2FYTA

Human hmt1 hnrnp methyltransferase-like 3 (s. cerevisiae) protein
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein arginine N-methyltransferase 3
publication title The Crystal Structure of Human HMT1 hnRNP methyltransferase-like 3 in complex with SAH.
rcsb
source organism Homo sapiens
total genus 95
structure length 311
sequence length 311
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 2fytA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fytA01
1RJFA 2FK7A 3D2LA 3B5IA 1VP9A 5DM0A 2P7HA 4QQNA 3EEYA 4GF5A 5FHQA 3FTFA 5FQNA 3A27A 1XCJA 3T0IA 5EQJB 4M36A 3LDGA 1NV9A 5K0BA 5FWAA 2P40A 2ZW9A 4C04A 3PX2A 4RVGA 2UYQA 2ZTHA 4ER6A 2P1DA 3KQMA 5EKUA 2P3OA 3I5UA 5EIFA 3CJRA 4IKPA 3HP7A 3ORHA 1I9GA 3UJ9A 4LWOA 4HRAA 1SUSA 2B78A 2IH2A 3SM3A 2ZIGA 3M33A 2O05A 4OQDA 5T6BA 4E2WA 4QQKA 5IH3A 2I7CA 3TLJA 1EG2A 2JHAA 5DM4A 2R3SA 1KPIA 4ER0A 3FUUA 2QRVB 2VDWA 4C06A 2AN4A 3HVKA 1DCTA 3NWEA 4GOND 5EEHA 3Q87B 4K6MA 4O29A 2C7RA 3EGEA 7MHTA 5EC8A 4YUXA 5FCDA 4PYQA 2XYRA 5K05A 2PY6A 3HA3A 2H11A 4GC5A 3SR4A 2ZULA 4CTKA 5CD1A 3HVJA 1NV8A 3EVGA 3SSOA 4BP3A 3HA5A 2Y1XA 2B3TA 1NT2A 2GA9A 3KR1A 4RVDA 4YV1A 2FRXA 1HMYA 3KKZA 2PV0A 3HCDA 1JG4A 3KR0A 5HILA 5KQSA 1KXZA 3GJYA 1RI5A 4CKCA 1V39A 1WG8A 2Z6QA 2YTZA 5MHTA 3NVMB 1WS6A 3PFHA 4FT4A 4IV0A 2Y1WA 2BZGA 2B9EA 1VLMA 3GRRA 4MWZA 2BR4A 3KQPA 3TR6A 4YUWA 3UA4A 3RIEA 2AOWA 4H0NA 5ICGA 3OFKA 3SSNA 1N7IA 3ELUA 4PCLA 4PYNA 4KIGA 1D2GA 4RV9A 2XYQA 1XCLA 1NW6A 3FPEA 4C08A 2AN3A 2GLUA 3R3HA 4EKGA 5K0NA 2XYVA 3PX3A 3UJDA 3LECA 3CKKA 4RX1A 4BP1A 2V7EA 2GS9A 1F3LA 3I9FA 3IHTA 2PT9A 5GIOE 4OA5A 3CGGA 3V8VA 1VP3A 5FULA 2IDJA 5GM2A 4YMGA 5HFJA 4HTFB 2UYOA 3K6RA 3NTVA 3FTEA 1NKVA 1M6EX 2NNWB 3G8AA 2YXEA 1T43A 3MERA 4KDRA 3IYLW 9MHTA 1RI3A 2CL5A 5JR3A 2HTEA 1DL5A 4RTKA 3DLIA 3HEMA 3T7TA 2PSSA 1M0EA 2YUIA 2AOTB 3JWGA 3LKDA 5HIKA 3OPNA 2JH9A 3GNLA 4YUZA 4P7JA 3WSTA 1Y8CA 5ICFA 3SVZA 4ER5A 3BXOA 4F85A 2P7IA 5E8RA 5LQJA 3FUWA 1VPTA 2PLWA 3MTEA 4RVFA 3M6UA 5D1NA 2CWWA 3B3JA 2G8NA 5FADA 4RTPA 2IH4A 1QANA 2IPXA 1JQ3A 1MHTA 1DUSA 4OX9Y 1OR8A 3FPHA 5KVAA 3EGIA 1YFJA 1NBHA 3ME5A 3ER9A 4IV8A 2JH8A 3OZTA 4ISCA 3P8ZA 3UJ7A 3OZSA 4F84A 1KYZA 2ZBQA 4YUYA 4AX8A 3RODA 1ZGAA 2PX5A 5EMKA 3CJTA 1YB2A 3G89A 1PRYA 1L3CA 3HCAA 4E2ZA 4E30A 4AZTA 3NWBA 4YV0A 5KS2A 3MCZA 4G56A 4GUAA 3NW9A 3HA7A 3BUSA 4OBXA 3G5LA 2AOUB 3NVKI 4YUVA 3PT9A 4YMHA 2EJTA 3QV2A 1HNNA 4HGYA 3VSEA 4X63A 1YZ3A 5E1DA 2AS0A 2ZIEA 5EHGA 5U4XA 4LWPA 4Y2HA 3C6MA 3NMUF 2NXNA 1ORIA 2NXCA 3P9NA 4QDJA 3BWMA 1AQIA 1TW2A 2AOUA 2P8JA 3C3YA 1H1DA 1QZZA 4GEKA 2ZCJA 3A25A 5M5BA 5K0GA 1FP1D 2UZ4A 1INLA 2Z6UA 1Z3CA 2QM3A 5CVJA 1YFLA 3FUTA 3BZBA 2ZIFA 1N2XA 2EJUA 3AJDA 3LX6A 3NDJA 3Q7EA 3LDFA 3CJQA 2BR3A 3PTAA 2P3LA 3VYWA 3ER8A 2B25A 2PX4A 1WZNA 3U81A 4FSXA 4X61A 3GXOA 3GGDA 3UBTA 4OA8A 5DXJA 5EMMA 3B7PA 3PFGA 5DXAA 3CBGA 5FA8A 4E2XA 4HSGA 3GIWA 5EZQA 1RJEA 5P8WA 3O7WA 3SX0A 5ICEA 3OE5A 3JWJA 3I58A 2IH5A 2OYRA 2VS1A 2E5WA 4PYOA 4V0QA 4M37A 5GINE 2YX1A 3EPPA 3P2IA 1B42A 3LKZA 3TFWA 5C9ZA 3DMGA 3QOXA 3KPUA 3B3FA 2NP6A 4PYIA 2FPOA 3BWBA 3FRIA 3E8SA 3M70A 5CVUA 3FYDA 1EJ6A 5DM1A 5DTRA 3CCFA 4DKJA 5DRYA 2V74B 4QPPA 2CMHA 3QOWA 1IY9A 1SG9A 4GC9A 4P7FA 5E1BA 4PYLA 5LQRA 1R18A 4P58A 5DRTA 3UJBA 2IDKA 2QY6A 3HCFA 1KYWA 1M6YA 3P9KA 3KQOA 4RTMA 4R6WA 1IM8A 4R8RA 2I62A 1I1NA 3G5TA 3KQSA 2ZLBA 3G88A 4ER3A 1D2CA 2HNKA 3E05A 4LECA 4OBWA 2GPYA 4R8SA 5CVEA 2QYOA 3EMDA 1SQFA 3G8BA 3GRYA 5E9JA 1ZKDA 5FHRA 2QRVA 1WY7A 3E7PA 1Q0TA 4FR0A 4BLWA 3P9CA 4KRGA 3JWHA 1KPHA 1L3BA 2VP3A 3UZUA 1NE2A 3LPMA 4A6DA 2ZSUA 4MQ4A 3GU3A 1D2HA 2NXEA 4GOOD 5F2OA 2PVCA 4RTRA 2AR0A 1XXLA 2AOVA 4X60A 4PYKA 2OY0A 4XUEA 5K0FA 3KPJA 4Y30A 2K4MA 10MHA 5D1HA 4M38A 2P35A 3TRKA 4GOMD 4P7GA 4POOA 2JG3A 2ZZNA 3MB5A 1KP9A 1AF7A 2WA1A 2O06A 3KPWA 4PONA 4U7TB 5ICCA 1RI4A 3JWIA 1PJZA 2F8LA 4U7PB 4EQZA 3MHTA 1G8SA 4PYMA 4ER7A 5EKXA 2BM8A 5T67A 4EK9A 3OE4A 2R6ZA 4DQ0A 3ELDA 3UA3A 3KQWA 1RI1A 2OB2A 5E2AA 5K09A 1X19A 2VDVE 3HVIA 3MGGA 4AZSA 2B2CA 2H00A 3KPYA 3E23A 4AZVA 4E70A 3AXTA 4KDCA 2YXLA 2OXTA 4Z2YA 5C0OE 4RTNA 1VL5A 5LR6A 4HC4A 3DOUA 2I9KA 5EMJA 3GRUA 2ONZA 5GIPE 3F4KA 3BGDA 2ZZMA 3UFBA 3DMHA 3FYCA 1EQAA 4IWNA 4AZWA 4R6XA 4RVHA 1KPGA 2ZFUA 3LDUA 4X1OA 1P39A 2ZWVA 5CUQA 4M7RA 2ORED 5F2NA 1FJXA 3EVCA 4HTFA 4ATNA 4PWYA 3UJ6A 2XVMA 5GM1A 2EG5A 3CC8A 1IXKA 1G38A 2PT6A 1R8XA 5HIIA 2AVDA 4XUDA 4EKIA 5DX8A 1SVUA 2AOTA 2O07A 1EIZA 3FPFA 3LCVB 3P9IA 3UJ8A 4CWAA 2Q41A 2HV9A 3P2EA 3HNRA 3P71T 1X1DA 2NXJA 3EVZA 3M6VA 3NJRA 3MTIA 5GP1A 5K0LA 4CXMA 1SKMA 4E32A 5H02A 5HZMA 2NP7A 5DTMA 2G70A 1N7JA 3ELWA 1L3IA 3R6TA 4V0RA 5DLYA 3KHKA 4LG1A 2UYCA 5EHIA 3LCUA 5CCXA 3IEIA 2ZVJA 2Z6AA 5HOQA 5LQKA 3FPGA 2IP2A 5K0JA 3BT7A 1X1CA 5EZSA 3PB3A 1XDZA 5LQCA 5BP7A 3LGAA 5DM2A 3HCBA 1YF3A 3CVOA 2OO3A 3AXSA 3DXXA 3EVAA 4BY9E 2O57A 3SXJA 2GB4A 1BOOA 2OKCA 1G55A 3B3GA 1L9KA 2A14A 5FTWA 3FRHA 5KYGA 1UIRA 2VZ9A 1NW8A 2IIPA 3HCEA 5EMLA 4QPNA 4BLVA 3M6XA 3A7EA 3TMAA 2GAFA 3LCCA 1ZGJA 1FPQA 4C05A 3EVFA 1ZG3A 2EX4A 2NYUA 3ELYA 3EVEA 3LBYA 2ZZKA 2ONYA 2PX8A 3HM2A 1QYRA 2IFTA 4R05A 1WXXA 2N47A 3KPVA 4CTJA 4DCMA 5CCBA 1R74A 3HCCA 5CVDA 1VBFA 2WA2A 1VE3A 3O4FA 4F86A 3LSTA 3TM5A 3G2MA 5EEGA 3TQSA 3KU1A 3TKAA 3TOSA 4DCGA 4QTTB 4RTOA 3LL7A 3DP7A 1R6AA 3GWZA 2IBSA 2OBFA 5K03A 1JQDA 3GCZA 5E8JA 3M4XA 4HH4A 4QVGA 2ERCA 3TKYA 5FQOA 3BKXA 5DX0A 3KQQA 1JG1A 1QAQA 4KIFA 4AUKA 2YR0A 4MHTA 1JTEA 3BGVA 3K0BA 4C4AA 5EG5A 3SGLA 4RTQA 2G1PA 3DR5A 1ZQ9A 2GH1A 4A6EA 1VIDA 2PXXA 1G60A 1XDSA 2YQZA 3ANXA 3FUVA 3GRZA 3O31A 5E9QA 3OZRA 4DF3A 4QTUB 5EPEA 1SQGA 3S68A 2PX2A 3FZGA 4FS8A 3LHDA 4E33A 2H1RA 5HEKA 3BWYA 2FHPA 5CVVA 3ERCA 1JG3A 2P41A 4PIPA 2CMGA 3A26A 4QDKA 2JJQA 1X1AA 2DULA 4PCAA 5BXYA 2QE6A 2AOXA 4FSDA 3RW9A 5DX1A 3MAGA 8MHTA 1NW5A 2FK8A 2FYTA 5BW5A 3A4TA 2O0LA 1R00A 2ZBPA 5FWDA 3LBFA 3TPZA 3EEOA 1P91A 1L1EA 3L8DA 3IV6A 3KR9A 3GRVA 3GDHA 4E31A 1FP2A 3H2BA 4C07A 5IKMA 3R9XB 3R24A 3X0DA 3THSA 3HTXA 3BKWA 4RYLA 2WK1A 5C1IA 4DA4A 3C3PA 3THRA 2ADMA 1WXWA 1G6Q1 1KHHA 4NECA 1NBIA 3FTCA 4FGZA 4FT2A 3G2QA 3OU7A 4GOLD 1O9HA 3R0QA 4E2YA 5K0CA 3G2PA 2PXAA 2ZWAA 3ID6C 1AV6A 4KWCA 5FUBA 1ZHFA 1P1CA 1NW3A 3B89A 3GO4A 1VQ1A 3DLCA 4QVKA 3DULA 5DWQA 4CKBA 4CKEA 1G8AA 4RSRA 5CM2Z 3DXZA 5JUWA 4EVIA 1JTFA 4YV2A 1NW7A 1RI2A 1YUBA 2EFJA 1JSZA 2VDUE 3KQYA 2C7QA 4RTSA 1RJDA 5GOZA 1BKYA 1EJ0A 3P2KA 3SMQA 3DUWA 5ERGB 5HIJA 1RJGA 2AN5A 3G7UA 5K8VA 3I64A 1F38A 1KIAA 2G71A 3V97A 3UJCA 1Q0SA 3C6KA 1EAMA 3DH0A 4BLUA 1QAMA 1BC5A 1MJFA 3EVBA 5E1OA 2G72A 3OFJA 4XCXA 3P97A 4EMSA 3HVHA 4RTJA 1P1BA 4P7KA 3C0KA 5B1SA 2BM9A 4MIKA 3TM4A 2PKWA 4B17A 5FA5A 2CKDA 3AWIA 4GBED 2PGXA 5DTQA 5LQAA 2JHPA 3NDIA 2AVNA 5EGSA 2YXDA 3VC2A 3A7DA 4HGZA 1AQJA 2DPMA 3T7RA 3PLAE 4DM3A 3DMFA 3FTDA 3OU6A 3PVCA 5LQNA 2PJDA 3DXYA 4PYJA 1I4WA 2JHCA 2OZVA 5T64A 2HMYB 3UJAA 2ZBRA 3OU2A 5DSXA 3AY0A 1TW3A 5LQUA 5LSAA 3BGIA 4C03A 2ESRA 3EMBA 4RWZA 4WVLA 1JQEA 5EVJA 4DZRA 2XBMA 2PWYA 4KVZA 1JR4A 2IGTA 5KQRA 2P3QA 4UOEA 4XUCA 1KR5A 4WXHA 3MCTA 1QAOA 4X41A 4JXJA 5HIMA 2BH2A 4ZTBA 3PS9A 4FZVA 4KW7A 1UWVA 5G02A 5DT2A 3REOA 4PINA 2XVAA 3G2OA 5E1MA 4PGHA 1TPYA 3M6WA 3SSMA 3EVDA 2C7OA 1UFKA 1XTPA 1JSXA 2PWPA 5F2KA 1X1BA 3UWPA 4GQBA 3FUXA 5DSTA 3EGVA 2PBFA 3KR2A 3MQ2A 1YZHA 5DPMA 1O54A 3FPJA 3DTNA 1JG2A 1R8YA 2FCAA 3I53A 3KQTA 2HWKA 3VC1A 4DMGA 2UYHA 5E9WA 4L7VA 4MTLA 5BW4A 5EIWA 5CIYA 2OPBA 2AZTA 2YVLA 4PIMA 1BHJA 2HR1A 1U2ZA 5K0EA 4HG2A 1O9GA 2OB1A 5E2BA 4RTLA 1XVAA 3BWCA 2C7PA 3KQVA 1FBNA 4PGGA 3T7SA 2BR5A 4FP9A 1XDUA 2IBTA 5EOVA 1XJ5A 5GWXA 5K01A 4PNEA 3OCJA 1SUIA 2PXCA 4OQEA 2KW5A 1ORHA 2LD4A 2I6GA
chains in the Genus database with same CATH superfamily
1QFSA 1M1YA 2QJOA 4Z0HO 2PNFA 3U1TA 2I8AA 2VAVA 1KHTA 1I14A 3LLCA 3RYHA 1F0PA 1XCJA 1PD1A 3T0IA 4LFBB 3YASA 1F2DA 5AJWA 1H8HA 4J43A 1RYNA 3B1YA 3PC3A 5LLDA 2JJ1A 3I5UA 3BXFA 4KIWA 4B7ZA 4CNQA 1SUSA 1MOQA 1DKMA 1XTJA 1YR9A 3GA5A 3CQ9A 3GJ7A 2XMQA 2X13A 2NSLA 2YHIB 4MI9A 4KTVE 2I7CA 3IX7A 1TAUA 1IUPA 1EG2A 5BYKA 1BXGA 5JDIC 4ZVKA 3WFIA 2CFCA 5JJ5A 1I8TA 5B3JA 3R75A 2UXBB 3Q3CA 1DCTA 4GOND 4ZOAA 5FO0A 3AU8A 3KYBA 2JCGA 3TRDA 4MROA 4C3OB 3EIOA 2ODWA 3K9GA 1Q1BA 3AM4A 1XDBA 2Q50A 3KVYA 4N41A 1NVAA 4PQGA 5AHKA 4RFSA 1C9EA 2HA7A 3A3OA 3NHPA 4R5HA 4EF5A 1SB8A 3JAMA 4B3HA 2AJ8A 3RU3A 4CTKA 1Q0QA 1RZ3A 2IIVA 5FORA 3EVGA 1JLLB 1ZD5A 2OHGA 3HACA 2BGKA 1A2KC 1EKXA 3LXUX 3OQ1A 8ATCA 3PITA 4ML3A 2A5FA 1FLNA 1S9HA 3LUKA 4FMCF 4MV9A 4XARA 4B79A 2ZWIA 1PUIA 1T4MA 1UOQA 2VL7A 3A3YA 4F1KA 1ENZA 4GT1A 4TYYA 1L4HA 2JKVA 3T6KA 1E2IA 1FXWA 2WG1A 3QE2A 3R3UA 3A1SA 3Q9LA 4R2WA 1G5RA 2BR4A 2QPAA 1KO7A 3IEUA 5JZSA 1FVXA 2IODA 4FOLA 3OFKA 1ODTC 1ZK1A 4KNVA 2J9GA 5I7FA 5I9TA 4R40A 2J3DA 4EUFA 1CQZA 1DXQA 2LNDA 2QK4A 2O8FB 4N5NA 2VG8A 4C7BA 1ESEA 1NC1A 2A5GA 3OAAD 4UFNA 2OFOA 3I9FA 3BMOB 4NNOA 5I4CA 5GIOE 4INAA 2ZBUA 5JI2E 4U3JA 1UZNA 3C3EA 3DBOB 5KPJA 3ZVMA 4HTFB 2XIJA 1E2BA 1CUAA 3FTEA 3RCBA 1KJYA 3ESAA 2GBLA 3CRRA 4ZCIA 3B1WA 3G6KA 2GFIA 2A67A 3C87A 1IOVA 1UDWA 3KOMA 3PNOA 5GONF 3HQ4O 5A2GA 2ILVA 3M5DA 2FSIA 2CHUA 2PSSA 2YUIA 3JWGA 4LCEA 4A73A 2YWDA 2C59A 4MUMA 4CLRB 1KMNA 1Y8AA 3LCJA 1PQUA 1KEPA 1EAYA 4N0MA 4BRWA 3SYLA 2O8EA 1ST2A 3G1WA 3O4VA 1ZI8A 1M1UA 1PZGA 3K9QO 5GGYA 1NONA 4CFSA 4XJTA 3V7FA 5MN5A 2D1FA 2AMFA 1TC2A 4OBEA 2H18A 3ENNA 2P2NA 2QVXX 3AR9A 4GD3Q 1I9CA 3TZQA 3ZHZA 2C4WA 4F11A 5KVAA 3ME5A 4WPGA 1RCTE 2WYVA 1RHJA 3QNUA 4TX1A 2VNHA 3UJ7A 3PCRB 3DW3X 4OFXA 3LC1O 2EX0A 5F5XA 3PC2A 2Z2XA 4JVOA 1J06A 3OT1B 4OUDA 1PRYA 4IPTA 1OWOA 2WC1A 1MDFA 4O4HB 3LCMA 3USES 1A8IA 3T38A 1A8PA 1ULZA 1SY7A 4HWGA 3SC4A 2V6BA 1ZSVA 3PT9A 4J9UE 3TQRA 5EJAA 4BFTA 3OM1A 3MLAA 4O5AA 5T8KA 1T0HB 3QX7A 1DDIA 3H5AA 1YVEI 3DE6X 2VRWA 3O03A 2NXCA 1N0VC 2HLPA 5JCOA 1F2TB 2WAOA 3HWWA 3MWGA 5GQSA 3IJPA 4DMLA 3W2HA 4GEKA 4TLMB 3T9EA 2QY9A 3A4IA 2VR1A 3CM0A 4EUEA 5M04A 1WPXA 2WYUA 1RE0A 3L7CA 1ZH0A 4MW2A 5T7BA 3O5AA 4MQMA 3QXGA 1R9JA 4MWTA 4NBNA 4OKSA 2H3EA 3GR6A 4EM6A 1NE7A 5IKOA 4QLAA 4MCAA 3AERA 4TKVA 1CF4A 1E7QA 1IBSA 2FPWA 1XALA 2DGDA 1U9JA 1LEHA 1V6AA 3U7HB 4Y6GB 2FFBA 2GERA 1SXJE 2A30A 3AUJB 1IZ8A 4J16A 4HSGA 3GIWA 4MQFA 4R3NA 5FA8A 3TL3A 1YIOA 1FLDA 2HSJA 1LDMA 2C88A 3FETA 3VR5A 4UUNA 4I50B 4RIEA 3D3KA 1Y8ZA 2E5WA 3Q9NA 1X0VA 3OFSA 3EPPA 5HM8A 1OXUA 3C7TA 3NXKA 4NH4A 5T4HA 4JC8A 1CUGA 1VMKA 1V11A 3V9AA 1WXQA 5K6RA 4DHWA 4CM8A 2FPOA 4RMIA 3MPOA 2W0MA 2CV2A 4GFDA 1FOEB 2J9ZB 2GWHA 2V74B 1KI6B 1DI0A 7YASA 1VZ2A 3MRVA 3EG5A 3JATB 1OX4B 2HLNA 5FUWA 5SICE 3WXMA 3CLUD 4LMPA 4PSKA 3ZV7A 5KJ6A 3DFFA 1OH5A 1UKAA 1DXHA 1TD9A 5KINB 1W75A 3PJDA 2D0PB 4BCDA 1P7VA 5E4YA 2WTAA 3WGMA 2GPYA 4R8SA 1K89A 4ZVVA 2V6IA 4PVDA 2XRZA 2GZAA 2O23A 2PVSA 3FKQA 1SEVA 2IYEA 1T5SA 2PS9A 1P29A 3L1KA 1VL1A 4IZIA 4ND4A 4CETA 2GK4A 4JUFA 3OQNA 1U0TA 1LPPA 1U0FA 2WKPA 1YUNA 1QOQB 3MGAA 2YS6A 1IY8A 1PKEA 4NARA 5B37A 4ARIA 2FX5A 2I0FA 1XXLA 3C1UA 4WESA 1TUEA 3ICCA 3UKOA 3JWPA 5KWEA 1GFSA 2JGDA 2XCRB 2K4MA 2IELA 2P6NA 3REGA 3D6JA 3GMTA 3TBHA 3IR5A 4QRIA 4UCXA 1OHHD 1KP9A 1AF7A 3JY6A 4EB3A 3TLXA 5JO9A 2XTMA 5CMLA 4H7JA 5B58C 2OFPA 3NHFA 1VLQA 2Z95A 3C8UA 3Q0TA 2JCSA 1UFVA 2ZJ0A 4XWYA 2HJWA 3KQWA 1V16B 5K09A 3ZBPA 5B7QA 2I3AA 3ZZUA 5F98A 1ZVKA 3PVZA 5A4KA 3EYWA 4OV6B 3HA2A 5TT0A 4GXQA 4BMXA 4JMLA 4DCJA 3DZFA 3BM5A 3VHXA 2ZZMA 4TRMA 5DE3A 1OGJA 4D02A 5HWSA 1Y6FA 2WLSA 3P0EA 2LVBA 2QXYA 3TOVA 4H1HA 2Q4BA 1W8IA 2QRGA 2QRKA 4F4UA 2J4CA 2R48A 3D02A 4I8IA 4KMOA 4I55F 2OFFA 3I9NA 4DLTA 1SVWA 3G2LA 3LCVB 1KJJA 2AOTA 4M1MA 3UJ8A 1K3FA 2W6PA 4BX2A 4NULA 4HQKA 1WUJS 1JQ5A 4U7GA 3V1TC 2PUAA 1XIVA 4EJSC 4LKRA 5FOQA 4EG5A 2CCGA 4YH1A 2A78A 4YHBA 4URUR 4RZSA 4JR1A 4G0XA 1SKMA 1C7QA 3GNSA 3NOQA 1Q1EA 4Q4DA 4U9IS 3E22A 3UGKA 5HZGA 2Q28A 3AB7A 1F48A 2HGSA 3QU7A 3IEIA 1XR3A 2ZVJA 4J91A 2C3OA 4CCAA 1EUDB 2NO4A 2AZXA 3K1AB 2C92A 3KJGA 5BW8A 4DSTA 1SG0A 1XDZA 1Y6JA 3DEAA 3M2PA 1JSCA 4AF7A 2Q5CA 1XC7A 1HOXA 3U4AA 4E0BA 4OJTA 3WI7A 1P4HA 1AUVA 2RHOA 2Z3ZA 1IHOA 3PE6A 1U2EA 3B3GA 1OE0A 2A14A 3B38A 4OD0A 2ZJFA 5TMBA 4B76A 2ZTUA 5IT0A 3KJFA 4KRXA 1F0KA 1XZLA 3M6XA 4L2IB 4G23A 3IDZA 1T0JB 3EYAA 2XWBF 3B5JA 1C0LA 4FN4A 1VE7A 3AFOA 3NWPA 3QUTA 4Q6WA 5FLEX 4DW8A 1E1RA 1D6MA 3AHGA 4B85A 4OLAA 5F35A 1NVWQ 4RKFA 1K27A 4XASA 5BYBA 1NZDA 2G04A 5J2TA 1R1DA 3KPVA 1OKKA 3LVBA 5AXBA 1XSEA 4EG3A 4ENRA 1HDGO 3N5KA 4GI1A 3S1LA 3HUFA 4PHGA 4DHEA 2GRAA 5ITZA 4X64B 3DWFA 1J9EA 5KWVA 2OTCA 2LW7A 4I2NA 3GLIA 4CEIB 2FRDA 5JIBA 1UEJA 3SS8A 3ZD7A 5YASA 5DIZA 4V0NA 4U00A 4EB6B 3GCZA 5E8JA 4RQUA 4IJUA 1JR3D 4NIMA 1CS0B 1GU7A 1IXYA 1CRPA 1E4YA 4TKUA 1V9SA 2PSJA 1PR4A 4GWLA 4X6YA 3R76A 5C1PA 3KKLA 1SIUA 3UXEA 1PWYE 3K0BA 1NHGA 1XP8A 1JG6A 2AI2A 3II6X 3DR5A 5EMHA 1EFRA 3GZTB 3TEMA 2BEWA 3ZU6A 1LNSA 2GSWA 5DM60 4AUEA 5CFOA 1ZJ4A 4S0ZA 1GNPA 3PHCA 5E9QA 3GUCA 4C2BA 1Y7HA 4DF3A 1WB6A 3VR0A 4LXXA 3FZGA 2JBAB 3PICA 1Z56C 1N2SA 4DCNA 1CE8B 4JT4A 4KI7A 1I51A 2WWXA 5JEDA 1E5LA 2O8CB 2PTHA 2AA3A 3GCXA 1D1PA 3W7AA 2NZVG 1XQXA 2XBLA 1V37A 1XJ0A 1TCCA 4GPAA 4JCCA 3H4VA 4Y6QA 4I5FA 4C4TA 2XKBA 1VI5A 3M5WA 3Q7QA 2QQ0A 4GYJA 2I3ZA 5TS3A 3KKPA 1NULA 2ZT6A 4JA2A 3RU7A 4LX0A 1KJWA 4BNDA 3INNA 4B0PA 2C9CA 3ESBA 2VFAA 3GDHA 4E31A 1PI3A 3DO6A 3ABOB 2G1AA 3ZJ5A 4FMCB 2J9FB 4K6KA 1PV2A 3BKWA 3LUHA 1TM2A 4BTEA 3LX8A 5CDUA 3DR3A 5FUQA 4DA4A 1J0CA 1U31A 4KGXA 5KC9A 2B99A 3T4XA 5E3IA 1YASA 1AA6A 1O9HA 4RKEA 3GFRA 3C3MA 3R8CA 5I7OA 3R9XA 5K0CA 1CY6A 5LB4A 2BUCA 4DMKA 1RR6A 1FSZA 1KDVA 2JZNA 5HRCA 5KWJA 1UKCA 4GKAA 1GZ7A 1X1RA 4WEOA 2XUOA 1BS9A 1P77A 1PK7A 3EBOA 3HY4A 3R5KA 5AP9A 5JMOA 4YDHB 3LT4A 3S2IA 3DULA 1KNXA 1WBJB 4HN2A 4XD7A 4CMBA 3MILA 1JQLB 2XA2A 1G8AA 5AVTA 3QMMA 1OOEA 4MEJA 1CNMA 3AUYA 3FN4A 1WHSA 2QAGA 1RI2A 4MULA 5A9TA 8LDHA 3KQYA 4DA7A 2NO7A 5EUQB 3GVPA 3RYCA 3PGKA 1NBOA 5GONB 5B64A 2GBGA 4ZIRB 5F76A 5JH7A 4Z54A 3L9XA 1MKYA 5A3JA 1EWKA 2WM2A 4G9BA 4RLHA 2A9RA 5CB4A 3P2OA 4BLUA 2I3GA 2H5EA 2ON6A 2TRSB 2XB8A 4DIDA 1PVVA 1U1DA 4EJ0A 3HR8A 2B4TO 1NZJA 3OFJA 3OY2A 3IUYA 2WHYA 3QYFA 4NYIQ 4Z9FA 3MJSA 3AVQA 4KSCA 5IFLA 1NMQA 2BSAA 2L19A 4Q1CA 4IO1A 4X91A 1RC8A 3V6MA 5TQ2B 1Y37A 4ZYLA 4QGSA 1SD5A 3HHEA 3TIXB 1X0XA 1T36B 2FXIA 3VC2A 2PRYA 1NLMA 3FWYA 3QIVA 2ZT5A 4NTZA 4BN5A 5I5EA 5IYZA 4UDXX 1QGUA 1T3ZA 1P2FA 2PJDA 1PJ4A 1APBA 3VR4H 4F91B 3BXEA 3R7DA 1ZCBA 3GDWA 3P9RA 1AB6A 2LIVA 1CXZA 5K6AA 5LSAA 4QUGA 1X7YB 2YRWA 3FNRA 3KFVA 1XTTA 2YDXA 3MTAA 4HHEA 4KO2S 3V4OA 3DS8A 2PMBA 1UBFA 5IZCA 3AVXA 3FIUA 3JVIA 3PIDA 4Q0MA 1JDPA 3P2MA 4HDNA 4N39A 1TZMA 1Y4SA 4XUCA 2NZYA 4C88A 4GZ5A 5EN4A 1WNFA 3E9YA 1PJ8A 1P8AA 3BMXA 3CS3A 5THXA 4A82A 1RHUA 3NDRA 1LLFA 3QUCA 4KXNA 4YI5A 2QA5A 3NB0A 5ANRB 3EVDA 2A3RA 3FNFA 4YXWA 1HLFA 3DT9A 3KBBA 2JVIA 3K8QA 5BY2A 5JWOA 5ALIA 4MR7B 5G4KB 1DIAA 3V4LA 2EKPA 1KYQA 4Z9AA 3AHHA 3EZXA 3N8HA 3QELB 4INZA 5C35A 1HI9A 1U8XX 1SXJB 3STYA 2J59A 2JLVA 2HR1A 5K0EA 3QVWA 4G5OA 4MV0A 4EA6A 3B70A 1XAJA 2HDWA 4BQIA 5L3SA 3LP6A 4H3SA 1Z0KA 4EKYA 4MHOA 1OXBB 2RB4A 3GN2A 4OHKA 3RVOA 5HRUA 3FVVA 1M2HA 4DABA 4TVOA 3KT6A 1CYDA 1FUYB 1XKLA 4Q9DA 1UZAA 2XH8A 3PCTA 4JP5A 3Q6IA 3VFDA 3BJMA 3C48A 2DYKA 1G8MA 1UMCB 3SQMA 2DETA 2XMPA 3PPYA 4Z86A 1UJ4A 2BE9A 2HF2A 1XJQA 3NM4A 4CKXA 1ISGA 2PYIA 5CLQA 2OO5C 2D2EA 1PR9A 2JC3A 4RQAA 1LI7A 3V8BA 5BNZA 1E9SA 1LRJA 4LQLA 1GPBA 1UDXA 5FHQA 3A27A 3IVCA 3N8NA 1PTJC 2NYVA 3GLHE 2BOVA 2RH5A 1TVCA 1KVUA 2WHRA 4KL8S 1WMAA 4F93B 2ALJA 1DDGA 1R4NA 2R11A 3AF1A 1HLPA 4IKPA 1R5NA 3V4FA 3ORHA 3IA2A 3OD1A 1WW2A 4KV9A 4C0HA 1XZBA 2BEVA 3JQ7A 3AUTA 4TTPA 4UTVA 3KSRA 1HDOA 2WD7A 1N5DA 4HV4A 4H1UA 4LYYA 2VATA 2D74A 5DM4A 3LRPA 2J0QA 1KH1A 3FWHA 3HL0A 3AO0B 4PRYA 1A8QA 3E58A 1U2RA 4HDKA 4S05A 1O6CA 2V4MA 4Q9LA 4JI2B 2C7RA 2PLFA 5KX5A 2YHUA 3UMCA 4HWSA 2GHRA 1O89A 4YP0A 4YUXA 3M0EA 1D2NA 5K05A 3O38A 1J9ZA 1RXSA 2DTXA 3OUUA 1RLOA 3NWJA 4ZZIA 1OZ0A 4UNSA 3A4NA 1M2VB 5K4GA 4RGBA 5NLLA 3QGMA 1EFUA 3ETCA 2FE1A 2VJMA 2QMHA 4WN9A 2I67A 2JDIA 3IO5A 5AR1A 3I23A 1RLJA 5DCLA 4CR7A 1V8BA 5JFTA 5DTIA 2YV1A 4P3YA 5JMPA 3Q8LA 1WG8A 3ABZA 2BF7A 1BROA 3K1JA 3NVMB 2CBGA 4RLQA 2XD4A 4GM4A 1QH8B 2G82A 4M88A 4KK3A 4HF7A 3ZQKA 4D6PA 1AS0A 2IUFA 4YUWA 4URYR 3SSNA 1QHIA 3BD6A 4QYXA 3I0NA 1AS3A 3DEJA 4BKPA 4IVNA 4C4ZA 3T1OA 5CDGA 1VCNA 3TZCA 2P9ZA 1NJGA 1CFJA 4KB5A 1BU8A 1OIXA 1NGSA 4LZPA 4DLVA 5FLKA 2QM8A 4RX1A 1H2FA 2IEIA 2H7YA 1KO8A 1BVUA 1NNI1 4JJ8A 4RSGA 4KDEA 1GT91 4YMGA 1S2LA 3REQA 3PNVA 4I55B 3ICEA 1Q44A 2DY0A 3EWAA 1JKIA 3AK4A 2A84A 3KJXA 3LYLA 1XCMA 2C4VA 2PL9A 3MERA 1SVIA 1XZGA 3K8OE 3PC6A 1OYWA 3GJ3A 4H6PA 4CMAA 3UO8B 3LHKA 1IN7A 4M89A 2GQ0A 3UAYA 2BGUA 5ECYA 4EBFA 3HKEB 2Z58A 5SY4A 1TNDA 2C5HA 3DDOA 1NNEA 1XFAA 2ZQZA 2N9UA 2WPNA 5BV0A 2EKBA 1OFUX 1AZLA 3VZBA 4G9GA 2OWEA 3RV4A 4EWLA 2B0JA 3SSAA 3I9JA 3LQKA 4WIAA 3LVRE 1UFQA 2FDXA 3ABSB 4RAOA 4CMEA 2CSXA 1XEWY 3F97A 3FZYA 1C1HA 1ID1A 4MPRA 3W3AD 1CRQA 3GEBA 5ERXA 5AK4A 1XLVA 5KNBA 2J32A 1DUSA 4TLEA 4LNUB 3ZE0B 3JWEA 3HZHA 5MGBA 2IQ5A 1FMJA 4OBBA 5T5QA 2ZIAA 1C7IA 3VV2A 3CWZA 1F8YA 1F06A 4M9XA 4HGOA 4UU7A 4EGAA 4DLYA 2JFVA 2Q8QA 4CGYA 1ZM9A 1RQLA 2O2GA 4M0LA 4R1SA 3E0QA 1VGVA 1E59A 2WI8A 1HFEL 3KZMA 5C1OA 1HM5A 3ZVRA 3V80A 3K70D 1DRKA 3VAAA 2NTVA 2QN1A 2CNBA 3KAQA 1EK2A 2WKWA 5T6MA 4IJVA 2J3HA 2JD2A 1BDBA 2XSZA 4YMHA 3VZQA 3TWOA 4F4CA 1MABA 1ZX1A 2Z9BA 3WBBA 2NQTA 2H0QA 4P2GA 4DR6B 3IAM1 4RHXA 3F6EX 3GH3A 1RMTA 4Q4JB 1D0VA 3HSKA 1KAGA 4QDJA 4TZ6A 5BNWA 2A5YB 3HR7A 3U9SA 1QZZA 4OHMA 3EXG2 3BIJA 4D3YA 4FZ5A 4BO3A 1V1MB 2P0EA 2IHBA 4HAZA 1SKBA 1YE5A 3DAGA 2OWDA 4LY3A 2F67A 4UMEA 3BZBA 2WYOA 3LBNA 2QN8A 4G5FA 3V1NA 1Z2PX 4RXTA 1LWOA 1KOGA 3Q7EA 1BRMA 1WABA 2RHRA 1MV5A 3IEMA 2AG8A 1XMVA 2BFNA 2X42A 3RC1A 4UEKA 1I3CA 3I3OA 4PLTA 5KBYA 3T54A 4RD1A 3UBTA 4ARUA 3U7IA 3ZEAA 1NVDA 1KOLA 3K94A 3MQFA 4ZDJA 2NT3A 3CBQA 2NZWA 5P8WA 3E9CA 2Q4DA 3I72A 5FOXA 5L95A 2VUTA 2NUPB 2VXYA 3CX7A 1VE6A 2ZDQA 4CG3A 4NICA 1DOAA 1YACA 3N70A 1QHHB 1T1EA 2JGIA 2PT5A 3E18A 3ZYZA 2J0SA 2MMCA 4RLSA 4ZPJA 2XIQA 2OV8A 1AGPA 1NUPA 4K8RB 3VM6A 2C3YA 2DHDA 3NFYA 2QM7A 3VJLA 3D43A 1E3QA 2QP9X 4TSKA 6AT1A 3CCFA 2R00A 4BZPA 4XYEA 3EY4A 1YS6A 4FMDF 1O8BA 1ETUA 1Z37A 4MUBA 4P58A 3IJRA 2I9KA 2QBYB 4HB0A 4PGAA 3HCFA 5JNRA 3IVMA 4DVJA 1YA8A 4MS4A 2NUBA 5AKYA 3SLGA 2I62A 1PYDA 3HRIA 3UTDA 2WFAA 3PFWO 1SA0B 3P2YA 4ER3A 4OKIA 3C97A 4QOIA 1NN1A 1L1QA 4KSBA 4O0MA 5CVEA 3MGBA 1SQFA 2XE4A 1NKTA 3HBFA 4CMKA 4B3BA 1YDGA 1P0PA 1SKQA 4WOBA 1GL3A 1JILA 4HDSB 1T8UA 4XH9B 5E7MA 4P7BA 3IKJA 4A6DA 2QRLA 2WD9A 3ND6A 3QVJA 4DUGD 3NUQA 4GVPA 1N5MA 3KYCB 3ZNQA 4FKMA 5AI0A 3IVAA 4OQFA 2HMUA 4X85A 5EINA 3AFHA 1NP6A 1A9SA 4Y30A 1P31A 4W7IA 8OHMA 3OZDA 1YRLA 2P35A 3TRKA 4GOMD 1PEYA 4FW8A 3BRSA 1VIMA 2O0KA 2E5LB 3AVVA 3R0VA 3QBTA 3WLQA 4XD2A 3ZGOA 3VAYA 2I2BA 3I9KA 3DTVA 3I92A 4MARA 5EJ2A 5JLJA 4QGHA 2YOHA 3M3HA 5T67A 2DJIA 3K0FA 4FYWA 4HNVA 4XA8A 4FFOA 3ASYA 5DEOA 4ZMBA 2ACEA 3ETHA 3JQ9C 1RWKA 1UEXC 1C0IA 4B5LA 4ZI5A 2G08A 3N8KA 4ZYZA 2EJCA 4MCIA 4CG2A 2QM0A 3FSEA 4K6GA 1KFBB 2IVZA 4IV5A 1V3QE 3P94A 3RC3A 3ZXSA 3NVAA 3VAZA 3DMHA 4LWQA 1E2PA 5TSDA 1UJ2A 1R8JA 5IUNC 3HWX1 1KZGB 2WAYA 2FWPA 1FP7A 2CNOA 2W5UA 4BTLA 1JDUA 2JLSA 1UMKA 1ISJA 1IXKA 2IIQA 4CR6A 1EP3B 4TWZA 3W5VA 2A35A 1JLMA 3KQHA 2VQ3A 1COWA 1DJPA 5KKCA 5CP8A 2IP1A 1A2OA 1WEHA 5KOHB 4LYHA 4ZTUB 2W4QA 3QWFA 4R7GA 2IE8A 4Z7NB 3G68A 1TEHA 1IAVA 3PUZA 5KTSA 2HU8A 5K0LA 3LA6A 5K99A 1KFJB 5DLYA 2ES4A 4UD2A 1Y7TA 1FPMA 1JR2A 3CRNA 3MT9A 3QKSB 2W98A 3ZKWA 2R65A 4EFLA 3IQWA 1KVTA 3FPGA 4RAQA 4WINA 3HN6A 2ZYVX 4MVJD 2IP2A 2CB9A 2WSYB 3PGA1 4YFYA 1NN0A 3MOIA 3PB3A 5DM2A 3EIXA 1L7AA 1LK0A 2Q46A 3W5HA 2F8TA 3A0RB 5AXCA 1MFZA 3FTNA 5BQOA 5ES4B 4D4JA 2G76A 4MYDA 3F1LA 5FTWA 5H81A 5HNKA 4HZUA 3UMVA 4MI1A 2VXBA 4QQFA 5ALZA 4XEHA 4UHEA 1GLNA 1SUCA 2ODNA 2WAAA 2X8WA 3AESB 2ZBFA 2ZYWX 3SYRA 1L5MA 2QE7D 3MWLA 1L4FA 1SQ6A 1N2CA 4I08A 4KQWA 2HMTA 2A0XA 4IJ5A 3WKBA 3ENQA 1C3XA 2W48A 3EGDA 1C4OA 1ECJA 2CLEB 3K6SA 3FM9A 1IHXA 2BP7B 2HGZA 3MT8A 3H8WA 4KXLA 4P86A 4I4IA 3SXUB 2VT2A 3TXAA 3UCXA 5JJLA 2AMYA 1QP4A 2EKQA 4DIMA 1PVDA 3NO4A 1FJHA 2GNAA 5IVIA 1TU4A 3EH1A 2C9DA 3SZUA 1TGVA 1H93A 1XF9A 1NXVA 2XAUA 5D51S 4LV8B 4OXIA 5E6RB 3D9QX 3JZAA 4EA9A 3Q0EA 5TNXA 3C3CA 3T5MA 4BFUA 3CW9A 1VLZA 2YZMA 3CR8A 3JQRA 2WWGA 5CX1A 4AS3A 4E5PA 1UH5A 2V58A 3AJRA 3W4IA 3PNLA 1YZTA 2YJNA 3KTAA 2ZSBA 1XAHA 1A95A 1XFDA 3GMIA 1N3YA 1QK4A 4AJPA 1Q74A 2V59A 2UV8A 4MMYB 1AHHA 3D1VA 3W1VA 5B6JA 3SZGA 1UJNA 1KK2A 4PC1A 1YU6A 4LYEA 3ZU3A 1U02A 1P9LA 1LBSA 4GQAA 5F23A 4Z4CA 2OEPA 1IHDA 4ZDIA 2PX2A 4UUBA 3F7NA 1PFWA 2IUYA 5TV2A 5I48A 4D4LA 2ZOSA 2H4YA 3BWYA 1BJKA 4FQ8A 1GL7A 4QJ5A 2E7ZA 3R3ZA 2JGLA 1X39A 2R8YA 4KXYA 4PCAA 4FSDA 4C3ZA 5KYWA 4ZCPA 3PHGA 4OHZA 4ZT5A 1C1DB 3EE6A 2FYTA 1VJTA 1X7XB 4WNYA 4JYCA 4QO8A 2AHOA 4DJ5X 4DJAA 4L9AA 4A0HA 4N48A 2HJSA 2O0HA 2Y4OA 2XF8A 2O2HA 2VZ8A 1K7YA 1FZQA 3LI2A 5CBPB 3R24A 4ONEA 4TQGA 2I5PO 1WPGA 4MUIA 2GK6A 4M2LA 1ZGZA 3JX9A 1WULS 1PW5A 2WK1A 4TWBA 3KKNA 3GD5A 3PF8A 2FI1A 3CUEF 5DNCA 1U7OA 4L50A 5LFAA 2J0VA 3H5LA 3UPDA 1E77A 1YVDA 4ZQGA 3JQFC 1XEAA 2CN1A 4W5JA 1YBFA 3BTVA 2B7BA 1J39A 5ALUA 1SCUA 1AV6A 3WL6A 5AK6A 3K0AB 4JI6B 4EMTA 2XGMA 3OF2A 2FZ4A 4QUJA 3KKEA 1BXRB 4UNQA 2PX0A 5KDOA 2IC5A 5AVKA 4FGSA 2UVPA 3E3NA 3L0BA 4CKBA 3ZWMA 1O95A 4RSRA 4O8CA 4AZ3B 1P17A 5JUWA 2VUSA 2EX1A 4FXOA 4WFIA 2P69A 2C97A 2YC4C 3H5TA 3CF0A 2QKYA 4M9CA 1WCXA 4A0SA 2WSSD 4ZOLA 3VZSA 4G0OA 5HIJA 4KPYA 2AN5A 4BV2A 3TSYA 5GVRA 4B5KA 4U9HS 1KIAA 4FGUA 2BGWA 3M81A 1NMYA 1K4KA 2EWWA 5IANA 4GXRA 3OFVA 1OH6A 1VPLA 1LX7A 4EQ6A 2CLCX 4R69A 2GJSA 4S1NA 4DIEA 4OQNA 3GLFA 6REQA 1T5HX 1RXWA 2OZPA 2ZAOA 1TECE 4MV4A 2V7UA 1O58A 1P2UA 2ZRDA 4K9PA 4DR3B 4H59A 5SYMA 3SC2B 4IRUB 1ZESA 2CEKA 1LDEA 2JHPA 2AVNA 4RD0A 1Z83A 2WWIA 1NJSA 4KQ9A 5EIOA 1N5RA 4WXEA 2ETVA 4MINA 3UCEA 3JW8A 2EL7A 4EEXA 4NAUA 1RIIA 2JFYA 4ZAFA 9ABPA 2QD4A 4QPZA 4KODA 4YRJA 1V1RB 3A1DA 3RFTA 2OBXA 4QARA 2RHGB 2JLUA 4ZVMA 2J46A 3GGOA 2GCOB 3J80A 1ZNZA 5L3QB 3TIGA 1EA7A 2ESRA 4IGEA 1JQEA 3HXPA 4GVXA 4CM4A 3P0FA 5CYGA 1E79A 3M34A 1W76A 3PUKA 1JR4A 1QO0A 4CNBA 2HA6A 3GJ6A 1YQQA 4LDQA 3EFBA 4JLMA 5AHWA 5A5EA 2BH2A 4ZTBA 3B3QA 5DN6D 1GG9A 1YK0A 4MRSA 1M2KA 2V6FA 5TPZA 3IVRA 4GX2A 4PGHA 3C3DA 5HJ2A 2DM6A 2B92A 1QYCA 3TJMA 3O4IA 1SCBA 3CO0S 4C01A 5ADWA 1XD2A 2O19A 5DP1A 4BP9A 2CHFA 5DBEX 3UFXB 2TMKA 2JJ1D 4R1MA 4K9RA 2OENG 5KIAA 1FUIA 4CUJA 1JRLA 4TYWA 5IJZA 1XU4A 1AHNA 2I3DA 3B2NA 1ZA2A 2GMWA 3DPSA 2JFPA 3GVIA 1HE4A 2OB1A 4D5EA 1P2DA 3WNDA 5DCUA 5G2OA 1K8ZB 5DNAA 2Q7XA 4XQ0A 2V6JA 5IAKA 5EIBC 1FFSA 1UJ5A 1NG9A 1JN0A 2VHEA 1YZQA 1IY2A 4LJ6A 1XMIA 2X8JA 5AVOA 3I6ZA 1MCZA 5DLEA 4JLOA 1W4ZA 1BMQA 4M0PA 4RDHA 1SXGA 1JYEA 1QV7A 4MRAA 4LY6A 4FMDB 2OHVA 1C0EA 4LRXA 2V9PA 4FFNA 4URXR 4W8GA 1QCDA 1VP9A 2NU7B 4NBVA 4UDYX 4DRZA 2XT9A 1F9AA 1V9CA 4GSKA 4ZT3A 4FOSA 4DYDA 3LUJA 1SCJA 1DHTA 4C04A 2MSNA 3PGXA 4N49A 3H3JA 3ZW9A 3KQMA 3UMGA 1A8HA 1PGNA 2H17A 3UOWA 4REQA 4EPVA 3UGTA 1NRXA 2F64A 1FNMA 1G8PA 3PQFA 4PRKA 4RF3A 2P2GA 2XNHA 1GKLA 1THTA 3V4SA 1B15A 3C5HA 3RUIA 1O1YA 4OQDA 4CLXA 5JFGA 2NQ2C 2FZGA 2HRDA 3AP3A 4ZVLA 1U7ZA 2ANCA 2C8JA 1LVUA 3OQJA 5LYJA 1CJBA 1OYOA 4WL0A 2JL1A 2AN4A 1QE5A 4BKMA 4Y8VA 1JAHA 1X7DA 2CXRA 2Z0MA 1Q57A 2HSZA 3NH9A 4WFKA 1IONA 3MJVA 3TTTA 2Q1UA 4B82A 4I9FA 4WX2B 3X1MA 1XMPA 4AMVA 1UUFA 1WDKA 2PBZA 3EXEB 1TU3A 4KLNA 1I7DA 3KHUA 2R1TA 3OTWA 2B3DA 1J7JA 3ILHA 4GMDA 4CTMA 1GAXA 4XDYA 1Z9BA 1ZK0A 3H11B 2EXXA 1U8EA 1CZNA 3FB1A 4TQAA 4CG0A 4WBNF 3HL4A 1EB9A 5EIEA 3BDIA 3OTIA 2I6QA 3T99A 4MKIA 5L9AA 2X0IA 5KPDA 1JMVA 3B12A 2H16A 4P5PA 4P32A 3ZHQA 3GRRA 3B53X 1I5RA 4IGFA 2FN3A 5BQPA 1XDWA 2FVXA 5JZVA 4LF5B 5CA1F 4JCOA 4L8GA 5KEIA 1MF7A 2F90A 1F4PA 4QIHA 1D2GA 5EXSA 4Z4IA 2XYQA 4QHTA 1NW6A 1AXGA 2G07A 1H65A 2LWIA 2HBQA 2YIJA 3CTMA 3IVXA 4TTRA 3GRCA 4D74A 1CP2A 4JKIA 4KFSA 4OA5A 1Y89A 4BPRA 2IDJA 1XEXB 4ZTZB 1WCWA 2FEOA 3ROGA 4L3OA 1A82A 5KKNB 4XAQA 3T5BA 3QVKA 3IYLW 2V3CC 4MV8A 9MHTA 1T6ZA 4NK4A 4MCHA 1OAKA 2IUUA 4E5DA 2B6HA 3OESA 5DN9A 3V4VB 2Z57A 4PSDA 3LKDA 2VPPA 4LQDA 2GEJA 3N2GA 2ID4A 2RGNC 3O91A 1N7GA 1Y5MA 3VDNB 4J07A 5LQJA 3VU3A 4GPD1 4KQ2A 1VRWA 1II8B 1G2QA 4QTZA 4W5RA 3VO2A 2NQ8A 2HSEA 4BVAA 1ZIXA 2G8NA 4RTPA 4HUTA 3CVYA 1TVKA 5KYNA 4DEYA 5DVZA 1SXJC 1M2OA 2JS7A 2JI7A 3R3JA 4KZPA 3FCXA 4NJMB 3RJ5A 4A10A 5KB3A 3KEMA 4F06A 4MS3A 4B73A 4DUPA 1VKJA 4PN7A 1ZU5A 4OI4A 1Z47A 3OZIA 1ML4A 4XTCS 3IKTA 5IVKA 5A7HA 4R1OA 4RD6A 4ZHSA 1MO5A 1RBYA 4B44A 1YB2A 4E2ZA 4JAVC 4Q9KA 3N0TA 4PBSA 4UDOA 3GCGA 1N7HA 2OAP1 5EWMB 2DBVO 2WSBA 3ANMA 4NKRA 3K20A 2XDWA 4CEHA 5EA2A 1GPNA 3DV9A 3C8ZA 2V55B 2ZS7A 3GBVA 1GEGA 3ZH2A 1FIUA 2Y99A 2ZK7A 3L8ZA 4ND2A 1QIJA 1I4EB 2PMDA 1DWQA 5D6OA 4I19A 2GHTA 1XCBA 2DHRA 5KCMA 1FP4A 1P1FA 3P9NA 4ZRMA 4BWYA 2AOUA 2WFLA 3TDMA 1GQFA 2C0PA 1SUEA 2CHGA 2IW3A 3JD3A 1N0IA 5AW3A 3U4QB 1U5AA 2P4QA 2AYXA 2C8VA 4HQFA 1XMOB 1CVRA 1NJ8A 1UWKA 1QG4A 4UCQA 5CVJA 2EJUA 2P2YA 4KQ1A 4V0ME 4B2YA 2MCFA 2IV7A 3VPFA 3E9RA 3OH8A 2WJGA 1HG0A 4FEEA 1ODSA 3KCQA 4A6PA 4IIGA 4E5YA 3T3OA 2UZ0A 5D6NA 1HNZB 2RBGA 5DXJA 1SBHA 1ZVJA 3CKMA 5DOVA 3OBIA 2O3JA 4XI9A 1Y9EA 1BO6A 2DECA 5EYPB 4WNAA 1G5HA 1P4SA 2C2BA 1T5DX 1I0IA 2JGEA 5DASA 1O94C 4JOSA 2B0CA 4H3VA 2WWVD 3PQ5A 3ETNA 1FFGA 3TZHA 3TFWA 4G9EA 3D6MA 3DYVA 2FGJA 2A5JA 3O8OA 1BE0A 2O1WA 1Z6PA 3NJ8A 4BUJA 2C2YA 2FPXA 1J21A 2MSWA 3CMMA 1ZJJA 4QPPA 5BWCA 4E03A 1G2OA 2XCQA 2VSYA 1R18A 4IJ6A 4LA4A 4XIYA 2BDEA 4S2EA 4S1OA 5BMVA 1U4OA 2C8KA 3GCWA 4NQRA 4IEEA 1AKTA 3R23A 2ZUFA 2AQIA 1OCEA 2EW1A 3L77A 5JALA 3D8BA 5HBRA 3DKIA 3BMCB 2BGMA 3TDNA 1Q15A 1I1NA 3AVOA 3ZZMA 3QVGA 2QZZA 1KEKA 1P1HA 4XWTA 3VU9B 5IAGA 5A2QA 3RADC 1T9KA 1I36A 3G8BA 4YC7A 2QV7A 4HGNA 2XXJA 3E5HA 1NMZA 3QLVC 1IDN1 1TB4A 2XT6A 3P9CA 4RPKA 5AKJA 1LC3A 5DHSA 3T5TA 4BQQA 4XQCA 3OLVA 1AS2A 1NE2A 2GLXA 1WA5A 2JAPA 1UDRA 2WSMA 3ONWA 2ZKIA 5TMEA 2AR0A 4J8PA 1M10A 1Y9DA 4D0GA 1JMKC 4MKGA 1H9BA 4GLLA 3RIMA 4GX0A 1MG5A 2BEUA 4OHFA 4QD3A 4O1IA 4BMNA 2AMVA 5IASA 4POOA 2JG3A 1BXZA 1VJ5A 5KDLA 2GKOA 3VKVA 2JAUA 3OZFA 4KAXA 4U7TB 4KRYA 1MOPA 3WIVA 2A1IA 4LK3A 1L5YA 5E7IA 3H2JA 4R8KA 4BGIA 2NV0A 1OD6A 3ETDA 1Y6RA 5JSUA 1PDOA 2XD9A 4NEQA 5I7AA 4DAOA 3E9EA 5H83A 2BJHA 4YP7A 3KPYA 1PV1A 2PS3A 2ZRKA 1W1WA 3TE7A 2PGIA 4UBKA 5HS4A 1JXMA 4Q34A 4DXAA 5EJFA 1MMFB 1RWXA 2PQ2A 4OK6A 4RE6A 2HF9A 5DIFA 4QFBA 4JJKA 4MGEA 3FYCA 1NR1A 3L7MA 1V1JA 3PSHA 1D1TA 3ETJA 3A1VA 1KMQA 4QBKA 4M7RA 3N0XA 4HEJA 4LHZA 5LZ2A 3DMTA 5BWMA 3H17A 3QJGA 3EBLA 2G6BA 2DT8A 3AMVA 1KAEA 3FPBA 4FYYA 2PT6A 4NZYA 2YFYA 1EX6A 3GELA 1N2ZA 5JWHA 1EWQA 2DRIA 2ZRAA 3HZRA 1SWVA 3G82C 3O8RA 3SR0A 1MU0A 2HZ7A 2BMVA 4W5HA 2AXNA 4DCUA 4DANA 1HKUA 3C14C 1PGJA 2WV7A 3D6HA 4QOHA 1OFIA 2C4MA 1X8KA 4D6YA 4ZEOA 3WQRA 1TJYA 5TR9A 1OKKD 2KX7A 4KQEA 3WGZA 2ODEA 4G4SP 2A1UA 4J6EA 2R87A 2L69A 5KSZA 1T4CA 5EHIA 1IWPB 1QV6A 3LCUA 3QQPA 2YW2A 4QUHA 1C80A 1U0NA 1WM1A 4B80A 1E5DA 5KQLA 4GP7A 3F7TA 1GADO 1SCNE 2R96A 1WDWB 1OBVA 4KR0A 4Q7QA 1TTTA 2O2ZA 4YJ3F 1HWYA 3OIWA 2JGRA 4URVR 3GQVA 4QOGA 3UJAA 5JCJD 4OI2A 2BF4A 2P75A 4JDPA 1CG6A 3OHMA 1PWHA 5CLFA 3GDFA 3GOHA 4L0QA 4UHCA 1E0DA 3JYNA 1I1OA 3CRQA 4TLCA 1TL7C 3WKAA 4HB2A 2FW0A 4MDFA 5EP1A 3HXLA 1YR2A 3K0CA 1UC4B 1EBUA 4R4JA 4XYBA 1SWWA 4BN0A 3T8YA 4JUBA 1QP0A 2VWHA 4TMKA 4V1CB 3MS7A 2ZUEA 3EQ8A 3IB3A 1U9IA 4MNTA 1Z0UA 2Q0QA 3IKMB 1FVFA 5FPYA 2OO7A 2VP6A 3NTQA 1J2JA 4FHDA 4QBHA 5D85A 1MIOA 3K09C 4KAJA 4CTNA 4EYSA 1XHLA 3H75A 4ZN6A 1GPKA 3C5WP 4M8IA 4MQ5A 4OHUA 3D0RA 5CVCA 4QULA 2FPMA 2E87A 3LL7A 4EHIA 1LVGA 3LT5A 3LRXA 3FCCA 5AMXA 3E53A 2Y0PA 3ISVA 1K6IA 1N0WA 3FDZB 4HWTA 1QONA 3PWKA 3LY9A 3HEAA 2HCFA 3VXKA 5IEBA 1JG1A 2LP4Y 2IXAA 4ERXA 5BSMA 4RJLA 1A98A 1W6RA 4C4AA 4G81A 1ZOSA 3WWYA 2GZSA 2C5SA 2RH4A 4RXUA 1IFXA 1ZQ9A 2YASA 5TF0A 1KAHA 2PXXA 2VHTA 4EI9A 2ZGVA 2PGLA 4JYMA 4IYRA 4Q9NA 4QTUB 1QFZA 4QASA 1SQGA 1ZL0A 3MNFA 5ES3A 5L7YA 5LC1A 4J4BA 4MUKA 1MO3A 5EJIA 1GAJA 2OCKA 3LPCA 1JEOA 4OPMA 3SC6A 4AMUA 3A26A 3LWZA 1SBNE 4US1R 3WGUA 1CZKA 2P5YA 4TS3A 2G1KA 4IFIA 5AXDA 1JKJA 4ALKA 1G20A 4IOJA 2NT4A 1G18A 3AYXB 3HNOA 3N0VA 4Q1EA 3CB4A 1GZVA 3DKKA 4XPIB 4EZBA 2HJ9A 3I37X 3PE3A 2ZBPA 3PZBA 2I2WA 5KYYA 3N75A 3D6VA 1MVLA 4WBNB 5A4FS 3IE1A 4DN6A 2HQRA 4JYAB 1E1QA 3ZWOA 5BRAA 2C9BA 1M9NA 1Y4ZA 2H65A 3O9ZA 4RYLA 1R0KA 2C84A 3KD2A 3THRA 3DFKA 3KWFA 3L8CA 4G89A 2R47A 3B13B 3C6ZA 5FTJA 1N33B 2ZRPA 3FFAA 1VIVA 1MFPA 4RKWA 5CA1B 5K6AC 2F3UA 3CKYA 4PX3A 4E2YA 2EFYA 2RK3A 2WD8A 1MB0A 1O97C 1BH6A 4MP8A 3FYHA 3L41A 4GPEA 4YNBA 4ZARA 5EAIA 1W5BA 1TT5B 4BMCA 3WLNA 4HJXA 1IN1A 4PZYA 2H4WA 1N1MA 3OEEA 1N0UA 4JBIA 4QSHA 3OIUA 1KYXA 1OYVA 2OGUA 3EVTA 4IS2A 3WFJA 2I4OA 1J5XA 1PCXA 3ETLA 4GP6A 4J0CA 5TGDA 3Q3HA 3KT0A 3A9WA 4NNJA 1ULSA 4A1FA 1CIJA 2VDOB 1PIWA 3PD1A 4ESOA 1NU8A 3CN9A 1V5EA 1LV7A 2FQYA 1UK7A 1GTG1 1TVEA 1RM4A 3TVTA 1E7SA 3G7UA 4BYMA 1RYYA 4O1MA 4P4UA 1B00A 1L5FA 3KLOA 1FP6A 4FXPA 4Q7KA 1X1SA 1AG9A 1LF0A 1ZOPA 1P0CA 2ZAMA 4NENA 3UJCA 4DSAA 4EY6A 1MT0A 1ZCFA 4EP1A 2V4UA 1HY3A 4NF2A 4CV3A 4HVAA 5CYPA 3P97A 3CPSA 2CZGA 1LJUA 3KO8A 4UHKA 5AOAA 1U1IA 1UPTA 4ZOEA 1DIHA 4ZEVA 4B7UA 3TM4A 4YXWD 4WJZA 2I2DA 4UTXA 1XK7A 4MYHA 3SNKA 4WKBA 3VZCA 1KIMA 1TUIA 1QVVA 3C39A 3OPXA 4JZKA 5DTQA 5EGSA 1RZUA 2SECE 3FLAA 2FU5C 4MQLA 1E3EA 1GD1O 2CJPA 2IZOA 4DLKA 1NNSA 2Q5LA 4C0SA 4JASB 4WVFA 3T52A 4AAYA 2RD2A 1KSHA 1PJCA 1N77A 2L2QA 3JQEA 1DBPA 1R66A 4RQTA 1HH4A 1PTKA 3OBBA 3VTKA 3ZHYA 4BNVA 1THZA 2DFLA 3E9MA 3WQBA 5KOJA 2JAWA 4JJ6A 2ERXA 1G9SA 1EHCA 1S1CA 1Z62A 4UMVA 4WLVA 4WERA 4OHYA 1FFDA 1HYQA 3UQZA 2VP2A 2ZVQX 5AKHA 3SVLA 3BVPA 221PA 4DDHA 3OLXA 5TVKA 4X44A 3RRYA 4KVAA 4UM5A 1UKBA 2W70A 5D3MB 5F3DA 1MQ9A 1GPMA 1J1ZA 3VX4A 3ZCRA 1PX2A 5G02A 3KJIA 2PLRA 4GH5A 4WEQA 3VR3D 1OASA 4D4HA 3H5OA 5H59A 3SSMA 1UFKA 2P4SA 4OYHA 3DFUA 4I9HA 4NFLA 4OLHA 5AK5A 3MJDA 3WMEA 3UWPA 2DCMA 3FUXA 3I04M 1WBBA 1MBZA 3BK1A 4KAAA 2ZDHA 4N3BA 3CY6A 1EWVA 2FCAA 2DVMA 4ZC1A 2BFOA 4DDWA 1QB7A 3ZDZB 2VHQA 1NF2A 2HBRA 5FDFA 3WLJA 4QNMA 3Q88A 1I3NA 3T0FA 1NW4A 3TO5A 1A5TA 2DY1A 3NJ4A 2C07A 2Y76A 3OPVA 4LHXA 5CT9A 4YN3A 2HUPA 4FHGA 3LT1A 4GW3A 2Y4NA 1XDUA 4RK5A 4DV6B 4P35A 3EZ9A 4CCSA 2SHKA 4BLRA 4CTOA 2CJFA 4PNEA 3MB8A 5LIPA 4BXOB 2W2LD 4FTWA 2KW5A 3P9QA 3WQQA 5J5AA 1YVUA 1ZP6A 5TX7A 2V5UA 4UZFA 1UXIA 2BISA 3F9CA 4L6IA 4MB0A 5K3DA 3U2QA 1Y3FE 4NYJR 1AM4D 5G40A 4DREA 1C4XA 1G3QA 4MP3A 2D8AA 3JQBA 3KSUA 4TOIA 2YZKA 1WLYA 4UMFA 1ODIA 2XXAA 1ODKA 4HYEA 4PYRA 4U9UA 1Y98A 3UPUA 5FWAA 1SEPA 2BMJA 1SO8A 5IUKC 4EDFA 1B8NA 1D03A 1XL1A 1JEQA 2HPZA 3JQGB 3WLFA 5EKUA 4LSZA 3R5JA 4I3GA 3RROA 1MENA 3DV0A 3UJ9A 4ASUA 1TCBA 1ZH8A 1Z7EA 4PZAA 5BR8B 3INTA 1ZDMA 3BXGA 4QJBA 4OH7A 2PANA 1YZLA 3NHSA 5LLSA 4EF4A 1CP3A 1ZM7A 2C83A 4PBRA 1I0LA 3RNLA 4JBLA 1FW6A 1KPIA 1Z4QA 3JARB 1JR3E 2VDWA 1LJ8A 2YIDA 1LS1A 4A0FA 4AMYA 5JSFA 4BUCA 3N8IA 1VYTA 1EJBA 3FZQA 1B93A 3HBJA 5EC8A 2JLXA 2HIAA 1KO1A 5KNCD 1EB8A 2JLQA 3RO7A 5IULC 1I4OA 1Y82A 3H3FA 4L0MA 1U2GA 5LP6B 3V8RA 4WZAE 1LSJA 2H11A 2VJNA 2W7TA 4H16A 3IV9A 4I7EA 4JV5B 1GRNA 5KYUA 1KJZA 1Z5UA 3PJFA 3RSZA 3L1VA 4OHVA 2GYVA 3I9OA 2FRXA 3EGWA 1IB6A 2R6GA 4R2JA 3BXZA 3PE4A 4V24A 3KR0A 1QRTA 4Y0NA 5KCZA 1KXZA 1U2DC 1LLQA 3ESRA 3LDAA 3OLQA 4GMGA 1BMTA 1EVEA 1H2EA 1JSRA 2NACA 2W6OA 3L0CA 4ZRDA 3SJBA 1BHQ1 2Y1WA 3OC6A 4C29A 3PSAA 3W8RA 5IJ0A 2W9XA 4NBTA 4RHYA 3WK7A 1TM4E 2FN4A 5J4LA 4YJ2F 2HSDA 3FLMA 1KQNA 1NYRA 4E11A 4PYNA 1T4DA 4JBWA 4P5DA 1DAHA 1E9EA 3HKBA 4PZCA 1TUBB 3PX3A 3LECA 4Q16A 4F2PA 2V7WA 4Y18A 4YAFA 4RJTA 1N6RA 4NXMB 5CNKA 1E99A 1VP3A 4NI5A 5GM2A 3H3XA 1O8CA 5KNLA 3SJUA 1RYHA 2JFZA 2UYOA 4JSTA 4UQLA 2O3QA 2UZIR 3PRJA 3GJXC 4IYJA 1P1RA 3SBOA 3N2LA 2XZOA 1XTIA 1A88A 4EZEA 1PGQA 4W5OA 1GQSA 4MRVA 4X7MA 4RZXA 4Y1RA 4RTKA 1WMDA 5F51A 4DG5A 2JH9A 4ER5A 3DEIA 2C1EA 4TLBA 3T0GA 2DSTA 4KWIA 2NO9A 4QX6A 3MTEA 1SELA 4FEYA 4E21A 4J03A 2PZLA 2OV6A 4RSMA 4RGYA 1EXNA 3U7EB 5JNWA 5AM3A 2ZU6A 4K9MA 4D9BA 5A9SA 2H8GA 4XB1A 1ZGGA 4PQEA 1FDOA 1CUUA 1MQAA 1SQSA 3EWIA 4YJ3B 3TLGB 1E0JA 2X2PA 1FDVA 1O08A 4G5HA 3WJ2A 4YUYA 3ZIUA 2JAQA 3VHQA 4LY0A 5ABPA 1H2WA 1IZZA 4G8BA 4OP2A 4D41A 4DLBA 3C74A 4Q1VA 5CYOA 1AB5A 1D6NA 1NLFA 4U7DA 1MJGM 4KPUA 4BMYA 1JEEA 2WJVA 2WW8A 3VO9A 2R4QA 3RAFC 5DYGA 1U8AA 2C31A 3L8GA 4LJSA 1EFHA 2X9NA 3W2IA 2BHLA 4L9RA 1TYZA 1E94E 1IOLA 4D9MA 5E1DA 2I8LA 4X8HA 1LC0A 2ZETA 4ALMA 3ZY3A 4W8OA 4KRFA 2NXNA 2AL7A 2B37A 2XITA 5JY1A 4H15A 1HSOA 1KMHA 1Z6ZA 3BPSA 1DAIA 3Q3EA 5JRJA 2GFQA 1GEEA 1S4QA 3B48A 1NF3A 3F96A 3FSGA 1NQWA 3NIFB 4BAUA 5CM9C 3QI2A 1EWYA 1Y80A 1YFLA 2GJAA 2JA2A 2CZQA 3DWEX 2QLMA 3SJAA 3X2SA 3LLSA 5C8YF 4FQ5A 5HF6A 3A6EA 3FW1A 5E2IA 2JCBA 2YQ5A 4KJXA 2EG9A 4IIHA 5FOWA 5TB5A 5D3ZA 3FKSA 3KZ1E 1XQYA 3ANNA 1LQUA 4FONA 4HFMA 2B25A 2EWMA 4C0KA 2CK3A 2RGWA 2WTBA 2PAAA 1RMYA 4YCAA 4X61A 5BQ5A 1C3JA 1RZRA 4B9AA 4PIVA 1PQPA 2YHSA 4YAKA 1DLJA 4JFRA 5JAMA 3IQGX 4LI0A 2HY7A 3I58A 5J4KA 5JC1A 2FW9A 2VS1A 4GR9A 4YCJA 2I66A 1NSTA 3SJ7A 8ADHA 3T41A 2F3PA 2Q4OA 3ZIAA 4PW0A 1SCDA 3GI1A 1QUEA 4EUSA 1N9GB 1KDOA 2FZKA 4XDHA 3T3NA 3R7WB 1V26A 3M70A 2OBMA 4NVRA 1A4UA 1QC5B 2G9NA 3ONEA 1AMOA 1KH3A 3HK2A 3ZY4A 5JD4A 4V3BA 2QL7A 3VI3B 2AEEA 4LRTB 4NCNA 3BSSA 4PYLA 5LQRA 1QTRA 3D6FA 4N82A 4DC0A 3NG1A 2L82A 3C4JA 2QY6A 3OP4A 4H6WA 5LXTA 1E62A 1VKHA 3SQLA 1QGDA 2UVDA 4RTMA 3K53A 4MLZA 2V1UA 4AJOA 1L5SA 2JIMA 2QL9A 1QE0A 1UQTA 2NZ2A 2RHCA 2CD9A 2VHYA 3GD7A 3GUVA 3UWOA 3DBLB 3UT0A 4PO1A 3O8QA 2Y93A 4V2IA 1FNSA 4ZT4A 3T3HA 1UOPA 1YBMA 1B6RA 4CGZA 2NZUG 2Q9UA 2OMEA 5E0OA 4FR0A 3WLHA 3N1UA 3H42B 4XM0A 4IDOA 1R8QA 3PDWA 4Z53A 1KFEB 1NVFA 2F62A 3BSFA 5KJ1A 3VV3A 3L5KA 2GYWA 2PVCA 4DMCA 3WIDA 1F3OA 2OY0A 5HF9A 2ADOA 3J81k 4J0HA 1S4MA 2VF2A 3K2BA 4TQUS 3ND5A 5D1HA 1Z08A 3G85A 4PPFA 3O8LA 4RK6A 1BA2A 4WNCA 2OBLA 3EXIB 1BYUA 3ECCA 3L18A 3V7WA 2D5BA 5BR1A 4X1IA 4CKEB 1KDYA 4HPXB 2P2SA 3ZGNA 1UODA 3DGEC 2PDAA 3LK6A 4PYMA 1IN4A 1XRJA 3AEUB 4DC1A 2YXPX 3NGMA 5K7SA 4KHPB 3MWDA 1O6GA 1XELA 3GGPA 4KHZA 2ZU0C 4CM4B 4UEQA 4F6RB 4YRQA 1X19A 2VQ6A 4OHRA 4F8EA 4P0TA 1EJ2A 3D4OA 1YDHA 2P1ZA 3UAWA 2I2XB 3O4GA 1ES9A 2CMDA 3F4KA 5KI6A 1N75A 2D62A 5JXIA 3TJRA 3UFBA 5HKBA 4S3MA 3NVDA 1RWMA 2QXUA 2ZFUA 1GCAA 1IEVA 3I9V6 4YONB 3ZUGA 4L5AA 5IG2A 3ZZ1A 5BSFA 4B6QA 1OVMA 1QGAA 1YMQA 2QZ9A 4EGFA 5J4HA 1P18A 3PQEA 1LTQA 3TE6A 4YT2A 1ONPA 1T6XA 4QJIA 2KE5A 1NVKA 1TC1A 3DNMA 2F3QA 3S2FA 3ZE2B 4ZHQA 4KREA 2HV9A 2FCRA 3NUGA 1W88B 2XKJE 3CUSA 3KBOA 1SPXA 3HNRA 3P71T 4XE5A 5CDTA 4RA9A 4BRUA 5L7TA 3QXSA 3R0JA 3VNBA 4Q12A 2AGVA 2W43A 1U8ZA 2EAUA 5CFPA 2QAJA 3BXXA 1SVLA 4QATA 2HJGA 2EYQA 1ODLA 1QRAA 3FJOA 1UMDA 1RE1A 4TRNA 4DLWA 4C5BA 4V1CI 2IZ5A 2QTZA 3EMVA 4GHWA 4PGMA 1Q0UA 5A4MS 1PT8A 2EQ5A 2HXGA 2IU3A 3HY6A 4LHEA 4CQJA 2J8ZA 1VSTA 1IEQA 4BVLA 1ZVQA 3WIOA 2GB4A 2GD2A 2K2WA 4YCLA 1I80A 3TRFA 4CF5A 1QIGA 1L9KA 1Z2OX 1EFDN 3CSUA 3KOOA 4G26A 4YP6A 4ZYXA 2UUCB 3ENWA 1WSAA 4BLVA 5I7UA 4DDUA 5DOZA 4UMDA 2JEOA 3JS5A 1E66A 1ZD8A 2MSKA 1Q84A 3F6RA 4O2AF 4PSVA 3WADA 4DMFA 5EJ6A 2VEDA 3U13A 2OOSA 3N2IA 4BB6A 1JQAA 3BG5A 1X7GA 3GBPA 3AJ9A 2V7BA 4YJGA 5FB3A 1QH9A 1ABFA 3HH8A 1G16A 1LSSA 3E61A 3KXPA 1GG2A 4EJSA 3WBJA 1H05A 5CDSA 3ZR4B 4RE5A 2D59A 4NSNA 2ZR0A 1KMIY 2PRJA 4O2BA 4XB6B 5E4JA 5E6UA 3W3AH 4C7OA 4RNCA 3LL4A 1JJVA 4N5IX 2CWDA 1A97A 2QN3A 2WJ4A 3KTDA 4LY9A 2WUEA 4HAWA 3O4HA 1G17A 3DYIA 3MSCA 5CITA 4XWWA 4FHEA 3EFOA 1LDNA 1V3TA 4IIYA 3BA6A 1KA9H 3L8HA 3COYA 3IOYA 3HXKA 3QLJA 2BFCB 2ZTLA 1E2DA 4OY3A 3NTUA 5EERA 1PEKE 1SGWA 3T7AA 4RTQA 3NZEA 5KJCA 2V9ZA 2UKDA 1J8DA 3H0EA 3UJNA 3HR4A 2ECKA 2ZXEA 1XDSA 4MUFA 4JBXA 1NXOA 3B9BA 2VP0A 2RI1A 3RTGA 1ZM2A 2JD0A 3LM8A 3CT6A 2J67A 3NNSA 4NYMR 4ZO9A 3ZE9A 7GPBA 3GZJA 4GEGA 4OK5A 1NYLA 3G8CA 5E38A 2K7ZA 5TXGA 2FHPA 4ZMRA 2H1IA 1M2WA 2PU7A 2WJHA 3V00A 4GGMX 4RD3A 5DHAA 3PEYA 4JD5A 5F1OA 2QX4A 4WZAB 2HWWA 4ARVA 2B61A 3TTSA 2GFHA 5CU7A 3C5VA 5FWDA 2OZLB 2F8MA 3FCSB 5EWLA 1TLFA 5IKMA 1GPLA 2JFWA 2BY4A 1K63A 3UMBA 3THSA 5AW4A 1UAAA 2BRUC 1A5SB 2OG1A 5B55A 2HO4A 4OQLA 1YS9A 1K1EA 1PUJA 3U61B 3WA7A 4I3FA 4WI1A 4CDNA 5HBGA 1KHHA 5M34A 6ADHA 2JGFA 1P9OA 3JAWA 4AYXA 3EF1A 4KK4A 5G0WA 2DT5A 1RAIA 2Q3BA 1BNCA 3I2JA 3GT4A 2EOAA 1Z2NX 2N0SA 2OGWA 4WK0B 4YJ2B 5DJ5A 1OZFA 4HDAA 5A3VA 2C7GA 4JUDX 1U81A 1XOIA 1EK6A 3QPUA 5FNVF 3HKDB 1P6XA 4XDZA 3TVYA 3STVA 4W99A 1NW3A 4WK4B 3HJTA 3EGXA 4L8LA 4MVXA 4H1WA 4I6EA 1RLIA 3HKCA 4FWIB 1YB6A 4MRPA 4N0QA 3DMPA 1ZUNA 1V0JA 1NM5C 3A8TA 3FOCA 4UXIA 3GA7A 2MDTA 3RVKA 3QEOA 1QV9A 3UW3A 5BO5A 1TK3A 1C30B 4XB2A 2DUNA 3PXDA 4LDZA 3Q85A 3H2IA 2HL6A 1IHUA 4EYQA 1V71A 2VWQA 4FNMA 1U7DA 2RFLA 4F5EA 3RS0A 5I5GA 3FYUB 5LZ4A 5C3MA 5LMNB 3BAZA 3EF0A 3KSZO 1QHYA 3CEHA 2A0UA 1X9HA 4FYJA 1AQYA 1U94A 3KAJA 3MQ4A 4HI0E 4UUAA 4BX0A 4P0PB 4K8OA 1P1BA 4L5BA 1KJ8A 4ANFA 5IDVA 4OHXA 3BGWA 1Z5ZA 1MG0A 4GOKA 3ZHXA 5E3HA 4WDQA 4ZQEA 1SKAA 1KI2A 5HTKA 5AVRA 4AXBA 1SCAA 2J85A 4ITVA 2I7TA 5EZ5A 3AF2A 3AJAA 3DMYA 1C7RA 3DXYA 1T0PA 1I4WA 3A4LA 1Y3IA 5CT8A 4L85A 1WO8A 3JAKA 4C4XA 2XF2A 2J33A 3AY0A 4POAA 2VP4A 5FUMA 1CNFA 4C03A 1XLWA 4D43A 3PQ2A 1O96B 3C3BA 4P34A 3VRHA 2JJMA 3MXOA 4RPJA 1ZWKA 3OQHA 1JFVA 5DTJA 5B30A 4LTNA 3U4DA 4CL8A 3QITA 1WW3A 3EIQA 3HSYA 5KYKA 3MJHA 4JXJA 4G0NA 4IIVA 3CCBA 1J0XO 4S2UA 5HMLA 1KYYA 1Q50A 2D1QA 1UWVA 2IL1A 3ACDA 3IQEA 5AK0A 4UHFA 4W7HA 3UBMA 4CN8A 1HT3A 2O7VA 4G3XA 3M6WA 4ND7A 5C8YB 4Z1MA 5GZ1A 2AG5A 3N0RA 5FBLB 1GPJA 1ZRMA 1QFYA 1MVOA 2O6HA 4ESEA 4BIMA 4FK8A 3TR0A 5JS8A 4LOKA 4HWPA 3GLFB 1F17A 4K26A 2IZ0A 2VJBA 4L0CA 2HWKA 4CI9A 1EDBA 4F12A 5C4MA 3ICQB 1NMEA 1QE3A 2AZTA 3VSDA 4BO4A 1U2ZA 4EIWA 2NSDA 4MVJE 2AV6A 5EL0A 2GGSA 1XMQB 3G7SA 4ID9A 4MVJF 4AKEA 4IGKA 5DHUA 2GN0A 4MJ7A 1XX6A 1YTUA 1N8KA 4NONA 5IW8A 2DWUA 4PX9A 5IBPA 2PKEA 2FWMX 3S0JA 3AY7A 1J8VA 3H0KA 2EFDB 4CIBA 4YP5A 2KHZA 3P52A 2H7CA 3LUAA 4L4YA 3LQFA 1QNFA 1ZZGA 2FSHA 2DOKA 4CUKA 2WUDA 4BLOA 3BH6A 4MVJH 4AWAA 1P80A 5BSTA 2G9QA 2FK7A 1MAWA 1MOSA 2WVAA 1S7GA 3PLNA 4LZJA 4Y2UA 2YV3A 2J0EA 3QSYA 1DUVG 3JYLA 2HXSA 5FQNA 1EM8B 4LN1A 1YOVB 3KJQA 1KL7A 4KUHA 3FG9A 1MZPA 3CNBA 4ER6A 2O8DB 1P4AA 2LPMA 3NAZA 1OV4A 5AW1A 2GO1A 3BRWA 1SRRA 1S3FA 4NMHA 3QU4A 4ZICA 3MJRA 3GC6A 1N4AA 1U99A 2H57A 1DAMA 2W2NA 3SM3A 2QX7A 3S7ZA 4NRDA 2A9PA 3KXDA 3ZGXA 1QPZA 1TM3E 2WPDD 1LH0A 3RQSA 1P73A 3I1YA 1N2BA 2YWXA 3NGLA 1VA5A 2CNLA 1C81A 4ZREA 3ZU5A 5JAZA 2QRVB 3HVKA 5DYWA 4UTNA 1UCFA 4D57A 1QYXA 4WKPA 5GJCA 1TO1E 4NOLA 4NU8X 4WT7A 3C1AA 4L8YA 2XLCA 1IDOA 2Z83A 4RHUA 4TUYA 1AUPA 2L17A 2XADA 3G9QA 3NONA 3J7AC 2HXYA 3BIOA 3DAPA 4MYRA 2H5LA 1HC7A 2HZBA 2OGTA 2KQUA 4YV1A 4L9SA 3ZJTA 4EHAA 2XW6A 2FLVA 3O8DA 4CM3A 4ZVRA 3WLSA 1BHO1 2GVDC 1X9GA 3W05A 5IVHA 1X42A 1ZGBA 2BMEA 2J5BA 3HMKA 3A9UA 4YJFA 3RARA 3QE0A 3URKA 2K7FA 1IZYA 1GPDG 1VLMA 3BJZA 4B6EA 5F78A 2C3MA 4CM1A 5AW5A 4NFSA 4RZ2A 1SQ5A 2UVQA 4TLAA 1DWUA 1V7PC 1Q0HA 1E6LA 1XCLA 1QHEA 3ZW8A 1JWLA 2GLUA 3P1JA 2CLOB 1S1MA 2IXEA 3JQAA 3UJDA 1JHUA 4BP1A 2V7EA 1F3LA 1QBGA 4H3KB 4ZAZA 4YWJA 1ZBQA 3OQ6A 3EZGA 4B4KA 4GLFA 2BSQA 5HFJA 2I9PA 1D04A 4RS3A 1O87A 1HTTA 2JCXA 4XX0A 4JI5B 1Y6GA 5BSUA 4GX5A 1B3BA 5JNVA 4ZVQA 4Q3BA 2H7VA 3E3OA 5IKPA 2J1LA 3I09A 3LWDA 4LSMA 2A0YA 1R6TA 1JDSA 2C7BA 3T5GA 1JF8A 3FDJA 5I9SA 3VR6A 4KLCA 3KS9A 4J0FA 5DMXA 1ILEA 3BB1A 3WA6A 5ICFA 3LF2A 4A3SA 4F85A 5ALTA 2P7IA 4KC0A 4QU9A 1PNRA 3QHQA 1PL0A 1VLVA 3AUUA 4MR9B 1HPLA 3X44A 5IUJC 3RT9A 5H0IA 3AHFA 1MEOA 1R0LA 2E82A 5ED0A 3RYFB 1EESA 3TX6A 1FUEA 2NXWA 4YRPA 3FPSA 9LDBA 1YCHA 2K87A 1OR8A 1Q5PA 3ZHUA 1KBQA 3SXPA 1JBEA 2YFHA 4NBRA 1CY8A 1YZNA 4TYPA 3R7BA 3RTAA 1UF9A 3B2EA 3IMFA 1PSWA 3H5WA 1C3LA 1ADCA 4FDVA 3WLIA 4TWAA 3K9LA 3HN7A 3VPGA 1RYBA 3M6MD 1S8OA 2WF9A 4JODA 4F4DA 3B8HA 4LGCA 3N05A 4TV8F 5FPSA 3SJZA 2X2EA 3WTBA 1YMUA 4R9NA 4DCSA 4ZD6A 1QIKA 4UAGA 2QYTA 4OBXA 2H7XA 3HUEA 4JXKA 2E4ZA 1XXHE 3DQZA 2P1RA 4O2AB 2WBLC 1EUCA 1SULA 3KKMA 1US8B 2Y1CA 3UB2A 3L6RA 1WP4A 3EDYA 2QHXA 2VVTA 2ZIEA 5FTMA 1DC6A 2ODAA 1QHSA 1O4WA 1VC2A 3NMUF 4KX5A 1VHTA 3O90A 1CY0A 4DM7A 5A6SA 3TBKA 1GTSA 2C5EA 4LMRA 2PPLA 3VSBA 3HB7A 4K9QA 4LYJA 3A25A 4NBKA 3RS4A 3A2MA 1INLA 3OEHD 3K70B 4JT9A 3GLGE 2QM3A 1NATA 4MR8A 2CFSA 3V34A 4X93A 2ZIFA 4U7FA 3VOBA 4CEJB 2H1VA 3HBLA 4JB2A 4LJKA 5JY6A 1YV9A 3KT3A 1ZGCA 4UUQA 3F90A 1VDMA 3PF9A 1YR1A 5BT9A 1BDMA 2PX4A 4MPPA 4J7CA 1GZSA 3CLVA 1Y1SA 2XE7A 3BMNB 3TVDA 3C24A 1R6DA 1S02A 3CBGA 2CXSA 5EZQA 3GZNA 4TTJA 2FWAA 4P83A 5COBA 5C81A 1NXSA 2OYRA 4C6TB 2R1VA 2YHBA 1ZMXA 4W6QA 2WOJA 2Z4RA 3FSRA 2KM1A 1NLZA 2GRJA 2DEUA 4FYXA 2OK7A 1J6UA 3SFVA 4YLYA 1JFFB 1WOYA 5DM1A 2P2ZA 4MVJG 2VJOA 4DIFA 3FGNA 2AN9A 4NPAA 4BMZA 5BUCA 1SKUA 1IY9A 1Q92A 3EXHB 4MP6A 3MMPA 4ZVSA 1S2IA 1QWSA 2BN4A 3ZVLA 4NCHA 5K6TA 2OP0A 3HB4X 3INGA 5LM3A 1P6UA 3UJBA 1FTNA 2AJTA 5C1BA 4AT1A 3H9QA 1EGQA 2IDZA 2WV9A 2ZPTX 3P9KA 3KQOA 3DD5A 1V5FA 3GLTA 3UCFA 3WGVA 5AJTA 2EZ4A 5HJ7A 4OI0A 4KMRA 5JARA 2GBIA 3E03A 3L2OB 5BOSB 3D3QA 1AKWA 2G36A 3RFVA 1GQRA 1DZIA 3OPMA 3DZJA 2M6KA 4RZ3A 4DBZA 1BJRE