4ZVTA

Caspase-7 variant 1 (v1) with reprogrammed substrate specificity due to y230a/w232m/s234n substitutions, bound to veid inhibitor.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
YQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Reprogramming Caspase-7 Specificity by Regio-Specific Mutations and Selection Provides Alternate Solutions for Substrate Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2015-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4zvtA00
2FP3A 3H11A 4QUGA 2C2ZA 1I4OA 4ZVTA 1RWPA 1IBCA 3GJQA 4IEFB 4FDLA 4IYRA 3V6MA 2XYHA 3R5JA 1RHKA 5IBPA 3D6HA 2FUNB 1BMQA 4FGUA 3EDQA 5IBCA 5H0IA 2Y0BA 4JB8A 4QUDA 2QL7A 2K7ZA 4ZVQA 3PD0A 4N7MA 2C2KA 4ZVPA 5IAKA 4EJFA 3OD5A 4NOKA 4QUHA 4ZVUA 1QTNA 5IARA 4PRZA 5LUAA 4QU9A 4D3XA 2C1EA 2J33A 3V6LA 4HQRA 1SHLA 2CNLA 3EDRA 3QNWA 1PYOA 4DCJA 2CJXA 2HBYA 2QL9A 4DCPA 4JR1A 5IAJA 3SIPA 2CNKA 4EHLA 3DEIA 2CNNA 4NBLA 4NOMA 4JR0A 1QDUA 3IBFA 4JJ8A 3R5KA 4QUEA 1CP3A 1F9EA 1RWWA 3KJFA 4LSZA 3R7NA 3DEHA 2FQQA 3KJQA 2XYPA 2J31A 5IABA 3H13A 4NOLA 4EHHA 3H1PA 2C2OA 3NS7A 3P4UA 3R6GA 3R6LA 4QU0A 1GFWA 2H5JA 4EHAA 4NBKA 4PS1A 4QULA 4ZVRA 2QLJA 5I9TA 3V3KA 4PS0A 2QLBA 3D6MA 3GJTA 5IC4A 2H4WA 2H51A 5I9BA 5JFTA 1NMQA 2H54A 3SIRA 1RHJA 1RWVA 2QL5A 4PRYA 4NOJA 1KMCA 3S70A 5LU9A 2H65A 1RWNA 3BIJA 1RWMA 4D3ZA 3K7EA 2H4YA 1NW9B 2WDPA 3KJNA 4N6GA 1K88A 3RJMA 2XZTA 3IBCA 1K86A 1RHRA 4JJ7A 3UO8B 2HBQA 5LUBA 4DCOA 4EHFA 4QTXA 2CJYA 5IC6A 4D3YA 5IANA 2J30A 1RHUA 3ITNA 1QX3A 1RWOA 4N5DA 4QTYA 2CNOA 4FEAA 1NMSA 5LU8A 1RHQA 3P45A 4HVAA 1F1JA 1PAUA 1ICEA 4N7JA 4HQ0A 1RE1A 4JQZA 2C2MA 2H5IA 4EHNA 5IASA 3GJSA 4AWAA 4AWBA 3D6FA 3DEJA 2XZDA 4ZVSA 1M72A 4QUBA 3S8EA 4N6OA 3DEKA 1I4EB 3R7BA 1SC3A 5IAGA 4QU8A 4NBNA 5K20A 1CVRA 4I1PA 2AR9A 1I51A 2HBZA 2NN3C 2Y1LA 3PD1A 3V55A 4QUAA 4QU5A 2P2CA 2XYGA 3NKFA 2H48A 1RHMA 3UOAB 2HBRA 2QLFA 4N6NA 1SC1A 4FXOA 4M9RA 2CDRA 3NR2A 4JQYA 5IAEA 1I3OA 3H11B 1GQFA 2J32A 3GJRA 4I1RA 3R7SA 1JXQA 3V4OA 1RWKA 4EHDA 3V4LA 3PCXA 4EHKA 3E4CA 2DKOA 4JR2A 1NMEA 4QUIA 4QUJA 1SHJA 5IBRA 1RWXA 4JJEA 3H0EA 4AW9A 4ZVOA 1SC4A
chains in the Genus database with same CATH superfamily
2AFVA 4AYXA 1G21E 5CM8B 1OX5A 1LBTA 5CEFA 1Z7GA 4K05A 4DUGA 3E6AA 3A32A 1QE0A 5F52A 4F4HA 4M2LA 4PFKA 1II8B 1Q0TA 2HHLA 2YR0A 1FSFA 3DL2A 5FPYA 3BWBA 4KPUA 2YDXA 3CO5A 2PMEA 1RAGA 4C7KA 4CM9D 2IPNA 3C3MA 2OLJA 3GEIA 2G07A 4RACA 3O5AA 4K9OA 4PQYA 1PLKA 3THRA 4F92B 2IV7A 1UOOA 4N0PA 2QYTA 2FWJA 1XAIA 1J8YF 4ZJPA 5CVUA 3SXUB 3RUFA 1LQTA 3FPGA 1FZQA 1ZGCA 2WB4A 3OEED 4NS4A 1BFDA 1ZQ9A 4O4LF 1TTHA 4LXHA 4Q7KA 4O2BB 4JWKA 2AOUB 1HGXA 3PUYA 3ZGXA 4DJJA 1ST3A 1MORA 2QB5A 1CNFA 4R40A 4RV4A 5AW6A 5HSGA 1KY3A 1U65A 4LJ7A 2JLXA 3EFOA 1X7YA 2IPOA 1SQ5A 3DOUA 3OFJA 3R24A 1O95D 1NT4A 3AM4A 4JKYA 2CNKA 3J81A 4NBLA 4FMPA 3T5MA 3W0LB 4NATA 1NVXQ 5BW5A 3RYIA 4TYQA 1COZA 2GM3A 2BBOA 5JJBA 2E37A 3RHSA 1Y6GA 3OJEA 1D03A 4JLVA 2XOEA 1Z6QA 2ZB8A 4LV8B 2FI1A 2G7MC 3IAS6 3IIJA 3AJ8A 3HABA 5TARA 4BV9A 3U6BA 3VZDA 1XMQB 4HNHA 3PHBE 2VT7A 1LLCA 4MRNA 4UVEA 4RTOA 3N6RA 1IJEA 3WP1B 5BQFA 5KYXA 3FDXA 4WL0A 3PNSA 1S7CA 3KV3O 3R7AA 5AVQA 2GCPA 3USZA 4CLOB 1L7RA 3CVWA 1F6DA 2FDXA 1U2ZA 1V9SA 3OX2A 4PNEA 3MMXA 2NQTA 4Z4EA 4E22A 2G80A 2GKOA 1DRVA 3FTCA 4LRSB 5M29A 1K86A 1SN7A 3ZDZB 3V8EA 1JX6A 1SU7A 1LK5A 3EGDA 2AZDA 4PTLA 2WT8A 4WKPA 2PMFA 1AK1A 4B81A 3IKMB 1NKSA 4KI7A 4U2DA 4D0SA 5HF9A 2VPWA 4AJHA 1UUFA 1T3SA 2PU7A 3WNBA 2V03A 3LFHA 1TPYA 2BPOA 2ZSUA 4Y2QA 3WK7A 4Y9TA 2HTFA 4KDFA 3IXLA 5AWFC 3ZQUA 4D56A 3WXMA 4F8EA 4RW0A 2I3AA 3FHTA 4LMAA 4BO4A 5JOQA 4IL5A 3LUDA 2OAGA 2FB9A 3SNKA 3NOXA 2JFNA 3NGLA 1PJAA 3U44A 5TGZA 1HO3A 1MV8A 4G4SP 2WOJA 3FSGD 3RU3A 4YV7A 2IELA 4JVLA 5K0GA 1FP4A 4MK4A 1YR6A 4DTIA 2Z57A 3T7DA 2BTQB 3K6JA 1C30A 3MJCA 2W9XA 3L6OO 3J81k 2HIHA 4IVPA 4PZ0A 1XNJA 2GWHA 3AKEA 3ICCA 3RRYA 3UJPA 4NY1A 4AI6A 3RVQA 1VRWA 1E1RA 3P0EA 4G0YA 4OMDA 3P0RA 2KE5A 3ZGOA 1FYVA 2EBFX 4F6LA 1DQNA 2PZMA 2CLSA 1RBMA 5FV4A 5CX1A 3UMCA 3WGHA 3ZKWB 1N6PA 3ZOZA 2JBAB 3Q88A 2O23A 2HRRA 5DF1A 5BYKA 1WDLA 5IWAB 2FWBA 3ERCA 2E4ZA 2IHBA 3I64A 2OZLB 3NAMA 2JLAA 3P9QA 3TRFA 4XH9B 4GOKA 1XI2A 1XCBA 2CJPA 2ZRNA 3W6PA 2KM1A 3DVAA 1F4LA 1XDSA 4Q5IA 4BBAA 4C03A 3AVOA 1PHRA 1RQLA 4O2AB 1NYTA 1VPEA 3N58A 3JWJA 2FW9A 5A0FA 5H16A 4J4HA 4IJVA 3UK0A 3WGOA 1TECE 3DMTA 4AY6A 4AN4A 4XDGA 2C0CA 2NXEA 3RGGA 5JPDA 3DCJA 2ZSEA 4XZ3A 3SS8A 4AXBA 2PUDA 2C2XA 1O8CA 1GQQA 3FB4A 2B6NA 4ZVKA 1CIPA 4RA9B 1N25A 1A5BB 2C4KA 2QIPA 3CTMA 5G0UA 5JS8A 2W58A 5IF9A 1FIUA 3AP2A 4TRJA 3M34A 2ZRQA 4TTVA 2ATVA 2J0UA 1CR6A 2P4SA 2XIQA 3M5CA 4BGDA 1A5ZA 1AGNA 3CF2A 3ZHCA 5DN6A 3G2KA 2QT9A 2ETVA 3RHFA 1JQBA 4MCIA 4PTZA 4QDTA 5CCEA 1WBBA 2GT1A 2Q6KA 1QVWA 2Y9MB 3CE6A 4H4EA 4GPEA 3TXAA 4G4JA 4P6VF 5JNSA 4NOLA 1XFDA 4RVSA 1ILWA 1E1CA 2V8OA 3HFGA 1PW7A 3P4UA 4GT1A 5B58C 1PFQA 4C6HA 4WPGA 3BM5A 1LVHA 4URWR 1BKYA 2YYZA 4AICA 1GL9B 4FCVA 4G0OA 3ONNA 4RFSB 3QELB 2VDWB 4DYVA 5HK9A 3NASA 5HZKA 5TLSA 3WO1A 2LNDA 2PT6A 3DTTA 2QD2A 4BUJA 4PRYA 3OESA 3QMPA 3ANMA 3Q5GA 4MKZA 3I4LA 3K4PA 2PCLA 1E3LA 3SX2A 1F2UA 4Q21A 2FWRA 5HIKA 3L9XA 5HOQA 3KJNA 2JLVA 1TU3A 3PSAA 3RRZA 4YX9A 3IBCA 2HA2A 4IJWA 1E1QA 1M83A 4DCOA 1QQTA 4M36A 5ADHA 1F0YA 3U61B 3KC2A 2QVYX 4WNIA 4YRLA 3VI4B 2BN4A 1IC6A 2PY6A 1MB3A 1WNFA 5B7PA 3KFXA 4ADSG 2ZIWB 3IP6A 4KR6A 2HN9A 5EAIA 1MPXA 1TUBA 5A05A 1ONNA 5FIUA 1WBJB 3VOAA 4YJ2F 4G8JA 5DLPA 2XUDA 1OTHA 1A71A 4RPHA 3VR6D 2FW0A 1MO2A 3GIWA 4IKOA 5IP5A 4E70A 2R7LA 2C59A 4ARSA 1XF1A 4UJ5A 3C5WP 4ZVVA 4EYSA 1KIAA 1MRSA 4BHTA 2BE9A 2PG3A 4BRUA 3GMDA 2ZEJA 4P32A 3TDMA 5LZ8A 3UIEA 1GNPA 3GHYA 3RW9A 3KPVA 3NV9A 4H3KB 1WEHA 5DPMA 5CJJA 2V7WA 2EBWA 3VQTA 3Q7PA 3ZHRA 2VBFA 2LCIA 3NMUF 1PEDA 4ZVPA 3VR3A 4BUCA 5KVCA 4J3JA 4ALNA 4FYMA 3DUFB 4L51A 1LTHR 4O3FA 2JJ2A 4XYBA 1UQUA 1X7YB 1BWPA 5HE8A 1J1UA 4MKRA 4MKHA 2W4QA 1JYEA 1UXIA 3F6PA 4QXMA 4DMRA 3LWBA 5AI9A 3FHJA 4OQZA 1HFKA 3VH3A 5K4HA 2VJKA 4D4HA 3AF5A 4AU1A 3QVGB 2A5GA 2FUKA 1RMTA 1AQ6A 3C6MA 2XYVA 3GGDA 4XQEA 3TLJA 1GM5A 1OAOC 3HGTA 1NOKA 2D0PB 4QNRA 4DLZA 4GI5A 3K1AA 1L4HA 4PYQA 2BKUA 2Q9AA 4FQ7A 1RM0A 1OJLA 2EIXA 2Q4RA 4HNGA 4LNUB 1KQ3A 2QM0A 4JP1A 3RBXA 4EF5A 1WMAA 1USKA 1Z5OA 1RJ9B 3C8DA 3ETJA 2FVXA 1VJGA 2VRWA 3ZE2B 5ADUS 3JAMA 1VPTA 2A58A 2O1WA 2XWJI 4PM4A 5IBCA 2RHWA 4ITVA 4CKWB 2JANA 4LDPA 1NXVA 3AM5A 4HWGA 2W6MA 2ZATA 3UCEA 1VGVA 3SR4A 1XBTA 4CQNA 1CY4A 1TNDA 4LRTB 2DGDA 1HI9A 3K5WA 4FFRA 1TAGA 4B79A 5A3JA 2JLQA 3L1VA 4HAZA 4N5MA 2ZI5A 1Z45A 3GVIA 4CGYA 1R6AA 4G8BA 4UVGA 4EG6A 2EIHA 5I7RA 1O94D 5CBKA 2WY2D 3CW9A 4P33A 2W6ZA 4U8HA 5IXYA 4ZPXA 1UC4B 3T1VA 5JMTA 3ETDA 5H68A 1RKBA 5J4KA 2WFZA 2GM4A 1U7TA 2GD0A 5CDFE 3W7VA 3B1JA 5BVGA 4O02B 4GL4A 5LYJA 2XB8A 3J80A 3JWIA 4C4AA 5FD8A 4DREA 4EHAA 4TLDA 2J46A 1FDSA 1VCMA 3OOYA 2CLIB 1XRQA 1FBNA 1A1VA 3DLPX 5IC4A 1E0AA 1T3TA 2WE8A 3F5MA 4R1PA 4U7TB 1YL7A 2FZVA 5BORA 1TVCA 1EGMB 4ZQFA 4WSOA 3F1LA 3DZDA 3PHCA 1IK6A 1J6UA 3VOTA 4ZU3A 1G8FA 1W52X 3K8YA 3C3AA 1Y5NA 2XYRA 4BDSA 1IM5A 1YK0A 3S8YA 4G26A 4Q9KA 4W7SA 4X61A 2MYPA 3A0UA 4A2WA 2VHWA 1N2CB 1W2GA 3LUCA 3DW3X 1H6DA 3AI7A 2JB9A 1DIAA 4RKQA 3C7KA 4B4DA 4MVCA 1QVRA 4ZOBA 1CPYA 1M67A 3Q12A 4PGFA 4EHNA 3SJAA 1I4WA 2RH9B 4IG9A 1YVPA 4AWBA 3SE0A 1EIZA 1JKJB 1UR5A 3F6SA 3NGMA 4NBSA 1W9MA 4WVLA 1G98A 4C04A 2ZM6B 1JQ5A 5EE9A 1MB9A 4EJSC 5P21A 1Y7PA 1XYGA 1SVKA 3AUUA 3QX9A 5KWEA 1CERA 2RHRA 2NVUB 1WKCA 3FMIA 4K28A 1CFZA 2AWOA 4M38A 1EG2A 2IYZA 4ANFA 3K9WA 3LE8A 2PNJA 3JY6A 3IGFA 2J3DA 1I01A 2IXFA 2WHXA 2I2CA 3MCTA 3UJ3X 3DLHA 4NBWA 1L6RA 1SD5A 4A3SA 4UZEA 3H4IA 2JCYA 3KSZO 1V6CA 1LI7A 3O3CA 3B1WA 5ALYA 3TBFA 4HGYA 2J0UB 2Z1MA 4N6NA 5GY7A 5JNWA 1GUDA 1I4TD 2B7CA 3DAPA 4L6CA 3IEMA 4W6QA 3DPIA 2PGDA 2PMBA 5K51A 1T6NA 4C1BA 3FHLA 4RE5A 2QPTA 1SUFA 4M0UA 1IH8A 3GRZA 2Y67A 2Q1YA 3RF6A 2F9LA 1Z88A 4HLNA 1BDHA 1KARA 3S5JA 1W25A 4B5KA 4TWZA 2VWGA 1GLNA 2JGDA 1GY8A 3KL2A 1P6XA 3OJFA 4MROA 3OM8A 4ACBA 4GQBA 4DXDA 2PXCA 3VPBA 5DZSA 5G53C 3PA8A 1UJ6A 2VJAA 2WIKA 2XDQB 1I33A 3IAUA 3TR5A 2JRCA 5B7GA 4RGBA 1JT9A 3TQTA 1NF8A 1KDTA 3NNSA 4F6RB 1J4AA 1GOTA 4MW7A 3A37A 3ELYA 1OAOA 1IQ0A 3GFRA 3MPUA 4M53A 3QIAA 1Y1LA 3GBSA 5EIAA 4P1ZA 3A05A 3OC6A 4KQ6A 3R8FA 4Y1FA 3HP7A 1B00A 4UM5A 2ZWAA 1BG6A 1NATA 1MX3A 1KJ9A 1PK9A 1XTJA 5F2OA 1LPSA 3G59A 1TF7A 2O52A 4X9XA 1BD3A 2QRGA 4X65B 2YJZA 3QA3E 2Z5GA 4RM2A 2EKLA 1CC1S 3IV9A 3FOWA 4I55F 2QJRA 3JSAA 2QLTA 3U17A 3W6ZA 4G5RA 5K8TA 3MMPA 2RD2A 2OYSA 1W2WB 3SIPA 5KNDA 2E82A 4RK4A 2ZTSA 1X13A 3E15A 5AKGA 1RYFA 2O2EA 4EARA 2KBFA 1XQ9A 3L49A 4UPVA 4E32A 5BNTA 2IE0A 1IVSA 2QF7A 2WIFA 4YRCA 2W90A 5JFGA 4G0XA 1Q74A 1QH8A 4QARA 4S24A 3HVIA 2D2VA 1E5DA 4Y2GA 3WGJA 2PA0A 4OXIA 3KVYA 1Y5LA 2B1JA 1XG5A 3JVEA 3JZDA 4LCJA 4Y6LA 3VYRB 4KAFA 1MFPA 4RA6A 1EG7A 1GPKA 3BMNB 3DB1A 3R3SA 5CDYA 2GBCA 5L4NA 1G8PA 2AD1A 1C1DB 3LQ2A 1TTQB 3KKLA 4MKIA 2B34A 5AKEA 3B38A 1U1CA 4IY1A 3NAGA 2XE6A 5EEGA 3VJMA 4BAGA 4BFWA 1NW9B 4XEHA 2I65A 5D6OA 4UCFA 4UNIA 2F1KA 3K8ZA 3B12A 4B34A 1WB9A 3EMDA 4RIIA 2VT3A 2X41A 3RVOA 2DT8A 4ER7A 3PVZA 5KHOC 4I3GA 3GK3A 3QXJA 4RMIA 5LL6P 1LTQA 3HGQA 4H6WA 4OATA 1GYQA 2IZ1A 2PKXA 2QMHA 3IJ5A 4GUDA 4CIVA 2HQ1A 1FU8A 5EKUA 1JL3A 3H5LA 1NXSA 1ONSA 3LTEA 1JJAA 2IHUA 1TQ8A 3EUAA 2C2MA 3N7UA 4WNYA 2WF7A 1Y4SA 4FFMA 4I0WB 4KN9S 5LBUA 1FK8A 2I7TA 5E6SA 1XXHA 3ZN2A 1T9AA 4HQOA 1ZUNB 3R09A 4JKIA 2IYAA 1XCJA 2VUIB 2OV1A 1T9GS 3P94A 1TM1E 2WFLB 4AY2A 3A3OA 2AMVA 5AJWA 1P5HA 1M0TA 2P2LA 1ZUIA 1ZLXA 2FUCA 2YCBA 4GKKB 3HSKA 2RHCA 2VSOA 5DYYA 5AM1A 4H0FA 4J16C 2QN9A 5J4LA 3O9ZA 1EP3B 3CLUD 2H0AA 4EJSA 4JI4B 3NQ41 1Z7WA 4CMBA 2AKAB 1B3BA 4G4SO 4NBUA 3AUSA 2PLNA 4B4KA 3LKZA 1BIFA 2VAVA 1BZYA 4X8MA 1DUVG 1U2SA 1SY7A 1ZGHA 3G5LA 1JEQB 3UWOA 5IK2D 1XRMA 2I54A 4ZN6A 3HK2A 3HACA 3FWPA 2ZRFA 2P9CA 4UUPA 1QGOA 2RKBA 1PUXA 3FYTA 4JR2A 4CM1A 2LTAA 4D6YA 4O4LB 3GT7A 3X1JA 1PTJC 3VNVA 3H04A 3HCCA 3OZAA 1IM2A 2X15A 4I1UA 3UK2A 4JJGA 4ZU6X 3WMFA 2J3MA 4PWZA 4M7OA 1JA9A 4C4ZA 2IXBA 4BEVA 2F1OA 1GPYA 1HC7A 3L7AA 3V6MA 4EFLA 1O6CA 2PL1A 4ND5A 5TVKA 1YQWA 1P8JA 3DT6A 3N0VA 2YX1A 3T7KA 4E09A 1T1JA 1ZOIA 4MV1A 5TV2A 5G1NA 4DJFC 2QT1A 1F0KA 1E1KA 4FNMA 4XSGA 3B9BA 1W6UA 5HTKA 4LOKA 4KKXB 1OXVA 2YS7A 4FZVA 4ZT7A 3S2SA 5CXXA 3IXMA 1FFGA 4TX1A 4TKUA 4LF9B 1W581 1A7KA 1RXEA 1NVDA 1E7QA 1VKRA 3G0IA 3GAFA 1UC9A 2RHHA 4Z3DA 5KI6A 4WTOA 3REOA 3WIBA 1HOXA 2IPLA 2XOKD 2CJXA 2CEAA 2WJJA 3FYDA 4H59A 1YAJA 4RMGA 3RIMA 1HL3A 3SE7A 2OYCA 5H83A 3A7DA 4GRIA 4QBFA 13PKA 1CUAA 2CGEA 3FBGA 4A9AA 2O1XA 2HX1A 5A4AA 1UPTA 1PFVA 4B0OA 2YOFA 4EFNA 3DBLA 3GCXA 3TOCA 3OOJA 2FLWA 4KLCA 1YZNA 3IXQA 4CMEA 2GCNA 3LLCA 2Q6VA 3F6YA 1UXJA 4PS0A 4K1XA 2MJLA 3LT1A 3CJRA 2VHXA 4IVRA 1J5PA 3AUAA 4AQDA 1TW2A 3NHMA 4MAFA 1NF9A 1JLLA 3IRUA 5AIAA 2BM0A 1U04A 1UADA 2EBUA 5GP1A 1G2OA 3FOAA 3IHLA 3B70A 3T12A 1MEJA 1JSCA 3P9NA 2I2XB 1QDLB 3CY6A 2QYHA 1ZCZA 4IM7A 4KO4S 5J63A 4J3NA 3RJ9A 3VNQA 2MMGA 3G5UA 2RHLA 4OGKA 2C7VA 4MVJE 4PN7A 4HDSA 3RC8A 2B35A 1YQGA 4WOJA 2OR3A 5ARCA 1R5OA 1I2DA 1CF4A 4K6FA 4QYTA 1X19A 5T67A 2HK7A 4PZUA 1MAUA 1YDFA 2GEUA 5ENDA 3WIUA 2RGWA 2XCIA 1COWD 4LDRA 4RK1A 1LBIA 2X7JA 5EPUA 3WNVA 3LK7A 2DUWA 2FCRA 3RK1A 3C97A 5EZQA 2GPJA 3CWCA 3LIPA 3D2BA 1BNCA 1GZVA 4HD8A 1IATA 4QWWA 1NFQA 4UUBA 5JDCC 1T9ZA 3FIUA 1YKGA 1IONA 3K1TA 1T13A 1XEWY 1Z62A 2Z8XA 2PSSA 3O21A 1Q0RA 4S3MA 2JKZA 3NI2A 2LDXA 4XIJA 2FFAA 2PRIA 3N7AA 3FGNA 5AVWA 4B5LA 1ZI8A 3GG2A 4XUCA 3DM9B 4R1NA 4KRGA 4MQLA 2H4JA 2R6GA 2N42A 1HDXA 2NSYA 1GDTA 1KH2A 3OQ6A 1JEOA 2IUYA 1IJKA 4L72A 3GYGA 1RDFA 1SBIA 3T5DA 1T2NA 4B44A 2Y27A 5DYNA 4JGGA 1OI4A 4FDTA 4J16A 1PS0A 3ND5A 5AVYA 2ID4A 1DXOA 1JPJA 3GDOA 1WD5A 3H2ZA 4JXKA 5HA5A 3TR0A 4BZZA 3CRQA 5CDHA 1I6LA 4KN8A 3JQCA 5IKOA 5ILQA 4WINA 1OI7A 1Y8RB 2A0YA 3P9YA 4F06A 1N2SA 5FWYB 1MB0A 3K9NA 1NAHA 5F76A 5THKA 4ZK6A 3TUZC 3V8RA 3AERB 4BYGA 3VKUA 2OZKA 5JXWA 3LLSA 1QFJA 2A5DA 3I04A 3MTBA 1RYDA 1CETA 4F4JA 4V0QA 4Q1CA 1PTJA 4LXIA 1G16A 3MERA 3U7IA 3W9BA 1ENPA 3WLQA 1NXTA 3GBPA 2DPGA 1YBFA 5GZ6A 4M0MA 1Z5ZA 1WU7A 4Y9RA 3VPFA 2D1YA 1GCAA 2GAJA 2K7ZA 2YWRA 3NHFA 4E0BA 2AR0A 3U4MA 4BV8A 3AUJB 3GPLA 2DJ5A 3OM9A 3HB9A 2JBWA 2WA2A 5UKDA 2BEKA 1LCIA 1TM2A 4PCVA 2AC2A 1FUUA 4ZYXA 1U9JA 3EB9A 4GP7A 1S2MA 1D09A 2O3JA 2ZT6A 4IVNA 2WWRA 4AJLA 4V1CB 3PPYA 4L95C 4BQNA 4CM8B 5F98A 2XMBA 3BFXA 1HF3A 3DAHA 1Y1RA 2BHTA 4BLPA 4CN9A 1M7BA 1N2EA 2I7DA 3NTRA 4GRAA 2G9NA 1P74A 2E5WA 3JQFC 3LZCA 3O2JA 7REQB 2NXJA 1V16A 4JLPA 3OX1A 1HORA 1U7OA 3HO6A 3BA6A 3UJ7A 2C8VA 3M5PA 1R0XA 4HN2A 1TD1A 3F7TA 5JS2A 3PIDA 4JU9A 2ZR8A 4LOAA 5EIBC 3I6YA 4OB6A 5J4HA 3QFTA 1GCUA 1LRJA 2ADOA 2OHIA 3EZ7A 4Y0AA 3D5TA 5F5LA 3VTFA 4D3FA 4YJ2B 4OX9B 1PBNA 3N8NA 4QOSA 4CKEB 4EJSB 1GNRA 1E63A 1OFVA 2PXXA 3OU6A 2A9PA 1GGVA 5F64A 1ZNQO 3L1UA 1VI2A 3WYBA 1INLA 4HDKB 1I6WA 1IXYA 2QUJA 4I5DA 3W8RA 4NONA 1YZGA 1JF8A 2HF2A 3ECCA 2XCUA 1NSYA 1VSVA 2ZAGA 2V6MA 1D5CA 1KJZA 3BMQA 1IOVA 3PL5A 4FZRA 5MGBA 3E9EA 5F77A 1EP2B 5DASA 5FWAA 4OK3A 5EJIA 5CBPA 1C5KA 3JZMA 1A50B 2A0FA 1I0LA 3D4OA 4YXWD 2ZIXB 1Y3IA 1Y9ZA 2BOVA 4WFIA 1RADA 4WT7A 4ZFNA 3LX5A 4D9EA 1Y1KE 1RM3A 4UBMA 1VJDA 1P3JA 1PUIA 3S0JA 4R84A 1YZLA 1Y48E 4D9HA 1D8TA 2VAMA 3VR4H 2HUNA 3H1FA 2XITA 4I1IA 3X1WA 2JHGA 1BSVA 3OZUA 4EYKA 1NRWA 2AJCA 2I0FA 3L6BA 4H9GA 3S8EA 5EJFA 5BMVA 5WRFA 2E4AA 2JFOA 1ZISA 3HEBA 2QUAA 3B36A 1UKZA 4OQMA 2NMVA 1UPFA 2ZSIA 2HUPA 2F9FA 2XHEA 1YKFA 2CF5A 4MHOA 3IT2A 4YC7A 4YH1A 4LBYA 4XR4A 5HFJA 2JDID 1L0BA 1C7JA 3F6BX 2Z56A 5JDCA 4ZYTA 1OBCA 4YPOA 2FSSA 2IV3A 1E4EB 4G07A 3OFSA 4GPZA 1D9XA 2H48A 3ED1A 4PAGA 3NRJA 4L3VA 3CURA 3G2JA 4PPYA 4DNFA 3P9CA 3SVTA 2GASA 2ZSHA 2AJDA 1EEHA 1T4CB 5C1PA 2LPMA 1U2QA 2HJWA 4CN8A 4JEIA 1Z37A 1YMQA 2L0XA 4JA0A 4FHZA 3VZRA 4GIBA 1IRIA 4X20A 3S27A 4OIFA 3EVNA 4KX3A 3V4VB 2JFGA 1JA1A 2VYVA 5JC1A 5AI8A 4OXQA 4WCFC 3STTA 3BX1A 2GCEA 5BQOA 3FLBA 2HSGA 3OWXA 4R2IA 3TQRA 4PCUA 3ZCVA 1KYYA 4M87A 5K8UA 1VTKA 1C9NA 1QWOA 2ZYAA 3EPJA 2AN1A 4S2EA 1DEHA 1FVHA 3HZOA 4FYHA 4F4FA 1RXWA 2NQ2C 4KREA 3VDMA 3AVXA 1W8IA 2PX8A 2YWDA 1NQUA 5BN5A 5IC5A 3LXRA 1HLPA 3ODPA 3L0PA 3RAFC 4G24A 3GMTA 1W1UA 1ORVA 5E7QA 3EWNA 2GZ1A 5ALUA 1QDEA 5JO9A 4DR5B 3JYNA 2ZR7A 3R5HA 3WQQA 5E3IA 4BIMA 2NT3A 2HBYA 3GDFA 3GNSA 1Z0UA 3OF5A 1FLVA 3PZRA 4ZPJA 5EPOA 3O4HA 3IS3A 4X92A 5GGYA 1ZD9A 1FMJA 5LIPA 1ISMA 3NIGB 4BQQA 2X0KA 4YCMA 4NU0A 3CW8X 3Q1KA 3E58A 4KNWA 1OFUX 4K03A 2OWDA 3ZZ0A 1XTRA 3WK4A 5LQMA 3NEAA 3NS7A 3N0XA 1L1QA 2A78A 2QW8A 3PUVA 1JWAB 2IYQA 3MBKA 4KTVE 3AW8A 1IAQA 1YDHA 2L17A 4B7UA 1OC2A 3AINA 3JQFA 2VTBA 1E9BA 1N2GA 5FJJA 4AS2A 3KV1A 1TMYA 2I78A 2VDNB 1BWRA 3IA2A 2EHDA 1IZ0A 1GFIA 3VU1A 2CXPA 5F7JA 5BWOA 5LU9A 1QYXA 3MUOA 2WZDA 4M55A 4EJ2A 1SBTA 1YS7A 5JVDF 4P81A 5AESA 3HRHA 1O95C 3GX1A 4B6GA 3KJIA 5KYGA 4QBIA 2E1PA 5E3JA 2YTZA 3NVDA 2R7MA 2ZWIA 3OPYB 3ITNA 4OUDB 2E18A 1OHHD 4JLJA 2H3EA 5A9RA 2C2BA 3EZ9A 4HRYA 4X1KA 4DS3A 5IKMA 3AH8A 4HQ0A 4HNVA 2ZIVB 3ESAA 1TEVA 2A9QA 4PAMA 4Y6PA 3MD0A 4KPYA 2PMWB 1OXUA 4HZUA 3F5SA 2BR4A 1K8XB 4ZVSA 1NRXA 3HRIA 4QHYA 4WZBE 2O6HA 1C4KA 2VPXA 1KMHA 4B6SA 2AA3A 4WK4B 2R1UA 1IXRC 4KITB 1RAEA 3ELDA 5DBHX 3RRNA 4CKBA 4D4GA 3F9RA 1IZYA 1OPXA 3D31A 5CMLA 3RAPR 4ZYYA 2I4IA 3O3NB 2YWGA 5DHQA 4QUAA 4DCNA 2Q29A 4N4AA 4GXNA 1XDDA 5FKJA 3AY0A 4MV0A 3REFA 4YUZA 6ADHA 4TMWA 2MYTA 1YB2A 3L0CA 1SXJC 4LWQA 4YRFA 3SBDA 4RSGA 4WACA 2QZZA 1JIJA 1Y98A 3CLVA 4AP9A 3G3EA 4DR2B 1GTJ1 5FTLA 4TGLA 3AOEC 3UB4A 3JQ9C 4PWYA 1D6MA 2C8KA 2C3PA 2WV7A 1KA9H 2QTTA 2ZYHA 4KBFA 4TS3A 4ZCSA 4E7PA 3PGA1 3IESA 2NOAA 4LFBB 5C53B 5J43A 1W48A 4MVJM 4Z54A 4G0VA 1EUCB 2ZRHA 2HT1A 5DIZA 3SZRA 4DB4A 4DCUA 2YJ5A 4IDOA 4NZNA 5CM2Z 3K92A 5CDSA 3A4NA 1YJAA 1S4QA 2YWXA 1T4MA 2ZVQX 4EY4A 3E8MA 1Z6YA 2QRVA 1C7ZA 3QUTA 4B45A 1IBCA 3PQ6A 1FNSA 2CHVA 3NUQA 3SXJA 4R2XA 2ZSAA 5C35A 4GR4A 4KE9A 1EZ1A 2YCLA 3QTTA 4PHHA 5T6MA 4DIDA 3SYTA 4RELA 2BZ0A 4D96A 1B0ZA 1Y63A 4F11A 4C7BA 4H2DA 4MUIA 1XD2B 4WCFA 4JL8A 1C4XA 4EYOA 4NFSA 1J2EA 3I2KA 1R37A 2NVWA 1VLVA 3QKTA 1MU0A 1FTWA 2LCFA 4FYVA 2ECOA 1VPVA 1Z17A 2V4ZA 3MRXA 4J0FA 4NS1A 4RCYA 4BP8A 4DARA 1GKKA 4KAXA 2ENWA 3IKVA 1YNOA 4XARA 3VYSB 3CZAA 4DILA 3WK9A 1KBQA 1FRZA 1XT6A 5LUAA 3MK31 1N5DA 1GKYA 1U81A 1HDIA 3EZGA 4UEQA 4Z7NB 2C95A 4U7JA 4ML3A 2ZPTX 4NULA 3AP3A 4B3IA 3HPRA 3IE2A 4D9MA 3GLIA 1SCBA 4F4IA 1EHIA 5E95A 1KZHA 5BWNA 2C5EA 2ODTX 2WTUA 3BE8A 3KKKA 4WAUA 1NT2A 1RXSA 2OB2A 4K86A 2AF4C 5EHIA 3DDNA 3TIXB 1Q11A 2IYEA 5KHLB 2W2KA 4C87A 3TQQA 2PFGA 1OB2A 1DUSA 4QXAA 5HGXA 4MVJP 2P3LA 3WQSB 4WY5A 5I48A 3UMJA 3L7IA 5JI2E 1Z6ZA 4QU0A 3RKSA 2ZTUA 2HYIC 2FQXA 4IEIA 2J48A 3VO2A 4EI7A 3EQZA 2GAOA 5FFFA 4I9HA 3EA5A 4OAOA 3VH1A 5KYWA 1OXSC 4P7JA 2Z8ZA 2NUTA 4FUTA 3QYPA 3L0ZA 1KE1A 2QMOA 4CM9A 4NV1A 1HM5A 1G18A 1RJDA 2GOYA 5F21A 3QWBA 2VSQA 4UBLA 3A6ZA 4BY9E 4IHAA 2GA9A 2H07A 5JFOA 1KFEB 4GKBA 2XKKA 1RIIA 2O8FA 1NZDA 3BTUA 3RJ5A 2NZYA 4A6DA 1JZQA 2VP2A 1XX6A 3CRZA 2N1BA 1P1RA 2A8YA 1V7CA 2IXGA 5EMHA 5AHKA 3K70D 5L3ZA 5D1NA 1G1AA 5IHPA 2GUGA 3ECAA 4IRUB 2AG6A 3BBLA 5EHGA 2DC1A 3ANYB 4JMPA 1O95A 2YFKA 2HSEA 2OKCA 3O94A 5SYNA 1YRLA 3SFTA 4KOAA 2XQJA 2PRZA 2QTVA 1Z0SA 2HMWA 3DOEA 1W35A 4ZALA 2X6QA 5LOVF 3DVSX 1DHRA 1S8NA 4UKDA 1M72A 2O2HA 3UQYS 2FFJA 3UMRA 3DEKA 3QJ5A 4ZGGA 3PJDA 1AGYA 1I2ZA 1MFZA 1E2MA 4FFBB 4OLJA 3BE6A 4FFDA 4I1VA 4TV9F 2GYVA 2MT9A 4QAJA 1F9AA 1KGSA 3CJTA 3S1AB 4S2UA 4X64B 4CQLA 5H5JA 2PT9A 4H17A 1Y6ZA 3FYUC 1GNTA 3L7MA 2JK0A 3CEHA 2AN3A 4IFBA 2JGEA 3U1TA 2XZPA 1KZ7B 1GXSB 3OZWA 4R16A 3MS4A 2VHCA 3N39C 1WXIA 4D2IA 3KOXA 1NN1A 1OH6A 2PGJA 2P0AA 3CF4G 3I92A 2ZG6A 3ZXYA 1KTIA 1J8MF 1V26A 1BFKA 1DNPA 1Y6JA 2A9JA 4U00A 2R25B 3A31A 1JGTA 2BFFB 1SH7A 4KQ9A 5HIMA 3T52A 2PKWA 3R20A 1O97C 5K8IA 1SXJA 3I32A 2OCLA 3LOPA 2YHAA 3VR2A 4JD5A 4U6QA 4XJTA 1X3SA 3SYRA 1L5OA 3AOEA 2HJSA 3JQ9A 1WCWA 2R1VA 3M1IA 5FBLB 4INAA 3L5KA 5GONF 4HNUA 1DO0A 1Z4NA 3P2JA 1YCHA 1E20A 5JAPA 4AO8A 3PNLA 1NNSA 1NXWA 2BBTA 4HSGA 5DP1A 1OAAA 1PWZA 1IN8A 1T91A 1R9MA 1SAYA 2JLSA 4I6JA 2SECE 1I5RA 4KXMA 2Q2OA 4MV7A 4PR3A 1XV5A 5E0KB 1T4DA 3QLVC 2CHGA 1YBVA 4GHWA 1A95A 1LJ8A 3FSGA 5H0IA 4E4TA 4RTMA 1NAIA 4KC0A 3ILSA 4KXXA 4F9GA 2P41A 4TTAA 1YBMA 2IDJA 2XPCA 4G0QA 4HFJA 4D3SA 5KX5A 3GLGB 4CEJB 1YZYA 4MVJD 4H7DA 2OLKA 4UTRA 1XPOA 3Q98A 1T3ZA 3B1KA 2OFOA 4PYRA 1W0KD 2GERA 4Y1RB 2CNLA 4WIAA 1C8BA 4H1WA 3PUIA 2FMIA 1H5QA 1THMA 1VFPA 1WHSA 3I4CA 4EHLA 4P92A 1ECCA 3N2KB 4HZUB 1H0HA 1B93A 4WKGA 2Q7DA 3HV2A 1BMDA 3OSUA 1DRUA 3OECA 2Z2XA 2UXCB 2OZVA 1L5GB 2MR6A 5ALTA 3BD9A 5HQ3A 3EA4A 3GNTA 3M49A 4Q3CA 4CM4A 2ZWMA 3Q6MA 3KB8A 1U8EA 3RVSA 2WKWA 4I1OA 4K6CA 4XTCS 4HDRB 2H51A 4KOEC 3O83A 1NUSA 3RKUA 5TGTA 1KMCA 3OAAA 4EHJA 4D9JA 5FT9A 2Z2YA 4QRIA 3COPA 3NUZA 1Z83A 1WPXA 2ACVA 4POOA 4GI1A 5BP7A 1O94C 4ZJUA 2I76A 3DOIA 4RCVA 1U7DA 3WO0A 1JTVA 3C87A 3F6RA 3JXEA 3EIHA 3BICA 4G5YA 3PX2A 4LDAA 4P38A 4XJXA 3KQYA 5IANA 2VQFB 3O82A 5A4FS 3QHAA 4HX5A 3ZD9A 1W76A 3T3IA 1U02A 1AHIA 1X87A 2ECKA 3UG7A 4BQOA 4UM7A 4RH3A 2RGDA 4A0HA 2EW8A 5EYPA 5KTMA 2R47A 1OZGA 1ZP6A 4WQMA 1ZSNA 2FPGA 2X0DA 5I51A 3LWNA 3IKLA 5KTYA 2DFDA 3E0XA 3Q5DA 1AKVA 3MJDA 3B2QA 3UB3A 4C43A 2RB5A 4CG3A 4HVLA 5CDGA 1BE8A 2FPUA 2RDMA 4LF6B 2XB2A 1ZUD1 4X93A 4G0UA 2G08A 3G2HA 1P4SA 2IITA 3AY3A 3TRIA 4LHYA 4NEQA 4U7WA 5AKJA 1MEEA 1BHO1 1TF5A 3B9RA 4JUBA 4BNDB 1YUNA 4RQAA 2R8ZA 3G2QA 4QGGA 3ND7A 2RJ3A 1ZVKA 2DYKA 3LSTA 4MRMA 3QVXA 3TLCA 3E3MA 3ZWKA 2G9VA 3GP5A 5E7MA 5G40A 1L5YA 3FYUA 3GLUA 4RGVA 5DNVA 5H3CA 3ZNNA 2FF7A 1EVLA 2Q4DA 3PJGA 3CLTD 4TRNA 4FB5A 3PITA 1GUYA 2HQRA 3INGA 3GQBB 5FTWA 1W36C 1AUQA 2D2FA 4LPKA 2WJHA 1OSNA 2B1IA 3OIGA 5B36A 5JATA 2ZSDA 2NNWB 3LVQE 4GBED 3I2HA 4DHWA 2OY0A 4H27A 1MF7A 3OQIB 3IPXA 3OMLA 2MSNA 1R0SA 3PE4A 4INOA 1DTEA 4ZVTA 4BO9A 5KCMA 3VR6A 5ECGC 1QZXA 2NYRA 1KRWA 4BO7A 4KSYA 4JJ4A 1MT3A 1NVTA 4JJAA 1QR2A 3SDZA 5GONB 1GV0A 2R97A 4FT4A 2FJUA 3FNGA 3SHOA 2Q2WA 3BD8A 3P97A 3VU8A 4DYHA 5C7IO 3DZHA 1B8UA 1C0PA 1JAYA 3QUCA 3N70A 4DIBA 2P8JA 2XB4A 3TSAA 4C76A 5KREA 3AR8A 5FTMA 2W6OA 4JCOA 2J0SA 4GP9A 2H85A 4COOA 2ARKA 5AXBA 1VIYA 4NICA 4QQNA 4D02A 4TWBA 4DM4A 1N6HA 1QB7A 2B9EA 3C7AA 3NBYC 1UPUA 1M33A 2DUMA 2W2VA 3QLVA 5FPSA 3ZUPA 4PYJA 3ZQ4A 5C8VA 1OWMA 1V41E 3BH7A 3R3JA 1DBIA 4FEEA 1E5LA 4Q1VA 5KPDA 2YVAA 3NT2A 3MTAA 1IQRA 3LW7A 1S0UA 5FBVB 2R86A 3HYLA 4CMIB 2FPKA 3LRPA 5D3KA 3RAGA 2Q2QA 3E23A 3WR5A 1E0KA 5DM1A 1T9KA 1KYWA 4PYKA 4YAOA 5KWJA 4EEXA 1UT6A 4CMKA 2XBUA 3CPJB 5J2UF 3SC6A 2BUBA 1WUIS 5G1PA 3K2IA 4B83A 5GJVC 4OQFA 5CP8A 2PQ2A 1GT91 2ZQ5A 4JBYA 2X1HA 1NLUA 4WKBA 1Y37A 6REQA 1IBLB 5JY1A 2IP4A 3HDGA 4FN4A 1X7ZA 1E3JA 4IZ6A 4M0EA 4O5AA 1KDYA 2WZCA 2DWUA 4MYUA 3W9SA 5ANRB 4KQIA 3LG2A 2H9IA 2H6EA 3W5JA 1ODLA 2YHBA 5CB4F 1QKIA 5IH3A 2PUGA 1E58A 3NBKA 1HV8A 3V4ZA 3B9PA 3E3LA 5CD1A 3M9LA 3Q6NA 3KVOA 1TO1E 2BGTA 1W4AA 3W2FA 3WAJA 1IL0A 2XMRA 1Q12A 2SNIE 4G81A 2X22A 4PF1A 2CFRA 4X6UA 3V7FA 4YGYA 1ZRSA 4WOPA 2WNHA 3QKSA 4DY4A 3ZIDA 1O94A 1HUQA 4N5NA 2RHDA 3FX2A 2I6FA 4NCJA 5DU2A 1W47A 4MS1B 1RRVA 2MTBA 4J49A 421PA 3DDOA 5FUQA 1BROA 1IDN1 4QQ8A 3RC1A 2VUTA 4B3RB 2IP2A 4HAVA 2AUTA 3OLZA 5FRDA 1KEVA 1ML4A 1ZOPA 4HYYA 5MFZA 3I37X 3U4QB 1N2JA 1CUIA 4AKSA 4PG8A 2GBLC 4PYIA 3GJ6A 2PS9A 5EA2A 3UAZA 2PS0A 4M76B 2LIVA 2UZ1A 5CHEA 3KDSE 4DSTA 2AWNA 2K6GA 2G5CA 1DBSA 2IUTA 2C58A 3B9QA 1A4XA 3EZXA 1R6BX 3ROFA 3ABSB 3E81A 3T35A 4MQUA 4UBIA 3T99A 3UT5B 3F3YA 5M3BA 4BOYA 2ID7A 2X7HA 4XQCA 2YMMA 3CLHA 5CCBA 2L18A 2MYUA 4AUMA 4D92A 2W43A 2CYCA 1G2PA 1LRLA 3ZCQA 3TW8A 4L15A 4TSKA 1I7LA 3QFFA 5BT9A 4CYMA 1PWEA 5GJBA 5KKCA 5EJ2A 3ON5A 3SS9X 2DHRA 3TLEA 2QM7A 1OZFA 2FLKA 2WHPA 3OHPA 3WISA 3VXKA 3K32A 4OPMA 3B1ZA 4B7CA 3T3NA 4DLKA 1RXVA 4AY3A 1HDRA 1A8IA 4NXNB 2ZJ2A 4Y3UA 2AFIE 2Q07A 3RC3A 2ZUDA 3RAJA 1TAHA 1K5DA 1UBEA 2I03A 4IXWA 1C9JA 1SU6A 1R6XA 2PYIA 3JYLA 4RGQA 1DAFA 5EZSA 3OT1B 4D98A 5BSGA 2VFAA 3QYJA 5EJMA 4KGDA 2PTHA 1KIFA 5C7YA 4TLCA 4DNOA 5HQJA 2JFBA 4ZRMA 4MEBA 2P2SA 1S2GA 4E30A 1RAAA 5LQUA 4OHPA 3G0BA 1KYXA 1JWBB 4IX1A 5IN4A 3ZDCA 2ZYUX 2ZZNA 3SC2B 2HIGA 4OHVA 3K6SB 4GBGA 3LO8A 4I81A 3VFDA 5F4ZA 5CA1A 2CXOA 1AKWA 4Q4HB 3VYWA 2CW5A 1L5MA 3DWIA 1CV2A 1N1DA 2XQIA 1NYLA 3EXEB 4QIHA 1UK6A 2R4QA 3JYHA 2RI6A 5JVDB 3OY7A 1R88A 2QN2A 4B6PA 2OHOA 1BC5A 1JHPA 3L8FA 4MW5A 1E7RA 2DPMA 2Q1UA 2J31A 3IR5A 2H00A 1CQIA 1E8DA 1HG1A 2HK9A 4HRXA 1WMFA 1NWHA 1XQ1A 5LB2A 3CGGA 3NEJA 2OORC 1KJYA 1QRAA 1WZEA 3AEYA 3ET4A 1H8ED 4IH9A 5L95A 3PEWA 4Z7QB 2P0YA 1MN6A 4XX0A 2B1RA 4R8KA 4E51A 2W70A 3LUHA 3U3DA 4EQZA 4Z4IA 2NTNA 1U8XX 4PLCA 3EHDA 3RSOA 5ICGA 1M34E 2CKDA 4RJIA 5GAJA 3UFXA 2Y99A 5TT1A 5FA5A 1B0AA 1C8VB 3LU1A 3UJ6A 4MW6A 1YE5A 3IA7A 1BCRA 1YB1A 3IV6A 1Z2NX 2PJDA 5CTJA 5ESRA 4AYWA 1JG7A 5LQCA 1XOIA 1SB8A 1K3FA 3OEHD 1Z6TA 2XT6A 1X86B 1NHWA 5KIAA 2PMKA 1TXGA 2GVDC 2B7BA 4YWJA 1T25A 4QJ3A 2D1RA 2W4MA 2BLNA 3TF5A 3FDZB 2P9FA 3HBFA 3I73A 4F3TA 3JQ8A 4XM0A 4CBVA 1CUXA 4RDIA 3WLIA 1Z6XA 2QMQA 4JJ6A 1GZ4A 3DOOA 4YT8A 3LY8A 4KJXA 1P80A 4MW1A 4IXNA 1KEWA 1NVGA 4GKAA 1N2XA 1GTVA 1M75A 1GQRA 1W8DA 3IVAA 4MIEA 5C31A 1GWNA 5D3QA 4A0GA 4R54A 1GTRA 1CF9A 1MO5A 4DJAA 1NVMB 2QJWA 3ENKA 1EMDA 3ZEIA 3CEMA 4BJHB 2BISA 4XIIA 3AJ9A 2XUKA 3C39A 1RPTA 2OBMA 3MYYA 4U2CA 1L5HA 3M6VA 1AD2A 5HJ2A 2MR5A 2BI4A 2VHYA 4AMBA 5K4GA 2ZJ1A 4GC9A 3PG5A 3ELWA 4CQMA 3OQNA 1BX3A 2EF1A 2DOKA 2WYIA 2HRDA 2ZAIA 2C4WA 4UATA 3TWOA 4N76A 3BD7A 2E4VA 4IFIA 2GBLA 5EHXA 4KSBA 2GR9A 2BEVA 3MTIA 1JVBA 2R5NA 3O8QB 4HDQB 3ACCA 3CE9A 4RS4A 3RS0A 4ND7A 3CPEA 4DZRA 4B71A 2OYRA 2EP8A 3VVBA 3PFBA 4G85A 3HDHA 3ABIA 1M66A 3K2QA 4G36A 1QLJA 1BCSA 1CE8A 1DQYA 1IMJA 1ATIA 2YWCA 4OP2A 1NUUA 1UDAA 5EUBA 4PCLA 3H7AA 4HHEA 3TYXA 1E94E 1SR8A 3GFBA 4EYEA 4ZI3A 3FDJA 4B3BA 1E6KA 3QE4A 4G1EB 1YGYA 3QY9A 3HMQA 3F3SA 4Q4JA 4RFLA 5DCLA 2OXFA 4B8WA 4OHUA 3NTOA 2WFMA 4GEGA 2X4GA 3C3YA 1EKXA 4NCXA 7MHTA 1N8NA 3ZWVA 3GXBA 4R0NA 1X42A 3CKLA 4X0EA 4OUKX 3AG6A 4JQSA 5KNDH 3U60B 1OBHA 2LRHA 3GQVA 4QYIB 4EPXA 3ORHA 1K7SN 3QPAA 5CAEA 3RSFA 5LP1A 1K4MA 2C5FA 1U8AA 5IDVA 3INYA 3GNLA 3LYUA 3P9XA 5KNLA 4HQRA 3GA0A 3TXXA 4OYLA 1QSGA 1UDCA 2V4MA 2X2EA 4GWLA 4K9RA 4LYAA 3SLRA 1SD2A 5IAJA 3UAVA 2DJIA 4BC0A 4KHZA 3OCCA 4IDGA 2V74B 3BIXA 2WHEA 3ZNOA 5JRJA 4PZDA 3VH4A 5FNZA 5EKDA 1HMYA 3SYNA 2ONKA 4GMDA 3BMCA 1D1SA 4LGVA 4MYTA 2WUVA 2VJNA 1Y7LA 3PEFA 1L4FA 2AEEA 5TQ2A 5KU7A 2FUEA 2VYND 3DNPA 3UJAA 4CVNA 2DR0A 4Z3OA 5TX7A 3CVOA 3L7NA 3RROA 2UZ1B 4RETA 1TZKA 2CSXA 2IV2X 1WKBA 4ZWNA 1XZHA 2ZRKA 1RZ3A 4O4JA 3U62A 3FH0A 2OORA 3B2NA 1ZJ6A 3H5RA 1XJWA 4HUQB 4PZYA 4RBNA 2JKYA 4TVSA 1E4VA 5LOVB 1SCNE 4URUR 1U8FO 2DY1A 4G1BA 3R6TA 4EF4A 3TIGA 2NO4A 2V0NA 2YV2A 1PZNA 5DYTA 1P1HA 2ON6A 4O6VA 8ABPA 1R0BA 2JEYA 4TV9B 5IM5A 5DLEA 5KB3A 3HWRA 3IBSA 4MV3A 3SDBA 1U0BB 3UJHA 1ZRMA 2GPYA 5JR3A 3WSWA 1ZAKA 3SJUA 4UCWA 1XD9A 3HZHA 2XOKA 4U9HS 3BIFA 3AU8A 3HQ4O 4LYJA 1R10A 2AW3A 1AQYA 3H16A 2QT0A 2CBZA 3CNOA 3I8XA 5DOVA 5FUMA 3HN2A 2BKVA 4R0VA 2XB9A 3W1VA 1W36B 2PV0A 1FJ2A 1GV1A 3KYCB 1VJ0A 3UTDA 4J0JA 1ODFA 2E6KA 1KI6A 2HAEA 3LC2O 1VMDA 4R8SA 1UXOA 4W9NC 5ALEA 3AEQB 4RZSA 4UPEA 3DOCA 3HJHA 1FRNA 3KYDA 4LTDA 2YZNA 2YXPX 5DHAA 5CURA 1P7WA 1VXRA 2Q1TA 3LK6A 2Q0HA 2PL9A 3TNJA 2H18A 1BW9B 2I4NA 3W6NA 3QQPA 5FBZA 3IT1A 3G49A 3B6EA 1UJ4A 2IUFA 2YVKA 2GO1A 4AMGA 4AG3A 3LXUX 1VE1A 2GN2A 4DR7B 4DKJA 3CINA 2XY4A 3HBJA 4FWTA 3UWDA 5FBQB 1U98A 5ARBA 3WRWA 3RSLA 4BMZA 5CNJA 4Y6RA 3L7YA 1UODA 4WLFA 4OHZA 1S02A 1BU5A 3E4CA 1TYBE 2C1XA 1U63A 1W1IA 4YHHB 4UHFA 4Y2HA 2EHJA 1SVWA 1COWA 4UCQA 4JN6B 1KNXA 2REBA 1DZIA 1LX7A 3KXPA 4EG3A 2QZJA 1APBA 5ISMA 1YZKA 3B48A 1YA4A 4TT3D 4WN9A 2XLBA 4BVJA 2GM5A 3UQZA 2XCLA 4ZI7B 4YRJA 2JFYA 2XNHA 3QJGA 5C1DA 3IPRA 4YWHA 3LCUA 4IV5A 5L45A 5LXTA 4B7ZA 1UCFA 4CLRA 4FHFA 4IDQA 2FG6C 4FJ2A 4HUTA 4AULA 1R0LA 4L22A 1GCIA 1VSUA 2OCIA 4XASA 3S29A 2SKEA 2X2FA 3ZLVA 1SXQA 1YA8A 4BX2A 1HTTA 3PBKA 2B2CA 4W4TA 1KU0A 3FF4A 3EXFB 2R0QC 1PBTA 2VPPA 4RPKA 3OQOA 3KU4A 5KBYA 1D0SA 4QQRA 1VHTA 3K1YA 2PH5A 2Z9BA 1E1MA 3T61A 1FLDA 3IOEA 1E62A 4MQ4A 5FF9A 3NC0C 1L4NA 4R2HA 2C31A 1Z2PX 3GLKA 4EY5A 3AKYA 4QM7A 4CTMA 1OI3A 3L8MA 1T5BA 4RIFA 3KUKA 3UJDA 4C4YA 4RVUA 4LTMA 2R44A 2QRNA 2CUTA 1AKMA 2BFAA 3OTIA 4IRMA 2B5WA 4OU5A 1UWLA 2KLHA 1CS0A 3ZK8A 1L5HB 4CNQA 1F7UA 4L0DA 2EKDA 1T24A 3M5WA 4J4BA 2OQIA 5JH7A 4HLDA 3ZXSA 1G5HA 1KC3A 4QD3A 3MHPA 4BO5A 3FZNA 1R66A 3I6MA 4L7VA 2EATA 4LBWA 1OF1A 1LSSA 1Y1SA 4JLSA 1LPPA 2GYYA 3GZJA 4B6QA 4D3ZA 2CLCX 2EZ4A 1QIFA 4GLJA 5LUBA 3PF9A 4L5JA 1GPUA 2IH2A 1TB4A 2Q99A 4QO8A 1VGRA 3DP7A 1J00A 1GAWA 3EF3A 4J0CA 5AKIA 1G3QA 1VMEA 3OUZA 1CE8B 4GZMA 4JP3A 4YJGA 5F9FA 4OXXA 3GRRA 3UHFA 2LVBA 1Q77A 2ZXFA 2XUJA 5E8JA 4AP5A 1O0SA 4G4GA 4IGKA 3HDTA 4EG8A 3S7TA 3GAMA 4OGLA 3F8SA 4LS3A 3TW4A 1WKVA 1XTPA 3CO0S 4D5GA 1O0BA 2GRUA 2P9TA 4Y30A 5SY4A 3GFFA 2IH5A 2CFCA 3FZYA 2X6RA 3C48A 3T5AA 3NJRA 3J7AC 2OD9A 1U3CA 4W9NA 5AXCA 4MAMA 4WBNF 5KOJB 1YR7A 3D5EA 4ODIA 1YQXA 2QL6A 2Y93A 2HADA 3HV0A 5AHOA 5BR1A 1J33A 2NZ8A 4OGGA 5A5DA 4JOCA 3L8DA 1ANKA 1JNXX 4Q3BA 4AZSA 2WZQA 2RGYA 4C7XA 3R7SA 4MGIR 3ME5A 3PDJA 2BBWA 2O7QA 3L1KA 2O2GA 1U5AA 1W85B 3NBAA 4YXWA 4US2R 3ORRA 3E7XA 3KJHA 3K4QA 5EP2A 1MRZA 1IB6A 2FU5C 4I4CA 1VCNA 5I4KA 1K2WA 4UQLA 1ZKMA 4LYHA 2W7TA 4ARBA 5JHHB 5CT5A 1N3BA 2AGVA 4C7JA 1BYUA 3JAWB 4HAYA 2QOEA 4D9NA 2BFBB 2C9BA 3G0GA 1R4NB 3OLYA 1XMJA 4WNAB 4OEHA 3AFNA 3RLFA 3JPYA 5IYZF 5J47A 1PT5A 1NL3A 5JMOA 1SU8A 4IJMA 1QIKA 1JI3A 1RCUA 4K5QA 4ZZ2A 5J2UB 1UC5B 4KXQA 5A04A 1TE2A 2JDIA 1XK7A 2ANCA 1B8NA 1GQSA 4ZQCB 3N0TA 5IS2A 3EISA 1MABB 1P1FA 1V1RA 2OXCA 4O08A 3TIVA 3RJTA 3ZCSA 4EB3A 1G0OA 4JZKA 4TRRA 4JUDX 3LUAA 4G5SA 4I1YA 1P91A 2D1TA 4C2TA 3EVEA 3E1KA 2IYFA 3OC0A 2PRKA 3QE2A 3ZXXA 3IAFA 1DX6A 2G1UA 3DT9A 3W5VA 5LJLA 1MQ9A 3I58A 3ONDA 1CZLA 3OKFA 5CGZA 2TMYA 1NIPA 3KLBA 5C3UA 3ZU2A 1GU1A 3AO0B 3MJSA 3D8SA 3SF8B 5DTRA 1KK0A 1ZN7A 5CB4B 3UBTA 2ASEA 4HWTA 2FRVA 2QX8A 2RHGB 5CJPA 5CDFA 2BKXA 3PNKA 5H8WA 5G0WA 1QP0A 1DDOA 2FR8C 3X0DA 1WV1A 3L07A 2IKSA 3L4JA 5DV9A 2GEVA 4OVKA 1YD7A 4U7FA 1EXNA 2PX6A 2VF7A 4ZOAA 4ZDIA 4KIGA 2IUEA 5AJXA 1H2FA 2QLJA 1IG3A 3C14C 1EVEA 3LYAA 4DCTA 1KVTA 5ALGA 3D0RA 3N5KA 4Z7OB 3FWYA 1DIRA 5JC8A 3O1JC 3UK1A 2NU6A 2W42A 1F38A 3H4VA 1M6VA 1J5XA 3P9SA 1M6NA 4XTRA 4BGUA 3A06A 4GF5A 5DI3B 1ZR2A 3UNXA 2P78A 3SU8A 5C3MA 3EXHC 2Z2ZA 2CDBA 5KCZA 1RWMA 3EYWA 3DTVA 2WDPA 5K0FA 5AVRA 2YMQA 3L18A 1CY6A 4KUGA 1SRQA 1J56A 3P1JA 4LK3A 2I1WA 4I4IA 3C3WA 4OMFG 2ZI6A 3AF0A 3WB9A 1ECLA 1XRRA 3QVSA 5DYWA 1YQUA 3JSXA 2BF4A 7ABPA 4H7KA 3WK5A 4Z0PA 2HU7A 1X15A 2OV4A 2XODA 4MUFA 1S2IA 2E6UX 3HFSA 4PYOA 4TN1A 1GDHA 5C18A 1E2JA 2OE2A 1U28C 3AHCA 2VTKA 4EI8A 4ASUD 3BQMB 1FF9A 2HNAA 1E3MA 1W5BA 5I4BA 1P77A 1MQAA 2Q6TA 1L7DA 5HEKA 1T8RA 2CVZA 4NWIA 5DBFA 3PC2A 4BATA 1EM6A 1QQ5A 5I8PA 3EOZA 1U1DA 3B6IA 3LQQA 3AMVA 3T7TA 1TTTA 2Q1XA 3KEOA 4KFTA 2RK6A 2B0JA 2V59A 2QX7A 5LQRA 3ZE1B 2VJCA 1I3NA 2N75A 1OFTA 5DBEX 3RS3A 3P5BA 3ZK7A 4BNIA 1EFVA 2P2CA 3K70C 2WTAA 2DVMA 2GRJA 2H2DA 5FULA 2FPXA 2OHGA 1Y6QA 3EBPA 3PD7A 5IUJC 2O8BA 3AETB 4PLFA 1GNQA 3B3FA 2RAUA 4UD6A 4FSHA 4PHCA 2Q9UA 3T9BA 3DMPA 3HU5A 2BKLA 1AZTA 3CSSA 3AV3A 1OHHA 3JRNA 5EWJA 5H9VA 4RQUA 1EGHA 2G77B 2WSLA 4EY6A 1FX1A 5JSUA 3PNOA 4FC6A 1ZI9A 1IEXA 3EYAA 3VHXB 1SPBS 3CR3C 4ZV9A 1ZFNA 3C8ZA 1SULA 1JDUA 1G8GA 1X1SA 2I62A 3D59A 3AILA 3HDVA 4TZKA 2HWWA 2HRZA 4R1UA 4A23A 4MWZA 5GIOE 3ZVRA 4OH7A 3R5JA 1SEVA 1U5BA 2W6ID 3TKYA 4OMCA 3U4GA 1M1NB 4KWIA 5LP6C 2Q2NA 2JH3A 1EDBA 3LJKA 1ZRHA 3WZLA 2JJMA 1O6BA 1DZ3A 2V5UA 1J90A 3OJ0A 3RRJA 4C6RA 1EJBA 1GUBA 4F2PA 2XVZA 3I9KA 2C5SA 1XTBA 3E5MA 3LIIA 1QS0A 2ISSD 4OJNA 4BMPB 4NJEA 4TS4A 5JJKA 1OYYA 5E9WA 3AESB 1X38A 3OT5A 4JK3A 4NZ9A 3AFIA 1U3TA 3EG9B 2DFVA 3OH8A 3G79A 1PO7A 3G8AA 3DBIA 4J0HA 3ZS9A 3O8DA 4DJDC 1NMXA 1SG0A 1QRDA 1TD9A 1V11B 4M60A 2IEIA 1XZGA 3KJQA 1V7ZA 2XYPA 4REQB 4INJA 1E2UA 1ONOA 1T4GA 2JAHA 1IY9A 2V97A 3HYTA 5F78A 2IEAA 3TL6A 3VGJA 1G3UA 4HLQB 3JZFA 3NP7A 4OI2A 1L5NA 3EGOA 3FGZA 1RS0A 4P4NA 4Q7JB 3KSDO 4ER6A 1YCFA 3E3AA 4GWGA 1HLFA 3Q6IA 2FR8A 4RHCA 4JI3B 3RU7A 5BW6B 5A2QA 2CFTA 1QLHA 3AM1A 1NY6A 3MWDA 3O2NA 3QEKA 2X8JB 3HVKA 2ZR0A 3ZHYA 1RRCA 5HE9A 4CE6A 3K5IA 3K8QA 2HYDA 3WIOA 4PXYA 3C8HA 5JUWA 1MJ5A 5KOIA 4S1OA 3NM4A 3KQSA 4Q4CA 5FPHA 2UUCB 2PFSA 1PJRA 3H2GA 1QOQB 4JLWA 1I0IA 3VNUA 2GZRA 3HJUA 5KHAA 3EXHA 4ER5A 1GPNA 1L5WA 3WMEA 1XTIA 1JILA 4HGQA 3JQEA 3NTXA 5HK8A 4EGQA 1QTRA 1M8KA 1NBOA 1R0YA 2XV1A 4R01A 4E12A 4FFVA 2H2GA 3AZQA 2Z5VA 3BWXA 3OM0A 3LY9A 2IHZA 2YYYA 4G5GA 1EM8B 1EVKA 4IJQA 2M6LA 1A7AA 1X94A 2NTEA 3GGOA 2Q0SA 2QUZA 1HQDA 4EZEA 1EFPB 3Q9SA 4X66B 3G8DA 3WV4A 1U28A 4Q3KA 5K0CA 4YNBA 2AI2A 3WDKA 4YR9A 3HM2A 1NW7A 2XTJA 3CB2A 3C5VA 3IUEA 4GO1A 1NG1A 5AJTA 5HGJA 4EYGA 1GUFA 3NWOA 1NVAA 4OSEA 3HLTA 3NYIA 3HCWA 4MVXA 5D00A 5KQLA 3QSYA 1PNRA 1W0CA 3NHAA 3OCJA 1W4CA 5AOCA 3HRKA 4FHDA 3OPVA 3BB4A 3BFJA 3UH1A 1GTMA 1FTGA 2P9JA 3X1YA 2NO5A 4KV7A 3SR0A 2FFBA 1U2TA 2VCHA 3VGPA 4JQYA 4HRVA 2OQRA 1SO8A 1B16A 1B73A 4R05A 4XUDA 5BV1A 4HEA6 2B3TA 5IUNC 5LNK6 3LXXA 3D2LA 2OFFA 2PMDA 2W71A 1F3OA 3WK6A 2H2AA 4L02A 1AT1A 4ZTBA 2VDKB 1VYHA 3H9QA 5DBOA 3TNDA 1X6VA 2XEXA 1KHTA 4F8JA 2CFSA 4U7DA 1IBMB 2O19A 2NUAA 5C34B 1ZMXA 3D2AA 5KNCA 4JC8A 1CJMA 1FMCA 3RLIA 2X4LA 2BGMA 1VOTA 2EDCA 2J9YB 3EGEA 1IN4A 2ZIGA 1MUUA 4HB4A 3PXAA 2XQGA 3DZIA 1U0RA 1XEAA 2DPHA 2O3RA 4L8FA 2YKGA 2II6A 1B23P 3HCNA 3T34A 5FR2A 1TA9A 3NHJA 1L3CA 2B83A 4GMXA 3F2VA 4MSUA 3FWNA 5DI9A 1MVNA 1N9ZA 3BTVA 2BF7A 1JTFA 2IWRA 3NTLA 4CU5A 2OBNA 3TZEA 1IHYA 5K0NA 3RUCA 5LP6A 3NKVA 2H7XA 3D3EA 1OILA 3TLGB 2OM2A 4JLDA 1ZXLA 1ZH4A 1TK3A 4G9BA 4PHFA 3Q7TA 3GLSA 4FILA 4I50A 4V0SA 1TQHA 2WINI 3IQWA 1UBRS 4WD3A 4CDMA 4F91B 4RESA 2PPVA 2QRLA 1OCEA 3VC1A 1BXRA 1GZ6A 3VH2A 4YUXA 2J8ZA 2V45A 4CEIB 1MD9A 2ZAOA 1LVGA 3RS7A 2ZJFA 5IEJA 2RC6A 4TMFA 4R81A 1ZGAA 3HNPA 4MX8A 4ZK2A 2BFCA 2H4HA 1J0BA 5COAA 3M5DA 4QHTA 5EZYF 2O7RA 3D64A 3R6LA 4L16A 3LVFO 1BX1A 1YR8A 1MC8A 1GKIA 2JI6A 1DRWA 1E3WA 2WD7A 4OI1A 4YRGA 5JXJA 1RI2A 4MJXA 3BC1A 1YJ8A 3BN3A 4GLLA 2OL4A 1TZMA 4F9FA 2DG2A 4NZYA 4QSHA 1M2GA 2Q45A 3T5PA 3K0KA 1RACA 4GU5A 5EMMA 3NFYA 4PBRA 2ZB7A 3PYLA 2O8BB 3S2EA 4C08A 3GCWA 3CLSD 1XALA 1RRKA 3UH0A 3FFXA 1IHOA 4UTZA 3KLMX 1O3YA 4D41A 4QEZA 2QBYB 4MVJA 2HMYB 3C41J 1IBSA 1UFVA 4NH4A 1Z4PX 1CIVA 3C7TA 2DLDA 3PFGA 5JS7A 1FQWA 1JQLB 4IHJA 4GVXA 1E92A 1M3SA 2HLHA 4ZJYA 4M1MA 4NE7A 3WOHA 4N18A 2PO5A 1CEXA 2J5QA 4FFSA 1S8AA 1KSGA 3BJZA 3TIIA 3IP3A 4RFVA 3DC7A 3GJYA 4LEIA 2XZDA 3TOVA 3KE8A 3H9UA 3TN7A 4I5FA 3TECE 1UIMA 3IDSA 2XAAA 4NK4A 2FSHA 1MNQA 2CE2X 3WKAA 4P9NA 4YUVA 3W4KA 1YVUA 3DE2X 5HDBB 2B8WA 4M0KA 3NXKA 1NULA 2C4MA 4TUYB 1Y3CE 4U9UA 2BMVA 4XLLA 4XOIA 2Q5IA 2R4UA 3PYXA 1D4AA 3T7JA 3V1UA 4RMHA 3VTKA 4CZ2A 3IE1A 3Q7IA 4EBFA 2Y4NA 5TY0A 5C1OA 4WKOA 4M7RA 1RYEA 1IZ8A 4GYKA 3S7ZA 2M9MA 4A03A 2P65A 5HF5A 1NA5A 1Z0FA 1E98A 1I1QB 4GZ5A 4OFXA 2DERA 4TPKA 3NH9A 1G3MA 3DZKA 4Y0VA 2V7TA 3SSNA 1FRFS 4EI2A 4FGLA 4H7JA 1Z4OA 3LDFA 1G20B 3NKLA 5GTDA 4LXYA 2WSMA 4GR9A 3WKDA 3PTLA 3ORYA 3NYWA 1AY0A 1NXQA 5DGHA 4HAIA 4HI0E 3CX4A 3LW8A 3KXIA 5CYFA 4RY8A 1QZUA 4PLTA 1RAHA 4PFSA 3GDWA 5LZ2A 1I5OA 3IAXA 5T3YA 3WKEA 2SCUB 5FX2A 1GTSA 4XYMA 4PSAA 1YZFA 1BN6A 2GZHA 2Y0BA 3IALA 5AYVA 4MW0A 1GZ3A 1YRHA 1ZCBA 4MRAA 4NXMB 5IAKA 1W2HA 2AG8A 2PJZA 3MGGA 3VI3B 5A6SA 3O3MB 4M3NA 5JAUA 2UUAB 3ISTA 2WU8A 4KQMA 5KMGA 1IPEA 3F74A 1RABA 3CLKA 2AH5A 3DEZA 3G7NA 1RI5A 4I14A 2PVPA 2Q49A 5C46F 3FGPA 2F43B 1VHLA 5TRTA 2AI1A 2WIJA 4YJKA 2G6TA 1NI4A 1VZ2A 1JHVA 3EEYA 3OJCA 2PD3A 4JYMA 5DTMA 5CLFA 4IX9A 2B0CA 1QHFA 2DE0X 1WXFA 4QUKA 2BMAA 5B58T 2H1VA 4DRZA 1WG8A 4A15A 1UANA 3IMCA 1Q91A 1W9HA 1XQYA 4H6VA 3DF9A 5MN4A 1EZZA 4TZ0A 2FVYA 4L8LA 3RRMA 1GRCA 4M8NE 5EIEA 4BLQA 3DQPA 5FNVA 1N1MA 1VKNA 1ISFA 4ZAZA 4OY3A 4I7EA 5EXSA 4KQGA 1T0UA 2JFFA 3ENVA 4FYJA 5JZBA 2ZU6A 4QT4A 3HVRA 3DO8A 2RAFA 2YJ6A 1GGHA 2IRWA 3P26A 2WSIA 5I9TA 3G89A 4C30A 4FFLA 3S81A 1BRMA 1EX9A 1K9SA 1NXOA 3EVZA 3JQPA 3MMNA 5ICCA 1P5RA 2XBLA 2B4QA 2YHIB 1NW6A 1BHQ1 2WKQA 1ZX1A 3WLAA 2P4HX 3DDUA 5B2EA 1UBTS 1EFKA 2PSFA 3I9FA 4WN3A 1OC4A 4GI2A 4YP0A 4M98A 1DKNA 1RP7A 1W4BA 1T2AA 1E4YA 4YLYA 2D0DA 2YS6A 1KSFX 3DMFA 4HN4B 3DKPA 3RYTC 3Q3CA 1G19A 3HKCB 3IAS1 4KPFC 3VU9A 3KEGA 1KQFA 4ZHQF 1QX3A 4RQTA 2QQEA 5CJ2A 1LPAB 1KZYC 5CA0A 5BMOA 1OLXB 3RREA 4WBNB 2Z2KA 3UMVA 2PWBA 2MHCA 3T9EA 5H9WA 1N2CE 1T2CA 4J7XA 4LJ4A 4LN1A 4QG3A 3TSZA 1L9XA 1XA3A 1F4VA 3FMVA 4IIFA 2ZB2A 1YA6A 2GXAA 2Y9PB 3BGOS 1L5RA 2QR3A 4DRYA 4I9GA 4AWXA 4GZLA 2XA2A 2RJNA 1QV6A 2WMOB 2YRFA 1OUMA 1AK9A 1PG5A 2FMTA 1NXPA 2HLDA 4NENA 4GLFA 1SBCA 2Y2UA 4XGQA 4U3JB 5EWLA 3H6KA 4JP5A 5DX0A 2F6RA 2WD8A 4QGAA 4Q9DA 1ISSA 4BZPA 2J3QA 4LZNA 1KETA 1NVBA 3WG9A 2CB0A 5C4MA 2Q5HA 4GPD1 4HQLA 5HM6A 2J7PD 4MYSA 1MJGM 5KYTA 1IMOA 2ADFA 4B80A 3NR2A 4LRUA 3GEDA 5IYZB 1EWQA 1P9WA 4EH1A 1YO6A 4H15A 3TSCA 3E7DA 3JQRA 4RIGA 5EQFA 2R7NA 2O8CB 1SHKA 1PZHA 1VHQA 3VR6H 3UATA 2Q8PA 3KXKA 9GPBA 1KYZA 5LSAA 2W83A 4RIEA 4LMRA 4FLMA 821PA 2A5LA 1XA4A 1DBRA 4PINA 4ZREA 4BKRA 5BWBA 5IDQA 4DWVA 3FUUA 2O0JA 1Q0UA 3MZ0A 4TMTA 1UZUA 1GJRA 3S2UA 3HUFA 1UC8A 3LCMA 1U31A 4RZUA 3VPHA 4LXTA 1NX9A 3R5SA 1DRKA 3N2NA 2NU7A 4JB8A 5FH9A 4YJ3F 4J4TA 1IDOA 1Y7IA 3BG5A 4ZIRA 1ZD3A 4M8SA 3UUEA 1ZC4A 2R8PA 3I5XA 4U7PB 2UAGA 3KPYA 1KBZA 2IGBA 1J99A 4C22A 1DEKA 1E1NA 1XROA 4I66A 3LCVB 4TYPA 4ZT3A 2J4FA 4OLAA 3NG1A 5DX1A 1Q0QA 1V4NA 2YIMA 5JTUA 2J3IA 3ZS8A 1HSZA 2X8WA 2NV0A 4OOEA 1ODIA 4AZ3A 3ZXUB 1PD0A 4W6ZA 4IQFA 1NMYA 2RHOA 2VRBA 4NH0A 1T5IA 4RZQA 4D57A 3FTEA 3TX6A 2OO5C 2P62A 4S1PA 3OSZA 2J59A 4L4ZA 3DNMA 1OIXA 2Y68A 3GWGA 4JHLA 3RUEA 1Z0KA 1CQXA 2D5AA 2DX7A 1DARA 2RBGA 3AR2A 2ZDGA 2B82A 4O0MA 5C4GB 2YXBA 3B3QA 4E2WA 3D4IA 1PT6A 3DHNA 1FB5A 1WRBA 3W2HA 1ZQ1A 2A3RA 4BLOA 1WCYA 1XRLA 2WYUA 1XZNA 1Z12A 3AL2A 5DW0A 2AFHB 5B3KA 1XNRB 2VAWA 5E9AA 4YP9A 4EEKA 3K31A 2JCSA 4DCGA 2WG0A 3HU1A 4AXXA 3AWIA 4JLNA 1HDZA 1A0OA 3EK2A 4ND3A 3GEBA 1O6GA 1JECA 1Q7EA 4RNCA 5I9SA 3OZVA 2VSXA 1JU3A 1E7WA 2VP0A 4Q4DA 1QYDA 4PHGA 5L40A 3VX3A 3GN1A 1R12A 1NSFA 3GRFA 2Q3CA 2QJOA 1I36A 1AF4A 1U2EA 5LBIA 1QHGA 3FWKA 3CYFA 3PI6A 2D6FA 1DTSA 1YOVB 2WWVD 4JOQA 4JX9A 4PXSA 1CZOA 3ZV3A 2WJIA 3CRVA 4JYBA 3CKYA 1H6AA 4P4UA 3S55A 3KVRA 3L8GA 1YU9A 3QX8A 5AK5A 5ADVA 1W73A 3JAKB 4KN5A 4WZBA 4X71A 4FBMA 4J9VA 3FRIA 3NORA 4AS1A 4JENA 4G5HA 4R2WA 3T9AA 1I51A 5EJ5A 3WGLA 3VC2A 5J23A 4IDAA 2IZ0A 3A2KA 1B6RA 4ZYWA 1N7GA 3GZNA 5KMGB 3A6HA 3ZJ4A 3LUKA 2QX9A 4PIPA 2LKCA 1Z5PA 2V6FA 2W0SA 2Y1OA 1U94A 4ND4A 1UK9A 2IVFA 4PC7A 5JYCA 2HSZA 2QAGB 4Q1DA 4F93B 1NUPA 3OEHA 2G04A 3FCYA 2NLOA 4YAKA 1JIVA 3LX6A 1L4KA 1C1HA 1JHYA 2O0LA 3RGWS 1YDWA 4C0SA 1R3DA 1SHTX 2HDOA 1HE5A 5A5GA 3KHUA 4BU1A 1RWXA 3AKCA 3RABA 3BBPA 1DAIA 1ZVVA 3IOBA 5FOXA 4YCLA 4P7BA 1XVLA 4YUAA 3KG2A 4QOHA 3HXOA 2O54A 3N05A 2ZANA 1VL1A 2H1LA 2QHXA 2GTIA 1C4WA 2DKNA 3X1ZA 1OLSA 2XCSB 3GELA 2XW6A 3DL7A 3FVRA 2JIBA 8ATCA 3UHOA 2Y0CA 5CLHA 4R2KA 3RBVA 4HLUC 3VAZA 4BAUA 1NSTA 3RUAA 1O5OA 3MAJA 3PGXA 1V43A 1FU7A 2ORVA 1ZESA 2XBMA 1EUQA 3KTDA 4G41A 3DV0B 4AMYA 5H7XA 4IOKA 1T3GA 4YCJA 4EECA 4KQ2A 4NYMR 1JDVA 4DLXA 1PN3A 3OE7D 4L73A 4B17A 1SG6A 1ZN2A 5CHYA 4B33A 5HDQA 4FEGA 2CNNA 4HWKA 1P1CA 2HPZA 4P3NA 4D4JA 1PJTA 3LA8A 4CCYB 1U7ZA 1I94B 3HC7A 1FNMA 4XB2A 2FQ1A 4C06A 2XTZA 3VJLA 1QIGA 1W6RA 4KH1A 3CVVA 5L3SA 1IPHA 2Y76A 3NH6A 3PQ7A 3KOMA 4HDNB 2H92A 2HA6A 2Q9CA 4HXYA 4RE6A 1GD1O 4MR7A 2FQYA 3FAKA 5KSPA 1L7NA 4MS4A 2OO5A 4G0MA 4UZFA 2A5JA 4JFRA 1D2CA 2ZSFA 2G67A 1QIMA 4EFDA 5IJ9B 3U5ZB 3KQKA 1Y5RA 3DJYA 1PEKE 1JFLA 2OSBA 1X80A 1AUPA 1MMFB 4M7PA 4ARZA 5JPCA 2QQ0A 3HN7A 2GRAA 4HTAA 3F1KA 5EI5A 1V5WA 3AFGA 5I8WA 1YB4A 1JDNA 1QZZA 5AI4A 5KJ1A 1N0WA 2VJQA 3PKJA 2I29A 5JZSA 1MIOB 2CJYA 2A35A 5CA1F 3ZE9A 4F86A 5HPYB 3QEBZ 3B5EA 3MUNA 2R96A 3LD9A 4N5DA 2X3FA 4XFKA 1EWVA 1UM9A 1CRLA 4URZR 3SEQA 4ZKDA 2X9LA 3BGDA 3OZDA 4H16A 4OHKA 4ZO9A 5A4JA 5CCXA 4O5OA 1SCIA 1TT5B 4QFMA 3VDQA 1UJ5A 3I2FA 1QZ3A 3FD8A 4KDCA 4F96A 1FFYA 1GZ7A 1XDZA 5FPTA 3FR7A 5JQGA 4Y6OA 4MTCA 1PJ2A 2XXBA 4NG5A 4P82A 4UHBA 1JN0A 2CVOA 3MGKA 2W8BA 5SZJA 2VYNA 3TQOA 5HMLA 1N5IA 5BW4A 2GJ9A 1OH7A 3SZGA 4L5AA 4LVOA 5K2OA 2Q27A 3R5XA 1HE3A 1ZITA 3D4BA 2HI0A 3IDOA 2FA9A 3WGTA 5K3CA 4BWYA 3KZVA 3C5CA 3UZUA 3GJ0A 4EGSA 5HZMA 1BXGA 1DB3A 4YECA 1SWWA 1KQGA 5BSUA 2HBRA 4YJHA 2ZYRA 1GKUB 1SCUA 3A1FA 1HE8B 5DB4A 1CUFA 1NPDA 4UARA 2ZIEA 2OXEA 3MTDA 1YFLA 3JX9A 1BX0A 1ACLA 4FT2A 1E79D 2YVQA 4RVDA 1F51E 4BVHA 1M2OB 4CG1A 4TZ6A 1CRPA 2DB3A 1Y1TA 1RJEA 5KTRA 3ZQ6A 5DTIA 1N3IA 2PKQP 4OQQA 3GD7A 1JDTA 3VNBA 1SC4A 4QFBA 1V7QA 1IY1A 3ZBQA 3B1FA 4IIJA 1Q83A 5H4GA 2PN1A 3I45A 2OFWA 3EEQA 3R75A 3RNOA 4QLBA 3RSSA 1OFUA 2AIRA 2H1RA 1U5CA 1AUXA 2JEZA 3QU7A 3TQSA 4EHIA 1E7YA 1AF7A 4BKQA 5AMXA 3HEAA 4YIKA 3EJWA 3OOEA 5DMHA 2P6MA 4Y8VA 3N53A 1O7JA 1J8VA 4LJRA 3IEUA 5EZYB 4YXFA 1Z39A 4LXQA 4CG2A 2PR7A 2QUBA 2ZQYA 4Z0TA 1NOIA 2JAQA 1XLUA 4XAQA 5ITZA 2O5VA 2Q3DA 1QTQA 1GA4A 1VE3A 4MO9A 3KOWA 2J5BA 3OTQA 4TL9A 3L02A 4XD7D 2FOIA 3O26A 4U0KA 4HLUA 2QAIA 1XL0A 1G6HA 1HYEA 1IHXA 1X1EA 4FOTA 4MR8B 3WGGA 3D2CA 4DGSA 4UOZA 4LHXA 3ZDDA 1Q14A 1U6IA 2DQZA 4DV7B 1XZKA 5B3JC 2WZBA 1RVDA 3AL3A 5F1KA 1J0EA 1YONA 1DS6A 2JLWA 1XL1A 1XKTA 2JAWA 2V58A 2XGSA 4L5CA 4MQFA 1E2BA 4FYKA 3QXSA 4RLHA 4A8JC 1GYPA 4HAWA 1ZICA 3ADOA 2W0MA 3GBVA 1K8YB 1W59A 5K1ZA 1QOPB 2VA9A 4TT3A 1NUQA 3A28A 4XWAA 3R4CA 1EUZA 4FR2A 1O03A 1YFZA 4MR9B 1XAHA 2WQZA 1UZNA 3GLQA 3CF6R 3FAZA 3LNTA 3PEVA 3ZTYA 5AW3A 1NJSA 1P4HA 3GARA 1LV7A 3GRUA 4KTTE 1DCTA 2C0QA 2CV1A 2PX4A 4KRYA 3UO8B 3A9TA 2X7XA 3T8YA 1XDBA 4EUKA 1XMOB 1T4BA 1BH6A 5FL3A 5IDWA 4DR6B 1JPUA 3IMGA 3UW3A 3NATA 3I62A 3M9XA 2HJ9A 2VBIA 3QQ5A 4GOMD 3AW9A 4XVHA 5I3CA 4BNUA 1G2QA 1U1FA 3QH4A 3B1YA 3X1MA 1GZSA 3GEPA 1OBOA 1PR9A 1TU0A 4MQ5A 6YASA 1TYZA 4XQ0A 3GA5A 4IWXA 2IJGX 3K8OE 2IX3A 5F7ZA 4FR5A 3CFYA 4X1IA 4MW2A 1ECFA 3T0GA 4E14A 2OUKA 4NBVA 4L5IA 4V02A 5E6UA 1JQKA 1ULZA 3PDIA 3U4AA 5JHGB 1CJTC 1ARZA 5JEEA 3W7AA 1ZK4A 2HHHB 4IWNA 4N0QA 1RCFA 1Y89A 1CB7A 1TQ4A 3F7NA 4I36A 4B85A 3RIGA 5KDDA 3H5AA 3I53A 1E9CA 1NP7A 3QPCA 1WSAA 2GAAA 2I9KA 1HQKA 1V37A 4Y9UA 1FC0A 2B94A 5EXPA 3VV3A 4YAUA 2GZ3A 4B4OA 4BECA 1V1JA 3NKFA 4TTRA 3NCTA 1TVKB 3HWX1 3GL9A 3G8CA 2H63A 3L0YA 1C2TA 1DJPA 4XGKA 2QX4A 2R48A 3NBFA 3NGXA 2GN9A 2V7XA 1PDOA 3BXPA 3CX6A 1YASA 4L4RA 2NP6A 4I1RA 4R1QA 1JH8A 3R8XA 1J07A 4BO2A 2AYZA 1XXLA 1MR3F 2N1MA 1YJ5A 1GVNB 4IOMA 1OFIA 2PD6A 5IABA 5JCXA 3MRSA 3THWA 3I4FA 3NJ8A 1UXKA 3VAAA 1F8XA 4EFKA 3BMXA 4CMCA 4HOYA 4MR7B 2XMZA 1I6MA 3DR3A 1US8A 3T7AA 1XQ6A 3A2LA 3QSGA 3V32A 4ONEA 2P6PA 2QV7A 3KUCA 1LY1A 5BUQA 3NRBA 4RF2A 2PV7A 1QH1A 2GN4A 1V39A 4QJ4A 1DVRA 4MJ3A 4MXDA 3KR2A 1FCJA 1W94A 1SWVA 1X8JA 4ZCLA 4EB6A 3JARA 1WMEA 3UK7A 3IB3A 5HTOA 4TKVB 4I2NA 1N8TA 1CJUC 1MLDA 1O1YA 4HXGA 4PRZA 3RASA 4BJ3A 5AVSA 3BL6A 1NM5C 3CR7A 4K9MA 4BX8A 1MX1A 5C51B 1XKLA 1L5QA 3NVKI 1EE9A 2YC4C 2E4YA 1TL7C 5A4KA 4P31A 2O8DA 1C14A 2IZOA 3RK0A 3RR2A 3V8BA