3Q9UA

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
138
Chain Sequence
ATRPIDGLTDEGIRETLTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKIEVVDLFVNPAKAWRFVAYAIKKGAKVVWFQYNTYYPLAARQAGLIIVANRCMMREHKRLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
molecule keywords CoA binding protein
total genus 38
structure length 138
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q9uA00
4FOOA 4I5GA 4Y6SA 5AXAA 4BS9A 3I3OA 1J49A 4DQVA 2YHUA 3JTMA 1PL7A 4UVEA 1ZSYA 3L07A 4UEOA 2J6IA 1T26A 3VPSA 4TKLA 3UUWA 1AGNA 5FYDA 3QVSA 3K2BA 1VL0A 2V6MA 1LUAA 3IIEA 1KEPA 2HK9A 3FNHA 2PLAA 2FOIA 4DYDA 3D5TA 4G2NA 2EEZA 4NG5A 1UP4A 1VC2A 5JMPA 3OM9A 1LU9A 3PJEA 3CTMA 1E5QA 3JD0A 4M1QA 4NMHA 4YTEA 3ROKA 5DP1A 1ADBA 1YDWA 2WWRA 4RPKA 3F1KA 1NASA 4UUPA 5TIIA 1YOVA 5CPBA 3V1TC 3RAJA 3RSHA 2DBQA 1JWAB 1LLDA 5CP8A 3JQFA 1XCBA 4L73A 1DXYA 5J23A 4MVJM 1B2LA 4WLNA 3UFXA 2CD9A 1RWBA 3GF4A 3OHSX 1VM6A 1HKUA 1ZZEA 4ZJUA 1U1IA 2PFGA 1CWUA 4EW6A 3PP8A 3F5SA 4DQXA 1I30A 2VN8A 2EGGA 2NADA 3R6DA 2X5OA 4IXTA 2E37A 1E3JA 3GK3A 4JGBA 3W8DA 4YT2A 5ER9A 1LDNA 2NU6A 1JQBA 3BIOA 1PJQA 4LSWA 3U9LA 3K30A 1TB4A 5TJ9A 1R4NA 4CV1A 3UICA 2Q1WA 3ZHXA 4CR6A 3BTSA 3IP3A 2HMTA 5BNFA 4E5MA 1PR3A 4OQZA 3GMSA 2X1HA 3IUSA 1XHLA 3LDHA 1E7SA 4E12A 3VZPA 5GMOA 3ZV5A 2GUGA 1GFSA 2PKRA 3GEDA 4D7AA 4EEZA 3PHLA 4A0SA 4BNIA 1IYZA 2C54A 1VSUA 3A14A 1F17A 2ZTMA 1K6JA 1U3VA 3UHAA 3U49A 3ZWNA 4CM3A 3EZLA 4XA8A 5A02A 2O3RA 2R2GA 2UUPA 1YOVB 4DPLA 3H9QA 3VH4A 1BRMA 5BSEA 1DSSG 1U3WA 3GN1A 5A9TA 3KV3O 4J1QA 1NFRA 4CM5A 3DMTC 4FPXA 4E5KA 3GMDA 5JBIA 3ANLA 4M55A 1F0YA 2C5AA 2G0TA 4UREA 2GRAA 1DIHA 1WZEA 1DJQA 4O6VA 5B12A 2C20A 4U5QA 3JQCA 2G1UA 5I8ZA 1CIVA 3ZWVA 1M2WA 5A9SB 3INGA 2X0RA 5FFFA 1P1RA 4BB5A 5T64A 2OP1A 2GD1O 3OIDA 1DC4A 1EEHA 2B0JA 5FEUA 2HUNA 4ALMA 1IZ9A 5LCXA 4EDFA 1L7EA 3PIIA 2X9VA 2Y66A 3M1LA 3PXXA 1E7WA 1WWKA 5JAMA 4KZPA 4DYVA 2P5UA 1NWHA 1XLTA 3WMXA 3WTBA 1ZSVA 2B69A 3WFIA 1ZK4A 3L0DA 4WGGA 5CG1A 3OMLA 4DXHA 1DRWA 4CMBA 1JVSA 4AJEA 3G79A 2Y0EA 1T4BA 4CMKA 4EUHA 4H15A 1YL6A 3WQRA 3GEMA 3RROA 2B4RO 3TSCA 4YA6A 2I9PA 3L4SO 2UUOA 5B4UA 2EERA 3GY0A 5DOVA 1JKFA 3HE3A 5L9AA 4IS2A 3LT0A 5G4KA 1G6KA 1KVRA 2VOJA 2VHYA 1EBUA 2VHXA 4F3YA 3UF0A 4L8VA 1SZJG 2NU8A 3AK4A 2GN8A 4JN6B 4DBVO 3FTNA 4J16A 2DU8A 3K5PA 4J9VA 4PLPA 5DCUA 4YPOA 3MJCA 3EVTA 3PQEA 3C1AA 1GUFA 2ZCUA 1W0CA 3CMCO 3GFBA 2CY0A 2ZIZA 4R1SA 1B8VA 3GFGA 3HDHA 1T2FA 1JA9A 2P2SA 1YL5A 3BTUA 4DL9A 4NPCA 3FBGA 4P4GA 3W4KA 2VUUA 2WMDA 5U9CA 3V1UA 3VZQA 5IZCC 5CAEA 1UXGA 4RVGA 5AXDA 5A06A 4WLOA 3IKTA 3G17A 3WLEA 5AXCA 3PWSA 4YAIA 3I23A 3KYCA 1UAYA 2VCYA 3DBVO 2R6JA 3COSA 3JQAD 1YJ8A 1N2SA 2D5AA 2PA3A 4CLRA 3GPDG 5T8KA 5KJ1A 1HSOA 1QLJA 2TMGA 1SAYA 4BO4A 5T67A 1NQ5A 3LQFA 3JV7A 4CM8A 3W8FA 2VZ8A 4PLHA 3NKLA 2IEBA 2CF6A 1KVSA 3DHYA 1MLDA 2HMVA 1IZ0A 1T2AA 2ZJ1A 1DO8A 3D5QA 4LSMA 3U4IA 3TQHA 2CDAA 2ZTUA 4JCOA 4FFOA 4FSHA 4RO0A 3DTYA 4G65A 4WECA 1UR5A 1T2DA 5FWNA 2JD1A 1LI4A 1WDKA 5A03A 1NM5A 1EK6A 2EGHA 1PZGA 3CH6A 4JIGA 3WQQA 2FR1A 3LF1A 4GPD1 2ZB7A 3IQDB 3DBRA 1S7CA 5JO9A 1UDBA 1NAHA 1YRLA 2AMFA 5L40A 3EGOA 1XELA 4WCFC 1K0UA 1Y9EA 3QE3A 1QXSA 1NPYA 4IQ8A 2C59A 4GVXA 2DBRA 3NX4A 2A9FA 3DL2A 5JDIC 1NAIA 2PR2A 3DONA 1NVTA 1Z82A 3IDSA 4PFJA 1ADCA 5DP2A 1QR6A 3O38A 4MVJA 4EITA 2O7SA 1I0ZA 4IDAA 1OC4A 3HUDA 1I36A 1CF2O 1MV8A 5CG2A 4IPTA 3LT4A 1B14A 4OOEA 3E48A 3HDJA 2J3KA 3AFMA 3HG7A 2D3TA 3PI7A 2QW8A 4AG3A 3F1LA 4JJIA 5JAQA 4K26A 1VLLA 4LGVA 5BR7A 5DBFA 5I7EA 2ZTVA 4YJDA 1NVGA 2DVMA 2XPCA 1HE4A 3TDKA 5IZCA 1VPDA 2WSBA 4OL9A 4WCFB 4TQGA 2DM6A 1B3BA 1F12A 1LBEA 4MVJH 2HMWA 3MOIA 1R0KA 4BNXA 5CFZA 2F00A 3NGLA 3RKUA 2DUUA 4UUNA 1XQ6A 3QQPA 1M76A 2BFPA 2PGJA 3ZWAA 2HQ1A 4ZGWA 2EG9A 6ADHA 1DJNA 3H2SA 1R4MB 4B4VA 2VRCD 4WLUA 5I7SA 3BHMA 3S8MA 3GOHA 1BDBA 1ISHA 4OOFA 2BHLA 1JN0A 5JFOA 1R4NB 3ZV3A 5L4NA 2FHSA 4NNJA 1NBOA 3INRA 1Y8QB 4IJKA 4CL3A 2AE1A 5C7LO 3GZNB 5F5LA 3EMKA 3WSWA 3V1YA 1IPEA 2DFDA 3RCBA 5IDWA 3WWYA 3PLNA 3PWKA 4JBGA 4J7UA 3SEFA 2ET6A 1LSSA 5KJCA 5KTKA 4YCAA 3SJ7A 2I6TA 4IUYA 1KY4A 5JYDA 2WD7B 2CSUA 1J5PA 4N54A 1A5ZA 1G0OA 2H63A 3ORFA 1A7KA 1RYEA 1N92A 3I9KA 4DPMA 2ZK7A 3QW2A 4IMRA 1YB5A 2D0IA 1Y6JA 2X8LA 1ULSA 2EW2A 5ES3A 3WS7A 5ADHA 4MP3A 4ZQGA 3WGHA 4PZDA 5CEEA 4N5NA 3RUCA 4GSLA 1EQUA 3O4RA 3DZKA 4F6LA 3GRPA 5C7IO 2C29D 3CUKA 3GHYA 5L95A 3K9QO 1PL8A 3ON5A 4AJ2A 1FDSA 4G5HA 1GQYA 5AOVA 5BQFA 1VKNA 4RDIA 2CFCA 1Y8QA 5G0UA 3S1LA 3WNVA 3BMNB 4RJTA 3M2TA 3GDOA 3I5MA 4R41A 4E30A 2Y1FA 3GZNA 4OYRA 1B7GO 5TLSA 3NUGA 5KJEA 4EZBA 2H5LA 5L3ZA 1ZK3A 1KYQA 3CMMA 1NFFA 4XDZA 3RFTA 4XYLA 1JW9B 2D59A 3VC7A 4CMEC 4B8ZA 3PGXA 4J4BA 4OO3A 4R68A 4ZICA 3NTQA 1TT7A 5CHEA 4A7PA 1MC4A 1RM0A 1ZEJA 4XIJA 3KZVA 2YV2A 3H3JA 3ONEA 4IJWA 3DTTA 2GZ2A 3ZV6A 2NM0A 2Y0DA 3H5AA 1QORA 1O0SA 3ULKA 3ZNNA 3M2PA 3EYWA 4YEDA 1JAYA 1WAMA 4HY3A 3NDRA 1C1DA 1YB4A 3GNQA 3DOJA 3H9JA 3WYBA 3S2GA 3Q1LA 3I4CA 5EINA 4D41A 3RJ9A 1ZVMA 3ZWWA 3JQGB 3R3SA 3KEQA 4TZKA 1LQUA 4RZIA 3LYLA 2C82A 3QJ5A 3NTRA 3UOGA 4BGVA 2VQ3A 4DA9A 1DRUA 1AXEA 3ZNOA 4J1TA 5ICMA 3FN4A 3FPLA 3QWHA 2GLXA 4RF3A 5ICSA 3KYCB 1MXFA 2PKQP 4RGBA 3RD5A 1LRKA 4CM6A 5JMWA 1JTVA 2NU7A 2PZMA 2GCGA 3UCFA 2JCXA 1YQDA 3FHLA 4BO8A 4TKMA 4CM8B 4F45A 1E6WA 5G0TA 4Y6RA 4NIMA 4JX8A 2Z1NA 1I2BA 5GY7A 1IE3A 4IDEA 1E6EA 1E1KA 1HRDA 1RYDA 3ANNA 2X0IA 1NPTO 5HWSA 4IGEA 2YFHA 2B5WA 8LDHA 4Y9DA 3TZKA 1TVEA 2HK8A 1ISIA 1VJ0A 1V9LA 3HB5X 2FN7A 2Q2WA 1V6AA 3DBRB 3F4LA 3OEYA 4Q9NA 5EMHA 5I9LA 4D3SA 4W7IA 4XQEA 5BSGA 4MDHA 4CV2A 4E3ZA 1LJ8A 1QP8A 2JCVA 3OJ0A 2JD2A 4N5MA 4NK5A 3AUUA 2JKVA 1D3AA 5G0WA 1P0FA 3E9QA 4GX0A 3BYZA 1OAAA 5AXBA 1J4AA 3ZW8A 4CV3A 3D3WA 2VHWA 3PHGA 4DMMA 1NTOA 1ZH8A 5B4VA 3P5SA 2W2LA 2DC1A 1DLIA 1T24A 4WOKA 5TRTA 3P19A 1CERA 4KMSA 5JC8A 1N8KA 4MIEA 1DAOA 4BKPA 4IZHA 3KBOA 3WGYA 4YT8A 2BELA 1BGVA 2VHZA 4E31A 4FCCA 4MVJD 1FDVA 3OIFA 4B4WA 1E1NA 3ONDA 2Q1TA 3MJSA 2J3JA 4Q3CA 4CM1A 4FJ0A 3SXPA 1R0LA 3D4OA 3RC2A 2FR0A 4XEHA 4XDYA 2I67A 2X0JA 3B1FA 3WXBA 3PTZA 2VYVD 4R3NA 5C5IA 3ST7A 4L4XA 4II2A 4OM8A 4P4NA 3RKRA 4CM9D 1R4MA 1SEVA 1GZ4A 4PG7A 4JLWA 2NTJA 4Z9FA 1TA4A 1YGYA 2CZCA 5FF9A 2DBZA 3TFOA 3DAGA 1KIFA 4GH5A 3PVZA 1HLPA 1QV7A 3K96A 4NBWA 4XYMA 1ZK1A 4NDNE 5AYVA 1LEHA 4D46A 1C0KA 2ZB4A 4Z6KA 2E6UX 1LLQA 2OORA 3GDGA 4XQCA 3I6QA 3JD1A 2V7PA 4BNMA 5KVCA 4NI5A 3AU9A 2VWPA 3H2ZA 1UXHA 1ISGA 1DBVO 1VI2A 4ZQFA 5KJFA 2VUSA 1JAXA 4HBGA 1B15A 3HADA 4OAQA 5A04A 3H6KA 2O2YA 1BHSA 3HWRA 4P8RA 3P2OA 2Q49A 4MKZA 2Q99A 3MTJA 5IXSA 3UCEA 1KEUA 3WYEA 4UAGA 3T7CA 4E5PA 1SBYA 4R1TA 4CMAA 3X2EA 1F14A 5F1PA 3KB6A 5L7TA 1PQWA 2B37A 4ND1A 4EUEA 2Q4BA 3EY4A 3BAZA 3WR5A 3NT2A 5KJ6A 3EK2A 4B3HA 5H83A 4BKUA 3EVNA 3C7AA 4BNZA 1UJMA 3JYOA 2RH4A 5EN4A 1P9LA 2RHRA 4XGNA 3FF4A 3DFUA 3AOEA 2NWQA 3GNTA 3JD3A 3PQDA 2EW8A 3WGIA 1HT0A 4CMIA 1TT5B 2W2KA 4RLHA 3I83A 4OGWA 2YFQA 2AEMA 2CMDA 3NJ4A 1HDYA 1D7OA 2JL1A 2AQ8A 2X9GA 3DMYA 2JAHA 3DC2A 3IJPA 4HKTA 2CF5A 2YUTA 3EUWA 3P7MA 2DTDA 4CMHA 1HETA 1O6ZA 4CLEA 1Q7CA 2FP4A 3IJRA 1ULUA 3DBLB 3O8QA 2J5RA 3JQAA 1AN9A 3U3XA 1ZW1A 4BV9A 4MINA 1J0XO 3E9MA 3VAZA 3EHEA 5B4TA 1QKIA 4IDFA 4EJ6A 3B6ZA 3PYMA 3VPXA 4IQ0A 2BF7A 2NNLD 1KY5A 2RAFA 3CE6A 3MCVA 2Q2VA 2VTDA 1P45A 5EL0A 3AFNA 5JS6A 1JKIA 4J4HA 4NJMB 1ZKMA 4PVDA 3DMTA 1RM4A 4UVIA 3F47A 3PHIA 3H8VA 4BMSA 1Y5RA 1DRVA 1O95A 4TRNA 4J91A 3O03A 4UUMA 2CNBA 4PLCA 4GLOA 2Y93A 2P68A 3IS3A 3F9IA 4L0QA 3ZH2A 3MJEA 4KUHA 1N7HA 1XIVA 4FR5A 1OZAA 4YDRA 3AU8A 4XQGA 3F3SA 4PN3A 1E7MA 3U4DA 2W4QA 2GN9A 2Y0CA 3JQGA 2BFAA 5B37A 4PLWA 3WFJA 4CLXA 2JCYA 2Q50A 4JP3A 5L7YA 2ZKLA 5I8WA 3RBXA 4NH4A 3DBLA 3O8QB 1F06A 3DZJA 3Q0EA 3L9WA 4WK6A 3JQAB 4BNWA 5MGBA 1A7AA 3PQFA 4WASA 1C14A 2Y05A 3C3XA 4FJ2A 2WE7A 5U1PA 1VE9A 3LT1A 3W1VA 4BNLA 1E77A 1MX3A 3QSGA 1YONA 3LC7O 2AEJA 2XXBA 4R16A 1PSDA 2GZ1A 3GEGA 1ISJA 1IOLA 3MJTA 4YAKA 2WDZA 1UDCA 4XJSA 1S6YA 4PRKA 3DOOA 4KDEA 3AJRA 4FFNA 4E2XA 4OKNA 4YAJA 5THKA 1KVUA 4K1LA 3PDUA 3H4VA 3ZWCA 1YH3A 3DBHB 4HNHA 2X7HA 4CLHA 3INTA 1A9YA 1QYCA 1KOLA 4BNYA 1OOEA 1E3LA 2BGMA 4ZD6A 4GMGA 4S3MA 4DVJA 4B79A 1R66A 4ZU3A 7MDHA 3U4CA 4BO2A 1U3TA 2FMUA 3ITKA 5IF3A 4HXYA 4AJ1A 5IN4A 1U8FO 3B1JA 1HDGO 4DBZA 3DQPA 4B3JA 3WIEA 4D3FA 2E82A 1M67A 1QLHA 2JFFA 4FD3A 1WVGA 5COAA 4XRGA 2DLDA 4J2OA 5C7OO 3DAPA 4KQWA 3Q2KA 3DZFA 3IOYA 2UYYA 1T1SA 3W6UA 3WDSA 1Z74A 1P1FA 2IRWA 1IHYA 2B4QA 2X4GA 3DHEA 4YR9A 3ZNQA 4G81A 1P1KA 2XXJA 2WYVA 3PGJA 1YXMA 2VRBA 4YWJA 4EJ0A 1EVZA 3DZBA 4RPHA 3OJFA 2NQ8A 4CL8A 2DKNA 1SEPA 5AVOA 2HJSA 1DB3A 1LC0A 1NQTA 1O8CA 3ZWMA 3BMOB 4L75A 5JC1A 4K28A 3S2FA 1P1IA 2ILTA 3GR6A 5FI5A 1C0LA 3FD8A 1ZJZA 3S2IA 1X1TA 3MJ4A 4AFNA 4AJKA 4Y67A 3EW7A 1C1DB 4CMGA 2AA3A 1WW8A 2FSSA 4AJIA 3AUSA 4FDAA 4NBTA 4NFSA 4GLLA 3F46A 3AI2A 2PY6A 3OICA 5TQVA 5CEJA 4KWIA 5HM8A 2OMEA 4J2HA 4HWKA 1HYEA 1QYXA 4MP8A 2X0NA 3DHNA 1YDEA 5TGDA 1HDCA 3CKYA 2VWGA 1I3MA 4PLZA 1PQPA 1LXCA 1E6UA 4I9NA 3VH2A 5IXYA 1HL3A 3PFFA 2VYND 1GV1A 4KUGA 2VTEA 3TFQA 3S55A 3QY9A 3WGZA 2X5KO 2R00A 2OHXA 2HSDA 3ROPA 1MB4A 1PWZA 1U2DA 4P4LA 2ZB3A 2V6BA 4AICA 4C7JA 3ADPA 4BNHA 4GSKA 1UXIA 3VTZA 3JCZA 2DQ4A 1EK5A 4WCFA 4D42A 3L9XA 3KHUA 5TX7A 1P3DA 3NTOA 2GO1A 4UEJA 2R00C 3TNLA 4XR4A 4NFHA 4Z9YA 2BKAA 3PK0A 3TF5A 3UAGA 4RZHA 3BTOA 2P4QA 2PD6A 5JDCC 4CQLA 1J6UA 1P44A 2RHCA 2D8AA 4WEQA 4YAEA 3KLPX 4HFNA 4GX1A 4Z0PA 4BL5A 1BTOA 2GNAA 2PD4A 2W2KB 1EDZA 1Y9AA 4TVOA 3TRIA 8ADHA 2X5JO 1KERA 4E0BA 1DOHA 2HMSA 3ENNA 3QWIA 5F21A 4EJMA 1ISFA 3A4VA 1PEDA 1VRWA 1WP4A 1Y7TA 2VYNA 3NAQA 4AL4A 3WOHA 1OFGA 5JDCA 4QO7A 1LLUA 1SO8A 3D3WB 5I9NA 3T4EA 4J4TA 4WEOA 2HK7A 2GF2A 2GN4A 4WJZA 4ZQEA 3KO8A 9LDTA 2OGUA 4ND2A 4C7KA 3F6YA 2Y67A 1ONOA 1MP0A 4K9DA 2NU9A 1U5CA 4EUFA 1NHWA 4XB1A 2Q1SA 2W98A 4XB2A 5CEFA 4CR7A 3ETEA 2PTGA 5IZ4A 4WNCA 4BKQA 3PHJA 1HE5A 5HTOA 1I32A 2GZ3A 1U4OA 4WCDA 5C3MA 2Q2QA 2QQ5A 4HFJA 5JW6A 3QVTA 3ASUA 1LQTA 3GAZA 3GT0A 4IDBA 4PZEA 4R51A 5KWEA 1PS0A 4L74A 1ZIDA 3CINA 4GX5A 4LW8A 5DZSA 4CJXA 1XG5A 2HLPA 4N18A 4EGFA 5JAIA 3PLRA 3FI9A 3AY7A 3HQ4O 3WYCA 1PZEA 1YQGA 2J5QA 3PZRA 4NBVA 3EDMA 4WLVA 3OQ1A 5JSFA 3KSUA 4EYEA 2O48X 1ENZA 2IZ1A 3I9NA 1WMAA 4XYEA 4C4OA 1MA0A 3GQVA 1NR1A 2BRUA 2UVDA 3PJGA 4Y98A 3QIVA 5F1OA 3R1IA 5JPIA 3S2EA 2V6GA 2WEKA 3Q6IA 4PVCA 3VVBA 5U4QA 3DWFA 1KEVA 4PG8A 3STHA 3UCXA 1BSVA 4HNGA 3E1KA 2EJWA 3HDQA 1T2CA 2VWHA 2ZYGA 3ZHBA 3VH1A 2EKPA 1UAGA 4YBZA 4ND3A 5DBIA 4ALIA 7ADHA 2RIRA 3FWZA 4Z3DA 3JQ7B 1ZJYA 2SCUA 1UP6A 1U28A 4OJNA 3LF2A 2Z5LA 4K6FA 4KUEA 4DIBA 3L77A 2H1SA 1HE2A 3E18A 4DWVA 2OOSA 1DHRA 2GPTA 3ANMA 2IEDA 1FDWA 3N74A 4FGWA 4FW8A 1XKQA 3PIDA 3HNPA 3Q2IA 2J3HA 3E6AA 5DN9A 4UUOA 2NV6A 6LDHA 3SC4A 5LDGA 5JE8A 1YBVA 2C2XA 3ZWBA 4RQUA 4OXKA 4JBHA 2X23A 4J1SA 3K8ZA 4U6QA 5A9RA 1E3SA 1PZHA 4LVUA 1AHHA 1YVEI 4L4RA 1TT5A 3I4FA 3DAFA 4GVLA 1MFPA 4RPLA 4NQZA 1UP7A 5I7VA 1BVRA 2HRBA 3KTDA 4HV4A 4FGSA 1E1LA 5HS6A 3WNQA 5CDTA 4J6FA 4W4TA 4NJOA 4AVYA 1AE1A 3TL3A 4U0KA 3TZCA 1M66A 3HHPA 4KWHA 1HLDA 1B16A 3PRJA 3ZWPA 2NTVA 3CIFA 3IC5A 4DGSA 3V2HA 1CETA 5DOZA 1O5IA 1P77A 1XGKA 3PPIA 3UKOA 2GSDA 1E3WB 1L1FA 3HZZA 4IJUA 4R1UA 4BO1A 2VYVA 4E32A 4NJMA 5CPFA 3RVDA 1LDYA 5JY1A 2EXXA 2AQIA 3E9NA 1ADGA 3CPSA 4OKIA 2OBNA 3I9MA 3QVXA 1CYDA 3BHJA 2P9GA 4KTVE 3FWNA 2PWZA 3EC7A 4Y8VA 5TSDA 1ZMOA 1DDOA 1GYPA 4U7WA 1IB6A 4E21A 4NHEA 3HDYA 3OP4A 1PJLA 3RUAA 4CM4A 3RUFA 4PLGA 1LC3A 5DT9A 2YZ7A 1MFZA 2P5YA 5FI3A 1U7HA 2EJVA 4KP7A 3KSZO 3OSUA 1PGOA 2JJYA 1HTBA 5G2OA 4A5OA 3U0BA 1ZXBA 2A94A 5EJ2A 2HCTA 1X0VA 1ZK0A 3JQBA 1OI7A 3MEQA 5JLAA 1TEHA 4PG5A 2O3JA 4GAEA 1EBFA 1R15A 2O3UA 4IS3A 4K6CA 4R4JA 4WLFA 3NDIA 2PZKA 4A03A 2PZJA 3RC1A 1E7QA 2PKQO 1V8BA 3D7LA 3DB2A 1O89A 2FZWA 4BMVA 1PR9A 5ENVA 4DIFA 2Y99A 2BMAA 2O3QA 1Q7BA 1ZFNA 1EVIA 3A1NA 1Q0QA 4A10A 4NBUA 4PLVA 1ZXLA 1X1EA 3AWDA 5ILOA 3T4XA 3C85A 4HX5A 2C5EA 1MG0A 4XX0A 3H5RA 3N58A 1EFLA 1GYQA 4NZ9A 1CEQA 2BLLA 5G0VA 5A4DA 1YKFA 4O1MA 3FCOA 1ZSNA 1E0DA 2D2IA 4GKVA 1DIRA 1UDAA 5DNAA 5TS3A 1GZ6A 2GASA 2RBEA 2EP5A 1I2CA 2WTBA 1C0PA 2TMDA 3K73O 3QA9A 2E49A 2AQHA 5THQA 4DTIA 5ITWA 1X7DA 2OZPA 3GUCA 4RF4A 2PV7A 1CQJA 2B35A 1L7DA 3CXRA 3OECA 1HDOA 2JFGA 3ROQA 3LLSA 4FJ1A 3DOCA 2YQ4A 1DFHA 2ZATA 4B7CA 2YHIA 4OQYA 4ALJA 5EERA 4DPKA 1ENOA 1GY8A 1UUFA 4CLOB 1E92A 1N1EA 1VJ1A 4RORA 5JNLA 4JBIA 2VNSA 1C1XB 3QWBA 1KVTA 3PFWO 2O50A 4DC1A 1ZK2A 3QV1A 4W7HA 4W99A 3SBOA 4GGPA 4GQAA 5KOIA 2VUTA 4XZ3A 3GN2A 3BMOA 3HJAA 2FPPA 4PIVA 1V35A 3ZV4A 4FFPA 4RLSA 3U4HA 4E13A 3C1TA 1Q0HA 1VJTA 3WJAA 3KVOA 3HFSA 1GUZA 4QT0A 2HAEA 3ZDFA 1G0NA 1HXHA 2O4CA 1VKOA 2OFPA 3LC1O 4IM7A 1U4SA 4FFLA 1Z7EA 2NVWA 3PHHA 1V0JA 1HZZA 3GGGA 3V8BA 3Q9UA 1IY8A 4CMIB 5DULA 1Y5MA 3AOEC 1H93A 1M6HA 4DRYA 3H9GA 4TMFA 4B7XA 1GV0A 2CUKA 2O2SA 4NK4A 4Q3NA 4BNFA 4CUZA 5EPOA 1UZNA 4H3VA 1QMGA 3NGXA 3MZ0A 2Y1CA 2DT5A 3D4NA 3RQSA 3PZBA 4WOJA 2W2LD 4FQ8A 1BWSA 1PL6A 1WDMA 2AG8A 4LVCA 5EESA 5TF4A 4BGUA 3AM3A 4PRLA 4OMUA 2OL4A 1I3NA 1M75A 3DEYX 4DMLA 4DIOA 2IYOA 1MC5A 3L6DA 3Q3CA 2YV1A 4Z0TA 4BNGA 3O9ZA 1QYDA 2JD0A 1DFGA 4RF2A 1XDWA 1EVYA 4XYGA 3OEWA 4IJVA 4BQPA 2OXIA 1Z75A 2CVZA 2QG4A 3A9WA 3VVCA 2G5CA 1E7RA 2Q45A 1PJ4A 2PK3A 3UGKA 1LDGA 2WJPA 4MVJF 3N7UA 4AJHA 1ZEMA 3PWZA 3TN7A 2I99A 1ENYA 4YJHB 3C8MA 1EZ4A 1RM3A 3D4PA 4IY1A 4M8SA 3WG9A 1BVUA 1NQAO 1XU9A 2O4UX 5K6AA 1I3KA 3GRKA 4RVHA 1ZCJA 4CQLB 1LX6A 4BQRA 1E7YA 3JQ8B 4AJLA 2EKLA 1MUUA 3JYLA 4GKBA 4Q3AA 5C37A 5L53A 4CPDA 3AUTA 1ML3A 4O5OA 1N5DA 4QEDA 2I66A 5KVQA 1JU9A 1YQXA 3L6OO 5MDHA 3GNSA 4B3IA 2QYTA 1TXGA 1YBAA 4TRMA 3D64A 5DCWA 3U5TA 3H9UA 4LCEA 3VKUA 1Q0LA 4L9RA 4E4YA 1U7TA 2NVUA 4JNKA 4MIYA 1QYVA 3GVPA 1N9GA 1KC3A 3FSRA 2P9CA 1GL3A 1E1MA 1PGNA 1NWCA 1AUPA 3GZ4A 1GUYA 5CDSA 1XWFA 1T25A 4ZA2A 4DLLA 3M1AA 4E2ZA 2QRKA 4CR8A 5KKCA 4O0LA 1PJTA 1PQUA 3R0IA 2D5CA 1KVQA 1QYWA 3WBBA 5CDUA 4BO0A 2ZCVA 1R0SA 1XSEA 2YJZA 1NPDA 1N1GA 3FR8A 4RCVA 4B4UA 1I5RA 3G49A 4OSPA 4MO2A 4J3FA 3DBHA 3ZHYA 1UH5A 1F8GA 3F5QA 1B0AA 1PZFA 3FPCA 5F1KA 1NNUA 3GVHA 5AQ1A 3ROMA 4CM4B 1DLJA 1PGJA 4E5YA 4EI2A 4UULA 1GQ2A 1BW9A 1H9AA 1JLLA 1Z73A 2Q4EA 2VHVA 4RL6A 4XGKA 3JQFC 1CQIA 4RVFA 2AHRA 1PS9A 2XOXA 4MKXA 4LISA 3FRJA 4R1NA 4JQCA 2IZZA 2O7QA 3ETDA 2NVUB 3G1TA 3IUPA 3WWZA 4QECA 2GN6A 1FMCA 3JYNA 3WQSB 1NR7A 4JK3A 4PCVA 4BB6A 4R9SA 4DLBA 1M6WA 1RM5A 4J1NA 4QQRA 3ZW9A 1HDRA 2QRLA 3K2EA 3QHAA 3QVWA 3JQ7A 3RASA 4MKRA 4PLFA 4YAGA 2Y1EA 1PJ3A 4J0FA 2NSDA 3V2UA 2HMUA 1YL7A 1PJBA 3MJVA 1XU7A 5A1TA 4UVHA 3ZU4A 4XR9A 4IQGA 3OJOA 2C7GA 2X86A 2YV3A 4KTTE 2FY8A 1HYHA 1AHIA 2B36A 3RUIA 4FFMA 2OBYA 2WE8A 5ITVA 2BFMA 5KIAA 4FC7A 4QTZA 3B70A 1CRWG 1WLYA 3FNEA 3PJFA 3D0OA 4ITUA 4TSKA 1KEWA 4YJGB 1H0KA 3BZUA 3WGQA 4DC0A 4BKRA 5T5QA 2DPHA 3RC9A 1P31A 1YBMA 4J9UE 3GAFA 4UVGA 3V5NA 4J7CA 4CMEA 5JY6A 3HFGA 4YB8A 3RBZA 1DFIA 3TL2A 5T57A 3DZHA 1GPJA 2ZJ0A 2ZQYA 3TPCA 2VT2A 1BMDA 1E3IA 2JAPA 5BSHA 3VH3A 3VDRA 3GUYA 1PS8A 2HRZA 3NJ8A 4OHUA 5LC1A 4CLDA 1H94A 3A28A 5TNXA 5JCJD 1NFQA 5BNTA 4TROA 1XEAA 5KKAA 3WSVA 1H6AA 4BNJA 2IXAA 1OMOA 1HWYA 3OA2A 2Y1GA 3DZGA 3JQDA 4I9HA 3ITDA 4FB5A 3NRCA 2UV8A 5T8KC 1H2BA 4P22A 1C1XA 4A27A 4YT5A 2VRCA 4XGIA 1TI7A 1ID1A 4I5FA 3W4IA 3GDFA 4XQ9A 4CM9A 3AY6A 4RF5A 4D79A 5IDXA 4YJFB 4ZQBA 3NT4A 1IUKA 3ZHZA 2CDBA 2E4AA 1LDBA 1DIBA 1U2GA 2AQKA 3GG9A 3JSAA 4YJGA 4R01A 2YW9A 1X13A 3SVTA 1P74A 3VKVA 4UVDA 4CODB 4CMCA 1V3VA 2BGLA 3ZWOA 4WPGA 1QRRA 1ZNQO 2LDXA 4J49A 3BMCA 3GG2A 5BNIA 1GZ3A 3OJLA 5DCYA 2YY7A 1NQOA 3UVEA 1T1RA 4EBFA 4YQYA 1HE3A 1PIWA 2C0CA 2AEFA 5JXWA 3GVCA 5HA5A 4NBRA 5ILGA 2PNFA 3LSYA 2VZ0A 1BG6A 4TZTA 2J3IA 4MP6A 3AW9A 3GLQA 1SMKA 3G3EA 5TC4A 1FK8A 1GEGA 2PGDA 4QXMA 1HDZA 5GZ1A 2QHXA 4CUKA 1A27A 4D45A 3TZHA 4D0RA 2BI8A 3MWDB 4HP8A 2GDZA 1B3RA 4Q3BA 4D3DA 2YDYA 3MOGA 3I9JA 4ESOA 1C0IA 2IZ0A 4YJFA 3OETA 1AXGA 4QFCA 2A92A 3JYQA 4WE3A 4YJHA 5GZ6A 1EE2A 1H6DA 5A05A 4I8XA 4NU6A 1LNQA 1I10A 2DFVA 4YACA 5F5NA 1LSUA 4BNUA 3AY3A 4HFMA 9LDBA 1RJWA 1ONNA 4U8GA 3ZU5A 4W9NA 1BXZA 5BT9A 4ALLA 3LC2O 3C7CB 1MGOA 5JCJA 3EAGA 1NHGA 3D1LA 1R12A 2AW5A 5IN5A 1FJHA 2DUWA 5DBGA 1Z6ZA 3VPHA 3BMQB 1DPGA 3W6ZA 1K2WA 4ZHSA 3WIDA 2AE2A 2YYYA 4I9UA 4KQXA 3LLVA 4ALNA 4W9NC 4R69A 5IAAA 4D0SA 2DPGA 3M6IA 1UZMA 4M89A 2PGLA 1A71A 3L4BA 1EE9A 5A3JA 3U62A 4LRTB 5L51A 4GX2A 4M86A 4KDFA 1GQQA 3IKVA 4BOYA 4YYZA 2EWMA 3I6IA 4RVUA 1N7GA 5KVSA 2D1YA 3ONFA 5EQDA 1GAEO 1NXQA 1U3UA 3C1OA 3E5RA 5K6AC 1SB8A 4EEXA 4MIOA 4NU5A 4GGOA 1KC1A 4JJFA 3UW3A 1YWGO 2A4KA 2X6TA 2C7VA 1JWBB 1X7HA 1LTHR 3GHHA 4Q39A 3UN1A 3ZWXA 3KETA 3LU1A 4XRRA 3SLKA 4LK3A 5EIOA 3WJ7A 1U9JA 4FC6A 1GEEA 4M87A 3OFSA 3RUEA 2QYSA 5DF1A 3ABIA 3JQEA 4Y6PA 3ENKA 1X7GA 3I1JA 1SNYA 3GPIA 1WDLA 5L45A 5A5EA 1HYGA 4CV0A 5L7WA 4RVDA 1BXGB 1SOVA 2A35A 4LMPA 1BW9B 5L4LA 5CDGA 2ZQZA 3KSDO 2Y1OA 4YXFA 1MXHA 3AUAA 3JYPA 1YE3A 2X58A 4QUKA 3C7DB 1HDXA 3VTFA 4WUVA 4AJNA 3DO5A 4FS3A 3Q11A 1W8DA 5KVVA 2NTNA 3KUXA 3BA1A 4D43A 1ISMA 4F6CA 2J8ZA 4R54A 3T7EA 2Y1DA 5A3VA 4BNNA 4MOWA 1E3WA 3RC7A 1XA0A 3MTGA 2XF8A 3RI3A 2FRDA 5CDYA 1W4ZA 2LDBA 4BO9A 4D44A 1G1AA 1LDEA 3X2FA 5KNLA 4J43A 3FTPA 4B8WA 3QVOA 3QWAA 2UAGA 4E2WA 4HUJA 3H65A 2HO5A 1Y8RB 2QX7A 4O63O 1IPFA 3KXDA 1UXJA 4FIZA 1D1TA 4YRAA 2E48A 3PYLA 1P33A 4CM7A 5IG2A 4H7PA 4R9RA 5T6BA 3HB4X 1K5HA 1BXGA 3L4BC 1ARZA 1UZLA 2D4AA 3DZIA 3D3EA 2IODA 1YB1A 4TRJA 1ZUD1 4MVJI 2IXBA 3TOXA 3E5MA 2PH5A 3JD4A 1FXSA 4RVSA 3TWOA 3SC6A 3RUDA 1WXDA 1LSOA 3CEAA 4L4SA 4PGFA 4DLAA 5BSFA 2X22A 3AOGA 4CQMA 4M54A 1K3TA 2HDHA 1SOWA 3A06A 2IE0A 3QRWA 3W8EA 1B8UA 5G4KB 3VPGA 5IDQA 4MVJP 1VL6A 1GD1O 1U5AA 3UH1A 4JP2A 1NYTA 1PGPA 2JHGA 4QO8A 1HSZA 4BO3A 4Q3EA 5I7FA 5GZ3A 2FPGA 1JKJA 1DAPA 4LCJA 3KYDB 1JVBA 4FBGA 4PLTA 4ZRNA 3PJDA 2OUIA 2JHFA 3EZYA 3HN2A 3GVIA 4W6ZA 5KCZA 4II3A 3JQ9C 4XYBA 2I76A 2FSVA 2WM3A 4R5HA 3KYBA 1PGQA 4L76A 5F3RA 3H9EO 3VOSA 4FN4A 2BFOA 1E5LA 3OA0A 2I3GA 1Y8RA 3LT2A 5H81A 2HJRA 2EP7A 2C2YA 4R3WA 3PDJA 3LK7A 2FWMX 1X0XA 3ZGYA 2OO5A 1I8TA 1TLTA 1K6IA 3B20A 3R3JA 1CJCA 1HEUA 2Q46A 4MVJG 4ONEA 1T2EA 4A26A 3TZ6A 4IDDA 4PLYA 2UDPA 4OH1A 5L4SA 3MWEB 4FOSA 2DTEA 1Z45A 4LN1A 3JQ6A 1OC2A 1Z7BA 4P38A 2JFHA 1A9ZA 1GCOA 2QZ9A 2B4TO 4CQMB 5IDYA 4E5NA 3ZN2A 3LZ6A 1I2ZA 2POQX 1EMDA 1VL8A 3ETGA 4INAA 4BO7A 4XJTA 2O23A 1QG6A 1P0CA 3NT5A 2GGSA 4H16A 4J7XA 1ONPA 4IDCA 4W82A 5COBA 3WB9A 1W6UA 2YHIB 4BGIA 3KLMX 4ZRMA 3RUHA 1ZMTA 2J5KA 1QSGA 3AM4A 4PZCA 2QZZA 1SB9A 1EFKA 4QSMA 4CLOA 4ZQHA 2V65A 3I52A 1A4UA 4O59O 1I24A 2I5PO 1PJSA 1OBFO 4YT4A 3H3FA 4GWGA 4BIIA 1GU7A 4JJGA 2ZYAA 3HN7A 4Z3KA 3ZCXA 2NQTA 2NACA 2GYYA 3CSDA 3RU9A 1QV6A 3GH3A 3G0OA 1V3TA 1B8PA 5K0ZA 3NDJA 4RPJA 4DUPA 1P1HA 3WX0A 2HU2A 2Y68A 1NP3A 4IDGA 1EUDA 1A72A 1DIAA 5I9MA 4WLEA 1PWXA 3VZSA 2G17A 3NEPX 2BGKA 4CMJA 4JROA 1HZJA 1D8AA 2I3AA 2FPIA 2H6EA 2EIHA 4ALKA 4B7UA 4I5DA 4BO5A 4BO6A 3ICPA 4CUJA 1PX0A 1U8XX 3L6EA 5ENDA 1P1JA 4U0JA 4QX6A 4RQTA 4FFRA 3TZQA 1GADO 5B1YA 1WMBA 4GI2A 4IXWA 3RWBA 3W4JA 4BNTA 3ZNPA 1RPNA 5TJHA 3FR7A 2B83A 4RV9A 1KS9A 1K6XA 4BGEA 4MVJE 3WICA 1PTJA 1RKXA 2P91A 3IL2A 1CDOA 3OQBA 3RIHA 4IZIA 3WGTA 1KETA 2NVBA 5HS4A 1FF9A 2Z1MA 2DTXA 2O3SA 3ZU2A 2BI7A 4BMNA 2RCYA 1V3UA 4XD2A 1A4IA 3NYWA 4KOAA 4MJLA 3B1KA 2GERA 4BNKA 2WYWA 2V6FA 4AJOA 4DREA 3G1UA 4XIYA 5TT0A 4XCVA 3WGOA 3P2YA 3TOZA 4NFYA 2Z95A 4J0EA 3WLFA 3JQ8A 3TJRA 1D4FA 1IULA 4ILKA 1LRLA 3FNGA 2EHDA 3QP9A 2DAPA 3E8XA 3F4BA 2ZTLA 4LRSB 4TVBA 3SX2A 1IHXA 3BMCB 3KEOA 1R6DA 2DBVO 3IMFA 2P9EA 2WD7A 2IDZA 3QLJA 3JD2A 1FDUA 4BKOA 2W8ZA 2Q3EA 1EQ2A 4BV8A 2PZLA 1I33A 1YS4A 1VSVA 4E2YA 5IJZA 2AG5A 1N9GB 1ZBQA 4IIVA 2QIOA 3NV9A 3WMWA 4BUCA 4ND5A 3AI3A 3I9OA 2PH3A 3Q9NA 1YJQA 4Z0HO 3WGGA 3ZU3A 2WYUA 1EUCA 5G4LA 4Z9XA 3UXYA 3FBTA 1Y1PA 1HF3A 3WBFA 3BXXA 1XQ1A 4I08A 3BMNA 3K31A 1DIGA 2EV9A 3ZZNA 3H5NA 4I5EA 4WNIA 1F8FA 4M49A 5K9ZA 4MPDA 5HBRA 2F1KA 2FZEA 2QRJA 3OJEA 3OIGA 5ER6A 1DC5A 1GPDG 1I3LA 3IP1A 2VWQA 4NR0A 2ZYDA 1EDOA 3RFVA 4Q3DA 1WZIA 1SPXA 1WNTA 1Q7GA 1H2HA 2ZB8A 3H7AA 5JO0A 4X54A 4CLRB 3BMQA 2NLOA 3KOUA 5JAZA 3SLGA 2VNAA 2VOEA 2X9NA 1H5QA 1X14A 2B5VA 1GTMA 4BHTA 2PD3A 1XYGA 1YO6A 3OF2A 1NX6A 2CVQA 2YQ5A 4DQUA 3FNFA 5G0SA 4ROSA 3VPFA 4BNVA 1I01A 3GGPA 3OH8A 5A9SA 3E82A 3C24A 3RJ5A 4A2CA 5JCXA 4I1IA 1IL0A 1LLCA 3I9LA 2EKQA 3KYDA 5HRUA 1C3VA 4XWYA 1D1SA 2WD8A 1EVJA 1UXKA 4RPGA 3DXFA 3GVXA 3PEFA 3AI1A 4BVAA 4TRRA 3CZRA 4B4OA 2FR8A 4GBJA 1GCUA 1O94A 4R5MA 5COQA 1BXKA 5A5FA 5LDHA 2YDXA 4J90A 4N5LA 2G82A 4N7RA 3DDNA 1H9BA 3KM0A 4OXYA 1ADFA 1DHTA 5EQFA 2BD0A 1LSJA 4PG4A 2CDCA 4QFDA 4IINA 5TT1A 3RU7A 1E3EA 3ICCA 1T4DA 1ENPA 2CVOA 4WKGA 3VHRA 4ZN6A 4HFRA 3V2GA 4F46A 1FDTA 1SCUA 2XAAA 2HKIA 1SC6A 4ID9A 4IIUA 1ORRA 3PYXA 1GDHA 1WPQA 2RH8A 4URFA 4IMPA 2H9IA 3DR3A 4IBOA 4LMRA 3CZMA 1LA2A 5JYEA 1LDMA 5JDIA 1Q2XA 3K92A 1MG5A 4GWKA 2VT3A 4A73A 3GA0A 3K6JA 3E03A 1LRJA 5H82A 4IGFA 1R37A 3RBVA 1X15A 1R16A 4GMFA 5IFLA 3ZWYA 4AJJA 1Y81A 2W90A 3LVFO 2C07A 4AJPA 3KRTA 4OSOA 2GR9A 2BH9A 4CQMD 4OIMA 1ZO8A 1B26A 1XR3A 3GGOA 4UEKA 2VZ9A 1NVMB 3JQ9A 1H6BA 1DC3A 4HADA 3JQBC 4OXNA 3OQ6A 2NUAA 4XKJA 2IYPA 2OP0A 5DDIP 4AJ4A 3QWFA 3VDQA 3WTCA 4TWRA 4U6SA 2Q1UA 1GR0A 1PJ2A 1H6CA 4RDHA 1PU2A 3VZRA 4E6PA 3O26A 3OBBA 3BHIA 3DFZA 3ZI0A 3ASVA 4E33A 2O3TA 3RFXA 4YRBA 3U09A 4JXKA 3HSKA 1KBZA 2P4HX 3IAHA 4YQZA 4YRDA 2I65A 4PG6A 4ND4A 1K89A 4S1VA 3ADOA 4GL4A 3SJUA 4ZVVA 2AXQA 2G76A 1W73A 1JDJA 4YVFA 1GYRA 2EF1A 1DEHA 3AM5A 3GC6A 1EUZA 1O9BA 1Q1NA 1DC6A 1BDMA 3BTVA 1PJCA
chains in the Genus database with same CATH superfamily
1OZ0A 2X1LA 4OI4A 1M2GA 3FUWA 1MVLA 5AXAA 1K27A 1KEZA 2XWJI 4UKDA 4UVEA 1GAWA 2J6IA 5DWVA 3RIEA 3VPSA 1S3FA 1SUDA 3DVAA 3LO5A 4IHQA 2HU7A 4Q03A 5FPPA 5FYDA 1POWA 1J8MF 2K6GA 4JUDX 2ESRA 1M0WA 3NHSA 3A2MA 1ONBA 2LV8A 3F49S 4C14A 2FPOA 2YZ2A 3JWPA 5E9WA 4EAQA 2EEZA 1PDWA 3AR5A 1VC2A 3C48A 4IFBA 1QTQA 1I7NA 5JCZA 4YTEA 5DP1A 1YDWA 3SKXA 2HREA 5JARA 1IK4A 1T4CB 1ZPDA 1FDIA 1T0UA 1PT7A 4UUPA 5C53B 3GYBA 1K5GA 3IKLA 3S5JA 3V1TC 1Z5UA 3NDPA 3RAJA 1KI8A 5BPHA 1LLDA 1M7BA 5CP8A 1XCBA 4ERXA 1QAOA 1UBKS 1UL1X 4KEAA 5J23A 1IN1A 2QUIA 1B2LA 1A7JA 1L5FA 3LXMA 4WLNA 3UFXA 3SEZA 3OESA 4KNYA 1FJXA 4IJQA 2QJFA 3RC3A 4I4IA 4M3NA 4KWTA 4LRUA 3TCKA 2ZULA 1BMFD 4YXWD 4GLFA 3VZBA 3EVAA 3OTHA 4DJ5X 2FSGA 1U1IA 1CWUA 1VIVA 5BRAA 2CHFA 2ICAA 3PICA 1DARA 2R86A 3OX2A 4Q9AA 1XZKA 1CR0A 2R4UA 3GK3A 5LBIA 4YT2A 5HZMA 4RXTA 3HUUA 1LDNA 1VYHA 2C2BA 1EUCB 1MT3A 4JITA 5C1IA 1CJUC 3V00A 1ZUIA 5TJ9A 1LTKA 2FQQA 2KX7A 1R4NA 2R6R1 4E5VA 4A0RA 3BJEA 2HMTA 5BNFA 4E51A 1PR3A 3HVUA 4YS6A 3FZYA 2X1HA 2FPKA 3IUSA 4IO0A 5E6UA 5BW4A 1JB1A 3GRFA 1DRKA 3RIGA 2ZZMA 1XLUA 3COVA 1Q16A 1QQBA 3RGWS 2GUGA 4OVKA 1TJ3A 2AI3A 1QZTA 3I04M 1S7GA 1JHPA 4IDQA 4D7AA 3UNXA 1FP1D 3PHLA 1H0HA 3B1ZA 1IYZA 4MHSA 1P4GA 2N9UA 4S24A 4W5TA 3PUYA 2UZ1B 1K6JA 1U3VA 4FDVA 5EJFA 1ZLYA 1OW3B 5KYUA 2XGOA 3K0CC 1NW7A 3UJAA 1D9XA 2O3RA 4NATA 2UUPA 3RKSA 3QFSA 1YOVB 4OU5A 3VH4A 1U3WA 2ZI4A 3GN1A 4C89A 4J1QA 4CM5A 3RSSA 3DT6A 4FPXA 3SZRA 2WA1A 4M55A 1F0YA 2O2JA 2G0TA 2O5RA 2Q3FA 2WWIA 5AK4A 5JEDA 5JRJA 4Q9HA 1GU0A 4JJ8A 4PIPA 1R8JA 3TB6A 2WT4A 5B12A 1H1TA 1DCKA 1L2TA 1GGFA 2PCJA 5K0JA 1CIVA 3QLUA 2JIRA 3IDOA 4BB5A 1WUTA 3L5KA 2QAIA 1SELA 5T64A 4X65B 1I2MA 3D54D 3N07A 4WXEA 1JIXA 1NV8A 2B0JA 2XQKA 4RFLA 3T99A 3VYVA 4AMBA 4EDFA 5LCXA 1L7EA 1DX6A 2C4TA 2HWKA 4YP7A 2WJYA 2FRXA 1UPCA 3WHLA 2EIXA 2BUBA 2J9XB 3B2EA 1LVHA 3ET4A 2P5UA 3JWEA 3PUXA 1KSFX 3DQQA 4F21A 3WLIA 2VF8A 5CGQB 4HT3B 2B69A 4M0MA 2JI7A 4FU0A 2X0KA 4P4UA 1Q57A 4TMYA 2KYRA 1HUQA 3ENQA 5KNCA 4ZVUA 1DRWA 1E5DA 1RRGA 1GL9B 3FMIA 2XBUA 2HQSA 1Q74A 3K2IA 2HXSA 3QX8A 2RK4A 4G3XA 4CMBA 4MB6A 3W2FA 4H15A 4XAQA 1FXWA 3ECAA 3WQRA 4UCQA 1QE5A 1TCVA 2BFWA 4N0PA 1GL6A 5M29A 2I9PA 3L4SO 5BV0A 1DKQA 3TVTA 4TV9A 1U2EA 3GLTA 4GVPA 4MQFB 4CL0A 1SM4A 3I5XA 4C4RA 2O8NA 5DJ5A 4G07A 2BEVA 4IS2A 2WM9B 3LT0A 5G4KA 4HN2A 3UJ6A 1RYHA 3RW9A 1QGZA 5JZBA 2J1LA 4L4ZA 4KRGA 4ES6A 4PX9A 1SZJG 3B89A 3DDCA 3OWHA 2NU8A 2GN8A 2VSYA 4OBBA 2CMKA 1M7GA 4CYMA 4QUBA 3QE9Y 4J16A 5K20A 4PLPA 3MJCA 2OGWA 4X63A 2P3LA 2ZRBA 4YREA 3EVTA 4KQEA 5A3SA 3TQOA 2B1RA 3TNJA 4DRXA 3CMCO 4JKOA 3ESAA 4D46A 1B8VA 5DASA 1Y0BA 4PYJA 2VK2A 3SCZA 1T2FA 2P2SA 1U8UA 3BTUA 1P5ZB 1YI8A 3PI6A 4NPCA 4OV6B 4PQFA 2XA1A 4FGJA 2VUUA 5U9CA 2RHTA 1ZM2A 3PNVA 2V59A 3UMJA 3O4IA 3G17A 1O4VA 2PXAA 3G13A 3PF8A 4OTZA 4RGYA 5AXCA 2AC7A 2ZIEA 3I23A 2A5YB 1Z4IA 1UAYA 4DV3B 1K6EA 1Y33E 4BB9A 3DBVO 1K4KA 3WOVA 3NASA 2G36A 2YY6A 2D5AA 4KCGA 4RPIA 1ITZA 2Y0PA 3A9VA 3D7MA 2VDNB 3RV3A 2AN4A 5KJ1A 2B1QA 1SAYA 4X6XA 5T67A 3BL8A 1NQ5A 1Z12A 3KKEA 3RUPA 5TVGA 3AHGA 4CM8A 4PLHA 1UC9A 1ORTA 2RGAA 3GEBA 1G7TA 4OQLA 5B7GA 4TKUA 3LGSA 5SZHB 4H6PA 1A9XA 1JMVA 1H69A 3ABOB 5DHFA 1NW8A 4C0KA 4R2IA 2CDAA 4RNCA 2QGNA 1RZVA 4HMQA 1DQYA 4N49A 1SUBA 3FOBA 4Y3UA 3DTYA 2DULA 2CDNA 2JGDA 3E9ZA 5FWNA 4PU0A 4DSTA 4FWIB 4RA6A 2JI9A 4JR1A 4LGCA 1RABA 5B2ZA 4N47A 2FR1A 2HXGA 2GEVA 5ERYA 2A84A 2XGGA 2Q9BA 4I0WB 3L1KA 1SURA 1UDBA 4V0QA 3M3DA 2WSYB 3VR3A 1GQSA 2F3SA 3FX2A 4YCCA 5L40A 1GCGA 1YS9A 2D7JA 2QSUA 4WCFC 2WJ6A 1VHDA 1Y9EA 1T29A 3UKJA 521PA 1XMOB 5ALDA 4IQ8A 1UM8A 3E8SA 4KGDA 4QGBA 5H3CA 2B7BA 3NX4A 1NLMA 3I61A 4EPXA 3UJ8A 1JFSA 2C2GA 4DEVA 2WFZA 1K3UB 2WINI 3F78A 1XP8A 2I1QA 1M74A 1JSXA 2JLQA 2HCFA 4IDAA 3U61B 2JRCA 1MV8A 3TUIC 3O4GA 1NI5A 4DIUA 3EGDA 1KBQA 4JJ7A 4EW2A 1MA3A 3JYHA 1OF1A 3AUXA 3OX1A 3UQYS 5A4FS 2WW8A 4WJKB 4HZUA 3HP1A 3QKTA 2QW8A 3F1LA 3PX2A 4Q9KA 2VF7A 1P7ZA 1U0SY 3K09C 2IS1A 5JAQA 3RS3A 1ZM7A 3VI3B 1U6IA 2XDQA 3KR1A 1KZ1A 3Q87B 4KPUA 2ZTVA 1Z4KA 1NVGA 3KZKA 3TDKA 5IZCA 3LX5A 4AY3A 4NOMA 2XKAA 3DEFA 3RYFB 3IUMA 1LBEA 2VTBB 3QMPA 1JHVA 1L9XA 3R3ZA 1KZ7B 1Z2DA 3MOIA 1WQ4A 1YRHA 5CFZA 2FWIA 2F00A 3OQOA 4H0CA 4AY5A 1JKXA 5B53A 4UEWA 4WFKA 4Q9DA 1M76A 2BFPA 2PGJA 1TM7E 1IRIA 2ZWAA 4LQCA 3ZWAA 3ANYB 4MB2A 4ZGWA 2E5LB 3BUSA 5FEMA 2Q7XA 4IFEA 3SDBA 1T5IA 4KO4S 1FPMA 3QUAA 4KITB 5K8LA 1C30B 1BCSB 2VRCD 1AQUA 3CRZA 4L5JA 2XWSA 2ZYHA 4YP0A 3S8MA 3L6BA 3WLHA 3V6LA 4MLPA 5JFOA 1JN0A 4A2PA 1X7ZA 4S0XA 4IIHA 4EHJA 1E2LA 2WILA 3NPAA 4HOYA 1UM9A 1ADJA 1V2HE 2FHSA 2QTAA 3EHDA 1F60A 1Y8QB 2H9AA 1IY2A 3G85A 3L7OA 4NYIQ 3HNRA 3VOTA 4M8KA 3VR0A 4E08A 1OWMA 1Z7WA 2PX3A 5F5LA 2WF6A 1AHNA 3WAJA 5H3HA 2LIPA 2E0IA 4Z1OA 5AVSA 3EMKA 3NHUA 3FOFC 3V1YA 1IPEA 2EKBA 2IVZA 5AKLA 2FNAA 4LGYA 1G2PA 1P17A 3W7AA 1TK9A 1N5MA 3WWYA 4CV0A 3PLNA 1RWNA 4MICA 2OGSA 4XXHA 4AUEA 1DADA 3HVHA 4IJ6A 4J7UA 2ET6A 1YU6A 1DJLA 1OBCA 3C3EA 3H1PA 1GSOA 4Q1BA 5B1DA 4IVNA 2QN8A 3K15A 2IQ5A 1FUYB 2BY4A 4AN0A 3T9CA 1A5ZA 1R6VA 1G0OA 3WNCA 5ARBA 1M34E 1RYEA 1TZMA 4FI3F 3ND6A 3ZHOA 4C7BA 2AD1A 1UPFA 2ZK7A 1YB5A 4BDTA 1RW4A 1N1DA 1E2PA 1R0WA 1Y63A 2FX3A 5M7EA 3V8VA 4QOJA 5ADHA 4MP3A 1DTEA 4PZDA 1E9AA 1EA7A 2YV5A 2ZITA 4EX7A 4G8JA 3DZKA 2SNIE 4CDNA 4ED9A 5IULC 3D8TA 1RI3A 3EA4A 5TF0A 3CUKA 2EFDB 3GA7A 1Q92A 2ID7A 4RZUA 1PL8A 3OLXA 2BOVA 2P27A 3UXHA 2OV3A 5EJ7A 2DQYA 3S7TA 5BV1A 1GQYA 5IYZF 5BQFA 1NUQA 3P94A 1O5OA 1O58A 4NE9A 4RDIA 4XOIA 1QCZA 5DHUA 2ZIVB 1J0AA 2CFCA 3S1LA 2O7RA 4EI7A 1C1HA 4ZTUB 3KZNA 1DEKA 1R0RE 4UU8A 4Y0VA 3GDOA 4XCQA 2O2HA 2E5FA 2PZBA 1GVNB 3O1HB 3VV3A 3GZNA 3A1DA 1B7GO 4E6EA 2HU8A 4UC0A 1CIPA 1A77A 4LXQA 2VFAA 3N6VA 3SYMA 1JYFA 1ZK3A 3I53A 5HZKA 3E3MA 1KYQA 1FTGA 1N32B 5BYJA 3S44A 3RFTA 1G63A 1SHUX 1UKZA 2J9ZB 2PVCA 2W37A 3FOCA 3REQB 1GXSB 1AZWA 3FLBA 4GKJB 1MORA 3HU2A 3OE1A 3KE9A 1SK8A 4J0KA 2ZYSA 4KAXA 4PGHA 1M5RA 1E6CA 4Q1DA 2QL9A 5I4CA 3PGXA 4R68A 3WMGA 3NTQA 5AH0A 3MWYW 4DR6B 1RM0A 3AG5A 1WV0A 4IWXA 1JDUA 2YV2A 3MLBA 3ONEA 4KR9A 4CF7A 1W36C 3DTTA 2ZJBA 3KLOA 4PSUA 3RK0A 3ZV6A 2PRYA 1E4EA 5DHRA 3EULA 2X4IA 3LY5A 4HDMA 5DTRA 3ZNNA 2YOFA 1GKLA 5UKDA 5EGSA 1WXQA 4B17A 1V1JA 2FEPA 4TMXA 4B6PA 4YEDA 4Q02A 1RKBA 5PGMA 2XB6A 1D03A 1UJ2A 4HY3A 3NIDB 2I55A 1IB0A 3K0FB 2CLKB 3NDRA 4LG1A 4DLSA 2RBKA 5CA0A 5BV7A 3GNQA 2WBLC 3DOJA 1XEFA 2BM9A 3HXMA 2JGKA 4NPHA 1ULZA 3WYBA 1GTRA 3DBOB 4JDPA 1TC2A 1C8BA 3ANSA 3I4CA 4EYOA 4ZTBA 3QXJA 1YOBA 1FEZA 1UANA 1L5WA 3DE7X 3T9EA 1U0RA 2WJHA 4TZKA 2PE5A 1LQUA 3W7VA 1KU0A 4JYPA 4TV9F 2AOTA 2JGJA 2ST1A 3AIKA 3ESQA 3FAZA 3LK6A 3NTRA 4PZAA 3V8PA 3WRWA 3ZNOA 3ZHRA 5J58A 2C3YA 4J1TA 5CD1A 1TQ4A 4PYOA 1V3QE 1L5RA 2PANA 3WKCA 3KYCB 1PTJC 2PRSA 1RRKA 2WZBA 3EXHA 1S96A 2IELA 4JEUA 4ZOBA 3RD5A 2Z04A 2JGFA 1GP2A 4F12A 1JTVA 2ZWVA 1V7PC 2GCGA 3UCFA 1E2QA 4F06A 3MJRA 4MYDA 1ABEA 3ZJTA 4I8IA 3I09A 3E53A 3RHFA 3EPPA 1Q0UA 1VGRA 1SD5A 1WE2A 5M3BA 4Y6RA 4ZI3A 5K5EA 5DMXA 2ZP1A 4IIXA 3DE2X 5GY7A 5F51A 1IE3A 3T6KA 1U99A 2JZOA 3PSHA 5AK6A 1BOFA 1U28C 2ZE7A 5HQ3A 1HRDA 2MYUA 2WM2A 5FV4A 1KDPA 3AL0C 1TVCA 4HATA 1QVRA 5HWSA 1PP4A 3A37A 1P9WA 3A36A 3OJCA 1PNOA 4Y9DA 3AETA 4EH1A 5BMVA 2IZOA 2R1VB 1E4YA 1V9LA 3AZQA 3PE4A 4UM7A 3K2QA 4I99A 2FN7A 2Q2WA 3OEYA 4Q9NA 3F4LA 4IIDA 1KP3A 1DTWB 1RQXA 4GR9A 5CBKA 2XB2A 3GPBA 4GO1A 4W7IA 1BDHA 4MDHA 1QYIA 2D2EA 3OZSA 4E3ZA 1M8PA 1LJ8A 1QP8A 1J1ZA 5CB4B 4H1UA 2JD2A 4I55F 1L5HA 3QIAA 4CEJA 2FP3A 1D3AA 3K1JA 4JLNA 3ZGXA 1YHZA 1QCYA 3JVEA 4PBSA 1CP2A 3PA6A 4LQDA 4Z8YA 1CUBA 1CLEA 5AXBA 3AJ8A 5LYJA 2E55A 3RYCB 2P9ZA 3ZW8A 4LY6A 4JI8B 1YUBA 3I42A 2VHWA 3PHGA 4RYDA 2A0UA 4TMTA 3RFUA 1KYYA 5BUZA 5FOSA 5B1SA 2G1JA 4DCNA 2BBOA 2DH5A 5IWCA 1F7VA 2DC1A 1C80A 2C5GA 1XPJA 2NU7B 4PYMA 3R3HA 3CNLA 4IVPA 1XZIA 5JC8A 2BP7B 2VPYA 1K5DA 5FWYB 1VA4A 4HNAB 4KI7A 1Z6YA 4TV9B 2GD2A 4YT8A 2ONZA 4IVQA 4KV7A 1S4QA 3EEYA 3H5OA 5CA1A 4MVJD 1FDVA 3V4LA 3PHBE 5FUXA 3VISA 2RG1A 1GLVA 1LWNA 2W6NA 3BPSA 3EPLA 1QBKC 2CLIB 1CZKA 2GPBA 1O95C 3MBIA 5AVZA 4PGMA 2FJUA 4XDYA 3FMGA 1P72A 3WXBA 2MSCB 3OD5A 4DRXB 1AQNA 1SZDA 1ZC4A 4II2A 2GPSA 1K7XB 4G4SO 3VU9A 2K87A 4CM9D 4Z9FA 2NTJA 1TA4A 3IJEB 5HM6A 5K3EA 1WABA 2DBZA 1IY9A 3DLTA 3HV2A 3GL9A 3DAGA 4NSNA 3TFOA 4EHHA 1PI3A 1TRHA 4GH5A 4TLCA 2JJ8A 4MWEA 4HDRB 3WXMA 1QV7A 1SBNE 2IYLD 3K96A 1IEQA 4XYMA 5JD3A 4F71A 4MRRA 1ZK1A 3A6JA 2GN2A 4R2HA 4RD2A 5D5PA 3RSCA 4UHFA 1VL1A 4TTIA 1LLQA 2OORA 4DCMA 4Z6KA 3WKBA 5CD9A 5F7XA 3BWMA 5E6SB 4QNRA 1TJ5A 2J0VA 2PRJA 1HO3A 2RD2A 1AURA 3AU9A 4WOCA 1PSWA 1YDGA 2XTNA 2VWPA 1GGNA 1Z2OX 3PUHA 4NZZA 3ZJ5A 2PT6A 1VI2A 4HG2A 2AJ8A 4Z7QB 2VUSA 3CLKA 2Y4OA 4N6NA 3HADA 4OAQA 3U1BA 5A04A 1KOFA 2QG6A 3OURA 3QUQA 5IJWA 2QLNA 1VPWA 1NMQA 4AMYA 4EL5A 3T1VA 2RGRA 3PA8A 5HSGA 1FNSA 2HB6A 2IIQA 1O87A 3VNRA 2Q49A 2QN2A 5EOVA 5JD5A 1LGYA 3LUCA 1NBME 2G5GX 2R6FA 2VJMB 3HBJA 3I2YX 1H23A 2Z3VA 3GV0A 1YB2A 3NM6B 4J16C 4OQMA 3KS9A 4TUYF 5LWQA 1SBYA 2P6PA 3EWSA 1VHWA 1BE1A 1L4UA 2I2AA 4ZI7B 1QHEA 4KSYA 5FBLB 4ND1A 4BAUA 5MN5A 2I03A 1FMLA 1VDMA 3NEYA 3BAZA 1EFUA 1ZD9A 1JLKA 1F8YA 2ID8A 4LGMA 3ACDA 5C8YA 1LPOA 3TEJA 2YWBA 4Q4AB 5ISMA 4BNZA 1ZISA 5EN4A 1CDEA 5HE8A 3WL4A 1KI1A 2XQIA 3FF4A 1EP1B 1L4LA 1XCLA 2NWQA 1JU4A 2HF9A 3AOEA 1QIMA 3PQDA 4AZ3B 4M1TA 1M8FA 2D54A 1HEYA 4RE5A 3IBFA 4ETWA 1ZW6A 1Z25A 1L1RA 3I83A 4G67A 4OGWA 4F85A 2X42A 3PQ7A 5EQTA 4MPTA 1YKGA 1Z26A 3UYLA 5IM4F 4BFYA 1YR9A 3DC2A 3LLMA 2EQBA 3WBJA 4EFNA 4NEQA 1V5FA 3DKIA 3EUWA 3KJGA 5AKZA 4KXMA 3UHJA 3UJHA 4CMHA 4ZIRB 2PUTA 3B1YA 1OBVA 4W8GA 3O8QA 3NP9A 2J5RA 2ZW9A 4L1KA 3LQ2A 2W22A 4CTOA 4BV9A 5A0TA 4E4RA 3SQNA 1WB6A 2RB4A 2OB1A 3AHIA 1QKIA 4IDFA 1E20A 3B6ZA 5B4TA 1L7AA 3TJZA 4KPUB 2YS7A 4F2PA 6PFKA 3F2IA 2EDCA 3KQUA 1MB2A 1VFNA 3QZUA 3NBFA 1UDWA 1P45A 2DF8A 3EGXA 3QPBA 4N3NA 4NBNA 1AH2A 1EG2A 4BLPA 1ZGGA 4CG1A 2WUWE 3H9CA 3HJBA 1T2NA 2Y9MB 3N6XA 1CXZA 3PHIA 4QDZA 5INTA 5JAUA 3NHYA 3FYTA 1RWMA 4AM8A 3ID6C 1G2IA 4J91A 4TRNA 5CT6A 2ATVA 3T94A 4R2MA 2O14A 5BOSB 3L5OA 2HCJB 4PLCA 4GLOA 4XVQA 5F78A 3PPVA 3MCAA 1BCSA 1RJEA 2P68A 1I6MA 3NR2A 3H5TA 2YNMC 3OM8A 1KBOA 6GPBA 2HUPA 3S70A 4EB6A 1N7HA 1QHHA 1XIVA 3DWEX 3F3SA 3ZBPA 1X6VA 2MJLA 2WQZA 1T36A 2PUBA 2FUG6 1O3YA 1JQKA 2X2EA 2Y0CA 2BFAA 4PLWA 1NM5C 3WFZA 2JCYA 1F8UA 2Q50A 2R1TB 4E2FA 3LRXA 1F9AA 3TLXA 1T9AA 5IAEA 4UPEA 1K4MA 1UC8A 2GTPA 2FZCA 2V6IA 4NH4A 3MM4A 1DIOB 3PWTA 3L41A 4JVMA 4XLZA 4C5AA 1UWVA 2NUPB 7REQA 3PQFA 1U8YA 4TKZA 1G41A 4IV8A 4DUGA 1CQPA 1WZCA 4FJ2A 3QU5A 4KIGA 2DHEA 4QBKA 3SMQA 4F6RB 3M6LA 5DISB 2GKOA 5U1PA 1XZJA 3LT1A 3W78A 4OYHA 3FGZA 3WYDA 1MX3A 2GBPA 1YJBA 3TAXA 1TFUA 5JZSA 2AEJA 2UUBB 1XCOA 1OFIA 1CR1A 1QVZA 2GZ1A 3HZHA 4DV2B 1IBMB 1NG9A 2PUHA 3LZDA 5A6SA 1ISJA 1XTUA 2FDXA 3I2FA 2FRVA 1IN6A 4I55B 4DQKA 3QVGB 2XSZA 3U3KA 4A0FA 4DXDA 5ETJA 4KDEA 2XUKA 3AJRA 4E2XA 5DV9A 3D7RA 3IB6A 4GMKA 4CCAA 1SUAA 5IMSA 3FSJX 4DTCA 5IJ0B 1KVUA 3OMWA 4K1LA 3H4VA 3V97A 2VP5A 1T9HA 2JFQA 2ZRPA 2EKZA 4WACA 4I2NA 3UY4A 2O8BA 1M1YE 1KFEB 3G2IA 1S9DA 4B40A 1QYCA 2RHLA 4BNYA 5KX5A 2BSAA 3QEAZ 1Z0SA 1SBZA 2PBRA 3CN7A 1E3LA 4GMGA 1I3OA 4B79A 2PL9A 2CLDX 3QPWA 5C18A 4RKEA 4EA8A 7MDHA 4BO2A 5IN4A 1U3TA 2FMUA 5IF3A 4HXYA 1KJIA 1HDGO 4PSAA 2WAXA 3SHFA 3UAOA 4DG9A 1V7ZA 1I4TD 3DC7A 3GLIB 1G8PA 3OTWA 3QENA 4JZKA 4ZV7A 3K8QA 1QLHA 2JFFA 2AOUB 1SVWA 2XUFA 4U4AA 2ODAA 5BSTA 3WRXA 2HT1A 3G5LA 1HV8A 5C7OO 1OIWA 1RXVA 2HBRA 1AK9A 2RGUA 2JFOA 4GR5A 3IOYA 4HO1X 2CBXA 2UYYA 3UWPA 3EVFA 5BQXA 3H99A 3WWCA 4WQMA 2BFDB 4EEKA 2ODNA 1VIMA 1Z74A 4D5EA 2GJ8A 4ZAFA 3WWEA 1NT4A 2WVAA 3C5WP 2X4GA 3T9FA 3ZD9A 3DHEA 5EXDA 5G1PA 2HR1A 1DBWA 2QT1A 1Q77A 1CUYA 3AFGA 3I1IA 4I9GA 2GZHA 4G01B 4DNFA 2R87A 1YXMA 3PGJA 3VR5A 1QIGA 3KR9A 4WN9B 2B4YA 3DZBA 3NAMA 2EFEB 4KQ6A 3EUAA 3HCFA 1J25A 1ZN7A 3WGLA 5AVOA 2H7VA 2SKEA 4EO4A 3A58B 4XGRA 3O4HA 3EY9A 3CISA 3QQ5A 3UAYA 2WR8A 3T7AA 3CVVA 2YXBA 2RH5A 1ETUA 1O8CA 5TQJA 2Z2XA 4L75A 2AF3C 3PNPA 4OFZA 4K28A 5JC1A 3S2FA 5C51B 3F9CA 3IOMA 5FHQA 5FKJA 1WMEA 3CBQA 1XZCA 2X7XA 2WTMA 3D6JA 4OXIA 5SV2A 1JT9A 3MK31 3HXOA 1P0PA 3S2IA 2J0UA 3MJ4A 4AD8A 1IOVA 5KYNA 4AJKA 3VJKA 1TNDA 3CCBA 4CMGA 4KLCA 1UBHS 2WWVD 1NQVA 1WUYA 2FSSA 5MGNA 3AUSA 2JGNA 3K3PA 1U8CB 4JB0A 5HM8A 3JALA 3CJRA 4W6QA 5DFAA 1TPZA 2VK8A 1VI6A 2X0NA 2AD5A 3DHNA 2JW5A 4EG6A 2EG5A 5K8VA 1Z8NA 1LV7A 3GJ6A 4ZGBA 2X3YA 4JY7A 1P60A 3RAPR 3CF2A 2IW1A 1QP7A 1AUQA 2WVJA 2VWGA 4G56A 4WKNA 4XSHA 5F4BA 4P53A 1ZGCA 2BGNA 5LA6F 1RXEA 1Y1KE 1SIWA 4CEIB 2AEEA 3L1HA 2OFXA 5GIPE 1T0IA 2ZRJA 3WL7A 3T5AA 5SYAA 2Q3CA 4KBYA 4PPGA 1QO7A 1PJZA 2CFTA 5DX0A 3TD2A 4X5OA 1T10A 5T41A 1XTVA 4C7JA 3NOQA 4CIXA 4BNHA 4GSKA 3UXEA 1KK1A 3L6CA 1UXIA 5K0GA 3VTZA 2ZG6A 2OHGA 2YVKA 2DQ4A 1EK5A 1HZZC 4WCFA 1AZTA 1IHDA 4U7DA 4ZVKA 1KHTA 2BKXA 2H7CA 3NC0C 2R00C 5DX8A 4Z3OA 1QPZA 1WF6A 4NFHA 5FPSA 1Z6AA 1H8HD 4B81A 3PL1A 1WRBA 4MMZB 2OVFA 4NCIA 1WHTB 1RXIA 5JDCC 2PA0A 5FBKA 5H4GA 5EJEA 2PKEA 4WEQA 4YAEA 2R25B 3KLPX 3Q7RA 4Z0PA 4BL5A 1BTOA 5CB4A 4CEJB 3KWJA 3PNLA 2PD4A 2W2KB 1EDZA 1P9NA 2FPMA 1W4RA 1Y9AA 8ADHA 2AJCA 3OF3A 1A5BB 1DEAA 2X5JO 5F21A 3ENNA 5CHYA 3B6MA 3MG9A 5JI2E 2XNHA 5BYKA 2ZWOA 5B1EA 3GWZA 1OFGA 5K6RA 4PSCA 4QO7A 2Q1XA 2HJHA 3DDHA 3O3OB 1ESMA 3A9UA 1DJPA 1N8TA 2ATCA 2QV7A 4WEOA 2GF2A 2AZXA 4WJZA 1PCXA 3OCUA 3TL6A 2OGUA 2Q1YA 2XMCA 4ND2A 4C7KA 3VM6A 2JH3A 3PF9A 1M0TA 2A0XA 1JMYA 4JBXA 4DZTA 4YLYA 5IASA 2NU9A 2WB4A 3U3RA 4RK5A 2WIGA 3V4OA 4QLBA 2JAWA 4XB1A 1JEQB 2Q1SA 2F6RA 1QRUA 4YQFA 4P84A 5I7OA 2AVNA 1ZRSA 2PTGA 5IZ4A 2K5UA 3W5VA 2QRPA 5GGYA 5I7HA 1GGMA 2GK3A 3QNWA 2GZ3A 4A8HA 1IQ0A 2C4NA 2P2YA 2QQ5A 3GAZA 3GT0A 4C6TB 1EQAA 1M10A 3SDZA 1PS0A 1QO9A 1SXJC 5DZSA 3H2YA 4EQ6A 1QE0A 1ZHHA 5JAIA 4EGFA 5ITSA 1T2UA 3ZZ0A 3AY7A 4H1TA 1W19A 2BEKA 3GEPA 2J5QA 3PZRA 2WKSA 3EDMA 4RTRA 3OQ1A 5LB2A 2JIDA 5JSFA 4WWHA 4KB5A 2JF0A 1HX7A 2ZJ3A 5KVAA 3U3MA 1GN9A 1P3Y1 4AULA 2PQ6A 1P8AA 1F1BA 1DKRA 3UT0A 2IXTA 1XROA 4GNKA 2UVDA 2O7VA 4RY8A 5JD6A 4YP5A 4AT1A 4U3JA 3IAEA 3ZS9A 3JVIA 3KCNA 4LYFA 5F1OA 4R1PA 3I1YA 2Z4SA 3RNOA 2ZUCA 1XVVA 2NZXA 1C9EA 3SC6A 3W06A 4CFSA 5DTEA 4IHAA 2JDID 1ZITA 2FG5A 1C7FA 3RSOA 4QGFA 5GONF 1J07A 5JADA 3THOA 4DMUB 5MFZA 1WVIA 2CC2A 2D0DA 3UCXA 2OLEA 2FOXA 2J6CA 1CUFA 2EJWA 2G0NA 2VWHA 4X1IA 1GFIA 1LFDB 1A88A 4S04A 2EKPA 3HDTA 2LVBA 4ND3A 1EE1A 4KR6A 1TQ2A 2RIRA 5CTJA 1ZJYA 1UP6A 4OI0A 4HUQA 1ZOSA 1MR3F 3CH5A 3AR4A 3LF2A 5DM0A 2DGDA 4ZI7A 1PW7A 2V7UA 3E18A 3G8CA 3HUTA 3ICWA 5REQA 3T15A 3WGJA 4B3XA 4RTJA 2GPTA 2W58A 3HM9A 4GPEA 1MB9A 3V4PB 4OAPA 1XKQA 1JRLA 3DP7A 3PIDA 4UCWA 3Q2IA 4WZAA 4EY4A 4KQIA 5C8YB 3SC4A 4P1ZA 1VA5A 5LDGA 4YRNA 3GBSA 2ECQA 5T3UA 2AG0A 5CFOA 5LKAA 2W0MA 1TE2A 5EWMB 1W1UA 3RHTA 2QOEA 3H97A 4JBHA 4J1SA 2VNKA 2B9EA 2XLCA 1PZHA 1YVEI 1KORA 1O6BA 3OWXA 1SK9A 3DAFA 5K01A 3E81A 4GVLA 3U4MA 1R27A 1Q5PA 2AJTA 3VHXB 3ZHVA 5I7VA 4JD5A 3IHTA 3NHMA 4C4AA 1TZBA 1KFCB 1XZGA 3A6PC 1E1LA 4KGVA 2BHNA 4IH1A 5CDTA 2KBEA 2IUEA 1ACMA 3MMPA 1YJCA 4W4TA 3AB7A 3PUKA 4JODA 4AVYA 4EY7A 5GTDA 4U0KA 4HX9A 4M88A 3TZCA 6Q21A 1T0JB 4KWHA 5FHRA 3IYLW 2LGJA 2I34A 1DI0A 1V41E 3PRJA 2VH5R 4FGUA 4PYIA 2IJGX 2NTVA 4U5XA 3ZWPA 4MZXA 5IVIA 4U7FA 3I4LA 3TW6A 2IIBA 4LYHA 4KXQA 4HAXA 5G1NA 3PPIA 4M9SA 2VK1A 1P39A 2WPDA 4REOA 5EQJB 4ZCPA 3O8NA 3AMVA 4M98A 4MQ6A 3HZZA 4DXAA 2VYVA 3OVMA 3FMFA 3KPUA 3MCWA 1O6CA 4KDCA 2OO5C 2N46A 5AKKA 5IC4A 5CPFA 5DLEA 5DBHX 4Z49A 2AQIA 4AZ0A 2CEAA 1ADGA 4ZHQA 5AWFC 2Q5IA 3QEJA 3RYHA 2HNBA 5FPKA 3HVKA 3BHJA 2P9GA 5EE0A 1ISRA 1Z8HA 5ADVA 1NBMD 1BE0A 1K92A 3EC7A 5ELLA 5KTMA 4D4MA 4UXJA 2XT0A 3W6PA 1O57A 3C3WA 4TN5A 1JMKC 3HDYA 1WUJS 3OP4A 4HQRA 5DT9A 1W34A 2YZ7A 3KZCA 1MFZA 5FI3A 3RANA 3BB3A 2IUTA 3WDKA 1NMSA 2BFCB 3OP1A 4KP7A 3T7DA 4D74A 3GP8A 2F55A 1PV4A 2YCBA 5JZ9A 5LZ2A 3RRZA 1VCHA 4L0DA 1ANKA 1HTBA 1W94A 5G2OA 1BHQ1 2ZKIA 3U0BA 2HCTA 4RCZA 2R1TA 3RREA 5A7GA 1BA3A 4V38A 4ZC1A 4PW0A 4O33A 1N4AA 2O3JA 3M34A 4Q48A 4KMMA 3AT1A 5IP5A 2Q6VA 2YZNA 2FWRA 3BKWA 1KEEB 1X2BA 1Y98A 3L6UA 2I4TA 3NDIA 3F74A 4GOND 4RENA 1SVUA 3H2KA 4YR7A 5I48A 1FFSA 5E8RA 4BATA 1AX9A 1O89A 2C0QA 2PSHA 1Q0TA 2P9TA 1BC5A 1JU3A 3COYA 4O4JF 3SQXA 4DIFA 2HTEA 3E2MA 4H7KA 4HDQB 2O8EA 1XJCA 2RHOA 4DA8A 3EX7C 5A4JA 4A10A 1ORWA 1T9GR 4NBUA 1US8A 1ZXLA 1M73E 1X1EA 2N1BA 4GEGA 4QA9A 4U2FA 4UBIA 5ILOA 1V1MB 3CEPB 2IHZA 2HJWA 4NZMA 1L3CA 2C5EA 4Y1RB 4EGJA 5IJ0A 1TJPB 5AKIA 2AUNA 2ON6A 4R2JA 2GH1A 3H5RA 4JUBA 3KOOA 2D1RA 3ZOKA 5LA6A 5G0VA 1GOTA 4S1OA 3TINA 5EKUA 3X1MA 3TZBA 2QU8A 1KGSA 1P1CA 2Q5LA 3FCOA 1M34B 2QT9A 4OB7A 1E0DA 1K68A 2D2IA 5HGXA 4A23A 2P6MA 2HO4A 1YV9A 2PUWA 2QNIA 1V5EA 3IBCA 2FW7A 1I80A 2HLHA 3CZAA 2G63A 2LE0A 2VBIA 3QA9A 4OGLA 2DECA 5AVRA 5THQA 4EPRA 2Q4OA 3UG6A 2QTRA 4CCSA 3GUCA 3Q1KA 2BDTA 3R3UA 1MO4A 2B35A 2VVTA 3JATA 4RELA 3S8EA 3R6LA 3OUUA 3AVTA 3ORSA 1M54A 4JS0A 4K6MA 3H86A 3W2TA 2ZRKA 1GPBA 2WFAA 1D7AA 1WMFA 4FJ1A 4KQ9A 1VCNA 1IG0A 4MAMA 2BN4A 4CN8A 1DFHA 2ZATA 4O8CA 1Z39A 4DGQA 3ZD6A 4OQYA 5A7HA 3ETLA 4DPKA 2PZFA 3BS4A 3N8NA 5AOBA 3L43A 2C4WA 4ECAA 1E92A 1FFHA 1VJ1A 2CV0A 3LW8A 1Y3BE 2GPWA 4JBIA 4AYWA 4BXOB 1UPBA 4MUYA 3SKYA 2JCGA 4RKQA 1EA5A 3IQFA 2JHCA 3PFWO 1J0BA 4KFSA 3D2LA 3EFOA 3SMVA 1YTUA 3PXAA 5FNVA 3SBOA 3HA7A 4GGPA 3OQJA 4GQAA 4H6XA 5E2AA 3VR6D 1IXYA 4C2UA 3B3AA 3GN2A 4C06A 1C7IA 4PIVA 1V8PA 5AQ1A 5KNBA 4ZMSA 2W8BA 1N2CA 3C1TA 1VJTA 2C96A 2BC9A 5HKOA 1T35A 3KEFA 2XI4A 3W9UA 1XEXA 2GEBA 2CFOA 3V6MA 5EHGA 3S5UA 4QT0A 2YIJA 2XRZA 4BY9E 1HXHA 2C1EA 4B84A 4BVHA 2GB4A 4HH0A 1TQ6A 1CR6A 1B6GA 4QGHA 3U7QA 4O2BF 3KAJA 2PFSA 3OI7A 1T9GS 1V0JA 3GGGA 4M7OA 2R6GA 3V8BA 3Q9UA 4LTMA 5ARDA 2JFPA 1Y5MA 3T3PB 3AOEC 1B0ZA 3VSCA 2E7ZA 2H07A 2ZREA 4JT9A 1V4VA 2ZRCA 4XVCA 1GV0A 2O2SA 4HXGA 4NK4A 1KF0A 2YRWA 1JP7A 1I1OA 4UOQA 5EPOA 2VHJA 3NGXA 4MS4B 1JUDA 3AEKA 3SD7A 1F2TA 2HHLA 3PZBA 5DKFA 1WDMA 4BGUA 1D5CA 5EESA 3LP6A 2I8CA 2H4YA 3DEYX 3SVZA 4DMLA 1FJ2A 2AN3A 2WV9A 3Q85A 4G9BA 4GUAA 1NN1A 3DV0A 4DBLC 1CZOA 2RGDA 2KB0A 3KYJB 2G08A 2HHCA 3L6DA 3NETA 2YV1A 3Q3CA 5ES4B 5KZMB 4Z51A 2E4YA 4KIWA 5D3ZA 1EVYA 4RTMA 1PYGA 2JGLA 3WSTA 4DCVA 4IJVA 4BQPA 4YXWA 2CVZA 2H9YA 3A9WA 4HDAA 2V96A 1LNZA 4C6SA 5ALUA 3U7RA 1XWIA 4KNVA 2PK3A 5DRTA 3ZWDA 1OFUX 3C3AA 1PNRA 2AGVA 4JUCA 3BVPA 5EXXA 1IBKB 3KJEA 5AK5A 3LUHA 3L0IB 1YIOA 3JQQA 1WCXA 2RH9B 4YJHB 3D4PA 3WAKA 3U44B 5D1HA 3AESA 2O4UX 1DKMA 3Q7SA 5JXIA 5K6AA 1I3KA 2AYZA 4DUZB 2PUVA 5B64A 1LVGA 3THYA 1LX6A 4BQRA 3JQ8B 3C5EA 1XQWA 3JZDA 4S0ZA 1O94D 2C2ZA 1T8RA 1ZICA 3R5XA 4G2TA 4LRYA 5FL7A 3WE7A 1B23P 3ZH9B 2I66A 4Y6QA 2G77B 2AZ4A 3GNSA 4ISCA 4B3IA 1X38A 2VBFA 1KQ3A 2H1CA 3A0UA 1I4EB 3QI7A 3WGVA 3GRUA 5IHPA 3VKUA 1RJ9A 1H66A 4LF7B 1U7TA 3E3OA 3SYRA 1Y89A 1ZD5A 2CKMA 4R0MA 5BN4A 3O91A 1G8FA 1N9GA 3QMMA 3JR3A 4TZ6A 1NA5A 3REOA 2B0CA 2P9CA 4X7PA 1TVMA 1L4EA 1KQGA 1E1MA 3A6EA 5FBZA 5KU1A 3GZ4A 4BQEA 4N76A 4ZA2A 3FFAA 3M1AA 4DLLA 2VP3A 5GV8A 2GA8A 4QYMA 5HHTA 3VV2A 1O94C 2PM8A 1EAMA 4MEJA 5EKTA 1S8AA 1Q1AA 4OQNA 1EX9A 5EKSA 3T3MB 3U3ZA 1O0CA 2D5CA 2J7PA 1KVQA 1QYWA 3UFBA 4P80A 5G02A 3OTGA 1U3GA 1CJVC 1VLMA 1I4LD 3B3QA 4UBJA 3LY8A 1WR8A 2GBGA 2WVHA 4NEGA 3L3BA 5EIAA 4R0VA 2WUDA 4EYKA 1N1GA 2HRQA 2WVGA 5KYKA 2F48A 4QT4A 3G49A 1ZRHA 4MHTA 5D1NA 2C77A 4QXRA 1TLLA 4DT1A 2VDRB 3DBHA 3BBPA 4N0DA 4BTLA 1FYEA 5EJIA 2ZUDA 2PSEA 4JGGA 5F1KA 5IUNC 3D31A 5IUJC 3BJRA 1XXLA 4U2BA 3ROMA 4CM4B 4F4DA 5IH7A 4TV8F 3J80A 4MRMA 4XJXA 1COZA 1BW9A 2HCBA 1AKNA 2IDJA 3JPWA 3L0ZA 1W85A 2UYGA 1JLLA