3BWMA

Crystal structure of human catechol o-methyltransferase with bound sam and dnc
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
214
structure length
214
Chain Sequence
GDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal structures of human 108V and 108M catechol O-methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2008-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bwmA00
2BZGA 1WY7A 3OU2A 1VIDA 3KPYA 1RJFA 3MTIA 2ZLBA 1QYRA 3DULA 3P9KA 3KQOA 4R6WA 3TQSA 1YZHA 2PXCA 2V7EA 3ORHA 4OQEA 2YQZA 1VE3A 2AVNA 2JH8A 3BGDA 3ELWA 3JWHA 1R6AA 3LHDA 3OE4A 1YUBA 2C7QA 4R8SA 2ZCJA 4RTQA 2IIPA 4OBXA 5EZSA 4HTFB 2E5WA 1L3BA 4YUXA 1L3CA 2AOTB 2B78A 5K0NA 3IV6A 3BWCA 3SSNA 1SUIA 2YUIA 3A4TA 1SQGA 4CTJA 1JSZA 5FTWA 3KU1A 3C3YA 4WXHA 3HVHA 1NV9A 2BH2A 3ER8A 3B89A 5G02A 5EPEA 3CBGA 1BHJA 4E32A 1I9GA 1VPTA 5EMJA 5ICGA 2OB2A 4RTNA 2YTZA 1RI3A 2P3QA 4PCLA 4FT4A 3LECA 1SQFA 1AF7A 3HVJA 3IYLW 2EFJA 1I4WA 3TKYA 3X0DA 4F86A 2JHCA 2G1PA 5DM4A 1NV8A 2H1RA 3G7UA 2HWKA 3GRRA 2CKDA 2OY0A 5EMKA 5EC8A 5KQRA 3BWBA 3LPMA 5HZMA 4JXJA 1ZHFA 4GC5A 2GLUA 2O05A 1AQJA 3TMAA 5T6BA 1FJXA 3VC2A 3U81A 3NWEA 3NW9A 4EKGA 1KYZA 2ESRA 2NXCA 3FUTA 4PYIA 3UJCA 5C9ZA 2YXEA 2G71A 4FZVA 1P39A 2JHAA 3EVAA 3FPJA 3M6WA 3GRYA 4X1OA 5DXJA 3FUWA 3LSTA 3SVZA 5JUWA 1XCJA 5K0GA 4DF3A 3EPPA 1NW8A 2FCAA 3HA7A 2P41A 3KPWA 3LX6A 4QDJA 5DM0A 5DT2A 5K0CA 5GINE 1DCTA 5P8WA 2I6GA 1BOOA 4X41A 1NE2A 1NT2A 4XCXA 4RV9A 4B17A 1F38A 2B3TA 5CCXA 2IH4A 2IPXA 3VYWA 1ZKDA 3DXXA 2WA2A 4ER6A 2CMGA 3B3GA 2NXEA 2B9EA 3MCZA 1YFLA 3K6RA 1NW3A 3DUWA 5DTMA 4CKEA 2XVAA 3HCEA 1WZNA 5LQCA 3DLIA 3FZGA 5E8RA 5C1IA 4BLVA 1XXLA 1N2XA 4HTFA 3UWPA 4RTLA 2AOTA 1TW2A 1PJZA 5EMLA 2NP7A 3I58A 2QYOA 5E1DA 3BUSA 1UFKA 1RJDA 2O57A 5CVVA 5K01A 4P7FA 4YUYA 3CJTA 1RI2A 2IP2A 2P1DA 1D2HA 2ZSUA 4XUCA 5GWXA 1R00A 4FP9A 1SUSA 4M36A 3GWZA 4P7JA 8MHTA 1JQ3A 5ICFA 4DMGA 2XYRA 4PIPA 5DSTA 3EVFA 3CGGA 2PWPA 3UJAA 5HEKA 1L1EA 4HGZA 2AOWA 1KHHA 3BWMA 2Q41A 5E2BA 5DX0A 3UJBA 3B3JA 2OZVA 4QTTB 2IGTA 3EVBA 3KQQA 4X63A 5CM2Z 2QE6A 5DTQA 4PNEA 4A6DA 5DTRA 4DQ0A 1RI4A 3OZTA 3F4KA 1HNNA 4YV1A 3C6KA 1G8SA 3ID6C 1KP9A 1L9KA 1U2ZA 2AN4A 4KDRA 2AOXA 3FYCA 4FS8A 1ZGJA 3A7DA 3RODA 5CIYA 3QV2A 4Y30A 4RVDA 3SXJA 3KPVA 1NKVA 4ER0A 1QANA 4OQDA 3ERCA 4QTUB 3EMBA 4FGZA 5EHIA 1SG9A 3C6MA 3G2MA 3VSEA 4AZSA 5FULA 1YZ3A 3FPEA 4FT2A 2Y1WA 3ELYA 3A26A 3G89A 3CVOA 3MGGA 4PWYA 5EEHA 5EZQA 1X1DA 5FHQA 4PGGA 3P9NA 3R6TA 3SM3A 5HIKA 3M4XA 2ZVJA 1RJEA 3H2BA 5F2KA 4X61A 5CVJA 5BXYA 4OA5A 2QY6A 5B1SA 3IEIA 5FUBA 2ONYA 4WVLA 2OPBA 1VL5A 3M70A 4LWOA 1JG1A 1Z3CA 3P8ZA 5DSXA 4YMGA 4ER5A 5FQNA 1ORIA 4BP1A 1D2CA 3CJQA 1EG2A 3HEMA 3DMGA 3GRVA 2ZZKA 4P58A 3NTVA 3P9IA 2FPOA 4E31A 2LD4A 4KWCA 2G70A 2NYUA 4XUDA 2PXAA 4RTMA 4BP3A 5DX1A 4PCAA 5ICCA 3M6VA 3P97A 3FUVA 1Y8CA 4U7PB 5DM1A 1YF3A 3IHTA 1MJFA 2YR0A 3M6UA 4PONA 4PYOA 5FWAA 3FTEA 3TM4A 3LKZA 3V97A 3Q7EA 4E2ZA 2ZWAA 2CL5A 3BZBA 1D2GA 4XUEA 5GP1A 3HTXA 3KQMA 2ADMA 1VLMA 2DULA 3GGDA 3LGAA 1F3LA 3GCZA 5EIWA 3MTEA 4PYLA 3SX0A 3G5TA 3EGVA 2ERCA 2XYVA 3AXTA 1N7IA 2GH1A 2GA9A 3PT9A 3LKDA 3PX3A 1DUSA 3OFJA 3GDHA 4IWNA 4RTKA 3CKKA 2ZBQA 3M33A 3OFKA 4OBWA 4GOMD 5LR6A 5FA8A 5CCBA 2N47A 4GQBA 3HNRA 3NVMB 2PT9A 3LBYA 4E33A 3BGVA 3DMFA 2OKCA 3MCTA 3T7SA 3TM5A 3ELUA 4EQZA 2O0LA 1O9GA 3G5LA 3LDGA 5GM2A 2ZIGA 1VBFA 4UOEA 1SVUA 3MERA 5HIIA 4GF5A 2IDJA 4QVKA 1ZGAA 5LQUA 5E1BA 1R74A 2ZZMA 4OA8A 2PY6A 4IKPA 3UJ6A 3CJRA 2P3LA 3HP7A 4C07A 2C7PA 2EG5A 2OB1A 3E05A 2AOUA 4C03A 3OCJA 4KIGA 5EEGA 5KQSA 1IY9A 3G2PA 5T64A 1ZQ9A 4LWPA 4PGHA 4QVGA 5E1MA 4E70A 4ER7A 3MHTA 2ZZNA 4YV0A 5BW4A 2ZBRA 3OU7A 4CTKA 4KDCA 2IH2A 1WXXA 1JQEA 3QOXA 2P40A 2ORED 3DXYA 3MQ2A 2ZTHA 2IBSA 3G8BA 1FBNA 2NXJA 3GU3A 2P8JA 2I62A 3KPUA 5DLYA 1X1AA 1EQAA 1G8AA 3KHKA 3KQYA 3O4FA 5JR3A 2JG3A 3EGIA 3CCFA 3OPNA 3ER9A 4ISCA 3P71T 2NP6A 3HCBA 3LCCA 3OZRA 4RSRA 2ZIEA 1IXKA 3PFGA 5EKUA 4YUZA 3EVCA 2ZIFA 1G60A 1M6YA 2QRVB 1JTFA 3KQSA 4RTOA 2A14A 3EEOA 2I9KA 3LCVB 3PLAE 5KS2A 4DZRA 3WSTA 2UYQA 2PT6A 4CWAA 1JSXA 4RTRA 3PTAA 4ER3A 4K6MA 3P9CA 4CKCA 3KPJA 3PS9A 1Q0SA 1O54A 2FK7A 3GIWA 5KVAA 5LQAA 1NW5A 2PX5A 3OZSA 1DL5A 3P2KA 2FRXA 1JG2A 3FRHA 5HIJA 4V0QA 2G8NA 2AR0A 3FTDA 4R05A 2K4MA 3HVKA 3RIEA 4QPNA 2UYOA 3BT7A 1EJ0A 4PYKA 2IH5A 1EIZA 3S68A 1QAMA 2EJTA 3QOWA 2O06A 4MHTA 2OYRA 3OU6A 1T43A 2HTEA 1JG4A 3AXSA 2PGXA 3FUXA 3GJYA 2OXTA 5GOZA 3UJ7A 3EVGA 5C0OE 4A6EA 4HC4A 2NNWB 2HR1A 1RJGA 3FPHA 5HIMA 2CMHA 1KPGA 3I53A 3NWBA 4DCMA 1NW7A 3PFHA 1XVAA 3R24A 2AOVA 3UJ8A 3UZUA 4PYJA 4PYQA 4POOA 2IBTA 4PYMA 4NECA 2AZTA 2EX4A 3TOSA 5BP7A 3LDUA 4RTSA 2AN3A 1KPHA 3A7EA 3DMHA 3RW9A 1G6Q1 4PYNA 5M5BA 2GS9A 3V8VA 3KKZA 2OO3A 4GOLD 4E2WA 2QM3A 4M38A 4GUAA 5K0LA 2AVDA 1V39A 2PWYA 2V74B 3HM2A 1Q0TA 4YMHA 4PIMA 3HA3A 2F8LA 4O29A 3TR6A 2AN5A 4GOOD 3T0IA 2PXXA 1FP1D 5HOQA 2H00A 5K8VA 2YXLA 4G56A 4QPPA 4C4AA 5E8JA 2JJQA 5LQJA 3LL7A 1VP9A 1I1NA 2QRVA 3KR1A 5DPMA 5K03A 3KQWA 3GRZA 5LSAA 2Z6UA 1JTEA 2GPYA 2BR3A 2P3OA 5K0EA 2VDWA 1NW6A 2PX8A 4KVZA 3GO4A 2VDUE 1YFJA 5EG5A 3HCDA 2H11A 4MWZA 2UYHA 4RVHA 3HCCA 3FPGA 4R6XA 5LQKA 5CD1A 4BY9E 1XDUA 3R0QA 3C3PA 4P7KA 4KIFA 5EMMA 4QQKA 3UBTA 5KYGA 2R6ZA 2UYCA 4V0RA 3UFBA 3B7PA 4LECA 1ORHA 2VDVE 3MAGA 3BWYA 2YVLA 1TPYA 1X1BA 3ME5A 3P2EA 3A27A 4BLUA 4AX8A 5E2AA 4PINA 5FWDA 2WA1A 2JH9A 1RI1A 1X1CA 2BR4A 3KR9A 2BM9A 3EVZA 2B25A 2XVMA 1N7JA 3G2OA 1WS6A 3G8AA 4QDKA 5DXAA 4DKJA 3AY0A 3PB3A 1WXWA 2HNKA 2HV9A 1YB2A 3E7PA 3BGIA 3DH0A 2HMYB 4RWZA 3ELDA 3TFWA 4C04A 2C7OA 2I7CA 2ZWVA 1INLA 4U7TB 3C0KA 3LCUA 3FTFA 3UJ9A 3E8SA 1P91A 2NXNA 1FP2A 3EMDA 5E1OA 5T67A 1P1CA 7MHTA 4KW7A 1HMYA 3BKWA 3T7TA 2GB4A 1M6EX 5LQRA 1VQ1A 5HFJA 2PBFA 1MHTA 1EAMA 3UA3A 5HILA 1G38A 3R9XB 5DWQA 4GEKA 2UZ4A 4FR0A 3DR5A 5H02A 4AZTA 4F85A 5GIOE 4YUVA 1RI5A 3EVEA 4FSXA 4Z2YA 4AUKA 4L7VA 2PVCA 1P1BA 4HRAA 3P2IA 2P7HA 3D2LA 2O07A 3FYDA 2PX2A 1NBHA 4HG2A 5EKXA 2Z6QA 1R8YA 3LDFA 3I9FA 2BM8A 3JWJA 2C7RA 2Y1XA 2PJDA 2G72A 2ZW9A 3B5IA 3A25A 1H1DA 3KR0A 5BW5A 3DLCA 3M6XA 5ERGB 1O9HA 1B42A 4HGYA 5EOVA 2IDKA 3I5UA 5EGSA 3NMUF 3L8DA 1FPQA 3LBFA 3PX2A 3PVCA 4P7GA 5FHRA 4C05A 3KQVA 2P7IA 3UJDA 3DOUA 2FYTA 4IV0A 4H0NA 5CUQA 1R8XA 3OE5A 3GNLA 4HSGA 5IKMA 5K09A 4MQ4A 3JWGA 2KW5A 1VP3A 5E9WA 3KQTA 4M7RA 4OX9Y 1XCLA 1KIAA 3KR2A 3NJRA 3EGEA 1X19A 2BR5A 2YXDA 3DTNA 4MIKA 2ZULA 5U4XA 4CXMA 3VC1A 4RVGA 5FCDA 4YV2A 2P35A 3NDJA 2FHPA 2Z6AA 4ZTBA 3ANXA 1UIRA 5GIPE 3SSMA 1G55A 4C08A 1IM8A 2DPMA 5DRTA 3THSA 2YX1A 4E30A 3KQPA 2ZBPA 1BKYA 3O7WA 1KXZA 2AS0A 1WG8A 3G2QA 3HCAA 3AWIA 3BXOA 4LG1A 2WK1A 5IH3A 4ATNA 2B2CA 5E9QA 3G88A 5EHGA 3Q87B 1L3IA 4YUWA 2PSSA 3HA5A 3TLJA 3TPZA 5F2NA 3SMQA 1KPIA 2OBFA 3DXZA 1NBIA 5E9JA 4AZVA 1UWVA 10MHA 2XBMA 1JR4A 3NDIA 2PX4A 5MHTA 3FUUA 4HH4A 1XDZA 4IV8A 2CWWA 4EK9A 5DM2A 1JQDA 1AV6A 3BKXA 4R8RA 5FADA 3THRA 1KYWA 3O31A 2XYQA 3TRKA 2EJUA 3EEYA 2PLWA 4KRGA 3R3HA 3K0BA 1R18A 4BLWA 3JWIA 3FTCA 1QZZA 3GRUA 5D1NA 3TKAA 1PRYA 4CKBA 1ZG3A 1SKMA 3E23A 4GBED 2IFTA 4DA4A 5K0FA 5ICEA 3T7RA 3FPFA 5DX8A 4Y2HA 4RYLA 2VS1A 1QAOA 3CC8A 4E2XA 5EQJB 9MHTA 4AZWA 1XDSA 5LQNA 3B3FA 3HVIA 3SGLA 4GC9A 4M37A 3SSOA 4DM3A 2FK8A 3HCFA 3I64A 4F84A 4RTJA 5CVDA 2GAFA 5K0BA 5EVJA 3SR4A 3UA4A 1KR5A 5F2OA 5GM1A 5FQOA 1M0EA 5FA5A 4EMSA 1XJ5A 1AQIA 4MTLA 4RVFA 2PV0A 4E2YA 1BC5A 5CVUA 5EIFA 1JG3A 3DP7A 1EJ6A 4GOND 5CVEA 2R3SA 1TW3A 5K0JA 4FSDA 3AJDA 4EKIA 2ZFUA 2ONZA 3NVKI 2VP3A 4C06A 4QQNA 3GXOA 1QAQA 3FRIA 5DRYA 4X60A 3REOA 2VZ9A 5K05A 4DCGA 2PKWA 2AOUB 3MB5A 4EVIA 4RTPA 3EVDA 5D1HA 4RX1A 2JHPA 1XTPA 1OR8A
chains in the Genus database with same CATH superfamily
2SCUA 3AEUB 3OU2A 5F7JA 2F17A 1YJ5A 2ZLBA 4KE9A 1A5ZA 4DCTA 3UMJA 3UGJA 1YZHA 4HF7A 1ID1A 2ASEA 1VE3A 2J3EA 3PDUA 1W49A 2VYVD 4BO7A 2NZYA 1FE8A 1KKMA 2FZGA 2JIDA 2R5WA 1QIFA 3K32A 2OQVA 1DIGA 2A5DA 4G1UC 4YXWA 1Y80A 4IDBA 3I9V6 1B8VA 2A9QA 4HBZA 1UAGA 4E51A 2WE8A 3JX9A 1Q0RA 5DHRA 3GEIA 3GUZA 3GPDG 4J94A 4EPWA 5A0TA 1NV9A 1SBTA 4P22A 1KZYC 1UC9A 3H65A 4XD2A 1HSOA 4D02A 1BKDR 2OHIA 5FWYB 3RRZA 3COWA 2ICAA 4O1IA 3AF4A 1SQFA 5FIUA 3OX1A 3OTOB 1OBCA 2O8DA 2C00A 2QTTA 5CNKA 5DM4A 3VHXB 5TQ0B 5CEFA 2HWKA 1EBFA 2EEZA 1QCCA 4ND2A 4LI3X 2GJKA 2IZ6A 3UO8B 2ZI3A 4M21A 1USUA 4GLLA 4C0SA 1C4XA 3I52A 4GT1A 1FJXA 5BV1A 2VN8A 2G7MC 4Q4JB 5BSKA 3NV9A 3QX9A 3HCRA 4M8SA 5J3JA 3ONFA 3DTTA 3BB1A 3A6DA 3FSRA 1P39A 4WKBA 4ROSA 1R37A 4I2VA 3DAOA 3UNXA 2DFPA 2OHVA 5G2OA 3EG5A 4WLOA 3PU6A 3QMMA 3PUIA 5JUWA 2IT1A 2EGGA 3H2GA 3I5YA 1I9CA 2P41A 4GOKA 1Y8RB 4QDJA 5DLDA 4RVNA 3ROTA 3TKLA 1KDOA 4EUSA 5FT9A 3X1ZA 3DW1X 4IRUB 3A10A 1MOSA 2AF4C 2JJMA 3U19A 1K3FA 2C5EA 1SXJE 1LPNA 2CXRA 4IDEA 4DMMA 3UK2A 1DI0A 2WU1A 3AU9A 3MTAA 4MUXA 1O3YA 4K81B 4N6GA 5AH0A 5DTMA 3CEAA 3R0JA 4F8JA 2FW9A 3DMDA 1PEDA 1UZUA 1JAYA 3UH0A 1CQZA 4UNRA 1ZXBA 2MYPA 3RU3A 3VAYA 3EJ6A 4J0FA 1TQ6A 2V1XA 1AHPA 5IT9A 4FC7A 3I58A 2NP7A 5KSOA 4PZPA 2EQAA 3FSGA 2JGDA 2VHTA 2PCLA 5CDHA 1TDJA 1R6TA 3H8WA 1I6LA 3EVTA 3IODA 3DZKA 4OLHA 5DCYA 1UDWA 3VR4H 1VFNA 1CJUC 4GKKB 3K7EA 1OWLA 1WVGA 1Q12A 2D1FA 2E87A 3GGGA 4ZRNA 5GGYA 3ONEA 5CDGA 1DCKA 4UPVA 4M98A 5MN4A 1PKXA 2Q8PA 4EW6A 3U1TA 2QL9A 2GZHA 2NUTA 3DCYA 3L0OA 1YR3A 4KG7A 3CRVA 3CM0A 2M2IA 5KYWB 4MHSA 1UMDB 5CM9C 2P27A 4FYHA 4K6FA 5EPUA 4DCCA 2BF7A 2H31A 4K7JA 4U02A 2JLYA 1W0JD 2G36A 4AKGA 4Y8VA 1G8SA 1W47A 2NLOA 1NJSA 1B73A 2YHIB 4M0KA 1P18A 1QH8B 5JJCA 2AJLI 4MYRA 1H5UA 3TCXB 4KIWA 4UBKA 4Z9AA 5EJMA 2AEJA 2OCYC 1K6XA 3PXBA 2RHBA 1VM6A 5FHQA 5K0ZA 1QGED 4D9GA 2P3SA 3OPYI 4IILA 2YXNA 1JAIA 3ZY6A 5C1OA 1AGPA 3DZIA 3IOBA 3KZMA 2WTMA 2WUEA 2ZVJA 1NG9A 3D59A 3ZVRA 1FBTA 4CM9D 4QEKA 2IK8A 2J6IA 4I55B 5B1HA 1YNOA 2X1MA 2X0FA 4CPDA 2A1UB 5JYDA 5KS2A 3VM6A 1XUOA 4Z4HA 1CR4A 2H1CA 5JISA 3NYWA 1YQEA 2DWCA 2VJKA 2Q8NA 3MD0A 5KWVA 3OCUA 3M1IA 2F55A 3NO4A 4QBIA 2QN6A 2BELA 2YQ4A 1HY3A 3KL2A 1LNQA 4CIBA 1CK4A 2HA5A 3GWGA 4AQ7A 4P4UA 4P58A 1U0GA 4Q4LA 3MQFA 1AHIA 4Q15A 4YH1A 3P1JA 3Q3CA 1I0ZA 3T5BA 3DMNA 3HDVA 4WASA 3QX3A 2REOA 1P81A 5I7RA 4JY7A 3L6RA 2W2OA 2A84A 2FWBA 2XNSA 4KPUB 3DHEA 5CHEA 2OBBA 2GZ1A 5DTQA 4AZ3A 5B7GA 1D9XA 1MJFA 1U1FA 2DTXA 2YR0A 3WYBA 3WXMA 4IFEA 3P2JA 3HLTA 4BO2A 4IIHA 3IJRA 1TLTA 1G41A 1YDGA 4CMIB 1HTTA 2H4JA 3GCDA 1NZDA 3CLSC 4MICA 4W9NC 1XQYA 4ZCIA 2X5XA 2CFCA 1QV7A 4JCOA 1SKQA 2Q1SA 3KQMA 4MRMB 3SI7A 2EQ5A 4KGDA 4ZO6A 3RSQA 1X87A 3M3DA 2ZJ0A 2X8JA 4MLZA 4ZQBA 1R3DA 2QT0A 3U26A 3MTEA 2QL7A 3ZKAA 5A6VA 1JB1A 4CLOA 4X7BA 1BX0A 3EASA 2QYSA 2X4GA 3B78A 1NE7A 2IC5A 1AVTA 4XZ3A 3UOWA 4URHA 4EGFA 5EJ4A 3PX3A 1X1EA 1WW2A 5CT6A 3HCOA 4MRAA 4ALJA 5HR5A 3O5AA 1NTOA 3MGCA 3NHZA 4M8IA 3WYGA 2XIQA 3CKKA 2ZBQA 3HY4A 2EIHA 3M33A 1GUYA 1TMOA 1E1RD 5BYJA 2VNAA 1SXJC 2UDPA 3DMFA 3EHDA 3HCPA 4HYYA 5EWLA 3VZRA 4E33A 1M0SA 4UM9D 5E95A 3KJFA 4QJ5A 2CCKA 4HAWA 1O9GA 4US0R 4BCDA 5KOHA 4EFMA 4RACA 3C7TA 3LUHA 2Q50A 2WD7B 3PF8A 3Q0TA 4WEQA 4BZPA 1QC5A 3MOIA 1D6NA 1GNQA 1H9BA 1UBUS 2IPOA 3ZQUA 4EGAA 5KTYA 3WRYC 4JT4A 2H63A 5NULA 4CCSA 2J3HA 4MS1A 3PXCX 1M2KA 4I81A 1GL9B 1YB5A 4UD6A 2B98A 3IJ5A 3IT2A 2ZRKA 3RTBA 4CTKA 2X3FA 2VUHB 3RIMA 1WXXA 4DUYB 1CJCA 4L7QA 3KUDA 2I6TA 3L1JA 3ICEA 5JQGF 1XEAA 2AGVA 2YXBA 2I62A 3O8QB 4TKMA 4MI6A 4XQGA 4LFBB 2H51A 1DIBA 4ISBA 4RPCA 3EGIA 4F06A 2C9BA 2IQIA 3UMSA 4J0CA 2FPGB 3OZRA 1YRBA 5DCLA 2O6HA 3P32A 2PAAA 1X7ZB 1TLFA 2QDXA 3EYWA 1JU3A 4M9RA 2H92A 5F4ZA 4Z0TA 1POWA 1QK4A 2DU8A 4UPEA 1PWHA 3C8ZA 4RPIA 4UUOA 2SHKA 4FS3A 1ISFA 3PPXA 1V3TA 1K89A 1HRKA 2F1RA 4LC0A 2QZPA 3IUEA 4Y6OA 1Z15A 1Z5PA 3HKEB 1Z88A 2JGJA 2RGAA 3LFUA 4RPLA 2BEKA 4B1FA 1QM5A 1HYEA 1SZDA 2CFSA 3OOWA 2IVFA 1O54A 4X20B 2ZXEA 1Q0HA 5D84A 3RUDA 1LI7A 1RLIA 2XCQA 2Q3JA 1OX4A 1DRUA 5TXGA 2IXTA 4MEAA 1WOMA 2NVOA 4RQUA 1CE8A 4HPJB 2HL6A 5G0VA 3B6JA 4BVBA 2P4UA 3ASVA 3OH8A 5LD2B 4DY4A 1E92A 5B1IA 4DQXA 4FDAA 4R05A 2GERA 1TUBB 4MCHA 4XTCS 2W2XA 4R8LA 1LBTA 2R6JA 2Q2OA 3MQ4A 4EZBA 1IPEA 3QFHA 3R6LA 5JH7B 4MWSA 1XLWA 3CLSD 5TS2A 5BNZA 3ZCXA 1K0UA 2JCBA 4DR5B 5GOZA 1DIOB 3JWPA 3KK0A 3O2NA 4Q0MA 3H8VA 3I39X 3JD1A 3U31A 2G5CA 4AFNA 1VTKA 1JIJA 3KZNA 4KYVA 4ZICA 4PYJA 4HNQA 1XVAA 2FPSA 4LV8B 1MXFA 2D7CA 1OTYA 3GXBA 4PYMA 2IBTA 4OLAA 1WL8A 5LQSA 5IM4F 1CDOA 1WCIB 3W5HA 1YTLA 4QODA 2JFPA 1XLVA 2RSLA 3LNCA 3ZCRA 4G4JA 3JCZA 3IP9A 4QFMA 5I7SA 2WIAA 6YASA 1Z26A 1T2NA 4B09A 4US1R 4FMPA 4DEXA 1SXJD 5BW8A 2H4HA 3NIFB 4QVIA 5DKFA 1YMUA 2EARA 3U5TA 5K3CA 3QLTA 4KI0A 1BDHA 1A5AB 1ZNWA 3HA3A 5A4AA 3CZ9A 3VO2A 4CM9A 3ZWVA 1OAKA 4BDSA 1FP1D 1OYVA 3FCUB 1ZICA 2FW7A 4J0IA 3KHTA 2A1TS 2LIVA 3HJHA 2PHZA 3CUWA 1XC7A 3SZ3A 1I1NA 4C7BA 5A9RA 1NUUA 1U0NA 2VSQA 2W2NA 2KBFA 1STOA 3DL4A 3FD8A 4I0WB 3RV3A 3QUTA 2B4KA 3M6LA 4NU0A 4BWFB 4IVNA 1SUBA 2WWIA 2Y1KA 3HCDA 3WQRA 1MVLA 3B1FA 3DOFA 4RVHA 1W7AA 1QG4A 1K86A 3R0QA 3RTEA 4KIFA 3H7IA 4M6WB 1G5HA 4O25A 1FTSA 4KRFA 3IXLA 3UFBA 4D9FA 2PL9A 4M3NA 3MTQA 3GLHA 3BMOA 4JYAB 1RXUA 1OLUB 2OENG 5AUNB 2TMGA 3AH8A 1G5RA 1GQOA 3QPCA 1V41E 1JEDA 1OLSA 1QHXA 1ST2A 1KZ4A 2HF2A 3G2OA 5DE3A 1NVUQ 4QDKA 3U4QB 1Q0QA 1R0SA 4M0FA 3CGWA 1YJCA 3ADDA 1V4NA 3T38A 3CNOA 1RAHA 3I9OA 4EF6A 1L8OA 2R6DA 3DH0A 4M55A 4X45A 1RR6A 1FFXB 2I7CA 1PR6A 1W581 4I4TA 5EFZA 1UDXA 3FKQA 4HLDA 4ARBA 4OHVA 2GK6A 2OHFA 4GKVA 2HF8A 2AHRA 4EPVA 2I3DA 1HDGO 3W8DA 4BTVA 1KI1A 3NFYA 5C5DA 1M6EX 2O7QA 3FGZA 5LQRA 2DOKA 1JKMA 2PBFA 2ZBGA 3BDVA 4U7JA 3WLPA 1S2DA 5B1EA 1XAHA 3R44A 5KI6A 1RRPA 4J2HA 4NE9A 3D6NB 1KWGA 3W3AD 1XYYA 3U3XA 3EG9B 3K5WA 3OPYA 1CRZA 1MZVA 1ZD3A 5CLQA 3EDQA 3TQFA 1ORVA 4UDOA 4HG2A 3RYTC 5L95A 3V4OA 5LYJF 4M7PA 5IMSA 4Q5IA 2BM8A 4AXBA 3L0DA 4CEIA 3HKBA 5HGXA 2UVDA 3DLCA 4WNCA 5AM0A 4DJEC 1B42A 1P2DA 1V5FA 4YONB 4R98A 4RQAA 2IHBA 2VK4A 2CE2X 3HP4A 1WVIA 3TL3A 1B1AA 3WRVA 4ZI2A 1MB4A 4TSFD 4KCGA 4TTJA 1R4MA 2VPXA 2Q0XA 3GNLA 2AK2A 4HAOA 4PSVA 2VAXA 4RD2A 2D7DA 4KMOA 1XQ6A 2RDMA 2FSIA 2IUTA 2P6MA 1XTKA 1QG0A 5FOUA 4BAUA 4BO8A 4MIKA 1E3DA 4LZOA 1H2XA 4MB0A 2BGGA 2HDNB 3RBAA 1GG2A 4L0CA 1VSBA 4QUBA 5ADWA 4LW8A 1D2NA 4GPBA 4J0EA 3O83A 2KS6A 4JJ4A 3DJYA 3QMWA 3TVYA 2PYZA 1BU8A 2G63A 2Q5LA 2XZPA 4O0MA 1PVOA 2NO1A 4IXMA 4ZYVA 1B74A 3QVOA 1PUXA 4GLJA 5BT9A 1FDSA 1G5FA 1X8LA 2UZAA 4LC9A 5JY6A 3GUUA 3MG9A 1Q0LA 2FWIA 4RKEA 2QTMA 3FDFA 3KUUA 4MQ5A 4JSRA 5EHGA 4DLTA 2R8YA 1CYDA 1KF0A 4PLZA 1U1EA 3AYZB 1KGSA 1K7FB 3ZWYA 3BH0A 1K5GA 1QGUA 2AYXA 4WY8A 3TBHA 3TRFA 1CLUA 2CY0A 3R9IA 4OH1A 3DONA 5JLJA 4JLJA 1A9XA 2QBYB 3O8NA 1NF8A 4IDFA 3GA5A 5CDFE 3R9XA 3PKIA 1NU6A 4A27A 5E3HA 2YWJA 3JALB 3LQRA 3FSJX 4LXYA 2OHOA 2Z95A 4E08A 4EWLA 4RIIA 4XLZA 4ZGGA 3C85A 4NLLA 1NVKA 3O1HB 4G5SA 2ATXA 2VJMA 3OC0A 1UQTA 1CDEA 2AD5A 2QTHA 3A2LA 4O2AF 4TWRA 4H7JA 4RYLA 5CURA 4HVTA 5FV4A 4XYGA 3ITEA 5EQJB 4R31A 3AEKB 5KMGB 5HF8A 1DKQA 5JSKA 3HVIA 4F84A 2CYBA 1M7GA 4AU1A 4YRAA 1L4UA 5AW6A 4DR1B 2Y4OA 3WKAA 1JPUA 4HNUA 4F1KA 3DUFB 3BEDA 1SCQA 1KTIA 1K8QA 3OZFA 1C8KA 4KXWA 1M0EA 3QWAA 3VPHA 2Y99A 3D5EA 1TM1E 1VE9A 1IHPA 4NVRA 2PZFA 1JXAA 3O2JA 3SXUB 1UEIA 1EGAA 2BEWA 4MKIA 4EGJA 4YMLA 2JPDA 5C37A 4LISA 2R11A 1UPAA 3HRKA 2LTAA 1NN0A 1LD3A 1U3DA 5J4YA 4L4XA 4AECA 1TECE 3WRYA 1IOZA 3DDSA 5IN5A 4EB0A 2IHZA 4X60A 2NTVA 1B76A 4C7VA 5HTKA 5K05A 3VA7A 3CO5A 3GELA 5IF3A 4Y9TA 3SJCA 1WMDA 5A4DA 1OSNA 2PPVA 3QXCA 4LXGA 2QGNA 1LPOA 1O95A 1K2WA 5TGTA 3RVBA 5L45A 3N2GA 4JBLA 5JVDB 2P4HX 2CDCA 2YQZA 3NTUA 3ELWA 3ZWBA 4CKEB 1SG0A 4K9SA 4N7RA 3HK2A 3GFBA 1OX6A 1F2TB 2VPYA 3SF8A 3SM9A 1T29A 3S44A 1N2CA 4LBWA 3M5WA 5A1JA 4HYTA 1NQ5A 1U7ZA 4KYIB 2R7NA 3LCJA 3MJSA 4HLQB 4L57A 4R2HA 2BGMA 4XRRA 4DXAA 4BEWA 7REQA 1NVGA 4C1NA 1DEOA 4BB5A 4EMUA 3VYUB 4YCJA 4RH1A 1UKAA 3FI0A 3B2NA 1TM7E 4FZJA 4HFMA 5EPEA 3WMWA 4BYMA 1XPUA 1BMDA 1E8MA 4KO2S 3RLIA 5KAPA 1PL7A 3HYSA 4M22A 4S0ZA 4KWIA 5JC8A 1J22A 3SJUA 1EX1A 4J75A 1RHJA 2PZLA 1DX4A 3BWBA 3OTHA 3BGWA 4P4SB 4BC1A 3UTDA 3PGKA 1CEEA 3CYFA 4GC5A 4GUDA 3NC1C 1B6TA 4RUKA 1PR3A 3AW9A 3HPRA 3ND7A 2JEYA 1ZMTA 3JQEA 1Q91A 1M8FA 2AN9A 4XDYA 3RNLA 1JEYA 4PXYA 5TEVA 4FZVA 5FV7A 5JNTA 3CE6A 1TM2A 1D2MA 1FW6A 4S1NA 4N47A 4D9CA 4F0JA 2H8GA 3O8RA 5LVAA 1SEPA 3EPPA 3KPWA 2WHQA 3ZU2A 5FWXB 2HMAA 4JMPA 5DM0A 4YP5A 4E5NA 1EIWA 5JFGA 4KTVE 3DOOA 3ZHSA 5AKGA 3BSFA 3EXG2 2BEVA 3EY9A 5TQVA 4BLSA 1XTBA 1KZHA 3HXTA 3V7UA 2VCHA 3BXHA 3DMTC 1JHUA 1E5VA 4FHGA 2BVNA 4YI3A 3VR5A 1PR1A 1IG0A 1YFLA 3D81A 3FVQA 1QE3A 4H0FA 1O57A 3DLIA 4DPKA 3HJBA 2ZEJA 4YP6A 2HQBA 1JKJA 1BG6A 4LZWA 3RRBA 3RC1A 4RTLA 1I2ZA 2ZXUA 4Y2UA 3VPGA 5EIXA 3K8YA 2FWJA 2JAUA 4TROA 2DLCX 1RJDA 3X1YA 5HBRA 2B36A 1RQPA 4QYTA 1RU3A 3G0DA 3RVMA 4KNYA 2GM5A 3VOSA 2H9IA 1VE6A 4QGGA 2HNBA 2NQ8A 3MB8A 5DK4A 4MYUA 2QVCA 1XZAA 4GZ3A 5YASA 4CQLA 1KEUA 1N6HA 2OGZA 1BVUA 2D00A 3B8EA 3CGGA 1ZU5A 4DQKA 1TTTA 5AP9A 1CPYA 1EDOA 1HLFA 2Q41A 3O26A 5KDDA 4ZCTA 5EUMA 3EGWA 4FNGA 5L3QB 3EVBA 2P5YA 2ZRCA 4O4JF 4RGYA 4R54A 2XTJA 1EUDB 2RHHA 3DDZX 3ZUPA 4NATA 3KKLA 3L7AA 1EJBA 2BFCA 2VQSA 1UPXA 1I5EA 2HPAA 2IV7A 2P4SA 2AQIA 4FN4A 2WT4A 4CG1A 2O4CA 3WWPA 3HEAA 4TSRA 2XRFA 1XCMA 2Z4RA 3OM1A 4PG7A 3WADA 2XNHA 1R6XA 3WFZA 1O8CA 4B48A 5JI3E 2QRZA 1IE3A 2RK3A 3D4BA 4ZEMA 2COEA 4FEYA 4TT3D 2PMEA 4MO2A 1MC1A 2HCTA 4CM8B 3CO0S 4CE6A 3AFHA 3FDZA 2X19A 3FFWA 4YAGA 4NI5A 1FMCA 2O3UA 5AJYA 4BNWA 2NQTA 2SKCA 5CW1A 1W25A 8ABPA 3DYIA 4MVJM 3EOAI 2XWJI 4XVQA 5HKKA 2O1WA 3O47A 4GH5A 4E03A 4O8ZA 3L7YA 4DDVA 2V6GA 4UHCA 3IOYA 2E5FA 2XPCA 1PGJA 4RL6A 4OA5A 5CA0F 3JWEA 3EN0A 1IEQA 1QZTA 2PWBA 1E60A 1SOWA 2KLBA 3JW8A 3PE4A 2Q3MA 4LWOA 5HQJA 4BRWA 4URVR 3EF0A 1BD4A 1ORIA 2J6CA 4L8WB 1OFHA 2GO7A 3MFYA 5BO5A 1M34A 2JIBA 1BOFA 2PT5A 4KNWA 5CIWA 4N65A 4IMJB 4DGQA 1CUIA 4G0OA 4BVKA 1ZLYA 3FVVA 5JO9A 1ZD1A 2HF7A 2NTYC 5G4LA 4JP3A 1QDEA 2NYUA 4P35A 3CW9A 2PG3A 1MO4A 2R48A 5A62A 4RTMA 3JATB 3G0HA 2FW6A 4GZ5A 1Q92A 2BYTA 1W4BA 4Q9IA 3D6FA 2PKQO 4N5HX 1Z07A 5FI5A 3J80A 1E1NA 4LF8B 3KKMA 2VA9A 1N57A 1JA9A 5HCIA 2A5GA 3BB3A 2CK3D 1U99A 2G07A 1TIPA 2J3JA 1AXEA 1DNPA 1RWNA 3LY8A 4F12A 5AD1A 3NG1A 5K3BA 4LYJA 1CRQA 2QN8A 3E1GA 3FFBA 1A5TA 2FEMA 2IYFA 4UAGA 4G8CA 1DWQA 2FXVA 4MLPA 1JFFA 3O82A 4Q19A 3MHPA 4WJLA 2VNKA 3Q4GA 2NXWA 2XYHA 2IYTA 5A9SB 1JHOA 3AUAA 2VQ3A 3N87A 1XMVA 3OE1A 2ERCA 2XYVA 3CRZA 5HBGA 3O3OB 4XWTA 1JR3D 4LNUA 2WF5A 1JKXA 1ZY2A 1D4AA 3NP7A 1FSGA 2Y0PA 2QTAA 3OFJA 2JFNA 3B2QA 1C3OB 4A0FA 2R6FA 2ZR8A 1C7IA 2D5LA 3LY5A 2PT9A 4MR8B 4ETIA 2OKCA 4EJMA 2HJWA 5LWHA 5TT1A 4UMFA 4WCFB 1NL3A 5ER6A 4BTEA 1PJQA 2PAFA 3L8FA 5JTUA 4Y9RA 3EXAA 4JDPA 5LQUA 1EWYA 1T9DA 2BEUB 3EFOB 4IKPA 1IOVA 4IDQA 4BXOB 4CCWA 3NYIA 3L93A 1IBCA 2OILA 3ZNOA 2PMCA 4B6EA 4EOGA 1OFIA 2HN9A 4XRGA 2C94A 2ZROA 2E4ZA 3G7SA 4WLUA 5ELMA 1GIAA 4FW9A 4B9EA 1P6QA 4BMCA 3BWDD 4ZDWA 4EW1A 4QC2A 2FRVA 1UK6A 1YS6A 3T1HB 4F2DA 5BVHB 4DFDA 1EWKA 1EVJA 1T0HB 2R8ZA 3FOWA 4OQNA 5FUXA 1JHVA 2H57A 1NDUA 1UUFA 3QXXA 1VPLA 2LNDA 1NHWA 3H2SA 3RYIB 4IOLA 2J7PA 5KINB 3JAWB 3NR2A 1VI2A 3VPBA 4EZEA 5KYKA 2WWVD 1DJMA 3LOPA 5A03A 2AI3A 2VF4X 3GFTA 4MUGA 1G60A 2D06A 5EUQB 1BH2A 4QWMA 3BBPA 3Q8KA 4HL6A 3LQFA 4C0HA 2XNCA 4BMNA 3OETA 3OQNA 5FTLA 3ESQA 3PTAA 2ISCA 3QX7A 5ALTA 3A14A 3B3AA 2D0DA 4IH4A 4KUGA 3VHXA 4I3GA 1ATZA 1E6KA 2QJFA 4NXMB 2VDOB 3TG2A 2O2GA 1ODLA 2UUOA 2Q5FA 2V5AA 3AT1A 3K9HA 4KH1A 3LE8A 1MVOA 4C3OB 4EO9A 2O2CA 3WOVA 1DPGA 4HWGA 4M87A 3OA0A 1NJ8A 4ZMSA 2ZRJA 4MW1A 1ORRA 4Q4JA 3SR3A 4AT1A 1E2NA 3K96A 2XE6A 1KMMA 4CV1A 2VPIA 2GVNA 2H2WA 1YCHA 3GLGA 4A6EA 3SYMA 3HRHA 5DXFA 4MWBA 3OCYA 5ES4B 2RE8A 1Z2OX 3KQKA 4LHXA 1J70A 3AVUA 3C3MA 1QTQA 2H54A 2LKCA 1Y8RA 3IRUA 1U8EA 1NWCA 4IDDA 3QIVA 3TOSA 5BP7A 4Z0PA 4FZRA 3K2EA 5H0IA 2P75A 5A71A 3ZDAA 2FG7C 1E2LA 3BCHA 4R51A 4AF7A 3VKHA 3KTFA 1VKZA 3EQZA 3L4BA 4XJTA 1QP4A 2GM9A 2QKYA 5EE9A 4E5KA 3I1IA 3JY6A 4DLUA 1M1YE 5DBOA 3A1FA 4B3SB 1VCNA 3C3AA 1D6SA 1MDFA 1J0DA 1HGXA 3HJNA 3PKJA 2CZCA 3IIIA 1GITA 5ALLA 5AM1A 3WE7A 5CT5A 1KMNA 4GOOD 1LF5A 1MLDA 1JXMA 2WYIA 1JMKC 3VR4A 1KAGA 16PKA 2ZJ8A 3MNFA 4GPAA 4RLSA 4RJJA 4LN1A 4E14A 5KWEA 2AG0A 4AO6A 4MI3A 4YPFA 3G9QA 3G0BA 2ZBVA 2C5LA 5JW6A 4JFAA 5IC5A 1OU0A 1J56A 2JGFA 3PYMA 1JHXA 1RTTA 4NOJA 1W4LA 3AKYA 4X5OA 3SE0A 3T3DA 1X1QA 1U1IA 2MSCB 4AWBA 3EMVA 2QMUA 2YL2A 2WWGA 3EXIA 1XRRA 5TPZD 3UJ3X 1X80B 4IKEA 4J0KA 3E03A 4PNPA 3S0JA 4MWCA 2DPLA 2O9JA 4RM3A 5CA1F 5J23A 3ADOA 3OEYA 3P0JA 4L5AA 4GZMA 2X0RA 3T1VA 1OWPA 2QZ9A 4EQ6A 2Y1GA 4QTYA 1COWD 1N7HA 2NN3C 4GICA 3WBBA 1I4DD 3HV0A 3GD7A 4DDHA 2YVLA 4HAYA 4NCKA 1QRUA 1D2RA 1RLOA 2O1EA 3TD6A 1E5DA 1DE0A 4OAQA 2O52A 1LA2A 1PR4A 2D7JA 2MMCA 2JLUA 1E99A 721PA 3UK7A 3ZWXA 4A1OA 4B80A 1DDGA 2EJBA 4Y9UA 1NPTO 3ED5A 4YP0A 3OPXA 2JIRA 4DDMA 1WPRA 3FR8A 4N8DA 3AIMA 5HIAA 3E7PA 4UQOA 5I4KA 5J43A 5JXIA 1EVLA 2IXGA 1K4KA 2QWXA 3CV3A 1INLA 4U7TB 3NORA 2A57A 2YMLA 4WQMA 1KEPA 3SKXA 1VLVA 3SQMA 3WK5A 4L5JA 4N0DA 4EI9A 1Y5MA 1FP2A 4EUFA 4WLFA 3ZU4A 2BI7A 3QE3A 3PQFA 4RORA 1L2TA 4I4IA 1FUEA 3NEYA 4LWQA 1XCBA 1F9EA 1C4OA 1YO6A 2EKLA 4UM8B 1PJ2A 4C6SA 5C32A 1F8XA 1G8JA 3SHQA 4GR9A 1JAHA 4YUVA 5LWQA 2O2ZA 4HRAA 3ENNA 3ODGA 3U4IA 3BK2A 4F6RB 3EEFA 5AQEA 1G1MA 2GYUA 4PLYA 4BKPA 2B82A 1DUIA 2I1LA 3QU2A 1HFEL 4B47A 2QNBA 4F7WA 4DBZA 2QS9A 5EOVA 4EEKA 4R3UC 1KP2A 3PX2A 1R10A 5TJ9A 1XZNA 4YFYA 3CISA 3KQVA 2ANCA 1BCRB 1UC8A 1L5NA 3JWGA 4OSPA 5D3ZA 1BNCA 1H94A 2MR5A 2OL4A 1MU0A 4HR7A 3T4EA 2IW3A 4OX9Y 1NNSA 1KOFA 3VR3A 3G85A 2QXTA 1ZX1A 1EGHA 1U7HA 1BO6A 4MRMA 2AMJA 1C1XB 2GJSA 1U9CA 2XE8A 5D01A 5GIPE 5FBLB 1ZOOA 2WD8A 5J5VA 4NH0A 3VUEA 4V2IA 4EPRA 2G09A 4IZHA 4DAEA 1AGNA 3I04A 3OT1B 2YX1A 1VGQA 2E18A 4MYHA 2HLNA 1P19A 2IUSA 4QO7A 3OEWA 3CEJA 4QYSA 3HFJA 5ABPA 2IY7A 2B5WA 3I3SR 4JUBA 4ATNA 5HUHA 4G5HA 1N5JA 3PR3A 1ISHA 2PRYA 4URFA 3SMQA 2OBFA 4KE7A 3GUYA 1IWOA 4M0EA 3TSAA 3HGQA 3WLKX 2R7MA 1I6KA 2PR7A 2QB5A 5JS2A 3QQ5A 2B7CA 3CRMA 4HH4A 1SU8A 3THWA 3IXMA 2GRJA 4MR7A 4PWZA 4HAIA 4JKOA 5DM2A 5AR1A 3F3KA 3GAMA 5I9NA 4MS4B 3C5WP 2PCJA 3TRKA 1AA9A 2C84A 2Z58A 2GUWA 4KQCA 1EGQA 1ULZA 2CVOA 3KSUA 4G24A 4MW4A 1E6EA 2GCOA 4YJKA 1GZSA 5TF0A 3ZLBA 4IIFA 1U1CA 3A9UA 1O5OA 3DG9A 1WMFA 3T9DA 3O1LA 1OOEA 2OCAA 3RU9A 4FFOA 3VVMA 1M72A 1E69A 5FWNA 2JFQA 1W9MA 4KWHA 5B3AA 3L4JA 5I45A 2WTEA 4RE5A 1QHGA 5HRAA 1H42A 1KO1A 1T8UA 1E20A 2EBHX 1C0PA 5JZOA 4LF9B 4QFDA 3ZWAA 2IYQA 1C9DB 4OBEA 3L6BA 2GPNA 1R12A 2XUIA 3Q7PA 1CIJA 2AUNA 3UA4A 4NABA 1I8TA 1PX0A 1B93A 2OBNA 3AY6A 3JD4A 2RHCA 2PUGA 1VHQA 1QVAA 1U0EA 2QTNA 2QPOA 3Q88A 2RKWA 1TVKA 3KS9A 4RVFA 5C8YB 4R01A 3PIIA 2XRZA 3O73A 5DT2A 4E11A 3E27A 2VXCA 2XCRB 4KPFC 4QQ8A 2DR3A 3MEQA 3F0TA 3HKEA 4BFYA 3ZU6A 1SXIA 2O8VA 2C82A 1VCMA 4V0MA 2I34A 3QP9A 1TB4A 2GPJA 1I5RA 2AKAB 4UAVA 1Z06A 4RYDA 5TMPA 5KOJA 1LY1A 2WDZA 3VJMA 1KJ9A 4L2IA 1AOXA 4JJEA 3R76A 4C0JA 3A1NA 4O2AA 4TMYA 1E1KA 1I4TD 1SURA 1ZQ1A 5FEUA 2X8WA 1T8PA 2V7QA 3KPYA 4QM6A 1E1QD 2HLPA 2VWPA 3TQSA 3NDPA 3BXEA 5FORA 5L40A 2D62A 2JH8A 1YR7A 3AM5A 1COWA 4FBMA 3G7NA 2D5IA 2VDPB 3DAYA 2IYAA 1PS9A 1A7UA 3E61A 2CJYA 2VF5X 4ZI3A 1W85A 4RFVA 2C4KA 5H4GA 3DF9A 2CLIB 3W8RA 2ZUDA 4IUBS 4RZQA 4IIGA 1AQLA 1SBZA 3D64A 5K4AA 3T7DA 5FTWA 2I1WA 4MJ3A 3ROFA 5FOQA 2OV6A 3ZIDA 3C3YA 1ZWLA 4IJVA 4BKOA 5DM70 2BH2A 4CQMA 3ZH9B 1USVA 4QBGB 4DV1B 4E2FA 2QLLA 2EFHB 2ZIWB 4B3BA 5E6SB 5TV2A 3D3KA 3UUWA 2XB8A 2GNAA 3LECA 2A1IA 4ZT5A 3D3WB 1WMSA 5AIAA 4B0OA 2HA4A 3CSDA 1JLMA 1J0EA 4TMFA 1P77A 5BXQC 2VJQA 3LPMA 2VZLA 4IDGA 3LT5A 3T94A 2VQDA 1YJ8A 3ZE6A 1ZHFA 2OMEA 2O05A 3FBWA 1SEVA 5EIEA 4NCIA 3SIRA 1SVKA 3NW9A 1II9A 1KIMA 4D44A 3IAAA 4KAXA 4V0OA 2JATA 3FNIA 3ZLVA 5BNWA 4TYNA 1GUZA 1L6IA 5GP1A 4JEHA 1J0CA 3DQPA 1C1HA 1X7XB 1S8OA 1FYDA 4FGUA 5IP5A 3S2EA 3IPXA 4JZKA 3AVVA 1G18A 5DOZA 1FRVA 4ERXA 1UXJA 3L6EA 5CFPA 3EQ2A 2G6BA 1E9BA 3TTTA 4LUCA 1U0TA 1ESEA 5K0TA 2YWBA 1X7DA 2HSGA 3ACCA 2Q99A 4NU6A 4EA8A 4B17A 2TRSB 3KKPA 8AT1A 2IPXA 4G1EB 1Y33E 2GCEA 1XXHA 1YSCA 1OLUA 4YQFA 2GO1A 1OFTA 3EMKA 4Q3DA 4EY8A 4US2R 4HN2A 1UIMA 4G1CA 5FR1A 4I46A 2W00A 2DSNA 1JJAA 3KFVA 3H0EA 1WZNA 1TGYA 3SHWA 4RC9A 4OFXA 5AUQA 4ESOA 1Y4SA 5LQMA 2M32A 2QRHA 4FQ7A 1N2SA 3F6CA 4QOFA 1IG3A 2BUAA 1UP6A 4NZOA 5L6MB 1J1UA 4WZAB 1RABA 1FFHA 1DTWB 5IDXA 1Z16A 4BP8A 5L53A 5JCZA 2QMHA 2IP2A 2P1DA 1D2HA 5HK9A 1R00A 2KSQA 2ZR0A 2REQB 2DWUA 3ABRB 3ANSA 3L82B 4CLDA 3B1JA 3EVFA 5J2TF 1YUNA 2KBEA 3JQFA 1CRWG 2PWPA 3UAXA 1A7KA 2D74A 3PUHA 2ZAOA 1YE3A 4AURA 1V1JA 4I36A 1PK7A 1WSBA 3N8HA 3RFUA 4C4SA 2H16A 4KHZA 2YRFA 4PNEA 3EG9A 1JHAA 3JR7A 4HUQB 3WLOA 3UAVA 4YPVA 3WK7A 3LKVA 1M6WA 1Q16A 3OZTA 3OZXA 1JEAA 1PDOA 2GESA 2I2AA 4MXDA 4YV1A 4KR6A 1A9YA 4LYGA 5BWLA 3Q7TA 4G41A 4MRNA 4V3CA 3WSWA 4QU9A 1C1YA 2X58A 2PFSA 3UV3A 1ITZA 2PE5A 4RVDA 3S5UA 2VBCA 5ANRB 2IPLA 4AS3A 2FLKA 2IEZA 2QHXA 4MGKR 5DZSA 2I5PO 1ISRA 2KLHA 1J49A 5JD4A 3FFXA 3JR3A 4D8XA 1Z0JA 4LY3A 5JOQA 1CV2A 2P65A 3RC8A 3FNBA 2EHDA 4AY4A 3NJ8A 2QUHA 3AIOA 1E6UA 2XKJE 1UFRA 3GROA 3L7BA 3D7NA 1PZHA 3PSAA 3H2BA 1EXDA 1ZN2A 5I4CA 4NAVA 4NEHB 1FDOA 2ONYA 1JHPA 2BMJA 3GGJA 4NOMA 5FKJA 3HQ4O 5FQNA 4BP1A 2J6BA 3O03A 4ZVLA 2QRUA 4XGIA 5CT8A 4KQXA 4Q93A 3ON5A 3CURA 3H4VA 1ZVMA 4PPNA 5CMLA 4U3JA 2Z5FA 4GP6A 2OHXA 5T4EA 1XZCA 3IL2A 4I5DA 4DNPA 1WR8A 3GJTA 1ZCJA 5IWAB 4YRLA 5H8WA 1I0LA 4WCFC 3W9UA 3AI1A 4EYOA 2O7VA 4H7DA 5DM1A 3UUGA 4AN4A 3HABA 3IKVA 1A71A 3JALA 1Y37A 2OGTA 1PW7A 3H4MA 3IQFA 3MRVA 3BCRA 4OTZA 1MO5A 5T8KC 3TM4A 4W5TA 4NDZA 4L9WA 4RK4A 3KOMA 4BGUA 4DMFA 4QLBA 4P80A 3I8SA 1IOWA 5ALQA 4WIAA 3LV8A 5I5GA 3PZRA 5CA0A 1RXCA 4OFBA 2ZYTX 2FX3A 4OJYA 3NWJA 1BX1A 3URKA 3L8YA 2V7BA 3A05A 4JR2A 3THYB 3LL4A 4GPD1 3HGTA 4P0TA 2J41A 1N7IA 4PVCA 2LCQA 4Q7LA 1ZFNA 3LKDA 4PGFA 3ND5A 4B3XA 1DUSA 3VNQA 2R6CA 2XRYA 3COVA 1ZNZA 1E18A 1HF3A 2C5BA 4C4YA 1E4EB 3GGOA 2PBLA 1AZTA 2YNMC 1YZQA 5FUMA 2BBTA 2VPPA 4IR7A 4YJ3A 1EFLA 2E49A 3I9NA 4RHUA 4GXTA 4D92A 3CKLA 1F4LA 2GN0A 4FLMA 2WVGA 2O0LA 1NBWB 4ZMRA 1H2AS 5CFNA 7AT1A 3MUFA 4LOHA 4HFRA 1ES9A 2GWRA 3CXUA 5KTKA 3PCTA 1YAHA 1NVXQ 4NICA 2GCNA 1Z6PA 3CJRA 2PVSA 1CX9B 1UWLA 2C7PA 1SBQA 2G0AA 4MUBA 2IGBA 4PQGA 2HTFA 1XA0A 2DRIA 5D7NA 5EEGA 1EXWA 1HV8A 4OY3A 2PD4A 4D96A 3KYJB 2WG0A 1UK8A 3KYIB 4Z9YA 3H87A 4LV5B 1HWYA 1NGSA 3PQ2A 4NZZA 2EW1A 4HWRA 1AMUA 1ISMA 2J5QA 2IH2A 2DHCA 2ILTA 3TLKA 4IFIA 5JXHA 4PBRA 1NQUA 4OCZA 2AUMA 4M9ZA 5A0VA 1FBNA 1VGRA 3KPUA 4WZBE 3RG2A 1F2TA 4PSCA 3TZ6A 2CF6A 4B5KA 1M6NA 3HO6A 1MC5A 3CLUC 1ZM7A 4RPKA 5IYZA 1I3CA 4JLPA 3IULA 6CHYA 1TUGA 3UAGA 3DWEX 1RS0A 2VP5A 4C5BA 2V3CC 1J9EA 2J9GA 4OL0A 4I9FA 5CBPB 1XRSB 4ND3A 1WZCA 5BSWA 1TI7A 2UUCB 1RYEA 2B21A 1N5MA 4CFZA 2PGDA 3L8CA 3KZ1E 2QE7A 3QLVC 1HZJA 4ER3A 2PX0A 5JJIA 2NZ8A 4CKCA 2QRQA 3GIWA 3RR2A 5LUAA 2DFKB 4DLZA 1Y4AE 3T3HA 1H93A 1BIFA 4NENA 4HXYA 3PNPA 3ZDFA 3EXEB 4WDQA 2XY4A 3GOHA 3RIEA 1Z2NX 3FCAA 2G5GX 1YDMA 1FNCA 1T9CA 3ZKWB 3DA8A 3GH3A 1GDTA 3HBFA 4GFDA 5LA6F 1IZYA 1HSZA 2VBFA 5FRDA 2Z43A 4LDNA 1GPKA 2ODTX 1TIKA 3AXSA 3UUEA 4FEEA 1NLYA 4DWWA 1FS6A 2HR1A 4CQJA 2VSXA 2BFNA 4YT2A 1FJGB 3U5ZB 3KYCA 5BVGB 1F9AA 2CNDA 2ZXFA 3K0EA 2DAPA 2P2NA 3QEOA 2JA2A 4KEAA 5DSZA 4PYQA 2DTDA 1QX3A 3Q7QA 5M7EA 2BFOA 3WWZA 1BDMA 4U7WA 3LDUA 1CUCA 1SPXA 4DV7B 1DV1A 2JARA 4XQCA 3DMHA 4R84A 1GXSB 4LRXA 3WFIA 3T3IA 4NULA 2TMDA 1A96A 1Z0FA 2YNMD 3DE5X 3O84A 3RYCA 5A05A 4E2WA 3CF4G 2C4WA 1ZD8A 1NW9B 2F8SA 4RY0A 3H1TA 3QEKA 4RK0A 3ZV6A 1QO7A 3QEJA 1Q19A 1DC6A 4HZGA 5ECYA 4CT4B 4DLYA 4DMUB 2PTHA 3HMQA 3B1XA 2YW9A 4GLFA 3F5MA 3ZDCA 3ROMA 2Q49A 3EQ6A 4HGNA 4TMTA 1GYRA 3NHWA 4L02A 2OGSA 4JLKA 1LF0A 1KY3A 1Z73A 2XYPA 1IJBA 1UP4A 2BEJA 4FMCF 5ALPA 4D0LB 4DM7A 4PVDA 2J6HA 4BBJA 2O20A 2WQZA 1LQTA 2EW2A 2OGUA 4BNGA 1ZUD1 3DD5A 2X1HA 1Y6JA 3DE4X 3CRQA 3HNPA 4FFDA 4FFBB 4MJ7A 3RS4A 5MN6A 3K5PA 4JMLA 2CF5A 1C9EA 1XDUA 13PKA 1D1SA 3DW3X 4KN5A 4BMDA 5I7OA 1CUSA 5L3QA 2XKAA 3RUIA 1EWTA 1ZHHA 3HM9A 5DLQC 2RI6A 3CLUD 3ZWOA 4BLUA 2IIVA 2PIAA 4YBZA 1EWVA 1P1HA 2XDQB 3D2CA 3OEHA 4JHLA 4PLCA 3RK0A 4JLDA 1D2EA 3EODA 1XRMA 1AS3A 2BM9A 4GX5A 5CEJA 1HNXB 3NOVA 1NXSA 3PB3A 4PC3A 1ZSVA 1Q7RA 1GNVA 1GN8A 4W99A 1XTRA 4U9IS 4Q4HB 3UAWA 3GP3A 4C04A 1U5CA 3PWKA 1KXJA 2EKQA 3EUEA 3NKVA 1Y1LA 4CM8A 3U7HB 2YFKA 3HACA 3OECA 2D3WA 2NVBA 2C8VA 1BFDA 3QUBA 3KRTA 4LVCA 4ZREA 2QAIA 5TVKA 3EZ9A 3TQOA 2C3OA 5IT5A 1JSRA 1XKLA 5IAKA 4D9MA 4M76B 3HU1A 3LPLA 4HQRA 3AZQA 1NC1A 4D41A 2R8RA 3GJRA 1G38A 1N1EA 4DNQA 3IALA 2EKPA 1RIFA 4JLWA 2HWYA 5AK6A 1E0JA 4OMFG 4RLHA 3ILXA 2PVCA 1COZA 4LZLA 2X0EA 1XK7A 1ZBDA 3QBDA 5EQTA 1S8AA 2PX2A 2GZMA 1R8YA 2PLRA 3OIGA 5H81A 2WHXA 1L5YA 1FLVA 4IIJB 4ERNA 1BXRA 4RZSA 5AJTA 4CF4A 2ZS8A 3PPVA 1ID8A 2KMLA 1IIBA 5IU6A 1ZH0A 3LBFA 1PU2A 2F00A 3PFIA 2CNLA 3TRDA 2EFGA 1HDIA 1RFGE 4B40A 5ESXA 3E9YA 3IP1A 1T3TA 4Q18A 3D54D 1EPUA 2EEPA 4GNKA 3KQTA 1ZRHA 1KIAA 1SHZA 4RV5A 1FDWA 2PXHA 2XVZA 3DTNA 2ZULA 1DO0A 3V7NA 3VAZA 3HZHA 4M7OA 4H18A 4OJTA 5U9CA 3HA2A 1SUDA 1WNTA 3D5QA 3DDCA 5FCDA 5JZBA 3COYA 1OLXB 2ZUWA 1F8UA 3SOPA 4UAUA 2VQFB 2QTVA 1E89A 1GGHA 1IHOA 3OFSA 2DPMA 1E3LA 1OXVA 3DYBA 4IGEA 3QW2A 1DX6A 1OZGA 1UFOA 3ANYB 2EERA 2RGUA 2BWJA 3PYLA 4FFLA 4H60A 4W8GA 2XUPA 3TJMA 5ILOA 4IDPA 4J6EA 1U2RA 5LQDA 1VKHA 1Q95A 5E9QA 3FVWA 3I2HA 2JEOA 4BUCA 1RRKA 1EFRA 1Q0UA 2C5HA 1T5HX 3TLZA 1W2WB 4I4CA 1DRWA 4DYDA 4QHYA 1J8YF 1W48A 4CF3A 4MR8A 5GZ3A 1XKXA 2Y3IA 4HWOA 2ON6A 1BFUA 2TMKA 1YOVA 2VRWA 1NR5A 1XDZA 1XZQA 2OG2A 2HNAA 1QXSA 1TKAA 2DWQA 2X2EA 3IFSA 3LLVA 2IU0A 4AO7A 4RULA 1OZFA 2H3EA 4MUFA 4DR4B 5G0WA 4BECA 1Q83A 1T4CA 3SEFA 2BEUA 3EFOA 3SICE 5JHGB 4LJ8A 1SUCA 2G17A 4L0MA 2AG5A 5B55A 1L5QA 1N5RA 3TG8A 4P3NA 2QD2A 2A35A 3BE4A 5KVVA 2AFIB 2JH3A 1AZSC 3F5QA 3MVEA 4II3A 3ESBA 1ZITA 2IYWA 5BSVA 4EPXA 4TN5A 3IMEA 3FMFA 4N1AA 4DPMA 3QG5A 3OOEA 1ZPDA 4BKUA 1HT1E 1YI1A 3QVWA 4Q7KA 1KNQA 1X8XA 3BMCA 3LC7O 4F4UA 3OLQA 2ZRBA 2CFTA 3AB7A 4XGRA 5AKHA 3VH4A 5L4SA 3R8CA 2I4OA 4NS4A 3SSOA 3DWIA 3KT3A 3HCFA 5C80A 3FNGA 3ESRA 1M2NA 4CUJA 3E1SA 3RFTA 1BW9B 1YVDA 1ZK0A 2YNMA 3QVKA 3T1NA 4CIAA 1MENA 1VYUA 4WY5A 3NIBA 1A0OA 4C88A 1PVVA 3BK7A 2WWXA 3WO1A 3CEHA 3GX1A 4NBSA 4BNYA 1ZUHA 2ZUSA 2JZCA 5D3KA 2YOFA 2H7CA 1QUEA 4H1VA 2R3SA 5TEWA 1Z4OA 1E2JA 4I5IA 4W82A 2WR8A 2VSFA 2Z57A 4R9SA 1G7CA 3D2AA 4DCVA 4KODA 2Q2VA 3LVRE 5JYBA 3MT9A 3FRIA 3ZJ5A 4OQQA 2VDKB 2DSTA 3IOEA 3LYUA 4GM1A 1PWZA 5CGQB 4BE9A 4EVIA 1GA6A 2ZT7A 4QXRA 4MINA 5JCJD 4JXXA 2GEKA 3E3MA 4PC1A 4DUPA 1IATA 4DC0A 3A2MA 3NHMA 4XFJA 3P9KA 3AUTA 3LY9A 4MDYA 4MWTA 3H5WA 4ZK6A 3AGQA 3UC9A 2E82A 2C83A 4V03A 2OLKA 1N2JA 3IEXA 1YI0A 2IIPA 1DAKA 4F3RA 1LCIA 2SKEA 3TFQA 5JMOA 2GM3A 1P17A 3U3MA 3GDWA 3LH5A 4P34A 5K0NA 4IUYA 4I5GA 1URPA 3KZKA 5BQXA 1SUIA 3H1GA 5FBRB 4KYUA 3IR6A 1RZUA 4LQCA 2IYUA 3NHJA 3PG5A 4QG7A 4D97A 3B89A 1JXQA 3CS3A 4NV1A 3H3XA 5HFAA 4EHHA 1UOPA 1I9GA 4ITUA 2YWCA 4OJKA 4YS6A 3KKNA 2NPIA 3R1IA 5B7QA 2OCGA 1ECBA 4ARVA 1M2EA 3TKYA 4KE8A 2W2TA 4G67A 1OH5A 3EOBI 2JHCA 1TA0A 1TYAE 3SQNA 3SCZA 4AAYA 4ZTZB 3H5OA 3NHFA 3OMLA 4WVFA 4X7RA 4WNAB 2PWZA 3P9SA 4OFWA 1IH8A 3BRWD 1U0JA 7ADHA 2PANA 3TMAA 1Z25A 2RGNA 1SULA 2HM7A 3QVSA 2NZ2A 3PP8A 1UWCA 1PJ8A 4TT8A 1KYZA 2YMMA 3GT7A 1T4BA 4LSWA 4WXRA 5EE0A 1W1UA 3RHZA 2LCFA 1E7WA 4JOBA 4RKYA 4DL9A 2VK2A 1HLDA 5EZ5A 2IPNA 1ZMXA 2CVHA 4EYQA 1PNOA 3KOYA 3FPJA 4ZI7B 5KTPA 5AK5A 1UKVY 3HYTA 1RSZA 1M2GA 4CHGA 1SKUA 1OH7A 2XCOA 3K8OE 1MVNA 2E89A 3M3PA 5ULLA 1KK3A 4WAUA 5KYXB 1XPRA 3UPTA 1VJDA 3FI9A 3SK0A 4C9BA 2YQ5A 3C1TA 3KIPA 4DJ5X 2IIBA 3H6KA 1DVRA 2R1TA 1M34E 1XRNA 3LPDA 1LC0A 4F5YA 3RS9A 4IINA 4UCXA 3SYKA 2ABWA 4B7AA 3C41J 1QHNA 2IS2A 4WLEA 1OUMA 3MLBA 4G4GA 1HLPA 3NBKA 5T3YA 1QX4A 1N32B 2IYNA 3FLBA 4NYIR 4CFSA 3ZQ4A 2OHGA 1L4MA 1XXLA 1SWVA 1R4NB 1T6BY 3CZQA 3PD1A 4HNTA 4UU1A 2JGLA 5JALA 3TE7A 1FL9A 1RC8A 2QYOA 3BUSA 1UFKA 3DE0X 1PTKA 2O57A 3Q1LA 4QGFA 5AXCA 1QPGA 3KALA 1JQJC 1Y48E 2MCFA 4AYWA 3CIFA 1GAQA 2FUG1 1OWMA 2F67A 1KGDA 3SFTA 3T7KA 3PDJA 3H9UA 5IVIA 4F5WA 1E79A 3F5SA 3R2JA 2HRBA 2HI0A 5D5QA 4DBVO 2QPTA 3CRRA 3O8BA 4MLDA 2VDWB 2W6NA 2O5EA 1MP0A 3QEMB 3QPAA 5HEKA 1W44A 1FFEA 3BTUA 4EIWA 1KHHA 1Z39A 1V5WA 1GYPA 3QTLA 3QEAZ 1TX4B 5E2BA 4CF7A 1N2EA 4XYBA 3S7TA 3B3JA 1CS4C 5JNRA 1CERA 5AJVB 2QT1A 2VDLB 3LT2A 2C9MA 2I8LA 3IHWA 1VRCA 1OC2A 2O2EA 2VJNA 4GE3A 3AGPA 1ADBA 1W75A 1ZWKA 2CBGA 4V0SA 4FQ8A 3ICQB 2ZUUA 2G04A 3ZR4B 1CZKA 5KVCA 1CY6A 1L9KA 1NXXA 3GFVA 4MW0A 3W1EA 1PSDA 2H1WA 4U2EA 3DTVA 4F71A 2AWOA 2OXIA 5CIYA 3B1ZA 5EGNA 1JE0A 1JJBA 3B1WA 3CLHA 4A6XA 4MGEA 3PE6A 1BCRA 2I65A 4PX5A 3PEWA 3ZV4A 1M2JA 1UC4B 2QPLA 2QLTA 3BTOA 3MJDA 2IODA 4FCTA 5CB4A 5J2TA 1NP6A 5GGXA 2F1JA 2HUNA 3D0QA 5EZQA 4BLTA 5HRUA 3ROPA 3O3CA 2OZLB 3KYBA 2V96A 4DLXA 1ZIXA 2ZWMA 5JPCA 3CN9A 3D6VA 4NYIQ 4BVGA 3NHKA 1RJEA 4N01A 3X1WA 1ZN8A 2WOJA 3RF7A 1V43A 4GRIA 3ZGOA 1YJAA 2A7QA 1VKRA 1T3HA 4JENA 4P3OA 2WSSD 3P4UA 4I1UA 1IBSA 2P8SA 5DLEA 4JJGA 5H70A 5TPWA 2AG6A 5KQGA 1MAVA 3BGOS 1Z5WA 3DLBA 2RFLA 4P2BA 2GKGA 1WV1A 1SXQA 2ORIA 4CI0B 5B12A 2BBOA 4DAOA 2HA6A 4KWCA 1LTQA 3CNQS 1XVUA 2FX2A 5KQLA 3EXHA 3F6PA 3VXKA 2V1UA 1Y9EA 2HQRA 2Q62A 4PCAA 5AW7A 3EIUA 4JJZA 1Q1BA 2JASA 3QTBA 4X00A 4YVFA 3ZYZA 1G3MA 5JZVA 3ZX5A 1F2UB 2F3RA 3P4YA 3I5XA 5CXXA 3M6UA 2R86A 5BN3B 1ZGHA 5ITSA 1U7XA 4TS1A 3R9KA 3PC4A 1XJWA 5HZGA 4ID9A 4MB2A 5JG7A 4Y1RB 5IBPA 5C52B 3AY3A 4NZ9A 2RBKA 3GP8A 3NEJA 4EABA 3MJEA 4Y6RA 4MEBA 4BO1A 2BGNA 2C5AA 1C4WA 1T10A 2Z2ZA 1E58A 1O77A 2A9OA 1M1NA 1QB8A 2YINC 1AT1A 1ULBA 3ECCA 4M86A 4YO7A 4YCSA 4CM7A 1VDMA 2W6IA 1X7HA 1J8FA 2VTVA 4MUIA 4QT0A 3M89A 3OKCA 1CUWA 3L79A 3W06A 4Z7NB 1VIMA 2VHCA 3D4IA 4HEJA 4RD0A 1P33A 4WOBA 3PI7A 3H75A 5G3ZA 1OIWA 2OC4A 3BFKA 4JC0A 1R6UA 4RETA 2EZTA 4D99A 4UZSA 4JBHA 1RQNA 4HVAA 5AVYA 4AB1A 3U80A 3HBAA 5EHZA 2Z5LA 2HQOA 3QZUA 4DEVA 4QYIA 3NASA 2NO9A 4QPCA 2JGKA 4YGXB 5C8YA 3OIDA 4YRTA 3CVUA 3SHFA 4RU1A 4PF1A 4MTCA 1QQTA 3BRWA 1ISJA 1NNI1 4H17A 1CJKC 1QP8A 1WCYA 5DGHA 3JQPA 1V45E 5TJHA 4DCOA 2QR5A 3U7QA 4FEGA 2FFRA 3A9CA 4QTXA 4Y6GB 2BMAA 1G291 3H97A 5WRFA 1JRLA 3RRFA 3TL6A 2QN2A 4TTTS 3OD5A 1LX7A 1FRNA 2ZU0C 4L73A 5BYAA 1V7QA 3Q3JB 4FE4A 4FHFA 4LZNA 3UATA 1HOXA 5FPQA 4ER7A 1I10A 2QTCA 2E4XA 2PD3A 1X77A 2DUMA 3KFLA 4RA6A 1G1AA 5CLGA 5AXDA 5K6TA 3P9RA 4JB3A 2IBSA 3KV1A 2N0SA 1E8NA 4J16A 2IITA 2C0CA 2PNJA 1LBHA 3Q8WA 4FMDB 1F5SA 4NNPA 2BKEA 1AY0A 1W87A 2B0CA 4KL8S 4BRUA 4CR6A 3HSSA 2Y77A 3F6EX 4QIHA 4YPOA 3R0IA 4RF2A 5B6PA 1GO2A 3PITA 3HL4A 3ROQA 4CV3A 1M8GA 4DCSA 4RK1A 4UM7A 1D04A 2J9FA 2WU8A 4K9NA 3U62A 2R1VB 3WB1A 1FFAA 3WNVA 4IGKA 4UZFA 2A14A 2BOVA 3L9XA 3TB6A 3N7UA 3JRNA 3MC1A 3SPXA 4XLLA 4FNAA 2F7SA 1NMQA 5DW0A 3WR5A 5AI8A 2PUTA 4MH0R 5BYKA 3L07A 4XJVA 4BVAA 5C7LO 1U4OA 4OVKA 3TRIA 2FMTA 3WLAA 2HBYA 3ZGNA 3LK6A 1JSCA 4O63O 4J1QA 4DRYA 2Y2VA 3DE3X 3FE2A 1NZJA 4ZEOA 4OYYA 2QTWB 4WMLA 4Y2TA 1KZ6A 4MVJG 3L8GA 4OIFA 3FTDA 4QJ4A 5GVRA 1W59A 2XHZA 2P69A 1A2QA 4NCJA 1K5PA 3AF3A 3GMSA 3CLVA 5CU7A 5B53A 4BQQA 4TLCA 2AFIE 1ZGCA 3OMWA 1KI9A 4JYMA 4N03A 3OHMA 3C16C 4EMBA 2OXTA 3SEZA 1NF3A 4RK5A 5KYNA 5C0OE 3QE9Y 3BJIC 3HEBA 3TSWA 3FPHA 3ROZA 3JASA 3PYXA 3PLRA 4C21A 1TD9A 1L5OA 2CMHA 2PJZA 4BVHA 2ODWA 1K2VN 1IAVA 4LJ7A 4LRTB 4ZQCB 1MGOA 1JIXA 3FH0A 1Q84A 1LLCA 1VYTA 3L43A 3NEPX 4W6QA 4A03A 3VYRB 4A1FA 3OJ0A 1HDCA 2XA2A 3N0TA 2H0RA 3E82A 1I4OA 1R16A 3IB6A 4JODA 5E9AA 1VL6A 2W43A 1GZHB 1HTWA 2V3VA 2X5JO 3GYGA 4MPDA 3SBXA 1AKWA 3U49A 3DLAA 4PCUA 1GRQA 1R9MA 1CJVC 1TQ2A 4DMKA 1EP9A 2JZOA 3QLEA 3ZJTA 3BYZA 4HWSA 4TVBA 3O9ZA 2OBXA 4JXKA 1MUUA 3C6XA 2YN2A 1ZAYA 1U7TA 4PIMA 4UBLA 5F1PA 2AC7A 4C6RA 4TV8F 4Y98A 1GTG1 3K5IA 4ZDIA 4DXDA 2JFHA 3LVFO 3BXZA 4WN3A 5LA6A 5ITZA 1GQRA 4ZHQF 2VYFA 4HXFB 2L17A 4OF4A 2V65A 3G1WA 4YRNA 5IT0A 1JTEA 1OW3B 3DBHA 1ZIPA 4J7CA 3GO4A 2DT8A 5A04A 4S12A 4TZ6A 2GN2A 3JQRA 4LIPD 1T5IA 3UMVA 5EMMA 3C3PA 3FPLA 2C61A 2ZRNA 3E2IA 4PZ0A 1P5RA 1QF9A 1HC7A 1V48A 1WHTA 1HRDA 1Y6RA 2FJPA 3DAFA 4HUQA 3H6HA 2HGSA 1LNZA 1P9NA 1Q3HA 1THZA 2YWRA 1O6GA 2YZMA 1KBOA 3P2EA 3CNNA 2CE7A 3HJUA 4G9BA 4TWBA 5IFLA 1GPH1 3PC7A 1RPZA 2OM2A 1RM3A 1SQ0A 1AUXA 5KOYA 1HETA 1JL3A 4IHAA 3EVZA 2ACWA 1K1EA 2YC2C 3AHGA 2BF4A 1XKQA 4MPRA 4BNTA 3CF0A 3KDPA 2CLDX 1FX1A 3Q2KA 4HUTA 3V9PA 3TCKA 4GECA 3NGMA 3ELDA 4UU8A 5PNTA 1GNLA 3TIXB 5I3ZA 1OH6A 4G1VA 1TO6A 5HF5A 1H9CA 5AVVA 2G1UA 1UMCB 2CVZA 1HT3A 1KMHB 3V7YA 3T12A 1GADO 1RCUA 4UNIA 2CLMB 4FI3F 3KKKA 4Z4CA 2WTUA 1LRJA 1EP3B 5GVSA 3WK6A 1Z33A 4B6OA 3WLIA 3FCCA 5IFKA 3KLPX 3A1TA 1YBHA 2CNKA 1Q1AA 3WB2A 1MMFB 4QGBA 1H6AA 1H0SA 5HM8A 1VPVA 4REMA 4S1TA 1SVMA 3PFKA 1GGFA 3C45A 3BG5A 5JHHB 4MR9A 5BQ5A 4MKFA 1UPUA 3RYFA 3MF4A 5EE1A 3JWJA 4QRIA 5A4MS 3NNSA 2Y1XA 4GM4A 3A25A 2PBRA 3T4XA 2YKGA 1GTJ1 4LCBA 3D6MA 1SCUB 1GDDA 3LQ4A 3FSEA 3MXTA 3L8DA 2WG2A 2NZWA 2XXBA 5C46F 4C05A 1K98A 1JDTA 1UDRA 2XGSA 4BEBA 3WIBA 3HGMA 5CUQA 3DWGA 4V0ME 1CWUA 2ODNA 2TMYA 4D26A 3GW8A 421PA 4KSBA 5B7PA 2DFDA 1IHUA 2EF1A 3K0HA 2JIOA 1X19A 2BR5A 2Q2WA 1TQDA 1CDZA 2BZSA 4JB2A 4OB6A 4LK2A 1Y9DA 4OH7A 2HMTA 5REQB 3IO5A 1KERA 5BN5B 2HADA 2VHJA 2HXSA 3FZYA 3QF4B 3PUYA 3IIEA 3K8QA 4B2LA 5IC4A 3KX2A 2ECQA 5C5CA 4BBPA 3THYA 4C08A 4WACA 5J9FA 2WLTA 1S7GA 3OQOA 4BE7B 3AILA 2EAUA 1IHDA 4HVCA 4ZALA 3ADBA 4D4HA 3CVJA 1ZI6A 4JSTA 2VG8A 4EB3A 2JLZA 4NHEA 4UOQA 1S5PA 1KEWA 2CCGA 5FYQA 4AZVA 2P11A 4QRDA 4CIVA 5C53B 5ALZA 1EZZA 1XJ0A 3HN2A 4UTRA 4E1AA 1NW4A 1XAGA 2VPQA 3BSWA 5FF9A 5LP6F 1YASA 2QIOA 3D8UA 1Z8NA 3QBJA 2E4AA 1G8FA 1SOVA 5FADA 2PWAA 3HXPA 3ES9A 2AR9A 3C74A 4KRGA 3VU1A 2A86A 3D6TB 4M46A 4WDRA 2O50A 1T15A 1KSGA 1DQSA 5EHNA 2Y9PB 1VYVA 1KH2A 5HE8A 4E7OA 4GL4A 5EVCA 5FPPA 3HB4X 3PWSA 4PSUA 5DX8A 1W94A 1FCJA 2I29A 1FXUA 3GD5A 3FJ1A 3B7WA 9MHTA 1MJGA 3RSSA 1PFWA 5DYGA 5AESA 5CAEB 5F77A 1GTRA 1LI5A 1V1MA 2I7TA 2PUJA 3M6IA 4PNHA 3E2MA 3R5KA 3ECSA 4UEQA 3AM1A 4OMDA 1IZ9A 2BUBA 2RAVA 5FA5A 2ZUTA 1YVRA 3E4DA 3BZUA 1KYVA 4A23A 1RXYA 3PENA 5IHPA 1CNMA 1TK3A 1LJUA 4E2YA 1PBNA 2I22A 2RGWA 3JYPA 3R3XA 1G21E 5LP1A 4IWXA 1GY8A 1L5MA 1P1KA 1Z4IA 3PR2B 5CVEA 3SDBA 4CMKA 4RMJA 1Q7BA 1QE5A 4Q1VA 4TGLA 4B7CA 5DGIA 2RAUA 3KLBA 4EKIA 3NVKI 3H2HA 2DHRA 2YC4C 4N0PA 4TXHA 4F3NA 4UTXA 2YFHA 2WYOA 4DC1A 1KQNA 3QMPA 4BBAA 1KMIY 4DDTA 5HQTA 2WPDD 2JDIA 4KP7A 4OHMA 2CFOA 3FTNA 2CMDA 4RM2A 1B14A 1JDNA 3BGDA 5K3SA 1RC0A 5G1PA 2EFDB 1L1FA 4B4OA 4OPMA 3VH1A 2FUKA 3TNFA 1NZFA 4HTFB 1BDIA 3QYAA 1J99A 5EP2A 2VAMA 2ZOSA 1L4NA 3LCRA 3KJHA 4EENA 4A8JB 3IV6A 5A02A 5BVGA 1TZBA 3HYCA 3ZHTA 1OWNA 1J8VA 3VJRA 1SQGA 2Q0QA 3K16A 3K09C 5U1PA 1FXSA 3PUKA 2IA5A 3GEBA 3KETA 1A50B 1OASA 3CBGA 3SLKA 3HXQA 2VUUA 3IQIX 1Y6ZA 5E6RB 4E32A 5EMJA 2ZYDA 3D8RA 5B6JA 1GXSA 4RTNA 2C3YA 2HIGA 3DDHA 4BPRA 1KIFA 1TIBA 2CC2A 5FTNA 5K6RA 4D7AA 3GPCA 1T5OA 1CUHA 2GBIA 3JRXA 1YB4A 3IOMA 3G7UA 2JFZA 4F45A 5LM3A 1JB9A 1A9SA 3VHQA 1BTOA 3IE1A 2OOSA 1EFVB 1F0KA 4KNVA 3LXUX 4MW2A 4RD4A 5EC8A 2J31A 3ZHRA 1NSYA 1AURA 3HBNA 3KB1A 3PDIA 1NVMB 3PQDA 3AUXA 3OZ7A 4RLFA 4MQEA 5BNIA 3AR6A 1V5GA 3BGSA 3IAM1 3SHOA 1SCJA 4AKEA 2XWQA 3UJCA 4JWTA 1M3SA 4HFJA 1FFCA 1L6RA 1Z37A 5C34B 3STXA 4BFWA 4FNOA 1VMDA 2MDTA 1DC7A 4JEIA 2RHTA 5L3SB 2DXIA 4X1OA 1RJ9A 4JLVA 3PX7A 1MBZA 4U2KA 4OHXA 1DEKA 2Z8XA 4FKMA 3V1YA 4MITA 4DF3A 5IDQA 1Y7TA 2NU6B 3OZGA 4PZ9A 3WWEA 3CH7A 2PDAA 2V6IA 1V11B 4D25A 3DBRA 4AIRA 1VPEA 4ZJUA 1V7CA 3RUCA 3OD1A 1RT9A 3SC4A 3FR7A 1NXPA 2XDQA 1E3IA 4AROA 2J30A 4HGRA 4KQ2A 4GXQA 3IE2A 3L1KA 5B6IA 2O7RA 2OP0A 1U8ZA 1YNSA 4KXLA 4Q3NA 4CGZA 3IHLA 4WXYB 1JDPA 1N2XA 1OPRA 2GJ9A 3IGFA 4UNSA 4CCYA 3M49A 3VOTA 4Q4HA 4DLKA 1A97A 1PJZA 2E3JA 3IP6A 2G4VA 4ZVVA 2ZU6A 4O5AA 5C35A 1YB7A 3OWXA 3UB2A 5BQOA 3SDZA 4PPFA 3PDHA 2EP7A 2HDOA 1YA8A 4GVPA 4QYMA 4U4AA 4GOJA 4XVRA 1XIVA 1CZRA 4GD3Q 3T9CA 2H1SA 2FLWA 1UPBA 4AF6A 4YAKA 4ZOLB 3MZ0A 1LDMA 4DUZB 3NCTA 3TTXA 4F60A 4TLLB 2JGEA 5J2UB 4HNGA 3THOA 3MTGA 5IASA 3K6SA 4OU4A 1DKLA 5DF1A 4QDZA 3UJBA 4YMWA 5FPYA 4QTTB 2XQVA 2QG9A 2Z2XA 3L77A 4IXNA 4YX9A 3PQ6A 5H3HA 4V1CI 4I19A 1XZKA 1RI4A 2HDWA 1H85A 1Z62A 3AUJB 4XVUA 4W7IA 1W8DA 2IJGX 3OZCA 4Z3DA 1ZM2A 5CLFA 1EP1B 5JSUA 1EFPA 2FSHA 3N8IA 3MS2A 3SZUA 4B5LA 2ORWA 1DIHA 3I6BA 4C2BA 1IK4A 5JY1A 5K4GA 4TYWA 2PMBA 3QV2A 4Q00A 5LLDA 2IU6A 4UHJA 4DEYA 2W6ZA 1JPVA 2J3KA 3SX4A 3S2YA 3ESAA 2P1RA 3RD5A 2HRDA 3ET5A 2B30A 1LW6E 2MYUA 3TZEA 3UAYA 2ODEA 2HWUA 3C6MA 4RFSA 2Y71A 3QVMA 1V8BA 1QQ5A 2HRQA 1XQ1A 3KOXA 4FFNA 1CKEA 4PWYA 3RJZA 5K8LA 4CTNA 1WB9A 4J7UA 5AW5A 1QGZA 1QV6A 2ZYHA 1SBYA 2NO5A 1NHGA 3GK3A 1GAEO 2AI2A 7YASA 2GEVA 1WPQA 1HFJA 1M9NA 3OBIA 2J3DA 1FNBA 3KWJA 2HT1A 4PZCA 3TECE 1ZJWA 3IAXA 3PCXA 2MU1A 1RQGA 3P8ZA 2GTIA 2ODPA 5BSRA 3U44A 1P5ZB 4JLOA 2IP1A 1GLGA 4ZIRA 1IL0A 1NMSA 4FYIA 3F49S 1Z4LA 4LYDA 3GGPA 1OH8A 5AFSA 1Y3IA 3IUJA 4L3VA 3SQOA 1YR1A 2BJHA 1EU1A 1NJGA 2AF3C 2H4ZA 3CEMA 4IVPA 5IBRA 4U7DA 1OROA 3QVTA 1O96B 3FYUA 1U3CA 2RHLA 2I87A 1P2BA 4UJ5A 4UNNA 4HB4A 4OXNA 2NV0A 1E32A 1M5TA 3SHTA 4DCPA 4AJNA 5B58C 5EJ8A 1FW8A 3HP1A 1GCIA 3IIJA 2SKDA 3ZU3A 4JSYA 1C29B 5DH9A 2DC1A 1M7HA 1D2GA 3A4LA 4RDCA 1M10A 2ADMA 4FC6A 2SBTA 3VAAA 3PHGA 4Z7QB 3TB4A 1DT3A 1RLUA 3C1UA 3HNOA 3IS3A 4NJEA 3LVBA 3GLIA 1F8FA 1BVRA 3K05A 1R0XA