3BWMA

Crystal structure of human catechol o-methyltransferase with bound sam and dnc
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of human 108V and 108M catechol O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwmA00
3MQ2A 4XUCA 5GWXA 2C7QA 4QDKA 3KQQA 4B17A 3F4KA 1PJZA 5HILA 1O54A 1UIRA 3G2PA 3NJRA 4L7VA 3TM4A 5CM2Z 5H02A 1G6Q1 1XDUA 3VSEA 5CCBA 2ONZA 1AV6A 1YB2A 3LDFA 2ZZKA 4MTLA 2BZGA 4GC5A 4M37A 2ZZMA 2AVDA 2BR3A 3TLJA 4EKIA 4PYNA 3KR1A 4EKGA 1BHJA 2PWPA 4KRGA 3RIEA 1N2XA 1SG9A 2AVNA 1JQ3A 4GOND 4QQNA 4E33A 3TKYA 3OE5A 3B3JA 4BP1A 3KU1A 1KYWA 3A7EA 4KIGA 5DX0A 3IHTA 1T43A 4FZVA 3I9FA 3SM3A 1G38A 3MHTA 4HGZA 3HA7A 1Z3CA 3A27A 2FK7A 2ZBRA 3LKZA 5LQRA 7MHTA 2ZWVA 3FTDA 5HIIA 1IXKA 3JWGA 5F2OA 5DM1A 1BKYA 4QDJA 4OBXA 2NP6A 3M33A 4LWOA 3PS9A 3DMGA 1IM8A 5FCDA 2BH2A 1JSZA 4C07A 1KP9A 2P40A 5CUQA 4BLUA 4DMGA 4WVLA 3TFWA 3C3PA 5DX1A 1VE3A 3GGDA 2IH2A 4M7RA 4PYMA 4PCLA 4QPPA 4AUKA 3HCFA 3C6KA 3MERA 4F85A 3G2OA 3K6RA 3KPYA 2EJUA 4H0NA 3JWJA 2XBMA 1NBIA 5LR6A 1Q0TA 3OZRA 3NDJA 1HMYA 2NNWB 2O57A 2P7IA 1KIAA 3JWHA 1NW8A 3K0BA 1RJEA 5FQNA 4RTOA 2YUIA 1RI3A 4EQZA 2UYOA 3JWIA 4P58A 3UJ9A 2NYUA 1MHTA 5C9ZA 5DXJA 3DXXA 4FSXA 4IV8A 2JHCA 3EVEA 1D2HA 2YX1A 4R05A 3SGLA 4ISCA 3SSMA 2I6GA 3B3GA 3PFGA 5DTQA 1BC5A 1IY9A 3R6TA 5ERGB 5FADA 1RI4A 4E2ZA 3HCBA 3PT9A 4DA4A 3PVCA 3NWBA 2PBFA 2PT6A 3I53A 4A6DA 3TR6A 3X0DA 3FZGA 3BGIA 5E1BA 4RTNA 4YV2A 3R3HA 1QAMA 1YZHA 3THRA 2QRVB 2VP3A 4AZWA 4POOA 9MHTA 3SR4A 1SQFA 3BGVA 3LDUA 3ER8A 3CVOA 3GRYA 1YUBA 4GQBA 3M70A 1EAMA 5EKUA 4CTJA 2ZW9A 5D1HA 3KQMA 3KQWA 3VYWA 1EJ6A 2XVMA 1JG2A 2AOXA 3CBGA 3HVKA 1P1CA 2P35A 3LKDA 2HWKA 4YUXA 4GC9A 5DLYA 5JUWA 5P8WA 8MHTA 5K0BA 5K09A 1YF3A 1QYRA 3BWBA 4RVGA 1FP2A 5K0FA 4XUDA 1WS6A 3BWYA 2GAFA 4LG1A 4X61A 3IV6A 5K0GA 2CWWA 2YXEA 5F2NA 4P7GA 4PYQA 3MB5A 5EIFA 4UOEA 3FTFA 4Z2YA 1O9HA 5E1MA 3SMQA 1RJGA 3CCFA 3HEMA 4YUVA 3PX2A 2V7EA 3BWCA 1O9GA 1G8SA 3A26A 1D2CA 3FPGA 3C3YA 1VQ1A 1ZG3A 1ORHA 3UJAA 1FPQA 1NV8A 1XTPA 1QANA 4ER5A 4QVGA 1R74A 3T7SA 4AZVA 5LQKA 4DCMA 3LCCA 5DTRA 2OZVA 3EEOA 2V74B 2Z6UA 1VP9A 1UFKA 3C0KA 3DULA 3KHKA 5MHTA 2AN3A 5T64A 5K0CA 4GF5A 2B2CA 3FRIA 1N7IA 1RI5A 3P2EA 4QQKA 4CKCA 5K0NA 3FPEA 1G8AA 5BW5A 5KS2A 3D2LA 4KDRA 4X1OA 2Z6QA 5GIOE 2CMGA 3CJTA 3P71T 2AN5A 5FQOA 4YV0A 1ZHFA 4RV9A 2NXEA 3HCAA 4BY9E 3L8DA 3EVZA 2ZIEA 2NP7A 1EJ0A 2AOTA 1YZ3A 2GB4A 5DX8A 1X1CA 4M36A 3UFBA 2ERCA 2BM8A 5KQRA 1SUIA 5EG5A 10MHA 4HTFA 3EVBA 5DT2A 3TMAA 2P8JA 3TKAA 3GRVA 4AZTA 5K8VA 4FS8A 5G02A 1SUSA 1MJFA 1VBFA 2CL5A 5E1OA 2XYRA 3HNRA 3KQPA 3KQOA 4P7JA 2UYCA 3FTEA 3KQSA 5HOQA 4CKBA 2ORED 5IKMA 1SKMA 1WG8A 2ESRA 2JHPA 2AOWA 1NKVA 4AX8A 4GBED 2EJTA 5CD1A 1D2GA 3A4TA 3FUTA 2GA9A 5E2AA 3SSOA 5GIPE 3UBTA 2A14A 3G2MA 3I58A 2JH9A 3AXSA 3VC2A 4C08A 2GS9A 1VP3A 4AZSA 5EIWA 2QM3A 2ZWAA 3HP7A 3KKZA 2C7RA 1NW3A 3G5TA 2FYTA 2HTEA 3BGDA 3Q87B 4OBWA 1PRYA 5GM2A 2OY0A 2IIPA 3T0IA 3UA3A 1JR4A 4OA5A 2ZLBA 1TW3A 4ER0A 1WXWA 1X19A 3M6UA 5DM2A 1ZGJA 4PIMA 5EHIA 1RJDA 3OCJA 2YR0A 4V0RA 1KPHA 5EMKA 2PVCA 4FP9A 4KVZA 3WSTA 1ZQ9A 1OR8A 3LPMA 3DMHA 3I5UA 2BR5A 3DTNA 5D1NA 5GP1A 5K0EA 5K0LA 3NMUF 2VDVE 4PINA 1Q0SA 1I9GA 1X1BA 2H11A 3G88A 5HEKA 2PLWA 3T7TA 2G71A 4DM3A 2Y1WA 2IBSA 2IH4A 4U7PB 2B78A 4RTPA 2AOUB 3OU6A 4OQEA 4U7TB 1AQJA 3CC8A 1HNNA 3GCZA 5FHQA 1NBHA 2PX8A 3OU7A 2VZ9A 3NTVA 3P2KA 1KHHA 3DMFA 2IDKA 4QTUB 5IH3A 1VIDA 3NVMB 3UA4A 2PKWA 5E1DA 2VDWA 5EPEA 2R3SA 3MCTA 3BWMA 5EGSA 4MQ4A 2OXTA 4E32A 3HCCA 1BOOA 3B7PA 3KQVA 4IWNA 5EZSA 5HIJA 5FA8A 2IPXA 1FBNA 1B42A 5EMJA 3LHDA 2Z6AA 4MIKA 3MTIA 2ZIFA 2ZIGA 2GLUA 3UWPA 4RTJA 2AS0A 1G60A 4NECA 2PT9A 4RVHA 1SQGA 4PNEA 2QYOA 2H00A 1X1AA 5EQJB 2EG5A 3IYLW 4C4AA 5FUBA 4PGGA 3B5IA 3A25A 3AXTA 3I64A 4M38A 3ANXA 2ZBPA 3DXZA 5EEGA 4XUEA 5F2KA 4RTLA 4PWYA 3FPJA 3DXYA 3M6VA 3FPHA 3KR2A 4O29A 1XCJA 5EHGA 2OB2A 2XYVA 1WY7A 1NW7A 3EGIA 2IGTA 3G7UA 4MWZA 4X41A 2DPMA 2O0LA 2PXCA 4LWPA 1SVUA 4E31A 3SXJA 3R24A 5C0OE 1L9KA 3V8VA 4YUZA 4RSRA 5M5BA 5CVJA 1UWVA 3VC1A 3ELYA 3DLCA 4C03A 1XCLA 1L1EA 1NW5A 2VS1A 2G70A 3FYCA 4FR0A 5EVJA 1L3IA 1KPGA 3MAGA 3TPZA 5C1IA 3O31A 4GOOD 3LX6A 4KW7A 2I62A 3REOA 4R8SA 2I9KA 2IBTA 2ADMA 3KPVA 5U4XA 3UJDA 3EVAA 1XJ5A 3EVCA 2P3QA 3HVHA 4PIPA 3FTCA 5CVDA 4CWAA 2IH5A 3PFHA 2ZULA 4MHTA 2OPBA 2BR4A 2UYQA 3KQYA 3G5LA 3HCEA 4PYKA 3HVJA 4DF3A 3NWEA 2IDJA 3MCZA 1L3CA 3DR5A 4HGYA 3E05A 1X1DA 3BT7A 4GUAA 4FGZA 3OFJA 4RWZA 3ER9A 3KQTA 4YMGA 5HIKA 2DULA 1INLA 2JHAA 3PTAA 3MTEA 5CVUA 2OO3A 4R6WA 4Y2HA 5DTMA 4RTRA 2BM9A 3CGGA 3GNLA 3HA3A 4RVFA 2YXDA 2R6ZA 5DRTA 4PGHA 3GU3A 3ID6C 2PSSA 1JQDA 3FUWA 5LQCA 2G72A 1AQIA 5DSXA 5DWQA 3LECA 3FUUA 2H1RA 1EG2A 3TM5A 5GOZA 5HIMA 1QAOA 1F3LA 3P2IA 4FT4A 2P3LA 1XVAA 5KYGA 2QY6A 4YUYA 3GXOA 1YFJA 4E2YA 1F38A 2P41A 3GO4A 4HC4A 1R8XA 3GIWA 4IV0A 1M6EX 4DCGA 1I4WA 3KPUA 3NW9A 1KPIA 2ONYA 5T67A 1KR5A 3G8AA 2O06A 3AJDA 3M4XA 3OPNA 1XXLA 3R0QA 4EVIA 3C6MA 2NXCA 3KPJA 1KYZA 2ZTHA 1JTEA 3G89A 3B3FA 4IKPA 3AWIA 4EMSA 3ELWA 4LECA 5B1SA 4PYJA 5LQAA 2P3OA 1M6YA 5GINE 2FCAA 3DLIA 3LBFA 3OE4A 5E2BA 5KQSA 5E9QA 5GM1A 2OYRA 3HCDA 1V39A 1ZGAA 5E9WA 4RVDA 3QOXA 5ICFA 3RODA 3E8SA 4XCXA 2AOTB 4DZRA 3ELDA 1EIZA 4PYLA 4FT2A 2ZZNA 3NDIA 4QPNA 2PV0A 1N7JA 3V97A 1P1BA 3CKKA 3S68A 5BP7A 4HTFB 3GRZA 4E2WA 4BLWA 5K0JA 4BLVA 4PYOA 3OZTA 4YUWA 2QE6A 3OFKA 2AZTA 1NE2A 3PX3A 4F84A 2IFTA 2YXLA 3EGEA 2FHPA 2OB1A 3THSA 4P7KA 4P7FA 1JQEA 2NXJA 5CCXA 1R18A 2HNKA 1QAQA 2E5WA 1R00A 3LL7A 2O07A 2UYHA 3PB3A 4PCAA 2PWYA 3P9CA 2B3TA 4GEKA 2AOVA 2GPYA 3GDHA 3GJYA 5E8JA 3EVGA 2C7PA 1WZNA 1JG4A 3ME5A 3O4FA 3UJ6A 3EMBA 3NVKI 3M6XA 3P9NA 2VDUE 1R8YA 2B25A 3MGGA 4HG2A 5KVAA 1TPYA 5LQUA 1NV9A 1XDZA 3ERCA 3PLAE 5FULA 1NW6A 4KIFA 2QRVA 2OBFA 1RI2A 3EGVA 1RI1A 1JG1A 2P7HA 3G2QA 5EEHA 5DM4A 2PX5A 3LSTA 5FWAA 3FRHA 4HH4A 2Q41A 4RYLA 2N47A 1WXXA 4RTSA 4OA8A 4DKJA 3EPPA 3BZBA 4HRAA 2O05A 2FK8A 4X60A 4E30A 4DQ0A 1ORIA 4E70A 5CVVA 2HR1A 2JJQA 3AY0A 3Q7EA 3BKXA 3LCUA 5HFJA 4QTTB 3ORHA 4C06A 1U2ZA 5T6BA 4PYIA 4CKEA 4YMHA 2K4MA 2HV9A 3BUSA 5EC8A 3KPWA 3SSNA 3GRUA 5JR3A 5DPMA 1NT2A 3A7DA 3FPFA 1R6AA 3BKWA 3DP7A 4K6MA 2I7CA 2YVLA 3TOSA 5EMMA 4GOLD 2CKDA 5FWDA 3HA5A 4GOMD 3SX0A 2G1PA 2FPOA 2ZSUA 4EK9A 5ICGA 3OZSA 3FYDA 5FA5A 5ICCA 2AR0A 5EOVA 1H1DA 1L3BA 1P91A 1JSXA 3M6WA 2HMYB 5E9JA 3ELUA 5BXYA 3R9XB 3UJCA 3UJ7A 3P8ZA 3BXOA 5CVEA 3LGAA 4X63A 3LCVB 2CMHA 1P39A 4ZTBA 3E23A 4CTKA 4FSDA 1XDSA 5CIYA 1DCTA 4HSGA 5DSTA 5K05A 4C04A 1VL5A 2AN4A 3EVDA 3LDGA 3EMDA 5FTWA 4C05A 3LBYA 2LD4A 2EX4A 2GH1A 3EEYA 3P97A 2JH8A 2JG3A 1KXZA 3DOUA 3DH0A 5EKXA 3UZUA 1RJFA 4KWCA 3FUVA 3QV2A 4Y30A 1QZZA 4OQDA 5LSAA 5EZQA 4ER3A 5LQNA 1TW2A 1VLMA 5K03A 2ZFUA 2PJDA 1AF7A 3CJQA 3HTXA 5K01A 1M0EA 4RTQA 1G55A 2PY6A 2P1DA 2YQZA 3G8BA 1VPTA 5DXAA 5E8RA 3HM2A 2EFJA 5ICEA 1DUSA 2WA2A 5EMLA 4E2XA 1FJXA 2PX4A 3T7RA 3TQSA 2B9EA 3UJBA 1JG3A 2F8LA 2YTZA 4A6EA 4PONA 4RTMA 4BP3A 3KR9A 5BW4A 2ZBQA 2ZCJA 2G8NA 4ATNA 3B89A 3EVFA 3QOWA 4ER6A 2XYQA 2ZVJA 1Y8CA 3GWZA 2PXXA 2WK1A 5FHRA 2UZ4A 1DL5A 3P9KA 4V0QA 3UJ8A 3FUXA 1FP1D 3HVIA 1JTFA 4ER7A 1I1NA 2PXAA 4JXJA 4KDCA 4RX1A 4WXHA 5HZMA 2XVAA 3SVZA 3O7WA 3TRKA 3RW9A 5DM0A 4R8RA 3U81A 2C7OA 2Y1XA 2KW5A 2IP2A 3OU2A 4R6XA 1YFLA 2WA1A 2OKCA 3IEIA 2PX2A 2FRXA 3P9IA 4G56A 4QVKA 3CJRA 3H2BA 3KR0A 3E7PA 4RTKA 2NXNA 5LQJA 4OX9Y 4YV1A 4F86A 5DRYA 3DUWA 1EQAA 2AOUA 2PGXA 3GRRA 4CXMA 1ZKDA
chains in the Genus database with same CATH superfamily
4KAAA 1K92A 4B7CA 2B82A 2FPPB 3O8QB 1O6FA 3NJRA 4OHWA 5HILA 4YGYA 2C7VA 3JQ7A 1Z4LA 4MK4A 4DL9A 2VUHB 4L6CA 5BN1A 2J6IA 5AVOA 5HZHA 4LSZA 1T13A 1Z8FA 4DMMA 3ZV5A 1YVPA 5JPCA 3GFOA 4NYJQ 4GPEA 5JSUA 5K20A 4PEVA 1II9A 1AGNA 5FTNA 2XUJA 2N42A 3RSSA 4AJPA 3B3JA 3OSUA 1P4SA 2XBLA 4LE1A 4LI0A 5DBHX 3NWPA 3AOGA 4AKTA 3AHCA 3D6VA 4BHTA 2JGFA 3TLEA 1G6KA 7MHTA 3QU9A 1KOFA 1MJGM 2MSLA 3FTDA 3Q0TA 4ECEA 1KJWA 3GPIA 5HF8A 3TH5A 4TZ0A 1NSYA 3LA8A 1YXMA 1CTQA 3COYA 1L8QA 2UUOA 1UQTA 3HVUA 4EGQA 4HPWA 3TNDA 3IKTA 4BPBA 1D4ZA 3F3SA 5LMZA 1TNDA 3DHVA 4F8JA 1YKGA 3NYWA 1MX1A 3CEJA 2CXQA 3I9KA 4M7RA 1XZQA 2E5LB 3FETA 5TF4A 4TWRA 3G2OA 4RZSA 4HDMB 3H1EA 4HLUA 1GTRA 3UOWA 3EBLA 1ILEA 5TGZA 1TCCA 2NU9B 4I55F 4RENA 3L6BA 4ZAYA 1WLYA 2JK1A 4LGMA 2NTYC 4EJSC 3TF5A 2JLVA 1QORA 1SJ9A 3UXYA 2YY7A 1HURA 1DZ3A 4DDHA 1AUOA 5KQPA 3IBGA 1CQIB 3OMWA 2LE0A 4ARVA 4NOJA 2WSMA 4OV6B 1DFHA 1ZI9A 2QMUA 3GZNA 5F9MA 3MUFA 4E2ZA 3R6TA 3A6PC 3PJEA 2Q62A 4CM1A 2B30A 3HHPA 4HO1X 3F7MA 3BWDD 2CXSA 3FZGA 4B80A 3BGIA 2RAVA 2IIVA 2WT4A 3HBJA 3AETA 4KWHA 4MRNA 5E4YA 3RSQA 1G5RA 2GEJA 2NSYA 2ISCA 1CR0A 3BRWD 5B3AA 3X1ZA 3ZC3A 3U7HB 2UKDA 1JT2A 1VCOA 3GRYA 4MVJA 4R40A 2IEAA 2ZW9A 5CFQA 4R2MA 1FNCA 3DFZA 4XYBA 2ZRFA 4QXQA 1H9AA 4GPAA 4C0KA 3FZNA 2HWKA 3F5MA 4XM1A 3H9GA 5GVSA 5KWJA 3FNQA 2WHEA 4YJ3F 3N6XA 5F64A 2E0IA 5H70A 3ZY2A 1V5GA 1X94A 4JLVA 2O8FB 1ZCFA 2VJDA 2XT6A 1G8KA 3H84A 1HUQA 1YU9A 5LWQA 2YXEA 4JBHA 4BJ3A 4Z2YA 4LZOA 1F4PA 3EG9B 1SU4A 1RJGA 2A9JA 2C3UA 2R00A 3HDJA 2XMQA 3QVJA 4XB1A 4OMFG 1EDZA 4BIMA 3QVUA 1TZKA 5GZ6A 2W83A 1VI6A 4G24A 1R50A 4ARBA 1F48A 1HH4A 3I9JA 4J03A 5C53B 1U0BB 1FQJA 2PRSA 1Q0ZA 2BY4A 4CGZA 3D8HA 3VPCA 2OYCA 4RGBA 1N0HA 1L6IA 2DFTA 3SDBA 1FSSA 3LO5A 5BY2A 4XWWA 3L79A 1Z33A 3RSFA 2PEZA 5CURA 2QGZA 1EX6A 1OXSC 2J31A 4MUFA 2Z6UA 2NZWA 2WTAA 2X42A 4MV8A 3T3MB 3OZ7A 2C4TA 1ELOA 2WYWA 2GXUA 1YB7A 3R09A 1L7PA 2XDYA 3CX4A 5CA1B 3T9CA 4QEKA 2NXWA 4QQKA 1R9JA 1YK1A 1QS0A 2J7PD 2PYIA 3OZCA 4HYTA 5E95A 1R37A 3D4IA 5EE1A 4CI0B 1QR6A 5F51A 3HS3A 4F2WA 2AN5A 2C99A 3IVRA 2OK8A 1NQWA 2NXEA 3EFOA 3HCAA 1DXYA 4RKYA 4RV9A 3SY8A 1NR5A 3QX7A 2H5EA 4N3NA 4A9AA 1X87A 4BC0A 1YQTA 1VM6A 4RH0A 4CFSA 3PHGA 3TTUA 3TMKA 2O2CA 3V8BA 3A1WA 1OOEA 1U5BA 4L7QA 5J2TB 2VYNA 3ZVRA 4TTIA 4E4YA 1DOAA 4MZDA 3W4JA 3UUEA 3RFVA 1ZXBA 5BV7A 3S7TA 3WYDA 4PR3A 3VH4A 4HPXB 3RF7A 4DMRA 5KX5F 1LB1B 3RG8A 5H3LA 3RRJA 3I1YA 4F2PA 4DV1B 2OBBA 1QKJA 2B9VA 3JQFA 3NHPA 1H5UA 2C4NA 2GZ3A 1IVYA 2JH9A 4LXUA 4B09A 4B3IA 3O2JA 5EE3A 1Z18A 1IZ9A 2CVHA 3RIMA 4P38A 4EG0A 2WZDA 3V5NA 4ZKDA 1UANA 2JGEA 4NBRA 4Q18A 2OVFA 1JIXA 2X8BA 2YV5A 1HKHA 4J0CA 4BX8A 4OO3A 5JT1A 5DM2A 3GQVA 5K99A 2X0EA 5AJWA 4PC3A 3AVWA 1FFXA 3K5WA 1E9DA 2QX7A 4CF5A 2QN6A 1JWBB 3SXUB 1ZQ9A 2VYVA 3NT5A 3QVLA 1UPXA 2GLXA 4QELA 4X90A 3WJAA 1TVKB 3CLHA 7ADHA 1KQ3A 3OHMA 4FOTA 3BTSA 2YWFA 5F7JA 4OYRA 2B78A 1O6GA 4IYRA 1I4TD 3ICEA 4W1SA 5JHHB 4MVXA 16PKA 4NU8X 5AW3A 5TLSA 4BE4A 4A2QA 2DR2A 1JQKA 1WKVA 4X6LA 4D3ZA 4G1CA 2PX8A 1SPXA 3OU7A 1BRMA 4RSMA 3NKVA 4EG7A 5F23A 2OL4A 5CP8A 1QFMA 2V5UA 2QGFA 5ALOA 2RG1A 3GZTB 2ERXA 3IUPA 3HU2A 2ZRPA 1Q44A 1KY5A 1PF7E 1BE8A 2O20A 1P6QA 2QB5A 3FHLA 3V6MA 3PJRA 4O4IF 3COJA 5DWDA 4ZI7B 3LWDA 4E22A 3ZZMA 1M7BA 2OV6A 3GLIB 1CUFA 1UOPA 1A7UA 1VCNA 1G60A 3MMNA 2PT9A 3BTUA 1YH3A 3WGIA 1RWBA 2H00A 4YJ2F 5JWHA 3IYLW 5JFTA 3R7AA 4TL8A 5FNVF 3KZNA 3R74A 1UBTS 1E7WA 1XZFA 3FSGA 3NEAA 4LVCA 2PX0A 1R6DA 1PTJA 4GE0A 4Y2VA 1GUFA 3SKYA 3LT4A 3FDXA 4XUEA 2BFDA 4LNAA 2PKXA 1GG5A 2G83A 3GGOA 2XYVA 3PFWO 3W2IA 2BTOA 5DHRA 1DJMA 2Y05A 1W8DA 4Q5IA 5CW2A 1G8YA 2BTEA 3DQPA 3EDOA 1K5PA 2OQIA 1V8ZA 1MD9A 4BNNA 4I1SA 1OKKA 1FYVA 2R66A 3DC2A 4UNNA 3ZDDA 4Q4CA 4EUHA 1H8ED 4MR7A 5EVJA 4JT2A 1VA5A 4Z9FA 3SM9A 4C0XA 4CM5A 1I3CA 1BQ4A 2QN9A 4K2HA 4N5HX 4WZBA 4B6PA 3BB4A 3L8MA 3WDMA 1KMIY 3KPVA 1NY5A 3JQPA 4C89A 2QDKA 3KTDA 3OT1B 2IPMA 3ESQA 3HVHA 3FTCA 5CVDA 3FVWA 1ZD1A 3OZWA 4DEVA 2FEWB 3WYEA 4HZUB 4UHDA 3Q98A 4KXFB 2ZULA 4Q4LA 4CKWA 1N5RA 3AMVA 3L41A 3STVA 3U9LA 5KOHA 2RD2A 1X8JA 1SQ6A 3K72B 5ADVA 3MCUA 1YS7A 3QXXA 3L6DA 4HH3C 2PZGA 3CQ9A 4IRMA 4PZAA 1L3CA 4HS4A 1R6BX 2YVAA 1EB9A 1L5QA 3OFJA 1SVKA 3KB6A 4N41A 1PK9A 1EGQA 2G9QA 3GFFA 3QYFA 4IRXA 4TV9A 1JKFA 1NQTA 3MTEA 1MAWA 2A0YA 2OO3A 4R1MA 3KEFA 3SHVA 1IZ8A 3A6DA 3AILA 4RE5A 2FUKA 1AZWA 1K3TA 3DBHB 3QWIA 4KGXA 2QWXA 2WG2A 3LJKA 4BE7B 4CETA 5JMOA 1HNXB 1F2TA 3OWHA 1EGMB 3OTOB 4DBLC 1K7FB 1BYUA 4NJMB 3VZDA 3FROA 4EZEA 4ZO9A 1SR8A 5DSXA 1O6ZA 4UMEA 3ZU4A 3RWMB 2JGDB 1LLQA 3BMQB 1VDMA 3TQOA 4OLBA 1DEAA 1G5TA 4CODB 5L6MB 4OJYA 1YDMA 2L17A 3QQ5A 4O2RA 1Q11A 2CLOB 3WQHA 2PUTA 2B8EA 5G1NA 1YFJA 1USUA 2X22A 3C8HA 4ZMSA 2PGLA 3HWRA 1AA9A 2G76A 4JLSA 1NXOA 3VTKA 4G4SO 3VU1A 5L45A 1D0IA 3DMTA 4OGFA 1U2PA 2QTZA 3O4GA 2MIIA 2ZWIA 4IL5A 2JFXA 3VOSA 5DF1A 1K9SA 4DR4B 5C5EA 1RCTE 2ASVA 1DJPA 2GKOA 3KPJA 3A4NA 1UWCA 3H4TA 3QY0A 3EDYA 2OCXA 1M66A 3AWIA 4MV9A 2Q6KA 2AEJA 3LT5A 4M0FA 2Z8YM 1AHPA 2LCQA 1Z68A 3GGCA 3LBFA 4DLYA 4JLNA 3OHPA 1G17A 1G8MA 3P94A 4HNAB 5E9QA 5CM8B 4JCOA 4MGZR 4B9AA 3ADBA 1W0JD 4BNKA 1GOTA 1AUPA 2CJWB 4RVDA 5A4DA 5HZGA 4D26A 3KT8A 3AW9A 2YDYA 1DELA 1DWUA 1SVMA 1TK3A 2WVGA 4TVOA 5JYDA 5J2UF 1DKMA 1YUMA 4NCXA 2EP8A 4TQUS 4HHEA 5CFNA 3TJRA 2WJ6A 1QC5B 3M5WA 3CLSC 3W6UA 2RB4A 1OBVA 4IGIA 4IHJF 1OJLA 4BLVA 1UKBA 3NVAA 3C6YA 3MBKA 3BJRA 3RS2A 4V0MA 3QEAZ 1PW5A 1EE1A 5KWVA 3NFRA 1GM5A 1R2QA 1A5ZA 3N8HA 3MTAA 4C78A 2VTVA 4X66B 3P9SA 4L4RA 3SLKA 3GLHA 1E0AA 4MJLA 4A92A 2A5JA 4YXWA 2ZUSA 3LFTA 1FNBA 1VJ5A 5DJ5A 4BLQA 5BSFA 1HDOA 1U7DA 1ZM4A 3WIOA 1I5EA 3AV3A 4BEVA 4EHKA 4FC6A 4Y98A 3N8KA 3GJYA 4YIKA 1U1CA 3GLUA 3RTDA 3T4UA 5CTJA 4CM6A 1YRHA 1ZM7A 3BD9A 2I7TA 4BBPA 4XKJA 2DZDA 2E82A 2EKBA 1XRMA 1XDWA 5FWYB 1USWA 4NMLA 2NVUB 4BBJA 3WLJA 2QRVA 4I1RA 3R1IA 5FPQA 3CVUA 1U7OA 5M34A 1HDYA 5DM70 3RADC 4HH4A 1IOWA 1T6BY 5HJEA 3OZXA 2O3TA 4Q4HA 5KSWB 3OZEA 4IOJA 5ELXA 5KYXB 3LVBA 5F77A 5BPFA 1LF5A 4DPMA 4C01A 5A0VA 2MYPA 4WXRA 4CQMD 4HQ6A 2B1GA 2ORWA 3N39C 1ZWLA 4P0PB 2KI5A 1EFHA 2JJQA 5EUQB 4GZLA 1XHLA 1DQYA 3F1KA 1P0FA 3GXBA 2WQZA 4DUGD 1EWRA 2GTPA 4M76B 4HRVA 2IKQA 2QD4A 4F2HA 4K9DA 4HQNA 3ZUPA 1NQUA 2GAOA 4V03A 5IJ9A 4FHEA 3GG9A 3KBOA 1XU9A 3E9RA 5EMMA 2JI4A 1RRPA 2D2XA 3RUFA 1E3IA 3CCCA 3WMXA 1E61A 1B7GO 3F7NA 1U3WA 4X71A 1IXZA 4AMYA 1AZTA 5HSGA 2AR0A 5BSMA 2CJFA 1AUVA 1RMQA 2BSQA 5JZVA 7MDHA 5IJ0B 1DPFA 1D5WA 2W9XA 3H1GA 3MCWA 3UT6A 2J41A 3V42A 4DQDA 1IDOA 2HSZA 2W58A 3F71A 3K1AB 3Q15C 1UAAA 4Q1VA 3HNPA 5F78A 4NBVA 1SWVA 4DANA 1A8HA 3CISA 3LDAA 4OQFA 4EY5A 3AJ9A 3ENQA 4U8GA 2ZYWX 3HJTA 4LYDA 4HSGA 5KHAA 1PK7A 4QXMA 1MB3A 2GZMA 4ZCLA 3ZV6A 3ND5A 3RK0A 4ENQA 3D8SA 2JG3A 1MIHA 3TQFA 2I5PO 3UZUA 4Z6KA 3QXJA 5IPFA 3FUVA 3UHPA 4KO2S 3SFZA 5FR2A 3X1DA 1O5IA 2WZBA 1T3SA 5ITZA 3HV0A 5JTUA 2FSPA 2ZWPA 4BRZA 4H27A 4QUJA 5GZ3A 1TO2E 3A05A 3G8BA 4R41A 5DXAA 2RJ3A 4FOOA 2FWJA 3SBEA 3WRXC 3G2KA 4CU5A 3Q1LA 4DG5A 1NMQA 1PJ2A 4WKPA 1IYZA 2P2CA 3B6ZA 1R9MA 5ALTA 5HRAA 4QU9A 1TE2A 3E9NA 4KE8A 1QPBA 2Y6VA 4I5GA 1YZNA 1OREA 2J9ZB 3I2YX 4UDYX 2PJUA 4CF4A 3HU3A 1CUBA 1K7SN 2ODPA 4Y2YA 2EX1A 2LDBA 5LLDA 2V7WA 1LTQA 3WYGA 3G0OA 2ECQA 4FB4A 2BYTA 3DZJA 1O57A 3JTEA 1PL7A 3VUFA 4OL9A 2OFFA 3ZE9A 4XB6B 2HXGA 3MAAC 4AWBA 3KV1A 4RX1A 4UEOA 4RSGA 2C1XA 3NZEA 4CMBA 4QOEA 4YRNA 3JAWA 2I6XA 2IYTA 5DNYB 2VF5X 3E5NA 2HO4A 4A0SA 5J9FA 2R6R1 2OFWA 2RBGA 3I9MA 1IRXA 1VSUA 4JH0A 1YQDA 4HFRA 2WA1A 4FU0A 4QVKA 5LLSA 1L4MA 4N3AA 2DQKA 4AJOA 1BXGB 3PUJA 3B1YA 2QD3A 3HBLA 4FINA 1GZ6A 1W8IA 3T5BA 3ODPA 4NYMR 4UCQA 1HFKA 1OFTA 1SC1A 4KC0A 2C9MA 3IAFA 1EU1A 2EAUA 4R83A 2HBQA 5F3DA 4AF7A 4OPMA 5C32A 5I7HA 5AOVA 2GCEA 3CLSD 1VI5A 1J24A 4RIEA 4LF4B 3ZQ6A 3BB3A 5EZ5A 2C88A 2VJQA 3M3PA 2OHVA 3ZWPA 1DRWA 4P2BA 1IPHA 2ZAIA 4WXYB 4CM4A 4X65B 3FTQA 3TZLA 3VR6A 4DZZA 3F5FA 5K2MA 5K5EA 4W5QA 4KRGA 4L9WA 3MXTA 2ZYAA 4K9QA 1MENA 3COZA 4IVNA 4TOIA 2HKIA 1C9DB 2RGWA 2HH9A 4TKUA 4E33A 1ZGZA 4RCVA 2ZUVA 4JI4B 1Z22A 3EXAA 3G82C 2GJKA 5BYAA 4KIGA 2SCUB 4HNRA 3NBXX 2C59A 1BXZA 1IY8A 1O87A 1Z2OX 3GNTA 3MBOA 3ZNQA 4BQNA 4HGZA 3R8XA 2FK7A 3PEFA 2Q1WA 4ZJZA 2IYFA 2VKQA 2OVBA 4OOFA 1J9EA 1ZNZA 1JTVA 1U9YA 3JQ9C 3UTCA 3WLMA 4EEXA 3PS9A 5A5GA 4OI4A 4ZI2A 4OFBA 1AGXA 3OY2A 1WL8A 4Q3KA 4ICIA 2CHGA 2HBZA 2HHLA 2YV2A 5GQSA 4F1KA 1ZAYA 2YHAA 1J23A 2QENA 2HZBA 4E5YA 5G0TA 3VKWA 3B6EA 1I33A 4UCWA 4R0NA 1TCUA 2Y0PA 2F4VB 1NBIA 2QJFA 3A3PA 5KC8A 2GRUA 2AG0A 1JLMA 1QLJA 2C2XA 2QW1A 3QIVA 4YJGA 3ZWXA 5B6IA 3A11A 1M2EA 3KE9A 1QYDA 1NW8A 4MJ3A 5FQNA 2I2BA 2BDUA 1MPTA 3E5RA 3U7JA 1WTAA 2BEKA 2VI5A 2WKRA 3EY4A 3L6OO 2NUPA 1UBEA 3M6IA 4JBIA 5JG7A 5C9ZA 2XTNA 5CLQA 1PI3A 2VH5R 2YX1A 1AE1A 2OUKA 3TZBA 4QOHA 4R1NA 5CA0F 1JHDA 1P5JA 5FF9A 2DJIA 2EF1A 1BC5A 1KNQA 3D6AA 4M1ZA 5AKXA 3VM6A 1TXGA 4LIPD 1W29A 1XMPA 4MZXA 5AKGA 3UG7A 5IFKA 2H4JA 1A9ZA 2Q2WA 5ALVA 4BMSA 3AFOA 5HTOA 3IOEA 3DC7A 3X0DA 1KARA 2EKPA 5C7IO 3PHJA 5FEUA 1AN0A 1RP1A 1RAFA 2XB6A 3JPWA 4N6OA 3CRNA 4BVEA 4YV2A 1TCVA 1UWLA 1J8FA 4RHCA 5CEFA 2LDXA 3WX0A 3ADKA 5JQGF 4HDRB 3WLAA 3MTQA 2PMCA 4ED9A 1E5TA 4MCIA 1XF9A 1B0ZA 2JFBA 1K4MA 1IK4A 1WAMA 2AOXA 2F1IA 2DVMA 2QRUA 2RGYA 2J09A 3O47A 1KBOA 4KK3A 3RUDA 4E5KA 3O6VA 4D99A 3AB3A 3N2NA 4B71A 3OPQA 4PZPA 4GSLA 2H63A 4URZR 4IX9A 2DEUA 5AJYA 3OJEA 4Z4IA 4GI7A 4I4TF 1WY5A 2XXBA 1PFUA 2O8VA 2ZB4A 3W5AA 3BWYA 2ZI3A 1CFZA 3DJYA 4LG1A 4I7EA 4MICA 2ZSKA 2BT4A 3IV6A 3P32A 4JL8A 5CIQA 5ECYA 3SYRA 5FH9A 4HGRA 2AFHA 3MB5A 2C2YA 4WWHA 2WSBA 1AO0A 1U8UA 1XFAA 3CCFA 3H2JA 1UXIA 4ZQBA 1A9SA 3FI0A 4LXHA 4TWAA 3MWDB 1VQ1A 3IPRA 3O3NB 2H57A 1ORHA 2ZE6A 5F35A 1KZ1A 1OTXA 2YIJA 4PFJA 1QQAA 2O8NA 5FBKA 3NHSA 2X6RA 3MWYW 3OOJA 5FFFA 4NJEB 3LAWA 4YK7A 1V9SA 2EL9A 4LZNA 3K9GA 5KSOA 4I55A 3T5AA 1FUUA 3Q88A 4OAOA 5JDIC 1TRKA 2RARA 5JEEA 1UCFA 2A7QA 3K53A 4ZJUA 4WEQA 1W88A 3KUDA 3U3JA 2YWJA 1N7IA 3VZCA 4M7PA 4B6RA 3R5HA 4EAAA 3MFQA 2P9CA 2PR7A 1UK9A 2X0KA 1YGPA 4LYEA 4BY9E 3RTEA 1D5CA 3ZYCA 4S1OA 5ECWA 1EJ0A 1K0UA 1KO8A 3G7NA 1YZ3A 3GROA 4I81A 1USGA 4NH4A 1JHYA 4XRRA 4CTNA 5EGNA 1W5AA 2BHSA 2FQYA 3AY3A 3P0RA 1M6VB 5EG5A 1TT5B 2PM8A 1O94D 1P0CA 4G3XA 2ZRGA 4J0GA 1VG0B 2R7KA 5JXHA 2DFKB 1U4OA 4UUMA 3WIDA 3AZQA 5GONF 1QV7A 2XMCA 3GAAA 3KQOA 3DE3X 2OSVA 3JY6A 4RPIA 3U39A 1E9SA 4IDGA 1IMJA 3AR5A 5A02A 1V5WA 3HN7A 5CDUA 1C3LA 1E2JA 1CUGA 4KLZA 4ZC1A 4R2JA 2WHPB 2LKDA 4HX9A 3WB2A 3A4TA 2WMYA 4YR7A 3TSZA 2IYSA 1IG3A 1KK3A 3CH4B 4YJ3A 5FLYA 4BUJA 4URWR 5D51S 2GS9A 4OXQA 1OVGA 1BWQA 1GZHB 3OLCX 4CUZA 2V7QA 1X8KA 3HRIA 3LUBA 1E5VA 5DHTA 5GIOE 2OY0A 9ATCA 1D03A 3UFXB 4CQNA 3JQ8B 5FWNA 2XCSB 4Y9SA 1RZRD 1Q92A 4EF5A 4MV5A 1FJGB 5F4BA 4BNYA 2AQ8A 3A6LA 1ONPA 1PIWA 5FPTA 4G1BA 1LV7A 2P75A 3GOHA 3B1JA 3D7LA 4HBZA 4I8DA 1BU8A 1XLWA 1JPNA 2DFPA 1M8PA 2WZCA 4QPZA 3SHTA 3VO1A 3UQYS 3CCBA 3NMUF 1PEAA 2F4NA 2ACVA 1I9GA 1R6XA 1BDJA 4DBLE 2JI6A 3TPFA 1O89A 4I5FA 3O8CA 2A78A 3LY5A 2OFPA 1KQFA 4GI1A 3ONFA 3RK4A 1AKUA 2WIKA 1TTPB 1T36B 2R96A 1W4LA 1D6MA 2EKQA 2PU7A 3SPXA 3VU9B 4JLDA 2NMVA 4EB3A 4PF1A 3S1AA 3KEMA 3PGXA 4QWMA 4D4LA 3JASB 3QPAA 1E1QD 3NP7A 4JWTA 4ND8B 3LZ6A 4P54A 4HNUA 1SXPA 4RV5A 3B9BA 1ODKA 4E32A 2BTQB 3K9WA 4G1MB 4MB6A 4YHHB 4NBTA 4PAGA 3AF3A 1SOMA 3VDQA 1EP2B 1GAWA 3PLRA 5FA8A 3ESZA 5BRJA 5EJFA 2RHOA 3WIEA 1QKIA 3MTIA 4AIIA 3UWPA 2IHKA 2Z5VA 1XQYA 4BGUA 4ZHSA 2RE8A 4RVHA 3ISTA 4KKVA 4TLCA 3QSYA 3D9QX 5EQJB 1QU3A 1CHDA 3DAHA 4GMXA 2FUCA 4JU9A 4U6QA 1A71A 5EWJA 2F6RA 5IZCA 5KX5A 3NAQA 2WTNA 1MZPA 1RZ3A 2RJNA 4MR8B 1B74A 1UKVY 2UVQA 3ZJ4A 3TZHA 5C34B 3GLSA 1G18A 4BVFA 3B7GA 1OTHA 3WLQA 2XMPA 2OAQ1 4NMHA 3KCQA 1J2TA 4DIFA 1NW7A 3EGIA 4CIXA 4NNJA 1AS3A 2FSIA 1KEEB 4E31A 4X7MA 4JDUA 3ULKA 4DIEA 1DC4A 1W94A 4E1VA 2I2FA 1QIKA 1J0CA 2BBSA 4CMJA 1GTSA 1G20E 1L1EA 1GGEA 3B85A 2R8PA 3FYCA 1SVSA 1KSFX 3TJMA 1KPGA 3A1VA 3MAGA 3WDLA 3ZLTA 4CGYA 1LLDA 1E2MA 1Z7YA 4MYCA 4BNUA 5F5XA 3RUHA 3GPLA 4AF8A 5U4XA 4OATA 2J0UA 2PAAA 1EFRD 1JLHA 2M6SA 4S12A 2GBLA 5L3VA 2YRFA 4IAOA 2VNIA 3OTWA 3KJEA 1IN4A 3BQMB 4ESOA 3IQDB 2F1RA 3TNYA 5LBTA 2W22A 1SY7A 3F9IA 1DIBA 3KRTA 3TTWA 4J0JA 1A4XA 1E3SA 3AYXB 1P7CA 5I7SA 4TTRA 3D7MA 5GJBA 4RV4A 2C9ZA 4TSKA 3PEEA 1X7HA 3DCYA 1PS8A 5ALMA 3FLMA 3W0LB 1KAOA 4CLRA 3PTAA 2O2ZA 1K3FA 4QDZA 4R6WA 4I1IA 5KTNA 2QX4A 3HA3A 3ABQB 1F06A 5JJLA 1A9XB 1SEVA 4O4IA 3ZW9A 4KE9A 1MO2A 2QZJA 2GFIA 2J9YB 4IG9A 1FLNA 4AQYB 2GVZC 2EZTA 3GARA 1FX0A 1PEKE 5BQXA 2QP4A 1KRHA 1CJBA 3DWEX 2RDMA 4JFAA 3OKFA 1M0TA 3MJEA 2C1ZA 4HY3A 1N2IA 1IWOA 2AW5A 2H65A 4RHFA 2RHWA 4G1VA 1XL1A 4PZYA 1US8B 1XVIA 3O9ZA 5EP4A 1EUDB 1R4ZA 1N0IA 3A4VA 4FMPA 4R7TA 4AMVA 2O8CA 2QHXA 5GMOA 2DBQA 1I2ZA 2QMEA 4Y1RB 4G1UC 5E7IA 4YIHA 3AF4A 2SKDA 1CJUC 3RC9A 3SEAA 2Z83A 4D45A 3MHPA 2AC7A 3OX3A 1U8AA 1ZGGA 3G89A 4EVRA 2UYYA 3S1LA 2IPAB 1NNI1 1GGFA 4PZCA 2AKEA 1YIDA 5JCPA 3OEYA 5KPDA 4AZ3B 1CUVA 2XQGA 2DQ4A 2Z09A 5KQSA 4Y2RA 4R69A 4CI9A 2H31A 1C8BA 3IIIA 3JW8A 4LSMA 5E9WA 3QLTA 1B41A 4ZVNA 3DGEC 3ANMA 1Z13A 1T9KA 1Z6XA 3LUGA 1K97A 3ELDA 4ZXPA 4HAZA 2PCLA 2C4VA 3ESAA 1T4CA 1RKVA 1JHZA 1ONNA 1SBCA 2ZRBA 1PG5A 3V97A 4L0CA 2XUZA 3W2TA 3R0IA 1AZLA 2JLYA 1QPGA 1ZM3A 2FQQA 5I8PA 4KOEC 3KFLA 1BE0A 5DGDA 4YUWA 5FPSA 1GNRA 2XGGA 2QQEA 2VNAA 4Z1MA 2DH5A 1WQ4A 1IEWA 2RHMA 1E89A 4K86A 1JQEA 1VPEA 3CNLA 1BWPA 4NPCA 3UT5B 4B5KA 3WO1A 3EPJA 1HSOA 1LDEA 1R18A 2AKAB 3ANNA 3BBLA 3D3EA 1JMKC 3JQEA 4JP2A 4MWCA 1FMFA 2UZ3A 1LBTA 2CJYA 4FHFA 4L8GA 5K3BA 5TVKA 4LF8B 3V8MA 2QUIA 4GEKA 5LYJA 1ONBA 4S2UA 1UPUA 4K3VA 4RADA 1AURA 3DAFA 2XB8A 3C43A 5JVDF 1M1YB 1GUBA 2WJZB 4LRTB 5J47A 2HU7A 3SQLA 4E15A 4FFPA 4AX4A 4J0DA 4X41A 5G4LA 1RI2A 5FUWA 3EGVA 3J81k 1P7YA 5TE9A 2GAIA 1XRRA 1MH1A 2P7HA 4OUDB 2NQ8A 3BMXA 3MWLA 4NV3A 1GPYA 1O9BA 1WSDA 1M5UA 1GN9A 1WXXA 2HIGA 1DIRA 3B2NA 1GFWA 3FCSB 3KXLA 3L8ZA 4YMSA 1W34A 4I6JA 4O4JF 5I7RA 1PLJA 2HQBA 4TS4A 3IAEA 3OMLA 2G06A 3TIIA 2O2EA 3FWHA 1NBME 4FFRA 3WQBA 1KEZA 1Z0ZA 3DWIA 3F4BA 4ZVLA 3LP8A 4F1JA 3FOZA 4O0MA 2A1TS 2DTDA 2I6FA 5FNZA 1WETA 4OB7A 2NAFA 2WSLA 3QLEA 4NWIA 2BMEA 1B1CA 1PTKA 3JXEA 1NONA 4EVQA 1PS0A 4QAJA 1Y89A 4KXXA 4BXOB 2X58A 3FFBA 1NT2A 4C4PA 3SYTA 2JD2A 3A7DA 1Z45A 2Y9MB 1CK4A 1USIA 2J5QA 1TAGA 2XNHA 1MXHA 3BXZA 3ECCA 4J0HA 3B48A 3IP1A 4OH1A 3MMZA 1OI7A 1CUAA 2IQIA 2OMEA 2ZGVA 4WA7A 3T0FA 2JLUA 3IEVA 1IJBA 1Y82A 1NU6A 1CR2A 2C3MA 2H4WA 3BFXA 3KL4A 2QM0A 3PICA 4IHJA 4NMWA 4Q16A 3W5HA 3DLPX 3DNFA 3CF2A 2IYUA 2O4UX 3DPIA 1E9VA 5FL3A 4F7DA 3IC5A 1ADYA 2HK9A 3FOFC 5LP6F 5AI8A 1YZKA 4CEJA 2B8TA 4KE6A 5EHNA 3UUFA 4BQEA 2E89A 3H5OA 4N8EA 4DXHA 2GZSA 1JR3A 2D7JA 1XTRA 4OLHA 4K87A 5HK8A 4EPXA 2IJGX 4L51A 2FOXA 2GD6A 5B3JA 3TGWA 1D6NA 1Y9AA 1JLSA 1ZZEA 2C2MA 3F7OA 3CW2A 4IW3B 2VEDA 3DKIA 1NRXA 3OM9A 3N6RA 5DYGA 3ADCA 1PZHA 3AG5A 1KSHA 1SIUA 1SUAA 1TW2A 2JJ2A 4FC7A 4KYIB 4LV5B 2PJDA 3JWPA 5DHUA 1N5LA 4IYJA 1UPCA 4RTQA 2IK8A 2RH9B 3B7WA 2EBUA 5BMVF 4L8VA 4QG7A 1QTNA 2FEXA 5IT5A 4E2XA 2WC1A 1ZIOA 4N47A 2ZI6A 3HB0A 1JEEA 3EUAA 3Q8XB 4M9CA 4BJ6A 2PGOA 3T06B 1MDBA 3GCXA 3K0CA 4ZVVA 4AMBA 1W9HA 3CKMA 3T95A 5KTMA 4M55A 3E1GA 3K2IA 4C4YA 3O26A 5C7LO 5FHRA 3PC6A 3A1FA 5SYAA 5KQLA 2FVXA 3FPLA 2ON6A 4DWWA 2RMKA 5ERYA 1MEJA 2W4IA 2I66A 4KJXA 2QU8A 1PSDA 2WEKA 2C8VA 3HKBA 4Q19A 3SVZA 1KZGB 1M6NA 3DHWC 3FFTA 1AGYA 4HXFB 3EPKA 2P5YA 3R4CA 1PR5A 3V2UA 4I8IA 2CDRA 2IP2A 2WHXA 3OU2A 2HF2A 4A26A 4BYGA 1UMDB 3DWFA 3H9BA 4RKWA 2FRXA 4ZT4A 3CRRA 1ENZA 3KKKA 4BFWA 5E6RB 3WP1B 4J4TA 5DOZA 4KQ2A 1XL0A 3BGWA 2GBPA 1YC5A 5JE8A 3OIDA 1S2DA 4M8SA 2ZT8A 4I99A 5IUNC 3G2PA 3QHAA 3R5JA 4AZSA 5CM2Z 4IIFA 3IUBA 5ILQA 5J1SB 1AV6A 2P4SA 2FV8A 1U2GA 3Q2OA 3DOJA 6YASA 1IEQA 3ZEIA 4MQBA 2VZLA 5ARCA 3ZHVA 1ZRHA 4FM9A 2MYTA 3RU2A 3ZQUA 4HNQA 3SEQA 4KZKA 6LDHA 1JQ3A 2QROA 1N1GA 5JH7B 3L7MA 3SQDA 2WWVD 4DCTA 1SKYE 4BP1A 3JYNA 1KYWA 2A8YA 4FIZA 3WZLA 3DE5X 5CYOA 2REQA 5D8DA 2BDEA 1VE1A 2WFMA 3H42B 4OUKX 1F7VA 1Z3CA 3GWGA 3OQNA 3VYTB 1BHSA 2E37A 2ZWVA 1QE0A 4LJ9A 5KIAA 1LLCA 2PGIA 1WDWB 2VUSA 1YMQA 2R6GA 4ZPXA 1L5VA 2AXEA 4U5XA 5CLHA 1JFFA 4ZCPA 5H4GA 1DKOA 1TC2A 2XB4A 1QDLB 2PFSA 1KMNA 3GNSA 3H5IA 3O4IA 4XWYA 4C0QC 5FT9A 5CEJA 5LR6A 2TRSB 3FBGA 1I01A 2CUTA 3OZRA 4KFCA 2WIDA 3H87A 3QU4A 2VHYA 3OH8A 4JP3A 4KSYA 1VRWA 2AF4C 2REBA 3OLQA 3OZBA 3JWHA 4OHKA 5T8KC 1TA9A 5JLJA 2H9YA 2Z1NA 1K89A 1AV7A 2IQ5A 3VRHA 3UJ9A 3K0HA 1TUGA 3LGXA 1MZVA 2FPGB 3L0SA 3FWKA 3HDVA 4NPAA 3H05A 6REQA 1L7OA 3CTMA 4XQEA 5TT0A 3TW8B 1E2GA 3CE6A 1BRTA 1GG8A 1T9GS 3S2UA 1QMPA 3PHLA 3AKDA 4LJ6A 2GETA 3CNHA 4FFNA 3VYSB 4IEIA 1W35A 3R7WB 1PJRA 1RM4A 4UAGA 1FP4A 3CX8A 4B6JA 4ZYVA 3BIOA 2ZJYA 4OKSA 3W6ZA 2VP3A 4AZWA 4ZQFA 3KSUA 3EFBA 3GEIA 1W4AA 1ODJA 1XXHB 1K6EA 2H2IA 2QTVA 4NS1A 5DH9A 4XGNA 4B3XA 3QHQA 4H6WA 3SC2B 4X8LA 4B3FX 4UJ3A 1JAXA 1KFBB 2PYZA 3ZG6A 4CIWA 4L75A 1Z6ZA 1UXOA 3H83A 4L76A 5T7BA 2BOVA 3CBGA 3HVKA 2P35A 5BWMA 2BGLA 4I5IA 4L16A 1ZD3A 3G59A 2H4HA 4TTPA 2X0FA 4ESEA 4JP1A 2QA5A 2F17A 1FRZA 1R1DA 3L84A 2JD1A 4O02B 1R3DA 3WTCA 2JFNA 2A5GA 5K0FA 3AM1A 5AOAA 4R9VA 2EP7A 4IINA 2HJSA 4CKEB 4R9NA 4FE7A 1MA3A 2CWWA 4DG9A 5EIFA 1T5SA 5EIBC 1GRRA 2IXEA 1ENYA 2WE8A 3NNDA 5DCYA 1G8SA 1B8VA 3A9SA 1COWD 2POQX 3GJ0A 4BZQA 2DUWA 5KZMB 4LF5B 1S96A 3UGTA 2D7CA 1ZG3A 3PCRB 3VR4D 3ZTWA 5JC1A 1QANA 3BRCA 3HZRA 5TF0A 4MPRA 2BEWB 5IRCD 3DT8A 3JQBC 1VPVA 3ROQA 3PD7A 4DCMA 4CR8A 4FDLA 5DTRA 4A6PA 1EMDA 5LKRA 1IQ0A 4RA9B 4JDPA 4WOKA 4LHWA 4B3TB 1OX6A 4Q3EA 2B8JA 2G9VA 5K0CA 3WB1A 1RHJA 2EC5A 2WG0A 3G49A 4WINA 1RBZA 5KS2A 1ADGA 2OEPA 5CA0A 1VTKA 1BDMA 4AROA 3LI2A 4B32A 4ZIRB 2PA0A 1Y33E 2NP7A 3BK2A 1ZIXA 3UWOA 3EVZA 2ZIEA 1C9KA 4EBFA 2QX6A 1JDPA 4N3CA 4Z1OA 1J8VA 1NLFA 3PJFA 4I2VA 2BM8A 1HK7A 3NU1A 4D9HA 4YP9A 1DQZA 3E9YA 2AKYA 3LTNC 1RYDA 5KSPA 4ALIA 2VAPA 5JQGA 3EH2A 5A71A 1WSAA 3LFUA 4ZKEA 1QO0A 4IDHA 1MG5A 3R0JA 2ORED 5A4MS 1AM4D 4W6QA 4DRYA 2ESRA 3OEEA 1PCXA 3Q5DA 5REQA 1SBIA 3FYTA 421PA 3Q6MA 2W00A 1A4RA 5EE5B 3AVVA 4INZA 4AC9A 4Q7LA 2ZQ5A 1A97A 3U7RA 5I01A 1V7CA 3K7EA 5GIPE 4I4TA 2I6TA 1BWSA 2HLDA 4JUIA 2FZLA 4BPRA 1NJ2A 3IT1A 1VXRA 4LX8A 4C6RA 1V3QE 4BNWA 3K70B 4KU4A 3G5TA 2CZCA 2ZTVA 3HWSA 2PX6A 4L07A 1IK6A 4G07A 4XWKA 4OA5A 3K20A 5AW2A 4LCJA 1NURA 2Q5EA 4PIMA 2BRUC 5DYTA 5KSZA 2VSOA 3H4VA 3KVNA 1Q0UA 2XMRA 2GOYA 3AIKA 4RUKA 3W3AA 4O2AF 1G41A 4BTEA 3ML1A 4KWTA 4ZDKA 4CEHB 5JU6A 4UJ5A 4RK0A 3IESA 4RHXA 1QRUA 2BKUA 1Y80A 2EATA 2PLWA 4J94A 3T7TA 4WFJA 2R2AA 2PE5A 3LUFA 2VJYA 3ZD7A 2AI3A 1XO1A 1GU1A 1VSQA 1ZUNA 2AE2A 5TJ9A 4KVFA 5AVWA 3GCZA 4A03A 1G2IA 1UP6A 2VP2A 3KB1A 4CMKA 5IASA 1J2YA 4IFIA 4PLGA 3QJYA 3FPKA 3UMYA 2A5FA 1USVA 2DKOA 2XIJA 3T38A 2RGRA 4D3DA 2IU6A 4LWZA 1TVEA 3LIPA 4NKRA 3M9XA 1KJQA 3O8DA 2X9QA 3NHRA 4MJXA 4DNPA 1T4MA 2UVDA 3TUIC 1L5HB 1PT7A 4G4JA 3D8RA 1PYDA 3DVAA 4CNBA 4IZOA 4CV3A 1JJ7A 1UKYA 3FPBA 2YUTA 3FMVA 1T2EA 2NO6A 3F90A 3LVRE 3PGMA 4FMBB 1AGRA 4IUDS 5GONA 3RE1A 3SYNA 3KXKA 1NY6A 5C3UA 5BUQA 3D0OA 3NKFA 3V48A 2HN9A 3L77A 1TDJA 2B20A 4PLCA 3IBCA 4LHVA 5L3QB 2JZNA 4GX2A 3DZGA 3ZWWA 4W9NC 3P9ZA 3DXZA 4KP7A 4NICA 3VZBA 1KQOA 3DV2A 3ZW7A 4BNVA 3QMMA 1M34E 3TTSA 4QUBA 2Z9BA 5JAHA 1TMKA 4LXXA 4WASA 3I05A 1EUQA 2IGTA 2D5CA 1ORDA 3JQ6A 4CYMA 2D5BA 5JBNA 1YVEI 1ORTA 1NMSA 5AI5A 2Y67A 1B15A 4JS0A 3EIWA 2R0QC 3U40A 4PY2A 4PSUA 1JEYA 3A6GA 1CR4A 3TPZA 3TCKA 1YJBA 2PCJA 2XVZA 1L3IA 4LNUB 5K45A 2OG2A 3I37X 3QF7A 4MVYA 1GCGA 3PQ2A 2AEFA 521PA 2QJWA 3H2SA 4UKDA 5EIBD 4QRIA 4LJYA 2YH2A 4UBMA 1O3YA 1Z6YA 5EINA 4CCAA 2MHCA 3RANA 4AU1A 3H2GA 4YQYA 1GQRA 1XZMA 1P75A 2VXCA 3NTOA 3TQQA 1W49A 3ISVA 3KHUA 5ALKA 2X19A 4TGLA 5NLLA 3T0GA 5ALYA 4DF3A 4IKOA 1DOHA 1YAHA 1GSOA 3IQEA 3RSHA 1FFAA 5ALUA 3TBKA 3IELA 4IWYA 2BKAA 4YA6A 3ZDEA 3Q6NA 1Q1EA 4J6FA 1GPBA 2A9OA 4YMGA 1VL1A 1IONA 1X9HA 3UQZA 2BJWA 2O59A 3FTNA 4TMWA 5DYIA 1QQ6A 1N5DA 1JV2B 2OWEA 1ISPA 2C4UA 2B1QA 4H16A 5EQTA 5CJ2A 4MR7B 2PSSA 1VSVA 4OBBA 5THKA 4EQ6B 2IHZA 3MWFA 1YQXA 4G09A 4IIJF 2HRRA 1G3IA 1GCAA 1AQIA 2WJHA 2OV1A 2XE8A 5DGXA 1EXMA 1NVVQ 3TL6A 3WV4A 1JJFA 3TM5A 1XUOA 3O9VA 3D2AA 1QAOA 1S2NA 2OCLA 3T52A 4EZIA 2CGEA 4XD7A 5EHXA 4FEYA 4WBNF 2D1YA 3K2BA 4IDOA 1YCDA 4IJMA 1QG2A 3QA9A 4N5DA 4E4TA 1GZ7A 1ODFA 1K06A 2WFLA 4P5EA 3QWAA 1UL1X 1H69A 2CXHA 2RHGB 3B5EA 4KMRA 4YJFA 4B3JA 5KTTA 3VYWA 3T4PA 1WMAA 3GNQA 5JD4A 5T67A 3GEEA 4KPEC 3BFVA 3G8AA 1QZUA 3HSSA 8OHMA 1OASA 1ZP6A 2YC2C 4FPXA 5BR4A 5MGBA 1JJIA 3DVRX 4J7CA 4PLVA 4JI2B 2VZ8A 1DB3A 1N2GA 3PDCA 5K8VA 5ETJA 2B4YA 1XZIA 3V9AA 2NPIA 4MNTA 2CNWD 1SD1A 5F1KA 1QIHA 5KNCA 2WQ7A 3A2LA 3E35A 1KZ4A 2BEUA 3ETLA 4YRQA 1SULA 2PZLA 3G1UA 4C5BA 3WDSA 1CQWA 6GPBA 3SWWA 2C82A 5ICFA 1QTQA 2DHCA 4RS3A 2AN1A 1CP2A 1JXQA 4BYMA 2RG7A 5DGTA 4BV3A 2VJNA 1I80A 3F6YA 2IF2A 1QJ4A 2OCPA 1A9QA 5G0WA 1XPUA 1DIHA 3RAEC 1XTKA 1LFAA 1TT7A 3S2FA 4XUGB 2I6QA 1U31A 3L7IA 4BX0A 1LK0A 1KKLA 2ZIAA 4X6XA 2R1VA 2QZSA 1OYWA 1DC3A 1C0IA 2QM7A 3D8UA 2AC4A 2PPVA 2HCFA 3IBSA 3ORFA 3WC4A 1KYYA 1AUQA 1KEVA 4GBMA 4XJXA 4ZOLF 3UPTA 2ADFA 4P7FA 4YECA 4UUAA 2CXUA 1QNFA 4MVJE 2ZBDA 4EW2A 4H2DA 3R76A 4C4RA 1ZS9A 2E5WA 3RJ9A 1E2EA 1YS1X 1KAMA 2RHCA 1X7XB 5IBCA 3I5XA 4CDRA 1PNTA 3CX3A 4NK5A 3WJ1A 3GLGB 2C7PA 3O3OB 4Q12A 4I08A 1U94A 1CYDA 2W2QA 1GU7A 4J3JA 4UVHA 5TC4A 3PLAE 5IDVA 3STWA 2DWQA 2YFYA 4DPKA 3ERCA 1BZYA 5JAUA 3K70C 2GO1A 4GSYA 3UMGA 3P9XA 2GDZA 3KO8A 4PN7A 3PEWA 3UAWA 4KBFA 1C1DB 1NFFA 2V0CA 2IITA 4UHCA 2OILA 5KWSA 3ZOKA 3PYMA 4IHAA 3T12A 3DBOB 3HI4A 1POWA 1ADJA 4O6VA 2GF2A 4IP0A 1OH8A 4E30A 5F33A 3DZDA 1CHNA 1VFNA 5D5HA 3AVTA 2C98A 2PKYX 4B7ZA 2QTAA 3LLCA 5EESA 1A0OA 1ZXLA 3P5BA 4BKQA 2IUYA 4C1NA 2FW6A 5KNDA 1U2ZA 1WUKS 1VIMA 3T4EA 3EH1A 3HUUA 3C5VA 2I2XB 4DAEA 1I8TA 2Z3VA 4EYQA 2E4VA 2V5AA 1BH6A 1H2HA 1I7NA 3I2IA 4PQEA 5JR3A 1YCHA 2D1FA 1OX4A 2BHTA 2F3UA 2QY9A 2JAHA 1VDZA 3D8NA 1PVOA 3FHTA 2AJDA 1Y8QA 4UVIA 1W4BA 4V02A 3CZRA 4YRJA 3RS5A 2D74A 3D31A 5HFAA 2G1PA 1HE5A 1T3ZA 5BT9A 1NZFA 2FPOA 1WDTA 1FB5A 2XOXA 3DDWA 3U31A 4NARA 4ZO7A 3ZWOA 3A28A 3QYPA 4DMLA 3H5LA 3SF8A 1G7CA 5JI3E 1ECJA 2OZEA 3EFEA 5KYYB 1O0SA 4BMXA 1E98A 2K2QB 1XFDA 2HV8A 1Y4ZA 4Q4HB 2CT8A 3RRNA 3H1BA 4DLUA 1KAEA 3D2BA 1YACA 2HHAA 4EPTA 5AIBA 3X1WA 1V6AA 3CMMA 1UMBA 1XDSA 5A04A 5DSTA 4ZI3A 2IU3A 4RA6B 3P7MA 3U4IA 3RVMA 1SXHA 2AA3A 3LU1A 5GJVC 4EHJA 2EVWX 3GGGA 1YRAA 2A33A 4II7A 4JJKA 1UDCA 3TLCA 5JO0A 1RWXA 1VYVA 3QV2A 5JVDA 4ROSA 1W5FA 3H04A 3WLKX 4B2LA 1MRZA 3WKDA 4C3UA 5K03A 1DWOA 4V0KA 2VIIA 4D9BA 3CIOA 3VH1A 3DVQX 2I1QA 4UOQA 1UDRA 2NZXA 1SBTA 4YAWA 2J3QA 2GPNA 5A4IS 2GXAA 5DT9A 4EYKA 2JIPA 2OLJA 2WA2A 5EJ8A 1TM7E 5B6PA 3T7RA 3C85A 3BFPA 4BNXA 4EFKA 2YBEA 2JBAB 3QX8A 5K3EA 3QFHA 4DIDA 2CV0A 5BW4A 5FAKA 3USES 2G8NA 2EJVA 3DFUA 2NU6B 1YSCA 2H7VA 3GWZA 3BCUA 4NENA 3G13A 2WK1A 2AUNA 1HBJA 2VQ3A 3P9KA 1PBNA 4R51A 5KYWB 3BJIC 3U9TA 1D0SA 1GAEO 2DHEA 2I9PA 3KBBA 5KJ1A 2ZB7A 4PC1A 4JXJA 2DP4E 3CRW1 3D4BA 5HVNA 1W59A 2RI0A 3RBXA 5HQ3B 3T99A 3G68A 4PHCA 3AVPA 1R7RA 5ITZB 4DR1B 3U44A 4NDZA 4JY7A 4ARUA 2JCGA 2YINC 5ALRA 3H2BA 3LTEA 2O2JA 1VMEA 1IZ0A 3TINA 1H2BA 4LEIA 5IC5A 3AF2A 4EECA 5LNK6 2WWWA 1EQAA 1Y7LA 5IEBA 1JHVA 9ABPA 1CZNA 1EB8A 1U3FA 5C31A 4XUCA 1M2KA 1E3MA 3AM5A 1EUYA 4B2IA 2Q5JA 1ZOIA 3C1UA 4P3XA 5A7GA 1B3BA 1RYBA 3GUHA 2DPYA 4N5NA 3TM4A 5CCBA 3F78A 4AECA 1JFTA 3RASA 3T3EA 3W5BA 3SOPA 2PGNA 5EUBA 4LJRA 2CLFB 2VUIB 5IVHA 1QIJA 4M37A 1MOSA 3DEYX 5FBRB 3TLJA 3WBFA 5KOJA 3D3NA 1BHJA 3A1DA 3TNFA 4B2PA 4TSFD 2ID4A 1AKRA 1PGPA 3LPNA 4GOND 1UPAA 3NHLA 3LQYA 2YWRA 3DL2A 4ES6A 2R87A 3A4IA 3A7EA 1EHIA 3MJRA 4KKXB 5DX0A 5AW7A 3VXKA 2ZSJA 5CLGA 2O2XA 5BMVA 2PXHA 3F98A 4LE2A 3W9SA 1FQWA 2FMTA 2H1IA 1O1YA 4X84A 4IX1A 5H9VA 3ZGVA 2I3AA 2IOFK 1RU3A 4BDTA 2FMFA 4C07A 2KBFA 4LDJA 1Z6QA 2I6SA 2HBRA 3G5UA 3LBHA 4NDNE 4ZYYA 5B57C 2BGWA 3OBBA 3S2GA 4Y2PA 1MUUA 4CLEA 1XD2B 4N76A 2ZIUB 3O95A 4UFPA 1ZD5A 4JI3B 2D5IA 3O3MB 4MARA 1D0VA 3IRUA 3JAMA 2GCGA 5ADWA 4HADA 3W04A 1N2CA 2VJMA 2ZM5A 1XZKA 2VAVA 4DB2A 3VNVA 1HNWB 4CMEA 4RHEA 2P7IA 1V43A 4LE0A 5JNSA 2DFVA 3P9RA 1T6XA 3ILVA 1I7DA 1ZH0A 3HFGA 2X5XA 4TS1A 3WHPA 1W85B 2UYOA 3HADA 3JWIA 4KLAA 3GUCA 1UXHA 4QIHA 5ALHA 4TKUB 5F12A 3R3XA 2VNJA 5KTKA 2D00A 1MPXA 1OU4A 4OK5A 1R4NA 1SM4A 2O7NA 2VN8A 4ZTUB 4YREA 4JUAA 4IJQA 1PHRA 4AQ7A 1IMOA 2CMDA 5DBIA 1I30A 4ESHA 1QOQB 4NCKA 1BVRA 2Z2KA 2GYYA 2QD5A 3DEZA 3KD3A 4V2UA 5TDHA 3V1MA 3B1VA 3OESA 3EWIA 5HF5A 1F8GA 4DDTA 3IHWA 2IVZA 3NLLA 4KN8A 4RJIA 1P1RA 1GN8A 3P9YA 4OP1A 4YWJA 3T1HB 3BCHA 4I50B 4XGQA 4XGKA 5EJ5A 5DYNA 3TD2A 4P80A 5HWSA 2HT6A 4IBOA 2PUCA 3DFIA 3M1LA 4GPD1 5DDIP 1C1XB 1DXOA 1CRZA 1HEIA 3SJAA 2VCEA 1ZVJA 4K9PA 2V4MA 2V7XA 4GC9A 1GZ4A 5DLYA 2VJPA 5F1PA 5P8WA 4DRZA 1CB7A 4ZGBA 1I2BA 5K09A 2JLXA 1SUBA 2GPTA 3NEJA 3PD0A 2J9FB 1SHUX 2D1QA 4FMDB 4ZGGA 2NT4A 1T0JB 5A0TA 1JSCA 3C3BA 3WMRA 5F2NA 1XYVA 4UOEA 2E4YA 1N25A 4LFBB 2VXBA 4S24A 1E99A 3T5MA 1A04A 3TOXA 4DC0A 5A5VA 3TIVA 3HY3A 5KCZA 2PUGA 3ZDAA 4IQGA 1HGXA 2WJAA 3C3YA 3OZVA 4ERXA 1T1SA 5JASA 3F8SA 3QYJA 2Q1XA 1FXUA 2QSUA 1L2TA 2PKRA 3GRCA 4A4DA 5A3JA 1U28A 1HETA 3AI7A 3BXEA 1TD9A 1Z0DA 2VJCA 3LC7O 4L9AA 2P1ZA 3A1SA 3W8DA 1M2OB 1UBMS 2OZVA 1JFSA 2R62A 1QB8A 1RMTA 4JKIA 1YIAA 2H2AA 4QA9A 3ZLVA 3ITNA 3ICQB 4O8ZA 3ZNPA 4I3FA 1G6HA 1IQPA 5HMMA 3KQUA 1GZVA 3IPXA 4GVXA 2W98A 4KSCA 5IAKA 5BO5A 1X86B 5HXAA 2CVFA 2AXPA 1I6MA 3CPSA 1ZIDA 2Z4RA 3D2LA 3AG6A 3K8QA 4C0WA 5FQOA 2YYAA 1F5SA 1YULA 3GLHE 2XCLA 2A57A 3T5GA 8ATCA 1BNCA 1ZUD1 1QGAA 2M1XA 1DX6A 2PZEA 2HO5A 3DKPA 2PSEA 1LF0A 1VCHA 1RBYA 3PUKA 3BSWA 5G4KA 5JRJA 3IBTA 4B48A 2WJPA 3PFFA 1A8QA 1T5OA 1JR6A 1NYLA 3NCHA 2XMGA 1VJDA 2FA9A 4J9UE 1EVEA 3IQXA 4G0NA 1OKKD 3KZKA 4KAXA 4BO2A 4XA8A 2WIJA 2X77A 4CG1A 2C95A 3PNBA 1V37A 1Z9BA 4TLBA 1C0LA 1KI2A 3HEBA 5AVZA 3RO7A 2Q0XA 5KTYA 4C30A 5CD1A 4P86A 3FRJA 1GXSA 3RJZA 2Q6VA 3G2IA 2BI4A 2YWBA 3IEMA 2EARA 1EP1B 2WM3A 3VUEA 2GCIA 5LFAA 3RBZA 4S05A 2VTKA 1CY0A 3HXMA 3HKCB 1S4QA 4GRIA 2VPIA 2VQSA 4KIWA 1XAHA 4DSUA 1AB5A 2COKA 4FE4A 1C30A 4WV3A 5JZMA 2A0WA 2CD9A 3OLWA 2GN0A 2R4UA 4RZ2A 5CJPA 1KPHA 4LJSA 1Y1RA 2AJLI 2G08A 2R1TB 4K05A 4ZREA 4A1FA 2FSVC 2M6KA 3JV7A 3V4PB 2M2IA 3IUEA 4EB6B 4WDQA 4BWGA 1E94E 2NUTA 4MKGA 4AP5A 4M21A 2IL1A 4TV8F 5SY9A 3VO8A 1CV2A 1Z6PA 2JGRA 3BMCA 4AJLA 4U7PB 2IW3A 3ACDA 3L8YA 3GGPA 5I4IA 1IOLA 3ZHSA 1QQTA 2CLEB 1Z6GA 4L5AA 4B45A 2G36A 3WP0A 2C83A 4P1ZA 1HNNA 2H16A 4WZZA 4H77A 2O2GA 4WLUA 4WJZA 1FFGA 1FYEA 4MQLA 4MV6A 1EQ2A 3IUMA 5K4AA 4B6OA 4HQ0A 4KWEA 1CJSA 4PLZA 1D4FA 3K8OE 4QYIA 3L06A 5IDQA 5EY5B 4DR6B 4PS0A 3ABOB 2Q2VA 2WAYA 1EM8B 3CXRA 3EG5A 1GR0A 3LP5A 4RM2A 3T61A 3K6SB 1BDBA 2Z8XA 2CDAA 2PZFA 4FFLA 5LB4A 1XLTC 1DEOA 1UK6A 2Q1UA 1SXJA 3KQVA 1ZXXA 3ZU2A 1U0SY 4E88A 3L7NA 4F12A 1C2YA 3B6IA 3F9RA 4NBWA 3SZGA 1F5NA 3LWNA 2PL5A 3AHIA 2AB0A 2DTEA 2DWOA 3FDZB 4Q15A 5DI3B 2CFIA 1EFCA 1CVIA 1I1OA 4CHGA 1HE8B 1YL7A 1WJGA 3GPBA 3R9XA 4JOBA 3RM3A 1Z63A 3A25A 3LUAA 5BR7A 2QRQA 4OGKA 4X5OA 5EZYB 3SVLA 2R65A 4XVUA 4BFYA 1ZMXA 2GERA 1DFGA 3BXPA 1X0XA 3M6VA 4PG8A 4JWKA 4IJ6A 1RWQA 1PLKA 2FJPA 3EUEA 4G4SP 3G7UA 4MWSA 3T34A 4DLBA 1U0TA 1Z0AA 1HC7A 1SVUA 4NCHA 1NASA 1G7SA 3KTFA 4F8EA 1Q19A 4TTTS 1HWYA 1QUEA 2JVKA 5B36A 1B23P 3G0IA 4HEA6 2ECPA 2NTNA 1ULSA 1XCLA 5AJUA 1AG9A 5BRNA 3NBQA 4JJ7A 4EJSB 2PGJA 4O2AA 4ARZA 4DG8A 2I1VB 3Q9SA 1M7HA 1X74A 2Q27A 4RF2A 1YR6A 1NJ8A 1F2UB 1U2DA 2FXIA 2P2SA 1MB9A 4PIPA 1WCYA 1ZLYA 2HZ7A 3F5DA 4Q05A 4R8VA 3SQNA 3TSCA 2IH5A 1WE2A 3LC2O 2RGNA 2I0FA 2OSBA 1JKJA 1KI1A 3ROGA 3VI3B 2IZ1A 2BR4A 4FEEA 1JIVA 3FI9A 1JMVA 1CUJA 3G5LA 4NYMQ 4G0WA 3AY6A 3OE1A 4TRMA 2B37A 4EYGA 6AT1A 2Q9CA 2ZRIA 4C6TA 4ENTA 1RXWA 1E9RA 1AZSC 1TIKA 3MLBA 1K3UB 4G5GA 2IHBA 3SICE 1X7WA 3KQTA 3MD0A 1U6KA 4P83A 4QRHA 5DTMA 2GRJA 4M0CA 1ODIA 5A9SA 5E0OA 4LJ7A 4XTRA 5BN5B 3TG2A 1JF8A 3EXHA 1GT6A 4XLTA 3EDCA 2QGNA 3NV7A 4YLEA 4JUBA 4BZWA 4NNOA 2FWPA 4J0FA 3HRKA 2GLTA 4DLKA 1YB5A 3BWVA 3ND8A 4ID9A 1H8HA 3Q7SA 5DFAA 5FV7A 4REMA 3FUUA 4TZKA 2UUPA 4TYWA 3MTDA 4X1IB 3VNUA 4RTJA 1MQ8B 2OM2A 4FT4A 1HE2A 5CG1A 4BB9A 4WHMA 4HP8A 3LKBA 1C0PA 2XZDA 2BBOA 3PT5A 821PA 3U19A 4FNAA 3NKLA 5LPNA 1Z7GA 3C70A 3GEDA 3PDIB 4RDHA 1RP7A 1U3TA 3TTXA 5L3RA 1SKAA 1B73A 1KR5A 4G8JA 3M4XA 4Q3OA 5B12A 1FS6A 4LQCA 2XA1A 2Q3HA 3TBHA 3A2NA 3PENA 1JTEA 1HZZA 1KVRA 2OGUA 1JEQB 3F3MA 4NZMA 4LECA 2A4KA 3SD7A 3U4AA 3S6JA 1BTOA 1KO1A 4RYDA 1ZGCA 5C4IA 1G20B 5CB6A 2VHCA 4BO9A 2IWHA 3U0VA 1BAPA 5K6AC 3G6KA 1SVWA 3TR0A 3WGOA 1NLYA 4XCXA 4ZVOA 5I9MA 3VU8A 1KIFA 4C0BA 3MAJA 1LPNA 1U2TA 1VHDA 4QAQA 4F6RB 4IWXA 1NPYA 1P1BA 3OQMA 2RI1A 2NU8B 3NJ8A 4IUCS 1RKQA 1S02A 3KVRA 2C03A 2QE6A 4PBTA 4HQLA 4KQ6A 4OJKA 5EIOA 4IIVA 4CE6A 1VC2A 4KIJA 4LHZA 4R9UC 3ZDFA 1WWKA 4F45A 5MDHA 3U6KA 2QBYA 1EFUA 4WVFA 2NV0A 4OJMX 3WWEA 3I6IA 2CVOA 2NYVA 3NM5A 4DIKA 4F9TA 2JLBA 1ISSA 1Y8RA 2Y0CA 4OK6A 3HR4A 5BOSB 2G63A 2GPWA 3PRYA 3DXFA 3SE7A 4IIJA 3GEHA 3VR3D 4A7PA 1L7VC 3WICA 3WA7A 3EVGA 2O2IA 1F51E 1E63A 4BGIA 1E5QA 3NHZA 4D9GA 4HDNA 4WK0B 1NN0A 4DQUA 2B25A 2N1BA 2OGZA 3CZ5A 2A94A 3N74A 3ONWA 4QBTA 5FUYA 4COOA 2CN1A 2AFHE 4AT1A 3AZPA 4AY6A 4X20A 2BELA 1UH5A 4HAIA 3PUXA 1CE8B 2AZ4A 2PSDA 1CG6A 2G5GX 5HMLA 5J2TF 5BSRA 4D7AA 5LQSA 1P61B 1VE9A 3G3EA 1L7MA 3LUCA 4GZ3A 4L5YA 3CWCA 5U1PA 2CXXA 1VPDA 3ZXSA 4U2DA 4BJ5A 4HVLA 4XX1A 5I51A 3HCRA 1AK9A 2QAIA 3G9XA 4X60A 4G0XA 2EQ5A 3AVQA 1YOBA 1QXSA 4OL0A 1LTHR 1YI8A 1O96A 2CYAA 2RGGA 3ZDYB 2HA2A 4PNHA 3UH1A 4LY3A 5FORA 1PEYA 2OHIA 1SN7A 2G04A 4PCVA 2QTMA 3Q5EA 4MUXA 4KXWA 5AW0A 1JYSA 4QLOA 4UNPA 4MWTA 2A5LA 2WWYA 1YR7A 1PT5A 3TW6A 1W1IA 4KN6A 2ZATA 2R60A 5ALWA 2IYQA 3ENKA 3GCWA 4ZWNA 3ZLBA 2L19A 1NKTA 4BIIA 5DPMA 5I7WA 3KWLA 1KJNA 1KDRA 2BONA 4Z9BA 2O3RA 2ZDQA 3MMSA 4GOLD 1GARA 1LCIA 4HEJA 1BN6A 1XTTA 3RLFA 3F3YA 4IS3A 3IL2A 4Y0AA 1KSJA 1WKBA 3EEBA 1DARA 2H1LA 1MT3A 2JW5A 2J48A 2ZSDA 1CULC 1SB8A 1N6LA 4TQ9A 2WJIA 3ICWA 4EBBA 2VWPA 3QFCA 1Y7PA 4J7AA 4HT3B 1LQ2A 4BP8A 3BXOA 1J42A 3ZVKA 2ZSAA 1ZNWA 2EG9A 3SYMA 2D6FA 3OIWA 3IO3A 4TS3A 1G1MA 2YMMA 4ZANA 2NUAB 5JROA 2FHSA 1SXQA 5JNVA 4YO8A 5G1PA 5LQJA 4C05A 4E12A 1QIDA 1J2JA 3A1TA 3T1QA 3CNNA 2IBMA 1JZQA 3QSGA 4RGYA 3WGVA 1TMYA 3VGPA 1LTKA 4JD5A 4KWCA 1EK6A 3H0KA 5AH0A 7YASA 5EAIA 1XNGA 2PRJA 5TJHA 5AUNB 5AVQA 3CUYA 5FOUA 1HX7A 4KMSA 1M1XB 2ZVQX 3CJQA 3I6QA 5CK5A 2AHRA 5JATA 1ZAKA 2PY6A 3INNA 4MW9A 1E92A 1XN4A 1DO2A 1M2GA 4B74A 1DKUA 3DFKA 3ZTTA 3JATB 3IVAA 1E4EB 1NVEA 1SKQA 2JGJA 2B69A 4K28A 1PFQA 4PTYA 4BWVA 5BV2P 4ZOEA 4BP3A 2WKQA 3GVXA 3X1KA 4Q39A 2F8TA 2JHFA 4GL4A 2WLTA 2XYHA 3DUFA 4LDZA 1GQOA 3L6RA 3RYTC 1XRQA 1YE3A 1C1YA 1FS5A 1SC3A 3PNYA 4S35A 4XCQA 3JAKA 4ZHQF 1FSZA 2YJZA 5LBUA 1AIPA 1VBKA 4I3HA 3RC3A 2M6RA 1Z5PA 2B94A 2JRCA 1PJ8A 5ALXA 3F74A 4KHPB 2XECA 3GQBA 4P08A 3EISA 4BWYA 1KDOA 3NALA 3JALB 3GHYA 1CUZA 1RZUA 3O83A 5DM0A 1C50A 3F5SA 1KFEB 3PUZA 4EEZA 4GEGA 2C7OA 2Y1XA 2XXAB 5EWMB 3SQXA 2XD4A 4R6XA 3TB6A 4JSYA 2XTMA 1NBAA 5AW1A 2X2PA 3CW9A 4MHSA 4UHJA 1RSZA 3JZFA 5KBYA 3QRWA 3FOEC 4FUTA 4EA9A 1PYGA 5IN5A 2GXSA 4GZ5A 2C4KA 3PFCA 3DUWA 5DRYA 1NVGA 3TWOA 3ZUGA 4AJEA 4CXMA 1ZKDA 3QVTA 2QMHA 4KV7A 3R3UA 4TL7A 1G21E 2CDCA 1V16B 4ZA2A 1D1PA 3RU9A 1C7ZA 1E3WB 1FZQA 1IAQA 4XWTA 1OGYA 1UIRA 3EPLA 1XTQA 1FBTA 3BPSA 3O3CA 1A1SA 1QCDA 1TL7C 1GL3A 2O5VA 4RK5A 4YCBA 5I8ZA 5IWAB 2P9GA 1UPBA 1QHNA 4Q82A 4H7HA 4LQDA 3SIWA 3IJRA 4RPGA 3D3WB 1SG9A 4XOIA 1C4XA 1N2BA 2Z04A 2QTTA 3VVMA 4QQNA 1EP9A 5L7WA 1F0PA 4GXQA 1U02A 4JVLA 2YZKA 1OH5A 5D84A 4ILEA 3DCJA 1KC3A 1R6VA 3TVYA 1R0BA 5ECGC 4C43A 3MHTA 3U7QB 3CZPA 4A0GA 3LKZA 2ZYTX 4GMGA 4J16A 1XNHA 2HWYA 1GPLA 4BTLA 3KEQA 5CNMA 2FI1A 1Q84A 4QVIA 3CNBA 5NULA 1H1LA 4I1PA 1P7WA 1QGOA 1PT8A 1V3TA 3FWPA 4K9RA 2XQVA 3O0DA 5CUQA 2WUFA 1NG1A 1KGDA 3RCBA 4AM8A 4AXXA 5K6RA 3E22B 2NTEA 1VE3A 1GZSA 3QBTA 1ICIA 4DOMA 2CZQA 4EH1A 4ERNA 4XVRA 1C9MA 3KT0A 4G5HA 4FFMA 2EJUA 2OE2A 5KB3A 4CCWA 3R3YA 1CZRA 2BDTA 4EX6A 3BJZA 1XBTA 3JVVA 3OTHA 3WNVA 2WINI 2FQ1A 2Z3ZA 3D4PA 3V3TA 3TLYA 3VNQA 1W25A 1U3DA 4OSEA 5JO9A 3IQIX 3NUGA 4MQEA 3QKSB 3R6WA 5I3ZA 2NYUA 4F6CA 2G82A 1KK2A 3WYCA 3DXXA 2C8JA 3SGLA 1T1JA 3CEHA 3VH2A 3ZGOA 5HG0A 1S01A 4NQZA 2FKAA 5TGTA 5ENZA 5FADA 1I3NA 4GKKB 5LIRA 4UHFA 1MIOB 2HPZA 1J2RA 2JCXA 4EWLA 3TLAA 5I7FA 1XRSB 3GMDA 2WVJA 1EFVA 3K9HA 3QKIA 2VLBA 2QNRA 1CT9A 3DTVA 3KOXA 5TQ0B 2X8JA 2AFRA 4K2AA 4RTNA 4GUDA 3KS9A 3Q9LA 1L5LA 4Z3OA 3FYUA 3ADDA 1ISHA 2VG8A 2OXCA 4G5SA 2O5CA 3NV9A 3FMPB 4WKCA 1U4SA 1GV1A 1NTRA 1Y8AA 3GLFA 2CF6A 4XYMA 5BV1A 1AQ6A 1CBUA 1A7AA 4K9LA 5AVSA 4CG2A 1TUEA 1EHYA 1Z4MA 4QT4A 2EDCA 1VCIA 5DOVA 1Z88A 1YKFA 3AVXA 4B1FA 5BN4A 5EXPA 2TMKA 1W36B 3MPOA 2XF2A 4XUDA 4MYHA 4Z8XA 1CY1A 1QF7A 2OQRA 4YX9A 5B3LA 4Z53A 1YQ9A 4ETIA 5BURA 3FKJA 1E1NA 3GL9A 4G8DA 4JNCA 4X6UA 4H1UA 4G89A 3D8BA 3TRHA 1H05A 1ZBDA 1E1KA 4RXUA 2GFHA 3UHJA 1DKPA 1SU6A 2I54A 2OENG 1H4TA 4G8BA 1PL8A 5AK3A 1T1IA 3UJAA 2C78A 3MN1A 1WPQA 1Z38A 1T2NA 3V1KA 4H0CA 1OU0A 4RNCA 3ZWVA 3NYIA 3U5ZB 2BGJA 1GRNA 2V74B 3TZKA 1GITA 2O7SA 5T3YA 5ARBA 2HGSA 4RJJA 3U3KA 1HFJA 4JYPA 2WU0A 2I7XA 3ZCRA 1JH8A 4LXIA 1F0YA 4RFSB 2IYRA 1GZUA 3M1AA 4K40A 5DVZA 3HXQA 4JHLA 3OX4A 1XWWA 3RBAA 2WJVA 4I46A 3TSYA 2XDQA 5MF6A 3VPHA 1SBQA 1WEHA 2GK4A 2GBFA 2B1IA 2YW2A 3M34A 3ZI0A 4NZ9A 4EG4A 4KBYA 4Z4FA 3KKEA 3P0HA 4PFSA 2A35A 3HJRA 3VPAA 5DX8A 3W2EA 1EYZA 4X1YA 1VKZA 4TKVB 1CY6A 3WOVA 4O3MA 1H3FA