4DOMA

Crystal structure of the tir-domain of human myeloid differentiation primary response protein (myd88)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
134
Chain Sequence
DMPERFDAFIYCPSDIQFVQEMIRQLEQTNYRLLCVSDRDVLPGTCVWSIASELIERCRRMVVVVSDDYLQSKEDFQTFALSLSPGAHQKRLIPIYAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Myeloid differentiation primary response protein MyD88
publication title Molecular mechanisms for the subversion of MyD88 signaling by TcpC from virulent uropathogenic Escherichia coli.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 134
sequence length 141
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4domA01
2Y92A 3UB2A 4C6TB 4C7MA 3OZIA 4LQCA 4FZ5A 4W8HA 4W8GA 5KU7A 4C6TA 1FYWA 1O77A 4C6RA 4C6SA 4EO7A 2Z5VA 3H16A 4LQDA 1FYXA 3UB4A 2J67A 1T3GA 4OM7A 5H3CA 4DOMA 2M1XA 1FYVA 3UB3A 2JS7A 4LZPA 3JRNA 5FORA
chains in the Genus database with same CATH superfamily
2ID4A 5TVKA 5JH7F 3HY6A 3LKVA 3U3MA 5A1JA 3R3WA 4FDVA 2GB4A 4NICA 1HA3A 2WM3A 1FFWA 4Q37A 4N41A 4AXBA 1V35A 4FYVA 1RQRA 2AD1A 4IIUA 1M76A 4CNBA 4EP1A 3K94A 2CLSA 2P67A 3CKLA 1ODSA 1LRJA 1FXWF 3ZDBA 2F6RA 1WXQA 3AL2A 5T8KA 2AXPA 2CK3A 3M6VA 1P45A 3U4QA 2KQUA 3VFDA 1FDVA 3HJGA 3TD6A 1RWKA 1M1ZA 2QRPA 3VR6A 2ZTMA 1P2GA 1H2XA 2DFTA 2G88A 3AP2A 3CEHA 3NRJA 4EFLA 2J9FA 4EHLA 3NEYA 4F2PA 1M5RA 4L3OA 4XPIA 2RGXA 2C9YA 2XEXA 2Z9BA 2AW5A 1DADA 2PZKA 2YV5A 3OMLA 3D59A 1PFQA 4P93A 1ZEJA 4PYRA 1UMDA 3I34X 2X3UA 4KAJA 3WV5A 1TB4A 2A0FA 2GYYA 2WR8A 4UTXA 4ZI3A 4RV5A 4S1NA 4KPUA 4D98A 4ETWA 5JY6A 1C41A 1PNOA 1S9DA 3A26A 3OJLA 3LFHA 2WWVD 3GHHA 5IJAA 5KMGB 1OY1A 2WMDA 3N75A 3MGGA 4L22A 4WBNF 3RV4A 1OIWA 2BGJA 4RFVA 3L82B 2WAOA 5FOTA 4HB2A 3LY5A 1KYZA 1N0HA 2CLLB 2PA3A 3BL5A 1KS2A 1HI9A 3QMPA 1BVRA 2RB4A 3KXIA 3PGLA 1CY7A 1Q7GA 2NT4A 2BM9A 3WDLA 1Y9AA 2DMRA 4QVIA 1YGYA 4LZPA 1IEVA 2DFDA 4ND6A 4TQAA 4Q0MA 3OTGA 2GPWA 4M8SA 4B7CA 2BGWA 3LW8A 1BWRA 3KT3A 4CTKA 1OW3B 4BLUA 4EKNB 3LDHA 4P4SB 3SE0A 2ZUFA 1OB2A 3TRKA 2QXYA 1FLVA 2E1PA 1SCNE 2WYWA 2H48A 3D6NB 5FWAA 1Q0LA 3N74A 4DMKA 3LZCA 3T7CA 4L72A 1JKFA 3PHCA 2VDUE 3OG9A 3D6AA 4MQFA 1NN3A 2C5FA 5EJFA 3UFBA 2O23A 1EDEA 4J0DA 4J1NA 2VQFB 2Y1KA 4Y2YA 2QVLA 4GMDA 3U3JA 3VZDA 4HT3B 4QYWA 4F97A 2GD6A 3JS5A 3V9PA 3WX0A 3AM3A 3OKAA 3QM1A 4N65A 4D7AA 2V6FA 3ROEA 3CX6A 1T5OA 4UXHA 1WQ1R 2WSYB 2QP3A 3B1YA 4BNJA 2WF7A 4G24A 5B36A 2Q99A 2PTHA 4TXHA 3H1BA 2LW7A 3ER6A 3I2HA 1O89A 4GMFA 3K7EA 3UG7A 5ADUS 2WK1A 1U0NA 3ZN2A 4GT1A 5HX7A 1H1DA 1F17A 1NYTA 3EXEA 1DQRA 1EJ6A 3H8JA 4JP3A 4KDEA 3N8GA 1ADBA 1G21E 4KTVE 3R9XA 5ESWA 3W79A 2PV0A 3IAHA 5AM4A 1Y6QA 1PHPA 5CP8A 3ZX4A 1YC5A 3G5MA 2VCYA 1KBZA 3VNRA 1LSUA 2UDPA 1JHMA 2ZP1A 1R00A 4GPEA 4NONA 2BMDA 1H2FA 1XRSB 4A8TA 1Z12A 3F6CA 4Q6BA 2R7KA 4UTZA 3EYWA 5DXAA 3ND5A 2D3TA 2DR0A 1V16A 4IZOA 2B4QA 2P4UA 3LFTA 2XD4A 3HKEB 1J8VA 1YNSA 4DNXA 3S1AB 3VU1A 1N36B 3ZLTA 2ZRGA 2YVLA 3EXIB 2N3ZA 3FHLA 3Q2OA 1VM6A 3FVVA 2GN2A 2XSZD 3N76A 2JRCA 2QY6A 1ISMA 4MROA 4NNOA 1KXJA 2VDLB 4CQMA 3TD2A 2PAAA 2I6SA 3D3JA 4KFRA 3T7RA 5LNK6 2GXQA 4EY8A 4GOJA 4DRXA 4MRSA 2P9JA 3OQJA 2DBYA 5TX7A 4EKGA 1IBSA 3EGOA 4TKMA 4IXMA 2ANCA 2ZSHA 1J8DA 1QDEA 3EEYA 4QAJA 3A4TA 4AZ3B 3AEZA 2ATVA 1T5HX 3DE5X 3I9V1 2PUCA 3EVNA 3L7KA 3LT0A 4LZOA 2OXTA 3ZDCA 1S8OA 5REQB 3JR3A 3ELBA 5DK4A 3B53X 1U28A 1TQHA 1VMKA 2V45A 4LXUA 3OOSA 2ALJA 3D8SA 1L7NA 3EZNA 4YAJA 1K2WA 3IT3A 4QXAA 1EWQA 2FCRA 4LNUB 2BFEB 3MS4A 1PAUA 1KC3A 3IAAA 1VCMA 1ZISA 1DKMA 3L7AA 2FUNB 4LZZA 4YV0A 4QPPA 1EUCA 1NMZA 5A6SB 1RPTA 1T5LA 4QBTA 1ZKDA 1NXQA 4H0NA 4EMTA 4IOMA 5HCUA 1E9RA 3N7UA 2YWGA 4JBIA 2H4HA 1XWIA 4RD2A 4YAIA 3KPJA 1GQRA 2WNHA 5BN3A 4Z0PA 3E22A 3K1YA 5CFRA 1AKUA 4M1KA 5EMMA 5HKKD 5MGNA 1YZNA 3M49A 4MWTA 4F5ZA 4UM7A 1RZRA 2O8BB 2J9RA 1L4BA 3JZIA 3UAXA 3F3SA 1UQUA 2IUSA 4O8ZA 2WPDD 3WMXA 4CM8B 2HMUA 1C0PA 1I14A 1UMCB 3E05A 1VKNA 4EL5A 4C7JA 5IASA 4XQEA 2IBSA 2F43A 1YL5A 5CEEA 1YTUA 4ZGWA 1W6RA 1Z5PA 4ZQGA 3FR7A 3S2GA 2XCTB 1N5RA 3C3PA 4EI7A 2YWHA 3MELA 2V65A 3FLMA 2L82A 2H11A 3Q0EA 4U7GA 3DZGA 4I4CA 4X97A 3P9IA 2NV2B 2D74A 4OSPA 5DRTA 1N2EA 1RADA 1NXVA 4NEQA 3I2YX 3NC4A 4F2WA 1VRWA 2P9ZA 3OZUA 3PGA1 3PLNA 4BBPA 2AZMA 5FNVB 4NCAA 4PAQA 3ELUA 2BV3A 5BSHA 2V5AA 4WACA 1RWWA 6NULA 3NNNA 2YZ7A 3DDUA 3B6KA 5CK4A 2VJMA 2FR0A 3FSGA 4H4CA 5BWBA 3L7OA 2AD5A 2FEXA 1UBMS 4G36A 4KWIA 2MYNA 3Q4GA 3I62A 2BGIA 3CQ9A 3EFEA 4HMQA 4K9NA 2OV1A 1Z2PX 3TL2A 4YDQA 4YT5A 1UJMA 4QPNA 2J31A 1R5NA 1P2DA 3Q41A 1G5FA 3T54A 3HXKA 1QC5A 1V8FA 2I2FA 3N0WA 2BHNA 3O75A 3CONA 2VAWA 1P9LA 1TM1E 3RRNA 1CV2A 3WMRA 4X44A 1VBNA 2CDRA 3V1UA 3ISVA 3ZJ5A 1D07A 2CNWA 1FNCA 2W4QA 2XGGA 2Z3VA 4LF8B 2I6TA 5KQSA 1ISSA 2QV0A 1QWSA 1L3CA 1NF9A 2X2PA 3IJRA 3OU6A 1DEHA 2PDAA 4DGQA 3U3RA 4K6CA 4B3FX 3X1WA 3VHXB 3MWJA 2PZ8A 4JI8B 1C7ZA 3NT2A 4RVCA 2UUBB 1Y4AE 1EGQA 2DCUA 4JEHA 4MJXA 1WABA 2FMHA 4BC0A 3GU3A 4CLRA 3KR1A 1BU5A 3ZWQA 2ZRIA 3PNBA 4F4JA 3LYLA 4YJHB 1CUDA 1GT91 4C43A 1XSEA 3WZMA 1OXSC 3AEQB 2J3MA 1GNVA 1KDOA 1ZAKA 1RLTA 4HDKB 1LPAB 3GDFA 3MTBA 3WP1B 1MB3A 2FG6C 1BRMA 1C0EA 1Y42X 1X7WB 2PKEA 2XAUA 4HRXA 4EUHA 3C3DA 1GUYA 1YS9A 1ZICA 4CG1A 4DR6B 1BS1A 4BAUA 3IEIA 3HMQA 4U7PB 2JJMA 3G2KA 4DDMA 5IU6A 2VNKA 1FDUA 3ZHRA 4L08A 4XW2A 1OXUA 2LKDA 4DA0A 2F3QA 4JD5A 3DULA 1AKNA 3MRXA 4OLBA 4OHCA 2DTEA 4PE5B 2RAUA 3K35A 2GRUA 2ATXA 5ALQA 5U4QA 2E5FA 4L4UA 2I1WA 4JGBA 4NMHA 2MMGA 5J2TF 1I2BA 2ACEA 1V71A 5T57A 1KZHA 3D1VA 2Y0DA 2QW0X 1U0SY 3NXSA 5LZ4A 3OPNA 1JR3D 1BQ4A 2ZITA 3NI2A 5EZ6B 1SXJC 2AJTA 1SHTX 3DS8A 3JVDA 5LDDC 4S24A 1XJ5A 3R5JA 2PZFA 3QITA 5JZ9A 5B2EA 1BIFA 1JB9A 1BEUB 5CT6A 4KXMA 3KKOA 5EWLA 5LU8A 1LFDB 1W5FA 2W93A 1HDIA 4C1BA 2RMKA 2V97A 3A9RA 4PFQA 2VP5A 4RQTA 4MR8B 2V58A 5C1IA 1TIBA 4D8VA 5MDHA 2OO7A 4WJKB 3FKSA 2XRMA 4XYEA 4EHAA 3PNPA 4UFPA 3W9SA 4DMGA 2QTHA 3U26A 5B2FA 4P8RA 1VB3A 2ONCA 4OTZA 3PPYA 3RVBA 1MPXA 3O3OB 5DBOA 1DJPA 4DHEA 3ZVLA 1QIMA 4JENA 5BV2P 1N2OA 2VIIA 4RZUA 3N7TA 5H8WA 1J6UA 4GXTA 4PGHA 4AT1A 1XAJA 1EEHA 3KHSA 4HAWA 1WPGA 4KQEA 4N5HX 5JCOA 2WJ4A 3G0IA 5TEWA 4TRNA 2JF0A 3L0DA 1Q0RA 1RSZA 1UEJA 1RRGA 4X1YB 4XFKA 1ZSYA 2D0DA 3CZAA 4LE0A 2D1QA 3JV7A 3V2HA 3QXSA 4CDNA 5CCBA 4IH4A 1IQPA 4OXIA 5J59A 1FUIA 4C6RA 4ZV9A 5CDHA 3GDWA 1IUOA 2ZI4A 3T3PB 3O7MA 4GL4A 4HQ0A 3TR5A 1CP3A 2PXAA 2FZGA 1GZ3A 2IUYA 2Q3EA 1G5IA 1WSWA 2NM0A 3DBRA 5KWEA 1WMDA 1QHYA 1A7JA 4IS3A 2AXEA 2XB9A 5DYIA 1IHYA 1JHUA 4L07A 2X2EA 4X66B 4IR7A 1WCXA 5BSVA 3NHJA 2PX4A 3B38A 3HS3A 3WRWA 1UKYA 5JNWA 2GTIA 5H9WA 3ADOA 4ALJA 1P60A 4I7EA 5GINE 2BEUB 2YINC 2VEDA 4IP0A 3KSDO 1XZFA 2VHZA 2XADA 2VF7A 4BCCA 4J3NA 1OWLA 3I9LA 2Q50A 1AHIA 2IYTA 4NATA 1IL0A 1AQ6A 1T4CB 2W58A 3E4DA 5A0FA 2RC5A 1CS0B 1PSWA 2LIPA 4I9FA 4MXDA 3K5IA 3DQQA 3QXXA 5LXTF 3SZOA 3TX2A 2FWRA 3ZWAA 1RTKA 1X70A 4FOTA 4EG3A 5LMCA 3FDXA 3AU8A 1Y1RA 2BGNA 1R66A 3I2KA 2FE4A 4LDQA 4LGVA 5CH3A 3KEFA 1B6TA 3ZJ4A 4WCFC 5TF0A 5K8VA 2JZOA 1DKNA 1ZCBA 2EDAA 2W0SA 2Y6VA 1FRNA 4I3GA 4PC1A 5JMOA 3GFVA 1VYTA 1M34A 2I6GA 4HFJA 1Z17A 3OIUA 4RA6B 2BKAA 4RWZA 2BGUA 5CDFA 3KQWA 3SSOA 3SX0A 3VAAA 3SBEA 3WLKX 3CLUD 1XYYA 2GUGA 3DVSX 3EIEA 4Q3BA 3FCXA 3PI7A 4RTPA 1LC0A 1WULS 3PQ4A 1L1EA 1L4HA 1AK9A 4R84A 4GOMD 3U1TA 3GDHA 1N6OA 3B1FA 3II6X 1G4HA 5AW9A 5I48A 1GPLA 3IAS6 4DMFA 5DM60 2J46A 2JFUA 5LM3A 1YULA 4EJSC 4JMLA 1YB1A 4MGYR 1XOIA 2PSSA 5AICA 2Z0MA 3K9NA 3QX9A 1I2AA 3ZY5A 4V1CB 1VMAA 5KSOA 2NQ8A 2XMZA 4R0MA 2R60A 3WLFA 3NTVA 3U7EB 1BAPA 1LTKA 1I1QB 1RLUA 1P3JA 2YW9A 2ZYVX 3L8YA 4N3GA 5DO9A 1NOKA 2ZT6A 5BMVA 5CLFA 5BW4A 3RS5A 2MR5A 4HXFB 3I12A 3V4LA 4AU1A 1RHMA 2GRAA 3IV6A 1TECE 4MYUA 2X14A 5KYUA 4RABA 3RVDA 1QCZA 1GEEA 4CIXA 2DB3A 1SD1A 2IVZA 1Z6XA 1FYWA 2GXUA 2GPBA 4HS4A 4CMEC 3THSA 1YKFA 3HY4A 3PC3A 4WOBA 2CK3D 5EP2A 3IPLA 4IDAA 3SX4A 4ZYUA 1CULC 1DELA 3ZE7A 1NUSA 2A4KA 2FPRA 3FWZA 3P19A 4RY9A 4NNJA 1E6EA 3V1LA 3ICEA 1E8MA 1SRQA 2SKEA 5JD5A 1IBKB 5BN4A 1HWYA 4F86A 4MQEB 1TEZA 1U98A 3TRDA 1GN8A 4RW0A 1CXZA 4B4KA 2D1SA 1ZCAA 3KKNA 2P30A 3QUQA 2OHJA 2D0OB 2J33A 3PXXA 3RHTA 2R6JA 4DN6A 5SV2A 3MGAA 3R3XA 2RB5A 3O21A 4FD2A 4GQIA 4HI0E 4HLDA 1G41A 4AJ9A 5DSZA 4GKKB 4H7KA 1RS0A 3FETA 5CM2Z 5CPBA 1Y5RA 4FYWA 2CHGA 5L3QA 3M6IA 3DW3X 2ANBA 3QA3E 1XQXA 1FMLA 1TVMA 3CF2A 4TWBA 1KYXA 2IYSA 1TYAE 3UGTA 4LSGA 1H1LB 4NDZA 5CLIA 1FDWA 1FQKA 2HHAA 2VDNB 4ZZ2A 2E4VA 2P41A 1KAQA 1TYDE 1HF3A 3S99A 3ED5A 1ZR4A 4B74A 2ZDHA 1P1HA 3CUTA 2EEZA 4HNSA 4PEVA 3IQXA 5DX1A 3VDNB 2PD4A 3CN9A 2W5UA 4QKQA 1IM5A 2RE8A 2P9BA 2K7ZA 4PRLA 3T6KA 1RQXA 5EJIA 3LQRA 4KN5A 2QL5A 3WV4A 3BL6A 2F1OA 5K0FA 2F67A 2CD9A 4DLYA 4X94A 3PENA 4C4TA 5C53B 1PEDA 4K2HA 4ER6A 2ZETA 2CKDA 2EZ4A 4DM3A 1KZGB 2GVDC 1PFWA 2C1ZA 1FDTA 4ANFA 5FAKA 1O0CA 1KFBB 1W6UA 4MKZA 4RM3A 1N8TA 5D1HA 4E03A 1B74A 4DOMA 4ZREA 2JB9A 1UC9A 3VZQA 2VCHA 1H93A 3TO5A 2QYOA 4R3NA 1RT9A 3STUA 4KV9A 3CKYA 2I8AA 1P9OA 3EG5A 1V9LA 3CVXA 2HWYA 2VRNA 1R50A 3WDSA 3B5JA 5IC4A 4R7TA 3CHYA 5CURA 3U3DA 1LK0A 4O1MA 1Q3TA 2WAMA 4PYJA 2E1RA 2YW2A 4Y9DA 2QQ0A 2H5LA 1RWPA 3HXMA 2ZU0C 1W2GA 3RIYA 2XDQA 4BWFB 4ZV7A 1JWBB 3NUQA 4RMGA 3AEXA 2BFPA 2O0MA 5CNIA 1X42A 1O5OA 3GLIA 1ZIPA 2P4HX 5AOAA 1PNRA 2MYPA 5JSHA 2DE0X 5K0EA 3RQIA 2P9FA 3T1QA 2BH2A 3NDIA 4U2EA 5K3OA 2P9TA 1UOEA 3F47A 1YMVA 5F5LA 3ZTYA 3GJRA 3LV8A 4DR5B 3ZV3A 1JGTA 1IG0A 3FUTA 4HB0A 4BN4A 4BPRA 3GT0A 4XWWA 2P0AA 5U9CA 1OYOA 1POWA 2Q5IA 4H4DA 4L7QA 1QNLA 2F4NA 5C4GB 2GTPA 4F6RB 3OQ1A 5JAPA 3CIFA 2EFEB 4YROA 3LUDA 1ORVA 2PS9A 1Q83A 3FWHA 4R3UC 2BEKA 3KR0A 5AKZA 1W73A 3TN7A 4MVJI 4CQMD 3Q6NA 3F96A 1UBUS 3PFHA 1N6RA 4N03A 4J1SA 4TSFA 2C42A 3NAGA 4NENB 1OBCA 2F1RA 1LFAA 3QE3A 4IEEA 3BE6A 4B3XA 1H4QA 1E99A 1RYEA 4X7PA 1POXA 1WNFA 2PR7A 2ZQYA 5JO9A 4F11A 3KVNA 4XB2A 3HDVA 5K0TA 1TVCA 3EC7A 5B4UA 3FPSA 2OM6A 1OKKA 1US8B 5IYZB 1NYRA 1K8QA 2QMQA 3A1SA 5ENVA 2YWXA 3WIEA 1WV1A 2LCFA 4QEDA 2REBA 2MINA 4C88A 4Z4FA 3G23A 5KVSA 2QWXA 3BPSA 3MBIA 4NBNA 5ICCA 1HDYA 4GWKA 4C4XA 4D6YA 5F98A 3KQPA 2O3JA 1UFKA 2B6NA 3OZFA 3RSZA 4RHCA 3QKUA 5D87A 3RFCA 1RQ7A 4J49A 4R16A 4PW0A 3V42A 4JP2A 4Y2XA 1OTXA 5DULA 3TDKA 2GEVA 4IDQA 3G9QA 5KDLA 4TM7A 2GHIA 1C9NA 3I4CA 1F8YA 3T7SA 1SVOA 2ODEA 1OTHA 3ZD8A 3L7IA 4EYSA 2AVDA 4N3NA 3SHFA 3FI9A 4ZVQA 4LRYA 3C4QA 5IBCA 1JJ7A 1RZRD 4MUGA 4Z9FA 3ZNQA 3GGCA 5FUXA 1CT9A 1OYVA 4QHYA 3OJ0A 1E4EB 1P5RA 4YV2A 2C5LA 3AKDA 2UUAB 2OCGA 5AUNB 2CXUA 1V5IA 2H0RA 4PYIA 2YOHA 1T0PA 5AIAA 5D3MB 3RIGA 3QKSB 2NZWA 4NBRA 1IRXA 3EXHB 4NHOA 1VKHA 4FZ5A 4XB1A 3CURA 3SLRA 3HLTA 2NACA 5EWMB 1P0PA 2E85A 2J3QA 2KM1A 4G97A 3OEHA 3UK1A 2V9ZA 4ZJPA 5BORA 2PMFA 2EFHB 3TQRA 4DYVA 1XRLA 3LU1A 4HPXB 1NA5A 5C7OO 1U90A 3PJDA 5FPTA 2V55B 3DQPA 2A9RA 3QOYA 3WKBA 4RFSB 2JBAA 2LD4A 4PZYA 3EG9A 4XWAA 2YV4A 1ZINA 2MYTA 3EGCA 3G82C 3OZ7A 1Y6FA 2B1RA 4WY5A 5DNVA 5C1OA 6AT1A 1LS1A 1QP7A 3SZMA 5KO2A 3RI3A 4FFVA 1E3DA 4QOFA 1ZGZA 5AVQA 5K6AC 2Q2QA 4RVNA 1XZHA 2XGMA 4RETA 4LC9A 4HN4B 3OP4A 4AZ3A 2F8SA 4YRBA 1Z4IA 2QN2A 4EJSA 1JSRA 1KAGA 1NVVR 2ZREA 2X2FA 2MIIA 3TZCA 3GA0A 4ZAFA 1GAWA 2CCKA 1YTLA 1SCAA 5A9RA 3CVOA 1GM5A 2ST1A 3S4YA 2CNBA 2AR0A 3M6UA 4LF4B 3VYRB 5A03A 3ZD7A 4EHDA 5J40A 5LL6P 1E1DA 4LNUA 2BFEA 3LHSA 4L57A 1GZ6A 4ZT2A 1AA9A 5B1DA 3SZ3A 3K53A 1GFWA 3L8ZA 4PX2A 5D5QA 5JRDS 4UNSA 1JHZA 1MV8A 4GXQA 4DTIA 3QUCA 3TLCA 3I04A 4WK4B 3PT5A 1HFJA 4JJZA 3HFJA 3T5AA 3AUUA 2FW0A 1Z2NX 5EE0A 1AQJA 4HB3A 2QZ9A 1WW2A 5TE9A 4DLZA 1TM7E 1U99A 4H1TA 2P7IA 3NTOA 4GVXA 2FRDA 8ADHA 1SHUX 4AY2A 5LZ8A 4WW0A 4CIWA 4ZHQB 4DWVA 5B58C 3L6UA 3V4OA 2FPUA 3IYLW 4GOLD 4UBOA 1MP0A 1NAIA 1TI7A 4OHBA 5FCDA 4LTMA 3UPTA 3RANA 4KBYA 3ZG6A 1C4WA 1L5GB 1PO7A 2FH5B 1O97C 4RY8A 3HYRA 3CH7A 3KFLA 1SOWA 1VL5A 3NBXX 4I9NA 1SXPA 1XTSA 4JIMA 1QOQB 3IE0A 1A8QA 1QV9A 3H17A 4X84A 2P91A 4E5YA 3IDSA 3KE9A 1IBLB 3H6HA 4PLTA 3C24A 1GZVA 5GJWC 5H1YA 5C1PA 1B8NA 2VDWA 3PFKA 2WUVA 4ZV4A 2G1UA 4PX3A 4EPYA 1RABA 4NARA 5KSZA 3UB2A 1W75A 2QS9A 5FNVA 1EUZA 5CM8B 4UQLA 3GRFA 3NC1C 3R74A 5BPHA 5IZCC 1Q12A 4J1TC 5JROA 3KCQA 4EUNA 5K99A 3F5FA 4XUGB 2LCIA 2PGDA 3GEGA 1FVOA 1K5GA 5BVHA 3DWIA 1ZM7A 1WG8A 3I5UA 4CVNA 5FPKA 4FFSA 2RC6A 2ADMA 1LJ8A 3WGQA 1GSHA 1H2RS 3QMMA 3WNBA 1SULA 3O2JA 5BR4A 5JZSA 4GL2A 3TWOA 5KOJB 2XYHA 4AF8A 5E2IA 1R9NA 1GVHA 1TEHA 1FZQA 2FETA 2RG1A 1W76A 1XCJA 4ND7A 1BMDA 1T2AA 1DKLA 3TR0A 4I99A 2HGSA 3RU3A 5I5EA 5M2QA 2JJ2D 1KQNA 1ZN7A 3H5OA 4QGBA 4EOGA 2AC4A 5CLQA 4P2GA 1QCYA 4MI1A 3FKSD 3NX4A 5A7HA 3QXCA 4RZQA 4HWPA 1VHTA 4HSEA 3IP3A 1DJMA 2ATEA 4Q3KA 4KYIB 1Z0UA 3WQBA 1Q7RA 1IY0A 2AOUA 3FBGA 4KQ2A 4QNNA 3SZGA 1U2QA 2OQ2A 3NVKI 1KYIA 4JR1A 4YCNA 3T0FA 1V26A 2AX3A 1TEVA 2FP4B 2LIVA 2IP4A 3HR8A 5IX8A 1QYWA 2XNJA 4N7BA 4EW1A 4QYSA 2I91A 2OHIA 5EE5B 4AULA 3AEQA 3HU1A 4TKVB 5EHZA 3N0VA 1W36D 4CV2A 3EFBA 3O6VA 1JZQA 1PG0A 4KR6A 3LUBA 3I73A 4XFJA 1NLFA 1FTWA 1X1QA 1OCEA 2ZBVA 4NOLA 5T4EA 3WYGA 1CEQA 4LOHA 4PYKA 4LSZA 4QNRA 1Z0DA 1RJDA 4UNPA 5IUJC 5HNKA 1O54A 3K96A 2PL9A 2WTMA 2GAOA 2WVAA 1NQ5A 3MG9A 3H5TA 3IULA 3TUZC 1KY4A 3WADA 4QDXA 4XB6B 4HMPA 4MSUA 1I6WA 1QXSA 1C3JA 4GKVA 4G89A 4E5KA 2O2HA 3GEEA 3RW9A 3SC2A 3CEJA 4EX7A 2WU4A 2HO4A 4LJYA 1J39A 4Q47A 3ZIUA 2XQFA 3PDCA 1Q1GA 4BCBA 5TJ9A 4LGYA 2OA0A 1PQYA 1BXRA 3ET5A 3LMKA 1QGDA 3NORA 2Z8XA 1JF8A 1OQAA 2JAUA 2PQ0A 1QHNA 4JX9A 1VG8A 3GJ0A 3CCCA 3ESYA 1UK9A 4O4IB 3PRHA 2OYRA 3WRVA 1EGVB 5TPWA 1X7GA 2GOYA 3HCCA 1EX9A 4E7PA 4U39A 3QX8A 2J3HA 2VBCA 1V95A 2GHQA 5FI0B 2HPZA 4B6PA 2B0CA 4AFNA 4UJ5A 1XPRA 3INGA 2YYYA 1F7VA 4C7XA 3EQZA 2JFHA 4IVNA 3FB4A 3RNLA 2O57A 1GJRA 4BEJA 2YIJA 3WB2A 4ND3A 3Q11A 3DYIA 3ZQUA 3PBKA 1PT6A 3UANA 1SUAA 3M9LA 4PGFA 4B8ZA 4C4SA 1Z5UA 4JEUA 5KQGA 3FMFA 1TT5B 3VR2A 1U7UA 4BC1A 3H13A 3R5FA 3AI3A 4L5CA 1EXMA 3TW6A 2HHJA 2Q41A 5F35A 4YP0A 4GFDA 2YXBA 4Z4HA 4II7A 2RI1A 1BWQA 4XD7D 3SHQA 2QX7A 2IOQA 3B3JA 3D3QA 2ROQA 4G9BA 3WHKA 5C8YB 4RTSA 3KIPA 2CZCA 1ZH8A 1CJBA 1QB8A 3ROGA 3T0GA 2JD1A 4IG4A 2VYVA 4L8WB 1QWOA 1GKYA 2CLHB 3BA1A 3PUJA 3MJCA 2NSDA 3I61A 2O14A 3DE2X 5FL3A 1QO7A 1ETUA 2OMKA 3O47A 4BJ1A 5KJ1A 3QZUA 1G38A 3K30A 4EG8A 1JKJB 2QTTA 3IMKA 4EY5A 1KGDA 3BL8A 3K1AB 2YFKA 3GD5A 3MMXA 5J9FA 3RTCA 4YQYA 1HDOA 4DMMA 3ANSA 4HUJA 4LWOA 1Z56C 3PQ3A 2DFNA 4XXHA 1MVOA 1PGPA 2G06A 2KSQA 3AHHA 1B14A 1GWNA 1HORA 3FZNA 3LNCA 4QTYA 3F73A 3DLBA 1AV6A 3DDNA 2WE8A 2LZ0A 2YHUA 3GI1A 1FW8A 3TPZA 2ZRBA 3OZXA 3U09A 5KVVA 3JZAA 3RGGA 1XJQA 1QFSA 1W4ZA 3OPVA 3GC6A 3F8TA 4ZI5A 2BEUA 3KZKA 1UPBA 2YWBA 3PITA 3QTLA 4KNVA 4KQFA 4OEHA 4TTTS 3CEAA 4XR4A 4OQDA 4K3VA 3SPXA 3ZY4A 3LCUA 3SQOA 4J0CA 3CLRD 2ZYRA 1FLDA 1NVVQ 3D6FA 4WUVA 4JCCA 3L77A 1TPZA 1LI7A 1U4SA 1NHGA 3VXKA 4ZD6A 2VSFA 1DMRA 1CQIA 1WZ2A 4ZPJA 5D1NA 3FDZB 3U0BA 4BLPA 1G5PA 1Y8AA 3GEIA 4C03A 1YFLA 4RHUA 2WWRA 5EXTA 1JIKA 5ECWA 2CDNA 3AJRA 3L7DA 4ECAA 2WJWA 3WLSA 4F3KA 5CVTA 4KAFA 1MXFA 1B6RA 2D1TA 4QSMA 5KJFA 3TAXA 4DR1B 1GZHB 3JPYA 4N3BA 1SVIA 1WMEA 2CYCA 3WQQA 5FOVA 2HMTA 4MLCA 4UDNA 4JLOA 1RM5A 4MV7A 1EWYA 2B8JA 2H00A 3M4YA 2GD0A 3VPGA 4M89A 4IFIA 2W83A 1AS2A 3VAYA 4E08A 3GUYA 1GSIA 1NDHA 3LJKA 4TM8A 1C50A 5FT9A 3W1EA 4AKTA 4N18A 1GG9A 4ZIRA 4ZAZA 5AJUA 3JVIA 1HE8B 3SXPA 1J9GA 2CE2X 3SM9A 4DDTA 1Y3HA 4E11A 1KFEB 2FJPA 1KJIA 4MR9B 4DV6B 3RJMA 4TUYA 1RXSA 3IE1A 1NP6A 6CHYA 3D9QX 1XROA 4P08A 4BMOB 3M6LA 1QU2A 4QFBA 3IDAA 1SWVA 3OD5A 1SC4A 1H9BA 2Z57A 3TAUA 4Q3EA 5G02A 2GH1A 5FTNA 4Y9SA 4NXNB 3C6ZA 1IM8A 1NUQA 2CJWB 5GMOA 1YSCA 4C87A 1X14A 4OU5A 1YZYA 3BICA 4OFWA 1J5XA 3VV3A 1SNYA 3O83A 1JHDA 2B92A 4XRGA 4DZRA 3SVZA 1BW9B 3EUFA 1BMFA 1JB1A 3MMZA 5BSEA 4FBGA 4OF4A 4TYWA 2HL6A 4RIHA 4JYZA 3KFVA 1UBHS 2HOQA 3TTSA 5JNVA 2HM7A 1E2FA 2W6NA 3NVDA 5BXQC 3A6EA 4Q1BA 3KETA 5HIIA 2B25A 1F4LA 2I87A 3K1JA 2C29D 1Q0QA 3OTQA 4MPDA 3NFRA 1CDZA 1FUEA 2DHDA 1V9SA 2YZKA 4JLJA 1KEVA 4QQFA 1PE0A 4E46A 4ZOLB 1EGAA 3B3QA 3FY4A 2DWOA 3KD3A 2JEZA 4XQ9A 5DOZA 3OQOA 2DWUA 3RV3A 4XCQA 1NNUA 3STXA 1NLZA 1DAMA 1UH5A 2R8RA 3NT5A 2PSEA 1ZGHA 3D7KA 4GXRA 1ULZA 3RAGA 5AHRA 1AB5A 4CETA 3Q10A 1Q0UA 5YASA 4ABYA 3GIWA 3E9QA 3LXUX 3NGMA 4GMXA 4KIFA 1ORHA 4LMRA 4Z1MA 2O1WA 2ETXA 1PJ3A 4KC0A 4E3WA 6GPBA 2BR5A 3ACCA 5FOWA 3ZKWB 4ZZIA 3A2LA 3UAOA 1XDWA 4XYGA 1H1LA 4MV3A 3GPDG 1EMDA 1EJ2A 2AR7A 1ZNQO 3SEAA 1AURA 3L8FA 1QONA 3PQFA 3KOXA 5I7EA 1WR8A 3ADCA 2XOKA 1IIBA 2BEWB 5J63A 5JLAA 2G3YA 1ZMBA 1EQ2A 4TKZA 4CQNA 1U1IA 4LMPA 3G6KA 2MSLA 4NKRA 1G3QA 3RYFB 1PK7A 2PZAA 4FINA 3OF3A 4XLZA 2CY0A 4BAGA 4E13A 3SDZA 1C0IA 1B00A 3EQ8A 4TSFD 2YWRA 3VOAA 1XMSA 1YCDA 1UC4B 3WGHA 4G5SA 1OFUA 3O95A 5AM1A 3JWHA 4B3HA 4OAPA 1NW5A 2VK2A 1TAGA 3COZA 3ORSA 4TTVA 4A2PA 2Y27A 4G0NA 3FTFA 1CDEA 1GDHA 1OKKD 1WD5A 1SBTA 1Y82A 2RCYA 3KELA 1L5VA 3LPCA 1SU4A 1ZBQA 3NH9A 5JD6A 3RWBA 2ODAA 1J90A 5BOSB 5GZ6A 4WNAB 1IWOA 2QX8A 3QNWA 3HCAA 1GNPA 3GNSA 4FGSA 1ACLA 4LPSA 2AOVA 2YMPA 5F64A 4DLVA 3EDMA 3WI7A 2X6TA 4XGNA 3GFFA 3A1CA 1BQ3A 2QRVB 3PDIA 4HTFA 3TQSA 4YI5A 1HUQA 4JWKA 4UNQA 1OI4A 1PFUA 1XD8A 2NT3A 3NWBA 4NU6A 5G4KA 1V41E 3PI6A 4AYWA 1OLSB 1IYZA 2OKCA 1FVFA 1TO1E 4UTOA 4A6PA 5IABA 4P3PA 5IPFA 5JXHA 2FZCA 5A0VA 1N6LA 2VJLA 3GT4A 4F4CA 1P72A 1NVWQ 3RVQA 3BTOA 5EP1A 5KYWB 5MGBA 3U7FB 4KLZA 2XZTA 4FVTA 2FJ0A 4LY6A 4DQDA 3D4LA 2IHZA 1U3GA 4XUCA 4DNOA 2FPMA 1N6IA 4JHXA 3U7GA 5ELLA 4HNHA 1SHZA 2Z56A 3K0HA 2CLDX 4RKFA 3UYLA 4RIEA 1O08A 3KRTA 4QG3A 3X1YA 1A9XA 2AEEA 1UFVA 2EYUA 2J5XA 4F9FA 1GTL1 3NOOA 1Y9ZA 4W5OA 2WU3A 4Y1RB 1K06A 2FW1A 2XUGA 4PAGA 2IUTA 1V11B 5SZKB 1QDUA 4G5YA 4ENTA 4G1VA 5IWAB 5ETJA 3OT1B 4MV0A 2ZJBA 4AO7A 2A1TS 1A4RA 5I7AA 3C3KA 2V3WA 5G1NA 3AVOA 1A4UA 5M3BA 2F1HA 1HRKA 1ZA1A 2G9QA 4M8IA 4CR8A 1ZJJA 5KVCA 4XQ0A 5CFPA 3KTOA 4A15A 1FBNA 4GPD1 1EUDB 2AWNA 4I1VA 1IBCA 3K0BA 4NECA 4J0FA 5DH9A 3ZE0B 2ZYGA 3S8EA 3VJRA 2WD7B 4GR9A 3PHGA 2Q9CA 4UBJA 4DA9A 5IYZA 2XE7A 4HP8A 1W7AA 3RSSA 4COOA 1K5PA 1PEAA 1G20E 1JZTA 1NUTA 4WN9B 2PL3A 1JQKA 3RU7A 3ITEA 3TQTA 2J3DA 2OK8A 3THXB 4JL5A 5JI2E 3NKVA 3IEPA 1JDJA 2J4FA 4FBLA 4BVJA 3FMGA 1ZUIA 2NU6A 1KYYA 2NYRA 2VXYA 1G3IA 3EBOA 4JJ7A 3QENA 4NMMA 1TOAA 3VC7A 4XWOA 1MC1A 4OAOA 4AMBA 3ABZA 1OBFO 3IB6A 3S2ZA 2JS7A 3HV2A 3G2PA 4GDMA 2C20A 2ZUSA 4ZFNA 1QH1B 1E1RA 2H3HA 4BWVA 1JFSA 3QQ5A 4YP1A 1AG9A 4CRWB 3T5DA 2BFCB 2ORED 3UAGA 5DYGA 3QP9A 2HWWA 2R11A 2APJA 4JAVC 1YUMA 1U8FO 1SCQA 3BREA 4LV8B 4D4IA 1RWXA 3SYRA 5CFMA 4JMPA 5IJ9B 3C87A 3VTKA 2IPMA 5HF5A 2JZCA 1E4EA 2XUAA 3DFKA 1ILWA 4BBAA 2BKVA 3EEFA 3BJZA 3R77A 3A1WA 3L5OA 4MDEA 3EARA 2BONA 4I4IA 2RH8A 5D3MA 1DGQA 3D3NA 3M6XA 2PGXA 4TLAA 5HM6A 1HETA 1K7CA 2B5OA 3IJ5A 4X8HA 1XFAA 1EQAA 1X8JA 5EWMA 4Y6QA 3VYWA 1B23P 5I9LA 3ZI4A 1ORDA 4I55A 1CY2A 2QTAA 3MGBA 2XE8A 3EGDA 3NH6A 3TW8A 4TMYA 2PPVA 3HR7A 4IJKA 5EMJA 4W9NA 2IX9A 4L27A 4U6SA 4W1PA 4W5WA 4WL0A 3OZDA 4DCNA 3FFWA 5EQDA 3PC6A 4B46A 5I7SA 2C5HA 4TTPA 3RLFA 1IQRA 1FC0A 2FR8A 2ZYAA 3ECAA 3JVEA 3H4VA 3NBQA 2PUHA 2XT9A 1PGOA 1R88A 2QLJA 4PFSA 3S7TA 2Q8PA 2W8ZA 1XZQA 3H5AA 3ZDYB 1MZPA 1D2RA 4KBFA 3ZC3A 1C9JA 3WKDA 3ZLUA 1EX1A 4P6VF 1KDVA 3TZLA 2Z5LA 2BKUA 4UVIA 1R0KA 1JYSA 5DGDA 4F4DA 3FCCA 5KI6A 4E7OA 2CF6A 3N6VA 4WXPA 2Z4RA 2JJYA 2MOKA 2C4VA 4EH1A 5HZMA 1WCIA 5ITZA 4KN6A 2VJAA 1VSVA 1X0VA 4QIHA 4KNYA 4WOKA 2B34A 4YV7A 4C3UA 4M9UA 5IJWA 4J0IA 2W2VA 2NP7A 3IDFA 3L84A 1O94A 2IS4A 3TK1A 2A1TR 1IHXA 2Y1FA 5DX8A 1A72A 3EZ9A 4LIPD 5KTRA 5FWYA 5L7WA 2FDXA 2VT7A 3HEBA 4OHPA 3AB3A 2X7JA 5IAAA 4H60A 3T9AA 4K9QA 5CMLA 3BH0A 1S8FA 4M7WA 2ON6A 2FZLA 3PD0A 1IOLA 1E8DA 3KEOA 3M6FA 4ZHQA 5KQRA 4E5UA 2RI6A 5HJEA 2VNJA 3V4PB 3ZJVA 5F2OA 3UHJA 4HEA1 4IJ5A 2FGKA 1R6VA 2AJBA 3BCRA 4F5DA 5C18A 3MYYA 5DXFA 2GPSA 2W4MA 2QU7A 5EC8A 3C6XA 1E9BA 5JASA 4HXYA 1F2VA 4IHKA 3WAKA 5CPFA 4D4GA 3GFRA 1G8KA 4PG4A 4DM7A 4AWBA 5CFOA 4ZI7A 2ZJOA 4JB0A 2QVGA 4JBXA 1QUEA 3OF5A 3VC2A 4C05A 4EUSA 5C8VA 2G82A 3GF4A 1ORIA 1VGRA 3PE4A 3JVVA 2PNJA 2FPLA 1T1SA 3DMRA 3GJTA 4L6AA 3SBOA 4EJ6A 4KPGA 4DMRA 2PH1A 1YF3A 4XTCS 1D0IA 2AEJA 3ODPA 3THRA 3SQDA 4CCSA 4TQUS 2CW5A 4GYKA 2PQMA 3MINB 4TZTA 4BQQA 5EIWA 3KKZA 1DEAA 3CX7A 1MOSA 1NW8A 3NEAA 4N9QA 1I1HA 4AJPA 1IQ0A 3THWB 1EWKA 1QKIA 4KVFA 1Z06A 4HUQA 4J9VA 1QHXA 4GX5A 3K9FC 4TVSA 6Q21A 5B53A 1IHDA 1X7YA 2JLQA 4J75A 7MHTA 3CB2A 1CZLA 3MS2A 4BMVA 1DQYA 4FX5A 4K8OA 4PZCA 2YHIA 4X8OA 4EATA 2FMXA 2YVUA 3SIWA 1NVTA 1HTWA 1NFQA 4L73A 1NF3A 1W46A 3UJ3X 4JLNA 4Z8XA 4OIFA 3WLMA 2KHZA 3UCFA 5JMWA 5JY1A 4GECA 1QYIA 2PWYA 5DZSA 5SY9A 1XMXA 2WMOB 2FPKA 1GPNA 1X1BA 3LC1O 3G13A 1UIMA 5JAZA 4CM6A 1I6MA 1WA5A 3QVXA 4RVDA 1EFHA 2HREA 5K8TA 3TFOA 2V1UA 4N4AA 4OMFG 3D8RA 4Y2RA 1FFDA 2RHDA 3PLRA 4GPIB 1RCUA 2ZYDA 3SYNA 2GGSA 2WMYA 4NOMA 4U5QA 5TIIA 2FRXA 4OB7A 3MWYW 1FRFS 3Q3JB 3E9NA 3VR2D 2VJKA 2QRLA 4H17A 5TJHA 3REOA 1YRHA 3C70A 2Y2UA 4C9BA 3TRJA 4Z9BA 4FOOA 4L5IA 1Y7HA 2X42A 2Q3CA 2R9VA 3FYTA 1ATZA 1E3JA 3HC7A 4GI7A 4TKVA 1I0IA 2IW1A 1ZC3A 3BJRA 4EF4A 3H0KA 4JLDA 3EFOA 2VYVD 3PC7A 2WBLC 2VP9A 4OGKA 4BQOA 3AIMA 2JLVA 4ADSG 3ER9A 4G01B 4QYTA 1JU4A 1ACJA 4U8GA 5DE3A 3WK8A 5CB8A 4P4NA 3EWSA 2FN7A 1SBYA 3EIHA 4RHXA 3ZDQA 3H1PA 3N2KB 5DKFA 2VSOA 4MIEA 3GQVA 3CUSA 3IQEA 3KNZA 4RF2A 4DMLA 4GSYA 3T12A 4UTVA 1Y5NA 5AI5A 3GFPA 1PVOA 1VPWA 4I9UA 4OL0A 4TSKA 1ULSA 1VQ1A 2VWGA 5HUJA 4EHJA 3ORQA 1SZDA 2C7BA 4GGOA 4Q21A 4M3NA 1YJ8A 2BI8A 2BE9A 2HJHA 3O1HB 4UPVA 1QIEA 3WL3A 4CMIB 4I4TA 4JROA 4EENA 1T5IA 5EMLA 1RMYA 5EXPA 2ZBGA 1DAEA 1ZIXA 2EJWA 5L95A 3NBMA 1E2GA 1PR1A 1Z36A 2WWTA 5ILGA 3T34A 4ARBA 1USKA 1OR8A 2B6HA 1X7ZB 1B15A 1QKJA 2AYYA 2C8KA 2I6FA 2IYNA 1PLLA 2R1TA 5ALHA 4XLTA 3HBLA 4BLRA 1ZFNA 4M88A 1R27A 3G49A 5IKOA 2FMFA 1EVEA 2PH5A 1AXEA 5DP1A 2IEGA 3B3GA 2YQ5A 4N8SA 1M0WA 2Z1DA 4J4BA 4RNCA 1QIIA 4GSKA 1NVUQ 2WLSA 1WBBA 2AXNA 1BXGA 4PO9A 4C6TB 5JNTA 5IJ0B 1SMKA 1ZI6A 1W87A 2XD9A 3FLAA 4B0OA 3LTEA 4YJGA 5C52B 4II2A 5IAGA 2VXOA 1Z0SA 5LMUB 3TW4A 3FKJA 3KXDA 2VQDA 4MRVA 4TV9B 2DFPA 3R24A 1SQFA 3MPOA 1KA9H 2O7QA 1F38A 4E31A 1FYEA 4ZTBA 1KYWA 1V1JA 1XU4A 2ISCA 4PYLA 4P4LA 5ARDA 1GGHA 1C5KA 3D8HA 4BGIA 5ESRA 4CG0A 3UOWA 1CY4A 3CLUC 3PTLA 5KVQA 1XK7A 4MW7A 2P27A 5IVIA 1OROA 1VLJA 3IKTA 2DETA 2GXAA 2EWMA 5JI3E 1C81A 3WWOA 3U80A 3VUFA 1Q7CA 1TIPA 4E51A 3WGGA 2JL1A 5E1OA 3O8QA 3DKPA 3ICQB 3KPVA 5HBGA 4LWPA 4EK9A 3LDAA 3UHAA 4MS4B 1Q6ZA 4TWAA 4YV1A 1A77A 1H0RA 4HFMA 1NE7A 1RYNA 3IBSA 4UHDA 3UH0A 4I3HA 1CYDA 5CJJA 3DL2A 3AG6A 4ZAYA 2GDZA 5EG5A 2X58A 1MIHA 4UD6A 2CLKB 3FCSB 5IW8A 5BSFA 1T9GR 1BMFD 1OFUX 4DMCA 4EI2A 2VJNA 4R51A 1GLVA 3BGIA 2C61A 1SBCA 3HKCB 3IA7A 1DQSA 1TW2A 4R1MA 4JJKA 4HQFA 4Z1OA 1CP2A 1CE8B 2OPHA 1NW3A 5GVRA 2BRUC 1Y9DA 2HGZA 4F5YA 1XDZA 3QWFA 1XQ1A 1I4EB 5T8KC 1EWRA 1D9XA 2YXEA 1KMQA 2Q62A 1RXCA 1FTYA 1IVNA 4W1RA 1T4MA 1C4XA 1KU0A 1GVNB 1X94A 3H5IA 3GUZA 4KL8S 4MIKA 2C7OA 4G2TA 1L3IA 2PWAA 2GS9A 1VMEA 4MHSA 4U2BA 3UQYS 3EX7C 1E1NA 3AINA 3WLRA 4V39A 3IXLA 4QXPA 1G21B 3E53A 4DCUA 3SSMA 2PRKA 4DEYA 5BNTA 4MA5A 4Q02A 1G5HA 4B17A 1NUAA 2FWBA 5UKDA 5ERYA 4G5RA 3NOQA 1AMNA 4N49A 4BNLA 5IBQA 1SVUA 4BE4A 4ZC1A 4Z1MD 1CR2A 1JAHA 2EKQA 3WA7A 1G7TA 4F2HA 4IDDA 3DTYA 4WAUA 4WBSA 3CRNA 3Q9SA 2BFNA 4LVCA 1I94B 1PRYA 3D2LA 3QELB 3LC2O 1A27A 1VE1A 1I3NA 2RBGA 2RFLA 1ZOIA 3F3KA 4QU5A 2XOKD 2EIHA 3CZ5A 3VVBA 1Q1AA 4MR9A 4BIMA 2QX9A 2YC4C 2ZS8A 3K0CA 4MK4A 4WSOA 1JI3A 3KOYA 4E6PA 5B4VA 1NVBA 4ENPA 5ITSA 4ZO7A 4P83A 4WCDA 3LQFA 1USIA 5TQ2B 1PP4A 1K7EB 2FU5C 2GBLC 1ZJ4A 2O50A 3R8XA 2H2GA 1JSZA 4AVYA 5IRCD 4JJGA 3C6KA 1HMPA 3HA2A 3IVXA 3EIFA 1ZCJA 2RKBA 2ZXFA 2GZSA 1CQJA 3U4CA 4YDSA 2G5CA 1FYVA 2O5EA 5CIYA 2E87A 1L4MA 3B82A 4YCDA 1NRWA 4MW9A 3ASZA 1XDDA 4MKXA 4RESA 1BW9A 5DNEA 5BN5A 4IXNA 3HH8A 5ALDA 4EZBA 4UHHA 1C1XA 2DR2A 4LYJA 1IK6A 3FWPA 5FBHA 3DE6X 4FZJA 5K7SA 2I76A 5SZIA 3ETJA 3C15C 4HAVA 4MVJE 5C1DA 3KL4A 1SUEA 2G25A 3ZWOA 2XHEA 4JI5B 5HXAA 1HFWA 3D3EA 4UUQA 3HUEA 4G0XA 4ZOLA 1XRRA 5GIPE 3ET4A 4C14A 2HSGA 2HF7A 2VKTA 1NBOA 3IEXA 5HIMA 3AILA 2KI5A 2QW8A 2Q5CA 2PXCA 4TXMA 1NM5C 4DKJA 4AJIA 2CV1A 2XOXA 4YRGA 1PI3A 1ZGGA 1D2NA 2ZUTA 2NSYA 3SSAA 4A23A 1SHJA 4QICA 2D4AA 2M98A 2XRZA 5TQJA 5HF8A 1M2NA 3QYPA 3O1LA 4XIYA 5I9MA 1NWCA 1G1MA 3NOVA 3Q85A 4FQ8A 1MPTA 3C4VA 5CDUA 1HQCA 4BX3A 1FFXB 4N7RA 3QLUC 2CSUA 3Q7EA 3R6LA 4F5WA 3EIUA 3S2IA 1L8OA 1QZTA 1P80A 3WRYC 3QOXA 1TGVA 2ZIWB 4HYTA 2I0FA 4R1LA 1O5TA 1S1MA 4P32A 2I8CA 3PR2B 1Q44A 3FRHA 1L5KA 5I7WA 4D82A 4GKJB 1A1VA 3EASA 1DZ3A 2RGRA 3HLYA 2R86A 2XZLA 1TUBB 3EUAA 1G8GA 3WYEA 1DXQA 1IDOA 2JI9A 3DFFA 4HB4A 4CTJA 2VH1A 5BY2A 1JFTA 2X0RA 2VLIA 3JRWA 2GHRA 4GE0A 2OBYA 5KQPA 5LNK1 4CEJB 1ZYUA 1UPAA 4QVGA 1U8TA 2QRHA 5TF4A 3RUPA 1LB1B 3M7IA 1Z6AA 1JR2A 2M6SA 3IP7A 2GJ8A 4P58A 3ZE8A 1TJ4A 4B6FA 4P82A 4QLOA 3JWIA 3W8RA 2HK6A 1LSJA 2Y4NA 4B47A 4U8HA 2ZIFA 4O4JF 5KEIA 1U28C 4QOJA 3L6DA 2YY5A 4Q9DA 3O2QB 4DQLA 2I55A 1C7FA 3CJRA 3GA7A 4KZKA 4YAOA 4BX9A 2I54A 3AFIA 3GLTA 2WJZB 3P9XA 3MWFA 1O4WA 1LSSA 5AO9A 1DT3A 3N3BC 2HRDA 5EINA 3KZMA 2VJBA 3FDFA 5K51A 3T4UA 3W6UA 4AF7A 4C0JA 3AUKA 4RTQA 3N8NA 5C5CA 1B6SA 5AKJA 4W7SA 5GP1A 4YMWA 2AN5A 4MUNA 4ECEA 3GGOA 5KWVA 5GVSA 4P1ZA 3R0IA 3NGLA 1UT5A 4QC2A 5D3ZA 2Y1DA 1OX4B 4HXEB 3WKAA 1JEDA 4ACBA 5LPNA 5F1OA 1YAJA 2V9CA 3K32A 4GS5A 2G70A 3DTNA 1Q0PA 3E18A 4LFAB 1KIFA 3CLVA 4AMZA 4KGVA 5KU7A 4R8SA 2QLNA 3AM4A 3ORYA 4EPTA 4EJ2A 4RV9A 1DAPA 4BO8A 5JXGA 3KQLA 1PFYA 3CWQA 5HJ5A 3IP8A 5GV8A 2GN9A 1XWWA 4Y1RA 1Q3KA 1T0HB 1U65A 5LMZA 3E8XA 3CE6A 1AA6A 5DMXA 4DCJA 2C7GA 1NX9A 2YS6A 4D5GA 3FPLA 1A5SB 2NP6A 3OT1A 4OBEA 4L8YA 1ZH4A 3F49S 1Y34E 3QUAA 4L4XA 2GA8A 4E1VA 4CPDA 2R00A 4F85A 1DAOA 1JSXA 3WSTA 1ZHHA 1GGKA 4LJSA 4OQ4A 4D9BA 1GQSA 2ZKIA 2VAPA 2JHAA 3IUBA 2AC2A 4G8DA 4XDYA 1CZRA 2F48A 2IF2A 3OX3A 2WD7A 1KIMA 3I6YA 4UW9A 5EIOA 4M0EA 4BP1A 2IYXA 2LBPA 3QV1A 3X3HA 2Q3BA 1Y37A 3MOIA 3LNTA 2OG1A 4U2GA 3DKVA 2D1FA 1LQ2A 3OJEA 4N8DA 3WHIA 1JFLA 4EMBA 3C1TA 1YU6A 3QOWA 4WN9A 4XVRA 4MYRA 4MIOA 1OX5A 1OPRA 4JT2A 4MW0A 3FB1A 1OXBB 3O9VA 3PYLA 5JTUA 4OBBA 1XLVA 4FLMA 4YMHA 1EZ4A 4GQAA 1XRQA 3JYPA 4BVLA 5JE8A 3WLTA 1RQ2A 2HLPA 2ORWA 1O94D 4PBSA 2XB2A 1O87A 2AW3A 3NETA 1WQ3A 3LZ6A 2ACKA 1UPUA 1U1CA 1BNCA 1XL0A 3DAPA 1M67A 4PLWA 4XE5A 4BN0A 3WXMA 3ABQB 5MN4A 1SIBE 3AVUA 3R0JA 4B3IA 1QE5A 2MT9A 2VYCA 4JI0B 3VH2A 3D3WA 5DBIA 4PBTA 3S5UA 3EAGA 3KVRA 2R66A 4C89A 3C8ZA 3F67A 3IAFA 3LDUA 2YZGA 1JBEA 4ID9A 4GU5A 1SKAA 4GOXA 4ZEXA 3VGPA 4EQ6B 4BN5A 5H81A 4ZKDA 3GLGB 2Y05A 3EMBA 3DMPA 2OZLB 2GN6A 3QX7A 4ZHSA 4DXHA 1UZMA 2FSFA 1RAEA 2QZPA 3PRYA 3UQZA 2OTCA 4A0SA 4YRKA 3MHTA 3INNA 4Z49A 1JDTA 2BDTA 2QPOA 5JSKA 5JAOA 1S3IA 2JHPA 2CVQA 3K2IA 2Z9DA 5D86A 4RCYA 4IIDA 2NTVA 4Y6LA 4YFYA 3HBJA 3L40A 3I2JA 1O6CA 1NXWA 5A5EA 3PPIA 4I1YA 3SMVA 5MF6A 2WAXA 3WZ2A 4XQCA 4BO1A 1PR9A 4RAQA 1CIVA 1NE2A 2HCTA 3K16A 3E8SA 4ENQA 1Z28A 3FIUA 2NQ2C 3R5SA 3L93A 2YL2A 4XIJA 5AHOA 9ABPA 2OOKA 3FPBA 1MJGM 1R0YA 4PSAA 5HKAA 4OREX 1EZ1A 1CRPA 3IT2A 1S89A 4OQLA 4AY5A 3QY0A 2GYWA 4IXWA 1WOMA 1WSBA 3ETEA 3GVXA 2H92A 4HLUA 5TNXA 1HZZA 4A27A 1QVWA 5A62A 4FWIB 3W7AA 4WMLA 4CEIA 2O8FA 5KINB 3LCMA 1E1MA 2H9IA 4HDNA 5DISB 1R6XA 5CX1B 1G8YA 4ZMSA 3LOPA 5IMSA 3EPKA 1QJ4A 5EVJA 1RC1A 2EL7A 3C8MA 3E84A 2HLNA 3EGXB 4RWEA 4A2CA 5C4IA 2WDPA 2PEYA 3GP8A 2ID8A 1DWPA 3DCYA 3MYRA 2IIQA 3P2EA 4RUKA 1RFGE 2WUEA 4M9QA 5GAJA 4UEQA 2NGRA 4BQFA 4GBED 1EP2B 1DX6A 3KEMA 4FHEA 4NU8X 2PKQP 3IIEA 1T6YA 4LECA 3B6JA 3RAEC 3O8OB 4JDUA 4OUKX 3SJBA 3B52X 4C7BA 4DSNA 4AICA 1BZYA 3GBVA 1KR5A 3F9CA 2C5AA 2A33A 3A4MA 4QYMA 1ESZA 5T41A 3DYBA 1GU0A 4RTNA 4IIYA 1K4MA 1TKRA 3VDXA 4DJAA 3A37A 5JHGB 1I2ZA 4LFBB 1JFFA 1CUAA 3JQ9A 3QBDA 1A96A 1QO9A 3D7SA 5C3UA 4WEQA 3AF3A 4IFBA 5EEHA 3W2FA 2C9MA 4PR3A 3GVPA 1LBEA 2JGNA 4N47A 3CNNA 1COWD 1F4VA 5KNCA 1ZIYA 1CK4A 3CEMA 1W36C 1Z34A 3FFAA 1SXIA 2XDYA 4W63A 1QUFA 2GWHA 4MQ5A 4D8XA 3G5AA 2VBGA 4G41A 1UP4A 2XKKA 1BHSA 4RJLA 2JGFA 2QTBA 5G3YA 2H2HA 3SHWA 2R1ZA 2PWZA 4PONA 2GO1A 2GAAA 1K2VN 1W44A 3LY7A 3QBVA 3FLEA 4EKDA 3LVRE 4S1PA 4GR5A 2X22A 4DNPA 3MJEA 4D9NA 2HMYB 5JCJA 2GFIA 1P2VA 1FUUA 3V34A 4QECA 8OHMA 1RNLA 1P74A 1V2GA 2ZJ8A 4NI5A 1WCWA 4WVFA 5I4KA 1RJGA 3BHJA 3ADPA 2PVCA 3M9XA 4H6VA 4YJFA 3G1TA 5T5QA 4IDFA 1F2TA 2YVAA 1W96A 2Z83A 1JVNA 3CVWA 2SCUB 1WXDA 1T0BA 3GQBA 4R2WA 1MEJA 1Z88A 4NX2A 2ZG6A 4E88A 2ORIA 4F60A 4JA0A 2WUWE 2FUEA 4RD6A 2AI1A 2P65A 3G5UA 4I9GA 3UUWA 1H1TA 2I2AA 4H2DA 1CDDA 3DOFA 1D5CA 1XXHA 3AY0A 3PVCA 5DM4A 3CSSA 3D43A 2ZRAA 4HH0A 4Y3UA 1Z39A 3ZY3A 2FZWA 1QAOA 3GL9A 4MW5A 1QIGA 3HU5A 4DABA 3K0EA 2P3QA 3DF9A 3PQCA 4GMGA 1PL6A 2X6RA 4Q4HA 3X1KA 3ZLBA 1YO6A 4AMGA 5FOSA 1FYXA 1J1ZA 3LG2A 1N5IA 4OYYA 4ARZB 1J00A 2E18A 2XB6A 3RRBA 3HDYA 3ZKAA 3HN7A 3MUNA 1JKMA 2A35A 3GAFA 4NWIA 4CKEA 3NKFA 3NHKA 4KMRA 2NUTA 5JFTA 5DBGA 1KETA 1N78A 3OJWA 4ITUA 3MAAC 3N2LA 1IUNA 3Q7QA 3TZ6A 4PC7A 4CM7A 5B7NA 3KAJA 4EJFA 5EZYB 1FNMA 2VPYA 2DUUA 2IYZA 1K3TA 1XB2A 2IXFA 2XE6A 3ITDA 4B71A 2WJPA 3IAS1 5AK0A 1XD2A 3H0CA 2XGJA 1QTNA 1MC4A 4B3MB 2IYEA 2PX8A 1QHSA 4R40A 2AWOA 1T2UA 3E48A 3PIIA 4N5MA 4ZQEA 3TIFA 1GTRA 4JC8A 2ZJ7A 5D3QA 2FLWA 5CCEA 1DMSA 1FJHA 3DEJA 2D2EA 4YX9A 1H2YA 2ID7A 3GJ3A 1G64A 2OG2A 1YR3A 5IF9A 4QXRA 1M1XB 1T5TA 3AERA 1VTKA 2PQ6A 3CUWA 5EZYF 1S3FA 1SB9A 1OBHA 3D8UA 4P3OA 2W48A 2BP7B 5AJWA 2Q5OA 4YA6A 2A88A 2RH5A 1DDGA 3A3NA 1SKYE 1RMQA 3LPMA 1CUXA 1BX0A 2QN9A 4H18A 2QLTA 2ZSDA 3OEED 4BX2A 5KDDA 3CLRC 3H2BA 1WTCA 1XZCA 2J4DA 1TW3A 4UNNA 7AT1A 2I1VB 1KDZA 1SHKA 5I7RA 2H5IA 2O20A 4ZVRA 5KAMA 5CD1A 2WUDA 2BJWA 3LRTA 2UYCA 1SKMA 2V8OA 4RE5A 4W9RA 2ZIAA 3B1VA 4LYHA 2EIXA 5CEFA 3T95A 1KY2A 5DT9A 4PRKA 4QNMA 3K0KA 1KPGA 4ZK2A 3I1YA 2V7VA 4CHTA 3VKWA 3BIXA 3KYDB 3BJMA 3WIVA 1W19A 3P5BA 3IVAA 4XDGA 2FEKA 4Q18A 1WF6A 3KUDA 4AECA 2WAAA 2HXSA 3VU3A 4BZZA 2JGIA 2CLOB 4Y67A 2OAQ1 4YHHB 3H9BA 2H57A 4FDAA 4NJMA 4DT1A 1ICIA 1X15A 2I8LA 4ZRNA 3H11A 3G8CA 1ZNZA 1JG7A 1R6DA 4X1IB 4KLAA 2CXNA 4GYYA 3QYFA 4G0VA 4D2IA 4LTNA 4MEJA 3WIDA 4CM4A 3WGVA 5JC8A 1YJBA 3HKDB 3IPCA 4F3CA 5B6IA 5BNIA 2QQGA 5JYCA 3OE5A 5JBNA 1Y0BA 3AHFA 5AKYA 5WRFA 4PIVA 5JBQA 2V4UA 4A4DA 2ZB2A 2PJRA 1VA4A 1YIAA 2C94A 3VH4A 4PHCA 1GEGA 2OO5A 2YJZA 4W6ZA 3V8VA 4EZEA 3EXAA 4EL0A 3GLFE 4TPKA 1XCGB 3Q3IA 1OAAA 2BFFA 1Q1ZA 2AMLA 2V0NA 1AO0A 1DOHA 2VYND 3JQRA 1QVRA 4YRPA 2FPIA 3C6MA 2G0AA 4HLNA 4U3JB 3JAWB 5C9ZA 1WB9A 1TYBE 2CLEB 1XI2A 1Y5IA 1TZCA 4QG7A 4PLYA 4TV8B 4EG6A 4JOQA 4PY2A 4XGRA 2Y9MB 4UNRA 1E0DA 1WLSA 2OESA 2AN9A 1PDWA 3PUVA 2JVJA 1FFAA 1RAIA 3STWA 4GKAA 1ZY2A 1Y4UA 2ZEJA 1QGZA 3F6EX 3MWEB 3ND8A 4FT2A 3E35A 4K40A 4NR0A 2ONJA 4HATA 5FRDA 1K97A 2BZ1A 1CUFA 3ZDZB 2NPIA 5AKHA 3ICCA 5LBUA 3OWXA 5KTSA 2W90A 4O33A 1KS9A 2P2ZA 5GONB 4X62B 1M6YA 4OQPA 3TJMA 4B81A 2G4CA 2ZIXA 3H97A 1PWEA 3UT0A 1GYQA 4TV8F 1HYBA 5T3UA 1GQOA 3A04A 5JWHA 4RCZA 2AJCA 3ZH9B 3P9NA 4OHOA 2QRUA 2XAAA 5D5PA 2IY7A 2QQEA 4CQLA 1T13A 1XK6A 3BZUA 5BWMA 4GG1A 3MAJA 2XJ4A 3EPLA 1EUQA 4KIGA 1L4KA 3TOVA 1ES9A 2NTNA 2FMTA 4LDZA 1GR0A 4UHFA 5FPQA 4HQKA 1PNVA 1EFKA 2H06A 2Q46A 4DBZA 1LRLA 2QJOA 3KUXA 1JMYA 4YLEA 4IGFA 3U37A 5HBRA 3TDNA 2Q6LA 2GBFA 1ZL2A 2X19A 5CA0B 4X0EA 3KUUA 4FC7A 4J6FA 5KYYA 3DBLB 1L7AA 3D0KA 4JVNA 3KQUA 4TLLB 2GKSA 4DUYB 1Z7GA 4EGAA 4GRAA 3CPHA 3UJ8A 1EDZA 5CT5A 3P2OA 4LXHA 2JI8A 4G5XA 4G5OA 4X7MA 4AMVA 5C8XA 4KOAA 3W5AA 1XAIA 3ENNA 4DCPA 4CLHA 2V0GA 1Z5WA 4FNAA 4WA7A 1JA1A 4C2TA 1PZGA 5B55A 1T6ZA 1DKQA 3OSZA 1Q84A 1EFRA 4FCTA 4DMUB 3EOZA 4C4RA 1OIVA 4BIIA 3G7NA 5B3LA 5CA0F 4YK7A 4C0LA 3SQLA 2XUIA 2Z98A 1YS6A 3QLVA 3TE7A 5CYOA 4L0MA 4KSBA 1THZA 1E6WA 1DTEA 2I9PA 3NJRA 1H23A 4NCKA 2WA2A 1XP8A 4K0KB 1UMBA 2EC5A 3T7TA 3BDVA 3OPYB 5EPEA 1FSPA 2C99A 5DHFA 1U9JA 2RGDA 1A5ZA 2FKAA 3LLSA 2C1EA 3HPRA 1FFXA 1VL0A 3F7TA 2I2DA 3EQ9A 3G7UA 3LQ1A 4PGAA 1N57A 4TL8A 3UT5A 2PGLA 1L8QA 2G77B 2JG3A 2AKYA 2Q0XA 5HIKA 2L42A 5AKIA 2F3RA 1UKEA 3L01A 4W5HA 1DRUA 3KO8A 2RD2A 3OLCX 2RG7A 1BA2A 2RHTA 3WQRA 1ADYA 2FPWA 2O3SA 4ZJYA 5ADHA 2FF5A 3C5HA 1KO4A 3D7NA 3I6IA 4QDKA 4LTDA 4YQZA 1WVGA 3IEUA 1Q15A 1W9HA 4QELA 4YRLA 5AM5A 4YR9A 1TQ2A 5D7BA 1GZ5A 1W0KA 4BWYA 3IKLA 4JI2B 3NKLA 3QVVA 1WJGA 3MIIA 3DCJA 3GFOA 1YS2X 3U4GA 1EBFA 2YWDA 3UAYA 3N9IA 4NCHA 4RY2A 2YMQA 3ENZA 5H82A 3C5EA 1ZUHA 3HLKA 5T4HA 1JECA 1TUIA 4OPMA 3RUAA 2DAPA 4WXMA 4MQUA 2AN3A 3IBGA 4M0DA 3UV6A 4LRQA 4YRQA 3L5KA 3V33A 1XTTA 1LNQA 2XUZA 3LO5A 3OTWA 3FFTA 3I76A 1LTHR 1KJ9A 4ZT3A 3QWIA 2EXXA 4I5FA 2P9QA 2WNSA 3JWPA 4IQ8A 1VC2A 4EEZA 2DECA 3A1NA 3A6HA 2ZTVA 1HL7A 2NYAA 4S12A 2Q4DA 4RENA 4BQRA 3ETNA 2AR9A 3MTEA 3L1JA 4ZQFA 4PHGA 4PLZA 1U2EA 4M9SA 3HEMA 5DP2A 5B3JC 4KITB 5JS1A 1KK1A 2RH4A 3DEIA 1A8SA 3HCRA 1U9IC 3KUCA 2IPAB 4Q7KA 5IG2A 2R65A 5HQ3A 2BH9A 3P9PA 3CCBA 3OP1A 2I4TA 2JGJA 2WZCA 3I58A 3P9RA 3STHA 4CLEA 2FRDC 4D4JA 4YIHA 2EJCA 5LDHA 2BZGA 2IGTA 2VUTA 4DPKA 5JSZB 1W30A 3HXOA 2R68A 4J7CA 2AIRA 2IS6A 4W6QA 1ODFA 2E49A 2XWBF 4BFWA 1VLHA 4H7IA 2WY2D 4MNTA 1R8QA 2OHXA 3OURA 4IXDA 1FSSA 1KAMA 2IE8A 5FWDA 3LKZA 3A6ZA 4LN1A 2QL7A 5K5EA 1MOQA 1QFYA 1UZUA 1WZIA 1BEEA 3G8YA 5E95A 1KRXA 3QEAZ 4QU0A 4BDTA 3EE6A 3I6BA 4ZU6X 5DBHX 3I5YA 4Y6PA 1U7HA 1YJCA 2HBYA 2WHPB 4XD2A 1NVKA 1N2SA 1FTSA 3VYTB 2JGDA 2C82A 2QRGA 2NZ8A 4OYRA 4UCWA 5F7ZA 1FDSA 2IT1A 3UCEA 3ZHXA 5C5IA 2RIPA 3AFGA 2PSDA 5TQ0A 1HE4A 3MUEA 1C9MA 2HYDA 1CZHA 1XVUA 4YP5A 4B4DA 4LJ6A 4L4SA 3E4CA 4PZ0A 7REQA 3OA2A 4AB1A 1MABB 2P68A 4K6GA 3C7CB 3R5TA 4PSCA 1XT6A 4LHXA 1DB3A 4EYOA 4S1VA 2HT6A 5JBIA 2BFDA 1P0FA 2Q3HA 4GICA 4J6EA 3OJXA 3UUFA 3WC4A 1R15A 1K3UB 3ILXA 3STVA 4MIYA 5SYNA 5JWRA 1QAQA 5JPCA 3AW8A 1NURA 1RPJA 3CZRA 4MPJA 4QAQA 1W4BA 3UGJA 1SM4A 1K75A 2WB4A 3CRQA 4MVYA 3L4KA 3TBFA 1YXMA 1YT5A 3V4FA 4BMPB 2IBMA 3PR1A 1PD1A 2HC9A 1MD9A 2GLUA 2ZJAA 3T3NA 1G17A 1Q7EA 2Q3FA 3TAHA 2ASEA 2FOIA 5K0JA 4DNFA 8ABPA 2BSAA 4CG3A 4I4TF 2JAHA 3IDOA 4OQFA 4JYAB 2MMCA 1YZTA 4PNPA 4YFVA 3G8AA 1VIVA 5DHPA 4Y7CA 2PSJA 5I8ZA 4R8LA 3K6KA 3LDGA 3VR1A 1PHRA 3GLGA 2FWJA 2NZYA 1CLEA 5EHIA 5BXYA 3O5AA 1GCIA 1O0BA 2IHNA 1ZESA 2O2EA 2O4UX 4QTTB 4BJ5A 1G60A 4YUWA 4L9WA 1CUJA 3WLIA 1Z68A 4X61A 1YQEA 2FG7C 2HA0A 3TUJC 4B31A 1DEOA 4MB6A 3PHBE 4Z4QA 4H7FA 4BNXA 3LGSA 4UAGA 421PA 2P6RA 1W88A 2KLBA 2OBBA 1RQLA 2BMVA 3GA5A 4D3DA 5JO0A 3R7DA 2BMWA 4TYMA 3UC9A 3BWXA 5E3HA 4I50A 4D97A 2C0CA 1KFKB 2FW9A 3T3HA 4BMNA 1H4SA 2Z1NA 3WHPA 1QSGA 1I3CA 3E9MA 3HJRA 1XZKA 4MQMA 1OHHA 1AKEA 1PTJA 3OECA 3OZBA 3LYAA 5HTKA 1HYEA 3I37X 4KWCA 3PXEA 2F9LA 2PO7A 3G6WA 2EZTA 1UKCA 4GVLA 3UK2A 1A97A 4B6EA 3HUFA 2XYPA 1VBFA 3CV3A 2JKZA 5JCJD 5I5GA 2YJGA 5E6UB 2HBZA 4GAEA 4PN7A 3H8SA 3L4SO 3WB1A 4PSVA 1M8JA 2JEYA 5IJXA 3WGZA 3UHFA 2QN7A 1TCAA 4U6NA 1TU3A 2VSXA 4L6IA 1DPGA 2HPAA 2XRYA 4YUYA 2EDCA 3AKZA 1C1HA 1UDRA 4U0KA 5LZ5A 3VDQA 1MH1A 1E8NA 5ALYA 4Z7JA 1O4VA 4YEDA 4YRNA 3BXOA 4N54A 1N25A 4KQMA 3ZCXA 3UMYA 2WHQA 5H80A 3C5CA 3AEUA 1NBMA 5I7FA 1MAAA 3R6GA 2BGMA 4FR0A 1WB5A 4GSLA 4KACA 4KQXA 1XAGA 3GRYA 2XQGA 1APBA 4HAYA 1DIBA 3DXXA 1N2XA 2F1KA 1GL9B 3LF1A 3LPDA 1YZVA 3R5HA 4J03A 1WETA 4YP9A 1YDHA 5KHOC 2YZ2A 3HK2A 1N8SA 4Y6SA 3L0OA 2BEVA 1PJSA 2EHDA 3C1AA 3MWDB 1PJCA 3QE4A 1GXSB 4PLHA 1VIMA 1YGPA 4N5LA 4LBZA 3H1FA 1FS6A 4C0KA 4OXXA 1ZOLA 4CLXA 2CBGA 4NCBA 3UJDA 4DSZA 4NV0A 3C6BA 5J5VA 1GQYA 3I28A 1Z3CA 1T1IA 1U2TA 1ZWKA 3BWVA 4IZIA 3UZUA 3LK6A 1YZKA 3QBEA 5TARA 1EDOA 2BHRA 2ZRPA 4G0OA 1AXRA 3BMOA 3S7ZA 4ZEWA 3ZWXA 3SVLA 2IHVA 4Z9AA 5SZJA 3DKRA 2FQYA 2P9GA 1EXNA 2JCVA 2PY6A 5MN6A 2LTAA 3NTXA 4M98A 2YYSA 5FR2A 5HF9A 3TS1A 1I5OA 3CF0A 4NDAA 2D62A 4LOJA 1WP9A 4NPAA 3ZBUA 2JHGA 4EYEA 2QRJA 5LQDA 3OFSA 3CR8A 3DXYA 9LDBA 5LU9A 3DLHA 1Q21A 4IXTA 2IPXA 4MB2A 1F6DA 1I4DD 2A9KA 1A88A 5KAPA 3W5CA 4LZNA 4J94A 1SCBA 4C76A 2R8EA 3OQVA 2PRYA 3CH6A 4J29A 2GVNA 3FWKA 2B82A 4DVGA 3DEAA 3GN1A 3P97A 4WZBB 5BNFA 4M9RA 5EHXA 1UPCA 1RZ3A 2FEPA 5E1DA 1A9ZA 2RGUA 3AW9A 3Q6MA 2ZGVA 2HSDA 3D02A 3B6ZA 4HKTA 1ISRA 3D7LA 4B3RB 1THTA 1D04A 4UU8A 2REQA 3H4MA 3TLGA 2AJLI 1NVAA 1QVVA 1TZ2A 1VOTA 1R3UA 3UBTA 3FMPB 5A4KA 1JEJA 1QK4A 1F3OA 2A2ZA 2B21A 2RIRA 3I0MA 3Q0IA 2QNRA 4QUDA 4R2LA 4R9SA 5EIFA 3ZZUA 3S81A 2JLUA 3UF0A 2AQ8A 2PKCA 3PZBA 4RHEA 2EFYA 5JQGF 1J8MF 2RK4A 2WJGA 4E21A 1W85A 3QVGA 1UXJA 2PRZA 3AP1A 1WHTB 4PBRA 2Z08A 2ZOSA 3B7WA 3I64A 1ULBA 2PWBA 4BKPA 4JI6B 2J0QA 4PYMA 1TJYA 2YV2A 4Q3LA 4GI5A 4RY0A 1AGXA 4YBZA 4EB6B 1U7DA 3K72B 1GG8A 1JFVA 3EGVA 3THOA 3TNDA 1R9JA 5M34A 3ZJUA 3UOGA 3E9DA 5A5VA 4ER0A 1DJNA 2FSPA 1YIDA 3QEMB 1GOTA 4X1KB 4ALNA 4BNYA 5JCXA 2K7FA 2ORYA 2R2AA 3DDOA 1VFPA 1ZUNB 4GLJA 4WZAA 3SMQA 1OBVA 5I9IA 2DVMA 5HKOA 1QRUA 3UMSA 4XX0B 3HYSA 5IARA 4YREA 2WSBA 4DDHA 2QR2A 4HRYA 3DOEA 3AKYA 2C54A 3GAMA 4GH5A 4ZCRA 1Z5VA 3PV0A 2B61A 3DJYA 3IVGA 3LY9A 5G1PA 2EJUA 4FHCA 3CX4A 2OOSA 2OV4A 2W2KA 2VI5A 3R6DA 4LV5B 3FHJA 1EESA 2PZEA 3BD6A 4CXMA 2F2TA 1C8KA 4Q05A 4ZGGA 4OKNA 4CEHB 2H2IA 2C0QA 5CFZA 2FI1A 4D81A 2QOEA 3EXFB 1QBKC 1IN5A 4LQCA 4AQYB 1HYHA 3GPLA 1KAOA 1L4FA 3DO8A 3ZCQA 2P2SA 1CQZA 4KQJA 1Z7YA 2GRJA 4DYHA 1T29A 1KMHB 2HLHA 3BGWA 5DNUA 5DHRA 1G8SA 1AK1A 2SKDA 3OI7A 3PB3A 4QTZA 3SBXA 4EY7A 3X1ZA 3ZW9A 1S7GA 1VJRA 2FK8A 3PPXA 4A8JB 4BB0A 5D6NA 1SXQA 1JRLA 3DYVA 2HDHA 3BMNB 3D6UA 3EJWA 1Z4PX 4FFBB 4D96A 1I9GA 1Z73A 1VBKA 2G7ZA 1FF9A 4HMOA 4ZVMA 1ZIDA 1QG4A 3QHPA 2VP3A 1ZVMA 3ID6C 4RO0A 2WT9A 2CHFA 1BEZA 2EBFX 1Q0HA 3VO9A 1R10A 5AVZA 3FF4A 1E2LA 1EM8B 1EVIA 4LRWA 5BRJA 3IV9A 4EHHA 4N5NA 3WNQA 1R64A 5G4LA 3AHEA 3R4VA 2L2QA 3X1XA 2YTZA 1QGUA 1ZGCA 1CB7A 1I4OA 3MB8A 2X0NA 2WILA 1FZTA 5A4FS 1EI9A 2RHOA 1G19A 3LY8A 4HY3A 1WUTA 5ALOA 5ALSA 4ZYLA 2F8TA 4MRRA 4LDRA 4V3CA 1KEWA 4HNAB 3MGKA 1ZZEA 1CWUA 3UGQA 1ESDA 4JUAA 4JC5A 4X1IA 1VSBA 1TDJA 3ETHA 3RVMA 2YASA 1TLFA 4M1ZA 1NBIA 3OCJA 4KX5A 4O5OA 5FOUA 1ORTA 3FDJA 4KIJA 3RVRA 3HKDA 1WOYA 5K01A 3RS7A 2HIGA 2Q9BA 3AP3A 1JXQA 1ISHA 3KOOA 3CUKA 1L5HB 1OMOA 2PKXA 4ZU3A 5BT8A 3THYB 1T0JB 1XQ6A 2R87A 1VDZA 4Y1EA 1L0BA 1MKYA 4GOOD 2WTAA 1XDUA 2R6FA 3D4BA 4QPZA 1P8JA 2E5LB 2WT4A 4KRXA 4TT8A 1UDBA 3AR3A 4YWHA 4QO8A 4QTXA 3E5MA 3RVPA 1T2NA 1Y4SA 1P75A 1L8AA 1CTQA 1TNDA 3HABA 3RFVA 1KWGA 4KN9S 3JAWA 2PR2A 4LUCA 4MVJD 1GTSA 1UBTS 1UAGA 2VXBA 4YRAA 1H0HA 1CNEA 3GOHA 1UXIA 1DLIA 1NRXA 1DCFA 3OTIA 5J5AA 3SJUA 2CNLA 2Y92A 4F4UA 1BCRB 4QGSA 4WZZA 2DWQA 1V1MB 4YMLA 4O2AB 3G0DA 3ME5A 3NAMA 3MWEA 3DA8A 1IFXA 2JANA 4KOEC 4J16A 2CNKA 4IOKA 3HSKA 1RHRA 1ZH6A 3Q3HA 3SNKA 1ONBA 3D5EA 4AY4A 3FRJA 4V03A 1FRQA 1AUOA 1P9RA 3GRCA 2EBWA 4UQPA 1C1YA 2F3TA 4YB8A 1LTQA 1QPZA 1C9EA 4MP6A 1ONOA 1OH8A 4YJ3B 4ZCSA 1XEFA 2ERYA 4DW8A 5FTJA 4NFYA 3N5KA 2ECFA 3DG9A 3CRZA 4Y7DA 3SGLA 4F0JA 3DKIA 1JIXA 1HOXA 1V8OA 2LCQA 4DB4A 4EX6A 2NLOA 2NO5A 4O2AF 4OMDA 5HPYB 4G5GA 1R4MB 3KQNA 2FKNA 2HQOA 1KJ8A 4JL6A 4LG1A 2FMKA 1YFZA 3DDWA 3H5LA 1HK7A 1SPXA 1I3OA 4Q4AA 2I9KA 2F1JA 2CVFA 4HVCA 4K9DA 3INRA 1Z75A 1IC6A 1B43A 3R4CA 4FK8A 4QULA 2I29A 3E3OA 4FSHA 4MGIR 5I47A 1W0KD 2P1DA 1WUIS 2X7HA 3QH4A 4O25A 1DUSA 4DL9A 2GZ2A 5B58T 1MFZA 3IRUA 1KEEA 3RADC 1J0DA 3Q7RA 1GAXA 3CT4A 4WTOA 3AFHA 5KYGA 4FKMA 3QUBA 4S3MA 1W1IA 4G2NA 2V7GA 4FMPA 1EBBA 5B5SA 1N32B 2G07A 3GMIA 3V46A 2QROA 4MVJH 6ABPA 2R4TA 3QW2A 4B0PA 2J8ZA 2B8WA 4EYGA 2Q7DA 1J56A 1JA9A 2FW6A 1WCV1 1MG0A 3BMCB 4I4LA 3JASB 3UYKA 1CUSA 5DHUA 2O6HA 2IUFA 4AF6A 3OLVA 4K6KA 2IIVA 5H9VA 5LLDA 2HIAA 5ICSA 3GZNA 5K1ZA 5CG2A 1EKXA 1SCIA 1N2ZA 5K0NA 1TZMA 1TCBA 4QQNA 4ZRDA 4D74A 5ED4A 5BR8B 2FN9A 1GQFA 5EWJA 3ZCUA 4EHKA 5FBQB 2ESRA 1Z6ZA 2EKPA 3KJXA 3AZQA 3OU2A 1ZK1A 3AC0A 3HDJA 4FYXA 2PA0A 5A2GA 4O3FA 4IYRA 1DG1G 3JQEA 4UUBA 3BH7A 5DGTA 2JLYA 4MWEA 5K4HA 1O95D 2WIAA 1UDAA 2W8BA 3DB2A 2BFBA 5FBKA 5A3VA 4EBBA 4Q9HA 3ZV6A 1EFDN 4JFAA 4YI3A 3M9WA 1VLVA 3PQ2A 2QEQA 2QXTA 1S3SA 3A36A 3JQGA 4FE4A 1P1BA 4WFIA 2Q6IA 1F8XA 2NU7B 1SBNE 4W5TA 3DMFA 4YYZA 1JZSA 3WK7A 4FUTA 4L15A 4YPOA 1QYVA 1AV7A 2A58A 1H3FA 2RAFA 2ZRFA 4UM9D 2YFYA 1OWNA 4CIDA 2YIVX 3PRJA 4W9NC 3U7QA 2AN1A 2V54A 4K2AA 3D0QA 3VNBA 4EFMA 1RYBA 5C32A 4OKSA 4QQKA 2PRSA 4YAWA 5T6MA 2FR8C 2NUAB 2ECOA 4WY2A 1FS5A 3N7AA 5JADA 1SOMA 1FSZA 1HDRA 2BI7A 4ZZ3A 2HUPA 1E3WB 1C7QA 4RDXA 2ECKA 3K73O 3LT4A 5H4HA 4ZVOA 1G3UA 3M4XA 1F5NA 1NBWB 1UUFA 2NO9A 3BB4A 3FGNA 3PHIA 1H6BA 4KWHA 4NBKA 3KKQA 1GNRA 4QPJC 4R2KA 3QKWA 4A16A 5IZ4A 3U56A 1K6IA 1JL3A 1G7RA 1M2OA 2W2XA 1NG9A 4GF5A 1TQ4A 1Z08A 3T7DA 1MQ9A 1ZC4A 3FPKA 3SNHA 3SHTA 2VK8A 2JDID 4V0QA 1KJJA 3F7NA 3ROMA 2GPNA 4P31A 1O94C 4YMTA 1PVVA 1RJ9B 4LOAA 2A0KA 1UBNA 1C4OA 3AYXB 3A0UA 3FYCA 5CTJA 3U4AA 1DC7A 1R8XA 1YB5A 3DDSA 4A8HA 5KJ6A 4O3MA 4TVBA 3HDTA 3L2OB 3BDAA 3D6VA 3JQAB 1E7MA 4Y9RA 1QQAA 2N75A 2VK4A 4GHWA 3W0LB 3WWDA 1IUPA 3L7YA 4C4OA 1RPNA 3IERA 4DYDA 2H7XA 3KJGA 1VCHA 4DXDA 3R3ZA 5JSZA 4Z54A 4BFTA 1MX9A 4KUEA 4X7BA 4AWAA 3AR4A 3L49A 2OFPA 3Q1LA 4RXMA 1G4UR 3K4PA 2C3OA 1YHNA 2CMKA 2H4FA 1W34A 2WG1A 4MQ4A 4CODB 1BS2A 3CUUA 4QJBA 4CHGA 5KVAA 2B20A 3O8CA 3IGFA 1E64A 1PZEA 5HRAA 1Y1KE 4HF7A 4HYEA 1RTTA 3EY4A 5I9NA 2HWKA 1J70A 2IA5A 1MEEA 2YXNA 4FMDB 1RD4A 5BV7A 3BHMA 2EV9A 2DZDA 3GCGA 3S8MA 2QW1A 3MCZA 2VPZA 3EDOA 3B1ZA 1FS4A 2K2WA 5ALLA 2EX4A 5IDXA 3DMTC 4C22A 5DM70 3E9ZA 1E0KA 2AQKA 3EEQA 4FFOA 4JJ4A 5FLYA 5JDIC 3SF0A 1G6HA 3O4IA 1Y1LA 2XKJE 4M53A 1SJ9A 2J0UA 4G25A 2X1VA 4RANA 1NL3A 2QIOA 1B2RA 1ZG3A 4QQ8A 3IT1A 8LDHA 4LJAA 4MGHA 4A0RA 5IXSA 4MVJM 1GUDA 3NBFA 4KYVA 1XZBA 821PA 2NU9B 2PMCA 5K0GA 4CKCB 1MZVA 2IEDA 2WSSA 2Z2KA 1Q1QA 2DHRA 3QKRA 1TX4B 5HM8A 5CVUA 1EQUA 1B4DA 4DUPA 5HYVA 1XZ8A 2BTQB 2Y8EA 2YWFA 2Z95A 5ICFA 1G2QA 3ABIA 1ZPDA 3DTTA 3I53A 3MA0A 3RUCA 4YAKA 4YRZA