3Q9UA

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
138
Chain Sequence
ATRPIDGLTDEGIRETLTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKIEVVDLFVNPAKAWRFVAYAIKKGAKVVWFQYNTYYPLAARQAGLIIVANRCMMREHKRLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
total genus 38
structure length 138
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q9uA00
1Y8RB 1JLLA 2PD3A 2BRUA 3WG9A 3ANLA 1EUCA 2HK7A 1I3MA 5IFLA 1WPQA 3MTJA 3DC2A 4D3FA 5KJ6A 5L3ZA 1GYRA 5JMPA 5LCXA 3S2GA 5ER9A 1GY8A 2W98A 2O4UX 3GC6A 1LLUA 1DOHA 4BNHA 1IYZA 5G2OA 2V6FA 3KYCA 4HFMA 3TN7A 4LMRA 5T8KA 5CDGA 3IJRA 1IB6A 3G0OA 5ILGA 1OZAA 4W6ZA 4PG5A 4OSOA 4QEDA 1HE5A 1H6BA 3WIDA 1Q0QA 3GGOA 3UW3A 4K26A 4MIYA 2CF5A 3TOXA 3ZWCA 4DPKA 4IQGA 1TVEA 3ZCXA 3NTQA 4Z3KA 2R2GA 3JQ6A 4FGWA 4D42A 1T2CA 4O1MA 3DBHA 1XR3A 2NU9A 1VKNA 3PXXA 2GZ1A 4FDAA 3AU9A 5JDCC 2B83A 5MGBA 1P1FA 1KS9A 3DTYA 3U0BA 1U3WA 3KEOA 3I1JA 2X5OA 5U4QA 3RQSA 3EDMA 4KUGA 3QVOA 3NJ8A 1LQTA 4KDFA 3C7CB 2CSUA 2BFPA 2W90A 4NHEA 1OC2A 5TS3A 1JDJA 2BGKA 4AJOA 5A3JA 2E48A 2O7QA 4WCFA 4M8SA 4XDZA 3HDJA 4WEQA 4R1NA 4XRRA 2ZQYA 3QVTA 4GLLA 3OJFA 1LRKA 1VLLA 4DTIA 3JYQA 3CTMA 4UUOA 4IJKA 4QO8A 1P44A 5F5NA 4Q9NA 4DIBA 4XQGA 4E2ZA 4YRAA 4RF4A 1PJ4A 2PKRA 1V6AA 1O9BA 4CM9A 4BKUA 4ZN6A 4IY1A 1P1HA 3T7CA 4G2NA 5EERA 1NXQA 2AQ8A 2X4GA 1VL6A 3JD1A 2BF7A 2Q2VA 1UXGA 2VZ9A 4GAEA 1QV6A 2W2KB 4L0QA 4O6VA 3B1KA 3PYLA 3FHLA 1ZXBA 3BTUA 4PRKA 3QA9A 4BMVA 3FNEA 5KJ1A 1F12A 1O95A 3NJ4A 4INAA 1T24A 4NFHA 2NVWA 5KVSA 2PZJA 1FK8A 1HSZA 3OICA 1HEUA 3MJ4A 4L74A 4NR0A 4OXNA 1NWHA 2C7VA 2O48X 3RBVA 3HADA 4TQGA 3WNQA 3CUKA 4QFCA 4E2YA 1M75A 4YEDA 3INGA 3GH3A 2PGJA 3T4EA 3TOZA 3WJAA 1R16A 3AM4A 3ONDA 5C5IA 1DBVO 2PA3A 1UP4A 4AJKA 5A06A 1EVYA 4W4TA 1AE1A 3ZDFA 4E13A 2R00A 4PLVA 4B8ZA 3IDSA 3OJOA 3WQSB 4B3JA 1HYHA 1GQYA 4ZHSA 4NBRA 4OHUA 4OJNA 4XKJA 3GDOA 3ENKA 5DBIA 4XYEA 1U5AA 3PLNA 1VE9A 1LLQA 2GGSA 3ROQA 1EE9A 3KTDA 1PR9A 3RROA 3CMCO 5BSHA 2Q99A 4AJIA 3ZHYA 3AJRA 1UAYA 4RZIA 4DQVA 1RKXA 3EVTA 3H5AA 1ONOA 3HDYA 5EN4A 3MJCA 1KY4A 1MFZA 5K6AC 5ILOA 5TLSA 3ROMA 4J4TA 2HU2A 3JQ8A 1KVUA 2JKVA 2E6UX 1XEAA 3DBRA 1R15A 2J3JA 4I5DA 1SOVA 3KYCB 1VSUA 2EP5A 1SZJG 5DN9A 2OMEA 2G82A 2EV9A 3R1IA 1NAHA 3PWZA 3LLVA 4FOSA 3VVBA 1EDOA 1I32A 4R4JA 3DHEA 3E5RA 4Y9DA 1H5QA 4DL9A 1YOVA 4IQ0A 2CVQA 3Q1LA 3F47A 3U9LA 1LLCA 3B1JA 3DBHB 1OC4A 2D2IA 3NGXA 2YDYA 3WGYA 1MB4A 4PN3A 4J90A 3L77A 1E7QA 2X6TA 3ANMA 4WLNA 2XOXA 3GNQA 5CAEA 3JD3A 4AJLA 1LQUA 2EP7A 3OHSX 3MWEB 5KNLA 1NX6A 1CWUA 1LSSA 1QV7A 3OIGA 4BL5A 3LF1A 4CJXA 3RFXA 5CEJA 4YAGA 4H15A 2PKQP 4J4HA 1GQ2A 1YXMA 3AOEA 4EITA 4WCFB 1HTBA 4RVGA 3HJAA 5IAAA 3FNGA 4XIJA 5GMOA 2QX7A 3ITDA 4RVDA 4CR8A 2NSDA 1DC6A 2P2SA 1MXHA 4XCVA 5CHEA 3LT0A 4W82A 4D7AA 1Z74A 1QP8A 4NPCA 3KETA 2HCTA 1R66A 2UUPA 3IQDB 2DBZA 3GRPA 3FN4A 3MZ0A 4LISA 3AY7A 4GGPA 5T6BA 4LGVA 2BI8A 2PD4A 1MLDA 1R4MA 3GAZA 3DFUA 3MCVA 3L9XA 1PQPA 1E0DA 4PLTA 5KVCA 3LU1A 4B4WA 5CDTA 1GAEO 5AXDA 4BO3A 3INTA 5GZ1A 3E82A 3GFBA 3U4HA 3WYEA 2F00A 2EWMA 3ABIA 3H5RA 4KMSA 3M6IA 4II3A 4JBGA 1E1MA 3UXYA 1D8AA 3V2GA 2VNSA 4IDBA 4MIEA 1TI7A 1XU9A 5L4SA 3RU9A 2X9GA 4WLEA 1L1FA 4H16A 1P0CA 1WNTA 4OH1A 4BOYA 5L4NA 1N1GA 1LU9A 1FDVA 3TQHA 2AG5A 5K9ZA 4TWRA 4J7XA 3DZKA 1L7EA 4Q39A 3WNVA 4AJHA 1YDEA 2V6MA 1EK6A 1ZSYA 4Z9YA 5G0TA 4CPDA 4BNUA 1UDCA 3PZRA 1PZFA 1P1JA 3DQPA 3JQCA 3UAGA 3ZU5A 3PHLA 2EGGA 4D44A 1LA2A 4XA8A 4NFYA 4CM9D 5JCXA 3RFVA 3IAHA 1IE3A 3PQFA 1T4DA 3ZHBA 5DF1A 3GPDG 1U8FO 4E32A 5HA5A 1JKFA 1QYVA 1KVRA 3OQ1A 4NBUA 4NQZA 2ZATA 4UUPA 3JQGA 3X2EA 4JXKA 3TL2A 1PS8A 1EDZA 4MKXA 1LTHR 2YFQA 2VWQA 3SC4A 1BVUA 3LSYA 3JQ8B 1F0YA 1LDGA 4OQZA 4R1SA 3JQ7A 4MKRA 3DBRB 3G17A 1ISJA 4MVJM 3D3WA 3VOSA 4BVAA 5JDIC 2J6IA 3MJTA 2D1YA 1W4ZA 4BV8A 3WS7A 4Q3AA 2H1SA 2UVDA 3FBGA 1I3KA 3H3FA 4IGEA 4CUJA 1KVSA 3PJGA 1L7DA 1P31A 4OIMA 5CFZA 4BNLA 4HNGA 3RC7A 1DB3A 4IS3A 3H8VA 1VKOA 2HSDA 3RFTA 1YOVB 1E3IA 3GN1A 3QWBA 1F06A 1PIWA 3HFGA 4Q3DA 1CERA 1ZK3A 2IZ1A 5EESA 1E77A 1LDBA 1H6CA 4ZJUA 3UVEA 3RC2A 1JU9A 2VUTA 5EMHA 3WICA 1V0JA 2CNBA 3UGKA 1I5RA 1RM0A 3PWKA 4XWYA 3SEFA 4HFJA 1Y9AA 3D5QA 3VKUA 3GVHA 2EKPA 4KWIA 4AFNA 1DFIA 4DQXA 4CLRA 3QVWA 2X23A 4PRLA 3WLEA 1K6IA 3JQAA 4K6CA 4UEKA 3TZCA 1GV1A 3QWIA 4N7RA 2FP4A 4IIUA 5JW6A 2XPCA 1PJ3A 1KEUA 2HAEA 5AQ1A 1C14A 1U3TA 3RAJA 3DB2A 3E18A 1KIFA 4BNYA 1P1RA 4E6PA 5TIIA 4TKMA 1RPNA 1LC0A 3HFSA 5HTOA 2D3TA 3DTTA 1BRMA 3H9JA 1LXCA 3RUHA 4FFRA 2W2LA 2NQ8A 1DSSG 1SB8A 5CG2A 3GEDA 3HWRA 3V1YA 4CQLB 1R4MB 5IZCA 3GHYA 3I23A 5H81A 5JXWA 1UAGA 2C5EA 1I2BA 5IG2A 1WAMA 3GGGA 4NBVA 2A9FA 2DPHA 2OL4A 4DLBA 1XWFA 2B4RO 3AUAA 2UYYA 4YAJA 2NU7A 1CYDA 2FWMX 3VC7A 1B15A 5JY1A 3R6DA 4BKPA 4DVJA 3PHHA 1KEWA 3NTOA 2E82A 3DONA 4PG4A 1PX0A 3WYBA 4M1QA 4AICA 4CMBA 5LC1A 3RCBA 1ENOA 2JJYA 3L6DA 2IEDA 4KQXA 4TVBA 3K8ZA 1S7CA 5AXCA 1NBOA 4FFLA 1EQUA 3OJ0A 4MVJI 4XD2A 4XR9A 4FOOA 2IDZA 4CMEA 2PD6A 1LNQA 1UZNA 2PFGA 3RC1A 4A73A 4ALIA 4CM6A 3PP8A 2QRJA 3WDSA 3TNLA 2C82A 4CLOA 3LZ6A 3CH6A 3ST7A 2WSBA 1Z73A 4ZQFA 2DAPA 1FDUA 3TDKA 1M2WA 3JQGB 1XGKA 4LW8A 2ZKLA 4OOFA 1U4OA 3H3JA 1NQAO 2AQIA 1S6YA 5C7IO 2RIRA 3JD2A 4DPLA 1CQJA 1UP7A 2DPGA 1GCOA 2JFGA 3KYDA 5DCYA 3DMYA 4TRJA 3SJ7A 3JQ7B 3U4IA 4EJ0A 1DEHA 3A06A 3D3WB 5DBGA 4PG6A 2I76A 3F1LA 2OXIA 1YVEI 4I9NA 5I8ZA 4MP8A 2I9PA 3BAZA 5TGDA 1HKUA 1PGNA 3TZKA 3ZZNA 3PZBA 2AA3A 1FDWA 1K5HA 3ZW8A 5C7LO 1CIVA 2OBNA 5F3RA 4HFNA 2J5KA 2UAGA 3FD8A 3SX2A 1SC6A 4RVFA 1G1AA 5ICMA 4ROSA 1E1KA 1KERA 1B3BA 1KEPA 4NG5A 1RM4A 3LT1A 4DUPA 4L4SA 2ZTMA 3DOCA 4CLRB 1SNYA 3JQAB 3KO8A 4GI2A 4M54A 2O7SA 2ZCUA 3WGTA 1Z7EA 2NWQA 5ITWA 4PCVA 1VPDA 4D41A 2DKNA 2RH8A 5DP2A 1NR7A 1F17A 1NQOA 1XYGA 2HK9A 3G79A 3WR5A 1NYTA 5ADHA 4Z6KA 1HE2A 1R0LA 3BMOA 4A2CA 2B4TO 3PGJA 3OECA 3ANNA 1NTOA 3QWAA 3D0OA 4UULA 3VAZA 4NH4A 3ASUA 2WE8A 4K1LA 5JYDA 4XZ3A 1SCUA 1N7HA 5L7WA 1QYWA 2PY6A 2VN8A 2CDCA 1QYCA 1ZK4A 3DMTA 2GPTA 3OP4A 2PGLA 4IM7A 2OHXA 4L4XA 4PGFA 4XGNA 4CR6A 2PKQO 4MVJA 2JFFA 3OQBA 5HBRA 5B37A 5JO0A 3EVNA 1HDOA 2FZEA 3C3XA 3W8DA 2DBVO 4IBOA 3KLMX 4TVOA 2VHYA 4TRNA 5EJ2A 4ZICA 3JQAD 1Y7TA 1JKIA 2HMSA 1P33A 1UDBA 1SO8A 4W9NA 3OH8A 2HKIA 2Z1MA 3T7EA 4NU6A 1E7SA 1DHTA 2HJSA 2CFCA 3E1KA 3WFJA 4GX0A 4EUFA 4YT5A 1GPDG 3AY3A 4R54A 4XYBA 2DTXA 1SAYA 2IXBA 3K9QO 5KOIA 4ND1A 2X9VA 3K92A 1MC4A 3ZWWA 2W2LD 2TMGA 4CLOB 2AEJA 5TRTA 2GLXA 3F4BA 4QSMA 4L75A 1HDYA 4L76A 4KDEA 2ZIZA 5TJ9A 2VYNA 4JK3A 4JP2A 3Q9NA 3FSRA 5JSFA 3ZWPA 3DHYA 5AVOA 2FMUA 5TC4A 4CM1A 1UDAA 2G76A 1QYXA 4PVCA 3R3JA 4XEHA 4WE3A 3KYDB 1D1TA 1UXHA 1ML3A 4ALNA 3N7UA 4R01A 1IPFA 2XXJA 1O89A 5DCUA 1ISGA 2Q4BA 3DAGA 5HM8A 2AMFA 4ZVVA 4PG8A 3DWFA 1HE3A 1RM3A 2B37A 3FNFA 4GMFA 2D8AA 1BWSA 3NDJA 4CMAA 3PVZA 1CF2O 3OETA 5T57A 1B16A 1VJ0A 2X0RA 3AM3A 4Y6PA 4KWHA 3RJ5A 1X15A 1A4UA 3VPHA 1BDMA 3VZPA 1AGNA 1EVIA 2D59A 3JD0A 1TLTA 3NT5A 3ZWMA 4OMUA 4CMGA 3H7AA 1NFQA 5A05A 1ONPA 1E3WA 3H9QA 2ZYGA 5L53A 1LBEA 4JN6B 5THQA 4B4OA 3I3OA 3A28A 3DOOA 1HLDA 3BTVA 1Z75A 5KIAA 4JBHA 1Y5MA 4N54A 3BMNA 1GADO 5DULA 2Y67A 1NHWA 1DXYA 1N2SA 1LEHA 4BMNA 2AE1A 3L4SO 2WD7A 3ADOA 4J7UA 4YJFA 2A92A 2RHRA 4AJNA 4LK3A 3VPSA 2ZB4A 4QUKA 2RBEA 4IGFA 1DFGA 4MVJP 1ID1A 2FPGA 3ONEA 4Y8VA 5FFFA 2HMUA 1X7HA 1KETA 1WZIA 2BFAA 3ZWOA 4E0BA 1ADFA 4WLOA 2VHZA 1JVBA 1KBZA 3BMOB 4ESOA 1E3EA 3F9IA 4RF2A 3QHAA 3PTZA 2HJRA 1YQGA 1PWZA 1YWGO 2AXQA 3K2EA 4UVHA 1UXJA 3F1KA 4EBFA 1AXGA 4RQUA 2EEZA 1JA9A 3IP1A 4GVLA 3VTFA 2ILTA 2W8ZA 4R5MA 4H7PA 3VH3A 5JO9A 3HNPA 3DZJA 3WXBA 3KM0A 1I36A 1A71A 5JAMA 1Z82A 2QRKA 3D3EA 5DOZA 3L6EA 2GASA 4NI5A 5L9AA 1XDWA 3TFQA 4I5EA 2FHSA 4FSHA 3ICPA 3GVIA 4P38A 2CUKA 5KVVA 2VRBA 3VVCA 2I3GA 2ZCVA 3TF5A 2AQHA 2D4AA 4IDEA 4CMKA 1O5IA 1XQ6A 2GYYA 4ZD6A 1RYEA 4J1NA 1FF9A 1VM6A 2HRZA 3PQEA 3Q3CA 4XQ9A 4DA9A 1DAOA 4B7CA 1DJQA 3C1AA 4R9SA 4EUEA 1PL8A 4OGWA 4J9UE 1R0SA 1RWBA 2HQ1A 4HWKA 3UHAA 1DIAA 1DIRA 1ADCA 3CZMA 1AHHA 4CM4B 2JCXA 4ND5A 1NR1A 1JVSA 5JC8A 3QVSA 4S1VA 3B20A 3KZVA 3PEFA 1LSUA 4MVJD 3GEGA 4R69A 3WBFA 4CR7A 3ZWVA 2NTVA 3AUUA 5BSEA 1VI2A 3RKUA 4CMJA 1Y5RA 3PGXA 1MG5A 1U5CA 4NDNE 5J23A 1X7DA 1GYQA 2EKQA 1TA4A 3FBTA 1Q7GA 4EW6A 3O26A 3FI9A 4NZ9A 4IDFA 1HDCA 2J5RA 1I3NA 3LK7A 1D1SA 5C37A 4B8WA 3KRTA 1LRLA 5EIOA 4IJUA 3K73O 1QKIA 1VJ1A 2HLPA 4ALKA 4RCVA 1G0NA 2FPIA 4FW8A 2O3RA 1VC2A 2VYND 3ZWAA 3KSDO 3BMNB 1PWXA 3I52A 4I1IA 2X0NA 4ZQBA 5DOVA 1JTVA 3K30A 4AJ1A 2EGHA 2WD7B 4YJFB 4J49A 1E3SA 1VL0A 2C54A 2ZTUA 3F46A 1P9LA 5TF4A 3RVDA 4ND2A 3HSKA 4WOKA 3P5SA 4G65A 1GD1O 1YB5A 3E48A 3FNHA 1EFKA 1P3DA 4J16A 2VYVA 4YJDA 1OFGA 1XG5A 2X86A 4FD3A 3QY9A 3V8BA 3VTZA 3CPSA 4Q3NA 3GNSA 3BHMA 1M6HA 4O5OA 2CZCA 3OA2A 5BR7A 3QQPA 1U9JA 3WBBA 1KY5A 1PZGA 2LDXA 4MO2A 2FOIA 3U4CA 4K6FA 4YQYA 2O4CA 1YBVA 3U3XA 1EK5A 1BDBA 2V65A 2JL1A 4A27A 3GN2A 2PR2A 4PLYA 3VPGA 1IL0A 2GZ2A 3FR7A 3IKVA 2I66A 4RQTA 4IDDA 5BSFA 5DBFA 2WJPA 4CV2A 4XR4A 4DGSA 3JQBA 8LDHA 4BO5A 4FB5A 2PWZA 4N5MA 4LSMA 5EPOA 4MOWA 1ADGA 2ZQZA 4ZGWA 4MVJH 2VUSA 1JWAB 1C0PA 2HUNA 3QWHA 4QTZA 3JTMA 1DDOA 2B5WA 2RHCA 3GQVA 4CMIA 4G81A 2DBRA 5I7SA 2J3HA 1YJ8A 2Y0DA 2GN8A 1HL3A 1P45A 4BGEA 5BT9A 3JQ9C 4ZU3A 1O94A 4LN1A 4PVDA 4XQCA 4CV3A 1V3TA 4OOEA 2JHFA 5L40A 2JAHA 3I4FA 4BNXA 4DMMA 8ADHA 4XB1A 1LUAA 3I4CA 2D0IA 5JS6A 4YVFA 5A02A 2J8ZA 2J3IA 1B8UA 1C1DA 1O6ZA 4WECA 4IJVA 2CF6A 1A7AA 1WDKA 4HBGA 2B69A 2RAFA 3HE3A 1X14A 4YT8A 3GOHA 2P9EA 3I9JA 5I7FA 1YO6A 3MOGA 3H65A 4GX5A 4AJPA 4BB6A 1GZ6A 2Q2QA 4A7PA 2Z95A 3PRJA 2EJVA 3GT0A 4J0FA 5TQVA 3GAFA 1ZBQA 2VZ0A 2Y1EA 2A35A 4E33A 2VQ3A 2XXBA 5G0VA 2I67A 1LX6A 2O3QA 1QXSA 3QWFA 5JE8A 4B79A 2AG8A 1PJQA 5COBA 2DTEA 4IZHA 2Q45A 1XELA 2YYYA 4N18A 2V7PA 1NAIA 1ISFA 3D7LA 3JD4A 1ADBA 2YHIA 2ZYAA 2YY7A 1OMOA 5FWNA 1WMAA 2ZJ0A 3I6QA 4GBJA 2X0JA 3COSA 3NT2A 4B3HA 4ND4A 1OAAA 4KOAA 2DU8A 1J4AA 5L4LA 2OO5A 3H9UA 3IMFA 3JQFA 4HKTA 4M55A 3GPIA 5KJCA 4CLHA 3U09A 2CVZA 2PGDA 4J91A 3EAGA 2QYSA 2C29D 1N5DA 2GRAA 3Q0EA 4E12A 1TEHA 2P9GA 4JJIA 3FCOA 3L4BC 4DRYA 1AHIA 2NLOA 3BMQA 1J6UA 1T26A 3V2HA 3RSHA 1HDZA 4BNKA 1XKQA 4OQYA 1WDMA 3ENNA 1D3AA 4E31A 4LVUA 1DIBA 1A5ZA 3GDGA 2OZPA 2QIOA 2FRDA 2VCYA 1U7TA 3RJ9A 3FRJA 3OF2A 4WCFC 4CM5A 5A3VA 1YL6A 1P1KA 4NBWA 4O63O 2I3AA 1Z45A 1W0CA 3PIDA 4OYRA 3DBVO 3GRKA 2DC1A 3GR6A 5G0SA 3ZNOA 1DRVA 4Y67A 3AOGA 3CKYA 3WTCA 1U1IA 3F3SA 2GUGA 1F8FA 1NVTA 3ITKA 4QT0A 3SC6A 3WGIA 1PZEA 1P77A 3KXDA 4CUZA 4HP8A 1FMCA 1N8KA 4RVSA 1XLTA 2BI7A 3C85A 1B8VA 3FF4A 4CMIB 1XA0A 3C1OA 3ZV6A 2VYVD 4WNIA 3IP3A 2I65A 3NV9A 2BFOA 2V6BA 5A9SA 1M6WA 4R3NA 1ZNQO 1NASA 2DLDA 2X8LA 5HWSA 2FZWA 1EZ4A 1H94A 4GX2A 3TRIA 5I9LA 1C1DB 1LJ8A 1QLHA 5GZ6A 1GCUA 2CMDA 2Y93A 1DLJA 4LCEA 1ZJZA 2NQTA 1NHGA 3ASVA 1IUKA 2X22A 4GGOA 5L95A 2PV7A 4U7WA 3FWNA 2X0IA 4BNWA 4DXHA 3PPIA 1JKJA 1R37A 2A94A 3RUAA 2EKLA 2R00C 5TX7A 5EQFA 2GSDA 1VRWA 1HF3A 4NJMA 1ZUD1 1E3LA 4WLVA 4BQPA 4DLAA 2VNAA 2HDHA 1HDRA 3QP9A 5FEUA 4YAEA 1QSGA 3D5TA 1UXIA 4FC6A 3FTPA 3L6OO 4OKNA 1B26A 4L8VA 1A4IA 4E21A 3ZV5A 3WSWA 4Y6RA 5F1PA 4GX1A 4MIOA 2GERA 1E6EA 2QG4A 1DC4A 2YHIB 3RBXA 3TZ6A 2PNFA 2C2YA 3GK3A 5A5FA 3ZWNA 4J3FA 4GQAA 3BXXA 1CQIA 3GZNA 5H83A 3OMLA 4HV4A 1AXEA 3OIDA 3S1LA 5T67A 3EMKA 2HMTA 1FXSA 4RPJA 5ENVA 2FR8A 4BKRA 2GF2A 1UXKA 5IDXA 3M2PA 5TSDA 3UH1A 3B6ZA 2DUWA 1XU7A 2G1UA 2Y1DA 4WUVA 4GWGA 5DP1A 1U28A 4LVCA 2PTGA 3DZBA 4XGKA 1LDYA 4MVJG 1K89A 5LDGA 1EQ2A 5CDUA 2VRCA 3H5NA 2IYPA 2F1KA 1WDLA 2ZB7A 3BYZA 3DZIA 1I10A 1V8BA 5JPIA 4XRGA 4O0LA 3PLRA 4IXTA 4JGBA 4JROA 5KKCA 4FC7A 4JJGA 3BMQB 2POQX 3PI7A 4Z9XA 4BO7A 3PK0A 1R4NA 1T2DA 3S8MA 2HMVA 1BXGA 4CM8A 1PJCA 3RASA 4ALLA 3WOHA 4RPKA 2QZZA 3QW2A 5IN4A 1ZVMA 3TWOA 3IL2A 4WJZA 1PGJA 1OBFO 4D3SA 5L51A 3AOEC 3MEQA 4IZIA 3H9EO 1MV8A 5DDIP 4BMSA 3VH2A 4JP3A 3U5TA 1CJCA 4UVGA 2Q1UA 3W4KA 3WGHA 1X1EA 5DZSA 1K3TA 3CSDA 3DOJA 4J4BA 1DRUA 3HUDA 4UAGA 4FFOA 1H93A 1QG6A 3RUCA 2O3SA 1TT5A 3GUCA 1BSVA 3OEWA 2B5VA 4DYDA 3EGOA 2HMWA 3R0IA 2X5JO 3GFGA 3KSZO 4MVJF 4P22A 5A9SB 1NFRA 1UP6A 4C7KA 3NDIA 4RV9A 1T2EA 4BNZA 1V35A 2BMAA 3GVXA 3UF0A 5A1TA 1K6JA 3KB6A 1HE4A 3L07A 3GUYA 5DNAA 1GFSA 4AJ2A 4XGIA 1SOWA 4Q3CA 2H63A 3ICCA 4OKIA 3K6JA 4C4OA 2Y68A 3PDJA 3UOGA 1C0IA 4RPLA 5I7VA 4WLFA 5LDHA 3QRWA 1FDSA 2EERA 1JWBB 1NPDA 2JD2A 1H0KA 3GZ4A 1DHRA 1ENYA 2GN4A 3PHIA 2FPPA 3I6IA 1X1TA 3BIOA 1SMKA 3G1TA 4K28A 4NJMB 4CODB 1E92A 2G5CA 3KUXA 1MA0A 4ALJA 6LDHA 3QJ5A 1GR0A 5G4KA 2EW2A 1YQDA 1K6XA 3SXPA 1EBUA 1TB4A 4MP3A 2DVMA 3DAFA 4IMRA 2DM6A 4AJJA 4XYLA 3EY4A 3O9ZA 2C07A 1NNUA 3NRCA 2NTJA 1U4SA 2LDBA 1LSJA 4BNIA 5KJEA 4UEOA 3CIFA 3WIEA 2GD1O 1I33A 1GL3A 3OFSA 4GKVA 4IXWA 5K0ZA 3DEYX 1Y81A 2QW8A 1V3VA 1Y8QA 3GZNB 1BG6A 5U9CA 2CVOA 1QLJA 1MC5A 1GV0A 4JNKA 2OP1A 4FN4A 3WGQA 3GY0A 1ZK0A 3ZV3A 2WTBA 2QRLA 3TSCA 5FI3A 3PHGA 3CXRA 3P2OA 4J1QA 3RUIA 4B4UA 3KBOA 3ZV4A 4F46A 1UUFA 1HZZA 1Y9EA 1V9LA 1NQTA 3C7DB 5B1YA 1WLYA 2EW8A 3C24A 3KYBA 3GMSA 5JC1A 5EINA 4LSWA 4GPD1 4YT4A 2PZKA 3ZNPA 1YDWA 1D4FA 3VH4A 4R16A 1UZLA 5JDCA 1DPGA 4CLXA 1PSDA 5AXAA 3QE3A 5THKA 4YJGA 3BHJA 1ULSA 3KV3O 1R4NB 2YDXA 3FPLA 2GR9A 3L0DA 4U6SA 5CEFA 4ZQHA 4GMGA 2Q50A 4N5LA 4YYZA 1M76A 1BXGB 4CM8B 1YH3A 4A03A 2Y1OA 4ID9A 4DYVA 3NX4A 3PJDA 4UREA 3LQFA 4FFPA 1F14A 4GVXA 3WLFA 5L45A 4EZBA 4HXYA 5HS4A 2GDZA 1KOLA 2NACA 3ONFA 2H5LA 5F5LA 2H9IA 3MOIA 3H2ZA 4YDRA 1HSOA 4FPXA 4OSPA 5KKAA 1JAXA 2CDBA 3E9NA 1UR5A 1U8XX 3C8MA 2O2SA 3NTRA 2NVBA 4WEOA 2PZLA 3NEPX 4E5MA 4YACA 4A5OA 3ZWXA 1Y6JA 1U3VA 3I83A 3LLSA 4FQ8A 2O23A 3NUGA 3R3SA 4BO8A 1HDXA 1B2LA 4BNFA 5ER6A 1TT5B 2VRCD 5IZCC 1LDMA 3RBZA 1SEVA 3GA0A 3ON5A 4RPGA 1Q2XA 1X0XA 1EUZA 4Z0PA 4YXFA 4LRTB 2YHUA 1V3UA 1EE2A 4YAKA 5JAQA 3RUFA 4CV0A 1C1XA 4DQUA 1YBAA 3ETGA 1E7RA 3MWDB 3B70A 3PQDA 3I9MA 2NADA 4XJSA 1BVRA 1LRJA 2WE7A 3PFWO 3TPCA 4BNGA 4QX6A 1ZK2A 3VPXA 4BO6A 1U3UA 1PJTA 2GN9A 1H6DA 3WMXA 5C3MA 4DMLA 4OO3A 1MP0A 4D0RA 3CINA 4AG3A 4TSKA 2UUOA 3HN7A 4CV1A 2CDAA 2HK8A 3LF2A 1BXZA 1BHSA 1A7KA 1NPYA 3CZRA 4CQMA 1GUFA 4PZEA 4G5HA 2C20A 3AM5A 2UDPA 2C7GA 1I2ZA 2EF1A 1ZXLA 2OFPA 3GF4A 4OXKA 3NGLA 2AEFA 4WASA 3F5SA 3WGOA 4CMEC 2IZ0A 1UJMA 2WEKA 5G4KB 1C0KA 3S2EA 4O59O 2DBQA 3OBBA 4ZA2A 3ZWYA 5B4TA 1YBMA 3ZNQA 4EUHA 4E3ZA 3ZU3A 2Q49A 2ZTVA 3ZGYA 4M87A 4ZQEA 2Y66A 5JCJA 5K6AA 3KOUA 2H6EA 3E5MA 3DAPA 3EHEA 4Y6SA 1ZCJA 1Y8QB 3EYWA 3KVOA 4W7HA 4BUCA 1ZH8A 3WWYA 4MPDA 2ZK7A 3K96A 5TT1A 1QMGA 1WP4A 4RORA 3VH1A 1A72A 2FSSA 4P4NA 1LLDA 2Z1NA 3OM9A 1F8GA 1I0ZA 3PDUA 2VZ8A 4RVHA 1YL7A 2D5CA 3JCZA 3GVPA 3I9OA 3D4PA 3A1NA 4J9VA 3IC5A 5CPFA 1ZEJA 3V5NA 3ZI0A 1RJWA 5BSGA 3L9WA 1Z7BA 2Q1TA 3DXFA 3RC9A 1G6KA 1N7GA 5A5EA 3S2FA 3MTGA 4NK4A 5C7OO 2DUUA 2WYUA 2FN7A 4YJGB 5DT9A 3SLGA 1EVZA 5JAZA 4R1TA 3RWBA 1PU2A 3GLQA 4EEZA 4H3VA 4K9DA 2P4HX 2BKAA 3E9MA 3HDQA 2Y1GA 4DBVO 1HRDA 4TROA 1GPJA 3RUDA 4CMCA 1E1NA 3RI3A 3E6AA 1AUPA 4RDHA 1I01A 3B1FA 1A27A 5TNXA 3HN2A 4TMFA 3JYLA 2FY8A 1E5LA 4QO7A 4OM8A 2QZ9A 2NUAA 5IXYA 4FGSA 1ZSNA 2FR0A 1CEQA 3V1TC 4FJ2A 1GU7A 3HB5X 3N58A 3WYCA 4IDGA 3U49A 4NNJA 3IUSA 4UUMA 1SEPA 5A03A 3D1LA 4BS9A 4LCJA 4HFRA 3QSGA 3AUTA 4R41A 1JW9B 3NKLA 1LDEA 3O8QA 2ZB3A 3QV1A 4BQRA 4RGBA 3DHNA 4BO0A 4CMHA 4BNNA 2NV6A 1C1XB 5IXSA 4F6LA 2Q4EA 5G0WA 4EJ6A 1BW9A 1PQWA 4DIFA 2A4KA 1UZMA 2BGMA 3NDRA 1ZJYA 3DMTC 3L4BA 1GDHA 4XQEA 2P9CA 2CY0A 5F1OA 4E30A 1ZFNA 5IDQA 4RJTA 4JQCA 2NVUA 1X0VA 1JAYA 2PZMA 2C5AA 3D4NA 1T2AA 1E3WB 4U0JA 4D0SA 4W9NC 4CQMB 4F6CA 4RLSA 1B0AA 3MJSA 1NM5A 3ZWBA 4WLUA 3AK4A 4AJEA 3O38A 3ZHXA 4U6QA 2YUTA 2OGUA 3UKOA 1HYEA 5U1PA 2C0CA 1N9GA 1YGYA 2DT5A 2VTDA 2Y99A 2YFHA 2I6TA 1DLIA 1CETA 2NU6A 3O4RA 4PZDA 5FI5A 1OI7A 1WXDA 1EFLA 4Q3EA 4D79A 4E5YA 1GEGA 3TZQA 1I24A 2WM3A 5A9RA 5BQFA 1U2DA 2B36A 5CG1A 3M1AA 5DCWA 4BO1A 1NFFA 1VJTA 3OA0A 3F6YA 2BLLA 1ENZA 4C7JA 1DAPA 1BMDA 1IZ9A 3GEMA 3EK2A 5JDIA 2YQ4A 3O03A 4I5GA 4CL8A 3K2BA 3M1LA 4DWVA 2O3TA 1T4BA 4FFNA 4L4RA 2VTEA 4I08A 4PLCA 6ADHA 2Y0CA 4EYEA 1EUDA 5EL0A 3VDRA 2B0JA 2FSVA 1P74A 1PGOA 1PJ2A 5H82A 1P0FA 4CQMD 5JMWA 3F5QA 3I9LA 4J43A 5G0UA 2Z5LA 3W8EA 1DJNA 4HUJA 3GG9A 2VWGA 1HETA 3N74A 5KJFA 4ITUA 1B3RA 4BNJA 1YB1A 2P4QA 4R5HA 1QYDA 4S3MA 5BNFA 1PS9A 4U5QA 4PFJA 1MFPA 3F4LA 1YRLA 5JLAA 1T1SA 4Q3BA 2GO1A 5AOVA 5JCJD 3P2YA 5F21A 3OSUA 2JCVA 3IOYA 5CPBA 4PLWA 4PLFA 3ZH2A 3AWDA 4FCCA 5KVQA 4E5PA 3DZGA 4XB2A 3VHRA 1N92A 3WWZA 1MX3A 1SB9A 1YE3A 2C59A 2NU8A 3H6KA 4J1SA 3VZRA 2X9NA 4A26A 3FWZA 4WOJA 3WX0A 2Y1CA 1ZSVA 4WGGA 4HY3A 3EW7A 3KEQA 4DREA 3HG7A 3OQ6A 3JQEA 1ISHA 3SJUA 3ZN2A 4A0SA 3DBLA 3S2IA 2YJZA 3O8QB 3AI1A 5CP8A 1WVGA 2IEBA 4J2OA 2Q46A 2VT3A 4WCDA 1I3LA 5T64A 3S55A 3Q9UA 4BNTA 4NU5A 1GZ3A 4YCAA 2IZZA 1BW9B 4BGIA 1HYGA 1VL8A 3SBOA 1E7YA 2RCYA 2Q2WA 4CLDA 1YB4A 4HADA 2HRBA 2PH5A 2WWRA 1ZK1A 1IOLA 1YS4A 4B4VA 2DTDA 1Q0HA 3V1UA 1ZIDA 4IINA 2WMDA 3FR8A 2IRWA 2NVUB 3QIVA 3UCXA 4KTTE 5F1KA 2BH9A 3TJRA 5HS6A 1ZZEA 3NYWA 1KYQA 3C1TA 4XJTA 3WQQA 4IS2A 3G1UA 5TJHA 4BO9A 2I5PO 1PL7A 1N9GB 3DDNA 3HDHA 4CM7A 1DIHA 1NVMB 5IZ4A 1ZW1A 4DC1A 3BTSA 4DBZA 3NT4A 5I7EA 1BGVA 5T8KC 5JFOA 4E4YA 1OOEA 1WZEA 3EZYA 4RO0A 2Q1WA 3LVFO 1IULA 2VHXA 2NNLD 4P8RA 4BNVA 5A4DA 3PYMA 4YAIA 3I9NA 5B4UA 4GWKA 4MINA 1YL5A 4MDHA 4CQLA 1ARZA 3UFXA 4B7UA 1U2GA 2E49A 3PIIA 4I8XA 1Q0LA 1ONNA 4YJHA 5I9MA 4RF3A 3A4VA 3JQDA 3AU8A 3WGZA 4BB5A 4GSKA 1HDGO 4M49A 4NIMA 1IHYA 1JN0A 4XDYA 5ES3A 2BGLA 4GLOA 4R1UA 1T25A 3PHJA 3KSUA 3K31A 1NP3A 3BMCA 2YQ5A 2X7HA 2G0TA 3BTOA 3EZLA 1HWYA 4IMPA 3PYXA 4KP7A 3ETEA 4YRBA 3IKTA 2J3KA 1NVGA 4RVUA 4UVDA 4RDIA 3K5PA 4IPTA 2IODA 3KLPX 3OEYA 5GZ3A 4E2WA 4F45A 2VHVA 4YPOA 4M89A 4A10A 3DZHA 4LMPA 4FJ0A 1GEEA 2AQKA 4XX0A 5EQDA 3DR3A 2Y1FA 3VPFA 1FJHA 1I2CA 1GUYA 2ZYDA 4WPGA 5BNTA 3JYPA 5JAIA 2GCGA 3OJLA 5CDSA 4QXMA 1KEVA 3WTBA 1AN9A 2VT2A 1LDNA 1PL6A 1YQXA 4JLWA 4FIZA 4J2HA 1K2WA 4KZPA 1VSVA 1Q7BA 2O2YA 2Q1SA 1XIVA 3W6UA 1SPXA 2AHRA 4RL6A 3DBLB 2VOEA 2PH3A 4PLHA 2JAPA 3BZUA 4ZRMA 4BHTA 4ALMA 1I30A 2VUUA 2IYOA 1A9ZA 1IPEA 3HZZA 4BKQA 2C2XA 2B35A 4YB8A 4YR9A 4J0EA 3VZQA 3WQRA 1C3VA 1Y1PA 1IY8A 4XIYA 3W8FA 5KCZA 1YKFA 3LC2O 1N1EA 4GSLA 1G0OA 2JHGA 3HQ4O 1D7OA 2GNAA 4UEJA 3X2FA 1HXHA 1DC5A 3AUSA 3D64A 1T2FA 3JQBC 2ZJ1A 4RLHA 2EG9A 5B4VA 4WNCA 3RIHA 4YA6A 1B8PA 4IIVA 1Q7CA 4JX8A 4BGVA 2AW5A 3LDHA 4II2A 4WK6A 4YBZA 1PJLA 4BO2A 5GY7A 2DQ4A 1WW8A 1ISIA 1M67A 1XCBA 4NFSA 1K0UA 4PLGA 3HB4X 4X54A 2JD1A 1NQ5A 3Q2IA 4IDAA 3JSAA 4IQ8A 4CUKA 1PJBA 5AXBA 1E6UA 2AEMA 3UN1A 3RU7A 4HNHA 5T5QA 1PJSA 1T1RA 2ET6A 4YRDA 3UCEA 5L7YA 3UICA 4R51A 4D43A 2WD8A 4UVEA 4ILKA 4Z9FA 3G3EA 1E7MA 1P1IA 4YJHB 3GGPA 2CD9A 3QVXA 4PLZA 2OP0A 3GHHA 5AYVA 3H9GA 4ONEA 3A9WA 2X58A 2VWPA 2JCYA 4J6FA 2O3JA 3BMCB 3U62A 2IE0A 4E5NA 2R6JA 3STHA 4D45A 3BHIA 2B4QA 4XYMA 3MJVA 3AY6A 3WGGA 3LYLA 1QR6A 4PLPA 2HO5A 3V2UA 5COQA 4I9HA 3ORFA 1TXGA 4DIOA 1RM5A 2IXAA 1W73A 4Z0HO 1Z6ZA 2OOSA 1W6UA 5IN5A 4YT2A 1PGQA 3INRA 4DC0A 3E8XA 3DZFA 1A9YA 3GDFA 2OBYA 2W4QA 3D4OA 2UV8A 2Y0EA 4TKLA 3IJPA 3TL3A 3GG2A 3IS3A 4M86A 1EVJA 1LC3A 1R6DA 3C7AA 1J0XO 1HLPA 3JQFC 3W6ZA 5BNIA 2XAAA 4L9RA 2VOJA 2X5KO 3ZNNA 3WJ7A 1LSOA 2BD0A 3A14A 1ORRA 4CM3A 1I8TA 4EEXA 1MG0A 3GNTA 4CL3A 3AI2A 1PZHA 3P7MA 1E1LA 4TRRA 3VDQA 1PR3A 1XSEA 5COAA 4BGUA 3AFMA 2RH4A 1EEHA 3Q11A 1HT0A 5G4LA 2D5AA 3ULKA 4B3IA 1NPTO 1MGOA 3IUPA 3M2TA 4URFA 3WB9A 2WDZA 4HX5A 1H2HA 2ZTLA 4JBIA 2J5QA 4L73A 4U0KA 3ZHZA 1W8DA 4UVIA 3ROKA 4DLLA 4I9UA 1YJQA 1IZ0A 1ULUA 2E37A 1FDTA 4D46A 4U8GA 1XQ1A 5KWEA 1R0KA 4JCOA 4YQZA 5KTKA 4EI2A 1H2BA 1M66A 3P19A 2NTNA 5FYDA 1U7HA 1J5PA 3W1VA 4QQRA 5A9TA 1E6WA 4W7IA 2JFHA 4BV9A 2PK3A 2P91A 1H6AA 2BHLA 3T4XA 4Y98A 1O0SA 5MDHA 1KVTA 3HHPA 2V6GA 4FR5A 3WFIA 2DFDA 1Q1NA 4TRMA 1B7GO 1IHXA 1WMBA 5B12A 1H9AA 1PS0A 2VWHA 2QYTA 3H2SA 4AL4A 3FPCA 3EUWA 1EBFA 3JV7A 3CEAA 1PTJA 5I8WA 1J49A 4UUNA 5JY6A 1SBYA 4R9RA 3Q2KA 1ZMOA 4E5KA 2EJWA 1TT7A 1PQUA 3UCFA 3W4IA 4BNMA 5CEEA 1DC3A 3AFNA 5IDYA 4PIVA 3GVCA 5TT0A 1XHLA 2O3UA 4NMHA 2G17A 1BXKA 4NBTA 4WKGA 3GMDA 3JYNA 2WYVA 3NAQA 3U4DA 3QLJA 4KTVE 2XF8A 1DFHA 1KVQA 1HZJA 4OAQA 3E9QA 1DRWA 2BFMA 3LT2A 1PEDA 1QRRA 3MJEA 3OIFA 4JJFA 2NM0A 4P4LA 4QFDA 4EJMA 1BTOA 3PFFA 5IF3A 5IJZA 1Y8RA 5FF9A 2P5UA 1ENPA 1ZEMA 2YZ7A 2ZB8A 2OORA 2EXXA 4RPHA 2OUIA 4YWJA 3OJEA 1KC3A 3VZSA 4MJLA 4FBGA 1RYDA 4KUEA 1LI4A 1GUZA 4R3WA 1E3JA 4B7XA 3CE6A 4AVYA 1JQBA 1DO8A 1X7GA 3SLKA 3LC7O 5IDWA 4Z3DA 4AJ4A 5JBIA 4IJWA 3ZU4A 2VHWA 1GZ4A 2X1HA 4CLEA 4FJ1A 2QQ5A 4DPMA 3UUWA 4OXYA 3WSVA 3CMMA 1YONA 4GH5A 4CM4A 3RKRA 3IIEA 3DFZA 4FS3A 1KC1A 4OL9A 1B14A 1UH5A 4FFMA 1DIGA 4J7CA 3DO5A 4Z0TA 4IUYA 2Y05A 4KQWA 4NK5A 9LDTA 4P4GA 4QECA 3FTNA 5ICSA 1C0LA 2P68A 1ZKMA 2AE2A 5I9NA 3VKVA 2GN6A 2Q3EA 3BA1A 4F3YA 3Q6IA 1CDOA 3ADPA 4JIGA 3TFOA 3PJFA 1EMDA 3W4JA 5L7TA 4TZKA 1GYPA 4BO4A 5HRUA 2YV2A 4GKBA 4E2XA 2TMDA 4NJOA 3DL2A 2BELA 1X13A 2O50A 4ND3A 1MUUA 3JQ9A 1O8CA 1NWCA 1R12A 4BKOA 7MDHA 3ZU2A 3PWSA 2EIHA 2W2KA 3PJEA 3H4VA 3WMWA 3RUEA 5JNLA 3SVTA 3JYOA 4ZRNA 4XYGA 2P5YA 1ZO8A 2YV1A 1MXFA 2FR1A 3TZHA 3LT4A 5ITVA 3ZW9A 4PG7A 4PZCA 1PGPA 2DFVA 4MP6A 4W99A 4LRSB 1E7WA 5JYEA 4J1TA 4GL4A 3I5MA 4ZQGA 5A04A 3G49A 3ROPA 2EHDA 3EC7A 2E4AA 3E03A 1GTMA 3KHUA 1ZMTA 4RZHA 1CRWG 1H9BA 9LDBA 4MVJE 4KUHA 4N5NA 4RF5A 2QHXA 3RD5A 4D3DA 4TZTA 3ETDA 4MKZA 2PLAA 4YTEA 4BIIA 4R68A 2YV3A 1GQQA 5CDYA 1QORA 2JD0A 2SCUA 2YW9A 4I5FA 3AW9A 1WWKA 2I99A 4IDCA 3I9KA 4EGFA 7ADHA 1ISMA 2WYWA 3AI3A 5ENDA 2GZ3A 3LC1O 4EDFA 1E5QA
chains in the Genus database with same CATH superfamily
4WSOA 1T34A 1L4FA 2G08A 2BSXA 5SZIA 3R7WA 1N75A 1PG5A 2JBAB 3DG9A 2A14A 3G6KA 3WHIA 4QOSA 5CVDA 5A4MS 1B6RA 1FFHA 2VDLB 3VHXA 1BJKA 3KQHA 2HBZA 1Z4OA 3DQZA 5KJ6A 1GDDA 2AF4C 4DA6A 1D09A 1RZRA 2AFHB 1BGXT 1ND5A 4K9OA 1A8QA 2BHRA 1ECBA 1NDQA 1Y4UA 4GKAA 5K3FA 3UJHA 3K9LA 3ZS8A 2IPAB 1ETHA 1FZQA 1U3DA 3FVQA 2OHIA 3IJRA 4G4JA 4YRQA 4F04A 1OZAA 1V8FA 1BWQA 3Q8XB 3BSYA 3GUZA 4L5CA 4OSOA 1J25A 1XZ8A 4QEDA 4RY8A 3RADC 3BL6A 5A7HA 4ZVTA 1PW5A 4MIYA 2VP9A 4V24A 5JAPA 2OCYC 5FUVA 3K6KA 3TBHA 3ZCXA 1RPTA 1T2CA 3DBHA 5ERGB 5JJIA 1VKNA 2PX6A 1M74A 2I4TA 5IHPA 2GZ1A 1ICEA 5FV7A 2B83A 4UJ5A 2WFLB 1NUPA 4EX6A 1ISRA 1KS9A 2FVXA 3VAAA 1MHTA 2FDRA 4U3JB 4V0QA 3A2KA 1QFJA 1U3WA 2AHOA 3R5TA 2AN5A 5FWYB 3RQSA 3DUWA 4KUGA 4PICA 3M6MD 4EFNA 3IELA 1I4LD 5FOWA 2K2WA 1MR3F 1OC2A 5GAJA 3AFIA 2W00A 4XI9A 1A82A 1YB7A 2O7QA 2RB5A 4WCFA 3HDJA 4YRCA 4DV0B 4B2PA 4XRRA 4LWQA 4ZVSA 2ZQYA 5KQGA 2REQB 4KFCA 4OGLA 4UASA 3VGJA 1VLLA 2SKEA 4K2AA 4LDNA 1XLWA 3VSEA 4JL6A 2FUKA 3WLLA 1Q0SA 3BC1A 4O33A 2WFZA 5EE0A 4LTDA 3KD2A 4DV7B 3IQWA 1NW8A 4WN3A 4HLUC 4YRAA 3DDSA 1PJ4A 2PKRA 4CM9A 1O9BA 3PSAA 2H7VA 2RH5A 3GO4A 1BRTA 4K2HA 4MRRA 4YXWA 4ZDIA 3EEFA 4IY1A 1OXVA 3M9LA 3QEMA 5EERA 1FYFA 2CXSA 4QRDA 2EOAA 2X4GA 3THOA 5KOHA 1QQAA 4BV3A 1UXGA 3VU3A 3QKSA 5D7NA 1QV6A 1QHHA 4O6VA 5I9SA 3PYLA 2QUIA 4GXRA 1I6KA 4YFVA 2B1JA 3LAWA 2WJ4A 2G1JA 1F12A 2E9SA 3HI4A 3S28A 1T24A 4NFHA 4C7OA 2NVWA 1WETA 2PZJA 4PSDA 1CY6A 2NO7A 1SC1A 1DBPA 1EKXA 1HSZA 1N9KA 2C42A 3KXIA 1PNOA 3OICA 3ZCRA 1HEUA 2FW9A 5FPHA 1V37A 2C7VA 4C5CA 5K0JA 4JI7B 1PDWA 1JPVA 1W4RA 3EH2A 1QGUA 2ADFA 3UW1A 2WT8A 4XFKA 2HUPA 3WYNA 4FNOA 2Q1YA 3AM4A 3ONDA 4OGFA 1UP4A 5IAGA 1AE1A 2OE2A 1AO0A 2G07A 2RHMA 3LUCA 4Q01A 4PLVA 4B3JA 2WW8A 3WQSB 3A3PA 2Y3IA 4LY3A 5E7JA 2LCQA 1E3DA 4QYXA 1XEWX 2V5UA 5AVJA 5IAJA 3GDOA 4GMHA 1TKBA 4YUXA 1T3TA 4XYEA 3PLNA 1EE1A 1E66A 5IN4A 3HBLA 2OXEA 1VE9A 1LLQA 1WU8A 1Y48E 1IIRA 4V3CA 2FZKA 2GGSA 1G42A 1W85A 3ROQA 1YHYA 3KTDA 1PR9A 4QWMA 2D5BA 2IYUA 3UM9A 4MSUA 3CMCO 1FFBA 1RZVA 1UT5A 2ZRFA 4RSGA 3IURA 1WCXA 4GMXA 4IHQA 4Y2TA 3A6HA 3G82C 3SDSA 2V3WA 4C01A 2GFHA 2DE0X 4RZIA 4DQVA 4TT3D 1QDEA 4LTMA 1LLFA 4MW6A 5FYQA 5JVDB 3Q3HA 4B9AA 4PNEA 1G59A 1ZHHA 2QTGA 2XUHA 3TIVA 2JJQA 4H17A 4QYMA 4RVCA 4DDHA 4MS1A 5FOUA 1YBFA 5BRNA 2YTZA 1KY4A 1MFZA 3MTEA 1DMRA 1KVUA 2JKVA 4PZPA 3AHGA 4HCJA 2C94A 3K2IA 1L4NA 2R2AA 3K5IA 4QBTA 2GPNA 1KEEB 1SH7A 1C9MA 3SR4A 5I7RA 1W49A 3M4NA 1CQWA 3TNJA 16PKA 1A7JA 3CT6A 2GEFA 3T5GA 1VIVA 2HA0A 3PWZA 5HKAA 2J0QA 4DLTA 3OSZA 4X84A 4UHEA 1KMCA 1G98A 5CVEA 3BSSA 3DHEA 4YR7A 2TMYA 1Z6YA 3E5RA 3AXTA 3D6FA 4Y9DA 2ZR0A 4AF6A 2QSUA 4DL9A 1OE0A 4I1OA 4F8YA 1SBTA 1DKOA 4QBHA 2CVQA 1E3MA 3Q1LA 4H0FA 3NHYA 4FEAA 4Q21A 1IJBA 2XMPA 1LLCA 3HFJA 4V0NA 3NGXA 4B76A 5JD5A 2JAQA 3ERCA 4H6XA 1ODTC 4J90A 1XRSB 2X6TA 3ANMA 5ARCA 3UXMA 4MQEA 3ETNA 2WAOA 4M60A 2F59A 2YHAA 3CBGA 3OIGA 1KHTA 4BL5A 2XMCA 3RHTA 4YIHA 3LPDA 2G0NA 4DEXA 4EJFA 2PKQP 5AM3A 5K05A 3ZY6A 2N3ZA 3LVQE 4O2AB 4UVHA 5E1BA 3QUCA 1Q3KA 1WZNA 1T1GA 3PNSA 4BQNA 3HJAA 3VJKA 3F6SA 5IAAA 4XIJA 3AKZA 1T1EA 2QX7A 5AWFC 5HHTA 3ITDA 4ZI5A 1E64A 3KR0A 1FYVA 3HXTA 3W0LB 1DC6A 4W8OA 4ESVA 3THYB 3AP2A 4KGZA 5CHEA 4W82A 1QP8A 1AUVA 3HVJA 3KETA 3GV0A 4BMXA 2HCTA 1Z8FA 3U3JA 4IKEA 2CV0A 4LJRA 4K9QA 1IM8A 1W9HA 3FN4A 3DV2A 4PS1A 3IRVA 4DG8A 4LGVA 2BI8A 3W3AD 4FHFA 1PT8A 4FZ3A 4N40A 2X15A 3DFUA 3ZIAD 1PQPA 1QJCA 1S4QA 1XQVA 4PLTA 2J0UB 4EB6A 1GAEO 5AXDA 1WQ1R 1T2UA 3INTA 3KXKA 4KE7A 4M38A 1MQ9A 3GBSA 3L02A 2VHTA 3GAMA 3DCJA 3GFBA 3OE5A 4MCIA 2WJJA 1WPRA 3WYEA 2NSYA 1DCTA 3ABIA 3QGMA 1M8KA 3M6IA 2PUHA 2RCNA 4DIDA 3TIIA 1QP4A 4MIEA 1TI7A 1XU9A 3JZFA 3K20A 4OXXA 3U0VA 4ARCA 1UPBA 4PE5B 10MHA 5FX2A 4R8SA 4V0ME 4WOCA 4AMUA 2F1IA 2BGTA 2N1BA 5F76A 4TWRA 5JWRA 3DZKA 4HR7A 2I8AA 2FXVA 3E3LA 5CLGA 1ODLA 1YDEA 3RYFB 2PRJA 1ZSYA 2A88A 2NYAA 4YNBA 3OY7A 2I91A 1MOSA 1XAGA 5E3JA 3FETA 3PZRA 5LQUA 1WCV1 3SVZA 1Z4LA 3HMKA 3JQCA 2YVKA 3JW8A 3UAGA 5IANA 3BILA 3ZU5A 5HNKA 3EEOA 4DWWA 3ND8A 1EU1A 2AUNA 1ZC3A 1BMQA 1Q1EA 1PSZA 2CNWA 2F7SA 1F3LA 2H59A 2HQOA 2NOAA 1T4DA 3L7BA 3PUVA 4JLMA 1VFPA 3E9EA 3GPDG 1U8FO 5AJUA 5HA5A 1JKFA 3CLSC 4Q7KA 6AT1A 1VB5A 3CRVA 4DADA 5CB6A 1KVRA 1WA5A 2W83A 3H13A 5D84A 5KSPA 3VFDA 3VZCA 1GZHB 1VHWA 3JQGA 3Q41A 4FT2A 1VOTA 3VM6A 4BX3A 2Y2VA 1O95D 1QFMA 2GAFA 2I1QA 2JIOA 2JGAA 2XA9A 2VUIB 1XXHE 4MKXA 1LTHR 1U2DC 3E27A 3ZDCA 2DQKA 3TW8B 4UTVA 1IB0A 2YFQA 2N9UA 3JQ8B 1EM6A 3LSYA 4QYTA 4RTNA 5DFAA 4CFSA 1L7QA 4LC1A 4MUAA 3M6UA 5IYZB 3EG9B 1OPXA 3GLUA 3ZZUA 5FUBA 4BB9A 2J6IA 1JQJC 4WVFA 1P7VA 5JDIC 5KYNA 3VJRA 1W4ZA 2AB0A 4CIWA 1V71A 3SZ3A 4GBGA 4Q3AA 2H1SA 4Q9AA 2P41A 1I3KA 3FBGA 1PD0A 2CV2A 5JECA 4PTLA 4KIJA 4UJ3A 4OIMA 2KLBA 3ZEIA 3IOMA 5LMZA 1GZ7A 3ILHA 4RLFA 4KK3A 1RKQA 4NCXA 1UBHS 3RFTA 1BS2A 1V4BA 3GN1A 3QWBA 1F06A 4L95C 5KPDA 1S2GA 1SD2A 1GPLA 3KOOA 3T9DA 3IHKA 5I01A 1UOEA 2G36A 2QZSA 1E77A 1CHNA 3PNBA 4X7MA 1CYEA 3UVEA 1Z6XA 1XZIA 3JU3A 1JU9A 4MWEA 3RC2A 1PKEA 4IVQA 5L3RA 1YIOA 2VTKA 3SHQA 1Q3TA 1PLKA 1F4PA 4HFJA 3QTBA 2VJKA 4C14A 3VKUA 3JVIA 3VKHA 4ZK6A 2J3EA 4KWIA 4XSVA 5FDFA 5AJZA 4AFNA 3V3TA 4DQXA 1KMMA 3I39X 3QU4A 4J03A 3IMGA 2NXCA 4PRLA 3WLEA 3JQAA 1BDIA 4K6CA 1ZNYA 4UEKA 1GRQA 2VHJA 1DX6A 5IBRA 1KEUA 2O8CB 2R1UA 1P80A 2FPOA 3U39A 4CIAA 1KSJA 2J7PD 2QTRA 3BWCA 4HH4A 5IDVA 2JJ2D 1RPNA 5HTOA 3TSWA 1BRMA 1XDGA 1QFZA 4MKFA 3B5JA 4IFIA 5AH0A 4XWGA 4LFBB 2V7EA 3GJSA 3GHYA 1P2SA 1QBKC 3I23A 4X90A 1BOOA 3QJGA 1MABA 2AS0A 2QM8A 2XQFA 1UAGA 5H81A 3VR6H 4ARZB 5JXWA 4GOLD 4HYYA 1WXQA 2CE7A 3HDTA 4WXHA 3KCQA 2H1WA 4NBVA 2QUBA 5JD4A 4BFWA 5KYXB 2OL4A 3KIPA 3PEUA 2CT8A 1ZHFA 5LXTB 5HIAA 3WA6A 1N77A 3W5SA 4GNKA 1YC5A 4YAJA 2AEEA 4ANFA 2VT7A 1JWLA 5ED0A 2GPYA 5JY1A 4JEHA 4C6TA 3R6DA 5J5AA 1ZJWA 3NVKI 1KEWA 4DG5A 2E82A 4R8LA 5JZSA 1PX0A 1A2OA 2J32A 3AV0B 3VBCA 4AICA 4B73A 3RCBA 1CDEA 1M0TA 1XBTA 1E2LA 2JJYA 4Y2VA 2IEDA 4UE6A 1JR4A 2BTOA 2XE6A 2PKYX 1S7CA 2B2CA 2WT4A 5AKGA 4JVSB 3EWSA 2H1LA 1JU4A 5AXCA 4JP5A 2YXPX 1TEVA 3KDSE 4OUDB 4XD2A 5CLJA 3HO1A 2FOXA 2PD6A 3TQSA 3EVGA 1PE0A 4LI0A 4Z86A 1KJWA 1HL7A 3E1GA 4A73A 4ALIA 4B09A 4B6GA 1MH9A 4CM6A 4PYJA 2ZBEA 3KZMA 4K88A 1GGJA 1N6PA 1XMIA 3F98A 4TXHA 1HRKA 3KP1A 4EW1A 5KOYA 3CH6A 3ST7A 2GHQA 4BNDA 1NIJA 3IVGA 4NE7A 4CXMA 2C4WA 1MAWA 4ZQFA 5HDQA 3IPXA 4ZT5A 2PUFA 1DTSA 3S0JA 3TDKA 5KAMA 4B3RB 1E4EB 3LBNA 1U4OA 5CA1B 2C58A 1NQAO 1IWPB 5DV9A 3ZKAA 3NGMA 2Z08A 3IUMA 3EASA 3IRUA 3EIHA 2IEYA 5KQLA 2RIRA 3JD2A 4R6WA 4LJLA 2JFGA 5M3BA 4E6EA 2OG2A 3X43A 4TRJA 1GAXA 1GFIA 1WD7A 2ZIWB 3GFFA 1SVIA 3HYNA 3U4IA 5B53A 3SJ7A 1DEHA 4FZ5A 3D3WB 1XZCA 2JLCA 4PG6A 3RYTC 5JS8A 4UNPA 3UGTA 2VNKA 1VJCA 5ULLA 2WR8A 3KCNA 4BX2A 1SG9A 4YRGA 3EXG1 2DETA 3NHFA 2P67A 5LB2A 4J07A 3GLHE 3C3JA 2HLDA 4OHPA 1G6HA 5TGDA 1HKUA 2VDMB 2QV0A 4ME6A 4OHFA 3TZKA 1XCPA 3ZZNA 3PZBA 2EKDA 3O7MA 2AA3A 4LHZA 2VATA 9ATCA 3O1LA 4QGBA 4HDCA 1SCJA 3R6WA 2V7BA 3PDIB 3U44A 1GNLA 4TZ6A 3BE4A 1KK1A 2UAGA 5EE1A 3C5HA 1SC6A 3TKAA 1EHCA 2ZR8A 3RT7A 2XTAA 3SG0A 1O4WA 4ROSA 2X4LA 3OU2A 4EA7A 2XNJA 2YX1A 1KEPA 3G8YA 1R64A 5BN3A 3GIDA 3RVLA 4DUPA 1RRFA 2YVQA 2ZTMA 3SEQA 1TCVA 8AT1A 3DOCA 3SSOA 3RYHA 2DT8A 4IOKA 5E1DA 5AJYA 4BP8A 3JWEA 1SVWA 1J23A 2CBGA 2FP4B 3L0IB 4ZVLA 4UBIA 4ZCTA 1KBOA 4QPPA 1D4ZA 3EW9A 5DYYA 2NWQA 2R68A 1MO6A 2WTNA 4F96A 3C3PA 4DV4B 4HZUA 5I47A 1XVUA 2IS4A 1W94A 2QN9A 2E89A 1AKMA 3PCRB 1EB9A 2QR2A 2A0UA 1YU9A 4D3YA 3WR5A 4TQ9A 1FFXA 2ILVA 5M04A 1R0LA 4MCHA 6PFKA 2BL4A 5EZ6B 4WKOA 4CVNA 4IDQA 5JD3A 3VR3D 1NJGA 1YJBA 3ASUA 2WE8A 5JYDA 1SCUA 3TMAA 2ZWMA 5L7WA 2HQBA 1LJLA 3EXHB 4LOJA 3W06A 3CG0A 1HOXA 3QITA 5FNVA 3WLKX 3W9UA 1IEWA 1MVLA 1WSDA 3AHCA 1ZK4A 2NTYC 3TXAA 4LGYA 5DGIA 3CLTC 2PEZA 5HIIA 3WNBA 3ECCA 1TUBB 3LP6A 1J06A 2QN7A 3QVJA 4CR6A 3LW7A 2KS6A 3VDNB 3OQBA 1E94E 1LK5A 4H7HA 5JO0A 3EVNA 4LF9B 4JLDA 3IQGX 3MHTA 3KLMX 5EXTA 2VHYA 2XDAA 2QD4A 1ONSA 4PAMA 3UC9A 4EHDA 4KE9A 2HMSA 2D2FA 1O7JA 1SO8A 4H31A 5LJIA 2HKIA 3NASA 2UYQA 4JXZA 4NU6A 2YOFA 1QGOA 4E3WA 3HB0A 4WERA 1LZLA 1N3IA 2WVHA 4TMXA 4UXJA 3UMCA 3V2IA 4GX0A 4B2YA 2XE7A 4EUFA 3H1TA 1DI0A 2R8OA 4R54A 1JV2B 1T6BY 3KU1A 1XYVA 1GG2A 3ZBQA 3BJZA 3R7FA 5AI4A 3WBJA 4KRGA 3K92A 3ZDYB 1Q57A 1UBTS 2AYXA 2HIAA 4RKFA 4U9HS 1VHDA 4UAVA 3UMMA 1W2WB 1ONBA 5FBWB 3F4BA 1DBSA 2FETA 4PZ9A 2QTCA 5EG5A 4L75A 3U60B 1KMNA 5BUCA 4R98A 1TGVA 5EY5B 5KYWB 1BZYA 3PEEA 1KFEB 3L4KA 1WCIA 2MYTA 3TSAA 5JSFA 1S89A 4NCBA 1ZN2A 2HOQA 4G4SO 5BWOA 1KZ7B 1R9JA 2AYZA 5DLPA 1UDAA 3VHQA 4CM1A 1VLQA 4WE3A 3ZEAA 2DKFA 2QY6A 3U56A 1ML3A 3A6EA 4BE9A 1AQJA 1IPFA 1O89A 2WU4A 3BB1A 5DCUA 1C7QA 1ISGA 2JGMA 4Z3OA 4JUBA 1E2HA 1G8MA 4X7PA 5HM8A 3ME5A 4FZRA 3TTYA 1Z8HA 3FOWA 5M7EA 5H0IA 3DWFA 2JZNA 2Q3FA 4FYPA 1X92A 4I1PA 1Z08A 3DB1A 3FNFA 3DR5A 4HAUA 1W47A 3G88A 1BWSA 3IDFA 4LJ8A 3PVZA 3EOBI 5DM2A 5T57A 3UUGA 4XVQA 1AT1A 4Y6PA 4KWHA 2H4XA 4B74A 1ZS9A 2IKSA 4MKHA 5BV8A 1X15A 3Q98A 1A4UA 3VPHA 1PP4A 1IRIA 4URYR 4C0QC 1KYVA 1FJGB 3ZWMA 3JD0A 1X7YA 2D59A 4N03A 5BQ3A 2R60A 1JG6A 4JJAA 2O6LA 4DS3A 1VE6A 4F21A 5D51S 3UOWA 4AS3A 1NFQA 2PSFA 5C8YB 5FR1A 3W5CA 2H4YA 5BR1A 3W5UA 2IXEA 2QI9C 3I3OA 5JU6A 3MAGA 3BTVA 4HDRA 1YR7A 1S3IA 1Z75A 5G3ZA 4AO8A 4J0KA 1AKYA 2XHEA 1E1CB 1VJGA 3GA5A 2PWBA 4OJTA 5DULA 2Y67A 1M2JA 1QYIA 3A4NA 3GWZA 4O3FA 4GOND 3NRJA 3N39C 1EWVA 1X1AA 2HA7A 1T3HA 2WD7A 1RI5A 3N7TA 3SYNA 2Q28A 5JTUA 2RHRA 1NBHA 1OTYA 3FZQA 4LK3A 1V16A 2ZB4A 5BT8A 4IGFA 4TMVA 2VG8A 3H16A 1ZM7A 3YASA 3VI4B 2FPGA 2GN2A 2OFWA 1UBMS 1FMLA 1WZIA 4NEHB 1SKMA 1G7CA 3GLTA 3N8HA 4WLOA 5AI9A 2J7KA 1XTZA 4HDSA 5D5QA 3O1HB 1CNMA 4N5IX 4GNRA 4RF2A 3PD7A 4O2AF 2HJRA 4MR7A 4ZO8A 4YRTA 1J8YF 1PWZA 5FCDA 2GAOA 1QIKA 3EG5A 1H2WA 1UXJA 1Z6TA 2ATIA 2JZOA 1AXGA 3FF1A 3FROA 3PHCA 4EBFA 1L5WA 2EEZA 4QOFA 2X1LA 4H7DA 4OHWA 4WXPA 2OT3B 3B2EA 3C6QA 3KJHA 4R5MA 5CR9A 1E96A 3QLTA 3OZSA 4JUIA 1N5OX 2I6UA 3GRRA 5CT9A 3VH3A 1NV8A 4C4RA 1RJDA 2YZ2A 4OK3A 2W2TA 1ZH6A 1P75A 3E7XA 3KQSA 3KM0A 1I36A 2B8JA 3AF1A 4JSYA 4MRNA 1DTEA 2B6NA 3MWYW 4DRXB 4EABA 1YI8A 2OPBA 4ESEA 3QOFA 3AERB 4MIKA 5DOZA 4X00A 3M4YA 5EJ7A 1JG7A 1P2BA 2GASA 4MKGA 4LJSA 3HDGA 4NI5A 5I7UA 3HVRA 2TSYB 3NVMB 3MMZA 4FSHA 3HDVA 5C4GB 2IWRA 4XVCA 3FOEC 5DI3B 4P38A 1L4LA 3IBGA 1J8MF 1AZWA 2CUKA 3OOHA 5AKYA 1VJDA 5KVVA 2VRBA 4S1PA 2ZCVA 3VVCA 5H16A 5AVYA 5JSZA 3D3QA 4CTOA 4RPCA 3AR4A 1NVKA 3EY9A 5BORA 3NKVA 5LWQA 4UUBA 1H23A 1NL3A 1YFZA 3P2IA 4ZANA 3F5DA 4BIMA 1DJQA 1X1DA 1RMYA 2XB8A 4W5JA 4EUEA 3PRKE 1EM8B 2PZGA 4WWHA 4EJSA 4NXNB 4HWKA 1Z0ZA 3UHAA 1JH8A 2GRUA 3CS3A 4L6CA 5I9TA 3RHSA 1K7XB 1ADCA 1TTHA 1PTJC 1SPBS 4MDEA 3DKIA 1U0BB 1GXSA 2C2KA 2HIGA 2DZDA 5DT2A 4WQMA 2Q6TA 4FR2A 4W7SA 3ZCTA 1J2UA 4TLCA 1NR1A 3I6YA 3LOUA 1PNVA 3ZDDA 2XUJA 1X9GA 2GBPA 4WRRA 2SECE 3WI7A 5C8DA 4YX9A 3B20A 3SHFA 1NV9A 3EUEA 4J0QA 4MVJD 3I05A 1ZCFA 4UC0A 5GOTA 4MR8B 1NLZA 1KY3A 4JYAB 3X2SA 2WTMA 4ZAYA 3ZWVA 4NARA 1ULHA 5F2NA 5KOJB 3AUUA 4JKOA 2EWVA 3V7YA 5BSEA 2DSTA 1B93A 2HQSA 3PUXA 3V6LA 3ZHCA 1Y5RA 2B8TA 4PPGA 4R7TA 3W9SA 3PGXA 5DNUA 3UK1A 4QJIA 2ZVDA 4DM7A 3NCHA 1YZHA 4O8CA 1MH1A 1CQPA 4GR4A 3RE1A 4Q3LA 3L6BA 3FI9A 3R41A 4NZ9A 1HQKA 4JKYA 4P32A 4F2PA 1MB0A 1RYFA 1KFKB 1C4XA 2JF0A 3LK7A 1D1SA 4MA4A 1ECGA 2GJ8A 4Y1RA 5C37A 2Z1DA 2GPBA 4OHXA 1TQ8A 3UJ9A 4CF3A 3K73O 1EXDA 1VJ1A 5EJ8A 3AM1A 4A6PA 4WX2B 1NF2A 2OORC 2EFYA 1ESDA 4YP5A 3PXAA 1TTQB 2VYND 3O8OA 1YV9A 4I1IA 1LFAA 1B00A 2X0NA 2P9FA 3TRFA 1JIXA 3ID6C 5DOVA 3F2VA 4MGIR 5LBUA 1K08A 4YJFB 4J49A 5EKUA 1E3SA 1QG4A 1AKVA 1H05A 2FW7A 5ALWA 4ABTA 5FPSA 2ZTUA 3CPHA 3BX1A 3TLKA 3VNQA 1YFLA 3BIJA 3IIMA 4R9NA 2GHIA 1PDVA 2XNKA 3P5SA 2XUAA 3FZGA 1T6XA 1CY4A 3E48A 4NYIQ 3FNHA 1EFKA 3R8XA 3SU8A 2PMFA 2VYVA 1RP7A 2XV1A 5ALYA 3QY9A 4Y1GA 5AMXA 4NS1A 2BMFA 4TN5A 5K8UA 5JRDS 3DVLA 1ZRSA 4G5GA 4KSCA 4KITB 4DNQA 2QVCA 3E35A 3OZFA 2ZJ5A 1DQSA 4TLMB 4MO2A 1BD3A 4KN9S 4LNHA 4PBRA 4YRZA 1HT1E 2B94A 2O4CA 3LX8A 3LY7A 3C7KA 1EK5A 4XJVA 2F64A 5D85A 2G63A 5ALDA 1YRQA 3U3XA 3DA8A 5EIWA 5K3EA 1L5HA 1QF7A 2V65A 3PQ5A 1J0BA 1BEUB 1SKBA 1YKGA 2JCSA 3AL3A 2ZXEA 3GN2A 4QYSA 4RA6A 2FAXA 3IKVA 4PXSA 4IDDA 2YMPA 4RQTA 1KI7A 1NMXA 4TMYA 5DBFA 1C1YA 2WJPA 5C31A 1DCFA 2XRYA 4GO1A 4RVNA 1KSGA 3QVUA 1VIAA 4D74A 4DGSA 2W42A 1VPEA 1MJ5A 4LSMA 4MOWA 3T5AA 1ADGA 1NF8A 2D7CA 1QX3A 2ZQZA 2VUSA 3IE2A 1JWAB 3Q2OA 4MWGA 3H5TA 1KH1A 3QWHA 3SS7X 4F56A 3IIIA 1X1QA 1YQQA 3KWJA 2RHCA 5AICA 4DT1B 1AKQA 2DBRA 4OQNA 2IYZA 1KE1A 2NYRA 2GN8A 5EMKA 1L9XA 1N2ZA 5LFAA 1B23P 2H1HA 2QAGB 2ZRBA 4LN1A 3WYFA 1X8XA 4PVDA 3NHPA 1ZIPA 1V3TA 4AYTA 1Y33E 1W1UA 4DMMA 3EC2A 2WOOA 5AK4A 1NE7A 3HKCA 1SRRA 2NP7A 1OB5A 1L0BA 1NOIA 3KPWA 3REFA 3SQMA 1GUAA 4ASUA 4IKOA 5DW0A 4EY8A 1USGA 2ZYTX 1BJRE 5CLQA 1M5RA 2H1CA 5DKFA 1ABFA 4HGZA 4II7A 4R9UC 4EMUA 4FWIB 4NESA 3TLAA 2A1TS 4DHEA 1UC4B 1X14A 3D5EA 4IHJB 2FFRA 3OHMA 3D2BA 3GOHA 3MAAC 3I9JA 1H3FA 4MWTA 3LBFA 3W3ZB 5I8PA 5I7FA 4RE6A 2XWSA 5DBEX 1CHDA 1YO6A 4V0SA 2W70A 1GU0A 2HBRA 1PV4A 1G9XA 3IUYA 1O9GA 4PQEA 4AJPA 1Q0TA 1WW2A 2V6JA 2JH3A 1KPIA 1RQPA 1XDBA 4N39A 2Y92A 2BF4A 3WGVA 1BX0A 1J5XA 1I1NA 2EJVA 3PRJA 1F8YA 4GOKA 3HGMA 4QRHA 5TQVA 5CA1F 3F5FA 4E33A 3SBEA 1JPNA 2A35A 1CCWA 2I6QA 2SHKA 2V9CA 3K0AA 2FQWA 2VQ3A 1VKJA 4LHEA 1OLSB 4PWZA 1T5BA 3RYCA 4C04A 5LA6A 3T1NA 1PJQA 5COBA 2J6HA 1BEZA 2I4NA 4IZHA 3SCZA 1FTNA 2V7PA 2IP1A 1ISFA 5K8TA 2H85A 1OZHA 3B38A 1ADBA 2YHIA 2ACVA 1D6NA 2GYWA 1K86A 2ZDGA 4R8MA 2BFBA 1PSWA 1YA6A 2Q8QA 1OKKD 2FPIB 2FWAA 2NO5A 1WMAA 2ZJ0A 4HL6A 4Q9LA 2ID7A 2QSJA 2X0JA 1ZWKA 1L5YA 3NT2A 1P5HA 2OGTA 4ND4A 3TCNA 5FTWA 2Q5OA 1UQUA 1FP2A 2AI3A 3BIXA 4LYYA 4UBNA 4X0EA 4WAUA 3SHVA 3U7RA 3WDMA 1ANKA 1J20A 4LWPA 2AFIA 5AR1A 1F2UA 3O5AA 4F4IA 4KREA 2Z8YA 1WL8A 2PA0A 3G2MA 1CB0A 4OP3A 4LGCA 1S5PA 3RABA 1ODKA 2CVZA 2PGDA 3F78A 2BPOA 5DRTA 3HJRA 4INZA 4CCYA 1RQLA 1FTGA 5AM4A 1A0OA 2QYSA 2PJZA 5BN4A 2C0PA 3FGNA 4B87A 1ZD4A 2BUCA 3L4BC 4LY6A 4AMVA 1AHIA 3L1HA 2NLOA 1VBKA 5BWMA 4WMLA 2GD6A 3TG2A 2QJWA 3ADBA 4GQIA 1R8YA 2AN3A 1E3QA 1Z83A 3QELA 4D9IA 4PR0A 1O54A 5BQXA 1MB9A 2OFFA 3PF8A 2IF0A 4DSUA 3USES 4MS3B 3PLAE 4KK4A 4ZEVA 3V46A 2I3BA 3PQCA 5IVKA 4OLFA 1MX9A 2ZJ8A 4L7VA 4MV9A 5BVGB 1RQ7A 4CM5A 3OF2A 2ZBPA 1FSZA 4P4SA 1QONA 1Z36A 4O63O 5LMUB 2UYGA 4OYRA 4R40A 4CEIA 3DE1X 3GRKA 3W8RA 1B2RA 2RGRA 4Y67A 4DQKA 5BXYA 1RXWA 3CKYA 4PHCA 1FEZA 3F3SA 3GU3A 3GPBA 1PX2A 2DCUA 1YQEA 1NVTA 4IKPA 3WGIA 2GYVA 4R1OA 5E4FA 5JALA 4HP8A 3GLIA 2UXDB 3A32A 4BZQA 3ILXA 3WP1B 3C85A 3QUSA 4BJHB 4CMIB 1JFLA 3HBAA 1ZDMA 3TQTA 1FXWA 1VHTA 1OQAA 4HLDA 4OYYA 2OYRA 4WNIA 3ZV6A 4AO7A 4A92A 4HJRA 2EFGA 1YCDA 4MZDA 1POXA 3A7DA 3NAGA 1KE2A 5D5HA 1Y98A 1BCRA 2RH9B 3MG9A 3HJHA 3DE3X 5HWSA 2FZWA 4GX2A 4RXTA 2WHPA 3AINA 3BGIA 4JDPA 4MYCA 5I9LA 2VH5R 1LJ8A 2GBGA 2UVQA 4O5AA 4E1VA 2Y93A 2Q07A 4JI6B 1JJBA 4CRWB 4HD8A 4LCEA 3P2EA 1IOWA 3ASVA 3VGPA 1IUKA 1NXWA 4EG6A 1TPYA 3KJIA 4CQNA 3R09A 2JIRA 1L7RA 2XYPA 1QS0B 2A94A 4LDAA 3R3XA 4OD0A 3CKLA 1Z4PX 5KPJA 2WUEA 4FYYA 1UKEA 2XMQA 4L22A 1JG1A 5DNDA 1FQWA 3DW3X 3K05A 5FLYA 3IHWA 2BMWA 2FH5B 2W6JD 3CTPA 4NAHA 2JDIA 2PRZA 3DPSA 4WXEA 2XZOA 5IJ0B 5JCOA 3D5TA 1Y1QA 1PL0A 3F7NA 3FTPA 1B26A 4I36A 1HGXA 1UDXA 2O1WA 3BGVA 3FX2A 2I2DA 2XJ9A 3KUUA 1E5TA 2C1EA 2GJ9A 2B4AA 1CIJA 1DBWA 3BXGA 2AFIE 2HW8A 2I87A 2B9EA 4KGDA 2FN8A 1DC4A 5BYBA 3NZEA 4XUDA 3V8QA 2FX2A 3TZ6A 3GP8A 4ZMRA 2FX3A 3BXXA 5H83A 4C9BA 2X4IA 3DT9A 1AQNA 2O59A 4JMLA 1FRQA 3A4IA 5T67A 4RPJA 1BX3A 4LIPD 4YUAA 5C1PA 1VGRA 3J81k 2RSLA 3M2PA 3ZW7A 5TSDA 5TQ2B 3UH1A 3RSZA 5KNDA 4UU7A 2Y1DA 5DP1A 3LO5A 4YMUA 1T29A 1YUBA 1G17A 1U28A 3AZPA 3I72A 2PTGA 4B43A 2OGWA 5BOVA 1OX4A 3LUHA 2VP6A 4NONA 3T7RA 2F1KA 3ETHA 3BYZA 3DZIA 4QGAA 2Q6LA 3ICQB 5JPIA 1PR5A 2WWYA 5C8XA 3FOFC 4OFZA 3QPAA 3TKLA 4O0LA 4JROA 1R0ZA 2RGAA 1TJNA 5JQGB 5KKCA 4G5OA 4HDAA 3TX2A 4BO7A 1YJAA 2A5LA 3WDKA 1JHRA 2EQAA 2OD7A 2ZB2A 3V1LA 4GP9A 1D5CA 1I3OA 1P1BA 3ONWA 2OEPA 2V7QA 3A0UA 3S8MA 1FTQA 2HMVA 3JATB 2H2FA 4ZO6A 4CM8A 1PJCA 1Z37A 2YWXA 3VYUB 2R8BA 3U4AA 1EZ1A 1OLUB 2Y1XA 5DXJA 4G24A 1HNZB 1TEZA 1LVUA 4RAQA 4YC7A 1OBFO 3KZOA 4ECAA 5TEWA 1R74A 4IZIA 4TUYA 3C97A 5DDIP 3O92A 3WYDA 4BMSA 1C3OA 2B7LA 4JUDX 2A57A 4C3ZA 1OYOA 3SXJA 2F1JA 2FGJA 1H3NA 3RGWS 2NO1A 4ENPA 1QTRA 2NV0A 1K6MA 3FHCB 4K46A 2WIFA 5YASA 3UTDA 3W4KA 5TPZD 3W5IA 2VPXA 1CJMA 1QHYA 1YVUA 3PQ4A 4HN2A 1QVVA 4CKCA 5HKKA 4HDMB 4J4BA 3HUUA 1CBUA 3HUDA 4DA8A 3HM9A 1FNBA 2BWJA 2M2IA 4UAGA 1DNPA 3PC8C 4HEA6 1NLUA 1QG6A 3RRMA 1GAQA 4PYQA 3OHPA 2YNMA 4FHEA 1RFGE 3KYIB 2HDOA 5BN5B 2DLCX 3FIUA 1MQ8B 2NYUA 5JH7B 3NCTA 1R6TA 2M9MA 1WHSA 3SIWA 4MVJF 1AGRA 4EARA 1EIZA 1UP6A 1H2EA 4C7KA 3WHLA 3MT9A 4IO0A 4DYDA 4RV9A 5F7JA 3DE0X 3MWDA 2BMAA 4F6RA 1KAGA 1L7NA 3BWXA 5DASA 3L7MA 5DNAA 2Y77A 2FRVA 2Z9CA 1SN7A 3L46A 4ENWA 1SOWA 4Q3CA 4WBSA 4YRNA 3MIZA 1DEXA 3HGTA 4AY2A 3L7LA 4FYWA 3W2EA 2IUEA 4RPLA 2DPXA 4X60A 4WLFA 1JRLA 4UM5A 2XHZA 5BQPA 3T5CA 2WKQA 1FDSA 4LOIA 1JKJB 3DXYA 4WY5A 1NPDA 3GZ4A 5K8JB 1OZFA 5FA5A 3GZTB 3C3WA 1GTVA 3N07A 1I4TD 3T54A 4S1NA 4XEUA 4NJMB 3G1TA 2VJNA 3BS4A 4UDXX 3OEHD 4FKZA 2VHEA 2G5CA 4Q15A 5K0TA 4MHTA 1XEWY 3L0ZA 2ZUFA 4LHXA 2XOKD 2YN2A 1FUKA 1N8NA 1QCCA 1YQDA 4P3YA 3OAAD 3SPXA 1HY3A 2GA9A 1TB4A 4KE6A 4B6EA 4C6SA 2FN3A 1U2SA 1SUSA 3WL3A 2PT9A 4IFEA 3STUA 2XITA 4I3GA 3ZR4B 1OXUA 1T4MA 3QJYA 2YY6A 3AF2A 4CWAA 1VLHA 2VDRB 3LDGA 4WKPA 5KVAA 5THXA 1J70A 3WIEA 1G20E 2Q6VA 3OFSA 4MYHA 4IXWA 3OU7A 1A04A 1T3ZA 4CDNA 1Z0UA 4HWGA 4ER5A 5U9CA 1OFUA 5FTKA 3C7TA 2XMBA 2I1LA 3H2YA 4JNKA 3EIQA 2UZ4A 3I01A 4PXAA 2MR6A 3ZV3A 1A5AB 2LV8A 2QP4A 2UZ0A 3PNKA 1JX6A 3JTEA 1VE1A 1ZW6A 3H19A 3P2OA 4J1QA 1L7AA 1N2JA 1XZDA 3IUQA 2V45A 3QOYA 5D00A 4BKMA 5CFQA 2UYHA 3ZJVA 2FCRA 3ZV4A 4Z8XA 3LX4A 1Y9EA 3E58A 5CB4A 1WLYA 5GIOE 1TKCA 1ZOLA 4EO4A 1OXBB 4KXMA 4GPD1 2PZKA 1T9CA 3ZNPA 1YDWA 1Z39A 1D4FA 1UANA 2D13A 2E7ZA 4P2GA 1K7FB 3SMVA 1ZR4A 1Z5UA 1BX1A 3QE3A 1H2AS 2Z30A 3CKMA 2O19A 3L92A 5ALJA 1BYUA 1R4NB 3AJ9A 1XDZA 2FSUA 2NSHA 3G0DA 5KTRA 1JR2A 4ZQHA 3LW8A 4KU4A 3ZE6A 1RPAA 1BXGB 3DVSX 4DJAA 5HK8A 4DYVA 3CX7A 3OX1A 3V7UA 3K1AB 2DECA 5FA6A 3L8GA 4GVXA 3WLFA 2P9JA 4BXOB 2IOFK 1P0QA 1RHKA 5ALGA 5HS4A 2GDZA 2NACA 4LI3X 4NYMQ 4RUKA 4B5LA 3UPTA 4IHAA 2E2WA 1J90A 2H5LA 4PINA 2H9IA 2YN4A 4YDRA 4KFUA 4OSPA 5F5LA 4KQGA 3COPA 4WJKB 2CDBA 2Q41A 5KKAA 4C4YA 1CS4C 1CF4A 4KN5A 1U8XX 4BYGA 3GOQA 4HLUA 3ESAA 1GU1A 3LXRA 4RMHA 5EGSA 1AQIA 4WEOA 4JJKA 3ESYA 5IYZA 4YACA 1YZNA 1C3XA 4LZJA 3G2HA 2IOFA 2HDNB 2R96A 3ZWXA 2IGTA 3I83A 1OAKA 3PQ6A 4QJ5A 1CQJB 1DOZA 3M6XA 1MAVA 2GPAA 3S2YA 2O23A 1XCLA 3NUGA 4RETA 1VIDA 1M2OB 1B2LA 1U0HC 2G7MC 1P18A 3Q5GA 3RBZA 1SEVA 1N2CB 3GA0A 4RPGA 3TLBA 1X0XA 2JI7A 3MT8A 4KLCA 1V3UA 3QE4A 1C1HA 5B57C 3FFBA 5LQSA 4GM0A 2FMTA 1YBAA 2GEBA 3SDZA 5K2OA 1GTJ1 3D8RA 4ZO4A 1VDZA 3B70A 3BRSA 3NWBA 2YMMA 2CHGA 3I9MA 1I7QB 2WE7A 3PFWO 1WCYA 1WV1A 2FB9A 1OGJA 3FAZA 5EPUA 1JEYA 5FULA 4JBNA 5BWBA 1PJTA 5CM9C 1H6DA 3WMXA 2AF3C 5C3MA 1CV2A 3UWKA 1JECA 4OO3A 5I4CA 2R5WA 1SUCA 4ZCRA 2H1FA 1G7SA 3CNQS 4F84A 3HL4A 1PVOA 1CRLA 2OWDA 2WFLA 3Q85A 4RMJA 1U7DA 4KQHA 1BXZA 1BHSA 2V7TA 3KVNA 5FBKA 2F6RA 4DLYA 5C2JB 1XKLA 3CZRA 1NSFA 3I8XA 1E4OA 4CQMA 4Q66C 1GUFA 4PZEA 2AZTA 4FIDA 1LH0A 3QPVA 4BP1A 3E0XA 1H2RS 3MD9A 4HWRA 4I4TB 4BU0A 2C7GA 4MQFB 3GLVA 1RYHA 2EF1A 3GF4A 4YRMA 2ZIAA 2BM9A 3A26A 3O4JA 1M10A 3WGOA 2WVAA 4TYYA 1TJ3A 4K9MA 2WEKA 4HB0A 1YR1A 5G4KB 1C0KA 5FBVB 1J9EA 4O59O 5JLJA