3IBFA

Crystal structure of unliganded caspase-7
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
140
structure length
140
Chain Sequence
TYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7
publication title Conformational similarity in the activation of caspase-3 and -7 revealed by the unliganded and inhibited structures of caspase-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2009-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ibfA00
2FUNB 3GJTA 3BIJA 4EHHA 2P2CA 2K7ZA 4JQYA 3GJRA 4JR2A 3R6GA 3R7SA 4DCJA 3OD5A 2J31A 5H0IA 1RWKA 3KJNA 5IBCA 2DKOA 4QU9A 5IAJA 3KJFA 1M72A 1RHQA 1QTNA 4ZVSA 3IBFA 4IYRA 4ZVTA 2HBRA 3S70A 2Y1LA 3H13A 4HVAA 3DEIA 1SC4A 4PRZA 5IANA 5JFTA 2J30A 2H48A 4JJEA 3H1PA 4M9RA 3UO8B 5IARA 1I4EB 2QL7A 4NBNA 2H5JA 4JJ8A 2CNLA 2J32A 4ZVQA 3UOAB 1ICEA 4EJFA 3SIPA 3GJQA 1SHJA 1RHMA 1RWWA 2WDPA 4N7MA 5LUAA 4EHLA 4JR0A 4QUGA 1NW9B 1RWOA 4IEFB 4I1RA 4DCOA 4QUJA 2QLFA 2FQQA 2C2MA 4JR1A 3QNWA 4ZVRA 1F1JA 4FEAA 3V3KA 4N5DA 3SIRA 1RE1A 1BMQA 3D6HA 4N6NA 4D3ZA 1PAUA 2HBQA 4JJ7A 1I4OA 1RWXA 2H65A 4QTXA 5IAKA 4PS0A 2H5IA 3GJSA 1SC1A 1RWMA 2CJYA 2CNOA 3E4CA 3D6FA 4ZVOA 3RJMA 4D3XA 3H0EA 2QL5A 1QX3A 5LU8A 3DEKA 2HBYA 2CNNA 1GFWA 4NBLA 4QUAA 5K20A 1CVRA 1I3OA 1QDUA 2C2ZA 4D3YA 3ITNA 2CJXA 4N6GA 4QTYA 4EHFA 3V55A 2H4WA 5I9TA 5IABA 4NOKA 2XYHA 4QU8A 4QUBA 3KJQA 3R5KA 1RWNA 3P4UA 2C1EA 4N7JA 3K7EA 1F9EA 4QUHA 1K86A 3EDQA 1RWPA 1RWVA 5IBRA 4FDLA 4LSZA 2QLJA 2H54A 2CNKA 2CDRA 1SHLA 1RHUA 4FGUA 4QU0A 3V6LA 1K88A 3PD0A 3EDRA 3DEJA 1RHRA 4QUEA 1RHJA 4QUDA 5IBPA 5IC6A 4N6OA 2QL9A 1PYOA 4AWBA 4PRYA 2QLBA 4NOLA 4QULA 3R7BA 1CP3A 3PCXA 4EHNA 4AWAA 1KMCA 5IAGA 3H11B 5LU9A 3NKFA 1I51A 4JQZA 2XZTA 4NOJA 2Y0BA 4QUIA 4EHKA 3IBCA 3PD1A 3R7NA 2XYPA 1NMQA 3NR2A 1RHKA 2XZDA 3V4OA 3V6MA 3H11A 1SC3A 4AW9A 4DCPA 3R6LA 4NBKA 1IBCA 3P45A 5IAEA 4PS1A 2H4YA 2J33A 2FP3A 1JXQA 1GQFA 5IASA 5I9BA 4QU5A 2AR9A 3NS7A 4HQRA 3S8EA 3DEHA 4EHAA 4ZVUA 5IC4A 1NMEA 4HQ0A 5LUBA 3D6MA 2NN3C 2C2KA 4FXOA 4NOMA 3R5JA 1NMSA 2C2OA 4EHDA 2XYGA 4ZVPA 4JB8A 2H51A 2HBZA 3V4LA 4I1PA
chains in the Genus database with same CATH superfamily
5CDUA 2QMUA 1CY0A 1EDDA 1SO8A 2A3NA 1ILEA 3V80A 4FWIB 4DCJA 5GIPE 1IM2A 3OSZA 1X1RA 5LBTA 5IM5A 4AG6A 5AJUA 4G1VA 4KYVA 2QJFA 4BGIA 3LT0A 4P7FA 4WT7A 1X13A 3OKAA 4BNMA 1MJNA 5LB2A 1RMTA 2BGTA 1QH8B 4WJKB 1H5UA 4RZSA 5BYKA 4AKIA 3DEIA 1RP1A 2IOYA 1E0KA 2P1ZA 5EG5A 2FPIB 5G41A 4NY1A 1PG5A 2GKOA 1WXGA 2MOKA 2VZ8A 1IN6A 1QO0D 3QHPA 5TRTA 3IUMA 3SLRA 2WHPA 4FOTA 4E33A 1I9CA 3K1AA 3OF2A 4DGSA 3RIEA 1HH4A 1MB0A 1HV8A 1XZGA 1ZJYA 1GV0A 2HA2A 3AKYA 3O4GA 3M5CA 3RRMA 4X9XA 1RI5A 2IU4A 4J7XA 4IUBS 1LV7A 3ZG6A 4ZT5A 4QUJA 1KK2A 2V7GA 1GDHA 4EW1A 1H2FA 4OYLA 4RXUA 3ZLTA 4V0NA 1I24A 3DSRA 4YUXA 5DCLA 5ESXA 1O89A 4CDGA 1H2YA 4DNQA 1LB1B 4X7RA 2FW6A 2ZREA 2FWIA 1NVKA 2OHJA 1OV4A 2GN6A 3BORA 4MCJA 2AJCA 5FL7A 4N65A 1SEPA 2QL5A 1UKVY 3ILXA 4HS4A 4HUQB 4Z5XA 3SDSA 1WW3A 4CQLB 4CQMA 3ESAA 2FU5C 1U8UA 2XKKA 1QVVA 3AFNA 3BRQA 4K2HA 4UUNA 5AK4A 4PZZA 1LSUA 2CNWD 3HL4A 1TKAA 1SXQA 5D1NA 4LC9A 2ZTSA 4M9SA 4U6NA 1XZKA 5GM1A 5I4KA 3PHJA 1PT9A 1ISIA 1N8SA 1N3BA 2C4MA 2FZ5A 1E3LA 5BRJA 2VPZA 4PGAA 2YWBA 2OLJA 4P5PA 5IBRA 3WK9A 1MU0A 4RZHA 1C81A 1SPXA 3KAJA 5HSGA 4RVGA 2AKEA 1AKYA 2YZNA 4D8YA 2GEFA 7REQB 4X92A 4M8NE 2UXDB 1KETA 5LBUA 4LZAA 2P11A 4QTZA 3KEFA 4P3KA 4BNDA 3FIUA 3ORRA 2QL9A 3MMNA 1R64A 1UXJA 2EKBA 2OZPA 4V0KA 1JR3D 2J41A 3EFOA 4FJ0A 4D9MA 4QVIA 2LW7A 4CL0A 4UCWA 2A0UA 2XUGA 3H5WA 3B36A 3K31A 3ZKWB 4B7AA 2JBWA 1GG9A 1RQ7A 2FWNA 5IHXA 2CXXA 4UTXA 5EJIA 1L5HA 2GM4A 5EE5B 3AX6A 4JC0A 4BFVA 5CB6A 1YB5A 3P32A 3UYKA 3ORHA 4YYZA 1N5IA 5FBVB 1DAFA 1J90A 3SQXA 1E0DA 2IY9A 4Q82A 1M5TA 1XVVA 1OFUX 1XT6A 3OUTA 4YJ3F 5K7SA 4G89A 3HTXA 1KVUA 4B8ZA 4WZBA 2QZJA 4BBAA 4E2YA 4ED9A 3C6MA 1U0SY 1A0OA 3WMFA 3BMQB 3BG5A 1LWNA 2VATA 3U4AA 4AZTA 2XEDA 3BK2A 1IN8A 4HJXA 2IH2A 2ZROA 3AU9A 2ORED 2ZRQA 3DXXA 1W0CA 2B4AA 3PFHA 3OE5A 4Y2SA 4F96A 4HNVA 5ALYA 2BF4A 5LP6A 5LZ7A 3PVSA 3T7AA 5AJHA 3ESRA 3SBXA 2OB1A 1XXHE 1HOTA 2QN3A 3LHSA 4C76A 2D0IA 1WD7A 3GEHA 4M8SA 1ORDA 4P31A 2IXTA 3UMRA 2X1VA 2IFTA 3JQ8B 3DZGA 1Z74A 4Y1RB 1VPTA 2WU0A 3HKCA 3HZRA 5AW0A 4HDMA 1A8IA 4BNUA 3JQDA 3TXXA 2HLDD 4WA7A 1KE1A 4QELA 1H4SA 2WUFA 5AMXA 1R4ZA 3WDMA 2ZRAA 4YLYA 1LFAA 4KO1S 2QP4A 1CRQA 1K06A 2D5BA 4LBYA 1LFDB 3AW9A 3DZDA 3KLMX 4CCYB 3EZFA 4ZKDA 3IAS6 1CS0B 2RHGB 4JS0A 4UHFA 3IOEA 2XCOA 2YS6A 3PRYA 3R5TA 1OXMA 1UJ6A 1PCXA 4LDRA 5JWHA 3VRHA 3ZCXA 5F3WB 1RPAA 4YAKA 1T26A 3U3MA 3UN1A 2ZPUA 1R00A 4CIYA 2W6JA 1T1GA 5LQAA 4PPGA 2XCUA 1S1MA 4MAMA 3DLHA 1DAIA 4NCJA 4J0CA 1ZSVA 3KSUA 3PNKA 3AWDA 3WLHA 4M7RA 2HBQA 3IT3A 4X95A 2RG1A 2Q3LA 2XOXA 4BYGA 3WLJA 1DP4A 5K09A 1E7MA 2OO5C 2QD3A 4M1WA 1P0MA 1FSSA 1ZGGA 4IDDA 4AJHA 1NONA 2ACVA 1YKSA 1SD1A 5ES3A 4DT1B 5BN3B 1RYNA 4D3XA 1ZL2A 3MIIA 3DBOB 3DPUA 3E0QA 4RCVA 2H6EA 3DG9A 5J5CA 2VF5X 4MWGA 4QREA 3MBKA 4CMHA 4FS3A 1I2CA 4DA9A 4FYKA 3PQCA 3FPGA 4CIBA 4W9NA 1C30B 1E18A 3V55A 4UU8A 4AD8A 3EVGA 3RS7A 1DC5A 2ZSDA 1ODFA 1MD9A 4NECA 3TAXA 1F8YA 1H6BA 1KKMA 2FZCA 1IIRA 5HKAA 4XZ3A 2O19A 2OHOA 3T61A 3IUNA 3GEDA 4AXBA 1S2LA 1I1HA 3JWJA 4QGBA 2J9YB 3TFOA 2C97A 4MZXA 1ICIA 3IQFA 3U9TA 3RUCA 5D00A 3MUEA 5J4KA 4H6WA 1U2TA 3PE4A 2I6QA 3AJEA 2ZE8A 5CNKA 5JXIA 2Q4DA 3O3CA 4H6VA 5CD1A 1U9IC 1Z4OA 1Y7HA 4NOLA 3BFJA 1IUPA 3DBHB 1C3EA 5KNLA 2WJIA 4P2BA 1DBWA 1HDOA 1XE3A 3D1JA 4EGCB 2PY6A 1K7YA 1QZXA 1L4NA 5JZMA 3PX2A 5DX1A 2BGMA 1SPBS 3T3EA 1JJVA 1PE0A 4EVSA 2AC4A 1E99A 1XIVA 2PA3A 1IQRA 2I2AA 3R6LA 4W4TA 1CJTC 3C2QA 4ZREA 1QWSA 4DEVA 3GR6A 3M81A 3N1UA 3ONFA 1APBA 4RTOA 3BDIA 4BNLA 4RXTA 4UNSA 3OOYA 4Z9FA 1L7DA 2E5FA 3GT4A 4J7AA 2BHLA 1SH7A 3FWYA 2FWMX 3JAWA 4H6XA 2PJZA 3MT7A 1XAHA 5DWQA 4C6TB 5H02A 1TRHA 2ILTA 1TUBA 4Q9LA 5FLKA 4RTPA 1FNNA 3BCRA 5IYZB 2QUAA 3JYNA 2RC5A 3O92A 4HNSA 3UB2A 4B3RB 1G16A 3OCVA 1T1RA 4HFRA 3K0KA 1QB8A 3ELDA 5IJZA 4LZPA 3OT5A 5AVVA 4L0DA 2VPTA 1EB9A 3FYCA 4LDPA 5BR4A 5IJ9A 4JDPA 3UF0A 4JVNA 2C9CA 4FDAA 4JXJA 1R0BA 1BD4A 3RC8A 1MRNA 2QW8A 1XCBA 4WY2A 1U5CA 1LDGA 2CL7X 4M0EA 1LTQA 1WXDA 2HWKA 1W47A 2Q3EA 3DZKA 3WB0A 3RWOA 5H59A 4GQIA 4RS4A 3ZWXA 2DLDA 1RIFA 2W83A 3WHPA 2NTVA 5JAPA 5IXJA 1VJRA 1P1CA 1KU0A 1MF7A 3COPA 1VECA 1D4ZA 3A6FA 2QQ0A 1T6BY 3OQVA 4NBNA 4K88A 2JCVA 1H93A 2GESA 2JG3A 3ZXUB 4C7XA 2RSLA 1KDRA 2HXYA 2G1JA 2C5AA 2I66A 2Q2WA 4IDHA 4PFQA 4N47A 1SMKA 3T5BA 4QLBA 1J8MF 1QGED 4S1WA 5DNDA 2ZATA 3ZGLA 3LUKA 4B6EA 2J3MA 2RGNA 4QD3A 1Y6RA 5K3CA 3Q7TA 3OCCA 1NVAA 4ARBA 1V6CA 3M6LA 1OH7A 5AVZA 5HF6A 4W5RA 2VTBB 5CFOA 2A7XA 3T41A 4DNFA 3EZ6A 4BX3A 4E30A 5JH7F 1HZZC 2H52A 3HFGA 3PGXA 4RF4A 5A06A 2QEQA 2YN4A 4AMYA 3HP4A 5BV1A 4E15A 3EEOA 1YJAA 1X92A 3RSZA 1B15A 4ZGGA 2PUDA 3VGPA 1ODCA 1RKQA 1DIOB 2KLHA 3MGAA 4TTJA 1HYQA 3SGLA 1FRQA 4RHCA 3RS0A 3SF8A 4EFKA 2IT1A 4IGIA 2FN4A 2HH9A 5EE9A 5FP0A 2CDCA 2QM3A 4E21A 4I19A 4RIEA 1QE3A 4RKWA 3DVRX 4DLSA 3L1JA 1ORVA 1YZVA 2AIRA 1R6XA 3WRYA 3IEIA 1H6AA 4KLZA 4Q4JA 2PRIA 4X45A 2FN7A 2EF0A 3P71T 3TLBA 3ZNNA 1I9GA 1XQ6A 4FDLA 3KOWA 1C9KA 3GJXC 3H9BA 2RGEA 3UXEA 2C5HA 4D9GA 3A2MA 2IX3A 1Q21A 1C4KA 5SZIA 5CA1B 1J0DA 1ZIOA 1YCDA 1SWWA 2WF5A 1ZYUA 3WK7A 1KDOA 3CR3C 4C7OA 3CF6R 1T2VA 1JQ5A 2BSQA 4EPVA 2IYYA 3H17A 3KSZO 1HXHA 2DUJA 1YQDA 1D4OA 1JIIA 1PK7A 4WZBE 1P4RA 3UGKA 1OT3A 2HUNA 4L5BA 4QJ4A 3QEBZ 5KKAA 3T1OA 4AQDA 1EX6A 4AO6A 1Z68A 2NT4A 4QHYA 4E11A 5IN4A 4CMKA 1P1JA 1V3UA 1W25A 2GEBA 3RT9A 5JDCA 3OQBA 1LDBA 2EJCA 4YJGB 2CBZA 2FMUA 5AT1A 5KYUB 4PTZA 1GPLA 2Z04A 4A1OA 4FB4A 1KOLA 1OXVA 1P31A 2B0CA 2G17A 3H11A 3HI6A 4MUFA 4XDGA 2GCEA 1K8YB 3HJNA 4C6SA 4L4SA 2Z5VA 2Q2NA 3A05A 3UW3A 2BFDA 5GTDA 2AOTA 1JKMA 1Y1PA 2DJIA 3DL0A 3MF4A 3OLXA 2HREA 3TZEA 3ZWOA 4R71A 4RF5A 2GVZC 4WVFA 1VA4A 4YN3A 1SM4A 3UT5B 3ZE9A 1H3FA 2FEWB 1Z2AA 1OIXA 2O2DA 1KEPA 4N8DA 1T0HB 4G4GA 4UOQA 2Y2UA 4L07A 2Z6QA 4BBZA 5HBRA 3HUTA 3PFGA 5F7OA 4TMFA 1SXJC 3ZY4A 5CFPA 1H2WA 5LSAA 2C5GA 3EXHC 5DI3A 1SFRA 4YAIA 1X3SA 4RK7A 4TWRA 3O8CA 2BGNA 5E7QA 5LCXA 2ONCA 3IQXA 1NOJA 3VU0A 4YRGA 1TM4E 4LF8B 4I9HA 3S8MA 2WMNB 1NBMD 3M4JA 5ILOA 4XQCA 1XHLA 3B1XA 1LPNA 4RY8A 1E2KA 2B69A 3K5IA 3QVTA 2OFFA 1EESA 1DBRA 1O96B 3MOIA 2FA9A 3AZOA 1SVIA 1F0NA 4Y2RA 5EFOA 1HFWA 5EJMA 3RYCB 3C1TA 5CPFA 3HBLA 4KXFB 5I4IA 1AMUA 3H9QA 1PN3A 4Q24A 2H3HA 1GITA 1KO7A 2XLBA 2I2CA 3ND7A 5T5QA 2QRVA 3LBIA 1U81A 5IM4A 3H1AA 1NUHA 2GUWA 4I5GA 1Q7GA 4EA8A 4MS3A 4HGZA 3RVBA 2Q5CA 4C05A 3KSAC 3LH5A 4XQEA 1B8PA 2ZDQA 4H4CA 3S99A 3RFVA 4LXQA 3TLZA 3LX8A 2V6FA 2G08A 1UBCA 2KBEA 3CMCO 5DVZA 1U1IA 5EQJB 4ZEVA 2PKQO 2NZ2A 2VDKB 3ET5A 4X6XA 1XEFA 1ADYA 1K5DA 4K3UA 1UBFA 3WP1B 1LW7A 1WMEA 1H0SA 2XNCA 3A9WA 2OK7A 1FTGA 2IIPA 4PLCA 4CIXA 2QJRA 5ARDA 1JH8A 5DI9A 3MPOA 2IP1A 1COZA 2X8LA 1TZBA 3GZTB 4HEA6 4RETA 3VR3A 3AO0B 2ZBPA 4JL5A 4O08A 4W5TA 3K30A 3RAGA 4MVJA 4CKBB 3GLIB 3ZU4A 4NAHA 5E95A 3ZH9B 4MA0A 3I9LA 1KFCB 3WLOA 2XNKA 4UU0A 4ENSA 3AQ4A 1O7JA 2XMPA 5IJAA 3ER9A 3Q8KA 2FUKA 1V45E 5T8KC 2VDQB 2OCPA 1GY8A 3QHAA 4J2TA 4ZXPA 2NPFA 2CUTA 3Q87B 2ZZKA 3BILA 3EOBI 4IJUA 5MF6A 3WV5A 3ROQA 4B3MB 2J9FB 1SVWA 3AR3A 1EKXA 4EY3A 3OVMA 4Q47A 1ZFNA 3ACCA 3GT0A 1ZWLA 2PX5A 1SZPA 4Y9SA 3CN9A 1HQKA 2OBMA 1JEYA 3JATA 3NIGB 3ZZ1A 1C5KA 2VHYA 3CEAA 3E03A 2YMQA 1KSGA 5I9MA 5KJ1A 1JQKA 1MDFA 3ZX4A 5BP7A 5KUTA 2C8KA 3GT7A 1VC2A 4KLNA 2BKVA 1BVRA 4TWJA 4NTZA 2VHZA 2H7YA 1YOBA 4PANA 2ZI4A 2PH5A 2NZUG 2UZ1B 3B1VA 4RKRA 1XX6A 2VHCA 4ND6A 1SC6A 1ZH0A 3UUEA 4GICA 1I3KA 3ROGA 4CMJA 1Q6ZA 3HYCA 3KJGA 4BFSA 2IIQA 1KJJA 4NCKA 3WO1A 1RC0A 1FDUA 5ELMA 3RVJA 1XF1A 4P38A 1ESNA 2AKAB 3WK4A 2Y27A 3HDJA 4IZOA 1H0RA 1OXBB 2AR9A 3F5FA 4L7VA 5JPIA 3ZIDA 4BNFA 1IY2A 1I7NA 3RLFA 1BO6A 2G9QA 4MUGA 4Q34A 2RI0A 3B7WA 4QJ5A 4Y6SA 2F3TA 2QIOA 2G5CA 2P65A 4QUKA 1RLOA 2QKYA 2RG7A 3FAKA 3JW8A 2VOEA 4RK1A 3VAYA 5ICCA 1W36B 1BXGB 4OGGA 3C6ZA 3IE0A 1BKSB 4KDCA 4Z3OA 3D6JA 1T5HX 4Q1CA 1TECE 3X2EA 1T5SA 2GCOA 4OHRA 1EJBA 4YTEA 4Q3EA 4ZDJA 2RHBA 1DRJA 2JVJA 3QTTA 1WLYA 3K0CC 5A1TA 1KZGB 1QS0B 2X2PA 2HRBA 4LRTB 1ZH4A 3G0DA 1ZR4A 4C0XA 1OX5A 1U3TA 4Y2HA 3S1SA 2B6HA 1X7YA 1VMEA 2XODA 2VBGA 2H48A 4CUZA 5AVQA 2R8OA 2X5OA 4NU0A 1YQEA 4PV7A 4XOIA 4IIYA 3ZTYA 4YT4A 5AW2A 3HXOA 3I5XA 1OIVA 4DPKA 2NUTA 4MUXA 4Q03A 3VO8A 3F74A 3LY9A 3C70A 1E3WB 4YT2A 3HSYA 4FT2A 3BF7A 1SIOA 4Y2TA 1C1DB 2DE0X 1F3OA 1YQWA 1CUJA 1S2IA 5JMTA 3F2VA 1OBVA 2R6AA 4RZQA 4TSFD 4XGNA 2G28A 2DPLA 5A71A 1KXJA 1BN7A 1R5JA 1R6UA 2ODEA 4EHBA 3L6RA 1EEXB 4AY6A 1QBKC 3AF0A 4YR9A 3QHQA 1M2HA 5NULA 1RJEA 5KYTA 2XUJA 1PJRA 3GLVA 4KO2S 4P82A 5B1EA 2ZK7A 4H7HA 1GKUB 2TMDA 1V37A 5T4HA 1U80A 3K72B 4Z8XA 3QF4A 2JIQA 3ED5A 1UADA 2E48A 4FHEA 3HB9A 1HQYE 3KYIB 3WK5A 1BHSA 2PBZA 1PF7E 3KPWA 1A5AB 3L9XA 3O1IC 4LC1A 2LE0A 3ITKA 2BELA 4JROA 5EHIA 3ENVA 3NIWA 2XCSB 4O4IA 1YZGA 1E1QD 1PZEA 2HLPA 2WV9A 2ZU6A 4HGNA 4QYMA 3TLEA 3TOCA 5ECGC 3SS7X 1WTAA 4H9GA 1IHDA 3GLGA 4F72A 2HX1A 3P2JA 1PJCA 5HJ7A 5EIBC 2KX7A 1N33B 3OICA 1NUSA 4KAJA 3SJUA 3L7MA 1UMDB 4I81A 2J5QA 2I2BA 5CDSA 4ZMSA 2XTMA 1C41A 1SUWA 9GPBA 1NSYA 5ICMA 1A5BB 5JXWA 3ZJVA 4CTMA 2J4DA 1MV8A 2XE7A 4I0WB 4P4NA 2O8EB 3FPEA 1QNFA 4XLLA 4EB0A 1DO8A 3EUFA 5I01A 5IVIA 1IJEA 4HLUC 4RW0A 4PF1A 4JWTA 4FYJA 3VYSB 5HJ5A 3HDGA 2J0QA 1ECLA 5HIAA 3W1VA 1FMLA 1PIWA 2EZUA 3FX2A 4AKTA 4I6GA 3O75A 1RCFA 4MUNA 3SY8A 3A1WA 3UK7A 5AD1A 3UKOA 2AUMA 1TLFA 1GNRA 2BVNA 3LS2A 4GMGA 1L4LA 2OO3A 4HH4A 4QSHA 1SC3A 3VR1A 4B76A 4DJTA 3ZV7A 1TUGA 2CLIB 2K4MA 3AW8A 3QMVA 4M7PA 4QAJA 5CIWA 2DGDA 4J4BA 3ZWVA 3PS9A 4RNDB 1C9YA 4BKUA 4E5KA 1U7WA 3I8SA 4S2EA 1ULUA 2FUG6 1RZUA 5L3VA 5K1ZA 4N41A 3EEIA 2GR9A 3OZAA 5DOZA 4JOSA 3AB7A 3ZWNA 1N2OA 1O4WA 1KWGA 3AESA 3CHYA 5EIWA 1D8AA 4J9VA 4X1IA 5CCEA 2FUNB 1PFVA 2O5RA 2JHGA 1GUBA 1K6IA 2ODAA 4EPWA 4U6QA 4FHCA 2C4WA 3UJHA 1YULA 2XDAA 2YV4A 1ZXLA 5IAJA 3I72A 2P75A 4ARAA 3ETEA 3W3AA 2DBYA 3K9QO 2WYUA 3IURA 2QN6A 1XV5A 2ZYDA 5IH3A 4OLFA 2QTAA 2OV2A 1X0XA 3H1PA 2DVMA 4UZFA 1VI5A 4NICA 3ZE8A 1LJUA 1DAEA 3J7TA 4B40A 3NFRA 3N2KA 3TLAA 4HPWA 2YHAA 2Y6VA 1EG2A 3TO5A 4LSMA 2CLEB 2D5CA 2I1LA 3PFBA 1EI9A 3DE3X 3QLVC 4C4RA 3O7MA 3U0BA 4FMDB 5DHUA 5JAOA 3B52X 4PCUA 3RT7A 1TB4A 3MAGA 2OVFA 1AQUA 1OKKA 3U7EB 2PX8A 3S6JA 4DIKA 4E1AA 2C99A 2Z4SA 2BAGA 5CT6A 4MWBA 1W5TA 2CMKA 5JCOC 3JQCA 4L0CA 4BMPB 3T52A 1M0SA 3BAFA 1R74A 2V45A 3HBJA 1O1YA 1STOA 2AJ8A 3CEJA 2R6GA 3RG2A 2HKIA 5I5GA 4MVJE 2O0HA 3E61A 5DHTA 3TTUA 1I6MA 3GIDA 5BRAA 5HGXA 1VJGA 2O8CB 3FOEC 2EZTA 4ALJA 2H1VA 5ALJA 3R9XB 1HNZB 4FNOA 1Z7WA 4KHZA 4BGVA 3IEKA 3VO2A 4ZI2A 3H8JA 1WP9A 3C8DA 5CT8A 3B3JA 5JNVA 1TYCA 3NH9A 5DLYA 3IFSA 5G3ZA 3ZIAA 1J70A 1LUAA 1Q17A 3EG9A 2GHRA 3GRFA 2ZYVX 5LKRA 1T34A 3E15A 4EYQA 3TD2A 1LQ2A 3GLFB 1KI2A 1VHTA 1YR9A 2OCBA 2P4EA 3WJ1A 3CR7A 5H5JA 1DO2A 4PQRA 4R1TA 5FPKA 2K2WA 3VYRB 3U3OA 5K45A 2A9PA 3NHZA 2XAUA 4Z1MD 3BT7A 2BZGA 2G0NA 5ALDA 3GMTA 1KSJA 3QXCA 4DUPA 2J67A 3GPIA 4BCCA 4YRIA 5I3ZA 9MHTA 3CNEA 2XJ9A 4G4JA 5FPPA 2IXBA 3ETNA 4A2WA 4Q21A 4MRMB 3CC8A 5FWYA 2DPXA 4HTAA 3QX3A 2QLBA 4I55F 4RELA 1GPMA 3PWTA 4EY7A 3DTNA 3F2IA 4BQEA 1FRFS 4OQEA 2YC4C 5CYOA 3NAQA 4AUEA 5HTOA 5IBQA 2FLVA 3VPSA 3X43A 5G53C 1Q11A 1TD9A 1PT6A 5B5SA 4ZALA 1V7PC 1M8FA 3BL6A 4QYXA 5LZ9A 3IMCA 4L50A 1CY7A 4RA9A 1KMHB 3FOWA 3BD9A 4OF4A 5D6NA 3ZW9A 5F78A 3PNMA 3MQFA 1MOZA 5I5EA 4C3OB 2F1KA 4J91A 4NBKA 4AW9A 2P68A 3OZWA 3SX4A 3HV2A 1U3DA 1VSBA 4C4AA 1JPVA 1EVZA 4PYQA 2FEMA 4US1R 1WE2A 2PSFA 3VZSA 3R40A 1L8OA 1KS2A 2WMYA 2CT8A 2FHSA 2UU9B 1TU0A 3H87A 4AG3A 3PFKA 4B7CA 2IF2A 4U0JA 5E6SA 3AVWA 4F4IA 3IXMA 4ZT6A 2C9OA 4OUKX 2YXDA 4BO9A 1X1AA 3EWNA 4H7DA 1W0KD 2HCRA 3VU9B 5JLJA 1EGAA 1YRQA 1CR6A 2NZJA 4Y7DA 2VWHA 2W93A 3IA2A 3O8LA 4WBSA 4GWKA 4I1PA 2FEAA 4MW4A 5FKJA 1NLYA 2MU1A 4KQXA 2XMSA 4CZ2A 2AL7A 4Q9JA 5BQPA 1IBKB 1W73A 4QT4A 3PQ8A 1L7EA 1RKUA 3EXG2 5CYFA 1T4MA 4D81A 1YJCA 4M86A 3VSCA 4MW9A 2PGAA 4X6YA 3LO8A 4RACA 3IIJA 3WO0A 1TMOA 1T91A 4PZLA 4RPKA 2ISCA 3ZHOA 1Z88A 2FRDC 3P97A 2RGWA 1UM9B 4EHJA 1BSVA 1JDTA 4XD7D 2E55A 5FA8A 1A9OA 4B35A 5ARBA 1PL7A 1CHDA 1W5SA 2BDTA 3CLSD 5JSYA 1DBSA 2HIAA 2QD4A 2QUBA 2CL6X 5B37A 5LM3A 1Y4SA 3W9BA 3ND8A 4G5YA 3VPXA 1J7JA 1M1NA 2NPOA 4IH9A 3STWA 3T35A 5JJIA 5B3LA 2ERCA 4INAA 3ROFA 2FDCA 2HWUA 4EK9A 4DWVA 1LDEA 1O08A 2OKGA 4B71A 2IUFA 4RIFA 4QDKA 2WWXA 2JLXA 3O26A 4L7QA 5DWVA 2PAAA 1BD3A 3A11A 2I4LA 5SYAA 4LG1A 3UXMA 2OVBA 1SUIA 1M7HA 1G20B 1E4OA 4L85A 1JR4A 1XKLA 3DBIA 3JVDA 4WK4B 1G21B 4FE3A 4ZV7A 2QLLA 4YRNA 3AUJB 4LGCA 2NU7B 3GLGE 4N5IX 3ETGA 4L27A 3FY4A 3A58B 2JAOA 4CR8A 3O4IA 4NDNE 1JU3A 3ABIA 1FUYB 1NIPA 1WUJS 2BGLA 2IK8A 3NNSA 4CIDA 1MW8X 3ICQB 1T15A 3JQAB 3K7EA 2VYQA 4OBWA 4RSRA 3E9NA 2OFXA 3CZCA 2X5KO 4XIJA 3P9IA 1SQ0A 1ZOIA 2F1HA 2XXBA 1QCZA 4XQ0A 3VR5A 2BKUA 1D4AA 4E1BA 1YQUA 4LSZA 3TG8A 4DLLA 2F8TA 3EAFA 2W4IA 1QVAA 4UZSA 5C7LO 3DOEA 2HY7A 3D3WB 3IBGA 4GL4A 4G5HA 3N8HA 3N9IA 1FUKA 2QTVA 3NGLA 3UWOA 3BHNA 1E0JA 2BUBA 4EVQA 2BCJQ 2XT6A 3DL7A 1U5BB 2AG1A 4EB3A 4YY3B 4RE5A 1T5DX 2HMAA 3CS3A 3L1IA 1UIMA 4KK3A 4OBBA 3PLRA 4RADA 1ODKA 4XM2A 1ZIDA 2XUIA 1XDWA 4A73A 2ZUEA 3O4FA 1AQIA 3H5NA 4I8XA 2ZAIA 2C7PA 1UINA 4NQRA 3PSAA 1EDEA 2MR5A 4PSCA 2BHRA 1DQRA 2HJVA 4BAUA 4ACAA 3VKUA 1P9OA 1P7ZA 2GZMA 2ZETA 3ZLVA 3DBVO 4MIOA 1WOMA 3E5NA 1L6IA 3NONA 1M6VA 2OILA 3CW2A 3FZNA 1IEQA 1PD1A 1Q0RA 1YACA 1OPXA 3AERA 1UDRA 1ZBQA 2UZAA 4IJ6A 2FVYA 5G4LA 2IVZA 4B46A 5IASA 1B0ZA 4AYTA 2HR1A 4DB4A 4OXKA 3ICOA 4DILA 3QX8A 4YECA 5AVUA 3M5PA 5HXAA 3IAXA 4P9NA 4QFDA 5BQFA 4X62B 4J6FA 1Z6TA 2O07A 5D87A 4RFLA 5GONB 2M2IA 4BN4A 3CLTD 4YI3A 4D26A 4FW9A 4MYHA 4XSVA 4DDKA 2AJTA 5CH5A 3K1ZA 1LA2A 5AKIA 3K6SB 4MEBA 2GPWA 1UP7A 1JEQB 2ZPTX 2Q3JA 3OIUA 1Y6ZA 3HN6A 3KYDA 2WNIA 3HZZA 5HWSA 3MTQA 3SXJA 5KOHA 3I45A 4HWPA 2MMGA 3AJDA 3LIIA 1WXEA 2WTBA 2WVGA 5EY5B 4WOPA 4ANFA 1ZL0A 3OEYA 1QHHA 4K9NA 2FRVA 3GZNB 5JFTA 1A1VA 3USZA 1XZQA 2E3JA 4BUJA 2HAEA 1IOWA 5DRYA 4EY4A 2Y0DA 4LVOA 2APJA 4UVDA 1ZGHA 3ZWWA 2CVHA 2CJFA 2HPAA 2W2QA 2WTUA 3PHCA 2VJAA 4AJKA 5FTWA 3SKYA 2PU7A 2QZPA 1WU7A 4LYDA 2DFTA 1RXIA 1V5EA 1MBZA 2JKZA 2H59A 3WYAA 1YDMA 1I5OA 5EMMA 4I1RA 1W4AA 2Y1XA 5BORA 2A5FA 1CW2B 1MMFB 2HQSA 2VT2A 3QU4A 5DT2A 2ZI6A 1YB1A 1CJBA 2VL7A 4E6PA 5KU7A 5HF5A 3B1ZA 2GA8A 2O05A 4L2IA 3RUDA 1DKUA 2Z5LA 1YBMA 1U2DC 3HGMA 1OI7A 5HM8A 3C6KA 3VVBA 4DR2B 1YUMA 4TL8A 1UQRA 4XB2A 3I76A 1VE1A 1AGPA 4NXNB 1DXOA 1OLSA 1TFUA 3KJZA 4MVJG 1AXRA 1YBHA 3ESCA 3BPSA 3GHYA 3ZQJA 4CF3A 3EBLA 5LQJA 1QGOA 2C57A 2YWJA 1Z38A 2CLDX 2PSEA 2V96A 3E9CA 5JU6A 1KTIA 3K70C 2D59A 3KV3O 4TKUB 5E9JA 1RRPA 3DO6A 2IPXA 2Y0PA 2UDPA 3Q12A 3UHJA 4DZRA 4E46A 3KJQA 2GCNA 3FPBA 2R4UA 3K6KA 3LLMA 4O2AF 3Q0TA 4OQPA 1NY5A 5ADUS 1TCUA 4JC8A 5LXTF 4BIMA 2VSNA 2ZPAA 3BMOB 4GGPA 3DLAA 4FLMA 2PRSA 5BPHA 3I09A 4ZOLB 2QORA 1WY5A 4EJSB 2O4CA 3ILVA 1G2PA 3AL3A 2O8VA 4YVFA 2XUQA 5E6RA 1YA4A 4AK9A 4FHZA 4RF3A 1FTNA 1QRDA 2XF8A 2N42A 3MMZA 4KVZA 1IYZA 1GAEO 3CXRA 1K66A 4XQGA 5TSDA 2OAGA 1ZZGA 4E4YA 3SMVA 2CXNA 2JGDA 3C7KA 3MWLA 4IJKA 3F6PA 1ZUIA 3IAHA 4IV5A 4N8EA 3TIVA 3WL5A 5FI0B 1P72A 4CMCA 3W5CA 4MAFA 4WW0A 1JFRA 3Q3JB 2E37A 2VJKA 1ZY2A 2O0MA 1PQPA 1PEDA 3F67A 4KX5A 1VG1A 1HE4A 1XMSA 3LPDA 4JQZA 3N2EA 4E2ZA 4AX8A 3BH0A 3AEUA 1GAWA 2PWBA 2IC5A 2JJYA 5DNUA 4KBGA 3GJ8A 1NMQA 3JQ9A 3SJZA 3EPPA 1NPYA 1DE0A 2VRCA 3DYVA 4Z86A 3Q0EA 3T9BA 1Y8QA 3PEEA 1Z39A 5ALXA 3DL4A 4EVRA 4DSOA 3O83A 1Y1LA 2B20A 4EMSA 2XCQA 4RTQA 1ZOPA 2IEAA 3JR3A 3AR4A 1UPTA 2REQB 1QDLB 1RWBA 3KLBA 1RYZA 4TTVA 3FFWA 1OJLA 3VC3A 1N3IA 3CFYA 2QZ9A 3RYHB 4I9GA 1IWPB 2HO5A 3TD6A 3ZBTA 3ZI0A 1YT5A 4PICA 5FH9A 3OFNA 1QYIA 1SU6A 3PUVA 3WBJA 4FN5A 1NF9A 3I9NA 4QOJA 1NQUA 4ND1A 3PXAA 2NSLA 3TZBA 1K0UA 4BMVA 4B3CA 2DPHA 1E9RA 1PGOA 1RPNA 4Z49A 1VKJA 1K9VF 2BGKA 4X20A 4C0KA 4YCLA 3Q5GA 5F76A 2HRDA 2A0YA 5CLJA 4NWIA 5EUMA 1WVMA 4U7PB 1XSEA 2Y4OA 1CY2A 2O52A 4L73A 2CHUA 1O6GA 1JP7A 4RDIA 1KVSA 2NXEA 2ZB8A 4NAVA 1G5TA 3LVRE 4R1PA 3RVMA 2OE2A 4IGKA 3U0VA 1NFFA 1FRNA 4I4IA 4IDCA 4TLMB 3ZUGA 4WOJA 2HA3A 1E7WA 3GEIA 3NV7A 4M9XA 4NBTA 4O4HF 2J30A 5D6OA 3ZS9A 2GJ4A 5K0BA 1T0JB 2RB5A 1QIEA 3THOA 3B85A 2A58A 2ZCUA 3KQLA 5IPFA 5D3ZA 1XWIA 3MTEA 2JIZD 5FTNA 4RTRA 1ZJ4A 2ZJ6A 4XAQA 1A8HA 2FPIA 2C3UA 4OBXA 4AN0A 1JIXA 1NN5A 2X7XA 1JEAA 3AB3A 4V3CA 4IHQA 4P3PA 5F35A 1YIDA 1A50B 1XQXA 4GDMA 4J1TC 3DMGA 4BC1A 2DSTA 3DAYA 4TZ0A 5KDLA 4M0MA 3RUIA 3DKKA 5EZQA 2QV7A 2YMLA 4ZAYA 3P9NA 3D7KA 3L0CA 4NFSA 4EPXA 1Q92A 3LNTA 3HU2A 1NUAA 3H0EA 3TR6A 2Q3CA 3O21A 1EVQA 1CUFA 2J48A 1T9ZA 3R3JA 1GXSB 2J3QA 4Q15A 1P1BA 4E07A 3CEHA 5A0TA 4FJ2A 4BJ1A 2VK2A 3JWIA 3TL6A 3UJ6A 5I9SA 3UA4A 3CKMA 3UJ3X 2BSXA 1QCDA 2B5OA 4N0MA 3ELUA 2OHXA 5G40A 1YHNA 5TMDA 5TVGA 4N5NA 2CJPA 4YB8A 3PKIA 3RHFA 3DDZX 2QN9A 1UJMA 2G8NA 2QLMA 4CT5A 4RZIA 1X1BA 2GEJA 4P3NA 5IMBA 5EHQA 4N1AA 3UGQA 3O74A 1QV6A 4JOQA 4ARZB 1AUXA 1A76A 4F4FA 4WDRA 1ZD9A 2J6CA 3EGVA 5EPOA 3TCXB 3M4NA 4E2XA 5C8DA 2XRMA 3ZS8A 2QNRA 3LUDA 3WGOA 4MKFA 1XPOA 3ZLBA 3PNSA 2D7JA 2BM8A 1AK2A 4U7FA 3QKSB 2ZIAA 3IRVA 4EIWA 2IPAB 5JO0A 2GWRA 2R9VA 2J3IA 5JISA 3UMFA 3RVRA 5KAMA 4IZHA 1PDWA 3OT1A 4WESA 3E82A 3D54D 2GNAA 3RM3A 2O20A 1NW3A 2VNKA 7REQA 1KAOA 3ADPA 4IVRA 1NXSA 2C5LA 4K6OA 1H2RS 4V0SA 1J42A 3AY0A 4PQFA 1QIGA 3FNHA 5B1IA 3G2IA 3IEMA 1QU2A 1E6EA 1E2QA 4OQLA 3AR5A 1VSUA 1O8CA 1RADA 2ONZA 2TRSB 3LX4A 3NBXX 4RFSB 4BKOA 1WSAA 4W82A 3GG2A 2X19A 2KM1A 3KM0A 4RDHA 1GU0A 4O59O 4DQDA 3BRWA 4C08A 4MI1A 3AIMA 1ISRA 1UAYA 2VRBA 3NTRA 3NXKA 3RS5A 4JJKA 4MRSA 4PLVA 3LPAA 1ODTC 4S35A 1UP4A 1G8AA 2FB9A 2OAQ1 1OIWA 3DBLB 2A84A 4K9LA 4KUGA 3FSGD 5IU6A 2RBKA 1W93A 2J1LA 1WBDA 3I32A 4OOFA 3K8ZA 4P8RA 1EM8B 5TGTA 3LCVB 3T1VA 3AXTA 3BSSA 3DC2A 4UQPA 5EIFA 8OHMA 1XZIA 2ZRGA 1KYZA 4RKQA 1QMGA 4KZPA 2AKYA 1QGAA 2WJ6A 3O84A 1XGKA 3ZZMA 3D2BA 4F5ZA 2H2IA 2ZZNA 3TEMA 1KL7A 3N39C 1OBOA 2B92A 4CN8A 2QF7A 2EERA 3VM6A 2A35A 4BASA 4BNTA 3T5AA 4V0OA 1EE2A 2CHEA 6Q21A 3DMTA 5KQLA 2B30A 3S70A 1XVAA 2WJ4A 3I3SR 3D3JA 4EG8A 1YA6A 3RSCA 2RFLA 3W8RA 3JQ8A 2I4NA 1I30A 3NWOA 3L6OO 2P6PA 3IEXA 1BROA 4M9RA 4Y1RA 3IT1A 3OHSX 3MWJA 3SYNA 5FHRA 2ZIFA 1TIBA 3EF1A 3NALA 3Q40A 4RHTA 2COEA 3T5MA 2QYSA 4S12A 2P9EA 4TWIA 4RHUA 2Z9CA 2KYRA 2PUBA 1OE0A 1P61B 2CV1A 3LNCA 1V26A 4EPTA 1OGJA 3X1YA 4Q4HB 2MT9A 4CCYA 2R7MA 4UPEA 2RONA 3ZV3A 1CS0A 4HL6A 4B8YA 4MDEA 3INTA 4D4IA 1RKXA 1JMVA 3ZDCA 1SUCA 3I42A 4JB0A 2W7TA 3HJBA 1VXOA 1JKXA 2QRLA 3HCEA 3H19A 3E4CA 4CKZA 1JLHA 1XYGA 4L8YA 1T0IA 3MS2A 1KYYA 2R79A 4PXAA 4UULA 3SHTA 2VUSA 4NZ9A 4RJIA 3QKRB 3WHKA 5BURA 1E2IA 4OTZA 3N7TA 1KPGA 2VPWA 1WZEA 5IABA 5CM2Z 1NL3A 3VHRA 1YK1A 1MZVA 1SHZA 5BN3A 2VYND 4ZTBA 4K7JA 2H06A 1PUXA 2XB6A 3DWFA 2E7ZA 2ZLBA 4N8SA 1V5WA 4YBZA 3VPGA 5JAIA 3BXPA 1WQ1R 4BE7B 5JEDA 4P7KA 4TV9A 5E7JA 1IL0A 1RYHA 2PCJA 2FSIA 1CFZA 2SICE 1KHTA 2WAOA 5I7EA 3KJXA 2P2ZA 4HDSB 1VPVA 1P1KA 2YC2C 1PDVA 1IQUA 2PFKA 3HFJA 3ZXYA 3VKGA 3RFUA 1JUDA 1IEVA 4WLOA 1Z56C 2XVYA 4KXQA 2LIVA 2BI4A 3PDWA 4B6PA 5LDHA 1EIWA 3MRTA 4JBXA 1T8RA 4LV5B 2ZG6A 4F3KA 1TGYA 2H2AA 3N86A 5FV4A 5KX5F 3FNEA 3BTOA 1HUQA 9ABPA 1WEHA 4KQEA 3JARA 1SCUA 4QBKA 2MYPA 2YICA 4ZVSA 4HSGA 3TJRA 1GP2A 3UY4A 1QRSA 1SKUA 2PBRA 1PTJC 3IUEA 3PXEA 5DOVA 3I5YA 1RHKA 1GN8A 2PQ0A 3DBHA 3CXUA 4UMVA 2QVXX 1KI7A 4IDAA 1J8VA 3EZGA 4RMNA 4Y2GA 2CDAA 3OTGA 4G0MA 2WWRA 1E4EA 3L77A 4ZVKA 4ZDWA 4KQ1A 3FTNA 4G0WA 3G3EA 1N4AA 2GSDA 1EA7A 4YQEA 5BR7A 3IEVA 1L7OA 2VVTA 3M6XA 4TPKA 3L06A 5AP9A 4CLXA 1NMEA 1N2JA 1PGNA 2WG0A 5BRNA 2X40A 3RAEC 4J16C 4BOYA 1J5EB 4QYSA 2N46A 3JD0A 4HQ6A 2F1RA 1Z25A 1PJAA 3QBVA 3NVDA 1ZMRA 4OATA 3CE6A 1J8DA 2J6BA 4WXRA 4HADA 4M7OA 4BO5A 1G8GA 1A27A 3HSSA 3QXXA 3RUEA 4C6TA 3INYA 3I2JA 2V4UA 3OU2A 1XVIA 2ZQ5A 4F86A 3K1TA 1JR2A 2QRKA 5LQCA 4I6JA 4OSEA 4ZOEA 4DV0B 4HH0A 1PEKE 3U7GA 4LYAA 1ZJZA 4A0QA 5FOTA 3GGCA 2I2XB 2PXXA 4Q37A 2NUAB 2QTLA 3W5VA 1FZTA 5B58C 3EK2A 1XCGB 3B6IA 4FIZA 2QT0A 1PW7A 2Y93A 3QVSA 1XZCA 5K0GA 3ILYA 4PRZA 4YROA 3SFTA 1PJ2A 2HLNA 4I3HA 3T34A 4KN9S 3VBEA 4BLPA 2B5WA 3WYDA 1G8MA 1YNSA 1KI4A 2O3JA 3E18A 1P4GA 1UT8A 1SBTA 2JH8A 4WK2B 3L04A 2Q2VA 2WIKA 3SE0A 1QK5A 2VDJA 1FVFA 2E1PA 2GLUA 1M6NA 5DXAA 1GU1A 2R96A 2GTPA 1ZCFA 4AJ9A 2CYCA 1X7ZB 2HC9A 3U61B 3VR4D 2IS1A 2SKCA 2VHTA 2J9GA 3DFZA 4OB8A 4EYOA 3BK7A 3H0CA 3K32A 4U7HA 3NWBA 2P8SA 3BERA 5F4ZA 2WVJA 3RRJA 4F97A 1NVBA 1KVRA 3OT4A 3WK8A 4JCCA 1KSHA 3DW1X 3V7UA 3NWPA 1LVUA 5EXXA 4AF8A 4DUGD 4LWOA 3BXOA 2AVNA 5AVXA 3GRYA 3U5TA 5EXDA 2XIQA 1SBYA 1F48A 3V33A 3IB6A 4JX8A 4JWKA 3IS3A 4DM3A 1CDDA 2J4CA 2QPAA 1Q1AA 4M1YA 2IKSA 2YNMC 4MLPA 1ZN7A 4ZU1X 3RWBA 3BXHA 3Q8XB 2OV4A 3HWWA 2BGWA 3PI7A 3F7TA 4H7IA 1MVLA 4MIEA 1GPWB 1F4LA 3ZCTA 3ES9A 2O57A 2CBXA 4QPJC 3PUHA 2GN2A 2XQVA 1XHEA 2RGDA 1QVRA 3V1LA 4AO7A 4TS4A 2QTHA 4TKZA 5L4LA 1HKUA 1EQ2A 5DKFA 3EGXB 4M49A 2V8BA 1HF3A 3LOPA 5LNK1 2XD4A 3EDQA 1KP2A 1EVIA 1AK9A 2F3SA 3RF6A 3PRKE 2ID9A 3MB8A 1Q6YA 1ZO8A 4II3A 1N2SA 1ZPDA 4FS8A 2VUTA 4EJ0A 5AM0A 4F3NA 4RMJA 3X44A 5T64A 2G25A 3DC7A 3PVZA 4JI1B 1X7XB 4RK6A 4I3GA 5CBPA 3PQEA 2X8WA 3CO5A 4NH4A 3W6OA 3G0HA 5K99A 2NXNA 1ST3A 1EFRD 3UJCA 2PH1A 2VP6A 4HI0E 4Y2QA 1KMCA 3DTVB 3U3KA 5C4IA 3Q8MA 4N5MA 1Z22A 3AUFA 4QBGB 4GKAA 4JOCA 2WQ7A 3RSQA 1Y8RA 3VH4A 5CA1A 1SK9A 1SVOA 5MN5A 1TCAA 3FKSA 2QK4A 3LK6A 2O5CA 3QJGA 4IWNA 1D6MA 3CNLA 5B2ZA 4B7XA 2XMDA 4ZYLA 5A7FA 1WF3A 4YLGA 5A4KA 2XXAB 1R5BA 2C2GA 3N7AA 4AJJA 3F49S 2OM2A 3C3EA 1V9SA 3D0OA 4NFYA 3KCQA 5EN4A 2WAAA 5F9MA 5BVGB 3IUSA 3JQRA 1OASA 1G8KA 3RYTC 1Q83A 2Q1YA 3T3DA 4YJGA 1P7WA 4FWTA 4OY3A 4HB0A 4RWZA 2O23A 4EFDA 3HVJA 4UNNA 4AROA 1VHLA 3LKDA 3JQGB 1CBUA 4I1UA 4Z2AA 3G23A 1U9ZA 3REFA 4B9EA 1WZNA 4OQQA 1NVMB 3FNQA 4II7A 3UT5A 1NHGA 2EDCA 1SVMA 2OPHA 1HZJA 4XWOA 5IZCC 1UXIA 4JDUA 3HVHA 4MJLA 2BFBA 1W0JA 4P5DA 1XTJA 1B00A 2NADA 2PFSA 2XI4A 2C5SA 3O2QB 3IIEA 1M6YA 1RWKA 2P7IA 4RH0A 4M9CA 4M0PA 3A4LA 3FMVA 3KB6A 3R5SA 1PJLA 3FETA 1VE7A 3FUVA 2PX3A 2GK4A 4Y6GB 1DHRA 1KJQA 1NXPA 2CE2X 2QAGC 2EFHB 3JPYA 2ZT6A 3TJZA 4R98A 3UANA 1VLVA 1JIQA 2GXSA 2W6ID 3W2GA 3BOSA 4BNVA 2ZWIA 3JZDA 3E5HA 3AOEA 3I34X 4H7KA 4COKA 1AF7A 1OX6A 2VR1A 4UQLA 2F1IA 2FR8C 1KP3A 3L7YA 4MQ5A 4TV8B 3PR1A 4Y2YA 5ITZA 1Q7CA 2XMRA 2NMVA 4D96A 3ZCRA 4ZTZB 1YUNA 3DFMA 5EP2A 2YV1A 5D86A 1GNSA 3WY9A 3WHIA 3ZCQA 1T9BA 3NYWA 3N0RA 1WQ4A 3ZWQA 4A15A 1OA0A 2G06A 3NTLA 4NYIQ 1YU9A 4RL4A 3ZWCA 5AIAA 2PUFA 1U90A 2UUAB 1V5GA 3E84A 3LJKA 4RVNA 1B3BA 2LV8A 1IPHA 3IAM6 3HUDA 3SIXA 2XMCA 4DSUA 4EL5A 1AVTA 3W5HA 1L3CA 1AB6A 2VJCA 3Q6IA 4MA5A 1RFGE 1R3UA 2BV3A 1UXOA 3SJBA 3IMKA 3NYIA 3RJMA 3VMMA 5BSWA 3H2IA 2EFJA 3E7FA 3H6KA 2AT1A 1PLKA 1I7PA 4X71A 3L4SO 4DLPA 1U8EA 1T8PA 3RAJA 4INPA 3UMBA 1SNYA 1J07A 2BOVA 4J0GA 5EIOA 3HY3A 3CX3A 1I36A 1VL6A 2GK6A 4S24A 3U4QB 2JCXA 4PYJA 1COWA 4DWWA 3KHUA 1ACMA 2C1EA 2RK4A 3RK4A 2I6GA 2A94A 1UK7A 3E23A 1OTXA 4H3SA 1C3VA 3I3OA 2D6FA 2I3ZA 3CWCA 4UZEA 3AB8A 1TMKA 1KYVA 5DXJA 3GLIA 5C37A 3DFKA 4JQSA 3H6GA 2REBA 3WLEA 2DUUA 3I6MA 3CKYA 5GIOE 2SKDA 4NFLA 2P4SA 3QFRA 4IY1A 3KKOA 2XVMA 3A04A 3LWNA 4TKLA 4UEWA 3ZR4B 1SU7A 5JNWA 5DV9A 2DOKA 1YS4A 1Y8AA 3O8RA 4C03A 1NRIA 5GV7A 4HQFA 4F9TA 3GU3A 1KK0A 2D1SA 2R66A 1ABEA 3O2JA 5TJ9A 2BE9A 2SECE 4B73A 2E49A 1Z7GA 3B53X 3ONWA 3Q7RA 1Z6QA 1Y8CA 1JHRA 4YV7A 3ZVMA 3C7CB 4JUCA 4UVHA 2YQZA 5IF3A 3C5CA 4KPEC 1T36A 4HEHA 2XNHA 1YRAA 4O1MA 4KFTA 2P9CA 4FFWA 1YRLA 2GVDC 721PA 1R6VA 2A2ZA 3HJGA 1DIHA 1Y9DA 3MD0A 1N5MA 2LPMA 1XTKA 1SXJD 3ONNA 4WXMA 5CU7A 2QAJA 1I94B 1IBLB 2GJ8A 3KDSE 1U9JA 5KHOC 4WXPA 4LYJA 2UZ1A 1UPFA 5K3AA 5B3JA 4KR2A 4R0MA 1KAGA 3PYMA 2W6QA 3AV0B 3BSYA 4DREA 3C8HA 5AW8A 3NEPX 1XK6A 3P9CA 1PG2A 1US8A 2OHHA 2W6CX 2AN5A 3BDVA 3DONA 3FUWA 2ECPA 4MPTA 1Q57A 1XR3A 1E2PA 2ZYUX 4NYIR 4O6VA 3CCBA 2OBXA 4TKVB 3SFZA 2FFJA 3OX4A 1QH1B 4DQVA 4JQYA 1RZRD 4Y9UA 1R50A 2C82A 5CX4A 2QM7A 4CMBA 4HAVA 4UUMA 1V1MA 1VRCA 3H2ZA 3IYLW 3WAJA 3RHTA 3VVLA 4F0JA 3WGIA 1BXGA 2PD6A 2JCYA 3AHGA 1CUXA 1N2EA 1WABA 4CL3A 1UFQA 1A8QA 3IO5A 5ADWA 3U16A 1XAIA 1T10A 4KG7A 1L7PA 4MUMA 1A2QA 2H5JA 3OQMA 2OTCA 4CU2A 1QS0A 2VP5A 3K6JA 4IZ6A 5DYTA 2J3JA 2WZCA 3V9PA 3F4KA 5AW9A 3UYLA 1RHMA 3IB3A 1HGXA 2A88A 4JR0A 3TEJA 1U1CA 4IIJB 5COQA 1FFGA 5BNZA 3VNRA 2R8PA 4ZYTA 1HPLA 2C2MA 4MIYA 5THKA 1A9RA 3MTAA 4LECA 4R8MA 2GX6A 1HTBA 2VJOA 4B7ZA 3ZVLA 1CE8B 2GBLA 1E3WA 2Q3MA 2JJ1D 3GW8A 3NMUF 5ENZA 1BDJA 3KYBA 1C1DA 3ZVRA 2J45A 2VHQA 1S2NA 3RC3A 3RTAA 1F4PA 3I9OA 4E6EA 3U7FB 1SXIA 2JL1A 1H1TA 2FOXA 3PHHA 4LHEA 4LZZA 1H66A 1B0AA 4MIKA 4UCFA 1GNLA 1GSHA 1CVRA 1JHPA 2X1MA 3LKZA 2EL7A 1N0HA 3F5SA 4FBGA 3ZDBA 1KJYA 1UP6A 1V2HE 1UZLA 1OTHA 2ZR7A 5AW6A 3DM9B 2YV2A 4IJ5A 3WYFA 3B1YA 5KNCD 1OWOA 3A27A 4J2HA 4UDOA 1XMIA 5DK4A 2FZEA 5AM2A 3ZGNA 4ABTA 5SY6A 4NE2A 3HDHA 4PLPA 4UEQA 1RXEA 3BIFA 4RE6A 1D2HA 4X44A 4DLRA 2JD2A 3M6WA 3FB4A 3LC2O 3Q98A 4K9KA 1FFEA 1XCOA 3B6ZA 4IXDA 4QUDA 4U1RA 4KXWA 1FP4B 1Z6ZA 5AKKA 3STHA 4CDRA 1KJWA 5B3KA 1CZOA 3AM4A 4Q3AA 5B1DA 2QTFA 3DMYA 5CFMA 1N0VC 2C0PA 3OX3A 4I4LA 2VH2A 3Q2IA 4MGZR 1AKRA 1QIFA 2NP7A 1UMDA 1Z5OA 5H83A 5KOYA 3BXEA 3VHXB 3M83A 3QFHA 4FGZA 5DF1A 5DPMA 5B58T 2JA1A 4CN9A 4BWGA 4URVR 3GX1A 3T1YB 1OTYA 2BFEB 1G7TA 1E1LA 1H6DA 1NQXA 2VS1A 3AILA 1ZN8A 2JAXA 3EA5A 1T9CA 1A5ZA 4UE3S 4ZVLA 1DG9A 4PS1A 1XQ1A 1ADFA 5BSEA 1DX6A 5FTMA 3ZKAA 2GSWA 4P5EA 5TMEA 3VAZA 1MN6A 1ZA2A 4MPRA 3SZ3A 1SIUA 4ZZ3A 3QMPA 3II6X 4R3WA 3F1KA 5HTKA 2AX3A 1AXEA 2WE7A 1ZMBA 3B48A 4HWKA 2AN3A 1L7XA 1Z45A 3JAKB 4DRXB 2FZWA 1DO0A 5FUMA 1I3CA 4L75A 2G9ZA 2ZIUB 3WSTA 3BEDA 4IHJA 1ENYA 5B4TA 1YRBA 1SC1A 2CJWA 2AQIA 4ZIRB 1RD4A 1VJDA 3IAAA 4HRXA 1EFVB 2X41A 2V7XA 1CR4A 4ZI7A 2A5YB 3MJHA 3PTLA 5EP3A 4D43A 4EM6A 2IL1A 4DNPA 1VSQA 4HNTA 4GMXA 5DM60 5FOVA 4GKJB 1B6SA 3DQZA 2EGUA 1BWRA 3OUZA 4IKPA 4KKVA 1YDEA 2WT8A 2YY6A 1E6UA 1LI7A 1QSGA 3JU3A 3OC0A 2ONYA 5F1OA 3ZHQA 5HUHA 1NAHA 5LP6F 1MT0A 3T3HA 1CNMA 1OXSC 3D1VA 1L4FA 1JA9A 1G3QA 1Y3HA 4PQGA 1GGJA 2J32A 1HBJA 1Q1GA 1A69A 1IXKA 1VL1A 4C14A 4EBBA 1Z8NA 1YSCA 2DECA 3WLSA 4D9NA 5EJEA 2BONA 4BLUA 1V96A 3AR2A 4FBMA 1JRLA 3WOHA 1X39A 2I3BA 3CWZA 1D8TA 1VHDA 2Z3ZA 3V4PB 4LSGA 4CFYA 5HIKA 5FUXA 2CWDA 2YN2A 5HMMA 1F1BA 4UHDA 1YAJA 1XLVA 3M6AA 1Z5GA 3PDUA 2PGLA 1DKOA 3JV7A 4NJEB 1JLKA 3BH6A 4EDFA 2IYNA 2WSIA 5JMPA 3W79A 1OX4B 1Y42X 2DCMA 3PC2A 3VVMA 3W2TA 5LP1A 1FMTA 2ENWA 1PKEA 3UM9A 4K0RA 4BRZA 4P7GA 5KJ6A 1QAMA 1E5LA 3PYLA 3SFVA 5IX8A 3EC7A 2FVXA 4MGHA 4AKGA 2IOFA 3O7WA 1ONNA 1RDFA 3IKLA 4FHGA 4PG8A 2H0AA 4V0LA 4WV3A 4HG2A 1O8BA 2X4GA 1X7DA 4A10A 3GLIE 5BQXA 1U7UA 4HEJA 2O8CA 3EDMA 1Y1SA 5EIBD 1N7IA 2VDNB 3BXXA 4D56A 1XPUA 1DBVO 4UJ3A 3IODA 4WN9B 4CMEC 5A3JA 3I04A 2BTOA 2GPNA 3MGBA 1V8BA 3KQOA 3WBBA 5JSUA 3TAUA 3NUQA 1MEOA 1RC1A 4KQCA 3HPQA 4JQCA 1UMCB 2FQYA 5JLAA 3WGGA 5I9LA 4UD2A 4HD8A 1OXTA 2B34A 3FNGA 1YC5A 5AOAA 3C3MA 3SHQA 3WGUA 3QIVA 4I66A 2QQ5A 2QG4A 1QOPB 3I30X 1BMFD 1BS9A 4WEOA 2HU5A 3KJIA 2VPYA 2ET6A 2VPXA 4HXFB 1P1IA 4XWAA 4Y1FA 4UMFA 2I7DA 2ZJ3A 3IV6A 5TDHA 3PV0A 4R1MA 1HYBA 5FULA 3T7DA 2ZSHA 1EFTA 1VYTA 3NOQA 1I3NA 3Q7SA 3PIRA 3AI7A 3H9JA 3MOSA 4RD2A 2O2EA 1JFFB 4P4SB 4BUZA 2HI0A 3NC1C 4MRMA 2OAEA 4UHBA 2WYIA 5DCYA 4J6EA 5E7IA 3WYBA 3IPAA 4YRTA 1DELA 2HNBA 2XZPA 3JYQA 5C1OA 1E6WA 1U3VA 2GPYA 4LWPA 5A0FA 4WLUA 2JIOA 2GN1A 1EM6A 4Q02A 5D3MA 3ZJYA 5LDGA 1G5HA 3DD5A 2CLMB 1UOQA 1NC1A 3A37A 3WQHA 2GAFA 2VJNA 1JQDA 4DMLA 2DBQA 4ETMA 4F4UA 4TZ6A 5E9WA 3MT9A 4KQFA 1QB7A 3DDSA 3EEQA 3H3XA 3RVLA 1HTWA 4JZYA 3B7PA 4NK5A 1IEXA 3L9WA 1IIBA 3D9QX 3GPDG 4IXWA 3OZ7A 4O2AB 2FPPA 3IBSA 5CMLA 3SZLA 1II8B 4HQ0A 3CONA 2AMFA 3VR0A 3QU7A 4BMOB 2XBMA 2IHYA 2LKDA 1BWPA 1EAMA 2XMBA 1O4VA 1JXMA 3SPXA 4EAAA 4ZYXA 1V43A 2X1HA 3Q85A 1K4KA 1SG6A 2X2FA 1TADA 1NXWA 4S2UA 3LZCA 2ATVA 2F67A 3OZSA 3PXCX 2VJYA 4H7FA 4W8HA 4AG5A 5HZHA 3NBUA 1CUWA 3VU9A 4CM4A 3AL0C 5J63A 1VMAA 4I8IA 1LV8A 1OV6A 1BN6A 4BJ5A 1O5TA 4BKMA 2D2IA 3FXAA 1MX9A 2JI9A 3DD1A 3ZI7A 1UIRA 3EC2A 4AULA 4DNOA 4TTSA 4H08A 1OXXK 4CKCB 3AR9A 3E7WA 4AF6A 5EPEA 5AK6A 1GCOA 2VF4X 1TRKA 5AM1A 4EG0A 1FFXB 2RKOA 1RBQA 3TK1A 1BH2A 1OFHA 4CMIB 1W4BA 4RKFA 1EBBA 2VPQA 4WLEA 2IEBA 4GE0A 4XWKA 1VPWA 1QF6A 2XUKA 4I1YA 1QC5B 1UM9A 4B3GA 2G9RA 4M55A 4ZVMA 4RMHA 1NTRA 5B4UA 4U2GA 3IDQA 3NBKA 1LRJA 2DWPA 2V7QD 1H2AS 1AS3A 4BATA 3ADBA 5DGXA 1L4EA 3FTPA 4LE0A 4MB0A 4KGXA 3IIKA 4OOEA 4RUKA 2YS7A 2FEOA 3TDKA 2CV2A 1QG4A 2ZVJA 1C7EA 3N2GB 3N0WA 1YB7A 3CY6A 1Y6FA 4N3GA 4YV2A 2HT1A 2YY5A 3G68A 2X42A 1RRGA 1Z9BA 1DHTA 2E5LB 2CMGA 4H4DA 3IULA 4BE9A 4NZZA 5C3MA 2XTNA 3D4NA 2PEZA 1GPYA 2FGJA 5HZKA 4U2BA 2E89A 3JYPA 2C0QA 4FKMA 4WNCA 4AJ1A 1MKYA 4U3JB 3UH0A 2XB4A 2ZRJA 1SQ6A 1WPXA 9ATCA 3UJAA 1JKFA 1KR2A 2C77A 2QRJA 5AH0A 2ODPA 1VL2A 5DLEA 4OQZA 5BSMA 2DHQA 4DF3A 4XLTA 1FUIA 1U0OC 4JNCA 5KYGA 2E4AA 3REQB 1PZNA 1PWYE 2JLQA 3JQAA 5EGNA 4CKEB 2BEUA 1BW9A 3W2HA 1GPAA 1HE2A 3RTEA 3WKBA 2XXJA 2HDWA 5A03A 2R0QC 4B2YA 1H3EA 1JIVA 3RTCA 2SKEA 2YZ2A 1RMYA 5BV8A 1Z0AA 3T95A 2QTGA 4LF4B 2Y1CA 3I39X 3LUHA 3GJ6A 2G9UA 5EERA 3LA6A 3SQOA 2ZIVB 4O8CA 4BRUA 1OAOA 1Q1NA 4R0NA 1P5HA 4KOAA 2O8BA 3SBOA 4PC2A 2EZ9A 3AHFA 4KACA 4G8BA 2EQBA 1U5BA 2MYNA 2OA0A 3ZQKA 5JR3A 5J3JA 1NHWA 1T9GS 3WFIA 1IHYA 2QI9F 4MUAA 4D57A 1NI4B 2DUMA 3GFPA 3QPDA 2CN1A 4OP2A 1FVOA 4B3DA 1RPJA 5HF9A 2NVOA 4CLOB 3I2YX 2JNWA 3CLVA 3CPSA 2ZT8A 3ZBQA 2M98A 3AXSA 2C7VA 4LQLA 5KNBD 4GEKA 3RUFA 1CHNA 4CEIB 4D6YA 1DCFA 1OFIA 8ABPA 4D9JA 2WWYA 1U0TA 3DP9A 4XCXA 5DMHA 5TQ2B 2BRUA 3ZK9A 4DA7A 4TT3A 1I6WA 4FZ3A 3FGOA 5AVWA 3DYBA 5M34A 4OXIA 1MGPA 2KMLA 4DE5A 2UZIR 4M21A 5JI2E 4BPBA 3HYNA 5I7VA 4HXGA 5K0SA 5E0OA 3K5HA 5CFRA 4NARA 3PEVA 5GONA 2P0AA 1E0AA 2EF1A 1F2UA 3A6HA 4Y2XA 3SZRA 4A3SA 3K1YA 1UMKA 2FY8A 2IU6A 2QE7D 3IMEA 4HVAA 4AAYA 1MX5A 3SC2B 2QMQA 4LBWA 1JEQA 1E1DA 1TK2A 2D74A 4MK4A 3ZD6A 4ZODA 1TO2E 3BZWA 3MN1A 4F1WA 2OEPA 2QTBA 3QPBA 4YXWA 3JASB 1SQ5A 5AKLA 3W3ZB 3ROTA 4ZCRA 1R0ZA 5BOSA 3OOEA 5IULC 1JXOA 2Y1EA 3KKKA 2QXYA 3HXMA 2AQKA 3G88A 3IQHX 1ISPA 1EB8A 2JJQA 2ZRFA 5CLLA 3GZNA 4K6HA 1RLMA 2D06A 4J07A 4M6WB 5T3UA 1WXWA 3K2QA 4WZAB 2R1TA 1T8YA 5EKXA 4EJ2A 4L9RA 5FLYA 4R16A 2RJ3A 1HT3A 3DOIA 5L45A 4ZJYA 2VUHB 5E8RA 3GFBA 4BQSA 1NX9A 2MTBA 2O14A 3EGCA 1OHHA 3MLAA 4HB4A 4CM5A 3NNDA 4AQ7A 1N6PA 2JEYA 2PMDA 3NG1A 2Y6UA 3LWZA 1USUA 1A3CA 3FCAA 5CAEB 1SG9A 1KE2A 2HJWA 2N75A 1PJBA 1W4LA 1MP0A 2LCIA 2OXCA 3ENNA 3AP1A 2RI1A 3RVQA 2M1XA 1JKJA 4E5UA 1DJOA 1RRFA 4GRIA 1DL5A 3DHNA 3DBRB 1N3LA 5IM4F 1L8AA 1YR6A 5EEHA 4B9AA 4YIKA 3TBKA 1XZHA 2Y71A 4UM9B 4HV4A 5C5DA 4PZYA 3H4VA 3S2SA 2IQIA 2I80A 4BTLA 1SULA 1Y37A 3GNTA 3FHOA 4LXYA 1URPA 1SQSA 3EIXA 4YLEA 5ALLA 3VFDA 4YHHB 3L1KA 3NFYA 3CUTA 2OWEA 3GT3A 4BO7A 4CM7A 4ARSA 3HACA 3GB9A 5DK6A 1BHJA 2QLJA 2O1WA 1N77A 4TKUA 3A4YA 5FXMA 5TNXA 3R7WA 1JSXA 2YMMA 4YMTA 2X14A 4IF4A 4XIYA 2L17A 1KO4A 1U2RA 3ZJTA 2UYGA 3BKWA 4ALIA 1CVLA 4EITA 4F9FA 1L7AA 1DADA 4OHXA 3BMOA 1XC7A 5KSYA 2OZLA 3CVYA 1FX0B 4MVJF 4ZOLA 5K3BA 3UZUA 2KPOA 4H18A 4L5CA 5CD9A 4CL2A 4X65B 1QRTA 1PGJA 1TZJA 1TIPA 3DDUA 4G5SA 5E4JA 1XPRA 1B6GA 3F7OA 3KTFA 3ZQUA 3IQZA 3VJLA 1E58A 3ISTA 1UBMS 3L7JA 4C4SA 1A4XA 3IHTA 1DNPA 1E63A 4GO1A 5KYXA 1YVPA 5FHQA 4OJNA 2GA9A 2EQ5A 1UJ5A 1O0CA 2PGIA 2PNJA 1V7ZA 4JXXA 4QXPA 2X7HA 2NLOA 4TVKA 4FFDA 3ELYA 2GCIA 4XX1A 4Z7JA 2WQ6A 3L01A 2DX7A 2PV0A 5KKNB 3MILA 3ONVA 2P9BA 1BTOA 4N0PA 1K3TA 4GNRA 1NV9A 1X9GA 4WI1A 5GJCA 2Y92A 4E70A 4CQNA 5K05A 3CLUC 4HDRB 5FOWA 1S9HA 1N2XA 2A7QA 4K1LA 5EJ9A 3PTAA 1FYDA 3JPWA 1ONBA 1UFKA 2FE1A 1RWQA 3BGDA 5FX2A 1TEXA 1I1QB 1TLLA 2PGOA 3WGMA 2XNJA 2WKWA 5DLPA 3WNVA 1SKAA 3R5JA 1R37A 2REQA 4G67A 3CT6A 1OR8A 1ZZEA 4LYHA 3U4MA 1LU9A 5L40A 1C1XB 1L3BA 1DKMA 1UM8A 1YE3A 2C29D 3K2EA 2UVDA 4ZP1A 4PTYA 2OBBA 4PVCA 1JSLA 5BWMA 1TQ8A 3EF0A 4DMRA 3RO7A 1UBSB 4C88A 5HILA 1BQ3A 5J2UA 2YHUA 1EK6A 1BXRA 1O0SA 4GLOA 5ALUA 2RHTA 3IVRA 4MQEB 4JJEA 4YCAA 4R2JA 1UBGA 2RB4A 1DQPA 3TB6A 1AGYA 2PT9A 2ZZMA 2G07A 2Q0QA 4KMRA 3DMDA 3TW6A 2L0XA 3FYUC 4YIHA 1MJGA 2RJOA 5KHLB 2B83A 2HDNB 3D0RA 2Q0SA 1D9XA 1KJ9A 1JBEA 3PJFA 4KJXA 1P45A 4N7MA 1BWSA 1AJEA 3IEPA 4GX1A 4MW7A 5CH3A 3RJTA 4F3YA 5ALVA 3W34A 1GAJA 2ATEA 3ETJA 3KQKA 1KVQA 3O9VA 4NDZA 3CBQA 1PUJA 3V3KA 1XEAA 4OXNA 1OGIA 1W5EA 4WX2B 2XE8A 3N5CA 4B81A 3FPKA 5T41A 3R5FA 4FNMA 4P34A 3K70D 4HDNB 4K3VA 2GASA 1C14A 4ZVOA 1WM1A 1G21E 4R8VA 1OPRA 2WM9B 3QXGA 4UHEA 5BN1A 1JVNA 5IKEA 2RHHA 4Z7QB 4MRAA 1ZM2A 4DHWA 3EBPA 3H3FA 4WXHA 1NASA 5I9TA 1TLTA 4LTDA 2B37A 4FHFA 4Z9XA 1KIFA 3RQIA 4MQFB 2O7NA 1DX9A 2W4QA 4FR0A 4NULA 5IJ0B 5KOIA 1GXSA 3ZZ0A 1TYAE 2ZUBA 3PX3A 3NHJA 4BZPA 3PJRA 2FX2A 2JGJA 3JTEA 4A2PA 5CM9C 4CCSA 1ZVQA 2B8TA 2DH5A 2CHVA 1E3EA 2ZWOA 3AP2A 3V8QA 1KORA 2PLWA 4B2IA 3QK7A 1VPLA 1D07A 2B99A 1M2GA 3C3PA 3MJ4A 4M99A 4ECAA 5HCNA 1HLGA 1YDGA 2Z57A 4GR4A 3RE1A 3RU7A 3AHHA 3PR2B 4HYTA 3T4PA 1WA5A 1V3TA 5AUOB 1HWYA 2H1CA 1VYUA 4AJOA 3DYIA 2C9ZA 3F5DA 3FDXA 3JQBA 1XKQA 4G1FA 4HR7A 4U9IS 3RFCA 1EFCA 2EKPA 3QKSA 4O4IF 2HSGA 4ZEWA 4GLLA 4JUAA 1MR3F 5EQFA 2QG6A 4U6SA 2XWSA 3QYFA 5SICE 3SQDA 2GK3A 5JWRA 5BSHA 4WH0A 1BDMA 5FBQB 4O8ZA 3EXEA 1KBZA 3I0ZA 2FSSA 2DMRA 1P5FA 4TWZA 5JYBA 2OOSA 4IQ8A 2X8JB 1FJHA 4JLNA 4LRQA 1RSZA 4M1SA 1PV4A 2GAOA 4HHEA 2DZDA 2WYWA 4E51A 3FPJA 5LD2C 1Z2CA 221PA 4M8IA 2IE8A 2AOVA 2F3QA 4RFSA 4MPJA 4WMLA 4D3DA 5LQNA 4H3HB 3DZHA 4PPQA 2MDTA 1X86B 4FIDA 3ZQ4A 4GYJA 2QS9A 4XDZA 2K7FA 5DBHX 5IWCA 1R15A 3ZI4A 2BKAA 5ERYA 3QU5A 2ZIEA 4LX0A 1TPYA 1Z5ZA 3SJ7A 2CXUA 3LYHA 3QE4A 4E5YA 2QUKA 3JWHA 1VJCA 1XQWA 4HMOA 5H82A 2EZ4A 3W5AA 1U8CB 1Y1KE 2AD5A 2WM8A 1EM8A 3D7NA 1JZTA 1Z13A 1RZVA 2JI4A 2YJ4A 2ZJAA 4URWR 1Z0UA 2Q9AA 1OYWA 1WVGA 3OHMA 4FKZA 4L6CA 3TH5A 3VR4H 4EG5A 2DEUA 4CNQA 5FBLB 3ZWKA 3LHFA 2GAAA 2PL1A 3LTNC 4NBWA 1KHHA 3D2AA 4NCNA 5B3AA 1CJCA 2HU8A 4YJHB 3UHFA 1Z2OX 3MB5A 4K6CA 1S3FA 5EZSA 5JC1A 1RIIA 3KVRA 3M6IA 1VLLA 3CIFA 2PUVA 4XD7A 3RIMA 1JNXX 5CB4B 5CFQA 3EA4A 1BRMA 4WE3A 2IYAA 4YP1A 3G8BA 3BD8A 1SR8A 2C4TA 2HQ1A 2FUEA 4OQFA 3SIRA 1ZNYA 2I7VA 3D02A 3M70A 1TU3A 4YWHA 5EHZA 1ZC4A 3EQ8A 5JDIC 1C7IA 1YZHA 2AR0A 2FWAA 3IMFA 3G6WA 4FC7A 3RSGA 3X3HA 3QUBA 1R9JA 5KSWB 2FP4A 3JQFC 1BAPA 2XPCA 4HLCA 4A9AA 3F90A 2IBSA 1E3JA 3GVPA 4Q4HA 4M89A 3ZGYA 3AEXA 3BMCB 4YRMA 3GLTA 1YQ9A 1ML4A 4HFNA 5DHRA 3LX5A 3P9QA 4MPDA 5GZ1A 1TDJA 1PL0A 1K63A 2QD2A 1RYEA 3KR0A 3NRBA 3PXUA 1UPAA 3QBTA 4NL4H 4EEKA 3SVTA 3FUUA 1H69A 2VNIA 3MINA 5H7XA 4B2LA 3R3VA 2WJWA 1F9EA 2JGEA 3QKRA 5F4BA 4LJ5A 4V39A 2DH6A 2IYWA 5I51A 4G56A 3AKDA 4FMPA 2JFBA 1BX0A 3G17A 4LF7B 3HVUA 1PJSA 2HMSA 3ZBUA 4AI6A 3B2QA 3ZE6A 4QLAA 3NWEA 1U98A 1ZBDA 2GRAA 4ZQIA 1BKDR 4C1NA 1K6EA 4MHOA 1F6DA 1CUUA 5JPCA 4GVXA 4UNPA 3ZHTA 4HWOA 3ZV4A 1D0IA 2R8EA 1ZW1A 4KV7A 4MEAA 3G89A 3EUAA 1H05A 4QUIA 2QMEA 3PXGA 4HO1X 1IBSA 2RH8A 2W0MA 1YNOA 2OOKA 1J5PA 1K3UB 2QVCA 4TTPA 4LYGA 1N0UA 1QYVA 2QTCA 4DRZA 2WYOA 2EU8A 3CRQA 1AUOA 2LD4A 3A6LA 3M8KA 3QOXA 3NAZA 1JSZA 4I14A 4NYJQ 3ER8A 1I2ZA 1FSGA 1XF9A 1Y80A 2HN9A 5E1OA 2OBNA 1NN1A 3FD8A 3OQHA 4RULA 3FJ1A 2NZXA 4PGMA 2BIFA 1ONSA 4NENB 1GQRA 2NO6A 2Z1DA 4I08A 5ADVA 5E4TA 4MVJM 4JLJA 2QQFA 2VDRB 3TPCA 3N0TA 1QRRA 1HETA 3A06A 2C4HA 5AXCA 4ZKEA 5HPYB 2FZKA 2OECA 4HQKA 4P81A 1JVSA 2QT9A 4GXNA 4PX9A 3WZLA 3CGGA 4NZNA 1N1GA 4BX0A 4LPSA 5FWNA 4JY7A 2O6LA 3MWYW 1N5KA 4GPBA 2V7VA 2P2CA 3UGTA 4JR2A 3GYBA 1Z4JA 3K3PA 4PZDA 4L9AA 4AY4A 4UFPA 1F06A 4HKTA 2JAWA 3QVGA 3N6RA 4YDHB 1X1CA 2GZSA 2DUWA 1NMZA 3OC6A 3IBFA 4MV7A 5FBRB 5TQ0A 4ER0A 4F56A 2IRWA 3W5BA 4KPYA 3DVQX 3FWKA 4LJLA 2GZAA 5K6TA 2ZIZA 2YFYA 4BGEA 3OURA 4NI5A 4F5DA 2H11A 4IFIA 5LMUB 1OB5A 3O90A 3DV2A 2VDVE 1GGVA 1P0IA 2NUAA 2WICA 3LL7A 2JFQA 5AI5A 1CS4C 5K4AA 4BYMA 1SCBA 2PUEA 4RQUA 3UAXA 1K8RA 4WIAA 3SHVA 3B1FA 5F33A 5LP6C 1NQOA 2PUGA 1WDTA 3DOUA 4TN5A 1Y63A 5IT0A 5DO9A 1BA3A 1T0UA 4MS1B 1MENA 1O9HA 3DWIA 4RLSA 3WYCA 1BFDA 1QYWA 3ODPA 3T99A 5FBHA 4F2PA 2ZR8A 3RKSA 2HRZA 2I5PO 5TF0A 1NRWA 3OCWA 4PS0A 2R11A 1X7ZA 1JU9A 1Z4NA 3AR6A 1UKAA 3MGGA 1HE8B 2BC9A 5DGTA 2XYVA 5DTQA 2O8FB 1EGMB 1WUKS 2G80A 4J1SA 4CU5A 4EMBA 4BO0A 5HM6A 3A3KA 1ZCJA 3QEJA 3R41A 2Z56A 3N2NA 5CLHA 3NDJA 4V02A 1CD5A 1Q7BA 3JX9A 3ZE1B 4BQRA 1J56A 3GXOA 4F9EA 2WPNA 3MWKA 4PC1A 3S5UA 2QM8A 4CI9A 4WFIA 4ZK6A 2WWFA 2WU1A 2Z95A 4M1EA 4OVKA 2JANA 4ZC8A 1EX9A 3IGFA 4TYQA 3IQGX 3JD4A 4FZRA 2P0EA 1B93A 1B14A 5F1YA 2JIMA 2BEJA 4L6IA 4LE1A 2P9TA 4NYJR 4PGGA 3L8DA 4NK4A 1GFIA 5J47A 3EGXA 1OYVA 1T25A 3HVIA 1GG2A 5D7NA 4FGSA 4EWLA 1P5RA 1E62A 2ZSUA 3A9VA 5CCDA 2V7EA 4QULA 3SYMA 2CUKA 1V8DA 2HSDA 2J3EA 3TL3A 3COSA 1Z62A 3D64A 2GRJA 1X7XA 2V5VA 2DQ4A 2H2FA 2OQIA 3FH0A 3C3BA 3GBPA 2QUHA 5AFSA 1RXSA 5I7FA 1SK8A 1RKVA 3GOQA 3QENA 4W9NC 1DDIA 2XYPA 3LT4A 3NC4A 2VWQA 5EWMB 3LQ2A 5ARCA 5LZ8A 1GNQA 2UZ0A 3DTVA 1NU8A 1SOWA 4BJ6A 4L8WB 1FNSA 1UH5A 2V74B 1WETA 3FMIA 1NR5A 4C3VA 4ZVNA 1LH0A 1VBNA 2JFZA 3NJRA 4EMUA 5JD3A 1N6IA 3U6BA 1AGXA 1ZGCA 4F93B 2QX8A 5CVEA 1P2VA 5DMXA 4MI9A 3K9CA 4G01B 2XXAA 2HPVA 4AY5A 1Z75A 4IINA 4UE6A 5F21A 2HIHA 4KFRA 1O94A 1GGKA 2JJ8A 4N3AA 3C3JA 4DC1A 5BNIA 1LI4A 4RTLA 5LZ4A 3IKTA 4F11A 5TGZA 4NOMA 2NTNA 3KE9A 2IEDA 2XOKA 4ZEXA 3UG6A 1XZFA 2OK8A 1U94A 5IVDA 1ZK2A 1UBHS 3ZWYA 1N2BA 3OEHA 4DMCA 3C3XA 1M9NA 5HOQA 4HDAA 4N3NA 4CQMB 1GZ7A 5ESDA 1QZTA 2PBFA 2V7UA 3B8EA 1SIWA 4I1SA 3W8NA 2GPTA 3DULA 2OM6A 2X0EA 3RNOA 2XYQA 1P3Y1 1M8KA 1QE0A 4Q7KA 1MB3A 2B4TO 4KODA 4D1YA 2Z4RA 4FYPA 1DU4A 2AXPA 5K8JB 1E2DA 1AZLA 3EQ2A 4GGMX 1ACJA 1FY2A 4IS3A 4WINA 4EA7A 1X38A 5LIPA 1KARA 4C2UA 4AFNA 4LYFA 1CY6A 1Z7YA 3GJQA 4IX9A 2BZSA 3ORSA 5LUAA 1ETUA 3OJLA 2B8NA 4BNDB 5THXA 5GAJA 3ZJ4A 1QUEA 4HQLA 1GGFA 2OQ2A 1OY1A 3DR3A 5SYMA 4W5QA 4JR1A 2EVWX 1Z33A 4UXJA 5DHQA 3EFOB 1RW4A 1YHYA 5DBOA 4TV8A 2YNMD 3TRJA 3RV4A 4UU1A 5T67A 2JZNA 2NO4A 4F60A 4Z4IA 4UPVA 2BZ0A 5KNCH 2W37A 5ALZA 4IVNA 2X9QA 1IBRA 1L5HB 1J25A 1PL8A 2R47A 5CA0B 1WLSA 2B25A 1GCAA 3PF9A 1ENOA 2PX4A 3LK7A 4BO3A 2ZYRA 3D8UA 1AO0A 3TW0A 2HRRA 3AUKA 3KP1A 1YTLA 3HU3A 4C7JA 4E3WA 4WZBB 3URKA 5HZMA 1NGSA 3F0TA 3NPAA 5HUJA 2ZTVA 4TLCA 3TOSA 2ZI9A 1KYXA 1XEXB 2XADA 3WWDA 1E60A 2ADFA 2NV0A 4KXLA 1L5YA 2AH5A 3IE2A 4JNKA 4QWMA 3E05A 4F12A 2D4HA 3EGDB 3LA8A 5DCUA 3DUWA 2DSNA 4DYHA 5IDWA 2R6R1 4CHTA 1ABBA 1QG2A 2P79A 5AK3A 1TTQB 4FFLA 3IDZA 4LF5B 5AK5A 4BWFB 4LHWA 2IKQA 2G4VA 3LKVA 2RGNC 3PNQA 2YIMA 4FCCA 3THXB 3GGPA 3WAKA 5DHPA 5T4EA 3ZHYA 1FTQA 1DEHA 3DCNA 1IK6A 3AI3A 4PFSA 5EVJA 5DNWA 5FTKA 2PMFA 3RROA 1SY7A 4AUKA 1NYLA 2I3GA 5JJ5A 3HR8A 1U8TA 2DY0A 3KQQA 2R87A 4U7WA 5FFMA 1H5QA 3UWSA 3X1XA 2R00A 3N2YA 5AKZA 3JSXA 1FYFA 4LF9B 5JSQA 5A6SB 4BFXA 2Q4EA 4LCBA 2OD9A 3P94A 4JLDA 2F55A 3B5IA 4LZOA 3NASA 3O8OB 4R6WA 1CZLA 2PXAA 3V3TA 1CQWA 1N9GA 5BW8A 4UHKA 2GKSA 2WU3A 3A2NA 5TF4A 4YQFA 1R4MA 4MQ6A 1IRXA 2RD2A 3EFHA 1QAQA 3H75A 3KZCA 3S5JA 1QGZA 2P5TB 1XKXA 3A3OA 3EZLA 3TE7A 3KPUA 4DIEA 4DIDA 3BJZA 1KH3A 1SUDA 3K4QA 3LRTA 5KEIA 4R9NA 1EHYA 2VJLA 3R9KA 1LLQA 2QI9C 2WJHA 2F62A 1XQYA 3T7SA 2B1JA 3O3OB 4U2DA 5L7WA 3LDUA 3S8EA 3OMLA 4KQHA 4F71A 2ZCJA 5BYJA 1E5TA 2DP4E 2HA7A 1BC5A 1W87A 1NC3A 2VTEA 4LNAA 3UCFA 4BMNA 1ECGA 1IHOA