5F12A

Wrba in complex with fmn under crystallization conditions of wrba-fmn-bq structure (4yqe)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
193
Chain Sequence
AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P)H dehydrogenase (quinone)
publication title Quantum Calculations Indicate Effective Electron Transfer between FMN and Benzoquinone in a New Crystal Structure of Escherichia coli WrbA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Oxidoreductase
total genus 68
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2015-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f12A00
1YCGA 2V5VA 4YAUA 4F8YA 3GFQA 2Z9DA 3EDOA 4Y7CA 5FUQA 2Z9BA 4CF6A 1E5DA 3B6JA 4NULA 4PU0A 2BZSA 3G5MA 3KAPA 2ZKIA 3U7IA 2W5UA 5NLLA 3OJXA 3TEMA 1D03A 3FNIA 2MWMA 1AG9A 3O73A 2M6SA 1OBVA 2HNAA 3OJWA 4ZVKA 4BMPB 1J8QA 1D04A 2MT9A 5EA2A 3LCMA 1RLJA 4FGLA 2D5IA 5F4BA 3N39C 3L9WA 2OHIA 1CZKA 4PTYA 3S2YA 4H2DA 4M0CA 1AMOA 2BN4A 4Y9RA 2MTBA 3QFCA 4GI5A 1FLAA 1FLNA 6NULA 3TZBA 1NNI1 4DY4A 2Z98A 2Z9CA 2Q62A 4LTNA 1WSWA 2F1OA 4NLLA 2V5UA 5FA6A 3B6MA 3NHWA 4LTMA 3OWXA 1JA1A 3OVMA 1CZLA 1CZNA 5LVAA 5BUCA 3OX3A 1DXQA 4QOIA 2HPVA 3NHUA 1KBQA 3B6IA 1T0IA 4LA4A 3QFRA 2BMVA 5LMCA 1VMEA 3GFRA 4D02A 1RCFA 1TLLA 3UXHA 1QBGA 3HR4A 3KLBA 2A5LA 2QWXA 4N65A 2B3DA 4U7GA 1CZRA 2BF4A 1BU5A 1QRDA 1YOBA 5A4KA 1D4AA 3NHRA 1FX1A 4LAFA 2Q9UA 4DIKA 4ESEA 1AKVA 3RPEA 3W78A 1YRHA 1B1CA 4R81A 2HNBA 3L9XA 1WSBA 4S24A 4BMOB 3K1YA 1YCHA 2X2OA 2QX9A 3NHLA 3ES9A 1X77A 1AKQA 2R97A 3D7NA 3OWHA 5LBTA 2QX6A 5F12A 4YAWA 3U7RA 2QMYA 4C0XA 1FLVA 3F6SA 1C7FA 4PTZA 4YQEA 3W79A 5TGZA 3EYWA 3NHPA 3SVLA 2QR2A 3TE7A 2FVXA 1T5BA 4QOGA 2FAXA 2MOKA 3P0RA 1J9EA 1RTTA 2KLBA 4QOEA 2OYSA 3FVWA 1FTGA 2OHHA 2WC1A 3W77A 2V9CA 5ULLA 1AKTA 3QE2A 3B6KA 3GAMA 4C0WA 3ESXA 3N3BC 1YDGA 4YALA 3NHFA 2KQUA 1J9GA 2BPOA 4LTDA 4QOJA 1AZLA 5FX2A 2FZ5A 3UXEA 1H69A 1OBOA 1FVXA 1CZUA 2FOXA 4XDGA 5NULA 2X2PA 2QX8A 1DXOA 1RLIA 1FLDA 1FUEA 1BVYF 1KBOA 1YCFA 1I1OA 3NLLA 4QOHA 5LJIA 5JROA 2XOEA 2FLVA 3K20A 5LBUA 4GR9A 3R6WA 4YAOA 2OHJA 1ZWKA 4FX2A 1C7EA 1XI2A 4QODA 2GSWA 4ICIA 1CZHA 4GQIA 5LJLA 4J8PA 1SQSA 2FDXA 2QMZA 4U7FA 4C14A 3NHKA 4CETA 1F4PA 4FGJA 3KAQA 4QOFA 1XT6A 4ZVMA 3ESZA 1SG0A 5LLDA 1AKUA 1ZWLA 1XYYA 1AHNA 4HEQA 5B3LA 4U7HA 5F51A 1ZX1A 2RG1A 3F2VA 3LT5A 4HS4A 1OFVA 4ZVLA 2M6RA 3FX2A 2FZVA 3JSXA 4N9QA 3HLYA 2R96A 3FW1A 4XDHA 5EAIA 3ESYA 4YAFA 2XODA 3GFSA 3FJOA 3NFRA 3KEGA 4H6PA 3F6RA 2ARKA 1AKRA 1H66A 3O2NA 2FCRA 3NHSA 1CZOA 1XYVA 4N82A 4C76A 2N1MA 2QX4A 4OXXA 3OX1A 4FGKA 3NHJA 2FX2A 2AMJA 4ZVNA 1GG5A 1YKGA 3OX2A 5EMNA 1V4BA 3HA2A 1QR2A 1JA0A 1TIKA 3NHYA 1J9ZA 3N3AC 1DX9A 5B3KA 3W7AA 4Y9UA 1AKWA 3F90A 3ZHOA 1QHEA 4DILA
chains in the Genus database with same CATH superfamily
2H5EA 2W0SA 2PGAA 4NR0A 2AVDA 5JVDA 5JY1A 5JJIA 3GZNA 5EIBC 3RQIA 2DH6A 3KBBA 4V0SA 4Z0NA 4KI0A 4EYKA 2UU9B 2NZVG 4BNKA 1Q5PA 4HPWA 1JXMA 5KKCA 3W4JA 4B7AA 3VUFA 3UGJA 4R2KA 2BP7B 4IIFA 5F3WB 1OX4B 4K9LA 2R0QC 4QQRA 3PUIA 2M2IA 5T67A 4TMKA 4K2AA 1MC8A 4X00A 1BNCA 4WK2B 2R2GA 2CXHA 2PSHA 2ZBFA 3C1OA 5IUKC 3B38A 1U8FO 4CQLA 4IIBA 5HBRA 5A04A 5JS1A 3C87A 3NYQA 3EXAA 2YWDA 1EHIA 2QOEA 4Q4JA 1YO6A 2Z08A 1Z6GA 1RXCA 2H07A 1NRWA 1SU8A 2OZEA 3OT5A 5AVZA 4EB6A 4NVRA 3AHHA 1Z6XA 3AU8A 3E84A 2MWMA 3RLFA 2E4ZA 1MC5A 2ORYA 5DCUA 2IWHA 2WNIA 3G23A 4CDMA 5B6IA 3IAEA 3O73A 4JJZA 3N53A 3W5DA 2E4YA 3LQ1A 4J0QA 2ZAOA 4LJ7A 5HQ3B 4MVYA 1XLUA 3IAS1 1JDNA 3M9WA 2PV0A 3FXAA 5E1OA 5KQSA 4GOJA 1MX5A 3GRVA 1SCNE 3Q3IA 1P60A 4KDCA 4YHHB 1MHTA 1JLRA 2CJYA 3L6EA 4P0QB 4OIMA 3E7FA 1YZNA 3P2MA 5TQ2A 3EBPA 1KPIA 4EBBA 1QZXA 5AM2A 1RHUA 1W1UA 4FHZA 2W6PA 1XLVA 2WWFA 5I8WA 2H1WA 3T3NA 1RLJA 1GPAA 3A6GA 2PWAA 4RABA 4S1VA 1KZYC 5AICA 5BRJA 5C37A 4EMBA 5DP2A 1RI3A 5EMHA 4JJFA 3NHZA 4KN5A 4O1HA 1E20A 2AEMA 4FFBA 4H18A 3ZU5A 4OTZA 5CNMA 4RFSB 4DCMA 3NTRA 4PTYA 1AUXA 3B70A 1ITZA 2PKQO 1UMBA 3CEMA 4GPTA 2LD4A 5TE9A 4U9UA 4BU1A 3O4HA 2ZGVA 4JXKA 1SOWA 2C2XA 2YASA 3EIUA 4QLBA 1QSGA 4MUFA 4CGZA 1HYBA 4FBLA 4LKRA 2P6NA 3RNOA 1B23P 3DXFA 1B0ZA 3JVUA 1K1EA 5JAQA 3U7QB 1PLKA 6REQB 3WHKA 4F06A 5MDHA 1SHUX 4YV0A 4NZYA 1L2TA 2R79A 3RRZA 4EELA 2FE4A 3OFND 3K73O 5I5GA 4WOBA 4GQBA 3QE0A 2HLHA 4JBGA 3C8HA 2P9BA 3BWCA 5U4XA 3A4MA 2XTAA 3TRIA 1NXOA 4QG7A 3HDJA 5K0JA 1ECJA 3DDUA 2CUTA 3KL2A 1QJ4A 1L4EA 3NVDA 3OCVA 1WKBA 2ZU6A 1VSQA 3ZY5A 5A9SA 3S1SA 2AQIA 4LUCA 1JHDA 4PC3A 4Q9JA 2ZVJA 4CHGA 2QY6A 4ARCA 2XLCA 1M1YB 4J7CA 4QUIA 4MI6A 2MINA 4RKQA 4X44A 1IVSA 4ER0A 4DR2B 5IXJA 3ZKWA 1X7ZA 4UZSA 2CFRA 4NMHA 4URUR 2PU7A 2HZBA 4Y9SA 1Z25A 1AQ6A 2H11A 5K5EA 1MO2A 1TJNA 3FOBA 2CL0X 4FCVA 1VMIA 3ESRA 4RHUA 5AJHA 4ER5A 2II6A 1L4LA 3KZXA 2FR1A 5ITVA 3TQIA 4WA7A 5JI2E 3NUZA 4Q21A 1FSFA 4RKFA 1JEOA 4OQ4A 3RKRA 1D2NA 2VOJA 2MIIA 3HZZA 3C7KA 4F12A 2XVZA 3JQEA 5F3DA 3ZDYB 4MR9A 1WOMA 1YTLA 4X1OA 3QVJA 3MTJA 3F46A 4YXWA 4UAGA 5MGBA 4JX9A 2VT7A 1DOAA 1ST3A 3LP5A 5EVJA 1N6LA 5EHQA 3URKA 4DCVA 1YQEA 1M34B 4JUFA 5DNWA 2ZTMA 3T0FA 3A6FA 5IVPA 3FOWA 4J49A 4WV3A 3SE7A 2HYIC 5D00A 2P2LA 3T6KA 5KQLA 4LHEA 4C0JA 3D3QA 3KS9A 5IAOA 1N8SA 2ZS7A 1DBPA 4MUYA 5CH8A 3L8FA 4DR4B 3N2IA 2YMMA 5KKAA 2RGEA 4XSGA 1TM5E 4PSAA 4MUXA 4W8HA 3OY2A 3B12A 4MMXB 3T5BA 1LTHR 2Q3CA 3TLKA 4BO3A 3CQ9A 3HH8A 4MV4A 5CBKA 5FBQB 2EKBA 3MT9A 2FKNA 4QL3A 4XVCA 1Q95A 1E5QA 2EX4A 4URXR 3K0BA 1O5OA 3JV7A 3PGVA 3BD6A 5AMXA 1SKAA 5EUQB 5GY7A 3KWMA 4YB8A 1ZW1A 4IIXA 3WO0A 2QRQA 1SULA 2OHVA 4JNCA 3WJ7A 2DXIA 3L49A 4P2GA 2FWIA 1DQRA 1EH5A 3LUAA 1EA7A 4XVRA 4F4FA 1D8TA 1QHXA 1VL5A 2YHIB 3ND8A 4NYMQ 3EVZA 2XDYA 2P2YA 2WIFA 3HKDB 4JJGA 5HRAA 2HBRA 3CWCA 3FIJA 4H1VA 5FNVA 4A9AA 3L06A 1SD1A 2JG3A 1KRHA 1QFSA 3BAZA 4QDKA 4DBZA 2Q1WA 1CUEA 3UY4A 3EW9A 3CVOA 4HRAA 2GN6A 1QUEA 2AFIE 1A8SA 3M3DA 1ZOOA 3WYFA 4RKYA 1XTBA 2DPMA 5D3KA 1ZUIA 2YV2A 4YP1A 1J0CA 2NU8B 1ZGJA 3U37A 5K8JB 5AHKA 1QRUA 3D8NA 3UJ6A 1RPZA 4S1TA 3FMOB 5GOZA 2JK1A 4HH4A 3VDXA 1TM7E 4R1SA 4XI9A 2EBWA 1TZCA 2A9JA 1VCNA 4YRIA 2I9PA 3E6AA 4DR3B 3BH0A 3RO7A 1NSFA 4D8WA 4ZFNA 1WR8A 3L9XA 1B1AA 3BORA 1PS0A 1ZZEA 5EE1A 2OWEA 3S1AA 3OLZA 1DARA 1PK7A 1ESNA 3Q10A 1RMQA 2QUHA 3U4DA 3ZWAA 4I5EA 2BBOA 3NHLA 4L7VA 2OO3A 4KQKA 1FBNA 2PS3A 3HUUA 3LXUX 2PK3A 3HM2A 4P38A 3TI9A 3GJRA 4WJLA 3SC2B 3FI0A 5H5JA 3BL8A 2TMYA 4UHBA 1Q2XA 1GA6A 3OWHA 5DGCA 5K3FB 3HDHA 2PTHA 2HD4A 1HUQA 2PKEA 3L8CA 5A0TA 5JNSA 1PR2A 3T7SA 2BH9A 4W5WA 3V1TC 5A5FA 4J07A 4IGEA 4FB5A 2W6ZA 2H16A 2QSZA 5H59A 5KOHA 5C7IO 3ORSA 1ZLYA 1THMA 1JRLA 4GE0A 4MUEA 1ODTC 2ODEA 2IY7A 1DC5A 3O9VA 3CEAA 4ME6A 2EXXA 1E5XA 1S8AA 2O52A 1XO1A 3SVLA 4YYEA 4X3CA 1TAGA 1K2VN 5EESA 4UEQA 3WVNA 1H2BA 5FDFA 4J90A 1PZMA 4JSRA 1FYDA 4RMJA 2PS0A 3MBIA 3QBEA 5SYAA 2PG3A 1R8SA 1JX6A 3RI3A 4B4UA 4OKSA 4EMUA 4W63A 3B3FA 1TM2A 4MLCA 1JG7A 4OB8A 5C5CA 2QW0X 3LOPA 3N0RA 4JL6A 1VP9A 2W70A 4QT0A 4MI3A 1AZWA 4XARA 1A96A 4PXSA 2IS2A 5HEKA 2FG7C 4EW2A 3HO1A 2Q1UA 2H48A 3ZCXA 5CJ2A 4RD2A 4M6WB 3BB4A 1KKLA 1U2GA 3RREA 4FMDB 2VPYA 4CFZA 4EOGA 4NCHA 5JW6A 3MOSA 1JDUA 1RCUA 2XBUA 3DCJA 4PX3A 1ZD4A 1I0ZA 4C30A 1FJXA 2V9CA 3OBBA 4Q3BA 3LUFA 3U2QA 1E3WA 4HLNA 3WP1B 3EXFB 2D7JA 2EZUA 3KG2A 1JFSA 4D9KA 2C9ZA 3SOPA 2CMHA 3KJEA 1IOLA 2D4HA 4BLOA 1ODJA 4KN6A 3PVSA 3S2EA 3DV2A 4BYMA 2BKLA 2E4XA 1VFPA 2W2TA 3PENA 4G3XA 4PLZA 2OYCA 1F38A 1N2OA 1PJBA 4IDGA 3LUCA 3RH0A 4YMLA 3E9QA 1J9GA 4CNBA 1DG1G 1C8LA 3EDQA 2O2EA 3HFSA 4N0QA 4PN3A 3H4TA 2ZJ0A 4DLKA 3H75A 3A4VA 4M0UA 1DX6A 1YR6A 4ZYUA 3PEYA 3WXMA 1EZZA 3AOEA 4G8CA 2PAAA 3ZYZA 2AOTA 4EJ0A 3I53A 4DMLA 4B44A 2OCKA 3H04A 3IRUA 2C3YA 1T1JA 4AQ7A 3TZHA 1NNUA 4F93B 2OFPA 2QX8A 1TM1E 4JVNA 4LBYA 3ZVKA 2ZB2A 4C4ZA 1XEFA 4FD2A 4MIKA 1YB1A 3QUAA 1GT91 1CERA 1KAGA 1KO5A 3ZCQA 4BGEA 1GUDA 4RF5A 2GZAA 5K1ZA 5H02A 1Q7BA 2AN5A 4DE5A 4TYNA 4KQ6A 3A6EA 2PMWB 1R88A 3TL2A 5CDFE 1U80A 2QQFA 2X86A 2HWUA 4TPKA 5COBA 2EERA 4DJDC 2P0YA 5HZMA 2QNIA 1GGVA 2YW9A 3QVSA 4CV2A 5A7FA 1QV7A 2F7SA 4XZ3A 1F0YA 1EFTA 3CF4G 5JZMA 1Z4KA 4AJ2A 3DVLA 4QUAA 2WNSA 5KYVA 1EFUA 3IHLA 4QNNA 5ISMA 4MGZR 4YAOA 4QFBA 3JQFC 1MMFB 2I6TA 3BKWA 3HXKA 2UZ0A 2JKYA 2JLUA 1E0JA 1PFKA 4DUGA 4U8HA 3V8RA 3C3AA 4QATA 2HAEA 1X8LA 2ERYA 3CKLA 1A76A 2PUWA 4P4LA 1OIXA 3UT5A 1YJ8A 4L72A 2ATCA 3OQIB 5CFNA 1UT6A 2XECA 2YXBA 3LYAA 5CVDA 5FUWA 1U28C 2R00C 3KOMA 3QLJA 4L9WA 4BNDA 5EJ6A 4BHTA 4TS4A 2HSWA 2P9EA 4CPDA 2N0SA 1I51A 3HGTA 3MXTA 4U2DA 4C5AA 1CHNA 2I7XA 3PYMA 4Q19A 1ABFA 4F3TA 1E7YA 5A6SB 3CX7A 4RHYA 1ZESA 1XTZA 3U81A 3LSYA 4JC8A 4X20A 4NZ9A 1T34A 3S68A 4U2EA 1R8XA 4PQFA 4MPTA 2WINI 5TR9A 1IDOA 1WVIA 3A9TA 3PPXA 2IK8A 3QFSA 4LVCA 2VWHA 4LC1A 1UFOA 2FCAA 4BN0A 3QKSA 4FGJA 4FFMA 2O57A 3JRNA 3I0MA 4IZHA 2FB9A 3WLTA 1ZAYA 2FG5A 3MCAA 3DDHA 3FCEA 1KYWA 4X6UA 5JMPA 4BQFA 5KNCD 1EFDN 5JE8A 2DJIA 4X54A 1N3LA 4PLTA 3C7AA 1LI4A 3DMRA 4DN6A 1XLWA 1F8XA 2W6ID 3OA2A 3RU3A 1OZFA 4E51A 3U13A 4PZDA 1NUUA 2PGJA 4KYUA 4QU8A 5EOVA 1QOZA 5I9TA 2QR3A 1OJLA 1U0GA 3AY0A 1JHUA 3ZDFA 5F51A 1VIMA 3NBZC 4A7PA 3LT4A 2XIJA 1ZM9A 3OY7A 1JJAA 2VZEA 1UXIA 5ICFA 2RG1A 3NG1A 5GQSA 2AJBA 2X6RA 2VP6A 3N2LA 2QXTA 3MPOA 4P3YA 2G4VA 4KACA 4Q48A 5LKRA 3KE8A 2VT3A 1RAFA 2FWJA 2RI1A 4JENA 1OJ7A 2D3WA 2GCOB 3D3KA 2GNOA 3NWJA 3V7WA 2X0IA 3PRKE 5E3IA 9ATCA 3M4XA 3N8NA 3T52A 5KYUB 3PQEA 4OQZA 5AW5A 4DRXB 5JU6A 3MIIA 2XA1A 2XCUA 5JXWA 4F45A 1NF9A 3GQVA 3QWFA 4E11A 2GPTA 2RKOA 2ZB4A 1KI2A 3V4LA 2ZRNA 2XQJA 2ZB8A 4L07A 4LK3A 2YDYA 4WZ6A 4WK6A 2DU8A 4GBGA 1JHRA 3K0FA 4A36A 3BM5A 5LLSA 4DWOA 3OOEA 3O4RA 4LCJA 4RCYA 1P2DA 3WAKA 3DUFB 2OBBA 4J0DA 2P4SA 3BMCA 4H15A 2QJRA 3OQPA 2AUTA 2XMGA 2Q46A 3BWMA 3QKUA 1NI3A 1Z37A 2ZWAA 5K6TA 1XQXA 1Y6GA 4U9IS 4LDZA 1Q6ZA 3M9LA 3H2KA 5ERYA 3Q2KA 5CNKA 3T7AA 1IEWA 4S1OA 2B98A 2FEXA 4C76A 2EJTA 3FKQA 1OI3A 3DKIA 4IJUA 2ZIXB 2FQ1A 1CQJB 1G18A 4FGKA 5LUAA 4GSLA 1GG8A 2J0UB 4HLUA 4M7PA 2D2IA 1DKPA 3A04A 1OLXA 1XCBA 3JAMA 3N8DA 1QPGA 4XB1A 2GNAA 3HCEA 3JAKB 8LDHA 3A05A 5JSZB 2CV2A 3A1CA 3UKJA 1MNAA 4ENUA 2DERA 3DZHA 1XRJA 2BZ1A 3SIXA 4YUYA 1SXQA 5BV8A 2WSSA 1SQ0A 3H3FA 4UHKA 4GKVA 5T8KA 1KEEB 1J20A 3OZGA 2D74A 1KVQA 1ZRNA 3NU1A 4HDAA 1XTJA 4YLYA 4GDMA 5DEIA 1NBAA 3QXXA 4H60A 1R18A 2FH5B 5MN4A 5D3MA 2VJMB 3AP3A 3B36A 4QEKA 2WD7B 4P80A 3FDZA 2YIVX 4RHEA 1OXVA 1TZJA 3SLGA 4BTEA 1PKEA 1TUGA 2DQYA 2E7ZA 4KQEA 1T2CA 3R6DA 3P0FA 5E4JA 2YW2A 2YWCA 3WGOA 4D9MA 1DSSG 2VPQA 3BJIC 3BCRA 3QU2A 5I9MA 4E7OA 1M3SA 1VPDA 5TVGA 1GU1A 4YRTA 3E0QA 3ZIAD 1Z38A 3REQA 2A14A 2ZIWB 5CB8A 3E4CA 3P20A 3PQ4A 5ELXA 1KJYA 2JIOA 3UWSA 4N7RA 4EHFA 3KQUA 3TLGB 4FI3C 1ZUHA 1JZTA 3ROKA 1LH0A 1XCOA 2DUMA 4IHJF 4QXMA 4HYYA 4H4EA 4ROSA 4F8YA 4FYXA 4ERXA 4UHHA 3CLSD 3MCUA 4BUCA 1NXSA 5A3QA 4WACA 3AF0A 4PCAA 1MO5A 3U4CA 5CB4F 5GMOA 4HB3A 1Q6YA 2QT0A 4REMA 4D9GA 2IS4A 1ATIA 1MLDA 2EX0A 3ZEAA 2Z6QA 2QNBA 3AUYA 3U60B 3BX1A 3KCQA 5CYFA 4J03A 4L08A 3M5WA 3CF2A 4L4UA 1BXRB 3O8CA 3MCTA 4G4IA 4KXYA 4Y18A 3U40A 3FYSA 4LRTB 2BKUA 2B0JA 2QR5A 4C4RA 4Q4CA 1CFZA 3NTUA 2VTBB 4NJOA 3RK1A 1V95A 1X7WA 4YEDA 4ZPJA 3R20A 1J8YF 2XXBA 3Q5GA 1IC6A 1QYCA 2D3TA 4GFDA 1TUBA 2JDIA 2M6SA 2Z8ZA 2ZTSA 3CS3A 3A1FA 4URWR 3TOVA 2CLIB 1SIOA 4ZD6A 5AO9A 2VHEA 3MZ0A 4I6GA 2Y1LA 4F7WA 4ARZB 3EPJA 1QIIA 1NJ5A 3IMGA 4FR0A 3HDGA 3AMVA 5HA5A 1J0EA 2B78A 2PVPA 3N59A 1DDGA 1N2ZA 3C85A 1E6KA 3G2OA 1DMRA 1A4UA 1UAGA 1YRQA 1GPH1 4MW4A 3JX9A 3ZDRA 4RTOA 1PYGA 3UFXA 3LD9A 5JASA 1V39A 4LXQA 4NOLA 2P4UA 4H7DA 1KI6B 3ONDA 3DXXA 4ZOEA 4B3SB 4M1KA 4WASA 3AEUB 4UPEA 4AURA 1CZKA 1OCEA 1WSAA 2QXUA 5IXSA 3AGPA 1L1EA 3ZK8A 2V7EA 1MH9A 4EEZA 4LF5B 4YRRA 4FYKA 5FL7D 1ESCA 3NV7A 1ZMTA 2GD0A 1AMOA 3PL5A 3J81A 4P9NA 2OC9A 5FV7A 4DAOA 1PLLA 4HJXA 1BMTA 1G9TA 1ECPA 1Z7EA 3IDOA 4GPEA 3FFTA 3WMGA 4D3YA 3FCAA 2PM8A 2WYIA 5K20A 2VXBA 3F5FA 2YYSA 3IILA 1FLAA 1ZINA 1UPFA 4NSNA 3EA5A 3GMDA 4H7JA 1IG3A 1TLTA 4DLBA 4ER7A 1EAYA 4FOOA 2PH5A 3QKIA 3OC0A 5HR5A 3QEMA 5H81A 3TZBA 3MINA 1J8MF 1HE1C 1R4MA 3RVMA 3ESDA 1BGXT 2NVOA 1OFHA 4B2PA 5IZCA 2V7UA 2JHPA 1Z2PX 4GMKA 3UHJA 3VH3A 4NICA 3WGLA 1MNQA 4TQUS 1OXKB 2IEDA 4LTNA 5A1TA 4RVCA 4WERA 3SPXA 4X1IB 2VJDA 4A0HA 1OREA 3UGQA 4UC0A 3SQNA 1AD2A 1Z29A 2I3DA 4NLLA 4CM4A 2IELA 1M7BA 2M1XA 5JCJD 1WPXA 4BFZA 1JYFA 3AEXA 2F55A 2NO4A 3RSFA 3NHWA 3A4IA 1Z6YA 4AI6A 4AUMA 2XQGA 4PYKA 3KKZA 4FSDA 4F96A 2ZRDA 5BYAA 1Y8RB 3BGDA 2A0UA 3BZBA 3K3PA 3CM0A 3L1JA 2IX3A 2WJWA 2GKOA 5LZ9A 3ANXA 1JLLB 3ROMA 5BW5A 3WRWA 3NMUF 2RHWA 1XJWA 1EWYA 5CDFA 1RRGA 4EHDA 4ZT7A 3SJCA 4AQYB 4QLAA 1RVV1 4H0CA 3SR4A 1YONA 3DP7A 1RJWA 4IDNA 4V03A 1PVOA 3OQVA 2EZTA 3NEAA 3T4XA 2O0HA 4B3BA 3CT4A 4D6PA 1JJVA 4HV4A 2IEYA 1ECGA 4D9NA 4Q3EA 3VVLA 4R2HA 5L4NA 1SOAA 2XYVA 3GPBA 1WPGA 1YT5A 4HAZA 2WT8A 2D1QA 3DOOA 3F1KA 2O06A 2P90A 4I55A 1PR9A 3BD7A 1QTRA 3PHBE 3O8QA 4MKXA 2WU4A 1PNVA 2ECKA 3ROTA 1SBQA 4BLWA 5HDQA 4RJ2A 4TTVA 5FR2A 2BR5A 2JBHA 1I3CA 3NBYC 1NM5A 1VXOA 3R2JA 4P83A 3W3AD 3SI7A 3T54A 1CC1S 2FR8C 2DR0A 5DYYA 2YOHA 3IIEA 3W8DA 1P8AA 4R1OA 5I7FA 3BDAA 2F3UA 3F7TA 3AVPA 4BO5A 3DEYX 3J7TA 4UEWA 3AL3A 3LKVA 1OXSC 4QA9A 3PX7A 4XSHA 2AW3A 2DFDA 1VGVA 1KH2A 2QAGB 2BGNA 1RRFA 2NU7B 1Y1KE 1V11A 3U1VA 2PZKA 2B35A 4HMPA 1FFEA 1MX1A 1LS1A 3IUNA 1PT6A 3B48A 1SA0A 4E4TA 2F1RA 2YVLA 1BWSA 4DC1A 1YBFA 2CNOA 2Q5QA 1E2PA 1XRPA 2PBFA 2P9TA 4ZTUB 4Q82A 1FS4A 3U49A 4LFBB 2RB4A 5D01A 2Y0CA 5JYCA 4JR2A 1PN3A 4OH1A 3V1LA 1BDHA 4Y30A 4TROA 1AHHA 3A1WA 4LAFA 3QFFA 4A0FA 3K96A 4YRQA 3RNLA 1RABA 5JJBA 3OPXA 4YPFA 1PZEA 1YIOA 4CM8A 4EIWA 2REQA 3MD9A 3T3GA 5A2GA 4KITB 2E5FA 4YI3A 1W36B 2WQ6A 5LWHA 3LHIA 1CUYA 2A78A 1EEXB 4KRFA 4S24A 1JDTA 4NOJA 5F52A 3W4IA 1I5OA 2R751 2EGGA 2VLBA 3Q7RA 2I3AA 2XWSA 2Z58A 4ZQIA 2AD1A 2AMLA 4NWIA 3C39A 2HO4A 1VJCA 3ADCA 4D82A 1YJXA 2RHHA 5K0BA 3DL0A 3UYKA 4OA5A 1SOUA 3DNFA 2CFSA 2C7GA 1W94A 1PVDA 4R7ZA 4K7JA 4PGGA 2XYQA 3PCTA 1O4WA 4IXMA 1P62B 3FWKA 3IYLW 2CN1A 3OWOA 8MHTA 3V8MA 1NMYA 1Z68A 3UM9A 5TS3A 5BVHB 1FE8A 4YAWA 1YRWA 4E94A 1P7VA 2QMYA 1QIFA 2Q28A 5FHRA 1IEQA 4Q4DA 4PLFA 4D4IA 3KEMA 4OM7A 1J5PA 3PHIA 3OU2A 3THYB 4XIJA 4H27A 2XNHA 4GVXA 2YRFA 4YQEA 3W79A 4URFA 1PYDA 4AIRA 2X5OA 2CLKB 4FFPA 5FPQA 1YVPA 2RGUA 5H68A 5L7YA 3IALA 5J23A 4KNVA 3DCNA 3ZWXA 2CBGA 3TVYA 5F5XA 5CM8B 3V7UA 4EITA 3CLRD 3NR2A 2GDZA 4RZ3A 2ZWIA 3FDJA 4GEGA 5AKYA 4AECA 2DQ4A 2WPNA 1YB5A 3KOYA 2EW8A 4PS1A 2QV0A 4NY1A 3U4HA 5M7EA 4CMAA 3T9AA 4OLAA 3GEMA 4PV7A 1XTTA 3DE1X 4QG3A 3OIGA 1KFEB 2OD7A 4M4SA 3V4SA 3UT6A 2EIHA 4HUTA 5HPYB 1UPUA 3ICEA 1J9EA 4PVDA 5BN4A 4YMHA 2J32A 3DMTA 3EC2A 2HW8A 1DFGA 4G2NA 4G0VA 3GP3A 4JSYA 1QHGA 1GUBA 3GDWA 4KTTE 1V1JA 5IJ9A 2EJWA 2C4TA 4MARA 4XFDA 3AF6A 1AGRA 2CXXA 3THOA 4KGZA 2LWIA 1N5RA 1C8VB 5EYPA 4XUGB 2VF7A 4Y67A 5AOCA 3EUWA 4Q6BA 1VL2A 3AP2A 3I1IA 1GDHA 1XRQA 1V9CA 2YV1A 2POCA 3FH0A 3HCAA 5DYGA 5IC6A 4EG7A 5K0EA 1ECCA 2BFFB 3F7NA 2YWBA 3ND5A 4MINA 4PX2A 3FBTA 4IEIA 1HFKA 3D3WB 1Z3CA 3UO8B 3ZE9A 1GGKA 1T0HB 4MCHA 3OLVA 3R3WA 3R77A 3H5LA 4HDRA 1QF6A 3O26A 4KXLA 3CUEF 2VCEA 1D4ZA 1YQDA 4GZMA 5LZ7A 5I9LA 4CLEA 4B76A 5CHYA 5KQGA 3UXEA 1WXWA 1H69A 4F5YA 1QHNA 2O8NA 3JASB 4GG1A 5H9VA 2WF5A 3ESCA 3TO5A 5C8XA 3MFQA 3IESA 4A1OA 2O7RA 1RD4A 1R9MA 2BEKA 1YFZA 3T7TA 1KSGA 3BAFA 3OE1A 1SOVA 5KCZA 3ZH2A 2CE7A 5CT5A 2W8ZA 3TOZA 4NCKA 2AFRA 1ZMRA 4RLFA 1K97A 3JYOA 4LSZA 4ZARA 2XWJI 1DO8A 3G6WA 2GCIA 3MWDB 3QI7A 5C7LO 5CMLA 1AE1A 2QD5A 1EWKA 1QHIA 3FROA 4C4AA 1HY3A 1PG0A 3H3XA 1I1OA 1MB2A 3D8RA 3DMYA 2FPGA 3E8XA 3UAZA 4KP7A 4ZCTA 5CVTA 4OLJA 1T5SA 5DGIA 1NFRA 2A1UA 3MUOA 5HTOA 2E37A 2RH8A 1SWVA 5FWAA 3V32A 4XE5A 5EWMA 4BE7B 3EGIA 4FOSA 4PTLA 2VA8A 3R6WA 1LK0A 2FA9A 3MPUA 3GUYA 2HA5A 3MJSA 1FQJA 4JHLA 2Y1EA 1KZ6A 3AF5A 1V9LA 3H5AA 4DA6A 3FHOA 5AW0A 2DEUA 3ZWCA 4QPNA 4X92A 3NUQA 1AHIA 1TFUA 2CVQA 3VJLA 1NVFA 5IN5A 2EP5A 3GPDG 4IS2A 1GZUA 5FI3A 2FP3A 3BJZA 1Q44A 3OQ1A 4V0LA 5CT4A 4RKWA 1OI7A 4C03A 1QLJA 1XAJA 2QTFA 4YV2A 3PHCA 1JDBB 3VMMA 3DTYA 5IS2A 3TEJA 4QYWA 4DJ5X 5G0SA 4B3IA 1L5HB 4J8PA 2XD9A 3GUZA 4Z9FA 1UQTA 2YN4A 4EVRA 3R3XA 2O8FA 1R0XA 4FC7A 3TCXB 1DFIA 4KR6A 2H9YA 3UUFA 3WYBA 5T57A 2I7DA 2BFDA 2HIHA 2V55B 4EGAA 1FMFA 2XUAA 3CUTA 3H2IA 3R5JA 4U7FA 2BR3A 3GCGA 3TS1A 2V7QA 1TEZA 3L8HA 3KT8A 4L5IA 2QN1A 1F4PA 3T0IA 1A5ZA 4O4LB 3UKOA 2YJZA 3FPSA 3FPFA 3L7YA 4MQ6A 1WQ3A 1TX4B 2HTFA 2ZAYA 1GXSA 3T94A 1Q7RA 4IV8A 1RYEA 4QXPA 2PRZA 4H7HA 1FYWA 4IJWA 1RAAA 3BCSA 4MV9A 3O2QB 5BV0A 4NYMR 2JKVA 3NEYA 3ZLBA 1ND6A 2ID9A 4Q93A 5G0TA 3H2ZA 3U9TA 3L84A 2UUOA 4RA9A 1FDSA 1ZUNB 1U1FA 3IPCA 2C4HA 2AC7A 4KAJA 3MWLA 5FOXA 4RDCA 4C0QC 4BVKA 3CRNA 4NMLA 1XQ6A 1BQ3A 1Z34A 3QW4B 3FIUA 3ZWBA 4CTMA 3KDPA 3FGNA 5JC8A 2FJPA 3ZHVA 1ZMOA 3VHXA 2ZETA 4IDAA 2ODAA 2LCFA 1JH9A 1VXRA 3QOYA 4YK7A 2PD6A 4FZJA 1J1UA 3HYSA 3I2KA 5A5DA 2BBTA 1LUAA 3ABSB 3EHEA 1UZUA 3IP1A 1FFCA 1SKQA 1ZNZA 1FFBA 3I5MA 1R5OA 2ORVA 5CXQA 1O94A 2QLLA 2J6IA 1M6NA 1TEHA 2QXYA 4BBPA 3ITDA 3I32A 3T5AA 1EFVB 1NY5A 4OI1A 3DFMA 3R4CA 3P26A 4DPKA 3CVWA 2NXWA 4JCCA 4J0JA 4DLWA 1G17A 3H0EA 5ARBA 821PA 1UMCB 1M0EA 3HY3A 1TMYA 5B30A 1W44A 5F1YA 4Q47A 5TPZD 2GASA 4S12A 3MUFA 1BRTA 3HVIA 3HEBA 2FUNB 4O2AF 2AI2A 4ILKA 3ELUA 1DEHA 4CT5A 2Z1DA 1V7QA 1XQ9A 4FZ5A 2AOVA 4BQSA 1H66A 4ENTA 2W2OA 1B3RA 4GGPA 4WOJA 3OH8A 1PTKA 3AI3A 1CZOA 1E63A 3RARA 4KPYA 4N5IX 3OAAD 4I8DA 1NVTA 4IKOA 1B6GA 4PHHA 4YNBA 1BQEA 4MJ3A 2EATA 3RS9A 4U8GA 4WNAA 4MDFA 1M2WA 2K2WA 2VJOA 2W2QA 1GG5A 1YKGA 2GHIA 2WOJA 3LUPA 4AW9A 5GPBA 2CJWB 3OX2A 5ALUA 1RWNA 5C8YA 3CZCA 5J5AA 3RUDA 3H5WA 3L4EA 4YO8A 4MA4A 2GT1A 2GFIA 4HNVA 3FCSB 2EU8A 2YQ4A 4D2IA 1W88A 2OV8A 3RSZA 3AI1A 4D9JA 1BHO1 4HR7A 1XL1A 1JPVA 1U2PA 3P0IA 2ECFA 2ZSBA 4K46A 1AUQA 1KC3A 1N2EA 1W75A 1WLSA 2X5JO 4FD3A 3O9MA 4PQGA 5TSDA 1KMMA 3F6PA 4QAJA 3TOXA 1CUDA 2CHUA 3SQWA 4KSBA 1NN1A 5DNEA 3HLKA 2PZGA 5KU7A 3HB4X 4AMUA 5C18A 2FMKA 3F6EX 4K40A 3I23A 4TLAA 4ETNA 2ZXFA 1XCLA 2ZUWA 2VHJA 4MMZB 5C7OO 2XMSA 3FWNA 3WRYC 5DBFA 3TINA 2PZEA 2ZIUB 3HI4A 2JAXA 3KU1A 4XGKA 4C4XA 1EINA 1CUCA 5IXYA 4JB8A 1QHHA 4IOKA 3TKLA 4OCZA 4ZZ1A 3IPRA 3ACCA 4UCQA 5I48A 2JVJA 4QASA 1YL7A 2O0JA 1KQ3A 2J3JA 4RV5A 2FPIB 3KHSA 3F5SA 3EDOA 1H22A 1YHYA 3L0CA 1YQXA 4LHWA 4UBLA 4P2BA 2EBUA 4P98A 1E32A 3U9SA 4AJ4A 1YTUA 2O7NA 1WX1A 4XX1A 3MB8A 1IFXA 4Y1FA 2J3DA 2YOGA 3EIEA 4FNGA 2OUIA 3ZE2B 1HNXB 4ZCRA 1CSEE 1HEUA 1WMSA 2LV8A 3B3AA 1N2XA 4LDJA 4WKCA 3WLKX 1M6HA 5LSAA 3TVDA 4DIBA 3SHTA 3V7NA 3ZCVA 1NSTA 2QLTA 4ZDKA 1XZLA 1QXSA 3K4PA 4C0AC 3PSAA 4GZ3A 4BZZA 1COWD 4R8RA 5EIHA 2ZCJA 3OPYA 3L46A 1EM6A 4PC1A 3HYLA 1AGYA 2BR4A 3DW3X 2Y1OA 4M83A 3WJ2A 2GLUA 1TUEA 1E1LA 1YQ9A 1H5NA 3N75A 1LVUA 1NPDA 2JGRA 3HKCA 2RK4A 3GA0A 5AKHA 2H3EA 4JMLA 4QPZA 1RQPA 3FVQA 4QTUB 1R9NA 2ZRIA 1SHKA 3PCRB 4GD3Q 5EE3A 5TMBA 3PGKA 3TZLA 3N2EA 5L3QB 4FJ2A 1VLHA 4J9UE 4ZRNA 4BO9A 3AX6A 3UA4A 1OF1A 4PANA 1G5HA 4LFAB 1PWXA 3QY9A 1WCIA 3W8FA 2BEWB 3MOIA 1PJZA 4LRYA 1YACA 1E4OA 1OPXA 4FZVA 2NM0A 2B82A 2D5IA 4RIFA 5IK2D 1N36B 3B5IA 1OH6A 3N39C 4GZ6A 2GZMA 3L7JA 4JYPA 2OHIA 1C3JA 1EBUA 1FVFA 2G5PA 3D1LA 4J0EA 1VBMA 3O38A 1ZICA 3BA6A 1N5KA 4O4LF 5FPSA 3ZJVA 1UFVA 1C3OB 1XTPA 3MTGA 1Z0DA 1KPGA 1D2RA 2HDNB 1V16A 1GZDA 3N2GA 4Q4AA 4UHDA 4X93A 4UTVA 3FNBA 1TVKB 1UBOS 3KSUA 3MJHA 4Y6RA 1DV1A 5JCJA 3WQQA 4F6CA 2MTBA 3GMSA 5DN6A 1ZA2A 4F3NA 4EKGA 4Z49A 1UFRA 1VHLA 2GK3A 1L5OA 4MITA 4X63A 1TYDE 1B15A 1ZRMA 4R6XA 4P7BA 5JD3A 4NENA 3W5CA 4L8WB 3CXRA 4ZK6A 1ORRA 3PFKA 1JSRA 2QJOA 2O9JA 2OG2A 3CMCO 5AI6A 2NYRA 1JIKA 5BOSA 3VV2A 2WILA 1E3MA 1MVLA 2JJYA 2P40A 2QHXA 3PDHA 3GOHA 3LRTA 4XQCA 5E7MA 5KCMA 3VO9A 5E1MA 3CZ4A 2BV3A 3DXZA 1CJCA 1CY7A 1HI9A 4S2UA 2XYHA 2ZI9A 1T0BA 2FG6C 3AW9A 4PYRA 3G5LA 2EG9A 1BOOA 2C8KA 4L57A 1B76A 3GELA 2ZWOA 1U9YA 2YWFA 1EVEA 3JD2A 4R16A 3WQRA 1QF7A 2PUEA 1C9MA 4FS8A 2DUNA 4WLNA 4A4DA 3FYUC 5GP1A 5KC8A 2FMUA 2HJSA 4F2WA 2AN1A 3AJDA 2ZBQA 2WMOB 1RKQA 3EXHA 1HEYA 2ZJ6A 4NAUA 1NI5A 1OASA 3LGXA 1SO8A 4Q05A 5JNWA 1EHYA 3EF3A 3ONFA 3OVMA 3PXCX 1SC6A 5CM2Z 2PXAA 4V0OA 4PHFA 2CNBA 1MAWA 4KC0A 3U3KA 1ONNA 5KYGA 5KVVA 5FV4A 2QMUA 2BE7A 2P3SA 3GQBB 4HF7A 4I0WB 5EWLB 2O2HA 2ZWPA 3KLPX 4CMEA 3STTA 3OOSA 4B46A 5BSRA 3S2ZA 4BDSA 3T1OA 2FMIA 2G0TA 3CONA 3IHWA 4A6DA 2XCIA 4FYHA 5FLKA 1U7WA 4QOIA 4V0KA 1YS2X 4JJIA 5ENDA 3WGMA 5HRUA 1GRNA 2IHBA 4KQWA 3ZV5A 3X1KA 1GTMA 3PHGA 4BO4A 3COZA 2YL2A 2OA0A 3JTEA 4IH4A 5SYNA 2GA8A 4X8HA 1UJNA 5EEGA 3IIKA 2Q4DA 3KQSA 2W43A 5HF5A 1A2KC 2XSZA 3A6PC 1ZCFA 2Y1WA 4K6FA 4J43A 2AHRA 5B7PA 1VZ3A 2NSJA 4QIHA 1VMEA 3RC1A 2PN1A 1HLPA 3CXUA 4UUBA 3H65A 1D9XA 2D06A 2DQZA 4PZPA 2QTVB 1H6CA 2QQGA 4DJJA 3GEDA 1NW5A 4YIHA 2G1PA 1AM4D 3W9UA 1U0OC 4LV6A 5BW6B 1KOLA 1TT7A 1PW5A 2D8AA 1Z16A 3TD6A 3L7KA 3I28A 2NYVA 5FD8A 5CDUA 4L74A 4H9GA 3I2IA 3EGDB 1JJIA 2HSEA 5KPJA 1Z0SA 2JFXA 1US8A 1ULHA 3ENVA 1SIBE 4Q01A 4YP5A 1K86A 2QWXA 3JZFA 1CNFA 4BPBA 4ZVPA 1CZRA 3N28A 4RK7A 5JXGA 3T5GA 4I1YA 2GRJA 2JASA 3ZE6A 4MEBA 1BDJA 2BDTA 3NTVA 2FPPB 4DV6B 3E8SA 2O4CA 2BTEA 5F78A 4F2GA 1ONOA 4CQMB 2E55A 3OJEA 2CW5A 4GC5A 5TT0A 2ZR8A 4B0PA 3HKEB 2D13A 3HJTA 5REQB 2GZHA 3JQGA 2B69A 3FF1A 3G8YA 1YZQA 4Y2RA 4MCIA 3QHAA 2F3QA 2O5EA 1U7ZA 4ZI7F 2O2YA 2AH5A 2HU2A 4F3RA 2J30A 5ALIA 4JJAA 1UWVA 1YQGA 3UJ9A 1BS2A 2DJ5A 3CW9A 3Q5EA 4KO2S 3B13B 2L19A 1AS3A 4OGGA 4BWGA 3VO8A 1IMOA 1H4TA 1J42A 1WSBA 1TA9A 2G0NA 2JVIA 2W2NA 1CBUA 1PEDA 1S4QA 2XKAA 4ID9A 1PT7A 3DBRB 2YYYA 4M9RA 1FSZA 1BIFA 1J09A 3AZQA 2V54A 4TYPA 4CM3A 3ECAA 2C4MA 1EFCA 4DG5A 4BNVA 5ALGA 2Q3MA 1CDEA 1T5TA 2D0DA 1CS0A 2NSYA 4KOEC 3UANA 1VGRA 1DAKA 3NBKA 1RXUA 3FI9A 4ZP1A 1P0CA 1OGJA 1N1EA 1R6DA 2IIBA 2IIQA 3EWNA 5FI1B 1U94A 2RGWA 3GNTA 5F12A 3A14A 1QQ5A 4BN4A 1Q2UA 3QMMA 3T4UA 5GIPE 4C0XA 1I7DA 3DV0B 1TCCA 1XF9A 3KYDB 2A5GA 3QYAA 2QUJA 4X94A 3KQNA 3PD7A 2BEJA 3MVEA 1F6DA 5K4AA 3FOEC 3LW8A 4L75A 3H2JA 1LNSA 1REQA 1XXHE 2VOEA 1OYVA 3MTAA 1Y7LA 3NNSA 2AKEA 3PC8C 3A26A 3L4BA 2OGSA 3C4JA 1N1DA 1RE1A 3NHPA 1VQ1A 2ERXA 3FDXA 2Y4NA 3DG9A 3P9KA 2VKTA 3QITA 4MYRA 4XR4A 3R8FA 1RYZA 5AR1A 4UM5A 1NRXA 3H11A 3FTEA 2G36A 5LQAA 3OQNA 1X38A 5G0UA 2Z0MA 4HO1X 4WESB 1FCJA 1JFRA 3DZKA 4IV5A 5I7SA 5IPFA 1T5BA 1M9NA 1K68A 1Q20A 4J0GA 3RRFA 2QRKA 2HGSA 2QN7A 3NVAA 1DLIA 2HLDD 3PXGA 1I14A 3EQ6A 4U5XA 4C22A 2PJRA 2FEOA 2AKAB 5FWYA 3RS8A 4G8JA 1WY7A 2R2AA 1UWCA 3HKBA 3N2NA 1U8YA 3PDWA 3P9RA 5HE9A 1JWBB 3R7DA 2C94A 2IUFA 3E3AA 3PQ7A 4HNSA 4OG2A 2QM3A 3AUAA 1E4EB 2EEPA 4DCGA 2H00A 4JBWA 2CB9A 3PPVA 3K94A 3H2HA 2WC1A 3MJEA 1JHQA 2C5SA 2L0XA 3R0JA 2WTNA 2GYWA 1JEDA 3Q15C 3GR6A 4JP5A 4JYCA 4QUJA 1L7PA 4Y2XA 4R1NA 3R75A 1VG0B 1VM6A 1JPUA 3TI7A 3ZZTA 1K8QA 4B47A 3QE2A 3I05A 2BVNA 4N40A 2WB4A 1E1RA 5ALZA 3ZXSA 5L3SA 3TCNA 3ESXA 4NEGA 2O8EA 4O4IF 2IIVA 1C81A 1F4LA 2WHEA 2QE6A 3Q8KA 2Z2XA 4GVPA 3NHFA 4OQLA 1GN8A 5DIZA 5ETJA 5FYDA 2NTNA 5BNFA 3GLGB 1N34B 3QBVA 4DV5B 3QLUC 1X7YA 1XRMA 1T9CA 4FKBA 1BCSB 2AJ8A 1Y3BE 2RAUA 2VTEA 3BIJA 2WQZA 4FSXA 4S1WA 5J5CA 2XHEA 3UUGA 1U99A 4CR7A 4DQLA 1TF5A 1RVDA 1OZAA 1UIMA 2G71A 2PSFA 2R1ZA 3PLNA 3MCWA 3TTXA 1P1KA 2Q1YA 2CZQA 4E70A 3H6HA 1FUUA 1G2QA 2OPHA 4PRZA 4BMSA 1CHDA 3EAGA 2ZRHA 3AIOA 4JSTA 2A0WA 2R4QA 1ONBA 5CLHA 1KYYA 1V47A 4L28A 5AVKA 1ZIOA 3VSCA 3H5IA 4EPTA 2WABA 3MTQA 5JYBA 1F20A 3K8ZA 3DB1A 1E4VA 3WO1A 1OAAA 1JJBA 1K0FA 3N5CA 1W34A 3NT2A 4L4RA 1J90A 1Q1ZA 1D0IA 2C7BA 2I1VB 3BHJA 2J4DA 1E7SA 3NOVA 4I4IA 1KY5A 4G1CA 5F23A 5JROA 3RRNA 1KHHA 3KALA 5HFJA 4D8XA 5AW4A 3SWWA 1ZJ4A 2GD6A 4V02A 4GYWA 4KPEC 4Q7EA 2J5KA 1HDEA 3TNDA 3DLCA 5GVRA 5DGTA 3PTAA 2NUTB 1YDEA 4YJGA 4YCMA 4FYPA 1IN1A 2AMYA 1SEPA 2DCUA 4WZAB 2BBWA 3ENQA 3LI2A 1GILA 3WYDA 4AQDA 3TZ6A 4B43A 2JC3A 4TMXA 4PLWA 2FRDA 5T6BA 2X5NA 3SEZA 3OTQA 4JC0A 4J0KA 1T35A 1T9KA 3NGLA 4KKXB 1UK8A 2SHKA 1SQGA 2O7VA 1D1PA 1IDN1 2DFNA 1XKXA 1QCCA 1G1AA 2HF2A 2PZAA 2V7XA 2X3UA 2VSFA 3DMGA 4MVCA 4H7IA 4NCXA 4BMVA 5I9IA 4RF3A 4FKZA 4OGFA 2UXBB 4MHSA 5C80A 1XNHA 4XSVA 5C7YA 3EC1A 1QZUA 4EYSA 1QIMA 1Y9EA 2IPAB 9LDBA 4CIWA 4KXNA 1OHHD 3GLIA 2HJVA 3WK6A 2DWUA 3CZAA 1F2UB 2H1CA 2MR5A 3SKYA 3GMTA 3GN2A 1KNXA 5EUMA 5KTYA 4BQEA 1C14A 2CK3D 4AMZA 2JK0A 4OMCA 1Z4NA 1NQTA 3JTMA 1H4VB 1UBMS 4WEQA 3VHQA 4KTVE 2B8NA 3OIUA 4MW0A 5BNIA 1WEKA 3IDZA 4H7EA 1BMFD 1WDMA 3PBKA 4MA0A 3I30X 2EF1A 2V7TA 3RUEA 3SIPA 3TDMA 4CKEB 1TIBA 3S2GA 4PSDA 4B6RA 1X1QA 1KI3A 2EKQA 5E6RA 4DBLE 4DLXA 5CAEA 3CO5A 4D81A 1SKYE 3NT5A 4EPYA 5FLXA 2GAOA 1X6VA 4L85A 1I6MA 1UZMA 5CA1A 2ROQA 4M88A 1GZHB 2WNHA 4QXRA 2PV7A 4UNNA 2ICAA 5KWJA 2QLMA 4J7UA 4D4HA 5T4HA 1N3YA 3A9RA 2I6UA 1BE6A 3ZHQA 2JCGA 3C8DA 1SXJC 4ZICA 3OJLA 3PV0A 5JLJA 5DBEX 4DEYA 5DASA 2Z4RA 3F8SA 1W46A 2Q9AA 4JUCA 4PX5A 4TLBA 1B3BA 2E6KA 4TWBA 5BT9A 2DLCX 3R3UA 1FXWF 1L7BA 1X14A 1JE1A 3FOFC 2H57A 4OIFA 3AHEA 3PNQA 4IG4A 3O8LA 2YWGA 5FH9A 5K0CA 1C4WA 1UKEA 4ZOQI 2XUQA 3FCUB 5KYWA 5IRCD 4CIVA 1QP4A 1DRVA 2BFBB 3ZWYA 3WIBA 3RFXA 4B6JA 2PQ6A 3B6EA 5KNLA 1V9SA 2W6JA 2Z30A 3C5HA 3K0HA 3IR5A 4GX5A 1IY8A 1UADA 1Q3HA 3PD0A 2FWBA 4IQFA 3B2NA 1SR8A 5DNCA 2VZ8A 3E22B 3I9NA 3VR2D 1WZNA 2FP4B 4AN0A 2F8TA 4G97A 1VPVA 5KO2A 3O8DA 2WHYA 5ED0A 2V0GA 4ML3A 1XYVA 4WCFA 1B73A 5E6SA 5KNBH 3KVRA 1K3TA 1O6CA 1D2GA 1YHNA 1ZL2A 5I8ZA 2XNDD 3DD1A 1P74A 1RP7A 4FX5A 4JLJA 4JU9A 5FEMA 3V34A 5J40A 3L5OA 4Z7QB 1XFDA 1ECLA 2NQ2C 4OOEA 1DAGA 4Z6KA 4XWKA 3UA3A 3QENA 4CEIB 1X42A 1BHSA 2FSHA 4BFXA 4C21A 3C3KA 2I99A 3KYCA 5AW1A 3RE1A 2JFFA 2KE5A 1PZNA 2ID8A 1QAMA 2GM4A 5L51A 3QU4A 1PKXA 4JT2A 2FPXA 4TTRA 3TLAA 4QGGA 3DCYA 5HCNA 4CR6A 2H8KA 4EI2A 2R5WA 1F5NA 3MJCA 1JDVA 3NEJA 3PXUA 5DGXA 2EWWA 1UK7A 1QC5A 3GRYA 5K09A 2PE5A 2O14A 3IMKA 2C2KA 4F1WA 4ITRC 3P1JA 1Z73A 3CB2A 3WXBA 4MWGA 4OX9Y 1VIYA 1FNBA 3MTBA 4HFNA 1R16A 1WXDA 1SVSA 3UCXA 3VZCA 4AU1A 4PRYA 4ZQGA 3RV4A 3BQ9A 3RS4A 5IWCA 3M0EA 2OQRA 3WADA 5ESDA 3NX4A 1F14A 1EUDA 1XMJA 4IIJB 1YC5A 1LRLA 3NDIA 1DT3A 3JVEA 2B92A 5D6OA 2HZ7A 2LDBA 5B7QA 1ZHOA 4KQFA 1U5BB 2H52A 4ALJA 1TMKA 4OXNA 5C8ZA 1RRCA 2VYNA 3BZUA 5EXTA 3PYXA 3CKYA 4EAAA 4U7TB 5EZYA 1Q1NA 3AHCA 4NECA 5EJ5A 3S8YA 4XGIA 5EWJA 5LQMA 4EKNB 4BNWA 2D0IA 4OJQA 4IDCA 5CT8A 5CA0B 3ECCA 3L7LA 5UKDA 1UDBA 2VDWA 4PZZA 1TJ4A 2ZULA 4NFHA 2MSWA 4ES6A 1OLSB 1JAIA 2AXEA 2IHKA 4NULA 1HXHA 4TLLB 4JXXA 4HDKB 1V2GA 3SC2A 1Z47A 3IOCA 1DQNA 1IEXA 2G04A 3G5MA 2P7HA 4PYLA 4E15A 1AK9A 2C97A 5DF1A 4ZIRB 2GWRA 4XJXA 4FOLA 4DJFC 1N6RA 3WL7A 3X1XA 1GU0A 1U0HC 2GXQA 4TWJA 5EE0A 1DKNA 2BSAA 4I1OA 3S3TA 4KCGA 1DELA 5G4KA 1EGAA 5F9HA 1XNQB 1IM2A 5CUQA 4FUQA 4PPGA 2D1FA 5D5QA 3B8HA 3E3OA 3N0VA 2VJBA 1M6VA 1U1DA 3KJZA 1EGVB 1PI3A 4G0QA 3SHWA 4CI0B 1XXHA 3WY9A 3GJSA 3I5AA 4I9UA 3LAWA 1DJNA 5DN9A 3UAOA 4DZRA 3UK2A 3P9NA 1QIHA 1II9A 2XEDA 3G9UA 5AW7A 2QL5A 2UZ1B 4GUDA 2ZQ5A 3GA7A 3PQFA 4Q1BA 2J67A 5KOYA 5CM9C 2F90A 1Y1SA 5LDGA 2VXOA 1WW8A 2HU7A 2O07A 2B4QA 4MKHA 4RNCA 1BJRE 4CCAA 3GLRA 2DP4E 4M54A 4IWYA 2VNAA 3L9WA 1NLZA 3SNKA 4X1YB 3TSZA 2AF3C 2XB6A 4H2DA 3VSDA 3G0DA 1TGYA 1U8AA 2H5JA 3BDIA 2B2NA 1U11A 2ZRGA 1Q91A 4JT8A 5IF3A 4FKMA 3RUIA 1T25A 3KQMA 4WLFA 2UYHA 2K6GA 4LPSA 2Z2IA 3NVKI 1TK9A 2JGMA 3TB4A 3DULA 2WAAA 3MFYA 4Y1RB 4OI0A 4FW8A 1VE1A 4RV4A 2JD2A 4P7GA 4WAUA 4ROTA 1TW3A 2OAGA 4XGQA 1Q16A 4QDJA 4F0JA 1FX0A 4DCJA 3C5EA 3EGWA 3QU5A 4M1ZA 3OJFA 5DW3A 1QH8B 3DVRX 1YA4A 2GOYA 1K7XB 2V0NA 1ZISA 3NUGA 4DV0B 4MWSA 3FR7A 4WXYB 2NIPA 2FZCA 4KGVA 2AHOA 2CC2A 1PQUA 1R64A 2HJ9A 1I3MA 2QRPA 3E1GA 4QTTB 10MHA 5J47A 3N0TA 2ENWA 2Q8PA 2X0RA 3SJAA 1OYWA 1GT6A 2VJKA 2X13A 1P17A 4FVTA 3ZIUA 4ATNA 5G2OA 4V1CB 3C6YA 5EGNA 5IDWA 3AETA 4RA6B 4HUQB 1ETUA 1NYLA 2IHNA 3IRVA 3HMKA 2IWRA 3SY8A 3P19A 4A6PA 1PJAA 3U80A 1ATZA 3C1TA 1P61B 3CX8A 3L77A 4MKZA 3VZRA 1XTUA 3R7LA 4D9FA 3CSDA 4TQ9A 2IOQA 3D6VA 5JEEA 4KIJA 1HG0A 3KAJA 1IBKB 4LHSA 4ZQFA 3PG5A 3W8EA 5K0TA 1OAKA 4YJ2A 2XT0A 3HYTA 3M7IA 4FEGA 4D3SA 1Z62A 1VLZA 2BUBA 4EAQA 1K9VF 1XD9A 5DXFA 3T7JA 3SQXA 1J1ZA 1S96A 1IH8A 3FNGA 5D2CA 4BTVA 2FWRA 2NP6A 1JXQA 2HPVA 2JA1A 2A88A 1MP0A 5FOUA 1VI2A 2WU3A 2IYFA 3ZZ1A 4EA8A 3FPKA 4LA4A 2ZJAA 3H9UA 1O97D 2HHJA 1QZTA 5L8VA 2OCYC 1T6XA 1N7HA 4P36A 3UPUA 3H9GA 1L3CA 2REXB 1UZNA 2ZR9A 4GPZA 4OLBA 5BWOA 1C8BA 2NVWA 3O1LA 5KYYB 5TIIA 1ZONA 1HYQA 1W49A 1BW9A 3PLRA 5ICSA 5LMNB 2ISCA 4XQEA 4DT1B 1PS8A 2PGDA 4O4JB 5LD2B 3L41A 2QRMA 3O3MB 1QH9A 1UK6A 1F2VA 3DMDA 4LMBA 1H23A 1RCFA 1TLLA 4C0LA 3T7KA 5KYXA 4JC5A 1XFAA 4BAUA 2NZUG 4FYVA 4C04A 4X41A 5FAXA 1V5FA 3CZRA 3DNMA 4J1SA 3ZJ5A 3NDRA 1RLMA 4AMBA 5U1PA 2E85A 1XJCA 2F4NA 2P30A 4D9HA 3L5KA 1DQPA 1WAMA 3WAJA 1PU2A 5D86A 4M7OA 4YJ3B 3LBNA 3MWEB 1G20E 2B3DA 4MP6A 2PQ2A 1QVWA 2Z09A 3J7AC 1C2TA 2YZMA 1A5SB 4CEHA 1UPBA 3VR3D 1PL8A 1CJUC 1WSDA 3PITA 4I81A 3M3HA 2IP4A 4HNHA 4I5FA 3ENZA 4N6OA 1HA3A 1RRVA 3U4AA 6ADHA 1BA3A 2JW5A 4W7HA 5IM4A 4MEJA 1T2DA 3IT3A 4NC9A 4ECEA 4EJMA 2AUMA 2Q9UA 2V6BA 3IBCA 1OYOA 4ESEA 1X92A 4KV9A 1TMGE 1X7XB 3NATA 3LPDA 4B3JA 4NIMA 2A92A 1WRBA 4GRAA 2PGOA 3HL0A 5CA0F 3HWWA 3K0CC 4JI7B 1CY6A 2G1AA 4RADA 5FXMA 3GZJA 3ZI4A 3E23A 5BR1A 3V3TA 3RIMA 3KHKA 1DXHA 1WMEA 4EFNA 5K0NA 3D1JA 1Q57A 4MRAA 2X2OA 1WUYA 1E4YA 1KEWA 1XEWX 4G0WA 1NE2A 1C3VA 4V2IA 4EUNA 1RJDA 1H2EA 3RRJA 4AMYA 4WLVA 2EJUA 3LPCA 2CFIA 3T1HB 2NO7A 1FTYA 3R6LA 4A10A 1JZQA 2QSUA 3D7NA 3PC2A 1XZPA 2CUZA 1TM3E 1DEKA 1IWOA 4ZN6A 1S7CA 4BXOA 1EGHA 5KVQA 3ZWMA 1EXMA 2A0YA 1CDDA 3E3NA 4GT1A 4BEBA 2PKXA 2R7AA 2XXAA 4DW8A 2HLDA 4D8UA 3OZWA 1RAIA 4Y7DA 3VV3A 2FW9A 1P91A 4YHBA 1KK2A 3TKAA 3TK1A 1GARA 2QQ0A 4TMWA 3L7OA 1RJ9A 2GVNA 1EK5A 4PTZA 1JDSA 4F85A 5FB3A 2FLKA 4XCQA 1VJGA 3BD8A 4CXMA 3JD0A 2PUCA 3D3EA 2A9OA 4JJ4A 4PAGA 2GCGA 4JU8A 2P2GA 4FMBB 1E2QA 2O20A 1U3GA 3F7MA 3UOAB 4KGXA 4HWTA 2FW7A 1D1SA 1GV0A 1XZGA 4G0YA 5ELLA 2OBXA 2RCYA 4F04A 5BMVB 1F7VA 3KDSE 3BG5A 4PM4A 5G0VA 2X1VA 1OXMA 2HLNA 2G9NA 1EJBA 4RFLA 2BEUA 2I22A 1TKBA 3JQCA 4FEEA 1SBHA 1WB5A 2FX3A 4W1QA 1GLNA 2JATA 1GKKA 5LYJA 1T24A 4BNGA 4NZOA 2QZSA 1DIBA 3E9EA 2PH1A 1JW9B 2A4MA 3QY0A 4ZAVA 3Q8MA 1IBLB 4ND8A 1YJ5A 2AXQA 1PW7A 4M1EA 2IH5A 3B85A 2GEVA 4WMLA 1X86B 2DHCA 2GPNA 4KPUB 2WJVA 1WB6A 5DWQA 5EKDA 5ULLA 4W9NC 5LB2A 1AKTA 4MH0R 1OTXA 2BGRA 4TRNA 4U5QA 7REQB 1NJ1A 4KWTA 4HGQA 2OD2A 2B9EA 2HA7A 1CJVC 3KT0A 1B14A 3DBIA 1YFKA 1R12A 3WK7A 4F1KA 4F5WA 1LPNA 5J4VA 2DHQA 3A0RB 2VT6A 2EWMA 2ZTLA 2QN3A 2LTAA 4JA0A 2NNLD 3PD1A 3PUJA 2AZTA 1EIZA 4N5DA 5HMMA 1NC3A 1UWKA 3E15A 4CKWB 1IJFA 4XD7D 4W5OA 3OIWA 4JVMA 5AVVA 3FUCA 3AO0B 3PUYA 9ABPA 1PDOA 1WHSA 2HHCA 2B7LA 3LLMA 3QPDA 3RVDA 2PXCA 3UATA 1L4KA 1PD1A 4ZQCB 4NAVA 3A0UA 3ZWQA 1A77A 3BMOA 4HYTA 2M98A 3QWAA 3QBJA 2IYSA 4JDPA 5A4AA 3AV3A 1IN5A 3T06B 4QVIA 3A10A 1W1WA 1L5YA 1I13A 4K88A 1RLIA 3AF2A 4BJHB 3BBPA 4B35A 4CKCB 3EULA 3RHZA 4W99A 4IGKA 5E9QA 4PG6A 5DGDA 1K92A 1PWYE 4LOKA 1KVTA 4QGFA 1HT0A 2R7KA 2V0CA 4TS3A 3WOVA 3WL4A 2SCUB 4KQJA 4NU8X 4G37A 4HEJA 1NWCA 3EY4A 4IUBS 4UNPA 1RPJA 1Y37A 5LJIA 2QTWB 2R1TA 4J16A 1TQ4A 1NF2A 1BH6A 2PRKA 1XTSA 1JR2A 2H2FA 3OZXA 4RMNA 1G5IA 2E21A 1GPMA 2JL1A 3PKIA 4RACA 4X8OA 4O3MA 5BVGB 4II7A 3N7AA 3IJPA 3QNWA 2C1XA 3UB3A 1MABB 1ISJA 3L07A 4YS6A 3EWIA 1OH8A 1G7SA 4MKIA 5EC8A 6AT1A 2CK3A 1KYZA 3I9V1 3EG9B 1ZIYA 4INZA 4OUKX 4QZVA 3VRHA 1YVRA 4FLMA 2ON6A 3KEFA 1XDWA 4G0MA 4G86A 5JS8A 4Z51A 5HRCA 3D6MA 2IS6A 3PK0A 4QPJC 2V9PA 5BR7A 1ZSVA 3M6IA 4LXUA 4ZDWA 1NW3A 1YGYA 2PX5A 4FEYA 3EJWA 2WOOA 1HQKA 3NETA 4UEOA 5B55A 3WTCA 1I7QB 1CZHA 2RH9B 1D4FA 1H6AA 1N6NA 1PR3A 1J99A 2OFWA 3LUBA 4OM8A 4D96A 1SQSA 4KXWA 1KP3A 1S89A 2F1JA 5LA6B 2ATIA 1ZJYA 1N6HA 2CXRA 4CQNA 1PP4A 2PFGA 3EVBA 2GK7A 3O8NA 3AT1A 4PWYA 3OFVA 1L4UA 2PPLA 2HQSA 1WVMA 3DPSA 3MWJA 4ZRMA 3ZQJA 2PUTA 2YWJA 4AUNA 4C2BA 4NXMB 5DW0A 4GS5A 2AKYA 2PFSA 3OZUA 2HV9A 3WRXC 4Z1MD 3C3BA 2ZOSA 2JFGA 1HE3A 3CIFA 3CX6A 3MGCA 2NXJA 4GWGA 4PINA 1C0IA 1L7OA 1TVMA 3D0QA 3MMXA 4O59O 2C78A 3L8GA 3DKRA 3O0TA 4UTZA 3TNFA 1CP3A 2J0EA 1BFUA 2HX1A 4GXTA 1LWOA 3E2IA 4I50F 5B2FA 5HK9A 3GAZA 2ZUEA 1XMPA 2QJWA 1MPXA 1AKUA 3RSQA 3T7DA 2GAJA 4YDHB 4E22A 1TFRA 1WZEA 1FNDA 1XYYA 3IT2A 2HL6A 3L7MA 4BLRA 1S6YA 2Q3FA 3PEFA 3SX0A 5ESWA 1JHOA 3MMPA 1U02A 4L16A 2P9ZA 2WJ6A 3FSGD 3OF2A 4RAOA 4CMCA 2XMBA 4CLHA 1HE2A 3PZRA 1NUPA 4LJ5A 3ST7A 1Z6PA 1EWTA 5EIBD 4NQZA 3ZBQA 2JAOA 1NZJA 2GEFA 2JJ2D 2GBFA 2YBEA 4I99A 4L78A 4X8MA 4AY5A 4NU6A 3K0AB 4GICA 4LQLA 5A62A 1DVRA 2IV2X 4RUKA 4XWWA 3JQQA 5BPHA 3WWEA 4ZGWA 4TTQA 2HR1A 3LX6A 1MIHA 3O2JA 3HCFA 4UQOA 3RASA 1YJBA 1KYTA 4CUKA 4L8GA 3EAFA 3C7CB 5FLEX 4AIIA 4I9NA 4UMVA 2TMKA 3SFVA 3KQPA 4DCPA 2HMSA 1ESDA 2VDJA 3O4JA 4MV6A 2WUEA 3RT7A 3HZOA 2J3EA 4XDHA 2NW6A 4U2CA 4UAUA 3M6AA 2X42A 3ULKA 1RKXA 4EMSA 2C88A 4KXQA 2RAPA 3OLWA 1GL6A 2GN9A 4KE7A 2WTUA 3NBUA 5C51B 3JY6A 1QHFA 4CMIB 3OIFA 3VZBA 5BUQA 4YASA 3TTUA 1YASA 3CFYA 2M32A 3IPAA 3OJ0A 2I4LA 4M9QA 3KZKA 1PGPA 3TSCA 2CDCA 3I6BA 2ZSAA 2FOIA 5J4YA 1CUIA 2FSIA 1LY1A 3N86A 2BEVA 5JAIA 7MDHA 2ONJA 5F5NA 1RQ2A 4HNAB 2R8EA 5JMTA 2A9PA 3TD2A 3HFGA 2FCRA 1U1CA 3L6UA 3PFHA 4N82A 3CEJA 3UGKA 5I3CA 5DHFA 1HFWA 3CUSA 4AZSA 1IIRA 3SFTA 1DC4A 2ZREA 1KK0A 5KX5A 2AW5A 4OHPA 5CFPA 4P5EA 5DHSA 3VU1A 2X9NA 1XC7A 2ZJFA 3NP9A 3VAAA 4UW9A 1VKJA 1XELA 1Z5OA 4WXEA 5J2UB 4CHTA 4YJFA 1JG3A 3H9CA 4JI6B 2F1KA 5BWCA 4FGUA 1HX7A 3H4MA 3GRZA 1V48A 1QM5A 1TIKA 3HZHA 4H6VA 4G5GA 2QI9F 4JJKA 3W5BA 1GSAA 3T1YB 3H9BA 2Q4TA 1LLQA 4O2BB 3ABZA 3NBMA 4IVPA 2QVCA 2FWAA 2QUBA 4H4CA 4R9VA 4FU0A 4UQPA 4ARAA 4YMUA 1T0JB 1PV2A 2GXUA 5IVHA 3BL5A 4K9KA 1SBZA 2IY8A 3ZD6A 1T9GR 1U2DC 1T8PA 1NR1A 5JAPA 3NTXA 2OO7A 1H1LB 2QK4A 3CINA 3UYLA 3WSTA 4YRAA 2BAGA 3W7AA 3TZQA 1UWLA 2FVYA 3ICOA 1KKUA 2ZZKA 4HBZA 2ZJ5A 2R86A 3EA0A 2OCPA 1BGVA 1VECA 3WE7A 3A2KA 3GB9A 4CG0A 2CVZA 2AEEA 5EUCA 1VOTA 1YCGA 421PA 4E5YA 5K3BA 5BSVA 5F35A 2EW1A 3IQFA 4IX9A 1A9XB 1H8HD 1YBHA 3T3IA 4HX2A 3GFQA 4AJEA 1XHLA 3LC1O 3AK4A 1JMKC 2GM3A 4NPCA 3IDSA 4PC6A 5JO0A 1Q0QA 4Z2AA 1JL3A 1T36B 4RZ2A 4XWTA 1C41A 2CCJA 1DJOA 1LXCA 2PWPA 3JQBA 1ZI8A 4BQIA 1CDZA 3KQOA 1GZ4A 4LSMA 4YAJA 2Z9BA 3TNJA 5AKXA 1VLLA 1ID1A 1WE2A 3D7RA 4QBTA 3UBTA 1ESEA 3OEHD 5CCXA 2RK3A 5DSZA 5DXJA 1VYTA 4JI4B 1MRNA 2BM8A 4WL0A 4YVFA 4RK6A 1VPWA 2VSOA 4O4HA 3KLOA 3LVFO 2QI9C 1PJCA 1VJ5A 3IP6A 4UBIA 5AW2A 2HOQA 2OCDA 4K0RA 3HVUA 2V7WA 2J48A 3V42A 1JEQB 1WDLA 1PS9A 2XXJA 4FNAA 4DPLA 4J4HA 3ZGOA 4MW9A 2FWPA 2VAVA 3KJQA 3DO8A 4A0RA 3QP9A 5FFMA 5JVDB 1DPFA 1SUIA 3GZNB 2BHNA 2BCJQ 5JOQA 3U61B 3HVJA 4FHDA 1JB9A 4YROA 3AM1A 4NP6A 2FPUA 4BV8A 4J3NA 1Z0KA 4M60A 4IJ6A 4BATA 3PWZA 1PFVA 3DWEX 4LVUA 1H6BA 3RKSA 3AGQA 4FFLA 1E99A 1X1TA 4G5OA 4KREA 2FFRA 3E70C 1YZFA 1DOZA 2FF5A 1NW7A 1VHQA 4GGOA 1FFWA 1PG2A 3HN6A 3WIVA 4BV2A 4G1EB 4UVHA 1ZI6A 3WKBA 4PR0A 2WFAA 4CQLB 3PI7A 3SLRA 1TU4A 1K8XB 1KRWA 1K6MA 1NQVA 4U00A 4B7CA 4FMCF 1TO1E 3EE6A 1N2CE 4DIOA 1WCXA 3H18A 1A7UA 4Q4JB 3DQPA 1CRPA 3R0VA 1DS6A 1M2VA 1VA5A 5FORA 4EB6B 1NBEA 1NBMA 2BFNA 4M1OA 4KV7A 4Y9RA 1NIJA 1NZFA 4PIMA 4FBGA 3ICWA 4NX2A 2G4LA 3IBTA 3QELA 1DKUA 1YI0A 1L5WA 4GOMD 8ADHA 4RQTA 2H3HA 2AZDA 1ZO8A 4UFOA 4YUAA 1XWIA 2W42A 3CPHA 2INGX 3TLEA 3IKLA 2C9MA 2HA6A 4L6AA 3ZWOA 4F84A 2P1RA 2Z98A 3PQ3A 4TT8A 5TQ2B 2CVHA 4EA6A 1WV0A 3TDNA 3W5SA 3KXKA 4JKOA 1M5RA 2JFHA 3UAYA 2FPKA 3ONVA 3U3OA 4JOSA 3UPTA 1GLVA 5IMBA 5H16A 4HOYA 2WB2A 3C3XA 4AS2A 1NPYA 3ZS8A 3QGMA 5ICEA 4L51A 3ZNNA 4FFBB 1Z0JA 2PSEA 1SFRA 4D99A 1OFUX 1YV9A 4PGMA 4WBNA 4LYJA 4A8TA 3KP1A 3VYRB 1KYIA 2NOAA 4KQHA 4QQKA 4X7BA 1OWMA 5JTUA 5K99A 1UMBB 4BLSA 4EYGA 4GR5A 1DIGA 2A9FA 2XMCA 4KZKA 3WGYA 4EKYA 2EEZA 4F72A 1XVLA 4IHKA 4J2HA 2VVTA 1QANA 2H08A 7YASA 5GZ3A 1CU1A 2RK6A 1HLFA 2PXHA 5EJIA 4PPQA 4TKMA 2YNMA 2GVDC 4GMXA 4QSMA 2FI1A 4M55A 4OYRA 5HCUA 1EG7A 1EFRA 3NIGB 4TWAA 4HAUA 2PLAA 5FWNA 5JD4A 1B2LA 2P9HA 4LSGA 4TXHA 1EP9A 2GPSA 3JWIA 2VPIA 3KQLA 2QRJA 1V7PC 4JCOA 4P82A 3GJ6A 1T2UA 5EZ5A 5LDHA 1UOPA 5A9SB 1XV5A 1VSTA 4JODA 1OAOA 1QG2A 1QVZA 1Z5UA 4PO3X 2CL5A 2J9FA 2MINB 3W34A 4H0FA 3ZKWB 3CN9A 1X7ZB 2AE2A 3VI4B 3VR3A 4AJIA 4BNUA 4DZZA 1EUZA 2F9LA 2GPJA 3NYWA 121PA 4JLSA 3M1LA 2Q3EA 5EKUA 1CQIA 2ORIA 2XE8A 2YVAA 4GL4A 1NBIA 2DBRA 1UXOA 2AK2A 3KOZA 5JJLA 3GBVA 2VPTA 4UEJA 1Z5ZA 4WUTA 2I9KA 2YRXA 4NBLA 4OBEA 1QV6A 3GJ3A 2X4DA 4OV6B 1UCFA 5CLIA 5K45A 4L0CA 2R6FA 1N75A 2QRLA 4J1TA 4RD4A 3RK4A 3S99A 1F4VA 3HACA 3NTOA 4XWOA 2J41A 1NBOA 2P5TB 4MR9B 1KMNA 4FNMA 2E5LB 1O4VA 1S2LA 4BAZA 4U7GA 1FBTA 4UM9B 7GPBA 2GTPA 1MB3A 2F43A 2VTVA 3SCZA 1QDEA 3I64A 4PLPA 4RQAA 2H92A 3LGSA 2QDKA 2OXRA 4CJXA 1CEXA 2W6CX 3CEHA 3I2GA 4UHCA 3T3HA 1XZCA 3NIFB 5EMJA 3Q0EA 3QVUA 4Z0HO 2QQ5A 1Y3IA 2YVQA 3BIWA 3HDQA 5KHOC 5GJWC 2LCQA 2JFPA 1RWVA 4E03A 5JZOA 3CLRC 1PNRA 2IEGA 2GCEA 1WIWA 3KD3A 4DIKA 2DX7A 3IELA 1ND5A 3B3JA 1Z4PX 1W5EA 1O2DA 3NDPA 5BWLA 3I8OA 2VEDA 1J39A 2WUVA 1Q11A 1Q0SA 4XPZA 2WYOA 1VKZA 1XUOA 5IT5A 1EK1A 4MW7A 3PFWO 3I01M 5TVKA 3K1YA 1V25A 1Q83A 4JELA 4WTOA 4X24A 4KBFA 5IYZA 1L4YA 5LQDA 5CX1A 1N5OX 1EVKA 1P2TA 3K5WA 1TO6A 4KL8S 2A3RA 1DRWA 4XJTA 3T95A 3U3RA 2IUUA 1XROA 3ZGNA 2R7NA 3IBSA 4YCJA 4B83A 4FDUA 5FNVB 4ER3A 4AP9A 1DL5A 2XCQA 1USGA 3D0RA 3QVLA 3CISA 4OFWA 1GU7A 1GQOA 3FLBA 3IMEA 3PB3A 1I10A 4ADSG 3ZHTA 3KJIA 2PZBA 2PQMA 3HG7A 5FI0B 3WWDA 3GRAA 3T5PA 4BEVA 1JI3A 1LRKA 2XZDA 1H2FA 3BRCA 1FLVA 3HJNA 1RC0A 4JYZA 5CDSA 2NXCA 1KDRA 2J5QA 1NY6A 2P2DA 2OK8A 2RONA 2WDPA 3IT1A 3Q5DA 3QVTA 3T1QA 3HVRA 3IUPA 2I6FA 2K4MA 3C15C 4AVYA 4MIYA 2GILA 3CUVA 3KD2A 1AB5A 1CUAA 4W8GA 1PVVA 3TRDA 4B33A 1GZ3A 5FO0A 2KPOA 3F67A 1NYQA 4AY2A 1GA4A 5COQA 3S1AB 3X2FA 2HTEA 3LTNC 3LNTA 4GX1A 2ZJOA 4ZCLA 1J2YA 5BN3A 2O7QA 3FCOA 5B3JC 2X8WA 1TECE 2NQTA 3EEIA 5ALLA 1GD1O 5JPDA 4MLDA 4QUHA 3GH3A 1GR1A 3WWCA 3HDYA 4JUBA 1BMDA 4L9SA 1EWRA 5JHHB 4ARIA 1T2FA 3FYCA 2Z3WA 1JILA 1K7CA 1V3QE 2DPHA 4FP9A 2FW0A 3DT6A 3ZDAA 1KJNA 3GRRA 4ZO7A 4LVNA 4MYHA 5DRTA 2HF9A 3EPLA 1C2YA 3IO5A 1Z0UA 2Q4EA 3EVFA 4Y8VA 4ZTZB 4QQ8A 3TXAA 3HCCA 4EGCB 1DZIA 1Y3DE 4KIFA 2IHYA 3MQ4A 3VYWA 3LOQA 2IUSA 2J6BA 4FJ1A 2MSDB 1JQAA 2Q2WA 5HGJA 3MN1A 2BCEA 2XVYA 4HBGA 3QX7A 3AVOA 3RTDA 2W4QA 3NAQA 3GT3A 4EW1A 3K70C 4M1TA 1PUXA 1UM8A 2HKIA 1IN4A 4HB0A 3SYRA 5JDCA 1JHPA 5EMLA 1OWLA 3F3MA 1SEVA 3Q85A 4JLBA 4IG9A 4MDHA 4MJ7A 1Z2DA 3MOGA 1NMZA 1QPBA 3MJFA 5EJAA 1C5KA 4DSZA 3D0KA 2F1HA 1O57A 1T9BA 5A0FA 3U4MA 1QYDA 3A1VA 2V9ZA 4ND3A 5KNCH 4RH0A 5IAKA 2FPIA 2ZYHA 1BQ4A 1BX3A 2Y8EA 1II8A 3BMNA 1IAVA 1U2QA 2QVLA 2RJOA 3F98A 3NQ41 3ORFA 3PC6A 5FULA 3F0TA 3SSOA 1EDDA 1HC7A 1U0LA 3N1UA 1DXYA 3LCCA 2J45A 3GJXC 4NPAA 2CNWA 2VHYA 3PC7A 4HEA1 1P9WA 5JWOA 3ZE8A 3G2NA 4NNJA 4UDXX 3X3HA 3S70A 4KR2A 1BVYF 2EKDA 1E3WB 2A57A 4ZI2A 4RDXA 5KZMB 2FN9A 3WNZA 1IHPA 3LKBA 1JQ5A 5JCZA 3PPYA 1E3LA 2A1TS 4LF4B 3IKMB 4FQ5A 7ADHA 1Q7CA 3CB4A 5EQFA 1ZU4A 1UBNA 4O0MA 3D8UA 1RXIA 1R0ZA 3UAGA 3NOQA 3I72A 4JBXA 3OP1A 1EDZA 2Z5FA 1E1QA 2BFPA 3ETJA 2EL7A 1Y5NA 4PYOA 3H1FA 3ICVA 4Z7OB 3SZMA 3KSZO 4UU1A 4A8JA 3KZMA 4EK9A 2XQIA 4I5GA 4RLSA 4Z1MA 3QOWA 3IR7A 3JQAD 4FK8A 8AT1A 4BNZA 1HTTA 2AOTB 3OZTA 4MS3A 2XKKA 5A1JA 3FVVA 3ER8A 1NDUA 4KLNA 4NMWA 4HB2A 1VIAA 2QYSA 3EHDA 4P5PA 2PUAA 2P2CA 4HXEB 4BZXA 5CYGA 1SQ5A 4HVLA 3LBIA 1RZRA 1ORDA 3H7IA 2B37A 3AQIA 4ICIA 2ZSDA 4GQIA 1VMKA 3TRFA 5FO1A 1NXVA 1LF0A 1UKZA 1JXOA 3FJ1A 1GNQA 3FTNA 1QGAA 3H2YA 4KWHA 4MLZA 4URHA 2GF0A 3T3OA 3FSGA 3HJUA 3AR5A 4WCVA 2C4UA 1UQRA 5LZ5A 1KE2A 3PI6A 4OBBA 4LXHA 3DC2A 3RUPA 2PYDA 4LGYA 2HCJB 3ILYA 4N3BA 4XH9B 4C14A 2JJ2A 1W0KD 1WBBA 3VSAA 2DG2A 3MUNA 3CU5A 4OQPA 3TR6A 3E27A 3L43A 4CETA 3NGXA 3V6MA 2B9VA 2AN3A 4NBVA 2IYEA 4LRSB 3SAJA 7ABPA 2CT8A 3ZDZB 3E53A 3DJYA 1LBSA 2ZLBA 4M0PA 2KM1A 1P6UA 2FFAA 3E7XA 1H1DA 4BY9E 3KQYA 3S55A 5HXAA 1ZMBA 4IPTA 2XNCA 3A70A 1DU4A 1PZGA 4FS3A 2H0QA 3UT5B 4WXRA 1TM4E 4Y3UA 4F11A 2BGUA 2ADMA 1E0AA 2JGDA 3BB1A 2ZUTA 4V3CA 3KFXA 3OIYA 4JOCA 5BV7A 3ETLA 4JBLA 4BNDB 1KI7A 5C5IA 5C0OE 3ANLA 5EMKA 4HS4A 2ZRLA 4J0IA 5GONA 1S01A 4RS4A 2JFOA 1H2YA 2OGZA 5H4GA 4OOFA 3HS3A 3W2GA 3L1HA 1UDXA 4WY5A 2FSSA 4URYR 2VQEB 1L5GB 3EDCA 1MJFA 1M1YE 1SB9A 1QQAA 4X20B 4JR1A 1TU3A 3VGJA 1MFPA 3ZDCA 1CEYA 1LLFA 2ATEA 4DTIA 4JI8B 1N0UA 5A7HA 2ODBA 2W00A 2WIGA 3OC6A 4LG1A 1NUHA 3WQBA 3E81A 4QBIA 4ZYTA 3QKSB 1CE8A 1P18A 1BE1A 3IVMA 3C3CA 1MU0A 4DUYB 4FONA 3I8XA 3LVBA 4EY3A 4ZEMA 4KUHA 1QTQA 1P0MA 2NMVA 1F1JA 3FTDA 4UOQA 4IQ0A 4QBHA 2VK2A 2D54A 3IURA 3N05A 2QYHA 3OF3A 4Q12A 1CB7A 5JSHA 2NN3C 1GGMA 1VHJA 4YACA 5ALEA 1C1XA 1O9BA 1HG1A 2JGJA 1ULUA 2EDCA 2XODA 2PZLA 1M8JA 3E9MA 1Y5LA 5K4HA 3F6RA 4ZC8A 4BLVA 2G8NA 1KZ1A 2BHTA 2IYQA 1ACMA 1NVWQ 2IHJA 3EMDA 3LPAA 2HRCA 5FWXA 5AK6A 2FW1A 3D02A 1M34E 1ZIPA 3SR0A 2QX4A 1FYFA 5KAMA 5CNIA 3SJZA 4YV1A 2NUAA 1TQ2A 4DVJA 2G6BA 4RNDB 3U16A 3Q88A 4R2IA 1GFWA 3KPWA 4LF6B 3IP3A 3D59A 4W1PA 4B48A 2PMEA 3LVRE 1LTQA 1K4YA 1TIPA 4WBXC 1WUTA 1W87A 3GH1A 3ENWA 1NR5A 4ESHA 4EL0A 1MAAA 4ZMBA 4AUEA 3IPLA 3IAXA 4IUYA 3GCZA 1JA0A 4NU0A 2A5DA 3A9VA 1IOWA 3CRVA 4LRQA 1J9ZA 1H8HA 3LQQA 4M38A 3K0FB 1FDTA 4QULA 5JSKA 1WUKS 4C0KA 1TRKA 5DTJA 1YZVA 2EFGA 3ETNA 3KLNA 3LKZA 1XMIA 2XYPA 2FY8A 1CJMA 3R23A 1TKRA 3BMCB 1VTKA 2HQ1A 2PLFA 1MEJA 1A69A 1Z13A 3TAHA 4TSFD 4E2WA 2HK9A 1ZRSA 1JQDA 2MHCA 4HZIA 4KWIA 4XJSA 1ZVKA 1RPNA 1Z0ZA 2C95A 4PNEA 4Z4FA 3OEHA 4O29A 4NMXB 1KGSA 1UOQA 5CIQA 1FIUA 1DQSA 2GR9A 2VDMB 4BX9A 4QWMA 3IAUA 3N0XA 4R31A 521PA 5TF0A 1IY1A 3EUAA 4MX8A 1OLXB 3HABA 2VSNA 3IEXA 3TM4A