3BWMA

Crystal structure of human catechol o-methyltransferase with bound sam and dnc
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of human 108V and 108M catechol O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwmA00
3A7EA 4IWNA 1ZGAA 5LSAA 5GIOE 1R8XA 3LGAA 4CKCA 3EEOA 1YB2A 5FCDA 2AOTA 4RYLA 2O0LA 3LX6A 5EQJB 1L3IA 2AZTA 5HIKA 5BP7A 4PYQA 4R6WA 2HR1A 4X41A 5DM0A 4CKEA 3UJ9A 3O7WA 3FRHA 5K0GA 1M6EX 3TKYA 4EK9A 1NW3A 4V0QA 5HFJA 1QANA 5CVJA 1SUIA 3S68A 2JH8A 2EFJA 4O29A 4P58A 4EVIA 5K01A 5U4XA 4A6EA 4ER0A 2IDJA 2OO3A 4M7RA 1WXXA 5DRYA 3I58A 4U7PB 3THSA 2OZVA 1RJEA 4FT2A 1YF3A 1D2GA 1VL5A 1R6AA 3TKAA 1XXLA 3NW9A 5LQUA 3PX2A 2YUIA 1V39A 3MCZA 4E2YA 1N7IA 3KQMA 5HIJA 2IIPA 3HCFA 5ICFA 3AWIA 5CD1A 3IEIA 4KW7A 2YXEA 4FT4A 3T0IA 1XDUA 4RTMA 2ERCA 4HSGA 3SSMA 3HVKA 4QDJA 3DULA 1YFLA 2ZIEA 2ZULA 1KXZA 2G70A 3HP7A 4PIMA 4PWYA 4QVKA 5C9ZA 2QY6A 4XUDA 5DM2A 3GXOA 1I1NA 2VS1A 5P8WA 5GM1A 1Y8CA 5E2AA 4P7GA 3DOUA 3H2BA 3CBGA 1HMYA 3CC8A 5KVAA 3GU3A 1QYRA 2GAFA 2P7IA 3O4FA 3P97A 4PGGA 5DSXA 1M0EA 3GDHA 2JHCA 4DCGA 4YUWA 3ELUA 2PXAA 3HNRA 2VP3A 2YXDA 4GEKA 4CKBA 1IY9A 2NNWB 1Q0TA 3TPZA 5T6BA 3ELYA 1SQGA 3GJYA 3LDUA 2BM8A 4FSDA 5DLYA 3MAGA 4RVFA 2O57A 1JSXA 1JSZA 2VZ9A 4PINA 2AOWA 3FTEA 3NDIA 3HCEA 3MCTA 4YUXA 3UJ7A 1XCJA 5D1NA 3G2MA 5C1IA 1X1AA 4RTSA 1JQ3A 3SGLA 2PV0A 2HV9A 2P35A 2IH2A 3R0QA 3SXJA 2B3TA 4GOMD 3LDGA 1P39A 3DMGA 4R05A 4PYMA 3KKZA 1R8YA 2PY6A 3OE5A 5EGSA 2HWKA 5K0EA 2WA1A 3DUWA 4P7FA 2ZSUA 3LBYA 1DL5A 5DSTA 3HA7A 5MHTA 3DP7A 4P7KA 2Y1XA 4PYNA 2AOUA 1JG1A 3B5IA 5ICEA 2P7HA 3NDJA 2NXCA 1KPIA 5E1OA 4C07A 2PX5A 1NKVA 1OR8A 5E1DA 1X1CA 5F2NA 1VIDA 1XJ5A 4EKIA 1MJFA 2GLUA 3EVZA 3LPMA 5EMJA 1TPYA 5EHIA 3UA3A 2VDVE 5LR6A 5BXYA 4QVGA 2Q41A 1G38A 1D2CA 4MWZA 1R00A 2VDUE 3P9KA 4C08A 2EG5A 1KPHA 2WA2A 1EIZA 1KYZA 3FTDA 3V8VA 2H00A 4E31A 3ER8A 4BY9E 3PFGA 2QRVA 3UJ8A 3JWGA 1KIAA 1VLMA 3PFHA 3NVMB 1RJGA 4GBED 3P2IA 2C7PA 3M6XA 2ZIFA 2PXCA 4KVZA 1R74A 1JQEA 1XDSA 5E1MA 3TM5A 1G8SA 3BGIA 3LL7A 5DXJA 3SSOA 2O05A 3JWHA 4OA5A 5K0CA 1JQDA 3EMBA 4QTTB 3G5TA 4ZTBA 5FADA 5CIYA 3ERCA 3GRVA 2PBFA 2C7OA 5DRTA 4DA4A 1RI2A 1P91A 4HGZA 1QAQA 1O54A 5LQCA 2V74B 1T43A 4OQDA 3HTXA 2IH5A 3LSTA 3FTCA 3GO4A 3RIEA 4RTLA 3DR5A 4MIKA 4ER6A 5EKUA 3THRA 1HNNA 3UJDA 4RVHA 3HA5A 2XBMA 3DLIA 3I53A 4AZSA 1ZG3A 2XYVA 2B78A 3FPFA 4X63A 5EPEA 2UYQA 2AS0A 2F8LA 3R6TA 4IV0A 2C7RA 2YXLA 4GF5A 2ZLBA 4IKPA 4RWZA 1X1BA 1YZHA 2ZBQA 1X1DA 3OFJA 4Z2YA 2P8JA 3OFKA 3BWCA 1PJZA 5E9WA 3M33A 2H1RA 1EQAA 3A27A 3ELDA 3G88A 4MHTA 2K4MA 4FGZA 3GRRA 3FYDA 4RX1A 4E2WA 2NXNA 4PYLA 2PVCA 5IKMA 4C05A 4EKGA 4FP9A 5EVJA 4DZRA 5K0LA 1G55A 5FA5A 3BUSA 2E5WA 5FULA 3OZRA 3KPUA 3FZGA 2XYQA 5HZMA 3EVAA 1PRYA 3BKWA 3OCJA 3T7RA 4PNEA 5BW5A 3R24A 3P8ZA 3P9NA 3KQQA 1UIRA 5ICCA 2P40A 3EVGA 5GP1A 3LHDA 5FWAA 2JHPA 3TQSA 2ADMA 2ZVJA 1FJXA 2ZZMA 2Y1WA 4LECA 4C04A 4F86A 2OB1A 1TW3A 4OQEA 4GC9A 1NBHA 2HTEA 4WXHA 3EVEA 3LCUA 2AR0A 5DXAA 4PCLA 5DPMA 3G8BA 3HVJA 3LDFA 1QAOA 3GWZA 4XCXA 5T67A 3UBTA 2I9KA 5HOQA 3D2LA 3P9CA 4DF3A 1YUBA 2G8NA 2NP7A 4M37A 3UJBA 3MQ2A 2P3LA 5DM1A 2FRXA 3P2KA 3BWYA 4A6DA 4PYOA 4F85A 5CVVA 3UJAA 1SUSA 3OZTA 4YUVA 2HNKA 4RTQA 2ZCJA 2PSSA 2OXTA 4FZVA 4YV1A 3WSTA 2PX8A 3KR1A 5LQKA 4R8SA 1ZHFA 3HVHA 4ER3A 2ZIGA 3Q7EA 5CM2Z 2G1PA 1MHTA 5GINE 3AXTA 4KIGA 1Q0SA 4BLWA 2UYCA 3NWEA 5CCBA 2ZW9A 3LCVB 5DTQA 4F84A 4OX9Y 4AZTA 3FUUA 4RV9A 3UJ6A 2UYOA 2AVDA 2BM9A 5K0BA 1NW7A 3BGDA 3IV6A 3VSEA 5EMKA 3FYCA 1ZQ9A 2ONYA 4MTLA 4QPNA 1AQIA 3LKDA 3TFWA 3K0BA 4OBXA 5E1BA 1EAMA 5FHRA 3KPVA 3BWBA 4E2ZA 2PKWA 1WY7A 2ZTHA 4LWPA 4NECA 1XDZA 2CL5A 1TW2A 4RVDA 2GH1A 1ORIA 2Z6QA 1XTPA 1N2XA 3KPYA 5LQNA 5DX1A 5CVDA 5T64A 4KIFA 4DCMA 4K6MA 1JG2A 3FPJA 4QTUB 4YMGA 2VDWA 1D2HA 2IDKA 4EQZA 3B3GA 2G72A 1NV8A 1NW6A 3EGVA 2LD4A 4GC5A 3HM2A 1BHJA 2NP6A 1WXWA 1F3LA 1G60A 3FUWA 4C03A 5LQRA 4E32A 4HTFB 4BP1A 2FHPA 3KR2A 2PT9A 4KDRA 4QQNA 5DT2A 4YMHA 3P71T 4MQ4A 5DX8A 3B3JA 3HA3A 2PJDA 5EIFA 1DUSA 2CWWA 3FUTA 3B3FA 3C0KA 1NV9A 5GWXA 1RI5A 3MGGA 3G2PA 2V7EA 3AXSA 2ORED 2FK8A 3FRIA 3NTVA 3QOXA 4OA8A 4PYKA 1G6Q1 5FTWA 4FSXA 3MTIA 3HEMA 3HCDA 3SVZA 3C6MA 3UA4A 2AN3A 3KR9A 3GIWA 3RODA 3HCCA 3FTFA 4BLUA 4EMSA 2IFTA 3PLAE 2EJUA 2FYTA 2P3QA 1R18A 4KWCA 2DPMA 5EMLA 1ZGJA 3KPJA 1DCTA 2IBSA 3NVKI 2BZGA 3BGVA 2QYOA 4FS8A 3PTAA 1SKMA 5CUQA 2AVNA 3VC2A 1JG4A 2NXEA 2PGXA 5KQRA 2IP2A 4XUCA 4B17A 2ZZNA 3OU2A 2ZBRA 3M6WA 4QDKA 1M6YA 2XYRA 3BWMA 1ORHA 3REOA 4DMGA 5CCXA 2O06A 4E70A 4YUZA 3NMUF 3R9XB 4GOND 3I64A 5E9JA 3JWIA 3KQTA 1JR4A 2OYRA 2YTZA 4CTKA 2Z6UA 1L3BA 2PLWA 2PX4A 3CVOA 4HGYA 2OPBA 4RTOA 3KPWA 2AOTB 4RSRA 1F38A 4RVGA 3DTNA 2NXJA 3KQYA 3F4KA 2IGTA 2B9EA 2DULA 1VBFA 4PIPA 1FPQA 1G8AA 2N47A 2NYUA 4QPPA 2ZBPA 3UJCA 1KP9A 3HVIA 3UWPA 4GUAA 4PYIA 4PYJA 3PS9A 4RTRA 4AZWA 3E05A 2FCAA 3EPPA 3K6RA 1FP2A 2JH9A 3T7SA 4HH4A 5K0NA 9MHTA 3KQSA 3KQPA 4L7VA 1I4WA 1NE2A 5EHGA 2C7QA 3KQOA 4M36A 3GRUA 5LQAA 2BR4A 10MHA 5KQSA 2A14A 1EJ6A 5LQJA 2PWYA 4C4AA 2YVLA 3KR0A 1ZKDA 1JTEA 4H0NA 3M70A 5E8JA 3DXZA 5FHQA 1KHHA 3LKZA 1AF7A 4HRAA 3FPEA 2JG3A 3ORHA 4OBWA 2BH2A 3QOWA 2AOXA 3T7TA 2Z6AA 1RJDA 3EMDA 3NWBA 2I62A 2UYHA 1NBIA 4C06A 2H11A 4YUYA 3MB5A 3X0DA 3IYLW 3G89A 5EG5A 7MHTA 3EGIA 1N7JA 4X1OA 3OU6A 4LG1A 5E9QA 5EMMA 3CKKA 1VP3A 4YV2A 5EC8A 2FPOA 1AQJA 1AV6A 4PONA 2OBFA 3G8AA 1VQ1A 3R3HA 2R3SA 4LWOA 3M6VA 2PT6A 5ICGA 4E2XA 2OY0A 1UFKA 2P1DA 1FBNA 2G71A 3FPGA 3TLJA 5EKXA 2JHAA 2I7CA 3C3PA 4PGHA 4XUEA 2QE6A 3FPHA 3DXYA 5E8RA 3B7PA 3G2OA 2BR3A 1EG2A 4QQKA 3FUXA 5KS2A 1L3CA 3C3YA 3MHTA 5HIMA 1BC5A 5CVUA 5K05A 8MHTA 1WS6A 5KYGA 3ME5A 5ERGB 5F2KA 3G7UA 3GNLA 5F2OA 2KW5A 1YZ3A 5FQOA 2HMYB 5GOZA 4P7JA 5CVEA 3LECA 5K03A 3KU1A 3M6UA 3BT7A 3BZBA 2XVAA 4AX8A 1UWVA 3EGEA 3EVFA 5IH3A 3DXXA 1WG8A 3UFBA 2AOUB 2CMHA 2OB2A 2O07A 5HILA 4HG2A 3L8DA 3Q87B 1BOOA 1L1EA 1IXKA 3LBFA 5D1HA 2JJQA 3B89A 5DX0A 3G5LA 1JTFA 3PB3A 4E30A 4ATNA 1SVUA 1INLA 2IPXA 4AUKA 3TOSA 4RTNA 3SR4A 1VP9A 3EEYA 2GPYA 5HIIA 1RI4A 5EIWA 5EEHA 3GGDA 3OPNA 4G56A 4HC4A 4GQBA 1B42A 4UOEA 4RTJA 1SG9A 2CKDA 4FR0A 4BLVA 3SMQA 3MERA 3GCZA 3SSNA 4CWAA 1X19A 5E2BA 2ZFUA 1VE3A 5H02A 2QRVB 3CJTA 1YFJA 4PCAA 4RTKA 3QV2A 2ZWVA 3SM3A 3ID6C 2GA9A 2IBTA 1NW8A 4KDCA 5JR3A 3AJDA 4IV8A 3V97A 5HEKA 1RI3A 3EVDA 1NW5A 4Y30A 3HCAA 2R6ZA 3HCBA 3KQVA 3BXOA 3CJRA 3PT9A 3UZUA 1QAMA 4R6XA 1QZZA 1WZNA 1XVAA 2BR5A 4CTJA 3RW9A 3VYWA 2YQZA 4M38A 2EJTA 2GS9A 1NT2A 2ESRA 4BP3A 5M5BA 3E23A 2I6GA 4ISCA 3OZSA 3LCCA 1KPGA 3PX3A 4X60A 1RJFA 3TRKA 1XCLA 1RI1A 2ONZA 5K0FA 2P41A 5BW4A 2YX1A 1SQFA 5FWDA 1FP1D 3BKXA 3CCFA 3G2QA 2PXXA 3I5UA 5G02A 4AZVA 4Y2HA 2AOVA 4WVLA 4DM3A 4POOA 3KQWA 1O9GA 3C6KA 5EZQA 3EVBA 3NJRA 4U7TB 3PVCA 3GRYA 2PWPA 3A7DA 2ZZKA 3DMFA 3A25A 3KHKA 5EZSA 2WK1A 2FK7A 4ER7A 3CGGA 4X61A 3FUVA 1VPTA 4HTFA 1O9HA 5GIPE 1KR5A 5GM2A 2OKCA 2IH4A 5DTMA 2PX2A 4R8RA 2XVMA 4GOOD 1I9GA 1P1CA 5B1SA 5C0OE 3TR6A 5K8VA 4V0RA 2QM3A 3VC1A 2UZ4A 1EJ0A 5JUWA 4ER5A 2EX4A 3U81A 1BKYA 3E7PA 4DQ0A 2B2CA 5DWQA 4E33A 3I9FA 2YR0A 4YV0A 2B25A 3EVCA 1Z3CA 3A26A 4JXJA 1U2ZA 3IHTA 2AN5A 3ELWA 3CJQA 2AN4A 3ER9A 1P1BA 3ANXA 2CMGA 3P2EA 5DM4A 3JWJA 1KYWA 5EOVA 5FA8A 3DMHA 3MTEA 4RTPA 2ZWAA 5K09A 4DKJA 1IM8A 1JG3A 5FUBA 3DH0A 5K0JA 2P3OA 4CXMA 5EEGA 3DLCA 4GOLD 3M4XA 5DTRA 3TMAA 1H1DA 3AY0A 3GRZA 3OE4A 3A4TA 3E8SA 2GB4A 3OU7A 4KRGA 5FQNA 1L9KA 3SX0A 3TM4A 3P9IA 3O31A
chains in the Genus database with same CATH superfamily
1PLKA 4QG3A 2P4UA 4LY3A 1XRLA 1UQRA 3NIDB 2FXIA 3TTWA 4R31A 1SHKA 4CKCA 1CRPA 2OFWA 5DV9A 1YB2A 3WWCA 1T8YA 3U6KA 2GCGA 2O0LA 2Z5VA 3QMVA 4JKOA 3GLFA 2OGUA 4I5DA 4M76B 3G5MA 4PHCA 1KQFA 4PYQA 3I2IA 2W6IA 5AUOB 1PN3A 3H1PA 3L7JA 2VF5X 4UEKA 5DI9A 4KQJA 3JXEA 1R88A 1QGED 1H5QA 1QANA 5LXTB 1SUIA 1ZIDA 3ESQA 4P58A 4DMMA 4E5VA 4MUGA 1Q5PA 2Z5LA 5CM9C 4B8YA 1L4LA 2GA8A 1O4VA 2JDID 3FLMA 3I58A 1D1TA 1YZUA 1B8VA 2A78A 1LX7A 4W1SA 3KOOA 1PR9A 4PNHA 3CXRA 4V0NA 1J5PA 2YJZA 3L1VA 3N8NA 4DCCA 1JAYA 3PR2B 4RYDA 1Y89A 3NHYA 4AS2A 1N9KA 3ZQ4A 3R7DA 2L69A 1NSTA 2A4KA 3H4VA 2CK3A 5GQSA 5DEIA 1T13A 2FX2A 2XZDA 2QLNA 4RENA 2Q8PA 4C14A 2D3TA 1E3LA 3AYZB 5THXA 4Q48A 3HZRA 1FTYA 2Z5GA 3BMQA 5T3UA 3OF2A 3GU3A 4DA0A 5EE5B 3TQCA 1DV2A 1NXQA 2BISA 3ILYA 3NHRA 5D3ZA 4YAEA 2JHCA 3ESZA 1PGOA 2MTBA 1QR2A 3HBJA 2R8XA 4W5NA 2EW2A 1J33A 5IH7A 1V6CA 4ND3A 1GVNB 2PGIA 1UPAA 4Y6QA 1BYIA 3PJRA 1SQGA 1OMOA 2HX1A 4Q18A 4O02B 1Z06A 1V4VA 2ZSIA 1UBHS 3ESBA 4O6VA 4B47A 4Y98A 2XAAA 2XIQA 5IJ9A 5JALA 2C61A 4CMJA 1MGPA 3PHIA 4S1WA 3M6IA 3TI7A 2XSZD 2ZIXA 5A05A 4OM8A 1GZDA 2H2FA 3R0QA 3CU5A 5DGIA 4RO0A 5FIUA 1B3BA 3BHIA 4EUFA 1P39A 4LNUA 5REQA 1CYEA 1TLFA 1ZSNA 3BXGA 1U0NA 5IKPA 3NHMA 5KYUA 1NR5A 1WP4A 3ISVA 1O87A 3B3QA 1XDWA 3C24A 3QVGB 1M83A 1UODA 2W9XA 4GWGA 1OTXA 2BF4A 2P7HA 3PPIA 5A6SB 1G42A 4JJ6A 5TPWA 5IS2A 3R2JA 2JLCA 2VTDA 4CLDA 3QXCA 2PUFA 1P8AA 5EHIA 1KQGA 3M5PA 5LC1A 2YBDA 3VTAA 3AUKA 1H23A 5E7QA 3UM9A 3WMFA 4A91A 2B4TO 2FZGA 4GSKA 1RIFA 4C08A 2EG5A 4HWKA 5IK2A 4QUDA 3QU5A 3BE5A 4RPLA 3ZLJA 1QK5A 1GGKA 1J99A 2VLBA 2WJPA 1Q0HA 3PFHA 1JRLA 3PXGA 2D2XA 3R7BA 3A6HA 1AXGA 2BKEA 4OXXA 1XVUA 1PZGA 5CFMA 3RS0A 2IYEA 2QMHA 5MN6A 3KEFA 4LC1A 1C7ZA 1U02A 2JJ8A 4H0CA 4JMLA 3WICA 1GSAA 1MB3A 3ERCA 3NTLA 2C4VA 2AL7A 1P5JA 1RAIA 3QFSA 4NQZA 4OJNA 5GJCA 1RVDA 4YALA 4BQFA 5LZ4A 1UKZA 3HKBB 3LF2A 3B6IA 4NV3A 4BRSA 1DDGA 1E2IA 3QNMA 3N2GB 5LYJB 1GTMA 2QU7A 1J8QA 2Q21A 1NFFA 2C9YA 3WMGA 4W4TA 1Z8NA 2XYVA 1UKAA 1KH2A 2JGKA 421PA 2JGAA 5A4AA 3HYSA 4BNUA 1H1LA 3H7IA 2ON6A 1LQTA 2QTMA 2ZRDA 3O7MA 4Z2YA 2O2GA 4L8WB 3K1TA 3TPFA 2GESA 5AO9A 1IPFA 1L7NA 2Q4OA 1EE1A 1P44A 2G5PA 2J3MA 3O75A 4NBKA 2A0FA 1FYXA 5FOWA 4AY6A 2P91A 3MWDA 3M9LA 1U28C 1ZEJA 2BHRA 1C1YA 3NAGA 1F06A 1GPUA 2ECPA 3VTZA 1B8NA 3L79A 5IFKA 1KZ6A 3OIGA 3T7RA 1PR2A 3BSYA 5JDCC 1N2CA 3OM8A 3ZS8A 2O0KA 1JR3D 3I37X 2WB2A 1PX2A 4Q4LA 4KR0A 5ICCA 2P40A 3GP8A 2AJTA 2GHQA 1W7AA 4M1KA 4CGZA 2JFVA 1I36A 3V7NA 2V59A 2VTEA 3F3SA 2AD5A 1AMUA 2GLXA 1AK1A 1FJXA 2A2ZA 5FOTA 3KKPA 3H87A 4KO8A 2X0DA 4WOCA 3GFOA 4QBTA 2RHRA 3EQZA 5ESWA 1L6RA 3EPLA 1V11A 1Q1EA 1XALA 3DOJA 4QOFA 2J59A 2B98A 4PCLA 3NBQA 4GM1A 2WHEA 4GZMA 2OM6A 1HEYA 3GWZA 3PHGA 2CJYA 2JCYA 3NCHA 3LTNC 3ICEA 4AMYA 5BSTA 1PZEA 3VU9B 4BNXA 5C7LO 2CD7A 2G8NA 3ANNA 2W2OA 3GCGA 3KFVA 3MQ2A 2HRDA 3OJXA 1ARZA 4IIYA 3U17A 4Y2YA 4MQEB 2VH1A 3GH1A 1S9HA 2H08A 2HJHA 2HNKA 3KJZA 1B26A 1USIA 3KUDA 5JVDF 2XX3A 5FUMA 3ZHZA 1YZKA 3NWJA 1I0LA 2HRBA 3QIAA 1YIAA 5KI6A 5LQKA 1FIUA 3B1KA 4BB0A 2Q6TA 3HYNA 4IRMA 2DECA 3D02A 4P4SB 3TG2A 1YZGA 2HB6A 2QBYB 2RHBA 4MMXB 3RQIA 3OZEA 4HO1X 4CLHA 4MZDA 3ZWWA 3K8OE 3NWEA 2ZW9A 1XZEA 2IUTA 4XGQA 4OX9Y 5E6RB 3VPCA 4YAGA 4LGMA 4TT3A 1K2VN 3B52X 4YJ3F 1I6KA 2AVDA 1CW2B 5FR2A 1KZ7B 2PU7A 4DG9A 1EWTA 4BPBA 4Q6BA 4CNBA 1AQIA 1P5FA 2ODAA 2IZ0A 4FOLA 1T6YA 4NECA 3E61A 3CUEF 4KK3A 4NBTA 1FMLA 1ILWA 1POWA 2YNMD 3FVRA 4K28A 3IALA 2ZI3A 3AM4A 1X0VA 4CMEC 4ZV4A 4DR5B 2FPLA 2HSDA 3WP0A 3PDWA 4NIMA 5AI0A 3ZI4A 3DFIA 3EC1A 3PKJA 4RW0A 3TNFA 3VC3A 3ZBPA 2O1EA 3E1SA 4BNHA 5INTA 1E7YA 3H5AA 3IOEA 5J47A 4TYWA 1WMEA 2OORC 1IAQA 1A71A 3JQEA 1USUA 4RDHA 1PDOA 1VL8A 4RVOA 1YDGA 1PTKA 5C1IA 4GXNA 1FQKA 3OIVA 4IRUB 5JNLA 2BEVA 1EFPB 1NV9A 2EKQA 1Z2PX 3DFMA 4RWEA 2ANCA 5G40A 2GCOB 3E2IA 1N57A 1EMDA 1G6Q1 2LKDA 2AEEA 3EQ7A 4N0PA 1GPLA 4IEFB 1BCRA 3HCDA 2PRSA 3A6LA 4B6PA 4C4PA 3O8LA 1M0TA 5DN6A 5BW6B 3TXAA 3GVCA 1GPJA 3THWB 2AMYA 4N5MA 2IV7A 2IFTA 2VDLB 3RRJA 4CM6A 4K0RA 2EJUA 4LQCA 4ND1A 1ZGJA 1OPXA 1G18A 2PQ2A 1KIMA 2WF5A 1ZHHA 3ODGA 4GAEA 5H3CA 4AULA 3LUKA 1PT7A 2J6BA 4V0ME 4W8OA 2IUEA 3IVGA 4B17A 1QG0A 4ICIA 4ZREA 1EJ2A 5TEWA 5KNCD 1FBTA 2HL6A 2YWBA 1NNUA 3TMKA 3C3BA 4OY3A 4Y2QA 4B3DA 4YP7A 5A9TA 2OCBA 3ORFA 4YYZA 1L1FA 2DQYA 4Y2UA 2J0SA 3FSJX 3IMEA 1G5QA 1YZVA 3PZRA 4PQEA 2FPRA 1NVBA 1LWNA 5LMUB 1GILA 2F1JA 1XTUA 1U8AA 3F4KA 1EZ4A 1TZJA 4BAUA 4F6LA 4NR0A 3V1NA 3PLNA 2VNIA 1SKYE 1IE3A 1NIJA 2OBBA 2VP5A 3O6VA 4GUAA 4PYIA 4EUKA 4G1BA 3KALA 4EPVA 2G40A 1JXQA 1JKJB 2VKQA 2XA1A 4FWIB 4C7VA 2JH9A 1JI3A 2OD2A 2XZOA 4HH4A 1GZ4A 1RRMA 3R5SA 1YS1X 1N6OA 3C8MA 4HXGA 4L7VA 4NDZA 4XDHA 5FFFA 5EHGA 3KQOA 4D0LB 1W5AA 2G1AA 4ZOLB 3GD7A 3CPSA 1QH8B 4TZ6A 1MAUA 5C3UA 2A59A 1CZKA 1U0EA 2GRAA 2OT3B 1TYBE 4DWJA 3DCNA 3V2GA 1BMTA 2F4VB 1LSUA 2ZJ2A 1WAMA 4KSBA 3DWGA 2GM9A 4GT1A 4Y0NA 1I7DA 4WZAE 4KLAA 1VFPA 2W70A 1AF7A 1IBCA 4WOBA 1O95A 3FOZA 3OAAD 3T3NA 1E8NA 1U6JA 1PJTA 2C9CA 4Q4JB 1ZFNA 1XVVA 1FNMA 3RUAA 2Z58A 5JZ9A 2B3DA 2TMYA 5DNCA 4NATA 1HSOA 4KX3A 3WJ2A 7MHTA 1DBRA 2O7VA 2FFAA 1N7JA 2QSYA 1YRWA 3BIFA 1QKKA 5GONF 5IKXA 4HAUA 3RRZA 1JI0A 1TM2A 2ZPTX 4E21A 5KEIA 2Q5JA 2JI7A 3EY9A 3LX5A 3V4FA 2XXJA 4MRMA 3W90A 1WPRA 1Z4NA 1I3KA 1OOEA 3WP1B 5JXHA 1C8LA 5EKXA 2HGSA 4ALIA 3TECE 4W5HA 1JDNA 4JL8A 5JE8A 1T5LA 3MSXA 6NULA 1LJ8A 4PSVA 3AC0A 5CXXA 1LDBA 1TM5E 3PHJA 2CMFA 5KZMB 2FFRA 3DC7A 3B48A 4HRXA 3E5RA 5IDYA 5K05A 3EJWA 3TVTA 2IPOA 4O4JF 4DMHA 1NULA 4YT4A 3WOVA 1UBKS 4MW9A 1HPLA 4EG8A 2CCGA 2D8AA 3WGKA 2A5YB 2GPSA 1T4MA 1J9GA 1HFKA 2XVAA 7YASA 3EVFA 2IY7A 2QPAA 3KAQA 1DXOA 2JI4A 2WVJA 1KQNA 2QNRA 3NDPA 3HCRA 5EVCA 4XX1A 1IUNA 3S1LA 4KXNA 2OHOA 5CH8A 2ACVA 3GGPA 2H65A 3LBFA 4KVGA 4R8LA 1FYFA 4NCHA 4NICA 5EWJA 4DA6A 4EF4A 4CQMD 3ZD6A 2FSPA 4Q82A 3V8MA 3SIXA 5CAEA 4CQNA 4TZKA 1O4WA 4BNVA 4F2PA 3FR8A 1XPJA 4YGYA 5H81A 2C7VA 3JQ9C 5G4LA 1HRKA 5EFZA 2ZRQA 4MMYB 1FNCA 4EA6A 1P33A 1XZ8A 4Z1MA 4TMXA 5MFPA 1CNEA 1IY2A 1DIGA 1RM4A 4OPMA 4R84A 4KRXA 4DREA 3WGGA 1PNVA 1VMKA 3SYMA 4IYJA 1NW8A 3AJDA 3M6MD 5AKLA 4ND7A 4DEXA 1CUSA 1RI3A 4L78A 5HQ3B 1F14A 3U4HA 3ONNA 3L84A 3B1FA 4G89A 2JLWA 2MMCA 2AEFA 2B69A 2J0EA 4W1PA 4DOMA 3OJLA 1JHOA 1Z07A 4FOPA 4PHGA 4U39A 4KC0A 3SXUB 4A5OA 1ZUD1 2YC4C 1JNXX 5M5BA 1KI9A 5LU9A 3RSLA 3L8HA 3PQ6A 5FBRB 2I6GA 5EHQA 3HR8A 4OJTA 5I4IA 2GHIA 2IV3A 1AN0A 1U2QA 2RH4A 5JD3A 1Y6FA 5TY0A 5K0FA 4Z1OA 2VTBB 4CEIB 2GFIA 4OG2A 5CJJA 1UJNA 4URWR 1EWRA 3EGCA 3FLEA 4F45A 5K3EA 1YI0A 2EWVA 4Q47A 4FCCA 3CUKA 5AJZA 4DANA 3N05A 2BGNA 2G88A 1PNOA 3A7DA 4KAFA 4MH0R 3A25A 3IT2A 1CF9A 4FFWA 5FP0A 5HOEA 4B3MB 4LF9B 1O9BA 1LS6A 4FEEA 5E4FA 4L8GA 3RDPA 1AGRA 4ITUA 4BTEA 3SS7X 5ALRA 3UN1A 1ZH6A 1HC7A 2QRZA 3ITEA 4CLOB 4ENTA 1Y4SA 1YI1A 3WADA 1HT3A 4Z6KA 1E6EA 3EZLA 4H16A 3PC7A 3TFQA 2P6RA 4EQ6A 5DWQA 1H9CA 2I87A 1AO0A 4WSOA 4OYLA 3AUSA 1RC1A 3B8HA 3F7TA 4H1TA 4IG4A 4KQMA 3N0XA 3SF8A 5JBNA 3RREA 4Y67A 1MABA 1N78A 2YXNA 3CLUC 1WXGA 4IAOA 3PUXA 3GT4A 4U3JB 5IUKC 2HUNA 4DLKA 3L0BA 1FSZA 3B1ZA 4XZ3A 2P3OA 5K0JA 4NPAA 3NG1A 4IQ4A 4B40A 3KV1A 3KXLA 3IXLA 4B7UA 3FMVA 1R8QA 1JDUA 4EAAA 4ZJYA 2EEZA 3OQJA 4PU0A 3RYFA 5DASA 2A5JA 1AS2A 4ALKA 4AW9A 4J0DA 4R4JA 5JPIA 1QQBA 3KQUA 3FCXA 3J80A 1Z5GA 4UNSA 3L82B 3C6QA 1GZUA 1Y8RA 3NIGB 4G8BA 5EQJB 3WAJA 3V4LA 1L5HB 2QORA 3TUJC 1VI2A 3W34A 4TLEA 3TBFA 4P9NA 5ECGC 3T9FA 4F1WA 3N1UA 2CNNA 4M8LA 3UVEA 2HMWA 1G8YA 3UK7A 1I3CA 1K0FA 2QQEA 3A1TA 3Q3VA 5DZSA 3JQFC 1THGA 3ROQA 2ZBFA 1WULS 3V4ZA 4CW7A 3ANLA 4MS1B 3THSA 3KQLA 1EBBA 3A6JA 4W9NC 3ZTTA 4TWBA 4ZDWA 3SZMA 3T7AA 3S7ZA 4IDOA 3I2GA 1XCBA 2W2XA 4E4TA 1KAEA 2M6RA 2PX3A 1Y5MA 1E2GA 2OECA 4MDHA 1V1MA 3DFFA 2RAFA 2ZS9A 2FZ4A 3CNOA 3U7GA 1U0TA 3BFKA 3QY0A 1RAFA 2Z43A 3KEOA 2XDWA 4MROA 3JPYA 3HGTA 5C5EA 4DT1B 5DM2A 3ZLBA 2GVDC 5DIZA 1YJBA 4HWGA 4AJ2A 4Q4CA 4EHNA 3ZS9A 5C80A 3QX3A 4B2PA 4TTPA 3V48A 5TMPA 5TX7A 1MZPA 2JFUA 4K9QA 1DT3A 1SQSA 1SCKA 4CM8A 1WR8A 2F48A 2JL1A 2VQSA 2PDAA 2ZRLA 4RJKA 1L5LA 4BQPA 2GF9A 1K3TA 1QP8A 4FMDB 5F23A 1PD1A 1X1SA 3U80A 3VDQA 1UAAA 3PXBA 3KLMX 5AKKA 4LI0A 5KKNB 1L4EA 4BQQA 2R2GA 1W36D 1NBMA 1HYEA 3A9SA 3HN2A 3L4BA 1DV1A 5DLYA 4Y2GA 3SG0A 5JWOA 1GDTA 5LIRA 3WYFA 2GZ1A 2DT8A 3IDZA 4QRIA 1A04A 2FFQA 2WTBA 1GN9A 5SZIA 4Z4FA 4I4CA 2D59A 4RQUA 5FNZA 1CDDA 1AGNA 1JQ3A 3LRPA 5TEVA 3I8OA 1W1WA 5E7IA 3DLHA 1XCOA 1Z88A 4G0NA 1DFHA 5HDQA 3MPOA 3A2NA 5CFOA 3ZHVA 1A8UA 3F5SA 5EGSA 3PPYA 3NTOA 3T61A 5T3YA 4JLWA 3ZIUA 4B80A 4DSUA 5BV1A 1GCIA 1GKUB 2O8VA 3K8QA 1DB3A 1Y5NA 4N03A 4NNOA 5FYDA 1ZDMA 4YCJA 3RNLA 4JT4A 4RQTA 1IXSB 2YV3A 1KJZA 1FDOA 1PR3A 5HQTA 3WHKA 3T0GA 3GI1A 5K51A 4ND6A 3EVZA 4ZO8A 4XGIA 4AJ9A 3W1EA 4RLQA 1WETA 1STOA 3DWEX 3H75A 3I0ZA 2GK4A 2V9ZA 5D3KA 5KMGA 1A69A 3H6GA 4HYEA 1RHMA 2OENG 3PNBA 1N1DA 3FTDA 3ETDA 5JQWA 2BC9A 4LGVA 2EAUA 3KB2A 3K9FC 4IS3A 1VLMA 1NLYA 1OVMA 2HC9A 2NGRA 4FKBA 2WZBA 4Q7MB 1AXEA 5F7ZA 4GMGA 3R75A 3AILA 3WDLA 4URXR 5HP4A 1CZHA 2GD2A 4BFUA 5C1BA 3GRKA 3JWHA 5CIYA 4BX0A 3PGXA 5ECYA 5FADA 3TWOA 4WZBB 1YQUA 2D5AA 4OJQA 5BNTA 4Q21A 1CC1S 3D0QA 3INRA 1UT8A 2VTKA 3DBOB 4V3BA 1HQYE 3UMGA 2DXIA 4OQDA 4P4LA 4FM9A 3HYTA 5HKBA 3LSTA 3MT7A 1ONBA 5JPDA 3H4MA 3TGPA 5KC9A 1E96A 3DR5A 4ZVLA 2Q1YA 2H1LA 3S55A 2ZUBA 2N75A 1QCYA 1Y3BE 2V0NA 1MJ5A 5JCOC 4TRMA 1X80A 1N7GA 4XB1A 1QFSA 4CV0A 1GLVA 3IPCA 3CT6A 4DLUA 5FPPA 3SZLA 1XKTA 1Q74A 2IP4A 2J45A 3CA8A 4X3CA 3RBVA 4DY6A 1PJ8A 2WU0A 2ZBVA 3EAGA 1RACA 4OK3A 1NRJB 2FV8A 4RWZA 4DLBA 4HZUA 3I8XA 2PZAA 2C00A 2P8JA 1N3BA 3CCBA 1RFGE 2KSQA 2W90A 3ESXA 2ZYGA 3C7TA 4HXFB 1OXVA 1TMGE 1XQ6A 2K4MA 3P52A 1P0CA 4E2WA 4BEWA 2E3JA 5FO0A 5CH3A 4KHZA 2OZKA 4IDPA 1C1XB 1KZGB 3BB1A 2Q5IA 2ZROA 4X5OA 3KPUA 5A9RA 4MJ7A 3HCPA 1F1BA 5C53B 5I7HA 5TDHA 3QKRB 3HP1A 1U3VA 4XX0B 3VYRB 2FTKE 1UIMA 3R23A 5CNIA 3W6PA 1GD1O 3RSSA 3FPAA 4CMCA 4E4RA 4QTYA 2EYUA 4NI5A 3P9NA 2O8DB 3F8SA 2A9KA 2RKWA 4Y8VA 3FW1A 4H31A 3CURA 1OU4A 2OCPA 5HKOA 1EK1A 2XUOA 4N54A 3R09A 3TLKA 1CE8B 3N74A 1KSFX 1FUYB 1KMIY 2YDXA 2IOQA 3I6YA 1I2DA 1B8PA 1V8DA 3VR6H 2Y67A 3L7LA 2X1MA 3R6WA 5FI0B 2FSSA 2ODEA 3PPWA 3IJRA 4B4UA 5CVTA 3VKWA 2HA7A 3EW9A 1X2BA 2AZ4A 4XCXA 2I9KA 2DLNA 2Q2OA 1LF0A 4ZYZA 4MRRA 2HXSA 1YV9A 2X2FA 4DV5B 3W8NA 1ZP6A 5DM1A 2H18A 2PNJA 5D00A 2REXB 3I52A 1T8RA 1OA0A 4PX9A 4NYIQ 4M0FA 4NXMB 3TLGB 1NN3A 3HSYA 2XOXA 2YYSA 1Y9AA 4GQIA 1SH7A 1ZOOA 2GK3A 3QUTA 1A77A 1WW8A 1ZHFA 4WXEA 3W9BA 1E79D 2O7SA 3PHLA 2XJ4A 1F2UB 1M34A 4YAUA 1RE1A 1XEFA 1I1HA 4BX2A 1D8AA 4I50F 5G4KA 2BFMA 4AZTA 3ICOA 4PZZA 1T9GS 2IXFA 2FKAA 3UWSA 4ED9A 1WQ4A 1CJMA 1NXSA 2A1UA 3GMSA 4PSCA 2R6JA 2WJGA 3LKDA 3OP1A 4OBXA 5EHNA 5I9LA 2RK3A 3IO3A 2DHRA 2ZTHA 3PWZA 4L0CA 1XDZA 3UMBA 6REQA 4W5TA 1QP4A 2JLZA 5LDGA 1MV8A 3IMGA 4P3NA 4MV8A 3JQPA 1GZ6A 4C0JA 3K0AA 3F5DA 4NZZA 4B43A 1KF0A 4DCMA 3FPJA 3EIXA 4QTUB 2JCVA 1T6BY 2O5CA 3BAFA 1ZBQA 3CUYA 3EF3A 5CW1A 1ZLXA 3DV9A 5HNKA 4DR4B 1P81A 3NEJA 1HDXA 3S2ZA 1YS4A 5C1OA 5F9HA 1TTPB 4GSLA 2NTJA 4K9SA 3WJ7A 2UKDA 3FETA 1RXCA 4HTFB 4EPYA 2FHPA 1IZ8A 3NT5A 3QUSA 5DT2A 4WH0A 4BRUA 4N47A 3O8CA 4K0KB 2PS9A 3HA3A 3DS8A 4OQNA 2HRZA 3CEHA 2NZVG 2YIMA 3BBPA 5LP6A 2RGBA 1LLQA 4TMWA 3CF4A 5E6UB 5FTWA 3BG5A 1HE5A 3HZHA 5I47A 2OV6A 3N5KA 3P4UA 4HWTA 4MYTA 1M2OA 2ZXFA 3UV6A 5L3QA 1UJ6A 2ZIUB 3GDFA 3HEBA 4DGSA 1CUWA 3ANSA 3ETEA 5EMHA 1A9OA 5EMLA 2IYLD 2ZAYA 2FPPA 3HU2A 1L7DA 2JATA 2VJQA 4HNVA 1P2VA 4LBYA 4ZYUA 2GRJA 2PGXA 1GTVA 4MUHA 3TOZA 2W2PA 4HFMA 2H8GA 5ITZA 3EUFA 1Z2EA 2ASEA 3T5MA 1GU7A 1A27A 5ANRB 3L6DA 1S6YA 4DR1B 4R7TA 3F7MA 4BO8A 3EISA 1MIOB 3UHJA 4KPUA 3PFIA 3C74A 1HEIA 2C7BA 3AW8A 2CDRA 1JQ5A 4JQCA 4PE5B 4WCFA 5KVCA 5KTPA 3RADC 3E8MA 1HR0B 1KK0A 2E0IA 1Q12A 1J4AA 2PX4A 4GYKA 3RIYA 1DIBA 4BVJA 5LQMA 1COWD 3FJ1A 1Y5LA 4U9UA 3GD5A 4ZODA 5J2UF 1W0JA 4RZHA 3TBKA 1Z0SA 2A7XA 3L6UA 2QPLA 1OA1A 1H4SA 5NULA 5JNWA 3CUSA 2QK4A 2BEJA 1V16B 3VYVA 4F9TA 4EAQA 5J2TF 3ES9A 1QOPB 3TUZC 4DJTA 5J58A 4JLMA 1ISRA 1M72A 4DUGD 2E4UA 4X24A 3M2PA 3TQOA 3WIVA 1PL8A 5AW4A 1L4KA 4F3NA 4Q3DA 4OHVA 1DJNA 4X00A 3T1NA 5A4JA 4WLNA 2XCRB 2CV0A 2X77A 2QXUA 4B3SB 4MMZB 3A9CA 5JBQA 1N5DA 4INAA 2QLJA 3H9JA 1II8B 3CTMA 2D0DA 1SBQA 4E5PA 4M7OA 3BJEA 4BP8A 1X94A 1G21E 1TZBA 3GA7A 4GOKA 3MHPA 2H4HA 1UBCA 4KXUA 4XGRA 3U1VA 4TL9A 4X62B 3K53A 2H59A 1GFWA 4XPIB 4EUSA 3IQWA 5JSUA 1MW8X 3TR0A 3DCIA 1DAFA 4BJ1A 4GX1A 3DZGA 4UUMA 5IT5A 2BGWA 1OC4A 4IIJB 2NZYA 2COKA 2O2EA 3QKIA 2F17A 4CMHA 4YUYA 3E9ZA 2DQSA 1BE8A 4BKQA 4X0EA 1UMCA 2XRZA 1YACA 1E3TA 2PMKA 4N6GA 3QE0A 1QF9A 2JC3A 4LEIA 3SC6A 4EFKA 5CH5A 3DMYA 1VPDA 2ZCUA 3DE5X 2H2IA 1L7MA 4BO6A 2AC4A 1M2VA 2QU8A 1T3TA 3O8BA 3E9NA 3OY2A 2J09A 2D5CA 2W2NA 1QH1A 4JP1A 1K7EB 4CL8A 1BO6A 1R7RA 2FVYA 3K9CA 4KN6A 4OKNA 1N32B 4QXOA 4BUZA 5ED4A 3TZBA 1DAGA 1GPNA 3OQNA 3G2OA 3RV3A 1URPA 3R20A 4ASUD 3AH8A 4HEQA 1BDHA 4NNJA 2GZDA 4DMKA 1PS0A 2P9YA 1QIIA 4XIFA 3OOWA 5AW3A 1QRAA 2BEWB 1T10A 5L40A 4FYXA 2XWJI 3MFQA 2HMYB 4G4GA 3GLGA 2ZE8A 3LFUA 4XSGA 5BR4A 1MRNA 4ABTA 1RXUA 3CFYA 4OLAA 2HYIC 2FI1A 2WKQA 4AX8A 4CG1A 4CCSA 2C5LA 5JHHB 1JR6A 3UMFA 2CMHA 4D4KA 4MUBA 4NFLA 5KDOA 4X9XA 3DOEA 1GTSA 2JANA 5H59A 2FZVA 5E0KB 2WIJA 3VOTA 1Y33E 3TCKA 3ZCPA 5I45A 4D82A 2XXAB 4QT0A 4B2IA 3PD0A 2P68A 4PGFA 1WHSB 1ZUHA 4RA9B 4QGHA 4LUCA 1XG5A 2W0SA 1OWPA 1VA4A 2XR1A 4HC4A 5EIWA 4F2WA 3JAWB 3CNBA 1FFWA 2BFAA 4C0KA 5IF3A 4GR4A 4GX0A 4GKAA 2B8JA 3ZGLA 1YRBA 3R3SA 1Y4DE 2F8MA 2V98A 4COOA 1DARA 1Z2AA 2JARA 4NE2A 1PEDA 1ESEA 4TS3A 5J4HA 5G0SA 1NF8A 2IYWA 5AIAA 4LRQA 3V8PA 4XTRA 3ZZMA 1RAAA 1SMKA 2VP4A 1SN7A 3E22A 1M5RA 2PH1A 1TK9A 1ORDA 5BR8B 2PR7A 1NP7A 2QEQA 4OHPA 1CQPA 3HFGA 1CP2A 4NYJR 3VYWA 4N3CA 3NUGA 4WUVA 2XUQA 1DUVG 4M38A 4KSCA 2CJPA 3QVMA 3VSCA 3ZU3A 5GAJA 1QG4A 1TPZA 3NKFA 1XIVA 4YXWA 2VZEA 2BGUA 4HNQA 5C46F 5IU6A 1GNPA 4DARA 3ZLTA 5TR9A 4YI3A 1UXKA 4AUEA 4UQOA 1PT6A 3O4JA 2C3YA 1NAHA 4DM3A 4POOA 2QJOA 1GKYA 4IDBA 5JRDS 4FBLA 3U4MA 1JIIA 5EZQA 5FOSA 2CFCA 2HFJA 4BB9A 2PWPA 1FTQA 1K06A 4UFNA 5BR1A 3OKFA 4R0NA 3A1DA 2HI0A 2LP4Y 3LX8A 2O3SA 4GI7A 4GR5A 2F6RA 2EATA 1E0SA 1VHDA 2G63A 1ZN9A 4EHIA 2I67A 5IWAB 2OHHA 4GEGA 2OKCA 4E09A 5B3KA 3IILA 1P5HA 3O8DA 3PEEA 1JHAA 4HB4A 4IEEA 4ZT6A 4D7AA 1AH2A 4KWHA 2V3CC 5TGDA 1FXSA 1FVHA 3DM5A 1PP4A 4RLHA 3AJAA 3RK0A 3VC1A 3ROPA 5LMNB 2EX4A 3GY0A 4K9DA 4MHOA 2BLNA 1MF7A 3GN2A 4K9KA 3OPXA 4XYLA 1NYRA 3GQBA 2J6CA 4BTLA 1R0SA 1VMEA 1S2DA 3WGQA 4HCJA 3RHSA 1T5SA 4J9UE 3HSSA 4ZDIA 4R1TA 1XEAA 3AU9A 2CHGA 3F2IA 1F7VA 4BASA 4F4JA 4OTZA 3B36A 4EARA 1N2HA 2DWOA 5ABPA 1MPXA 2C99A 3AIMA 2V5VA 1LQUA 5F5NA 1YBMA 3QWHA 4LE1A 3SSAA 2CD9A 3U0VA 1CQIB 1Q1BA 3ZD9A 3IP7A 3MJSA 5U1PA 1N6RA 3VOSA 1GV0A 1K5PA 1NVMB 3R40A 2I6TA 4LF8B 1FUEA 2Q1XA 4YQEA 2ZR0A 3WKCA 4M88A 2H8KA 1BROA 2RH5A 1OH7A 1K9VF 4NV1A 1RYBA 3DMTA 4Y2RA 2AZTA 3CF0A 1TA9A 1OYOA 4G37A 3VGPA 2TECE 4NFSA 1SBNE 4K1XA 3K35A 4ETWA 2HR1A 2QYTA 4PLPA 4UCQA 4C20A 3UJ9A 4O2BF 4D6XA 4MVJF 4ARIA 5H9WA 2HJVA 4YMSA 2O2ZA 3WSWA 4V0QA 1JL3A 1P0MA 2REBA 3FXAA 2IPLA 4H7JA 4N5DA 1A2KC 4DRYA 4BGDA 3VV2A 3E9DA 2IDJA 4Q3CA 2OAEA 4V1CI 4I19A 1FQOA 5FPYA 2MR6A 2ZIZA 3AP2A 1XRSB 4IUDS 1GGHA 4J1SA 4F7DA 4C2TA 4LJKA 3ZWQA 3TF5A 4IIVA 1WMBA 1XN1A 3VJLA 2RI0A 4F6RA 1X7ZA 3QPCA 1TMYA 1YR8A 4COKA 4PIVA 5FUYA 1T2DA 4ND2A 4B46A 4F5DA 1J49A 2FQYA 5KQMA 1TECE 3NALA 3FYUB 1YMUA 3NWPA 3OTWA 3WGIA 3T3DA 2BP7B 2WWRA 1E3MA 3HP7A 5ALJA 2Q3JA 3IQIX 4E7PA 1C4OA 1AX9A 4LYHA 3D6NB 3IR7A 4WXYB 5BSVA 1MR3F 3NB0A 4FLEA 3EZ7A 4BU0A 4CMIB 5M34A 1DAOA 1XTVA 2WM3A 1VL2A 2HSEA 4HNAA 5K2MA 2CLDX 5JSHA 2QZZA 5AHKA 2XNHA 4FE3A 1JLSA 4YJ2B 1DEAA 3AESA 1GTL1 4GGOA 4MPPA 4N49A 4PN7A 3K16A 4EUEA 1NYQA 4YRIA 3REFA 2QX7A 3HVRA 1POXA 3ZDZB 5F51A 2Y4OA 3A1FA 2HEGA 1BYUA 1LBQA 2VZ9A 1Y7LA 4P38A 5CX1A 5JVDA 5DNYB 1LKZA 1ZW1A 1OZGA 3MD9A 4I99A 5JMTA 3VO1A 3W6ZA 3KLNA 4YRDA 3KXKA 3OFND 2DM6A 2IEGA 1GIAA 3UMRA 3WKBA 1ISMA 3S29A 4R3NA 3SGLA 1WXIA 1GSHA 1N1MA 1QO0D 1UBNA 3C3KA 1SU4A 3B3AA 2SKDA 3FTPA 3N0WA 5IW8A 1FFXA 3ROMA 1ISHA 4Z53A 1WW2A 4XGNA 3GMTA 3KKZA 2CY0A 2OYCA 3STHA 1QYXA 3HJFA 2WA1A 4BZQA 1AURA 4YJ3A 5ENVA 1K8YB 1Q6ZA 3LQFA 1FTNA 4UJ5A 1IC6A 3ZXYA 2WMOB 4G1EB 5JPCA 4XWWA 3HXOA 2O8EB 2OK7A 3NDJA 2VP9A 4IXDA 4RK7A 3M1YA 1NJSA 1W581 3NETA 2ZIAA 2SCUA 5E1DA 1W36B 3LD9A 1VCMA 1JSLA 3WGUA 2O5EA 3HV2A 3DTVB 1V7ZA 1PDVA 2WDPA 3PP8A 4NONA 5IBQA 5LR6A 2GERA 5LWQA 4P08A 3AHDA 3AY7A 4MS3B 4MWZA 5D5PA 4ZVPA 1GAXA 5H7XA 3K9QO 3V8VA 3I42A 3WWZA 2H00A 4YC7A 4UNPA 4WXMA 5JLAA 5HFAA 1UC8A 4ARAA 1OAAA 2OE2A 3QBTA 2DBZA 1GGJA 1RJGA 2QQFA 2Z2JA 5JBIA 1I33A 4P6VF 3RS5A 1D1QA 3ZCXA 2WD7B 1JQEA 3WIOA 5BWLA 3DVLA 2R1UA 3EGWA 3VDNB 3W5BA 2XDQB 4KBYA 4FNGA 2CT8A 3CPJB 1JE0A 3LPLA 2FXVA 3B13B 2QT9A 5T5QA 1GITA 5ARDA 1YUNA 4A92A 5JS2A 2DFVA 5C51B 5B3JC 1B1CA 2QUZA 4KQGA 4DXHA 4EY6A 4L0DA 4WAUA 1ZHOA 1X1RA 2QRJA 3STWA 3I28A 1DX9A 3STTA 1E20A 1AUVA 1DG1G 3FYUC 4H1VA 4JODA 1RDFA 1Z62A 1VGRA 2IPAB 4MRNA 1YR2A 3HWWA 4XDZA 4RJLA 3RJMA 2Q9UA 3U1BA 4X20B 2F8LA 1L5ZA 1GGMA 2BD0A 2BTQA 2ZLBA 4D9BA 3I2FA 2M32A 1ECJA 1UXHA 3JQDA 1CUYA 5B3AA 4WLOA 1J2YA 3WLEA 3K0FB 3TG8A 4OKIA 1O94D 3TRIA 4DB2A 1PWHA 2ZDQA 3NBKA 5F64A 2FUNB 1GM5A 3OFVA 4JQYA 2C3PA 2GXAA 5AKYA 4RMHA 4TWJA 4YIKA 4ZAZA 4E3ZA 4WJLA 1Y3DE 1DOZA 4KFTA 3H3FA 2QL9A 2XOKA 1XYVA 3JYHA 1FFGA 2BSAA 4BWGA 4OH7A 1X38A 5AVZA 3GLIB 2YHBA 3E2PA 5FOXA 3BXEA 1CEEA 1KVQA 1ESZA 1G6KA 2FZWA 1A0OA 2I22A 3AUYA 1NYLA 3OWOA 4IGAA 5GP1A 4A0QA 1YA6A 3O84A 4ZQBA 4V0MA 3UGJA 1JQLB 1HG0A 1TO1E 1I3LA 1TD1A 2EOAA 2ZVJA 4HF7A 5EJIA 1DMSA 3OCXA 5DISB 5K5EA 2JGNA 1UBUS 2TS1A 4B7ZA 2B0CA 1I5OA 2FFHA 2XCQA 1GPDG 1YI8A 3NIWA 2Q1TA 4GC9A 1AUPA 5AJTA 2OZLB 2NSLA 2R86A 5BUQA 3P9PA 3WGJA 3BRQA 4TRRA 2WIDA 3HNPA 5CT9A 4CM9D 5C3MA 2ZRPA 1XJQA 1Y8AA 2VHEA 1XU4A 1AV7A 1E3JA 4P33A 1HE3A 2NZ8A 3TTTA 1W36C 3IT0A 4PPQA 1BDBA 1LLUA 1TVKA 3TLGA 2M1XA 3AVYA 1TCAA 1IDN1 3OBIA 4JBIA 5IUNC 2OXTA 4F92B 3CH5A 4IDFA 4AZ3A 1C1DA 3KO8A 1JFFA 4QGSA 2ZYVX 4IOLA 2P4EA 4CETA 3G6KA 4FWBA 1Y63A 4A2CA 4BQEA 3AR6A 4ON9A 4TXJA 2IYSA 5GONA 1V1RB 3WLNA 3KJFA 4FOSA 4G3XA 5HW0A 5CM2Z 4LHVA 4IDQA 1BMDA 2XCUA 3RROA 3WIEA 3R9IA 4HLNA 3W4IA 4BLWA 2PZKA 2WMNB 4LZJA 4PO1A 4ZWNA 4F84A 1E4YA 3F6BX 3C4QA 2PL9A 4NZNA 2JBAB 3M4ZA 2L82A 3WGHA 4E51A 4D3DA 2IY8A 1GCGA 3OZAA 4BO5A 3R6DA 1TU4A 4UM9D 1WSBA 4ABYA 5J3JA 1R9MA 3A6ZA 4NJEA 4OGFA 3TSCA 5FHRA 1AN9A 4UXHA 1IK6A 3HLYA 3UKDA 1F2DA 3AEKB 8ATCA 3VPDA 3VYTB 5AXAA 3CNLA 2QN2A 4QREA 3I83A 4D8YA 1Y5RA 1U7WA 3UWDA 2I03A 2GH1A 4MI6A 3ZZ0A 2XEXA 1LH0A 2RMKA 1U0BB 4B0OA 4O4JA 2GAOA 2J0UA 1X8JA 1XGKA 1KJ8A 1ML3A 3SC2A 4BO4A 4EYEA 1AQNA 4N4AA 1SC1A 3F96A 3AEXA 4A8JA 4YHHB 1PSDA 5L3VA 3E18A 3AHFA 1II0A 2BGJA 4UVIA 4RMNA 2BRUA 3DJFA 4NS4A 4A8PA 1KK2A 4V24A 1L8AA 3MB8A 2JLXA 1EVIA 2IF2A 3KJXA 5IANA 2VPIA 4NF2A 1U98A 2XQJA 3A1WA 3H9GA 1HUQA 2GEDA 3A1UA 3CXUA 1VRCA 3HY6A 4CIYA 3G2PA 2JEZA 3FTNA 4U2CA 3SHVA 5AW0A 1VB5A 3WGLA 2VTVA 4PAWA 4YTEA 3TAUA 3R5KA 5A2QA 3CYFA 2R751 4Z3OA 4I9UA 4M1TA 3W3AH 3UNXA 1X87A 1Z0AA 3JAKB 1W93A 1WV0A 3RODA 3NHJA 1AB6A 3ZHXA 1N1GA 3TNDA 5ALVA 1E1MA 2FYTA 1ZH2A 1R18A 4RDXA 2DWUA 4G9GA 4V03A 3RAJA 1AHPA 2QYOA 1ZMTA 3QEBZ 2OHFA 3FYHA 4YMLA 3PTAA 5GTDA 4A6XA 3ZGOA 2JJMA 1IHYA 1C2YA 2P2GA 1GTZA 4RA6B 3LJKA 3TL3A 1JMYA 2XYRA 4F3YA 5CCXA 4KZKA 1GG9A 1MGOA 5TQ0A 4FDMA 3EBOA 1CJVC 2LPMA 1ZO8A 2C5EA 3E1GA 3A3YA 4YFYA 2QR3A 5FNVB 3B78A 4CBVA 5KX5F 1VC2A 3DLBA 1H2ZA 4Q4HA 2FWIA 4LXYA 4MW4A 4Q9HA 1KKUA 4D81A 1E63A 2WOOA 2IZOA 1JEYA 1JIUA 1ACMA 1RQGA 4D43A 1XTTA 3D81A 1IHXA 1VBFA 4RJJA 3R7FA 2NX2A 2WWVD 3RH0A 4D79A 4MO9A 4DYHA 2R7NA 1GL6A 2XGGA 3UJ3X 4BAZA 4ENQA 3OQOA 2J30A 2VT3A 3TK1A 3QUAA 3TS1A 4E5UA 5IAAA 4LPSA 3SU8A 4YP1A 3ZVMA 4DTCA 1NM5A 4H1HA 1PHPA 4HN2A 3G13A 4II3A 4ZU1X 3L0CA 3CX3A 4MQ6A 3BX1A 4Z5XA 2IZ7A 4D8TA 4H1WA 2QM8A 4DLSA 2QGFA 4MJLA 1MG0A 4KLCA 3U7JA 5JC8A 2I29A 2JHFA 3F71A 5BMVB 4HATA 3OEHD 1JA9A 1DC4A 1W2WB 2IJGX 2VBGA 1C3OB 1BA3A 3IVRA 4LJ7A 1ONNA 4LYAA 5A2GA 4IMIB 1OY1A 1GUDA 2P2CA 5KREA 2B92A 3D1LA 3K1ZA 3F6EX 4MKRA 3N28A 4LGCA 5KHAA 2WI8A 2YZ7A 1T4DA 1NQ5A 1OWLA 4LOJA 3MTAA 1BE0A 1CR1A 3I12A 3PFBA 3QOWA 3QITA 2I62A 4BMYA 4LDRA 1NBIA 4MV1A 4JU8A 1M8PA 3QPWA 1PR0A 1CUEA 4XCQA 2NSYA 3ZQJA 1UBLS 1P80A 2ZRHA 3A2LA 4KGZA 2DLCX 4JVLA 1OT5A 4WNCA 4HDCA 4PTYA 4Q9IA 1QHYA 3UICA 1JTVA 4D9IA 5EC8A 3KOZA 3COSA 5CBKA 2OBFA 4PO9A 4KODA 3BORA 1JEEA 2NU7B 3H2SA 4MHSA 3GNTA 5LP6F 3JD0A 5LZ5A 1DI0A 1XR3A 3ZWAA 3QH4A 4TKVB 2Q1WA 1XXHA 2G71A 3D3QA 1YAJA 4TLDA 3FPGA 3DEFA 1ZX1A 1GT91 3TO5A 1QYWA 5BORA 5KUTA 2EP5A 3MJHA 2YY7A 1SEPA 2VKTA 3IVMA 3EZYA 5GV7A 5LBUA 2CLLB 5CHYA 1UFQA 2ZR7A 1P2BA 3C3YA 1T4BA 3AI3A 4YEDA 1AKWA 4E07A 4ZYVA 3EUWA 3K4PA 4W8GA 4YUAA 1CD5A 3BB4A 2JGRA 4Y2TA 4YT8A 2C77A 2I2CA 4OP1A 2FWAA 3AKDA 4WD3A 4YDQA 1U81A 3GUHA 5LWHA 1KO4A 2PUCA 4TN1A 1SUDA 2AXQA 3I1FA 3D9QX 5D5QA 4LSGA 5EFOA 3S2FA 4EG7A 3KXPA 4AIIA 2P3SA 3ABQB 1M6NA 4N5NA 1DAKA 4QYIB 3OPYB 1PU2A 1NJFA 4BUJA 5BRAA 4V1CB 2Q5LA 4M9XA 4PSKA 1IXKA 1HQKA 4IY1A 1JXMA 4MQFB 3ZVLA 2EKBA 1XEXB 3IVAA 1GUZA 4JB0A 3DFZA 4KACA 1ZM9A 1KZYC 2FMUA 3RVDA 3K05A 4EGFA 2G7ZA 1NBOA 2K2QB 4YPVA 1I4LD 3LYHA 1D7OA 3E70C 4XQCA 4BLVA 4HYYA 3OQHA 2XT6A 4JITA 1PKEA 1OWMA 5AUPB 1RYMA 1BDMA 1ZICA 2XA9A 2DQ4A 4GBGA 4PCAA 4W7HA 4PC3A 4RUKA 2G5CA 4WCDA 2EYQA 3FOCA 4R83A 2CC2A 5HEKA 4KFSA 3IURA 4RF5A 1CYDA 3FKSA 4O4HF 5KTOA 2JJ1D 2PKRA 3IBSA 2ODWA 2OP0A 3GV0A 4NBUA 4LXTA 4U7FA 1WZCA 2Z2ZA 2XUHA 1NVTA 1W4AA 2Z57A 2D7DA 3DSRA 5CFPA 1WVIA 2PO5A 1BDIA 1CLEA 1JLMA 1PJLA 2I1WA 1XTZA 1ZW6A 2YV4A 1JHYA 1YRLA 1QMPA 4ISCA 5MGBA 3EK2A 2EZ4A 2KBEA 2QA5A 3GDOA 3FPKA 4Q3AA 2H92A 1YUMA 1XCLA 3D1JA 2QPTA 4E03A 3OHPA 3QF4B 3E9CA 3U3JA 1KWGA 1P7ZA 1I4DD 3ASYA 4U6QA 4RORA 4MW1A 5E4JA 1YBFA 2IWHA 1QKJA 4TWRA 2ZZKA 3OLCX 4DCPA 1GZVA 3WTBA 1KOJA 3NKLA 1KEPA 2FK7A 1SXJD 3AR4A 1V2GA 3CLTD 1L7BA 1ZAYA 4JJEA 4JB2A 2PU5A 1ZEMA 4M60A 4NDAA 1Z08A 5JARA 1TC1A 1NWCA 4UEWA 1N5JA 2CXHA 4OMCA 4PHTA 1S8OA 5KTKA 13PKA 1JDSA 1JT9A 1YVUA 1JN0A 2V6BA 1LBHA 3FJOA 4WESA 3RASA 3S1AB 4FDAA 4YMTA 2G09A 2LWIA 3U81A 1FYVA 4IH4A 2FSVA 1A72A 2ODTX 2D54A 1P72A 2VG8A 4J0EA 4C6HA 4R69A 3ONDA 3P9QA 4RHEA 1AUOA 2H7YA 2QVXX 1YWGO 4F9GA 3DL0A 3JVDA 1C2TA 4TYPA 4TLMB 5EP3A 3A6GA 3OECA 3UYKA 4DXAA 4ZEVA 5I9TA 1F5SA 1PWXA 4EF6A 1VG1A 2OBLA 3B38A 3EDRA 3HJRA 3NM4A 1VHJA 4BFXA 4C4SA 4GKKB 4ZVUA 1C0PA 1E4EA 1S96A 4O2LA 4P31A 4X1YB 1QX4A 4YWJA 2O7QA 1UEIA 3U44B 1GFZA 5F33A 3U3XA 1W48A 4JI4B 2W2KB 3ZYCA 1WY5A 3QBVA 1VHLA 5KOJA 2GVZC 3TSOA 1JFVA 2HXGA 2PR2A 2WIGA 3CZPA 5EWMA 5CK4A 2FN9A 2VUUA 5ICSA 1JLKA 7MDHA 5A5DA 1PNRA 5BUZA 4DDWA 2DBRA 5EINA 3IE1A 4B3TB 4M0UA 5LXTF 1IBSA 1KFEB 1Z29A 2HIGA 3HDJA 2VH5R 4EK9A 2UUOA 3S68A 4J7XA 3ETGA 1TVCA 3E7WA 1Z4PX 2WKSA 3N0TA 3PZBA 3WZ2A 1YR6A 3CF6R 4BMVA 5DCLA 3V8NA 3WQQA 4F6CA 3D6VA 2EFEB 1E3IA 2CFSA 4U7PB 2QPOA 3R3YA 4JHXA 1SHUX 4R40A 1E0JA 4UQPA 5CPFA 1YDMA 8GPBA 1UQUA 1YC2A 2IZ5A 4R7ZA 1OQAA 3FCSB 3TIIA 4NE7A 3NAZA 3EXHB 3FVQA 3L0YA 5JC1A 1DOAA 1WUKS 4JZYA 3PHBE 2Q9AA 1RBQA 3PI6A 4L4ZA 5A4DA 1G3IA 4C22A 2P2SA 2QTVA 3K5IA 2HN9A 3WO0A 4OHWA 4ALJA 5ALOA 1YD7A 2QAGA 1NW9B 1R16A 1X13A 4ZAGA 4YO7A 4PNPA 1LSSA 2KLHA 2ID7A 5J4LA 1ORVA 4PZLA 4QDXA 4KOEC 1JG6A 3NTQA 2OGWA 3QW4B 1YU9A 1CRZA 5LB2A 2NPFA 4X65B 1T4CA 5HJEA 4JBGA 5L3ZA 1WB9A 3L7MA 2B6NA 4JGBA 2FMXA 3SZ3A 2UV8A 3KOMA 2Y93A 2N1MA 2PKCA 2OVFA 2VP3A 3QEKA 4BKOA 4NJMB 4WX2B 2QRUA 1EESA 5AVOA 3T4EA 1VSQA 3RK4A 1JAIA 4M8NE 3S8EA 1XZHA 2XMRA 1WP9A 1JSXA 1W4BA 4KMOA 1XMJA 3B2QA 2XKJE 4YX9A 3KZKA 3CZCA 3X1WA 1M7GA 2ISQA 1NXXA 1J0CA 2IZ6A 1W5BA 1Z74A 5D1NA 4ZCRA 1PEYA 2BKVA 4RTSA 1VSBA 4HGQA 3UPUA 3L5OA 4HNHA 5FOUA 4EO4A 2C03A 1P0IA 3SXJA 4OHKA 2DKOA 3N7UA 3EH1A 2QLTA 3AWDA 4FFLA 1FVXA 4PX2A 4ESVA 4I50A 5BRJA 2RARA 5K0EA 1JEAA 2ZB4A 1DO2A 1Z0FA 5K6AC 2I2AA 2GFQA 4WJZA 1ST2A 1GR0A 3W79A 3ZXUB 4FKMA 1G3QA 4LJLA 3CTPA 5J1TB 1SD5A 3KSZO 2EKPA 3SPXA 4URYR 1PUJA 2FVXA 5E1OA 1C14A 2W2QA 2PX5A 1OR8A 1KIFA 4REQA 3G8YA 3T7DA 3MK31 1EWYA 1A7AA 3VNRA 4DIFA 3RWMB 2CNDA 1X7DA 1JKFA 3QFTA 1E59A 2OL4A 1QHGA 4QU8A 1A9PA 5CDUA 2ZS8A 2IHJA 4WJKB 3WLFA 1D2CA 2C1EA 4A7PA 3P9KA 2AC7A 5AI6A 1DQYA 4US0R 3C85A 3DGEC 5CLJA 1V6SA 2CJWA 3I92A 1K5DA 1NYTA 4P5PA 2XA2A 4X1KA 1J8FA 1SCBA 3GWGA 4B6GA 4WLUA 3Q8KA 3BM5A 2FPUA 4U7WA 2FWJA 5LA6A 3MJEA 3HFRA 2J3HA 4NBWA 1E1CB 4B3FX 3G5TA 3ZY2A 4CL2A 4R51A 2RCNA 2KJQA 1KP2A 4HGZA 1SHLA 3KZOA 1ISFA 3ST7A 1O54A 1PL0A 4A6PA 3EPHA 1T43A 3LYLA 3V7FA 2HZBA 5LYJF 5BNFA 3DQQA 3O9VA 2OFOA 1OXKB 2R00C 3BHJA 4JUCA 1YRAA 1XCPA 1D0VA 1VYVA 2O2SA 4MIKA 4QATA 1AK9A 3UY4A 1YTUA 2G6TA 1EK6A 2I4RA 2QP3A 3EGDA 1USGA 2ISCA 2GF0A 1NIPA 3VO2A 4BFSA 1CHDA 1FFDA 1U7OA 2VSYA 4GPTA 4TMVA 5EJ5A 3UF0A 2IHUA 1J7KA 1GPBA 4N3GA 5DBGA 4E4YA 2C7RA 4IKPA 3WV4A 2Q46A 2CWDA 4JDUA 4AO7A 4G41A 2IXBA 3IBCA 1JSCA 3M33A 5E9WA 5SY6A 5TQVA 3SHTA 3LC1O 1QOQB 5K8UA 4MHTA 1HNWB 1KY4A 1I10A 2J9FA 2IXDA 3FYDA 2EFYA 3U7RA 4EKGA 4DZRA 1RHJA 2E5WA 1YB5A 5J2UA 2Q3EA 1DWOA 1SCDA 3F8TA 3K9BA 3M83A 4CQLA 4NYJQ 5EXEA 4DQDA 4QEZA 4YXFA 5JH7B 4AYTA 3NHUA 5BW5A 1KDTA 1EP2B 2DWPA 5J2TA 1DTWA 1EXNA 2RGEA 3DL4A 4FEAA 2Y6VA 3T4XA 4DCUA 3ZHTA 2HW8A 4TSKA 4S2EA 4BXOB 3CN9A 3VKFA 4EB6B 1SBTA 2QT1A 4G0UA 4M49A 4FS3A 1ZK2A 1R5OA 2DHDA 2GN1A 3CCCA 1JNYA 3ZN2A 1JQJC 5I7VA 2XNDA 3FNBA 2Y1WA 3I2KA 1OCEA 3ZI7A 1L1QA 4D98A 3REQB 5CFNA 4YCCA 1ODTC 4Y9RA 1J21A 2HK6A 1G8MA 4UVHA 5HBGA 3RKRA 4DBLC 5DXAA 1VSUA 2FQQA 4TMZA 3ZV6A 1BX1A 4JUDX 1QAOA 1QZTA 2PKXA 4U2BA 3ADCA 1REQB 4DR6B 2EGUA 1Z6XA 1LDYA 1TLLA 2Q0XA 1NVDA 1QIEA 3H3JA 4HVLA 1UBFA 1UPXA 3ET4A 3AU8A 3IAEA 4NAHA 3ZE7A 1EVZA 1PR6A 4C01A 1FUUA 5C34B 3T1VA 2P9ZA 2Q6OA 3W3AD 4M1QA 1SUSA 2WU8A 4PX5A 2ZCJA 1QHHA 5ALXA 1SKUA 3I32A 4YV1A 4PZPA 2WWIA 1XLTC 3IV7A 1E1QA 3KR1A 4JC5A 4N01A 1BS2A 1N0WA 3IDAA 4GKVA 1MHTA 1O89A 5GINE 2BFFA 3NXKA 3ZWCA 1SOMA 1JFRA 5CT8A 3EXIA 1PL7A 1UP6A 4Z8YA 5EYPA 3E35A 3ED5A 4IXWA 3TLBA 1RYDA 2AXPA 2JLBA 4UMVA 2WICA 4F4IA 1Y7PA 4P0TA 4QBFA 5EZ5A 3IAHA 1NMEA 5CP8A 3TFWA 3GLTA 4G1MB 2B6HA 4DB4A 4JLOA 2AMLA 4HGNA 4MR8A 1UM9A 1BJTA 1WX1A 1ESMA 2C5SA 3JWPA 3VMMA 4BBPA 3KDAA 1B2LA 1NBEA 2PS3A 2C9BA 2R6CA 4Z4QA 4BZZA 4EJMA 3LYUA 3K0HA 1W85A 2JKZA 2WFMA 3PUKA 2C1ZA 2GCIA 5JU6A 3RT1A 3LUCA 1GCUA 3A0UA 3BD6A 3MMPA 4S35A 3X1MA 4EQZA 5EP1A 5CEJA 1D2AA 2X5KO 3EDOA 5ILQA 4AKTA 2OBXA 4BVKA 1BHJA 2ID4A 3R41A 4L0QA 1WXWA 1DEOA 4ZIRA 2IHNA 1WDMA 1QORA 4JOBA 1G5PA 2PT9A 4O25A 5BN4B 2WU3A 1N6PA 2DR3A 1OHHD 5DX8A 1KVSA 4DG8A 4UM9B 2CWWA 1YFZA 3B3FA 2QHXA 5JMWA 5IYZF 2AG8A 2WM8A 3OT1A 3MA0A 2Y1DA 1EFVB 3TNYA 4MUMA 4RPJA 4ZCSA 3SVZA 4OU5A 3C6MA 3ICQB 3KZ1E 2QVZX 3NRJA 3GIWA 1S0UA 2GZHA 4H0FA 3HY4A 1XQ9A 3B6MA 5IZCC 2RK6A 3I5YA 1BXGB 4ZYTA 4XARA 1LNQA 3BZWA 3BGVA 3CH7A 2FETA 3L40A 1EFRA 3LK7A 3TXYA 1PZHA 2FUEA 2B7CA 4NENB 2AVNA 3I8SA 1GOTA 5LZ8A 3KTAB 3AV0B 2FX5A 3IJEB 1QRSA 4JVNA 3VO9A 2BWJA 2X4LA 4R2LA 1C5KA 3LA8A 2NVUB 2VYVD 3NMUF 3R9XB 5F3DA 1TGVA 1GYRA 1S1MA 4YRJA 4AWBA 4MUXA 3FCUB 5F78A 2G9UA 4IDEA 3WK4A 1O94C 1S7GA 2J6IA 1G20E 2OPBA 3D6HA 1SAYA 5A3SA 1NQXA 4NESA 3ROGA 2ZJ4A 3DTNA 1GNTA 2GHTA 2QN1A 5T4FA 4DEVA 2CK3D 1N6NA 1OW3B 2Y6UA 1PJAA 4W6QA 4TSRA 4ZI7B 1GJRA 2G4VA 4AU1A 1ESCA 2IUFA 1QFYA 4EG4A 1EYZA 1ZVJA 5C1PA 2DOKA 2ES4A 3M1AA 3MJDA 2PZJA 1ZAKA 2G5GX 2CDBA 2P90A 3NHPA 4UXJA 4E1AA 1R6BX 2ONKA 2DEUA 4HMOA 4KJXA 3FNEA 2PD4A 2EARA 4L85A 4RACA 1MUUA 4ZOLF 3U9SA 1B15A 5BV7A 1R4MA 1JIXA 3F5FA 4KN8A 1YRHA 2X2EA 3ZBQA 2C7QA 1TJ3A 4M87A 3ZGYA 1RZRA 4DLLA 5LQSA 4JAVC 5LB4A 3SJZA 5H5JA 3VR5A 3F8WA 4PM4A 1PSZA 4ALNA 1QE0A 3DV2A 4HNSA 1XZKA 1U04A 3L6EA 4OFZA 3A3PA 3I3OA 2VR1A 4H0NA 1L5YA 4FC7A 2MSNA 3PXEA 5AVRA 5FHQA 1LB1B 3JQ8A 4B3HA 6GPBA 1DFIA 1RQXA 2FPMA 2WFLB 3PG5A 3OZXA 2UVPB 2Y66A 3QFFA 5COQA 2ZRFA 3E03A 4YMIA 3RHFA 2YIDA 4L27A 3B12A 5B36A 2JAOA 5F1PA 5I3ZA 3TJRA 1JAHA 1AKQA 2PO7A 3L0IB 1KDYA 3ZDFA 4EI7A 3MB5A 5DLQC 3G89A 3LXXA 4RMGA 3GGSA 2GBLA 3HCWA 5FBHA 4D26A 4MPTA 3C1TA 4IUBS 1P17A 2BKXA 4Y6LA 5E9QA 1AV6A 3CKKA 2Q2QA 3TEFA 3LHIA 1XL0A 3G8AA 2YJ4A 1G0NA 3S5JA 1NI4B 2BELA 2R3SA 3M6VA 3R3HA 5G1PA 4X1IA 2Z6VA 3WGOA 2MSDB 1ORTA 1LY1A 4GGMX 5K3BA 5EIOA 1E2PA 2HBQA 1Y82A 2WMDA 5E7JA 2GMWA 3A32A 1HDGO 4UTZA 1MJHA 3FPHA 4UUPA 5A02A 3TL6A 4EM6A 2XUIA 4O2BA 4MVJA 4DSAA 1W6UA 2FEMA 2Z95A 1FYEA 1ECBA 2JW5A 2LRHA 3FUXA 4KBGA 4WUTA 1ZN8A 2JFYA 3BIOA 5IK2D 2AFIB 3E3NA 3V1LA 4CUJA 1JPNA 4G0ZA 4E5NA 4W7SA 5F2OA 4NU8X 1HTWA 3DBHA 2G80A 1RYFA 3ZV7A 5K03A 3AOEA 4MV0A 3JQGB 1IN4A 1DJLA 1UWVA 2OCDA 5AMXA 3F9CA 1SCUB 2VRCA 1U99A 3AKZA 1GV1A 4D42A 3NFRA 5DSZA 1IBMB 1J1IA 3EVTA 4TVOA 5BNIA 1RD4A 2E37A 3B82A 4DJFC 1I7QB 2O8BA 4FPXA 3BILA 2P9JA 3F1KA 1V8ZA 2P6MA 1X7XB 1ZRSA 3AEQA 3IA2A 3KV3O 3LWZA 3N76A 5EEHA 1G8JA 1QG6A 1DJPA 2CXRA 3CB4A 1N5MA 4LF4B 3DZBA 1ZUIA 2VUSA 4JYAB 3MSCA 2CEAA 3NHKA 3HXKA 4D5GA 5L8VA 2CBXA 4CWAA 1RWQA 2XWBF 2PQ6A 2OXRA 3I6QA 3IIIA 4FZJA 3EXEA 3NHSA 3TZHA 1RXEA 4MWCA 1G19A 1PX0A 1KAOA 2X14A 2EJCA 4FFRA 4MJ3A 4BVFA 3T3OA 3MS2A 4PPFA 4FYVA 3EVDA 4RQBA 2RGNC 1IPHA 4C89A 4R0MA 4C3UA 4J0IA 3BK1A 4G4JA 5AJHA 3ZUPA 3IE0A 2YMMA 5TJ9A 3OQ6A 1JG7A 2VJPA 4LSWA 5ALEA 3QXHA 5BN5A 5BVHA 3UOGA 3QW2A 1EB8A 5IEBA 2AF3C 1QMGA 1BSVA 2GS9A 3NUQA 3RIHA 3TKLA 3RAPR 4EGQA 5C2JB 1XZAA 3VISA 1KPGA 2BIFA 1EGHA 4DCTA 3DPSA 3SX4A 4ZAFA 3GJTA 1IHDA 3N6RA 1Z75A 3G2QA 3PGVA 4G0YA 1B41A 2XMGA 3KQWA 1O9GA 5G0UA 2C3MA 3MRTA 3T5CA 3EVBA 2AFHA 4D41A 2ZQ5A 5FOQA 5HZKA 1JXAA 4FW9A 4NCKA 1NFRA 4DBVO 4JGGA 5D7NA 2CVQA 2E18A 4LZOA 5ERYA 2HBRA 4EI2A 1DC5A 2VT2A 5GM2A 3N8KA 3L02A 4XE5A 4ZCLA 4IWXA 4N0EA 3V2HA 2FMHA 2PX2A 2PMDA 2Z4RA 3CB2A 2HHAA 2ZAMA 1QWOA 3EXFA 4GMHA 4H08A 4ROTA 3TR6A 3UG6A 5KBYA 1KFBB 1QS0B 4M9SA 4C2AA 2HJ9A 4LDJA 3K09C 4R8VA 4YRSA 2YR0A 2VCHA 3CT4A 4KRFA 1ZUNB 2PUWA 4C87A 3PUIA 1DSSG 2MINB 1KQPA 1K7XB 3MGAA 1H8EA 1LA2A 3VU1A 2IYUA 2DUWA 2QAJA 2EZUA 2QUIA 2BSQA 1H69A 1A4UA 1IN7A 2HK8A 2HIHA 2YXBA 3GLKA 3OJOA 4S12A 2F59A 3UAVA 3CWQA 3L0DA 1SXJB 2Z4TA 3A4MA 3DLCA 4GOLD 3RBAA 2IHBA 3STXA 2O8CB 4NMWA 1WD5A 3OE1A 3V00A 4BDTA 2E48A 4IWNA 5AI9A 5LZ2A 2J3JA 1R8XA 1Z4LA 1RS0A 1WMAA 3LGAA 5A3VA 1APBA 1Q3KA 1EXVA 2EFDB 3QKSB 2WWTA 1CVRA 4WNYA 1T2EA 3RVJA 4RYLA 3GP3A 3AVOA 3HR7A 3EG5A 3LH5A 1CUCA 1NUPA 1CY4A 4URHA 1KC3A 5BP7A 5JZOA 3M0EA 5KYTA 1Y98A 2Z8YM 3CZ5A 1F8GA 4ZHQF 4AVYA 1WA5A 3JASA 2ZVQX 3QVTA 4HMQA 5HFJA 5A3QA 5K01A 2JH8A 3ZV5A 3TJMA 1AKRA 3IRUA 4A6EA 4ER0A 2ZT7A 1H8HA 4RHTA 2P9FA 3N2YA 4MB0A 1Z6AA 4D9GA 3AFNA 3CF2A 5AVJA 1CZLA 3BH7A 3EOAI 2I1VB 2Q5FA 2ZQYA 2NO1A 2ZT5A 3QQ5A 3TKAA 1Q0PA 2YUIA 2CE2X 3OF3A 1GDHA 1XCGB 2I6QA 2FE4A 2NUPB 2QW0X 2Q3CA 3AR8A 3SFVA 4CMKA 4E15A 1FSPA 2ZB7A 4NOKA 3NLLA 2HYDA 4QC2A 4D56A 4MEJA 1Y9EA 1C9MA 2V6MA 5C37A 5BOSA 2ERCA 5DN6D 2I2FA 4XVHA 4KPEC 3E5HA 4RLFA 2ZIEA 2HU5A 4TS4A 1UBTS 3URMA 2ZP1A 3WNDA 1KEKA 3SQDA 5HMLA 1EUCB 4BJHB 1YB1A 4JSTA 1DBVO 2W71A 2V7GA 3RPEA 3VGJA 4JI0B 1CJSA 1QLHA 1ESDA 2FFBA 4BV2A 3V80A 2XF2A 2Q2NA 3EIHA 1XTIA 1BMQA 4GG1A 4IDAA 1P74A 3BWXA 3V2IA 3CLSD 4FMDF 1HLFA 4LYYA 1XHLA 1A5BB 2Z4SA 1LBEA 4MA4A 4QUKA 2PFKA 3IIEA 3UTCA 1YR1A 2ZYSA 3R3UA 4XYMA 1M0EA 4ZVSA 3U7QA 1R3UA 2ORVA 1Q0TA 3GPIA 3QE9Y 4BBZA 4J0GA 3RJTA 2IYXA 1W5FA 1DVRA 1H6AA 3VAZA 2X6RA 1LDNA 2XQKA 1KU6A 1J09A 3C5WP 3IIJA 1ZNWA 4IV5A 5K8JB 1Q7EA 2O57A 4BZPA 4C6TB 2XRFA 4QWMA 4IJUA 2QX8A 2J8ZA 4PC1A 3ZNNA 4DMRA 3BSFA 4ZCMA 5GZ3A 3QU4A 4R68A 4BNZA 5H82A 4F1KA 5SZHB 1XHFA 2AJ8A 2Z0MA 1X1AA 2O2CA 1LDEA 2OQIA 4DQLA 1C29B 1OYVA 3ESYA 4N9WA 3W8RA 3FZYA 1QONA 2XZPA 3LGSA 4PYMA 5FFMA 3R9KA 3T5AA 2XODA 3A06A 1MC5A 4BP9A 3IPRA 1DL5A 2GD0A 4OSPA 3S0JA 4MS4A 5MHTA 4UXIA 2G1JA 1U0OC 3IP1A 1SXJC 4ZZ1A 3IKMB 3CLTC 5CLGA 4A10A 1CX9B 3WQSB 4LCJA 2GKSA 3D8BA 3M6AA 2VF2A 3ZWMA 4PYRA 3LPMA 1ACLA 1YS9A 1SXIA 2IHKA 2XJ9A 1FEZA 5FEMA 3VPFA 1M1NB 2EX1A 5JTUA 4G1CA 2R6FA 4RVUA 8AT1A 2R44A 2WHXA 2Y3IA 3PGA1 1V5WA 3PDHA 2CNWD 4Q02A 1ZSVA 4JP5A 5DNAA 4F4UA 1O95D 1JDVA 3VDXA 3PXCX 2GAJA 5DYNA 4LBWA 2RAUA 3VR4A 3D6MA 2QRVA 3MGBA 5EY5B 3WISA 1QQTA 3AVUA 1NPTO 1LRJA 3LAWA 1QZXA 2WJ6A 2XUZA 4OYHA 2IE8A 2V6IA 4DYVA 1PGNA 2FH5B 1T26A 4S1NA 3RG2A 4K86A 2BGTA 3OD1A 1II9A 5KYWA 2V97A 5JG7A 1U1DA 4BNJA 4ZTBA 4ZXFA 1PCXA 4LN1A 3NRCA 5CYOA 1G8FA 2PBFA 3OJCA 1QUFA 4QXRA 4YAJA 4GBMA 1ZOSA 4MW6A 4NK5A 1I30A 4KK4A 2ZXEA 3O91A 3S2EA 1OJ7A 2H16A 3V2UA 3FTCA 1YULA 1YKSA 3I73A 1A50B 1QGUA 5FPSA 1V1JA 2Q5OA 5FBZA 3IFSA 5EIEA 3B8EA 4QO7A 1MQ8B 3L7OA 5FPHA 1NY5A 2X86A 4MI1A 4RFSA 3RBXA 5DNUA 2WJYA 3D8HA 3CSUA 4J16C 1N2EA 1TB4A 1RTTA 2IOFK 2VA9A 2WV7A 4CE6A 2Q4DA 1E9BA 4WA7A 5GOTA 3BC1A 4RFVA 2NOAA 3BA6A 3H4TA 3OI7A 5TMDA 2OMEA 3THOA 5KX5A 1UBSB 3ZWOA 4AN1A 4KLRA 4YRZA 4I55B 1KVTA 2PZMA 1EP9A 1JE1A 4M9RA 1QHSA 4L7QA 5EQFA 1U5BA 3OEEA 3BTOA 4WNAB 5IM5A 3CW8X 4AO6A 4M21A 1YCDA 3TDKA 2C2KA 1MB4A 4AT1A 1G8PA 1VYUA 1JEJA 2WD9A 4HH0A 2J5XA 2Z9CA 3I5XA 1IDOA 1Z6GA 3OX4A 3HBMA 4CIAA 4OX9B 2Z30A 3OETA 4KXLA 2Q2WA 3QWIA 5KAMA 2Y1CA 4H4DA 2H1SA 4D74A 4L4XA 1M10A 3BXFA 4KO4S 2QTGA 1WVGA 1ADFA 2MSEB 5L3SA 2CJXA 4WDQA 1VHTA 1YQXA 4KDFA 4GPAA 4AUNA 1C7JA 3BRWA 4O4LB 2K6GA 1FFAA 3RTGA 2BCEA 1XF9A 5EJEA 1PG0A 3B6KA 2E55A 3E53A 3AM5A 1TAUA 1JHRA 2IX3A 3W5SA 1VSTA 3KVRA 1PBNA 1U1EA 1DBQA 3TVDA 1JBQA 5J5VA 1Z6YA 3ZCRA 4ILEA 4DF3A 1DO0A