3IBFA

Crystal structure of unliganded caspase-7
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
b'TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibfA00
1SHJA 2XZTA 4FDLA 4D3ZA 2H4WA 3EDRA 4EHKA 1GFWA 3GJQA 1I4EB 1PYOA 3R7BA 4HQRA 5IABA 2DKOA 2H51A 4QUJA 3P4UA 4FGUA 2H5JA 1RWPA 2FUNB 3UOAB 4JR2A 4NOKA 4D3YA 2QLJA 2XZDA 2QL7A 2QL5A 4QUIA 4ZVUA 3PD1A 3NKFA 4QUGA 4EHLA 1RHKA 4PS0A 2XYPA 4EHAA 2HBQA 2CDRA 3DEKA 4JR0A 4QULA 2Y0BA 5IARA 3UO8B 2J32A 3H0EA 3SIPA 4DCJA 3V3KA 5K20A 2AR9A 1RWOA 2C2KA 2P2CA 1K86A 5IC6A 4EHDA 3D6FA 3IBCA 2C2MA 5LUAA 4PRZA 2QLFA 3D6HA 4JJEA 4NOJA 4ZVRA 2CNLA 4FEAA 1RHRA 3PD0A 4N6OA 3R7NA 4QU8A 4NOMA 4ZVOA 4I1RA 1F1JA 4N6NA 2XYGA 5I9BA 3P45A 4DCOA 1CVRA 1KMCA 4NBLA 1QX3A 1SHLA 2XYHA 2CNKA 4EHNA 3V6MA 3DEHA 2Y1LA 4AW9A 1QTNA 3H1PA 2H48A 3PCXA 5IAKA 2H54A 1F9EA 4LSZA 3NR2A 4N5DA 2K7ZA 4QU9A 4EHHA 3V55A 1NMQA 4IYRA 4JJ8A 4QUDA 4ZVPA 1NMSA 5H0IA 4EJFA 2HBZA 4N6GA 3V4LA 5IBCA 3R6LA 1GQFA 3R5KA 1K88A 3KJQA 3R5JA 1RHUA 1RWNA 4JJ7A 3S70A 3NS7A 4QTYA 5LU9A 3SIRA 1RWXA 3EDQA 4I1PA 2C2ZA 3E4CA 1I4OA 3OD5A 4DCPA 3H11A 1PAUA 4QTXA 4QUEA 1JXQA 1RHQA 4QU0A 3K7EA 1SC4A 4AWBA 2J30A 4QU5A 5IASA 2CNNA 3H13A 3QNWA 5IAGA 5IC4A 3DEIA 4JR1A 4FXOA 3V6LA 1M72A 3GJSA 3KJNA 1RHMA 1BMQA 2CJYA 5IBRA 5IANA 3GJRA 3RJMA 1IBCA 3IBFA 1I3OA 1NW9B 4QUBA 1NMEA 2H4YA 2NN3C 2QLBA 3S8EA 2J33A 3BIJA 4M9RA 4EHFA 3H11B 2CJXA 3DEJA 4HQ0A 3GJTA 5JFTA 4IEFB 1RWVA 5IAEA 4D3XA 1SC3A 1ICEA 4AWAA 2HBYA 2HBRA 5I9TA 1RWMA 2C1EA 1RWWA 4ZVQA 5IBPA 2CNOA 4NOLA 4N7MA 4PRYA 4QUHA 4PS1A 3R6GA 5LUBA 1RE1A 3KJFA 3V4OA 4ZVSA 4QUAA 2C2OA 2H65A 2QL9A 2H5IA 4JB8A 2J31A 2FP3A 4NBKA 1CP3A 1I51A 1RHJA 5IAJA 2FQQA 3ITNA 4NBNA 1QDUA 1RWKA 2WDPA 4N7JA 4ZVTA 5LU8A 3D6MA 4JQYA 4JQZA 4HVAA 1SC1A 3R7SA
chains in the Genus database with same CATH superfamily
2OV4A 2CBZA 2DAPA 4YLEA 5TRTA 3AHDA 4EX7A 3N75A 1VYHA 4KUGA 4ZMRA 1E3SA 1CUJA 2G8NA 2KB0A 2W2NA 2BLNA 4KMSA 3EE6A 4XUCA 2QZZA 4D46A 5JXHA 2ZG6A 4B5LA 2VKQA 1MABB 1GNRA 4FFDA 5CB4F 1BDJA 2H7CA 3DBVO 3GEIA 2PO7A 3I01A 2VRBA 5CB6A 3PQEA 1BDMA 2PMWB 1A97A 3CO5A 4X44A 1L6RA 2GR9A 3WC4A 3U3RA 1ADCA 4AJLA 1KPGA 5TT0A 3NBQA 4I3HA 3T1OA 2Z6AA 1NVFA 2CFTA 5AOCA 5H4HA 1UJ4A 1NF3A 3U6BA 2HCTA 3D8SA 5JRDS 1TJ5A 5JCOC 1EFRA 4JB2A 3UMBA 1I9GA 1L3CA 1UP6A 3IBCA 3T1QA 2V6IA 2GD0A 3G7NA 4E7OA 3KSAC 3TW6A 2J7KA 3DLPX 4YO8A 2D0IA 3A1SA 4FILA 4DY6A 1FDVA 2O2IA 1X0XA 4GI7A 2EU8A 2BFFB 2IP1A 3OX4A 3UT5A 2CHUA 2BGUA 3TX6A 4UTVA 1Z5NA 2QVZX 1GGVA 4P4GA 2ZUFA 4AN4A 5B6PA 1ZC4A 3EG9B 1OZ0A 4JROA 3KV1A 1EWRA 4HB2A 1Y98A 3LQ2A 3IA7A 5IM4A 1X7ZB 4YRFA 2QZSA 2E5LB 4DCOA 3ZWWA 2ID4A 5DNUA 3CX7A 4O2BB 5T6BA 5JCXA 1MIHA 2SCUB 4YUAA 3G2LA 3AY7A 2TMGA 2AJLI 2XMDA 2Y4NA 3AHJA 2XDQB 3GLQA 4KL8S 2E6UX 4YGYA 3V6MA 4A6DA 2HV9A 2C5FA 2X8JB 2EEZA 4WKGA 3T5TA 3QK7A 4L15A 4HG2A 4F3YA 3UHFA 1ZCZA 3OZRA 3WGOA 1E62A 1E3IA 1GPWB 4X60A 3ZBPA 3F7MA 2E4UA 2GZ1A 3U49A 4YDHB 4IIFA 5F2KA 3T6KA 4N3GA 1YZLA 2V6BA 1ZSVA 5CEEA 6GPBA 1MU0A 3ZY6A 3KXKA 4RPLA 4X63A 2V3CC 4XLLA 1GZ7A 1NXXA 1UIRA 3C0KA 4RKFA 2I2DA 3AKEA 1IZ8A 2ZUDA 4GPD1 3VZBA 5IASA 2Q28A 1G60A 4TTTS 4A6PA 2AV6A 1JIXA 4C08A 1JG4A 4INAA 4EW2A 3I53A 2ZQYA 3DE4X 4EYKA 5IANA 1EZ4A 4B79A 3R24A 3GJ5A 3HO6A 4HXFB 4XYGA 3S5JA 2B4RO 4IX1A 1E58A 4LW8A 4QUBA 1S2MA 5HCUA 4KQMA 5BOSB 2V55B 2VLBA 1DRJA 2QD5A 3IDZA 4TZ0A 4KGZA 3ZHXA 1G7RA 5DBIA 5AXCA 3N0RA 3FI0A 2FI1A 4JLKA 3X44A 4UQPA 2QUBA 3I5MA 2FXVA 4G1BA 3FKSD 2DSTA 4ZPJA 4IOJA 3B51X 1T9DA 4ZGWA 1U0GA 5CG2A 1DEOA 1TU4A 2OTCA 1EFDN 1QJ4A 3CSDA 3NOQA 3AI2A 3JWPA 5ER9A 3V97A 3WR5A 3F1KA 2VDOB 4RK6A 3ESDA 3EXFA 4MR8A 4EW1A 3JZIA 1W9MA 5REQB 3TLCA 4XUDA 1DBWA 1HO3A 4JGGA 4P6VF 4UM8B 4C76A 1KDZA 4YJ2F 4W5QA 1I7DA 3K05A 1AS0A 4BXOB 3I37X 1DXYA 3RS3A 4ENUA 2QQGA 5ALYA 3GI1A 1X77A 3ICPA 2VSYA 4DR1B 3WHLA 2TYSB 3DE3X 3RU3A 4IFBA 2GAAA 2XGOA 3BA6A 1U3WA 5I51A 3THYA 1GRVA 4UBJA 2QENA 1JAHA 1QZZA 3CF0A 4Q3CA 1ORVA 2ASEA 2PAFA 3K4QA 2BDUA 2Q2OA 5DEOA 1TW3A 3EQ9A 3I92A 4OHXA 3HDHA 4PC3A 1SD2A 4RE6A 4LYGA 4G0ZA 2FQWA 1AQIA 1JJIA 4GX5A 1T5LA 3ABRB 2WJ6A 3ZDYB 3BH0A 1L2TA 3AR5A 2O1WA 1XD9A 1P0IA 4Q9KA 4CVNA 5KYKA 2FSIA 4Y6RA 1VMKA 2HK7A 3K1YA 1C0PA 3FX2A 3LPDA 2WTNA 4LNUA 4Q4HA 4P93A 4IWYA 1L5YA 5JJCA 5ESWA 3FSGA 2VAVA 1LS1A 2QN2A 1NATA 3CG4A 4MW0A 5AK3A 1NL3A 3VAYA 4HR7A 5EIHA 2IPMA 1GZ4A 1I3LA 2BTQA 2D3TA 2ENUA 4BO9A 2WWIA 4X6XA 3BA1A 3HNRA 4RTPA 2JZOA 5ERYA 1OXMA 3F4KA 2E2WA 3OEYA 3I8OA 5D51S 4MVJI 3AEUB 2P79A 3VSCA 3CPEA 3H16A 3WJ1A 1O94A 4FOLA 4W5NA 5KEIA 2XB8A 4L7VA 1Z7EA 3H2YA 1A9ZA 3D2AA 3HXOA 4OP1A 4AG6A 5E2AA 3WBKA 2ZRFA 1QTRA 4M98A 1QMPA 5IBQA 3SF8A 4MMYB 1Y3CE 3IEPA 1L4EA 4IQ8A 4O0LA 1G8PA 3RO7A 2B25A 3IMKA 3O2JA 1XF1A 2CXUA 3OUZA 4NYJR 5IK2D 1VDMA 3U44A 3AK4A 4NENB 3VTAA 3MSXA 3QKSA 2PZMA 4O08A 2ZUUA 4CUKA 2NTEA 2JLZA 2HSJA 2ZTHA 2AH5A 3WQSB 2QVXX 2F8LA 4DMLA 3BDAA 2CHGA 1ADBA 1QFSA 5DHUA 3IHKA 4B40A 2OL4A 4U2CA 1MJGM 3LU1A 4WY5A 4ZI7F 2EJTA 1NUHA 1RPZA 3PYXA 3TSYA 3WL6A 5AI9A 1DI0A 2CJYA 2H1CA 3DOIA 1WPRA 3EZ6A 1XC7A 1ARZA 1DKUA 4LS3A 5K6RA 5ILQA 2ZATA 1WJGA 3FCSB 2NSYA 5A3QA 3AHEA 1E9FA 1QAOA 1R6TA 3WBFA 4EAAA 3I9V6 1THGA 1VKRA 4GG1A 1Z0FA 2YZ7A 4K1LA 5FH9A 4CCSA 3TN7A 3IR7A 3P19A 2CSXA 2Q2NA 4RELA 1RFLA 4UCQA 3V9PA 4CM4B 3ZWPA 2I1WA 3CPJB 1Y3DE 1I3NA 1ORTA 1A04A 2NU6B 5FV4A 4FYPA 2EHJA 2HMSA 3M4ZA 4S24A 1QFJA 4BYGA 4ZK2A 2CNOA 2EZTA 3ZWVA 1FUKA 3QFCA 2MCFA 1JLLA 3LPMA 4ZVSA 3DDNA 1XELA 3QX7A 3EVBA 3WWOA 5IAJA 5JFTA 5ESDA 1UPXA 4NHOA 3EFEA 1WETA 4WFQA 4YAEA 5BYKA 1UDAA 1L5MA 5GWXA 1G8KA 2D2XA 1SC1A 3GFPA 4KLRA 4RJIA 5E0OA 1WZIA 2WMYA 1JLHA 2H59A 3FKJA 3D59A 3IC5A 4KC0A 2VTBA 2H52A 2IY9A 1JSXA 1RC0A 2PU5A 3JQ9A 2DKOA 3C7TA 4M9SA 2I4TA 1GCIA 3F7TA 2BGMA 3H5WA 1YCFA 4HT3B 2IBSA 5CT8A 4LF5B 4F96A 4JR2A 4FUQA 1JAXA 5E2BA 3V1KA 5EFOA 3RG2A 3VX4A 1E2QA 5HZMA 3EFHA 5P21A 3CVYA 1HQKA 3V8NA 1ZH4A 3T12A 5KCZA 2FW7A 2G04A 2CVOA 2ZPTX 3Q3IA 3WI7A 3ND8A 2R1ZA 4ZAVA 3P9XA 4QDTA 4ABTA 1A96A 1K5DA 1MA0A 1OXVA 4A73A 5KJCA 4ARCA 2JIPA 3PIRA 1L1FA 1EFVB 3ONWA 1Q0LA 2FUG1 5D86A 3FY4A 2H17A 1X38A 2VDLB 1C80A 1CT9A 1GN9A 3C6YA 2A84A 3SJBA 1XX6A 2C61A 2VWQA 4MW4A 3PE4A 4IIYA 2GD2A 3R7AA 4MNTA 3LH5A 5CA0F 4K9NA 3L7DA 3RS8A 4BWGA 4RTRA 1ENYA 2MSEB 4LNAA 3JY6A 4RU1A 2WSIA 4D9NA 2FZ4A 1TT5B 2GNOA 4B3XA 1IDN1 1OPRA 1S96A 4LGVA 5B1SA 2V7QD 3L41A 3DL4A 2VJCA 4KWTA 1GSIA 4NS4A 1G1AA 2QD2A 3QVWA 3GZTB 4LY3A 4WOPA 2Y0EA 5EZQA 5ECDA 3SOZA 2AX3A 3OF2A 1J00A 2ECFA 4YMLA 5HPYB 5CJ2A 4DG9A 4EZEA 5C4MA 2ROQA 3GGJA 1H42A 3GHYA 4CLRA 1WHTB 3KB1A 3OEED 2ANBA 3SKYA 3ILSA 5ALLA 1RJGA 4EJFA 5KWVA 2PCLA 3VO8A 3HZOA 2AZ4A 4PNZA 1YQ9A 1VC2A 3OSUA 4LAFA 1A9RA 1DAMA 1U5BA 1GPUA 2ZRJA 3B60A 3HDTA 3NRBA 2JL1A 3WGVA 2D5CA 4XPIB 3WLMA 4PHHA 3COZA 2ZRQA 3PFFA 1QAMA 1KPHA 4RWEA 2O3UA 1H94A 2OE2A 3QX9A 3ETHA 3O8LA 4TL7A 4HXGA 5GJVC 3KELA 3PVZA 4IICA 3ZIUA 1K7FB 3WGQA 3GA0A 1P2TA 3OPMA 4JSTA 5KNBA 2XGJA 1OY1A 2FX5A 4PG7A 1UP4A 1JG1A 1Z68A 4PNPA 1EDOA 1SQ6A 5FORA 5C1BA 1RJFA 5CU7A 2QRGA 4HX9A 1V8DA 5HMMA 2HXGA 3WKCA 3VR0A 1PVDA 4JBWA 1P1KA 4QO7A 1RD4A 4K1XA 1YF3A 1EWTA 1E7YA 3KOYA 3V4SA 3V7FA 4NF2A 2CHVA 4Z4CA 3A05A 2V7VA 2R7MA 3WLJA 4M6WA 3H5LA 3O31A 1PTJA 1Z35A 3GCGA 1N5IA 4EPXA 2E37A 1PR4A 3CR3C 3NJ8A 3OOJA 4H6PA 4ZV9A 3D4NA 1NJSA 2DP4E 3DLIA 4HFMA 3M6VA 4MUNA 5DT9A 1JA0A 2O6HA 2HYIC 4ASUA 3ZZ0A 3UHAA 1L7PA 2QAGB 1V4BA 4MIKA 4UMFA 2ZJFA 4CMGA 5I9LA 1VL1A 4JEHA 5DXJA 2XF2A 3MWKA 2BV3A 4B6FA 1XI2A 3N0VA 4KVZA 1BGVA 5B6IA 4U0KA 1S8OA 2WQ6A 2R62A 3WXBA 4BCCA 5LD2C 2FSVC 2J6IA 1NM5A 1RACA 1NVEA 2X8LA 3HB9A 3QBEA 4MJLA 3H9CA 5DP2A 1I4EB 2XHZA 4DABA 2E18A 1ACJA 1BD4A 1QM5A 3GGOA 1HNXB 2OBYA 3FVTA 2GBPA 2XRYA 4MW9A 4R8RA 2C9CA 4HS4A 2YJNA 5JSUA 1HSZA 2FN7A 4EYEA 5KKNB 1OREA 3DCNA 4OIFA 2P8JA 4Y3UA 5LZ5A 4LMRA 3ZQUA 4ALMA 4PS0A 4RVUA 2VDVE 3AQ4A 2ECKA 4FSXA 3RI3A 5EWLB 4IXWA 1X8LA 2E5WA 4RC9A 3O0DA 3R5FA 3TW4A 3EDCA 3ORYA 2WJYA 1IHOA 5KOYA 1NN0A 2XKJE 4BX3A 2DRIA 3OG9A 1NONA 1G5FA 3PJGA 1CY4A 2CXHA 1JBEA 1E4EB 1HLFA 1N5MA 1TJYA 3BEOA 5EXDA 3NM6B 4D57A 2I99A 5DLPA 1Q7TA 1E9CA 1N5LA 1PG0A 1PZEA 4RADA 4XFDA 3UAZA 1UJBA 3BGSA 1HETA 3JQAB 3O2SB 2WVAA 3CW9A 2FWNA 2Z2KA 1B8OA 2Z2YA 1I7LA 3CBQA 3ZN2A 5HRAA 3LA8A 2IYPA 1S3IA 3HU5A 2PUJA 4AF7A 1K63A 2JVIA 4N01A 5L3ZA 2ILTA 3S8YA 2Z6UA 1UC5B 2E49A 5JARA 1J6UA 3BXFA 4ZAWA 1TGYA 1KDRA 3B38A 4B8YA 4CJXA 3GGCA 1SHLA 3HBMA 1V43A 3RWOA 4MB2A 4ARAA 3TXYA 3A6JA 5J4YA 4U2FA 5LVAA 1N9GA 4ZJUA 5AI4A 1NR1A 3HCDA 4QOSA 5HBRA 5AR1A 4EELA 1NRIA 1TC1A 1FXWA 1C2YA 2H0AA 4LGYA 2SKCA 3WQBA 4ESEA 2J9ZB 4GPTA 2RHOA 4RHXA 2PGNA 4UU7A 1QZXA 3RVLA 1YMUA 2J45A 5TX7A 3W3AH 4EA6A 3M3PA 2XWPA 1E5LA 1I4OA 5DNWA 3SVZA 4R98A 3OZBA 1XD2B 3AEQA 2FR8A 3LFUA 3UXMA 1E2JA 3PDIB 1RP1A 4CV0A 1BXGB 3OQJA 5C4GB 1H2HA 2ZRPA 1DAHA 3UAVA 1E2PA 1K4MA 3DHWC 1O08A 3I8XA 4XGIA 1XWIA 4BNFA 1IBCA 2YNMA 2NXWA 1VFPA 2C0CA 4HWPA 3O7WA 4TTRA 3UXEA 3OHMA 4F7WA 3K0SA 3BQ9A 3TCKA 2FZWA 5KVQA 2HFKA 3K4PA 1YQQA 1IUPA 4YS6A 1CY0A 1RRVA 1WU7A 4H15A 3U3OA 3RTBA 1U2ZA 3WNZA 3JVDA 5ARCA 4ZA2A 1GG2A 1Y1QA 4QYXA 4Y2GA 3KUKA 5ALFA 3P9ZA 3OCJA 2G09A 4C6SA 4CV1A 2ANCA 4NJMB 1AK9A 2OKCA 2DQYA 5HZHA 1XOIA 2OHOA 4CFYA 2OUKA 3UGQA 3LSYA 1OWOA 1FFXB 2OFPA 2IYEA 4B82A 1SBHA 2IPLA 4HB0A 1CRLA 2WNHA 3W79A 4Z49A 5CLJA 1RKVA 2Y67A 3DUWA 2R7KA 2G67A 4RD0A 5H3LA 4BNLA 1XCGB 1D0SA 2SKDA 4H59A 3VZDA 3ED1A 3HLKA 4TM8A 2Y1EA 5DN9A 5CEJA 2ZB8A 1GAQA 1T5TA 2VNHA 2IZZA 2VWPA 2W22A 3KIPA 4DJTA 1OFUX 2C5EA 4F60A 3QE9Y 1BEEA 2OVFA 3HKEA 4IHAA 2Z3WA 3DBRB 1PDWA 2PBLA 3U4CA 5K8JB 2WM9B 3H8WA 3KZ1E 2XMRA 4FMPA 5JNSA 4U8HA 1SKUA 2I22A 2D7CA 5KTKA 1T91A 2W5UA 3LUGA 3IAXA 3R5SA 3S2GA 4Z3OA 3JZMA 2BFPA 1T4DA 2ECPA 2FPSA 3TQTA 1RI4A 4AKSA 1V16A 3OOWA 1K2VN 1VRVA 1Z6QA 2JI9A 3QXCA 4MWTA 1M76A 2QL7A 2WJJA 3NANA 3BWVA 4WOBA 1DWQA 1E7WA 1T6NA 3NKFA 5CYFA 4ZXFA 3UM9A 4C7XA 5KREA 3QX3A 1RTTA 2CK3D 3OQMA 3ETDA 2NADA 4G0YA 4JCCA 4JT9A 5GY7A 2H29A 4DLSA 1LDBA 4XGKA 5BUQA 2DUWA 3SIPA 4Q1BA 2XNCA 1R9NA 1ZCJA 1K8YB 1GNLA 4MV5A 5DI3B 7MHTA 4UE2A 4ZMSA 1BS1A 3GARA 2OBBA 3GOQA 5G41A 3U9SA 3WY9A 4ZYVA 4QRDA 3HJRA 4EY3A 2NVUB 4NX2A 1EAYA 3ZU2A 1T4GA 3LCMA 1ZRHA 3S1SA 5G0UA 3H84A 4IHJB 2ZEJA 1T4MA 4NE2A 4OMDA 3ECAA 4YAJA 3OQVA 4ALLA 3INRA 4BB9A 1CR6A 4AY4A 1QH8A 3FD8A 3Q7SA 1PNVA 3ZWQA 3JQPA 1UBMS 3WGJA 2JRLA 3TLKA 4DIFA 3DL2A 4Q37A 1PFGA 3G9ZA 1PS9A 3PCXA 4POOA 4YMSA 4UVIA 1GZ6A 3EXEA 2WILA 1QWOA 3KXPA 4Z9FA 3U17A 3M6IA 5LZ4A 1HYHA 3DF7A 3QJGA 1TD1A 4JA2A 4MVJP 4NQZA 2JGEA 4Q4JB 8AT1A 4BVKA 3OCZA 2W8BA 3ESQA 3GMTA 5LU9A 3ND6A 3NHZA 2X5NA 3BQMB 1L4BA 4D26A 2C2XA 4EARA 2W6JD 1G4AE 4LJ6A 2HREA 3OJEA 1U2QA 1PQUA 1CK4A 1N25A 2BISA 4XD7D 3RREA 3SMVA 4BFZA 4F21A 4CPDA 5LQUA 3DO5A 2NAPA 5BSUA 1MRNA 4EDHA 4QT0A 1BDHA 2Q2QA 5ENDA 1T15A 3ZCVA 3HDYA 2ZIEA 4V0LA 4UMEA 2PGJA 4GR4A 5BSMA 3CRRA 4RF3A 2YWFA 3BGDA 4E12A 1TVMA 4L02A 4W8HA 2AI1A 1GADO 3DFZA 3M9WA 1E1LA 1GCGA 3ICOA 4I55F 5IPFA 1JQ3A 2HC9A 5C7YA 1LY1A 1ZJWA 2OC4A 1QDLB 2ZVJA 4JJAA 3ZHOA 5K3DA 3RYCB 3AVVA 2ZWIA 3DAOA 1U1IA 1HTWA 2CJXA 3GT7A 5F1YA 3G8CA 4AJOA 3ZOKA 1QAQA 4DG5A 1MQSA 3C6KA 3T5PA 3AGPA 1DO0A 4GU5A 4C78A 4NCIA 4OKSA 4X8LA 1FS4A 1KI6A 2PXAA 2QJRA 4X93A 1VJ0A 2ECOA 4PN7A 2JAOA 5H4GA 1H69A 4XJXA 4RA9B 3X1MA 1G9SA 2C54A 5IBPA 2I2CA 2QYOA 2XI4A 3FWHA 4N7MA 4TV8B 3SP1A 2OWEA 3G8YA 3KR1A 3R6GA 4G63A 1FQKA 1MJGA 3DWEX 4RYLA 5MF6A 3NMUF 2GLUA 1EJ0A 2JGIA 1DQPA 3VMMA 2B94A 1RHJA 1X94A 2HL6A 3IR5A 4MQEA 4S1NA 4E1AA 1BEUB 4EJSC 1MAAA 4F2HA 4U7FA 1D4ZA 4EW6A 3RPEA 2GN6A 1FSZA 2X6QA 1SHJA 4M9UA 4D3FA 2W58A 3JQGB 5EPUA 2HA5A 2ZU0C 4P08A 1RJDA 5DISB 3ZE1B 3HU2A 1E2UA 2AF3C 4P3XA 1E1YA 1FYWA 2B35A 3I6YA 2A2ZA 5IX8A 2VHCA 1GUZA 1KFJB 2ZLBA 4P0TA 4TLLB 4HX5A 2HJ9A 3O84A 4MV7A 4ZVMA 1TTQB 3D6NB 4O4LA 5B1HA 1UBHS 1EBUA 4S1WA 4BQQA 2HUPA 3EGCA 3KBBA 3HVRA 4HRAA 4MW1A 4F1JA 3DV0B 3LX5A 4CL3A 4B45A 3LGXA 2WSSD 5AKJA 3V1LA 4YAIA 2DMRA 2J5RA 4GIBA 5FJIA 1A9OA 4UOEA 1CQPA 1FX0B 3OM0A 5AW7A 5JMWA 3KEGA 3KE9A 3L4BC 4TYYA 2WHXA 1Q74A 3RRJA 1Z56C 2VHTA 3ZD9A 1L4YA 2OPHA 2BYTA 1ZOPA 1N36B 3PICA 4KR6A 3TNFA 4L27A 1ZH6A 2X7JA 4EA7A 4GX0A 2ZRBA 4X3PA 1JYFA 1WZ2A 2RGBA 3DP9A 2J9RA 2ZRDA 2B5OA 2PNJA 3E7PA 3A6GA 1S5PA 2Q4RA 1NLZA 2BEWA 3VVLA 1KDPA 1TQ6A 4S1OA 3CGWA 2FYTA 1X3LA 1DG9A 2VYCA 4FX2A 3ZEIA 1D1SA 4ZCSA 3Q85A 3RGWS 3A04A 4BZXA 1RAIA 3D8NA 1ZJYA 2ZUCA 1RI2A 1XG5A 1Z4KA 3FZGA 1N5RA 2L19A 3T3EA 3K70D 2B61A 1ILEA 3BVPA 4R1TA 4B31A 1GQFA 2CD7A 4DR2B 2CE2X 2ZTVA 2A9VA 4O2LA 3KT6A 3VPAA 4N0DA 1DWOA 4LYDA 3ZVRA 3OHSX 4ALNA 4OKIA 4HC4A 2PBZA 4HGOA 3HEBA 5F4BA 4DCNA 3R1IA 3L04A 3U3ZA 3MB8A 4MQMA 4RH1A 1ZNZA 5AJYA 2XUZA 3M49A 4OSOA 4ANFA 5IKMA 1D6JA 2CCGA 2OGTA 2B37A 2RHJA 4KN8A 1Z2PX 2J3MA 4RANA 1WMSA 4G0XA 2GJAA 4L72A 2WJWA 1DSSG 3QXXA 4ENVA 1M0TA 3SHQA 2JA1A 2ZSUA 1A95A 1K5PA 4KO2S 4OQPA 4P2BA 4DQ0A 4P81A 2JFVA 1UDXA 2YASA 1Z5OA 3L0SA 1Y9EA 2JFXA 5C31A 4AUEA 4DB2A 3VGJA 1WZCA 3KSMA 1HY3A 2JCGA 1J2JA 2YOGA 2WWTA 3I9OA 3LPCA 3P0EA 4KBGA 4H4DA 6REQA 2A1UB 3SAJA 5I9TA 1CJBA 3L46A 1H6DA 1W35A 1WXGA 3B9PA 3R7WB 1XEWX 1A8UA 3OTHA 3NVKI 5AUPB 5I01A 3GCXA 4M0PA 4DDMA 1J0DA 4X7RA 2D00A 4KPUA 1V6SA 2QZJA 1NR5A 2TSYB 4K26A 4LTNA 2Q7DA 4CTJA 3A2KA 3E58A 2I03A 3OZ7A 4AY5A 1EHCA 3FNFA 5GPBA 4FLEA 5ULLA 4HVAA 3DDUA 4YHBA 1XJCA 1JDTA 1SQSA 5DYTA 1EFCA 2W48A 3PQDA 2BMWA 2VP4A 1R4NB 2WB2A 2PJRA 3ZJ5A 1TCCA 4ND8A 3WLKX 2X0KA 4HQRA 1ZOOA 2AFHE 2Q8PA 4JAVC 2VKTA 1BKSB 2COUA 3GBSA 4ZI5A 3W1EA 4I4CA 4Z3DA 4CV2A 3LY5A 2AXEA 1VPWA 1LZLA 4JYCA 1DKNA 4HD8A 2GKOA 4HN4B 4H77A 3ZCPA 1C81A 3CJTA 3F96A 3V1MA 1YD7A 3CINA 1XCOA 3GUCA 3KQYA 5AKEA 4AO6A 4DTCA 1T2NA 5AKIA 4KBFA 4XVHA 4C1BA 2XTMA 1L8XA 5JTTA 2XYVA 1EFTA 3NALA 4KU4A 2OXIA 3REGA 5FXMA 4QVKA 3RVSA 5KOHB 2H7XA 3BFPA 2P90A 4YJFA 3N07A 2JI4A 2BZ1A 3QKRA 4PRZA 5JOQA 4P7JA 3AF6A 2GILA 2WJPA 1XWWA 1X1SA 3S44A 3SF0A 2GX6A 3JQ9C 3QVJA 4RDXA 1W34A 3ORRA 3PQ5A 4H7DA 3ZK8A 1BMFD 2AG8A 1TT7A 2EF0A 5TC4A 1KFEB 1CR2A 3QU9A 1A9QA 2ZRAA 4MPPA 5EEHA 3TLZA 3W1VA 4HBGA 2O7VA 2B98A 4AMYA 5EJ8A 1YZQA 4TYWA 3LL4A 5EJ5A 1CUWA 2Q6IA 3VVMA 5C2JB 3N8KA 4EL5A 3TBFA 4LGCA 4L5JA 1EVIA 2QPAA 4P7FA 5ITWA 4W9NA 3E22B 4QGBA 1W94A 1BSVA 1VMEA 3CRW1 2O0LA 3CURA 2XNSA 4FFVA 3ZDCA 1XDBA 3JQDA 1Y1LA 2Q9UA 3Q8WA 3RYHB 2C9DA 2ZANA 2ODWA 4LRXA 5IAKA 3GN1A 3V8PA 4ZDJA 5E3JA 1GTL1 1VE3A 4JXKA 3F7NA 2YJ5A 3NEYA 2FEMA 4OUDB 2H4JA 1BNCA 2ACVA 4EVRA 1P5ZB 3REFA 2Q1TA 4MW6A 3DP7A 2C00A 1E5VA 3WS7A 1MH1A 4QIHA 3KOXA 4CM6A 5IW8A 4A15A 1E3JA 1QYXA 4FYYA 4QU5A 3GWZA 4KXYA 1HMPA 1JBKA 2IKSA 2JAUA 3NP7A 3Q8LA 3I64A 3ROGA 4WNIA 3K16A 3GJSA 3MJEA 4Y6SA 2ZYGA 1Y1SA 1MJNA 1BWPA 1U98A 2E4XA 3K6JA 2HNKA 4TS4A 4WK2B 4BVGA 2ORVA 2QT9A 1Z4PX 1PUXA 4JBGA 5G02A 3W4IA 4OM8A 2RHHA 3VOBA 1WDTA 4C04A 4DV2B 4E7PA 2C4VA 4M9RA 4PV7A 4BWVA 5KX5A 5A3SA 1PDVA 3BTOA 2PRYA 4AUMA 1KE2A 1KSJA 1WUIS 3G85A 3NGXA 4LRYA 4DYHA 5BVGA 5LWQA 1HQCA 4X85A 5CNMA 4A1FA 4JX8A 1EHYA 1X7XB 2VYNA 3N2GB 1W4BA 5IMBA 1XHFA 4RK4A 2GBGA 5IVDA 3ZIAD 1SY7A 4EKIA 5JU6A 1L5RA 5K3BA 1O57A 4FX5A 2CLIB 4NBUA 4QO8A 2PZLA 3YASA 2RSLA 1ITZA 5DHAA 1L3IA 4TKVB 1YGYA 3WJAA 4DCMA 3CTMA 2CDCA 4S35A 4U8GA 3SSNA 3PX3A 2YIVX 4Q15A 3SGLA 3VJRA 3F6PA 1GKKA 1P7ZA 3FZQA 1D2NA 1OXTA 1F2UB 3V2UA 2AZXA 3EVNA 4PAWA 1W5AA 5G0VA 3HHPA 3IBYA 4O4HB 4EA8A 1WP4A 1HMYA 1GZSA 1Q83A 2QSYA 3MT8A 4LHEA 3KU4A 3I34X 1V8PA 3ETNA 4LEIA 5CIWA 1SKBA 2JK1A 2Z9CA 1BROA 3CNHA 2J48A 3ZKAA 2I4MA 2XCUA 1SXHA 4CKYA 4NCAA 4UAUA 5BMVA 4NXNB 1W1UA 4KREA 1QRDA 1JPNA 1XXHB 1UDBA 1I4LD 1SBNE 1RHKA 2DUJA 1CDOA 2OOKA 1EFLA 3GA5A 4HWTA 3DEKA 3ZHQA 4DVJA 1JG7A 3BMNB 1RYYA 2CKDA 4GDFA 1GCAA 1UFRA 3O3OB 3SXUB 4EB6B 4BN0A 1BGXT 1LK0A 3D5QA 3QG1A 4A8JB 4GNKA 5KQSA 3FF1A 4A8HA 3RH0A 4DMHA 2FZKA 4EFMA 5KTOA 3ORSA 3LXUX 2JGLA 4U7DA 5IJ9A 3E8MA 4Q00A 1M8KA 2AUNA 1IBLB 3A6DA 5NLLA 3E81A 3LT2A 1WQ1R 2PLRA 2PZKA 2HI0A 5AUQA 1G42A 5TGTA 1YRHA 4Y2HA 3AY6A 2VXBA 1P6QA 1Y34E 2H2GA 1FTQA 3MINA 4KJXA 1YIAA 3TAXA 4LXGA 4H7PA 3WWDA 2YFHA 3PVCA 3ESYA 3P2OA 3SBXA 4CGYA 4D9IA 5HQ3A 4H16A 1RZRA 3FSGD 2CVZA 4ATNA 5JJKA 2M9MA 2NZJA 2X9QA 4ZKDA 2NT3A 4BFSA 1THZA 3MMNA 1ZI9A 4GOKA 4CUJA 4Z9XA 3U5TA 2DF8A 2V59A 3GD5A 3WWEA 2H54A 1C7JA 4MDYA 4ND5A 4OAQA 2D7JA 2G76A 4XQGA 1T3LA 4PONA 5FR2A 4ZVPA 4MICA 3T61A 4R8LA 1N2EA 2B69A 4QQ8A 4CF3A 4BMDA 2QYTA 1VZ2A 3LM8A 3TPCA 2IVZA 3E61A 4UXHA 1RHUA 4AL4A 2ZE7A 4H6WA 4YIHA 3NV7A 3KZNA 4BJ5A 4BVBA 1WR8A 4C5AA 2DR0A 2D7DA 3TFWA 4LSWA 1Y7IA 3FNQA 2JB9A 3H3FA 4AWBA 1P5HA 2NYVA 4ZO8A 1A4UA 2GCPA 4MA4A 1K5GA 2I1QA 4GW3A 1EK2A 3EYAA 4KNVA 3VU0A 3MHTA 3AOGA 4NCJA 1OX5A 4MRPA 5JIBA 3QTBA 1OX4A 2C8VA 1J2EA 1DAIA 3C3BA 5E8JA 3VA7A 1X13A 1UZMA 4KQGA 3T3PB 1ZHOA 2RH9B 3M6UA 3JSAA 3BGVA 3HR4A 4E5KA 2O3JA 2PPVA 1TQ8A 4N82A 4R9RA 1GFIA 3IAAA 3EEYA 5K6AC 4YT5A 1KZ1A 4FINA 2IH2A 4J0QA 2NZWA 4EMUA 1GKIA 2I54A 4YP0A 4JEIA 4ND3A 1PJBA 4FYWA 3A3YA 2XPCA 5B58T 2FLVA 4CQLA 3P4XA 2WHPA 3KYCB 4WOJA 5IAAA 3EPKA 5BP7A 2XE4A 3FNRA 3ZEAA 1P1JA 2DVMA 2WD9A 2H9AA 2YW2A 2X0FA 4MWOA 4KXQA 1S0UA 1UJNA 3EJWA 3HJBA 4AJKA 5KYYA 5A0TA 1YULA 1OH6A 2XWBF 1JSRA 2HLDD 3RSGA 3PTAA 5L3SA 1YTUA 1T36B 4PTLA 1QH9A 4IH4A 1ZMRA 2CLDX 2FSUA 2DY0A 4KIGA 1FDIA 3OE7D 3PGLA 3O9ZA 1QCYA 3H2SA 3FTFA 1ZBQA 2Q9BA 2PWBA 1CHDA 4V0KA 3TIFA 2PQ0A 1R15A 3GMIA 3QYAA 1PR6A 3CVWA 3HP4A 2P75A 1KZHA 3VR2A 3HVUA 1HR0B 1KO1A 2YQ4A 3ECCA 2HEIA 2MSDB 4LV8B 3S28A 4MGHA 5LL6P 3K5PA 1F20A 3VMFA 1FW8A 5JW6A 4TOIA 5IVKA 1SU8A 1WY7A 4H0CA 4Q6BA 1VJTA 2VN8A 3W9YA 3NBKA 3OOEA 1E7QA 4KN9S 5K0ZA 1I6LA 2ZJ4A 1BO6A 1MRSA 4B4VA 3B6JA 1QLHA 1KZGB 1E4YA 3BRWA 3MLEA 3OPYA 1FU8A 3IELA 3LHKA 4FLFA 4GOLD 4JLWA 1U4OA 2ZDQA 3P0IA 5CH5A 2OO3A 3K0AB 1E5TA 3C8DA 1DOZA 3EXHC 2FWPA 5EI5A 3OU2A 4PFSA 4A2PA 1U8AA 2JJYA 5CD1A 2BEUA 1YCHA 4HMOA 2WHYA 4J7UA 4H7IA 4OJQA 3VDXA 3KD3A 1WKBA 3FA2A 10MHA 1JTVA 1Y5LA 5JS2A 4HDSB 2P9FA 4NXMB 3WTCA 3R20A 4FQ7A 2BFWA 2OK7A 2UYGA 2F55A 2X3FA 3JYOA 2B1JA 3U7RA 3ZVNA 3UH1A 1CQJA 3E05A 3ZS8A 4LC1A 4BAGA 4BJ1A 2B78A 1AIPA 1ND5A 1P7VA 2GEUA 3U4QA 4HQOA 1QTNA 1J0BA 1PJQA 1QVZA 5DHSA 2QX6A 4G8DA 2HAEA 3KHUA 4FZVA 3RVDA 4ALJA 4AYWA 5BT8A 4KWIA 3D4PA 2B4AA 1OFHA 3GCWA 3IDFA 1B2LA 2R79A 3FUVA 1QV9A 1HE3A 1IPHA 1WLSA 3GZNA 4PRLA 4D43A 3AEYA 3EA4A 1E59A 1W9HA 4N65A 4P34A 4KYVA 4OAOA 4LISA 5DOVA 1JHVA 3TG8A 5K4AA 3NIDB 2O0KA 3L1KA 4GGPA 3UPUA 2GEKA 3ZLVA 1G2QA 3ZXXA 5EZYA 1GQ2A 4DQXA 2RHGB 4DJDC 1EG2A 4ENWA 4NU0A 4B3MB 4BEJA 2MSCB 2IUTA 3OPNA 1M72A 4PHFA 4G0QA 4C7MA 3IEMA 2W0SA 3ADDA 3SQLA 1E99A 5C8VA 4LMAA 3UV7A 1NVAA 4MR9A 4F84A 1QYWA 5FI1B 4DGSA 4EGAA 4YMUA 3KAQA 4UU8A 1CUCA 1YB6A 4QA9A 1COZA 3WP1B 2NVBA 2PANA 3H1TA 2O0JA 5FFNA 3QA9A 2AI3A 1B73A 4RVDA 3VPSA 1XWFA 2G5CA 3ZG6A 1CE8A 4ETMA 5KNBD 1U1FA 1HSOA 2XVMA 4QYIB 5BQ3A 1PUJA 2BE7A 3DKKA 1U2DA 2HMTA 1W4AA 2XSZA 2YY7A 3HQ4O 2O20A 3K3PA 1RWMA 2W43A 1OB2A 1Q3HA 3HXLA 2WMNB 1Q7EA 1HTTA 2QLNA 2O5CA 1E98A 5FF9A 2CV0A 4TMKA 5ARDA 1DXQA 4H4CA 3PUZA 2HWXA 1DXOA 4PFKA 1QZ3A 3PR2B 2CY0A 1ISSA 3P20A 4IIJF 1WUJS 1GUBA 1RWKA 2BR3A 3OJLA 1UPFA 2R2GA 1YS9A 4LOHA 4WOCA 3ZE8A 4MGYR 4MR7A 1ZMBA 1QRTA 1YR8A 2ZJ1A 4QC2A 1VA5A 2XEXA 3B1FA 4FDUA 5C5DA 1V1RB 2IDJA 4L4XA 5E1MA 4YB8A 1QIDA 4C3UA 1V7QA 3VXKA 2QRVA 4HLUC 1O5OA 4X90A 1QONA 4TPKA 1ZPDA 2RCNA 1OJLA 1W76A 3ABIA 4RMGA 4BC1A 3LRXA 1ZA2A 3ZGVA 2MT9A 2IUYA 5ICEA 4GZ3A 3BMXA 4A0QA 1OBOA 3QU5A 2PE5A 4GPZA 2O0HA 3PNMA 3LI2A 3WV4A 4MLZA 1H2YA 3VPXA 4LJSA 3ZXYA 2IDMA 4BMZA 4TKLA 3MRSA 4D98A 2HO5A 4MYUA 4G84A 3TAHA 1RM5A 5K99A 1F1BA 1OH5A 2KM1A 4TYNA 4JP1A 5EE0A 3BG5A 3NTVA 3ZGYA 4FE3A 2RGDA 2AG5A 3EOZA 4MZXA 4YYZA 2OO5A 1X7GA 2ZSIA 3GPBA 3M81A 3NIFB 3HSYA 5EKDA 3V7UA 4X1KB 4AS3A 5LQRA 1DTSA 1NC3A 3EC1A 5GZ6A 5TXGA 4B6SA 3AM3A 1X1TA 2OK8A 1KR2A 1WULS 3QW4B 1SULA 3T1HB 5EZ6B 3HYTA 4PZ0A 1ZG3A 4REQA 1IULA 4N8DA 4RX1A 2EQBA 1CUBA 4M0EA 2BRUC 4N5IX 4N9WA 4XDGA 4GL2A 2BGTA 3FRJA 2QP4A 1IXYA 4WESA 1VCHA 3CW8X 3PC3A 1P80A 4K9MA 5H16A 3CX8A 3T34A 3ZE0B 1U04A 3CZ4A 4RKWA 2R5WA 3KSZO 4W1RA 1WXDA 5L6LB 4NV1A 2PX0A 5EJFA 2R4TA 3T3HA 4NONA 5AUOB 3R5JA 4JODA 2UUBB 1JL3A 5E4JA 4Y7DA 1CR1A 4WJKB 3OO1A 1QGYA 4PNHA 4I6GA 4IIXA 1ZVVA 4HUQB 4FEGA 1E9EA 3DYBA 1AKRA 1RPTA 1V3VA 3Q9UA 4G8JA 3VU3A 2V7EA 1PT6A 2OBLA 2XTJA 4IDQA 4KTTE 5IN5A 4DR6B 1NX6A 5CM8B 2Q5IA 4O4IA 5DYNA 1XLTC 4I4TF 1YNSA 3C8ZA 4IDOA 3M4NA 2HJHA 3NOOA 4WCFC 4DGQA 3BJZA 5BN3A 2BY4A 2YHIA 5BXYA 4QASA 4CKZA 5TS3A 2R7LA 4NZMA 3A1DA 1KJNA 3AERB 3QLTA 5GVSA 1SPXA 1WD7A 2DLDA 2CLCX 2IELA 2O0MA 3K20A 2ZI3A 4DLBA 3ILVA 3NIWA 3OPVA 2HWKA 1F2TA 5CVCA 3NBAA 3KPUA 2JGKA 3JWGA 3NVMB 1TNDA 1IN5A 3BH7A 1SC3A 4TV9A 4RXMA 2YNMD 3E70C 5BRNA 1CJKC 1CNMA 1KORA 5IM5A 4K9DA 2D8AA 3ENKA 4OHWA 1GL3A 3HCWA 3BE5A 3WRXC 3FPBA 3RJTA 2AK3A 3LCRA 1J23A 4I36A 4NU8X 2YRWA 1D03A 3NC0C 3PR3A 4A0HA 1CP3A 3U5ZB 3WB9A 5JFGA 2AN5A 4GMFA 3LY7A 4TRJA 4GLBA 3A4TA 1XQYA 1OQAA 1L7DA 2Q6OA 4GVXA 2WJIA 1XVLA 1A9TA 1SRRA 2AMYA 1AY0A 2A33A 1BE1A 1ZCBA 4UUMA 4WNCA 5DGIA 1EJ2A 2P78A 3HUEA 3N28A 4YPFA 1KEWA 1F8XA 1RS0A 3F78A 3VV3A 2QR2A 4MPDA 2ZIGA 1NI4A 3DXFA 5CT5A 1AT1A 2NPIA 2O8CA 2BJWA 2NO4A 3BGIA 5LZ2A 1GEEA 1W29A 4ZTZB 5JSKA 1U8YA 2VWGA 1J8YF 4HGRA 3TLBA 5J2UF 1VHJA 1ZN8A 3MJCA 3NBMA 4MQFB 1A1SA 2HJSA 4Z4QA 1P7WA 1CJSA 5L4NA 1PYDA 3BJEA 1QH0A 3AI3A 3BMOA 3C5WP 1XDUA 2NTJA 4F6CA 4EOGA 3PNBA 1YB2A 2L2QA 4P86A 5AQ1A 4A16A 3KBOA 2GKSA 5BUCA 4PO9A 1C9YA 4J7CA 4ZAFA 2X40A 4YTEA 1KARA 3ST7A 3SY8A 1LPBB 1MA3A 4W6QA 4EB0A 3GRVA 1JRLA 2BDEA 4L76A 1HYEA 1O1YA 2DSNA 4FFLA 2OXFA 1X1EA 3C3MA 3MGAA 3JPYA 1JDSA 1Q1EA 4K9QA 5AQEA 1JVSA 3A3OA 3WZ2A 4XLTA 3HFGA 3FYHA 3HVHA 4F93B 1W93A 4CN9A 3UCEA 2BEVA 3L84A 2BGJA 2XYHA 3ZC3A 3OIGA 4AXBA 1EGMB 4NCXA 1Q15A 1TE2A 1UMDB 4TQUS 1ZITA 3OZIA 1UIMA 4HDCA 4YUWA 2B99A 2BHRA 4Z51A 5KSOA 1IBMB 2OGZA 3HHEA 1EGAA 4JLNA 4M0LA 4PZAA 1JFFB 1QHEA 2PN1A 2QD1A 2XZLA 5K0JA 1J49A 4J90A 4WOKA 4ZP1A 1Y1PA 2C3OA 4NTZA 5HIIA 3OLZA 3GFSA 2Z5LA 3MPOA 4KQCA 2YWBA 3E9MA 4H17A 4LZNA 5I3ZA 3KQQA 2PR2A 2YZKA 1D09A 2BGIA 3UB4A 3GQVA 2ZRGA 5LN1A 5LR6A 4DT1A 1NVTA 2FRVA 3QITA 1Z5WA 3FWZA 2ZT5A 3IUBA 4XIYA 3GAFA 2J0UB 3U40A 5JCPA 3LWDA 1XZNA 2I29A 3BXOA 1MO3A 2PFKA 3B70A 3VM6A 1JG6A 1V5GA 1JJBA 1T4CB 2IZ5A 3MCUA 2V3WA 4Q3OA 3GEPA 5BO5A 2JGDA 3A1FA 4XJTA 4AZWA 1RRKA 4IXTA 3LVRE 5A6VA 5FB3A 1AS3A 2HYDA 1XEFA 3MTQA 4GEGA 4PO3X 1WF3A 4EM6A 2Z83A 3EJ6A 3IDAA 1KXJA 2GLXA 3OD1A 5IFKA 3FYUB 1K97A 4PX9A 1HZZC 1SVIA 2NUTA 3VR5A 2QW8A 3RWMB 3GJYA 4BB0A 4LTMA 1JIKA 3JQQA 1QG0A 3IP8A 4NE9A 3RRMA 2DECA 3E53A 4F1WA 3BE8A 2FPOA 1JHAA 1CDDA 3VKWA 1O9HA 1LF0A 4HGNA 3NQ41 3H5OA 1A5TA 1DBRA 4OJMX 5EZ5A 4GPEA 1A8SA 4JB8A 1IU9A 4M9QA 3TZCA 3FVVA 4B4UA 5JZBA 1SVOA 4NATA 4EO9A 3R9XB 2O2HA 3HN7A 3L18A 3B48A 2YXNA 3GFTA 2BUBA 4JI3B 5HGJA 4EPYA 1UAAA 1Q0PA 3K1JA 4LQ4A 5ECGC 5HIAA 4ND7A 1YVPA 3ZVKA 4MX8A 1HYGA 3RT1A 5BWLA 1F60A 2Y99A 3FCOA 2FR1A 5L6MB 3R3VA 3R74A 1N6NA 4QTUB 4MVWA 2XGSA 4IGFA 4QUJA 3UMJA 3WYBA 1Q50A 3TQQA 4RJLA 4HDAA 3ZE2B 4B4OA 3F0TA 1DP4A 2XXAB 5HE8A 4ZVUA 1XTJA 4BUZA 1O3YA 3MQ2A 5FI5A 3VR3D 2D62A 2HR1A 4RENA 3TOVA 2NXJA 2VBIA 3DDCA 4LV5B 5AW6A 3TW8B 3THXB 2UVPB 3CCFA 3PDHA 5JAZA 1V11A 1L5ZA 5IXYA 1BE6A 1IG0A 5FTWA 4ZV7A 1SVMA 1Y8QA 3ZLTA 1JECA 1R5OA 2FEPA 1L8AA 4IH9A 4MQBA 2VBCA 4CKBA 2PRKA 1Z5PA 4B3TB 3L43A 4FFRA 1X9IA 4AJEA 4F46A 3I23A 3OZDA 5JNLA 3Q6IA 4EUNA 4LCJA 1A9XA 1WCIA 4CQNA 3KG2A 4ZHQA 2D74A 1U31A 3TNYA 3W6OA 5DK4A 3I2HA 4DA6A 4OPMA 1C4KA 2R96A 4O2RA 1YFLA 1P6XA 2EJBA 2CDBA 2XB9A 2J9GA 3OQIA 4RHCA 7AT1A 3MTIA 3O4FA 2X77A 5U1PA 4BWFB 4XVUA 1QGUA 3DDSA 4MAMA 4JYAB 1O54A 2ZJBA 3RWBA 1UINA 4J9VA 5C18A 5BSEA 5BSHA 1HG0A 4WASA 3ADCA 2D59A 3DHYA 3IJEB 3BK2A 3VDRA 3RC3A 4QDJA 2HQSA 3DOOA 3N2KA 3ZD8A 4I4LA 1PKXA 4KDCA 4DSNA 2OZKA 2HK6A 3UAOA 2ZBEA 2XX3A 2XLBA 4E51A 4I1PA 2JEZA 3AKYA 5JYCA 5EJ2A 2XODA 4M0MA 1MKYA 2GM5A 2GTIA 2Q6VA 3CU5A 3MS2A 1OVMA 2WZQA 3NNDA 3OC0A 5K6TA 2IHNA 1R50A 2G83A 3Q7RA 3EIFA 5JYDA 2Z2IA 3NHFA 4LFBB 1M8JA 2LKDA 5K7SA 4JP2A 2ST1A 5JE8A 2Y1WA 4WKBA 1NYRA 5TPWA 1R16A 3NM5A 3OT1A 5DLQC 1KDYA 1KQOA 2NPFA 2QI9C 1X9HA 2C4KA 2IYWA 2RH8A 4DBLE 1D0IA 2CFSA 3L2OB 3QE2A 1CUSA 1DRWA 2NNWB 3IQFA 2CLMB 3TYXA 3LYLA 2QPOA 3BGOS 2BZSA 1YA4A 3TPZA 3VJKA 2CXQA 3GJ3A 5JMPA 2VYQA 1KVUA 3JRNA 4PY2A 5A71A 3DSRA 3KWLA 3ANYB 2P35A 4EI8A 4ZOQI 5KVVA 3D5EA 1GTRA 4Y7CA 1C1YA 5J1TB 3KJGA 3E9RA 1RADA 3FNGA 4R2KA 5HCNA 4KK4A 1JA1A 1DTEA 1VBMA 1OYVA 2VTDA 5BQXA 5EGSA 4DIKA 1Q7GA 4ZAGA 1XAHA 4YDQA 3FPSA 3MCAA 4FZJA 3GJZA 4REMA 3C43A 1SUBA 1T9GS 3SJCA 1O4WA 2M1ZA 5IJAA 2YUIA 3H2GA 4OXQA 1LLDA 3ZBTA 4C20A 5HUQA 3OMWA 1TYZA 3FBGA 4DPKA 1XRPA 5I8ZA 4Y0NA 4CTNA 3DFKA 4U7HA 4OGFA 3D8BA 1QIJA 2GBIA 1X7HA 2J7PA 4CDRA 1CUAA 2MHCA 3ZZTA 1XL1A 1IXSB 1FSGA 1TK3A 3WLTA 3ZWBA 3GJQA 1NZJA 2F1OA 2NV6A 1VG0B 5LJIA 1QPZA 3BWEA 3IUYA 1KI4A 2C82A 4ZOLF 3HMQA 1NVXQ 1THMA 4A91A 4N9QA 4CQMA 4BLPA 2WRZA 2GA9A 1P5RA 1W36B 5FPQA 1COWA 3H1EA 4LK2A 5EHXA 2YXEA 2VXOA 1OH7A 3TDMA 4Y6PA 3R0XA 3G3EA 3MCVA 3HDGA 1I24A 3EEIA 2G9VA 2YQ5A 5F7ZA 3K35A 4C9BA 2DUNA 4RZQA 3T4UA 4HAWA 4WXEA 5KX5F 1QMGA 1ISHA 3PDIA 3SYMA 1K0FA 2JCYA 4TKUB 3IX7A 2C2KA 2WUWE 4IM7A 3RU2A 4HTFA 3VOTA 3VC7A 2V74B 4Y2JA 1OI7A 5FT9A 1LCIA 2VJKA 5KKAA 4PCAA 3E15A 5MFPA 3PD0A 2ZUBA 5JLJA 3MWDA 3U13A 4AU1A 4URVR 2FEAA 2H8GA 2WHRA 1C7IA 3IPAA 3QUAA 4WV3A 1GPKA 1M34B 1NKVA 3A9UA 1S1CA 1V5FA 4IVRA 5EP3A 2G0TA 2WZBA 2C2YA 3KJZA 1DOHA 3B5IA 1RI1A 4R9UC 3LXRA 4WLNA 3DWIA 3EUFA 4LBWA 2FB9A 3GRAA 5KTRA 2H2DA 1UANA 5HSGA 1AQNA 1QS0A 1FDSA 2BSXA 3LLVA 1RP7A 3KKMA 5C32A 2PAAA 5KI6A 4P4SA 3RFXA 2GLTA 1M8FA 4LXHA 1EG7A 1USUA 4CETA 1PGJA 2K7ZA 2W0MA 2Z2XA 4K0RA 1X7YB 2GS9A 3PKZA 5LDGA 5BMVF 1EFPB 5JI2E 3JYPA 3PI6A 1KWGA 4LZOA 3S2IA 3WGKA 4E14A 1T2DA 1FNMA 4QOGA 4YRSA 2WDZA 4MVYA 4OGLA 4YRZA 3H11A 1YZYA 1R0YA 2JBAB 2OWDA 3MJHA 4QU0A 3U3DA 1FFGA 3NHYA 4IGKA 1NN1A 2BT4A 3IOYA 1STOA 4M1ZA 5IAGA 4HVLA 2OBXA 1E3TA 3I9FA 1H1LA 2EL7A 3NTLA 4E4TA 5FBHA 1EE9A 3SBDA 4J1NA 3E9EA 1ZIDA 3BTSA 3HBNA 3OBIA 1FJXA 3R75A 5BWMA 2CCJA 3QMWA 4Y2VA 2OCYC 1XA4A 4LJ9A 3L7NA 3TB6A 2ATEA 4A8TA 4F2DA 5LZ9A 5T67A 3CEAA 1HV8A 2QX4A 3EAQA 1I2ZA 3RK1A 1K8RA 2IEAA 4DKXA 3D8RA 4O3FA 3K0CC 4KWHA 1OX6A 2EQ5A 4WERA 5KMGB 4D44A 1ANKA 2IU6A 1RXWA 3W04A 5LNK6 2PH1A 3TTSA 4M3NA 4JXXA 4HNHA 2VHVA 5B2ZA 4AQYB 2XMCA 3FPEA 5CD9A 5I7WA 1X9GA 5L3RA 5F76A 3RC9A 4F85A 1M1UA 1DELA 1WCV1 2QI9F 4NBSA 4OAPA 1RTKA 4ZICA 3VTZA 1YIOA 2P40A 2XB4A 1RMTA 4X7BA 4RTQA 1WB4A 1Z17A 1FRFS 2PRZA 1BVYF 4PLPA 4RO0A 1W1WA 4BV8A 4YCSA 1POXA 2BI8A 4IEEA 3WL5A 5A5FA 1AVTA 1AGPA 1NW7A 2LKCA 2Q9CA 3ANSA 3TIXB 4D4JA 4Z99A 1BHSA 1G20A 1C9EA 2HSGA 4NMXB 1NWCA 2B8EA 3F6BX 3QFSA 1OLUB 1YI8A 1AQLA 1ST3A 4FMCB 4N7BA 3ETEA 4PGMA 4MZDA 3G6WA 3NOVA 3BERA 1QF6A 2Z8XA 3X0DA 1G98A 1L4NA 2IE0A 5H02A 4ITRC 5JQGF 2H1WA 4MO2A 3K6SA 4P4UA 1XPUA 1JFVA 1KRXA 1EDDA 2KYRA 2AOTB 3KTDA 5H8WA 2EF1A 4KDFA 1G1MA 3RYIA 7YASA 3U3MA 3EXG1 3AF0A 2JLYA 1NBOA 1E8MA 1IH8A 1TEHA 1UQUA 4L5AA 4MPRA 4PYQA 3WGGA 5BNWA 2B0JA 3DHEA 4QX6A 4BCDA 4MRMB 3VKGA 2P7IA 1XUOA 4AY3A 3IVMA 1YDWA 2ET6A 4L0CA 4L9RA 1AXGA 1LPNA 2EFDB 4O33A 4WLOA 1NNSA 3HB7A 3NDPA 4ZVRA 3RUEA 4BBAA 1FTGA 2IU0A 3HCCA 1JKIA 4WUVA 3FUCA 3SC6A 4LHSA 3H5VA 4RSMA 1GRCA 4DDUA 1DRUA 1GKYA 4JN6B 2C7RA 1V39A 3S8MA 4KRYA 2ZBGA 2N1BA 4H1WA 1E6WA 3WDKA 1GDTA 3EODA 3ACBA 3OJXA 3ABOB 4RA9A 2QP9X 1VRCA 4X3CA 5F12A 3BDVA 3V8MA 3G5UA 2DUUA 5KWIA 2WA2A 1I1NA 4EO7A 4ACBA 1RJWA 4MUIA 4MTLA 1RC1A 4RY2A 3AY0A 4TWIA 1CUZA 2GAIA 1C7ZA 1HFKA 4OU5A 3RBZA 3SEQA 2Y8EA 4AIIA 2YKGA 3U0VA 5CMLA 1FU4A 3WGYA 5CJJA 4JUCA 5DSZA 3DG9A 3I9V1 1RZRD 3SBEA 5LOVB 2QPTA 4ZFNA 3MB5A 1ZIYA 4JA0A 5EQDA 3QHAA 1DXHA 4KPEC 1NBWB 2J5QA 3FUWA 4BOYA 4Z4GA 1IXZA 4G2NA 4K86A 2GWHA 3QU4A 4IY1A 1RBMA 1YJ5A 1M2HA 1PEDA 5T7BA 1OIVA 4GR9A 5DJ5A 4AMZA 1EINA 1XFAA 1ZBDA 2BBOA 4PPFA 1PQ4A 1V95A 2EOAA 3EGEA 4QXPA 2J67A 4WKPA 4EG7A 2WF6A 3GT3A 5H9WA 1AKNA 2VR1A 1XZPA 1J39A 1GPYA 1OROA 4DV5B 1F4LA 1VLVA 1WBDA 3AR7A 4DQKA 3ER6A 2P11A 1QR6A 3TBKA 3SI7A 1RLOA 1LDYA 1GIAA 4BRUA 4XZ3A 1XVUA 2FTKE 4NFSA 4I50F 4K46A 4XX0A 4ZV4A 4RULA 1JWAB 3W3AD 1IN8A 4WWHA 2WJVA 1W7AA 4QDKA 1ZIXA 3A2NA 2XV1A 1SUEA 4ZQFA 4Q1FA 3LO8A 4ISCA 3FCYA 5EXXA 4X0EA 2UUPA 1UAYA 2HMAA 2WIFA 2VJNA 1AKYA 1RE1A 1H5NA 2Y77A 3LGSA 3MUFA 4FR0A 4RL6A 2QMHA 4KQ9A 2Q50A 3WJ2A 1TAQA 3ELUA 3KZOA 1IUKA 1FA9A 1Z08A 2K2QB 4M9XA 4RV9A 4W5HA 3L7IA 1W2HA 3K4HA 1Z73A 1CNEA 2WJ4A 1YZTA 2WZDA 3UVEA 1C1DA 4PYJA 3QVGB 4X20A 4RTLA 1Q0ZA 3BX1A 3KXLA 2H4WA 5TQ0A 1QU3A 2JLXA 2B5WA 2PS9A 2ZWPA 2WF9A 3D2BA 3KUDA 4NECA 1ZFNA 5EZYF 3RSOA 5IC5A 1R0LA 2GNPA 4FGUA 3EXG2 4LX8A 4RSRA 4Z9YA 5FIUA 4ZYXA 2LPMA 1VCOA 5A4IS 3C5HA 1M8GA 2IPNA 1IQRA 1QBGA 1Z0AA 3NKLA 3R4CA 4Q18A 5AW4A 3VHXB 1NW8A 1KBQA 4BDTA 4WNYA 3ZGNA 2ZT6A 3HCAA 4B3DA 1DC3A 4D9BA 5KS2A 2GAFA 5CG1A 2GJ9A 1WY5A 4C2TA 3F5QA 3VI3B 2N42A 4D9HA 1RM4A 5KHLB 1UXHA 3DNFA 4IDBA 1TAUA 4HNQA 5ALMA 4OF4A 1ZUD1 1FQWA 1ZQ1A 3N2LA 1AB5A 4JLOA 2FQ1A 3LT4A 4MGZR 2QMUA 1XTUA 3NH9A 3ZX4A 2DT8A 4EEXA 1JSZA 2N9UA 1ZSNA 3D4IA 2X0IA 1BE8A 5FBVB 4ZU3A 2XTNA 1IRIA 2YR0A 4JLSA 1N2ZA 5B4VA 4KQKA 1O58A 1TM4E 3QE4A 2BELA 2MIIA 2QQFA 2CKMA 3T54A 4A6XA 4JHLA 1NF9A 3T8YA 5BN5A 4WNAB 3M8KA 4XRRA 4W1QA 3ZCRA 4LY0A 2ZDHA 5A4MS 1IVNA 3ML1A 2HWYA 2WAYA 3EVZA 4IOMA 2IOFA 4OFWA 4B6JA 4D9GA 2Y6UA 3QMMA 4UNNA 2DWPA 2UV8A 3L6RA 3H9JA 1KAMA 3KKEA 2V6MA 4FVTA 3A0UA 3O82A 1IHDA 2Z1DA 3TLEA 1RQXA 3WLIA 1SCAA 4EY7A 2AJDA 4IWXA 2QYHA 1USIA 4BVLA 1UFVA 4LYHA 1HWYA 2JGNA 2PT9A 1Q20A 3R3ZA 3VR6H 1VLZA 2OXEA 1E9SA 1U6IA 3P2EA 2NU9B 4OQZA 1W4LA 5AT1A 5KTNA 3WB2A 1BH2A 2OB1A 3KKNA 4XLZA 1SCNE 3DPIA 3AIMA 3BK7A 3IOEA 4D5EA 4AG5A 2JIOA 2FSSA 2H0QA 3DT8A 1R9JA 3B1YA 3ID6C 3P5BA 4OHFA 4AK9A 4JGIA 4G1VA 4XDYA 3AUXA 1I3KA 1BW9A 2JI7A 3KFXA 3KYDB 2VG8A 2NZ8A 4YWJA 3OSZA 1KKLA 2C9BA 1T6YA 2RK3A 2XUHA 2OMKA 4WVFA 1PP4A 3S29A 1M2EA 3OUTA 5JDIA 4QTZA 3GLFA 3A14A 3AZPA 4X64B 5LLTA 2G1UA 3P2JA 4G5YA 3ZNPA 4ED9A 5ESRA 1KJZA 3KETA 4GXNA 2RAVA 1JMKC 1MGOA 3IMGA 4UUBA 1J0XO 1VCNA 5EJIA 1XRRA 1SCDA 3L4EA 3T7AA 2PL1A 1QIIA 2ZCVA 4URFA 3C1UA 3UKJA 3GRUA 4V2UA 1W8IA 2IYOA 3K32A 2FOLA 3SU8A 3REQB 1P4HA 3LLUA 3TRIA 1WU8A 4DYDA 5LBIA 4R31A 1J20A 4OQ4A 5FWDA 3NAQA 3N7TA 2J3EA 3PE6A 3DVAB 4OO3A 4FE7A 1XA0A 3QUSA 1ZUIA 4PCUA 5A4FS 5EIOA 2Y76A 2ZB2A 2XSZD 3MPUA 4WIAA 1OT5A 2D0PB 1JB1A 4OYYA 1S8NA 3R2JA 1K8XB 3UJ9A 3M5DA 1GHTA 2ZK7A 4OB6A 3II6X 3N5KA 3Q5EA 3CKYA 4US2R 3GFFA 2JAHA 3BS4A 1CB0A 3QU2A 2D5IA 4O4IF 4R54A 2P5YA 3ZQJA 4EKNB 3EPLA 3DWGA 4B75A 2HIMA 3N8IA 2EARA 4DRXA 4FQ5A 1KKMA 5DWVA 3RRFA 2UYHA 1DMRA 4I9NA 1MB9A 3RDPA 3G5AA 3K9FC 3OM8A 4CRWB 5CDTA 1DLIA 1RT9A 1PEKE 1C41A 3EIWA 4OHRA 1CYEA 2QNIA 5E9AA 1IY9A 2YL2A 3OE1A 4F4FA 1QTQA 2HDWA 2ZRKA 3ICWA 1LF5A 2FR0A 3B9BA 4NY1A 3E9QA 3PZBA 4QNNA 3BIWA 3I3SR 3H65A 1MVOA 4Y30A 1NKSA 3K1ZA 1DAOA 1NT4A 1QHFA 2DULA 5ELMA 4LCEA 3TD2A 1DQZA 2FA9A 2H11A 3PDWA 1DOAA 3PR1A 4AJ9A 5BORA 1W0KD 1SXJB 4GQAA 2P0YA 4LE2A 1V45E 4TLDA 1SG6A 1WUKS 5FQOA 1ONPA 4JVLA 3PWTA 2GASA 4GZLA 4JEUA 2RARA 2QIOA 4GYKA 2DR3A 4AIRA 4E5MA 5LIRA 5IULC 2OXRA 4IS3A 4AMUA 4REOA 4Z4IA 2F00A 2WJ3A 1CY2A 3PUYA 4AZTA 4FCTA 4Z3KA 4BGUA 1DFHA 1QKKA 4S1VA 1JR3A 2GJKA 2QE7A 1UMCB 1TUBB 1NHWA 3MWEB 2YJ4A 5GAJA 3M1AA 2DFVA 4WBNB 4ES6A 5HGXA 4XIFA 1SKQA 2DC1A 4QM6A 4TT3D 2JG3A 1VHLA 5E6RB 3FMPB 4B17A 1S9DA 1ZUHA 4L07A 4BASA 4TVSA 3PF8A 2Q62A 4IRMA 3G0GA 2Q4EA 4OJKA 1U2EA 3RADC 3WLLA 3HXPA 4QOFA 2RMKA 1ZSYA 3KUCA 4EGSA 1XMOB 1FSSA 4LHZA 1R2QA 1RQ7A 2J30A 1MDFA 4HFRA 1XJ0A 4B9EA 1ATIA 1A69A 4L4ZA 1VP3A 3LAWA 3SLKA 2GH1A 2X4IA 3A70A 1W4ZA 4ZRNA 3UWMA 3C6BA 1KSFX 4ZJPA 3GPLA 2OKGA 2F59A 1AZTA 4UDXX 2IL1A 1NVVQ 4GAEA 3RU7A 3PHGA 4V0SA 3T06B 5IJWA 4DM7A 4EHFA 2OV1A 3UHJA 1E2DA 5JSZA 4ZO7A 4BBZA 4IO0A 3AF2A 4YMHA 1Q0UA 3LBNA 4MS1B 4C29A 4AQDA 3L9XA 5CK4A 4W7SA 5EHIA 5AVZA 3LFTA 2QZ4A 4YDRA 4ZWNA 1NZFA 1FUEA 1S1MA 2YS7A 3NBUA 4G4SO 5DCYA 1EGHA 2C4WA 2IT1A 1NSTA 4LOKA 4RHTA 3RBAA 2IF0A 3FPCA 3VPDA 3L7AA 1WV0A 3LCJA 5TVKA 5HILA 2Q6LA 3GRYA 3NI2A 4MKIA 1SXIA 1M75A 2ZB7A 3FNIA 1V4NA 2YYAA 3A6HA 3GAAA 4YAFA 4E13A 2HXSA 3JALB 3TGLA 1USGA 3Q5DA 1ZVMA 1TAHA 1PS0A 4ARBA 1RZUA 5HW0A 3MJSA 2X0DA 4YEDA 5DMXA 1NV9A 3LA6A 2EKLA 1P1CA 3B6IA 3KDSE 1G5PA 3RW9A 5KYWA 5J5VA 4XYLA 5L3QA 1DCKA 1M2VB 1DKOA 3LDAA 1HQYE 3SYNA 3F2IA 4QE3A 3FBTA 3ADOA 3CNOA 3DMTA 5FPYA 5SY4A 5T8KA 3VU9B 3O8OA 1FFWA 1REQA 3GT4A 2JH3A 1IM2A 3HNPA 3M34A 3P4UA 4F5YA 2PGOA 2E7ZA 2NLOA 3U39A 4K9LA 5BUSA 3RG8A 1QO0D 4YA6A 1CKEA 2BM9A 3VKVA 2VNSA 5CHYA 1SCQA 4JZKA 3BN3A 4OK6A 4WDRA 2X3YA 3F46A 4HBZA 1YI0A 3RRZA 1WHSB 3BC1A 4UUOA 2REOA 2VF8A 4HXEB 2QHXA 4J16A 2G7ZA 1WOYA 1AK2A 3DBOB 4TSFA 3QPUA 3W77A 3G0HA 1FDOA 1TEXA 4EUHA 3C48A 4F4CA 2QORA 2VSFA 3NYRA 2I76A 2FRXA 2PRSA 4S0ZA 3H04A 5DCWA 2G9NA 2J0SA 3PEWA 5K8IA 1HLPA 4GPIB 2X8BA 4XVQA 3ROXA 1P3Y1 4CW7A 5LM3A 3D2CA 2YJ6A 3DE0X 5CA1B 4O2AB 5AIAA 3QELB 4LZWA 1V37A 4DCTA 1A2KC 1K98A 4ZVLA 4RZ2A 4KO3S 1AU9A 3OF5A 4OOEA 1TCUA 3HKCA 8GPBA 1QHYA 5B3KA 4DV4B 4HRYA 1BAPA 4DV7B 4Y1RB 3V8RA 2AW5A 1NTRA 1N6KA 3CC8A 3DAFA 2NU8B 3RF6A 2O8EB 4MSUA 1TLFA 1JS1X 4TL8A 2O14A 5KYUA 1YHNA 4PICA 5K0LA 3GCDA 1DPFA 1ICIA 2C2HA 1Z0JA 4JYBA 1B42A 2CE7A 5DM2A 3AJEA 4AZSA 2A5LA 3BE6A 4PANA 3QVKA 1Y89A 1YS7A 3ZK7A 4DW8A 3SIRA 3D6VA 3WISA 2GZDA 2IOFK 4IKEA 3SVTA 4TL6A 1KRHA 2DWUA 1K6XA 4WK0B 3ESXA 4KQ2A 4MV9A 4L78A 4YJKA 5IHPA 4B9AA 1G5IA 1Z6ZA 2IS6A 2VQSA 3PHIA 4LJ5A 4RGQA 1LVUA 3G1UA 2ZREA 4D8YA 3ZUGA 2AL7A 3QEMB 1JEYA 4JOSA 1EVJA 4X1YB 5H59A 1TEZA 2IKQA 4IDFA 3EEQA 1UDRA 5LXTA 1U2RA 4LYYA 3R8XA 3BICA 4BX0A 3QLEA 4D0RA 1NVGA 2EFCB 5JPDA 3U1VA 1VI2A 2J3KA 2KX7A 2ORWA 4GP7A 5AK0A 1KH3A 3VSEA 5LQDA 4QZVA 2W83A 3CJQA 3H9BA 1XMVA 2EDCA 1S89A 1EVYA 3CWZA 3VSDA 1WKCA 3I2YX 5CYOA 1OAOC 5LC1A 2IYNA 4YV2A 5I7SA 2OV8A 1EQ2A 5TQ2B 2PS0A 3UAXA 1R0RE 1I5EA 4IDEA 4CMAA 2MU1A 1U2GA 2YVKA 2D6FA 1N0UA 5JASA 3AHHA 4DRYA 1BCSA 3IVXA 4JNCA 1Y9AA 3JQ6A 3WNCA 5GGXA 2ISCA 4DR5B 3PNKA 3BT7A 4RPHA 3ZKWA 4E6EA 1ATZA 1GUYA 4HDSA 4M1YA 1MT3A 4LRQA 3F71A 3CF6R 3WDMA 4URXR 4TZKA 5EXSA 3R3HA 1W0CA 1UL1X 2D5BA 4LZJA 4QJIA 2WINI 3VH2A 1YS2X 5C5IA 4LDRA 4C88A 2ASVA 1I5OA 1U0SY 4JI0B 3IP6A 3OF3A 4RHYA 4XCVA 5H1YA 3STHA 5CVTA 1HOXA 1N8NA 4RS4A 2AYXA 1USKA 1X70A 1A5SB 1YS1X 2X3UA 3TXXA 4CV3A 4FOSA 2FMIA 2OM2A 5KPJA 3Q7QA 3JS5A 3C4JA 1G8HA 2NAFA 2HA2A 2ATCA 2QL5A 5D6OA 5G0WA 3AEKB 4M83A 3B13B 1M1NB 3JQ7B 2CWDA 4YRCA 3M83A 4FNOA 1Z2DA 1EX6A 1SA0A 3DEAA 4DA9A 2WMDA 4YUXA 4UE6A 1NJ6A 3PENA 2Y2VA 4KGDA 5G4KB 3S27A 1LI4A 5CAEB 3DGEC 3W2FA 2GXAA 1JLSA 3LWBA 1IBRA 2R60A 2ZB3A 4A9AA 5FEUA 4EPTA 1MO4A 5AM2A 1C3VA 3AP3A 3TEMA 3OTWA 3OLYA 1PWEA 4C7BA 2FE4A 4KBYA 4P4TA 2LRHA 3EGIA 1W48A 1CVIA 1DIHA 1E92A 1NN3A 4L2IB 2WP0A 2OV2A 3LUHA 4DLUA 5JXWA 5EINA 4L3OA 4HWKA 1KMHB 1QF7A 4LC9A 3TRJA 1FZTA 3K6RA 1HT1E 3M4YA 2C97A 4I1RA 4Y6GB 3R40A 1E6EA 3CUSA 3M0EA 1PIWA 1N3BA 2YHBA 5TF4A 3GF4A 3FUUA 3LPAA 5HUJA 4CEIB 3WLSA 5BQOA 2CL0X 3JAKB 3NEJA 4B46A 3B2NA 2LXNA 5CTAA 3X2SA 1HC7A 4F9FA 3PX7A 5ALNA 1CY7A 2BCJQ 3K96A 5FHRA 1KYTA 4C07A 3K70B 2CXOA 2KSQA 1KY4A 4N4AA 4PLTA 3RU9A 1C9KA 1NMQA 2IEZA 4WBSA 1KY3A 3A37A 4U7TB 1L5QA 1PU2A 4CN8A 5EA2A 1AA9A 3CX4A 1WW8A 5BSTA 3TK1A 2WM8A 3SIWA 1LC0A 4F5EA 2MMGA 3TTYA 4BO4A 2AMVA 2BPOA 3O92A 2IOQA 5DTQA 1ZUNA 1N2CB 3IKMB 4WN9A 1IJFA 5ALIA 3TH5A 1NMZA 1U65A 3ZD7A 1L5FA 1CCWA 3RYFB 3FZYA 2JLCA 3IAS6 4JUBA 2QLTA 4DQUA 1D2MA 1U6JA 5B37A 5IYZB 1N9KA 1JKJB 3N05A 1RYNA 3PBKA 3KTAB 3V46A 3OOYA 4ZVVA 2OLKA 1TM7E 2R1TB 3QU7A 4WD3A 3WIUA 1FVHA 3HBAA 1H2AS 2WAAA 3AHGA 4PF1A 2ZBFA 3DM5A 5SV2A 1K5HA 4V0OA 3ZDQA 4QBTA 5JWHA 4H3HB 3TVTA 5JJ5A 5JUWA 3S2UA 1P0MA 1L8LA 4ILEA 1H9CA 4UM5A 3ZTYA 4CM5A 3SOPA 2JGRA 1FMLA 2PMDA 5DZSA 4G5OA 4JUIA 4B35A 1AHHA 2Y1OA 3PUXA 1MB3A 4FM9A 2Q07A 2QLMA 5LA6B 3SX4A 3U7QA 1FBTA 1WO8A 3AYZB 2BW0A 1OI3A 1E79D 1VYUA 3USES 3VJMA 1ISRA 2QL6A 3GNSA 4DY4A 2E55A 1CZUA 5BN4B 4P31A 1IN1A 2H65A 3TE7A 1XKTA 1UT8A 4H3SA 4TMFA 1Z0UA 4Q3LA 2HKIA 4NZOA 4K3UA 4MVXA 1AMNA 4HGYA 2FFHA 2GM4A 1S3GA 4NLLA 2CWWA 4FDLA 3EFOA 1J97A 2JEOA 1T3ZA 2W2KA 2RHCA 2ZSHA 3R7BA 1M5RA 3E3LA 1PSWA 5ADVA 1I9CA 1E2FA 4UMDA 1MTOA 2VHWA 2Q5CA 3CJRA 3EEBA 2MYTA 2W00A 4LHYA 4OLHA 4RMNA 3SM3A 5LKAA 1T24A 3EW9A 4OQEA 4YJ3B 1V5WA 2OYCA 3KKOA 2ERXA 2WIAA 2IYFA 2J7PD 4QXRA 2IY7A 4QOIA 3W2IA 1ZD3A 1QCDA 1YS6A 4NBTA 2YRXA 1M67A 1SUIA 4FJ2A 4HEA1 5FPHA 2F8TA 1P2FA 3H0EA 1Z16A 1ACLA 4PLYA 5HFJA 3UQZA 2I1VB 1S01A 2XTAA 4CQMD 3HS3A 3BWCA 2PGAA 1VJ1A 1V0JA 1ISMA 4O6VA 1QLJA 4HK4A 2WSBA 3O8DA 4S12A 3VZQA 5JD6A 3WIBA 4GLJA 1Z5GA 1DUSA 2IIQA 4RAQA 1ADFA 4IPTA 3DTVA 5A7HA 3ZCQA 4BX8A 1PD0A 2ERCA 1DRKA 1R6UA 2QP3A 2R85A 4L0QA 4YP9A 3KAPA 1FXUA 2FMHA 1NQOA 3K8YA 2GHQA 5FEMA 1YMVA 2J0EA 2DKFA 2LZ0A 3IHTA 3LUFA 3NIGB 4IHJF 3P5SA 4DM4A 1QHIA 3O75A 5IUNC 2PYZA 1VMDA 3HO8A 5ADHA 2Q3DA 1JG3A 1GNTA 1NOKA 2PZAA 2GSWA 2F48A 2PIAA 3K9WA 4UUQA 4KOEC 3TLGA 3UT5B 4D4HA 5SZJA 1TO1E 2AWOA 3QV1A 1KGSA 4FN4A 1WTCA 3LYAA 1NPDA 4MW5A 4ND2A 1XXLA 1RRPA 4QUKA 2YXLA 1E69A 2LE0A 1FFCA 4MRAA 5AHXA 1Z4IA 2ETVA 4GPAA 2EFGA 5TS2A 3V2GA 3PFNA 4AJJA 1SC4A 5KQMA 4ND1A 1KNXA 1DC6A 1Y4ZA 2JJMA 3T7RA 1EXVA 5AW0A 5I8PA 1HKHA 1XB2A 4FS8A 4GM4A 3BCUA 1HEUA 3SS8A 2XLCA 2GD6A 4ENTA 2IS1A 3ODPA 5TPZA 4CMCA 5CFQA 3GN2A 1EUDA 3QPBA 1TZBA 1LB1B 3CLVA 1YK1A 4EABA 5IWAB 4BB5A 1XNGA 4BC0A 1EXNA 1V41E 2WUDA 5A4AA 4LK3A 4QQFA 4ZTUB 1MVNA 1Q57A 4RESA 3IQHX 3RSFA 2ZUEA 3ILHA 4K8OA 4EKYA 2JJQA 2IXAA 2BL4A 3OEHA 1JKFA 4Z7QB 1JHPA 3DV2A 3U7FB 2HT1A 3IPXA 4KQHA 4MW2A 4NK4A 8ABPA 1W5SA 4GKKB 3S7TA 1TUIA 3H4VA 1KZ7B 1UFKA 4HZGA 1RI5A 2J6BA 2WWHA 2PVCA 4P98A 3BZUA 1DBVO 3HTXA 2F9MA 3VR4A 1C9NA 2AN4A 2ZKIA 3D6UA 1FYEA 3LTEA 2AMJA 4BRZA 1Y3HA 2CL6X 3FHOA 4TV8F 2PSHA 5K3FA 3PKJA 3IR6A 4N3AA 3V4OA 4FT4A 4B43A 4IJKA 4IJUA 4ZKEA 4BUCA 5LPNA 3ZE6A 3HLTA 3PA6A 1WMEA 3W7AA 1DKQA 1RAFA 4J3JA 1W4RA 1GUAA 4DHWA 1Z8DA 4N7JA 3OIFA 3HWSA 3B53X 3Q12A 4E09A 1SIBE 2JIRA 4YRNA 1CJVC 3QF7A 3ZDDA 2AQHA 2B1IA 2IE8A 4NV3A 4DR3B 4ZVNA 4KKVA 2WAMA 3NWPA 3WWYA 3LIIA 2Z3VA 3EXFB 4MR8B 3KK0A 2UUAB 1EFHA 1VPEA 4HMPA 1UBGA 3F90A 4L3WA 1H0HA 1RLMA 2JFUA 3BHNA 5I5EA 2Q99A 3AT1A 2YVAA 3LOPA 4O59O 2GGSA 2FUKA 1MNAA 3PGVA 4RM2A 1ULBA 2BKEA 2DPLA 4G5SA 1WUHS 3UFXA 5CDGA 4QUGA 1OTYA 1KK1A 5CEFA 1M5TA 3EC7A 4B6GA 3RUCA 1QK5A 3B3FA 4H6VA 1LTHR 1C4WA 4OXNA 4FD3A 4Q4DA 4XIJA 4XJVA 1XMIA 1US8A 1I94B 3O1LA 3KCQA 1MFZA 1YJAA 3THYB 2HF9A 4G5QA 3VC3A 1SWVA 4A0SA 1VIAA 2O05A 4HN2A 4KR0A 4O1MA 1D8AA 4KACA 3U81A 2FVXA 1CUIA 1XVAA 2XUAA 3DT9A 4YRRA 1NQ5A 1Z83A 1IM5A 4FKMA 4J49A 2Q3BA 4AJ4A 3TFOA 3QVLA 3GD7A 3LHFA 4ONEA 2G7MC 3ASYA 4L0DA 4XE5A 4ZEWA 5FO1A 1G2PA 1AXEA 1Y48E 2VNJA 3E2MA 4OFBA 1VFNA 2ZUSA 4XA8A 4LNUB 4CBVA 3IUMA 3CHYA 1T3GA 3V33A 1IOWA 2F4VB 1MENA 1U11A 3P2MA 3T4EA 5CCXA 1VPVA 1IPFA 3A11A 2BTQB 4FGZA 2VP3A 2I0FA 1W6UA 3O4VA 5E0KB 2E9SA 1I32A 2ZAGA 3A2LA 4EHHA 2V3VA 2VA8A 1M6VA 3L05A 5K3CA 2ZM6B 2PL5A 1J2RA 4L51A 4TQ9A 4HEJA 1UF9A 1KOFA 1TA9A 2EKQA 4U7JA 1QK3A 3P52A 3GLHA 3I9LA 1KETA 2XUPA 4A03A 1CS0A 1LWNA 3I4FA 1P72A 4BJHB 4Y6LA 3WJ7A 1A27A 2WPNA 1OWMA 5KYXB 3SF8B 3H75A 3ZLBA 3FDFA 1GNSA 1E1RA 1E8NA 1FFAA 1KH2A 4P3YA 421PA 1T9CA 2WC1A 2WF5A 5G0SA 4BQRA 5JR3A 3W6NA 3U44B 3QKSB 2CZQA 1DC8A 1JN0A 3VZRA 1NVUQ 1Y8RA 3PD7A 4CM7A 3KFVA 4LF6B 5ILOA 5EXTA 5C7IO 5IF9A 4RF2A 2XCLA 2JANA 3IUEA 1IHYA 2IWHA 1AF4A 3THXA 3Q7IA 4GKJB 3SQOA 1XTBA 2XKAA 3W5DA 2UXDB 3OLCX 1CEEA 4FYXA 3I52A 3TTTA 1ULSA 4EQ6A 5AJUA 4ZC1A 5LP6B 3PVSA 2Q46A 3TFQA 4E6PA 2DPGA 2VUUA 3F5MA 1EQAA 2XCOA 1T2UA 2VK4A 3IHLA 4S0XA 5GMOA 3A4MA 4Z0PA 1MOQA 1SUAA 3D6JA 821PA 1XALA 3PNVA 4L85A 2Y0DA 3OIUA 4B2LA 3CLHA 5T5QA 2PNFA 4C0QC 1G20E 2D4AA 2QLLA 2R00C 4ZZ3A 2Q1UA 3FYSA 2LD4A 2IHZA 2I78A 3N86A 4CU5A 2DFTA 3D6MA 3EBLA 5AKKA 3WLFA 1R00A 3WGIA 3F9IA 3EY4A 4MRNA 3W6ZA 3PL1A 4TLMB 4PG6A 2OB2A 3R5HA 4FWIB 2CEKA 1XVVA 1WEHA 1KYYA 2G1KA 3CN9A 4A8JC 4X7PA 1XO1A 2KE5A 3I9JA 1JLLB 1ZJJA 3FFAA 2HU2A 2IW3A 1QYDA 4JBLA 5KNDA 2GHRA 4J2OA 3Q88A 3TL6A 2GBLA 3MYYA 4W7HA 2JCSA 4PAGA 4FSDA 3KZKA 1I8TA 1CEYA 5CFRA 1E8DA 1EX1A 2PSJA 3AB3A 3QY9A 4W8OA 8OHMA 2NZUG 4G67A 1GGKA 1MAWA 4LQCA 4LVUA 4JL5A 3SDBA 5ARBA 2ZZKA 1I6WA 2FW6A 2F3QA 2V97A 4GXTA 1HK7A 5CCBA 4RBNA 1ODCA 4JP5A 2EJWA 3KAKA 2PMFA 4L8VA 4KH0A 4UJ3A 2ZVDA 3RIHA 4NCBA 3D64A 3NNSA 4FS3A 3WLAA 4YMGA 3DR3A 4R1PA 1PS8A 2AC4A 5FUQA 2LV8A 4JDUA 1JYEA 2VP0A 4B0OA 1JLKA 2O9JA 3I62A 4NHEA 3FVRA 4F3TA 4YY3B 1D9XA 5EESA 3ZUPA 5KB3A 4FR5A 1AMOA 1NYTA 2BLLA 2W2OA 4ZCRA 2A0XA 3ZIDA 1DJLA 1AXRA 4D96A 1CW2B 1R0CA 3NCHA 1P7PA 4ZQCB 4PSKA 1FTSA 2OHHA 2AOWA 3HSKA 5JAUA 4Q93A 1QQTA 4OQYA 5EMHA 1VL5A 4BTVA 1J33A 5KQGA 4MIEA 3CVUA 3G5LA 1N9ZA 2VHEA