3IBFA

Crystal structure of unliganded caspase-7
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Caspase-7
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibfA00
3H13A 2AR9A 1K86A 2J30A 4DCPA 4QUBA 2XYHA 4ZVRA 3IBCA 5IBCA 3SIPA 4N5DA 3R5JA 1SC4A 2QL5A 3KJFA 5IAEA 1SC1A 3GJQA 5IARA 3SIRA 5IAGA 1RHUA 5IAJA 3RJMA 3K7EA 2CNLA 2C1EA 2K7ZA 4FEAA 4JB8A 3GJTA 3NR2A 2Y0BA 3D6MA 2DKOA 1RWKA 3D6FA 4NBNA 3BIJA 4QTYA 1I4OA 1SHLA 5I9BA 2H5IA 5H0IA 4EJFA 4ZVUA 1K88A 1KMCA 2CNKA 3PD1A 2NN3C 2QLBA 1NMEA 4PS1A 4QUGA 1F9EA 2CDRA 2J32A 4JJEA 4HVAA 2XYPA 4NOKA 4IEFB 1RHMA 4QUEA 1RHKA 4QU0A 2H5JA 2C2OA 4JR0A 4QUJA 2CJXA 4PRYA 5IANA 3GJSA 1IBCA 1CP3A 1QX3A 4QUDA 4ZVPA 4QUIA 4DCJA 1SHJA 4M9RA 1RHRA 2XYGA 4EHFA 3V6MA 4ZVOA 2XZDA 2H4YA 5IAKA 1F1JA 4EHDA 4PS0A 5JFTA 2HBYA 1PYOA 1BMQA 1RE1A 1RWXA 3H11A 2FP3A 1NMQA 4QUHA 4ZVQA 4QU5A 4JR1A 3R7BA 3D6HA 1I51A 5I9TA 1RWMA 4AW9A 1GFWA 2H48A 2CNNA 3V4OA 3R7NA 3R7SA 2QL9A 4HQ0A 4JR2A 4JQZA 1I3OA 2HBQA 4NOJA 4FDLA 4NBKA 2QL7A 4DCOA 3V4LA 3R6LA 4LSZA 4AWAA 2XZTA 4N6NA 4AWBA 4D3ZA 3H1PA 2H65A 4N7JA 3S70A 2H54A 4NBLA 2J31A 4QUAA 4QULA 4QTXA 3GJRA 1RHQA 4ZVSA 1M72A 1CVRA 1RWWA 1QDUA 4FXOA 4NOLA 4EHLA 3V6LA 3QNWA 2QLJA 4JJ8A 4D3XA 4HQRA 2Y1LA 2H4WA 3UO8B 3ITNA 3PD0A 4EHKA 1RWPA 2WDPA 4QU9A 4EHNA 3H11B 3NKFA 3DEJA 1QTNA 3UOAB 3R5KA 4EHHA 4ZVTA 4N6GA 1GQFA 2C2MA 4JJ7A 3S8EA 4D3YA 3OD5A 1ICEA 1RWOA 1RWVA 1SC3A 5LUAA 4JQYA 2P2CA 5K20A 4EHAA 5IABA 3DEIA 3NS7A 4N6OA 2QLFA 3KJNA 3P45A 4NOMA 1RWNA 4FGUA 3V3KA 5IASA 3E4CA 4QU8A 3V55A 3PCXA 3IBFA 2CJYA 2CNOA 3DEHA 3EDQA 1NMSA 3H0EA 3KJQA 4IYRA 5LUBA 4I1RA 5IBPA 5LU9A 5LU8A 5IC6A 1NW9B 4I1PA 2J33A 3P4UA 1RHJA 2C2ZA 3DEKA 1I4EB 2FQQA 2FUNB 2HBRA 4PRZA 5IBRA 2HBZA 3EDRA 1JXQA 2C2KA 2H51A 1PAUA 4N7MA 3R6GA 5IC4A
chains in the Genus database with same CATH superfamily
3RSSA 5AD1A 1U3VA 4FOTA 1J8YF 4PLFA 3G7SA 3ZLBA 2JL1A 4Q37A 1W6UA 3FFBA 5JWHA 5EHXA 5LB4A 5FTWA 1JYEA 3VYTB 3UKJA 3Q3GE 1SBYA 3AU8A 4MIEA 3OZCA 4O63O 4DZRA 1SVWA 2UYOA 1YH3A 4L3WA 4OHPA 5TQ2A 3GVHA 1N2CE 4FYVA 4O4IB 2ENWA 3NR2A 1W9MA 1TU3A 2J6IA 1UPXA 1KYQA 1T5IA 4XFJA 3DE4X 5AOAA 5CYGA 4WX2B 2QSZA 5IM4F 4C30A 5BUCA 3INNA 3DYVA 1A9RA 3QE4A 2I4OA 2J9FB 3CE9A 4NEGA 4MS3B 3RVJA 4YT5A 3O4FA 1HTBA 1INLA 1CUDA 3FPBA 4KZKA 3PC7A 4NPAA 3UUEA 5KDDA 1CSEE 4UOZA 3C3DA 5K4AA 3S2FA 2GPNA 2YJ4A 1E4VA 1F7VA 1ODFA 3Q7SA 4M7RA 5CX1A 3QVTA 3CW8X 4TQ9A 5I5GA 5KX5B 2YW2A 3NHJA 1OYVA 4FZ3A 3DZKA 4IHJB 3UJPA 2CXOA 4OMFG 3AG6A 2G1PA 1HYHA 4URZR 1QYIA 1XQ6A 3O4HA 4NS4A 5DPMA 1UAAA 1MB2A 1MO2A 3B85A 4R9NA 1KR5A 1Y7IA 3D7RA 3OETA 4O2BB 2WYIA 5JNWA 2XA1A 5FTNA 2QD1A 3WB9A 4D9IA 3VJKA 3SVTA 2GARA 2UZ1B 1XTRA 3SS9X 1NPYA 3R7NA 1NMXA 1CUBA 5JYEA 3ERCA 1Y3BE 1T29A 2WHRA 4AT1A 2VTVA 4HYYA 3OJXA 5D3MB 3VHLB 4BUJA 1R8XA 4A0HA 2GDJA 3NEJA 5LLTA 3W5BA 1BMTA 1JZSA 1W73A 4RVUA 1XEFA 2DBVO 1JIJA 4R8LA 6AT1A 2IX3A 2P6PA 3FOFC 3WLSA 1KARA 8AT1A 4NMWA 3OX2A 2NNWB 2X5NA 5FUMA 5JQGF 2VJCA 4C0XA 3NWPA 4EPTA 3Q85A 5ALXA 3STXA 4IIUA 1QGUA 5FLXA 3G9TA 1MLDA 1QVZA 2L18A 4QSMA 4KIJA 3BZUA 3CR3C 4NESA 4B82A 3OZSA 2H85A 2I3GA 1A2OA 4ZPXA 1GLNA 3S68A 3KKZA 1TAUA 4AMGA 4S05A 2BZSA 5GGYA 5HKLA 1DQZA 5K45A 2GTPA 1AA9A 3OM1A 2ZYUX 3DVAB 3LYLA 3NG1A 3QA9A 3ME5A 4Q9KA 4X3OA 3U13A 5I7VA 1X74A 4PBSA 1O6ZA 4X24A 3A4MA 2VDQB 1PDVA 3CUSA 5JAHA 1SM4A 1NT4A 3L7DA 4NULA 2XVZA 3WGNA 1MN6A 2HT6A 4FK8A 5CFMA 1HG1A 1QGUB 2BMVA 3MINA 2IDMA 3KJEA 1VE5A 1NVWQ 1D4ZA 5AH0A 3W79A 3JSXA 5JCJA 5JS7A 5IXJA 4HTFA 4WDRA 2CB9A 3T4XA 3WO0A 1XLUA 5EZ6B 1DAFA 1AUPA 3PCXA 1OGIA 4D9FA 5FWYA 1AQYA 1WBDA 4I9NA 3K0FA 1Q50A 3IBGA 3U4HA 2R6HA 3STWA 2RHGB 5H3HA 4CI9A 3BIFA 4WK2B 4DMCA 3NXKA 3LF2A 2GCOB 1BMFD 2F3QA 4NCHA 3GLGA 2WRZA 2FUNB 3IV7A 3ZVMA 1WG8A 4CQNA 5FWXA 1DKLA 4X61A 1K9SA 2G9UA 5CTJA 1Y63A 5HDBB 5K3OA 4MO9A 1MKYA 1NWCA 3P96A 2DFNA 3IBCA 3S4YA 2JIQA 5TLSA 5B6PA 2Q2VA 1IXZA 2XXAA 5DIZA 4X8HA 5JECA 6PFKA 5D7BA 3RJMA 1NR5A 2RKWA 2CLMB 4CM9D 4EPWA 2R1TA 4Q34A 3L1VA 4HNVA 3AJAA 1QMGA 3KKOA 3VTKA 2DKOA 2JZOA 3PHLA 4OQ4A 3D6JA 1BIFA 1QBGA 2BELA 4MQFA 1ZVQA 4R8SA 4R1UA 4TUYA 4ZC8A 4DM4A 4YCMA 5ALGA 3GLFB 1UMBB 2M1XA 1GGEA 3P94A 5AJHA 2ID9A 5HS4A 3EMVA 1FPMA 4JBHA 1Y5NA 4BRUA 3NAQA 3TRDA 4MCHA 3A6HA 3NEPX 3CR8A 3Q4GA 5FEUA 2E89A 2B4QA 1YIDA 4RSRA 5BO5A 1DVRA 2ZJ0A 2VK1A 1MFZA 1M8KA 1JJVA 2J5RA 1HEIA 1TIKA 3CG4A 2P78A 4JWKA 3K96A 4QG3A 3OPXA 1E1KA 1E66A 1HNNA 2AOUA 2FI1A 1M5TA 4C7OB 3TLBA 1SVKA 2X0FA 3ZQUA 2CLCX 1H8HA 4BE7B 3ZK8A 1QVRA 1KIFA 5IJ0B 4JUAA 4Z9BA 1XHLA 4X7MA 3EC7A 4MQUA 2W2MA 5CNKA 4LRTB 3MWDB 1T35A 3D8TA 4Z3KA 3G2NA 4ZXPA 2R8YA 3NU1A 3M6WA 4EO9A 5JISA 3LQYA 4HNAA 3TSCA 3ZGNA 4R83A 2X8JA 1MZVA 1S3IA 4AU1A 3OPYB 4NYJR 4W1PA 4D9CA 2Y67A 1EXMA 1U4SA 5EE9A 1K8XB 5IXYA 1EFRA 4K9MA 4YWJA 2FMHA 2V7PA 1T1IA 2FUCA 3G8YA 3UJ6A 3BKWA 2X0NA 1ESMA 2G04A 2Z3VA 4ZYUA 1MPXA 2B35A 2BFBA 1CUYA 3ORFA 3R3YA 3WJ1A 5DASA 1FXUA 5JYBA 3WFJA 1NBME 1CQIB 3G9QA 4HQNA 3ITNA 1ZGGA 3C74A 2F1KA 1G66A 3ZX5A 4CV3A 4F60A 4HXYA 5FBHA 3V34A 3W5DA 3QZUA 1VRCA 4X65B 1G42A 4BFXA 3S3TA 2IKSA 4WLEA 4TRNA 4QSHA 2QDKA 3FVVA 1VI5A 4JCOA 1TOAA 2FMXA 5B5SA 5CEFA 1JEYB 2X5JO 2ZETA 3KQNA 2GPJA 1XKQA 2OB1A 3OE4A 1V5FA 1GL3A 3EFOA 3IJEB 4HZUB 3LPNA 3OCCA 1T36B 3M1LA 1GARA 2QLFA 4HLUA 3THXA 4AJ2A 1F8YA 1NOKA 4EF6A 4CGZA 1KO7A 3C3JA 1O95D 2UZ3A 2AF3C 4ZDIA 2Y1EA 3GX1A 4ERNA 5FAKA 3GRPA 4HAZA 3WJ7A 2DP4E 2QN9A 3HY6A 1IRIA 1UKZA 4KDFA 3K9HA 3WNBA 4V39A 1XZEA 3FN4A 1I7PA 5LDGA 5A5DA 5LZ4A 5HRUA 2HRBA 3VHQA 1QR2A 2A5FA 2O20A 3FRHA 4CU5A 2WU1A 3N86A 5A02A 1HNWB 3BRCA 1R74A 1KZ4A 1WEHA 4S35A 5F1YA 5BSRA 4D9GA 2IFTA 1WDMA 3A26A 5DBHX 1X8LA 2QKYA 2YY7A 2GO7A 2P2YA 2B7BA 2D8MA 4CR7A 2W71A 3SIPA 1CXZA 1PD1A 4DLTA 2ZCUA 1KO5A 5JNVA 3P9ZA 3D8RA 4Q01A 5IVDA 2HWXA 3LP5A 2ZJFA 1TX4B 4GKJB 1U1CA 3ZY2A 1DO2A 1GFIA 4TS3A 1Q0LA 3WGGA 4BBAA 3EPPA 3GJTA 2PS9A 4CEHB 1SHUX 2H1IA 1QDEA 2FN9A 1VIAA 3HY3A 3PFBA 2CNWA 1MQSA 3OIDA 1U2SA 4ENPA 1LFAA 3TKAA 1C30B 3ONDA 3TQIA 2R97A 3PPWA 2QLBA 3L3BA 4OM8A 2OKCA 2EYQA 4LJ8A 3RBVA 3RS7A 5G53C 2J0VA 1VBKA 3M4JA 4RTJA 1VHJA 4HWTA 1VPEA 3AC0A 1RJWA 2PGLA 3COZA 1B23P 4DJDC 3J80A 2ZBPA 4MUAA 2HJRA 1H0HA 1X3SA 1P6XA 2WJVA 3QWBA 3UUGA 5EIOA 4DL9A 3PCRB 4S1OA 2I55A 4KAFA 621PA 1FRNA 1K7SN 3AFOA 4MS4A 4FDMA 4XDHA 2C3UA 1P45A 4JJIA 1CVIA 2TRSB 2Z5LA 1CWUA 3A1CA 4LRYA 4ZT6A 1OX4A 3L0DA 1RIFA 2FJ0A 2OD2A 3IUNA 4KH0A 1NUUA 1KI2A 2AXEA 1BCSA 3KHTA 4RENA 2MSNA 3RLIA 1RWMA 3ZV7A 5JXGA 2ZSAA 1ZVKA 3PRHA 4K87A 4HO1X 1NKSA 4KKVA 4PXSA 4H3HB 3IA2A 5GP1A 3VXKA 2D7CA 4MV7A 2G9NA 3ZWWA 2DG2A 4ZJPA 4J4BA 3DT8A 2I65A 4HBZA 4RYLA 4ZZ1A 4Z8YA 1QO0D 4U3JA 2I78A 3CUYA 2XCIA 3PJGA 3QPDA 4RLSA 3HEMA 4R1SA 5ALDA 3S1AA 4EG5A 5K0ZA 4CG2A 4JJZA 1N6OA 2W4QA 3O38A 4PE5B 1YKSA 4ZQGA 1TM4E 3NHAA 3EFHA 4CMGA 4ZN6A 2VP0A 3EZ6A 4BKRA 4IDFA 4W1QA 1GQRA 3UHAA 1XALA 1EQAA 1A9XB 4UTRA 2IS1A 1L5YA 1P0MA 2ICAA 3V4VB 3W2IA 3MTDA 3OZTA 3ZKWA 2JGIA 3TXYA 2FG5A 5LDDC 4ZQFA 1AA6A 1J8VA 1AV7A 1WMBA 1XEAA 1UC4B 4P2BA 3RKRA 3UXYA 2EEPA 4KXVA 5EESA 2CFSA 4FC7A 2WMNB 4RVSA 5DRYA 4XX0A 1T6NA 1P7VA 4KE8A 3AW8A 1KP2A 2LW7A 3QF4A 5F76A 1P6QA 1W19A 2JBAB 4G2NA 2YVUA 4YCDA 4BZPA 1Y8ZA 4C2TA 3STUA 3TFQA 2I9KA 1W59A 4HV4A 2NVUA 2OZLB 5J43A 1Y6QA 4ZQCB 5J3JA 3I5XA 4LRWA 3LSYA 2PMWB 4KI0A 1UT8A 3WWOA 5AW3A 5IASA 1HT1E 1U2GA 4M2LA 5JE8A 5EMLA 2F64A 2H00A 3MTBA 5KTSA 4MR8B 2PZMA 3UAWA 1ZCAA 4BO5A 5CBPA 2VUSA 1VRWA 3A3OA 2EX0A 5DEIA 1DBQA 2Q3LA 3A6ZA 3DKIA 1KK1A 1XRLA 1QIIA 3RC8A 1WSAA 1DBPA 1DJLA 1T5SA 1XZMA 1X1SA 3IERA 4AZSA 2F8TA 2BEKA 2FX5A 1JBKA 2GYUA 2BH9A 3I05A 4JNCA 4JV5B 2Z5FA 4MMYB 2UZ0A 721PA 1RR6A 2JFGA 1SPBS 4GZMA 4QQNA 3U7EB 1IWPB 1R5BA 4R01A 4O6VA 1JNXX 2NMVA 5HZHA 4IQ4A 4FOSA 1EKXA 4AKEA 3ASYA 1YR9A 3F71A 1SU8A 4L2IB 1YR2A 2C1EA 5HM6A 3N2GB 1Z6AA 2XNJA 1YMVA 4JJ4A 3QLTA 4OQQA 4J29A 5DGDA 1CUWA 2ZE5A 4KNYA 2EZTA 2O8DB 2HQOA 2DERA 1IN8A 3DBLB 3LDAA 4ND3A 4BO0A 1JSLA 1AKUA 1SCNE 2SCUB 4QXAA 5AIBA 5KNCH 1GD1O 1YBVA 3C3WA 4LG1A 5ITZB 4IEFB 2N9UA 2C7BA 3KZMA 5G4LA 4BMOB 1GLGA 1IVYA 1DEHA 4G36A 4GMDA 4HOYA 4R3NA 4ZOEA 1MV8A 1SCUB 1PF7E 2O7SA 2P65A 1B7GO 2VRNA 3JZFA 1PWXA 3EISA 2BBTA 3GP8A 1KQ3A 1W1UA 1YCGA 1L4NA 5CNJA 4XDGA 5ICFA 4WLVA 2Y0PA 2XUOA 1ZFNA 5I9NA 1C1XA 1BFKA 3HYRA 4JLDA 1P9OA 5TC4A 2ECPA 5KMGA 1T34A 4TMYA 4PZYA 2EKLA 1ZK2A 2ET6A 4NH4A 3LUHA 4LGYA 4M1MA 1VKHA 3WYEA 4BP1A 5DNEA 3UK0A 4DG5A 1U2GC 3ONFA 1VL5A 3L01A 4FSDA 4KPGA 3HGMA 4PX2A 4R3WA 3OMWA 2YXBA 2GZSA 3HVJA 3IUEA 1GL6A 1LBSA 1M7BA 1S3GA 4PRKA 1GSIA 1Z08A 1RXCA 5U9CA 1SBCA 1TQDA 1XZCA 3BIWA 2WWVD 5ISMA 1WNTA 4ZTUB 2ADFA 3GQBB 1H9BA 4GI2A 5CHYA 4V1CA 1EJ6A 2JKYA 2C2HA 1CVRA 4KI7A 2C94A 3RYIA 3GN1A 1NWHA 2UUCB 2HQ1A 1KK2A 1LCIA 1KOFA 2OAGA 4YRFA 1TD9A 1OYYA 1N2HA 2ZBDA 4RVHA 3G0BA 4CKBB 2HSGA 3MEQA 2QRVA 2H4WA 3A27A 3ENNA 5DNWA 2QSUA 4QQFA 1L7QA 3VR3A 4A2CA 4N3GA 2GCNA 3RYHB 2WBLC 3MRTA 1X13A 5EZQA 2QUZA 4DEYA 4JSYA 4CDRA 3FCOA 2AJ8A 4JJ6A 3U44A 1R0YA 3M6LA 2AGVA 1PJ8A 3DXXA 4K6GA 1Z2PX 3JQBA 5BN3B 2ZM5A 4J6FA 3A1FA 3OT1B 4Z0NA 1CCWA 1V4VA 3ELDA 3DV9A 4FBGA 1QFMA 4UHFA 4LFCB 1Y7TA 2HDWA 4DA8A 4E70A 2FE1A 3TTYA 4Y6RA 5I7WA 5DNDA 3NTUA 2D2VA 4RTLA 1XTUA 3ILXA 1F2VA 2BEUB 4H16A 3JQ8A 2GQ0A 1GUBA 1DO8A 4DA7A 4JEHA 1JKJA 5CG2A 2IXFA 4L5YA 4NABA 5JARA 1YDHA 3WYCA 3U7FB 1DTSA 4I50F 1UDRA 1BS1A 2JI6A 1C80A 1DBRA 3CGGA 2JJ1D 1YS9A 4NZ9A 4RGQA 4IIYA 2AE2A 1GGHA 1GY8A 5DTEA 2HKIA 1FBTA 2PK3A 5F23A 1GQSA 2EGUA 2VI5A 1UFVA 3HKBB 5B1SA 3RNLA 1NPTO 3RHFA 5CB4B 1KMHA 3H13A 3CRMA 1YL5A 5E1MA 3TQOA 1T6YA 2EF1A 3E61A 3QBTA 4LXYA 3P4XA 4FQ7A 1R3UA 4R05A 4I7EA 1JKFA 4R7GA 3E9RA 5T67A 1E2KA 4XOUA 2C4UA 5BMVF 1IEQA 3U9SA 2IYWA 3GJ3A 1Y7PA 1ZGHA 3D6AA 3G9UA 3IJPA 1BFUA 3SSAA 4BQRA 2PEZA 3IAS6 2QTFA 1I2DA 1K7CA 3C7CB 2N47A 3LXXA 4R2MA 4CYMA 1HDOA 3JARA 2XOEA 1A96A 1PR5A 1RC0A 1IEVA 1JG1A 1VL0A 2AS0A 2R4QA 3IOMA 4HDNA 4HNRA 4Q47A 3UJ9A 1XQVA 2VBFA 2QN3A 4KQKA 2FSVC 3P9XA 4BVEA 3FY4A 2I4MA 4B09A 5EMNA 1HRKA 4UUNA 3W1VA 1OKKD 4G63A 4FMDF 2YWDA 4ITVA 3H65A 1ONPA 4YJGA 4A0QA 4EW2A 1M54A 4MDEA 1RE0A 3GJ4A 1YJQA 3QVGB 1IN1A 1HL7A 2VZLA 4X1IB 3OZUA 2MOKA 4UE3S 4WKGA 2FG7C 5EP3A 1AE1A 2FSUA 3ZLTA 1PS8A 2IXAA 5F98A 1I1QB 5DO9A 2AIRA 2OSVA 5LMNB 1QYXA 2YVKA 2HSZA 2AG6A 1LWNA 4TYYA 4BUZA 4Z4EA 2DKNA 2JLZA 4KXQA 4OP1A 1FFHA 5TRTA 4BN5A 4QU5A 3R7BA 1LLQA 1KDYA 3H18A 3RVQA 1AN9A 3RGGA 1I10A 3GBVA 1UPBA 3D5TA 3NEYA 3ABQB 4MVJH 2X2OA 4KR7A 3VPGA 2WUFA 4Z7OB 5K0FA 3O1IC 3E7FA 3C6KA 2Q6OA 1ML4A 4CT0A 4BAGA 3TI7A 2DPYA 2A35A 3K4PA 4IXMA 4BB0A 2CL6X 3X1ZA 5TMDA 1WVIA 2ETVA 4XGNA 2H4JA 3VGJA 1TYDE 5LJLA 5C31A 4W6QA 5INTA 2BKLA 1JR3A 1A9YA 3E2MA 1E64A 5CFRA 2QVZX 3U31A 1KE1A 4IXNA 3MELA 3OZEA 4RF4A 3MT7A 4MRVA 4XWTA 4JIGA 2W6CX 3I5YA 2O8VA 1M76A 2CZQA 1ZNWA 3AYZB 5TQJA 4HG2A 1EGVB 3Q11A 4II2A 1XZGA 3LYUA 5UKDA 1DBIA 1AQIA 4E5DA 4LK3A 5GVSA 2L82A 4MR8A 5CBPB 4YBZA 1OXKB 5EYPA 4MYDA 4CE6A 5ALSA 2PXXA 2EL9A 2AZDA 2WWGA 3R5KA 2PMEA 4KK3A 1HH4A 2YVAA 3F1LA 5DGIA 3ZGYA 4D8XA 3OM9A 4JLSA 4JFAA 4MHTA 4H7JA 2VSFA 4HXGA 4YO8A 2JFPA 2NZWA 4OJTA 4UHJA 1X7HA 4XXHA 4C6TA 5BN1A 5I01A 1Z0AA 3P8ZA 4HH1A 3WV5A 3PSHA 1B3RA 5LJIA 1CRPA 9ATCA 1NUSA 2R3SA 2YDYA 3CXUA 4FKMA 2NO9A 2VF5X 1CFJA 1ZRSA 2QD5A 3A36A 5E9QA 1ZXLA 5KINB 1GCAA 3E4CA 2EC5A 3L4SO 4IH9A 3IBFA 1RLMA 3LLUA 3KBBA 3WBJA 4B1FA 4BTEA 2G83A 4W5OA 1U7OA 5IMBA 1UMBA 2VJQA 3SWWA 3UJ7A 1WA5A 1YRAA 5FOUA 3AVTA 2CXSA 1G5PA 2FX3A 1K0UA 4FN5A 1H3NA 1JSXA 4EZBA 1W5BA 1JG7A 1FQOA 3C5VA 3KOWA 3EVFA 4LOLA 1SUDA 4C0WA 5BWNA 1HUQA 5EMHA 1O95C 1P1RA 2WA2A 5I7RA 3NM4A 4M87A 5F7XA 4MSUA 4C14A 2VRCA 2XVXA 4RCVA 1GG2A 3DV2A 1NVFA 2Q46A 4N7RA 5FNZA 2GLXA 4BU1A 5IPFA 1NRWA 2GPYA 5G1NA 3ZLVA 3CLVA 3TF5A 5BQXA 1HOXA 3WRYC 3MJCA 1MJFA 4JVSB 4LIPD 1CBUA 4JC4A 4QBKA 4FNOA 4KTTE 3ZWCA 4ESHA 4TMTA 1DIAA 2ODAA 2FNAA 2C5GA 5EIXA 1BKSB 5HBGA 3GT3A 4B5KA 4BKMA 4YB8A 1ZK3A 3D6UA 4RPKA 4I0WB 5I7AA 4BE4A 2PKEA 3CVVA 4HR7A 1GRVA 1PZEA 2J9FA 4IDBA 4UFOA 5ALTA 3B6KA 3LHFA 1I4LD 2GJ4A 2RCNA 3DWEX 1IVSA 4PZEA 1YR1A 2BLLA 1RRFA 2C92A 1O94A 3GPDG 5CLLA 4TMXA 4OA5A 4IIFA 3U3KA 4BV9A 4JYZA 3EASA 2ZRPA 1M66A 3SMVA 3HI4A 3QLUC 4RFLA 3AVQA 4M8KA 5BPHA 3UK6A 4MI6A 3D1JA 4JJFA 4KQFA 2BGGA 1R6UA 4UVDA 7MHTA 1MEEA 4K3UA 1NYQA 3BEOA 4IF6A 3UTDA 3CVXA 4QO7A 1L6IA 5E0KB 3ACDA 3MQ4A 2G5CA 2FUG1 3M6UA 3GDOA 1LDMA 4ZXFA 4NBKA 3C3CA 3RASA 4AF6A 4ESOA 2HHCA 5LBTA 3GRYA 5IMSA 2J5BA 1RZRD 1V35A 2F00A 1VLZA 1M2OA 5D1HA 3ZXXA 3IULA 1YIOA 1DIHA 5G02A 3HN7A 4KSCA 5KOIA 4NMXB 3DF9A 3HK2A 1P2SA 2G63A 2OHFA 5B6JA 4MKZA 1EA5A 2AR0A 3JATB 4LJ6A 4EKGA 2I6QA 1XTJA 1NBWB 1YMQA 3MGGA 4J0JA 5FCDA 3W9YA 3H7AA 3OPNA 1XLTA 5IK2A 2ZJ8A 2MCFA 3GZNB 4HH3C 3ESAA 4ZOAA 2H16A 3KPJA 4GT1A 5DYIA 2XNKA 1HG0A 1UJ2A 4AULA 5ILOA 1E6WA 2GBLA 1KFBB 2HNAA 2I4TA 2O3QA 2OV6A 1F6WA 2G5GX 1OFVA 3RUIA 4A0SA 4HCJA 4UNPA 2IYOA 5J23A 2W83A 4J2TA 1QRSA 4QYMA 3O8QA 2PH5A 1ST3A 1LBHA 1BWRA 1MQAA 4MUMA 3NGMA 4KPUA 4RKYA 2CSUA 3V9AA 1L8QA 5KNCD 2VOJA 3Q6MA 4LF5B 1JEYA 4YECA 2NW6A 3DNPA 3K0CC 5JSKA 3S1SA 1CR2A 1UPFA 1CHDA 2YH2A 3SM9A 4UD2A 2GNOA 4BC0A 1CJMA 1WDWB 3HWSA 4ZYYA 5TS2A 1M3SA 1VI6A 2P0YA 2X0KA 3VX4A 4M1YA 4NARA 4EDFA 1ZPDA 3KJQA 4MIKA 3DVAA 3QW4B 4G9BA 2XMQA 3OCUA 2XUIA 2FFHA 1H0RA 4IICA 4DGSA 1G8SA 3CX4A 1T1JA 4WUTA 1X1EA 3BZWA 3G2IA 1L7EA 3OZFA 4EA6A 2PG3A 5TVKA 3F78A 1FFDA 4GPBA 5CMLA 3AR5A 2JGRA 3QENA 2FP4A 1Y81A 1L5ZA 5TF0A 3OZGA 4LE0A 3TK1A 4P53A 8ADHA 4IYJA 1IULA 1KE2A 2L0XA 2GM3A 1PNOA 5ELLA 1G8GA 2ERYA 1VLHA 2W6JD 2YN0A 3A4VA 4YRIA 3Q5DA 3QFSA 3TQTA 1I7NA 4JI1B 1SY7A 2GN9A 4LNUA 3Q8MA 1WPQA 2AXNA 2Y0BA 1Y8RA 2CHQA 4HS4A 1ZD9A 1GXSA 1Z37A 2I7TA 3PWTA 4QA9A 1YONA 3RC2A 2QT1A 1WXIA 4TTRA 1R15A 4IM7A 5AESA 1QGED 2RHRA 3CF0A 4HLQB 4MK4A 1FMFA 1F9EA 3CJQA 2R8ZA 3OECA 3LDFA 1NKTA 4C6RA 4B2PA 2REQB 3P0HA 2W0MA 1N7HA 4AZ0A 3FSGD 3LHIA 4EMTA 4JKYA 2IUEA 3NHZA 1XXHA 3IUSA 2BFNA 1JEQB 4QGGA 4OSEA 3WTBA 5BWMA 4IQFA 4YH1A 1BD4A 3PC6A 3QXGA 4P0PB 1MMFB 2TMGA 2X0IA 2IUFA 4AY6A 1ID8A 4XIFA 4OXNA 2QMUA 2WFAA 4CDNA 3C85A 2FRDA 2VT7A 5DTRA 1YDWA 1XIVA 2WU3A 1FX0A 2YZKA 4MGKR 4MS3A 2FDRA 4DUYB 2CVFA 3RM3A 4RETA 1EP9A 3GRKA 3OIGA 2YXPX 3V8PA 4P81A 5BQPA 4CHGA 4OKSA 4ZU3A 1F5SA 4EJMA 4LEIA 1A9ZA 1JVNA 2A8YA 4HN4B 1X1DA 3W2HA 3HYTA 4F3CA 2HBQA 3EPLA 2QTBA 4L4UA 3IEXA 2OPHA 1X80B 5CCXA 4IXTA 2HIHA 2CDBA 4L51A 3H1PA 1YZFA 3G2PA 2I99A 4JLWA 4NE9A 5C35A 5FUYA 3ICCA 1FVHA 1Q22A 2FN3A 1E58A 1W47A 3I34X 4WAUA 1IJFA 2O3TA 1U3FA 1LPBB 3O90A 3NAMA 2VQEB 1AVTA 4TWBA 4BEWA 4D9NA 3EEQA 4LXQA 4TSFD 4WASA 3SR3A 3KTFA 4B4OA 2ZRMA 3PE3A 1JDJA 2O0KA 2HT1A 2CBGA 3HDJA 2VUUA 4B83A 3K9WA 1I13A 2FW9A 3HVRA 3IMFA 3RJTA 4KE6A 1F4VA 3C3MA 5D86A 3SEFA 3LPAA 1JR3E 3I37X 1JEDA 2BGIA 4QFDA 3GJZA 3WK4A 4CL8A 2A92A 2AX4A 3BD6A 3LJKA 4R81A 1E5XA 2YBDA 4QC2A 4W4TA 1UM9B 2JGEA 2PZBA 3CCFA 4JGGA 4IFEA 5AP9A 5CIWA 2GX6A 5HQJA 2Z3ZA 3KX2A 4CIYA 4TGLA 5CDYA 3OD5A 3HO6A 3OM8A 4N4AA 4X6YA 1BH2A 3SQWA 1IBLB 3HL4A 1XCPA 3AHFA 4COOA 1O9BA 3OJEA 1U0NA 3GCGA 5GTDA 1U9IA 2J85A 4GVPA 4I9FA 4JEUA 3BAFA 1YUMA 4QPCA 1WB4A 4YJFA 2IKQA 3FOBA 3RS5A 3FUWA 3L4JA 1OWNA 1X7DA 5DW3A 4UFPA 2BRUC 3SSOA 3I62A 2HMAA 3F6YA 3Q8KA 2PSJA 1YO6A 3F67A 5LUBA 4RH1A 3TFWA 1REQB 2GEBA 2D62A 2XYVA 4IVQA 4EYGA 3RYTC 3I9OA 4LDZA 2F62A 2OXFA 2AN5A 3KSMA 4LJAA 4NZMA 4BVBA 2ORWA 5JASA 1RI3A 3D43A 4FOLA 4RZQA 1K7FB 1NF3A 1JLSA 1LTKA 5TE9A 4J7XA 1R6VA 4RZ3A 2WPDA 4X1IA 5GY7A 4F6RB 4W8GA 4D45A 5C81A 2WHQA 5KHLB 1PX0A 5ALNA 5BY2A 4BNLA 3FTFA 1NXOA 3SHFA 2YJ3A 4PNZA 4TT3D 2WI8A 1XTKA 1E2DA 3GJQA 1XFDA 1D2NA 4GM4A 4CM6A 1NC3A 5FTMA 2AZXA 3LNCA 1H2ZA 2GD6A 4QDKA 4XLLA 5IYZA 4BMVA 2XAAA 4WJKB 1SKBA 3D0QA 2QE7D 5H81A 1KDVA 1GVNB 2C8JA 4Q7LA 4YRBA 3PUIA 4NNPA 2GA8A 4IR7A 5EJ5A 2GJKA 3L8GA 5IKPA 4ZRNA 3RUAA 4O33A 3VSDA 3Q2OA 3DLTA 1Q77A 1XELA 1U63A 2Y8EA 1LH0A 1QRRA 1Z7WA 1DWOA 2B2NA 3KUXA 5IN4A 4RD2A 1CR0A 1MORA 3HMQA 5I7SA 3ZCUA 5KYGA 2Y2VA 1DI0A 4ZVVA 1M0TA 3LOPA 2D0PB 5JG7A 1JEOA 3SHVA 4C4TA 1K0FA 2Y6VA 1JHAA 3DMTA 1ATIA 3A3PA 4ETNA 1UFOA 4CIDA 4RAOA 3UGTA 1JTEA 1PLJA 3A7EA 2ZUUA 4E31A 1SBTA 3SXUB 1OWMA 4V2IA 1FA9A 1XCJA 3R9WA 1VHTA 2QIOA 3H9UA 1IQRA 1E9BA 1K2VN 4LRXA 4P1ZA 1N6PA 3ZWPA 1LPOA 1Z13A 2ZYRA 4OAPA 3TLJA 3UH1A 5KYXB 3THYA 1X1AA 4UNQA 2OZVA 1IQUA 2VN8A 3LA6A 3LLSA 3LPLA 3OC0A 5CYPA 1H23A 3OQ1A 4IVRA 5DBOA 3UW1A 3TSWA 3NHMA 3VOTA 2FWMX 2WK1A 3AUKA 4BXOA 2H7YA 2J45A 4PZ9A 3HN2A 4BNTA 2AN3A 4TYMA 3QI7A 2YCLA 4GSLA 2ZPAA 5G0TA 2XMBA 1VXRA 2BFDA 4O4JF 3QE2A 2AQ8A 3EW9A 3RAFC 5JJLA 3UJCA 3DLIA 4U3JB 1TO1E 3DLCA 1MP0A 2IYSA 3EQZA 5G40A 4G4GA 2OILA 3K1TA 3WZ2A 1NTOA 1U80A 3UPTA 4TMZA 2OLJA 2GETA 4D3XA 1XPOA 1F17A 4RWZA 2JZNA 4FKZA 4DLLA 1I3CA 3OIVA 5DN6A 4C5AA 1NHGA 3QVWA 4LZOA 2X1HA 5DLYA 1OV4A 2RJOA 1TZJA 4N40A 4XEHA 5SY9A 5JANA 3JQAD 4DLAA 4YMUA 4FZJA 3A9UA 2JZCA 3A28A 3V5NA 3U61B 5JXWA 1R88A 2QLTA 2WD7B 1J39A 4JYCA 4O4IF 1X1TA 5J1TB 1T8TA 3ZZTA 3FWKA 2RAFA 2B0CA 2X9VA 4K9KA 4U63A 2DY0A 4WERA 3AP3A 5ALZA 3W8FA 1UJCA 4ZAGA 3ZGOA 3BTUA 4Z1MD 1WSBA 5EHQA 1KRXA 4IMJB 5BSKA 1ZMBA 4G56A 1VGVA 1KZ9A 4PANA 1AS2A 2R0QC 1U5AA 2A6PA 2HQSA 3BQ9A 5DM0A 3AVXA 3GG9A 4M88A 2LR0A 1MGPA 4MGHA 2F2TA 1E60A 3T3IA 2R1VA 3L6OO 4WOCA 3OLYA 1L7RA 3K70B 3SY8A 1B8NA 5JLAA 4LNAA 2VDPB 4M1OA 3I9V1 3U37A 1NRIA 3ZK7A 4CTMA 2WPDD 4ID3A 3DMGA 4CIAA 4IBOA 1DAEA 3K5WA 2Q99A 2OHGA 2IPXA 2QROA 1F0KA 4AVYA 1Y98A 2IU6A 3KRTA 5JC1A 3WG9A 1CZHA 2HPVA 3IRVA 5CLQA 4FYPA 4PVDA 1D9XA 1TGVA 2X6QA 3KXIA 2YIVX 3QMPA 2FW8A 1E6MA 1M2WA 5EERA 1KJYA 1Y80A 3ENQA 4OQDA 1RAIA 1HPLA 2FXVA 4W63A 2X8WA 3SEAA 4TLMB 3TD6A 1JLHA 4RHXA 3BULA 2XMPA 3TW0A 2V55B 2Y76A 3C3PA 2F9FA 2RI0A 2HXYA 3ZD6A 3AI7A 2EZ9A 4PYRA 1KOGA 1IZ8A 1D2CA 2VPPA 4B7XA 4ZVUA 1C3OA 4NR0A 2A1IA 4J3JA 1GCGA 4M1QA 2BFOA 2CMDA 3MG9A 4GRIA 3TQCA 6ABPA 1NF9A 3C97A 2J0UA 5AUNB 2QJWA 4UQOA 1NP6A 1FYXA 3GLGB 1SIOA 1FTQA 2A0XA 4YRSA 1IOWA 4HLUC 4BFSA 2ACWA 5CBKA 5DLEA 3URKA 1QGDA 2MJLA 3VR4A 4ZQHA 3E0QA 3ZE9A 1IHDA 2L17A 3OT5A 1CUAA 3M6FA 2P6RA 4P0QB 5A2QA 1OH7A 1GPLA 3UCEA 3WGJA 3F2IA 1D5CA 5FNVF 3IHKA 1JG2A 4K0RA 4H0FA 2IYQA 2R5FA 4TZKA 1VE7A 4GICA 3M3DA 5JFTA 2I7DA 5SZHB 3SSNA 3JQFC 4DMUB 4ZALA 4MRPA 3TLYA 5FOXA 1IY0A 1UKVY 3FLEA 1U7XA 4F46A 4B6OA 1GFWA 5B53A 1FP4A 4QPJC 3PD7A 2OG1A 3V4OA 3K0KA 4HEQA 4KFCA 4QREA 4IJVA 3G79A 1LW7A 2BF4A 5EC8A 3DBRB 3BYZA 3DKPA 2JFOA 1Z7GA 3VI4B 4WE3A 5CFPA 2HMWA 2QYTA 4ND7A 2RAPA 5AM0A 4D8TA 1EVLA 4OK3A 4CJXA 1N7GA 4L9SA 1F8XA 4MI3A 4G0YA 1UM9A 5EWMB 5ICCA 3V9PA 1IIBA 1S2GA 3OU2A 5JCPA 4AICA 1SA0B 5FORA 3KJHA 1P77A 4E30A 1T2NA 2P35A 3C98A 1F51E 3CURA 4LRUA 1THGA 2FR8A 2JHCA 1AX9A 2XIQA 5IT4A 5G1PA 1XNJA 1UH5A 2O7VA 1KYZA 3G8DA 4NFLA 4V1CB 1R50A 1RLIA 1ZH4A 4LQCA 5BMOA 1L4FA 1TRHA 2IYYA 3PS9A 1HNXB 2QGFA 3I2JA 1JLMA 2Z4TA 4LXUA 3ESRA 1Z2NX 1SZDA 1DOHA 4H1UA 5F4BA 4HGNA 4TMWA 4US2R 1XEXB 1V1RA 3FWZA 3S8YA 5TMBA 3NDBB 3CEMA 4LZNA 3QWFA 2WHPB 3VO1A 3J7AC 4W5HA 4HWOA 5E9AA 2G40A 1W0CA 4XB1A 1QHNA 3ZHCA 4FHGA 1T9CA 2CD9A 4FYYA 4LV5B 1DQPA 1R0CA 1UBLS 2JAUA 4YHHB 3GPIA 4Q7EA 4ZTBA 1JFFB 2EZ8A 5AVRA 3P19A 3OX4A 1TF7A 4DVGA 1JDVA 2E1RA 2IU0A 1EYZA 3PRKE 4J90A 2FSVA 4LSWA 1C3VA 4D41A 2VDNB 5KWVA 3FCUB 4IMIB 4BWVA 5CGQB 2CLEB 2D54A 1RP7A 4TZTA 1ZINA 2VHWA 3T61A 4AJ9A 5J2UB 2IUSA 2PEYA 1EUCA 4DIUA 2PUBA 4Z7NB 2LCIA 4TUYB 4Q9IA 3FMFA 1SRQA 2K4MA 5SY6A 3AEUA 3MOSA 1ISSA 4FM9A 1D03A 4PLTA 2DULA 2HK9A 3H17A 4I3FA 4BL5A 1KQOA 2R7MA 4EKIA 4PWYA 4TLDA 5ETJA 3SIRA 2J3JA 3ROTA 4E13A 4LDQA 1GKUB 2C4HA 3N59A 3J81k 4XYGA 2GFQA 4UVIA 2LE0A 3OFND 5DK6A 1VSTA 4D8WA 5A6SA 1C30A 3H87A 4HDOB 2QN2A 3G68A 2P8SA 3KYCB 2VTDA 4WADA 2W42A 2CFRA 4LNUB 2DETA 3IFSA 1NPDA 4KMRA 4C3OB 1HYGA 3MS7A 2EG5A 4S1WA 1NASA 3TCXB 1LVGA 3E5NA 1RYYA 4MYRA 1Z5GA 3C3KA 1EIWA 3ZHVA 2O0MA 4KIWA 3TOCA 4A92A 4Y1GA 4LF7B 1Z2CA 3I39X 2E4YA 2JIDA 3K35A 3LVFO 1L7NA 4LDAA 2PD3A 4DCTA 1WE2A 4DUPA 5LZ7A 1LUAA 4IGFA 4KQWA 2I3DA 1OE0A 1M8JA 4NDNE 4XPIB 4B6FA 4BFTA 4PRYA 3ZWDA 1NVVQ 3ZWOA 3BSYA 2DCMA 1WMFA 1YB2A 4ZREA 2I8LA 3R3XA 3KQQA 4M9RA 1JI0A 1K5DA 3OX3A 2RD2A 3K4QA 4RA6A 3E18A 4ZT5A 2B1QA 4NXNB 2HBYA 3IXMA 1DAIA 2AN9A 1GIAA 1Z16A 1ZMRA 2G0AA 2PKQP 3GT0A 1NMQA 4L4SA 5AM2A 2BGLA 2ENUA 1O97C 2ZUSA 1B00A 1P2VA 4QBGB 1FTGA 1ZNZA 2C1ZA 4JQZA 3E9ZA 4EGQA 2YMPA 4LRSB 4UCWA 4TL9A 1HR0B 2WIJA 3QKSB 3DLBA 3EFOB 4RZXA 2CXRA 1R0SA 3GF4A 4LXXA 3LIPA 4BATA 1N5MA 1D0SA 1SZCA 2Z6VA 4G67A 4QTXA 3LBYA 1W85A 2DUUA 4G5RA 4K28A 3WWYA 1AF4A 1RWWA 4K6KA 3OCXA 1OU0A 5LNK1 1D7OA 5BV8A 2PR2A 4WI1A 3SMQA 4B8ZA 2P1ZA 3N0XA 2PGAA 2AI3A 1W88A 4M9ZA 4IH4A 2GKGA 1AHHA 1QH0A 1W0KD 3A2NA 3QEKA 3R9IA 1PJRA 1YJAA 4H27A 4WESA 1RDFA 5JV5A 3G2HA 5PNTA 3TM4A 4Y9TA 2JA1A 2O06A 5TDHA 2EJBA 1RTTA 5IUJC 3OFJA 1TCCA 2GEDA 2Q2NA 4RIHA 1Q19A 4G1MB 3T1OA 4R8VA 4E5MA 3IESA 4DT1A 1P9NA 3SZLA 1L1FA 2ZU0C 1V5GA 5ANRB 2A67A 5CB4A 2RGXA 3K1AB 1D7AA 4QWWA 2REXB 5FPQA 3PEFA 1PV1A 2E48A 3LE8A 3KQHA 4I3HA 3ZEIA 3V8MA 4A26A 2QAIA 1TKCA 5LXTB 4QTTB 4LYHA 5CRIA 2KBFA 2LRHA 1XE3A 3V2HA 3F90A 3WJ2A 2WFLA 4FFSA 1PTJA 4DCGA 1DU4A 3LCVB 4ZAXA 4QYTA 3RADC 3HR8A 4KQMA 1CIPA 1L4GA 3TD2A 3F74A 3SQMA 3ZS9A 2J46A 3LG2A 3AERB 5J4LA 4F7WA 2WKQA 3QTLA 3TQHA 4HF7A 3TI9A 3VOBA 1ZJ6A 3W90A 3L84A 1M1YB 3I42A 4UPDA 4MTCA 1Y5MA 5F1KA 1JJBA 4EFNA 3T3HA 5AXAA 3DV0B 1XMPA 3A10A 3UWSA 1H22A 1TZCA 2BGKA 3LCJA 4NYMQ 1DRWA 1NBEA 4BNDB 3PUXA 4RU1A 4RY8A 3TVTA 4GKBA 1LPAB 5E6SA 4LKOA 2JPDA 1COZA 3OO1A 3B9PA 3ILVA 4YRLA 3VYVA 3H2HA 2J09A 3AF2A 1SIWA 3L6DA 2JEZA 2WUEA 3RS9A 2HFJA 4X85A 4HXFB 3S27A 3SM3A 3MB8A 1K7XB 3PXUA 4X1YB 1P18A 1D0VA 1E8MA 1K5PA 1W46A 3VR4H 4NI5A 4E15A 3K6SB 3L79A 4FYIA 3URMA 1AQLA 3TGPA 4U7JA 1YA6A 3O95A 1P3DA 4EI8A 2BGMA 2PVCA 3F4LA 4B74A 4XX1A 3E7XA 5D5PA 4DRYA 1AXRA 4RNCA 4DCJA 1F2TA 3DM9B 1JG6A 5FA6A 1PR0A 4CMBA 3I9NA 3I1FA 3BGWA 3LCCA 1VJ0A 2RKBA 3NWBA 4GNKA 3K16A 4KWEA 1CQJA 3WLNA 1SKUA 5KWJA 1V37A 1NW4A 3I30X 1QRDA 4TN1A 1WZEA 2H3HA 1JR3D 1PQUA 1JPUA 4N47A 5DYYA 4XWKA 5JSZA 4P3NA 5ABPA 5L51A 3LM8A 3RAPR 1EGAA 2PUAA 3W05A 4HAIA 5ECWA 5KJCA 1VG8A 2AFIA 4OB6A 4KZPA 5D6NA 1XZHA 3DOOA 4YYEA 3IP9A 3C3YA 2O6LA 4QNRA 4BMDA 5I8PA 3W5CA 4MX8A 3ZGLA 3NCTA 5GIPE 4LDRA 2C9YA 1EB8A 1TF2A 1UT6A 2R7AA 3KD3A 1Q14A 3KOYA 3MGAA 3N5CA 3R5SA 10MHA 4AN0A 1D1QA 1II8A 1MO5A 2ZS9A 3PPIA 1NV9A 3HO8A 1QBKC 3I73A 3TX2A 1ISMA 2P2NA 3AM5A 1F14A 4D2IA 3TNJA 4NOLA 4MRMB 4DWVA 2PTGA 5HJ2A 3RVBA 3MXOA 4WLOA 2EL7A 4QVKA 2DBRA 3DCIA 4OGLA 3RB8A 3KSUA 1Z5WA 3SNHA 3T5CA 3QBVA 2AFIB 3OTWA 1Q44A 3EH1A 4TVOA 2NU8A 3HFRA 4PHGA 5AW5A 1AQJA 1JV2B 2VHVA 5CA0F 1CR1A 1ZUHA 1B73A 1J24A 4GGMX 2ZIXB 4NCKA 2IS2A 1BGWA 1CVLA 2X1VA 2WVAA 4EW6A 4W9RA 5KVSA 3TSYA 4N3NA 4MV8A 3EZNA 4U7FA 2XGOA 3DDNA 4I3GA 1RLJA 4FUTA 3V32A 2W2XA 4B3RB 2RGUA 2OAEA 4LF8B 2XA2A 3FMPB 2HLDA 2E4ZA 5D6OA 5G3YA 5LUAA 5K20A 1VIVA 2WMYA 1PP4A 2PFKA 4KFUA 3S2YA 4AY4A 2A4KA 3W9BA 1E4EB 5ALIA 4EHJA 1PQPA 1KH3A 1IHYA 1O96B 4RM2A 3OLZA 4U7WA 3TYXA 1T3TA 4PYLA 2QP3A 4DC9A 2IYUA 2RHMA 3NH9A 3G9XA 3FCSB 3P5BA 4FD2A 2NUAB 3UHJA 2JLUA 2GI4A 3QXJA 1XU7A 4AYXA 4CLOA 1EUCB 4UFNA 4D9MA 2D59A 1RRVA 4JL8A 4ISCA 4LWPA 4PLVA 1UWVA 5A03A 1RYEA 4KJXA 4DDUA 2PWZA 4PRZA 5KPJA 1QSGA 5HS6A 4JL6A 3KQUA 1FVOA 4IS2A 1Q2XA 4PQGA 2KS6A 4YHBA 3TKYA 3TW6A 3WRXC 4AMUA 4D42A 4UMFA 3GAMA 3NIWA 3UQZA 4F3KA 3PJEA 3V2IA 2J9YB 2QY6A 3FHOA 2DQ4A 3WIVA 2JARA 3VHXB 1O2DA 4YMVA 1A9SA 4YJ3B 1D8TA 2OXCA 4MZXA 2CN1A 3ZJVA 1T1EA 2DAPA 1BYUA 1Z6TA 3ZNNA 4HUQA 4DEVA 2GK4A 3RAGA 2D5LA 3HUEA 1A72A 2WW8A 4D4JA 4UE6A 5FUBA 1WCWA 4E32A 5BUSA 1MC4A 4FR5A 3O8CA 2PJZA 3CRNA 4FEYA 4E5NA 3VJRA 3NKVA 1YJ8A 5I3CA 2OZEA 4PGFA 3M6AA 3FPJA 5EKTA 1AKEA 3IVXA 4NWIA 3S1AB 3GNTA 4I55B 3PBKA 4QHYA 2YFQA 4NMLA 3OJ0A 3TQFA 4PC2A 1X2EA 3G5MA 1LBQA 1U3TA 5SYMA 2W93A 1CX9B 4QQKA 3WLKX 1ZXBA 4DV1B 4KVZA 1PG2A 2FPOA 2QTRA 2GYWA 4BZQA 4Z4QA 5T3UA 1JZTA 3EAQA 4BO4A 3BXEA 4KCGA 2COEA 4RPGA 2XUPA 1SXJB 4GU5A 4JXJA 2XGGA 4KGZA 5TPWB 3VR0A 5I3ZA 1B1CA 3D7KA 3EE6A 3DUWA 2NU7B 3I5UA 1M2JA 4H7IA 4WA7A 2Z3WA 2MHCA 1WUJS 4XH9B 3TZKA 3IQGX 3VH2A 4ZYLA 4TKMA 3A04A 4O1IA 2P9HA 3WSWA 4YIHA 2HMTA 3UYLA 4E5VA 3F6RA 2YYAA 5EQFA 4CCYB 5JFOA 1YTUA 3H1AA 1TT5A 5CPFA 4DN6A 4N6NA 4LCBA 3HVKA 3NYRA 1Z7BA 1IPFA 4C1BA 5F7OA 5CLIA 1WULS 1WWKA 2ZDQA 4G0NA 5B3LA 1EWQA 2GBFA 4RV9A 2IIPA 1X7ZB 3F3KA 5I9LA 4ZZ0A 4GXQA 5K6AA 4JI8B 2BKEA 4TYPA 3P52A 1K7EB 2GCGA 1HKHA 1V5IA 1VKZA 4W9NA 4JXZA 1UBMS 2H06A 2VQ6A 4YEDA 4DEXA 2EGHA 4IV0A 4G1VA 2FH5B 1Y1RA 4FWTA 1XX6A 1ZJZA 2Z5GA 1EUZA 3GV0A 3OFSA 3ZPXA 3ZV3A 4EUHA 4FX5A 1DBWA 1TYEB 1FOEB 1HTTA 3WBFA 5AK0A 4NJMB 2Z4RA 4EM6A 3B9QA 1YASA 4L76A 4GNRA 2ZW9A 4TKVB 5LP6C 3VSAA 1GZ5A 1Z5ZA 2BAGA 2AFRA 3PJDA 4Q7JB 1LPMA 3ZBQA 2JAXA 2EFCB 4HB4A 4OX9Y 3P4YA 4BC1A 1TT7A 2R8XA 5C9ZA 1LBTA 1IK6A 3CIOA 3WQBA 4QOSA 4P34A 2IY9A 3PDUA 4QE3A 4Y2XA 4AKHA 5C1PA 2GTHA 3P45A 4OHFA 1C2YA 3SLGA 3ZJ5A 3ONWA 3GA5A 4CKEB 2Y1OA 1F8FA 2XWSA 1OAKA 5KO2A 3G13A 1UF9A 2GAOA 3SJ7A 1YNOA 4ZYVA 4GBJA 1M2FA 4HJRA 1YS4A 1KORA 1Y8AA 2Y1CA 5D7NA 3HKBA 1UK9A 3P0RA 3ZZ1A 3D3WA 3CBQA 2Q9UA 1YK0A 2OFOA 2FVYA 1RM5A 4HZUA 4GI1A 1TO2E 3BMQB 1NBAA 5LLSA 1XLVA 3O83A 1PL6A 3KT6A 4W5WA 3AONB 3DT6A 2Y1DA 1CUXA 3EMKA 4M9SA 4NE2A 4QYXA 2XDAA 1G3IA 1SC4A 3H3JA 3L8DA 4G0MA 5FF9A 1HDXA 4CHTA 1I2ZA 1OVGA 2WJ3A 2JG3A 4RH3A 2HZBA 2J4CA 5AOVA 1ZM7A 1DKNA 3GAFA 3B53X 3DFUA 1WCIB 1MRSA 1YRHA 4C7BA 2YZMA 3PT5A 1IY8A 1DZIA 4XLZA 2FRVA 1JT2A 4NZYA 5FYDA 3CJTA 4BV2A 3G7UA 1PCXA 1KEZA 3B6EA 2N1BA 3HGTA 1Y8QB 3TBKA 4ZRMA 2AT1A 3SYKA 4BOYA 4U02A 4YMWA 3U09A 4O2LA 2I6FA 3DUFA 1ITZA 1HTWA 2ACKA 2P4HX 2Q1XA 3E1GA 4WZZA 5SZKB 4PYOA 2CV1A 1AY0A 2AFHA 3GJ0A 4HB2A 3ZYZA 1GUZA 2UYHA 3WHKA 4GX0A 4JIMA 2Q9AA 1P60A 3DE2X 1Y4ZA 3PRJA 3RSZA 5DN6D 4AQ7A 4UXHA 2QUJA 4WCDA 3CEAA 1YGPA 4JD5A 4BYGA 3O2SB 2G67A 3WWCA 5E8JA 1RBMA 3DYIA 4PSVA 4H3VA 5E6SB 4BFLA 2YJNA 1Z39A 4ZVQA 4P22A 4US0R 4CCSA 4DLVA 3U5TA 5IJ0A 4RJKA 2Z04A 4PRLA 2OKGA 4EX6A 2QTGA 1CEQA 2NAPA 1MUUA 4B3BA 4U6QA 2BE9A 4GP9A 1P3JA 2ZZMA 5AK3A 2YMLA 4BXOB 4NJOA 5KHOC 1ZNYA 3BHNA 5DULA 2PX2A 4MCIA 3KR9A 3UT6A 1ADJA 1GPDG 3IVMA 5ALUA 3TR5A 1VIDA 3I3SR 5CHEA 1NVUQ 1EDBA 1O77A 1P4GA 3WP0A 1WMAA 1ZA1A 4YP5A 4AS1A 1LJUA 1E3WA 1E1YA 2C7GA 4I55F 5EWMA 3GUYA 3WYNA 4KFTA 4H1TA 5D85A 3TDKA 4R16A 4DJFC 1ODJA 3PGKA 2J67A 2PL5A 3WNZA 1UZAA 2GFIA 2B7CA 4B80A 2YINC 3MM4A 1V95A 4LV8B 4EY8A 4RTPA 1XT6A 3ZE8A 1IXRC 4DOMA 4IJ6A 3EG5A 2M1ZA 2QNIA 2XOKD 3N7TA 1R4MB 1J2JA 2DTXA 1IRXA 2C2MA 4BNYA 2IWHA 4GIBA 2JFQA 5CDHA 1SKMA 4BUCA 3JQ9A 1RWVA 4DQXA 1BXGA 5BRJA 4BEJA 1GTJ1 4EPVA 1XZQA 4D9HA 4RHTA 4Y2JA 1NRXA 4N0PA 3U1BA 2QE7A 4IHQA 1NP3A 3D2AA 1RI5A 3LSTA 3IHTA 2Z57A 2IDZA 4X6UA 2IK8A 4RDXA 1GHTA 1X7YA 1QIKA 3DPSA 3JQRA 6LDHA 1NRJB 1VPDA 1DFIA 1KFJB 2PFSA 2FSSA 4TT3A 3JYPA 5BSGA 1SURA 2PX6A 4OP3A 2A0FA 3ZWXA 4Q1BA 5T57A 1HE1C 2XR1A 1QPZA 1WOMA 2D6FA 1EFUA 4NAVA 4UEQA 1HYBA 2HA3A 4V0LA 2AHOA 2QD3A 2XBMA 2AMFA 4MB0A 3T9BA 4N7MA 4Q3OA 3CUTA 1JXOA 4EFLA 3WWEA 2R48A 1RAGA 1Z6ZA 3FWPA 4YXWA 3S8MA 3ISTA 2WQ7A 2XH8A 4AJIA 1ZIYA 3DHNA 3V7UA 4RQUA 5AKHA 4B81A 3ILYA 5KBYA 5CB4F 4OQPA 1VG0B 1O95A 3OMLA 4F5EA 4TXLA 1KJ8A 5BYBA 5F3DA 4PG6A 5BSTA 4L22A 3IAAA 4L5AA 2OSBA 4I8XA 3LX5A 2ZWIA 2NSYA 4G4IA 1QLJA 1VDMA 4UTXA 2AJBA 5ALOA 4IO0A 3H8VA 3TXXA 4A6PA 5JZMA 4JU8A 3OQVA 4LI0A 2CWWA 1USUA 4PM4A 4ROSA 1E5DA 3D5EA 5JJ5A 3BXHA 2OQ2A 4Q4JA 2FPIB 1VL6A 4CQMB 4EBBA 2QR2A 4Z4CA 3WKAA 2OBBA 2GZMA 3NQ41 1JB1A 1PUIA 4X8LA 5L3SA 4BNFA 3EQ9A 4KO1S 4BVKA 1XP8A 4K6HA 5D3MA 3AQ4A 5CAEB 3WIEA 4C2BA 2VIIA 2DQKA 3L43A 4PR0A 1PZNA 3PLAE 4E4YA 2Q2OA 4GBMA 4J9UE 2W90A 4TSFA 3WOVA 5BW4A 4Q18A 2R6FA 4RDIA 1FK8A 3AL0C 3TSAA 2QOEA 3TZHA 2PH1A 4P5DA 1A71A 1W44A 4AZVA 2K7FA 3JATA 3JD0A 3RJ9A 3WRWA 3ZLUA 3IE1A 1BDIA 3LOUA 1RSZA 1V8DA 3JQQA 3TNDA 3HY4A 5EPOA 5DTMA 3W6PA 3IEMA 1KI1A 1ODSA 1J0CA 3EVZA 2GGSA 4Q03A 5KQLA 3G2MA 3IXLA 3R9KA 3NAZA 1EVYA 2J9XB 3U80A 2YRFA 1C0IA 1RLUA 2F1JA 4J0FA 1X7ZA 1TEZA 4UBIA 4BY9E 1N5KA 4O08A 1UBRS 5JD6A 2A5YB 2CJWB 5BT9A 4MI9A 3VZBA 5KWEA 3QELB 5DB4A 5HE8A 5TNXA 4MAFA 4E2FA 5DNUA 5KKAA 1JEQA 1RPZA 1M75A 1ISIA 1Z7YA 2FF5A 3AR9A 5FFMA 3G88A 5CCDA 1Z0FA 4DDKA 3ZNPA 1CQIA 1CUHA 1SC9A 1SCAA 5JW6A 3OHMA 4OQNA 1UODA 1VL2A 1UXKA 2OMKA 1J22A 2ZJ3A 2DFPA 3KQPA 3Q5GA 4EYSA 2AQKA 4KXMA 3AH8A 5C7LO 3AJEA 3OF3A 4HVTA 1U2PA 3E1SA 4MGZR 5ESXA 5IJ9B 3WHPA 4LCJA 2JFBA 3DEJA 3MF4A 1J9GA 2IYZA 2Q6VA 2DWPA 1ADCA 4Y6QA 2TMDA 3ANMA 1I6WA 1V0JA 2GVZC 2IGTA 2BE7A 2OFXA 2BFCA 5T6MA 4C4ZA 2NU6A 4IOJA 1AQNA 5F9MA 1E6UA 5TMEA 4I2VA 1ZH8A 3EVDA 1FDIA 4IXDA 4EHHA 1U8EA 1BVUA 3PU6A 4J4HA 4Q3DA 2I4LA 4RIGA 4Z3DA 4QRDA 1B2RA 3AEKB 4DT1B 2ZIAA 1XWWA 3CZRA 3WMWA 2FV8A 3EWSA 5TPZD 2G8NA 3R7LA 4RVNA 4C0LA 1PJZA 2CL0X 2H5LA 2HCFA 3ETNA 3K1AA 5DP2A 2ECFA 5FBRB 3STYA 4YRZA 3EXEA 4L9AA 3DPIA 3FLAA 4PFQA 2RHLA 3ET5A 1HRDA 4KWCA 4QXQA 3MB5A 5HG0A 2LUOA 4R0MA 2CXNA 2NVBA 4RK0A 2NG1A 2GEJA 2XAUA 3NB0A 4ZQEA 2QI9F 1VMKA 3AI1A 1EFLA 3GRAA 3M1YA 4Y6SA 5EJGA 3ZU2A 1HWYA 1MJ5A 3ABSB 3OUUA 4QBHA 1RXUA 4GWLA 1E1CB 2XUFA 4AX8A 4L7VA 3LOQA 4OJYA 4R2LA 3A8TA 1M1YE 2BMAA 3STTA 3W6UA 2BHSA 2HRCA 2ABWA 5FPHA 2P3LA 2BMJA 1CY8A 2EFHB 1CIVA 1QB8A 3D0RA 3DE1X 1DX4A 2HZ7A 3AUJB 3LI2A 3JZDA 1YC2A 4GVLA 3RH0A 1M6WA 4BB6A 2W58A 1LC3A 4OBXA 4EG0A 3OKAA 1F4PA 5EZYF 5A3SA 3C45A 3ZHSA 3NHUA 1NXSA 1ENOA 5CX4A 1Z47A 4DANA 2CCJA 1I7SB 4FHCA 4ALMA 4UDOA 4BNMA 2HQRA 1GEEA 4CQMD 4HVAA 4JDUA 1TT5B 4NOKA 1TF5A 2AUMA 4DBVO 5KVQA 2Y3IA 3T3OA 4PPYA 1U8ZA 4NH0A 1VSVA 3UYKA 2IF2A 1BGXT 2H7XA 1ID1A 1N9ZA 3GFPA 4CMEC 2C2GA 1EUQA 3KPVA 4MINA 2OFPA 2E55A 2PH7A 4XPIA 3GDWA 1JDBB 5IK2D 3F6BX 5JXIA 3PHBE 4OK5A 4H7KA 5THKA 1KY3A 2J3LA 4PZUA 4HGOA 4BP3A 2ZUBA 2W8BB 4LVOA 7GPBA 5KTRA 3ZY3A 2YOHA 5EHIA 2MSWA 1SHKA 2F4VB 3WJAA 2G25A 1C81A 1B6SA 3A2LA 3ZD9A 2BBSA 1RZRA 2BGWA 1F9AA 1YTLA 2C5HA 5F4ZA 1E3IA 2E4VA 4X20A 2V5UA 5IKXA 4RW0A 3X1WA 1E5TA 3T7JA 3AI2A 4IVPA 2MYNA 3HBNA 1KTIA 2YQ5A 2CDCA 2WUGA 1DRKA 1VP9A 3ROFA 4EJ0A 2XQVA 3FVQA 4F1KA 4IWNA 3I04M 5CU7A 5MDHA 2V03A 4PSKA 2WSYB 3CR7A 3RVOA 4CFYA 1O94D 1K6XA 3HXPA 1WB6A 4R9UC 5U1PA 4BVAA 2HPHA 2CFCA 1YFLA 1QRTA 3FFTA 5JS8A 2IYLD 1JSRA 5FV7A 3JRXA 3FI0A 1OTYA 3LP6A 3QSGA 3ICOA 1KBQA 3QUBA 5TEWA 3CN9A 2R4UA 4FBMA 5HRCA 4RLHA 4GQAA 4X62B 4HHEA 3IKMB 1H05A 4HRXA 2FPUA 1GQ2A 4CMCA 2VXCA 3JZIA 3B6IA 5AWFC 1A0OA 4B6PA 5KVVA 2R7LA 4AJNA 4G5QA 1BO6A 1I5RA 2QS9A 3N2YA 2APJA 1Z12A 5EE3A 2WKSA 2WKRA 4GYKA 2FPPB 2RK3A 2AC7A 1G7RA 3ROKA 4DDTA 1JQDA 3NHKA 2MWMA 1KR2A 1O96A 1V1RB 5JJIA 4MWTA 5CM2Z 2HH9A 1SG6A 2G09A 4OYHA 3OA2A 1H9AA 2DH6A 1UIRA 3GLHB 2WB4A 3UT5A 2Q49A 4L28A 4G81A 4Z2YA 2Q6LA 3GHYA 1Z88A 2QM3A 3EEYA 2QPLA 3M82A 3AVYA 3AIIA 3CWQA 1YZVA 3CF4A 1KH1A 5LM3A 5C8YB 2XKJE 2FXIA 2IH2A 3BGOS 3D2BA 4MDHA 4Z1OA 4BO8A 4CMJA 1GTG1 5SICE 1S4QA 1HF3A 1R8YA 1YVUA 1D6JA 1M1YA 4G01B 4DARA 2M9MA 4FT4A 1N5JA 1GOTA 1P19A 1Y7HA 4DQUA 4O5OA 2MYTA 4UM5A 4V03A 4YI5A 1CQXA 2GRJA 3EPJA 4K9LA 1WKBA 2QX6A 3IT1A 5JIBA 1QYDA 5HNKA 3QMWA 1WPXA 4OLJA 4Q9DA 5DW0A 5EWJB 5FA8A 1I4OA 3HP7A 2H2GA 1R0RE 4DLRA 1IIRA 2PUJA 1N2XA 3N3BC 3DZGA 5FTJA 3UFXB 1ZRMA 2VSXA 3RRNA 1QH1B 2WSMA 3PFKA 2PNJA 4YJ3F 1N8NA 3AETB 1Y1LA 5IH7A 4H15A 2MSEB 2ZJ2A 4ND4A 3ND6A 3QU5A 3MTQA 1JDZA 3UAZA 1EVQA 4XTCS 4X44A 2VAMA 4CEIA 1CP3A 4HQ6A 1QV6A 1P4AA 3BSSA 1MGOA 2VNSA 1H1DA 1JALA 2J3DA 4Z9YA 1UXHA 2NQTA 5I8WA 1H3FA 2CUTA 3AXSA 2A9KA 4HWKA 1NJ1A 1WIWA 1PQYA 1XJ0A 5AJZA 4XRGA 1G2IA 2B92A 2XI4A 4GZ5A 4D99A 1QYRA 2VJAA 2VNAA 2GHRA 3HCEA 1LB1B 2JEOA 3UAXA 4JI2B 3K30A 3QPCA 1NYLA 3Q98A 4TV9A 4YA6A 4XUEA 5JAQA 4FMBB 3TM5A 4ARCA 1X3LA 1J5PA 3BJZA 3MGBA 4BX9A 4NV3A 1GU0A 2VHJA 4GM1A 1XMOB 1DJMA 2C58A 3KTAA 5JD3A 2FFJA 1NDQA 2E5WA 3IV9A 4YT4A 5LFAA 2NUPA 3WAGA 1DKOA 1Y82A 4JJKA 4ACAA 3FKJA 3Q3CA 3A0RB 4MIYA 2BSAA 3CW9A 4QUAA 3CEJA 4ZU1X 5CLFA 2HL6A 5HIKA 1IOZA 2C0CA 4GOKA 3CT6A 2P9CA 4RTQA 3I6BA 3LQQA 2YNMC 3WL8A 2QLJA 1XK7A 5B64A 4PHHA 2FRXA 2R1ZA 2Q45A 4ZD6A 2MYUA 4RACA 4DDHA 3PTAA 2NX2A 2W48A 1OW3B 3CKYA 3Q1KA 2ATVA 3BDVA 1KYIA 2GA9A 4W9NC 5LBIA 4F71A 2BT4A 1LZKA 4LUCA 3ADDA 1ZZEA 2XBLA 4FINA 1ND6A 1C7QA 4F1WA 3BG5A 3S2SA 1ZP6A 1TPYA 3GEHA 2VJKA 4LRQA 4M0FA 5HOQA 1JFFA 5B1EA 2I29A 1LVHA 2JGJA 4F11A 2ZI4A 1JJAA 4DV4B 1VSBA 1P31A 2ZI3A 4DQLA 3EGXB 3RHTA 3AINA 2XT9A 1YNSA 3KB6A 4UQPA 4PNEA 4CLEA 3E3MA 4CTJA 3TXAA 1ANKA 2A94A 5DE3A 2I6TA 1O4WA 1SH7A 2WWTA 1OILA 3W2FA 2PPLA 3OD1A 4BB9A 5EIEA 1EXVA 1Q1ZA 3EK2A 3T3EA 1YV9A 1RVV1 1Y9JA 2REBA 4ZVLA 4P3XA 4JLBA 4KIUA 3T3MB 2AWOA 1SVUA 1OT3A 3G89A 2FPWA 3H6GA 3KYCA 3P4UA 3QOFA 4RDHA 4FWBA 2RE8A 4BJ5A 3QU7A 1P2UA 1QHHA 3B82A 3PEVA 5FD8A 2IDJA 1S1CA 3IKTA 4H59A 2VAXA 3CLKA 4PYNA 5JO9A 5KWIA 4X90A 1PUJA 3EMDA 1QCCA 4ZCLA 1C0EA 4HYTA 4HRVA 5I4IA 2DYKA 1Z38A 3QUAA 3X2EA 2P0AA 5AW1A 4AZ3A 1DWPA 1IXYA 4QQ8A 2NT3A 5LZ5A 2FK8A 1G20B 5DCLA 2A9RA 5E7IA 1MW8X 3JASA 5A62A 1CB7A 2GBGA 3TLGB 3W4IA 3K71B 1GZ4A 3QX7A 5T3YA 4C3VA 3BIJA 1FU4A 1TJ5A 1L7PA 1KZ6A 1ZBQA 1LF5A 1LPNA 2ZB3A 5IVPA 4FFBB 3DS8A 2W4IA 3NGLA 5C4GB 4I8DA 5TXGA 4C01A 5E6UB 5ARDA 1NATA 4Y9RA 1TC1A 2O2CA 5JDCC 1UXJA 1S5PA 5CVDA 4ZQIA 1ECFA 1NONA 3TTUA 1NQWA 1DARA 2DCUA 1Q95A 2GZ1A 2HRQA 4QOIA 4CN9A 1UMDB 3HBMA 3BMQA 4I4TA 3H9CA 3EQ7A 1PJLA 1N6LA 3GARA 3K8YA 3SLKA 1CS4C 4N12A 4FCVA 3MFQA 1QHEA 4HDRB 1K08A 1MDFA 1KYWA 1ES9A 1U2ZA 1W9HA 5EP4A 3E2IA 5B2FA 3N7AA 3H6HA 4PS0A 4FFWA 1ZD2P 2O2XA 2Y1XA 2E0IA 1ZD1A 2IPNA 5CA0B 1VG1A 2QJRA 1FEZA 1YZQA 4XQEA 5DSXA 5AQ1A 1RABA 5JRZA 3ASZA 2AXQA 2JFXA 4M0UA 5B58C 1R6AA 1ZYUA 4MV6A 4ZOLF 3O8DA 2ZT5A 3GJXC 4RULA 4BPBA 1KYYA 4J4TA 1E79D 1VCNA 1SMKA 4GWGA 5HVNA 1C4WA 2OO7A 3SVZA 3R3ZA 4EK9A 1V16A 4RMJA 3KYJB 3LYHA 2J9ZB 2Q8QA 4H6PA 2BP7A 1QG4A 3COYA 4CKYA 2F1IA 3KZ1E 2XSZD 4IJQA 1ZR4A 3PR1A 1J70A 1A5BB 1TM5E 2IX9A 3ENKA 4TKUA 1SCIA 1ZA2A 4G1EB 4GGPA 3UCXA 3GFSA 4ZAWA 3HBJA 3AQIA 3E7WA 3SYLA 3EPKA 2FZ5A 2BEWA 3QKWA 2JGKA 4MEJA 2NWQA 3ET4A 4IFBA 3ROGA 2JH8A 2YUTA 2J3HA 4HP8A 3WGLA 2GN6A 3IOCA 3SC6A 1QQAA 3EARA 1LD3A 3KFVA 4O25A 4MLPA 4Q15A 1OFUX 1LLDA 3JR3A 3E7PA 3T1HB 4UULA 1EGMB 2D4HA 2P2DA 3HYCA 2ZJ4A 3OZRA 3NHBA 4MWEA 4DA9A 3GA7A 3IQDB 3EEIA 5SYAA 3HU3A 3AVVA 4FOOA 1N92A 2G6TA 2JGMA 3DZ8A 1UBTS 1Y37A 5DHRA 3TTXA 4X7PA 1SC3A 2QGZA 1FTYA 3DAYA 3W4JA 2VPTA 4DILA 1TLTA 3UJ3X 4P5PA 3AFHA 2YHBA 3ZJYA 3CNHA 4MVJG 4A5OA 4IIJA 4KX5A 2VSNA 3F49S 2AFHE 2R8RA 3RYFA 3GLFE 3QKIA 2DXIA 5A1JA 1EAYA 5CCEA 2CKDA 2QR3A 3BCUA 1PYDA 4IDCA 3E82A 4S1VA 2YZNA 4MS1B 1EJ0A 1E79A 3KVVA 1EHCA 4CUZA 2XDYA 1HQKA 3FB1A 3JARB 1J8FA 1DWUA 3KSZO 4UHBA 4WUVA 4Y2QA 2XITA 3RK0A 1DKUA 4DCCA 3DMTC 4WGGA 5L40A 4WLFA 3U16A 1BA3A 1RFGE 4RCZA 5H5JA 4C22A 5KNDA 5CH5A 1MW9X 4DHEA 5GONF 1NVMB 3B13B 3GLUA 3H9QA 3P26A 5IBCA 1EINA 1JP7A 5JWRA 3C1AA 1V3VA 3FIJA 3HLTA 2R00A 4LBVA 1R5OA 1B74A 3O2QB 1J1ZA 3CPSA 1OA0A 3RAJA 2NO1A 3PHCA 4RF3A 1OI7A 1CJTC 4KRFA 3RFTA 4O4LB 1E1DA 1Z8HA 4Z5XA 2HJGA 4M21A 4ZAVA 4AG3A 3N70A 2Y0DA 4MVWA 4C21A 1WDKA 4V0NA 4Y0NA 1AMNA 5BUQA 5F5NA 4CV2A 5YASA 3JQDA 2NN3C 4BBJA 3KXPA 3LMKA 2Z9BA 4IZIA 4QUGA 5CVCA 2WF6A 1E9EA 5JSZB 2HRZA 3EVEA 1U3CA 3BTSA 3VHXA 1WCYA 2HJVA 3H9JA 3ONVA 2QPTA 3TX6A 4S3MA 3P9SA 2XYQA 2PLRA 3BUSA 3FCEA 3REGA 3E15A 1A27A 3I4FA 2AOTB 3FCXA 2KLBA 4TUYF 4WVFA 2POCA 2DWOA 2I4NA 3ACCA 4Y1RB 4EI9A 4CETA 5MF6A 2YOGA 3DEYX 3NIDB 2PJRA 4DMMA 2QM8A 4LFBB 1FDTA 4XQGA 1PN3A 1T2EA 1Z75A 3QU9A 1T8UA 4MUNA 2D5AA 3SJBA 3ZV4A 2J5QA 3S28A 1DKPA 3MRSA 5KJ1A 3E9QA 4BNZA 1M2VB 1IC6A 4P33A 1FUYB 3G2KA 5CFZA 3QXHA 1XZIA 4ITRC 3WIBA 1QO9A 1BKDR 2X2PA 3LBFA 4I08A 3THWA 1SVMA 3E48A 4DPKA 1KAOA 4JC5A 4ZTZB 1G4AE 3ANYB 4DF3A 4RABA 1S4MA 2VDWA 3RUCA 4LSZA 1A1SA 2X8JB 3DBIA 1BRMA 2B61A 1XCBA 2H1LA 3DL7A 3N05A 3QVOA 2JGFA 3HKDA 3S7TA 5FOQA 3K31A 3OQIB 5CGZA 5TEVA 3C5EA 4HQFA 1RZVA 2V7XA 4DLUA 4C7KA 1P5JA 1UDWA 1V3QE 2WTXA 1VCMA 3RROA 3VNUA 1CRZA 2WKWA 4F85A 3PC3A 4KLCA 3FHTA 2J3EA 2NU8B 4BLSA 2HU2A 4P7BA 4CF5A 3PWKA 1HT3A 3JTMA 1XVIA 3ECSA 3PD0A 1A2QA 3C87A 3C6YA 3DTVB 5EXTA 4B4KA 3Q8LA 5C3UA 3OIYA 2YWXA 4JX8A 3VV2A 1JVSA 3T34A 2B2XA 1DAPA 2C03A 1JG3A 1H0SA 3EXFB 4LDJA 4BE9A 5DM2A 3MT8A 4V0SA 2H57A 1WX1A 3QVLA 3ETDA 5ALKA 2V4ZA 3H3XA 1X7GA 2ANBA 3PFWO 2WG2A 1KRWA 2O1SA 1EAMA 1ZGAA 1P4HA 3ENVA 3DHVA 4OMUA 5BSFA 4B8WA 3P0IA 4QUKA 2V1UA 1NBHA 4KIGA 3KJNA 2HM7A 1Z4QA 3HJGA 4FGUA 1QUEA 2OLEA 4JVLA 2H2IA 3R7WA 4TWZA 4D4MA 4MVXA 1WLYA 3QVSA 3SQLA 1SQ0A 3VX3A 1D5WA 4Y3UA 1TK2A 4KQ6A 1SXJE 4BASA 1DAGA 3GJ5A 4CQLA 1QC5B 2D2IA 4D3SA 2O05A 3BBLA 4XPZA 2Z98A 2HF9A 2OUIA 4ID9A 3VR6D 3FJ1A 4BHTA 4F9FA 1L0BA 3G85A 3ZBUA 1U7HA 4JYAB 3IO3A 3VKHA 4I9GA 3LZ6A 1U0FA 3MN1A 3MUOA 3CVYA 2UXCB 1TFUA 1XCOA 3E03A 3GJ8A 4LE1A 5K99A 2XV1A 1EWVA 3OSUA 1WY5A 3KQOA 4QQRA 4I66A 3CUKA 4LK2A 2H2HA 4AUKA 1JL3A 2H31A 1TVCA 1YULA 2AG0A 1O5TA 2HOQA 2FCAA 2NOAA 1RM4A 1V8BA 3BDIA 1CUJA 3H8JA 4MHOA 1E3TA 4OYYA 1XZLA 2VHXA 2B3TA 3JD1A 2WU0A 4IDNA 2BFAA 3DTYA 3FIUA 4KQ9A 1GA6A 4OI2A 1RWKA 1BN6A 1S7CA 4H08A 4D0LB 5FHQA 3MTEA 1QIJA 4J9VA 4I1YA 3B6MA 1ZS9A 2WNHA 1XL1A 2QRLA 4Z49A 3GK3A 3I9V6 1I30A 4LJKA 5GV8A 2J32A 2HY7A 3OCZA 4RK7A 2W6IA 1E7QA 1WOYA 4I5DA 5JALA 1E9RA 4QDOA 1ZVMA 4E4TA 2RARA 3I58A 1XTIA 1EFPA 1U7DA 1QH1A 2P9EA 2I6UA 3TW8B 3K5HA 4RD4A 3OEHA 4Q9HA 1VSUA 2Z8ZA 3HR4A 4OPMA 3L7IA 2PVPA 3TVDA 5CLJA 2C31A 4B44A 4OU5A 2X5XA 2GESA 3EGOA 3WMRA 3OJOA 4H3SA 1OJLA 5EJMA 1QFJA 2X14A 1YQXA 2XCUA 5EE0A 2EU8A 1E0KA 2WTBA 2I1VB 4L8YA 4YPOA 3HA5A 1DC4A 2OQRA 4B76A 4M8SA 1H94A 1CZRA 5HGXA 4ZRDA 4WXEA 4RESA 3NOXA 1W48A 4CKXA 4QGBA 1TUGA 5K0SA 3AV3A 1EFRD 3PI7A 4NDZA 5AHKA 3U9LA 1IOLA 2VCEA 4CI0B 5HZMA 2EGGA 4YCAA 1S9DA 2VT3A 4CMHA 5C7OO 2FW7A 1T24A 3PXXA 3FDFA 2SKEA 1NVGA 3FZEA 3GA0A 1ZAKA 2RH8A 4FLMA 3WB2A 2X8AA 3BJMA 2GPAA 4ZCSA 3GNSA 1I6LA 4CR6A 4Z4IA 1RC1A 1A5TA 3LXUX 2FQWA 4AMYA 2A1TR 1H8HD 1UKBA 2L2QA 3DL4A 2JK1A 3K9CA 3QNWA 2W6OA 2FU5C 3I2FA 3RW9A 4BCCA 4FYJA 3CW2A 5BN4A 4LPSA 2CHVA 5B37A 1UQTA 5GPBA 2DFTA 3GPLA 4M0KA 2B34A 2AFIE 4ZU6X 1L4YA 3H5NA 1KOLA 2KI5A 1ZIXA 5JXJA 1DG1G 3C6BA 2WVJA 4F2HA 5CURA 1L5GB 1DRVA 3K72B 3PQEA 4DW8A 2VDMB 1Q7EA 2NUTA 3AKZA 4XAQA 3TLXA 1S2IA 1NAHA 4JI5B 1JQBA 3NCHA 4EP1A 1TLFA 1CRLA 4JROA 3RV4A 4FGSA 2FPXA 5AHRA 3P9QA 3U0BA 2V6FA 3OBBA 5IABA 1ZHFA 2PCJA 4MV1A 1YI1A 5FL3A 3RSOA 3B3JA 2H9AA 1BCRA 2JW5A 3PV0A 4PZZA 3K8QA 2Q8NA 5TQ2B 1Z0SA 2YCBA 3ROZA 3ZXUB 2I2BA 4Z4HA 1T0UA 1UZUA 2JCXA 5BMVA 4MDYA 2VT2A 4RZUA 1I4EB 4DVJA 1JWAB 4JT8A 2ZIZA 4K81B 2PR7A 1VCHA 2GEFA 2OV8A 2PD4A 1MAUA 4ABYA 2IF0A 3F98A 1P1KA 1FS6A 3OY7A 4MB2A 1VHLA 5DM1A 5ES4B 3ZDCA 1FFYA 5I9IA 4PZCA 3SDBA 1ULHA 3GN2A 1UKCA 4EI7A 3HE3A 4CLXA 1L5HA 1SNYA 5D8DA 2D1SA 5LYJA 1YE8A 1Z29A 2O6HA 2RHWA 3E5HA 1KEUA 1WVGA 4DJ5X 2ZBRA 3PHGA 3HP1A 1MB9A 4NTZA 2OYSA 2EHJA 1GT91 1RPTA 3PNBA 3CTPA 3PNYA 3FRJA 5F3WB 4W7IA 1C9DB 4K46A 2WWYA 1BDHA 3EY4A 4RGBA 1Y1SA 3WA7A 1HE5A 3HB5X 3L49A 4LHYA 1VA5A 3OA0A 4YUAA 3HCWA 3GLVA 2QR5A 2CDRA 2KW5A 2Y66A 4X3CA 3K9FC 3TOSA 3ZBTA 4WGFA 2IXDA 5HUHA 1UAYA 1JXAA 3QLJA 3C15C 1PFGA 3FI9A 3V8EA 2VWGA 1BEUB 5KOHB 3GP3A 3DQZA 1ETHA 4RY2A 5REQB 4IDDA 4XJTA 3QVGA 1FLDA 2DPLA 4H0CA 1QGYA 3UA4A 2R6DA 2FFBA 1DJNA 2NGRA 3O75A 5ITSA 5IUNC 2FFQA 3L4EA 2AFVA 4FBLA 2ZIEA 4H7EA 1I33A 3DCYA 1N1GA 1PWEA 2MU1A 1N9KA 2VDLB 4R51A 4ILKA 3OTGA 2IV2X 4DNPA 5BWOA 1RMTA 2H4XA 4R2WA 2Q5OA 2X2EA 1CJUC 1QG0A 3KDAA 4LQ4A 5LQKA 2CF6A 1QJCA 1MAWA 2OBLA 5EZ5A 5DCWA 4M3NA 3AHDA 4F21A 1X9IA 1NXXA 1HV8A 2C2YA 2PIAA 4UUQA 4WKOA 1VJTA 4KQXA 2Q0SA 3RTCA 2IOFA 4PC6A 3VOSA 1CDZA 1M1ZA 4LX8A 4DWOA 1KC1A 4B75A 5BV0A 1DKQA 2JIZD 2PT7A 3EY9A 3VPXA 1SPXA 1L7VC 4ZDWA 1QP4A 4PO8A 3IPRA 5FUXA 2F90A 3EA4A 4Y98A 1OWOA 5P21A 2P9GA 4WD3A 3WKEA 1O57A 3T0IA 2YXLA 1DOAA 3UO8B 3RPEA 2AMVA 4LSGA 2X19A 4AN1A 2W70A 3BL6A 1SD2A 4D3FA 1U1GA 2O4CA 4W8HA 5AYVA 2R1UA 2QW0X 1O03A 2V0CA 4ZZ3A 1PVDA 2NTYC 5EL0A 1JECA 4ZYTA 3FNRA 1S2OA 4OOEA 4QJBA 5GONA 3N53A 2WR8A 3KQTA 3NJ4A 3REQB 4U1RA 4G4JA 1OXMA 4TL8A 4P3OA 3KSBC 3VO9A 3BRQA 2XCTB 1V48A 3FNGA 4YFVA 3LBHA 4F04A 1P1HA 2B83A 2IPMA 1LY1A 3GCDA 4U2FA 5H16A 1Z26A 3N39C 1RAHA 2WU8A 3F46A 4HNQA 4RJ2A 1HQDA 4XA8A 4DHWA 4KN6A 1G9SA 3ZHBA 2D1YA 4URXR 2YN4A 3D3JA 2WFMA 2AEEA 4QXOA 4I6JA 3V46A 3OZBA 3WK8A 3JVUA 2F3UA 3BMNB 1XWIA 2I2DA 4C04A 3KL2A 4ES6A 1RQ2A 2D4AA 5KSYA 1G3UA 3ZWVA 4Y2SA 2Q1TA 4EH1A 2HW8A 3GOHA 3ZHTA 2L42A 1I1NA 5C2JB 2RSLA 3PVZA 4OSOA 4RO0A 2B4TO 4DREA 2DHDA 1Z5UA 1CZNA 3DUFB 2EXXA 2FN8A 3EXAA 3MAGA 3P2JA 4G6ZA 2R7NA 5AM5A 4BAUA 3AEYA 4D4IA 3NUQA 4BZXA 4DMHA 5MGNA 4ZVNA 3ITEA 3NTVA 3C43A 1J00A 3RVPA 1QTQA 1IDOA 1U5BA 1U98A 3HRKA 4BX2A 1TA4A 3BKXA 3PYLA 1FFBA 2JFNA 3M6IA 4J1QA 4TTIA 1GAWA 1KQGA 1I5EA 1FF9A 3GGPA 1C4XA 3UJNA 3F7NA 3P9RA 4OUKX 4YJDA 4Y6OA 4B8YA 5HA5A 3WYAA 1V8OA 4Q4JB 1UPAA 2YYZA