2FYTA

Human hmt1 hnrnp methyltransferase-like 3 (s. cerevisiae) protein
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
311
structure length
311
Chain Sequence
FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 3
publication title The Crystal Structure of Human HMT1 hnRNP methyltransferase-like 3 in complex with SAH.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 311
sequence length 311
ec nomenclature ec 2.1.1.-:
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 2fytA02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2fytA01
4GEKA 4WVLA 5EC8A 4GC9A 4RX1A 2NXNA 1P91A 3BWMA 1JG2A 1EJ6A 2O0LA 5D1HA 2PKWA 1G8SA 2YXDA 5T64A 5DX8A 1EQAA 1ZHFA 1XVAA 3AXSA 4KVZA 5DLYA 2P7HA 3ANXA 2GS9A 4E2WA 1OR8A 1P1BA 2XYRA 2ESRA 5K03A 5GP1A 4PYKA 3FUTA 1PRYA 2G72A 1Q0SA 3G2QA 3CC8A 2GA9A 1VE3A 2IP2A 1YFJA 2ERCA 1L3IA 1L3BA 2ZZKA 3AWIA 3LKZA 4XCXA 4NECA 9MHTA 3OE4A 4HGZA 4EKGA 5E8RA 5DM4A 2BM8A 3BGDA 4RTKA 3HP7A 1EJ0A 5EHGA 2PT6A 4F85A 3SGLA 4GF5A 3M6XA 1ZQ9A 3LCVB 3M4XA 1UFKA 3UA4A 4KIGA 4HC4A 1KYWA 3UA3A 3UFBA 4HH4A 4C07A 5EZQA 3R6TA 3UJAA 1NW3A 3UJCA 1JQEA 2I9KA 1U2ZA 4RTOA 3FPJA 4QPPA 2OPBA 4CKBA 2C7QA 2UZ4A 1R00A 3O7WA 4JXJA 1XDZA 4YUYA 2VDWA 3G2MA 2Q41A 3G88A 5C1IA 1EG2A 4XUEA 4PYJA 3C6KA 1YUBA 4FZVA 1D2CA 5E9JA 4AUKA 2IDJA 4PIPA 4R8RA 2NXJA 2YXLA 1WZNA 2R6ZA 3OFKA 3C6MA 3UWPA 2ZWVA 4PGGA 4CTKA 4X41A 5EGSA 4C03A 1H1DA 5CVJA 8MHTA 3NTVA 2O05A 2PT9A 4OQEA 4DQ0A 1NBHA 2ZBQA 3FUVA 2NP7A 1IXKA 1L9KA 2O07A 3EVAA 3PB3A 3KQTA 2YTZA 2AOWA 1RI2A 3C0KA 3ME5A 4IV8A 3TQSA 2OO3A 4MTLA 3BKXA 5BW4A 4P7GA 3FTEA 4RTLA 3ID6C 1TPYA 2ZSUA 3KU1A 1WXWA 4OA5A 3HA5A 3TR6A 5GIPE 3DXXA 3GRUA 4OBXA 4PCAA 4YUVA 1BC5A 5F2KA 4GQBA 2HWKA 3HCEA 5K0NA 2GPYA 4DF3A 3NJRA 4E70A 3MGGA 3EPPA 3JWGA 1X1BA 5HEKA 2QYOA 2ZFUA 2B9EA 2IGTA 3BWCA 1JTEA 2UYQA 3P2IA 1AF7A 1KYZA 1VP3A 1RJDA 3EEYA 5F2NA 1VBFA 1QYRA 5LQNA 3BT7A 3KQOA 5EMKA 2PBFA 3DR5A 4OX9Y 3SSOA 5DXAA 1NE2A 2JHAA 4HRAA 1SUIA 2YX1A 4U7TB 4QVKA 5E1DA 5U4XA 4ER0A 4FS8A 1G60A 2OY0A 4AZTA 2NXCA 3NVMB 2ZVJA 4X61A 1RJEA 2CMHA 2CL5A 3VYWA 4WXHA 1SQFA 4LWPA 4PIMA 1SKMA 5DTMA 4YUZA 3FYDA 4C08A 3KQQA 2AVNA 4CTJA 4KW7A 4ER5A 1R8YA 7MHTA 1YB2A 2YUIA 3KR9A 5K0LA 4DMGA 4PGHA 5KS2A 3GRVA 4OQDA 4RSRA 1L1EA 3A7DA 5CVVA 2CWWA 3LDFA 3BWBA 4M7RA 1JSXA 2PSSA 1R6AA 3A25A 3KKZA 4E2YA 4YV0A 3T7SA 3UJ8A 4HG2A 5CCBA 1G38A 3P9IA 2XVMA 3I53A 5FHRA 2UYCA 5LR6A 2IH5A 2AS0A 3HM2A 3C3YA 5DTRA 1ZGAA 5IKMA 4YV2A 5EMLA 1XCLA 1IY9A 1FJXA 1XDSA 3M6WA 4CWAA 2H11A 2PX5A 1JQ3A 2QM3A 4BLWA 2WK1A 2PY6A 3MERA 5EEHA 3PS9A 3UJ6A 2PX2A 3KR0A 5LQUA 2DULA 4GOOD 3FPFA 3M70A 4Y2HA 4E2XA 4QTUB 1X19A 2B3TA 1BKYA 3KQPA 4RVFA 4A6EA 3MAGA 2AR0A 4LG1A 4E31A 1R74A 3X0DA 3O31A 4K6MA 3ELDA 2OXTA 5GWXA 3A26A 3SR4A 3BXOA 4DA4A 3ELUA 3GWZA 5DPMA 1NT2A 2PXAA 3LBFA 3IEIA 3UJ9A 5LQAA 2FK8A 4M37A 3AY0A 4F84A 3KR2A 3HA7A 5CIYA 3G8BA 2DPMA 3FTCA 3EVCA 3T0IA 2GB4A 1VL5A 3GJYA 3P71T 1XTPA 2P3OA 2HR1A 2EFJA 4PCLA 5H02A 2EX4A 2XYQA 4V0RA 3HCAA 3EEOA 2BM9A 4FR0A 5BW5A 1T43A 1PJZA 4YUWA 5HILA 2IPXA 3P8ZA 3EVDA 1NBIA 3P9NA 5DTQA 2PX8A 4P7FA 1MJFA 3QV2A 3UZUA 2GLUA 3EVGA 5DSXA 5E2AA 4B17A 2P3QA 2JHCA 2P7IA 5JR3A 3OZRA 1EIZA 3I64A 1TW3A 5FA8A 5G02A 4QDJA 3G5TA 3NDJA 1QAQA 2PWYA 3PTAA 1IM8A 1KIAA 5DM1A 5HIMA 3SX0A 5HIIA 3TRKA 2F8LA 2ZCJA 3E05A 4ER3A 3JWJA 1VPTA 4RTQA 5CVUA 5EMJA 1DL5A 2P3LA 2HMYB 4QPNA 4GC5A 3SM3A 4X60A 4AX8A 5C9ZA 3HVJA 2K4MA 4E33A 3P97A 2IIPA 5DX0A 5DXJA 1RJGA 2O57A 3HCCA 5DM0A 1SG9A 2PWPA 1XJ5A 3TPZA 2EJUA 3BUSA 3Q7EA 1YZHA 4QVGA 2NP6A 3DLCA 4FT4A 4PYQA 2IBTA 3CJQA 2PLWA 3MCTA 5FCDA 1ZGJA 3HNRA 3TOSA 3R9XB 5E2BA 5HFJA 3GRRA 1JQDA 1JSZA 3P9CA 2P1DA 2JH9A 2OZVA 3LHDA 3EVZA 1FBNA 3P9KA 3THSA 1YZ3A 2VP3A 4GOLD 3LECA 4P7KA 3CCFA 5GIOE 5E1OA 5EKXA 2G1PA 1ORIA 4BY9E 3SXJA 2VDVE 1HNNA 2ZTHA 2A14A 3E8SA 5EOVA 5FWAA 3I5UA 2OYRA 3RIEA 3TKYA 5LQJA 2ZZMA 3OU2A 3V97A 3AJDA 3TM5A 4CKEA 2P41A 4MWZA 4QTTB 4ER7A 3CGGA 1V39A 3TM4A 2Y1XA 3OFJA 1G6Q1 2PXXA 3FZGA 2JHPA 5FQNA 2EG5A 4RTMA 3MHTA 3G5LA 2FRXA 1TW2A 4YMHA 4RYLA 2BH2A 2ZIGA 4MQ4A 3P2KA 5GM2A 2Y1WA 2ADMA 3QOXA 1BHJA 4KDCA 3REOA 2FCAA 4IKPA 5E1MA 4IWNA 5HIJA 1KR5A 4E30A 3P2EA 1DUSA 3FRHA 4YMGA 2G8NA 2ONYA 3E7PA 5EZSA 1NW8A 1VIDA 2YR0A 3DTNA 1NKVA 1G8AA 3I9FA 2NXEA 3OU7A 1F38A 3LL7A 3PFGA 2YVLA 4RVDA 2N47A 3R3HA 2ZW9A 3K0BA 2H1RA 3MB5A 1EAMA 2AVDA 3FYCA 4KWCA 2JG3A 3KHKA 2AOVA 3R0QA 4RTNA 4C05A 2QE6A 4P58A 4PYMA 3MTEA 3OE5A 4ER6A 1O54A 4FT2A 3LCCA 4YUXA 2AOUA 2G71A 1R18A 5K01A 4M36A 1D2GA 5ICCA 3PVCA 1RI1A 1QAOA 1X1CA 3ELWA 3LSTA 5LQRA 5ICGA 2XBMA 2AOTA 2AOXA 3UJ7A 2IDKA 4DCGA 4PYLA 4DZRA 3GCZA 3GNLA 3TLJA 2IH2A 4U7PB 3IV6A 1NW6A 3G2OA 3DMGA 5ICFA 4R6XA 2NNWB 5K0FA 2I62A 3G8AA 4GBED 4PNEA 2AOUB 4QQNA 3SSNA 2FHPA 2ZWAA 3DOUA 3KQMA 5EIWA 2I6GA 3ERCA 2ZBPA 1UWVA 1ZG3A 3B5IA 1I9GA 3G89A 1KHHA 4M38A 2GAFA 4IV0A 1VLMA 1N7IA 1ZKDA 3EGEA 3HA3A 5DRYA 3KQSA 2AOTB 5EQJB 3B3FA 3GGDA 4BLUA 2C7PA 1X1DA 4GOMD 2OB2A 4LECA 5CVEA 4RV9A 2AZTA 4GUAA 3LPMA 1RJFA 3DP7A 4AZWA 2GH1A 3CKKA 3R24A 1FP1D 1N7JA 3OPNA 3OZTA 4FSXA 4ISCA 4AZVA 5K09A 3FTDA 5LQCA 3MTIA 2IFTA 4EKIA 4MHTA 3EMDA 3CBGA 3L8DA 4RVHA 5FULA 2B25A 3CVOA 5K0EA 2ONZA 5JUWA 3GXOA 3RODA 1P39A 5LQKA 4RTPA 1D2HA 1M6EX 3KPUA 5KQSA 2HNKA 4LWOA 3FUXA 3KQWA 1JR4A 3LBYA 4RWZA 1NW7A 1XCJA 4XUCA 2P35A 1I4WA 2FPOA 2PVCA 2BR5A 1KXZA 1INLA 4QQKA 4OBWA 1VQ1A 2ORED 3EMBA 3HCFA 3IYLW 5T6BA 2ZBRA 2G70A 4EMSA 1Y8CA 2FYTA 3EVBA 5K05A 5FQOA 1B42A 3OCJA 4HTFA 5P8WA 4C4AA 5FUBA 2Z6QA 3B3JA 1UIRA 3JWIA 4R05A 4DM3A 2VZ9A 3V8VA 4A6DA 5EPEA 4UOEA 5DWQA 3S68A 5HZMA 3LDGA 2P8JA 2QRVA 2AN4A 1F3LA 3MQ2A 4L7VA 5E9QA 3DXYA 1YF3A 3NVKI 3H2BA 5EEGA 1NV9A 3NWBA 2BR4A 5EMMA 2O06A 2B2CA 4PYOA 2VS1A 3Q87B 1XXLA 4KIFA 1VP9A 1KPGA 4HTFB 2CKDA 2PJDA 3UJBA 3EGVA 5DRTA 1JG1A 2FK7A 3B89A 3D2LA 2BR3A 4ATNA 3DMHA 3PX2A 2BZGA 2C7OA 10MHA 4YV1A 2HV9A 2P40A 2QRVB 2UYOA 3JWHA 1O9GA 1KP9A 3VC1A 1SVUA 5M5BA 3GRYA 3M6VA 3M6UA 3SMQA 1WY7A 5BXYA 1P1CA 2CMGA 3KQYA 5CCXA 4Y30A 1WS6A 4DKJA 1Q0TA 4QDKA 3BWYA 2LD4A 1FPQA 3BZBA 5EG5A 3DLIA 3FPHA 3NMUF 3AXTA 4PYNA 3DMFA 3UJDA 5EHIA 1HMYA 1G55A 3PX3A 3T7TA 5DX1A 4OA8A 2HTEA 3DXZA 5DM2A 1QANA 4FGZA 2OB1A 4HGYA 4H0NA 2ZULA 3TFWA 3FUWA 3EGIA 3FPGA 1Z3CA 1L3CA 3HCBA 4EQZA 3VC2A 3UBTA 2VDUE 5FWDA 1RI3A 1DCTA 5FA5A 3KQVA 1QZZA 1JTFA 4V0QA 3SVZA 4AZSA 3LCUA 5HIKA 2YQZA 2Z6AA 5LSAA 3I58A 1AQIA 3LDUA 3MCZA 4X63A 3KPVA 3PLAE 2QY6A 3FPEA 3QOWA 4DCMA 2EJTA 4E32A 4P7JA 5FTWA 5CUQA 2JH8A 2PXCA 3LKDA 3THRA 3HCDA 3BGIA 3B3GA 5KQRA 4EK9A 2PGXA 3GDHA 5DT2A 2ZZNA 4XUDA 1JG3A 1XDUA 3NDIA 5K0JA 5GINE 3HVHA 5D1NA 3TMAA 4RTSA 1M6YA 1SUSA 1MHTA 3ER8A 3FTFA 3HVIA 5HOQA 3VSEA 5EKUA 2C7RA 5B1SA 5K0BA 4EVIA 3U81A 3LX6A 3KR1A 2AN3A 1WXXA 3RW9A 3ER9A 3G7UA 3NW9A 2PV0A 2WA1A 3SSMA 3B7PA 1RI4A 3BGVA 1O9HA 1X1AA 5BP7A 2E5WA 3GRZA 2H00A 5K8VA 1KPHA 5F2OA 1WG8A 2YXEA 5ERGB 4PWYA 2B78A 4PYIA 2PX4A 5GOZA 2AN5A 4C06A 5ICEA 4GOND 4KRGA 4BP3A 5MHTA 2ZIEA 3A4TA 5E8JA 3DULA 3GO4A 5E1BA 3KPWA 3HVKA 1QAMA 3G2PA 3NWEA 4FSDA 1FP2A 3HEMA 3DH0A 1KPIA 5FHQA 4RTRA 5CM2Z 2V7EA 3CJRA 4BP1A 2IH4A 5FADA 5IH3A 3O4FA 2I7CA 1NV8A 1SQGA 4CKCA 1N2XA 5EVJA 2XVAA 3GU3A 5GM1A 3C3PA 3IHTA 4MIKA 3EVFA 5K0GA 5E9WA 3A27A 3TKAA 1AQJA 4PINA 4RVGA 3EVEA 3T7RA 1YFLA 1RI5A 2XYVA 4R6WA 5T67A 4HSGA 5CVDA 3WSTA 5KYGA 2OBFA 5EIFA 1I1NA 3A7EA 2NYUA 1ORHA 3PFHA 1R8XA 1BOOA 4POOA 2IBSA 4X1OA 4G56A 5K0CA 2Z6UA 3GIWA 3HTXA 3K6RA 3PT9A 4F86A 4BLVA 2KW5A 2UYHA 5DSTA 4E2ZA 3KPYA 3DUWA 3OU6A 4O29A 3CJTA 3OZSA 2OKCA 5KVAA 1M0EA 3LGAA 3KPJA 3BKWA 4PONA 3ELYA 2ZIFA 4R8SA 4CXMA 3FRIA 3F4KA 3FUUA 3ORHA 2R3SA 2ZLBA 4Z2YA 5C0OE 1AV6A 4FP9A 4RTJA 4C04A 2WA2A 2JJQA 1JG4A 1NW5A 3M33A 4KDRA 4ZTBA 5CD1A 3E23A 2V74B
chains in the Genus database with same CATH superfamily
3KX2A 1N25A 3G5MA 4GEKA 4J0KA 4QUAA 1NUUA 2BUAA 1IE3A 3T38A 1BZYA 1VMIA 1JG2A 4QYTA 4BFCA 4EH1A 2H51A 1EQAA 1G1AA 3KKLA 1DU4A 5F5NA 3AFOA 1GUYA 1LZLA 3G8DA 3TRDA 1P1BA 2XYRA 4EQ6B 3C7CB 2ESRA 3OM1A 5KYKA 4HUTA 5A62A 3K16A 2HSDA 4Z7JA 1W5FA 2WF9A 3H11B 4EJSC 4OUDB 4Z1MD 1M6VA 1NQWA 4L6IA 3R1IA 5IS2A 3TLBA 2DR0A 3P2OA 1XFAA 2Q99A 3IFSA 3ZU4A 1PZNA 5H80A 5AK0A 3W8EA 4Z86A 1UP6A 4K81B 3ECSA 4GX0A 5HJ2A 2H3EA 3WFIA 4IYRA 3OLWA 4C7OB 4EG3A 7GPBA 2R8XA 3FPBA 1PFQA 5T6MA 1NIPA 4MO2A 5TX7A 3LCVB 1P1RA 4KIGA 4LK3A 4IOKA 2YZKA 3RS8A 2GPBA 2FPIB 2JFOA 4RSMA 2D06A 3HACA 3FMIA 3I5XA 4L4SA 4RZHA 1U2ZA 1ZITA 4IR7A 3NIGB 2CK3A 3VNVA 1UBJS 2N46A 4W82A 1M67A 1C3XA 4OMFG 4UTOA 1EAYA 1IDOA 2G5PA 2RAPA 4HR7A 3N3AC 2X0JA 1YBVA 3CY6A 4DSTA 4MW1A 1WZNA 4M8SA 3VC3A 4BKRA 5C5EA 4HTAA 4K1LA 1TF7A 3VSBA 4X41A 4C03A 2RBKA 4TROA 4W5WA 5JAUA 3VU3A 3X2FA 4BRWA 2GCGA 4P4UA 1UL1X 4BRSA 1QM5A 2UVQA 7ADHA 1NBHA 4NK4A 4MV3A 2OHJA 3CNQS 3QW2A 1E2UA 2CVOA 5GONB 3ZTYA 5L53A 2O07A 3PUHA 4AWXA 2UUAB 3JPYA 2DWUA 4O4LB 2W2MA 3S40A 3P7MA 4EY3A 2ZYSA 1Z7WA 3K53A 4MW9A 3AB8A 3EY4A 3UJNA 4QLOA 2WF8A 1Y6QA 3N76A 4OQLA 3TR6A 4QREA 5FB3A 4GPEA 5J5AA 3ZYCA 2PTHA 2Q3CA 3G3EA 4RD1A 2AXNA 4MV4A 4NARA 3H17A 5K0NA 3STUA 1Z4IA 3MGGA 3NRBA 3PBKA 4G07A 1KEEA 2JGNA 3OLQA 5H4HA 1E5DA 1K75A 4ZQFA 3U1VA 1GPLA 3DDUA 3GJZA 4JI6B 4G4SO 1EK5A 4FC7A 5A1JA 5KQMA 4H3SA 4BAUA 4KPEC 4IIFA 1SOMA 1U0JA 3JYOA 4NABA 4PQYA 4YRFA 1SB9A 5LQNA 3L1KA 4PRZA 3BT7A 4NU5A 3EDOA 5EMKA 4DLKA 2VNHA 4C22A 1RP7A 3SSOA 3G6KA 4B6RA 4HQOA 3E3LA 5I9TA 1COWA 2ETVA 4U39A 4ND8B 1V7CA 1MQ9A 2BVNA 4C43A 5FOVA 1QU3A 3AVPA 3TSYA 4UBOA 3AUFA 2ZVJA 1EFUA 2FN7A 2WE8A 1L7PA 1MTZA 3E27A 4F4UA 3C8DA 1PE0A 3AT1A 5DWVA 5KHOC 2HU7A 2WW8A 1W48A 2YL2A 3H2KA 4KVFA 3FMGA 3B82A 4YAKA 3IDZA 3HZZA 1B0AA 3EGCA 3LLUA 1NULA 4ER5A 1ZSYA 5HP4A 2F1RA 1M34E 2CDBA 1VIMA 1LLUA 3A1WA 5B12A 1WD7A 3DE5X 2EFDB 1K92A 3ZXSA 5AD1A 2RE8A 5CVVA 1M2HA 1SC4A 1Z88A 1DXHA 2WF6A 1QCZA 1LI5A 4M7RA 4L28A 3QLVA 1J0CA 3T7SA 4D6YA 1AXEA 3IGFA 4FLMA 3H1AA 3I05A 4LXUA 2AZDA 3M2PA 2UAGA 2V54A 2IH5A 1J2TA 3THYB 3SLRA 4PTLA 1CP2A 1T9ZA 1BN7A 1TJNA 3SBEA 1UJCA 4P4SA 4NS1A 4WCFB 1L7MA 4MGIR 3R7FA 1VGVA 2PY6A 3JQDA 3MWJA 4C2AA 2FWJA 1C0PA 4EMTA 4C5AA 4OU4A 3EHDA 2H52A 1OZAA 3SP1A 5IJXA 2SKCA 3AF0A 4GOOD 3FPFA 4QTUB 2B3TA 2EIHA 1PNRA 3QENA 2VQSA 3NUQA 2VPYA 4LDZA 4N8EA 2R60A 2PYDA 1ECFA 2RARA 1YQGA 4M9UA 3A9RA 2HEGA 4GHWA 2C92A 3K09A 1QGUA 1T4BA 3FKSD 1OC2A 2NPOA 4Q37A 3UKOA 5I9LA 1HX7A 2FE4A 3UJ9A 1MG0A 1ZUNA 3Q98A 1PEYA 5HM6A 3UEOA 5FPTA 1NSYA 3D7RA 4LE1A 5CHYA 1XTIA 2FQXA 4HDRB 3BMNB 3ITDA 2ZSIA 1D0VA 1NMYA 2A9RA 1RSZA 2E49A 4MUHA 3U9SA 3EEOA 1Z6AA 2BM9A 2YN2A 2XGSA 3UN1A 1PJZA 2C8JA 3O8QA 1PFWA 1AM4D 1HA3A 1MJFA 3DMYA 3SC2B 5TS3A 2J09A 3WE7A 4E5SA 2EOAA 3LQYA 1ZI9A 3H5VA 5I3CA 3I9V1 1TZ2A 4HGQA 3SHTA 3TIXB 3DV0B 2MSWA 3RFCA 1TXGA 4IHJF 4E11A 4CUJA 4FD2A 2PZGA 1OV6A 5TQ2A 1UK9A 2BKLA 1RPTA 3G5TA 4OLAA 4LRXA 1EFPA 1GPUA 3VMFA 4YREA 5F52A 1ADCA 3SX0A 2Q1TA 4WBNF 1M0WA 5DSZA 3LT0A 1U8ZA 1AS3A 2B4AA 2ZT6A 1YRLA 3G8YA 1ATIA 1PYGA 1SZCA 5EMJA 3K05A 3OCZA 4QXAA 1UZNA 3WJ1A 4CM9A 4DA9A 8AT1A 3P94A 1KMHA 2QLMA 4G2TA 4G81A 5KYWB 1LNQA 1YB4A 5BN3A 1M8GA 1AURA 2JIPA 3DZFA 1JWBB 1B0PA 3GFVA 1BN6A 5CDYA 3EGOA 1UKBA 1OT5A 3ZPXA 1JDBB 1U80A 2BTOA 3KK0A 3IBFA 4J1TC 4AJKA 3R77A 1ETHA 1IWPB 1DG9A 3EZYA 3IQHX 4FOPA 2ZRPA 3WQRA 3FLBA 1PR3A 3EEFA 3LF2A 1DGQA 3T9CA 2PH7A 3LQKA 1NPTO 3KHTA 4IVNA 3TTTA 5DYGA 3D5TA 4GLJA 3BX1A 5DB4A 3EPHA 4HFRA 2JC3A 1G3RA 4V3BA 3IEKA 3EVZA 4QDTA 1WCYA 1A04A 5IM5A 1CQIA 4YPVA 3OQ1A 4CKBA 3C8UA 1M1YE 2VTDA 4MIEA 2EP7A 4GI5A 4HAUA 1XVUA 5JYDA 3CONA 3VR1A 2XMGA 4F72A 1JEAA 3CBQA 4J9VA 1OGYA 1KSJA 2W2LA 1PP4A 1RZUA 2F48A 4ZAZA 4CF4A 5IDYA 1TCBA 3OKPA 4KO3S 2JFGA 4HVLA 2QTBA 1JIIA 3REOA 3K5PA 5T8KA 4M6WB 4MO9A 1CQJB 1KEWA 4KFUA 3ICEA 1Z0IA 3VOSA 3COSA 3KXDA 4OI1A 2VBIA 4DBZA 1ZJWA 4YMGA 1XF9A 2HA0A 1C9NA 3WP1B 1QK5A 4ALJA 2ERXA 1NW8A 3DUFB 4TVKA 3TI9A 5JADA 1RWOA 1FSFA 5AW4A 3LW8A 4CODB 4C4PA 2VJDA 3E9QA 1KE1A 3C14C 2I2WA 3TEJA 2FRDA 4Q1FA 2R1UA 1H22A 1M2GA 3JVEA 1QJ4A 2WBLC 5K6AC 4FBLA 4ARIA 3K9LA 1KYYA 4QNNA 2OENG 1TQ8A 3L8EA 2WYUA 1G9SA 2AOUA 2PMDA 1HLDA 1QCYA 1RTTA 2CL0X 1XL1A 2CLOB 1NYRA 2CZQA 2JJYA 3AM3A 4IDFA 4BB9A 1L4NA 5TJHA 3H2HA 4Z54A 3ZW7A 2EX1A 1ODSA 2P75A 4E6PA 4ERXA 4QXOA 2TYSB 1DC3A 5C35A 2XCSB 4P3YA 1XPRA 2XBMA 3IURA 2J48A 2QRZA 4J2HA 4N01A 5AKLA 4HDAA 4W9MC 3QU9A 5J58A 4DRZA 2EKDA 2FWBA 1HRDA 5AVYA 3GZNA 1ID8A 6REQA 4ESVA 4QDZA 3EQ7A 5IMBA 1QRUA 1PR1A 4KN5A 4F2WA 1DAFA 2HXGA 2BFEB 2P9CA 3BH6A 4TTSA 3WGGA 3C7DB 2HGZA 4AJEA 5CDGA 3CB2A 3FH0A 4ZEVA 4NXMB 3DHVA 2H0RA 4BNIA 4I46A 1E7RA 3KP1A 2KYRA 4A8TA 4IIUA 4JB0A 1TCUA 4MDFA 3O8OB 4GPBA 2V3WA 2EF0A 4QJ3A 4LVCA 4DEVA 1JH9A 4I50A 1N7JA 3OPNA 4B6JA 1F5SA 3DAPA 3KE9A 3JD3A 4HVCA 5B7GA 1F7VA 2ECPA 1ZPDA 4XJXA 1R2QA 3C3DA 4NENB 3FPCA 4D96A 4DQXA 5BT8A 2XF8A 4LI3X 4R9UC 4PN7A 1VE7A 5K0EA 4MICA 3FTNA 4QOEA 1B6TA 1N5LA 3F1KA 3JX9A 4NG5A 4TTVA 5AKEA 5DGIA 5EL0A 3ZBQA 4GZMA 2QN6A 3COWA 2HNKA 2VNAA 4KYIB 1T29A 3DFUA 4Q1CA 4X5OA 4IZHA 2WSLA 4G0QA 1J5XA 4B8WA 3BWVA 3B1ZA 1QONA 1T4CA 2CNLA 5HGJA 4Z7OB 1BWRA 4C4AA 4L5JA 2Z6QA 2IZOA 3PJGA 3JALA 1V1RB 2CFCA 2D5IA 2YV5A 3INNA 4M1MA 3SEFA 2ORYA 1R16A 4B8YA 4EBFA 4IJQA 4ZO4A 3ABRB 1B6SA 5BSHA 4ZC1A 3U7RA 5EIXA 3ESDA 3IUSA 2PUDA 2IC5A 1DIHA 1ZWKA 1G21A 3UUWA 3KLNA 1ACMA 1HURA 3ZTTA 4O33A 2OMEA 2P2LA 3HC7A 1SU6A 4ILKA 1H4QA 1VP9A 1KPGA 2HL6A 2NG1A 1AGRA 3JVUA 4HTFB 1KKMA 1E6EA 1TMGE 3PCRB 2GCIA 3ZV5A 1SG6A 4HJXA 3EXFB 3IUPA 1LXCA 2VI5A 2VTEA 3DLTA 2CNNA 4PFSA 5EZ6B 3UW3A 2Y68A 2EF1A 1QPZA 1EM6A 2ZJFA 1PFGA 3JZMA 3X1WA 2ZIUB 4O25A 4A0GA 1X1SA 1XYVA 3GN2A 2QOEA 4XDHA 4OOEA 4B4OA 1L7EA 1ZESA 4L95C 4GVPA 4HDKA 2WLTA 1R0CA 2VPXA 1OWOA 3LPLA 4TZTA 4XZ3A 3WP0A 4ADSG 1GTL1 2XPCA 3UO8B 3TUZC 3FPHA 4QHYA 1CB0A 5B4UA 3TTUA 3DMFA 2OCGA 3FM9A 3I45A 5H4GA 4Y9TA 2GKOA 2XGOA 3ETDA 4LJ4A 4MUMA 3F9RA 1T8PA 3Q8LA 1R1DA 5JS1A 1CJTC 2YZMA 1U9CA 2BHRA 4P53A 3LUFA 2CL7X 5HG0A 1A0OA 4S1OA 3QE4A 4OQFA 1EGAA 1ONPA 1XTSA 2FV8A 2XOKD 3DSRA 1R4NB 4YA6A 5A5DA 4ED9A 1W581 3B13B 2DRIA 1BX1A 2L18A 1PT5A 3OAAA 5CLHA 5J4YA 4IAOA 5ALTA 2D62A 5LA6B 3M6AA 3A9WA 1MD9A 2FX3A 2H2DA 5DE3A 4EVQA 5JXJA 1ZCFA 2EJTA 2RAUA 4NE7A 2JLCA 1CWUA 1XPJA 4JI5B 4OAOA 1O94A 1YJAA 2QS9A 6NULA 2GTIA 4BX2A 1E4OA 2B7LA 1EFLA 1B14A 1UBUS 2IV2X 2D7JA 2H1CA 4AK9A 3E2MA 2P2NA 5JAZA 2XF2A 1C1HA 3GA5A 3E0QA 3TL6A 3MBIA 2G4LA 3BRCA 5HX7A 4LGMA 4DS3A 4KQ2A 1NYLA 4IRXA 4EHKA 1Q1NA 3WL6A 4UDNA 1XJQA 1XU9A 1LPMA 1FNCA 3K71B 2E4AA 4ME6A 3C4JA 2H2FA 1RPNA 4XGKA 1L5KA 3F7TA 3RJZA 3WVNA 3NW9A 3SYLA 4G1UC 4XD2A 3OTQA 5TGTA 2WV9A 2J1LA 4CKWA 1ZC4A 5BQOA 3RSGA 2BBSA 1ZHHA 2XWJI 3BTOA 4YXWA 1U1IA 1OGIA 1DCKA 3Q3IA 2HPAA 4GMGA 4GWGA 1YE8A 4PR3A 5ALWA 2AN5A 4G65A 4YJHA 4ER6A 1M2VB 1ZM3A 2Q4DA 4YBZA 3F6PA 3SCZA 4GL2A 1YTUA 3QVUA 1HT2E 3ZWVA 3ZX5A 1KWGA 3DULA 4ZMSA 4B3XA 4O2BA 3D1JA 3GGPA 2YV4A 4YGYA 3SX2A 2HSJA 3K9FC 4WOCA 1NVXQ 4GZLA 4Q3DA 4DLSA 5L8VA 1ONBA 2XWQA 3UIEA 5H5JA 1NVVR 1P60A 3RYCA 4OLJA 4CKCA 5KYYB 4ES6A 2C5BA 5TE9A 4MP3A 3L9XA 1U98A 3NHBA 2BELA 4WL0A 2KSQA 4YIHA 1VPDA 2ZXFA 3UMJA 3T7RA 4AROA 3K70C 1UC8A 2Y1LA 5T67A 1I0ZA 1YU6A 5K9ZA 4CR6A 1PQWA 3JTMA 3HBJA 4YRDA 5LMUB 2NSYA 1VCNA 3PXUA 5I7AA 4V0OA 3HEAA 1NZJA 1E8DA 4UPVA 2C77A 1BS1A 5IVPA 4EUSA 2Q7XA 3N8GA 2V7BA 4UHBA 1ZM2A 4TT3A 1QFJA 3LGAA 4AICA 4AMZA 4AYWA 1R5NA 1A88A 2QM7A 4Q6BA 2IU4A 4YQEA 5IT4A 1GGEA 2I1WA 4LV5B 1LNSA 4HRVA 2FR8A 2HPVA 3KVRA 4KMRA 4WLEA 4ENTA 2XQKA 2OAP1 5CXQA 3MCVA 1Z4MA 3QU7A 4OL0A 1XEWX 1KR2A 3A4LA 4AJJA 1Q7TA 1MXHA 4IUDS 1XCBA 1ARZA 3C5HA 3C6ZA 5DX8A 3BMOA 1S02A 4FQ8A 4MULA 5KOJA 2XXAB 5AWFC 2ZM6B 4DLYA 2H4ZA 1GQOA 4P22A 3WLMA 5D00A 3F5FA 3GH3A 1FTQA 4M21A 4JI2B 1S2LA 2B98A 2DBYA 2ZAIA 4K40A 8ATCA 3E7XA 3CC8A 2FUKA 4K9SA 4OXRA 2ERCA 1XMJA 3AWIA 1F2DA 1ZVMA 4IX9A 1GNSA 1OAAA 5IP5A 2EBUA 4GIBA 1HZZC 2XNSA 3AHFA 3GY0A 1Z25A 2Q07A 3IUQA 4ZOBA 2ENUA 4GW3A 2PUGA 3S27A 4D8WA 1NHGA 5BMOA 1S7CA 2JHFA 5A4KA 1LPPA 1B73A 4PPQA 3UJCA 1P3Y1 1IEVA 3DVAA 1T4GA 4NKRA 3F2VA 4G1CA 3PE4A 3UK2A 2R86A 5L95A 1G19A 1NDUA 3V1NA 2UZAA 1EG2A 3G0GA 3QBEA 3E15A 3PQ4A 4LHWA 2H6EA 3UKJA 5E9JA 3UT0A 5A04A 5BN1A 2YJNA 1K8QA 4PIPA 2YICA 2NXJA 3WL3A 4DSUA 2ECKA 3A0UA 3D0QA 3NBMA 4GU5A 4HLQB 5EIAA 4CTKA 2Q4TA 3J7AC 5IYZB 1JDUA 3HY3A 3NTVA 1GDDA 4RZ3A 3QOYA 4ZVNA 2IHVA 1YRBA 3DCJA 2JAOA 3NETA 4DQ0A 1NTRA 1RBQA 4BLQA 4N48A 3RYFB 2BUBA 2F4NA 2JLZA 1FSZA 4JLOA 3RH0A 2OMKA 4TKLA 1GL7A 1OILA 3BB4A 3RU7A 1MOSA 3C0KA 5IN4A 2J0UA 1BHO1 4KAXA 5DK6A 2UDPA 4MRAA 4WZBB 2BJVA 2H9IA 2FETA 4H16A 2O8VA 4RHYA 4WKPA 3HA5A 2X1VA 3FI0A 4AQDA 4HGOA 3NHLA 2FXIA 1PG5A 2C2WA 1T10A 2WG0A 2Y0BA 2HF2A 2QRPA 4H7KA 2VYNA 4MUJA 3BPSA 1WV0A 4IBOA 2AEJA 2P9YA 3K0FA 3QU5A 5EWLA 3BA1A 3RUCA 1RJWA 3OLYA 2GK7A 1HG0A 1CZHA 1SRRA 2REQA 5EHQA 3QFSA 1OH5A 3EZFA 4TZ6A 1Y7PA 3EIOA 4PC1A 2GFQA 2PNFA 2UXBB 3GAZA 3PRHA 4BGDA 1GRVA 2KQUA 3VTAA 1FX0B 3M5PA 1ESEA 2HYDA 2K5UA 5BOSA 5IKXA 1UBRS 1IHDA 3OEHD 2UZ1B 4LXGA 3NAQA 2XZTA 1O77A 4M8IA 3V1LA 3ADCA 1JVNA 4A15A 5E1DA 2F90A 4FS8A 4L9SA 5JYCA 4ZKDA 2W37A 3EXIB 1QO9A 4LOLA 1UJ5A 2XQIA 4UQOA 3U31A 1C7IA 1QNLA 1B4DA 1E1DA 2LCIA 2JI7A 2VDQB 1U0EA 4D4KA 4B76A 2AMVA 1IG3A 1REQB 3JYLA 4DTCA 2P9EA 4C08A 2Q3BA 4XRGA 2AVNA 1BO6A 3PHCA 4BJHB 3NNSA 2P3SA 3N2GA 5KS2A 4E22A 1XGKA 1AQ6A 1DAHA 2C5HA 5JJIA 1G7TA 1MQ8B 2CXSA 1T8RA 3EE6A 3GFOA 2PSSA 1QIIA 4HDSA 1MJNA 2IPOA 3SBDA 2ZXEA 1S2OA 2KB0A 3RABA 2ZJ0A 2SCUA 1AT1A 4JVNA 2HC9A 721PA 3WB0A 3LCRA 1VFPA 4UVEA 2XUHA 2EQ5A 3UHOA 1ENYA 3AVUA 3GFQA 2FPPA 2RKWA 4Q47A 5K6TA 2A1IA 4A1OA 1U0GA 3MJSA 3OTHA 5GY7A 3E0XA 2XWSA 1H3NA 3BGSA 3GJRA 4DNXA 2QA5A 4HWTA 1CRLA 4ZT5A 3VKHA 2AFIA 1AQYA 1SUDA 1YL7A 5C51B 2B9VA 2DCMA 3Q6MA 2C4WA 5L3QA 3PDCA 1JA9A 4UNNA 1XROA 1P2GA 1H2XA 5AVJA 1IWOA 3IVAA 4PC2A 5DHPA 3JRWA 3RAJA 3PTZA 4ZI2A 3M8KA 1DRVA 3ELDA 1QGED 4IWXA 3SR4A 2H92A 4OJMX 3VH1A 3GRPA 2WOOA 5JNLA 1G21E 1V6SA 3W8RA 4RY8A 4QICA 2RFLA 1XTBA 5DDIP 4PANA 3SKXA 2CK3D 4LN1A 3HA7A 2HRDA 4N0DA 3GZ4A 5FOTA 4BJ3A 2FZLA 3PQFA 2MYUA 2XUKA 1H4VB 3F6SA 2Y0EA 3K5WA 1PWXA 1RXIA 3P71T 4W6ZA 1N6PA 1PJTA 2YNMA 1U0SY 3AUJB 1Q1GA 2IJGX 2ZIAA 2YHIB 3LZCA 1MO5A 5FUQA 2X8BA 4CUKA 1X80A 2ZSKA 1XKTA 2NTNA 3HDGA 3ZXYA 2WKQA 1O03A 3EG9A 3A4NA 2IHJA 3ENQA 4I4CA 1LNZA 5A4MS 2X58A 3AL2A 1RP1A 4IIXA 3SN6A 4ZCLA 4TTJA 1CYEA 4WLUA 2NTJA 1HSZA 1P80A 1QTQA 3QLUC 4J2OA 4ZOLA 1WA5A 2XKBA 1XOIA 3ED5A 4ZHQB 1M66A 3SC6A 2CNDA 1D5WA 1D6NA 4QE3A 3ENVA 1QAQA 3GDFA 3W2TA 5T7BA 2HJRA 2YCLA 4AMGA 4Q1VA 3Q3HA 1VYTA 3EZXA 4A36A 4B2YA 3OX1A 3SJAA 4BLPA 1J8QA 1GDTA 3ASUA 1VC2A 3H6KA 1A2QA 1KC3A 5EXPA 1VIAA 5GMOA 4INPA 1UP4A 3R40A 4O1HA 3HVJA 2KBFA 2ZOSA 4JLDA 1R4AA 1CZUA 3OC6A 5TVKA 4DHEA 4OB8A 2E2WA 3WL5A 3RHSA 3RD5A 4QOGA 1B2LA 1WOYA 2QSYA 4M1KA 2F8TA 2C82A 4WESA 2E5FA 1X1TA 3QMVA 4DYHA 4C5BA 2OCDA 2CDNA 3PKJA 3LVRE 4MKFA 2DTDA 1COWD 2H5JA 3UAXA 1OJLA 1NT4A 4LHXA 4ND4A 1BXZA 2W2VA 5LCXA 1H4SA 2JEOA 4UCWA 1CIVA 1SEPA 3VAZA 1GTSA 3AK4A 5JZOA 2VPQA 4DPLA 2CDAA 4LC1A 1V11A 1MVOA 2YJ6A 3H1GA 1T9AA 2QORA 1P81A 5E1OA 4BY9E 3UWDA 4MW2A 3BD9A 3EQZA 1TU4A 3AR3A 3CZ5A 2IKSA 2PX6A 2R62A 1U8YA 2C2ZA 4HAWA 3GOQA 3ZG6A 4CKEA 4EY6A 3TM4A 3HXLA 4QYSA 3UT6A 3U4GA 1ESDA 1ZJ6A 1JEJA 2AB0A 5TC4A 3IUJA 3AERB 5HHTA 2ZIGA 1YI1A 1LSOA 2Q4RA 4L72A 3BF7A 2NTYC 5HQ3A 4J7UA 2J5BA 3LT2A 1KQNA 2SECE 4OFBA 1D6MA 2ONYA 1AUVA 4BKPA 1QIEA 4FFWA 2UVPB 1G17A 3OIWA 4YJ3F 5TRTA 3Q3GE 3V4LA 1QOZA 2N47A 4R8VA 4FZRA 2X6QA 2VF2A 2GILA 2A9VA 5JEDA 3M1LA 2QDXA 3EOAI 4XQGA 3ZVRA 3QKWA 1JAYA 2HHJA 2ZI6A 1IN4A 4RPJA 5ARCA 1BKSB 3K0AA 5KYXB 4LXHA 5HCIA 1U9IC 3K94A 4TV9F 1O54A 2BGIA 2QUJA 3JQAB 2AIRA 4M83A 3RADC 1E2NA 3DWFA 1ZLXA 1JALA 1UBNA 2ID7A 5BSEA 2W4MA 3LGSA 1BKDR 3W5BA 4PSKA 1GKYA 3R3VA 2X7JA 4M0FA 4NAVA 4Q3OA 3URKA 4H18A 4RENA 1FLVA 4BKMA 3QX9A 4MUIA 1XALA 1YQ9A 1W76A 3B1VA 5ICGA 2XGGA 1R3DA 5KTSA 1GG8A 1U0OC 3ESYA 1QF6A 4J0CA 2DUWA 3I52A 3X1JA 3AU9A 2KWIA 2RK3A 2VQEB 4QRHA 1QH1A 1TYAE 4ZYYA 2JA2A 3I9KA 3DOUA 1BJKA 2YMQA 3H9UA 1KHHA 2WRZA 3D7KA 4D9IA 2VNKA 3KL4A 3GGDA 4JN6B 4N8DA 1OX4A 1ZM7A 4N3BA 4B6FA 4ZIRA 3E9MA 3WBBA 3D4OA 3KUDA 3KDSE 1PV1A 1AB5A 3LPMA 4Z53A 2P9TA 4HN2A 4KI0A 5JJBA 3KYDA 1QIFA 2EGGA 3PFBA 2AXPA 3E9EA 1DKNA 3GT7A 3BCUA 3DTTA 4X1IB 1FFAA 1YS1X 1WRBA 5EKTA 4F3RA 1ZK0A 5FULA 1H0HA 2PS9A 2V0CA 1KQFA 4QJIA 4XDGA 4DRXA 4PGFA 2N0SA 3KWFA 4KRXA 2I7XA 1T15A 2AYXA 5JUWA 4WAUA 3UAYA 2FHSA 3PP8A 5DEIA 2CLSA 3G9XA 3AOEC 3KXKA 3LBYA 3OFNA 3RVOA 4CM9D 4IIHA 1I4WA 2JLRA 1KXZA 2QX4A 4DNFA 3CF6R 3NHPA 5T6BA 1OH8A 4HB0A 2FYTA 2G1KA 1ZNZA 1FFXA 2I3ZA 3ZCXA 5CFPA 3GPLA 3AVXA 1ZMTA 3HJGA 5ITZA 1UIRA 3PSHA 5TR9A 3DW3X 2AX4A 3NOQA 3N70A 1IN5A 2P6UA 2W11A 3U1TA 1O0SA 5DASA 5SYAA 1CY7A 2ZETA 1D2EA 3AEZA 4KE7A 4QBTA 2VKQA 4V24A 4IJMA 3ZHXA 4IG4A 3NHFA 5FWXA 5JZBA 2Q5IA 3VV3A 2CJWA 2NLOA 3Q87B 2XNCA 5HZGA 2DGDA 4DJ5X 2R96A 1PNTA 2XD4A 2O52A 3PL5A 3TXXA 3UB4A 4FI3F 3PWSA 3B6EA 4Y6PA 1F8YA 4LI0A 5J2TF 1RRVA 3DMHA 4D26A 2ZJ1A 4YV1A 3ZW9A 2BGTA 2GZHA 4YXFA 1G6KA 2JNWA 3BQ9A 1C7EA 3DVRX 4OLHA 2NU9B 3HU2A 2BDUA 2W2LD 5M5BA 3H13A 3PUYA 1YVUA 1G2PA 4GP7A 4HK4A 4RMJA 3SY8A 1WY7A 1I13A 3IJEB 4PAOA 3FNFA 4CNQA 5IJ9B 1AQLA 3H75A 4LSZA 1MC5A 2O50A 3KQYA 1C1DA 3BXXA 3L0ZA 3LRPA 4H7JA 3R7NA 4G0UA 1DRJA 4L75A 1Z0JA 3EZ2A 8OHMA 3HCRA 5C1DA 1RYDA 3DQQA 3O1IC 4IPTA 1GILA 4KXXA 4R1PA 1S2GA 2ODPA 1ONSA 5AQ1A 3TZHA 2BBWA 4PS0A 2R8PA 3FOZA 2PT7A 3KETA 3AEKA 3QELB 5CA0B 1E4EB 3AG6A 2QVYX 3O5AA 4OHKA 5CT5A 4KWIA 4CE6A 2P2ZA 1CUSA 2ATXA 2PANA 2IUEA 5KAMA 1QGZA 1AKTA 4LRTB 3VC2A 3CLRC 1RI3A 3CUSA 4LC0A 1QZZA 3UNXA 2Z6AA 4MQFA 3A6GA 4CIVA 3MUFA 3MCZA 4QJ5A 4JL6A 1SCUB 2YWXA 2O2ZA 3SF8A 4WBNB 4TVBA 2IPLA 3WXMA 5I7UA 4V0KA 2AHRA 2FRVA 3C7TA 1D8AA 3Q5GA 4MV7A 1M1NA 5F23A 2GSDA 5KQRA 2WDZA 3QLJA 3EX7C 1A95A 4EK9A 1MABB 4RXTA 4OO3A 4V0ME 4G4JA 1HORA 1UKZA 5ESXA 4HNAA 5A9TA 2DQSA 3K4HA 2GTHA 4ZK2A 3F3YA 2G17A 3CNLA 3OBIA 5CFMA 5JZMA 4EPYA 1Z4QA 2BLNA 2JVJA 4US0R 4AI6A 4HLDA 1I33A 3H4VA 1WPRA 4DREA 2B37A 3DAGA 1R7RA 2QV0A 1ZMXA 1T24A 4ZMBA 4Q4HA 5E3JA 2WA1A 3K0KA 5JNVA 2IXTA 3MLBA 3QVVA 3BGVA 4LRYA 1ACLA 1M8KA 2Y1GA 4M60A 5BMVA 2BEJA 1YCFA 1JQKA 1WG8A 3OICA 4MWOA 1SUBA 1VSQA 2IL1A 4WERA 1MJHA 4Q5IA 3WAGA 1OZFA 3CT4A 2ZUEA 2AFIE 2FKNA 2H2AA 5A2GA 1QHFA 1TKRA 4QOIA 4BFSA 3EUAA 4JQYA 4R69A 1LSJA 1H0RA 4ZO9A 3Q7QA 2ODQA 5HMMA 4D9MA 3Q0EA 4B0OA 4QGSA 5HOEA 3MWEA 2H7XA 2B8TA 2FW0A 2Y99A 5DN9A 1SQGA 3Q3VA 1CEEA 1WPXA 4RCVA 2D0IA 4P0PB 5ALYA 4J1NA 1J25A 1P6QA 2Y8EA 3O3NB 5KPDA 1FXWA 1P7VA 4O4HF 2G80A 1RYEA 2IOFA 1JJAA 1I1NA 1T4MA 1O97C 1ACJA 3F2IA 2D8MA 1CUYA 1FRVA 2QRMA 4RD4A 1HSOA 1NONA 2EJVA 1TK3A 3ILXA 3JVVA 4N0EA 3L6RA 4ZAVA 4RD2A 4EWLA 4KIWA 3WLQA 5BSGA 2ID4A 1CJCA 4X8HA 5JO0A 2G6TA 2XGMA 3HS3A 1HFWA 2AZ4A 4HDQB 2AZXA 1J0DA 1KK0A 5KNCA 1LLDA 1IZ9A 3IA2A 4G5YA 4YAEA 5GZ3A 4CXMA 2CHUA 2Z4SA 4KX5A 2R3SA 4XVRA 1J8MF 5A06A 1KQPA 3GVCA 3WYCA 4C04A 3QWBA 2VJLA 3FWHA 4KDRA 1Z0AA 5T4EA 1CKEA 1XAIA 3G59A 4KVAA 2C3OA 4GF5A 4RF5A 2IDZA 3NOXA 1CTQA 4AKEA 3ROZA 3WXBA 3QOFA 1IZ7A 3HADA 4NIMA 3OZXA 4UDOA 5DLYA 3AJRA 2DFLA 3KFLA 1WDTA 4M9RA 1TCVA 5TT1A 5AW2A 2GJAA 2RGDA 4BVFA 3DEAA 4OP2A 5G41A 1FP4A 3DFIA 3R7WB 4XAQA 2EEPA 2HGSA 1KDZA 5CFLA 2AD1A 3PI6A 1A3CA 1L3IA 1XEXB 1Z06A 4LZPA 3KNZA 5AKHA 4RANA 1BH6A 5JAQA 4EX6A 4DR1B 3W6ZA 2R85A 2W6JD 4MV0A 3R0ZA 4KXWA 3ZWDA 3ZHQA 3UXMA 4OK6A 1VKZA 4QYWA 1HZZA 1S3FA 5CT4A 3ILSA 4P93A 2BFWA 4UASA 3DMNA 1PG0A 2F55A 4P5PA 3OAAD 4OJYA 1T3LA 1Z2DA 4IJ6A 2CXOA 2M9MA 4IKEA 1HNXB 5HJ5A 2VH5R 1YR6A 2JGIA 2ZYUX 3DD1A 2W6IA 1Z8HA 1C4KA 3E9NA 3KXPA 4QBFA 3WNVA 2ISCA 3BD6A 1GVNB 3FVVA 4B3DA 4R2JA 1WZUA 1IZZA 1O94D 1SCIA 3S8MA 1NJ6A 3ZKWA 1ATZA 1C8LA 1KERA 1YIOA 4RIFA 2VC2B 4FFBA 1KOFA 1ZRMA 2ZJ2A 4FIZA 3EUWA 2HY7A 2D1RA 1KYVA 1JEQA 4G36A 1WXHA 3QVJA 4TV8B 3AG5A 1ZI6A 4X7PA 5ALHA 4GR9A 3WS7A 3Q3CA 4F46A 3JR3A 2LWIA 3MZ0A 3SBOA 3M4NA 2IWRA 1U7TA 2KLBA 1BCSA 4LXQA 4RH3A 4GI1A 1NATA 3NATA 3EVAA 3A06A 2YYAA 1EFAA 1YMVA 3QITA 5F7OA 2YYYA 1NA5A 3FD8A 4YXWD 3UT5B 4MTLA 3L92A 3C85A 2TMKA 3V9AA 4AKIA 4TTTS 2PU5A 3BCHA 2VNIA 3WK5A 4Y1RB 3GRUA 4OBXA 1WUHS 1BU5A 4LJAA 1J70A 4F2DA 1KNXA 1Z26A 2W4QA 3M4YA 4R9NA 2BOVA 2D1YA 3EGDA 3JATB 4B35A 5G3ZA 3NUGA 5F64A 3SKVA 1UM9A 1PJRA 1XDBA 2SBTA 5HZKA 1N3BA 3CPEA 3OD5A 4ABTA 4LJLA 2V1UA 3P0HA 3D6HA 3AF2A 4HSEA 2BMFA 4K3VA 1FSGA 4L73A 4P32A 1HWYA 1KYZA 1YHNA 4F5EA 2IV3A 2F6RA 4BQEA 3KAJA 2O1EA 3OUZA 1P7PA 4UUAA 2QLLA 4MPDA 2XKAA 3PQ5A 2QZJA 1TVEA 1DLJA 1EBFA 2ZIXB 4XYBA 1E61A 1D1SA 4OGKA 1WZEA 1JSLA 1R0XA 1JXMA 1JQLB 4OGWA 4YUWA 4D0RA 1P7ZA 5AI6A 3ONWA 1SH7A 5ALFA 5KUTA 2QLJA 2ZROA 5JISA 1XZLA 2BHLA 2KI5A 4DDTA 3BDIA 1XQXA 5EFZA 3NU1A 1A50B 1FDTA 2IIVA 4TWAA 4KN9S 1NUAA 1W4AA 1OLSA 3IT0A 3K1YA 4TT3D 5TDHA 1A1SA 1X2BA 1HH4A 2ZDGA 5KVSA 4NU6A 2Q6OA 1OH7A 3K35A 2HA2A 4B40A 1IK6A 3ISJA 4GSYA 1YWGO 1KEPA 5ERYA 5JVDA 1W2HA 3IELA 2IYYA 4L3OA 4TMKA 3AVVA 3DZHA 1V5WA 2JK1A 2I4OA 1E1KA 1T9DA 4E2YA 2Z9DA 3JASA 3UK7A 1V9LA 2Z57A 4GEGA 5LNK1 4NY1A 4U3JA 1R4ZA 3HM2A 3K1AB 1QLHA 5LUBA 3VZDA 3T7JA 3W05A 1ZGAA 4NJOA 1J97A 1WAMA 4B6OA 5CDHA 3HL0A 3HN6A 2RGBA 3TNYA 2PZEA 1VL1A 4QNMA 2QM3A 4G6ZA 3IDFA 2VTBA 3ZHSA 4M9ZA 2N9UA 2XSZD 5B55A 2QI9F 3U2QA 1WPQA 5IASA 1GJRA 1Z5NA 1IFXA 2DFNA 4EG6A 3ONEA 1X19A 4W7HA 2H4YA 1SWVA 3QMMA 1FOEB 4GVXA 1O6BA 1IZYA 1O8CA 1PGOA 1OTYA 1SUPA 1VE6A 1KZHA 1IAVA 2VLIA 4UUQA 4AU1A 1T8TA 1N2JA 3ZE6A 2RHBA 3R3SA 2I6TA 1KFEB 2NUAA 5GWXA 3A26A 4NPAA 4I8IA 4B43A 4DV2B 1GPBA 3BWEA 3NHAA 4REQA 1TIPA 4Y9SA 1W0JA 1UF9A 1D6SA 1EZ1A 1W0CA 1JLKA 2A86A 2L82A 2X2OA 1VHQA 3HH8A 3HP4A 1I2MA 1KZYC 5IAKA 5KOYA 3UANA 2EBWA 4HZUB 3NTQA 1IU9A 5FV4A 4JC5A 4RKRA 4MUFA 2P3OA 3PCXA 4JLNA 1W29A 3TBFA 1Z5UA 5D3MA 3LIIA 1NVKA 1VL2A 2FSFA 2CYBA 4M22A 3KEGA 3IESA 2BGLA 3UHFA 1A7AA 1ENPA 5ER9A 2Z2KA 5HILA 3GUCA 1GCOA 1N3IA 4L8YA 1A9QA 3EQ9A 3FVWA 2WT8A 1ICIA 3CURA 4RSGA 4C01A 4EGQA 5EXDA 2QTMA 2UXCB 1DAOA 1Q92A 4YT5A 1L4EA 2A9JA 3K9CA 4X20B 1H5QA 1TC2A 5G02A 1CZLA 1ZRHA 2FSIA 4GI7A 3ZXIA 4D8VA 3JYHA 2NVUA 4UQLA 2FZEA 3F3SA 4YV7A 1W85A 1T2CA 1YMUA 3KJFA 3NO4A 5DM1A 3T1NA 6Q21A 2X1MA 5DISB 3VU8A 3BL8A 3CVXA 4IIVA 3E05A 2VYND 1EDZA 1J2YA 1FMLA 1VPTA 2AFHE 4RH1A 2X0DA 1YS7A 2N1BA 1DSSG 3FBGA 1VJDA 5T5QA 1RDFA 5JRZA 4GC5A 2COKA 3EIHA 1O57A 4AX8A 2VWGA 4CW7A 4NCJA 1NMSA 4RGBA 1ECGA 2JCYA 3E5MA 5CFZA 4N1AA 2YDXA 1Z75A 3WK6A 1UPCA 2WICA 4YRSA 4C5CA 1FJHA 3KYCA 1ESNA 1ZEMA 2KBEA 2OLJA 4YRLA 1EEXB 1EA5A 3G1WA 4JKIA 2XT9A 2P0YA 3LI2A 4P34A 4YRTA 1SWWA 1V8OA 2NWQA 3MCTA 1PW7A 5HFJA 2QD1A 3GRRA 2CUTA 3OJ0A 1I24A 1QC5A 3TL2A 1GM5A 4CRWB 1IBMB 3RKSA 3EIUA 1D1QA 1ULSA 2BTEA 1ZUIA 3ED1A 1J9EA 1GNPA 4M1QA 2ZVQX 2CJYA 3ICPA 3KDAA 2PLAA 2ZZMA 2EZ4A 4QFBA 4WEQA 4ZEWA 1C7QA 3AM5A 3DYBA 1HFEL 2C9OA 2I76A 3TM5A 1OB2A 3HR8A 3GUUA 3OFJA 4PE5B 3EEIA 2FH5B 4YQYA 3KB2A 3BHNA 3FZGA 4QEKA 4RTMA 4KSYA 1QK4A 3TW8B 4CT4B 4DVJA 1WZIA 2WYVA 2ZTVA 2MU1A 1NY6A 1Z5ZA 2CVZA 2PQ6A 2RI0A 3AF1A 3DL2A 4LPKA 3ZKAA 5BRJA 1N6OA 4MB6A 4KDCA 4XEHA 3CUWA 4DR7B 2H16A 3QVSA 3IIIA 1TPZA 1LQ2A 2AWNA 2ZYWX 4BPBA 3EWIA 4GNKA 4GWLA 3U3RA 4CQMB 2VK1A 1RBZA 2BSQA 4R0MA 3TZCA 3ND9A 5A5FA 2I9PA 2WHPB 3RB8A 2JVKA 3IPYA 2FEMA 2RKBA 3R3YA 4Z4GA 2AOVA 1IBSA 1PL0A 2FPUA 4AIRA 1NNI1 4MUKA 2IYQA 3R6DA 3D7LA 1P5JA 3OE5A 2Y4NA 2PMFA 4H60A 2ZI9A 4H6PA 1SVOA 4XX0B 1YL5A 2IELA 1MIOA 3CX8A 4ENQA 1DRUA 4IMIB 5FORA 2QP4A 1K6XA 1PTJC 3QUAA 4JKYA 4TM7A 5ICCA 1PQ4A 3I5AA 1QAOA 4JB8A 1C4OA 1J2EA 4AS1A 1XJ0A 2VH2A 5A6SA 5DF1A 5FLXA 3GGSA 4DMRA 2XCOA 4U7PB 2QAJA 3D2AA 4MWDA 4MVJM 3U3KA 4WECA 2GZRA 2YC2C 2YNMD 2F9MA 2QF7A 3G17A 1P5RA 2OHOA 1ZIXA 2X4GA 3GD5A 2QPLA 1CHNA 1VA4A 4DY4A 3OOJA 5D84A 1SHLA 1LKZA 3P26A 4FWIB 4RVHA 3GP5A 3DAFA 2HCJB 2XCQA 4OQXA 3SHVA 1Z0SA 3VR2A 5LXTA 3I4LA 2AZTA 3F4BA 4P3KA 1W49A 5AIAA 2B8NA 3EFHA 3OOWA 1KH1A 2QK4A 4F9GA 5JMTA 4N49A 2WD7B 1A7UA 1QO7A 1VLLA 2Q3FA 2C42A 1R4MA 4H7FA 2BFBA 2ZVDA 4MWEA 1YQQA 4E7PA 1A82A 1QSGA 2FU5C 3ZZ1A 1RQ7A 4QG7A 4YTEA 1TQDA 2ONZA 3G68A 1JR3A 2GBPA 1M34B 4OAPA 1M6EX 3I2FA 1SCNE 2EKQA 2PXHA 1NW7A 2MYNA 2Z9BA 1ESCA 3KZNA 4IKOA 4Y2SA 2H63A 3DF9A 3O3CA 1Y8AA 1UBSB 1UPBA 2JGRA 2OAQ1 4OGLA 1H8EA 3KFXA 5FLKA 2YFHA 4KQXA 3ZJ5A 3L4SO 1XAHA 4ARZA 2O8EB 2B4TO 3TTXA 1OQAA 1XKLA 4KVGA 1N5JA 2V6GA 3ESAA 3L0PA 5CBKA 5L7TA 4H6VA 5BQPA 4J91A 3Q12A 4ARVA 3D8RA 1TFRA 1O4VA 4JK3A 3FCAA 3K4QA 5A3SA 5JSZB 3L05A 3EBLA 1UKAA 1OWMA 3DXYA 3L7KA 4NEGA 5C5IA 4O3FA 5EEGA 2LE0A 3P9RA 5KYNA 2GT1A 1XXHA 1FLNA 3FCOA 2C83A 2D5AA 2VH1A 2VS1A 2XIJA 4JCCA 4MCAA 4OQNA 1T5OA 1VBKA 4I9UA 4DM7A 3PX7A 3DV9A 4I55B 2N42A 2WE7A 3PXEA 2BMJA 2BZGA 3ZLVA 5D7NA 1M1UA 4G8DA 1Y9JA 2XUOA 1FUKA 3ER6A 3QPDA 2MR5A 4YRCA 1DAPA 3KDPA 1ZP6A 1WMAA 3EDCA 3HB5X 3LV8A 4FFPA 4GT1A 1N3LA 4PXSA 3GF4A 4BN4A 1XZQA 1YOVA 4C0HA 3TG2A 3IQXA 2WFLA 2W2KA 3N2LA 3E6AA 4Y30A 2Z09A 1X38A 1PAUA 1WXQA 1FU8A 3DCNA 3C6YA 3QKSA 1N2EA 1X70A 4Z8XA 3SWWA 4MVJA 1K2WA 3KD3A 3F46A 2VYCA 5CAEB 3V8MA 2GZMA 1RAAA 6AT1A 4JUDX 2QAGA 2WAMA 4FYPA 4U6QA 5EXSA 1I4TD 3C70A 2GZSA 3ORYA 4R68A 5JTTA 4KR7A 2OQIA 4DIFA 1TOAA 4O59O 2QX8A 1WKBA 3A1CA 5BUCA 1A1VA 2Q5OA 3U3JA 5JDIA 3M5WA 5EPOA 4ZU1X 3TFWA 1QBGA 2E4UA 4EG8A 4MARA 1CNFA 4CCYB 5BN4B 3LPAA 2YRFA 2LDXA 3KD2A 2NZWA 3Q9LA 3FSGA 4WQMA 1XTZA 1EVIA 1SC1A 2R7AA 4WY8A 3THOA 1HE8B 4OHXA 3FZQA 1K7EB 1WSBA 2XZOA 4NYIR 2PXCA 1FX1A 5AHRA 1JBQA 1GPKA 1MV5A 2WYOA 4ID3A 3RYTC 5CVTA 3A8TA 1IXYA 2UU9B 3HEBA 3DG9A 1NJ2A 4GI2A 1UQUA 1DCMA 3HVHA 4P4TA 1YS9A 4E03A 1W1IA 4RTSA 3ZJTA 3LHIA 3H2SA 2YZ7A 5SICE 2QTWB 4WTOA 2P27A 2O0JA 1DO8A 1I2AA 1D4ZA 1U7OA 2VDJA 2ZRDA 2BUCA 3IOCA 3OLZA 4LMRA 4E09A 5C8XA 4B3RB 3CX6A 3S2SA 1D2RA 1QFXA 3GL9A 2AN3A 3S0JA 4IOMA 4IFBA 3LWBA 3WV5A 4EYEA 5B3JC 5LQDA 2Z2JA 1FDWA 2ODEA 2Q50A 2OV4A 5GJWC 5C3UA 5J3JA 4UU7A 3W5JA 4X97A 1ZQ1A 2H00A 5K8VA 1A27A 2CLMB 1GGFA 3JSAA 1II8A 4GM4A 1G8MA 4WBXC 3B1XA 5ICEA 4GKKB 1GQFA 3ZWWA 1UOQA 1HEUA 3QVKA 3UTCA 1G64A 1M1YB 3NGLA 5DK4A 5KYUA 1BHSA 1FDIA 3A4TA 1U8CB 4ZZ0A 2HIAA 2C9DA 3HU3A 2FUG6 4C4YA 1EFHA 3IAS1 1FP2A 2VSNA 3OFND 3ONNA 3TTVA 3GNTA 4KITB 4QC2A 1PR0A 3WFJA 4DUZB 4N5MA 3PPIA 1O3YA 3DOFA 2FWAA 5FADA 3PIIA 1CQXA 4RPGA 4XIFA 4DQLA 4F2PA 3C3BA 2YMMA 4OIMA 1R0SA 1W25A 4PINA 3ZV3A 4IIJF 4A0FA 4C0WA 3T3HA 1FVHA 4Q21A 3BHIA 1TLFA 1KOLA 1ZIPA 3RFFA 3FWNA 3KXIA 1ZRSA 4YJ3B 4JOCA 3QE2A 1PSDA 1J21A 4EFLA 2C95A 1BOOA 4A0QA 2XBUA 4G56A 1PJ3A 4HDMB 1DKRA 1A9SA 3QX7A 1WZ2A 1AKVA 4L27A 4AYXA 2KW5A 4I99A 4MQLA 4OYRA 4E2ZA 5IM4F 3AVWA 1AUPA 4G8CA 4KWEA 2IX3A 4XPIA 3IA7A 4PHFA 1IN6A 2C7QA 1QGDA 1KI6B 1XQVA 1QVAA 1EFTA 2OVBA 2ZLBA 3F0TA 3ENNA 4G4SP 2PA3A 4HNGA 4X7BA 4F8JA 5ES3A 1OXSC 1B3RA 1NW5A 3WB2A 1QHXA 3B1KA 4G1FA 4BVEA 1SVWA 4JBGA 2Z1NA 4UHHA 5C18A 4UNSA 4BECA 4YDSA 2NXNA 4L5BA 1P91A 3KOZA 1CVRA 2NYRA 4D99A 2DVMA 2ZRMA 2R7LA 3WWCA 5LBTA 2VCHA 4KVZA 2Z43A 3UV7A 1YRQA 3S2ZA 3VOTA 4DDVA 1LY1A 3EWNA 3MLEA 4FMDF 3W5HA 3S55A 1P0IA 4PGAA 1P1IA 1MX3A 5BV1A 1G18A 3LCJA 2I2BA 4KE6A 5AK6A 1FS6A 2IP2A 4MQ6A 4HYYA 5DNYB 1P0QA 2O2IA 3PJEA 3O2JA 4D42A 4EVSA 5E8RA 1PNQA 1Y4SA 1OW3B 2GUWA 1RW4A 1BMFA 2G9UA 1XRMA 1SAYA 3N3BC 4JJZA 5AW5A 3A10A 1UMBB 1JFFA 2JJ8A 3WMGA 1GPMA 4KCGA 2FMHA 1K5PA 1JFLA 1TL7C 3CR3C 4YT4A 2QRHA 2QBYB 1JKXA 5BPFA 5TGZA 4A8JC 1PYOA 3I83A 2PU7A 3VO8A 5DBIA 2DEUA 3K6SA 1V6CA 3HBMA 3A6ZA 1NAIA 1R00A 2B7CA 1RVV1 3JAWA 2C9MA 1O6CA 3KRTA 4Y0AA 3NH6A 1WXDA 5DHTA 1NDQA 5IFLA 1CD5A 1EX1A 1TT7A 3JSXA 3NH9A 4WNIA 5EHXA 4PGGA 2JHGA 2A1TR 2FZ4A 3JW8A 4W8GA 2LUOA 5D6NA 1YDWA 1BS2A 1XCOA 4UXHA 4X1YB 4X0EA 4P38A 1IQPA 2I4NA 3FTQA 3FYTA 1Y3BE 4FPXA 1EKXA 1EXWA 4H9GA 4S12A 2IY9A 2CN1A 2XDAA 2J9YB 3RSZA 3T3PB 3WC4A 3L5OA 1T2UA 2DMRA 2HWXA 1WW8A 2W6CX 4C3ZA 4KMOA 4DJFC 3FTEA 5IAJA 1Y6RA 3N6XA 2QN1A 4KQFA 1NJ8A 2OAEA 5F21A 3D6NB 2VG8A 3BXEA 4JIGA 4F0JA 2BGKA 5J2TB 2AQHA 4CMBA 2RH8A 4OBEA 4RV5A 2GPYA 1GL6A 4E70A 3GQBA 2OC4A 1U1EA 1Z3IX 2JL1A 2VSYA 1QYWA 2Q5LA 5IPFA 1TF2A 5E0OA 1RBYA 4DIBA 3DHYA 4ACBA 4O4IA 1W47A 2GD6A 4DPMA 1JHUA 1PWEA 2WWFA 3HLTA 4JJKA 4MPPA 4US2R 1QCDA 1NFRA 4MYRA 2VZLA 2IHBA 3JQ9A 3DBLA 3OPYB 2JHAA 1W4LA 3ORRA 2I1QA 4ARUA 1KEEB 2C8KA 3JQEA 3DOHA 1Y5IA 5BR1A 1I4LD 4EA9A 2IYAA 4UTNA 1KDRA 3NKFA 1G60A 1UZAA 2FG7C 3PDHA 4UHEA 4AZTA 1GR0A 1QG4A 2EZ8A 3R0IA 4WHMA 4CI9A 4ZOQI 1PV4A 2G09A 4K8RB 2INGX 1AUOA 3TNJA 2SKEA 4FWBA 4Z3DA 2HMWA 1ZD1A 4M0KA 4G23A 5IULC 1SQFA 2L0XA 2VJQA 1YS6A 2YOHA 3IXLA 5DTMA 3D3JA 5KNCD 4RA9A 1X7ZA 5DNCA 1Q7RA 4XLLA 4HNHA 4MVCA 1ANKA 4CMGA 5F12A 2M6LA 1I51A 1IPEA 3F6CA 2IZ6A 5JZVA 3HHEA 1PJCA 2G1JA 2IF0A 4HEA6 1PNOA 4IXNA 1RQPA 2FVXA 3TLCA 3WNZA 3U80A 2BD0A 5BR7A 1QP4A 3D3NA 2JFPA 1D0IA 1I36A 4JA2A 4KPGA 3ABOB 1YHYA 4LF9B 3C48A 3AI1A 1NQVA 4ZGWA 1JR3E 4JVOA 1YCDA 2V3CC 3EOZA 4I9FA 3VKFA 3O4VA 3EY9A 3GFBA 3HUTA 1XCLA 4MYDA 4PAMA 3UB3A 4A73A 2ZUFA 2PX5A 2YS6A 2EP5A 4X91A 3CF4A 4BLRA 2OQVA 2FPRA 3BZWA 3WDLA 1UR5A 1P6XA 3A9UA 5EJFA 5J40A 4DLZA 4HV4A 3N0TA 5E6SA 1SVSA 2EKPA 3RRJA 1XMPA 4XKJA 1DOHA 4B3CA 3TLXA 5CEJA 4GR4A 3CRVA 1VG8A 4N6GA 1VBMA 4P92A 1WOMA 2YIMA 4G67A 4OEHA 4PQEA 3ZNOA 4HWGA 3EIFA 3PC7A 4GI3A 4M7PA 4XM2A 3GVIA 4E31A 4AJPA 5BWCA 3HWX1 1U6IA 4IL5A 2Y1DA 1L5ZA 4BKQA 3GEPA 3T15A 1ULBA 2HJSA 3AEUA 3C3EA 2PT5A 3EXHA 4DCJA 3K2EA 3GNQA 1G7RA 2I6QA 4B3FX 2HWWA 2W6ID 3KLOA 1YR8A 4M37A 4RPLA 4MSUA 3KR2A 3KSDO 1VZ3A 3QQPA 2BEVB 3WWPA 1G3UA 3G8BA 4G0OA 3MSCA 4KQEA 4CM6A 1QYDA 4PX9A 4UTXA 3X1XA 2IBMA 3HKEA 1V8ZA 4F97A 2DY0A 4PZYA 3H5WA 5C5CA 1N7HA 2C58A 1KFCB 1T1IA 1Y3AA 1QGUB 3QBJA 5ESWA 2AW5A 5JCOC 1KZ7B 4OB7A 1GN8A 3WGMA 4AUMA 1ZUNB 2IS1A 5A0TA 4O4HB 4BWYA 1IOWA 3IEXA 1UKEA 1Q3HA 3DWGA 2IYTA 4Y9DA 4AO8A 4ZP1A 2YBDA 2EW8A 2G9ZA 3NM4A 4U0KA 2P67A 3ESRA 4XWWA 3QF7A 1TIBA 1E6CA 2ODAA 3MWKA 4O4JF 4RAQA 4LF6B 4QDJA 1RXCA 4S24A 4CIBA 4L8WB 3O8QB 4MNTA 2IZZA 2QYTA 2V4MA 3MB8A 4KFRA 3PUJA 1AE1A 1F60A 1AX9A 2C9ZA 2IGBA 3WL7A 4I1UA 3WK4A 4EFMA 2HAEA 1HE3A 3L02A 5DCLA 4ZAWA 4BMCA 3M4ZA 5CVUA 5F98A 1KOGA 2OBXA 2JKZA 4FOOA 2I6FA 2V7VA 2IYUA 2R84A 3IE1A 4Z4EA 1CUZA 3IC5A 4E33A 3RNOA 5TQ2B 4Y6QA 3DKVA 5JS6A 2GN1A 4K5QA 5DM0A 4HH3C 3C3XA 4IHQA 5D51S 3N8DA 4JDPA 3CRMA 1T8YA 3DFFA 5G1NA 3OX3A 2DPXA 3IIKA 4PYQA 2Y9MB 5IBQA 3RLFA 4Y2UA 3VA7A 1U0FA 2GERA 5EJ6A 1TEHA 2B99A 3NBQA 3R9XB 4CL8A 3R0XA 1B6RA 2BN4A 4JGBA 4H4CA 3LHDA 4M49A 3P9KA 1YZ3A 1GZUA 5AUPB 4KAFA 1X7YA 2RSLA 2OZLA 5BVGB 5KU7A 3GB9A 4NONA 4JJIA 4GE0A 1PZXA 1WF6A 2JRLA 2LKDA 4FE4A 5KJFA 5DLPA 3ZLUA 4HB2A 1K6MA 4OQZA 4YK7A 3V6LA 4JR1A 4I5DA 4KH1A 1YUNA 3OFSA 1J1ZA 2X86A 4IDNA 4YRGA 1UJ6A 1K6EA 3K2QA 3MJ4A 4XI9A 1CQIB 3MHTA 1FVFA 2ZM5A 2JI9A 2BKXA 3BMQA 4I5FA 3ZWXA 4EW1A 3DYIA 4NFSA 4CF7A 1YZLA 3G0DA 3RS7A 2WKPA 5J4HA 3WWZA 4HQFA 2WVJA 2YW9A 1AIPA 1HDRA 1VZ2A 1ULUA 4NZMA 2Y0DA 4Q7LA 4EZEA 4KR9A 1FRNA 4MUXA 2HWUA 2DUJA 8ABPA 4OKIA 1PGNA 2BCJQ 1TMKA 3R4CA 3A1SA 3ZCTA 3FE2A 4KWCA 5HUQA 2O4UX 4C6TA 3V8QA 4RTNA 3DL0A 4HX2A 3LRXA 4EFDA 1TRKA 3R6WA 3F5MA 1GNTA 3F7OA 4PHHA 4RY9A 4JDUA 4AZ3A 4EMBA 3WA7A 4AY4A 1H9CA 2ZI7A 2EXXA 3SNHA 5FPYA 4CCWA 1R18A 5K8JB 1VFNA 2I6SA 1YBFA 1V5FA 3H2GA 2PPLA 1JI3A 1K86A 1W0JD 2I2DA 2J6IA 1Y5RA 3NIFB 2GMWA 2NQ8A 3ELWA 4JJ6A 5DEOA 1L5GB 2XRZA 1U11A 3I23A 1P5ZB 5BSTA 3R7SA 1Z6ZA 2AI3A 1OXMA 3KAQA 3QG5A 4P36A 4BVGA 1RM4A 1SUAA 3JY6A 1XLUA 3HCPA 4OLFA 4ZYLA 4AMVA 2B8JA 5I7FA 1LJUA 2AOUB 4XB2A 1RMTA 5AKKA 4UREA 5KHAA 3VOAA 2OFWA 2ZWIA 8GPBA 1QZ3A 3FAKA 1XK6A 2YJ4A 1YB5A 1KJ9A 4K26A 4MK4A 1KQOA 3KKOA 3QM1A 1A5TA 4AZWA 4IV5A 2DKNA 5AVWA 3GZNB 1B23P 5ULLA 4U7HA 2QLFA 3EC2A 1EZZA 3I72A 5CITA 4Y6SA 2YIVX 2W6ZA 2AK2A 1SHJA 2G3YA 4QQFA 1IBKB 1R0BA 5ETJA 2HK9A 3O90A 4X54A 1HRKA 2QVCA 1FBTA 1JVBA 3EK2A 3MTDA 3TUIC 3G0HA 2IXDA 1QQ7A 3O8LA 3ZWYA 2G04A 1F8XA 3K92A 1BQ3A 4Z9BA 3W5VA 2CMFA 2G28A 4MJ3A 5FEUA 2P35A 4I50B 1ZN9A 5ANRB 5K8UA 1L8XA 4CV2A 5LZ2A 4INJA 1VQ1A 1Z6PA 2CFOA 3LY8A 3QFRA 1CJMA 3OQNA 1W9MA 4Z49A 1GTZA 1W96A 4JX8A 3WL4A 3ZJYA 3OPXA 4ITRC 4TL8A 2C4UA 5CHEA 5EKSA 2PWZA 4QPZA 2GYWA 1C80A 1W5BA 4OQMA 3V8VA 5AICA 4PW0A 2JG3A 2IRWA 3AB7A 1GGNA 3P32A 3OZUA 1WBDA 4C7OA 1LU9A 2BRUC 5F3WB 3H4IA 1XYYA 3MJCA 3NBYC 4W4TA 2HIMA 1NV9A 2VP6A 1BX3A 1T3TA 2VJPA 4YCDA 1FFYA 1AUQA 1T4CB 1X86B 2FPIA 3B6ZA 1RWNA 3R7BA 5AI8A 3T5MA 3U7FB 2FN3A 2PJDA 4URZR 3D6TB 2X13A 3FW1A 4ABYA 3HJBA 3O3MB 3WTBA 4CF6A 3SAJA 4E5UA 5A3JA 4D46A 1YC2A 2HO4A 3U4CA 1E3IA 3O8RA 5JBIA 1FFHA 1G21B 4LBZA 1WHSB 1Z6YA 4RWEA 3CZRA 4YY3B 3I4CA 5HBGA 3OCXA 3LA8A 3ZDEA 5JASA 2XV1A 4QDKA 3TUJC 1TUGA 2QR5A 1ADFA 3Q0IA 1BAPA 3HZHA 2E89A 2HA4A 3ISVA 4HNRA 1PL8A 3AKDA 3AXTA 3HB7A 3MJTA 4WN9A 4NU8X 5CX1A 4DM4A 4DMCA 2Q6IA 4O4LA 1FJGB 1HMYA 4RY2A 1SHZA 1Z4NA 4LJ7A 1FUYB 3CUKA 4OA8A 4CMCA 3DE3X 4DIKA 4IJKA 2P9GA 1SELA 1XRRA 5DHFA 3TW0A 1OV4A 2WILA 3MCAA 3DPUA 3MIIA 4S1TA 3SEAA 1ZS9A 4WKGA 1Y9ZA 2Z4RA 1YIDA 3N74A 4K9OA 4L8VA 3HCBA 2NV2B 4U9IS 3RFVA 2WU1A 2FWRA 2YN0A 3PEFA 5HKOA 5AW9A 3SIPA 3S7ZA 3SICE 4DJDC 3LL4A 4K9DA 5JLJA 4PLWA 1JHXA 4XTRA 1UBFA 1GTMA 2ZUCA 3FFXA 1U8FO 4S0XA 1Z5OA 2QTRA 4E88A 3JQ6A 1FUEA 5HE9A 2M6KA 5HRAA 3B2EA 5BW6B 1KAOA 1LDBA 1XLVA 2RHHA 3V6MA 1RYMA 2OFXA 3LQ1A 1H93A 3HR7A 1DWUA 3E1SA 2EL9A 4ENVA 3ER8A 2H54A 2A78A 4DCUA 4MWTA 4PQRA 4X7RA 2XTMA 2WIGA 4R1SA 4OBBA 4CLHA 3VR2D 3GJSA 1IBRA 2B4YA 4MVJI 5FPQA 2FEPA 3S2FA 2PV0A 2RH9B 1G5IA 4PSVA 1T91A 3GG9A 2R00A 2BZ1A 5DLQC 1PZHA 2GEBA 3QUTA 5BOVA 3VPDA 1FE8A 3WO1A 4FHFA 2FUCA 2ON6A 4K8OA 4MI6A 5B6JA 5ERGB 3V32A 4HOYA 2NQ2C 5F78A 5GOZA 4G37A 2FW7A 3IKTA 2HF8A 1E1YA 2WG2A 4ZDJA 1JR3D 2ZIEA 3I6BA 4XOIA 1XRQA 3ZR4B 1Y8ZA 1NY5A 4DZTA 2R65A 3RYIA 3VUFA 4DOMA 1QAMA 1BEEA 1E0SA 3HGQA 3RIGA 1UAYA 4MHSA 3ETJA 3OSUA 1RKQA 1U4OA 2ZR7A 2MMCA 1AS0A 3EBPA 4E1AA 3C3CA 4JT9A 5B6PA 3BWXA 5KC8A 1H8ED 3BDAA 2EVWX 1P4AA 1F4LA 4MI9A 3JZAA 4Z9AA 5JRDS 1RXWA 4YJHB 5GM1A 3KOXA 3LC1O 5JAHA 2GN8A 2GPAA 1LZKA 3HI6A 5BNFA 4WINA 1E3JA 1A77A 1OAOC 1RI5A 1RWPA 4HWOA 3QXSA 5LYJA 4B80A 1O96A 3WSTA 4U2GA 2Z08A 2GA8A 3EGXA 2NVOA 1KZ1A 2O54A 3AHEA 3O26A 1HTWA 1B15A 5K0CA 3HJFA 5ALIA 3RYCB 3Q2OA 1ELOA 3G1UA 2JATA 4OHCA 1Z8DA 2VR1A 3IEPA 3PNQA 2HHLA 3AV0B 1BYUA 2JFBA 3DOIA 3I1JA 2Q6VA 4TRNA 4XB6B 3C98A 4QSHA 5AOBA 1IEXA 1AZLA 2HF9A 4Z2YA 3FPSA 5ADHA 2FZKA 3RSSA 4WJZA 2P4EA 3CTMA 3NP7A 3TVYA 2XQVA 3PNSA 4UJ3A 5CJPA 1M2EA 5IEJA 4A92A 1PWYE 1SY7A 4HDRA 1WULS 3BMNA 4WVLA 1DADA 4GC9A 1IOZA 2OCBA 4MGZR 3GEDA 3PF9A 4KAJA 4EPVA 1PT6A 3UWSA 2YXDA 3DONA 4PLYA 4MVJD 4MW6A 1NVFA 3AXSA 3DNPA 3GJTA 1OR8A 3SC2A 1BEZA 5CGQB 2IUYA 1RRFA 1N5IA 1RQRA 2NU6A 2QGZA 3PDUA 3E35A 3GYGA 5JSHA 1UXGA 2VUUA 1MT0A 2ZQYA 4MR9A 3WMWA 4XWTA 1Q95A 1WHTA 5K4GA 1FYDA 1SGWA 3D3EA 3DKKA 2BEKA 1YZVA 3IPCA 1ZOPA 4QBIA 3OM8A 5E3HA 4KJXA 5CTAA 4C20A 3O4JA 4HGZA 1GUAA 5I4BA 4J0DA 3HP7A 3AUKA 2XLBA 3E4DA 4GPTA 4NK5A 2R48A 5EE3A 1WEHA 1Z07A 2ZU0C 1IY0A 3UFXA 5DI3A 3UA4A 1OF1A 2JANA 1OU4A 1L5OA 1I3LA 2A2ZA 2GO7A 3PFNA 3UJAA 5EZQA 3FSGD 2VT7A 3HMQA 3OBBA 5HDBB 5FKJA 3P27A 4B8ZA 1P8JA 4A8JA 1I80A 1DFGA 1RMQA 3FZNA 4I66A 5SZKB 1PI3A 4K2HA 4JXJA 4MYUA 3RE1A 2GSWA 3OZ7A 4UBIA 3PR2B 2PR2A 3ITKA 2OHFA 2GFIA 3SSAA 1YDGA 3UY4A 3WKAA 1RHQA 1K4YA 2ZRAA 2VJNA 5CX4A 2F17A 2FDXA 1TK2A 4PTZA 4YJ2F 4QRIA 2WUFA 1V4NA 1L7NA 3JQBC 4JJAA 2P9HA 2O3SA 2FSGA 3TDNA 3DVAB 4DLVA 1D4AA 1RC0A 4LDNA 2CKMA 3G2HA 2GAJA 1YAHA 4PLTA 4UDXX 4D9EA 3TQTA 5CEEA 5IKEA 5G0WA 1JAXA 1ZGGA 3HRKA 3HVRA 1E32A 5EJIA 4P7GA 3HJRA 1E3WA 3ID6C 1TPYA 2ZSUA 5I5EA 4JBYA 1BWPA 5JY6A 1M2OB 1AD2A 2P2YA 2FR1A 2GD0A 3A58B 2JCBA 3WGOA 1EINA 3UMCA 3B5JA 1O5TA 2DXIA 1X1BA 1KJZA 4M1WA 1TVMA 3O0DA 1OXUA 1DQNA 4FKBA 4OXKA 1IY2A 5DNEA 3VR6A 2J0UB 2ZFUA 2YHSA 4M55A 1HG1A 5T4FA 4JYZA 1KJNA 1V41E 2UYQA 5DHSA 4LYEA 4YB8A 3SM9A 4Q4LA 3TLYA 4MX8A 5F2NA 1E5LA 1QYRA 2G67A 1F48A 2VP9A 5C3MA 3GOHA 1Y48E 4IFEA 4OHFA 4D3XA 4UUMA 3KJZA 3GRFA 5EWLB 4D5EA 4FLFA 3CPHA 3FDFA 1RCFA 2JFFA 4X95A 3S8EA 2BDTA 1WQ1R 5FWYA 4CEIA 3OA0A 1GKKA 2QVXX 1Y1LA 4RQTA 1B8OA 1YK1A 5FRDA 1N2SA 3GJ7A 4LK2A 1RM5A 2J30A 1F06A 2J46A 4Q00A 4R8KA 3VR3A 3H99A 2CL5A 2HPHA 1Z37A 4HBZA 1TA4A 3IR5A 3UBMA 5BOSB 4J0JA 1CRQA 1H8HA 1VLQA 4E4TA 2OEPA 5IARA 4KW7A 3EAGA 3FAZA 3QVLA 3R5JA 1KI2A 1ZWLA 3KR9A 3PNBA 2H7CA 4QGGA 1AC5A 2C9YA 3TOCA 5BY2A 1JT2A 5H16A 3MYRA 1ZIYA 1TD1A 3LO5A 1K98A 3GPIA 3OOEA 1U3WA 4QDOA 1D09A 3ZDRA 4DPKA 3EQ8A 4IIBA 5FHRA 4HFJA 4BMVA 1TQ2A 1PYDA 5KDDA 2PJZA 1E9SA 2PBRA 3NCHA 2XVXA 5DYTA 3N2GB 4C0AC 3IMGA 3VDMA 5EMLA 1P2TA 4JC0A 3LBAA 3O93A 2D1QA 5LZ5A 2C4NA 3GEGA 4NBUA 4NZ9A 3O8OA 2GKSA 4HDSB 2DULA 1XZFA 1CF9A 3PWZA 2SCUB 1WB5A 1LDNA 2RHWA 3EZNA 1LBEA 3I9JA 1SU7A 3LXRA 1JFRA 1V8FA 3IILA 4NENA 3ZCUA 1VCOA 1BMFD 2NXWA 2PIDA 2FPPB 4O0LA 4TKUB 2ZTMA 3K31A 2F1IA 3HWWA 3NHRA 4O02B 4DSZA 1V71A 1HBJA 1G7SA 4NESA 3IP5A 3U9TA 2O5VA 3NAGA 5K3CA 3WGUA 4N5IX 2VPWA 2AFIB 3O1LA 3H9BA 3MLAA 2A9FA 2PK3A 3AY7A 3LC2O 3AYZB 2FK8A 1U81A 5L3QB 1AJEA 1MFZA 4YRRA 5K7SA 1E5VA 5ISMA 3IAM1 4H2DA 3G7SA 3PQEA 4MQBA 1LQUA 1R6TA 2F00A 4W7SA 2GB4A 3M5DA 1V1RA 1E59A 1CY0A 2H9AA 2OXEA 2PIAA 4PQGA 1MO3A 5IU6A 4XVHA 4ZVMA 1R5JA 3CB4A 3B53X 5JATA 1RHJA 4H15A 1FU4A 2NO9A 2AD5A 1T43A 4IIJB 4L0MA 2IPXA 4AJ2A 3P8ZA 5JC1A 1VYUA 1ZI8A 1NMEA