 3KUXA 2J3IA 4PRKA 4XGIA 4CQMB 1KC1A 3Q3CA 1I36A 1CEQA 4DQUA 1Y8RB 3GF4A 4CM4A 1NAHA 3BTVA 3GZ4A 5I7EA 4GLLA 2Q1WA 3PHJA 1E7QA 2I67A 4LVUA 4ND5A 5TNXA 1EE2A 1G0OA 2TMDA 3BAZA 2HMTA 4XEHA 1ULUA 4J1QA 1LSSA 1KOLA 4Z0HO 4G65A 3AY6A 3RJ5A 4CMJA 1UP6A 4D3SA 1ZK4A 2YY7A 4CMBA 2GDZA 4QEDA 1U2DA 2Y0EA 3VZQA 5IZCA 1UAYA 3JQ8A 4NJMB 1MXFA 3CMMA 3RU9A 3ZI0A 3ZWPA 1D7OA 1R66A 1XKQA 3TZCA 3QA9A 1H93A 3KSDO 4FC6A 4K6FA 4AJJA 1HLPA 1VJTA 1A7KA 2Z95A 3WS7A 5A9TA 3FBGA 2X5KO 4FFOA 2YZ7A 2V6FA 3RQSA 4OSPA 4ESOA 5KKCA 2Q3EA 2C20A 3OIDA 1PL7A 2X7HA 1A4UA 3M1AA 1U7TA 1XSEA 5DZSA 4TMFA 4J16A 3TN7A 4IJKA 3PQFA 3GHHA 1EK6A 3EMKA 4MP3A 4E5KA 2DM6A 3E5RA 2YQ4A 1HDGO 4FCCA 4ZQFA 5LC1A 4D3DA 1I3KA 2JHGA 3E5MA 2VT3A 5JY6A 1GAEO 4J7CA 2VWHA 3ZU3A 4L9RA 1NR1A 1RPNA 2ZTUA 4WCFC 1RM3A 4H7PA 1SPXA 2Q2VA 4BO1A 5K6AC 2DLDA 3WDSA 3UCXA 4I9NA 2XF8A 1P33A 4DC1A 1I2CA 5ENVA 3QY9A 5KCZA 3CUKA 1N9GB 2BF7A 3ZHZA 1R4NA 5A9RA 1DPGA 2JD2A 2R00C 3E82A 4NFSA 3ZU4A 5JXWA 4OXNA 1JQBA 1MFZA 4DTIA 4YB8A 4PG8A 4ND2A 2CF5A 1Z75A 4PLTA 5L95A 3FHLA 3QVSA 3AU8A 3DZHA 1GYRA 4I9UA 1I2BA 3GDOA 4MKZA 3AOGA 4GPD1 1NHWA 3Q2IA 3KTDA 3OQBA 1KETA 3EDMA 5BSGA 1JU9A 2Q99A 4E0BA 4D79A 1SNYA 3CKYA 1DXYA 3D3WA 1DJNA 4UEJA 4A03A 1TI7A 3F46A 1GTMA 2HDHA 1RM0A 4F45A 2BI7A 2O3QA 2NU9A 4PLHA 1S6YA 1GZ4A 3GUCA 1YGYA 2CMDA 4OAQA 3UH1A 3CEAA 4DLBA 3GOHA 3VTZA 2PKQO 3QLJA 4YPOA 2EIHA 1X7HA 3DZGA 4WK6A 3DAPA 1RJWA 3INRA 1CQIA 3IOYA 1YQGA 4YEDA 5GY7A 5FF9A 4DPLA 4R68A 5L3ZA 4JP3A 4L74A 2ZQYA 3VTFA 3T4XA 3MZ0A 3RCBA 4XYLA 5MDHA 4DIFA 3VC7A 4A2CA 1P1HA 4B3IA 4CQMA 1BDBA 4J4BA 3DQPA 1BXKA 1EDZA 2C2XA 1KVRA 2HSDA 5C7OO 3OJFA 4RDHA 4K26A 4MP6A 4CLRA 5BSFA 3PIDA 4J9UE 4KTVE 4WNIA 1DOHA 3EY4A 3NEPX 4Q3AA 5F21A 1E7RA 1QXSA 1NYTA 2F00A 1TB4A 4PLPA 4PLZA 2D1YA 1N1EA 2X9VA 4FDAA 4BHTA 2PGJA 1LDGA 2JFHA 1GU7A 4JN6B 3WNQA 2CVOA 4ZD6A 3NT5A 3UGKA 4BV8A 4DL9A 3C1OA 2I9PA 3V1YA 4OO3A 3C1TA 3T4EA 3S2FA 4CMEA 1WVGA 3O9ZA 4NMHA 4BNMA 4E5PA 1QORA 4IDCA 2Y1OA 2HJRA 3GDGA 2VTDA 3AW9A 4JGBA 1D4FA 2C82A 4OGWA 1E7MA 1V3UA 3DAGA 3U4CA 2O4UX 3WGIA 1WZIA 3IC5A 2J5RA 1WZEA 2GN8A 4ID9A 3STHA 4NK4A 3LLVA 3I4FA 5JDIA 4OKNA 4PLFA 1JA9A 2GYYA 4MVJI 4YJHB 3BTUA 4GGPA 4S3MA 4D0SA 4CM1A 3E48A 4MVJE 4RPHA 4YWJA 4BVAA 4IGFA 5EERA 5A04A 1T2CA 1LC3A 1E3IA 4Y9DA 1O95A 1E7YA 2ZYAA 3O03A 4Y6SA 1SEPA 1WNTA 3E03A 4IMPA 4J1TA 4XYBA 2EW2A 1S7CA 2Q1UA 2YW9A 4MKXA 4O63O 3ZDFA 4EW6A 5IDWA 5ES3A 4XKJA 4NG5A 5JCXA 3UFXA 4FFPA 4C7KA 3PQEA 4G2NA 5KVQA 4YT2A 2VHWA 3TZKA 1Y9AA 2ZQZA 4FS3A 4WCFB 4CLHA 5KOIA 4RV9A 6LDHA 4AFNA 2GRAA 3LU1A 1DC6A 4FJ1A 3OIGA 1DRVA 1N9GA 3G49A 4OQYA 4NQZA 4K28A 4ZJUA 2JHFA 4BNVA 4HY3A 3JQDA 3L4SO 4CM9D 4XQGA 4HNGA 1UDBA 2OL4A 3DWFA 4J2OA 5JW6A 1EMDA 3WMXA 5DBFA 3C3XA 3ETEA 3WWYA 3TJRA 1HEUA 3HG7A 2CZCA 2GN6A 4BL5A 3S2EA 2BRUA 3KBOA 2FN7A 4P4GA 1HF3A 4JIGA 3E1KA 3TWOA 3QHAA 3WBBA 2FPGA 4GMGA 3WMWA 4EJMA 2NTJA 4ZU3A 1MB4A 3EK2A 3PDJA 1SMKA 3LC1O 2A4KA 2NM0A 2VRBA 4EEZA 4FJ2A 4NNJA 1E6EA 1PS9A 2H1SA 3WTBA 5JAIA 1X0XA 2DU8A 2XAAA 4OYRA 3B1KA 2GASA 4OHUA 5HS6A 3BXXA 2V7PA 4P22A 4PZEA 1V3VA 3DONA 2P5UA 4ND4A 3TL2A 2VNAA 2EEZA 2AMFA 5COQA 4BNZA 4RLSA 2IEBA 4K9DA 2QW8A 4JROA 3WGZA 8LDHA 3ZWBA 2J3JA 2DTXA 4XQEA 4D46A 3PJGA 1VLLA 1RYEA 3H5NA 3OJOA 3RBVA 4WASA 2RCYA 3IJPA 2H6EA 1JTVA 2HQ1A 1ISMA 1U7HA 1LLDA 3ANMA 5HWSA 3ZU2A 5LDHA 4BO7A 2GSDA 3WR5A 1I33A 4DRYA 2VYND 1ZXBA 4JP2A 2ZYDA 5AOVA 5G4LA 2AEJA 3GN1A 3FF4A 3P19A 3I52A 5ITWA 3D4PA 2Q4BA 1MV8A 3INTA 3DB2A 1BDMA 1M67A 2D5AA 4R3NA 1Q2XA 1I8TA 3L4BC 3ZU5A 1IYZA 3H65A 1GD1O 3UOGA 4GKVA 3AI3A 4J43A 2WSBA 4B4VA 3H7AA 2EJWA 3IKTA 2EP7A 2B5VA 5HS4A 4GAEA 1X7GA 4YJHA 2UAGA 1YQXA 4BGIA 5KJ6A 4FC7A 1DFGA 1NASA 4U6QA 2ZB3A 2BGMA 3KEQA 5LDGA 3PIIA 5DBIA 4E5YA 5T64A 4KP7A 4CM3A 1VJ1A 3O38A 3B1FA 2FSVA 1E5QA 1SOVA 3GMDA 3JQFC 3BHMA 3W8DA 1MC4A 4W7IA 5TC4A 5J23A 1NPYA 3QJ5A 2O7QA 2VYVA 4ZA2A 2Q46A 3TZ6A 3EZYA 3FSRA 3GQVA 2X0IA 5EN4A 1R0SA 3ZHXA 4GMFA 1LDEA 4HP8A 5B1YA 2Y0CA 3QWFA 5CHEA 4LRSB 4RVFA 4WCFA 4QFDA 3I9OA 4E12A 5K6AA 4QFCA 4UVHA 3PGXA 3PYXA 4CV0A 1HL3A 4MVJD 4UUMA 4AVYA 4C4OA 2PZLA 2I99A 1B26A 3NDJA 4O5OA 1TT5B 2YDYA 1C3VA 5TT0A 1E92A 1EBFA 2XPCA 3DBHA 4BMVA 5TIIA 3DAFA 3I4CA 2R00A 3ADPA 3UXYA 5A5FA 4RLHA 3KEOA 1QV7A 3NKLA 1BG6A 4CUJA 3GNSA 4JX8A 3WJ7A 3MCVA 1I10A 4L73A 3KO8A 2VWPA 4GH5A 1ONOA 2YV3A 1ZK0A 3W8EA 1UXJA 1XEAA 1BTOA 2DTEA 5IF3A 3CIFA 3QRWA 2CF6A 1CF2O 3S2GA 2DAPA 3DBVO 3S2IA 4W9NC 2CUKA 3QE3A 3VZRA 1RM4A 5EQFA 1A5ZA 2UV8A 1PGJA 2HKIA 3ORFA 1HE2A 2H9IA 3H3FA 4KUHA 4ONEA 1LDBA 1EVJA 2D4AA 2IZ1A 1JWAB 1M6WA 2I76A 2VHYA 3C8MA 4R3WA 2J3HA 4FFRA 3OFSA 1GPJA 3OJEA 4A26A 1AN9A 1J0XO 3LK7A 1XQ1A 4WJZA 4CM8B 4GKBA 1Z7EA 1ZSYA 4B7CA 4JLWA 4IBOA 2C7GA 3ASVA 1AHHA 5CDYA 3V1TC 2RHCA 5ER9A 3D64A 4TKMA 1DAPA 1EUZA 1QP8A 1EQUA 4W4TA 2OOSA 3MTJA 4RF5A 4AJPA 1PS0A 4ZHSA 2O50A 4KDEA 4Y8VA 3NTRA 2B4TO 2HK8A 1N92A 3Q1LA 2VOJA 4YT8A 2PGLA 1CIVA 4BKOA 2VTEA 3C85A 5IZ4A 3H9EO 2DVMA 3DOJA 4QXMA 4J90A 3W6UA 2FHSA 1BXZA 2BD0A 2PFGA 3FNGA 3R6DA 3ZWOA 2D59A 3D0OA 3NDRA 3RUAA 2VN8A 3WX0A 1M76A 2VZ0A 2OMEA 2DBVO 3C1AA 3C7DB 3HDJA 5TSDA 3E9NA 2A9FA 4HFNA 4W82A 4TRMA 4BKPA 3MJTA 1HKUA 1KVSA 2OORA 5ADHA 3OECA 3F47A 1R6DA 3U49A 1TLTA 3U5TA 2BFPA 5JAQA 4B7UA 3OBBA 3DZBA 1F8FA 4GX0A 1JWBB 3AUAA 1DIGA 3ZW8A 3NJ8A 2DBQA 1C0KA 4RPKA 3Q9NA 2OO5A 1J6UA 3PGJA 4WUVA 5EIOA 3WGGA 2W2LD 4CV1A 5KIAA 4U7WA 1DIRA 1C0LA 2CD9A 1ZSVA 1IB6A 1EEHA 1XWFA 3F6YA 1N5DA 3ZV5A 4CMAA 1E6UA 2J5KA 4XRRA 2EWMA 1BSVA 3GY0A 3DDNA 4N5MA 3F4BA 3UHAA 3WSWA 3ZH2A 2EF1A 4E4YA 1QG6A 1PQPA 5I9LA 2QIOA 2EJVA 4GX5A 3QVTA 3KYDA 3QWBA 3OEWA 5CDTA 4R41A 3ROKA 4PLVA 3JD3A 1TT5A 2YV1A 1KEUA 1B8VA 1ZSNA 2QZZA 4J2HA 4R1UA 1R0KA 2EXXA 2I3AA 1A72A 4NH4A 4AJEA 2AQKA 2IE0A 1MX3A 4XR4A 1LNQA 4RGBA 4J0EA 3PK0A 3RC2A 1WLYA 2PD6A 2I66A 4WLVA 1PJCA 1HTBA 5IDQA 4J3FA 1NHGA 1O6ZA 1SCUA 3TSCA 4Z9XA 3GHYA 2NU6A 4MVJH 4AJ2A 3GGOA 6ADHA 1NAIA 3DZJA 3VPGA 4URFA 3GMSA 4TSKA 4CUZA 4ZQGA 2QQ5A 2DTDA 3OSUA 4FGWA 4ZN6A 4D41A 2HU2A 2NV6A 3SX2A 5IN5A 1NNUA 3PLNA 4R5MA 1CWUA 1E1MA 2A94A 3GDFA 3GR6A 3P2YA 4J4TA 3KVOA 2EW8A 2BFOA 4BO5A 2BKAA 2ET6A 3VH4A 4DVJA 4UVGA 2JKVA 3H5RA 4TVBA 3TFQA 1EQ2A 3G0OA 2TMGA 3CINA 4CPDA 1SAYA 1B8UA 3V2HA 3HJAA 4BO3A 1YDWA 1V9LA 3AI2A 3WGTA 4DWVA 5JYDA 5BT9A 2Q1TA 1DLJA 3D5TA 4CM8A 3JQEA 1E7WA 1LDYA 1GUYA 4L75A 4LISA 4UVDA 3M1LA 1EDOA 2YHIB 1XELA 4Y67A 2SCUA 3EZLA 4KZPA 4Q9NA 3RI3A 5DCWA 1E5LA 3OA2A 3DHEA 3OF2A 1ISGA 4RF2A 2E4AA 1PJQA 3BHJA 1Q7CA 3QVOA 1LEHA 2QG4A 4MIOA 4XDZA 4BMSA 1JKFA 1P1JA 4EI2A 1DIHA 4QTZA 3RC9A 1ZK3A 4JJGA 1TVEA 4Y6RA 1W0CA 1GQ2A 1VL8A 5KVCA 1H6BA 3L4BA 4XYMA 5L4NA 2P4QA 2Y67A 1ADBA 4EUFA 2W2KB 2H5LA 4IUYA 2VT2A 1SZJG 4IS3A 4E31A 1B16A 2YUTA 4WLFA 2E37A 5HRUA 3PI7A 5DULA 3UICA 2B4RO 1A9YA 1N8KA 1MP0A 1U4SA 4PFJA 5JO9A 4M54A 3K5PA 2JCVA 1R4MB 3JD1A 3B70A 3GEMA 2LDBA 1M66A 1BVRA 1U2GA 1VSUA 3JQFA 4FFLA 4FW8A 1MGOA 3IS3A 3NV9A 1YB5A 4XD2A 2IXBA 1HWYA 2V6GA 5CDGA 5THQA 1XLTA 4P8RA 1GZ3A 3RASA 1F8GA 5JY1A 2B35A 3EC7A 4CM5A 4Z6KA 3IKVA 4UEOA 1QKIA 3MJEA 4B4WA 2X4GA 4OL9A 1GUFA 2C0CA 4J9VA 1OBFO 3TL3A 5IXSA 1E3WB 2HUNA 2PGDA 4J7UA 4C7JA 1U28A 2AEMA 1KERA 2ZB8A 3G1TA 1U3TA 5CFZA 3R3JA 1YBMA 3DBLB 4KDFA 4XYGA 4CJXA 3OJLA 4DIBA 4AG3A 3HSKA 1PWXA 1IZ0A 1ZK1A 4K6CA 2JJYA 1YS4A 4ROSA 3BYZA 1EFLA 4BO2A 5DP1A 3WSVA 4FB5A 2C5AA 3AY3A 3DFZA 2QRJA 1ADGA 3ZNOA 2FR8A 4CMCA 1ISJA 4NPCA 4NBVA 4YJFB 1YBVA 4LN1A 1P1FA 4WCDA 1Q1NA 1ZFNA 5H83A 1J4AA 2PH3A 2QRKA 3HADA 4BKUA 4FIZA 5C7LO 4YRDA 3AWDA 2PA3A 1VL0A 4OXYA 4W9NA 4PLGA 3T7CA 5MGBA 5JAMA 3F5QA 2VZ9A 2VOEA 2DBRA 3AM3A 2G82A 4CLXA 1KEWA 3GN2A 1E3SA 3RKUA 1HRDA 1NPDA 2YFQA 3JSAA 1O8CA 2VWQA 4H3VA 4IMRA 1A27A 1JVBA 4E6PA 1HYEA 1ONNA 4XYEA 1ENZA 2DFDA 2X0RA 2WYWA 4LK3A 1UDCA 3VPFA 1YB1A 3FNFA 3ZCXA 4BO9A 1YH3A 3SJ7A 1W8DA 3V8BA 5BR7A 1YRLA 4CM6A 4RF4A 4CODB 3E8XA 3NTOA 2JCXA 3TQHA 3DL2A 1YO6A 2RIRA 4LCJA 3ABIA 3VPSA 4TRNA 5IG2A 1VL6A 3ANLA 4WE3A 4YYZA 3JYPA 3QP9A 3JYNA 5A02A 2O23A 3I9NA 3D7LA 1L1FA 2GO1A 2LDXA 1WWKA 2GGSA 2QYSA 4LSMA 2EP5A 3OETA 2RH4A 1FDSA 1U5CA 4I8XA 1JVSA 3WYCA 1KVQA 3RU7A 4DIOA 1QYDA 5FI5A 4E2XA 1AGNA 3W8FA 3DOCA 1H9AA 4OSOA 1VC2A 2EKPA 4IPTA 5TRTA 3AY7A 4DBVO 2QRLA 4YVFA 1H5QA 3I23A 5JMPA 3IP3A 2ZCVA 2F1KA 1GDHA 2ZJ1A 1DSSG 3ONEA 5T57A 2HK9A 2AW5A 1DLIA 1LXCA 3GPIA 3JD4A 4OKIA 4Q3CA 2C54A 4WKGA 5GZ6A 3SVTA 3U9LA 4HBGA 4GVXA 4I1IA 4YAEA 1M2WA 4E32A 1GR0A 3CE6A 1UXGA 1E1NA 3MTGA 4ZRNA 3G79A 3RWBA 3GEDA 3ZWWA 4D43A 3ZNPA 4DYDA 5JS6A 4IXTA 1R4MA 1Y8RA 1LTHR 4XCVA 4YT4A 5L4LA 4EGFA 2AHRA 1UZLA 3ZV4A 3HN7A 5ENDA 4P38A 4J7XA 1XYGA 2CSUA 1SC6A 4ZICA 4XJTA 2X58A 3K92A 3GZNB 1F0YA 3ZWMA 2B5WA 1KY4A 2Y99A 3DTTA 2RHRA 1P1IA 3HZZA 4ILKA 5JSFA 3HQ4O 3GVXA 1EBUA 4HNHA 1R16A 5CEFA 4GWGA 3ZWXA 4XB1A 4RPGA 1AXGA 3RUEA 1E3WA 3JQBC 3H9QA 4D0RA 3UW3A 3LT0A 4NJMA 4YAJA 4J1NA 1U9JA 2AG8A 4N54A 2CVZA 3DZFA 5IJZA 4PN3A 2UDPA 2EERA 3H9GA 3WXBA 4TQGA 2V65A 3FBTA 5C37A 1QMGA 1NM5A 3KZVA 5DOZA 3ROPA 4D7AA 1V35A 2VHZA 5DP2A 4HUJA 1I3MA 1L7DA 2JD0A 3QVXA 5EQDA 1ZBQA 2WDZA 3CZMA 1C0PA 1DO8A 4E3ZA 4BKQA 2NQ8A 4D3FA 1IOLA 5CG2A 4ALJA 2OHXA 1WXDA 3HE3A 4INAA 4D44A 3WIEA 3N74A 1PJLA 3JQ6A 2NU8A 5ICSA 3WGHA 1U3UA 5ITVA 4EUEA 1NVMB 1QYXA 3ETDA 1UXKA 3G3EA 4YJGB 2UUPA 1HDCA 2FR0A 2G1UA 3A14A 4BNIA 2IXAA 4IIUA 1VRWA 3SLGA 1NFRA 5CPBA 4DPKA 1I32A 2BGKA 1YDEA 4M55A 1PJBA 2IYPA 4N7RA 2J5QA 3VOSA 4I5GA 2FY8A 1ZMOA 3EUWA 3RJ9A 3WLEA 5I7SA 3DEYX 1Y6JA 4KQXA 1PGPA 4RQTA 4DBZA 3FR8A 3EAGA 5I7VA 1XCBA 3ZV6A 4PVCA 3VZSA 4UVEA 1DHRA 3HDHA 3LT2A 4DUPA 1RKXA 1ZZEA 3EHEA 3UN1A 1R0LA 2GN4A 3CTMA 3NRCA 4CMIB 1H6DA 3Q11A 4ZQEA 4CQMD 3PYMA 1T2FA 1GZ6A 3H9JA 1XQ6A 1YVEI 3VHRA 4QO8A 1HETA 3IQDB 3RFTA 3JTMA 3LF1A 3MOGA 4B79A 5A4DA 4EITA 1IPEA 2A92A 3PWKA 1NWHA 3AJRA 4JQCA 2PH5A 4N5LA 4BO4A 4CR8A 4BNLA 2C2YA 1P0FA 1YL6A 3I1JA 5U1PA 3GAZA 4NJOA 4YA6A 4EEXA 4CM7A 1SEVA 4PLYA 1NR7A 2P68A 5TX7A 1O89A 3BMCB 4IJVA 2PR2A 4Y98A 3UUWA 3VH3A 3FPCA 3K9QO 4K1LA 3WQRA 4F3YA 5G2OA 4GX1A 1UZMA 1FDVA 4Z3DA 4RPLA 1B7GO 5B12A 1UR5A 3VDQA 4KWIA 4DC0A 1ZKMA 1LA2A 1H2BA 1BRMA 4GSKA 1PSDA 1WAMA 3IJRA 1NBOA 3KLMX 4R4JA 4A10A 2VYVD 2ZTMA 4BNJA 1KY5A 2YYYA 1OC2A 1PQUA 3BIOA 4ZGWA 2WTBA 2B36A 3ZWNA 2CY0A 3ZWAA 2ZTLA 1K6XA 4MOWA 5CAEA 3GC6A 1C1DB 1YE3A 4W7HA 4GLOA 2ZTVA 5JCJA 1IULA 3GZNA 4P4NA 4XGNA 2X22A 1BMDA 1ML3A 3FN4A 4IDFA 2WYVA 1ZMTA 1QYWA 4GL4A 3WWZA 1KYQA 3OP4A 3SBOA 3NJ4A 4AICA 4HFRA 5TT1A 2O2SA 3QIVA 3LVFO 1ZEMA 3I3OA 2NU7A 3JD0A 4I5FA 3GAFA 1LLUA 4D45A 4M1QA 4U5QA 2E48A 3WNVA 1LSOA 3OIFA 4PRLA 4WGGA 3WOHA 1HDXA 1YB4A 4F6CA 1LLCA 1YOVB 3CSDA 2Y1EA 1XG5A 5COAA 1ZXLA 1NFFA 2EV9A 2D5CA 2PD4A 2X5OA 3WG9A 4BOYA 2AE2A 2Y0DA 1SOWA 3ON5A 2Z1MA 1ZW1A 4PG7A 4YCAA 1VSVA 3W4IA 1N7GA 1DAOA 1K3TA 1UAGA 4KQWA 2O3JA 5BQFA 3ZWCA 1BXGB 1WMAA 2GD1O 3JQ9C 5L40A 3K6JA 1YXMA 3I9KA 4R5HA 3KM0A 2OXIA 3RUFA 3X2EA 1QV6A 2VWGA 5A9SB 3H2ZA 4NU6A 4L8VA 5JMWA 4GSLA 4MPDA 1NQTA 4GX2A 4MVJP 4U6SA 5H82A 2FZWA 2VQ3A 4MVJM 9LDTA 1NTOA 4RPJA 3ST7A 1ZVMA 3PHIA 1I5RA 2BLLA 4H15A 1OOEA 4Z9YA 5IDXA 1OC4A 1YBAA 1A71A 4WLUA 1T2AA 1ZIDA 4IJWA 5U4QA 1I2ZA 1T1SA 2X9NA 1FK8A 1UZNA 1YONA 1DEHA 3L9WA 5DCYA 3IMFA 4BNFA 4CMIA 2P2SA 4UULA 4MVJG 3ROMA 3R0IA 2FRDA 1Y5RA 2YQ5A 2Q2WA 5JAZA 4BV9A 5GZ1A 5FWNA 1MA0A 4J0FA 1IZ9A 1Y9EA 4I9HA 4A0SA 3A9WA 3OQ1A 4Q3EA 3TZQA 1B8PA 3C7CB 1OI7A 3HWRA 4BO8A 2NVBA 4M86A 2IZZA 3QW2A 4IM7A 2J3KA 2X9GA 4TRJA 2BFAA 2EGGA 1E7SA 2DPHA 3DXFA 2P5YA 1UJMA 1X15A 3BMCA 3GG9A 2I65A 1I30A 4S1VA 3EGOA 2V6BA 1P77A 1T26A 3CZRA 1XIVA 3TZHA 4YACA 1VI2A 4OMUA 3RUHA 3FPLA 2V6MA 4FN4A 4RO0A 2VRCD 3GA0A 2Y1CA 3AM4A 1EVIA 1Q0LA 2NNLD 2BH9A 3SXPA 3U4DA 3U09A 3GVHA 4ALKA 3F1LA 1UXIA 2YHUA 3FNHA 4EZBA 5C3MA 3K30A 2VHXA 1JAYA 3V5NA 1C1DA 1F06A 1KVTA 2VHVA 1H6AA 3CMCO 2X5JO 1BWSA 3KSUA 4GVLA 1T2EA 1DB3A 4CMKA 2PK3A 1GV0A 3ADOA 4RORA 3O4RA 3COSA 4L4RA 5A05A 3WFJA 3LT1A 1T4DA 2G0TA 4NFHA 3SC6A 5DF1A 2ZB4A 3PFFA 4A73A 3KV3O 2FZEA 5A1TA 3IL2A 1FJHA 2GPTA 3LSYA 1IUKA 1DFHA 4PGFA 2EHDA 3JQBA 1ADFA 4PG6A 3NDIA 3I6IA 4J4HA 4M89A 3PHGA 2B83A 3V1UA 3L0DA 3DMTC 2IEDA 2VUSA 3O26A 3DR3A 4GWKA 1LRKA 3B20A 1AUPA 3BZUA 2PWZA 4DGSA 3V2UA 1PX0A 1YOVA 3D4OA 4BQRA 2YFHA 1ORRA 4BUCA 2AQIA 4UEKA 1E3JA 3HN2A 1DFIA 3K73O 3FTPA 4JBGA 4J1SA 1LQUA 5B4VA 1H0KA 4IINA 4B4UA 4YQZA 5EINA 2IODA 2VRCA 1EVZA 4QECA 1LSUA 1P0CA 1ZEJA 2VUUA 1QR6A 5K0ZA 4BGEA 3EVTA 4RQUA 2AEFA 4U0KA 5CEEA 2Q1SA 1DDOA 3Q0EA 4LRTB 4WECA 5JC1A 4UUNA 1K89A 3ENNA 4DXHA 3TOXA 4E2ZA 3RUDA 4O59O 1SBYA 3NAQA 2QX7A 2OP1A 5A9SA 1HXHA 1QYVA 2W4QA 1P1RA 3GT0A 2HO5A 2B4QA 3LT4A 5I8ZA 4WNCA 1B2LA 4FGSA 5DNAA 1R12A 1JAXA 4RVSA 3RFXA 3QWHA 1NVGA 3JQAB 3E18A 4IQGA 3WQQA 4CM4B 1D1SA 1HDRA 1YJQA 3WTCA 1WDLA 5G0UA 3P7MA 5L4SA 2OBNA 3PQDA 2JL1A 4RL6A 3GLQA 3ZNQA 1WDKA 1Z74A 1IY8A 4AJIA 1V3TA 3OICA 3GGPA 3PP8A 1DC3A 2G5CA 2ZJ0A 1KEPA 2X86A 1BGVA 3ITDA 3RIHA 5EL0A 9LDBA 4KOAA 3VPHA 4BNYA 5JNLA 3P5SA 3D5QA 2XXJA 1RM5A 4YAKA 1A9ZA 1HE4A 2Y68A 4NBRA 1FXSA 2HMUA 3U62A 3QV1A 4XX0A 2NQTA 2Y05A 5B37A 2W98A 4NBWA 3WIDA 4GGOA 1J49A 4QO7A 1Z7BA 1NPTO 1LX6A 3WQSB 3F1KA 4BNGA 4CUKA 1M75A 3FD8A 5JFOA 1I01A 2FP4A 3QVWA 5DT9A 1WDMA 2P91A 3PWZA 2WE7A 3I6QA 4ALIA 3ITKA 5AVOA 1O0SA 3DC2A 2BFMA 3AOEC 3GUYA 1T25A 3BMNB 4L0QA 5DOVA 5A3VA 5I7FA 5KWEA 4B7XA 1MG5A 1PR9A 2A35A 3GNQA 3PEFA 5CP8A 5L53A 4AJ4A 4PLWA 2BI8A 3ZZNA 4GQAA 1G1AA 5FI3A 4CL3A 5ICMA 4NI5A 1WP4A 2RH8A 1Q0HA 2YJZA 4JXKA 1GYQA 2Y1DA 5AQ1A 3ZNNA 1C1XB 3ULKA 1B3BA 4JBIA 5CEJA 3OA0A 1R4NB 2Q2QA 3GVIA 2DC1A 3HDYA 2UYYA 4E33A 2GUGA 3H2SA 3IUPA 3S8MA 3K2EA 2DPGA 2Y93A 1DIAA 4RDIA 4DYVA 2X6TA 2XOXA 5KNLA 1PZEA 3A1NA 1NWCA 4UREA 4IQ0A 1NVTA 2ILTA 1BW9B 2CDCA 1E1KA 3FNEA 4I5EA 4MVJF 4RCVA 4NK5A 1DJQA 4ALMA 1AHIA 1ZJYA 3GK3A 4R1TA 3IP1A 1WMBA 3D3WB 1VM6A 4J49A 4TWRA 2EGHA 2WYUA 5U9CA 3GNTA 4EJ6A 3SC4A 3EYWA 4YDRA 4ZRMA 1KS9A 3TFOA 3SLKA 1PJ2A 1JW9B 1E1LA 2GZ2A 4FD3A 1YJ8A 4YQYA 2EKQA 5AXAA 1GPDG 1G6KA 2X1HA 4PZCA 3RC1A 3JQ9A 4JBHA 1PZFA 3SEFA 4ND3A 1YL5A 1HDOA 3ZW9A 2Q4EA 3GH3A 4R9RA 4MJLA 2X0JA 4FQ8A 2GNAA 1U3VA 4IZIA 4NIMA 3JQAA 5FYDA 1GCOA 4CLRB 3KHUA 3Q6IA 3H5AA 2FPIA 1P44A 4R1SA 4W6ZA 3D4NA 4XQCA 1HT0A 1K2WA 3BTSA 1B14A 1NQ5A 1OMOA 1LI4A 1PGQA 5AXDA 3E6AA 5JDCC 2PKQP 4X54A 1DBVO 1X7DA 2WWRA 3LLSA 2ZKLA 3LYLA 3B6ZA 2JFGA 3KLPX 4G5HA 1XU9A 3VPXA 1IHXA 4MINA 1O5IA 3UCEA 4G81A 4WOJA 4YXFA 5JO0A 4TKLA 2FMUA 2I5PO 3PZBA 2HCTA 5HTOA 2AA3A 3F3SA 1GCUA 4MO2A 1TA4A 1MLDA 4NDNE 5KTKA 1R15A 2BMAA 2I6TA 3L6DA 4OXKA 4UUPA 1CQJA 5T67A 4XRGA 3PXXA 4FFNA 1LC0A 1YL7A 4CR7A 4WLEA 3WYBA 1EUCA 4Y6PA 2DKNA 4RZHA 1YKFA 3DZKA 2W90A 4WEQA 4FPXA 1Q7BA 3U4HA 4DA9A 4DREA 1U8XX 3LC2O 1HZZA 1MC5A 1ZO8A 3JD2A 2VNSA 4J6FA 4E21A 4YJDA 1PL6A 4PIVA 4D42A 3BMNA 4F6LA 1PU2A 2H63A 1DRUA 4UVIA 2X8LA 3A06A 4IDEA 1GFSA 2BELA 2GLXA 4N5NA 4Q3BA 5LCXA 1H94A 1EUDA 2YHIA 3TDKA 5L9AA 1ISIA 3C7AA 3H9UA 3AUTA 1PJTA 1EK5A 3RC7A 2WEKA 1GL3A 1C1XA 2WD7B 2PV7A 3N58A 5DCUA 5AXBA 4LGVA 5JC8A 5ER6A 3I83A 3NT2A 3MJCA 1MFPA 3MWDB 4A5OA 1SB9A 3W4JA 3D1LA 4BNKA 4BB5A 3B1JA 2NTVA 2O2YA 1PWZA 5G0WA 8ADHA 1PS8A 3VZPA 2Z1NA 3F5SA 5I8WA 2BGLA 3Q9UA 3WLFA 2POQX 3ETGA 3WGYA 1LLQA 1TEHA 3Q2KA 3UF0A 2D8AA 5JE8A 3AFNA 1BW9A 2DUUA 3VH1A 3N7UA 4Z3KA 2W2KA 1QLJA 2IDZA 3GRPA 1V0JA 3DMTA 3DHNA 3PYLA 5EPOA 1L7EA 4PG5A 2CFCA 5F3RA 4I5DA 4O6VA 1HDZA 1LJ8A 1X0VA 3PHLA 4E5MA 3AFMA 3NUGA 4LCEA 4WEOA 1XDWA 1GQYA 2JCYA 3G1UA 4CLOB 4BKRA 5JBIA 3KOUA 3KYCB 3RBZA 4XR9A 1ZUD1 2Q49A 3OHSX 2W8ZA 2O7SA 3GPDG 1LUAA 3ONDA 4BNNA 1HYGA 3PDUA 3UKOA 1T2DA 1GYPA 1ULSA 3G17A 4JCOA 1D1TA 3H6KA 2PD3A 1O94A 5KJ1A 4JJIA 4HADA 4IXWA 4NFYA 1E6WA 1LDNA 4R1NA 4UAGA 1MUUA 4J91A 3RAJA 1LRJA 1B15A 3ZV3A 2Z5LA 1PTJA 5A3JA 3DBLA 5TJHA 5F5NA 4XQ9A 1TT7A 4XIJA 3OMLA 2HMSA 3U4IA 1HDYA 4TZTA 3RROA 1QRRA 4QSMA 2R6JA 3DHYA 4IS2A 3VVBA 3MWEB 4JJFA 3OJ0A 2C29D 4HFJA 5G0VA 4BGUA 1KC3A 4B3JA 4GI2A 1KEVA 2O48X 4YAGA 2JD1A 4YJFA 2PZMA 1ENYA 3BA1A 4E5NA 3KXDA 4E13A 3IAHA 5F5LA 1IL0A 3OQ6A 3VVCA 4YAIA 2XXBA 1CDOA 5BSEA 4RJTA 2QZ9A 2ZK7A 4MP8A 2AXQA 1FDTA 4BQPA 2O4CA 4XZ3A 3K31A 1HYHA 4MKRA 4AJOA 5CDSA 1NQOA 1CERA 1P9LA 4WLOA 4B8ZA 3RBXA 1H6CA 7ADHA 1ENOA 1M6HA 2I3GA 1XA0A 4JK3A 5AYVA 4CV3A 1G0NA 1NX6A 4R9SA 4BS9A 1PZGA 1U8FO 2PTGA 5G0TA 4KUGA 5C7IO 1ENPA 2FSSA 4HX5A 4WLNA 1TXGA 2DBZA 3D3EA 3AOEA 2O3TA 1PL8A 3DFUA 1N2SA 1U4OA 1DRWA 1FMCA 3NGLA 3I9MA 4IJUA 1KVUA 1D3AA 1FDWA 4L4XA 4FR5A 2NTNA 5JCJD 1XU7A 4CR6A 2WD7A 4ALNA 2G76A 3TOZA 3U3XA 1PJ3A 2P4HX 1AXEA 2RBEA 2WJPA 1NP3A 3L6OO 3DBRB 4XGKA 1DC4A 4IDGA 1U1IA 4HXYA 4OQZA 2HRBA 3T7EA 4AL4A 5L7TA 3HFSA 2RAFA 3DBHB 3H8VA 3WGOA 4IIVA 4BNWA 4IDDA 1JKIA 1ADCA 5G4KB 4R54A 1UUFA 3U0BA 5I9MA 2EKLA 5TF4A 3KB6A 1Q7GA 2GZ1A
chains in the Genus database with same CATH superfamily
3RUCA 3AJAA 1N5OX 1EFUA 1W93A 4HEQA 1VB5A 4DMLA 1J5EB 3ZU6A 3QYFA 1YZHA 2X40A 3UC9A 2V7TA 3HKEB 3IFSA 4GR4A 4Z0PA 3V4SA 2AZXA 3R1IA 1SIUA 2NVUB 1Z6ZA 4L7QA 1KOGA 3TNLA 2X3YA 4LWQA 2QJOA 4RSHA 2FJUA 1YZYA 1U2RA 2RHGB 1F2TA 1VBMA 1NT2A 4CI0B 2ZIWB 1ZJ4A 4BX8A 4JLJA 2P78A 3GLRA 3NIDB 1R37A 4OP2A 3HA5A 3JAKB 2F48A 2GZRA 1O6CA 1KDVA 2BEVB 1OH6A 5EJ2A 3H9CA 3KYCA 4Y2JA 3HU1A 1XTUA 5HFNA 3QU9A 1L3CA 1R8YA 3FDXA 4KK4A 2QGFA 3NS7A 4TRRA 4AXXA 2NZJA 2Z2KA 4ZQBA 1QC5B 5KQPA 1XQWA 2X0NA 2XECA 4HVTA 4ZYZA 3JWGA 1C7ZA 5IVPA 1P39A 1T5BA 3GLVA 1CT9A 1JKJA 1UPUA 4LVCA 4RM3A 1QF9A 1VI5A 4P36A 2IY9A 5JWOA 4Q3NA 2ZT7A 4LNUB 1GQQA 3GFQA 1OZAA 2RI0A 1R6BX 4RZIA 1KDPA 1KO7A 3Q10A 4I4LA 3F2VA 4PC3A 3S1LA 3U3JA 1ONSA 4CL8A 5DGIA 3PZRA 4X8OA 1JXAA 2AG5A 3JALA 3RVDA 3H97A 1PSZA 3E7FA 1PBNA 1GP2A 3PC3A 3QLVA 4OQNA 5TVGA 2OBYA 3M2TA 2Z57A 3BE4A 4KXWA 4XIYA 4X00A 1VPWA 4I8DA 4OUDA 4H16A 4FHFA 3MWEA 1NC1A 4MMYB 5HA5A 2XUHA 4F1JA 4F5WA 5KKAA 2HSZA 5P8WA 4QUGA 5HM6A 3LCUA 4BVFA 1UJBA 4ND8A 4WWHA 5G1NA 1MEEA 2HMWA 2JIBA 1M5UA 2HYDA 5JSZA 2Z8YM 1UMKA 5KDLA 1XXHA 1KMQA 3HUDA 2P6MA 3HBLA 3O3OB 4O4JB 4COKA 5DM1A 2ZRJA 5COBA 2A58A 3DXXA 2NUAA 3Q8WA 1VE9A 4QDUA 5TPZA 4DCTA 5B3LA 3LC7O 1FDOA 1Y3HA 3WLIA 1XKTA 2WIAA 3H2IA 3LYUA 3ESRA 5CRIA 4G8DA 4BUJA 1PGNA 1N32B 2PPLA 3GW8A 4EL5A 3R75A 2YNMD 4LW8A 4DGQA 2CHUA 2XUJA 2QHXA 4IGEA 4Q9KA 2DWCA 3JQCA 3PQ2A 3UVEA 4DJFC 3UZUA 4HDKB 1NVKA 1X94A 1SUFA 3LWZA 4KVAA 1R0YA 5FADA 5FLXA 1XHLA 4B7ZA 1I6KA 1NE7A 1H1LB 3QU4A 4PG4A 5L7YA 3DVRX 3PNQA 5F1PA 5AIBA 4P33A 1ZINA 1NLYA 2VYFA 3ABRB 1JDPA 2IYUA 3K9WA 1OFGA 1UMCA 4FSHA 5BN4B 2MSCB 3C14C 3UK2A 4YRQA 7MDHA 4M36A 1A9XA 4Y18A 2HB6A 4M37A 4E2WA 4ZEMA 3L9XA 1YDMA 2VAVA 2FG7C 1XVUA 5EHQA 3LZ6A 5IBQA 1KQGA 2W6JA 4C4ZA 4MXDA 4A7PA 2ID7A 5JQGA 3MGGA 3ADDA 4OJQA 5GIOE 1HPLA 2H1WA 4IRXA 2ZYWX 4IV8A 4JUBA 3T9DA 4U8GA 5CD9A 1GPWB 1UAAA 4OB7A 2XCSB 4QRIA 1CUUA 2YBEA 4YRBA 3PRJA 1K9VF 2CK3D 3O1JC 2BM1A 3PJDA 4R69A 3QYJA 1U2DC 4LOHA 3KYDB 3O8RA 3DBRA 5HKAA 5IZCC 2VAWA 4HV4A 1Z0ZA 2AE1A 4OBWA 3PUYA 3AUUA 3QNUA 5T5QA 1IQRA 1MVLA 4IZHA 5GVRA 2QM0A 2P9HA 1P31A 2NPOA 3PGVA 2HNKA 2RONA 2A67A 4TOIA 4YFYA 3P2OA 1C9JA 2ISSD 2DYKA 4YT4A 3ORQA 2ZIZA 3ENKA 3PWSA 2M1ZA 4Q4HA 1ISFA 4RELA 4F4DA 3B1ZA 1VG1A 4KEAA 1PEDA 2JAHA 2R4TA 1GGJA 3QEJA 3U7FB 1ODTC 5IJWA 3FFBA 5D5PA 4MYRA 1GHTA 3LNCA 3WYEA 3AU9A 3LDGA 4PFSA 2C4MA 4G1MB 5FA6A 3PE3A 5FTWA 3ZHBA 4L4SA 3U3OA 5GVSA 3GLTA 1EBBA 4KRYA 3RREA 3VKUA 2NVUA 5FA5A 4UCXA 5T3UA 2N1MA 5KJCA 1EJBA 1YQ9A 4TMYA 4LFCB 1VL2A 1XD9A 3IIKA 3E23A 1EWYA 1DS6A 3MLBA 4EK9A 2CFRA 3M6IA 2FRVA 4EB0A 4EJ2A 1W34A 1W75A 3Q5DA 4YH1A 4B47A 2PUEA 1EAYA 3JAKA 5H02A 2BEVA 3IDQA 4FQ5A 4YMLA 4B6EA 4F3RA 2DETA 2BGTA 1RJ9B 3E9MA 3M3PA 3JW8A 3GG2A 1WG8A 1RTKA 1QG2A 2Y66A 3KCNA 4J75A 1QGAA 2DFVA 1UPFA 1WMFA 3EIFA 3F4LA 3DEJA 3GQBB 1G16A 2W5UA 3DMNA 3LBAA 3LCMA 1WP9A 4CMHA 4CVNA 1T15A 3EAQA 1EVYA 1WXQA 2N1BA 2W7TA 3DE5X 1KY2A 1RWBA 2XMZA 3Q6MA 1JQAA 4H7EA 4ZEWA 4BFVA 4E30A 1XA4A 2FW9A 3E58A 4AMBA 4LX0A 2HR1A 4K3VA 1AQ6A 2ZIUB 3A1FA 4DF3A 3FOAA 4XVCA 4AJ1A 5JLAA 4JLAA 5K3FA 2P6RA 5I9NA 2A5GA 4OOFA 1OILA 2PZ8A 1RPAA 2C9BA 2IRWA 3FYTA 1YVDA 2X23A 2JGDB 2YDXA 5JNUA 2POCA 1GM5A 1TQ2A 3VYSB 3PPIA 3R3VA 4DIDA 2CWDA 3E27A 4EFNA 3TUIC 5EIBC 1VBNA 2WJIA 1CIPA 2NZWA 2P9CA 1G3RA 5ED0A 3JASA 1K88A 2KYRA 1MDBA 5F1KA 3KQVA 2Q9CA 3M6AA 2B8NA 1O2DA 5EJ9A 4QDKA 2V03A 4D3XA 5GZ3A 2CE2X 3GFVA 1UP7A 3AKZA 3JSXA 5JCZA 3NALA 5BW6B 3AFHA 1KAOA 3W5VA 4RXUA 1WXHA 2HSEA 1KBZA 4TVSA 4N18A 2I0FA 5IAGA 1T3SA 5ALKA 3WADA 4R7TA 2P3OA 3N0RA 3KEFA 1ZM4A 4C4PA 2IZOA 3GB9A 4ZV7A 2WHYA 4LRWA 4HUTA 3CLUD 2FLWA 3RFVA 2VA8A 2FWMX 3FFWA 3E8MA 5BV1A 2QYTA 4HDAA 1EVEA 3DKRA 2B34A 4S0XA 3VO9A 1R64A 3N86A 1AO0A 2C8KA 1RMTA 3GGDA 1R6XA 2R7LA 3UBTA 3QEMB 4RIHA 3HXPA 4ZVVA 1CY4A 2QZPA 4FDUA 5JAMA 1OASA 4JSTA 1H1LA 1INLA 2JC3A 1DRJA 3L7DA 1OWOA 2A1TS 1ZU5A 4AIIA 3ZDRA 2H16A 4L76A 4M49A 5KVVA 4I99A 2G1AA 2B0JA 2MINB 3HDQA 5H9WA 3O7WA 2W2NA 3Q9LA 1SG0A 1HMYA 1VKNA 2NADA 2JFVA 2WHQA 1NQVA 3PTZA 3HUTA 4BNTA 1E2UA 3AZPA 3PNBA 1HSOA 1I5OA 4HSEA 3BWBA 3VU9A 4PX3A 1NYLA 3FR7A 3HNOA 4HXFB 4LY9A 3WWZA 4DMFA 3LQFA 2XCIA 4M0DA 1MG0A 4XASA 4UUAA 3THSA 4RJLA 1JHUA 1IVYA 2QPTA 3QKRB 2G09A 1U8YA 3PXEA 1XDZA 3K2BA 3WJAA 1UJ4A 1G64A 1ARZA 3PJFA 1H2EA 3BBLA 3TLXA 2L2QA 4ER6A 2PZJA 5I4KA 3FZQA 3ZWYA 4LDNA 4MR8B 2CLOB 1L5FA 1Z33A 4CLEA 5CU7A 3OH8A 3BJRA 3FKJA 5U4XA 1QO9A 1F8XA 3SSMA 5ALHA 3RVRA 1G5RA 3B5IA 2O3RA 2WM8A 3IP6A 3IUSA 4TQUS 4BMZA 3WYGA 4RVHA 1I7QB 2VYQA 2FQYA 2XSZD 5DT2A 1KTIA 3IXLA 3N39C 1IPFA 1B2RA 3SBDA 1NVXQ 1E2KA 4EPXA 1R9NA 2BTEA 1E2MA 3G2HA 2CXUA 1Q11A 3CM0A 4JC5A 4LTNA 1IJBA 4GLFA 4XM2A 4AJKA 5ALRA 4B6PA 5ILOA 4YWHA 3M2PA 2WE8A 3ONFA 5FA8A 5EHZA 1EFDN 1YJAA 4YP6A 2QT0A 3SJBA 5HK9A 5LQRA 1G291 4YRGA 1IVNA 1NTRA 3HPRA 4R51A 5DYTA 1EIZA 1Z45A 4BP9A 4DN6A 3HP4A 1X1TA 3KBBA 3ZHYA 3IMCA 1BZYA 4I55F 1YK1A 3A28A 4RK1A 5AJTA 4XPIB 1UH5A 2EBFX 4N1AA 5HDQA 3MCUA 2QMOA 3D3JA 3SI7A 2ZUUA 1Q84A 4IKOA 3HKBB 2VJQA 3KXIA 1Q44A 4KUEA 2FMTA 4GHWA 1QE5A 2IHJA 3GQBA 3BHIA 3O6VA 4N12A 4W5JA 5D1HA 3QFHA 3PHHA 5EVCA 3WFIA 4L8FA 1I3NA 2D2IA 2HY7A 3KPWA 3EXIB 1TEVA 1LVHA 3TPCA 1G3QA 4BFZA 4H60A 1TU0A 1XR3A 1JSCA 3N1UA 3FYHA 3JQAD 5FR2A 1ISPA 1JMYA 1M74A 1FZQA 4F9GA 3NT4A 4ZODA 3A10A 3INYA 4EUNA 4AMZA 4OXQA 1K98A 1XGKA 2WG2A 2XIQA 4HLDA 4PR3A 1S96A 1UC4B 1OZGA 2I87A 2JGDA 2FKAA 3EDOA 4QEKA 5G02A 3ZN2A 3UTCA 4UFNA 2B1JA 4DCJA 3TF5A 2B94A 2A9KA 1DINA 1OV4A 1Z68A 4FXPA 1CJCA 3GZTB 1PFUA 2WT9A 1VIYA 4KIFA 2I80A 2P1RA 1HZJA 2DQ4A 1TFUA 1A9OA 1RZVA 3OPNA 4J94A 2JFXA 4CCSA 2NZYA 2ZJAA 4D99A 4MI3A 1SVKA 2HLPA 4PZDA 3UMSA 3LX8A 4IO0A 1YI1A 1C0IA 3RC3A 5A03A 2ZI3A 3WGQA 1HG0A 2QPOA 4DV2B 4BKMA 4CLDA 4IIBA 4EX6A 4OHKA 5K99A 1HLDA 1O9GA 1Z5VA 1JALA 4TYWA 1K5HA 1Z3CA 1XTSA 1OXVA 4OKSA 3PPYA 1JMKC 2GVZC 2Z3ZA 4M0KA 4INZA 5DHAA 2CNBA 5EXXA 5BRNA 1G5IA 1W1IA 1W96A 1YBHA 3THOA 3D8BA 3LKVA 4DM4A 1VCOA 5JXHA 1W94A 2P8SA 1P7WA 1IY1A 1KRWA 4LQ4A 1G2OA 1KMMA 3L3BA 2PMKA 3QEMA 3FPAA 1XJ5A 3FG9A 1NP6A 2B3DA 3FTDA 1A8SA 1JJAA 1SC3A 5BT8A 1ZZGA 3OLWA 1L4BA 1ZRSA 4AY6A 3WLJA 5L45A 1M1UA 2ZR0A 1KP9A 1QR2A 2AD5A 4IO1A 4XGIA 5CDFA 2CYBA 1R3UA 3IDAA 4CT5A 2G6BA 1BQ3A 2CCJA 3Q3CA 1I36A 4XE5A 4B3CA 2E18A 5CX4A 1CEQA 3CEJA 1CQPA 1FNBA 1Y8RB 2XMBA 4CM4A 621PA 1CUBA 1VI6A 2XMQA 5GONB 1UM9B 2QI9F 5I7EA 4JQZA 4OQFA 5GWXA 1JQKA 1G55A 1TK9A 1FX0B 4E11A 1J25A 3PHJA 3KYJB 3OM8A 1E7QA 1EXWA 2EL7A 1ZONA 1F6BA 1I13A 4LVUA 4NJEA 4AP9A 4ND5A 5TNXA 2TMDA 1PHRA 2GVNA 3DKKA 3DT9A 3IAUA 5C35A 2AC2A 2H2GA 3ZJTA 4C4SA 2HF8A 5AHWA 4Z0HO 2GM9A 3IILA 1F9AA 1BH2A 1TKAA 1XT6A 2WF7A 3CZAA 3EG5A 1ZK4A 3EIQA 3NOXA 5EWJB 4MRMB 2GZAA 4FGUA 4G0XA 3QKRA 5BMVB 4LYYA 4QEDA 3FWKA 2PBRA 1KFCB 2IBTA 1O1YA 4UNNA 5C8XA 3LM8A 3CMMA 1R6TA 1GGNA 3JWEA 3PKZA 3TD2A 1G8GA 1C9NA 4JQSA 2DHCA 3EH2A 1W1WA 1DQPA 1P2SA 4FC6A 1VJTA 1A7KA 1XEXA 3WS7A 4DWWA 2KE5A 2AHOA 4FFOA 3RQSA 2V6FA 3EGXB 1LF5A 4O0MA 3B6EA 4IWYA 5LUAA 4XWWA 3E3NA 4R8KA 2Q3EA 1TM1E 2C20A 4JJAA 3E61A 1PL7A 4P86A 2N3ZA 1Q3TA 1I1QB 1JA0A 1PE0A 3R6LA 4V1CA 3U80A 1YI0A 3G0HA 4BE9A 2V5UA 1V26A 2OZVA 2NU8B 5A6VA 1ZM9A 3GHHA 2IXEA 4MP3A 1SZPA 1YGPA 3GGSA 4E5KA 4YGXB 4JWKA 1LZLA 2FN3A 2YQ4A 2QP3A 5AVRA 1QE3A 4F1WA 4ZQFA 5LC1A 3O4HA 4LJRA 3SXUA 2VWHA 4HQOA 4EG5A 3EOBI 3ZU3A 4L9RA 1XZLA 3RF6A 1JT2A 1T6YA 2OHJA 2QJTA 2QTLA 3PD0A 5FLYA 3TB4A 3UB4A 5SV2A 4FEYA 4WCFC 4QT4A 4TSFD 1JHQA 4BO1A 4C2UA 2FV8A 2DLDA 3C5HA 3HKBA 4GKKB 3UCXA 1WB4A 2R8OA 4I9NA 4HXEB 1CBUA 1GL7A 2CLIB 3F90A 4XB6B 5EZ5A 1W9MA 2CEKA 2HWUA 3W5HA 5DHUA 2OV3A 1H0SA 3FROA 4KRGA 3EXIA 4CU2A 3CUKA 4EF5A 4D96A 4KN9S 5FORA 1XRNA 5A9RA 3E82A 4JYCA 4AYWA 1FS4A 4M1KA 5BVHA 5ALTA 1AN0A 3RYFA 4XD7D 1H8ED 4DDTA 3QVUA 4DTIA 4YB8A 4ND2A 1L7PA 4MRSA 4UHDA 1Z75A 1OFUA 3LVRE 5FRDA 3FHLA 2AFHE 2IPAB 3B3QA 5JRJA 3DZHA 5AO9A 1OI2A 1IN1A 4EMUA 1PYOA 1JDVA 2ZRLA 3GDOA 4PN7A 2Q4OA 3AOGA 1KRHA 1NHWA 3FA2A 4GPD1 3ZJYA 2WAAA 5ITZB 1TIPA 4KR7A 3HRIA 2RJ3A 4L5YA 1JU9A 1C4KA 1VMAA 4N3CA 4RLFA 4E0BA 1IXSB 1DXYA 1DJNA 2AYXA 3CEPB 1DBWA 4Q9IA 3SOPA 1MJHA 4EF4A 1GRNA 1RM0A 3NOOA 2CLDX 3MTBA 1G19A 2O3QA 3RVMA 3AF1A 3CRVA 4D9HA 3DEIA 4X60A 5B2EA 3OC0A 2AG0A 4YV0A 3GCXA 4X8LA 5DLYA 4OAQA 4LDRA 2D4HA 1NKSA 1KZ1A 1TO1E 1XZGA 4FSDA 4L3OA 4LXYA 5JNSA 2XBUA 1SRQA 3AKEA 1L7VC 5ADVA 1HR0B 4LMAA 2IZ5A 2EIHA 3RH0A 3DZGA 3S40A 1Z07A 3OJXA 1EZ1A 2XZTA 3IOYA 4DLWA 4JFAA 4YEDA 5GY7A 2I54A 1KJWA 5FF9A 3NDPA 3H5IA 4ZVQA 3LWDA 3MWLA 1XX6A 1NC3A 2ZQYA 4KIUA 2BTQB 3VTFA 2PKWA 4YRIA 3AERA 3T4XA 5IWCA 5KSZA 1GFIA 1CJSA 1S2NA 4RMGA 1G9SA 3VX3A 3BGVA 3QW4B 4KXMA 1JHPA 1YRAA 3KXLA 1T9CA 4GPTA 4HNUA 3IB6A 4IYJA 4MPTA 4R1UA 4BUZA 3DQPA 3JZAA 4Q3KA 5EZ6B 4RDHA 5LBTA 4K26A 2E89A 5HRAA 1SHKA 4HWPA 5GONA 1FFYA 1UM9A 2FZLA 2DFLA 3A6PC 3A6KA 4HAWA 5F21A 5T4HA 1KPHA 3C8DA 3UATA 3UK1A 1IBRA 1I3CA 1N5MA 5AVXA 3E22B 4FDAA 4BHTA 3HNRA 1E69A 3QMPA 3TVYA 1UBCA 2JFHA 1ZNYA 2CVOA 3NHZA 2FEAA 4BV8A 4MRMA 5K8UA 4S1OA 3ZDQA 1GUDA 5BMVA 5JWHA 5CA1B 1HI9A 4LBVA 3S2FA 5CXXA 1WVGA 3QU2A 4CMEA 5H1YA 4L0MA 4L2IA 4NMHA 4JSRA 4CF3A 2KB0A 4O33A 4E5PA 2DR0A 3L0IB 5E0OA 2Z8ZA 1OB5A 5HJ5A 3NHRA 2OCKA 1OZ0A 4JGBA 1V1JA 2OORC 4UAVA 2C82A 5AK0A 3UB2A 3RIEA 2XIJA 1V3UA 3AFIA 3AV0B 3WGIA 2O4UX 2V9CA 1WZIA 3PQ3A 4OHOA 4TLDA 4ESHA 1J0DA 3IC5A 9MHTA 3LXMA 2JIPA 2PU5A 4C6TB 5AW2A 3R9KA 2G4VA 3Q15C 4EG1A 3AUXA 1ZICA 3LLVA 2J9RA 4ZO8A 3COVA 2CUNA 2GYYA 3BM5A 2ONJA 2OO5C 3BTUA 4GGPA 4S3MA 4P3KA 4YJHB 4EA8A 4EHNA 3K0AB 4RD2A 1EESA 1NULA 2OKCA 4MVJE 4RPHA 2PLFA 2WU0A 5GJCA 4DKJA 2JB9A 5FUMA 1Z8HA 2MMCA 1LC3A 3BL8A 4MUYA 4EY4A 2Z1DA 3O03A 1Q1GA 2XQFA 4J0KA 4PYOA 5KTTA 1U2ZA 1Z7WA 3HJTA 1FCJA 4PIPA 1PT9A 4R98A 5FO1A 3S3TA 4ACAA 1UT8A 1Z4MA 1RJDA 5KNDA 1KRXA 4PHFA 1WX1A 3N2LA 3MINB 1S7CA 4WN3A 1RI3A 2GPAA 3QF4B 2H2DA 3ZDFA 5IVHA 4L8LA 5ES3A 5JCXA 4FFPA 3N76A 1RI5A 2A86A 5CLHA 1M2EA 4G2NA 5KVQA 2KW5A 2CLEB 2VHWA 4LKOA 3IRUA 4C0LA 2I1VB 3USES 3VI4B 3ZE7A 3E3AA 2GRAA 1U0GA 1DC6A 1YZFA 2D74A 4OLJA 5FOTA 1NI3A 3VVMA 5LZ7A 1FMJA 4QOJA 4OLAA 1RLIA 3ZGZA 4AP6A 4HATA 4KGXA 2JHFA 2ZT6A 2IYYA 3DXYA 4AO8A 3U7QA 4HTFA 1AXRA 2GYUA 1MC8A 2QN1A 2C4UA 3AY0A 3V7YA 2I4MA 3L4SO 4A82A 4CM9D 5DNWA 1TQ4A 2FP3A 4U1RA 1MIOA 1MO2A 3OWXA 4V3BA 3R76A 2HQBA 4KV7A 5EFZA 3ZXYA 5M04A 3RRMA 3E1GA 3FLMA 1NXTA 2ZE8A 3H83A 5DH9A 2QY9A 3WMXA 3EIXA 4OQLA 4L51A 1TW2A 3W2HA 3TJRA 1N5JA 3MIZA 3HG7A 4G0YA 4IFIA 4YQEA 1R5JA 3SJZA 1MO5A 2Q5IA 1R0CA 1V8DA 3ZH9B 4EHDA 1CUSA 3AVQA 4P4GA 1HF3A 5LZ9A 1YS2X 4GEKA 1FP2A 5CVJA 1Q0SA 3OJCA 4UFOA 4LYGA 5M2QA 3MHTA 2OFXA 4TXHA 2E0IA 3WMWA 2CT8A 3L8FA 4WXEA 4XQ0A 1E62A 1MB4A 2XA9A 3ZIDA 1UBNA 3I04M 1H42A 3PDJA 3UWSA 2YVKA 3AJDA 1KGSA 5TR9A 3GWGA 4HWGA 4EPTA 4NNJA 2DRIA 1K68A 3IPXA 2H2FA 3H2KA 1AUQA 2W71A 5JAIA 2GJKA 2GFQA 1VJCA 2DU8A 2IUSA 3B12A 4W1PA 4EW1A 3B1KA 2P3QA 3VYUB 2P2CA 2YS7A 2YJGA 1UC8A 3TLMA 2QGNA 3G7NA 3SEQA 3G1WA 2ISCA 3EOAI 5BOSB 3ELUA 5C1DA 4NS1A 2V8BA 2DH5A 5LQUA 5COQA 4BNZA 4Q9LA 4RLSA 2IEBA 3DC7A 2RGNC 4KLNA 5DLPA 4JROA 1WY7A 3BEDA 5DHTA 3WGZA 3WK4A 2L42A 4D46A 2WB4A 2V0CA 4EHFA 1RYEA 2IQIA 3NRJA 4K81B 3X2SA 4C5CA 3I61A 3IJPA 4X45A 1JTVA 4IF4A 5KQSA 1UFVA 4QFMA 1P1BA 4P53A 5HWSA 2Q3DA 1ZD2P 4BO7A 2GSDA 2TSYB 5B58T 1F0PA 1ZXBA 2J41A 4JP2A 2ZYDA 5L3QB 5ITSA 3DTVB 5KOHB 1R5BA 4CCWA 5AWFC 4BV3A 2HEIA 3FF4A 1NUPA 2BEWB 3P19A 4D9IA 2XWBF 5ITWA 3D4PA 1MV8A 4PZAA 3TD6A 1BDMA 1D4OA 1RYFA 4FUQA 4JITA 5LB2A 1NMXA 1I8TA 2RGBA 1IEXA 4JZYA 1IJFA 3VV3A 4DCSA 4DY6A 3K70D 5JS7A 1IYZA 4NX2A 1LV8A 2WU8A 2R4UA 3TNFA 2P90A 2IHZA 2WUFA 3CRQA 3NVMB 3Q8KA 2DG2A 3VHLB 3G7SA 3UV7A 2Z83A 3Q72A 1ZD8A 3MB8A 4BMDA 5I3ZA 4GKVA 1B93A 3RR2A 4C6TA 1U0TA 3PITA 3H7AA 2EJWA 2XYGA 4N7MA 4RH0A 4CN8A 4O4LB 1GG5A 4RMHA 4A91A 4F5ZA 3KZKA 1P5RA 4GAEA 1WXGA 4E6EA 1X7GA 3HLTA 3M9LA 4YJHA 1BJRE 2ZJ2A 3K0AA 1YQXA 3V7NA 4BGIA 3PR3A 4D9FA 2ASEA 2J4CA 1FC0A 1DUIA 4PX5A 1F5SA 3PIIA 5DBIA 4E5YA 1BE0A 1O87A 3OLCX 1ZW6A 2YR0A 2QLMA 1JTEA 3O38A 4RTOA 3B1FA 4DQKA 3BWDD 1YQUA 4IG9A 1E5QA 1BO6A 1SOVA 1Z4NA 3JQFC 4ETMA 2OFFA 2UKDA 5J40A 1QCYA 3MINA 3TZ6A 1VLVA 3EZYA 2MYNA 3GQVA 5EN4A 3ZHXA 4OFXA 4UOEA 4X62B 2PSFA 1BKDR 4HP8A 1E2BA 3HR4A 2ZPAA 2R4QA 4TWZA 2DSTA 4RVFA 1Z5OA 4CG2A 5AVZA 4E12A 3K0KA 1UFQA 1XJCA 4M38A 3RRBA 1A5BB 2Z9BA 4RD3A 3ZWKA 4MVJD 2HCJB 4AVYA 4BXOB 3C3DA 2I99A 4TTPA 3AX6A 2EFJA 3JVUA 1B26A 1N5LA 3TOVA 3GLHA 2YJ5A 2YDYA 4Q19A 2REOA 4C03A 1I2MA 1IBSA 2B8EA 2ZSAA 4LSGA 1EBFA 4RC9A 5H9VA 3WO1A 2HA3A 3AIKA 5AW4A 1PEKE 1SHJA 2HPZA 1SBTA 1N8SA 2F1OA 4RLHA 1KU6A 3KEOA 4ZMBA 4KZKA 1WF6A 1EG2A 3URMA 2BTOA 3BERA 4Z2YA 4DLXA 2YXDA 3GNSA 2M32A 2PBLA 3HYTA 2EJUA 2P9BA 4X84A 3RVBA 1G9XA 4ZCRA 3BJIC 4QQFA 4PTYA 4IMIB 3SZMA 4XIFA 3TQIA 4E5VA 4ZYWA 3EGDA 1ZK0A 2FPMA 3H1GA 5DCLA 3W8EA 2QTVB 1VA5A 3I72A 1XEAA 1HLFA 5HGXA 2O07A 1PNTA 2Z8YA 4LHVA 5IF3A 2IY8A 4TUYB 2FF5A 3QRWA 4MWZA 3EZXA 3PI6A 2CF6A 2PT7A 1XMQB 2HRDA 5K3AA 1CF2O 1KYTA 2DAPA 3LPDA 3IIJA 1O97D 3QE3A 4W9NC 5BPFA 2EFCB 1JKMA 1OBHA 1DNPA 5EQFA 1U94A 3AKDA 3CX4A 1PGJA 2XMGA 1RT9A 1BA2A 4GI1A 1PNVA 4UBKA 1EVJA 2I2FA 2IZ1A 1M6WA 2VHYA 5ECYA 2RSLA 2AG1A 2FP4B 2HM7A 3U7GA 1NDHA 4A0RA 4XDHA 2JFQA 3B89A 4EG6A 2C0QA 3DDCA 1R8QA 4IH4A 4R8RA 4MUHA 3LK7A 2A2ZA 1DXHA 3M0EA 3SHOA 2INGX 2H31A 2WNHA 1J1IA 1SC1A 1V96A 4HDNA 3TZEA 2GI4A 4B7CA 5A4JA 4HEA6 4OHFA 1X77A 4C01A 3OZFA 3ASVA 5EP4A 5ER9A 1EUZA 2XE7A 2AKAB 4W4TA 1IVSA 4AJPA 4RF5A 3DMHA 1HNXB 2SCUB 2O50A 3H05A 4V1CI 2GO7A 4B3FX 5AM2A 2B4TO 1Z4LA 1N92A 4F4IA 1E3TA 4JB0A 2VOJA 2NXCA 1AKMA 2RG1A 3BD8A 3DE7X 3MRXA 2O0LA 1BA3A 3H5OA 4GKAA 3Q12A 5LNK1 5L3QA 2PSEA 3DTVA 5B6IA 5IZ4A 2NNWB 1M9NA 3GJ5A 3O9VA 4RANA 4CKCA 2FPOA 2BD0A 3U1TA 2BEWA 4NBKA 1CQXA 1WOYA 5GQSA 2PBFA 2H1LA 5LQSA 4MGZR 2DBVO 3C7DB 1Z36A 4OQDA 4EVQA 2PRZA 2ZUSA 3ZWQA 2QD4A 4H4EA 4YJ3F 4W82A 4TRMA 2PGNA 1PFGA 4BKPA 1FP6A 5ALQA 5D3MB 4DAEA 4C2BA 4XWGA 9ATCA 1TLTA 2OQVA 5DIFA 3OBBA 3VI3B 2XCRB 1N6NA 2CVPA 5FUWA 1OREA 1CY0A 2FE1A 3NJ8A 1YUNA 2QRHA 4RYDA 1H3EA 2IKSA 2Y6VA 5JADA 5E1BA 3PGJA 2Q28A 5EIOA 4EGJA 5JXGA 3IQZA 4ARAA 5IXSA 4RK6A 1DIRA 5DYYA 7GPBA 2O5EA 2V4UA 2PYIA 4RHEA 1IB6A 3SG0A 3DNFA 1XWFA 1IMOA 1R1DA 2HADA 3F6YA 1M54A 1PUJA 2P3LA 2D3WA 2JFOA 2YBDA 2GTPA 2J5KA 3BAFA 5CK4A 1PWEA 3OU7A 2IV2X 3Q8MA 1SUBA 3L6CA 1Y48E 5SZKB 3UYLA 2IW1A 3GY0A 5AK5A 2K4MA 2VJYA 4N5MA 3F4BA 3VO1A 2CMFA 2G8LA 2R7AA 2RHWA 3ZH2A 4E4YA 1M8PA 4CCYA 4UE2A 1KQNA 5I9LA 2QIOA 5J1SB 2EJVA 4QBIA 4EH1A 4DCVA 3NASA 4R41A 5CDTA 1U9ZA 4L5IA 2OBBA 1Z0KA 2QLNA 3FJYA 2OHGA 4LEIA 2QZZA 1ZSNA 4G0NA 1RWQA 4RIGA 2I3AA 2JCGA 5KX5B 1NM5C 2BMVA 3BEOA 2PZAA 1MX3A 2IE0A 1LNQA 4J0EA 1H2RS 3PK0A 3H9BA 2QORA 4P9NA 1AMOA 1JJFA 3NHSA 2J9FB 1T36A 1J1ZA 1GT91 4P31A 3LFTA 4Z9XA 2NU6A 1V41E 2QTVA 5K1ZA 3GGOA 4OI4A 1NAIA 3MAAC 4GOOD 3RVNA 3VPGA 1TTPB 4TSKA 2VXCA 5FL7D 4CUZA 3DEKA 2H3HA 3CS3A 4FMCB 2IC5A 3BUSA 4ZN6A 1A95A 2PMDA 2HU2A 3VR2D 2QS9A 4TL6A 3WLSA 3TW8B 4ZGBA 4R5MA 1NF8A 2WJYA 1CWUA 2ZSEA 3ANYB 4M1SA 3P2YA 4OFWA 3T1VA 3KVOA 4Z51A 2BFOA 2X8JB 2CL5A 3EZ6A 3C4JA 3ODGA 1XWIA 3X1DA 3MJFA 2DHRA 4DVJA 4F96A 3OE7A 5AVUA 3QMMA 3NC0C 1ZA1A 4UVGA 1D4AA 1S4QA 3H5RA 3HBMA 3QLUC 1XP5A 2R6ZA 2TMGA 3SM9A 4ZFNA 1YACA 2D7CA 3K72B 3D3KA 3V2HA 1POXA 1OTYA 3PCRB 2L0XA 1UCFA 2LGJA 4D8YA 1ECCA 5L3VA 2WICA 1BJTA 5GOZA 3I9V6 1DLJA 5B1DA 1HTTA 4JCCA 1E7WA 5J5CA 3EMDA 4JBNA 4UM9D 4RL4A 5EYPB 2I62A 1QHHA 1QFJA 1TCAA 2YHIB 5FWDA 5JJCA 2PSDA 2H59A 3JWHA 3LYAA 1JG4A 3I4LA 2ZI4A 4V02A 2DR3A 2AMVA 2SCUA 2V5VA 4MQMA 3RFCA 4CGYA 3E5HA 3C0KA 2ZDHA 4LQCA 5DCWA 4LF6B 2ZB2A 2YN4A 4DT1B 1ISGA 1OV6A 3HUFA 4RF2A 4DLZA 3GUHA 4ZREA 3A2KA 3QHQA 2HDWA 4PIMA 1GOTA 4PCAA 2QQEA 1LEHA 2IUYA 2JS7A 2QG4A 3V4FA 2A1IA 4MIOA 2D1QA 3ZD8A 4XDZA 1CUIA 1CVIA 3MBIA 2H1OA 3M70A 1TVEA 1QIDA 3FYUC 4C4XA 2MTBA 3E84A 4Q4AB 3SHVA 2FB9A 1XZIA 1XBTA 4HJXA 1JX6A 3AB7A 3OC6A 1H6BA 1V8ZA 4XYMA 3SR3A 3W5SA 1OWMA 1QJCA 3H5VA 4Y1RA 3NR2A 1O7JA 5D3MA 1C30B 2CBXA 1E99A 2HJWA 4C7VA 2H5LA 1R4AA 2KM1A 5K0CA 4HYTA 4E31A 4TXMA 1V8FA 4X91A 1U6KA 1PK9A 3VYWA 3BXOA 3CVJA 4NHOA 4IFEA 4EHHA 3ZBTA 4GZ5A 2VIIA 2HDOA 1PEAA 3EF1A 4RY8A 4TVKA 1N8KA 4QVIA 4LJAA 1MP0A 1U4SA 2EZ4A 4BP1A 2HJ9A 3BA6A 4HAVA 1QK3A 1X9GA 2QG6A 4O1IA 4X95A 5TPWA 3O94A 3GLFB 4KR0A 1KYVA 3KWFA 4JYPA 4M54A 5A62A 4AKGA 5FPHA 1FTSA 1R4MB 5I4IA 3GEMA 4QODA 1G8AA 3NHJA 3TQSA 2V5AA 1BVRA 1U5BB 2QD2A 1I80A 2V97A 3CZ4A 4QU9A 1MGOA 4EZIA 1W4AA 1SK8A 4MW9A 1YB5A 3I5XA 1VHLA 4CKBA 3KKPA 3VMMA 5C18A 4HLUA 3RS9A 2W0SA 2O8BA 1CIJA 5E7MA 3K2QA 1V5FA 1XLTA 3BIXA 3P9NA 4LV8B 4B73A 4YUZA 4LF9B 1GZ3A 3CRRA 4XTCS 2WUWE 3B1VA 5FAKA 1XAGA 4TS3A 4P2BA 3G6KA 4CIBA 1V9SA 1R0BA 1Y8CA 2ZJBA 4QHTA 2ZZNA 2R48A 5DNCA 2IOYA 2PWPA 3KLNA 1GUFA 1XPJA 4B4WA 4EVSA 1OBFO 3CSUA 1E3WB 3QG1A 4C7JA 1JRLA 1U28A 2C61A 1KERA 2QTWB 4BCDA 3G1TA 5FNVF 3FNIA 1QVWA 5KX5A 4M60A 4EFLA 1P4SA 4X3OA 2ZWOA 1L5RA 2ATVA 5C1PA 1T6ZA 4MEJA 1OFVA 1YBMA 1QBGA 2A1UB 2I6UA 2IX9A 2RIPA 3AFGA 3B2EA 2Q3FA 1U9IA 2XUKA 2P7IA 3HSKA 3IE0A 3OX4A 4JUAA 1IZ0A 4DA0A 1N0IA 4BEJA 4JEHA 4X44A 3ZDCA 4WERA 1PT7A 2J9FA 1EFLA 5F7XA 2XGGA 2C5AA 3AY3A 2QRJA 3CBGA 1MJGM 3LA8A 3UK6A 2Q41A 4YUAA 2FR8A 1MOQA 1RHKA 3G8YA 2R6AA 3GT3A 3UAYA 2IXGA 1ISJA 3Q1KA 4DAOA 4NPCA 4RNCA 1ZDMA 2R8RA 3A3NA 4YJFB 4ZTZB 3ITNA 3OKPA 1DWPA 3EFHA 2JF0A 3TW8A 1M34B 4O4IA 1J4AA 3KB2A 1N7JA 1EAMA 3ESXA 3KOMA 5WRFA 1N2XA 4I5IA 3HDVA 4OXYA 1RYMA 3BWYA 4TZ0A 3R24A 3RJ5A 3H0KA 4K9MA 2AOVA 3T7CA 2VZ9A 4C22A 4F2DA 4US0R 4X3PA 2YZMA 5DXJA 3ZXXA 1Z6PA 3M4XA 2BGIA 4H3VA 1O8CA 3N70A 4XTRA 1XZAA 1I9GA 1A3CA 2IHUA 3PICA 4JUIA 3IHWA 4P3NA 1A2QA 1RQXA 3DPUA 4E6PA 1HYEA 1V3QE 421PA 2NYUA 4O4HB 1G8JA 1QX3A 3X0DA 4F2WA 4JEIA 5J4YA 1E6MA 3ZCXA 1U1FA 4O8ZA 4X61A 4HH1A 1SQ5A 4LKRA 3D6NB 4CM6A 2FUCA 1UC9A 1W0JD 3JQQA 2LTAA 2PS3A 2JCXA 3TQHA 2QD1A 4B34A 4MI6A 1AB6A 1YO6A 4LCJA 2XCOA 2R5NA 1E0KA 4DT1A 1YJ5A 5IG2A 3ANLA 1I4WA 3AWIA 1JGTA 3SQMA 4M1OA 3L7LA 2VDRB 3CLRC 2FDCA 3EVEA 2W2XA 2GO1A 5AR1A 1L1FA 3AR5A 4I4TF 2QMYA 1CVRA 5CH8A 5JZBA 2O2HA 4DCUA 2QYSA 4E70A 4CNBA 3L8CA 3MCTA 1DUVG 3PXUA 4K6OA 4NH0A 2AI3A 3ZTYA 4CBVA 4ENQA 3GJ7A 5FI5A 3RAEC 3DMPA 3T95A 1KSFX 1U0RA 4WX2B 2QY6A 1Q1ZA 3DOCA 4Q4AA 4OSOA 3W8FA 3UM9A 3VU8A 4ZALA 2OGWA 1PRYA 2EKPA 3LPMA 4IPTA 2GK6A 3TIGA 4UNRA 4DBVO 5KNBD 4J0DA 2VH2A 1E96A 4YVFA 1WLSA 4PQYA 4OH7A 3BIJA 3EMBA 1KR2A 1NXPA 3E53A 5C4GB 1QQ6A 2HA0A 2R1VB 1C30A 5KYUB 4KCGA 3OESA 1E2GA 3IE2A 3QA3E 3KQQA 1D2EA 3T6KA 5EIEA 1SXGA 1YJCA 3O8LA 3ZZUA 4B85A 1PR1A 2B7LA 3MTAA 3JD4A 5LYJF 3F9RA 4Q3CA 5MGNA 1FQJA 3GEEA 3GROA 1UODA 1KMHA 4HBGA 3T7RA 4GVXA 1RVDA 3AH8A 1RFGE 2CLHB 4YAEA 1AKVA 3N6RA 5M29A 3GLFA 1Z18A 4D43A 5AJWA 5JS6A 4IXTA 1R4MA 5A0FA 5KYGA 4XCVA 3ILVA 3KKZA 4Q37A 2AHRA 4Z4EA 1CR2A 3MILA 3HN7A 3RHSA 4LJYA 2FXIA 5LDDC 1ZY2A 4D25A 2H85A 1QRAA 1EG7A 1XYGA 2CSUA 4FNMA 4GW3A 4J7XA 1SC6A 3H17A 3U7EB 4XJTA 3PTAA 3K92A 3VV2A 3NQ41 3ZWMA 2B5WA 3W05A 2FJPA 4E2FA 2RHRA 1CUVA 2W48A 3FTQA 3QKUA 1HY3A 2HUPA 3HQ4O 3NFRA 4GWLA 3NHMA 7YASA 5JSFA 1R16A 2ZE6A 5CEFA 2CJWB 4JA2A 1OU4A 4GWGA 3QPDA 4Y2HA 3TDNA 3B6MA 3BE5A 4XB1A 1Q22A 2QX9A 1E3WA 5CT8A 2ZRQA 5K2OA 3H9QA 3UAZA 1P62B 4D0RA 1A8HA 1U1EA 4GP9A 4NJMA 4AWAA 4Q18A 1U9JA 2AG8A 3WAJA 1AY0A 2X14A 1G4HA 4QXRA 2VSFA 3AI7A 5A7HA 2QVZX 1E2FA 2P4SA 2VPTA 3IH5A 2E4XA 5I51A 2WJZB 3CWQA 1QMGA 3ROPA 2EL9A 3T12A 2C84A 4ZXPA 4ZKDA 3B3AA 4HUJA 4EM6A 2D62A 1B42A 1EHCA