4ZVTA

Caspase-7 variant 1 (v1) with reprogrammed substrate specificity due to y230a/w232m/s234n substitutions, bound to veid inhibitor.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zvtA00
4ZVTA 3GJQA 3H13A 4M9RA 3QNWA 3UO8B 2QLBA 3KJNA 3V3KA 5H0IA 5IAKA 1GFWA 2FQQA 1IBCA 2HBYA 4D3XA 4ZVOA 3V4OA 4JQZA 4FGUA 4N7MA 3S8EA 1F9EA 2H4WA 3GJRA 4AW9A 3H11A 2P2CA 3V55A 4LSZA 2XYHA 3P4UA 5LUBA 4QU5A 5IANA 3P45A 4FDLA 2C2OA 4EHKA 1RWMA 3RJMA 1F1JA 4DCPA 3DEKA 3R6LA 1CVRA 2WDPA 4PS1A 1RHJA 3S70A 3V6MA 1NMSA 4N6GA 2J33A 1RWWA 1RWKA 3SIPA 1I4OA 4HQ0A 2QLJA 4EHHA 5IBCA 1GQFA 4QUBA 4I1RA 4NBKA 1K88A 3ITNA 4EJFA 5JFTA 3EDQA 4QU9A 1RHRA 3R7NA 3R6GA 1RHUA 5IABA 1I51A 1NMQA 3H1PA 3R7BA 1SHLA 1RWNA 2J30A 4QUEA 5IBPA 2C2MA 4EHNA 1RE1A 4EHDA 5IBRA 1NW9B 2H5IA 2HBQA 4HQRA 1ICEA 2CNLA 4ZVRA 4NOKA 3IBFA 1JXQA 2C2ZA 4IYRA 4JR2A 5IAGA 3UOAB 2CDRA 4IEFB 4NOMA 4AWAA 3D6HA 4EHFA 2FUNB 3PD1A 3IBCA 3DEHA 5IASA 2HBRA 1RWPA 1SC1A 2NN3C 2QL5A 2XYGA 5IAJA 3OD5A 2FP3A 2H48A 4EHLA 5LUAA 2J32A 2XZTA 4QTXA 4QULA 1I3OA 4HVAA 4ZVUA 4JJEA 5LU9A 4N6OA 3PCXA 2CNOA 4QUGA 4JB8A 5I9BA 5I9TA 3KJFA 4QUHA 4QUJA 4DCJA 2XYPA 4NOLA 3D6MA 4JR1A 3NKFA 1K86A 3NS7A 1M72A 1I4EB 2HBZA 5IARA 5IC4A 1RHKA 4QU8A 4D3YA 1CP3A 4FEAA 4PRZA 4PRYA 4ZVPA 4JR0A 2Y0BA 3R5JA 4NOJA 3GJTA 3R5KA 3E4CA 3SIRA 2H65A 3EDRA 3V6LA 3DEJA 4AWBA 1QDUA 2CNNA 3BIJA 3KJQA 3PD0A 2CJYA 2J31A 2H4YA 4EHAA 2H54A 2C1EA 2C2KA 2DKOA 4N5DA 1SHJA 3H0EA 5LU8A 4N7JA 4ZVSA 1QTNA 2CNKA 1RWXA 1RWOA 2XZDA 2QL7A 3H11B 4QUAA 1QX3A 4ZVQA 3DEIA 2H5JA 4N6NA 1BMQA 2QL9A 4NBNA 4QUDA 2CJXA 3D6FA 4DCOA 4JJ7A 4PS0A 1RHQA 1KMCA 4NBLA 5IC6A 4I1PA 5IAEA 4JQYA 2H51A 3V4LA 3NR2A 4JJ8A 1SC4A 4QTYA 1RHMA 4FXOA 2K7ZA 5K20A 4D3ZA 1NMEA 3K7EA 1PAUA 1RWVA 4QU0A 2AR9A 3GJSA 2Y1LA 1SC3A 3R7SA 4QUIA 2QLFA 1PYOA
chains in the Genus database with same CATH superfamily
4O59O 2OG2A 3KYCB 1JEEA 1RPAA 3DMHA 1IU9A 4GO1A 2VOEA 5IG2A 5JXHA 1UKYA 3LLUA 3R0ZA 4BU1A 3LUPA 2EFEB 3F8WA 4UXIA 1W87A 3QLEA 3BXEA 4FR5A 3C1AA 3WFIA 2XMPA 1NZFA 3GLHB 4HO1X 5KOIA 2OL4A 6PFKA 1SBQA 1QM5A 1YF3A 2ZJYA 1QZUA 2W4QA 3DVRX 1RXYA 2AVNA 3EVDA 3K9WA 4MKRA 2M6KA 3T94A 3EJWA 2GESA 3FWYA 4WA8A 4O5AA 2XMRA 2YOGA 4LECA 1J0CA 3RS0A 1Z4MA 3C3XA 4JK3A 2P5TB 4R40A 1LZKA 4NV3A 2XHEA 4G5RA 2FJPA 4BYGA 5AQ1A 3NBXX 3W4KA 3JS5A 5B1IA 2GCOB 3HUFA 3M6FA 1TF7A 3OE5A 1VHDA 2ZBGA 4KQFA 1RI3A 2Z98A 3QX3A 2XA9A 3TVTA 1TZKA 2HTEA 2ERXA 5CW2A 3R7NA 1FL9A 4P7GA 1VRVA 1Y3CE 4IL5A 3T7RA 5L3QB 4YAWA 5DXAA 4IJ5A 1JB1A 4BQIA 2Y0CA 1C3JA 1M5UA 2JBHA 2RGWA 1TA4A 3LLCA 1O0SA 4MLZA 2GJSA 1HX7A 3W77A 3SSAA 2HLNA 4RTOA 1OHHA 3IOEA 1GZSA 4UATA 4MPTA 5LD2C 4F6RA 1YRLA 1JV2B 3BDAA 3JPWA 3JTMA 5LD2B 4Q12A 5CB0A 4MYTA 4HTFB 4YECA 4G09A 3C70A 3QEMB 5I7RA 3L92A 3IV6A 4AM8A 5INTA 1N5LA 1BMFA 3HR7A 3ZLBA 2QR5A 2JS7A 1YS1X 2XITA 4LSMA 1O6BA 3TRJA 1P1KA 4I55A 5CFOA 4MQBA 1K89A 1AQ6A 1DAMA 1F06A 2JKZA 2NWQA 2P40A 3PD7A 3W5HA 4B87A 2D06A 3I9NA 2BTQB 3H99A 3UK0A 1L4NA 1E2LA 5ITZB 4JN6B 4W82A 1ZJYA 4DANA 2G1PA 3BMNB 4C6HA 4JEIA 5AQEA 2YY5A 1L5SA 2V6JA 3BIXA 1C0KA 4UEOA 4Y8VA 3U7FB 3LWDA 3N8GA 2B7LA 2B2XA 1X9IA 3QPAA 4RX1A 4IKPA 1FDUA 1PFGA 3BIJA 5EJ5A 1YS2X 3L6OO 2AMLA 3RJZA 3E9ZA 4BVEA 3PWKA 4QYSA 4XVCA 4RCVA 3I1YA 4KRYA 1B7GO 2F3RA 1PUIA 1YOVA 3ANLA 3CTMA 3GMTA 3TI7A 5KQSA 1EI9A 3D5EA 2I2XB 1MP0A 3IUNA 4N6NA 2AR0A 5DOZA 2CBZA 2BH9A 2QXUA 1LC3A 2BHSA 2YNMC 2O2DA 5AI9A 2QRUA 3PFNA 3PQ2A 3RVSA 4DMMA 2GTHA 4MO2A 3ZHBA 1SCJA 4U0KA 1QLWA 2PRYA 3TTXA 3RUIA 2JHGA 4NP6A 2RONA 5FA6A 3KHUA 4HGYA 2YWFA 4IVNA 2ZREA 4TVKA 3OFJA 1OU0A 3CSSA 1EFPB 4MMXB 1Z16A 1WMBA 3DDZX 1A2QA 3I04A 4OXYA 2ZRDA 1V8BA 5HG0A 3RABA 1YU6A 2EAUA 3CQ9A 3OU6A 1GL9B 4MAFA 3L5OA 2PAFA 3T4EA 1A7KA 5CNKA 3VNBA 1Y8RB 2FUG6 2QVXX 4ZTBA 5KNDA 1C1XA 3HJCA 3QTTA 2JJ2D 3SNKA 1BKSB 3BT7A 4E5PA 2B2CA 1R8YA 1C7ZA 4BE9A 1SH7A 2R6AA 3HSYA 3K09A 3DYIA 4DCUA 1BWRA 3LYLA 1PL7A 2GN1A 4AMZA 1JU9A 4GQIA 4NFYA 4BLPA 4F1WA 2I78A 1U1CA 1T34A 3DFKA 3FF1A 3CINA 1IM5A 3WL4A 1K08A 4P4TA 1IY9A 5T8KA 3KP1A 1AQLA 2BZ0A 4B45A 2XA2A 1O9HA 3QXCA 4Q9JA 1AUVA 3WK5A 4YDHB 5EIAA 2B2NA 2C8KA 2F1IA 3ONFA 1ZR4A 2ZM6B 2AX3A 2HIGA 3NFRA 2FK8A 3NTUA 1X42A 4GEKA 4JDUA 4M1MA 4AULA 4N03A 4F2GA 1BXKA 2ZI3A 1Z26A 4NFHA 4X8HA 2IXGA 2ZEJA 4WKBA 1B8OA 4AAYA 1YZHA 4UCWA 2PX5A 3GLQA 2FEPA 1Z6GA 2HA0A 4AY5A 3WIBA 5KQLA 1LWOA 3R7BA 2AK3A 5LPNA 4KJXA 1XQVA 1I80A 2C2BA 3IJEB 5EHNA 3GCDA 3O92A 2W0MA 1OD6A 3HDGA 2OOSA 3LNCA 4I81A 5EE3A 3DV2A 5CIWA 2R00A 4KYIB 1Y3FE 1CNFA 3IBFA 1NQ5A 4MQMA 5CBPA 5A9RA 1F38A 1KI6A 2OKCA 3BF8A 5EC8A 3PL5A 3CG4A 1N1DA 4LXHA 1L5QA 2BR3A 2BEUB 1XLTA 2B3DA 4KN9S 3FZEA 4Q05A 4YPVA 2EEPA 5A5DA 5CFNA 6NULA 1JNYA 3TQQA 4X61A 4DR6B 4TWRA 1AQJA 3EXIA 5BNZA 2NZUG 3P8ZA 1L8XA 3KR2A 1GPDG 2JNWA 4UEKA 4ER7A 2GMWA 4ZGWA 1JDTA 4TPKA 5SZJA 3B36A 1YJQA 3PVCA 1MR3F 3FTFA 3TGWA 4H3KB 2OV3A 3O2NA 2Q5HA 5KVQA 1HQCA 4EI7A 1SUSA 1TLTA 2QENA 3SE0A 3VC2A 5AUOB 1CR0A 1T9GR 5BNIA 2DR0A 2MSLA 1N9GB 1E18A 5JIBA 1MV8A 2KSQA 1NBEA 1YVEI 1ZVMA 3MAJA 3LY7A 3OKFA 2ZVPX 5TS2A 1AUXA 3UHFA 4GBJA 1N3YA 2P0EA 3OJFA 1QVRA 3ETHA 3LO8A 3MWDB 4US2R 3ZE7A 3DG9A 2FE4A 1PEAA 1RM5A 3DT8A 5JYDA 2QPAA 1SHJA 4WWHA 3TX6A 3VKWA 3EF0A 2VRWA 5L51A 3KAJA 1FBTA 1MABB 3RHSA 3S44A 5BV7A 1B8VA 5JCJD 5F33A 2BFAA 4JWKA 4RD2A 3HKCA 4CODB 2JGEA 4D41A 4G07A 2E89A 2P35A 4K9RA 3JZDA 3PGLA 2PWAA 2V7QA 4ND8A 4B3JA 4HLUA 1XJCA 3BFJA 4H4CA 2GRJA 4C7OB 4UM8B 3OU7A 1FNNA 2W70A 4MCJA 3NR2A 5BN5A 3G2QA 1CIJA 1Y3AA 2ISQA 3NC4A 3U80A 5JCPA 1FMJA 3U3DA 2FOLA 2GHTA 4EKNB 1QJ4A 5FLYA 1ZBQA 2AR9A 3JQAD 4MW2A 4BNDA 1PEDA 3BH6A 4GP9A 4MKGA 4Q93A 4KR3A 2VXOA 2WG2A 1T2DA 1X6VA 4PO3X 3VKHA 1ZNZA 3GELA 3ZXSA 1KZ6A 2CCKA 4UW9A 3T34A 3A28A 4OSEA 4QJBA 4MW4A 5A6SB 5B6IA 4U2EA 2H17A 3WYDA 1F0YA 1A95A 2IJGX 1D6SA 5KNCH 4WJKB 4C1NA 1ISMA 4AZWA 3X3HA 5EZQA 3H2GA 4LXUA 3WBJA 5JZBA 2DR2A 1T4CB 3LUCA 3OCVA 1NBME 2JANA 3FVWA 3SQXA 1RYYA 2FVYA 3E22B 5JROA 3RSSA 1GAJA 2VXCA 1PEKE 2ZTHA 3PXXA 2IV7A 2O54A 1ZIDA 4CKXA 1XCGB 2I9PA 2WF6A 3OHMA 4P33A 4XGKA 1AUOA 4ZEXA 1DCFA 4BP3A 5AKGA 4BQFA 1E1CA 2GVNA 4BNIA 4DDWA 5KQPA 2VDNB 4P5EA 2TMGA 3U4MA 5LDHA 2AJ8A 1TQ8A 5AW2A 4ZI3A 2VN8A 5KKCA 2R8OA 4ZRDA 1KYIA 4NPAA 4QBHA 3UK1A 3SHOA 1T5TA 2YJ3A 1W0KA 3CEMA 4UVGA 1N6LA 1UZNA 2I3ZA 1N2SA 4H27A 1F2UB 3KDAA 1IB6A 2DHDA 2EQAA 1H42A 3S2EA 1KJWA 1KIFA 2O3QA 3Q7TA 4FFWA 4A73A 4DMKA 4EPVA 1NPTO 5AVXA 3FDXA 3I6BA 2NT4A 1SKBA 2CYCA 2B5WA 3R41A 3L8MA 1AA9A 4Q1BA 2I2BA 2WZBA 3FNGA 3N75A 1BXGA 1HFJA 4Q5IA 3RFCA 3T5TA 1HA3A 1W4CA 4UFNA 5JAPA 3A3KA 5IJAA 2H16A 2P91A 3HL4A 1F3LA 2DFLA 1Q7RA 4DNPA 4JJEA 2EP7A 2IPXA 2IPLA 4OBEA 4C0QC 2W2LD 2V9PA 1C1HA 4PCUA 3EVFA 3O4GA 5CLQA 2WZDA 3NATA 5ALPA 3U39A 1XJ0A 4DKXA 3OA2A 3TSYA 1DDGA 4LQCA 4MIYA 2B8EA 3UGQA 4OHFA 2PJUA 3WP0A 3F5QA 1SC9A 3ZDCA 4I6EA 3W79A 1XMJA 3QXJA 3WKEA 5FTLA 2BGMA 2QG4A 4MGZR 1JS1X 1JB9A 3HLYA 2GBFA 2PDAA 1PQWA 3PFBA 2X14A 5JG7A 4CKBA 4ZVMA 4YGXB 1VMKA 3ROQA 3B3GA 3S8YA 1U0OC 2FWBA 4R1OA 3AW8A 2Z6AA 3MJ4A 1XAJA 1LI5A 4RDCA 2H7CA 1CY7A 4IXDA 4W1SA 4BP1A 3IRVA 4ANFA 1DV1A 5IK2A 6CHYA 2XUIA 1KETA 3W6OA 5AM0A 2EYUA 4DLTA 4RQAA 4OLHA 3T41A 4ZEMA 1UKVY 4PO1A 4RS3A 2Q3JA 2BI7A 5DVZA 3GF4A 4A26A 4LTMA 1S5PA 1AF4A 2IYOA 1JDUA 2M1ZA 1XDGA 2REBA 2WTEA 3ETLA 3G82C 3K5WA 4MHSA 3ZXYA 4BVJA 1RC8A 2FZKA 2ZIAA 5DDIP 5LZ5A 4XE5A 1E2HA 3O8QB 1PYGA 1R6XA 2CDBA 3LZDA 4LVUA 4RIFA 3GP8A 2ANCA 3ZS9A 4BY9E 5EMHA 5TT1A 2VDMB 2PUHA 2IEAA 2WMNB 1AY0A 4EGQA 4GW3A 3PNLA 4A03A 2EBFX 3D8SA 3MLBA 3LQ4A 4DVJA 1P45A 1XMSA 3ZHSA 4M9RA 4B8ZA 4FLFA 3L1UA 3T35A 4TKUA 1E77A 1HURA 4B8WA 2OGSA 4IQ4A 1Q2UA 3M70A 4JCCA 4KFTA 3H2YA 4M49A 3SQMA 2O8CB 1EFLA 1PDWA 4HNQA 1EFRA 1SRRA 5H3LA 4BV2A 3Q5GA 4OOEA 5LZ4A 3AJAA 1Q1GA 1QHYA 2JIBA 3N2IA 4K1XA 3R3UA 2LCQA 3UY4A 4A2QA 2RD2A 2Y66A 4MDYA 5A0TA 4KXLA 1NUSA 1JEJA 4WI1A 4X20A 1MX1A 3NJ4A 4Z51A 1I8TA 3QWBA 4JKYA 5FWXA 4MV7A 5HZGA 3LM8A 4WEOA 1YVPA 3KJGA 1BRMA 1OXUA 2VH2A 4TN1A 3VX3A 1W47A 4GRDA 2HWWA 4YRSA 3FJYA 5KC8A 3D3JA 4ESOA 1Z8DA 2OKGA 4PZCA 2QLJA 2SCUA 3QVTA 1I2BA 2VNKA 5DI3B 1H0RA 2ZIXA 4QDUA 1HFKA 4BPRA 1TUEA 3U3KA 1HYHA 4QU9A 3LF1A 5JSFA 3JASA 3BVPA 1IRIA 4MUIA 4YR7A 2OUIA 4B6RA 1JIQA 1SQFA 1OBCA 5ALGA 2P4EA 3MFYA 1TAQA 4RTKA 4KTTE 3FLBA 1XU9A 3LKDA 3MERA 2P65A 4FNGA 1Q21A 3SSMA 1VKRA 3E23A 2RH5A 4AZSA 1LFAA 1QYCA 16PKA 1ZI8A 1OJ7A 2Z30A 5FR2A 7MHTA 3K1TA 4ARZB 4HL6A 4FT4A 2CL5A 4J4TA 2VTEA 2VWPA 1AURA 4NU0A 1CZUA 2DTEA 4M1WA 4RPHA 3D2LA 2WUGA 2WWGA 1Y63A 2W2OA 2ZUBA 1P0MA 3C48A 2O1WA 2P9FA 3D8TA 5TE9A 1NNI1 4NE2A 1U8FO 1WXWA 2B82A 3Q3IA 4HNAA 5H83A 3SHQA 3T3MB 4YACA 1XZPA 3JRWA 4J2TA 1Z5NA 3G2LA 3OC6A 4OQLA 1XPJA 4XX1A 1L5GB 4D5GA 2VLIA 4Q4HA 4D9IA 3WAJA 2G6TA 5KOHB 4NBRA 5IXYA 3FM9A 2VC2B 1RWBA 1GGJA 3AM3A 1C8LA 3SIXA 1GSAA 4DGQA 2NU7A 5JDIC 4UHDA 2OB1A 2PX6A 4CR6A 3VR5H 3AILA 3OKPA 5FUWA 3E4DA 1VHWA 4KVAA 3WK9A 2DY1A 3PZBA 3DO8A 3DVQX 4ESHA 3KSAC 3QI7A 3TQTA 4E6PA 1OB5A 3QYPA 4L72A 1TUBB 1UXHA 4GWLA 2AJTA 1M2VB 3R76A 3TQSA 4ALMA 5CA1F 3W5CA 3PXEA 4R9VA 1PJBA 4WCDA 1HC7A 1OA0A 5JAQA 4Q02A 2XV1A 3UJ8A 4MULA 2P2NA 3AKDA 4IJUA 1BHSA 5T4HA 4FFSA 4WEQA 5MDHA 4L9WA 1IJKA 3KZXA 1NULA 1QIMA 1WPGA 2J09A 2RJOA 3FHOA 4K6MA 3HABA 4TL8A 5I4KA 4WOCA 2CN1A 2BF4A 3KE8A 4UD2A 2YUTA 1C3LA 2PBZA 5JADA 3GT4A 1VHQA 3G8CA 5IUNC 2H51A 4HRVA 4D4IA 4U2GA 5C8XA 1S3IA 2H1SA 4V0KA 1CRWG 3LP8A 2YFKA 1BXRA 4KDFA 3G8YA 1J9EA 2RH9B 4LJ5A 4JOCA 1P3DA 1K98A 3F71A 4RD4A 1ZIXA 2QIPA 3WGNA 2C2WA 2G36A 1SBYA 1FUEA 4P3YA 1KMHA 3VHLB 5CBKA 5IU6A 1G6Q1 3BAFA 3C3EA 2ZSDA 5EIFA 1M6VB 2QLFA 2QTRA 5FJJA 3AHGA 3RUDA 4AVYA 5KTPA 3FCAA 1LLUA 2VBGA 1TKBA 4KBFA 2Y1DA 4QC2A 4RHEA 4F7DA 5IS2A 2IV2X 3QY0A 1NV8A 1P81A 3RH0A 2BAGA 1OXMA 2PT7A 4UTRA 3FPSA 1HSZA 4RZXA 1N1EA 4PZYA 5K45A 3UPTA 4DKJA 2CXRA 3REQB 4ARCA 2QD1A 4PIMA 3KOZA 5JNUA 3PRHA 4LHSA 2YKGA 4A6PA 3P45A 4FDLA 1I2AA 4DQLA 2TYSB 1PR6A 4MYDA 4KE9A 4B81A 2EW1A 4BBJA 3G3EA 2AEJA 4WXYB 2XQIA 3C3DA 4NCJA 3E58A 3L0PA 4L5YA 3VZRA 3A0UA 2C5GA 1C1DA 3P9ZA 1ZCJA 1TKRA 2WHQA 1OY1A 5TRTA 1U6IA 2H1WA 5AK3A 4EP1A 1XVAA 4MOWA 2OHXA 4GBGA 2ISSD 2YIVX 4JA2A 1DUIA 2BYTA 2OFOA 2IP1A 3DUFA 5DEIA 1I5OA 1R8QA 5LQCA 2VAXA 5A3JA 1W34A 3WV4A 1KJJA 2R87A 3QKTA 4WA7A 1YFZA 1V5EA 5FORA 1NVDA 2DR3A 2HHAA 4OHVA 2FSGA 2WIAA 3I8OA 4EELA 1OX6A 2D54A 2YJGA 2VJMA 2FR8C 3S1AB 2G28A 1E9AA 2CYBA 4DYDA 2I65A 1KTVA 4K2AA 2OHOA 5FI5A 2ZANA 1FB5A 4TQGA 1RPJA 1OV6A 1YQGA 3RYIA 3IOYA 2H0RA 3IP9A 4R05A 4ND2A 4I4CA 1T0IA 4J94A 3SVZA 4EYQA 2WVAA 2Y71A 4N5NA 4WOJA 1LDNA 4FBGA 4OHBA 4ZARA 1Y33E 4F3TA 1O2DA 1L1RA 3V8VA 1ZITA 1MC4A 3ILSA 1RHKA 4FOTA 4A16A 4PTLA 1ECBA 1YDWA 5ELLA 2GETA 4C0BA 1USUA 1WPXA 2JJYA 5ALSA 5ULLA 1GCIA 1IPHA 3ADOA 3HFGA 3VI3B 1CIVA 1P1CA 4LI3X 3ZLTA 2XVXA 4GL4A 3IQZA 1F9AA 1PKEA 2BMEA 3W5UA 4DADA 5AW7A 2B4QA 1U3CA 3ITEA 4NMMA 3K6SB 1C4WA 1QCCA 1YA4A 5IW8A 3RTBA 4GZLA 4NNJA 2NXEA 3FYSA 2WTAA 5KJFA 1AZWA 1CZLA 3F3YA 4K9KA 3O4FA 1GYPA 3HA2A 4IWNA 4L8LA 2G3YA 2G63A 2CUKA 2GDZA 2HAEA 4K6OA 3BMOA 5F4ZA 5TF0A 3B70A 2RK4A 2V03A 3MGGA 2HL6A 3KZNA 2OFFA 3K1AB 2JCYA 3PQ3A 1V3QE 1SXGA 3N7AA 3QXHA 3VUEA 3ESDA 3KD2A 1QYVA 3IUEA 3KQQA 3RO7A 1JLMA 3K8QA 3X2SA 5B4VA 4BNZA 2AOTA 2EC5A 1TK3A 4PSVA 5IBQA 4B3IA 4N3BA 2NZVG 4X7PA 4YMLA 1PU2A 3BYZA 5DGDA 4EA8A 4RTRA 3TMAA 1CNMA 4B17A 4EAAA 4R81A 2B5OA 2IYZA 2AXNA 3M9XA 1UBGA 3ETJA 5CB8A 1MX3A 1O96B 4EGCB 1IN4A 5K03A 3S40A 1RCUA 2OC4A 4H4DA 3C7DB 2CD7A 3DNFA 2ZUWA 3GCXA 3CW8X 3AR6A 1R18A 2X1HA 4L22A 4MSUA 3R8XA 2PRIA 1EJBA 2ZSIA 1N8NA 3H3XA 3LUAA 3MWYW 5AJTA 5AVQA 3VHRA 2NVBA 2EKZA 4R1MA 5D5HA 1CJCA 4D8XA 1FCJA 3PPXA 2H4HA 3U31A 1I33A 2IGTA 1DJNA 5EIBD 4GR5A 3TYXA 1MLDA 4EB6B 1Z39A 1CUUA 3WB1A 5LLTA 3L8ZA 4KRXA 1I4DD 3M6XA 2BGUA 1EDZA 2JGMA 1NOKA 3R0IA 2VTKA 3OPYI 4YJFB 5CFRA 2WQ7A 1MW8X 3KHTA 2BSAA 1PNVA 2Q5OA 5ECYA 3HO1A 1O95C 4UTZA 1NY5A 4D4GA 3E5HA 2BR4A 3I9V6 1E9EA 3AESA 1H2HA 4DZTA 4J76A 4DZRA 4A7PA 2DTXA 2CMKA 3AXSA 3EGVA 2H06A 1USGA 1EWRA 1XCBA 1J6UA 4H1UA 4IDFA 1G3RA 4BWGA 4QOJA 4LF4B 2UKDA 4QSHA 4K6CA 2IY9A 4ZQFA 2E48A 1M34A 4X7BA 4J0IA 1UPUA 2PUAA 2F9LA 5FD8A 4EKYA 5KWIA 2PGIA 1WKVA 2X9GA 1Y5NA 1T1JA 1U8EA 3FPGA 4RCZA 2A33A 3BX1A 5DHSA 1NJ5A 1P75A 1KK0A 1QGYA 4MVJA 4BOYA 1NYLA 2WTUA 4D43A 3IRUA 1ZKMA 1N9ZA 3GDHA 3VMFA 2Z4SA 3WJAA 4W9MC 2E3JA 3WZLA 3SC3A 1J8FA 1OH8A 2PBRA 1TU4A 1A3CA 3KZOA 4NEQA 4E30A 2QM8A 1GEGA 4B7UA 3C3JA 3LQYA 2PLNA 2QJOA 1W19A 1L7BA 3JCZA 2KM1A 4OMDA 4FX5A 4C30A 4AT1A 1JG2A 1IJFA 2XCUA 2O1XA 4HGNA 5K5EA 3KWLA 2Z2JA 1EUDA 4WZAB 4CM8B 2BMAA 4BQEA 4EW2A 1MENA 3I64A 5TJHA 2PX8A 4N5DA 2FR0A 4D5EA 5EWMB 5CA1B 1KOJA 2GCGA 4ZDJA 1NTRA 2CNKA 3HBLA 3OPMA 5GWXA 1U8ZA 3ORHA 1Z8NA 2OORA 2ZTUA 3CUVA 4NZYA 4RHXA 3VR2D 2FW0A 4RL4A 2XCSB 1J90A 1NYTA 1KP9A 2CFTA 4TXNA 1IBRA 3BIOA 1XKTA 3H9EO 2CDNA 3RK4A 3QVLA 1Q3TA 5MGNA 2J9GA 5J9FA 3I58A 3CWQA 4EAQA 4OO3A 3ZI7A 3OJCA 1G3IA 2FQWA 4GR4A 1H23A 1G38A 2A9OA 3D0KA 3JRXA 1XKXA 4Z1MA 4HD8A 4DIBA 2I99A 2CL0X 4G0XA 5IKEA 2C7RA 3IDZA 4CJXA 1RW4A 4FFLA 4P86A 1NVVQ 1S02A 5A62A 4QM6A 2XQKA 5AOBA 5BV0A 2I4NA 2QNBA 2A9RA 3NHFA 3ABOB 1G1MA 3LUFA 2HO5A 3H13A 2NO0A 4LFAB 1SU6A 1II8A 3OTHA 1T5OA 4KLZA 1XNRB 1EFVA 4JA0A 4ZDIA 2P6NA 1QUFA 4RVOA 3ZG6A 4E5KA 3E3AA 3ODGA 4CL0A 1MJNA 2IY7A 3S2SA 2HLDA 4DGSA 4F4DA 2TRSB 3EDOA 2WAAA 1H2XA 3SNHA 2C5HA 3N7TA 2HYIC 3R7FA 1BROA 1GDDA 2B9EA 3EFHA 4YCAA 5LMCA 1FFEA 1OLUB 2JEZA 2NO7A 3HV2A 4N0MA 3IH5A 4ZHQF 4ZYXA 5HF9A 2C2OA 3EA5A 1JVSA 3KG2A 1J97A 3O84A 3WJ2A 1XVLA 3TLAA 1GUAA 2VH5R 5IFKA 1ZINA 4MW6A 3K73O 3U40A 1A27A 2XE4A 4CM9D 4ARIA 2G0NA 1X7ZB 4B6QA 3C6KA 4D57A 1D4FA 1P77A 2QUIA 3Q7PA 5IJ9A 2AN1A 5EKSA 4M7PA 4O2LA 3ESYA 3ZV5A 5C18A 2Z0MA 4PLVA 5GQSA 1W4RA 2A9JA 4JH0A 4NNPA 5IT4A 1AHPA 2ID8A 2E87A 4M0UA 3LSTA 4KX3A 3BB3A 5EQFA 3PC8A 5AK0A 3JU3A 1JHYA 3L01A 2CVHA 3BMCA 2MDTA 2GHQA 3TJRA 3VSCA 1V8OA 1Y6GA 5JVDF 3AEUB 2XMGA 2HA5A 2L18A 3CJRA 4B31A 4WBSA 3W2IA 3GFQA 4K2HA 4JC5A 3Q8LA 2QMYA 4E13A 1ULSA 2NZ2A 1L4GA 1QS0A 3PFKA 4KVFA 3RVPA 2NZJA 2X5NA 3HDJA 3IVRA 4DMHA 4BIIA 4W8GA 2HB6A 3RSGA 1XZJA 5DLDA 4EA7A 3KNZA 4DBLE 1G5PA 1M6EX 2BISA 2WMYA 3TH5A 4B6EA 2EEZA 1VJ1A 1FTNA 1KO8A 3B3AA 5CAEA 4H0NA 2SKEA 3L6EA 4EYOA 3KPJA 3HHPA 1KPHA 2G88A 3HVJA 5B30A 5HQ3B 3T3HA 1H2YA 1UFRA 1R5NA 1MN6A 3IPAA 1ZRMA 3WMFA 5IJXA 5T57A 3JSXA 4I9UA 5JJIA 4XEUA 2B6HA 1DKLA 4NQRA 1HEIA 1EEXB 4FD3A 1VL2A 4K6FA 1R6TA 2ATEA 2ZYIA 1E3QA 4RA9A 2XECA 3RADC 1K1EA 2YXDA 5IAAA 1V26A 1JLLB 4BO7A 1P7ZA 3ZNQA 1ESDA 4TYWA 1C1YA 4XSVA 3ACDA 2ZRLA 2A0FA 2PJRA 4XR9A 4GNRA 2PGXA 2J31A 2NQ8A 2PZAA 1SM4A 3NPMA 1PP4A 1PFVA 2PUBA 1L7VC 4DQUA 3L0YA 1ZRHA 2VQ3A 1I1QB 1QF7A 3LXXA 1M2EA 3TM5A 3D9QX 4AICA 1SAYA 3FGOA 5CJJA 5AIBA 3T7IA 1J1UA 2IIVA 3RPEA 4UOEA 4WJZA 1OBFO 1QYDA 4ZZ3A 3OZDA 2GCOA 3S2UA 5C8DA 2C7GA 5I5EA 4U8HA 2Y1KA 5DI9A 1J7KA 3RHTA 2A5YB 4MYCA 1ZNQO 3U4QA 1PQYA 2QT9A 3M6UA 3HR8A 2F1RA 2DPXA 3MJFA 4PGHA 2HQBA 1GUZA 2VYND 3GMDA 3HUDA 3KKLA 4DM7A 4HUQB 2OVBA 2QPOA 3D4BA 4F56A 3H6KA 1V8ZA 4XWAA 1QVVA 5JSQA 2PIDA 4O1HA 1I4TD 4MROA 4CIDA 5L4LA 3VO9A 1I5EA 3NM4A 3EXFA 1G66A 2GD1O 3OKAA 4BO0A 1QH1B 3AJEA 1XVTA 2OQIA 4DR7B 1AKQA 3IAXA 3WJ7A 3AM5A 3LHIA 4TTAA 1IVNA 1WQ4A 5FPHA 1RVV1 1LVGA 4NECA 3PC7A 3Q8MA 5EXDA 4AXXA 2FPPB 2RJNA 3P52A 4FE4A 3FCUB 3EUEA 3LKVA 4AS1A 2QYOA 2BTQA 1O5OA 1PLLA 1RHJA 1DLIA 3ESRA 1SCUB 4PAGA 3R5SA 2GAIA 2JH8A 3AFIA 4Q18A 4F3CA 5ITZA 5BOSA 5EJ4A 1UFKA 5LBTA 4V1CI 1ORTA 4HQ0A 5FPQA 2FZ5A 3ZDXB 3B13B 5BSWA 1W4AA 1X7YB 3IUQA 5HJ2A 1NUUA 4W5RA 2Q8QA 3DCJA 3P4YA 4G5XA 3JQFC 4CMEA 2P3OA 4OPMA 1UKAA 1JDVA 1DAPA 3D8BA 5A3SA 3N2KB 1DAIA 1YJ8A 1H9CA 4Z0HO 1JAZA 1G8GA 2GPYA 1L5RA 1JKJA 1M2OA 1Z83A 3SI7A 4XX0A 4ZZIA 4I1PA 2FHSA 4HBGA 4F85A 1KMIY 5LM3A 1N0IA 4I4NA 1BDJA 3FHCB 4TSFD 3A1UA 2QXYA 2P6MA 2N9UA 4DV4B 3T0GA 2FJUA 5C9ZA 4JMLA 2DFVA 4TS3A 1AVTA 4IIVA 3TB4A 4IUBS 3ZWKA 4U9IS 1CWUA 2Q0QA 5L9AA 4KQXA 5EJ9A 3S2GA 5IKPA 2PMCA 1G21B 5CX4A 2EFGA 1YSCA 3ZHZA 1E0DA 2H6EA 3V1TC 2LBPA 4JBHA 2BWJA 3GVIA 2WYWA 4HXYA 2WK1A 4J1NA 3TIXB 4LJRA 3C8HA 1B73A 1U28A 4YCBA 4CFYA 1R6VA 2FSFA 2CMHA 1E0JA 3GDGA 4F4IA 2FPKA 3FJ1A 3Q6NA 3QV1A 3JYQA 4MRRA 1WXGA 5JY6A 3L84A 1BEEA 4P93A 1Y7TA 1IONA 1EX1A 2I8AA 3QOYA 1JIIA 1LDBA 1QO9A 2XJ9A 1SZPA 3FYCA 3O90A 3SGLA 4UTXA 4DUPA 2G8LA 4MIEA 3RFXA 4P7KA 4L8VA 3NTOA 4P0QB 2VZ9A 1LBHA 3WKDA 1Q77A 1RYBA 1W4LA 4KBGA 4JBIA 3KQTA 4ZGGA 4RIHA 1SVUA 1WRBA 2YS6A 8OHMA 3VVMA 4NCXA 1CR1A 1NLZA 2VJLA 4ZVSA 1Q0PA 1DUVG 2QL7A 4HWSA 2JHPA 3DW1X 2PYZA 1ADGA 5FUXA 2WWVD 1AE1A 3WY9A 3OOSA 3UT5B 5K8CA 3GDOA 1RXCA 1IRXA 1JJIA 2HCFA 2CMDA 1KZHA 3WISA 5GVRA 3C5EA 3OM1A 3U56A 1NWHA 1QHSA 4PZEA 3OLWA 1XA0A 1QJCA 2R8YA 1F8GA 2WHXA 3U5ZB 3DHYA 3A1NA 4HAXA 1HLPA 3AUKA 3GJ7A 5ITSA 3LHKA 4OK5A 3TPCA 2B6NA 4D81A 4ARVA 4JJFA 1R64A 3HUTA 4X5OA 1L1QA 3X1DA 5AVTA 4TQUS 5EZYF 2GBLC 3DGEC 1P9OA 3ANMA 3CNLA 3JZAA 4TWBA 4WK4B 3R44A 1OZGA 5CHYA 4N0PA 5TGTA 1QGED 1QU3A 1Q0ZA 1N2IA 3QG5A 3K96A 2EHJA 1IY2A 2O2HA 4LV5B 1L8OA 5DO9A 3K53A 4NKRA 2WTMA 3FYDA 1IM8A 5I6DA 3S2IA 1GSHA 2L42A 5KJ1A 4DLNA 3A4VA 4WNIA 3OCWA 1B6SA 1GFSA 1LPMA 1NUAA 1T0JB 2GFIA 2I1LA 3OEYA 4PG5A 1Q1AA 3NPAA 1GR1A 4LJKA 4W9NC 1HDXA 2Q3BA 3SS7X 4ZHQB 5JS7A 5E1OA 2ECFA 2UVDA 4BNNA 2RIRA 4RFVA 4MV5A 1VRWA 2X3YA 3LUKA 1V9CA 2NXCA 4GI5A 4L8WB 4Q9IA 4Y67A 1N9GA 2QLLA 5JAUA 3FR8A 3O6VA 2AF3C 2ILVA 5IDWA 1M7GA 3FTCA 5EZSA 4DSNA 2WVHA 1N34B 1NN0A 4ICIA 2RAVA 4X1YB 3OZAA 5BR8B 5CCDA 4GOOD 3MWDA 2GZSA 4NS4A 5CTAA 4Z2AA 4ZZ1A 1UWVA 1KZ9A 4PICA 4KHPB 2AFIB 4E3ZA 1RE0A 1NE2A 3FDZB 4QWMA 1WUJS 1W46A 4Q00A 5EVCA 1P44A 3N53A 2QTMA 5JVDB 2ZTVA 1E58A 3OLCX 1C9KA 1VE1A 1LBEA 2CNDA 4NYJQ 2FQXA 4P2GA 1IN1A 5ERGB 2I4MA 3HV0A 1H85A 1VJTA 3FNRA 4Z5XA 4G81A 1OFHA 1W30A 4U5XA 2VJPA 1WABA 3DE2X 3NP7A 3CR3C 3MGBA 2ZT6A 3U0VA 2JGLA 5DW0A 5JJLA 2OSBA 2PLWA 3T15A 5KNCA 3IC5A 1PVVA 2B21A 2X5XA 4P7JA 3CZAA 3W7BA 1OLSA 3L46A 1QK4A 4HP8A 3W9UA 3NT5A 5I7AA 4Y1RA 2GXUA 1RXVA 3HZZA 5TPWB 1LKZA 3A4YA 1TJPB 3STTA 4JI8B 3JQDA 4MMYB 4BMYA 2C2HA 4GHWA 9LDTA 2QTBA 3DGFC 4J91A 2PH7A 2Y2VA 1C30B 4G0MA 2V6GA 1E5VA 1EWKA 4HWTA 3KKNA 1GNPA 3AIIA 3AFOA 4RVNA 5EYPB 1GXSB 4AS2A 2QZ4A 3IAFA 1J25A 1T10A 4MK4A 3FB4A 5AHOA 5A6SA 3IX7A 5BYBA 5LSAA 2ZCJA 3HA5A 2JZOA 4A91A 4PPFA 2PKXA 3IUSA 4TXHA 2JLXA 2VP9A 3NZEA 3V42A 2V59A 2V98A 1MGPA 2X0IA 3MHPA 2PD3A 5C46F 2JATA 3GNSA 1JSZA 4DR4B 1CLUA 1DWPA 1ZRNA 2A7QA 3DZHA 3O95A 4IMRA 4E5NA 3L4KA 4HXFB 3K0FA 1GLGA 5HF8A 3RU3A 5CG2A 1T9CA 3UAZA 1JKMA 5LMNB 2DY0A 4HPJB 2NXWA 3SF8A 3MCVA 4B48A 3WHLA 3AVWA 2R2GA 5EIOA 4KQKA 3C6YA 4RD1A 3ZGYA 1YZQA 1RPNA 1HZZC 1KY2A 1O4VA 3NWPA 1PT5A 2FNAA 3PR1A 4EVQA 4DA8A 1RCFA 2DLDA 3L0IB 3V9AA 4LUCA 3TNFA 4L1KA 1AT1A 2RB4A 4FCWA 4F3KA 2VPZA 5HZKA 5CVTA 1B2RA 1F2UA 2Q5LA 4KN8A 2C7VA 1MJHA 2R5FA 3JQ9A 1HE2A 4I9NA 4GZ5A 5EERA 5EZ6B 5FO1A 5TMPA 5IF9A 2ZIFA 4AS3A 3BC1A 4DL9A 3OJEA 1YDHA 4M21A 1QHFA 1UDWA 3H5NA 4LRXA 4YP6A 1JDZA 4UNPA 5CM2Z 4XASA 5AJVB 1K63A 1KGDA 1DG1G 1U8CB 2NYUA 2UUOA 3OP4A 4NU5A 5BSRA 5FPKA 2Z2XA 2F3QA 4BO6A 2ST1A 4B85A 1Z0IA 2OZLA 1CRQA 2XNCA 4AJOA 2HGZA 2BTEA 4S12A 3GN1A 2O7VA 1L3IA 3IT1A 4Z7QB 1SG9A 4RTPA 2XXBA 4XB1A 5B53A 2ES4A 2GYVA 4A10A 4IIJF 3DMGA 3UJCA 1ZRSA 4M6WA 3LCUA 1GG8A 4COOA 2OB2A 4I5GA 3TR6A 4JXZA 4CFSA 3T1NA 2HDWA 3K0CA 3WLJA 3QM1A 2AZTA 5JW6A 1O87A 2W0SA 4UFPA 2VR1A 3VU9A 1B74A 1XZGA 2QE7A 4OEHA 5I51A 1IH8A 1AB5A 5F2OA 5FUQA 2MOKA 4U7GA 1NHGA 2NUTB 5IKMA 2J5KA 4LDAA 4LF8B 3P2EA 5F23A 1A9QA 3BXFA 4AB1A 2IHYA 3LKBA 4HDKA 5K3FB 1DFHA 4QO7A 3UAGA 1EVYA 3VHXB 2ZFUA 5CXUA 4C3OB 1QG0A 1XZFA 1L3CA 3GWGA 3HLKA 4NCKA 1IEQA 1YR8A 3KB1A 2ZJZA 1BGVA 1PS0A 3NUGA 5DM1A 3K16A 4ZT7A 2OEPA 4YHBA 4R1NA 1NW4A 1V1MB 1GUDA 2BUBA 3GHYA 2Q0HA 3O8QA 4EHIA 4C5AA 4CLRB 1E8DA 2YV2A 5FP0A 3GZJA 4CM4B 5AJXA 3O4HA 2F8SA 1UF9A 5IMBA 1UK6A 1CK4A 2YMQA 2Q21A 4KDCA 3AF3A 2JLUA 3BQMB 1NBHA 2FEWB 1PT8A 3E84A 2QUZA 5KWJA 4LFBB 3MW8A 1I2ZA 2YDYA 10MHA 1U98A 5SZKB 1ZA1A 2PXXA 3E5MA 3KELA 3PNVA 1NURA 5ALUA 2GAJA 2ADMA 4BMVA 4MKHA 3A3NA 1EGVB 2PBLA 13PKA 2YFHA 2FSUA 3H8WA 2GJ9A 4LTNA 5KS2A 3EGDB 2KMLA 4NJEA 4BX9A 1XTUA 4RKQA 3T1TA 2ZRCA 4XM1A 2P0AA 3AUUA 1GGKA 4MRAA 3LGAA 3GUHA 3DAPA 2Q7OE 3N5KA 2ZJ3A 3H11B 4PLWA 3FB1A 4K87A 1WUTA 1QDEA 3MT7A 4BMOB 2D5IA 2FLKA 2OHGA 3DOJA 1TZJA 4II2A 4LHVA 5DBFA 3VPHA 4HQOA 2QI9F 3DA8A 4EG5A 4NXNB 1PRYA 1XU7A 3AEXA 3MG9A 3QKIA 3FLEA 3IPYA 3B2QA 4H0CA 1R15A 4AC9A 1JE0A 4NK5A 4XPIB 3FDJA 1NIPA 3P9PA 1U63A 1TNDA 3M4YA 1EDDA 1OASA 1RT9A 3VU8A 3WOVA 4KIGA 5EIWA 2C0CA 3RYCB 5DHUA 3AO0B 5FBQB 2EX0A 3WAGA 4EF4A 2JAXA 4FYXA 2XPCA 1TJ4A 1CUGA 4PVCA 5MF6A 4UHFA 1IXYA 3RG2A 4JL6A 5EZYB 2NOAA 1IWOA 1XLWA 4K9LA 3VO1A 3VR5A 1ID8A 4IIBA 4MPPA 3M1YA 1QIKA 4ARZA 2FFBA 3ZWVA 4K9DA 4M1TA 2FMXA 1UUFA 1PBNA 4PZAA 4PYJA 4DQ0A 4KOEC 2Y1WA 3ORSA 4NULA 2Z95A 4PFQA 1WCWA 3TDMA 4CIYA 4XQ0A 4Y0AA 1S3GA 4IXMA 4PLGA 1BJKA 3F1KA 1T1SA 3AJ9A 3I8XA 2AOUB 1ZN9A 4D42A 3OEHA 3H4MA 2Z43A 5IM4F 2C5LA 2GVDC 4MLCA 4UE2A 4R7GA 3RV3A 2O4UX 2JJQA 1WUKS 3IESA 4B34A 2DQYA 3DAFA 5JSHA 3EEYA 1DRUA 1ZN7A 2W8BB 2X5OA 4P4NA 2ZUTA 1OH6A 4L50A 3D7LA 3UC5A 4R9UC 1E2JA 2GFHA 1DEOA 1T8WA 2QSUA 2GEUA 3NYRA 4WPGA 3USES 4KI0A 3VI4B 2KPOA 2FWAA 3I9OA 1IVSA 2F4VB 1EK1A 1FTWA 3FNBA 2QS9A 4JB2A 4NBKA 4XXHA 1SD2A 3E9DA 4YV1A 5EA2A 2IUFA 2C8LA 4J0KA 4KFUA 4ZT5A 3PIRA 4OQQA 4IYJA 3RBXA 5BN1A 1TUBA 1VPVA 1WY7A 3SQDA 4REQB 2GCIA 4WLEA 1X70A 3WQRA 2QPTA 4KACA 3HBMA 3MWEB 1O6CA 2E6UX 1YASA 4PX3A 1P19A 4E6EA 1XTJA 2IIQA 2WG1A 1CTQA 5IT9A 4L8FA 4FM9A 1C7QA 3HWSA 5FOXA 2VKQA 3K4HA 4M9CA 4CCSA 2QB5A 1TYCA 3FX2A 3EARA 5JCOA 4F97A 5AI6A 1BOFA 3CA8A 3LPAA 3OIDA 3NNSA 3UFXA 2JVJA 4B84A 5E6RA 2ESRA 1EAMA 1X94A 2BZSA 3ONNA 4JP5A 4C07A 3HK2A 2ZSKA 2OO5A 3Q2OA 2CHQA 1Y1PA 3RT1A 2FX5A 5EJ6A 1COWA 3EVGA 3NHAA 4N54A 3KVVA 4XVHA 3DDHA 1JH8A 2W22A 2CC2A 2LWIA 4X71A 2MR6A 4M89A 4QNNA 3TOZA 4G36A 5M34A 1Z38A 2VK2A 4BNHA 4KR9A 2H7VA 1KKUA 3TDNA 3W2TA 4QOHA 3L4SO 4HEHA 5FBWB 4LOJA 3BS4A 1QHHB 1ZEMA 3BGVA 3COZA 2J7PA 3GJXC 3HG7A 5DLPA 1ATIA 2VSOA 3PD0A 3UK6A 2X3UA 3EQ2A 5IT0A 2PXCA 3LIIA 4RPCA 5E7JA 1VDZA 4HVLA 3BWMA 3Q15C 1P17A 3V4VB 1VP3A 3GLGA 1Y6JA 3BA6A 3FMVA 3MRVA 3OFND 2XUZA 5GM2A 4TT3D 3TI9A 4DV1B 5JSKA 1SNYA 3DEIA 1TXGA 3AUFA 3TGLA 5JQGA 4UU0A 3DWEX 3SYTA 4D0GA 2ZRFA 4QHTA 4RM3A 4G0PA 3IIMA 4ER0A 3MPUA 3R75A 4B4DA 5DHFA 1A76A 5AM4A 1JQJC 1EX7A 4RPKA 4HHEA 1PKXA 5AK5A 1ZVJA 1DMRA 3F96A 5FI0B 3STXA 4ZMRA 2EIXA 3IDAA 6ADHA 1QHIA 3T0FA 1DAKA 1NXWA 3LBAA 4B7CA 3FTPA 1X92A 1RAIA 2ZPTX 1N77A 3N39C 1BFUA 2BGJA 2N46A 2HJWA 4HDSA 4LF9B 2V54A 1FP6A 4BFXA 3ZHXA 3HEBA 1LTKA 3BH0A 3ZD7A 1D2GA 2FZGA 1K4KA 3LVFO 4CYMA 1MJGM 1AMOA 4EEZA 1DG3A 2OK7A 1G291 1UBKS 5B3KA 2Q50A 1K9VF 3V4OA 3HCWA 1QGOA 1VHLA 4H31A 3QIAA 3UCFA 5B55A 4H1HA 1BQ4A 2ZJ8A 2FZWA 1TTHA 4ALNA 4R2WA 4JLJA 4GG1A 1OX5A 1VLZA 1P7VA 2XB6A 3C8ZA 2JDID 3EDYA 1QO0A 3F49S 4TV8A 4XVRA 5EJFA 2FPMA 2J3HA 2XOKD 3D43A 1YR7A 2C7PA 3U6KA 1PNRA 4Z4IA 4OIFA 1OR8A 2VSYA 3LY8A 4K05A 3URKA 4L9RA 5DM0A 3TSCA 4EJ2A 2I3AA 3DEYX 4MLPA 5TPZD 2EZ8A 1AA6A 3DM9B 4GKJB 3Q41A 3B89A 4IIJB 5HUJA 2FWRA 1IWPB 1N92A 1O7JA 5FOVA 2A9FA 3W5SA 1PGOA 3KZ1E 1OPXA 1N0UA 2N1BA 2C8VA 4AF7A 5HE8A 4B2LA 5AVJA 1GADO 4KAFA 1MT0A 3ELDA 4YONB 2WRZA 3K6SA 1Q5PA 1V11A 4NMHA 4WLFA 4S04A 1MOPA 3THWA 4HH4A 2BJWA 5AICA 3ROZA 2P4SA 3N8NA 4XUDA 4IDCA 4Q9NA 4HQRA 1HT0A 3IJPA 4OQFA 5CYOA 4F2WA 2EW2A 1DHRA 1DKNA 1WXFA 2CD9A 2ZIEA 2JFQA 3MB5A 1L5HA 4ABTA 2GN4A 3IHLA 4FQ5A 3S29A 5CHEA 3I6YA 2CKMA 4KODA 1VA4A 4EHLA 2TSYB 1EVIA 2IBSA 4DNFA 2R86A 3FWZA 3DLBA 5JJCA 1SN7A 2B69A 1YCDA 1SUAA 2ODWA 3HKDA 3OQIB 4GUAA 4O0MA 5COQA 5IM5A 4E46A 2BRUC 1EWTA 5HIKA 4M9UA 3WKCA 1XDUA 3GLVA 1XTSA 5BVGB 4DJJA 1E61A 3QXGA 4KO1S 1SD1A 2GKOA 5AI4A 1PUJA 3M3DA 3HXPA 1U9CA 2VF8A 1KPIA 5D5QA 2DQZA 5UKDA 3TSWA 3UA3A 4FEAA 2DSNA 1SULA 2GJKA 2QZJA 1GZ6A 3D02A 3UZUA 4QYTA 1CHDA 3I42A 5TMDA 3LBFA 3ST7A 3LH5A 1N7GA 3H5OA 2HO4A 3E53A 4DDVA 3S1SA 3ZD9A 3M5DA 3Q98A 5FNVF 5JBNA 1P6XA 3T7SA 3WL3A 3CJTA 1SBZA 1Z8HA 4OA5A 5BURA 3QWFA 4FYPA 3B6JA 3KX2A 3NIDB 1NM5A 2VHQA 3RANA 3ILYA 4DMFA 1T2UA 2NO4A 4MB0A 2CXXA 4NZPA 1QBKC 1LA2A 5C3UA 1DQRA 1MAUA 2I2WA 2O6HA 2NSYA 2X41A 3KZMA 4TVOA 4WCVA 3ZHYA 2QI9C 1XNHA 1KE1A 4NBVA 5FADA 4CGZA 2CUZA 4F92B 3IB6A 3HTXA 4IJKA 3GH1A 4F4JA 5IT5A 1OAAA 1CZNA 3DXFA 1TVKB 4GT1A 1SXJA 3A6EA 2I4IA 2PLFA 3LQRA 1FVHA 3M81A 4ZOCA 1N32B 1FF9A 1NF8A 1QB7A 3CRZA 4RTQA 1B4DA 2Q4OA 3ZLUA 2AE1A 4JJ8A 2XQGA 3CZ9A 2JJ1A 4E1AA 3KE9A 3WA6A 2WIGA 2YDXA 3D6VA 2MSNA 4EQ6B 4F71A 1CS0B 1Q57A 2GH1A 2QX8A 2MSWA 3F9CA 2GQ0A 3IAUA 1Z88A 2ACKA 5HDQA 5J58A 2O8NA 3A04A 1S8NA 2C57A 2V97A 2ROQA 4PGAA 3EX7C 2CK3A 3GLTA 2H9AA 4IDBA 5I9MA 5J3JA 3VBEA 1MO3A 1WM1A 2WLSA 3NEPX 4MI1A 1DSSG 2D7CA 4MRMA 5HS6A 2P7IA 4G0WA 1V41E 3PDWA 1SZCA 3Q9LA 4HH1A 3QA9A 1W6UA 4NFLA 2WWWA 3FNIA 1B8NA 4ND1A 1IOVA 2WPDD 5F35A 3RJMA 1R8SA 5K99A 1ZD8A 3ML1A 1ZK3A 3IP6A 1U31A 3W2HA 2ZI9A 4EVRA 1SPXA 3N2EA 1R0ZA 2YXPX 1RWWA 1TTTA 2F90A 5EJAA 3UCXA 1JZQA 2QYTA 1IQ0A 4XIGS 1R6DA 4BATA 2IOQA 3EBOA 3EUAA 4CE6A 5JFTA 2XRZA 4O25A 1WZ2A 4N0DA 2PPVA 4CM8A 3WKAA 2IHUA 3V4RA 1AGNA 1UPBA 5AKEA 5EY5B 2AX4A 2HT6A 5FFMA 1FX0A 2P9TA 1Y34E 5EWMA 5CA1A 2ZAMA 1C4OA 1YZGA 3CE6A 1FUKA 3P0IA 4LHXA 4Q3AA 2XBMA 3G2JA 3WZMA 2C96A 3A2MA 3OLQA 2ZVDA 3UGKA 1SEPA 4EGSA 1GTMA 2EFHB 5EN4A 4BV3A 521PA 4M0DA 4YRAA 2OBBA 5M7EA 1NNUA 3K2IA 1JJ7A 4TTJA 3RYFA 4HDRB 4U5QA 1RWPA 1NG9A 4I19A 2DM6A 1ZGGA 4HEA6 4EYGA 1YB1A 3FOAA 3G9QA 1Y4ZA 3L6UA 4FYHA 4DAOA 4GM1A 1WCIA 4TLBA 4DRXA 2Q99A 2O3JA 1A97A 1DIHA 5FULA 5KPJA 4D3SA 2YQZA 4TQ9A 3OQPA 2AG8A 5A6VA 1G3MA 4J0FA 2WKSA 4DCJA 3H05A 4ZWNA 4DQVA 1PSZA 4B3TB 5FL7D 2AJBA 1AQYA 3H9GA 4EQZA 3L7AA 3D7NA 3Q88A 4KXMA 4QU8A 5L3VA 3HN2A 1LI4A 1RJFA 2E85A 3WL5A 4HZUA 4RF3A 1Z6TA 2WAMA 3LGXA 2PGJA 5KSZA 4OFWA 4YUXA 4E03A 1M5RA 4IZ6A 2W11A 3DD1A 4ND6A 3V34A 3E82A 1TRHA 2G9NA 1P7CA 2YC4C 3RKRA 3UM9A 1Q0LA 3ZKWA 3IKJA 1R4MA 3KJQA 1XA4A 1FDVA 3JAWB 2C1EA 2H54A 3QKWA 1NVTA 5TSDA 4CEIB 3WGQA 2R4TA 1OLUA 1KZYC 2QVLA 3SS9X 3WK8A 2FA9A 5LOVA 1RWXA 2V58A 1E2DA 1J49A 3AF4A 4HI0E 4DV0B 2BGIA 2WMDA 2IS2A 4ZVQA 4UE6A 5DNVA 5AVUA 1TEVA 1KJ8A 1MO2A 1XNGA 4KWCA 3FW1A 2KE5A 5BWMA 4F6CA 5A3QA 1L5KA 5IXSA 3L4JA 3DOUA 2QQEA 4ZXFA 3RRZA 1E92A 1CVIA 3EG5A 3ZUGA 3QFTA 2PHZA 2VQ6A 2Q9AA 1G9XA 3ZCSA 3D3NA 3B6ZA 2CNBA 1T13A 3Q9UA 2WZCA 3H86A 4XFKA 1TT5B 1D5WA 3MF4A 4MCIA 4KPFC 1A0OA 5JD5A 2GBPA 4R2IA 4ZT4A 2CHUA 3K7EA 2AI3A 3N5CA 3S3TA 3NBUA 1MO4A 2I6TA 3OPYA 2HDNB 1KQPA 4QUIA 4KXFB 5KO2A 2FUEA 4OBBA 1A9TA 1VHTA 3IEMA 1YB7A 3WO0A 1WMEA 1FP2A 3OFSA 5EINA 3T52A 2Y0PA 5LNK1 1VMDA 4MKZA 5EQDA 4G0UA 2JGDA 2BBSA 1CUXA 2P7HA 3ZHRA 2GK6A 1GEEA 3I2YX 1KO5A 1VBFA 3GZNA 1G2IA 3JAKA 4G5FA 4JLMA 5JE8A 4KO3S 4B09A 5BSHA 1PWXA 4EDHA 1T35A 3U7QB 3R8CA 4AKGA 4RE6A 4LDQA 3P2MA 4Y2XA 3U19A 1KVQA 1DC3A 3KKZA 4R51A 4LDRA 5EP1A 2CLEB 5J59A 1J39A 4RH0A 1FDIA 4RADA 4R7TA 2BEJA 2K4MA 4MR8A 1TO1E 3EZ2A 3JPYA 4QHYA 3VC1A 1QNFA 2I80A 5A2QA 1TCUA 4KDEA 2ZAIA 3DCNA 2EJWA 4B44A 3LPMA 2FN9A 3Q1KA 3DNMA 3K0KA 3JZFA 1JLLA 1W5AA 4WCFA 5IP5A 1UKCA 3G8AA 1UOEA 2F3TA 4JDPA 4XFJA 4S0XA 3SR0A 1ECPA 3KEOA 1YKGA 4DE5A 2ZXEA 3DNPA 5KQMA 5DLQC 5G1PA 3C6QA 4CN8A 2FDRA 1C9JA 2CCJA 2OGTA 4C6SA 4Z9YA 3ZDDA 1VDMA 3IOMA 5DISB 5CIYA 3UMJA 2AMJA 4S1PA 3QX7A 2XZOA 3NVAA 2FPUA 4DQDA 1OWOA 1USWA 4RKYA 1ZR2A 3T38A 3IVAA 3ZS8A 3TUZC 2Q3FA 2QKYA 1QFMA 3IKTA 4Y6GB 3QVWA 5CXQA 2XXAA 1M2JA 1AK9A 4D6XA 1OUMA 1EGMB 1VCMA 1PVDA 2QJFA 2DFTA 2WKPA 3O26A 4F5EA 5DTJA 3TE6A 1KVTA 1T6BY 2WICA 3BQ9A 4M36A 3ZY3A 1G8KA 3KALA 1X9HA 2B4TO 4P4GA 5DFAA 3T7EA 1R9GA 1NPDA 1NPYA 4QUHA 3I04M 2UZAA 1XEXB 3C6ZA 4ZJYA 5I47A 3VSDA 3FXAA 2OQVA 4EATA 1DT5A 4V0MA 1ZM2A 1EVEA 2A0WA 3QXSA 4GH5A 1VMEA 1OGJA 4BO3A 2Z04A 1BQEA 2ZYRA 3O8OA 2O3RA 1Q3KA 4I8IA 5IKXA 1ZOPA 1CKEA 2YXEA 1XB2A 1YZNA 3ZV6A 1PTJC 2LV8A 1T0PA 3GPBA 4ZRNA 1E9DA 3GGOA 1TIBA 2IH2A 5EHZA 1WVGA 2GILA 3RFTA 5FNVB 3OCXA 2DKOA 5FV7A 1XCPA 3WE7A 5JYBA 4XOUA 3ZLVA 4INJA 4Q3DA 1YRAA 1OA1A 5LBUA 2OMEA 4RMNA 1W0KD 2LUOA 4DMGA 1UANA 1LX6A 4C7XA 4KIUA 2QL9A 3C74A 1KC1A 3PSHA 4Y2QA 4QEZA 2ZBEA 3G49A 5GINE 4GOXA 3JQBA 3ND6A 3AZOA 2QX7A 4WV3A 3E3NA 3PT9A 3E1KA 1JWLA 1X7YA 1GN9A 2QUBA 4UUQA 1BO6A 3AFHA 5IC6A 1LBIA 3Q9NA 4IS2A 3FTNA 1PE0A 1QMGA 3U7HB 3LCCA 1E3SA 1EK6A 1SBTA 2IU3A 2EG5A 2RB5A 3EJ6A 1G4UR 3SD7A 3GD7A 3DOEA 3WAKA 4DT1A 1II9A 4CKCB 3HJAA 3NETA 2P77A 3LP6A 3PX3A 3GDWA 3K32A 5KOYA 5B1YA 1FFGA 2EZ9A 3RAGA 4HWOA 3CM0A 1XHLA 2XT6A 1SHUX 3FR7A 3QKSA 4YJGA 2W6IA 5DHQA 3TW6A 3PC4A 1C7JA 1K6XA 4TOIA 5A2GA 2Z3WA 1DNPA 1X8JA 5J4KA 2A6PA 4HEQA 1SCDA 2OO7A 2A1TR 4DR3B 1ZXBA 1YO6A 2Z58A 2IYVA 2ZJAA 3BHJA 3KC2A 3VA7A 4JUCA 1JHDA 4H60A 3ADDA 1WS6A 1U8TA 4WINA 1U8YA 3PRYA 1GWNA 4GP7A 2NV2B 2Z5VA 5HCUA 1NT2A 5KYXA 1GPJA 4OGWA 1NQUA 4Q4AA 1R9MA 1G64A 3DMTA 4G67A 3JYOA 4P3KA 4YMTA 3M2PA 3H5IA 3E3MA 1T2AA 5CVUA 1ABEA 4GVPA 4H7KA 3WLLA 5FTKA 5BT8A 3I9MA 4L6IA 5EEGA 5JEDA 2AL7A 1NVWQ 1SHZA 2RK3A 2X8WA 3A1CA 2BFEB 3RU2A 3HKBB 4Z99A 1A8QA 3PUJA 3WDSA 4WBNA 2XSZD 3I0NA 3QE2A 3RSLA 5FEUA 3QYAA 2EVWX 4FJ0A 1F6BA 1AMNA 4LQLA 1C2YA 2VTBB 1A9XB 2QRQA 2OBLA 3ZU5A 4MDEA 4KYUA 2YFQA 2BGTA 1IY1A 1CR6A 1UJMA 2JD2A 5K2MA 1NR1A 2H63A 2B99A 1GVHA 1K8QA 3OT1A 4L5CA 2JAPA 1Z3IX 2Y3IA 4JSYA 4Y0VA 4NZNA 3U6BA 1NJFA 4CLEA 1U0JA 2QAGC 2OO3A 3BFPA 4NG5A 1X15A 3W0LB 1QHXA 2QAGB 4FHZA 1L4FA 1SFRA 3GPCA 4PFJA 1E3WA 4D44A 4F45A 4HNTA 5F1YA 1NUPA 5HQJA 3ER8A 4DM4A 3TTTA 3G88A 1SVNA 1FRVA 1XEWX 3EXEB 4MS4B 1JIUA 2Q6IA 2X9QA 2ZRBA 1A5ZA 4MIOA 3AVVA 1ZD1A 1X9GA 3OX2A 1JI0A 3ZE8A 1U0BB 1Y8CA 2C5SA 3UKDA 2EIHA 1DO8A 2ZAYA 4D97A 3PYMA 4M0CA 4KIFA 5K7SA 1QFSA 3JYPA 4CUJA 1DGQA 5IVDA 4ROSA 1DXYA 3PQ8A 4R8LA 1S0UA 1KJIA 4Y7DA 5CM9C 2VJKA 4HR7A 2J6BA 3F5DA 3H9BA 4PXSA 5BXQC 5AHWA 2VHJA 2ZIWB 1QDUA 3ICOA 3SX4A 1ZVKA 4HZGA 5K01A 3WRXC 4O2AA 3EIWA 5FBHA 4LF5B 1LW7A 2XUJA 2VJAA 3DLPX 3PHCA 4KKVA 4EZIA 4KXNA 1ID1A 4KQ6A 4ZHQA 1SQSA 1DJPA 3MS4A 4HQLA 4EZEA 5CFQA 1G8JA 4QYIB 1J0BA 2WIDA 4LXGA 2B30A 2Y68A 4J49A 4ZT3A 4WNCA 2Q3HA 2ZJ6A 3ZBUA 3TPFA 4R8VA 1PG2A 1U2SA 1FUIA 4OBWA 1XZKA 5C4GB 3RK0A 4EUEA 3WYCA 3E5RA 2B1JA 2MJLA 3O03A 2O0LA 4CM1A 3QELB 5C80A 4IGIA 4KXQA 3M33A 1BW9A 4LJ7A 5AHRA 4NBWA 1OAOC 4RGVA 1Y3HA 4C20A 3KIPA 3D7SA 4V1CA 2X0KA 2D3TA 1PWZA 2B8NA 4CM3A 2Q46A 4RY0A 4CNBA 4KR2A 1LNZA 1SBCA 5FQOA 3V1NA 3K8OE 4F21A 1I7LA 2OLJA 4JSTA 3RIYA 4EY7A 1ULZA 4LOHA 2F67A 2BKAA 1GR0A 1X1AA 3FPLA 4PHCA 5B2FA 2W7TA 3B20A 5A06A 4JASB 4PGGA 3OIYA 2PWYA 3LYHA 3QHQA 1E3DA 1NKVA 3I72A 1THGA 4DFDA 4BPBA 3NV7A 3E61A 3EC2A 4HN9A 1OX4B 4PE5B 3OTOB 1CRPA 3O47A 3QVGB 2ECQA 4E2ZA 3IQWA 4C4PA 1C30A 4G1MB 2EWWA 3DTVB 5CGZA 2G4VA 1E0KA 1Y8QA 4TRRA 2YZNA 4QELA 1D1PA 1PHPA 4L75A 4R83A 4DDHA 4EY4A 1RJ9B 4RDIA 1RACA 1LUAA 4WXPA 5C4IA 5JR3A 2DLCX 4XDZA 4J1TA 5KU1A 2DAPA 3R4CA 3DKRA 4FIZA 1NQOA 3C5HA 3FVRA 5BR4A 5JAHA 2BHRA 2FUKA 2XUOA 2G9UA 1KQGA 1PJCA 4HADA 3MT8A 2IS4A 1K3UB 5A4KA 4N8EA 3REGA 3KTAA 4EW6A 2ARKA 3P0HA 3GB9A 3KSBC 2QD4A 2YMLA 5CEEA 5EWLB 1U3TA 2CXOA 2JGFA 2HMSA 2BM9A 2QQ0A 1ULAA 1WKCA 4FCTA 4MAMA 4XDYA 5TXGA 2P2LA 4YYEA 3V32A 1F6WA 1Q0HA 2JGRA 2QLMA 3NKVA 4E31A 4C4XA 5JDCA 3EFOB 4JLSA 4K6HA 4QOGA 1HZZA 2QQFA 4MUYA 3AL3A 5IVHA 1MNAA 5I3ZA 3LBNA 1MW9X 2GM4A 4NOLA 5K3BA 2Y6UA 4JR1A 1SKAA 2O0JA 2GNOA 5JS8A 1UWKA 3E0QA 3DR5A 4U2DA 1WL8A 1T3LA 1NSFA 2EARA 2IE8A 2OV6A 3L82B 4JJIA 5FYQA 3SZ3A 1HTBA 3NTRA 2OCPA 1SHKA 3DMDA 3GVHA 4IIEA 1FRFS 4FX2A 1GOTA 1K2VN 2V3CC 3V2UA 1ITZA 3DE7X 5JRDS 3KTFA 3ELYA 5ALQA 1ZOLA 1V2GA 1R4NB 5C1OA 1JLHA 1IDOA 3CZMA 4WDQA 1OMOA 1A96A 3RVRA 2E4YA 5G41A 4C9BA 1S3SA 2WAXA 3TB6A 1Z4KA 5HGXA 4TMTA 2XBLA 5CG1A 1BVUA 3OPQA 2C3YA 3UG7A 5H7XA 4E07A 3H0CA 5FOTA 1OW3B 1YHZA 4RF5A 1CQZA 3RWMB 1QH9A 3QTLA 1SCIA 1JILA 2DU8A 3PGKA 4X8MA 4L5BA 3ZLJA 2GN6A 2GLTA 2WWHA 1NMXA 4KIWA 3I5YA 5G4KB 2D5CA 3TCXB 3BE5A 3GT3A 3ABIA 3AY0A 3JQ8B 3LPDA 2GPWA 3SKVA 3NM6B 4DLKA 2I7XA 5CDHA 1JDNA 4HAIA 5E2AA 2W6MA 1XOIA 2CLMB 2FRXA 4RXMA 3GPDG 1M83A 3G0CA 1XDWA 2HWXA 2BOVA 2G80A 4KLAA 4WKNA 3WFZA 4B80A 5H80A 3VNVA 1A04A 1XXHB 3WYEA 2IP4A 1FUUA 1V39A 2FQQA 2YHIB 3TEJA 5L3ZA 3GLFA 1AM4D 2ZI5A 4XWYA 3I09A 1LQUA 4WMLA 5ALXA 3U3RA 4BWYA 1PR1A 4LGYA 4YT8A 3HVHA 2XE7A 4BMCA 3VYUB 1CQIB 4UQOA 2O3UA 2XTZA 5HJ5A 5DHRA 3LXUX 4RD6A 3H1EA 3PGA1 1BEZA 2WJJA 3PEUA 1CUHA 2AUTA 4FS3A 5KYWB 1A4XA 1QRAA 1T91A 5I9SA 1XYYA 3CF2A 1Y0BA 2NUBA 3FRJA 1HLDA 1J1IA 1KAGA 1LLFA 3C16C 4FYMA 4X97A 3G2PA 2A88A 2I66A 4WZBB 5B1SA 3SZMA 2FZEA 3D31A 5DNCA 2RIPA 3QJYA 4UDXX 3K20A 2YZ2A 4FGKA 4KV9A 1IQRA 4MJLA 2CE7A 1A7AA 5J4HA 2Q6TA 1CYEA 3TLGB 3H18A 4JEMA 4P31A 4OHPA 2BH2A 1CFZA 3PITA 3KYDB 1WW8A 2AD5A 2P1ZA 1S01A 4FSHA 1QSGA 4WK0B 4YV7A 3LLSA 1L2TA 2JJ2A 4GYKA 3MWLA 4ZOLA 3RTDA 4V0QA 4D9KA 5FAKA 1KDTA 3EIUA 1TGYA 3EIQA 5EKTA 4M0KA 1I7QB 4JVMA 3BMXA 5FV4A 1YHNA 5AP9A 1P0IA 2ZJOA 5I9IA 1ANKA 1Y81A 4IYRA 1Y1QA 5TQ0B 1KS9A 2JG3A 4O3FA 1BC5A 3AR4A 3EQZA 5L45A 5B7GA 3WWDA 4KUHA 2ORVA 4JT2A 5LB2A 1RKUA 4L4RA 1SU8A 4AN4A 4N49A 4JUFA 3MT0A 1VPLA 1RKVA 2PL9A 1L4HA 3QFCA 1FY2A 2B36A 3OAAD 2CV1A 4P82A 4QYXA 3UV7A 1OTXA 3KPUA 5BYAA 2CEAA 2Z2IA 3CXUA 1XQWA 4U9UA 5EZYA 3AMVA 4JYMA 3T4XA 1Z33A 5C7YA 1X1RA 1GG5A 1UK9A 3RVDA 3TECE 5C2JB 2WJYA 3MILA 3FWNA 4ER6A 1OF1A 3NBAA 3J81A 1Z47A 1EFDN 1DJMA 1XE3A 2FW9A 3IP7A 3ZHCA 1WY5A 1ZDMA 5ALYA 1Y37A 1W76A 2UZ1B 1Y9AA 3AUSA 3TD9A 1WF3A 3OTGA 2NPOA 1TL7C 5FHQA 3Q6IA 5HCIA 3ZD8A 2FPRA 1VG8A 4L15A 3TLCA 2W5UA 3R24A 4C04A 1N8SA 1THMA 1W581 2P2ZA 3LF2A 3OLYA 4GBED 4NU6A 4ZU1X 4TTPA 4MVJE 5CNIA 1XVVA 3IMGA 4J0QA 1VJDA 5B7PA 2E37A 2WJHA 1T3GA 4P1ZA 5LQJA 2D2XA 1HE3A 1YE8A 4HK4A 4KYTA 4MQUA 3JVEA 3JX9A 2X15A 3A9RA 2AWNA 1F12A 1GU0A 4BEJA 4DLUA 3THXB 3RNOA 3VDMA 1PR9A 1Y8AA 3B6MA 1ZGZA 3RGWS 4ABYA 2MYNA 3AV3A 3F8TA 3BDIA 4JYPA 4Q7MB 1BDMA 5BWLA 1I01A 2BEVA 3ZKAA 3NHYA 3MWEA 2PR2A 1EQAA 2JFVA 1IMOA 2X0EA 2I4OA 2JFUA 3CH6A 3V2IA 3O1LA 1ISHA 5HPYB 4X3OA 2Q07A 5FTMA 2FY8A 2NZYA 1LTHR 1REQA 4LHWA 1RAEA 4X1KB 2AW5A 1T36B 3VR1A 5JCJA 1TPYA 5K0SA 3E9NA 3WLRA 3E3OA 3KJXA 1GPMA 3ABRB 1N6RA 5EXPA 3DQZA 3UWDA 1G9TA 1KAOA 5BSEA 2CLSA 2IZ5A 5CU7A 1I2MA 2NUAB 4P8RA 3WSVA 2BKEA 2XAUA 1MH1A 1W2WB 3FI9A 4RLFA 3S2FA 1RIFA 2AXQA 3NTVA 4MP8A 5BMVF 2HEGA 3L7DA 4KL8S 1U99A 1GG2A 2XW6A 1DC6A 4HVTA 3KV3O 4DNQA 1M74A 2D1SA 1N0WA 4TLDA 2E5LB 3Q8XB 1U7DA 1T4GA 3NIFB 4U7TB 3SE7A 3TZ6A 3H5LA 4OHZA 4R2MA 3SKYA 2XDWA 2HK7A 1RZVA 4CQMD 1K88A 2ZUDA 1DX6A 4ZVVA 3JQAA 4DIUA 5DBOA 5BW6B 3P9YA 4O4IF 5FUVA 5JFOA 2YL2A 5ICSA 3BXOA 3KQYA 3QPVA 3KKPA 5FA5A 1U1GA 5C34B 2COUA 3DOFA 4KPUA 2F64A 2P8SA 1S2MA 3B2NA 1UMBA 3QUBA 3IQIX 4D8VA 1P0QA 1EZ1A 2HMUA 1ZC4A 3BJEA 4XIIA 3RVJA 4FGSA 5KCZA 1PGJA 1TO2E 1L9XA 3SLGA 3H8JA 3WWZA 4ITUA 2VF2A 2H1IA 1SIOA 3ESQA 3LW8A 1QQTA 3EW7A 3QG1A 2HA2A 2QROA 1M6WA 3G79A 1SIBE 5LWQA 2JLQA 2J9FA 4PSCA 1FJHA 2VAVA 3S6JA 1G20B 2FMTA 1T5HX 1GLVA 3RRXA 2IELA 3D6MA 3EHEA 2IS6A 1OIXA 2IVFA 4BP9A 3QRWA 4GMFA 3K3PA 2QTGA 2PKQO 2MHCA 2QSYA 3JVUA 4CF4A 2E4ZA 1YVRA 1OLXB 1PD0A 3L77A 3M5PA 1NAHA 1IOZA 1O54A 3DVAB 1EAYA 5FQNA 3ZY5A 1AOXA 3WWPA 1RSZA 1I7NA 3L0CA 2JFGA 3DMYA 3VOSA 3NHPA 4AWBA 3PNOA 4UD6A 2JFHA 1FA9A 2XNDD 1K7EB 1U5BB 4U8GA 1V5FA 1GV0A 1PTKA 4IOKA 5T4EA 1FFBA 3WLSA 2E4WA 4HDCA 1LBQA 3V9PA 4C43A 1MQSA 1YS7A 1VB3A 3EBPA 2ZTSA 5G0TA 4F4CA 1L7AA 3AB7A 3EUWA 1MUUA 3N86A 1WD5A 2EDAA 3NI2A 3S0JA 1CC1S 4GXNA 4MS3B 2W2LA 1VI6A 3U61B 3QK7A 1GPH1 2GM9A 4G5HA 4KG7A 1SC6A 4MGKR 1QG2A 3U26A 3ZUPA 4G56A 3KTOA 2X7XA 5DT9A 2X8BA 2P0YA 4U39A 4GIBA 1TAGA 4BB6A 3OE1A 4OX9Y 4JI4B 1E0AA 1TM7E 4C4SA 1T4MA 3MD9A 4KAJA 4OKNA 5KX5F 2NW6A 2XVMA 3U7JA 4AZ3B 3NU1A 3SOZA 1ESEA 4RFLA 4HQKA 4QKQA 4G4GA 4MUAA 4U9HS 4YRNA 1UADA 4QPNA 3AG6A 1PI3A 2O2JA 1G7CA 2WWYA 2OAP1 2I33A 2C8JA 1LBTA 2JFYA 4ZOBA 5IAKA 1K7FB 5FRDA 1SOAA 1H2WA 1W8IA 3T9BA 5LYJA 5IH3A 1USIA 4TYMA 5A5EA 4B76A 3WGGA 1EKXA 3AR3A 4CEJB 1UBFA 4IAOA 4IJ6A 2GAFA 5TC4A 4KMRA 1XMOB 1RI4A 4MVJM 3QUCA 3UHPA 1GGVA 4P7BA 3CEJA 5HNKA 2ZE7A 3NHJA 5CM8B 1CSEE 3I12A 3U48A 5LNK6 5HF5A 3U1VA 2IA5A 4OB7A 1HO3A 3EIXA 2G17A 2NTJA 2IKQA 5JRJA 5L95A 1PFQA 4MEJA 4LA4A 3BXGA 1YMQA 1IN5A 1NW8A 2R7LA 3ZEAA 1OQAA 5GOZA 4MUKA 3HCEA 3D0RA 1QFXA 1CUZA 1AO0A 4AO8A 1J5XA 4CHGA 4PLPA 5A3VA 2C97A 1CUCA 3QLJA 1SHLA 1C50A 2XMDA 3QSYA 2FEAA 1ZK1A 3H9QA 2D1FA 4J0JA 3B1ZA 1GCAA 5FR1A 5TNXA 1W5BA 1OC4A 1E3TA 3AR8A 1VECA 1HRKA 1KSHA 2XYRA 3L79A 4BKOA 1ODIA 4GR9A 5H3CA 4PGMA 3DKVA 3OM9A 1QOQB 1HETA 2OSVA 2PGNA 3I4FA 3NIWA 3FUUA 3LT0A 4UASA 4AWAA 4E1BA 1K3FA 1WR8A 5E4TA 4EHFA 1Z35A 5E8RA 4GKAA 4TVBA 5B7QA 2YJ6A 1OZAA 2NNWB 4MR9B 1ENPA 4WASA 5IXJA 3FNHA 4BE7B 1X7HA 4DR2B 2CJWB 2QLNA 3QFSA 3BAZA 4QYWA 3PQDA 1JT2A 1E63A 4W1QA 3QLVC 4LBWA 4PZ9A 4X63A 5HBGA 2KX7A 2XI4A 1QKKA 2FI1A 2GEDA 2J48A 2CLFB 3NS7A 3O8CA 1YULA 4X8LA 3RCBA 3OUTA 3PPYA 3C5WP 3V8BA 2W2QA 1LFDB 3P2KA 1XVUA 4KH1A 3U09A 4OH7A 3UB3A 4I3GA 4PAMA 4PYLA 2VCHA 3BWCA 3NWOA 5JD3A 3VZBA 1NP3A 3RIMA 4G3XA 4XIJA 3I2GA 4BFWA 3EK2A 5JHHB 1M6YA 2Q3EA 1KQOA 3U49A 1W73A 1MF7A 3IMEA 3IO3A 1U0SY 1GQSA 3L7NA 3MIZA 2FX3A 2VTDA 2WTXA 4MQEA 3OQ6A 2O7NA 3K1JA 3WK7A 3R2JA 2GSDA 4G8DA 1NKSA 3U62A 3IIEA 1BMQA 3GRPA 3QQPA 2J5QA 1BJTA 1JIXA 2G9QA 2HXYA 4O2BF 5CT4A 3CBQA 3I1FA 3V4ZA 2GKSA 5F7XA 3IEIA 1C9DB 3DDWA 1D4ZA 2WDZA 2IH4A 1XP5A 3HUUA 4DIFA 2YNMD 2V4MA 4COKA 3TFOA 1UDXA 1T9AA 5AVOA 1UK8A 4GX5A 3MQ2A 4CM7A 1EUCB 4Y6RA 2P1RA 1VGQA 4BJ3A 3BD7A 2JIZA 1CZOA 2PSHA 3C8MA 3U9TA 2AXPA 4E2YA 3GPIA 4KKXB 3V7UA 3A6KA 4CLHA 5ICCA 4JCOA 3CCCA 3TOVA 2R84A 2JIDA 1PJZA 4PAOA 2JA1A 4KX5A 4N5MA 1JVBA 5IJ0B 1Z0AA 3EASA 3GG9A 2YINC 1RMTA 3EVCA 4YAKA 5JO9A 4HDRA 3U16A 2AOWA 1LNSA 1YJAA 4BGIA 3DB1A 1VXRA 1IUNA 3AI1A 3R09A 2HXGA 4KFRA 4FINA 1ZSNA 1R66A 5M5BA 1Z2EA 3QENA 3S8EA 1G7RA 1J56A 3G0BA 2G0AA 2BELA 3DZCA 3ET4A 4ZVLA 4HAYA 3DEAA 3VGJA 2ZYTX 5KSYA 4MINA 3BE6A 5FUBA 3TSZA 1H5QA 5BMVB 5FBRB 1WZCA 2AN5A 3OEED 1BD3A 3NWBA 4IDOA 4O4LF 5TGDA 5K0ZA 5A5GA 4G5QA 1RRVA 2RGYA 4UBNA 1KEVA 1RP1A 1Z4JA 3B48A 4B6PA 1GQFA 3OC0A 1EK0A 4TN5A 5J23A 4MUEA 3OBIA 2FSVC 4I4TF 5JNWA 3NHUA 1G60A 4UC0A 3WZ2A 4YRGA 4KR6A 1P2SA 2O50A 3IDOA 1TUGA 2C20A 2OCBA 1DARA 2TMYA 3WWEA 5LQMA 4YY3B 3CURA 2UYYA 3ECSA 3JWIA 4LJ9A 4GYJA 4O4IB 4N65A 1H4VB 4AP9A 2H4FA 4PAWA 4YROA 3HP4A 4OTZA 3DHNA 4DSUA 4MH0R 3FZYA 3LVRE 1C4KA 1ES9A 3M0EA 1V6SA 3KXKA 5ICMA 3JVDA 3SBXA 4P3PA 4CMGA 2HI0A 4DLAA 2O8FB 5ERYA 4ND3A 4QBTA 1L5VA 1I0ZA 1CY8A 3A4NA 1D07A 1E2GA 1SC1A 3BZBA 3HVUA 4O4HF 5JSZB 1MPTA 2FPSA 4NAVA 3WNBA 5BW8A 5IWCA 1VKZA 4Q34A 4BE4A 1EP2B 1RAFA 3IL2A 1FDTA 5JYCA 3DQQA 3B8HA 4RSMA 3TTWA 1XCOA 3NCTA 2R6CA 3A32A 3L06A 5L3SA 2DFDA 1DB3A 2PA3A 2CUTA 1JFRA 1J8VA 4TXLA 4FYYA 5KNBD 4C2UA 4IMPA 4L27A 5KOJB 5DBHX 3HE3A 1RLTA 1LRJA 2XZLA 1I13A 3GRCA 4CWAA 1PJ2A 4DTCA 3KQNA 4TTTS 2R8BA 1UMDA 5HRAA 5IRCD 3T1HB 2P2DA 2H65A 4IDQA 4NPHA 4ZICA 3RUCA 1LVHA 3CNBA 3G0GA 3LPCA 4LPKA 4B7ZA 2IHKA 4KHZA 2FSIA 3MN1A 3O5AA 4PCAA 3BXPA 2DECA 3AGPA 4ZI7F 1U94A 1SUEA 1C7IA 4FR2A 2YRWA 4WRRA 4JX9A 5A4MS 3O1IC 4H1TA 2NO1A 2XB2A 1KAHA 3GL9A 4TYQA 3SFTA 1U4OA 2UVQA 2ZYGA 1JQDA 4M88A 1RXWA 5T64A 1SXQA 1QRRA 3JQQA 1I4WA 5BT9A 1X39A 3WQBA 1SG0A 3BSFA 4E51A 2B35A 4X93A 4L2IB 1N5OX 5SZIA 1U0FA 2CNWD 4A5OA 3FUTA 4DG8A 1UBEA 3Q8WA 4BVKA 1EM8A 3FUVA 2IE0A 3RVLA 3L9XA 4GOND 5ARBA 2YW9A 3SFVA 1JJBA 1GL7A 4LNHA 5G1OA 3JQEA 5GV8A 3IHKA 1B0UA 1N6KA 4HLDA 3WB9A 3NDBB 1Q14A 3C5VA 3LVBA 2GEVA 4FOLA 2Y1OA 1EA7A 2M6RA 3D0QA 2WM2A 3CEHA 3SJBA 4ZVTA 1ZX1A 2D0OB 4WECA 4ZMSA 1P8AA 2AEEA 2I1VB 1L7NA 2II6A 2VJNA 3I01A 3QA3E 4G5SA 1TX4B 1JHOA 1AZSC 3O31A 4MA5A 1GIAA 5HM8A 2EBUA 2VI5A 1P39A 4FGUA 3VVCA 1XQ1A 2CSUA 4EL0A 4WKGA 4ZAFA 1Y8ZA 5GM1A 5A7HA 1IATA 2QEQA 2PU7A 2IEBA 4RD0A 2QHXA 5FO0A 4AFNA 1UJCA 2B25A 3BULA 4CL8A 3R7LA 2IQIA 3AONB 4AZ0A 4EF6A 1Y3DE 3CX3A 4F3NA 2K2QB 4IDNA 1SB8A 4KWHA 4LRQA 3V33A 4XUCA 1FEZA 4A0RA 5IFLA 3EGXB 3I6MA 3RU7A 3G02A 1I24A 4JJZA 4K9SA 4C06A 1JTEA 4F3YA 1M2GA 1RR6A 2PK3A 3GN2A 3CKYA 3B5IA 4OATA 8GPBA 1FYEA 3GZTB 1BA3A 5TB5A 1TVEA 2X13A 3RODA 4A15A 3AIKA 3K92A 1N36B 2BHLA 3QFFA 1XPUA 5B1DA 2ZIGA 3N07A 4FWBA 5CLLA 2RGXA 4DWOA 2H92A 3OOHA 2PO7A 1SELA 3O3NB 1STOA 4OIMA 1ZUNB 1ONOA 3ICCA 2VBCA 1PWYE 3F6YA 3DLHA 2MSEB 3DR3A 3TIFA 3R8FA 5HIIA 2ENUA 2HHJA 4C2AA 4IS3A 2PE5A 5JU6A 3DDUA 1SURA 3BREA 1EFAA 4LMPA 2H2AA 1S4MA 3ODPA 2NPFA 1HMYA 2O8BA 1W88B 3U4DA 3IJRA 3HC7A 1T5IA 4ALJA 1OWMA 2P9JA 2CZQA 5TQJA 2WIBA 5JLAA 4HYTA 3ET5A 2QSZA 2GERA 5JISA 3DZGA 2IUEA 4ZAGA 4HXEB 1C7FA 2LRHA 2PRZA 3DKKA 4PY2A 4RV9A 5JCZA 5B2ZA 2DP4E 4QX6A 3HA3A 5GJVC 1JFFB 2VUSA 1QKIA 3WRYA 2FEOA 1P6UA 3MBKA 1RS0A 1C9MA 3LD9A 4F8EA 4RGQA 4YEDA 1L4MA 3CRNA 3SIRA 4GAEA 3QIVA 5LZ8A