5F12A

Wrba in complex with fmn under crystallization conditions of wrba-fmn-bq structure (4yqe)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
197
structure length
193
Chain Sequence
AKVLVLYYSYGHIETMARAVAEGASKVDGAEVVVKRVPETMPPQLFEKAGGKTQTAPVATPQELADYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQEQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQGTPYGATTIAGGDGSRQPSQEELSIARYQGEYVAGLAVKLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD(P)H dehydrogenase (quinone)
publication title Quantum Calculations Indicate Effective Electron Transfer between FMN and Benzoquinone in a New Crystal Structure of Escherichia coli WrbA.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 68
structure length 193
sequence length 197
chains with identical sequence B
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2015-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5f12A00
3TE7A 4C0WA 1WSWA 4Y9RA 3NHWA 3QFRA 1AKWA 3GAMA 3D7NA 1AHNA 4HEQA 2QX6A 1WSBA 3U7IA 1RLJA 4CF6A 1XYVA 4ICIA 2N1MA 3KEGA 5B3KA 3GFSA 3ZHOA 1AMOA 4NULA 4U7HA 4YAUA 1RCFA 3L9XA 1AKRA 4NLLA 3GFQA 1D4AA 4R81A 3RPEA 5LBUA 4YQEA 4QOJA 2X2PA 4C14A 1H69A 1CZLA 2V5UA 2OHJA 2XODA 1YCFA 1FLNA 2OHIA 4FGJA 2BMVA 4M0CA 4BMOB 2WC1A 1TLLA 4ZVLA 2FOXA 3K20A 2Z9BA 2B3DA 3NHPA 5F51A 4H2DA 3R6WA 1KBOA 3OJXA 1X77A 2HPVA 1VMEA 3HLYA 1RLIA 1ZWKA 3NHJA 3TEMA 1QRDA 2QWXA 3F6RA 2GSWA 2W5UA 3TZBA 1FVXA 5LLDA 4LTDA 4CETA 1XI2A 3OJWA 1FLAA 2X2OA 4PU0A 3W78A 3ESZA 1CZOA 1H66A 5ULLA 1CZRA 1XYYA 2BZSA 4GI5A 4ESEA 4QOEA 1D03A 2ARKA 1ZX1A 2BF4A 4C0XA 1SQSA 3NLLA 2OYSA 5LJIA 1ZWLA 3FNIA 1QBGA 2QMYA 1YCHA 4LTNA 2FLVA 1YOBA 4Y7CA 3O73A 1QR2A 3NHUA 2BN4A 2D5IA 3O2NA 4C76A 1AKVA 3KAQA 1AKTA 2MTBA 1OBVA 3G5MA 4QOIA 3EDOA 3SVLA 4LTMA 3P0RA 3FJOA 2A5LA 3B6IA 4D02A 3UXHA 1D04A 3NHYA 5TGZA 4PTZA 4XDGA 1DX9A 3N3BC 1FX1A 4QOHA 3OX2A 3NHSA 2R97A 1C7FA 1F4PA 2MOKA 1FLVA 3KLBA 3NHFA 3K1YA 4QOFA 1YDGA 3JSXA 1CZNA 5EMNA 3N3AC 5LJLA 1V4BA 5F12A 4N65A 4QOGA 3NHRA 5BUCA 1BVYF 4YAWA 2BPOA 3LT5A 2QX9A 5LMCA 4LAFA 1TIKA 1RTTA 6NULA 1JA1A 2FZ5A 4LA4A 4F8YA 5B3LA 5LVAA 4FX2A 3N39C 1QHEA 3NHLA 3OWXA 2MWMA 1NNI1 4S24A 3B6JA 1AKQA 4BMPB 5FX2A 2FX2A 2RG1A 3ES9A 1J9ZA 3S2YA 2FVXA 4DILA 2FDXA 5A4KA 4XDHA 1CZKA 4N82A 1B1CA 4OXXA 2Z98A 3OX3A 1DXQA 3FW1A 1YCGA 5JROA 1T0IA 1DXOA 2QMZA 3F90A 1CZHA 1E5DA 2M6SA 3GFRA 1I1OA 3QE2A 4GR9A 2R96A 4HS4A 1YKGA 2Q9UA 1AKUA 2AMJA 3W7AA 4GQIA 3ESXA 5NULA 4N9QA 2HNBA 1J8QA 1AZLA 2FZVA 3ESYA 3U7RA 4J8PA 1C7EA 1SG0A 5EAIA 4FGKA 4QODA 2Z9CA 2F1OA 2V5VA 1KBQA 2Z9DA 1OBOA 2Q62A 3OWHA 5EA2A 2OHHA 2FAXA 1YRHA 3QFCA 5LBTA 2KLBA 1FLDA 4FGLA 3FVWA 3B6KA 1J9GA 3W79A 1CZUA 1GG5A 3KAPA 3HA2A 4YAFA 1J9EA 3L9WA 3F2VA 2ZKIA 5FUQA 2XOEA 3W77A 2QR2A 3OX1A 2KQUA 3LCMA 3EYWA 2V9CA 4PTYA 4DIKA 1JA0A 4U7GA 2HNAA 2MT9A 4ZVMA 5FA6A 4H6PA 2M6RA 1FTGA 5F4BA 4U7FA 2QX8A 4ZVKA 1T5BA 3NHKA 3UXEA 4DY4A 4ZVNA 2FCRA 3F6SA 1BU5A 3FX2A 3HR4A 5NLLA 3B6MA 4Y9UA 4YALA 3OVMA 1XT6A 1FUEA 2QX4A 1OFVA 4YAOA 3NFRA 1AG9A
chains in the Genus database with same CATH superfamily
4KQFA 4F1JA 3G2OA 4JH0A 1QKIA 1DIOB 1NUAA 1M73E 3Q15C 4JEUA 4YDQA 4DF3A 1BN6A 1SWWA 3AQ4A 4IIGA 3N6XA 2B9VA 3F46A 2R47A 2W98A 3H1AA 4LJLA 4V02A 1CU1A 1V8BA 1G8SA 5JDIA 1OD6A 1Z68A 4NAVA 4MR7A 3HXQA 1V5FA 1AO0A 3MHTA 4O2AA 5JRJA 2C92A 1HXHA 2BW0A 1O8BA 4CF6A 1QV9A 5SY6A 5IN5A 3A6EA 1UOOA 1Q1BA 2KBEA 3AEZA 2A58A 3GIDA 4ZRDA 1HG0A 2VATA 4JR0A 1ZGCA 2AS0A 4TSKA 1I2MA 3AR9A 1FYDA 3E3OA 2MCFA 1X8XA 1OX4A 5HGXA 5ALJA 1XLVA 1M6VA 1CUHA 1U0RA 2AFIA 1AK9A 2C9MA 4G4SO 4LZNA 1AS0A 2PFGA 4P7JA 4PGFA 5CT5A 3TOXA 3ZWNA 1TJNA 1GA4A 1NV9A 5AM3A 3L7IA 4MJXA 3VBCA 4NLLA 5B37A 3GFQA 2O3UA 3WQRA 1EINA 1P91A 4BFUA 5I6DA 5EEGA 5CBKA 1TZMA 1YZTA 3EXFB 1IY0A 1E5VA 1I4OA 1S7CA 1VLMA 1Y9DA 3NZEA 3U13A 1QCCA 1ZA1A 3W9UA 4C14A 4F72A 5KSWB 4ZZ2A 1Z5WA 5UKDA 1QF7A 1CJKC 5I7RA 3LKBA 4DJEC 4KLAA 3STUA 621PA 4CT0A 2EV9A 3LP6A 5JNTA 2QTMA 3PNLA 1JG2A 2XGSA 4DUZB 2ISCA 1IJEA 4H60A 1ODTC 2WDPA 2OE2A 3TRJA 2EZ8A 2WC1A 2VQFB 2AN4A 1LBIA 2CMKA 2GTPA 2G6TA 4TTIA 4Q37A 4CCWA 4GOKA 2NVBA 5CR9A 4YIKA 1KVUA 3M1YA 3IGFA 1JIIA 3GP8A 4RJ2A 2EQBA 3DUFB 4Z2YA 3C3WA 2AXQA 4QUAA 4MAFA 4PZEA 3H1PA 4NAUA 1T6ZA 1L4KA 4BO1A 2RHOA 3AIIA 3OM9A 2XJ9A 5I5EA 2GBCA 1USUA 2Z56A 3WLMA 4J4BA 3SR3A 4XB6B 3UQYS 1L8OA 2B4AA 2FG5A 5GTDA 1FYXA 3AZPA 4IWYA 1OT5A 4KVAA 4LGVA 3OJXA 4JKOA 4CGZA 4JB8A 1V35A 1JRLA 2UZ0A 4CKEB 1NHGA 2NO1A 2XUIA 1NIJA 4GE0A 4PG5A 3OTGA 1F5NA 3NYIA 4M6WB 4RJIA 4QSHA 5ALHA 5HS6A 3IV6A 3V7FA 4AIIA 2BV3A 4FYJA 4IDNA 3I6BA 4BLUA 1S3IA 4INOA 3KFVA 3AVWA 2YRFA 1Z0FA 3DAFA 2HDHA 2VDWA 4PO8A 5HOQA 3JARA 4R1NA 2W5UA 1M8KA 3FSGA 3EVTA 3QWBA 4EF6A 3VAYA 4MCAA 1MFZA 2R751 2E7ZA 4S0XA 1MABA 2P2GA 3U4IA 4EFDA 1H6BA 1O96A 3EQ6A 3GGDA 3JQRA 3KKQA 1BA3A 4OHWA 3T3MB 2YL2A 4D7AA 3CUKA 2J5RA 4GNRA 1CZOA 2FDCA 1PEDA 4C5CA 4G37A 2QRZA 2QUJA 2B4YA 3K1AA 3LTNC 1NUPA 2CNOA 1N5OX 1AKNA 2CK3A 2TMDA 4M37A 4HTAA 5E4FA 3WBFA 1M7GA 1NBME 5IABA 4BEJA 3DFKA 3S1AB 5BMVF 2QVGA 4GI5A 3BB4A 4YJ3B 4KH0A 5ESDA 3UFXB 1SCAA 3HABA 3V4ZA 3P20A 4L6IA 4KIUA 2ARKA 3NBKA 2D0IA 4DBVO 5D7NA 5JU6A 1XRMA 2VK2A 3EQZA 3TUZC 5CFPA 1U94A 3C39A 4GMGA 3RQIA 1BCRB 1JF8A 1PN3A 4FGWA 3ACDA 3QWHA 4L5AA 1H8EA 2HD4A 3KZKA 4WJZA 3R5SA 1GA6A 1L5MA 3VPBA 1RCUA 1KEEB 2FE4A 4MRRA 4KXXA 2PZ8A 5T6MA 5JAHA 1T5LA 4H7FA 2CNDA 2J85A 1ZVVA 1QLJA 1P72A 2C95A 5JIBA 2IYNA 3PA8A 4DZRA 1J0BA 2YVQA 1I24A 1P1JA 2Y4NA 4C4SA 2EG9A 4PZPA 2OQVA 1UWCA 4F86A 4MVJG 2PG3A 2V8BA 2YFHA 2BN4A 2W9XA 5D6OA 4LVUA 4O08A 2PK3A 1SELA 4TRNA 2QUZA 4RZSA 2RH4A 3DP7A 1F2TB 2BGJA 3GO4A 1ENYA 4HUQA 3V8PA 2IKSA 4UTRA 4CLRA 2JRLA 1M2NA 1NVFA 2GNPA 1MO2A 2B5VA 3IV7A 1ECLA 1AKVA 3MK31 3NBYC 4L3VA 2IWRA 4C5AA 2CNBA 3ZDEA 3IH5A 3HMQA 1HDGO 4OH7A 3QHPA 3U16A 5FYQA 1B6SA 2MTBA 2XBUA 1RXCA 2QQ0A 5H80A 4GOJA 2LIPA 2XT0A 1N2ZA 1GGEA 3I5UA 5K8IA 5T3YA 1PNRA 2ZRLA 1KI1A 3B1XA 4Q4DA 2HJVA 1XDWA 5D5QA 2XGOA 4M0KA 1A9OA 3DLTA 4NH4A 2RHBA 1JPJA 4L4RA 4CEHB 3A31A 4LTMA 1RIIA 3ZGZA 5TPZD 3F8WA 2FFBA 4MYRA 1ETUA 1ZISA 3OCXA 2R25B 1Z4IA 4BVJA 3H97A 4L50A 1WP9A 3RHFA 3U1VA 3ZVLA 4W99A 4JCOA 4MPDA 4RVSA 4BRWA 3OFND 1EDEA 5LXTA 1G59A 4LXQA 4X65B 4EMBA 1B00A 4MRMB 1H05A 3CFYA 2BFNA 3AJRA 1XNHA 4NJEA 4KLNA 4R84A 2RK6A 1HZZC 1K75A 2ZJ7A 5CH8A 3OPYA 5HKAA 3COWA 2DPYA 2HMWA 2DXIA 3W2EA 2WG0A 4PPYA 4B43A 2PWPA 1H3FA 2YFQA 3WKEA 4PO1A 2J4CA 4P34A 1YVDA 3PTZA 5EKDA 1TQ4A 3UGTA 2QVLA 4GPTA 2R1VB 3U7QB 4MKRA 2Q6IA 3II6X 1TKAA 3F8SA 3C74A 2VDUE 1P2BA 1GADO 4TVKA 3KLBA 3SYLA 1H2FA 2O2ZA 4RAQA 1MCZA 5KMGB 1H85A 4ZI7B 3SQMA 3OQNA 1T35A 2B1JA 2YWJA 2RJ3A 3TIGA 1FX0B 4BLWA 1DQZA 1I3OA 1V1JA 1ZHFA 1U04A 4K9DA 4BNGA 5I7EA 3E3MA 3UJ3X 4Q6WA 2QE7D 2K87A 5LJLA 3DOOA 4Q1EA 1I4TD 1BMFA 5JH7F 1UMCA 4PC7A 3U4MA 1S8OA 2HF8A 3VUEA 3IO3A 3OEEA 4BLVA 2A5GA 1XLWA 3T0FA 4N76A 2XMBA 1THTA 3OKFA 2GZSA 1OA0A 4ZVSA 1Z8FA 4ZHQF 2VJPA 3BE6A 1G8HA 2EVWX 3KEFA 3DMRA 2GZHA 3QM1A 1VSVA 4ISBA 5ALKA 1IHXA 1II0A 2ZT5A 4DNFA 3VO9A 4QOSA 1M2WA 5LMCA 1F8XA 4IRXA 2VK4A 2J5BA 3EEYA 3HKEA 4GVXA 2FPRA 2FSSA 4FN4A 4LAFA 4H6WA 4IZ6A 2VJQA 3EAGA 1N2BA 3PUIA 1IE3A 2XCIA 4OMFG 5GZ1A 2RC5A 4BMCA 2XOXA 3RIGA 4LECA 4BBZA 1FP7A 4Q3AA 4TL9A 4WJLA 5KOYA 1WQ1R 1Z0UA 5H3CA 1FNDA 4L5YA 5JNLA 4CTOA 3U19A 4DWVA 3IEVA 4RA9A 1E69A 5BSGA 1VP3A 4EFNA 2WYIA 2DWCA 3MB8A 4Y2TA 2A9KA 3CKLA 4UUNA 2E4UA 4XR4A 2C5EA 1M5TA 4HEHA 4I1RA 1O5IA 1FYWA 1QIEA 4OB6A 1G4HA 3R8CA 5A3QA 1N36B 1GNSA 3EIXA 5KAPA 4EY3A 2RKBA 3OWXA 1I7NA 4DQUA 3CUTA 3OC0A 4O8CA 1DEXA 1OGJA 1ZGGA 4L6AA 5AJVB 2ZWPA 4OJMX 1CNFA 3C5VA 4KP7A 4LHWA 4NJOA 4WBNF 3MERA 4ZOEA 3DNPA 1BX1A 4G09A 1MG5A 2D2FA 3TCKA 4GWGA 4ZYVA 4YMVA 2Z8YM 1KAEA 4GZ5A 3ZLJA 1V9SA 3DDZX 2GN4A 4IUYA 3RAGA 1Z73A 4Y9SA 1DZ3A 4MV5A 5DGDA 4RJJA 3SJ7A 3RFFA 3HVKA 3FPJA 4R8LA 5HJEA 1Y6GA 4QU5A 3FI9A 4TMZA 1CUUA 2EP7A 1P4SA 1SBNE 3UMFA 1VG9B 5I4KA 3DDCA 1IATA 1P7YA 3K1TA 1FRNA 2C7GA 4G9BA 3AUTA 5EMMA 4CQMB 1EI9A 1EPUA 3IRUA 1J1ZA 3LT2A 3WYGA 2P0AA 1PT8A 5E3JA 4KIJA 2QSYA 3FW1A 4AU1A 2NZXA 5SZJA 4B44A 1NW5A 1SVSA 2W6QA 2YN0A 1TCUA 4Y6RA 2J3MA 3HC7A 1FDSA 1N2CB 2HU7A 1YQDA 1P2UA 4J2HA 4CRWB 4OLAA 2EIXA 3PU6A 3PF8A 3RKRA 4DXDA 2PGAA 3NEJA 4UXJA 4GOOD 1Y33E 2Q5CA 3PYMA 4M1OA 4UAJA 4HDOB 4P4SB 5JJKA 3IQGX 1SG6A 4S35A 4JBYA 3T34A 4QXQA 1OFUA 3HCEA 4LZWA 4GR9A 1U3WA 4CQLA 1JW9B 1PFWA 4L74A 4UFNA 2DLCX 10MHA 2I4NA 2XD9A 2ZBVA 1Z33A 2AWOA 3D6HA 1J24A 3I6ZA 3OF2A 1BX0A 3AR7A 3OBIA 4J3FA 3STXA 4BVLA 1IWBB 4O0MA 2Q6KA 4MQUA 1M2FA 3ANSA 3FVTA 2M1XA 3O8QB 5JAIA 3VPSA 4RUKA 1JJAA 3WL4A 3EG9A 1RTKA 4PPQA 1M33A 4RESA 1LTHR 2QMHA 3O9VA 4C7XA 3A1VA 4RHFA 4WNCA 1SZJG 4Y3UA 1HQYE 1C7EA 2J87A 5HK8A 1EM8B 4G8JA 1NGSA 3M8KA 4LW8A 3G79A 4QAQA 3CLHA 4NZZA 5TIIA 3TLXA 4AP9A 4MNTA 1AUVA 1K3UB 2WA1A 1TCAA 5FAXA 3VX4A 1UM9A 2P78A 4BNTA 3Q0TA 5KSPA 5KEIA 1L5ZA 1DTSA 1QOQB 2I6XA 5J5AA 2EYQA 4DA6A 1O9GA 1JT9A 1RWXA 1UT5A 1VRCA 2C54A 3LGXA 5EIHA 4AS1A 1ZU4A 4Z0HO 3JASB 2O57A 3ECSA 3QVVA 3U4QA 2PUBA 2WV7A 3OCJA 3ZE9A 3DLBA 3RROA 3QOXA 1S8FA 1U0HC 3A9CA 1R15A 1TUBA 3WSVA 2W8BA 3HK2A 3IDAA 4HDMB 4X9XA 3I1IA 1ZK4A 3KJIA 3P7MA 4LOIA 2WBLC 5CNKA 4JQSA 2RK4A 5HIIA 4XXHA 4O2BB 3E3LA 2IC5A 1PL6A 1JVSA 4Q3DA 5FWYA 1SCIA 2HIMA 3RREA 1QE3A 3DFIA 4CYMA 3KQNA 2BEVB 1PSWA 2C9DA 3ZVRA 1L7BA 2DLDA 1ZJ6A 3GLIE 3DEHA 3IEIA 3OLVA 2X3UA 2IF2A 5B1YA 1E0DA 2Y93A 2DFTA 2FDRA 2O5EA 4JL5A 1E2PA 2RFLA 3E3NA 4YFVA 4QUEA 1CUGA 1KU6A 3TLCA 3WNBA 2Z5VA 1FP6A 1NVAA 2NZ8A 3EGWA 3A0RB 4HVTA 1RAIA 3TKYA 3UF0A 3L0CA 2HCJB 3RHTA 1U4SA 4MV8A 3CBGA 5FB3A 3O3MB 4P82A 3N1UA 3ZH2A 1FFGA 2OLEA 3CLRC 4QG3A 4D82A 5C1IA 3RSSA 5MN5A 5C51B 1F8FA 3TOZA 1T0UA 4CMBA 3GV0A 1QFYA 1QK4A 2WU4A 1YSCA 3VO8A 1XCBA 2X0DA 5BVHA 5JS6A 5DM70 8ABPA 4DZTA 3BM5A 2X5XA 4I1PA 3A26A 1G8FA 4U7GA 4WZZA 3QBDA 1PTJC 3G1UA 5C1OA 2YJGA 3B13B 3SSNA 4DIFA 1II8A 3D5TA 5B5SA 1QCZA 3M5WA 3RASA 1HE4A 1S2NA 2BBWA 3RWBA 3PC8C 4JT2A 3EFOB 3MYRA 3ER9A 2VJBA 2NAFA 5JAMA 1YZQA 4ETIA 4HWRA 5ALVA 1N5KA 1P0MA 3OJ0A 4X97A 1XRLA 1IUKA 4B71A 1DJMA 4IVQA 3L6EA 4NV0A 3PDUA 2YDYA 3ER6A 4JYPA 3ZKWA 1ZOPA 1YGPA 1F6DA 3A0UA 4L51A 3K32A 2WE7A 4OM8A 1XAGA 3B70A 4NPCA 4X6XA 4YJ3F 3L6DA 4W6ZA 3W2IA 4DTIA 4BJ5A 4QX6A 4FNAA 1BU5A 3IBGA 1T3LA 4S0ZA 3BHMA 4RELA 1BAPA 1P9OA 4NCNA 5IZCA 3WGOA 2QENA 2CV2A 1REQB 2ZR0A 3A10A 2OA0A 5LQKA 1JXOA 3B6ZA 1KJWA 1V5GA 1GGKA 3JRWA 3KZ1E 5ENDA 4F4HA 1LTKA 3GRVA 3KD2A 1A72A 5IRCD 2EW8A 3BA6A 4KN5A 4WXRA 4ALKA 3AEQB 2IDKA 1LSJA 1WRBA 4PLGA 1FUEA 3AG6A 2QT9A 4UREA 2BJVA 1VMIA 3M7IA 2POCA 2I7CA 4CHGA 3PQCA 3G0HA 3LCUA 3MTQA 3WS7A 2B4QA 4P35A 2NP7A 1RVDA 2X58A 1V5EA 3HWRA 2NZVG 4KR9A 3L46A 4BMXA 1FXWF 2H9IA 2VDNB 3FTQA 4JXJA 4C1NA 1WSWA 1KQOA 4UEOA 1CDZA 2CYAA 5IN4A 3V4OA 4XB1A 4OGWA 3PHIA 4OCZA 1DOHA 3LUFA 2W83A 1O6GA 3NCHA 4JUBA 3WL6A 3HB9A 4J16C 4UBKA 3TSWA 5JNRA 1E2KA 2QTWB 3KWJA 3G0DA 2HPAA 1EFAA 2IUFA 1ECGA 4ZANA 3F8TA 3VO1A 5EJEA 5JBIA 2RHDA 1YZFA 3GJ0A 5GP1A 1CVIA 3SC2B 4DCNA 1UJ5A 4FYHA 1RT9A 4KPYA 2BISA 1L8LA 2E6UX 5JMPA 3VNBA 3PQ7A 4EEXA 1EVKA 2P9YA 2FW9A 2QQ5A 3GFSA 1GCAA 3EGDB 4DR5B 3SS7X 2HWWA 3GQBB 3X1YA 1E3EA 1NYQA 3CLSD 2OFXA 4HQFA 1WMAA 4MB2A 4RWEA 3ZXIA 3SY8A 5E8JA 1P2GA 1WB6A 4UEWA 4WIAA 3ZV6A 1NM5A 1C8KA 4MB0A 3T6KA 2GH1A 5G02A 4DV1B 4RKEA 1FVHA 3RPEA 2FPLA 2G4CA 4MVXA 3AHHA 2NUBA 4YA6A 2YKGA 2QYTA 4PQGA 3R7NA 1RJ9A 1ZGJA 3SYKA 4UMEA 1CRZA 3OIFA 2I4LA 1QQ5A 4P22A 3TZ6A 2OLJA 2VHEA 4I50B 4IIVA 3M3DA 4FKZA 3K71B 2ICAA 3A4YA 3W9BA 1EWRA 1B0ZA 1VMKA 1NL3A 2E21A 4R71A 3KSRA 4MEJA 2FJ0A 3A9UA 2OVFA 1UC9A 1I7PA 3S5JA 3T3NA 2D3TA 4KDFA 1CB0A 3ZU3A 2DUWA 4LFAB 4W8GA 2WWVD 4E14A 3DMGA 1RM5A 1HLGA 1E9VA 4AW9A 2G72A 1JP7A 3KDSE 2YR0A 4HEA6 2EJCA 2H7YA 2BKEA 1T29A 2HIGA 2NGRA 4H35A 4Z9FA 5CD9A 1MO6A 5EMKA 1JU4A 4F6RB 2C57A 3HY6A 4ZI7F 5F51A 4MVJP 2YMMA 1FU8A 5I51A 2BEWA 2ODQA 1VKHA 3ELBA 1GGHA 3CMCO 1E2FA 1XU7A 2IDZA 3WHPA 2QXUA 3ZDRA 2XT6A 2HF7A 2CHQA 2ZZNA 1PL7A 3V1NA 2V3CC 3UMJA 4EFMA 4YPOA 4PVCA 4KFTA 2HMUA 2BFFA 1XIVA 3LQ4A 3TINA 1CRWG 1NVTA 1OB5A 4RY8A 5FJIA 1HORA 3THWA 2QR5A 2D1YA 1RLIA 4WCVA 2J9RA 1G6KA 5EIXA 1P0CA 4M99A 4CMAA 1PJSA 4NQRA 1GGVA 3VJRA 4C07A 2E55A 1XD9A 4ZAXA 4M9QA 2N0SA 3V8NA 1QB8A 3VJLA 1SJ9A 1U2QA 3DW3X 2H54A 2GFQA 2AC4A 3HMKA 5KJCA 3NMUF 4NMWA 4P32A 4UBNA 1HOXA 1X3SA 4P3NA 3HM2A 3R7BA 3UTCA 2OD7A 2YXDA 4LVOA 3W78A 1SKYB 1TUEA 4NH0A 1U0EA 1QMGA 3T9FA 3DD1A 1E6CA 3PVZA 5KWSA 3EGXB 1A88A 1B6GA 4GL4A 1NA5A 3CNOA 1VLLA 5FA8A 1GZVA 3K9NA 3L04A 4GZ3A 1RXWA 1A27A 1IBKB 1JDNA 2AOXA 4LRQA 2WVAA 4KMSA 3QVGA 5A5DA 3J7TA 1EBFA 4HNSA 1NJSA 2CDAA 1U2RA 4GI3A 4NG5A 5C8ZA 1OMOA 2GZAA 3FWPA 2FRVA 3MRXA 3MS7A 4TZ0A 1NV8A 4E6PA 5IX8A 3QX3A 3BBPA 2HHCA 5CD1A 2Z2IA 1BXRB 2OXRA 4YUYA 5BYJA 3OKPA 4YUXA 3NI2A 5DN9A 4KPUB 5KINB 2JEOA 3OCZA 4P84A 1V1RB 1W36B 2X3YA 4CG0A 2O8DB 3WV5A 3OZBA 1PR9A 4OHRA 3EDQA 1EEXB 1QP4A 2UZ4A 4YJGB 2GN1A 4HADA 2P9QA 1HGXA 1FDIA 2GEKA 3HCFA 3THOA 4ZIRA 2HRBA 4JBLA 4MYCA 3E9EA 3MGKA 3TD9A 1W5SA 3QPDA 3FPGA 3QMWA 3NIFB 3A4LA 5FPHA 1H4QA 4QDTA 2DKFA 4GKVA 5DHAA 3KJHA 4RVDA 4R9UC 3E2MA 2QM3A 5H5JA 2ZM6B 1R0CA 4WDRA 4D5GA 3TSZA 4UBJA 1Z82A 2YBEA 3QBVA 2LDBA 3FZQA 3WWPA 2PWYA 4PYIA 1U1FA 1IPHA 3FHJA 3HP4A 3GGSA 3IMEA 2BY4A 1LBSA 13PKA 1E0KA 1SPXA 1A2KC 3A7DA 4OXQA 4PV7A 1GPDG 3SYTA 1QQAA 4ZO9A 1J8FA 4RPJA 2JHCA 3TDMA 4IICA 4OVKA 1XEAA 4WI1A 1EVJA 1CUEA 5AICA 3QTTA 1ZR2A 2O2EA 4G0NA 4HZGA 2ODPA 3OZUA 4S3MA 2P9JA 5E6SA 3MJHA 3OPMA 3UMBA 3WRYA 1ABBA 1OI7A 1OXKB 1MT0A 1I4EB 2VP5A 3LA6A 3QU2A 4I55A 3WLAA 3RSFA 4X8OA 1KTIA 4MI3A 4IQ4A 1T0PA 4HAVA 1BHSA 2O5RA 3M1LA 2XZTA 4CVNA 2C07A 4B3RB 2DHQA 2GZRA 4NL4H 2GRUA 3K92A 3IQXA 4UFPA 4AYTA 2B4RO 3SVLA 2GBGA 4LOAA 2ZUCA 2XE4A 1ZXXA 4G0VA 4RKWA 3VHXB 3B5IA 3P0RA 5AW7A 1FL9A 5ALIA 1I7QB 1TEHA 2WOOA 4FYVA 4K9PA 4K28A 1RYFA 3DKIA 3X1JA 1Q19A 4BOYA 3I2FA 1ODIA 4FSHA 4XSVA 1FQOA 1NR5A 1WD7A 4RV9A 2QD4A 3QKRA 5BWOA 2KMLA 1K6EA 4C20A 2JJ8A 1DRUA 3TLKA 2G07A 1FFYA 1L5WA 3OY2A 2C58A 3LRPA 1TK9A 1LXCA 1UAAA 4K81B 3BZUA 4BJ3A 5CFOA 2JARA 1U6JA 2HA3A 2Y99A 4O4HB 4A6PA 2ATIA 3RIHA 1L5YA 5FL3A 5CJPA 4LE2A 2XNSA 3FFBA 3PUYA 5LIPA 4HXYA 1UFQA 1JQAA 1EGHA 1WBJB 2J1LA 3PE6A 4RD6A 4WK2B 1JDJA 3PJDA 3Q10A 2ILVA 5KKCA 5ITSA 2PUCA 1GHTA 1MHPA 2VWPA 2WSYB 2V6FA 4GMHA 5E3IA 4MWTA 4YCBA 5E6RA 3I9LA 1G8KA 5HFAA 1AV6A 4J94A 2WIKA 3ELWA 5EMNA 2G1AA 2V45A 3LUGA 4O2BF 5K3FA 2QL9A 3WSWA 5KYWA 4RMGA 4BIMA 3GLFA 2VJKA 3HDQA 1T1RA 4DL9A 2KB0A 3AETA 1GUFA 1TJYA 2NYUA 2UVQA 4JC4A 1BVYF 1TLFA 3CZMA 5TV2A 1KVTA 2OESA 4M88A 4LJ5A 2VOEA 5DKFA 2FE1A 2JCXA 2FMXA 2WQZA 3TLMA 3AV0B 1K6MA 4ZVVA 2ORWA 3ZQ4A 5B4VA 3BQNB 4WKBA 1RRFA 2D62A 2O8VA 4YGYA 4CLEA 4DMGA 1NBIA 2VNSA 1SIWA 3DT6A 2YJ5A 2CHVA 4HGOA 1UOEA 4K9MA 1G2QA 4C6HA 3HO1A 1HDXA 3AIOA 5J2TA 2AN1A 5B6JA 1SKUA 1DCKA 4E5PA 3R74A 3CEJA 5B2EA 2L69A 4KQEA 6NULA 4HHEA 2KWIA 2JLQA 1PNVA 1H2WA 1XMSA 3KDAA 1Z12A 3PZBA 5FIUA 1B2RA 1NC3A 3BMCA 5EXEA 5KNCD 3D6FA 4FOPA 1XZ8A 2YW2A 3TZHA 3BH7A 5F2EA 4FKBA 3GNQA 4GXRA 4JY7A 1C4OA 1BGXT 2WJPA 2R5NA 3RK0A 2A8YA 5B7QA 1JLHA 1DO2A 4QBTA 1Q1NA 1QV7A 4ZPXA 4HRVA 1NJ6A 3ETEA 5KTNA 3BMQB 1AOXA 3WI7A 1EFHA 5AMXA 3K5WA 2EDAA 2VDMB 4AL4A 3F7OA 2AVDA 4HDAA 1W0CA 3KQHA 4BV2A 4GP7A 2QZPA 4B6JA 1QCYA 2D8AA 4LNUA 3ZKAA 4Y6LA 4Q03A 4JDPA 2QQGA 4MIOA 4E2ZA 1UANA 2EZUA 1PKXA 1Z4MA 3A37A 3IXLA 2XQFA 2QDKA 5C52B 1M1ZA 1U90A 2XMPA 2H2GA 4C4XA 5JYCA 5IC6A 2MSCB 4B3IA 4M53A 3GMIA 1ZKMA 3R3UA 1M2GA 4F7DA 4IG9A 3FYCA 1JHXA 2H11A 3LBNA 4QO8A 1BTOA 1O6FA 3TIIA 2VPZA 5J47A 1MJ5A 3NM4A 3TNLA 1Q2UA 4PG7A 2N3ZA 2ZJ0A 1FDTA 3RSLA 4B9AA 2IV7A 1FMFA 4IF6A 2JCVA 2AMFA 1PE0A 1V11A 3COYA 1LC3A 1SWVA 3H5IA 3RVOA 1A8PA 4ERXA 5ERXA 4LJ6A 2YNMC 3WL3A 3LUJA 4NOKA 4BNUA 4CF5A 2QMZA 1ODJA 3FNGA 2I66A 5JSQA 1BEUB 1GLNA 4HRYA 4MOWA 2FZEA 4WE3A 5GQSA 2ODTX 1CLUA 4KX5A 5A7GA 4HWKA 2PTHA 4AC9A 5EIAA 4E4TA 3OU2A 1YF3A 2DC1A 3WDMA 1UJMA 4L78A 3HUEA 1CUJA 1YU9A 2HK6A 2R96A 2ZTMA 4B3FX 4Z0NA 4TTQA 3K09C 2QJWA 1W36C 1KO1A 2ZBPA 4MA0A 3ZY5A 3OM0A 4J0CA 5SZHB 1GGNA 3TW8A 1J7JA 2JCGA 1XA0A 3SBXA 3LKZA 2X8JB 3PJFA 3MWDA 1JAIA 1WP4A 2WJ6A 5NULA 1FNBA 3TNDA 1A5AB 2VAXA 4LZOA 3R7AA 4U2BA 4C0SA 1PEAA 2HLPA 1OX6A 4K03A 1ZCAA 1AV7A 3K31A 5JEEA 3HYRA 3KLPX 4KN6A 4MVJA 5SY9A 3UBMA 2PH7A 5CX1A 3DT8A 3FUTA 1RKVA 5A05A 4NXNB 3LP5A 1VYVA 2HDWA 5AXCA 5IJWA 4RHEA 1YTLA 4R8MA 3H8WA 4YXWA 4DRZA 2CUKA 3C3KA 4MI9A 3DKKA 2R65A 2R00A 5BW8A 4EL5A 1PR6A 3EOZA 2W6MA 3N0VA 4I50F 1Z8HA 3I3OA 3K8YA 3M3PA 5ALXA 5CT9A 1KZHA 2GJAA 4ZAYA 3AUKA 4Q9LA 5M3BA 3MYYA 3FOAA 5EP1A 1VBFA 4CCYB 4UQPA 2PCJA 3K73O 5LBTA 3RYTC 2EATA 1UT8A 2D3WA 5HM8A 3LGSA 3AEXA 1XDSA 1C8BA 1TU3A 4K7JA 4UCQA 3T38A 1D1QA 4KX3A 1F2UB 1K9VF 1LZKA 1A5TA 3BULA 5REQA 3LUHA 1RLOA 4IJMA 2R79A 2UZ1A 1ZIYA 3H5OA 3N05A 4LGYA 5K3SA 3KS9A 2DFLA 4BV8A 3WOHA 1QNLA 4HLNA 4REQA 2O7VA 2Y0BA 1RQXA 4EVRA 3KVVA 5ITZA 4AAYA 4P33A 5KYUB 3VDQA 1E79A 4X93A 2WWIA 3WGGA 3IIMA 3LBFA 2BELA 4MR8B 3UHOA 2V9PA 4WBXC 1YCDA 4CFSA 2ZKIA 1CUFA 3FLMA 3DKRA 3MGBA 4L9WA 3UVEA 1TMKA 3QVKA 3AYXB 3DDUA 3LLSA 4EX7A 3LNTA 4M7WA 3M5DA 2EOAA 3RK4A 1U9YA 4HV4A 3ADCA 4DAOA 1A8QA 1EBBA 1W85B 5AVOA 3B8EA 3VR5D 2C0CA 3E7WA 3LIIA 5BR7A 5FORA 5KYYB 1XF9A 3FPSA 4JA2A 2GZ1A 4U2CA 1N1MA 3VXKA 1NQWA 1NKTA 1YVPA 3L7MA 3AY6A 1L6IA 2BOVA 4FP9A 5ALTA 4B9EA 3JQ9A 2NU8B 1GFSA 3SS8A 1HFEL 2I99A 3JWPA 3REQB 1HV8A 4EI2A 1GNVA 5HJ5A 5A0TA 2G83A 4TMTA 5A3JA 3FNQA 1BKYA 3FYHA 1BS9A 4LYHA 4F2DA 2RDMA 1NF3A 2XITA 4LJYA 4NU6A 4PZZA 4QQRA 2VTBA 2P9EA 4MYSA 1CR2A 2ZR7A 1U1IA 3CO5A 1OI3A 1DV1A 3QBEA 3AF0A 3Q4GA 4QG7A 3RVJA 1O9HA 4WX2B 2JJ1D 2NU7A 2ZYUX 1L7AA 3PWTA 1OHHD 4YP0A 1IM2A 2JIQA 3F6SA 2GD0A 2K2QB 3AP1A 4TGLA 2FPWA 1AF7A 3MM4A 5LCXA 1H94A 2CDBA 3V4SA 4UDYX 3G0IA 2CF5A 4M9XA 4YV1A 2PD3A 1AHIA 4DR3B 1A4UA 2R8EA 4N03A 4RS4A 3SZ3A 1Q6YA 4U0KA 3W2HA 3CZRA 4PC3A 5JSZB 1GQRA 3PKJA 4ID9A 1LC0A 4PWZA 4XUEA 1P1IA 1I2ZA 4KO8A 5TDHA 2A59A 3S2IA 4RY2A 1SKBA 4L4XA 1P8JA 1P2VA 3OT4A 4X54A 2ORVA 3P9QA 2GM9A 4QTYA 2W2LD 3JVUA 3N2YA 4YVFA 5TB5A 1ZZEA 4DLKA 4MDEA 2P27A 3W5IA 4MRPA 2CVHA 3NAGA 2QTGA 4TWIA 3IAHA 2RGYA 1OXUA 3HDYA 2NO9A 1L4MA 3U48A 4GO1A 2YXLA 2EZTA 3OKAA 4U7TB 1QK5A 3UO8B 2XNDA 2ZS9A 1RQ7A 5JD6A 4QNNA 2FEMA 2IX9A 1ISMA 1GU1A 1UKBA 2J9ZB 3G6KA 5JVDA 4OF4A 4F91B 1PG5A 2A0XA 4L5CA 3UV3A 1UPBA 5JASA 1N2IA 5AW3A 2A92A 3PZRA 3PRKE 1HEYA 3WGMA 5CNJA 5I4BA 1P9RA 2JPDA 2IJGX 3LZCA 2DG2A 3C8UA 4IDAA 1RLJA 2YDXA 4R51A 3R7WA 1MA0A 1EE9A 2Q0QA 3BA1A 3P0HA 4E07A 4UCWA 5E2IA 4IJ6A 1Q6ZA 3OX4A 1PS0A 1CUSA 1NVKA 1UPFA 1FSSA 4XPZA 3UK2A 4C08A 2AOVA 2HWKA 3NIBA 4ENPA 4GI7A 3JQAD 1PIWA 1Y48E 3GA7A 3WQBA 3DE4X 2JLAA 3JQ8B 5LQCA 4JQYA 4X7PA 4EY7A 2PT6A 3PHLA 3DZGA 3T1OA 3MZ0A 3HY3A 2QLFA 2ZGVA 3F97A 3L9XA 1V9CA 3D9QX 1KJYA 3C3PA 2Q3JA 3ANLA 3DTNA 2F64A 3TLAA 1E4EB 3I5MA 3LX4A 1PP4A 3C24A 4MWBA 1ZGZA 3W7VA 1JR4A 1QDEA 2IV3A 2GETA 4G67A 1QRTA 2QLBA 3RVSA 1BOOA 3ICPA 5JJLA 1WDMA 2X9GA 3O31A 1P77A 2PLAA 8ATCA 3S27A 3TK1A 3R6TA 5LOVF 1HE8B 1WQ3A 1AQ6A 1EFLA 3ITNA 1POWA 1XMXA 3AY7A 3OZSA 3NORA 4QUBA 3ZTWA 4LF7B 4BMOB 1NXOA 2VHTA 2JAXA 4M22A 4D4MA 3PC2A 2EHJA 2ZJAA 4O4HF 2IZ7A 3Q7SA 3JZMA 1ECBA 2JI7A 2QN6A 3Q8WA 5T4EA 3H1FA 3C3JA 3DYBA 2QMEA 1HA3A 2AYZA 1LA2A 2AN9A 2IIVA 3OI7A 3TRHA 1LVUA 4BNDB 3LBAA 3LQFA 1ORTA 3HEBA 1E5QA 1XVAA 4FJ2A 6AT1A 1AQLA 2IQIA 1QG6A 5KHAA 4X0EA 1C80A 1VJ0A 3K9CA 3NR2A 4ND8A 1NFFA 1YC5A 2WJYA 3UV7A 4OQZA 1WA5A 2MSNA 2YVLA 3PNQA 5FBHA 1S2IA 2RHCA 3N6RA 2VT7A 3K96A 2H6EA 5D3MA 2UYCA 1IBMB 1PZGA 1G1MA 1VE6A 3E0QA 1BDIA 3EZFA 3NVKI 5I4IA 2WHQA 3QFTA 4XGQA 2PU7A 3J81k 3G9XA 4IVNA 3H19A 5LLTA 1TZCA 1U1DA 2AD5A 2FPMA 3DBLA 3ROEA 1CE8B 1NVXQ 4EVSA 5JCXA 1H2AS 1H4SA 1YMUA 4Q3BA 4QREA 1WX1A 2QD3A 5FJJA 2O19A 2R87A 1CUDA 1SXJE 4HX2A 4QU0A 2JIZD 5FKJA 4B7CA 4S1OA 3H3JA 1O3YA 2AYYA 2ZATA 2J46A 5M7EA 3G2LA 4RQBA 3T5AA 2Q3MA 2ZQ5A 2O5CA 2OXFA 3TTVA 4XJTA 5LLSA 4GR4A 1LEHA 1GKUB 1EX1A 1H0KA 2HXSA 4ZCQA 5TMPA 5FPPA 2BFAA 4LIPD 4R5HA 2Z04A 5HM6A 2XNKA 3RIEA 3V7UA 3QXJA 1PGJA 2PRYA 4QA9A 1Y3FE 4PRZA 2HBRA 2GCPA 2DMRA 3TLGB 1QDLB 4DDHA 2JLVA 2QBYA 1XHEA 4ND1A 4L8LA 1IQUA 3OPYI 3MTAA 5IM5A 3TTWA 1D03A 1U2DA 4F9FA 3CH7A 1ATZA 1S9HA 1Q95A 1U98A 2Q3HA 3LT4A 3SIXA 1RI2A 2BUBA 4Q05A 3VNQA 4UUBA 4DZZA 4RTOA 3RHSA 2HQBA 3DT9A 1R0KA 1ZX1A 4QBHA 3WB1A 1D6MA 2WAAA 1FUYB 1JA9A 3NGXA 5E2AA 2B25A 2OKCA 2XIQA 4FUTA 4OBBA 3PSAA 1E60A 3E8SA 3P4UA 4Z0TA 5BNZA 1ELOA 3PWKA 5DWQA 2FSGA 2ZK7A 2QLMA 2BFDB 2UZIR 2BM1A 2V7TA 1P7VA 3G9ZA 1IHUA 5HW0A 3BK2A 3JAKB 2Q5HA 3ZK7A 3NKVA 1RRMA 3GHHA 3L1VA 4X1YB 3SAJA 2GKSA 1DAPA 2DPMA 1KXJA 2VTKA 3PT5A 1M34B 4TKLA 3JQCA 1T9AA 4HK4A 3RVMA 1T4GA 3GK3A 1OI2A 1A04A 4CCSA 4F5EA 2X8BA 4HDNB 2E85A 2W8ZA 4EECA 2ZYDA 2YJNA 3U3MA 1IEXA 1IG3A 1PTKA 2MJLA 4H4CA 1QBKC 2HWUA 3ICCA 2Q7OE 1I6MA 1LPSA 5KNLA 1YAJA 4AUNA 2OGTA 3PGMA 5LZ8A 2UXDB 1QYDA 3W6NA 1IULA 3IURA 4JP2A 4L8WB 3SVTA 1KO4A 2KI5A 4RKQA 2CXSA 5EJ4A 1CQZA 1QFXA 3A6HA 3MT0A 2JLXA 2ZXFA 2XTZA 4Q01A 3SM9A 1TJ4A 2XTNA 3L7DA 4YV0A 1PG2A 1KDYA 2X0IA 1YGYA 2CHFA 3GUZA 4LS3A 4WZ6A 4FMDB 3RBVA 3RRJA 1Q11A 2PJUA 5CG2A 1EUZA 2EKDA 3VR4H 1Z75A 3KU1A 2V7QD 3CXUA 4ENUA 4XGKA 2QK4A 5DYTA 3VHRA 2R7NA 4LV6A 3IBSA 3BPSA 4B84A 3ZE1B 3FOZA 3ZCXA 4MKFA 3KWFA 4KQKA 3ZXXA 2AEEA 1V6AA 2P2ZA 4GX2A 1WMEA 2H17A 4OBEA 2FQYA 4UOQA 1G66A 1NRWA 5BNIA 1HC7A 1W2GA 4PYLA 3T5TA 3LE8A 3LDAA 1QH8A 1Y6FA 3U60B 3W3AD 1EWTA 3V5NA 2G06A 2M2IA 2G77B 2H2AA 2VKTA 3HA7A 4Y0AA 3D81A 1RWWA 1UMDB 4K3UA 1C0KA 3GPDG 4WZBE 4EMSA 1DJNA 3FUWA 5GJCA 4AURA 5B6PA 4RD2A 1DC3A 1K7FB 2YX1A 2GOYA 1ECCA 2ZBEA 1UH5A 3WIDA 3BDVA 1QAQA 4C30A 2XUFA 1F4PA 3RVPA 5K0TA 1GPMA 1V48A 3U31A 4QBIA 5G4KA 1RFLA 5CEFA 1A9TA 4OXKA 4DXAA 4X44A 2PSFA 1D6NA 3CB4A 3CX7A 4BMSA 2HC9A 2QVCA 3P0IA 2Y66A 1MAAA 3FN4A 3CH5A 1IMOA 4TS3A 3M89A 1C1DB 3AG5A 1DAFA 1HM5A 2EFGA 5FYDA 4G1MB 4IJVA 4ATNA 5AW1A 4BGIA 2IGTA 3NBZC 4FIDA 3GZNA 2RC6A 1Y6JA 4J0FA 4X8MA 1G20E 4XYGA 2CLFB 2P40A 4CV0A 3G2IA 2CDNA 5DHPA 1UC4B 3HB0A 4BX8A 4GBGA 4NHEA 5E7IA 1PZMA 1P2DA 2H18A 4HB3A 3HNOA 3GEPA 3HXMA 2H85A 3KQWA 3PDWA 5C5CA 4PLTA 4WT7A 3Q9SA 4CU5A 3TGPA 2XQVA 1LBTA 1Q84A 5EE1A 4PFJA 4BECA 2XMZA 1IOZA 4LV5B 3KQVA 1EP1B 3V8MA 5IH7A 1Y9JA 4TWZA 1FYEA 4QFBA 3TSYA 3FBWA 2JZCA 4RD3A 2XJ4A 4A10A 1TPZA 1ISFA 5SYNA 1JEJA 4GUAA 4QVKA 2OMKA 1ST3A 1ZNWA 3DNFA 3KKMA 1SHTX 4F04A 4Q3NA 1TU0A 1D9XA 3ZWKA 4CTJA 4ZYZA 3FD8A 3IUEA 1G5PA 3K0AB 4I5GA 3JV7A 4P3KA 3K0EA 1TUGA 4BGEA 1Y8CA 3CU5A 4FX2A 4NBSA 3AB8A 3UMVA 4QLOA 2XWJI 3EA0A 3R4CA 2J3EA 3DOCA 3TNYA 2ZSDA 3CZQA 2WF8A 4RA6B 1XJQA 1WHSA 1AM4D 1JHAA 3FOBA 1XD2B 1OOEA 4TMFA 2HY7A 1T1JA 3BSYA 3OSUA 4LYFA 1HYHA 4CUJA 3HCAA 5L45A 2EFDB 3CLRD 1O7JA 4NMHA 2C3OA 4D9JA 1QGYA 3H0KA 4GOXA 1RCTE 4YWHA 4GXTA 2VUTA 4B4KA 3SN6A 1NQAO 4DILA 3A11A 4UD2A 5GM2A 2HQ1A 2AI1A 2QZJA 4CPDA 3KSMA 4XDHA 5JATA 1MH9A 1Y3IA 3IBCA 1QKJA 5EHNA 1ZGHA 4EI7A 4YK7A 1HR0B 1VLQA 1TZ2A 1GKLA 4FEYA 5CYOA 4CDNA 3QLUC 4ZU1X 4DLLA 3OPVA 4K1XA 5JY6A 2IBSA 1JZQA 1YE8A 1ZONA 3RYIA 2F59A 2Z1MA 5I01A 3AR2A 4BWFB 2IPAB 3P97A 3I0MA 3BGVA 3VR6H 5A4FS 4AUEA 3LGAA 4EKIA 4CKZA 2NW6A 1ZN8A 3FE2A 3UAVA 1ZVKA 4KRGA 4KXVA 4O02B 4ONEA 3ZBUA 3ZGOA 4TVOA 1NSFA 2CMHA 2EEPA 2FMFA 4G5QA 3H1EA 5LZ5A 3ETCA 1TXGA 3O9ZA 1KGDA 5EZSA 5KTYA 2QAJA 2XE8A 5ABPA 2I2WA 1E2EA 5JZ9A 1TA4A 2GR9A 4G25A 1NBMD 4UPEA 1E5DA 2Q4OA 3PLNA 3HNPA 1AZSC 3PGKA 4W9RA 5E9QA 3E23A 1JHMA 4TTVA 3RUEA 3JQ7B 3EWSA 5TMEA 3WGTA 1LQ2A 3LK7A 1UUFA 3L84A 2C2YA 2J9FB 1TM4E 4LZLA 4HFJA 1KP3A 3HSSA 3DDNA 4KWCA 4URZR 5HIJA 1WDTA 1HI9A 3VHLB 4BQPA 1X1AA 1PF7E 3FMIA 3KT6A 4L4UA 4QECA 4R83A 1B8NA 4D46A 1K08A 4DWJA 3FUVA 5A06A 1N3IA 4OYHA 1BDJA 4JSYA 4MS3A 4UE6A 4HVCA 1XWWA 5DIZA 3C3CA 1Z2CA 4XYMA 2ZE8A 4ZICA 4CKWB 4M1SA 2COKA 2YWRA 3ZJVA 1W5EA 1MW9X 3T61A 3LY9A 1RWVA 2ADOA 4IKPA 3Q1KA 4U63A 3IV9A 3G0BA 4GI1A 1RU3A 1WZNA 2QIPA 4Q7JB 4QODA 4JV5B 4NBLA 2GI4A 2HK7A 1K6XA 4WA8A 3SQNA 4E5YA 5JS2A 1G20B 4ZTBA 1LBHA 3WIBA 3QI7A 1ZIOA 3JTMA 1D2CA 3ELUA 2X9VA 2F55A 1NDHA 3PR1A 2BRUC 3QG5A 5EHIA 3KSBC 2HAEA 2BIFA 4YRKA 2ZSKA 2WHRA 3ZHQA 3I53A 1H8HA 1N2HA 3E5HA 5FLXA 2J6BA 3C6KA 3ODGA 2CCKA 3UNXA 2FN8A 3RG8A 1PLKA 2GHRA 3TM5A 2ZJ2A 2GK3A 4EHNA 1ZFNA 4GX5A 2PRIA 4RC9A 5TEVA 5A2GA 1PT7A 1LSOA 4Y2XA 5F73A 1Q1ZA 1KEWA 1VA4A 5FADA 4ABTA 4CXMA 4AY3A 4RX1A 2CXTA 1SXGA 5T4HA 1KVQA 2O52A 2YW9A 2JB9A 3FVWA 2H4XA 3EZNA 4QQNA 5HF9A 4BU0A 5DNWA 3QX8A 4C78A 2C9ZA 3IOEA 4CQMD 2OFPA 1CPYA 1PZHA 1V47A 3JY6A 1JEQA 1O0CA 1J7KA 1JNXX 4MUYA 3FOWA 1K97A 1WDLA 2Q5QA 3UAOA 1TRKA 4N1AA 4P3OA 1RBZA 5C4MA 4AMGA 4AM8A 2WJIA 2XDWA 3PFKA 2EF1A 2VAWA 3LQ2A 1N0WA 3H0CA 4X71A 1JFTA 3SKXA 2H9AA 1P4AA 1XOIA 4NV3A 4ZK6A 1MHTA 4ZTUB 2BH9A 3FUXA 1IEQA 5JCJD 2KQUA 3RF7A 1DC4A 3ZV7A 1G38A 1P9NA 4ZYYA 3EUEA 2I1WA 1SH7A 5D3KA 4DLYA 1CHNA 1LCIA 5K51A 4TMKA 1BRMA 3EOBI 3QOYA 5KYKA 3GDHA 2REBA 3KKPA 2P0EA 1EX6A 3WGZA 2PWBA 2A1UA 2YZNA 3KU4A 5HE9A 1UDBA 2V6BA 4PPNA 1U7ZA 2B92A 2CV0A 2AFVA 4Q1DA 1SXJC 1USVA 4GAEA 3C3AA 1Q5PA 3B2EA 2P4QA 4H6PA 4IRUB 3T41A 2PZJA 5LDGA 3W4IA 2REQB 1TF2A 5F4BA 2BGMA 2WIBA 2P4UA 1V43A 2GJKA 3Q7RA 1M2HA 3BXFA 4HN4B 4BJHB 4JYAB 2QX8A 2NN3C 1RI3A 3H4IA 4KVFA 1KE2A 1BZYA 1CF9A 3R8FA 4DY4A 2J6IA 4PTLA 3QJ5A 5BYKA 1Q22A 2A67A 5K01A 5U9CA 3ANTA 4US0R 1ULZA 4YRBA 3LC0A 2ZAMA 1AGPA 2HRCA 4IXNA 1CX9B 2WIJA 4I1YA 5DXFA 4BB0A 4CV2A 1Y8ZA 4R9SA 4RFLA 3IEXA 1GL7A 2FFQA 2NPOA 4QU8A 4N0QA 4DT1B 2ZSEA 1YD7A 3H18A 1I7DA 4UCFA 3GWGA 1K8XB 3JQGA 5AQEA 4IWNA 1W19A 5HCNA 3WHKA 3FR7A 3O1HB 3T3GA 4X63A 4XVQA 4B7AA 5KWJA 4KE9A 3ZWCA 1I30A 3B9BA 1KOLA 3ORYA 1MXHA 1E4OA 4PYNA 2GK4A 5K0ZA 4HGNA 2UYQA 4UVGA 3EK2A 2XHZA 1UBJS 4UHEA 4F5ZA 2EQAA 4JWTA 5ES3A 1JFSA 1K3TA 1U28C 3O82A 4XM1A 1VSUA 1YMVA 1ZBQA 3W7BA 4EWLA 221PA 3T95A 3T3EA 3IHKA 5JV5A 2P7IA 4I4TB 3L7AA 4AXXA 4BXOA 1F0YA 5AXAA 4D1YA 5FL7A 4DV3B 4DCTA 4BPBA 4X60A 2HOQA 3QFRA 4YHHB 4G5FA 3L0OA 3OMWA 3WMEA 5AT1A 5E7JA 1IVSA 5JUWA 3AFHA 3HG7A 1GRCA 2PX6A 3PRYA 2R84A 5JYEA 4JI1B 2PUEA 3EAFA 3EWAA 4LEIA 1G7RA 4Y2YA 2B0CA 1A9XA 4AJLA 3RSCA 1WXIA 3ESDA 1Y8QB 1JR3A 2Q1XA 3HKDA 2QN1A 2J3IA 2YUIA 2YWFA 3EN0A 1J2JA 3PUWA 4R6WA 5FNVB 3QKWA 1R1DA 4W1PA 2DBQA 1EFPA 1L7MA 2NIPA 1GFZA 4RSMA 4BX2A 2W2KB 1KHHA 4JJGA 1GPYA 4ARZB 1UEJA 3IR7A 4FMDF 2P77A 2FWRA 2RAPA 5DBGA 3CLUC 1GV1A 3CVXA 3CSDA 1KO7A 4L2IA 2DPXA 1JXQA 4JENA 3U3XA 1H3EA 2PTGA 4BQOA 4GBMA 4ZU6X 3ROKA 1RHQA 2QG9A 4QPDA 5JFOA 3BWCA 1FFSA 4PX9A 1IRIA 4QXPA 4EG7A 1QVRA 4OSPA 2C9BA 4H08A 1X3LA 1TA9A 2W2TA 3PQ4A 3H2ZA 5I9SA 2CLOB 1TK2A 4MWDA 1M67A 3WLIA 1GQ2A 4MQFB 1UOQA 3IT3A 1ULSA 1Y42X 5I8ZA 3E1KA 4HPWA 4IX9A 4J2OA 3T9BA 3IL2A 1G0OA 5T4FA 2GKOA 3ZNOA 3N28A 4X3CA 2WJGA 2UUBB 1AN0A 3CV3A 3W6UA 3KSZO 4MS1B 4CEJB 2AUMA 4AZ0A 4H7KA 1UT6A 1C7JA 1OWPA 1ZN9A 2AFRA 1LLCA 4C7OA 4PHFA 1P2FA 4YASA 4EGFA 3SEFA 3K1ZA 3Q12A 3TSAA 2AVNA 2PANA 3RFCA 5KVVA 3DYVA 3IOYA 3K7EA 5CDUA 2PMBA 1OIWA 5A9SA 4E70A 2V7PA 1P0FA 3K8ZA 1UBUS 2OV3A 4H2DA 4HLUA 1KFKB 1RHKA 2ZS8A 3AZOA 4YACA 1EFVA 1H1TA 3E5MA 4X8HA 4Y6GB 4F06A 1ODSA 4HTFB 2JH8A 2F8MA 3THXA 1EZ4A 1WZEA 8LDHA 1SZPA 4OOFA 3FCEA 4CN8A 3UT5B 3MC1A 3GYGA 4HBGA 2X1LA 1FYVA 3HLYA 3UAGA 5FUMA 5JJCA 4ZCMA 1XZLA 3MQFA 1CF4A 2FVYA 3N6VA 1T5OA 3ZEIA 2WWTA 4IV8A 4RVHA 3YASA 3MMNA 3M2PA 2FX5A 3TZBA 5LLDA 3FYSA 2A0UA 3KL2A 5TS2A 9GPBA 4ZT6A 4F2PA 2DHEA 3T1YB 4KVGA 4B7UA 3PFCA 3ZE0B 3FTPA 1CJUC 3QPUA 2FRDC 2B34A 2Q1UA 1Q0QA 3QEMA 3FKSD 3B9PA 4HGQA 3SKYA 3MWFA 4F5YA 4GLFA 3GJ8A 3KFLA 4NBVA 4JELA 4NIMA 4XM0A 3KPUA 3DXZA 3OHPA 1BD4A 2CXQA 5DI3A 5JT1A 1PZNA 2QG4A 4RYDA 2JI9A 2DQ4A 2F1JA 4EPTA 4AJJA 2AOTB 1NMYA 3V1MA 4TQUS 1L7RA 4TV9B 2R9VA 3P5SA 4YP9A 1U3TA 4M0MA 5GADl 4CODB 1I32A 1P1HA 1NNUA 1J8YF 2XE7A 1GLVA 4R2WA 5F1KA 1E1YA 2PS9A 1N4DA 5CCDA 4ZN6A 3STTA 1MTZA 1V25A 3NP7A 1I4WA 2ZTLA 3SCZA 1TO6A 3PEYA 1X1EA 5AVSA 1B0PA 2NUAA 3EVCA 1LJ8A 3BZWA 1GNRA 2W2QA 4KDRA 1Y80A 2DPLA 1P2SA 3EQ7A 2BONA 3QVWA 1NASA 4P4NA 3AKZA 3TTYA 1K7CA 3UHJA 3WMXA 4IEFB 5JOQA 1WWKA 1VGVA 2IYOA 2EL7A 3KOUA 3OZGA 3UMRA 3NC1C 2PIDA 2QJFA 2BGTA 3T7KA 1A9SA 1EX9A 3NBQA 1CRQA 2B5WA 1QFJA 5CFMA 1P7PA 1H5NA 1LSSA 4YQFA 4RTLA 4FE4A 4FHFA 4KGDA 3ONNA 5HWSA 3KG2A 2V4ZA 4EB6B 2EQ5A 3DL0A 4IS2A 2CLEB 2KLHA 4K0RA 4P4TA 2JFGA 1JLSA 1WB4A 4YIHA 2ZP1A 4R3WA 4UE2A 1KERA 2FPOA 4AS3A 4OREX 1OV6A 2DVMA 1E32A 4KO1S 4CV1A 1AXEA 4QNRA 5BSEA 4CIAA 1SBTA 3KT0A 1DDIA 2F3RA 4CGYA 1PLLA 5CURA 5A9TA 2IEIA 1J1UA 2D5LA 1US8B 3F73A 3NG1A 3N7TA 4B3TB 4J0HA 4OQ4A 4AG3A 1E6EA 1WM1A 2HCRA 4J4TA 3SX0A 3HU5A 1IXSB 2I2BA 4D9NA 3KSAC 4CL0A 2GJ4A 2IVZA 2EW1A 5JDCA 3I32A 4MHOA 3SC4A 4BFTA 4XIFA 1PX0A 2VJLA 2VJDA 3X1DA 2P6PA 3QTBA 1DUIA 4DGSA 3QNMA 4RORA 1Z34A 5DASA 2G4LA 4TWBA 1ECJA 3TQRA 4BNWA 4KR2A 1N32B 4YV2A 4D02A 1T4MA 4O2RA 3OD1A 3GPIA 3FSGD 3UXHA 1WUHS 5MHTA 2ZRIA 3ACCA 2ZG6A 3IPLA 3R5FA 4QRDA 4LF8B 2NWQA 2Y1WA 3DO6A 4U3JB 1GN8A 2JD0A 3GPBA 4NOLA 5HFJA 1PUXA 4JI6B 3ZE8A 2NNWB 4RTKA 1KI8A 2ZDHA 3QU4A 1HQCA 4BZWA 5FI5A 1GCOA 1XVIA 4O33A 4QZVA 4V03A 5FAKA 2GXSA 1HE1C 3K0HA 2WWXA 5AI9A 1DX9A 1AN9A 1VIVA 3EB9A 1U9CA 1TO2E 3CBQA 3TW0A 2ONJA 1R9NA 5FTLA 2G09A 4XTRA 1FX1A 5JZSA 1ESEA 4UHFA 3EXEB 3NTLA 2OR3A 1E66A 5HOEA 1NIPA 1NLUA 4IXMA 5CIWA 2UYYA 4I1IA 5HFNA 4KKXB 5CFZA 1U9IC 3ED5A 4GFDA 1W36D 3BT7A 1WUIS 2B3TA 1JHOA 2JGDB 1ZL2A 2Q99A 3EY4A 3KQPA 3MAAC 4KK4A 5SYAA 2C4TA 3EUFA 4J0JA 4YS6A 3WXMA 5HQTA 3DCNA 3G13A 5CT6A 5BSTA 3ZNPA 3MBOA 4H1HA 2XTJA 4KTVE 2OM2A 3R0ZA 1CZNA 4YCAA 1EG2A 1XWFA 4RZ2A 1PJ8A 1Q3HA 3M9WA 3N3AC 5A5FA 3HYNA 4WNAA 2OBYA 3B60A 3OE5A 1S96A 5J4HA 4J1QA 4K9RA 1QHHB 3ONFA 4X7RA 4HB2A 2RBGA 2WHXA 2SCUB 4HZIA 2VQEB 3BYZA 3DZHA 1Y4ZA 3ASYA 1XEWX 2CVPA 1O8CA 1Y4SA 3RYFB 4CLDA 5GONA 3AHDA 1Z6YA 2Q50A 1RAHA 1ZUD1 1GZ7A 4I08A 1QK3A 2VPIA 5AJUA 4AF8A 2P9HA 2DEUA 2O6HA 4D3DA 4L9SA 4K9KA 1FFAA 2Y1DA 1YR1A 4CR7A 3H99A 1RAFA 3PGXA 1R16A 3LO5A 3UG6A 3WP1B 1FU4A 5EINA 2OXCA 2ASEA 4CR6A 4KNYA 3IP1A 3PTAA 1Z0SA 4M49A 3PVCA 4LDRA 2ET6A 2ZPTX 3ZCQA 1YS4A 3MT8A 3HR7A 2XVXA 2MU1A 3G1WA 4F5WA 3I64A 4MVJI 2JAOA 4TT3D 4WFIA 3RUPA 2BFEA 2VO1A 3HS3A 2ZU0C 2DQSA 3QX7A 1A8UA 5CXXA 3WZ2A 4UFOA 4DIBA 3AFNA 4JUFA 5FTWA 5I7OA 3BMOB 2H5LA 2V3WA 2W90A 3AR5A 1YASA 3KBOA 1R27A 5EJIA 4OA8A 3NOVA 3NHLA 4KFRA 2Q5FA 3FWNA 1PKEA 3LHSA 1RNLA 3KB2A 1CXZA 2ZIAA 4XUGB 2H2HA 2RHTA 4CFYA 4LC1A 1N92A 1FSZA 1XRNA 5PGMA 4UATA 1DG3A 2ABWA 1OXXK 3IXQA 1JV2B 4YRFA 4B1FA 4PCVA 2OO7A 2OG1A 4O1MA 1OFTA 4PGAA 4HI0E 4TLEA 4DV6B 1QLWA 4FYXA 5C8YA 2XF2A 4FHZA 4RD1A 2CSUA 2HRRA 2VSNA 4CLOB 5EJ2A 5AJYA 5EI5A 5JWHA 5KKAA 1Z4KA 2V03A 3CONA 3KYCB 4LOHA 3K2QA 4OJKA 4Z1OA 1YJ8A 3TTTA 1COZA 3OX3A 3X3HA 5D51S 4ON9A 3WK7A 5IU6A 3ZU5A 5J58A 5T3UA 3TQOA 4D8VA 3Q3CA 4OHVA 4RIFA 4B2YA 1ES9A 4D3SA 3CRNA 4JYZA 4F3TA 3D7KA 1XPUA 2VF4X 1Q91A 3NV7A 1U11A 1U3VA 4F8EA 4HC4A 4RNCA 1E5XA 1N9ZA 3L7LA 4HYYA 4O2AB 1EFCA 2QL7A 3F90A 4G56A 1MC5A 2AZMA 1Z5PA 4BS9A 1KQ3A 1VQ1A 1EK2A 4I4TF 4TTRA 3BF7A 3CX3A 4G4JA 5FOUA 4BO7A 5C4IA 5LFAA 2XYRA 4F84A 5BY2A 5ICCA 2ZIXA 3B2NA 1SPBS 9LDTA 1MR3F 4ZT4A 3RM3A 5JXHA 4PHCA 5KCZA 1ZUHA 2XSZD 3EDRA 4UTZA 1GO2A 4DIUA 4MQBA 4JIMA 1ISGA 2ZRDA 1MXFA 1X1DA 1JAYA 1NJGA 1HYGA 1XN4A 2CHEA 2HSWA 2P67A 2WPNA 3IESA 2QMQA 2P2YA 4XWTA 5B58C 3AVYA 2X0NA 5IDWA 5DXAA 4U02A 3JVIA 3QE4A 2PA3A 5FCDA 5H0IA 2GPBA 3R4VA 4GQIA 4Q3KA 1A9RA 4TL7A 2Q46A 1JHRA 2VYQA 2XDYA 5FNVF 3I73A 2OBNA 4UHKA 4MS4A 3SYRA 4DEVA 3AX6A 4MVJM 1M9NA 4IOJA 4PRLA 4BEBA 3C7DB 4A6EA 1Q3TA 4OV6B 2O05A 4Y0VA 5ECYA 3MUFA 5DO9A 3TRDA 1GSAA 3IT0A 1SOAA 3MD0A 3EEIA 3BRSA 3AVUA 5G2OA 1KY5A 2OOSA 1LY1A 3DVLA 4N3NA 3S8YA 4DV7B 2P91A 3KR1A 4QBKA 2O8CA 3EPPA 3NBMA 3IPRA 1NPYA 1XKLA 4U8GA 4D92A 4Q1AA 4RTJA 3U81A 1T8SA 1XXHA 1TCCA 2Q62A 4P53A 4JMLA 1C5KA 1PNOA 4OP3A 3WYNA 2PJZA 1T2DA 2PGOA 2VJAA 4R40A 3TPFA 1HEIA 3UGQA 5KHOC 5LDDC 4RANA 5ESXA 4BVBA 4PM4A 2BFCA 4N3AA 1WCYA 2ZRQA 2J3QA 1PFUA 4TRRA 4ML3A 4WASA 1U02A 3C0KA 2QN2A 5BURA 2IEBA 2KM1A 3LVBA 4KO4S 2P5SA 1KOGA 1ZAYA 1GXSA 2FPIB 2Q2WA 2GEVA 3S29A 3ZW7A 1VLJA 3BRCA 4C06A 3HDVA 3MAJA 1Z56C 4JOBA 3WGHA 5AUOB 1XZDA 1CW2B 4RSHA 3C15C 5LOVB 2WP8J 2JLBA 3CKYA 4FB5A 5JD4A 3FTEA 1OU0A 5A2QA 4M1YA 1WVMA 2GSDA 2IW1A 3UWSA 3AYZB 3BJMA 1SBQA 4IXTA 3I92A 3K6JA 3FB4A 1IEWA 5DK4A 3TXAA 4F4JA 5CEEA 3LL7A 2FQ1A 4PAMA 1JL3A 3TMYA 4F4DA 5AKGA 1EJ2A 4XCVA 4GYJA 2H8KA 1L1EA 2RHGB 4IEIA 2FPKA 3F0TA 3GXBA 5JTUA 3QWFA 4YXFA 4TLDA 5BQPA 3LRXA 2XA9A 3VOSA 4ZGBA 2NSHA 1MIOA 4MI1A 4BFZA 5KTMA 3JALB 4G4SP 2FYTA 4B0PA 3I0ZA 1MABB 2A14A 1HEUA 4RPHA 4MGEA 3ZI4A 2V6MA 2XI4A 2QV7A 4RTRA 3OESA 3CVYA 2WJ3A 4B82A 1Y1RA 4WRRA 1TGVA 3EC2A 4KOEC 3GVXA 4DWOA 5TPZA 4J7UA 2IWHA 3RS0A 4L5BA 4AF7A 3N8IA 1QGUB 4HX5A 1E3QA 4JT9A 2P4EA 3MJDA 2HR1A 2RGDA 4QXMA 4F9GA 1U8YA 3G5UA 4RPKA 3M1IA 4I7EA 3VI4B 2O7SA 3JATA 1Y8RA 3OFNA 1SVNA 2PV0A 4PF1A 4QL3A 1QZZA 1Y6RA 4UHDA 4A0QA 3QVJA 2IXBA 5F98A 1RMQA 2HV8A 4L8YA 3H86A 4UNNA 2WQ7A 1KI7A 1KKLA 4MPJA 5K3OA 4H4DA 3WNZA 3ND6A 1VKNA 1MRNA 5FOVA 2ZAIA 4YJHB 5T57A 1TM3E 4HQOA 1H1LB 1PT6A 3PPIA 3BFJA 4XWOA 5J5VA 3UANA 4BKQA 4TV9F 1EXDA 5AI5A 2IYLD 4HP8A 1FRVA 2IODA 2ZUEA 3SGLA 3KV1A 4WESA 5EN4A 3VMFA 3RJMA 1SOMA 1HYQA 2Y68A 2G7MC 1T1SA 2QAIA 3IVAA 2FN3A 3K70C 4LMPA 3ILXA 3UHFA 1UMBB 2MMCA 2UAGA 2XCUA 4YALA 3V9PA 2QW1A 3F3SA 4Y2UA 5BV8A 3OVMA 2J5KA 3I76A 3KUUA 5BSWA 4K0KB 5AK4A 2XKKA 1XKQA 4Q3LA 1W44A 4BNXA 4HUQB 2A7QA 4OQYA 3QH4A 3HSYA 3L8YA 2NU9A 5JD5A 7GPBA 2R7AA 2CMGA 2C7BA 2FFRA 1Y34E 4XQ0A 5H7XA 4CQNA 4BUZA 1SUFA 4QRHA 1CJVC 3IT2A 3RTAA 3TF5A 4R1SA 1VHJA 3EOAI 3WGIA 4INAA 1ID1A 3V32A 4DNOA 1RYDA 4EITA 1WKVA 1LK5A 1GZUA 2NXWA 3AJAA 3EF1A 3QY0A 3I9FA 4M9UA 5ARCA 5HRAA 4ER3A 1K4MA 3JYQA 4KE8A 3U4DA 4PSKA 3WRVA 1SCKA 2M9MA 2ECKA 1AHNA 1C4WA 4XFKA 1JXMA 1Z2EA 1QOZA 5FUWA 1WSBA 1LU9A 3OCWA 3MMPA 4OLBA 2O59A 2PLNA 3LHFA 4M1MA 5C7LO 3EH2A 4N7RA 3TB4A 4CMIB 4ED9A 4PYJA 1MO5A 3JD3A 4G23A 4QPZA 1IN5A 1GNQA 2IPMA 4G0PA 3VR2D 2WJVA 6YASA 3BVPA 1OYVA 5HQ3B 1QYXA 1NMQA 4F97A 3DPIA 3H2YA 4CM6A 4W7HA 4D4KA 2EX0A 2V96A 2JGMA 4KV7A 4B73A 2ZE7A 1MQ8B 1XQYA 2VSFA 3U3DA 5JTTA 3HCPA 5IJ0B 1YBFA 4N48A 2H1CA 4MQ4A 4RK1A 5KX5A 3OFKA 4Y1RA 3BIWA 4TMYA 5GIPE 2XQGA 4H3VA 5IAGA 1RC1A 3DS8A 4RMJA 3BH6A 1J23A 4WV3A 4PRKA 2YCLA 4N6NA 4OJNA 2V5UA 1E1CA 2XVMA 4E5VA 4KIGA 1HH4A 3DDHA 4MPPA 4EELA 3ZVKA 5T8KC 3ZWXA 1GKYA 2FW0A 4ACAA 4AZ3B 5FLYA 5JRDS 1KQFA 1EVQA 1Q3KA 5FLEX 1F3OA 3IOMA 3V1YA 3NOQA 2ZVJA 5EZ6B 1Y0BA 4ZOLA 2XEDA 3F7NA 1K1EA 1RHJA 1RJEA 2ZAYA 2HF2A 2JBHA 3AB7A 3OA0A 3ETNA 4GMDA 4I9HA 3V2IA 1NE7A 4UTPA 5AOAA 3U4CA 2QXYA 1Z2NX 1LRKA 2SBTA 1DIHA 4ZZ0A 4IGKA 2YV1A 4V0ME 2XUKA 4QEDA 2Q41A 4ZT7A 1UMKA 4LXYA 3E27A 3N86A 4EG4A 4R3NA 1D4FA 3U40A 3UKOA 1J0DA 5AD1A 2HQRA 3OBBA 1H0RA 3OIDA 5CW1A 3RJTA 2NQ2C 1B26A 1KBOA 3CE6A 4Q34A 2P5YA 4Q19A 1FFDA 3KOXA 4DQLA 1YIAA 3A6ZA 4J9VA 2O7RA 4Q3OA 5HRUA 2RD2A 4OBXA 1PYGA 5KYTA 1MOSA 1Q44A 3TW4A 1Y4DE 3U09A 1GRVA 4HEA1 2HMYB 2J67A 1BWQA 3FPFA 3H9QA 2AMVA 3JR7A 3ZDYB 4K46A 2LPMA 1JFFA 1GAJA 3SJUA 2ZJFA 2DSTA 2Q1SA 5G1NA 2HT6A 4EGCB 1C29B 1KA9H 1OZFA 2LDXA 3HNRA 3KPWA 3W05A 4E32A 4YJ2B 1GV0A 3R7FA 2YYYA 2HCBA 4LTDA 3WGYA 2CXHA 2BFBA 1Y5LA 3GVHA 4EK9A 2JFYA 2VYND 4WFKA 3I5YA 1MB0A 1L4LA 1T6BY 1IVNA 1UP6A 4OM7A 1OXTA 4RA9B 3UHPA 2ESRA 3C7AA 5GMOA 3OO1A 4XH9B 4CEIB 3W9SA 4H77A 1LNQA 5FTJA 1RKUA 4J29A 4HBZA 3TI7A 2ZB3A 4MX8A 3VDRA 3ZH9B 3U37A 2E5FA 2WAYA 1OILA 2FMHA 4OI2A 2Y8EA 4ZKDA 1MV5A 3EUAA 5KC8A 2FMUA 4H7HA 4UUMA 1YR9A 3I09A 2DY1A 3HI4A 2IY8A 1CQPA 2GZ2A 1NBWB 4RCVA 3SXUA 2ZYRA 4OLJA 2MSDB 2OUIA 2BF4A 2F1KA 4JASB 5EGSA 1KMHA 1U3FA 1XLTC 2LBPA 2NYRA 1S01A 2EC5A 2WB4A 3B1YA 4LYJA 4R8SA 4FHEA 4MYUA 2A78A 1F20A 1WF3A 1QONA 1W5TA 2AKEA 1P1FA 3D5EA 3AVXA 2NADA 2QRPA 5EJ8A 3E9QA 3MCTA 2OYSA 2PLFA 4OXIA 3P2MA 4MXDA 4S1VA 3VPCA 4BQQA 1QBGA 4ZMSA 1YL6A 2I6UA 2JIBA 1AB6A 3MVEA 2DR2A 4UM8B 1HO3A 4CL2A 1NVMB 1PVDA 3HQ4O 4PYQA 4NCAA 5IAAA 1ZJYA 2AMYA 2HI0A 4Y7CA 4G5GA 2H48A 4GLJA 5LZ4A 3FGOA 3IQWA 1QR2A 1E3TA 3C5EA 4FW8A 3WFIA 1IY1A 3CZPA 2P3OA 2WR8A 4PANA 4DSNA 3OSZA 2B36A 4HDRA 1Z3CA 2J3LA 4KRXA 5E7MA 3B7PA 3QMMA 4KKVA 2RIRA 2PT7A 1ZQ9A 3WYAA 1Z83A 1PQPA 3KAQA 2B69A 4AYXA 3EZ6A 2BTOA 3B38A 1AJEA 1YQGA 4GMFA 1M0TA 3R3VA 5SV2A 3FI0A 3LCJA 2AI3A 2A0KA 4TYPA 4RZUA 4QM7A 3I04A 4ALJA 2VA8A 4GSKA 2QN9A 4M1ZA 4QEZA 4MV6A 2Q2QA 4MEBA 2BGIA 1Z08A 1MQSA 1KMCA 2RJOA 3A3NA 4QEKA 3S7ZA 3CO0S 5CVJA 5CBPB 2WZQA 2FQWA 1H5QA 2GZMA 4GI2A 1MOZA 3H84A 4KQCA 2GCIA 4BO5A 3D02A 1VC2A 3ECCA 2YRXA 3AKYA 4M76B 1LDEA 3O4HA 3ROTA 4PYMA 1A98A 2G9QA 3TIFA 4GXNA 1SURA 4XKJA 1XHFA 3VPHA 5BR8B 1UM9B 5DW0A 1VB5A 1P3Y1 3P1JA 3IUPA 1NXPA 3VBEA 5AJHA 1YB4A 4M9CA 2YY5A 1UXOA 4B35A 2PZGA 2V0NA 2VF2A 3TL2A 1DO0A 4P0PB 1FMCA 5BV1A 4MJLA 3K0CC 4LRXA 4BBAA 2BHSA 5D01A 2XE6A 3T3HA 1OFUX 1AIPA 5E4YA 4BMZA 4QLBA 4IXDA 4PC6A 1M1YE 3T8YA 2JFQA 3A58B 2RHHA 4AZVA 3GGOA 3EWIA 1BMTA 1C7FA 2X1HA 3CNBA 5EMJA 3VQTA 1EXVA 1ACLA 1USGA 2BHNA 2DBZA 2WAMA 1QC5B 2WM3A 5IT9A 3TVTA 3TNFA 3SXPA 3ORHA 3OQVA 4MULA 1P5ZB 4NRDA 1IC6A 1C1YA 4D8WA 2P9BA 1KS2A 2D59A 2OEPA 1BH2A 1M10A 2QW8A 3C3YA 1FEZA 2QL6A 3MRVA 5A6VA 5KC9A 5TF0A 2IBTA 4EB8A 2IPXA 4DHEA 1IHDA 2PMWB 5BSVA 1DCTA 1IM5A 1B73A 1U3GA 3AM5A 2RGCA 3ANXA 2HUPA 3CXRA 1OIXA 3GRZA 5AHXA 2OHOA 5AJWA 1L7EA 3AF2A 2PMDA 3V1UA 2O0LA 3U26A 1GAQA 5F1OA 5BRAA 4RTQA 2P3QA 1QIDA 1N6OA 3G49A 3GGPA 1I94B 1FDWA 1ZM7A 4MWCA 1E3WB 3V1KA 4ALLA 1CR0A 2NZJA 2RCNA 4AMBA 3QKUA 4EPYA 1Q74A 2OD2A 4D4IA 4XIIA 4EY8A 2YY7A 1LDBA 5DLYA 1Z5UA 3CN7A 1P0PA 5TC4A 3WGKA 5AM2A 1E2GA 4YRIA 5H68A 2G67A 1G2IA 3GCGA 4GC5A 1T5DX 4P3YA 1M1NA 4YBZA 2DM6A 5JNWA 1ECPA 4PONA 3HSKA 3RTBA 1VDZA 4KQ1A 4KIWA 1TT7A 3WHIA 1C81A 3L6BA 1OLUB 1U0FA 5ERGB 5JC8A 1K5PA 4V1CA 2FZLA 2O3JA 2B61A 3RO7A 2PS3A 2WWYA 2C4KA 1EHIA 2WKQA 2IYWA 1JEYB 3FG9A 3WYEA 1AGRA 1L3BA 4V0LA 3N76A 2OK7A 3ZK9A 4FDVA 4MKXA 1KI6B 1YDEA 5DF1A 2PUWA 2PZMA 4PO3X 1F0KA 1XK7A 2ECOA 3WJAA 1KK1A 1QTNA 3HLTA 1F14A 1JQ5A 4ERNA 2V0CA 1HK7A 3KEMA 2JEYA 3SHOA 5JZOA 5K0BA 3FCYA 2NUTB 3PFHA 3GRYA 4W5HA 1SU7A 1MLDA 3U1TA 3LNCA 2C5LA 3G2HA 4G1VA 4PNHA 5ITVA 1RKBA 2I1QA 5FX2A 2II6A 1J4AA 1E3JA 1OBFO 1SK8A 4FYYA 5DM60 4FC6A 2EFHB 1IZ0A 4Q9AA 4EJSA 1E5LA 1E9SA 1S3FA 2IYXA 1J9ZA 1GILA 2OCYC 4R8RA 4M7OA 2YN2A 1UPUA 2A94A 4EHIA 3J7AC 3OF5A 3UK0A 4JI2B 4PXYA 2UVPA 1CZKA 1DKPA 4ZZ1A 4L8GA 1GJRA 3MGGA 2PUVA 1HTBA 2RCYA 3UJ6A 2JBWA 1SXJD 2CFRA 4JLOA 5ALPA 2OGSA 1FFWA 1ZJ5A 1IIBA 1GLGA 3EWNA 3HKBB 3L0SA 4RD4A 3ZGLA 4E6EA 1Q21A 3TKAA 5ELMA 4HDSB 2R8OA 5DSTA 1ZLXA 3BC1A 3WWDA 1OPRA 1SQ5A 3DWFA 3PNYA 3LM8A 1JG7A 2JK1A 3DD5A 5I7SA 1R3UA 1QWSA 4MDYA 2HHAA 2G63A 2YTZA 3BWMA 1YDFA 3B3GA 3CX6A 3D7LA 3GAAA 2CVZA 3K9BA 4OO3A 1J5EB 3ITKA 2EERA 3R7SA 3ZIDA 1L5NA 5GJBA 1CZHA 4ME6A 5CTAA 4I1OA 2DSNA 4UEKA 1V45E 1KI9A 2X41A 5HIKA 1RQGA 3KOMA 3L93A 4BUCA 3RLIA 5GVSA 4DCCA 2JFVA 1M1YB 3KJGA 2PL3A 4PBRA 1X7YB 3F6CA 1T6YA 2H57A 4RCZA 4XYBA 3GJ3A 5CU7A 2WVHA 1JIJA 1NF2A 3IDFA 2WD8A 1WSDA 8ADHA 2JLSA 5IT5A 1DC8A 4A8JA 3NBXX 4WAUA 5A03A 3OUZA 1J97A 3BJRA 1XTBA 4WLUA 1T2CA 1UK9A 4BLTA 4CMEC 4ID3A 1XVTA 4Z7QB 1AZLA 3FWZA 3HKCB 1C1HA 1XAIA 5F78A 1UBEA 3UJ7A 5HKOA 4O8ZA 2FWMX 3PEWA 2GPJA 1OWMA 2Z2ZA 4QUKA 4HAYA 5FWAA 3ZHVA 5HX7A 4WZAB 4IAOA 4J9UE 2D13A 1AQJA 2AB0A 2VSQA 3LQQA 2R7KA 4M0PA 5T4BA 3V8BA 3WG9A 5JCZA 5KDDA 2FB9A 3V3TA 1ZC4A 1P4RA 3HO8A 1M6YA 4R8VA 3NVMB 5HDBB 4W5OA 5HTKA 3O1IC 1R9JA 2J59A 1B41A 1DMRA 2QQEA 2YZGA 3FYDA 1GAEO 1ORWA 3HCRA 4ZEMA 1WULS 3PD7A 5IC4A 5HZKA 1KQPA 1PR1A 2FFHA 3BMNA 3SEQA 2H7XA 4Y1GA 4D3XA 2I78A 3MINB 2QU7A 3VVLA 1OIVA 3QYJA 2HO4A 1XCMA 3WFJA 3PDHA 4CMJA 2A84A 1VJGA 1PYOA 2W4IA 5JZVA 4DMLA 3RFXA 3CLUD 1P61B 3AFIA 3QEBZ 4V0RA 2CXNA 4FZRA 3HB1A 3Q8MA 3QLVA 1NUUA 4FZJA 5DHFA 3W90A 1SBHA 2EJVA 4NS1A 5D3QA 2IHNA 3WA6A 2BI4A 1OLSA 3GGCA 1LWOA 4P36A 4DIMA 2BAGA 5FPSA 3HXKA 4PFQA 3EXAA 1FP4A 1W29A 2JFNA 3BILA 3EGIA 3LI2A 3LYUA 2V8OA 3ZHZA 3E70C 3BDAA 4NFLA 5BN1A 2UUPA 4QQKA 5IYZB 2OO5C 2J9YB 4JP1A 3UKJA 4YJFA 3MBIA 3ILYA 5CM9C 3ZGVA 4DQDA 1DT3A 4Z9XA 3SICE 2XB4A 5FDFA 1IN1A 1SUPA 5AKHA 4OYYA 3DV9A 3IUQA 1SAYA 1YR7A 1EA7A 1EMDA 4UASA 1QHXA 4YJ2F 5C1DA 3OE4A 2OBLA 2DY0A 5FBWB 4EKNB 2PR2A 4DQ0A 1CV2A 4QWWA 3UMSA 1ST2A 3C98A 4EO4A 2M6RA 3AR4A 1SOVA 4OP1A 1J0XO 2RBEA 1QWOA 3DLIA 4YRPA 1P19A 2N42A 3D0RA 3T3PB 3VGPA 5ADUS 1BE0A 1QQTA 4YJKA 3KQKA 4KWEA 7ADHA 3ERCA 3DCYA 2IIPA 5DTIA 4UAGA 1L4HA 2WRZA 3NPAA 1S2MA 4KXUA 4C04A 4XASA 521PA 2WHPA 3KK0A 1KJJA 1BCSA 1T1IA 4MHSA 2PFKA 5DHTA 2NO7A 3EZ7A 1R74A 3CN9A 2DKOA 4GP6A 1YS7A 1AXRA 4DN6A 4MW7A 3PA6A 1SUDA 4MVJD 1E8DA 4NECA 5CLLA 4CQJA 2WTBA 2B1IA 1JVBA 1V4VA 2GASA 3ML1A 3CIFA 2I76A 3NHBA 3QEJA 1FS5A 5CM8B 2LCQA 4DMMA 5KYXA 2IHZA 5HMLA 3TQHA 3E9NA 4E3WA 1F8GA 3MOGA 5CVEA 3KKZA 4DNXA 4EUSA 1YJBA 2E2WA 4E4YA 2HB6A 1X9GA 5JAQA 4MUAA 4PZLA 3GA5A 4W4TA 3SSMA 3RBXA 1Q0SA 2XUHA 4MYHA 2VH1A 3OM8A 4L7VA 4WCFA 1WNFA 5CB4A 2DFKB 3V2UA 5LIRA 2O2XA 1G16A 3K72B 4X45A 1MX9A 3I2JA 5CA0A 2BYTA 1NW6A 3BIOA 4M1TA 5KWIA 2Z43A 5E6SB 3HJHA 3ZEAA 3HUFA 5JPIA 4JLSA 3RC7A 4I55B 4H31A 2PH5A 3O8OB 2WWHA 4DTCA 4JLNA 2B7LA 1WLYA 1LW6E 3S40A 4EAQA 1RXSA 1Z5GA 3AESA 1JYEA 1SHKA 1G42A 1XQ6A 2OC4A 2E49A 1A97A 1R0SA 2CJPA 1K86A 1YFZA 2QX6A 2FUNB 3PJRA 2NO5A 4EUEA 1I2BA 2Y1GA 2DHRA 2R8ZA 5JMWA 1A7JA 1X2EA 1GSHA 4C6RA 3U1BA 4CBVA 2NUPA 5DTMA 1E2UA 5KNCA 1R5BA 1XDUA 1C7IA 1BE1A 3KEOA 2WICA 3ND7A 5DP1A 4YUVA 3RS5A 5BWNA 3QKRB 2P41A 3ZVMA 1K2WA 1GUDA 2R2AA 2HKIA 2J31A 2YWXA 4HWPA