3Q9UA

In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
138
Chain Sequence
ATRPIDGLTDEGIRETLTRYKKIALVGASPKPERDANIVMKYLLEHGYDVYPVNPNYEEVLGRKCYPSVLDIPDKIEVVDLFVNPAKAWRFVAYAIKKGAKVVWFQYNTYYPLAARQAGLIIVANRCMMREHKRLLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A de novo protein binding pair by computational design and directed evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding, de novo protein
molecule keywords CoA binding protein
total genus 38
structure length 138
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3q9uA00
4HFMA 3IKTA 3K8ZA 1LA2A 3HG7A 3IJRA 3LYLA 5IDQA 1I3NA 4OGWA 2TMGA 2VYVA 2NU8A 4D7AA 3L0DA 3K96A 4PZCA 3PWSA 3LT4A 4KOAA 4CMEC 1U9JA 2YYYA 1D1SA 4RQTA 1Y1PA 2PH3A 3AFNA 1N1EA 2AEFA 3B6ZA 1EUZA 1V6AA 2GZ3A 4C7KA 5BSEA 4J0FA 1OC2A 5FWNA 5IF3A 2X0RA 1JVBA 3GGPA 1WMAA 4Q3BA 4WEQA 4BKRA 4IDBA 4IGEA 4J0EA 3IL2A 4MVJG 1H2BA 4CLRB 4MKRA 3WYCA 1F12A 1CWUA 2B4TO 4CMKA 3IP1A 2JKVA 3PZRA 1A7AA 2ZB7A 5L7YA 4GPD1 4DMLA 1C3VA 1V3TA 3WJAA 4AJHA 2PGJA 1B26A 1PS8A 3OA0A 2WWRA 1X13A 3WGYA 3F4BA 3PJFA 4YEDA 9LDBA 5L95A 4ALLA 3GNTA 4WLEA 4XYBA 1HDOA 2J5KA 4CMJA 4KTTE 3DWFA 1L7EA 1I24A 2H1SA 4J6FA 3AM4A 2VHWA 3ZDFA 4DGSA 3CZRA 3NV9A 4CM7A 1R0LA 1ZK0A 1SEPA 4JCOA 4MIEA 3GEDA 3V2HA 3FHLA 1DC6A 3QV1A 3L77A 4RZIA 3UGKA 4EJ0A 1PGOA 2HUNA 2QW8A 1NQTA 4BNHA 4IIVA 3LF1A 3GNQA 3LSYA 4FOOA 4ZRMA 4R68A 3X2FA 3ZH2A 1P44A 1M6HA 3VH3A 4WASA 2NACA 5B12A 4ZQBA 3ZV5A 4FIZA 4YCAA 5HWSA 2DBZA 4U6QA 3A9WA 3ZWOA 1PEDA 3ENKA 1PQWA 2ZKLA 3RKUA 5JCXA 3KSZO 1ENOA 4TVBA 5GZ6A 1KBZA 4ID9A 4Z0TA 1IPEA 3JV7A 1Q7BA 4U6SA 5TNXA 3GN2A 2C59A 3HADA 2J5RA 5CDGA 1DLJA 3FNFA 2NU6A 2GN4A 2GPTA 3C1OA 1Q1NA 1X7HA 5KWEA 2HMWA 4BNWA 3ZHZA 4LMRA 1KEUA 2VRBA 3HQ4O 5L9AA 3AI1A 3K2EA 2OHXA 4GAEA 3RC7A 4Y9DA 1Q0HA 1YGYA 5L7WA 2X22A 2P9EA 2Y1DA 3GUYA 4NJMA 2C0CA 1I2ZA 3NTQA 1UP6A 3GQVA 1PQPA 3TZKA 3OH8A 4XCVA 1EE2A 3QY9A 4I5DA 7ADHA 1Z82A 3ZWVA 1W6UA 2PFGA 3DBRB 4ITUA 4UEJA 1LRJA 1P1RA 3FNGA 4YB8A 5T57A 5JXWA 1H93A 5AOVA 1EFKA 4DRYA 3S2GA 2JFHA 2QG4A 5JO0A 1IB6A 2GN6A 1DIBA 5DBGA 1KC1A 3E82A 3U4IA 3K2BA 4FFOA 1EDOA 4ESOA 3ZWNA 6ADHA 2B37A 4B3HA 3GUCA 3RVDA 3T7CA 4GLLA 4MVJH 1D1TA 3PTZA 5G4KB 4ZQFA 1WP4A 3E18A 2EKLA 3D4PA 4PG5A 5F21A 4AG3A 4WLVA 1GCUA 1QP8A 3W4IA 1QYWA 4HX5A 5THQA 1O5IA 4J1TA 5BR7A 3QVSA 2OZPA 2PA3A 1MC4A 4KQXA 1I0ZA 3VPSA 1CETA 4IQGA 2HMUA 3H5NA 3ST7A 3ZV4A 4DQXA 3U5TA 3TZHA 3AUAA 3KYCB 3GRKA 3OJFA 5IXSA 2Q45A 3ZW8A 1E6EA 5KVSA 1ZNQO 1LDNA 4HFRA 3SEFA 1KY4A 1RPNA 4CLXA 5JBIA 1GU7A 4MP6A 2Q46A 3ZHBA 4H7PA 1E6WA 2GDZA 1E7QA 4QO8A 4R5MA 2H63A 3C7DB 3WFJA 3KOUA 1HZZA 4BO1A 3HDHA 3PFWO 3RC2A 1HE5A 3Q6IA 4O59O 3R1IA 4R3NA 4YT5A 1GL3A 3DC2A 3RU9A 1Y8QB 4L73A 3GVXA 4YXFA 2PY6A 3GR6A 4DREA 1E5QA 2WM3A 1MB4A 4B4VA 2Y66A 1EQ2A 3DZKA 1DHRA 1NR1A 4J4BA 1P45A 3JYNA 5FYDA 4EW6A 1CIVA 3E5RA 1QRRA 1LI4A 3WB9A 3HDYA 5BT9A 2C20A 1Q2XA 2PTGA 3AM3A 1XU7A 3AOEC 2C07A 3GVCA 1TT7A 3DHYA 5TRTA 1J4AA 1DC4A 2BI8A 4WJZA 5CEEA 4FB5A 1J49A 1EQUA 1TXGA 3BTOA 4RDIA 2RHCA 3DTTA 2C7GA 4XJSA 3D1LA 4YBZA 2NUAA 3GEMA 4AJEA 1I8TA 3PHJA 1R12A 2Y05A 1E7SA 1KVSA 2IDZA 2WTBA 3JTMA 2VNSA 4IXTA 5DN9A 2CDBA 4WGGA 3DXFA 5GMOA 4ONEA 1HT0A 1T1SA 4OAQA 4E5YA 4NPCA 4ZRNA 2PZLA 3G49A 1L1FA 2EXXA 1P1FA 2YDYA 2XXJA 5KVQA 3CMCO 3M6IA 4CV1A 2PK3A 4E2XA 4MINA 3ZU4A 1R6DA 2V6BA 3W4KA 2ZJ0A 1HE4A 1F0YA 4EJMA 4W82A 4DIBA 3JYQA 4I1IA 1PTJA 4OSOA 4CLRA 1UXJA 3FR8A 1BVUA 1M6WA 3U0BA 2OP0A 4DLAA 3GH3A 2X1HA 4UUOA 1EEHA 1CRWG 4Q3AA 5DF1A 5EQDA 4CR8A 4B8WA 1HLDA 3F46A 3GZ4A 1XR3A 4BQRA 2JAPA 3JD2A 1MA0A 2FN7A 4MIOA 3OF2A 5IXYA 3PYXA 3L4SO 2NNLD 4BOYA 3JD4A 4J1NA 1L7DA 4LCEA 2AA3A 2NU7A 3WSWA 4MPDA 3LDHA 3D0OA 4R1NA 4URFA 4MVJE 4XB1A 5ADHA 1PJ4A 1HYGA 5C37A 1UP4A 1SB9A 1GFSA 4G5HA 4KDFA 2PD4A 2O2SA 4FD3A 1PR3A 1HE2A 1ZBQA 4IBOA 1SEVA 4N5LA 4BV9A 1LRKA 1NM5A 1K6XA 1M76A 4RL6A 5B4UA 2ZCUA 3DMYA 4WNIA 4YT8A 5IJZA 2WDZA 4J90A 3H5RA 4HNGA 5A9TA 4XYEA 4OIMA 1B8UA 3GNSA 1D4FA 2VYNA 4FN4A 1ZZEA 3AY7A 4M55A 1B16A 1KY5A 4RORA 1DIAA 3GG2A 4S3MA 4BV8A 2LDBA 2DBVO 1W73A 4GI2A 3UUWA 1P33A 3ADPA 1E1KA 3L6EA 2VUSA 4CQLA 3C7CB 5G4LA 5JMPA 1MXFA 3GGGA 1PX0A 2CDCA 5I7SA 3WQQA 4IMRA 4WE3A 2Y0EA 4ZQHA 1I36A 1PS9A 2OUIA 1NR7A 2YHUA 3DZIA 2VOEA 4H15A 4JROA 1CYDA 4XGKA 1XLTA 1O94A 1LLDA 2HSDA 1ZSYA 4GQAA 1DB3A 2AQIA 2YQ5A 3LC1O 3W1VA 4IZIA 3LT1A 4DQVA 1HRDA 2CD9A 2DBQA 3C3XA 3DL2A 5JNLA 3ZU5A 4DLBA 4GVXA 2NLOA 4ILKA 4CMGA 1ENPA 2UUPA 1QSGA 3A1NA 4BNFA 3CPSA 4R9SA 5HBRA 5EJ2A 1NPYA 2YFHA 3JQDA 3IJPA 5CDUA 4OOFA 2P4QA 4U0JA 3H2SA 1XG5A 1HWYA 1VLLA 4QT0A 2JD1A 5A1TA 3MCVA 4RVGA 3RSHA 5COAA 2BFOA 3RBZA 4XA8A 4XIJA 1RYDA 1EK5A 1SNYA 1YVEI 5I9NA 1P1KA 4ND4A 2I6TA 5DNAA 5IDYA 4R41A 3F6YA 1GV1A 2DUUA 1R4MA 4E5PA 3LC2O 4RVSA 1JVSA 2UVDA 1ML3A 4TZTA 1C0PA 5JYDA 2DFVA 1GPDG 2EP5A 3IMFA 4IPTA 4Y67A 1AGNA 3ZW9A 4B8ZA 5A04A 1YXMA 1DFGA 3ZNNA 4EEXA 3WLFA 5GZ1A 4Y6RA 3VPGA 3CE6A 3ULKA 1P31A 2AEMA 4D3DA 4DPLA 4AJJA 2DTEA 2GF2A 4O6VA 5LDHA 1FK8A 3QE3A 5AVOA 2ZTMA 3E9MA 5CG1A 3QW2A 4PLZA 3F47A 2FHSA 1Q7GA 1DFHA 2YV2A 4FC6A 3U49A 2J8ZA 1F06A 1QORA 1E1NA 4BNIA 4BMNA 1CQIA 5TQVA 4PLVA 5HS4A 3RUAA 2RH8A 3U4HA 2G76A 1VL6A 1WZIA 4RPJA 3UW3A 4M1QA 2CY0A 2Y67A 3IC5A 1ULUA 2EGHA 1HDZA 2W2KB 1A71A 3A14A 4RPGA 3F5SA 1R0KA 3VH2A 2C5AA 3Q9UA 3JD1A 4Z3DA 3FBTA 1OC4A 2JL1A 3OHSX 4D0SA 1RWBA 2F00A 3WTCA 5C7IO 2DAPA 1P0CA 1DAPA 3F4LA 4NH4A 4XKJA 5CDTA 1I2CA 1E3EA 2VUUA 5JAIA 1I3LA 5F1OA 3LQFA 2GZ2A 3GG9A 2JAHA 2DFDA 3H65A 4QEDA 4R51A 3MTJA 4QXMA 2DC1A 5CPFA 5AYVA 1HDXA 4R54A 1GADO 4PFJA 4O1MA 3DOOA 4FFRA 2EF1A 3H4VA 3WGQA 1UP7A 4IMPA 5HA5A 4PLYA 2XPCA 2VWPA 3AI3A 3WWZA 1UXHA 3BA1A 1QV6A 2V65A 3OA2A 4KUEA 5TJ9A 4OSPA 4M86A 3WGHA 4MP3A 3RJ9A 1VL8A 2HAEA 2VYND 1GY8A 1UZMA 4GKVA 1EVJA 3WDSA 1LC3A 3RU7A 4H16A 2PKQO 5EMHA 4YA6A 1NXQA 4CM1A 3U62A 5JC1A 4DMMA 1PSDA 5DCUA 4J43A 1T1RA 1J6UA 1Z7EA 4HWKA 4OQYA 5DZSA 2W2LA 3DMTC 3GY0A 4BO4A 1GQQA 3VH4A 3EY4A 3KXDA 1VJ0A 2VT2A 3ASUA 3CSDA 3RQSA 3BMOA 3RIHA 2IXBA 4LSWA 4BIIA 2DU8A 2GERA 4HUJA 2O2YA 4BS9A 4CM9A 1ADBA 1NAIA 4R69A 2GASA 3OJLA 3WNVA 4BB5A 4XGNA 3MJEA 2HJSA 1U7HA 3GDGA 2PGDA 5BNFA 4N54A 2EWMA 4NBRA 2P9CA 2ET6A 3RFXA 2DBRA 1PJSA 4BO2A 3O8QB 1FXSA 1YJ8A 2PZJA 2I5PO 5DCWA 3EC7A 3F1LA 2ILTA 2GUGA 2X5JO 3C1AA 1Y9AA 4JLWA 4N18A 5A9RA 3U09A 2PKRA 2BRUA 2WD7B 4W99A 4QECA 1JKJA 1P74A 3MJ4A 2B4QA 3DBLB 4M87A 1Y81A 1DRUA 1AE1A 2AE1A 4XGIA 4NK5A 4DYVA 1PL8A 1TA4A 3OIFA 2J6IA 2ZB3A 1B15A 3VDQA 3JQBA 1LSUA 3DFZA 4CLHA 5CFZA 4MVJI 3UHAA 2ZB8A 5TT1A 4CV2A 3GT0A 1EVIA 5KVVA 1CDOA 2W2LD 1KIFA 2B5VA 3JD0A 1NQOA 3UF0A 1UR5A 3RBVA 3JYOA 4NMHA 5JDCC 1VC2A 2HMVA 3OICA 3LK7A 3OIDA 3L6OO 1N9GA 3COSA 2SCUA 4IJUA 3GFGA 1A9ZA 3JCZA 5A9SB 2Y1EA 1O9BA 4RVFA 2NU9A 4EJ6A 3DB2A 1D3AA 2LDXA 2B0JA 3X2EA 3EAGA 5EERA 5LC1A 1H0KA 1E7YA 4JIGA 4Q3NA 5TSDA 4JX8A 4ALMA 1RKXA 1AHIA 4KP7A 2JCXA 3PHIA 4PRKA 1HSOA 3QWIA 3HFSA 4AJKA 2DUWA 4QO7A 3EYWA 3VKVA 1EFLA 4CJXA 3DAPA 1PL7A 2PWZA 4XQGA 2I9PA 3C1TA 2AHRA 3H9JA 4NBWA 4IDDA 3W8DA 3I4CA 3HWRA 5EESA 1YBMA 1LLQA 5B4TA 4YPOA 3JQ6A 3NX4A 3TZCA 4A10A 4GH5A 3KVOA 3DZFA 1T4BA 1GEEA 1GCOA 1U7TA 3O38A 4J2HA 2J3JA 2W4QA 3SC6A 5U1PA 2R00C 5ER9A 1HLPA 4JJIA 4WLOA 1X15A 1O0SA 5EN4A 2DPHA 1VPDA 4YJFB 2BD0A 5F5LA 3KEQA 1GZ4A 1NWCA 4ALNA 4TRJA 4BVAA 4ZJUA 3EMKA 2RHRA 1X14A 4EYEA 1YL5A 1HKUA 2HO5A 3PEFA 3RBXA 1WMBA 5JW6A 4BHTA 3HE3A 3C8MA 3EGOA 3ONEA 4BNMA 4J49A 2GD1O 4E5KA 1XU9A 2BLLA 4DTIA 3TF5A 4A03A 3KEOA 3I9MA 3KV3O 2G17A 2W98A 4BNYA 1C1XB 1H6BA 2I65A 1KS9A 1KEPA 1F8GA 5ILGA 3BMNA 1YQXA 2B36A 4A7PA 3SLKA 3KYDB 1BXKA 3FNEA 3PWZA 3DHNA 3WLEA 2FR1A 5JYEA 2Y0DA 3LLSA 3LVFO 5K6AA 3G79A 3D5TA 1JN0A 1AUPA 3GMDA 3UFXA 2V6GA 3DONA 5I7EA 1DC3A 3HB4X 2ZYDA 2X4GA 3AU8A 3KM0A 4UUNA 4I5FA 4CR7A 1C0KA 2O7SA 3JQAB 1RM4A 3WOHA 1ZK2A 1OBFO 3ZI0A 4P38A 2YJZA 3MWEB 4YT2A 1NWHA 2JD2A 2Q2WA 2EEZA 2WE7A 4GWGA 3HN2A 4D45A 1EK6A 3VH1A 4A27A 4CQMD 1Q0QA 1LC0A 1MUUA 2I3AA 1N2SA 3A28A 2G5CA 3MJTA 4D3FA 5EIOA 1X0XA 2BF7A 2W8ZA 3U4DA 4CMBA 1XIVA 1YJQA 4MIYA 1ZMTA 4BO3A 4K9DA 3FNHA 3BMNB 3OETA 5KJ6A 3DEYX 4NFSA 4NJOA 2P9GA 4BUCA 4E2YA 2NADA 4BKPA 4J4HA 1KOLA 4Z9FA 1U2GA 2JHGA 2O3JA 3D7LA 4UUMA 5TF4A 2R6JA 3ROMA 5HTOA 4YJHB 1GV0A 3WIEA 3DR3A 4PG4A 2F1KA 4E6PA 3GVIA 2O50A 1IUKA 1PJBA 1LQUA 2RH4A 3IIEA 4R01A 2IZ0A 4IDEA 4XZ3A 1DPGA 2WMDA 1QG6A 3VDRA 2DQ4A 5T5QA 1KEWA 2Q99A 1DFIA 4NNJA 3S55A 4RPLA 2Q49A 1NX6A 1U3WA 2QRLA 4DVJA 4OJNA 4YRBA 4GSKA 4JBHA 5L4NA 5G0SA 2G1UA 3BTVA 4J9VA 5A4DA 1HSZA 4RV9A 5DP2A 3NJ4A 4LRTB 4XRRA 3OM9A 4D46A 2BKAA 4BO5A 4CLEA 1ZK1A 2XOXA 1QKIA 5G0VA 1QYCA 2CVZA 2D0IA 3NAQA 3P19A 4UVEA 4TKLA 2H6EA 2WE8A 2AG5A 2Q1TA 4XR9A 1Y6JA 1VRWA 3F5QA 4MKXA 4R1UA 5I8ZA 3WJ7A 3FR7A 3L4BC 1TEHA 1E6UA 1VKNA 3KBOA 3FPCA 1F14A 5DBIA 3VZRA 2AQKA 4ALIA 3I6IA 3VTZA 4WCFB 1YL7A 2CMDA 2HK7A 4ND1A 1WVGA 1ONNA 1WZEA 1ZK3A 4IINA 4F46A 4J7CA 2HRZA 4BMVA 4XJTA 5JY6A 4BKQA 3TFQA 3H3FA 3EVNA 3GPDG 1H94A 4R1TA 2GR9A 2ZK7A 3CKYA 4WEOA 1E3JA 2D3TA 5THKA 1LUAA 1HETA 1W8DA 4ZHSA 5TIIA 5B37A 2GO1A 1HDRA 3MEQA 3GN1A 3WNQA 3GFBA 4D41A 4XEHA 4IS2A 1K89A 4U0KA 4UUPA 2YY7A 1GYPA 3UAGA 1SPXA 4TSKA 2RAFA 2HMSA 2YZ7A 2VOJA 3L07A 3WS7A 3KLPX 4ZVVA 1ZJZA 4AJ4A 5C3MA 5L4SA 1B0AA 3G0OA 3NT5A 4N5MA 5L40A 4RGBA 3TWOA 1C14A 5BSHA 1RJWA 1ADCA 1EZ4A 2BH9A 4EBFA 4RPHA 4DBZA 2UAGA 3TDKA 3E8XA 1J0XO 1DHTA 1E5LA 3QJ5A 1NPTO 4PGFA 2Y99A 3QHAA 4JP2A 4CLDA 1EUDA 5A9SA 5CEJA 4IQ8A 3K30A 2IZZA 2HJRA 1P1IA 2Q2VA 4W9NA 1I3KA 3FBGA 4FFLA 4OO3A 9LDTA 5ER6A 4CQLB 3I4FA 2HQ1A 3N7UA 3PYMA 2BFMA 2VWQA 1I01A 1R4NA 4WKGA 3AUTA 1ADFA 5KCZA 1QLHA 1SMKA 3WXBA 3B20A 1A4IA 1TLTA 4GX5A 3TL3A 5ILOA 3PRJA 1UZNA 3LT2A 3UVEA 4CQMA 2IYOA 2Q4BA 2X5OA 4KWIA 1YB4A 5IN5A 3ICCA 1H2HA 3KSDO 3RUEA 4XYMA 3VC7A 3PHGA 4X54A 3DZBA 4W4TA 3TNLA 3E9NA 3PWKA 4JBGA 2YV1A 5KTKA 3NDRA 2JHFA 4P22A 4WNCA 3NT4A 3KYDA 4BB6A 3VKUA 1ENYA 3GVPA 3E03A 2JCVA 3UOGA 4P8RA 3WG9A 3CXRA 1Z45A 3M1LA 5F1KA 4L4XA 3ITKA 4OYRA 4RQUA 1W4ZA 3PGJA 3SX2A 2HDHA 2P4HX 2C29D 1AN9A 1T25A 3WR5A 1BGVA 2WSBA 4BMSA 2P2SA 3JQ7A 5I9LA 3E5MA 2R00A 2AG8A 2UDPA 4WOJA 3ZHYA 3L6DA 5T6BA 2EKQA 4CPDA 4IJKA 4RF5A 2BGMA 1F17A 1PZFA 4A73A 1TT5B 1RM3A 4B3JA 4LN1A 5JE8A 2WEKA 2QYSA 2X5KO 3HUDA 1O89A 2GRAA 1V9LA 5IZCC 1LDYA 1E3WA 1N5DA 2NTVA 4G81A 4DYDA 5MDHA 2OORA 5A03A 4L8VA 3WFIA 4CUZA 4PLGA 3JQ8B 4B4UA 5IZ4A 3AM5A 3DAFA 1LDMA 5DOVA 1U3UA 1Z73A 3FWNA 1XYGA 3DOJA 1YOVB 5KKAA 4ND2A 1T2FA 1B7GO 3G3EA 1P1HA 4FGSA 3D3WA 4FJ2A 4PLTA 4J1SA 2Q3EA 2BGLA 1AXGA 5ICMA 2AEJA 2Q1WA 3GHHA 2CUKA 1GPJA 4RF3A 1PR9A 1X7GA 4IDAA 1MX3A 3AOGA 1E3IA 2OL4A 5TLSA 1DIHA 1LRLA 2QX7A 4WCFC 1PGJA 3WX0A 4E5NA 2IRWA 3D3EA 1SBYA 3OJ0A 3RUIA 3O9ZA 2WYWA 4AJLA 4C4OA 4EGFA 1MC5A 2Y68A 2VZ9A 3RUCA 2HU2A 4WOKA 1SOWA 2FPIA 3QVWA 1KVQA 4K1LA 2HKIA 3GF4A 1PGNA 3JQAD 3KUXA 3R0IA 3VZPA 3HB5X 1E7RA 1EBUA 1AHHA 2EERA 4YAEA 1V8BA 3D64A 3GMSA 3ITDA 2HK8A 4F45A 2C7VA 4NI5A 3VTFA 3I9KA 4QFDA 1I33A 3OEYA 2FZEA 1GAEO 1ISHA 3ZWBA 4JBIA 1MGOA 1MLDA 4WCFA 2FP4A 3QVOA 5DULA 4I9UA 2HCTA 4UVDA 1NASA 2DVMA 4PLPA 4ALKA 4NZ9A 3JQ7B 2D1YA 1U1IA 3JQCA 5L7TA 1I5RA 5JFOA 4Q3EA 4B7CA 3CINA 5JO9A 5FEUA 1ZEJA 3HDJA 4F3YA 1BW9B 4B3IA 3PDJA 4DC1A 1VJTA 4R5HA 3QQPA 3H9UA 3VVBA 4O5OA 1FJHA 3R3JA 2PV7A 4JN6B 3JD3A 1R0SA 2AMFA 4BNUA 4D42A 3KYCA 3PFFA 4DA9A 4UAGA 1U5CA 2HLPA 1VE9A 1PJ3A 1YO6A 4NDNE 2VTDA 2ZQYA 4M8SA 3ZV6A 4U7WA 5AQ1A 3IOYA 2YDXA 3OEWA 4B79A 1GYQA 1T2EA 4P4LA 5ENVA 4AVYA 4LISA 2GGSA 2GZ1A 1PJ2A 2I99A 3UICA 4YR9A 4K6FA 1M75A 3GAFA 1LQTA 3QIVA 3JQEA 2WYVA 1LSSA 1LLCA 1EVYA 3QP9A 5CP8A 3UKOA 3AY6A 1O6ZA 1Y8RA 3M2TA 1MXHA 2QZZA 4YJGA 3E6AA 1DIGA 3IUSA 5K0ZA 2VN8A 1GUYA 4ND3A 3VHRA 3ZWWA 4PRLA 1JU9A 3PDUA 5CDSA 4M89A 4BGEA 4J3FA 1I10A 1M66A 4BO8A 4FBGA 3PLNA 4U5QA 4M54A 4PVCA 4BGIA 1ISIA 3PJDA 4TRNA 3STHA 2VCYA 2J3IA 2IYPA 1JTVA 3SJUA 3ZWYA 1UUFA 4MVJF 4NR0A 4NIMA 4DBVO 2ZTVA 4JQCA 3PI7A 4DIFA 2PZKA 3FN4A 1BW9A 1JAXA 1QYVA 1IYZA 4K28A 1KYQA 1DEHA 1N7GA 3K92A 3ZWXA 1EDZA 1KVRA 2J3HA 4I5EA 3Q2KA 4CMEA 3JQFC 1UAGA 3T4XA 3HJAA 1X0VA 3DOCA 4B7XA 1TI7A 5K9ZA 1OAAA 3IP3A 1EE9A 4RLHA 4E13A 2VZ0A 2VWGA 3FSRA 2IZ1A 1XEAA 2ZCVA 4FOSA 4Y98A 3UCXA 5DCYA 3V2GA 1BSVA 2O23A 4CM9D 3C7AA 5F5NA 1YS4A 2PKQP 4JNKA 4OM8A 4W9NC 1NHWA 5COBA 3Q3CA 2BHLA 4LVUA 2PH5A 1WLYA 3K5PA 4BNZA 4EEZA 2PD6A 1BRMA 4FJ0A 1U8XX 1H6CA 1N1GA 3CZMA 3ZN2A 4E4YA 3TFOA 2BELA 2EW2A 1RM0A 3KO8A 4RZHA 2Y0CA 3RFVA 1V35A 4YRAA 1I32A 3PHHA 1JKFA 2OOSA 1Q7CA 2GNAA 3WIDA 1ISFA 1FDUA 1ISMA 2NTNA 1UAYA 3GDOA 4ROSA 3UXYA 4CMCA 4E31A 1DBVO 4TRMA 4YAKA 5BNTA 1Y7TA 1WW8A 5G0UA 5IG2A 3BZUA 5HS6A 1T26A 3GAZA 5TX7A 5A3JA 2OGUA 4E30A 1PS0A 1KVTA 3JQBC 4AJ1A 4TMFA 3B1FA 1CEQA 1XA0A 3GA0A 3RI3A 3RC9A 2ZTLA 4W7IA 1FF9A 3IS3A 3R3SA 2E49A 2FPPA 4CMIA 3TN7A 4BO9A 2X9NA 1YBVA 2BFAA 2YHIA 3WQSB 1H5QA 1BMDA 1JLLA 1ADGA 1JWBB 3AJRA 1BDBA 3ZWMA 1ZMOA 3EZYA 2O3RA 3G1TA 3UH1A 3GGOA 3PZBA 4IUYA 1G6KA 4NK4A 1Z6ZA 1IPFA 1CERA 4AJNA 1ARZA 1EVZA 4PG8A 1R37A 1B8VA 3BIOA 2E48A 2FRDA 3ZWAA 3RAJA 1ZW1A 1OMOA 1VL0A 2XXBA 1Q0LA 3INGA 3MWDB 1T24A 3EW7A 1HL3A 2NM0A 4O0LA 4J4TA 4OQZA 5BNIA 1PU2A 1EUCA 5TT0A 3GPIA 3PP8A 5AXAA 5LDGA 2HRBA 4MP8A 5KJ1A 4J9UE 4YTEA 3JQ9C 3FTPA 1P1JA 3PIIA 3A4VA 1E3SA 2VRCA 2Q50A 4CR6A 4Z3KA 3HDQA 4XD2A 4MDHA 5A05A 4QQRA 4XYGA 3KLMX 5CHEA 2GN9A 5COQA 6LDHA 1LDGA 1A4UA 3MTGA 3QVXA 1UH5A 1C1XA 1PZHA 4BKOA 1K6JA 3DBLA 3DQPA 4OKIA 3OQBA 1P0FA 2GN8A 3AY3A 2FZWA 4XQEA 4D79A 1DLIA 5HRUA 2XF8A 1P77A 3B70A 2YV3A 5C7LO 2VUTA 4NBTA 1PJCA 1UZLA 1YONA 3ZWPA 1ID1A 1A5ZA 1E3LA 2J5QA 2Y1CA 3H6KA 3HHPA 2TMDA 3P2YA 4W6ZA 4YT4A 3K73O 4OL9A 3RROA 1UXKA 4TQGA 2GLXA 5ICSA 3W8FA 2UV8A 1Y8QA 1YDEA 5A02A 1LBEA 3QWAA 1HF3A 3DZJA 2OO5A 1Y5RA 1UJMA 2BFPA 1ISGA 3PQDA 4QTZA 5TGDA 4J16A 3PPIA 1IZ9A 3PK0A 3WBBA 1LU9A 1T2AA 3CIFA 1K3TA 1Y8RB 4FFPA 4YJGB 4XWYA 2HK9A 2FMUA 1QLJA 3Q2IA 4KZPA 2A35A 4N7RA 4CM5A 2EJVA 5TJHA 1O95A 3ZNPA 4OKNA 4BO7A 1NVGA 1WDLA 3D5QA 1YRLA 4AFNA 2CSUA 4TWRA 1ZSNA 1ONOA 1CF2O 1ZUD1 4UVHA 1D8AA 3ANNA 3DMTA 3NDJA 2RBEA 1GD1O 4II2A 2X58A 3CEAA 3VPFA 3QRWA 1P9LA 3EHEA 1E77A 2IEBA 1ZXBA 2VHYA 3BXXA 2IXAA 3WYBA 2A92A 4A5OA 1XCBA 1D7OA 2X86A 5IFLA 3WGZA 2I66A 4KDEA 2B4RO 2UUOA 2C82A 3V2UA 5FFFA 1BXZA 5BSFA 3SVTA 1DRWA 2QIOA 1NYTA 3A06A 3HN7A 4FGWA 1N92A 3SXPA 4HNHA 2VT3A 1XELA 1X1TA 3PIDA 4ALJA 4E2WA 5ES3A 5L3ZA 5BSGA 5JCJD 2B5WA 3ZNQA 5IN4A 4P4GA 3UN1A 4WLNA 2NVUB 2DM6A 2A4KA 1YH3A 2YFQA 2IEDA 1I30A 5EQFA 1GQYA 3WBFA 4RVDA 1B8PA 3GLQA 3O4RA 2O4UX 1DSSG 4B7UA 3BTSA 4BNXA 1WAMA 3DBVO 1PGQA 3EZLA 4K26A 3PJEA 3CUKA 1LDEA 3DBHA 3ADOA 3NYWA 3LLVA 4YDRA 1KC3A 4MVJP 1ZK4A 4L4RA 3WQRA 4CUKA 2JFFA 1H6AA 5J23A 1BVRA 2PLAA 1MG0A 3HNPA 4NG5A 5BQFA 4JGBA 3ICPA 1K6IA 5IAAA 3EUWA 4RCVA 4CM8A 4EDFA 4NBUA 4RJTA 2QZ9A 3FTNA 4D3SA 1G1AA 2YW9A 3DHEA 1R16A 5KJEA 4CM4B 1DJNA 1YWGO 3GRPA 2OP1A 4GSLA 1NFQA 4TROA 2CVOA 5DOZA 1WDKA 2X9GA 3H9QA 2X0JA 4IIUA 3JQ9A 4R4JA 3INTA 5L4LA 4TRRA 1NVTA 1YE3A 3PGXA 3TSCA 1IZ0A 1GR0A 4IDFA 1Y9EA 1XKQA 4PG7A 5FF9A 4DWVA 4FQ8A 4NU5A 1JWAB 1GTMA 1PZGA 4CV3A 1U2DA 1SZJG 4S1VA 4ZICA 2V6MA 3H9EO 1HXHA 2OMEA 2Y1FA 2QRJA 3IKVA 1H9BA 3CH6A 2Y1GA 2FOIA 5H82A 3E48A 1QXSA 3E9QA 4CMAA 2FR8A 3W6ZA 1FDSA 4U8GA 2YUTA 3HZZA 4GL4A 4WPGA 3QSGA 1HYEA 3DZHA 2QQ5A 3QWFA 4NQZA 8LDHA 3U9LA 1C0IA 1R15A 2C54A 4INAA 4LW8A 5LCXA 3WGTA 2AQ8A 2B69A 4L74A 1SOVA 5L51A 3T7EA 1U3TA 5JS6A 1ZKMA 3NGLA 2W2KA 4J7UA 4JJFA 3H2ZA 2ZQZA 3L9WA 3NTOA 2OBYA 1W0CA 4HBGA 3KSUA 2JFGA 1C1DB 1DXYA 1IHYA 1VKOA 3IAHA 3C24A 4CLOB 4CMHA 4Q9NA 2VRCD 1PIWA 3RUDA 1ZFNA 1PJQA 2C2YA 4XYLA 2VNAA 3S8MA 4A2CA 4CM8B 2Z1MA 1NPDA 1QYDA 1ZIDA 1PGPA 3V1YA 3EVTA 3NT2A 1WPQA 1SC6A 3P7MA 2PGLA 2O3QA 3E1KA 3TOZA 4BKUA 4XIYA 1T2CA 3ROPA 3MJVA 5HM8A 3BMQA 4GWKA 5JDIA 3ANMA 1XSEA 3OQ6A 4GMGA 4IXWA 4Q3DA 5DBFA 4ZU3A 2OBNA 4CQMB 2PD3A 1O8CA 4IM7A 3AW9A 1FDWA 3LC7O 1NVMB 3O03A 4YJDA 1X7DA 4G2NA 4Z9XA 4L75A 3B1JA 1IULA 1CJCA 2PNFA 3Q11A 2OXIA 1XWFA 2AQHA 3BHMA 1V0JA 1G0NA 1MP0A 1FDVA 3F9IA 3WTBA 5GY7A 3FCOA 4KUGA 3AK4A 1QYXA 1GEGA 2CVQA 4BO0A 4LRSB 2AE2A 2FWMX 3I9NA 4XB2A 1QR6A 3AFMA 3I83A 4II3A 2CZCA 4FR5A 3GC6A 4RPKA 1C1DA 4CL8A 3DO5A 4AJOA 2ZJ1A 5FI3A 4F6LA 4CM3A 2D5AA 3BMOB 4GX1A 3WGGA 3SJ7A 4DIOA 4GX2A 1Y5MA 1LNQA 2DT5A 2O4CA 1OI7A 1ZSVA 3VOSA 2FSSA 2P68A 3JYPA 1A9YA 1FMCA 2OFPA 5A5EA 2EJWA 2QYTA 1YOVA 4DXHA 3DZGA 3FI9A 1LXCA 3S2EA 3O26A 2EKPA 2X23A 2H5LA 3DFUA 2JJYA 3RC1A 4E0BA 1LSJA 4UULA 1E3WB 3V5NA 7MDHA 2AXQA 5F3RA 3VZSA 4OXNA 5T8KA 1VI2A 3RD5A 5K6AC 2FPGA 2Q4EA 1MG5A 4I8XA 4RVUA 3TL2A 5JDIC 4LSMA 4KMSA 1TB4A 1KETA 2O3TA 4FCCA 4OH1A 3D4OA 4J91A 4E3ZA 5JY1A 3TPCA 4QFCA 1NFRA 2YQ4A 3I9JA 3V1TC 1HDGO 1I2BA 1M2WA 3AUUA 3M1AA 4E2ZA 3IQDB 4BNNA 1AXEA 4GKBA 3M2PA 2O48X 1ZEMA 2V7PA 2ZIZA 4NBVA 3T4EA 2V6FA 2NQ8A 3BTUA 3I3OA 4FDAA 4PN3A 4UEOA 3WMXA 1FDTA 4YVFA 4ZD6A 3GEGA 3OBBA 5DT9A 1X1EA 4IS3A 1T4DA 4PCVA 4RF4A 3SLGA 4E12A 3K31A 1PL6A 1PWZA 3S1LA 5A06A 4MJLA 2FR0A 4MVJM 3RKRA 4WK6A 2PR2A 4IY1A 4FFNA 2A9FA 3ZWCA 4DPMA 2VYVD 3KZVA 1M67A 3DBHB 3ZGYA 1HDCA 1XDWA 4YJHA 1ENZA 1GQ2A 2HMTA 4F6CA 1LSOA 2CF5A 2IE0A 3TJRA 1DC5A 3DDNA 5JAQA 4EITA 1S6YA 2Z95A 4M49A 4CL3A 3G1UA 2GSDA 3TRIA 4E33A 1SB8A 1Z74A 1JDJA 1TT5A 1E7MA 3V8BA 3D4NA 4IZHA 1A72A 3NUGA 1ORRA 1B14A 4FJ1A 3ONFA 4Y8VA 2DTDA 4EUEA 3IUPA 3NTRA 4FC7A 4YQZA 2BGKA 4QSMA 2Q1UA 3GZNB 3ASVA 1VSUA 5G0TA 1YQDA 4EI2A 1V3UA 3VVCA 2Q2QA 1WWKA 5C7OO 1OOEA 1DJQA 3ONDA 4Z0PA 1KVUA 4Q39A 5IZCA 4NHEA 3ZZNA 5U9CA 1R66A 4JXKA 2WJPA 1IY8A 4GMFA 1N9GB 4L4SA 5TS3A 2PZMA 1BWSA 4R9RA 3VZQA 5EL0A 5T67A 2WYUA 3LZ6A 1SO8A 4GBJA 2IODA 3FWZA 3I5MA 3PHLA 2X6TA 2B83A 1U4OA 2CFCA 2O7QA 1LEHA 1ZH8A 3VPXA 3DAGA 4BNJA 1ZVMA 3RCBA 3OP4A 1LX6A 4I9HA 1NFFA 4GGPA 2DLDA 3ENNA 1GZ3A 5F1PA 4AL4A 5AXCA 4FPXA 1HYHA 3JSAA 2D8AA 1A27A 3U3XA 1XGKA 1NQAO 4HKTA 4KTVE 4J2OA 5GZ3A 4E21A 1JKIA 3QWHA 3RASA 3P5SA 3WSVA 5T8KC 4BNGA 5ITVA 3JQAA 4I08A 3GK3A 4MO2A 5EPOA 2P5YA 3WYEA 2X0IA 1LTHR 5EINA 2E4AA 3OQ1A 3PJGA 2GYYA 4Z6KA 1P3DA 4IQ0A 2P5UA 4CUJA 4QUKA 2CDAA 3ZHXA 3RFTA 5MGBA 4KQWA 2NV6A 4NFHA 4LGVA 1TVEA 3CMMA 4B4WA 3AWDA 2YHIB 4HFJA 1Z7BA 4RLSA 1E7WA 3ABIA 3GZNA 2VZ8A 3GHYA 1UDAA 3W6UA 1XQ6A 1I3MA 1IOLA 4RO0A 4OOEA 1R4NB 1PWXA 1SAYA 1U5AA 4R3WA 5KJFA 1HZJA 5H83A 3NGXA 1WDMA 2NSDA 3FF4A 4I9NA 3ETDA 4CMIB 3ZCXA 1JW9B 3KTDA 4IGFA 4PG6A 4MVJA 1NNUA 3PQEA 3H7AA 3TZ6A 3BMQB 3ZU2A 2FSVA 3EK2A 3WGIA 1BG6A 3GOHA 1UXGA 4JJGA 4DQUA 4PZDA 1A7KA 1XHLA 1T2DA 3MZ0A 5IDXA 2EG9A 1BXGA 3W8EA 4BNVA 2Q1SA 4EZBA 4YAIA 2ZYGA 3ETGA 4IJWA 3Q1LA 3OMLA 4J7XA 4BNLA 1VSVA 4G65A 4GX0A 1KEVA 1NBOA 5A5FA 1PQUA 3AI2A 3RUFA 1NAHA 4ZN6A 4D44A 1Z75A 3OFSA 1E1MA 1HTBA 4OMUA 4Z0HO 4MVJD 4O63O 4XQCA 2QRKA 5I7VA 3H9GA 2ZB4A 2XAAA 1U28A 3OJOA 1YB5A 5CPBA 4EUHA 3EDMA 3KYBA 1U3VA 4BGUA 3QLJA 4A0SA 3RWBA 3V1UA 5U4QA 2EW8A 3PQFA 3ANLA 4TKMA 2DTXA 3VAZA 1K5HA 2D2IA 3LT0A 1DIRA 5A3VA 3NKLA 1ZXLA 4NFYA 1LLUA 3BMCB 3C85A 3TOXA 1JAYA 3GVHA 4B4OA 5CDYA 1B2LA 1CQJA 3LU1A 1EBFA 1IHXA 3JQGB 2BI7A 1HEUA 1WNTA 1K0UA 4DLLA 4XRGA 5JSFA 3NDIA 4JK3A 5I7FA 4XX0A 4GGOA 3JQ8A 4K6CA 4CODB 1DOHA 1UDCA 2EIHA 5L53A 1IL0A 1OZAA 5KIAA 3TQHA 2RCYA 3I6QA 4UREA 3BHJA 4ZQEA 3F1KA 4YQYA 1ZCJA 3K9QO 5JCJA 1C0LA 3KRTA 1NQ5A 3MJCA 4QX6A 3VPHA 3ON5A 5B1YA 1DDOA 4WLFA 2Y93A 4FW8A 1ULSA 4LK3A 2UYYA 1V3VA 2G82A 3WWYA 2H9IA 5AXBA 1EMDA 2WD8A 1YL6A 2A94A 5CEFA 3BHIA 4WLUA 4RVHA 5ITWA 3ZV3A 1JA9A 3ORFA 1VJ1A 1ZJYA 1JQBA 4XR4A 1MFZA 2E37A 2VQ3A 3I52A 4GLOA 4L76A 5H81A 3WMWA 1ONPA 1PJLA 3S2IA 4GVLA 3UCEA 2I76A 1UXIA 1KERA 3MJSA 3KHUA 2D4AA 3NEPX 4E32A 4TVOA 2Z5LA 3SBOA 5JAZA 2Y1OA 2O3UA 4AICA 4AJPA 4PLHA 4W7HA 4OXYA 4OHUA 3QA9A 4WUVA 1ZO8A 1G0OA 2X0NA 4L9RA 1J5PA 4WECA 4LMPA 3AU9A 3H3JA 2R2GA 8ADHA 3I9LA 1QMGA 5DP1A 2I3GA 4BNTA 3FD8A 4WCDA 3BMCA 2JD0A 2NTJA 3IDSA 4DPKA 1R4MB 2VTEA 3ROQA 3N58A 5JAMA 3OSUA 1YDWA 2C2XA 4TZKA 5T64A 4ND5A 5KNLA 4Q3CA 3B1KA 2VHXA 3HSKA 5DDIP 2FY8A 4Z9YA 2NQTA 2NVUA 4BNKA 3JQFA 4UVIA 5JC8A 4A26A 4ZQGA 1LJ8A 1BTOA 4EUFA 2X8LA 3SC4A 3TZQA 1H9AA 1PZEA 3U4CA 4YYZA 4YAJA 5CG2A 1RYEA 1IE3A 5I9MA 2VHVA 4PZEA 1B3RA 1LDBA 3PLRA 4RDHA 2VHZA 3OIGA 4DUPA 1H6DA 4PVDA 5KJCA 3NRCA 4PLWA 2CF6A 4L0QA 4XDYA 4HADA 3DBRA 4AJ2A 4IDGA 3OJEA 4HP8A 1HE3A 1BHSA 3F3SA 4YACA 2X7HA 5FI5A 1U8FO 3RUHA 3Q9NA 1B3BA 5B4VA 4FSHA 5KOIA 5KVCA 2E6UX 3PXXA 1UDBA 4LCJA 4NJMB 4CV0A 1GYRA 5L45A 1E1LA 4I5GA 4CM4A 4R16A 1GUZA 4PIVA 2POQX 4NU6A 2NWQA 1WXDA 4RF2A 4D0RA 3I1JA 4H3VA 4J1QA 3BYZA 4Y6SA 4OXKA 2DPGA 1ISJA 3K6JA 1RM5A 2Z1NA 1F8FA 3PVZA 2I67A 5G0WA 2P91A 3QWBA 2X9VA 3OECA 4UEKA 3BAZA 2B35A 1N8KA 3AOEA 3AUSA 3ETEA 4BL5A 1U4SA 3P2OA 3ROKA 1E92A 2E82A 3MOIA 4FFMA 1DO8A 5TC4A 4Y6PA 2EGGA 2G0TA 3RJ5A 4P4NA 1DRVA 3FPLA 3N74A 3WICA 3I9OA 1GZ6A 1GDHA 4HFNA 1MV8A 3KETA 3H5AA 5ENDA 2ZATA 1S7CA 1N7HA 3ZU3A 4PLCA 3L9XA 5C5IA 3H8VA 2ZTUA 3R6DA 1HDYA 5JDCA 2EHDA 2EV9A 4N5NA 4DL9A 1MFPA 4YWJA 1BDMA 4FS3A 3DTYA 4PLFA 4D43A 1DAOA 3CTMA 4R1SA 3KB6A 4HXYA 1QV7A 3Q0EA 4YJFA 2VWHA 3L4BA 2ZYAA 4KUHA 3D3WB 4BO6A 4HY3A 5IDWA 5KKCA 4BGVA 2QHXA 1NTOA 2W90A 4BQPA 3JYLA 5AXDA 2NVWA 4IDCA 4E5MA 3PYLA 3HFGA 1YQGA 3I23A 4YAGA 5G4KA 5G2OA 2EP7A 5JMWA 1OFGA 3JQGA 4LVCA 4XQ9A 1PJTA 2BMAA 1NHGA 2GCGA 3WGOA 4IJVA 4C7JA 4UVGA 1BXGB 1YKFA 4CLOA 2DKNA 4YRDA 2NVBA 2O3SA 3GDFA 4XDZA 1E0DA 1GUFA 2AW5A 3QVTA 1SCUA 1K2WA 2JCYA 3S2FA 3INRA 3W4JA 3FRJA 4MKZA 1VM6A 2WD7A 1NP3A 1XQ1A 1YBAA 2CNBA 4CM6A 2J3KA 3G17A 4KWHA 3NJ8A 4JP3A 1YB1A 5JLAA 5JPIA 4DC0A 3LF2A 2C5EA 2D59A 3ZNOA 3MOGA 5I8WA 4HV4A 4AJIA 3O8QA 3UCFA 4MOWA 2RIRA 5CAEA 2D5CA 4ZA2A 4ZGWA
chains in the Genus database with same CATH superfamily
1Z0JA 3ZR4B 1TZBA 3IKTA 1J2TA 1XZHA 5L3QB 4YRCA 5FPKA 4CEHA 1LD3A 1Y9DA 2Q6LA 3HO1A 3DV0B 3K2QA 3CUVA 2CHQA 1KGDA 1W48A 1W9HA 1CY2A 1QC5A 1XZJA 2NSYA 3L0DA 3QXHA 4UC0A 4KYUA 1V5WA 2ZR9A 5JH7B 4LQLA 1KWKA 3B12A 3EEYA 2C96A 4B0PA 1NBWB 3AC0A 3PWSA 1BEUB 1MD9A 4LOAA 4MHTA 4Q3KA 2R6DA 3WB9A 1MN6A 1D1SA 3KWFA 4RABA 1MHPA 4JJ7A 4LZPA 1QJ4A 1Y1PA 3VGJA 3TSZA 3VU1A 3H8SA 4PPYA 1H23A 1E32A 3QVVA 5BSEA 2FTKE 5B1EA 2F9LA 5FO0A 3ZBTA 1OC2A 4FGJA 4BKRA 4WEQA 4BTLA 4IDBA 4IGEA 4J0EA 4N1AA 5T4BA 1KYIA 3K9NA 1L4UA 2R79A 2PL3A 3N87A 4F3CA 3LOQA 3IMEA 4CMKA 4PZAA 3IP1A 4KR9A 1EWVA 3EZXA 1XTPA 2GZMA 5ILQA 1USKA 2WYIA 4MS3A 4HLCA 5K2MA 1SBZA 3UJ9A 2FSGA 5ECGC 5CCEA 3TR5A 3FYTA 2QYOA 2RAVA 3V55A 3CPHA 1B26A 1YZNA 4P7FA 4F9TA 1C4WA 1N1DA 1U04A 3EBOA 3ZS8A 3K1YA 9LDBA 3QNWA 5L95A 1HFJA 1FMTA 4WLEA 3VC3A 3F49S 3RREA 2VSXA 5BNWA 4X6LA 3SICE 3DWFA 3EMBA 3UWPA 3J80A 5IVHA 4J94A 3NNSA 4MWGA 2B99A 1A7UA 2QGNA 3BWEA 4J6FA 2DCUA 3ZDFA 5HUQA 3RYCA 3LUDA 4IIBA 2DQSA 4ASUD 3IAUA 4JCOA 3IEMA 4G8BA 4M1WA 4YI3A 3SEAA 2O52A 3CGGA 3FHLA 1G66A 3QV1A 3UGKA 4F9FA 3QI2A 1UFRA 3TQSA 2AT1A 3FRIA 3K9LA 2C77A 3TE6A 4WBNA 1YZGA 3JRNA 4QNNA 1V2HE 4WASA 3WSTA 4ABYA 2X77A 2XH8A 3ZV5A 1JE0A 4RY0A 1YS9A 2JLAA 3NC4A 3E27A 3BBPA 3KE8A 3NORA 2ZOSA 3A9WA 4YASA 3TZEA 4RDXA 3ENKA 2ZYHA 2O59A 3RKUA 1T9ZA 4ICIA 1QPBA 1F7VA 3EB9A 4ZAYA 3C3WA 5GZ6A 4RU1A 4G8CA 4L7QA 5FA5A 1IPEA 2B6HA 4PFQA 1BS1A 1Q7BA 5H9VA 5B1SA 1H1LB 3HADA 2C98A 3LX5A 3FY4A 5B6JA 1DLJA 1N8TA 3UMYA 4XGRA 1TYDE 3C1OA 3QKIA 3UUFA 2BV3A 1U7XA 1I7LA 2HMWA 1D9ZA 3JPYA 3TQOA 1E3QA 4BNWA 5HSGA 2FHPA 2VRBA 1R8YA 2ATEA 2CLIB 2YRFA 2G4LA 3AI1A 4HG2A 4I81A 4GAEA 4YRRA 4DARA 5KSZA 1V7ZA 5EZ5A 4JIMA 4BMXA 1KZ7B 3PPXA 4JAVC 4K1XA 1YGYA 1ZJ4A 3GUYA 4XPZA 5L7WA 2AWNA 3NTQA 3Q40A 2B1JA 2ACWA 1GGVA 2F9MA 5AKHA 1PQPA 1C9KA 2JLQA 3BICA 4N5IX 4U3JB 3FTEA 2CV2A 2PSHA 2E0IA 1KY2A 1J0CA 1ZM3A 3DO6A 3F6BX 2D3WA 3OH8A 3W2FA 7ADHA 1JHMA 8ATCA 4XPIB 1P9RA 4EY7A 3WLMA 3DBRB 1NOJA 3H6GA 2YIVX 3F9RA 4O4LA 5CK4A 3ZQJA 1PVOA 1LRJA 1X42A 3AGQA 1ESNA 3FNGA 5JXWA 4HMOA 2ORVA 1C30B 1HNXB 4NESA 4X41A 5TMPA 4XB6B 1SKQA 2GVDC 1KC1A 2PVSA 3U4IA 1ODFA 4PU0A 2ACEA 1ADJA 3D8BA 2H2DA 2EATA 3CWCA 3QMWA 5F35A 1P0QA 3UANA 4EG3A 1UT6A 2RGYA 3GUCA 4GLLA 1D1TA 4JZYA 1KRXA 5FAKA 1L8QA 1QAOA 5G4KB 4ZQFA 2QXUA 2FWJA 2FZ4A 1WP4A 4JBWA 1ORTA 3MMNA 5H5JA 5F21A 2H5EA 2YC4C 1RYZA 3IV7A 4MPJA 3TW6A 3W4IA 5C7LO 4HX5A 3FSEA 1U0EA 4XOUA 1AQLA 3BJIC 3QVGA 4AS1A 3PQ6A 4F5YA 3N05A 4WY8A 4DQXA 3C6KA 3H5NA 5E3HA 4IV5A 1RC1A 4V2IA 3KAQA 2XVXA 2QQEA 1M1YE 1SHUX 1YR2A 4AXXA 3OJFA 3QKUA 3DWIA 1IAVA 4F96A 4KE6A 3TW8A 1VB5A 1NVEA 3N6VA 5H70A 1W96A 1ZNQO 2WYOA 4HXEB 4CLXA 2R44A 3FOFC 2DBYA 3ODPA 2VPIA 4TT8A 2VP5A 3OCVA 2ZETA 1S1CA 2VXYA 4H7PA 1SRRA 4P3NA 4YRFA 3I5XA 3N8KA 4R5MA 1ETUA 1V9SA 1WZCA 2PBRA 3H16A 4MB2A 1SVOA 1HZZA 4UTXA 4BO1A 1WXIA 1HI9A 4HDAA 4R05A 3Q7PA 3OZAA 3VSAA 1N2GA 1NBHA 2RGRA 3LQYA 3PC7A 5IT9A 3ZG6A 3HVRA 2BONA 1IBKB 2ERCA 4V24A 4BFVA 1RMQA 2DUMA 1G6HA 2GEJA 4LWZA 3P4XA 4LGCA 4RMJA 3VDMA 4AWAA 4IXNA 1UBUS 3ZUPA 4DREA 1QZZA 4G1FA 5FYDA 1M0EA 1DAHA 1R0BA 3TXAA 1M8JA 1UEIA 5SY4A 3A36A 4K87A 3RHFA 1C29B 3AHJA 1JTFA 4FM9A 4Q9AA 2C07A 3ASYA 2NU8B 4XWOA 3K0CA 4HTFA 4FOTA 2D7CA 3DHYA 4G4JA 3KL4A 1J4AA 3ZDBA 1GCIA 2C9DA 4UHFA 4QBGB 1OFHA 5KNDA 1ZHHA 3VYVA 1B0ZA 4RDIA 3TGWA 4TS1A 4LYEA 4WJKB 1TIKA 5P8WA 3UMGA 4XJSA 1EXMA 3E2MA 1V1JA 3Q5DA 2BZSA 2C5GA 2FRXA 1K3FA 3N07A 3OQHA 1WX1A 4AJEA 2G6BA 1AVTA 2OK8A 2P11A 2WTBA 3P9YA 4IXTA 4WGGA 2C3OA 2JA2A 2X6RA 1C3OB 1UBFA 3MCUA 4ONEA 4Q48A 2PBZA 1K86A 1T1SA 3O8RA 4E5YA 5FDFA 4ZRNA 2IYEA 2FEMA 3I1FA 4GPZA 1U9ZA 3FAZA 3G49A 2VPTA 3KLNA 3CVVA 1P1FA 4UHDA 2BTOA 3D8HA 4R8LA 5J3JA 4JYAB 2Y6UA 1HE4A 3ZLUA 4UAVA 1GPAA 1Q3KA 1YHNA 4W82A 1NQWA 3H1FA 4HH4A 4I1UA 1QUFA 3TRJA 1T4GA 1YCDA 2J5XA 3UJ7A 1M2HA 4KFSA 3R9XA 2PSDA 3T5DA 4CEJA 3NIBA 1GRRA 2OP0A 4DLAA 5K7SA 1BYUA 2IIQA 1D6MA 1YVRA 2REQB 1CRWG 2QX4A 1K88A 1YK0A 2WKPA 4JSTA 3ZK8A 4DSZA 5JMOA 3F73A 3DLHA 4LZWA 2NQ2C 2O0KA 1HLDA 1ZXXA 1CUJA 1YS6A 2VNJA 2ZSKA 1XR3A 3G2JA 1ABEA 1WEKA 3JTEA 2JAPA 2QORA 3EEFA 4NHOA 5LB4A 4PSUA 4BQRA 1HX7A 3OF2A 4UPDA 1UBRS 2ZJ3A 2ZU0C 1V1RB 2ATXA 3L4SO 5BVGA 1Y3CE 3JAKB 5IXYA 1CUUA 1SUFA 1KOJA 3U17A 1XWIA 1XRRA 3I04A 4LRWA 4J1NA 1FXUA 1L7DA 3WSWA 3JZAA 1VCIA 2B3DA 4XCXA 1YMVA 4MMZB 1TTQB 4R1NA 3E9CA 4MVJE 4XB1A 5ADHA 1B23P 1R0ZA 4TUYA 5C37A 1EDEA 2OAQ1 4FD3A 1JR2A 3DBOB 3OKPA 1Y3BE 4Q21A 3AERA 1PR3A 4IBOA 3LNCA 2OSVA 3B3AA 1QTIA 3KOYA 1JFLA 2HSEA 4RL6A 4EO4A 5B4UA 5E7IA 1JZTA 3CUYA 3CZCA 4YT8A 5IJZA 1TVKA 4HBZA 3FPKA 3PGLA 4I3GA 1FTYA 3T3OA 2FG6C 1UQTA 1JQEA 1RYBA 2JLCA 4H4EA 1NXOA 2Z83A 4L9SA 1PW7A 4UU0A 2DR3A 3GNSA 2A59A 1D4FA 4D6PA 5ICEA 1E1CB 3L92A 4QELA 1J8FA 3R74A 4P1ZA 2NXNA 3CPJB 4RORA 3W5BA 3NVKI 3R9WA 4WRRA 1BE8A 1C3OA 4PNPA 4AKTA 3CLRC 2DBVO 1V11A 2NUPA 3D6VA 1ZQ9A 5JZ9A 4GI2A 3VOBA 4AJPA 3UUWA 4C5BA 1P33A 4N82A 3PA6A 1ZN7A 3KQNA 3C7CB 3NJRA 2YVKA 2WIGA 1XALA 1XD2A 3FUWA 3GGGA 4HWSA 5G4LA 4D8XA 2IIVA 1E59A 2CFOA 3B6KA 2VAXA 4MUMA 4IMRA 4NJEA 3WQQA 2Y0EA 1I36A 5HRCA 2HSZA 2VC2B 4FWIB 2NZ2A 1GVHA 3U9TA 1LLDA 1Z0FA 3TTTA 5KC9A 4OHOA 4P31A 4BFSA 4N65A 1KARA 4PO9A 4KWCA 4E14A 4BAUA 1UBHS 3BDAA 4FKZA 2JEOA 4GVXA 4DLBA 1CD5A 4CMGA 3PEEA 2O05A 3CPSA 1SHKA 4C08A 1C2YA 1PZMA 2C5FA 5HJEA 4B6FA 2YW2A 2RIPA 4QNMA 5EJ2A 2C5SA 4OBBA 4JELA 1E4EA 4KQJA 4EKEA 2UYQA 5CVTA 3DPSA 4RHUA 5BW6B 4BLVA 3GFSA 1PFKA 2JD1A 3B1YA 4QT0A 3FLBA 3FUVA 4HGPA 1CLEA 5GJWC 4QYMA 2ERYA 2PNJA 3RSHA 1SKYB 3G2NA 3VAAA 3ZLJA 4RFVA 2BSQA 4F0JA 2WP0A 4GSYA 3SP1A 1YQUA 4LQCA 3HB7A 1SNYA 3G13A 2RJNA 3KTAA 1NIPA 5LZ4A 1ZMRA 4P4TA 2EQAA 5IDYA 1KI7A 3AERB 4PYIA 5H3HA 3V6LA 2WKWA 2WABA 2ZYTX 1MVNA 1GN9A 5HFNA 1SD5A 2BMFA 2GJ9A 5HCNA 4DABA 3RTBA 3R6LA 4PSKA 3UAXA 1DTEA 2R6ZA 4OU4A 4LC0A 5AM1A 4KH1A 5IRCD 4NCBA 4KQHA 3IMFA 1ST2A 1EB8A 2JGIA 3IOCA 4QUGA 1L7XA 1EHCA 2PDAA 4Y67A 1O08A 4M36A 2A14A 3ZNNA 1F2DA 1ZI8A 2V7QD 1G18A 3I64A 1SIOA 1N5KA 1WHTB 2C94A 3ULKA 3LVRE 5A3RA 1YDFA 4QDJA 1XBTA 1YQWA 4DPLA 4AJJA 2DTEA 4UOEA 4HDOB 2REBA 3QE3A 4MYHA 5AVOA 3H2YA 2L19A 2QS9A 3QW2A 1LI7A 4IDOA 1N2ZA 3F47A 3HEAA 1Q7GA 2W48A 4HJXA 4FC6A 4PXSA 5F2KA 2H92A 3V4VB 3WADA 1G38A 4NJEB 2DH6A 1IOZA 4GGMX 4I50A 2P2DA 3CSSA 3V80A 5I4KA 3OQNA 3EDRA 4N8DA 4PLVA 2YY6A 2ZRCA 1L8OA 3HV2A 5HS4A 1SBTA 3OCXA 4C0SA 4OUKX 4EHJA 1COZA 1KFEB 1VL6A 3COYA 2JK0A 1O97D 3O0DA 1WZIA 3I53A 2WT4A 2IYTA 2Y27A 4LI3X 1HDZA 1BWPA 4GLFA 4HWPA 3FDIA 2X5XA 1RLOA 5BMVB 3EARA 4XTCS 5EXTA 3WTCA 5BN4A 1JR3E 4CCSA 2NAPA 4NH4A 2I4LA 4B2LA 5BXQC 5CDTA 1U7OA 2IBSA 2Q29A 3VR3D 1ZX1A 1JQKA 3GG9A 2BTQA 3LQFA 4A0GA 5CPFA 3H65A 3C1UA 5BSMA 4TKUA 1XDBA 2R4UA 2YNMA 4G24A 4FHDA 3DOOA 4PZYA 3O8BA 3H4VA 3GFTA 1FS6A 1L5HA 1UP7A 1EJ0A 4IMPA 4W5OA 5HA5A 2XPCA 1AS3A 2VWPA 3DT9A 2A7QA 3PQ7A 3BA1A 2X3UA 1OKKD 1DO2A 2C4UA 5TJ9A 4AMZA 1Y9ZA 3BXFA 1AY0A 4MP3A 3RJ9A 4OFZA 1NVFA 1VL8A 2NO6A 3OFNA 4M0FA 5E9JA 2HAEA 5I48A 1Q0TA 1HYQA 2XEXA 1GY8A 4JLAA 1UZMA 4K3VA 4ZOLB 4PHTA 1EVJA 3K09A 4H16A 3UMFA 3OZIA 2IOYA 2AFIE 3AZQA 1M2KA 5KPDA 3KHKA 4LKOA 4YA6A 5IYZA 1JLMA 3AUKA 2IU0A 1J39A 2G5PA 1TM7E 3MUEA 2Y4OA 1IMJA 2J3LA 3U62A 4DMMA 1VIMA 1XXLA 3HB1A 5JC1A 5DYYA 1G21E 2GEFA 3WLAA 1OX6A 5F9FA 4HAZA 3U26A 1G64A 2WM9B 3DMTC 3AIKA 3GY0A 3P26A 1GQQA 2EJTA 3VH4A 1NW5A 3O1JC 5DTQA 4I0WB 1UWCA 1VJ0A 3ASUA 1IIBA 3NB0A 4UNPA 4XTRA 3BMOA 3RIHA 2DU8A 1J9GA 3PB3A 4N3BA 4EFDA 4R69A 4BB5A 5JCOC 4NP6A 1NSTA 3CH4B 4WN9B 3REQA 1YS1X 3SC2A 3NRBA 3MJEA 3LFHA 1T0JB 4HQOA 3IYLW 3RJTA 3H11B 5FV4A 4LZOA 4JL8A 1H2EA 5BNFA 4I8DA 3VR5A 2ET6A 5EIXA 3ZKWA 3DG9A 5ENZA 2PKEA 3S5JA 4JUFA 4X1KA 4G4IA 5JNUA 3KQWA 3MQ2A 1IXYA 5JH7A 3N2LA 3AYXB 4BQSA 5B58C 2PUVA 1DWPA 1PQYA 1Q0SA 1C3XA 2QTLA 4UHHA 5CM9C 3NIDB 4LA4A 1QX3A 1K3UB 1K97A 2AH5A 1NBIA 1JPNA 2BRUA 1PLLA 2CKMA 2Q3BA 3HCCA 3OQJA 2V58A 4W99A 3Q8XB 4I66A 1PNQA 2IPOA 5AFSA 2B8EA 5IJWA 5IULC 2VP6A 3AH8A 4ACBA 3DBLB 1OI2A 1DRUA 4PZPA 1AE1A 3ET5A 1JQDA 1VKJA 2WPNA 5LN1A 3A1UA 3IJEB 2PGAA 3RDPA 2Q7XA 3OIFA 1V16B 4M1YA 2SBTA 5CNJA 4DEVA 4RKRA 1LSUA 3Q12A 3UV7A 1KP2A 5A4KA 3LUCA 4ZWNA 5DLQC 4ZYWA 2MMCA 5HIMA 4Q4AB 3CRRA 2HYIC 1SRQA 4J0IA 1KIFA 2B5VA 3VOAA 4G1CA 1NQOA 1I1HA 3OZBA 1DT5A 5HPYB 3N5CA 3JYOA 5ALJA 5EQJB 1C41A 4HNQA 2HMVA 2QMYA 3COSA 3H6HA 3CLUC 3K6SA 3R0XA 2AF3C 1A9ZA 3JCZA 3B78A 3PPWA 4RVFA 3IEKA 2C7OA 4Y2RA 1D3AA 5ESXA 3CRZA 3CS3A 2B0JA 4BB9A 3FI0A 4K2HA 4LYAA 1HMYA 1DEOA 2CEKA 2WT8A 5B3JA 4W9RA 3QX9A 4Q3NA 1D9XA 3SEQA 3SBDA 2OZKA 3WGKA 4PCUA 3T4PA 4ZC1A 4ALMA 2FEXA 4IFTA 4KP7A 2V3WA 1M0SA 4P4SA 4PRKA 1T5DX 1L4BA 1TVCA 4LOIA 4LTMA 2UUAB 4QJIA 2O2ZA 3V34A 1XD9A 3AP1A 3D6UA 1HA3A 3EYWA 2OORC 4UMEA 2JHPA 1SY7A 3DAPA 3GZTB 3T3EA 4TXJA 1K7SN 3VR4A 4F21A 4PN7A 1MQ9A 1Q19A 1DADA 3ZVLA 3VKHA 2XNHA 3C1TA 2AHRA 3AR5A 5DGXA 4IDDA 1VL2A 5EESA 1BC5A 1LLQA 2EYQA 2BRUC 5KTRA 1TFUA 1GPKA 3VR0A 5JALA 3JQ6A 3NX4A 3KTFA 4A10A 5H9WA 3H0KA 1JDPA 1XQVA 2EX1A 3HYRA 1T4BA 1U7TA 2QN7A 3K53A 3O38A 4HL6A 5DHAA 1XPJA 3SR0A 3ZXUB 3MWDA 3NV7A 5I7AA 4EX6A 5U1PA 3D3NA 2R00C 3IDAA 3VTAA 2PX6A 4UNIA 4WLOA 2R4TA 2R8XA 2BGJA 5F52A 1O0SA 5KAPA 5EN4A 4FQ7A 2VQDA 2H4XA 1Z8HA 2CXXA 4Y1FA 4WADA 1GZ4A 3ENQA 4OJKA 2QD3A 2Q3DA 4ALNA 4OMCA 4FDVA 1NLZA 3AG5A 2RHRA 1X14A 3K72B 1ZNWA 5FRDA 1HKUA 4NS1A 2ISCA 4RD6A 1UJ2A 4K8OA 4EHLA 2OHIA 3OOJA 1X7YB 3QMMA 1Z5PA 4IIJA 3HE3A 5WRFA 2JASA 1VBFA 1VL5A 3KB2A 1F20A 3KSRA 3O4JA 1YRYE 2I7TA 1COWD 2GD1O 4RADA 5DMHA 5LNK1 4DTIA 2DJ5A 2XB4A 2FN9A 3PD7A 3Q7RA 5KINB 3F74A 1H6BA 3EPKA 1BCRA 1KS9A 4K2AA 1KEPA 4V0RA 3TLEA 1UIMA 1XCPA 2C9BA 2H1RA 4UBOA 1QRUA 3N8GA 3SLKA 1X7WB 5E1MA 2PO7A 3STXA 1Q57A 4Q6WA 1JIKA 1VLMA 3RVJA 4BZQA 3FPFA 1DU4A 3BORA 3P0FA 2AHOA 1LVHA 4OI4A 4N9QA 1XLUA 3LLSA 3NEAA 3R3VA 3DS8A 4D97A 4E5DA 2PSFA 2JGLA 2J4FA 1L5WA 3D5TA 3EASA 5HIJA 1FX0B 1AMUA 2OCGA 3KX2A 3UFXA 4BMCA 2V6GA 3BSWA 4AAYA 2CN1A 2FQYA 1DC3A 5CRIA 2ZYDA 5DHQA 4XSGA 3TQTA 4A2PA 4E1BA 2JLRA 5K2OA 1C3JA 1C0KA 1MABA 2AOTB 3JQAB 3BJEA 4FINA 1RM4A 3DE4X 4UMFA 3KQVA 3EDCA 3MGBA 1OBFO 4ERXA 3ICWA 2YJZA 4LAFA 1IN8A 4IEEA 2EEZA 1PG2A 2GBIA 2OHHA 4G6ZA 1FDRA 1FYVA 2JFQA 4GWGA 4UNQA 4UMVA 4D45A 1KFJB 1EK6A 5AW8A 2IVZA 2V0NA 4Q19A 3FKQA 4DIEA 2N0SA 4GBED 4CQMD 1PDVA 1M2GA 1GUDA 1FVHA 1EA7A 1G8SA 3MJRA 4HDKA 1MUUA 4L6IA 4TVSA 3KJQA 2NO1A 1M6VB 3BEDA 3KXPA 4WIAA 4DDUA 3P20A 3F8WA 4BEJA 4PSCA 4BJHB 5JQGF 5L6LB 3WMEA 3A0UA 1NOKA 1X0XA 5JWHA 2W8ZA 3U4DA 3M89A 4CMBA 1YJQA 2RARA 4MIYA 2IKQA 3MF4A 4ZK2A 3FNHA 1KRWA 3BMNB 4LOJA 3FDJA 1F2TB 5KJ6A 1T5HX 3N2KB 3HXLA 2ZXEA 4R8SA 3A6PC 1NE7A 3OOSA 4E2YA 1QQAA 2DMRA 1H8HD 1A69A 1SH7A 3JZFA 1OXMA 1IQRA 3C43A 3HJBA 4NENA 5H68A 4LFCB 2GLUA 1RYMA 2JHGA 4MNTA 4UUMA 1BJKA 3ROMA 5KZMB 2R97A 4KAXA 1F60A 3WIEA 2TECE 4PG4A 4E6PA 1KMCA 4FLFA 1PJBA 2W0SA 1LQUA 1UK8A 3PFGA 3IIEA 2XNCA 4FDUA 5ESWA 2WMDA 3R75A 1QG6A 1IHDA 4FMDB 3GGDA 5FNZA 3VDRA 1RQGA 5KQPA 3ADCA 1Y5LA 4LF7B 5T5QA 1KEWA 4UUNA 1IMOA 3G2LA 3EIXA 2PPLA 3GUZA 4JR2A 4NNJA 4DLWA 8AT1A 4URXR 5AKJA 3UENA 4YGXB 4ZYVA 1U3WA 3VDNB 4L15A 2IYZA 1NP7A 4REMA 1NJGA 4CU2A 3QVKA 1FRZA 2PCLA 5A4DA 3E4DA 4DCCA 5CURA 1HSZA 3OQIA 1V43A 4RV9A 3SJBA 4F1JA 5JXIA 1Y6FA 3DMDA 3GRCA 3D3QA 4I1VA 3ZCQA 3AUJB 3CPEA 2Q6IA 2XOXA 1QKIA 2LRHA 5G0VA 1QYCA 1UOPA 3TBKA 4M8NE 5F73A 3UMCA 3WLNA 2CVZA 3CY6A 3WIVA 2ZRKA 3CKLA 1MBZA 5I6DA 2GM5A 4EHIA 1RJ9A 1W36C 3PE4A 4KDCA 1RZUA 4BLTA 4XR9A 3THYB 3TTYA 1K7CA 1QS0B 1JLRA 1RI3A 2FFRA 4G37A 4R1UA 2QMHA 1N6HA 2FWBA 3FR7A 4ZPXA 3UEOA 3K70C 3KBOA 3P9NA 5DBIA 5BN3B 1O6GA 5BV7A 2AV6A 3QFFA 5E6SA 3GP3A 3KZMA 3E23A 1KJNA 4R3UC 1GO2A 1Z0UA 2HK7A 4YDHB 5FOUA 1WVGA 2QAJA 4DG8A 5JNVA 3LCJA 2GILA 3MMSA 4PX9A 3DEHA 5AJUA 3MAAC 2MYTA 4J7CA 4HLNA 1M7HA 5LBUA 3V2IA 4AQDA 4O4JF 3EULA 4F71A 5JY6A 1P2SA 5DM70 2QMUA 1J24A 1OVGA 3F8SA 4DWJA 1F4PA 4DJ5X 2HSGA 2UUCB 1KI8A 4WXPA 4NOLA 4C6SA 2ZK7A 4M1TA 5TPZD 4OXQA 1E3JA 2D3TA 5HF6A 1MO2A 6AT1A 1U2DC 1HETA 3RWMB 1PUXA 5BYKA 1D6SA 4Z9AA 5B37A 3TUJC 4MQFB 2GO1A 1SA0B 1TM3E 4HQ0A 3YASA 4DR1B 2DT8A 4KPYA 3GFBA 1V41E 3EQ6A 3LMKA 5D3MA 4D41A 1JHZA 1NURA 5FWYB 3IE1A 4UUPA 1ZJJA 3MBOA 1DNPA 1RRKA 2ZIXA 5IW8A 4B84A 1SPXA 4ZRDA 4D3ZA 3HZRA 3MNFA 4GPIB 3NEYA 3T95A 4G2TA 3KOZA 2C04A 2CZGA 2XX3A 3KLPX 4AJ4A 3RVOA 1E64A 3HYNA 5L4SA 1B00A 1B0AA 3NT5A 3VNBA 5L40A 1GAXA 2ZAOA 4RGBA 1QIEA 1I7QB 1OWMA 2VJOA 4OFWA 3U1TA 1WSDA 4WZBA 5CYFA 3BWDD 3QVGB 4JP8A 4XEUA 3TDKA 2NSHA 1E5LA 3MYYA 2R84A 2Y99A 1U90A 4C9BA 2YWDA 1JLHA 4MKGA 3TCKA 4F1WA 4BWYA 5A9SA 3K30A 4C76A 4KQ1A 1JP7A 3FBGA 1LBTA 2P8JA 3PEVA 5ER6A 3TLZA 4X97A 3Q5EA 5IYZF 5BSWA 2HQ1A 2ZWAA 1JDVA 3I01M 3KEFA 4Y1RB 3NATA 1WLSA 1ZCZA 2A0FA 1I01A 2GZDA 2VWQA 4MWBA 3RK1A 1QF9A 2G4VA 1A9XA 4XM2A 4LF6B 1SMKA 3WXBA 1IHUA 1Z6PA 3FIJA 1FQWA 3BG5A 3ESAA 1AUVA 4K0RA 4Z0NA 1IC6A 1JDZA 3WIBA 5ELLA 5EEHA 2BM1A 3R8XA 4CKWB 3RUEA 3NWOA 4CIYA 3A1FA 3O8LA 3PHGA 3O8OA 4R0VA 1ZJWA 3E9NA 3SYLA 4XM0A 4JBGA 3QHPA 2YV1A 3AONB 2I2CA 4TMWA 1XTBA 3T5CA 1MPTA 2JHFA 1RTKA 2G8LA 2WNSA 4WNCA 5JSZB 4WXMA 4AY3A 4CFYA 1PO7A 3IAEA 4CWAA 2J41A 3OD5A 1ZOIA 3E8SA 1ENYA 2P3SA 4ILEA 3IHTA 4TXMA 2GEKA 1L5NA 2FOLA 2RBGA 1RE0A 3FCEA 4P8RA 1I4TD 3WG9A 4S1TA 4EMTA 3F3MA 2B7BA 4MW7A 4PBRA 4WERA 1JLKA 4RQUA 1NVXQ 3SX2A 4BCDA 2X13A 3LX6A 1GGNA 3NBMA 2PZEA 1N2CB 4JU8A 5E0KB 4N0DA 3V8RA 5I3CA 1GPLA 1YRBA 3TIVA 4WZZA 5BWMA 5I9LA 1U4NA 4C6TA 2R00A 4YV0A 2AG8A 2UDPA 4YMGA 1IWPB 2W2QA 2ASEA 3ELBA 2CXHA 5T6BA 4AS2A 1YR3A 3D4LA 2EKQA 5FOXA 1XA4A 3L4JA 1S7GA 2C4MA 2BGMA 1H2WA 1PZFA 2OO5C 1TT5B 3ELUA 2B92A 2WG2A 1RM3A 1GUAA 1ZAKA 3IE0A 4OVKA 2OTCA 2WEKA 3FCYA 3K32A 4Q0MA 4EHBA 4ZALA 1ZM2A 3MTAA 1Y1QA 4Z4IA 1Z22A 2GRAA 1PNRA 3CR8A 5CIWA 1E3WA 1KIAA 2FSUA 3PXAA 4FK8A 4KU4A 3RR2A 1WQ1R 2A9VA 3O9MA 4YO7A 4ZZ3A 1GT6A 2ZRNA 1Z2NX 3JQ8B 1KFCB 1L5RA 1PFWA 4H7EA 4RSRA 3DAFA 3I8OA 2B4YA 3AVUA 1B74A 2FZVA 1U3UA 1Z73A 1ESEA 1IONA 4R2HA 1MB3A 3ASZA 2B9EA 1BNCA 5BORA 1DS6A 2Q3EA 2QR2A 1Z4JA 3FPHA 1OBHA 1L5FA 2XUKA 4U9UA 3VVMA 2GUWA 2AD5A 4XWKA 1Z2CA 2FPWA 1TQ6A 2NV0A 1GPUA 1XZQA 2CUKA 3ENWA 4BAGA 2EGUA 3UJNA 1X7GA 2QWXA 1JJVA 3FHOA 1OB2A 3K05A 1E3IA 5E38A 3MWFA 5EMNA 1DIHA 5TE9A 1LRLA 1TTPB 3WHLA 2ID4A 4IJQA 1PEYA 1XRMA 2ZJ2A 2QROA 3LJKA 3MXTA 3QNUA 4E5NA 2IRWA 1XDSA 3D3EA 3H13A 4DLYA 4C4OA 2WYWA 4F3KA 4KXVA 3FKSD 2Y68A 2IPLA 1T9HA 4B5KA 3NLLA 4M1OA 4P86A 5D6OA 1SOWA 1KORA 3OD1A 2VHJA 1IUPA 4G1BA 4RL4A 5ALHA 1L4FA 1AGPA 4B6OA 4BZXA 3AL2A 4E4TA 4EBBA 1C7ZA 2C58A 1NN3A 1GDDA 2NZUG 1QJCA 1EBUA 4YAEA 3D64A 2Q07A 4O4JA 4TUYB 5ALEA 5AM4A 2C7VA 2J0SA 3HK2A 2XADA 1KDYA 4BFLA 4QFDA 1P2DA 2ZRGA 2E4XA 1GAEO 5C7YA 1MOZA 1ISHA 2QTTA 1KJ9A 2I54A 2XUAA 5KWSA 4B34A 4JBIA 4QJ3A 4DKXA 3IOEA 5DULA 2XZDA 4UD6A 4G26A 2DVMA 3EDOA 2QGFA 4IDQA 2GMWA 4Y1EA 1D6JA 1RADA 2AW3A 2HA5A 3HCDA 4I50B 3RFUA 5L7TA 3I0ZA 4MLPA 4QRHA 3MJDA 3WLSA 3PV0A 2EX0A 4QDUA 5A2GA 4KBYA 4QUBA 5FEUA 4YMUA 2FEKA 4RE5A 1U98A 1MQ8B 3I1IA 4Z2YA 5DU2A 4ZIRB 1UMBB 2G09A 2OCKA 2XB9A 3ZQUA 3PFBA 4BE9A 2NW6A 2PMBA 3R5FA 1H1DA 3MUNA 3UG6A 2FSPA 1QKJA 4MQFA 1GJRA 4O5OA 5FOVA 3SYTA 3VVBA 3R3JA 2JI6A 2R48A 3IA2A 3LPDA 3NHFA 1LBIA 1R0SA 4JA2A 1GZHB 2ZAIA 3T38A 4ZZIA 1GCGA 4D42A 4P93A 3PFFA 3KOWA 2W58A 2VAWA 4UAGA 2HLPA 3NHJA 4HYTA 2WJ6A 3MINA 1STOA 4KYIB 3IT2A 3DP7A 4KI7A 4A6DA 2P1RA 5F78A 2ZQYA 1JJIA 1XMSA 2ODQA 3GPBA 4L0CA 1LVGA 4DHWA 5AQ1A 5J47A 3RS7A 1MOPA 1BX3A 2E2WA 4P4LA 4HWGA 1JB9A 5AW5A 4EVSA 4LISA 1KPIA 5FBVB 5SYNA 1G7CA 4DLRA 5FBHA 2GJ4A 4YR9A 2VRNA 1QFSA 3GAFA 4BY9E 3QIVA 2P2LA 3HCNA 2GYUA 2WYVA 4O4HA 4RV5A 4ZOLF 1IIRA 2F62A 4QUDA 2QU7A 1GGKA 1H8HA 1G6OA 1WVMA 3AY6A 3ED5A 4KAFA 2DY1A 4GYKA 3CH5A 2CBZA 3HP4A 4TYQA 3WK7A 4A36A 1DIGA 5K0ZA 4Q05A 2P69A 4YJ3B 1XK6A 1GUYA 1VFPA 5AI6A 1LW7A 5E95A 3OKAA 3VHRA 2XMCA 5IANA 1HC7A 3A2KA 4U2BA 5TGTA 1ZIPA 1BJRE 4Q37A 4TWIA 4ASUA 5JYCA 3GROA 2HF8A 3O90A 1KJQA 1RAHA 1T6NA 5CDSA 1G4HA 4M89A 3MOSA 2HWYA 3ZCVA 1SG0A 3GBSA 4FBGA 4X6XA 1Z7WA 1S1MA 4DQKA 5IF9A 4G5QA 4HPWA 1VB3A 1KY3A 4LF8B 1XOIA 1KMIY 3CYFA 3X44A 1GKIA 4K8RB 1VFNA 1JTVA 4M83A 4QIHA 5DI3A 5FKJA 4BB0A 3WAJA 4EARA 1C9DB 3PL5A 4B3BA 3ND5A 4NR0A 2PLFA 3ONVA 4L5YA 4JX9A 5DM0A 5C8VA 5JCPA 5KPJA 1VLHA 1KWGA 3NHSA 2XGJA 2VHTA 5K0EA 2AR7A 3PI7A 4G85A 5EHNA 4DIFA 3FN4A 1R5OA 2FAXA 1QYVA 4JC0A 2ZI5A 4MV7A 2GBCA 4V3CA 5U4XA 1FSGA 3T52A 4U4AA 2PS3A 5FWDA 3DL4A 3MS4A 1N7GA 2OZLB 3S6JA 4U7GA 4DW8A 1EDZA 5IASA 1KVRA 5K3SA 2OR3A 1GQOA 4OHXA 4CMEA 2HD4A 3JQFC 2WF5A 4KMMA 4HH1A 4MEJA 3EG5A 1X0VA 2PMCA 4HYEA 4B6EA 5HIIA 4DANA 2XTNA 3GA5A 1LFAA 3BMXA 4GW3A 3T5PA 1RYFA 2C4WA 2LUOA 1I0LA 2OCLA 3DNPA 3CC8A 2VEOA 1I6KA 1PHPA 2Q27A 1U31A 1Y6RA 1ML4A 1Z29A 1HFWA 2Z0MA 3EUEA 4RJKA 2O23A 5CNIA 2BMEA 4F5ZA 3CNOA 2QUBA 1G2IA 1I14A 3PRHA 4UFOA 1T91A 3MSXA 5F5NA 3VMMA 4GOXA 1ZIYA 5EA2A 1Y4ZA 4RM2A 4DDHA 1N6KA 2ZR7A 3AEKA 4W5JA 1PEAA 4OM8A 4ER7A 1FFAA 3HU5A 4M0LA 1AV7A 2QTAA 1L3IA 4MQ6A 4Q16A 4Y6LA 5COBA 3T1QA 3VO2A 1NYRA 4BNZA 1CE8B 1OH7A 4LJ4A 1A9RA 1BRMA 5DYIA 3T9AA 4GRIA 4ZV4A 1KKMA 3GUUA 4NOJA 4JBYA 2I2FA 1E2DA 2IHUA 4H0NA 4NOMA 2J07A 1GZUA 2EW2A 3OT1A 3VI4B 4E4YA 2E5LB 1V25A 5A2QA 3RFVA 3FYDA 1G21A 5F2OA 1V35A 2P78A 4KPFC 2XGGA 4YRAA 2QDKA 3WO1A 1CUFA 4NXNB 4F93B 4I7EA 2GNAA 2P27A 1ISFA 3BWYA 3EXG1 4RH0A 1ISMA 4AJ9A 4EO7A 5K4GA 5HKKD 2XZOA 4BDSA 2P7IA 2Q5FA 3OJCA 3VR6D 2ADFA 4O4LF 4CMCA 2C8KA 3MMXA 5BNTA 3WLKX 5G0UA 2BW0A 3BZUA 1YZHA 1J33A 2A9JA 3EOAI 2ZUWA 4XFKA 1T26A 4FGZA 5HS6A 4CHTA 1TKRA 1NXTA 1N2BA 2OGUA 4E30A 3DCIA 1LS1A 3BRQA 1JRLA 1YVPA 5CGQB 1U1EA 1Q14A 1U1DA 5BUQA 1OAKA 2QVXX 1ZMXA 3IODA 3V9PA 5CFNA 3RI3A 4LF4B 1E79A 1WHSA 4DA0A 4PAWA 3VR4D 2HFKA 3RC9A 1Q1EA 3AUXA 3A11A 4HAVA 4N39A 4IHKA 4CI0B 2CLOB 3SF8A 2FPPA 5HF9A 4BO9A 2IA5A 5JSKA 1G8AA 2F8LA 1YBVA 2OUKA 1RHJA 1UJ6A 3CJTA 3IT1A 3P4UA 1GOTA 4IOLA 1V11B 2NUPB 3GJ7A 4G67A 5DTIA 5IAKA 2C4VA 1KR5A 3IDFA 3JSXA 3LUJA 2O3RA 3UH1A 2MYPA 3ND9A 1T0UA 3MRVA 4R2IA 5SY9A 1FZQA 1G6KA 1Y1LA 3MPOA 1BKYA 1CERA 1SU6A 3A4MA 2XR1A 3I12A 4NK4A 4OATA 5IJAA 3V7WA 4ML3A 1EPUA 1WCWA 1K75A 3ZYCA 1U8YA 1WXQA 3EVAA 1VP3A 3QFCA 3CBGA 4FEYA 1ZW1A 4ZOEA 1OMOA 2Q3MA 3RAJA 4RD0A 3ZWAA 2XXBA 4BV3A 2C4KA 3MWDB 2JGRA 4ZHQB 2NM0A 2ZJ6A 1F2VA 3IBTA 3AINA 3HLTA 4OQZA 1QGUB 3NUZA 1PU2A 1EUCA 2ZYSA 4TS9A 4X8OA 2CHEA 1MJ5A 3KDSE 1Q1AA 1Q0UA 1XT6A 4ZDJA 2HRBA 1OA0A 3JQ9C 3O47A 4YUAA 1AQIA 2PCJA 3DWEX 3U7FB 3PIIA 3G8BA 1E3SA 2VPXA 2Q50A 2WA2A 2X2FA 4CR6A 3OURA 1NVVR 2AKEA 1RXWA 3TQQA 4MDHA 2KM1A 2ZSEA 2GCNA 1L4NA 5T4EA 4RA9B 4O33A 2GN9A 4X60A 3WE7A 6LDHA 4P3KA 4MUXA 1A4UA 1J56A 2QUAA 1THMA 4BKOA 1K6JA 2QVBA 3DBLA 5LZ2A 3HPRA 1AG9A 3CF6R 3W2IA 2DR2A 1OASA 3WBJA 4POAA 3OQBA 3VRHA 1UK9A 4RANA 4XE5A 1EFVB 1XVVA 5EXEA 1XNRB 2FZWA 1EGMB 2FPIB 3CF0A 4NU0A 2Y9MB 4BQEA 5AI5A 1R0WA 2RC6A 3PTAA 3U3DA 1JF8A 1S3FA 3E3LA 3MWEA 1L4LA 1BE0A 1H1TA 2VUTA 3OZGA 3PCXA 3TW4A 3WGMA 4E1VA 3TUIC 4NBTA 2XQVA 1YONA 2HSWA 5SV2A 3G0HA 1E3LA 4TZ6A 3RTCA 4WZAE 5HKLA 2J6CA 1GZ5A 1RRFA 1TAHA 2JI7A 4TQGA 3PE3A 4JI4B 1Q16A 2FK7A 2HQBA 4FU0A 1YDEA 3C6YA 5A02A 3EPRA 3BKXA 4OKSA 3BCRA 3QWAA 5AVWA 4YRGA 1P72A 4BJ1A 1CYEA 3HR4A 1QIHA 2IU3A 5GOZA 4U39A 5CXSA 5TGDA 1JT9A 3UZUA 2W6ZA 1RXYA 5EZSA 1L4HA 4MXDA 3G0DA 1U0HC 2PIDA 4FFPA 2FA9A 1X9HA 3RVRA 3N0WA 4XVUA 1KXZA 1ZRNA 1S96A 2ODNA 5LR6A 4F3TA 5CM8B 1ZOPA 4G56A 2A35A 3MUOA 1PTJC 2BSAA 2YFKA 2EJVA 4RTQA 3O94A 1NP6A 4ER5A 2CLFB 4OKNA 2IYXA 2XRMA 4MRSA 1SGWA 4RMGA 4M0EA 5CCXA 3D5QA