3Q9UA

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
138
Chain Sequence
ATRPIDGLTDEGIRETLTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKIEVVDLFVNPAKAWRFVAYAIKKGAKVVWFQYNTYYPLAARQAGLIIVANRCMMREHKRLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, de novo protein
molecule keywords CoA binding protein
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 138
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q9uA00
4KZPA 2NSDA 2WYUA 3V8BA 2P9EA 1DXYA 3A4VA 3E03A 4RDIA 2AW5A 1Q1NA 2VN8A 4J7UA 2VWHA 4ALJA 4I5GA 2NV6A 2P9GA 4INAA 3KEQA 3PWSA 4WLUA 4MIEA 2RCYA 3OJFA 2ZIZA 3U4IA 3V1YA 1U3VA 1O9BA 2PGDA 4DBZA 4YAEA 1GU7A 2RH8A 2W90A 4PRLA 2HMTA 3FN4A 4CM6A 3T7CA 3L6OO 3B1KA 4KOAA 3ROQA 4TRJA 1H6AA 2VCYA 3ANLA 1KEWA 4MOWA 1WZEA 3EDMA 5IFLA 4Q3BA 4E31A 5U9CA 3PDUA 1E5QA 4Z9FA 1NX6A 3HWRA 2CDAA 2QRKA 5A05A 4CMIB 1PQWA 4P38A 1KY5A 1XKQA 2D8AA 2O50A 5LDGA 3TDKA 5T57A 3W4IA 1JKFA 3WQQA 4RL6A 3DBRB 4YXFA 1QR6A 1Q7BA 2GN4A 3FR7A 1UDAA 4RVSA 2B69A 4TQGA 3T4XA 2NADA 1JA9A 3BTSA 3VVCA 4ALLA 1ZK1A 1ZSYA 1V3VA 2ZB4A 2GDZA 2GPTA 4CM4B 4DC1A 1LQTA 5JY6A 2QRJA 1ORRA 4J1SA 2NM0A 3GVXA 4AFNA 2V7PA 4D43A 1DIAA 3BMQA 4D46A 3GMSA 3ZNOA 4OSPA 3WYCA 4BNWA 4IUYA 2IE0A 3EW7A 3VZQA 1P45A 1Q0LA 4B4OA 3E18A 1CERA 3P19A 5JDCA 4XIJA 1WXDA 1H94A 3RUDA 1B16A 3U5TA 2J3KA 4Y6PA 4BNJA 2P5UA 1H9BA 2GNAA 2VHYA 2VUTA 2ZK7A 2HMSA 1GFSA 1NPYA 3I4CA 4WEQA 4YT5A 3ZV4A 5BSFA 1TT5A 4LW8A 2PD6A 1WAMA 3Q2KA 4WEOA 1PL7A 4IDFA 1R0LA 4NBUA 4U0KA 1PS9A 2GF2A 2ZQZA 1Z7EA 4B8ZA 4IDGA 4BO8A 4Q3DA 5AYVA 1VRWA 5H82A 3GK3A 3OMLA 1SOVA 1CQJA 2X4GA 1TI7A 4R5MA 4W7HA 2VUSA 1YDEA 3FCOA 5THQA 3VKUA 3NKLA 1QYVA 2WD7B 3NUGA 2X9GA 3WXBA 4G5HA 5EMHA 4BNGA 5KTKA 4FIZA 2GZ3A 4BO9A 4CQMA 1VSVA 5L4SA 3DAPA 1MUUA 5TX7A 2FHSA 4D7AA 1ZJZA 2D5AA 2NACA 4QQRA 4AJNA 4GKVA 3E9NA 4HBGA 4MKZA 3W4JA 1I2ZA 3GAZA 3JQ9A 5IDWA 3PLRA 3K8ZA 1N1GA 1ZEJA 2A92A 4FBGA 4R1UA 5CG2A 3RJ5A 2BLLA 4IDDA 1ZO8A 5CHEA 4HADA 5GZ6A 1I5RA 4ILKA 1WDMA 4ZVVA 1I8TA 4WPGA 1XWFA 1ONOA 1WLYA 1IYZA 3ZWAA 1ZK4A 3PJFA 4S3MA 2EEZA 4NG5A 4WK6A 1YDWA 1JU9A 2PZKA 2GD1O 1BGVA 4GQAA 2B5WA 1U7HA 1ENPA 1UAYA 2Q2QA 5U1PA 3W8FA 5JS6A 3I9NA 4XEHA 2Y93A 4DGSA 1AHIA 2D59A 1TB4A 3BIOA 3WSVA 1ZXBA 1Y8RA 3SC6A 1O94A 1UZMA 1P33A 4J1NA 3DBLB 3BXXA 1U1IA 3ZH2A 3W8DA 3DONA 4JBHA 3ICPA 1EK5A 3OQ6A 3GEMA 3ITDA 3AM3A 4BNKA 4IDEA 4J9UE 2FMUA 2FPIA 3L77A 5ES3A 3OIDA 4BO6A 2Y1FA 4WLOA 2BF7A 4UVGA 3AU9A 3OFSA 2Q46A 2R6JA 3CXRA 1LQUA 4C7JA 3JQGA 1H6BA 2ZATA 5K6AC 1LDBA 2C82A 2HK8A 3OSUA 3TZHA 2BELA 4EJMA 3GNQA 3CZMA 5AVOA 2BGKA 3ZWOA 4BMVA 3FR8A 3JD2A 3CZRA 4BNTA 5MDHA 3QRWA 3UN1A 5EIOA 4QO7A 1J0XO 4IJWA 2FRDA 1J49A 2AEFA 1YXMA 4M89A 2EP5A 3UUWA 1PL6A 3PP8A 4MKRA 2C54A 2X22A 3IP3A 5IAAA 4E2WA 5JCXA 1E6EA 1WMBA 1F12A 2QZ9A 3P2OA 4J0EA 5EN4A 4IZIA 2XF8A 4YQZA 2JL1A 3RUIA 3C7AA 4QEDA 4BO7A 1QYWA 2LDXA 5DP1A 4B3IA 9LDTA 2Y1GA 2RBEA 1LRLA 1E3SA 1EZ4A 2CDBA 3WX0A 1P1FA 1QMGA 2GUGA 3RU9A 1GADO 5IDQA 1ZK3A 4RF3A 5KVVA 2LDBA 1YBMA 3O9ZA 2PY6A 3ZCXA 1P74A 2A4KA 2VHWA 2Q3EA 3RVDA 1B26A 4PN3A 4F3YA 2F1KA 4HKTA 4ALNA 3CUKA 1R4MB 4B79A 1ZH8A 2VOJA 4U6SA 3UH1A 4UULA 4YAGA 3CPSA 5TT1A 5KNLA 5IN5A 1ZMOA 3PEFA 3X2EA 4Z9XA 5EERA 3TQHA 3G0OA 3ROMA 4NZ9A 3ZU4A 3OJOA 4GSKA 5I9LA 2VT3A 1RJWA 4ZICA 4KDFA 3I6QA 3TRIA 3ZWPA 4LMPA 1EBFA 4BNHA 4F45A 1H9AA 2PK3A 1LX6A 2VNSA 5L7YA 2WDZA 1X14A 3E8XA 2OBNA 1NWHA 2YHIA 2OHXA 3A14A 5T8KA 3WGQA 4MKXA 1IHYA 5IZCC 4Y6SA 3WGGA 4CV0A 1W73A 4RPJA 2I99A 3Q9NA 2WSBA 3PYMA 1X7GA 1F06A 2AG5A 2OO5A 3H65A 4AJOA 1R0SA 2EG9A 2E48A 1NFFA 2NTNA 3IKVA 3H9UA 3HG7A 3IS3A 3VHRA 5K9ZA 1LNQA 1M76A 3D0OA 5LDHA 3K31A 2FP4A 3JD1A 3RUHA 3TL3A 1HT0A 1BW9B 1GZ4A 2XOXA 3CKYA 5AQ1A 5TNXA 3DZGA 3LF1A 2DFVA 3L0DA 1ENOA 1GEGA 2D1YA 2AEJA 2VYVD 3GHHA 1JQBA 3GPIA 3MJTA 3H7AA 3QW2A 4J43A 3WSWA 3K30A 4L76A 1LA2A 1N2SA 4K26A 3QV1A 4IXWA 4J4TA 1Y8QA 2RHRA 4KWIA 4W82A 4E2XA 2JCXA 1Z82A 3JYLA 3PWKA 1ZMTA 2JFFA 4R01A 2OXIA 4D41A 1IZ9A 4DLLA 4MP3A 3ROKA 1TEHA 4L4SA 4MVJM 3KSUA 5DP2A 3ANNA 3EC7A 5KWEA 5DT9A 3NX4A 3PHIA 1YQDA 2CUKA 2VQ3A 4WKGA 4E5KA 1PSDA 1UP4A 2YY7A 3LT4A 3M2PA 3TZKA 1DHTA 2XXBA 4JGBA 3DZKA 1C1XB 1WPQA 4RVUA 4GVXA 2Y0EA 2DUWA 4Y9DA 4IJVA 3HQ4O 1KVQA 2NWQA 2J3JA 3H8VA 3D4NA 4IDAA 4IS3A 4J3FA 1JTVA 1VJTA 1N8KA 1I24A 3GGPA 3MEQA 2GGSA 1BVRA 1HL3A 1VM6A 3CEAA 4WUVA 1QV7A 1B3RA 3PYLA 4ZU3A 4EYEA 3ZZNA 5DF1A 4AICA 3WGTA 1U2DA 5TGDA 4PRKA 1YL5A 5JYEA 1DC3A 1DLIA 4YJHB 3A06A 5BT9A 2B36A 1DOHA 4DIOA 5L95A 1MGOA 4GMFA 2BMAA 3FNGA 2DBRA 2ZJ0A 3KEOA 4X54A 3CMCO 3GZNA 1FDSA 4CLRA 1LC0A 1ZIDA 1UAGA 2HKIA 3O4RA 2WD8A 1DBVO 2CFCA 4OIMA 3RUFA 2E4AA 2QHXA 1F0YA 3D4PA 1HSOA 1MP0A 2GN6A 5F3RA 2FR8A 5GY7A 4DWVA 2GYYA 1BXZA 3HDYA 2AE2A 3I9KA 3K73O 4OMUA 5CPFA 5T5QA 2DT5A 3UVEA 2Q2WA 3C1AA 4OXNA 3PJEA 4BNNA 2PH5A 4M55A 5JMPA 4E13A 4TZKA 4E2ZA 1NVMB 1UZNA 5JO0A 3MTJA 2UDPA 3H5AA 1YQGA 4RVGA 1C0KA 2X0IA 2AG8A 1SNYA 2NU6A 1NQOA 4CM5A 4IMPA 4CV1A 3JQBA 2G5CA 2B4RO 2HJRA 3F1KA 2DKNA 3CSDA 1Y1PA 1AE1A 3MOGA 4TRNA 3BMQB 1A4IA 1DDOA 1P3DA 3U09A 5A9SA 1T1SA 1H6CA 4BO1A 3AOGA 4BV8A 4NBVA 1GQ2A 4BNVA 5G4LA 5U4QA 2FZWA 5AXBA 3ZWMA 5EQDA 1MG0A 1N92A 3GVPA 4FC6A 4II2A 4WCFA 4MO2A 3OP4A 3OQBA 1M6WA 1J5PA 3F6YA 2EXXA 2YQ5A 1CRWG 1HEUA 1U2GA 1TT5B 4CM9A 4FJ0A 4ZQFA 3RUAA 3C8MA 1NVTA 2RAFA 4J4HA 1PIWA 4HY3A 1SMKA 2PH3A 3ZHXA 4IJKA 4PLWA 2Y67A 4JROA 4XR9A 5TRTA 1I3KA 1YWGO 2UVDA 3L9XA 3NYWA 4L75A 1MC5A 3OICA 1LUAA 4RPKA 1B7GO 7MDHA 1GQQA 3MJSA 4CLHA 5I8WA 4A5OA 1PJQA 4RLHA 3DMYA 5A5FA 4CR8A 3DZFA 4CM3A 4FJ1A 4D0RA 1NPTO 4EBFA 2C29D 4U8GA 1LDNA 5ICSA 2AEMA 1GYPA 3C3XA 1ISFA 5DULA 3CIFA 3TWOA 4CQMB 3E1KA 4OHUA 3ZWCA 1YB1A 1PEDA 1PJSA 2WTBA 3FSRA 1AGNA 2X86A 5DDIP 4EUEA 4ND2A 4YTEA 4AL4A 2X0RA 1D8AA 3LC2O 3RFXA 3OJ0A 1DSSG 3L4BC 4PLPA 4YBZA 3GFBA 4PLZA 3WR5A 2HLPA 3H6KA 3WMWA 5I7FA 3ONFA 4OQYA 4CJXA 4BNMA 4NNJA 1WVGA 1EUZA 2WM3A 1EFKA 1T2AA 3AFNA 1I10A 3AY3A 4QTZA 2V6BA 2PV7A 3WB9A 1M67A 4A26A 1PS8A 1MFZA 1GV0A 1I0ZA 4XDYA 3DZIA 4N7RA 4FFNA 3V2HA 2PKQO 5HS6A 1GAEO 1B2LA 1LSSA 4Q3CA 1YKFA 3RC9A 5L9AA 4FFRA 4KUHA 1Y8RB 5COQA 4TWRA 4WLNA 1O0SA 4PVCA 3RC2A 3PLNA 4E5PA 3VPSA 1S7CA 3AJRA 1DJQA 3DZBA 3OEYA 4ITUA 1EUCA 1X13A 4RO0A 1A7KA 2Y1DA 3QY9A 4GSLA 4GX1A 3HDJA 4D42A 3JQGB 3F47A 1E3LA 1HF3A 1DHRA 2E49A 4MVJI 4UUPA 3VH3A 4BL5A 4XYMA 1MXHA 5CP8A 5CEFA 3INTA 1CQIA 3VTFA 3NDRA 1PJ2A 1WWKA 3FTNA 1P31A 3EZYA 1ZXLA 4BMNA 4ALIA 1A71A 2BI8A 1NQAO 2EERA 3R0IA 4BO4A 3F5SA 3WMXA 5KJCA 5EJ2A 2IEBA 1K89A 3R1IA 5TSDA 3ZDFA 4E5NA 1OC2A 2J3IA 2Q1TA 1YL7A 2V6FA 3G17A 4NMHA 4QUKA 1L1FA 3PGJA 3SC4A 4NU6A 4BB5A 4PG8A 5ILOA 2O2SA 5BSGA 2WMDA 1B15A 3HNPA 3ITKA 4CUKA 2HMVA 2CD9A 3MJEA 1HDXA 4FFPA 3L4SO 4KTTE 1F8FA 4RPLA 3I9OA 3MJCA 2QYSA 1E7QA 3AFMA 2JD1A 1T4BA 4AJ2A 3ZWXA 2NLOA 1VPDA 3DL2A 3EVNA 4N18A 4GPD1 2ZYAA 1JDJA 4A73A 1K6IA 3NTOA 1GL3A 2B83A 1EQUA 5CDUA 1QG6A 1G1AA 4J7XA 4CL8A 5A3JA 2EJVA 4HFMA 5F5NA 3TL2A 4S1VA 2HRBA 3WFIA 3KHUA 3QP9A 1SB8A 3AWDA 1ADFA 4RF5A 3H3JA 2I3AA 4K9DA 1DIRA 4YAKA 3RBXA 1DAOA 3ZU5A 4EGFA 2O3TA 5I8ZA 2ZCVA 4KQWA 4YT8A 1HYGA 3WWZA 5JW6A 4NDNE 3IUSA 4NK5A 2HO5A 3GMDA 1E1NA 4QX6A 4I08A 2Q99A 3L07A 4Z6KA 3VC7A 2OORA 3GY0A 5DBIA 4K1LA 2E82A 3PQFA 3JYNA 1NAIA 3H3FA 3C1TA 4F46A 4ZQEA 5TS3A 3GGGA 5F5LA 5L3ZA 4JNKA 2ZTLA 3Q1LA 2J5RA 4DYDA 2EJWA 3QWIA 2X6TA 4XDZA 2VWGA 3U62A 2WJPA 4OH1A 1EQ2A 1HKUA 5IXSA 1UP6A 5C7IO 1CWUA 4ND5A 3M1AA 3GG9A 2YHIB 4P4LA 1YE3A 1M75A 3L6DA 1K2WA 5CPBA 4ZN6A 2GSDA 2Q4EA 4GWGA 4J4BA 1QV6A 1CIVA 5ER6A 1UXKA 2H63A 2GCGA 4P22A 1E7WA 2FOIA 3RC1A 2O4UX 4L8VA 2UUOA 1QKIA 5DZSA 5COAA 1ZUD1 3INRA 1RWBA 5T67A 3ZW9A 4CPDA 1EVYA 4HNHA 3TF5A 4R69A 3HADA 4LK3A 1ZKMA 5L40A 1AUPA 2EW8A 1FMCA 4UVIA 3H9GA 1KVUA 4A7PA 2PWZA 5B12A 1Y5RA 3KLPX 3UF0A 1NFRA 4MVJF 1KY4A 3RU7A 3V5NA 3B6ZA 2P4HX 4CODB 2AHRA 3DOJA 1XQ1A 2GASA 2G82A 2RIRA 1YS4A 2Y1EA 3ZWYA 4R9RA 5AXAA 1C0PA 3PIDA 3JV7A 2CMDA 3DHEA 1JW9B 2JHGA 3ZU2A 4PZCA 2ZB8A 3S2GA 1QYCA 5TT0A 3PZRA 4J2HA 3M2TA 3KUXA 3RFTA 4D45A 3CH6A 2X9NA 1XLTA 4DMLA 1B0AA 4NBTA 4BNFA 3PHHA 4MIYA 2ZB7A 4G2NA 2IODA 3SLGA 1ISGA 1IZ0A 9LDBA 4L0QA 3D3WA 4NBWA 1HZZA 4E12A 2Z95A 4J91A 4NFSA 3OA2A 3ZW8A 5HS4A 2GR9A 1SBYA 3NJ8A 1LRKA 1VI2A 1VJ1A 3IQDB 1VSUA 4QT0A 1D3AA 2X5JO 1N9GA 3ON5A 4LVCA 2HAEA 2PKRA 4Q3NA 3RKRA 5BQFA 4TSKA 2O48X 3DMTC 4PLHA 2VNAA 2GZ2A 1MC4A 4DREA 4GBJA 2PD3A 3FWZA 3QWAA 4FDAA 1KIFA 1M66A 3SVTA 3BHIA 1KS9A 1E3JA 4E30A 1I33A 4BO0A 1H2HA 3BMCA 1XGKA 3VTZA 2J6IA 5C7OO 4YWJA 1SB9A 2EGHA 2Z1MA 1T2CA 2CY0A 1LLQA 3GZNB 1Z74A 4KP7A 4ROSA 4TMFA 5G4KB 2WEKA 2IEDA 2YDXA 3SX2A 4CLRB 1Y6JA 4W7IA 1X1TA 2J5KA 4ZJUA 5FYDA 5JMWA 4PGFA 1PGJA 3W6UA 4DXHA 1ISIA 3F46A 3H4VA 3I6IA 1MB4A 3G3EA 4E5YA 3LQFA 5KKAA 4CLXA 3O26A 3AOEC 4R9SA 3COSA 2DBZA 5CDYA 4JJIA 4BKOA 2C7GA 4PZDA 4IBOA 4DC0A 2QYTA 5DOZA 3VDRA 1CF2O 3HDQA 2CDCA 1UR5A 4KTVE 5DNAA 4W6ZA 5B4VA 3ONDA 4WLEA 4R5HA 2VHXA 2XAAA 4M87A 2PLAA 3UFXA 4BKUA 1FDWA 4ZD6A 1PZGA 3LLSA 5A9SB 4YEDA 2BFOA 3WIEA 5CFZA 1HE2A 3PVZA 4OOEA 4AJ1A 3M6IA 1XHLA 1T4DA 2FPGA 4B4VA 3ZGYA 3R3SA 4WCFB 4AJ4A 3GOHA 2FSSA 2R00A 1HRDA 2NNLD 1QXSA 3FF4A 4FB5A 1GZ6A 4GL4A 1BWSA 3GHYA 4OL9A 4YRDA 2VUUA 5DOVA 3WQSB 2CF5A 3UAGA 3LU1A 1WMAA 2Y68A 5TLSA 3IL2A 2NVUA 3LDHA 1BVUA 1EDZA 4XZ3A 3F4BA 4JJFA 3DZJA 1QYXA 2BKAA 2FSVA 2X5OA 2DAPA 3F9IA 2YJZA 4JBGA 3LSYA 3PDJA 3ZNPA 1T2FA 3DTYA 4WNIA 3ULKA 3TOZA 4JN6B 4H16A 1NNUA 1A7AA 1IOLA 3OIFA 1QORA 4YQYA 5GMOA 2FR0A 5CDTA 5A3VA 3RC7A 2A9FA 3N58A 1OFGA 4I9NA 4LN1A 3VKVA 1PTJA 1LSJA 1WW8A 1PZFA 3OHSX 1EE9A 1GDHA 4XR4A 4E0BA 2I3GA 5F1OA 1HYHA 5J23A 1V8BA 4ZQGA 1HDRA 4UEOA 4O63O 3KYDA 3BMOA 2G76A 1U4OA 1GUZA 1X0VA 3IJRA 1F17A 3K2EA 1ZZEA 1NXQA 1Q7CA 3CMMA 4OQZA 4XWYA 3HHPA 4DTIA 4BQPA 1Y7TA 1ZCJA 3JQ6A 1I32A 1H6DA 4J1QA 4OKNA 4C7KA 5KOIA 4DMMA 4UUNA 5A06A 1NTOA 3FD8A 1GQYA 2CVQA 3ENNA 4D44A 3PYXA 4IGEA 4TRRA 3TNLA 4EJ6A 4CMEC 2D3TA 1IL0A 3F1LA 3GEGA 3WOHA 1RM3A 3F3SA 1NR1A 1Q2XA 4FOOA 3H2SA 4IDCA 2X5KO 1VL0A 4IQ8A 4GX0A 5FI5A 2D5CA 4KUEA 4CMCA 1UXHA 5IF3A 1A27A 1SO8A 2H6EA 5ADHA 1MG5A 4BUCA 4CLDA 2VOEA 3MTGA 3LT0A 2DVMA 2DQ4A 4L73A 4PLCA 5CEJA 2BHLA 2YDYA 2NQ8A 4BNLA 4W99A 2TMGA 4W9NC 2H5LA 4NJOA 1LC3A 5GZ1A 1O89A 1SAYA 3P5SA 1U28A 1X1EA 2WE8A 1U5CA 1P0CA 1V3TA 3ONEA 4XGNA 1OOEA 1TXGA 3WGOA 4GKBA 1D1TA 3D1LA 4R54A 4HP8A 5BNTA 5A5EA 3BA1A 3TFQA 4LGVA 4NPCA 4B7UA 3JQFC 3TJRA 4CMGA 5HM8A 5G0VA 1B8VA 5EQFA 4DBVO 5CDGA 4BO5A 4Q9NA 1NHGA 1PZHA 3Q3CA 1A9YA 1G6KA 5DBFA 1DJNA 1Q0HA 3VPHA 1C1DB 4XQ9A 2BFAA 4JIGA 1ISJA 2Q2VA 3NRCA 3KYBA 4IY1A 2Q1SA 1ONNA 2Y0DA 3CE6A 3OETA 4ID9A 4PLYA 3HFGA 2SCUA 3KTDA 2QW8A 3PJGA 2P2SA 1MX3A 3K92A 1K5HA 3JYPA 3NDJA 2WWRA 4NH4A 4AJKA 4XGKA 2C2YA 3SXPA 4FOSA 3AUSA 2WYVA 3KSZO 5G0WA 3PPIA 2OP1A 1U4SA 5JDIC 3DBHA 2UYYA 1YQXA 1V0JA 2G17A 4J1TA 1H5QA 4U6QA 2P68A 2C59A 4L74A 3PWZA 1KVTA 3IKTA 3P7MA 3JCZA 1A5ZA 3E9MA 3I9MA 3TFOA 5BNFA 2B4TO 4FW8A 1EFLA 4I9HA 3V1UA 1HDOA 1HLPA 5L4LA 1EMDA 1O95A 1Z75A 2IYPA 3JQAD 4TRMA 1CEQA 1LDEA 1MXFA 5KJ6A 1LSUA 3BHMA 3VH1A 5K0ZA 1C0IA 5L7TA 1XEAA 3D3EA 4GX2A 2W98A 1Y5MA 3IAHA 2GRAA 4DIFA 3QA9A 2XPCA 2YW9A 2QX7A 2OBYA 4FFOA 1HZJA 2JAPA 3ADPA 3FBTA 2ET6A 3GC6A 4BOYA 4CUJA 5ENDA 1BTOA 1K3TA 4JLWA 5IZ4A 1BXGA 4K6FA 3DBRA 1E92A 1PZEA 4LCJA 3G49A 1KEUA 4GAEA 3Q6IA 2NTJA 4BGUA 5IDYA 1YONA 1FF9A 1ADBA 5TC4A 2PFGA 4BHTA 1ISMA 4UVDA 2B0JA 2H9IA 1M2WA 3D5QA 2HUNA 1T2DA 1GCUA 5EL0A 3C7DB 3W6ZA 4ONEA 4YRBA 1LLDA 1E5LA 3NT4A 1C3VA 3WJ7A 1ULSA 1XQ6A 2QG4A 3WG9A 3D7LA 1HE4A 3EY4A 1JWBB 2O3RA 4YA6A 1YH3A 4MVJH 2FWMX 2ILTA 1SZJG 5H83A 5T6BA 3TPCA 4Y67A 3RFVA 2UUPA 3GLQA 1U7TA 3KRTA 1KEPA 4CQMD 4E4YA 4K6CA 3FNEA 1YJ8A 1OBFO 3JQ9C 4FCCA 4LVUA 3LVFO 4XRRA 2BGLA 1P1IA 2YUTA 4WLFA 4BGEA 3GN1A 5JCJD 4XQCA 1XR3A 5CEEA 4DLBA 2OOSA 3WLFA 4P8RA 3GPDG 2PGLA 3D3WB 4E6PA 3ETDA 1UUFA 1X7HA 1SEPA 1EK6A 1OAAA 3DAGA 4O5OA 8ADHA 4XB2A 3NV9A 3DZHA 1I3NA 3UCFA 4NI5A 4JX8A 4WNCA 1N9GB 4XGIA 2UAGA 3WBFA 2WE7A 3H9EO 2ZTUA 1UH5A 1GPJA 4LRTB 3VPGA 5JAIA 2J5QA 4DLAA 4WOKA 5KJEA 3E82A 4XRGA 1VE9A 3BMCB 4PCVA 5L45A 2P4QA 3AK4A 2JAHA 5GZ3A 1T2EA 4AVYA 3UKOA 1RPNA 4FPXA 4XYEA 1P0FA 1IULA 1P1JA 4KQXA 5A04A 1GPDG 3KM0A 4BNZA 3EK2A 3DTTA 2P91A 3AI2A 3QVOA 4ESOA 3NTQA 3E48A 1IPEA 4RJTA 3RASA 1K6JA 1LLUA 4XD2A 3VZRA 2GLXA 4IZHA 3L9WA 4GX5A 5L4NA 5KIAA 3LC1O 1EDOA 8LDHA 1TLTA 4AJEA 2PR2A 2DFDA 1B3BA 2PNFA 4GI2A 4ZQBA 3F4LA 4Z0HO 1UDBA 5IXYA 3KSDO 2O2YA 4PG7A 4CLOA 3DO5A 3FBGA 4XJTA 1BXKA 3RBZA 4RF2A 4IIUA 4N5MA 3JQ7A 1D7OA 2OMEA 1ISHA 1BMDA 1ADGA 3OECA 5KJ1A 4P4NA 1XG5A 1A4UA 1OC4A 5I7VA 3DDNA 3ZWBA 1DAPA 5HRUA 4RDHA 1W0CA 1JKJA 1K0UA 2IZ1A 1E77A 4UREA 3LLVA 2HJSA 1KVSA 3H5RA 1F8GA 4N5LA 2NVUB 3RAJA 4RLSA 1N7HA 2PZMA 3WICA 4EW6A 3AUTA 3H5NA 3CTMA 1LSOA 3PGXA 4EEXA 3PQEA 3VPFA 4XCVA 1MLDA 1I3LA 4MVJP 3IJPA 3ZWWA 4EI2A 1IHXA 4NFHA 3GVIA 3DAFA 2BD0A 3HN7A 1HWYA 2BFMA 2C20A 2IRWA 1R15A 4B8WA 2HK7A 1HXHA 3ETEA 1X0XA 4M49A 1ARZA 1PJCA 2B4QA 2VTEA 4HXYA 4PG6A 4IINA 1R37A 3K2BA 4BO3A 3U4CA 3H9QA 3AW9A 3OBBA 4ZQHA 4BS9A 4QFCA 4D3FA 4GLOA 4DYVA 1SC6A 1P1HA 3E6AA 1C0LA 4FC7A 4BKPA 3KYDB 2W2KA 3ORFA 1KEVA 3GNTA 5KCZA 3UGKA 5T8KC 3BZUA 3BYZA 3JQCA 4FR5A 4CV2A 1R66A 1DRUA 1WP4A 2NU9A 2PKQP 1N5DA 2NTVA 5TQVA 3AU8A 3RCBA 4DRYA 4NJMA 2P5YA 1CDOA 4PFJA 4PG4A 4H15A 4J2OA 4CM8A 1PJLA 2DPHA 3VDQA 1E0DA 1U8XX 2EP7A 1LDMA 3HFSA 4MP8A 4AJIA 2DBVO 5JXWA 3UHAA 4D3DA 2EF1A 1PGNA 4MVJG 1T1RA 2VYND 1SEVA 4KDEA 1NQTA 1E1LA 4QXMA 1OZAA 1DIHA 5TIIA 1KVRA 3KXDA 2OZPA 4MJLA 5DCUA 4YVFA 5K6AA 4J16A 1LJ8A 2DLDA 3WDSA 1UXJA 5A9RA 1PJTA 3JQ8A 1P1RA 5KVQA 3ZV5A 4IGFA 3JTMA 2XXJA 3Q2IA 4PG5A 3CINA 3LT1A 3N7UA 2O3UA 1TVEA 3Q0EA 3GDGA 1R16A 1RM5A 2AQKA 4RV9A 2ZTVA 4LRSB 3KLMX 5JC1A 1EVJA 1ENYA 3GA0A 4J7CA 4Y98A 4I8XA 4Y8VA 3ENKA 4J6FA 4CV3A 5CG1A 5ITVA 1HDCA 1VJ0A 4CM1A 1PWZA 1O5IA 1GYQA 1KC3A 3JD0A 1RM0A 5F21A 4YR9A 5B1YA 4RORA 4MINA 1VL6A 4HFJA 4BNUA 4E2YA 1LDYA 3I83A 3LF2A 2HSDA 3JD4A 1QSGA 3K96A 1BSVA 3G1UA 4YJFA 2J3HA 1NFQA 1G0OA 3KOUA 3QWFA 1FK8A 2B5VA 1PQUA 1V3UA 1PQPA 4DQUA 3QE3A 3TOXA 4GVLA 4CMAA 4RPGA 2AQIA 3GF4A 2IZZA 4DA9A 2JJYA 1FDVA 4WE3A 4NU5A 4WJZA 5HTOA 4UUOA 1SPXA 4BKQA 2W2LD 5KKCA 3DBVO 4CM7A 3LYLA 3MZ0A 2OFPA 2Q49A 2W4QA 1RYDA 1LDGA 2D4AA 3D64A 3GNSA 2O23A 2YV2A 5EINA 3WFJA 1IY8A 4M8SA 1GUFA 1H93A 2I65A 1VKOA 1IB6A 2NUAA 2ZYDA 4XJSA 1I2CA 4EEZA 1UZLA 3FTPA 5BSHA 3DBHB 4KUGA 1ID1A 3INGA 5HA5A 1NAHA 4LSMA 3OA0A 3QIVA 4XA8A 1Y8QB 2O3QA 3HE3A 4AJLA 3V1TC 1B8PA 1Z45A 3ST7A 3PRJA 4JQCA 3PQDA 4BNXA 5IZCA 5A4DA 3JQBC 5JPIA 5AXDA 2CSUA 1XU7A 1AN9A 1W6UA 4U5QA 4MP6A 2JHFA 3DQPA 4N5NA 4AJJA 2HMUA 4FSHA 4YJHA 5FEUA 4DUPA 1RKXA 5G2OA 5L53A 1FXSA 3DXFA 1SCUA 3DEYX 1DFHA 3UICA 1PX0A 2Q50A 1E6UA 1PGOA 4IQGA 2W8ZA 4WCFC 4OJNA 2AQ8A 1SOWA 2O7SA 3NT2A 2VYVA 1O8CA 3S55A 3I3OA 1K6XA 2V6MA 2TMDA 1I30A 1BXGB 1NVGA 4DIBA 4ZGWA 4CM9D 3MCVA 5JDIA 2YYYA 5DCYA 4YCAA 4RZIA 5DCWA 5JAQA 2Q4BA 4OO3A 2ZJ1A 1R4NA 1YBVA 3ASVA 2FY8A 3ZN2A 4ZA2A 1E7MA 3PFFA 4N54A 3LZ6A 4BQRA 1YJQA 1R6DA 1Z73A 3JQAA 3OJLA 2FZEA 4HUJA 2EV9A 4P4GA 3U0BA 3FPLA 2RH4A 5FFFA 3S1LA 2X1HA 1YBAA 3S2FA 3FRJA 4R51A 4CR6A 2X23A 3EAGA 5EESA 2OGUA 2RHCA 3E5MA 4A0SA 4PZEA 4TROA 4IS2A 4GMGA 1T25A 3DHYA 4FJ2A 4NHEA 1E7SA 2Y66A 4HWKA 2ZQYA 5AOVA 1ZFNA 1NYTA 4OXKA 3NAQA 2HU2A 2I76A 4J49A 1XCBA 2J8ZA 3I23A 4E3ZA 1PR3A 1DRVA 5ER9A 4R3NA 3BAZA 4YPOA 1X15A 2C7VA 2VHZA 1KETA 3G1TA 5ITWA 3ZNQA 3GEDA 1UJMA 4I1IA 1NP3A 3T7EA 5JAMA 3WTCA 4YACA 1GCOA 2HQ1A 2H1SA 1L7EA 4Z3KA 1KBZA 4D3SA 3PJDA 1PJBA 5JLAA 4ZRMA 1GUYA 4HV4A 4IXTA 2VRCD 3RD5A 1WDLA 1QLHA 1MV8A 3HSKA 4R41A 3RJ9A 3EVTA 3RQSA 3I52A 2BH9A 3R6DA 1JAXA 2AMFA 3AUAA 4FGSA 1FJHA 3BTOA 3H2ZA 3S2IA 1W4ZA 3IC5A 1PL8A 1E3WA 5JCJA 1HE3A 4UVHA 3WBBA 5KJFA 1DRWA 3AI3A 1XIVA 3DB2A 1GY8A 4CQLA 1DFGA 4GH5A 1DB3A 3VAZA 3T4EA 1HDYA 2YFHA 3EHEA 3P2YA 3Q9UA 5L51A 1YRLA 4O0LA 4IMRA 6ADHA 2X0JA 2DTEA 1R0KA 1DIGA 4UEKA 4WASA 5A9TA 5JC8A 1EVZA 4CMBA 1GEEA 2YHUA 1BG6A 3E9QA 3JQEA 4XIYA 2IXBA 3JSAA 4QECA 4BV9A 3ZNNA 4Z0TA 3WGZA 1ONPA 2I9PA 4YJGA 2NVWA 4R1NA 4UAGA 2NU8A 4YRAA 4HFNA 5JAZA 3VVBA 4FS3A 1DC6A 3O8QA 3WWYA 3ZHBA 5MGBA 1JVSA 2VZ0A 4CLOB 1HDZA 3ANMA 3QVXA 5TJ9A 4WLVA 4JK3A 1E7YA 3ZHZA 2IDZA 3JQ7B 2YV3A 1NR7A 1UP7A 2G0TA 4XYGA 3DOOA 1U5AA 4CLEA 4AJPA 4B3JA 3KV3O 3IIEA 1E6WA 2VT2A 4CL3A 1YOVA 2DBQA 1DIBA 4RGBA 4HX5A 1O6ZA 1BDMA 5C3MA 1LXCA 2OUIA 1J6UA 1FDTA 1Q7GA 4Q3AA 5ILGA 4YAIA 1HYEA 4IPTA 4O6VA 4TVBA 3STHA 5DBGA 2POQX 3FPCA 1QLJA 1JLLA 1L7DA 1LI4A 3U49A 5CDSA 2Z5LA 3B20A 3D5TA 4WECA 1DPGA 3RKUA 3KYCA 2QRLA 3SLKA 3WNVA 4LISA 1LEHA 1HE5A 1EUDA 4MIOA 4J9VA 4RVHA 3DC2A 3NEPX 4MDHA 4BGIA 4R3WA 3VH4A 4I5FA 1DO8A 1XELA 3NT5A 3GDOA 3L4BA 3WJAA 1XA0A 3IP1A 5THKA 2X0NA 2QZZA 3EUWA 4OKIA 1HETA 1A72A 1E7RA 2C0CA 1IE3A 1NHWA 3BMNA 4CMHA 4PLGA 3D4OA 4M1QA 3U4HA 3IOYA 4CMJA 3GR6A 2PZJA 2W2KB 1ADCA 1ZK2A 3LC7O 1GV1A 2HDHA 3HUDA 5A03A 4Q3EA 3EMKA 3VOSA 3SEFA 3QQPA 2X9VA 3RBVA 1PJ3A 4RQUA 4WCDA 5AXCA 2Y0CA 1PWXA 4MVJD 4TZTA 1ZVMA 1HSZA 3DFUA 4UEJA 3FWNA 5A1TA 4PLTA 4W4TA 1CETA 4NJMB 3DR3A 2G1UA 4ND4A 2Y05A 3WGIA 1WZIA 1U8FO 4CM8B 4DL9A 1HDGO 4RVDA 1LRJA 5HWSA 3GT0A 1JVBA 4BNIA 1PJ4A 3UW3A 3LK7A 2CNBA 4EJ0A 3S8MA 4B4WA 4RQTA 3TZCA 2Q1UA 2ZB3A 1RM4A 3K6JA 1PR9A 3JQ8B 1VC2A 2VZ9A 3O03A 3A1NA 4R1SA 3GUCA 3NGLA 1XYGA 3GFGA 1ZK0A 3A28A 4CMKA 1RYEA 4EUFA 2DTXA 5B4UA 4ND1A 2NVBA 4EZBA 2O3JA 1E3IA 3TZQA 5FWNA 2DTDA 5EPOA 1U3TA 1VL8A 2JKVA 4DPLA 3ADOA 5I7SA 3GZ4A 1UDCA 1YL6A 1ULUA 4FD3A 3WYBA 3GAFA 3ROPA 2VYNA 2X58A 4HNGA 4F6CA 1LBEA 2DPGA 1KERA 3QHAA 3I4FA 3QVTA 4KMSA 1B8UA 4EUHA 4I5DA 3PK0A 3QVWA 1PS0A 3PI7A 1KC1A 2EIHA 3ICCA 3ZI0A 2C2XA 1T24A 3Q11A 4YJFB 5JO9A 3ZWVA 3R3JA 3JYOA 3HN2A 1JN0A 2QIOA 5F1KA 3OM9A 3NGXA 4YAJA 4WGGA 3NJ4A 1ENZA 5JDCC 3MJ4A 2IXAA 2ZTMA 4OAQA 4DQVA 4CMIA 2JCVA 4R1TA 3DHNA 2PZLA 5HBRA 1MA0A 5L7WA 5H81A 3E5RA 1NPDA 1U3WA 4D79A 2A94A 4QO8A 4AG3A 4IQ0A 5BNIA 4U7WA 2OP0A 2GN8A 3ASUA 2BI7A 3NTRA 4E32A 1PGQA 2JD0A 4NQZA 4CM4A 4B3HA 4JCOA 1KYQA 2HRZA 4A03A 4EDFA 5JNLA 4JP3A 1Y9AA 3QLJA 4A2CA 2UV8A 4DPKA 4AJHA 4Y6RA 3QWHA 3UOGA 2GERA 1P77A 3QVSA 4I5EA 2B35A 2C07A 3W1VA 2I5PO 4YJDA 1GD1O 1ZSVA 4TVOA 3B70A 2EKPA 1PGPA 2Y99A 3ABIA 1YVEI 3JYQA 4XB1A 4OM8A 1M6HA 3GN2A 1CJCA 4FGWA 4Z0PA 2W2LA 5G4KA 4YT4A 1AHHA 5G0SA 1ML3A 1UXGA 4XQEA 4BGVA 2R00C 3HB4X 4M86A 3H9JA 2JCYA 1DC5A 1B14A 4Q39A 3TZ6A 5IN4A 2V65A 1MFPA 4GGPA 4RCVA 3L6EA 4LMRA 1W8DA 1P9LA 3AM4A 3GQVA 2EGGA 4GGOA 3MWEB 3GGOA 3OH8A 4OYRA 4JP2A 2WD7A 1R4NB 1IUKA 4FQ8A 4L9RA 4Z9YA 3S2EA 4YDRA 3WNQA 3WYEA 1AXEA 2VWQA 4RZHA 3V2GA 5DN9A 5IDXA 2PA3A 2Q1WA 2JD2A 3JQAB 4NIMA 1DC4A 3GUYA 4OGWA 4URFA 2BFPA 2EHDA 2I66A 2PGJA 2Q45A 5B37A 4L4RA 3WQRA 5JYDA 4H7PA 5I9MA 3QJ5A 3B1FA 3RUEA 3TSCA 1DFIA 4I9UA 1GZ3A 4IM7A 4L4XA 5I9NA 3QSGA 1BHSA 3SJUA 1OI7A 2IZ0A 1D1SA 3GH3A 4D0SA 2PTGA 4FFMA 3RIHA 1XU9A 1P1KA 3F5QA 1E1MA 4UVEA 1YB4A 3FI9A 4OOFA 4PLFA 5JE8A 4EITA 4XQGA 1VLLA 3I5MA 3KBOA 1NBOA 4RVFA 3AI1A 2EKQA 3AY7A 1LU9A 4F6LA 3FNFA 4GWKA 1G0NA 2YV1A 4OXYA 3PHGA 3PFWO 1WDKA 4PVDA 1HTBA 1KOLA 5JY1A 1ZW1A 3VZPA 2QQ5A 3DMTA 2X7HA 3OJEA 4BMSA 5JFOA 5KVCA 4RPHA 3WS7A 3I9JA 3KO8A 3WTBA 3IUPA 2DU8A 5T64A 1Z6ZA 3DBLA 3KB6A 5G0TA 4BO2A 3HZZA 2BGMA 4G81A 5KVSA 2YFQA 3MWDB 3IMFA 3MOIA 3PTZA 1D4FA 1Y9EA 4BIIA 1QRRA 1EBUA 4GLLA 1WNTA 2AXQA 4Z3DA 3WGHA 2O3SA 3I1JA 1Y81A 4II3A 2AA3A 4PIVA 2FPPA 3BTUA 2VWPA 1V9LA 2DM6A 2GN9A 2IYOA 2D0IA 1I2BA 4K28A 5F1PA 4DPMA 1DEHA 2DUUA 3BHJA 5JSFA 1E3WB 1ZNQO 3AOEA 2FR1A 3FHLA 4JXKA 4CQLB 5BSEA 3UXYA 1PU2A 2YQ4A 3PIIA 4PLVA 3AY6A 2EKLA 4YT2A 2D2IA 3JD3A 2HMWA 2B37A 1EVIA 2ZCUA 1BDBA 3C24A 4DVJA 1X7DA 3RWBA 3LT2A 3ETGA 3OQ1A 1I36A 4NFYA 3ZV6A 4XYLA 1NQ5A 2JFHA 2DC1A 1F14A 2A35A 3I9LA 4M54A 2CZCA 5JBIA 4J90A 3GRKA 3O38A 1ZJYA 4ALMA 4BKRA 1QP8A 2ZYGA 1Q0QA 4YJGB 4YB8A 5IG2A 4ND3A 1TT7A 1U3UA 3UCEA 5A02A 2AQHA 3O8QB 1NM5A 2VRCA 4KWHA 1NWCA 2OL4A 1V35A 4E21A 1N1EA 4LCEA 4FFLA 5C37A 4A27A 2VHVA 4E33A 3BMOB 2JFGA 1V6AA 1XSEA 2P9CA 4MPDA 3UCXA 3IDSA 4CUZA 4YYZA 1C14A 1JKIA 1FDUA 5COBA 3RROA 6LDHA 1U9JA 3GVHA 2FN7A 4G65A 4IDBA 3SJ7A 3GG2A 3M1LA 1YOVB 1XDWA 3MJVA 3RUCA 4UUMA 1GYRA 2BRUA 5TF4A 3OIGA 1R4MA 3K5PA 1EEHA 3ZV3A 1ZEMA 1ZBQA 2ZKLA 1ZSNA 2EWMA 2GO1A 3W4KA 4BVAA 2NQTA 2V6GA 2F00A 3G79A 4B4UA 3B1JA 1AXGA 3DWFA 3A9WA 1T26A 4XYBA 3EGOA 4BB6A 3KYCB 4DQXA 4NK4A 4O1MA 2WYWA 4TKLA 1VKNA 4LSWA 5FI3A 1I3MA 1JWAB 3KVOA 4RF4A 3DOCA 3N74A 4R16A 3K9QO 3RI3A 3FNHA 4ZHSA 2PD4A 3OEWA 4IJUA 1YO6A 3PHJA 4TKMA 4B7XA 3ZU3A 1E3EA 5C7LO 5CAEA 4ZRNA 2VZ8A 4R68A 1BRMA 3JQDA 5B4TA 1J4AA 1CYDA 2GZ1A 5TJHA 3NDIA 1C1DA 2YZ7A 1H0KA 3BMNB 3U4DA 4H3VA 5C5IA 1HLDA 2E6UX 4NR0A 3HJAA 3C1OA 1YB5A 4XX0A 3AM5A 5I7EA 3WGYA 1LLCA 3KETA 4A10A 2C5AA 3VZSA 4QSMA 3PZBA 3U9LA 3U3XA 2O4CA 4NBRA 2Y1OA 4MVJE 4R4JA 2I67A 3HDHA 1DLJA 4U0JA 1H2BA 5BR7A 7ADHA 1A9ZA 5ICMA 1Z7BA 1TA4A 2I6TA 1NASA 5LCXA 1P44A 1BW9A 3TN7A 1EE2A 2EW2A 4CMEA 2CF6A 1QYDA 1S6YA 2NU7A 5G0UA 4IIVA 3GRPA 3RSHA 3SBOA 3V2UA 3HB5X 4JBIA 3C7CB 4WOJA 3EYWA 1R12A 2VRBA 1UXIA 4QFDA 3ZWNA 4E5MA 3OF2A 3PHLA 5ENVA 2Y1CA 1GTMA 3VH2A 3VPXA 4C4OA 1E1KA 3PXXA 2CVOA 1JAYA 3WLEA 3BTVA 3GDFA 2X8LA 3X2FA 2C5EA 5IJZA 2HK9A 3KZVA 4W9NA 3AUUA 2VTDA 3QWBA 4HFRA 5FF9A 3ZHYA 4O59O 4XKJA 3WIDA 4JJGA 1C1XA 1LTHR 2O7QA 3DFZA 4J0FA 3C85A 3GVCA 4MVJA 2Z1NA 4OSOA 1N7GA 3W8EA 3JQFA 4FN4A 3EZLA 4ALKA 4CR7A 2R2GA 1OMOA 4BNYA 1YGYA 2CVZA 2AE1A 4B7CA 5LC1A 2HCTA 1IPFA 1I01A 2E37A 1GR0A
chains in the Genus database with same CATH superfamily
1KYWA 1LI5A 4A1FA 1YFKA 4KZPA 3KDPA 3GLTA 1LQ2A 3A4VA 3V8BA 2CL7X 3EE6A 3DGFC 2OR3A 3DVLA 1UBCA 4ALJA 4UM9B 2NV6A 1N6LA 2P9GA 3BBLA 2I7DA 3CF0A 5DYYA 4ZEXA 2XWPA 2CN1A 2B3DA 5BOSB 5JBQA 4RULA 1L5ZA 4I36A 5SY4A 3T0FA 1Y5IA 4KXYA 3V1YA 2RG1A 5JQGB 1FZQA 1Z0KA 1FDOA 4DBZA 5CIYA 2R5WA 1V3QE 4TN1A 3ZDBA 1VE1A 2RH8A 3ZE1B 4Q82A 3FDIA 5AK6A 2HMTA 1ECBA 4BFSA 5J5VA 2Q3DA 3T7CA 1FSGA 3AZQA 3QW4B 2HW8A 4DCTA 3D3JA 4F3TA 2GCOA 3CN9A 4P84A 2QVGA 4Q5IA 2VCYA 2PH1A 2V9ZA 1Q7EA 3X1JA 2PJDA 1IZ8A 4Q19A 1KEWA 5IFLA 1WZEA 3WLIA 4BFZA 4Q3BA 1Q15A 1DQSA 1Y33E 3P52A 2CDAA 3D59A 4X0EA 4I4NA 1USGA 3W4IA 3GLGA 4XH9B 3WQQA 5KNBD 3W06A 3DBRB 3GBSA 1NYLA 1VGRA 3K15A 1QC5B 1Q7BA 3FR7A 4YXFA 5AK0A 2HQBA 3GZTB 4Q9LA 4TQGA 4FMDF 1GG9A 2RGYA 2ZPUA 4KXLA 3ZGNA 2ZE5A 3LUCA 2ZJ5A 3VVCA 4UNPA 1I7QB 1V3VA 2PWAA 2XA2A 3K0KA 1AK9A 2DCMA 3GJTA 4W5QA 5F35A 2ROQA 1C7FA 5DYTA 1ICIA 1ORRA 5A2QA 4GWLA 3L6BA 1VMIA 3AQIA 2IYZA 4RXMA 1DJOA 2V7PA 5DM4A 1DIAA 2G04A 4JLSA 4D46A 2AOWA 2C4VA 4WL0A 1EK2A 4BNWA 1A97A 2DHQA 4LFCB 4IUYA 4ENWA 5AOAA 3VSEA 2FMXA 4C1NA 3MFQA 2P9HA 1T3LA 3F8SA 3SXJA 2PLNA 2B4AA 2RHOA 3MTIA 3FNRA 4EARA 3IEMA 4K9OA 5CDFE 3KAKA 4BNJA 1G291 4KDCA 5JROA 3O3CA 4YT5A 2VUTA 1VBKA 3W8RA 5D3KA 3R3HA 1TT5A 3O0TA 4AQYB 1U0BB 1S8OA 1DCTA 4LW8A 1RJFA 2D1RA 3P8ZA 3B8HA 3IEIA 1NQUA 4TYWA 2CJXA 2FPOA 3ZE6A 5JVDA 3UJCA 1TZ2A 2WVAA 5E0KB 3RK1A 3JQRA 2TSYB 3KEGA 4IDGA 5PNTA 1OWPA 4YCLA 4Q3DA 4Q15A 2AMLA 1G3IA 5EXSA 1L8AA 5H82A 4M1YA 1JHVA 1I7PA 2BFCA 2FQWA 3GK3A 2DQSA 5KAPA 3N76A 1Z5ZA 1M2KA 4NZOA 1CQJA 3VPDA 1TE2A 4PZZA 4W7HA 3VKUA 2RGEA 4TX1A 2PBRA 1RWOA 3ROGA 5M34A 3NKLA 2GAJA 1QG4A 4GP7A 1L7MA 3PVCA 4F3KA 3FSJX 4E7OA 4A36A 1WS6A 4TLDA 4I66A 4BNGA 4TZ6A 3OEED 3O2NA 3SQDA 2GZ3A 1RHMA 2ADFA 4B47A 1CZHA 3QG5A 1ZJZA 1VIVA 1XJCA 2NACA 2LP4Y 1VPTA 2D1QA 2F7SA 2JFXA 2YUIA 4WINA 4MJ3A 1WNFA 3U44B 3A31A 3FUUA 4KE8A 4LBYA 3TAXA 3GAZA 1WPGA 5EAIA 2R6HA 1N1GA 1SXJA 1ZEJA 2PQMA 4R1UA 5CG2A 4ZOLF 3JWGA 3JWPA 3X1XA 4JGIA 3D3QA 2QV0A 1QBKC 2OYSA 1YAJA 1WDMA 2MT9A 4ZVVA 4ZCLA 2PYIA 1ONOA 4KMMA 3DTVB 3TS1A 1SJ9A 1SXGA 4S3MA 2F90A 3IUBA 2A5DA 4P5DA 5B3KA 2ZI5A 3EBOA 1TUBA 1E59A 4K81B 3FTQA 3TGLA 1BGVA 3C16C 1TQDA 2B5WA 3ENVA 4GECA 5AWFC 4AK9A 1HTTA 4JP1A 1M5RA 3EH1A 4MDEA 1ENPA 3LY5A 4NC9A 1ZN8A 1NG1A 5U1PA 1NN0A 2D4HA 3IP7A 4W5RA 2QBYA 2G9NA 1Y1RA 2Y93A 3G6WA 3VR3D 1PK8A 1MAWA 3EXHB 3AHJA 2Z57A 1TB4A 3BIOA 5KYYA 4PYKA 2ZJ8A 5CFQA 1Y8RA 4U39A 3SC6A 1UZMA 1W5TA 3CX3A 2GXSA 3DBLB 3AGPA 3F6CA 3L01A 1KH2A 1IN6A 1V47A 1P4SA 1WZNA 4HX9A 4AUKA 1SU8A 1W0KA 2ZI6A 1SPBS 1KJYA 3GEMA 3KWLA 2EEPA 4BNKA 2JJ2D 2LW7A 2FPIA 3L77A 3M0EA 2B4KA 3PC7A 4WLOA 2ANBA 2CLCX 1XK6A 1RMQA 2HU7A 3OFSA 4KO3S 2R6JA 3VA7A 2I78A 2DY1A 1JYFA 4BFYA 3JQGA 2GSWA 4QRIA 4J16C 4YCNA 4GKKB 4GI1A 2QTRA 4PBTA 2NNWB 4OAPA 1S3FA 1R27A 2OYRA 4BNTA 3CZRA 4FFBA 1FTYA 3NZEA 4QUAA 3FZQA 5EIOA 1C8LA 1UQUA 3SQOA 2OORC 3CNOA 5DISB 4A6PA 1M73E 1J49A 4Q1AA 4HDMA 4UDOA 2ISQA 4IOLA 5ESRA 2PLRA 3IIIA 3VU3A 2FK8A 1IAQA 2OXCA 3UUWA 4B73A 3PP8A 2C5FA 4PC6A 3TGWA 2HLNA 2M6RA 4FW9A 4G9GA 5MF6A 3KHSA 5JCXA 3AKEA 1AVTA 2IDJA 3QPUA 4NZYA 4PS1A 1JEAA 3I9FA 4B17A 4XQ0A 5EKSA 5B7NA 1Y98A 2BZSA 4BLOA 3C7AA 1FFWA 2QP4A 4HDSB 3BGWA 4BO7A 9LDTA 4M9RA 1KO1A 1P39A 1LRLA 5FOWA 3H19A 1PX2A 4DBLE 1EZ4A 4CKEA 2VFAA 1P1FA 1UC8A 3AVOA 2I03A 5I9TA 5HZHA 5IT4A 4LX8A 4K40A 3UA3A 5K8JB 1CUAA 1W1WA 2D2VA 4AO7A 5CJJA 4DMFA 3FZEA 3PE3A 2NZUG 2PY6A 2IH4A 1RBYA 3KIPA 4S0XA 3ZCXA 1P74A 4CG3A 4EB8A 4YJ3A 2YCLA 3ZZ1A 1Z7WA 2P40A 3O1JC 1B26A 4PN3A 4F3YA 2F1KA 2ORVA 3A2MA 3HABA 4HKTA 4ALNA 2D6FA 3CUKA 4OA8A 3X1YA 4DNPA 1ZH8A 2VOJA 1MJNA 3B1XA 3P20A 3UH1A 1L1EA 3HP1A 5DFAA 4JI1B 4INZA 2H1VA 5E9QA 5KNLA 1VLHA 3PEFA 1SN7A 4Z9XA 2C2BA 5ESDA 5EERA 1QGUA 1TQ8A 3ITNA 3L18A 3G0OA 4OB7A 2EP8A 4BFCA 1ABEA 1U7OA 2Q1YA 5ITSA 1ZJ4A 3FB1A 4GSKA 2OILA 3I4LA 1G3UA 3GUZA 3TQIA 2XZLA 4FDTA 3QHPA 4KDFA 4F45A 4LMPA 1QRSA 3RLIA 3S1SA 4B2LA 1DAKA 3PCTA 3AR5A 1DJMA 2PN1A 2YW2A 1R9NA 3RGWS 3IFSA 1RLIA 2VNSA 1IHDA 1NZFA 5L7YA 3L1HA 1KY2A 4FGJA 4WTOA 3E8XA 1L7NA 3AEUB 2X4IA 1NWHA 4LWPA 4JD5A 5FI0B 2IA5A 4G36A 5IT0A 5T4BA 5IZCC 1IHYA 2IBTA 2BDTA 1MH9A 3ASZA 1MO6A 4P5EA 5DXFA 1W73A 2HWWA 1MX9A 1WHSB 2FP3A 3G2OA 4DDWA 5MN5A 1KPHA 2A5FA 4L5AA 2I99A 3KHKA 1F06A 1GZ7A 1XF1A 2FW8A 3HYTA 3TCKA 1LVHA 4TKVB 5LBIA 4E1BA 4IEFB 4WXHA 1NX9A 2GD0A 2NTNA 3I37X 1LI7A 4W5JA 1ZESA 5HCUA 3NPMA 4LE2A 1ZDMA 1RJEA 2AG0A 2ES4A 1P4RA 1QH1A 2C9CA 2QLBA 4KPGA 4QNMA 1BW9B 1GZ4A 3C3CA 4X7MA 4D57A 3CKYA 3QVKA 4XSGA 1VPEA 2IUYA 3K9GA 3IXMA 3LF1A 1D2AA 2HOQA 5DTMA 3GLUA 4AS2A 2B7BA 2C9YA 2AEJA 2BY4A 3MS2A 5FOQA 1XD2B 4J43A 3K30A 2WAXA 4L76A 3H86A 1LA2A 3NNNA 4YUWA 1CVIA 3BAFA 3HM9A 1U99A 3EMBA 2OC9A 3U5ZB 4UPVA 1OJLA 4WHMA 5AVYA 1M8FA 2REQA 1RLJA 1COWA 4GPEA 2WKPA 3VUEA 2OXIA 3NW9A 2H5IA 4TWBA 2JZCA 4C03A 1KFJB 2O07A 4RZSA 4L4SA 5DP2A 2JLYA 4Y2SA 3AR7A 3HWWA 1VSQA 3ANNA 3EC7A 2G71A 5TPWB 1TC1A 5HFNA 3S99A 3NX4A 2O6LA 1YQDA 3CT4A 4FP9A 2CUKA 1MAVA 4E5KA 1HE1C 2ID7A 3FPBA 2XNDD 3ISTA 3M2PA 4DDTA 2XXBA 5LKAA 2K4MA 5A5GA 2QL9A 3DLTA 4RVUA 4CQJA 2VATA 2XCOA 5K8LA 5EQTA 2F3SA 2QN2A 2JGRA 2WJZB 4OQNA 5FULA 3T5DA 4WZAB 5F4BA 1VZ3A 4Y9DA 1Y3CE 4TN5A 2PGOA 3COJA 3NIWA 4PCAA 1KVQA 2P2ZA 2VJMB 4NOLA 4PM4A 3FPEA 2O8EA 2FEKA 2QTHA 3PNQA 4ZT6A 1H2RS 4L95C 5KPDA 5AFSA 1E79A 3A4YA 4IDAA 3WIUA 2YKGA 4K2AA 1P60A 1ETHA 1JTVA 4J3FA 1L4GA 3MEQA 4YS6A 1JLSA 1W4LA 2NPIA 1BVRA 2YIDA 3P9SA 3GCGA 4YREA 2FFAA 2Q8QA 2IX3A 4AYWA 5DF1A 1U2DA 5TGDA 1FS6A 1YK1A 4CT5A 1YZUA 1UK6A 2P65A 3BF8A 1ZRMA 2JK1A 1CEXA 5LKRA 1DLIA 3ZKWA 5F23A 3GL9A 3A06A 4HDAA 4ZVNA 3W6OA 5KTMA 1W6RA 2FLVA 1V8FA 2VP6A 2WWTA 1EA7A 5JH7F 1JT2A 3WGUA 2GCOB 1OB2A 4ZOCA 2E4XA 3HY3A 1UBKS 4ZT3A 3RRZA 4CLRA 1ULTA 1Y4UA 2HKIA 3HWSA 3JVEA 3O4RA 3N2GA 3VI4B 1ATZA 2RGWA 5DNYB 2GBFA 3VKFA 2FX5A 1RHJA 1V4BA 3DM9B 2YXNA 3OJWA 5LD2C 1DBQA 1E4EA 2PSSA 5DNVA 3GLGB 1GDTA 1XJ5A 4QXOA 2AR0A 1EP9A 2E21A 3C1AA 4BFLA 1JHMA 2ODTX 4KAJA 4M55A 4RJKA 4TZKA 3I64A 2ZYTX 4R7GA 1F8YA 5ALVA 3FJYA 2BFFA 2FH5B 1VXRA 4OA5A 1YAHA 3ZCRA 3H5AA 3FPJA 1YQGA 3E15A 1QHNA 3N6VA 2FRXA 3CO0S 5KNCD 2UYOA 3G5UA 1XHFA 4I50A 4WZZA 2J0VA 3IQHX 2C8LA 4CM5A 4CV1A 3JQBA 5KOHA 2HJRA 2B4RO 1PE0A 3CRNA 4KSBA 1Y1PA 1AE1A 3CEJA 3BDAA 3MOGA 1JA0A 1K66A 4I3GA 2R0QC 2FSGA 4X6YA 1JBEA 3LD9A 4FUTA 4REOA 5FA6A 4BV8A 4PIMA 2RH5A 5J1SB 3BUSA 4BNVA 3R24A 1KO7A 2DJIA 3A1VA 5IM4F 2ZZKA 3UM9A 5BYBA 2EX0A 3GRFA 4FC6A 3K5WA 5A6SA 4K3UA 1JXMA 3EVEA 4QYWA 4ZYVA 3OP4A 2FF5A 5AHKA 1T8RA 1J5PA 5ANRB 2EXXA 1DGQA 4AY5A 2P62A 2QROA 1FTNA 1PNOA 3NC1C 2O2JA 1TT5B 5JXGA 1Y1LA 4L0CA 4ZQFA 1MMFB 4CKBA 3C8MA 2VJOA 2BFBB 1PIWA 3CB4A 4HY3A 5JVDB 3WIVA 3V55A 3ZHXA 4N5HX 1RWKA 1A7UA 1MQSA 1Q57A 5JJCA 2F1RA 2CUZA 2VDNB 2XOKD 4PLWA 4YFVA 4C01A 5TRTA 1TO1E 3HKDA 1TD9A 2BFCB 1BKYA 1SG9A 1N4DA 3SYKA 1GQQA 2P1RA 3HJTA 821PA 4EATA 2BWJA 4OGLA 2A0YA 4V2IA 4D6PA 1NMZA 2OV6A 2WUWE 3DNPA 3I8OA 5KVAA 1D5WA 1G2QA 3DMYA 2XJ4A 2MU1A 2X15A 4BFWA 4BZQA 5A5FA 1YVDA 3BQNB 1WO8A 5BWOA 1Q1QA 1V4NA 2B6NA 3E27A 1LDNA 1N75A 5ICSA 1OI4A 3C3XA 4GBMA 4FD2A 4OHUA 1YB1A 3CO5A 1PJSA 4JYBA 2I54A 4M6WA 4OCZA 1WY5A 4ZEVA 5DDIP 3TLJA 5A4MS 4EL0A 2PZ8A 5GONF 3W3AH 4IG4A 4LF4B 3LC2O 3RFXA 1AO3A 2P3SA 1DSSG 1JFLA 1KHHA 1O8BA 1SXJB 3B48A 4JBLA 4PLPA 3W79A 5K99A 3H6KA 5I7FA 3U9SA 2PHZA 4GE3A 3M5DA 3LRTA 1CFJA 4KGZA 4M0LA 4OQYA 2VQEB 4YGXB 5JJ5A 1GAJA 4NNJA 3RTGA 5K0FA 1EFKA 1T2AA 2VRWA 3QLTA 4KQHA 1B00A 2E5WA 2V6BA 1TUBB 3FFAA 4NZPA 4DCOA 2QZSA 4NLLA 1TAGA 3BE4A 3CLUC 1J2RA 2VBCA 3LKZA 4XDYA 4A23A 1QRTA 1EAYA 4H4DA 2R3SA 2YWHA 2WA2A 4EW3A 3U4GA 1F2VA 3CLUD 1SQ6A 4O4LB 3CXUA 4MVWA 4B81A 3GFQA 2QBYB 1RW4A 2XRYA 4IX1A 2ZG6A 2HT6A 4MGIR 2HPVA 3NRBA 1IHOA 1K63A 5KYYB 3KELA 1U0GA 4KUHA 1Y8RB 4WLNA 4QEZA 4P80A 1EX1A 3TTXA 5AI5A 4CL2A 3VU9B 5I4IA 4PVCA 4PQYA 3RC2A 1TKBA 4JC0A 4FSDA 1TKRA 2E87A 2YWJA 2BR3A 2FPIB 3QU2A 5JNVA 4OUKX 4CTMA 4V3BA 2R8XA 3KUKA 4RO0A 3D6UA 1I4OA 1A7KA 2OCKA 2XVZA 3FH0A 3L8ZA 3U17A 2BEJA 4UM8B 4PIPA 3JQGB 3F47A 4HMPA 1HF3A 3BWXA 3FNQA 4I4LA 4MVJI 1R0RE 1NT4A 3EZ7A 3L0BA 2P6PA 4U8HA 3TVDA 3NDRA 3VTFA 1P2GA 4BN4A 4EKDA 1R5JA 3CLTD 1ZXLA 3WMGA 3R9WA 3IAAA 1A71A 2BI8A 1W85A 4BO4A 6AT1A 4FFBB 3JWEA 4UCFA 4PZYA 5K0LA 5FUVA 2V4UA 4QVIA 2CV2A 3DULA 3R1IA 5HOQA 1T9DA 1OC2A 4MRVA 3OOEA 3OE7A 5BO5A 4QQNA 3CUSA 4BB5A 4HDMB 2WJ3A 4RPCA 1YFZA 2DF8A 3QVJA 5AHWA 5BSGA 3HNPA 3ITKA 1H9CA 2O8VA 1OVGA 2HMVA 1YDGA 4QODA 3CEPB 2ZBRA 3V4VB 2PQ2A 3EVGA 3IQEA 4O4IB 2JLWA 1YZNA 2WZQA 4H2DA 3I9OA 4BFUA 1BKDR 2QYSA 4PHTA 1RWXA 4FZJA 1SULA 4UMEA 4AJ2A 1T4BA 3MGGA 3DL2A 3EVNA 4G0OA 4LDZA 2JIMA 3ZE7A 1JDJA 4KJXA 4A73A 1NNSA 4W5WA 1H2FA 4OL0A 1F2UA 2G9UA 1QG6A 3F0TA 5CGZA 5DU2A 4DCJA 1CNEA 4Q9DA 5KYWA 5F5NA 2II6A 3PKJA 4GL2A 2WAYA 3EQ6A 2HRBA 4RV5A 3PR1A 3RSLA 3WFIA 1WCV1 1NF2A 4P7KA 4TQUS 1R3DA 4WFKA 5F4ZA 1ZU4A 2C98A 4OEHA 4ZYTA 1ADFA 1O95D 2W6ID 3FSGD 3GIWA 4RF5A 1ODJA 4Z86A 5DPMA 2XE6A 4K9DA 2WU0A 1DIRA 1URPA 4UNNA 4EDHA 1L6IA 3R5JA 4GLBA 4F11A 4TL6A 2O3TA 1QO0D 3F4KA 4OJMX 4MHTA 2Q3LA 4YJ3B 4KIJA 4GHWA 4NDNE 3NG1A 3TB4A 1CUEA 4L6IA 1V8ZA 4QX6A 2OVBA 4ZMRA 3T1HB 4DR3B 1J06A 3VC7A 1DAGA 1PWEA 1J1ZA 3UHJA 1ZNXA 2DHCA 1REQA 3PXAA 1GGKA 2M1XA 4F46A 1O4WA 1VMAA 3GGGA 3MMXA 1QGUB 2OCYC 1BN6A 1NVBA 3ONWA 4TLLB 2B7CA 5F5LA 3E05A 4DYDA 3QENA 2J09A 4KIWA 1SBQA 2EJCA 5NULA 5KI6A 2AN4A 1NG9A 1RXIA 1W96A 4LZNA 2RGGA 3CIOA 4XDZA 3IMEA 1A0OA 3U62A 1OVMA 3WLAA 4LZZA 1CHNA 2B8JA 1SHZA 4CIAA 3OZAA 3SSMA 1WIWA 2C0QA 2R79A 1OI3A 5DLYA 1AZTA 3UANA 3I2GA 4LAFA 4TTPA 3H17A 5IAKA 1EE1A 4FYXA 5JSQA 4LHSA 4B34A 4YX9A 1D2RA 2NYRA 4P4LA 5M5BA 3B3AA 5CNIA 1K2WA 1J24A 1G8FA 4M9UA 1KZHA 1NT2A 1ESMA 1U8UA 4URZR 3FE2A 5CPBA 4W5HA 4ENTA 2A57A 5NLLA 4GWGA 4LFBB 5ER6A 1CBUA 4NCIA 1WF3A 1IN7A 2IZ7A 3DPSA 4PWZA 2JJQA 2O4UX 4H1VA 3IBCA 5DZSA 4QU5A 1KQOA 1ZUD1 2EBFX 1U2ZA 5JCPA 4UUBA 1EXVA 5T67A 2QN8A 4LHWA 4TT3D 4CPDA 1C50A 2A9KA 3G5TA 1LS6A 1AUPA 1BE1A 1X74A 2AH5A 2EW8A 1QH1B 5A62A 1F2TA 1TYDE 4UVIA 1KQ3A 5B57C 5HF5A 4U1RA 2G08A 3H9GA 1FSFA 1KVUA 3TSYA 1O0BA 3SYRA 5LQSA 5B12A 3HACA 3ZE0B 1W34A 4LJ5A 3S6JA 3UF0A 3MOSA 3O2JA 1I1QB 3FOEC 2A86A 2NXEA 2REOA 4UAJA 3LHSA 3B6ZA 2P4HX 1ETUA 1CF4A 2YJGA 4AO6A 4CIDA 3DOJA 3TDNA 4H35A 2Z08A 4YYEA 2X3YA 1Z3CA 1YS4A 3HXPA 3PNOA 5HX7A 1IJFA 3RS8A 1B42A 5DNWA 5E38A 1JUDA 2DWPA 3ZXSA 2HADA 4G4IA 4UTNA 2GFIA 3FPGA 4GSYA 1A96A 2N47A 1J5XA 1ESDA 4EB3A 3ZVKA 2CMDA 4B2YA 1TYBE 2PIDA 4OLAA 1QLWA 5TMEA 1X9GA 3CLRC 1P7YA 3ZU2A 4PZCA 1H4QA 2KQUA 1CC1S 4UNSA 4X6LA 1QYCA 2IVFA 5TT0A 3UAYA 4DLPA 3CLRD 2ZBQA 1QONA 1QB8A 5JTTA 1E2BA 1B0AA 4NBTA 3PHHA 2KJQA 2ONKA 2V74B 1YNOA 2FFQA 2Q5LA 5DGTA 1NVUQ 1E2EA 1QX4A 1HZZA 1RZ3A 5AKJA 3T9CA 4OGKA 3ZW8A 2O8EB 3MBKA 3ZY6A 2Z2YA 1QP4A 1T0IA 1LNZA 3ZDCA 1JZTA 4YRQA 2P2CA 1VI2A 1VJ1A 4L4ZA 1VSUA 2JFUA 1J00A 1N9GA 1K5PA 3MWGA 4ZT2A 1MHTA 2QE7A 3AIIA 4Q3NA 4IW3B 1E94E 2FE4A 2QD4A 4PLHA 2GZ2A 1MC4A 3G9UA 3HZRA 3K9NA 4PAQA 5AHOA 4D9FA 2PD3A 2HYIC 2NZWA 2NO1A 4FDAA 4YXWD 1KIFA 3SVTA 1FRQA 2IOQA 2C5LA 1MQ8B 3CG4A 5FNVA 3ZCVA 4D8TA 3EZGA 4UQOA 2F3QA 2WQZA 3G9ZA 3ZKWB 1H2HA 2Y6VA 4MZXA 4F60A 2GXAA 1XGKA 2J6IA 5ALEA 1R3UA 4UBJA 1FLNA 1SB9A 2VBFA 5CR9A 5J59A 2B9VA 3K6SA 2JAOA 2Z1MA 1NMSA 5CFLA 4C0HA 2CY0A 3C6QA 4PX9A 1Z74A 2AVNA 3R4VA 2IEDA 1T0UA 4CLRB 5JNUA 2JLUA 1MO5A 2JHPA 2P35A 3N2GB 3D8UA 4PGFA 1RXSA 5AVJA 1EVQA 2RC5A 1PGJA 3OPMA 4A8PA 1E4EB 2H1HA 5EG5A 3OY7A 1GPWB 4FDUA 2VXOA 5CNJA 3I6IA 3M1IA 1MB4A 2O0HA 3ZHQA 4BE9A 5IJ9A 1QHEA 3JVDA 4URXR 5KKAA 3DV2A 1WXFA 2JFOA 3AOEC 4G5SA 4R9SA 2DBZA 5CDYA 4JJIA 1N1MA 2ZRDA 4IXNA 4YP5A 2BFFB 3L1VA 3TRJA 2QYTA 1L9XA 2ORIA 2VF8A 4RABA 1NVEA 4X8OA 5CM2Z 3VDRA 4BX0A 1CF2O 3HDQA 1DEXA 2CDCA 4IVPA 4KTVE 4W6ZA 4DJEC 4I50B 3HLYA 4R5HA 1XL1A 3A4MA 5KOHB 2HUPA 1PW7A 1OLXA 2JAXA 2XW6A 5J4HA 4ZTZB 4DCNA 8MHTA 3GFRA 3PPXA 2XXAA 1TJNA 4UTVA 1NJ1A 4AXBA 5HIKA 3AF0A 3KPUA 3LLSA 2H2DA 4YEDA 3OCXA 3UFBA 1P9RA 3WIEA 4CBVA 1IJKA 5CFZA 1KOGA 1ST3A 2D13A 4KO4S 4TXHA 1NM5C 1XHLA 4RD4A 3VVMA 2FPGA 3IPLA 3RPEA 3R3SA 1TRKA 3EGDA 4RLFA 4MAFA 4CZ2A 2FSSA 4D9GA 1J42A 3PNSA 2EFCB 4QU8A 2NNLD 2WW8A 3T15A 1RKBA 4MV6A 2AOVA 1GGMA 4HF7A 5FAXA 3ANXA 2F3PA 2VPYA 3WRYC 5A4KA 3WQSB 4D9MA 4JODA 4OHRA 1XZMA 3C70A 4CKBB 2Q8NA 1VA5A 4PR3A 2A1TS 4JB3A 4UBIA 5TLSA 4MI6A 1NJSA 3FZGA 3VNBA 4YRKA 3WJ2A 1AK2A 3DZJA 1G55A 1L8QA 1M5TA 1RNLA 3E9DA 3HKDB 4MUFA 5LLDA 4N0QA 2PR7A 1G9XA 1BOOA 2IYTA 2X5OA 1NYRA 5B53A 4F6RA 5CK5A 3B9BA 2YJZA 4JT4A 3VC1A 3SHTA 3LSYA 3HK2A 1X70A 1QV9A 2IPXA 3FDJA 4UZSA 1YA4A 2H2IA 2P79A 3IKJA 5LYYA 4LYFA 3TOZA 2LKDA 1GZUA 4JN6B 4H16A 4E07A 1PT7A 4KVGA 3DLHA 4RPIA 1QORA 4YQYA 4PGHA 1ZVQA 3RC7A 4DR1B 1QQ7A 2PX3A 1OFGA 2XB9A 3E53A 5DRYA 4M6WB 4W8OA 3KDSE 4A15A 3AESA 1PTJA 1SKUA 1WW8A 1B93A 1PZFA 1KI3A 3AONB 4UBLA 1HYHA 3ZHUA 5GV8A 4EMSA 2R6CA 2FA9A 2WSSD 3EWAA 1MT3A 1HDRA 1WKVA 3P9CA 5KDLA 4DIKA 1ZR2A 1D2NA 2V7WA 1DEOA 1LPSA 3W6PA 4ZDIA 3IVXA 3RVMA 3BICA 4YUYA 2H1LA 4M83A 5J4VA 1XTPA 2AMYA 1KKMA 5D6NA 5EXXA 4F4IA 2P3OA 1ZCJA 3JQ6A 1H6DA 3Q7SA 2M1ZA 3N1UA 4J1QA 5HKOA 2Q07A 2HYDA 2R9VA 4C20A 4OATA 5KBYA 1N7JA 5CLGA 2QD2A 3IEVA 4QBGB 3F8TA 4JBNA 5A06A 3VNSA 1O5OA 4HDRA 4KLCA 2CVQA 1QWOA 4GZLA 3AG6A 4TRRA 1Z5NA 4PANA 2IYSA 3NLLA 4HWPA 1EFCA 1IL0A 6REQA 5EIXA 3O8LA 5D3MA 5T3YA 1UBMS 2OFOA 3ZUGA 4M60A 4IDCA 1JU3A 1XZFA 4IQ8A 4KXMA 4U5XA 4V0QA 1EWTA 4M0DA 4C6HA 3OFKA 4RY0A 1JBQA 2XA9A 3C48A 4KUEA 4LKOA 3OWOA 4G63A 2AX3A 1A27A 3TNFA 1SO8A 3V8PA 1CUVA 1WF6A 4GEGA 4BUCA 1B73A 1UBSB 1XVUA 2VOEA 2ZJAA 2C8JA 3LY9A 4Z9BA 4J3JA 2C1XA 3GU3A 4Q02A 5BMVA 1MA3A 1UT6A 1XTQA 4V2UA 1J1UA 4UAVA 3AVYA 1Z5VA 4F5WA 2NQ8A 3KB8A 5LQJA 4W99A 5IW8A 1TIPA 2OFXA 2ZYWX 2JB9A 4NJOA 1LC3A 1VLQA 1X7XA 1YQQA 3JTEA 1XNQB 1W85B 1SAYA 1X1EA 2QPOA 4OP2A 4BQNA 2FF7A 2P77A 4L1KA 1CIJA 3OM0A 3V48A 5DRTA 2PUVA 3WGOA 1Y1QA 3D1LA 4ZZ0A 1J0AA 1ORHA 4QM6A 2QL6A 1W47A 5HZGA 4LGVA 4BQQA 1G64A 3GRCA 3KQHA 5KYNA 2JI7A 1RXVA 5I51A 4CMGA 4BVJA 4DM4A 5J2UF 1IZZA 1KP3A 1ZN9A 3CUEF 1A9PA 4B9AA 1E0SA 5CDGA 4EJ2A 5FUMA 5LUBA 1NHGA 1PZHA 3Q3CA 1YS9A 5G41A 3QPDA 5DEOA 2ZEJA 3TBFA 2CVFA 1O7JA 1F2UB 5AJYA 2I4LA 2QUJA 2YR0A 4MKHA 3EIUA 3H0CA 1XDGA 3NM6B 1NUPA 1ISJA 3NNSA 1NE2A 4IV0A 3MN1A 4JIGA 5KYWB 3RYIA 2HC9A 2XKAA 2NN3C 3DT9A 3UJNA 2PVSA 2DKFA 4DLNA 3KYBA 2NZJA 3PLAE 2Q1SA 3A27A 3KKZA 1R74A 4QXQA 5BSMA 1AKYA 1ONNA 1WXEA 4RVNA 1YUNA 2CMFA 4PSCA 5EP2A 2X77A 4B0PA 4KLNA 5K8VA 5EXTA 1NXWA 2OTCA 3KTDA 2G06A 1RJDA 2I2XB 2JCGA 1OI2A 2OKCA 5GJWC 1MX3A 4ZMBA 1X8JA 4LMAA 2O2DA 1ZD4A 1RABA 2CXHA 3NDJA 3JYPA 4QUGA 1OE0A 4MB2A 5KTPA 2OQRA 5DGCA 4K46A 6YASA 3PV0A 4HWSA 4K8OA 1X42A 4FOSA 3H2IA 1LPOA 1REQB 1S4QA 1WVIA 4RADA 1E2IA 1I6WA 4BEBA 3KSZO 5G0WA 3WDLA 2B1IA 1EX9A 5A3QA 5AKIA 2QA5A 4L8FA 2PZAA 3DEHA 4DFDA 3RS5A 2CJFA 1FQKA 3Q3EA 2YX1A 1PT6A 3AR8A 2G17A 2XUHA 2JHAA 4GXQA 1O97C 3V9AA 3UV3A 4NARA 1NRWA 1V25A 2I1LA 1PT8A 3E3AA 3ETCA 3JCZA 4IQFA 1O97D 2VT6A 4QTUB 4C4ZA 2Y8EA 2R86A 4ZO4A 5A2GA 3TFOA 3CZ4A 3P2EA 1RXYA 3L7IA 2PNJA 3V1UA 2BEUB 4MGEA 3QSYA 3WV4A 3QU5A 2IYPA 5FTJA 3AL0C 4LNUA 2JGLA 4V0NA 1W94A 5IJ0B 3B6MA 4IDOA 5KJ6A 1LSUA 5AJWA 3BHMA 3HLKA 2YXLA 4W1QA 1MB0A 1GSAA 2H4HA 3D3EA 3PFBA 3QHQA 1A9SA 4L6CA 4BUJA 4E46A 1R8QA 4AM8A 4IZ6A 4HYTA 4B3CA 2VAPA 4ZAXA 5AUQA 3IEXA 4OI1A 4YMLA 3RJMA 4C78A 2YW9A 3R23A 2RGAA 2OK8A 3FBTA 1E8DA 2H06A 1AQJA 1TYEB 4HAVA 2MDTA 5CBPA 4YECA 3W3AD 1ZIXA 2YINC 5ENDA 3X1WA 2P9QA 2HY7A 1SG0A 2O5CA 1F2TB 4IIDA 4LCJA 4LPKA 2GA8A 3TQTA 2FOXA 4GAEA 3RREA 3Q6IA 4IO1A 4Q3OA 4BGUA 1QDLB 4F56A 5MN6A 2BGNA 3ZVNA 1K97A 2HNBA 1YONA 5BR4A 3OKFA 3V1LA 2BV3A 3LBNA 1MVOA 4FX2A 1ISMA 4BHTA 3AVVA 5C18A 1QKJA 4WH0A 2GFHA 1PWYE 1T2DA 1GCUA 2EWWA 4DA8A 1M2HA 4P81A 2GTIA 4PO1A 4YRBA 4ZHQF 1XF9A 2IIVA 3LG2A 4C07A 1E5LA 3TSAA 4US2R 3BSFA 3U7GA 2UUBB 2E85A 1KYIA 3LCUA 1C3VA 4KXUA 1D6SA 1XQ6A 2VNJA 3FOCA 4G4JA 2GZDA 3D7LA 4JT8A 4WI1A 2HV8A 5CLLA 5ALJA 3KFLA 2JCSA 3DZ8A 4F2HA 2L18A 4HQKA 2ILTA 2EGUA 2V4MA 3IGFA 3I5UA 5H83A 4ECEA 1VDMA 4E4YA 3GLQA 3KRTA 3OX3A 4MUBA 4BP3A 2LR0A 2OKGA 4ND6A 1PG2A 4YIHA 5FOVA 3JQ9C 1WPRA 4WY5A 1WUJS 2I4RA 3LVFO 3BH6A 1P1IA 4WLFA 1L4BA 9ATCA 5JCJD 1KI1A 4XQCA 5CEEA 3HGMA 3UK7A 3C8UA 3L7YA 1LKZA 3FYUA 4P8RA 2XB6A 5FUBA 3TLGA 1UINA 3WLFA 1JG6A 4L7VA 1RP7A 1WTCA 4C4RA 1XXHA 5SZKB 1V95A 3LV8A 1KDRA 2F17A 1UMDA 3DAGA 4RMIA 3EFHA 4XB2A 3W2EA 4NI5A 4JX8A 1N9GB 5JT1A 3S44A 3WBFA 2P8JA 3FGOA 4NSNA 5D87A 1IUOA 4NDZA 5IMSA 2BR4A 1GPJA 2OLKA 3LT5A 3PFKA 4LRTB 4AECA 2CVHA 2RIPA 2WTXA 1EFRD 1QIDA 2A1UA 2FDXA 5FNVB 4R2KA 1IIBA 4WKBA 2VSXA 4LJ8A 5E6RA 1BOFA 4J8PA 4XRGA 4CF3A 3GMTA 2P4QA 1J2JA 1YIOA 1BN7A 5IJWA 1ZN7A 2JAHA 3MCTA 3K6SB 4H7FA 5MGNA 1E3DA 1RPNA 1LPMA 3O75A 1A82A 3I9V1 1T9AA 3LK6A 3RVBA 5FPYA 3RARA 2BFNA 3DTTA 4IJQA 5ECGC 4BNZA 4ETMA 2BSXA 3QKSA 1GHTA 5DWDA 4M99A 3AVTA 1E2JA 3MAAC 4I9GA 3NTQA 3DM5A 3E48A 2W2OA 3S27A 5IJ9B 5CXSA 2FFRA 3RASA 3Q6NA 2JPDA 1K6JA 2H31A 2BR5A 1LLUA 3VZRA 3ZHTA 2ATEA 2GLXA 2WI8A 3QH4A 4PV7A 4B31A 2RGUA 4HB3A 3SSOA 2MINA 5L4NA 1MIHA 1W0JA 1D1PA 5JADA 2CJPA 3OX4A 1EDOA 1XT6A 2B94A 4UMVA 1TLTA 3OOYA 4RHUA 2PUGA 4QGAA 4AJEA 1JKMA 1EP3B 3DZCA 5LM3A 1SVNA 2V3CC 2PNFA 3SZ3A 4GI2A 1H5NA 4C5BA 1UDBA 3P9QA 1OLXB 5IXYA 3FZYA 2VF2A 4HZIA 5FWAA 2O2YA 4EVRA 2GXUA 2I4OA 4XJTA 3TCXB 1XMVA 5LIRA 2OFWA 3PXBA 4FNGA 3T52A 1R6UA 3JQ7A 1ACLA 1FNBA 1E1RD 5KNDH 2MMGA 2OD9A 2OMEA 3C8DA 4M0FA 1A1SA 2O7VA 2O2CA 4JSTA 4F84A 1K75A 2BKXA 4X61A 1DJPA 3OECA 4WT7A 3VRHA 3EGDB 4P4NA 3ZKAA 1XG5A 4B76A 1A4UA 4W9RA 1ZW6A 3CB2A 5LR6A 4Y1GA 5LZ8A 1UEXC 4MS1A 1L5LA 1L7AA 3NHJA 1M1XB 4LMBA 5HRUA 4B6EA 5FTMA 2ZREA 5CFNA 1QJ4A 2CXSA 2FETA 2CFOA 2HJSA 3FUXA 1KVSA 4D0LB 1Y6FA 2YVLA 3A1UA 1RRGA 621PA 4BLWA 3B12A 3CNBA 3RAJA 4RLSA 5LFAA 1FBNA 3HV0A 1N7HA 2AOXA 3OEEA 1O58A 3AUTA 2IHYA 4EW6A 4EEXA 5EGNA 1BHO1 3PQEA 2BMEA 2VK2A 3GFOA 4F6RB 1MLDA 2I87A 5HDBB 4TMTA 4BPRA 1QU2A 1JQDA 2PRYA 2YC4C 1IQ0A 2W2PA 1P19A 1YR2A 1WSDA 4HMQA 4M98A 4O5AA 2IRWA 2OSVA 4OFWA 5HUQA 4I2NA 1QK5A 2GI4A 3V80A 4HCJA 3ZX5A 2R68A 3H6GA 1GFWA 3LBFA 3PDWA 2RFLA 4PYMA 4IINA 2DE0X 3KQVA 3AR2A 4TWJA 1ZGCA 2H51A 3AESB 3TQOA 5A4IS 3AW9A 1NN5A 3OBBA 4Q1CA 5ALHA 4Z54A 4RKEA 4DBLC 4I46A 2ONZA 3CBQA 3FJ1A 1NRXA 1Q1AA 2PMFA 5F7OA 1XVIA 1G7CA 2HHJA 1WA5A 4YP1A 5AVRA 5IKOA 3Q8LA 3QYAA 4PU0A 5K4GA 3CJQA 3R5SA 4TQ9A 3VR3A 1ZQ1A 2P41A 3ESCA 2I55A 4UZEA 2F4VB 3F96A 2NTVA 2WJHA 4FGLA 1Z26A 4BCDA 1X19A 2C99A 4QFMA 2OV4A 3KJNA 5BR1A 3U4AA 4PFJA 3D2CA 5M04A 1YC5A 4CM8A 1EZZA 2KSQA 5BQ3A 4HDRB 4URHA 3V1NA 4WZBE 4KPEC 2EP7A 4I1VA 4MP8A 3AKCA 2DBVO 2OCXA 2VAWA 2RK4A 3FPHA 5EZYA 2ENUA 4C4TA 4EFNA 4KYVA 5FBQB 1ECPA 4Q0MA 1JDBB 2ZR7A 6REQB 4R0VA 5D3MB 3SYTA 1Z36A 3B1ZA 1NQTA 3OKCA 2J9XB 4QXMA 2FHPA 2IP4A 2E89A 3TR6A 3C8ZA 1EVLA 1S02A 2ASEA 3TXXA 5H1YA 4MJLA 5C8YF 4J16A 3WDSA 1Q16A 1I5OA 1UPBA 5AJVB 1Z8NA 2WWFA 4LY9A 3N2KA 1Q0RA 2J4CA 5AM1A 3Q7IA 3ZV5A 4POOA 1PD1A 3QFFA 4U00A 5BMVB 2XXJA 2O19A 1QDUA 3Q2IA 4PG5A 4UD6A 4F5EA 1S1MA 1X8XA 1MTOA 3F7OA 1RZVA 2YHBA 4NWIA 3ZVMA 2VXYA 3I2HA 3GGSA 2ZTVA 3KBBA 4LEIA 4JLDA 4LRSB 2Y4NA 4V24A 3CZAA 3VOTA 5JC1A 1GL6A 1ENYA 1AS3A 1OU4A 5B2EA 1UPTA 3GA0A 4J7CA 4QXAA 3ENKA 2FOLA 4DIMA 3ZLUA 2WF9A 5IULC 4GW3A 1QOZA 3VPBA 1J0CA 5CG1A 1IXKA 4RKRA 3DOUA 1M8JA 1PWZA 1O5IA 1GYQA 1SOUA 1XMJA 2ABWA 3A1SA 1R9GA 3IUYA 3O4IA 5AI6A 5AKZA 5T41A 4CFYA 1QIKA 3RSSA 4WY2A 3ZY4A 3FPKA 3IRUA 1PKXA 4RORA 2YASA