4DOMA

Crystal structure of the tir-domain of human myeloid differentiation primary response protein (myd88)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
134
Chain Sequence
DMPERFDAFIYCPSDIQFVQEMIRQLEQTNYRLLCVSDRDVLPGTCVWSIASELIERCRRMVVVVSDDYLQSKEDFQTFALSLSPGAHQKRLIPIYAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular mechanisms for the subversion of MyD88 signaling by TcpC from virulent uropathogenic Escherichia coli.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Myeloid differentiation primary response protein MyD88
total genus 35
structure length 134
sequence length 141
ec nomenclature
pdb deposition date 2012-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01582 TIR TIR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10140 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Toll/interleukin-1 receptor homology (TIR) domain 4domA01
1FYWA 4EO7A 4C6RA 5H3CA 2J67A 3UB4A 4W8GA 3H16A 4OM7A 4W8HA 1O77A 4C6SA 3OZIA 3JRNA 2Z5VA 3UB2A 4DOMA 5KU7A 2M1XA 4LZPA 4C6TB 4LQCA 4FZ5A 1FYXA 5FORA 3UB3A 4C7MA 1FYVA 4LQDA 2Y92A 1T3GA 4C6TA 2JS7A
chains in the Genus database with same CATH superfamily
1XNGA 2Q3CA 4K1XA 3VISA 3HEAA 4BLPA 2WKSA 2YBDA 3SX4A 1C30B 1Y1LA 1YJCA 3OIUA 2JFQA 5HZHA 3IPAA 3DE1X 1HDCA 2YQ4A 1F48A 3TDKA 2VJQA 5T57A 3FDZB 2HMSA 1ISFA 4KQXA 5A05A 1D2GA 4GICA 3Q10A 4AIRA 1JXQA 2I6XA 5CDGA 2J1LA 2AA3A 4RWEA 5GGXA 2R44A 3EH2A 1U6IA 2WD7A 4PWZA 3WV5A 3F73A 3Q4GA 4L8GA 1SXQA 3KAJA 1NVBA 1E9AA 1E9CA 3I1IA 3DGFC 2D0DA 3NAMA 2IUYA 4OHCA 3WNCA 3ZNQA 1NX6A 1CFZA 1QO0D 3EA5A 5K3DA 4AF8A 4E15A 3T5AA 3VGJA 1P33A 1NY6A 2HO4A 4LIPD 1HNWB 2OV2A 1RZRA 1B23P 3FYTA 1S7GA 1JV2B 2AJ8A 3OTGA 4HGQA 2JA1A 1DKRA 2VHQA 2NZWA 4KUHA 3G9QA 2J7KA 4EW1A 3DMTA 2NIPA 3A1UA 3DOJA 3AVWA 1ABFA 1MX5A 2RJOA 3Q3JB 2PBLA 5B1IA 4B4WA 2NO6A 1TK2A 4PGMA 2YL2A 3L1JA 4UEQA 1YCHA 3B6KA 3HXLA 4JMPA 3QPAA 3GGDA 2PT5A 1HDRA 4G1CA 2XV1A 3H04A 3FPFA 1DKUA 1LBHA 2HDOA 4C4OA 1RTKA 1CC1S 1T29A 2DTEA 5E9WA 2WQ6A 1KR5A 4MS3B 2H0AA 4L6CA 3IGFA 3WZ2A 4UXJA 2OZLA 2GESA 5C2JB 3ICOA 4UATA 1XXHA 5CNMA 2QTVB 3THWB 5UKDA 4PYRA 2G77B 1K8QA 3GRVA 1YRAA 4QXPA 3PEFA 4YBZA 3AEZA 3F0TA 2PA0A 2G1PA 4Y7CA 1W35A 5ALKA 2XQJA 3IPYA 2FW7A 3FLEA 3MXOA 4M7OA 1CYDA 1MN6A 4URHA 2NU9B 2M6KA 5K3SA 5CFLA 3IAAA 4XD2A 2VHCA 2D7CA 3L0BA 1AG9A 3RASA 4KREA 5DN6A 1C1HA 1UDXA 3GH3A 2WHPB 1KI8A 2M1ZA 2SKDA 3P9KA 4RHFA 3K0CC 4TVOA 1GUZA 5CIWA 2WC1A 2NQ8A 2G1JA 5ALWA 5JAPA 3VQTA 1V5FA 4A0GA 4RTLA 5T7BA 3KQUA 4JI0B 3LRTA 3PGMA 4RANA 3TJZA 3UY4A 1XJCA 1ZJZA 3MIZA 4IUYA 4LXHA 4KMSA 1D5WA 2WMNB 4M8SA 4E5UA 3AUSA 5KKCA 1EZ4A 4IOKA 1X80B 2CVHA 2FXIA 5K0FA 1NF3A 1J23A 1BE8A 4RCVA 1SUSA 1FFYA 4PLHA 2CLOB 1FUUA 1NNEA 4LF9B 2RGBA 2PEYA 3IJRA 2C5FA 1Q0ZA 2C2ZA 2VNAA 3DOUA 3NBUA 2JH8A 2WIKA 4KFSA 1GZ4A 3SHQA 3TRKA 3U48A 4L95C 3AY7A 5FBZA 3HG7A 1HDYA 3NRBA 4DLBA 3AM3A 1QPZA 4FONA 4M76B 4LDQA 3E48A 3FSJX 1OXUA 2XVYA 3S1LA 3GMTA 3BSSA 3C3CA 2Q2NA 2I4TA 1T2VA 2AK3A 1L4BA 4DA0A 1PBTA 5BWNA 4LZOA 3TSCA 1R74A 1KC1A 2PQ2A 3P52A 1OH5A 3FKJA 4GMXA 1EG7A 1B76A 3A9CA 3AILA 3M1LA 4S24A 1XLVA 5K0TA 4YRNA 1LSOA 3HJBA 4I1IA 3ZNPA 1EVEA 5G41A 4TMYA 2X0KA 3KUDA 3MUNA 3C5WP 3AX6A 3ODPA 1NJ1A 4YB8A 5AM3A 3N1UA 4BNVA 4DN6A 3NV9A 1SXGA 2P6NA 4EJ2A 5M04A 1TZMA 3C5HA 1BRMA 2QEQA 2WJ4A 2ZWIA 2B2XA 4JC0A 4H08A 4ZQFA 1DEXA 4I46A 5FOSA 4OLAA 4LZZA 2FQQA 2IOYA 1KVRA 5EFZA 2BYTA 1JR3A 1CTQA 1U5BB 3PA8A 1RI1A 4TYMA 3VH2A 2DJ5A 1LLQA 1MJFA 3L6OO 1RAAA 3DDSA 3NTOA 5EIOA 4UMFA 3I5XA 4FYIA 4QGFA 4X1KB 1EE1A 2P2NA 3H13A 3CUEF 2R7NA 3MGGA 2FWAA 3TXYA 3PQCA 1F9EA 3L04A 2RAPA 3CZ4A 2I4IA 3A0UA 1F5NA 3GK3A 3HDQA 1R4ZA 2C54A 4UARA 1EHIA 1IHUA 5F1OA 5I45A 2EFCB 3FVRA 2EYUA 2VQEB 1OE0A 3MXTA 3V7FA 1GXSA 1UANA 4E30A 5FEUA 2O59A 5DGTA 3QEOA 3DAHA 4DANA 1GQRA 4MXDA 2HT1A 3ESXA 2EJTA 3W9BA 3U09A 2CFSA 2Q5HA 4LYGA 3G3EA 1TW2A 4AC9A 4O59O 1FYVA 3QWFA 4JI2B 1AS3A 1AN0A 3MJHA 1A4XA 1ENOA 3WR5A 1YUBA 2CEKA 5ENDA 2C88A 4LF5B 2X6QA 3AL2A 1XA3A 2ZRHA 4FHZA 5CLFA 4E88A 1N3LA 2CZCA 3KYIB 1TKCA 1A7KA 3H1EA 2PDAA 4RK0A 3HM9A 1W8DA 1G9SA 2IHJA 5JI2E 1XJQA 3F4BA 3EVFA 3L7DA 2CVPA 1RM5A 3NDRA 4XYMA 1Z7EA 1SRQA 4GZ5A 3AVYA 4RABA 3MBOA 4PRYA 4E1AA 1UBHS 1A95A 4TVKA 3DE7X 4MV6A 5EP2A 4QELA 2CSXA 5JZBA 2Y71A 3R9IA 2JI6A 4MPDA 1W36D 4BO2A 2NX2A 4F4FA 3BH7A 3CNBA 2CLMB 2RHWA 4DM3A 2GM4A 2NGRA 4ACBA 3C5CA 1X9HA 2VSXA 1X6VA 3RAFC 1QP7A 4ARSA 4GPBA 2A30A 5ERXA 1RKUA 4C4RA 1JPUA 2JS7A 1ODCA 1KI9A 3G85A 3RHSA 1NSFA 5LQRA 3AXSA 4KSCA 3AERB 3L84A 1WCV1 1N8NA 5H3CA 4C6RA 4OA5A 2NTEA 2DWCA 4I8IA 4F38A 1E2JA 1SELA 4AX8A 5KDLA 1H2HA 5HOQA 4HQ0A 3D2BA 3H1TA 2FZKA 1NP3A 3SFVA 4WY2A 3MOIA 4KWTA 3NHFA 1PZHA 3KKZA 4I14A 4Z0PA 2VHZA 2JA2A 2NVOA 4XYLA 1RQLA 4ZI2A 3ICQB 2ERCA 1N3IA 1NAIA 4YYEA 1X1TA 1YAJA 4QDTA 3JQPA 1KS9A 4HMQA 4P9NA 1DC4A 4RC9A 4Y2RA 5CLQA 5JS2A 3VZDA 4NXMB 3OCVA 1BTOA 1TKBA 4A2PA 3QLEA 5EVCA 3EGVA 3FYSA 1N92A 4DIMA 2GBLA 1VL5A 5LA6F 5JNUA 4H3KB 4PLWA 1GG8A 1KFKB 2HQSA 3PICA 1QZ3A 4FNAA 5TVGA 1B0ZA 1HT1E 4YMGA 3S8EA 1J2UA 5B5SA 1S5PA 3MTBA 3O8QA 2ONZA 1NATA 5A6SA 2DVMA 2XGOA 1J0AA 2D5IA 3NHYA 4NH0A 1KYWA 2YWXA 1WY7A 3INRA 1Z3CA 4M4SA 4QULA 4WLEA 1WTAA 4A26A 5AW5A 4EF6A 5IJ0A 2A5LA 1BCRB 4EPRA 2WMYA 3P7MA 4G1UC 3FDFA 1NZFA 3PHIA 1MF7A 2JBWA 2VLIA 1AKEA 2OD7A 1G8SA 3SQLA 5L3RA 4O2AF 2F8SA 2V5UA 1O57A 1BHSA 1XN4A 3D4LA 1RWXA 1RYYA 4Z3KA 5BVHB 5HR5A 1Z6ZA 2GJ8A 2YRWA 4CT0A 1HLFA 4ZFNA 2PMCA 1Z13A 2RE8A 3VR4H 2C8KA 2WHPA 3MS7A 1GAJA 2HGZA 2X3FA 1OKKD 1JDUA 3NOOA 1A4RA 2BH9A 3DO8A 4KVAA 4YCMA 1VE1A 1OT3A 2A88A 1I1OA 3UCFA 3VNAA 1A76A 2GPSA 3SX2A 3REGA 3JQEA 4GMDA 2FUG1 3LT0A 4DC0A 3WGVA 4EKNB 1PDWA 3G6KA 4AJ1A 4LDNA 2V7XA 2QR3A 2ZYHA 5G3ZA 4KTVE 4B80A 1Q7EA 2E1RA 3L6CA 3L7BA 1QQBA 2RHCA 4H1WA 1OIVA 4Q9IA 4BKUA 2HPVA 4OOEA 5FUXA 1APBA 4D4KA 1CY1A 4EA6A 1QX4A 1ABEA 4YPVA 2XT0A 3JRWA 2GZSA 4G8BA 3BE4A 4PX3A 4JLAA 1E6WA 2TMGA 3KJQA 4YC7A 1PK7A 3LT5A 4EJSA 4ZK2A 1QGZA 1BEUB 2IVZA 3DF7A 4ND5A 1WX1A 4RF2A 1QRRA 4WLNA 1NVFA 4XPIB 5AK4A 1NMEA 1PTKA 1V1RA 1YDFA 4RTJA 3ZQKA 4PFQA 1JHXA 3EEYA 2VNIA 4K9NA 3CGWA 1UIRA 2Y1LA 4HUQB 3ZR4B 1UQTA 2B3TA 1LQTA 2R6R1 2R00A 5ICGA 2PQ0A 4GVLA 4I9NA 2Z95A 1U0LA 2JFXA 3ZLTA 4CHTA 4X3CA 3ENZA 3MT8A 1WUTA 4UOQA 1T8PA 1A8SA 3N8NA 5EMNA 4TYPA 1F2UB 3SC3A 1UBGA 4CFSA 3IUBA 4NYMQ 5AVTA 3D0KA 1I2BA 4I4CA 1JU4A 3KV3O 2AMJA 1R37A 4QOGA 5F76A 3WK4A 4CQMD 3EPPA 2MINA 4OPMA 4NDNE 4DUPA 5SYAA 5LD2B 2P2SA 1QZTA 4BV3A 1BS9A 3FZEA 5AO9A 3C7TA 5AUOB 1ZY2A 1J9EA 2YWRA 1I2AA 3HB9A 4HN4B 5HWSA 3ZVRA 2BTQB 1EFKA 5AXCA 1JW9B 1O8CA 1Y6RA 1ZICA 4Q4JA 1QM5A 4TRNA 3NO4A 1WPXA 2C7GA 4H17A 4ITUA 3SG0A 3FHTA 1QBKC 2JFOA 3WL5A 3P45A 4DA6A 4CMEC 4MRMA 3VR4A 2RGNC 4RU1A 1ADBA 1M2VB 3IP9A 5FD8A 3QF4B 4X24A 5CH3A 5EHNA 2XDYA 5DHUA 3NJ4A 4AVYA 4CCWA 1TZBA 3ZY6A 3L1IA 3HWX1 2FFBA 2O2YA 1SXPA 4UDOA 3VKUA 5ED4A 2ZTUA 4CQLA 1U7XA 2OXEA 3VDXA 2BI4A 4DUGA 4WA8A 4F91B 3EEQA 5A3JA 4QRIA 1D4OA 1FXWF 2SHKA 1GL6A 2OECA 1ZNXA 3NYRA 2GPNA 5T8KA 2JLRA 4MV4A 3EUWA 5EUCA 1RD4A 2DT8A 2G28A 4XVHA 1NQAO 2B4YA 2W2MA 1KZ7B 2XTAA 1Q3TA 2XWSA 4LXTA 5JAHA 1C1DB 2GYVA 3H2BA 4L4XA 5TQ0A 5HK8A 2D62A 3E03A 4ZC8A 5JXHA 1JKXA 1GY8A 2WV9A 2Q62A 3ABZA 3KVYA 3O3OB 4DHWA 3QW2A 2PH3A 1MQ9A 3DWEX 2C29D 4OLBA 4CBVA 1U5CA 1IZ8A 3B3FA 4II7A 3U7JA 3I1FA 3NFYA 2DU8A 3DQPA 4YV1A 1V4NA 3S8YA 4YFVA 2XOKD 4EHFA 3DBIA 1NKSA 2Z8XA 4JJKA 3VVMA 2YN2A 1BAPA 3OZGA 4J7AA 2OHVA 2PT7A 5JOQA 1TQ6A 1W48A 3RVNA 1E3EA 2I65A 1YSCA 2CUTA 4GEKA 1UXHA 4K6FA 3T4PA 3VHQA 3TECE 1NHWA 3ZK8A 1UBJS 2Q3HA 2GEKA 3KXIA 5A0TA 1A9QA 3EG5A 4YX9A 2C0CA 4QUIA 1D2AA 4N9WA 4A6XA 1ZM7A 1E2MA 2JJ8A 4G67A 3JY6A 5DBIA 5IABA 3OCCA 1WPRA 1AO0A 3TI9A 2WJVA 2P5YA 5A9TA 2CY0A 1GCGA 1N5LA 4E5KA 1ULTA 2NU6A 4KAFA 5EWMB 1DX6A 3OX3A 1PJ3A 1C81A 1YHNA 2JC3A 4UEJA 4D6XA 5LXTF 2VG8A 1SCAA 3LWZA 4Z86A 3L82B 3QXGA 2XVMA 3X1DA 3ELWA 5JH7A 5AKZA 2XWQA 1IVSA 1WIWA 2VHEA 2W00A 1X7XB 4EB0A 3ES9A 4IRUB 4PSUA 2XUHA 5BUZA 3RT1A 3VPBA 5ALMA 1YACA 5T4FA 2ADFA 5JZ9A 1D4AA 2AJLI 4ZVNA 2RI6A 4PTLA 4XIYA 1RVV1 5IT9A 2Q9CA 3CB4A 3E7PA 1B15A 3ANMA 4B4VA 4MDYA 4ND8B 1EIZA 3VU9B 4CKEA 4M1QA 3LDHA 4NK4A 1GZVA 4B7XA 4M1WA 1XAHA 2ZWPA 3A1EA 4HL6A 4I6EA 3ZH2A 3O4VA 3ED1A 3GROA 2ZLBA 1L5OA 2OV4A 2HH9A 4ZOBA 2ZXEA 2V7VA 3TGPA 3TZHA 3O26A 1SBIA 2Z3ZA 3T94A 4MUIA 1S8OA 1F8GA 3NKLA 4NBKA 1IOZA 1YCDA 4DQUA 1W52X 4IGFA 1Z6XA 5DOVA 4JT8A 4JELA 1M1YB 3D31A 3PEWA 1JG4A 1KI4A 5HMLA 2VK1A 2RB5A 1OI3A 4FMCF 1EK2A 2QZZA 3HWSA 1N7JA 4QUDA 5EIFA 4EMTA 3OJFA 4LZNA 3VO9A 1ZISA 2R66A 3AB7A 5KTRA 4AQ7A 3JVVA 1FSSA 1Q3KA 1BU8A 2PH1A 5K0NA 4AXXA 3CF6R 2VJLA 1F2TB 4AZ3B 2IIVA 4QUEA 4X5OA 3WL4A 1DAKA 1E79A 1PZEA 1NPTO 2BOVA 5THQA 5CURA 3IUPA 1D4ZA 2ROQA 3W4KA 1VB5A 2JIZA 4CM4A 1Z0IA 4PIVA 1TCCA 3M0EA 4QTYA 1H2AS 2WUFA 4I7EA 4IQ4A 3SBEA 3IQFA 4HGYA 1NT2A 1W30A 1X7DA 1FP1D 2FSSA 3F74A 3HGQA 1R9GA 4TVBA 3FTEA 2B5VA 2O2IA 1XEWY 4W4TA 5T4HA 3BEDA 4GXRA 3Q3HA 4ZDIA 1SB9A 3WLIA 3P26A 1JDSA 5DM70 5B57C 5CXQA 4NDZA 3TZQA 4JWKA 3M1IA 4BO6A 3UJPA 4O4IA 4KFCA 4R41A 2OD9A 3RUIA 3E9QA 3H5IA 2VXYA 3GLHB 5D84A 2OAEA 1DAOA 4EFMA 2W2LA 4WJKB 2GB4A 1DKPA 1VA4A 1B00A 2OO3A 4UMVA 3K1AA 3O8OB 1ZVJA 3K35A 4IXWA 5JQGB 2HMWA 4MI3A 3GQVA 4RH3A 3B38A 3QEBZ 2RMKA 5B3LA 1BVUA 4DV4B 2QSJA 1SC1A 5KYUB 1KQNA 4MAFA 3K0BA 2ZSBA 4HYTA 1E79D 5JSYA 5KQSA 1FQKA 4LZLA 5JXGA 2Y1XA 1IBCA 1GPWB 1KJQA 4FMDF 2GCPA 5FTLA 4GBED 4DPMA 2CWDA 3BK7A 1XL1A 4JCCA 4LGVA 1GZ6A 4NBSA 1IMJA 1FS5A 2VJMA 3RTAA 3G5TA 3OE4A 1DPGA 3K31A 4BATA 1FBTA 1OZAA 5BW5A 5HJ5A 2GKOA 3GJ7A 3NP7A 4UHJA 3BJMA 3RVSA 2O8DB 1NBME 3MCTA 2WFLB 2CC2A 2W6MA 4AO8A 1JBEA 2JLXA 5JD6A 4C6TB 5JZOA 3SXPA 4NS1A 2H07A 1RWMA 3HZZA 1HDIA 4R16A 3AF4A 4JXZA 2XB4A 4WKBA 3UJ6A 4IO1A 2JLWA 2JD1A 4D98A 1V2HE 1MZPA 3M2TA 4LJSA 1X2BA 4OFZA 3D6MA 1NOIA 3I9MA 2FR8A 3RV3A 4FFBA 1YUMA 4D8YA 1QJCA 2ZITA 4PRZA 5CXUA 2GXUA 1Y1SA 2ZIVB 4H1TA 3RUPA 1Z2OX 4QD3A 4EHDA 2ZVDA 2C2KA 1KZYC 4FHFA 5T64A 1XL0A 3A1CA 1SNYA 1N0UA 4X1OA 4LYHA 3TCNA 1T5SA 2XDQA 5MGNA 2C7RA 5LUBA 3OX4A 4OK3A 1Y8RB 1YQXA 2JCXA 2ATEA 4B76A 2AEJA 3E8SA 4Q4DA 1F7VA 4PAMA 4WTOA 1Y3AA 3RRMA 4U8GA 2D2FA 3G59A 4YRCA 2IV7A 2AEEA 2YASA 4PGFA 4H1HA 3CNHA 4MRMB 4YASA 2EL7A 2Z43A 3KCQA 5BXQC 1TEZA 5E95A 1ZONA 3LUFA 4RGVA 4C01A 1TOAA 3OIWA 3LVFO 2XUPA 3D7LA 2SKCA 3MAJA 4YO7A 3VSBA 5KYXB 4RTPA 1Z88A 1ATZA 2HSWA 4G56A 2JH3A 2AD1A 3GD7A 2QL7A 1DG9A 4KHZA 5KI6A 4X65B 3C24A 3ZZNA 5FI3A 4IKOA 3C0KA 4TKZA 1T9DA 2I1QA 2WAAA 1GPYA 2ZS8A 4GZLA 4A8PA 1WETA 4CQMB 5A62A 1YULA 2AXNA 4KACA 1Q11A 3AI3A 5TJ9A 1J2TA 1WHTB 2H0QA 5B55A 3KKKA 5CB4F 4CLOA 4MVWA 5JBIA 1XLTC 2X40A 4YRZA 3E70C 4IJ6A 4ZJPA 1U7HA 3O8NA 3I8SA 2XX3A 3PT5A 1K27A 3PK0A 3BB1A 1VC2A 1ZZEA 3PTZA 4LQDA 1T2FA 2OYSA 2RH5A 3I6QA 3IIEA 3U9LA 3UJ3X 4BMZA 5I9IA 4WGFA 3CWZA 1FK8A 3G88A 1H22A 1T1RA 1WP4A 3I5UA 4L6IA 3VJKA 1T8WA 4B74A 2W5UA 5KMGB 3PNYA 2FPIB 3BL6A 1NJ6A 5EYPA 2Y9MB 5GY7A 1XE3A 3GJZA 2QBYB 1WVIA 3VOBA 1ORHA 2JATA 5DNYB 4KDRA 1EUDB 4RDIA 3MD9A 4WE3A 4FN5A 4ZTZB 5AW6A 2IH4A 1C41A 3T38A 2I2CA 4RELA 1XEXB 1Y1TA 2PT9A 3AY3A 3PRHA 4C4YA 1DFHA 4E1VA 1JBKA 2KQUA 1NR1A 4I1UA 1RP7A 2B4QA 3BMCA 3OWXA 4P4LA 4YV7A 4C2UA 5ADHA 1SN7A 4YP6A 2OD2A 3CU5A 2DB3A 4RLFA 3FKSA 5ALXA 3UHOA 3ORFA 3NQ41 4WADA 1Q77A 2YZKA 4GPD1 1NYLA 1KVSA 1XTZA 2JIBA 3F7TA 3ID6C 4NTZA 5JSKA 2NW6A 4DLXA 4KGDA 3AHGA 4Q19A 1ECCA 2C92A 2CLKB 4X8LA 4GF5A 4OXYA 4I55A 1FDSA 4M1MA 1OILA 4KFUA 4UQOA 1HDGO 1I0ZA 3GUUA 5KOYA 1ZAKA 3BJIC 4IRXA 2BMJA 3DZKA 4NMMA 4QRDA 4PYIA 1U04A 1T5HX 4HRXA 4XFDA 5LQAA 4UAGA 4B33A 2P2ZA 2BFFB 5FTNA 5J2UF 1N5JA 5DTQA 2PD3A 4LS3A 3W6PA 4JLBA 4JI3B 5B2FA 2EYQA 2REBA 3DH0A 1Z25A 4YLYA 4JKOA 4MYDA 2ZUFA 2A1TS 2B61A 4G0OA 5F12A 4DSNA 3EC7A 1IY0A 3KB1A 3CGGA 1MOQA 1NU8A 3B1FA 4NU0A 1GTVA 3T95A 3AM5A 1UAAA 3V8VA 4DWOA 1ZN9A 3AG5A 1FFBA 2O3JA 3OCZA 1U2PA 1OAOA 3AM1A 4ZVTA 4TZTA 1CQWA 3OO0A 4I55F 1IUPA 1B3RA 2WE8A 2J32A 2PSFA 5IMSA 1QVAA 2H4FA 5E4JA 2IRWA 3BMNA 2XCQA 3KSMA 4ZCSA 4I2VA 1YCFA 3WGQA 5BRNA 4DCCA 5KC8A 3WSVA 2V6FA 5TE9A 4YAGA 3ZDBA 4N0EA 1YK1A 1GD1O 2ZDHA 3GQBA 2SECE 1J7JA 4LOIA 3WB1A 3LVBA 3EAGA 4LYAA 3TGWA 1GILA 1X2EA 3A10A 2H1CA 4EA8A 4ER7A 2XCIA 1AO3A 3GPBA 4PYMA 3HJCA 3M4NA 3LUGA 5D3MA 3R7LA 3UYLA 3KKOA 1KYYA 1OA0A 3NONA 2YHAA 2V7TA 3R76A 2WG1A 3EBOA 5L95A 1USUA 2HM7A 1IB0A 2EWWA 2G9ZA 3G1UA 3GEBA 3GNQA 3IEXA 3PHLA 4IHAA 4B0OA 1KPGA 4G07A 1TIBA 2FVXA 4DM4A 1SVUA 4IWYA 3ZNOA 1O5IA 4QQFA 2N47A 4FDTA 1MB0A 1VYVA 3F3YA 2GFIA 2J0SA 2CCGA 1GOTA 2HMAA 2OHXA 4PAGA 4RY2A 4TT8A 5JCOC 1WDTA 1ZJJA 3BGIA 4PQFA 3BFVA 4I1VA 1PR6A 3JD3A 1R8YA 3QJ5A 4J03A 2EIXA 3JTMA 3A9VA 4ZT5A 1N0HA 4IX9A 1RFLA 4TVSA 2F8LA 4OKSA 3PFHA 721PA 3ZVMA 4BNHA 4U00A 4OLJA 2JZCA 2QL6A 3PDJA 4F0JA 1FUKA 3O7MA 4COOA 4DNQA 2P1ZA 4U3JA 1XJ0A 4IYJA 4CTJA 1L8OA 3N58A 2EJCA 4FGLA 2WOOA 2IHKA 3NNNA 4E5MA 3NEYA 4B3GA 3L4BA 3AXTA 4L0CA 2LPMA 2NV2B 4I1OA 4Q6WA 3A1VA 3DB2A 5TMPA 1J7KA 3PYLA 5I3CA 4RY8A 3LUAA 2W6ZA 1OB2A 1YZVA 1CUIA 3PHJA 2GERA 5D8DA 3H75A 4WLVA 3CURA 3OJCA 4HQRA 4CUKA 2N1BA 1WCWA 1ZESA 2JJ1D 2FLWA 4D5EA 2H5JA 1NVVR 4TTVA 4C1BA 1JEYA 3EBPA 5GVSA 5EWLA 2V6GA 1NJ2A 4A8JC 4A73A 5LQCA 4JFAA 3T52A 1U5BA 1M2FA 1ULUA 1YZTA 4GKBA 2EP5A 3GO4A 4JUAA 1PFKA 1TZ2A 2V6IA 1JDVA 3IAXA 3OJ0A 4CV0A 2I33A 4EENA 2NUBA 3FJ1A 3DEAA 3FKQA 4ZP1A 1P73A 4CXMA 1FS6A 1NUHA 3QTTA 4Q3NA 3KL4A 3TNFA 3K2BA 4QUHA 4CU5A 1NDQA 1ZK3A 5BQPA 4KWHA 4L6AA 1G291 5AIBA 3WS7A 1XXHE 1ONPA 3G89A 2ZJ7A 1CJSA 4NE7A 4NLLA 1FTNA 2HYDA 4DY6A 2CB9A 1H0HA 1QS0B 2WSSD 3CRW1 4WBXC 3KQMA 1ZC3A 4O4JF 1PR0A 1XP8A 1I33A 2XZDA 1VFPA 1CUUA 3NI2A 5D6OA 3OE5A 5JLJA 1VE6A 1MU0A 1ORVA 3M89A 1RXEA 3DLIA 3DJYA 1FSFA 3SKXA 4DR2B 1PLLA 2H3EA 2ZB2A 4BLSA 3TAUA 2Y27A 3KXLA 4YYZA 4GOXA 3L02A 3VKGA 3OCYA 4BTLA 3EXFB 1PX2A 1Z39A 4DPKA 4V1CB 1XDWA 3A9UA 2G82A 2VSQA 4W9RA 3U40A 4C0WA 1KH1A 1SIUA 3K6RA 4MUKA 2FLKA 5F35A 3RRYA 1DARA 1RPJA 3TIGA 2P9EA 1H1DA 3GVXA 1PJLA 3N6VA 3PFGA 5FOTA 1EFVB 1E7WA 2FG5A 2X4IA 3G8BA 3JASA 3R3SA 1R6BX 3N2EA 3JQGB 1R88A 4WY8A 5BV1A 4P0QB 4P3OA 1UZLA 2ZBRA 4LBYA 5IUJC 6Q21A 3N3BC 4QWWA 5KQLA 2Z3WA 1IQ0A 1Q20A 1RWNA 2HF2A 4M0KA 1MHTA 1CR0A 1XTQA 1M8GA 1HOTA 1R3UA 1ZI8A 1AK2A 3PUJA 2CVFA 4EFDA 4MQ5A 2P0YA 4I2NA 1QIGA 3K6SA 2D0PB 2YJZA 5L4SA 3SHWA 5CBPA 3ECSA 2YUIA 1AU9A 4EGSA 5REQB 4WVLA 1S9DA 2NYUA 4OUKX 3H18A 1VP9A 2VP4A 3SIPA 3AFNA 4BQRA 1XQXA 2GKSA 1XEXA 3CG4A 1G3MA 3KU1A 1PDVA 3KE8A 4OH7A 4TUYB 2EW1A 1UK6A 2IV3A 3RWBA 3M4YA 3B9RA 4WINA 5AM4A 4JJAA 4LV5B 4OGKA 5EXPA 3AHJA 5GPBA 3AVVA 4G8DA 4PO9A 4WSOA 1IEQA 4JEHA 5SZJA 2J3EA 5CA1A 2HF9A 3BWEA 5MHTA 1TC1A 4YJKA 1D2HA 1YJXA 3U3JA 3GT3A 3NHBA 4NHOA 4S1PA 4MI6A 1VE3A 3L9WA 5LN1A 2HCJB 2XZOA 1CHDA 2YVLA 2DHDA 5DHSA 3KT8A 1NF8A 4MQ6A 1JDZA 4QUKA 4Z7NB 1L5HB 2UU9B 2O57A 4GI3A 1A9RA 2DSTA 1XZLA 1BCRA 1H4TA 2QIPA 3H2ZA 3OD1A 4UE6A 4EEZA 4F2WA 1U1EA 4UTOA 4D56A 4NU8X 2PO5A 1UT8A 3AUAA 5BSUA 3EIHA 2Q5CA 3HYLA 5CVUA 2GEVA 1H1LA 1E7MA 1G4AE 5KJEA 1FXWA 1XU9A 4OM8A 5D1HA 1VRCA 3AKCA 4ND6A 1AIPA 1CDZA 2YQZA 3FAZA 2VAXA 3R0XA 4ZT2A 4EPTA 1YFJA 4BRWA 3G2MA 4RXTA 4GQAA 2PM8A 1IK4A 1NONA 2ZQZA 3FOZA 2A9QA 1CERA 1IZYA 3AVQA 5AI9A 2WT8A 4C3UA 3AQIA 3AIIA 1BMFD 3SYMA 4YUZA 4M7WA 2XUQA 2IYLD 4M9CA 1Z3IX 4Q3CA 1Z5NA 2EEZA 3B60A 3GYGA 3MTEA 5E7MA 3OZCA 3HKDB 8GPBA 5MDHA 5TT1A 5IVKA 1EVIA 1Z4MA 1T9CA 3IILA 1Z0JA 4JD5A 2OM2A 3CJRA 2Q7DA 2X9NA 5KQPA 2W48A 2F3PA 5LXTA 2YZMA 3N2KA 1NJFA 4ZU1X 1ZAYA 2GK7A 2DPHA 4RY0A 4XSVA 3S99A 1PVDA 1VLMA 4RM3A 2XMDA 1QSGA 3SWWA 1ZUNA 1SCQA 3EK2A 1V96A 1AGNA 2QQGA 2XDWA 2G0TA 3W9SA 3VPXA 3DEHA 4XOUA 1CEXA 5IMBA 1KWKA 3I4CA 3KQLA 1A2QA 1KKLA 1AUOA 2C9CA 1NRWA 2WFZA 4CIXA 5IDXA 2GPJA 2IY7A 2FCAA 5M34A 1BH2A 2D5BA 3B1JA 4HATA 1KPIA 4ZHQB 4CIAA 1MT0A 5JS7A 4QM7A 4HZUA 2EWVA 2YRFA 3NIBA 3QF4A 1N3BA 1W96A 2EIHA 1RPTA 5ICFA 4NXNB 1CY2A 3WGNA 1EWRA 3CRVA 2BSAA 2VJNA 4K6GA 5J2UB 2JF0A 3P5SA 5FI1B 3F7NA 1TUGA 5AOCA 3ON5A 4HLNA 5H1YA 3D1VA 4DIEA 2EKLA 1XZMA 1Z4JA 2C2YA 1HLGA 4G1BA 3I6MA 4GH5A 3OJWA 5TNXA 3UOGA 3CLUD 5CW2A 4DLTA 1FYDA 1X86B 2WEKA 3GGCA 3I76A 1V5EA 4JX8A 3SYTA 2DFNA 1JR6A 3TG8A 4ETNA 1BQ4A 2ZVJA 3GA7A 4DMGA 1MQ8B 4XYBA 3P19A 1QRUA 3DCJA 4H0FA 2TSYB 1QS0A 2ISSD 1NWCA 3DVSX 2EC5A 3CNOA 3STHA 3F7MA 3PT9A 4JB3A 3DZJA 3WK6A 4EEKA 5HIKA 4MK4A 3RNOA 3GA0A 4J29A 4FUQA 3LA8A 3UGTA 4J91A 3PENA 1JVBA 2WNIA 5ERYA 1HYHA 4E5DA 5EE5B 3T9CA 5KVAA 1GPH1 4FYWA 4JR1A 4C0BA 4K8RB 3FSGA 4H4DA 1G20B 2F1OA 2I4MA 2K7ZA 2J0UA 3H8WA 3NOQA 3RODA 1CF4A 4PC2A 5LDDC 2HSEA 4RIHA 4RO0A 2YVQA 2P65A 2HPAA 2YUTA 5ABPA 2A57A 1I3KA 3R0QA 5CU7A 4MVCA 5LBIA 3LQRA 3UZUA 1JFVA 1GA4A 1GGVA 2ERYA 5LMUB 2BSXA 1C3XA 5TXGA 4DPLA 2Q4RA 4DDKA 5TMEA 3HP1A 1PGOA 2H2HA 3N2GB 2ACKA 2A0FA 1OU4A 1SZCA 1IBMB 1O94A 4R2MA 1P0PA 3QFRA 4ZAFA 3QYJA 5F33A 4HH1A 3Q7QA 3UTDA 4BC0A 1E77A 2JKYA 2G0NA 2OENG 2WILA 4HMPA 1KJ9A 2VAWA 5K8JB 4DR1B 1V5WA 1WU7A 3P0IA 1P80A 1WW2A 1G3IA 2FE4A 2GGSA 3TLGB 1OF1A 3UENA 2XRYA 4KIWA 3KWFA 4PLYA 3E18A 3KUUA 1QFZA 4ARVA 3AI1A 4KPGA 3QKSB 5GMOA 1V3VA 1V26A 1V8PA 3LP8A 1OLXA 3PCXA 4MHOA 2G4VA 3D0OA 4Q34A 3RSCA 3TOZA 3U7QB 1PS0A 4TWRA 5IPFA 3MILA 5EEGA 4B83A 1E0DA 3L7OA 2WOJA 1D1QA 1SC4A 1DG1G 1I36A 2EKPA 2WZDA 3N2LA 4DLNA 5IDWA 2BZGA 2Z1MA 3LUKA 1L7NA 5CITA 1N1MA 1XEFA 3DL7A 1FYEA 2XCUA 2NU9A 3OJOA 1ILEA 1HORA 2PRSA 2YJGA 2F1JA 1DX9A 1EWVA 2HWUA 3DFMA 4JUDX 4DR3B 2W71A 3ZXIA 4ETWA 1ZCZA 4IL5A 2PRIA 3L2OB 1XCLA 5A4DA 1CJTC 4TPKA 1T0IA 3KBOA 5AVJA 1DSSG 3S7ZA 1KAGA 1ST2A 3I0MA 4QTZA 1E2KA 2RHLA 5F2EA 1SC3A 4B71A 4D74A 6AT1A 5JEEA 1QZUA 2J3DA 4KVZA 4U2DA 5EXTA 4N5LA 1CZHA 2QTWB 1D6JA 1G0NA 5CT4A 2A8YA 2ZAIA 4NICA 3ROXA 1Z5GA 4AKSA 3KB2A 1E9EA 1M7GA 5SYMA 1F38A 2HQRA 3MRTA 5FPHA 4Z7QB 4DR7B 2ZAOA 1RWKA 1WA5A 4QQKA 3DPIA 5AKIA 2X5OA 4L4RA 1Z4KA 1GITA 2XNJA 3I32A 3UW3A 1UFQA 3VR6A 3FI0A 3H16A 3A1FA 3SQOA 3WMFA 2O8BB 5JIBA 1VJTA 1W94A 4HTFB 1LPBB 3IHTA 4JB2A 2WSYB 4BLTA 2PXCA 2JGEA 2EF1A 3M1AA 4IO0A 5ALTA 3BDAA 1YQWA 4WXPA 1SBHA 5HF8A 2OHIA 4B4DA 3NBFA 4EHBA 1V9CA 3E4CA 3ORHA 5D86A 3VFDA 4OAQA 3RC9A 3HYRA 2RG7A 4OP3A 2G5GX 3NT5A 1WCIA 2YH2A 2J87A 4JLSA 3KEOA 3O1JC 4BS9A 2PVPA 4W1QA 1OXVA 2YYZA 2FPLA 3E9NA 3AIOA 3S2ZA 3WMXA 3MUOA 2KWIA 4AO7A 3KXDA 5J1TB 1R0SA 3S4YA 2CZQA 2Q4BA 2R1VA 1AQYA 2BF4A 4E94A 1YI0A 2Y6UA 4X94A 2Q4OA 1A2OA 1VIVA 3L7AA 3QYFA 4AJNA 1N8KA 4YCDA 4C89A 5A06A 1TQ4A 2ZI5A 3K9NA 4QNRA 3IOBA 5IJZA 1G6KA 2XCRB 2PWYA 4FGSA 2OXCA 1CKEA 4DCGA 1HE8B 1DJNA 3AQ4A 4R81A 3HUEA 3PSAA 4CMBA 2GD0A 2VYQA 2B1QA 2F48A 1YB4A 3BMOB 4F9EA 3UV3A 4WNIA 3DDOA 1RJ9A 4JI6B 1PR9A 4F9FA 1YJAA 4MVJF 4LVCA 4YVFA 3TLKA 1PL6A 3IPRA 4HV4A 1REQB 1EUDA 1GJRA 4OI4A 4DCSA 1HETA 1U8UA 1NVKA 3SR0A 1TAQA 3MLBA 2R7MA 3FZNA 5JHGB 1KY2A 3T7KA 5BN3B 1SKMA 1B26A 3E3MA 1LSJA 4JOCA 1JMKC 3AHHA 4D7AA 2JAQA 1TRKA 1XALA 2QD4A 4QGGA 2DUJA 1IWOA 1NKTA 3QFFA 4DCNA 3ESAA 2YW2A 2XZPA 4LHWA 3OM8A 4KU4A 1FCJA 1NN3A 3EGIA 1LQUA 2QNIA 1M3SA 1XEAA 1ZLXA 3G68A 3ONDA 4R83A 3I5AA 4QTTB 5BQ5A 2O7QA 4A0HA 3ZVKA 3LWDA 5HRCA 1JE0A 4OYRA 4W8OA 2WM3A 1P7VA 1F6WA 5DYTA 2H0RA 2PYIA 2EX0A 1KSGA 4IV5A 4EFNA 1G98A 3LECA 3THOA 2A1TR 4BUCA 421PA 2ZJ5A 2X0EA 1J22A 2YY5A 4CQMA 5AUPB 1WP9A 2NZYA 3KKEA 1LJ8A 1V3TA 1Y9ZA 2QRVA 1KOFA 3S1AB 4WZ6A 5K0BA 1Z5ZA 3K09C 3N0VA 4PYOA 5DXFA 2FWMX 2XUFA 2GH1A 4TT3A 2IUSA 4TV9F 4HAOA 3O8BA 1U2EA 4ZODA 5ALYA 5L3QB 3CNNA 3BRWD 3KR0A 4I4IA 3A4IA 2YZ7A 2J85A 2ZSEA 3KQTA 1MXHA 3ETGA 4KQ1A 1XHEA 13PKA 3GG9A 3GJ3A 3KDSE 3NORA 5DZSA 3SJ7A 2QBYA 2OR3A 2QT1A 3B13B 3OX2A 3HO1A 3LO8A 3PA6A 1HX7A 2ID7A 4ZVOA 4HAUA 1TQDA 3EJWA 1Z2EA 3KYDA 3WNBA 2TRSB 4F1KA 4HX9A 3W90A 1EM8B 1GKIA 2IJGX 3U6BA 2ABWA 3NHPA 5FR1A 2W8BB 4W5QA 1BNCA 1TA9A 2AX4A 1EXVA 4P3KA 2AG8A 1M1UA 1Y8RA 4UHCA 3A3PA 3GEIA 4BQPA 4HB4A 3VPFA 3DT6A 5CLJA 4W8GA 1AH2A 4BO5A 3GLIB 2VJDA 4X1IB 5ULLA 2LRHA 5FBVB 4J1QA 4QOEA 3I23A 1DLJA 3GT0A 3RROA 2FMIA 1FNDA 1N3YA 1W0KD 1IE3A 1MB9A 1QK4A 2BFFA 2CHVA 2D1RA 2D8AA 2M9MA 4L2IA 5KYXA 4MCIA 5EJ5A 4R0NA 2O1XA 5LU8A 4L8WB 1NQWA 1YBVA 4QYMA 4PPNA 1L7OA 3O84A 1PWXA 4IXNA 5FWYB 2I76A 1DCFA 3HU3A 4FOSA 1U0OC 4L4SA 4TSFD 4AUKA 4EM6A 2D4HA 4JXJA 4KGZA 4KR9A 4O2LA 1XKQA 1P31A 1P81A 4AUMA 4HAIA 4C4SA 3ZCTA 1HNXB 1L5FA 1UPXA 3FPJA 3U7RA 4LE2A 1CBUA 3M4JA 2V97A 5BV2P 2BCEA 1OWOA 1CUCA 3UJNA 4RHEA 3MWYW 1TJYA 3U26A 5IC6A 3UW1A 1KEPA 3HY6A 1ADCA 1U7TA 2H1IA 2XAUA 1RQNA 3G9XA 3PPVA 3QWAA 2VPYA 2GEFA 4Z51A 3LKVA 3PC8C 3R0ZA 2ARKA 1Z68A 3QBJA 1HNZB 2BTEA 4JNKA 3V3TA 3GZNA 4YJHB 1YUNA 1I5RA 4NK5A 4QDXA 1YQDA 2F67A 4EUKA 5JYBA 2OHGA 3RABA 2VXOA 4EG7A 4J94A 1QCDA 4KQCA 4LK3A 3VZBA 5FUVA 4PN7A 3FCOA 7AT1A 1FUEA 4HDMA 1OZ0A 4BMNA 1ML4A 4OUDA 1KP3A 1ZSYA 1J6UA 3OE7A 2GNOA 4ESEA 2VF2A 1Y3FE 4J0IA 4CKWB 4CNQA 3HKBB 4XRGA 4DA4A 3FHOA 3MW8A 4E6PA 1DCKA 3RPEA 4B5LA 2WI8A 2VQSA 3ND6A 2JLQA 2CLIB 3ITEA 3RIMA 4LC0A 1NJ8A 2Q2WA 3IKLA 3ND7A 1MO2A 3NYWA 4GMFA 1SCDA 4HNHA 3VC1A 3AEQB 4R3WA 3RSLA 4AP6A 2BFPA 4YLGA 1BU5A 1Y6QA 2HJHA 1TX4B 2QVGA 4NHEA 3FUVA 2UVDA 4K9KA 3AL3A 1KK3A 4PQGA 2HK8A 5EJGA 2NPOA 2RAUA 5KWSA 2XNCA 1PG2A 4J49A 4BFZA 2VEOA 2X1MA 2PAAA 3T1VA 2NUTB 4K7JA 1QTIA 4Y2UA 2AMFA 5GV7A 2GEBA 4KAXA 4IIJF 4L27A 1D7AA 4YCBA 5IHXA 4F97A 3T7DA 1R4AA 4FXOA 5E3IA 5E7QA 5LLDA 3AP2A 2Q6LA 5AI0A 5KYVA 1OYOA 2I78A 5EJMA 2C2XA 2I3BA 3M34A 4LYFA 3C7AA 4RMIA 3AU8A 5KTKA 3EVCA 3O73A 1ONSA 4JKIA 2F3SA 1H42A 2RHHA 3ZZTA 1UDAA 2RBGA 1PFYA 3K9GA 2EG5A 4G5SA 3R9KA 4BO8A 3LY7A 1PP4A 1A2BA 2HCTA 5TPWA 5JVDA 3GCXA 3GRAA 1CETA 1CUSA 1LBEA 1TJ5A 1NWHA 2AC4A 2VK8A 1DCMA 2J4FA 1ZMXA 2WPNA 3HRIA 4J7UA 5B58C 5F5NA 3TUJC 5KEIA 1F0NA 3AESB 2PUWA 4G0MA 5CLLA 4BUZA 1P1JA 1VHDA 1EU1A 5H83A 3QKWA 4LPKA 4M36A 3AKYA 2MSLA 5I7RA 1DL5A 2CV0A 5HHTA 3EIEA 2AYYA 4TXNA 4EECA 1D8TA 1SO8A 4RJKA 4ERNA 5CDFA 1YRWA 1W59A 2G76A 3KAPA 5EQDA 1E9BA 1P3JA 5J5VA 4BE9A 4PTYA 2FG7C 4AMBA 4BNZA 6LDHA 4DB4A 1YA4A 3GLGB 3CV3A 4TS9A 1K6MA 4MR7B 1IEVA 1VPTA 3GGOA 3J81A 3NRCA 3JQBA 4RHTA 4B3MB 1DMSA 2BKLA 1OBVA 1U99A 2VNJA 3GFQA 4G36A 3O0TA 2UKDA 4CE6A 3P97A 3GDFA 3CN9A 4D9GA 3O1HB 4DMRA 3RGGA 5B1EA 3FWNA 5BV8A 1JSXA 4GC9A 5G0VA 4BO7A 2HB6A 1M7BA 4FGUA 3SI7A 1ZRHA 3UYKA 5K8CA 1QLWA 3RU2A 3GH1A 1QLJA 3AR9A 4RVHA 3AKDA 5IT5A 1PR2A 1UC5B 3LV8A 1VBMA 1JFRA 1WB5A 1EFTA 2I4NA 3FNRA 3NR2A 4JC4A 4R40A 4J6FA 4ZTUB 3ECCA 5HZGA 1KMCA 1EFLA 4IJ5A 4R69A 5C1PA 5ECDA 3ZLBA 1P6XA 2OQ2A 3PR1A 3R7WA 2RGUA 3FDJA 1BKSB 4MQEA 4UNSA 3B5IA 4HQLA 1AT1A 2AJDA 2Y1CA 1FX1A 3LPLA 2C5AA 1S2IA 1ST3A 2RH8A 3AR3A 1ZHHA 1QKKA 2RGEA 1IZ7A 5F3WB 3TCXB 5KTNA 2FOXA 1EB8A 3TLYA 1L8AA 4NENA 1RJ9B 2HPHA 2YYAA 3HB0A 3QEKA 5A71A 4CCSA 1VYUA 2V4ZA 4IDEA 4P3PA 2FZWA 4M60A 4X92A 2GD6A 1QQ7A 2IT1A 3UT0A 5C1OA 5JCJA 3WNDA 3A25A 3DKVA 4CCYA 5B3KA 3DMDA 4KJZA 5C52B 3HN2A 3ENQA 5KVVA 1ZR4A 1CT9A 1CCWA 1Y8CA 1TIKA 2B8NA 5I7AA 3A70A 3TTTA 4CR8A 3RVQA 3H65A 2R1TB 1NY5A 2AFVA 5HQTA 4XAQA 2BHSA 4F5WA 4KQMA 3O2QB 3BCSA 5TV2A 2QT9A 2V98A 3VPDA 4OSOA 2VSYA 3KJFA 3PXXA 2JFYA 3ZLUA 3IVCA 2BKAA 1M2NA 2PWBA 3AJAA 3DC7A 4QDJA 1GTG1 4Q4JB 4RQTA 4LZWA 4Q7MB 1POWA 1IXYA 2NT3A 2FZ4A 3Q7IA 1DBPA 2J3IA 3BXGA 3L7IA 5EPUA 3BX1A 5IN5A 1EJBA 3RADC 3BRCA 1G64A 4LXQA 2HSDA 3ST7A 4I1PA 1CJBA 4BCDA 1WSBA 4OQFA 3RTBA 1RPNA 1OI2A 1KEWA 1NW3A 1JZQA 5ILQA 2IPAB 4QA9A 4R8LA 5DP2A 2RHJA 4QU0A 3TLJA 2FOIA 2R1ZA 4AN0A 2YIDA 5I9BA 4EUSA 1HKUA 4D8XA 1UBFA 4X91A 4PEVA 1P5HA 2C2OA 3GF4A 3DFZA 2IW1A 1C8LA 3A36A 5FXMA 2QIOA 3DG9A 4OO3A 4R1UA 1YIDA 5LQSA 1T3SA 4L3OA 2EEPA 2IWRA 2CT8A 5CGQB 3HLKA 3T12A 2CLFB 1CSEE 1C0IA 3DLTA 2IYAA 2R4UA 3F4KA 3I6ZA 3ISVA 1WHSA 2FWNA 3O93A 1Q0PA 3OMXA 4L75A 4XTRA 3WGJA 2ZRMA 4ND2A 5LOVF 5KBYA 5LNK1 1CRQA 2D0IA 2ZUCA 1Z29A 5IDVA 4G1FA 3DW3X 1ESZA 1FUYB 4O0MA 5BT9A 3D4NA 4C0SA 1YI8A 4BB6A 1BFUA 3A11A 5LVAA 3MJEA 2V6JA 4HEQA 3Q8LA 4UZSA 4TYYA 2RKBA 5LJIA 1B16A 3H2SA 1BOOA 3D7MA 4JEMA 4X85A 4YAIA 3D43A 3R3UA 3R41A 3KSDO 4K3UA 5E6SA 4EL5A 1I30A 4QPNA 3U3KA 3MJFA 1QVVA 1LQ2A 3NDIA 5AW0A 2IHYA 3ZXXA 2LWIA 2FMKA 4PYQA 8AT1A 1PWZA 3L07A 4FHCA 2H08A 1SVLA 3KYJB 4ZU3A 1RAGA 1L3BA 3MHPA 4HB2A 4TLDA 5I51A 3PPYA 1GV0A 2JFHA 3D7RA 2QTZA 3B70A 3PDHA 1RQRA 3LQ4A 5C80A 4IG9A 3WNVA 2CUKA 4HAXA 4XA8A 1S4QA 3BRQA 3U80A 3SSAA 1KMQA 3CF2A 1MFPA 1PEYA 4NCXA 2ZIUB 2P1RA 4I19A 1A9SA 4OJNA 5JS8A 3GAFA 1US8B 2ODAA 4ZHSA 3HWWA 2OO5C 4JQCA 4QC2A 2G1AA 5EJ4A 3SC2B 1S2DA 1CUXA 1Z7GA 1GEEA 3HKBA 4MS1B 5AW9A 4DE5A 3PJEA 2R4QA 3RRXA 1U6KA 2MSCB 4DCUA 3ZIUA 3TAXA 2QUHA 2PGNA 5CAEB 2GPYA 1ID8A 1QAQA 5I9LA 3GGGA 4HAZA 5D5PA 3ZHSA 1U8FO 2BBOA 2VZLA 1BYIA 3OQMA 3EJ6A 2B30A 1PI3A 2I2XB 3IT3A 2FDCA 3WLRA 4UZEA 4OM7A 5AI6A 3S3TA 5G40A 1YR2A 2X4LA 2VS1A 2HV9A 3MPUA 2VJOA 3OJLA 4NQZA 1E1KA 4NS4A 1QNLA 3ZY4A 2HFKA 3U62A 4CF7A 1NW6A 5KMGA 1KP2A 1M2HA 1MHPA 3DZGA 3NCTA 3PEVA 3DBRB 4LMBA 4Z5XA 2QD5A 3EZNA 3W5AA 3DNPA 5CG1A 4E2XA 3FX2A 3A32A 1WB9A 1XLUA 2IF0A 3R5TA 2W6QA 2BFWA 2B6NA 3PPXA 1HEIA 4GR9A 3A3OA 1PJCA 2XWBF 3EN0A 4GBGA 4IHKA 3RS3A 3KNZA 4A1FA 3RBAA 4XLLA 3T54A 4F1WA 3R7NA 2F4VB 4RKQA 1UH5A 2IA5A 2QTFA 1VSUA 3IAFA 1ZA1A 3MTIA 3OUZA 2OGZA 1MW9X 2RGDA 2GS9A 1ODJA 3REQA 2ZZNA 2IOQA 1O08A 3C6MA 1U90A 3MJTA 5A6SB 1MVOA 5HP4A 3EPKA 3R1IA 3DLAA 3FYUB 2WM8A 4GYYA 4C08A 3PC6A 5DEOA 1RRMA 2PYDA 5DK4A 3WGMA 1QB8A 1G2IA 1ZDMA 1H2BA 5B53A 2PKEA 1W1IA 4WCVA 2HC9A 2WYUA 2QP4A 1FMJA 4K2AA 4QVKA 1DP4A 1PSDA 4LX0A 1JR2A 1C4XA 3EPLA 5IBCA 2YMPA 3VDNB 5EIBD 4L1KA 3R8CA 3ZZMA 4YY3B 1KY3A 4CKCA 5BN1A 4PNHA 1SZDA 4D1YA 3GUHA 1V11B 4LC1A 1FW8A 2XUJA 4CMIA 2Q3EA 3GEEA 5SZHB 1K6IA 3ZGNA 1AKRA 3EIFA 3PEUA 2Z5VA 3QOWA 4PNEA 4O33A 3P27A 4XDZA 1WKCA 3GGJA 4PPQA 1P4JA 3TD9A 3Q8KA 4NY1A 4TM8A 4WN9A 5DEIA 1N25A 1GFSA 3HM2A 4AICA 4DJAA 2WKQA 4F3TA 1UAGA 2VAVA 5A0FA 4V0MA 1LK5A 4MJXA 2HAEA 3A6KA 5DM0A 2QORA 4RTMA 1EFAA 3R6WA 4Q66C 3SHVA 4TMWA 4IMIB 3UWDA 2AFIE 1L7XA 3K6KA 2ADOA 4HR7A 3KSBC 5EHXA 1MR3F 2QU8A 2XYHA 3GLGA 4BP8A 3UB4A 5K3EA 1I0LA 2H5LA 1CS4C 1RP1A 1XK7A 3GA5A 1OVGA 3DEJA 4MKZA 1ZD2P 2W0MA 4A1OA 4UHFA 2Z4TA 3JAKA 4QGSA 1PNTA 4LV8B 5EMKA 1LRKA 4L08A 3UK1A 1J2RA 5CD9A 2H00A 1MEJA 3KKLA 5KINB 3SS9X 4RKRA 3EZ9A 4OB7A 1YTUA 4ALMA 4HYEA 4ZMBA 2RGWA 3U9SA 3U7IA 1Y6JA 3PFKA 5H4HA 1MG0A 2C1EA 4YRTA 3E2MA 3EXG1 3QQPA 2PJRA 4NU5A 1R4MA 2D2EA 2QD3A 4S05A 1JH9A 1BA3A 3HKCA 4C9BA 1WAMA 3SC2A 2LTAA 2PUHA 4KPUB 4F71A 4GAEA 4L74A 1FF9A 3RT7A 4BAUA 1N2GA 2PUEA 1MO3A 2ODBA 2ZBPA 3NVMB 4P8RA 3ZOZA 5GJBA 2CDNA 4KMOA 4CTOA 3NDBB 3AR6A 3T3HA 4W5TA 1T5BA 2H65A 2FUCA 1C29B 4Q01A 2XTNA 5F77A 2WY2D 5BUQA 3V4SA 2H92A 1RQGA 3T1HB 3CKMA 2AFHE 3T06B 3BFKA 3UH0A 3WWYA 2NADA 5CLIA 2DPYA 3NHJA 3C14C 2AL7A 2C9BA 2WWXA 1QK3A 1ZIXA 4XQCA 2IYWA 2E7ZA 3TTYA 1YZKA 3S2IA 2DYKA 2FPUA 4Z8YA 3QVKA 3RHTA 3ZE0B 4BFUA 4DA7A 1JU9A 4ZEWA 2PUFA 1EDBA 5I5GA 4B31A 2G09A 1V9SA 3FR7A 3GNSA 5DN9A 1EDDA 4U0JA 3F1LA 2ORYA 1S3SA 4ZVVA 2XSZA 2XKAA 3O9ZA 2HKIA 4MV7A 4TKVB 5THKA 3AY0A 1J56A 1G9XA 4A0QA 1CF9A 3DE6X 5EESA 1KVQA 521PA 2EJUA 2ZU0C 4MIYA 3W2GA 1EDZA 3TLAA 2IZ1A 3G2OA 3KPVA 4KYVA 1T1JA 1RNLA 1E1RD 4RF5A 3D0RA 4RV9A 3OCJA 3FTCA 5AYVA 4ECEA 1SQ5A 1S2MA 2IVFA 4UEWA 2QYOA 2FZGA 3S5UA 4TYNA 1LC3A 2I7VA 2EBWA 3T9AA 1XZQA 3FRJA 1I10A 1R5NA 3G8DA 3RR2A 4B6QA 1NUTA 3ETLA 3M6VA 3ICVA 5KREA 3GQBB 3JQCA 2P9JA 3IQGX 2O8BA 4JI7B 3GAAA 3LQ1A 1E2QA 1OXKB 2JJQA 2VJBA 1O97C 4FHEA 3C3DA 4WXYB 5CNKA 2Q8QA 1HDEA 1KSHA 1FDTA 2YDXA 3HFGA 3WLNA 4QYXA 3WRWA 2DPMA 4XJXA 5FFMA 1RLJA 5JMOA 3WJAA 1R1DA 2HJ9A 2CNOA 4LY6A 4H7IA 4CV3A 1ISMA 4R9SA 1E2IA 1KH2A 4XSHA 1E8DA 4CCAA 3TW6A 2KS6A 1E7SA 5IWCA 4BVGA 2IP4A 2ZTMA 1SOVA 2PGXA 5DX8A 5DHFA 1NXOA 2J9YB 6ADHA 1WXIA 3HR7A 3OUUA 2HREA 1JFSA 5DP1A 4PO3X 4RDXA 5JRJA 1TT7A 4YNBA 5FLEX 2PE5A 3A9SA 3DD5A 3PP8A 4RD0A 1RAFA 5CTAA 1SJ9A 4JENA 4EB6B 4IFEA 3ZXYA 4EG8A 4HXGA 4R0MA 1RCUA 3L93A 3T1YB 2FI1A 3FDXA 3DR3A 3OHMA 4ZWNA 2AR7A 3DAOA 3E9YA 3IULA 1LD3A 1VL6A 1IOWA 3NBAA 4FD3A 5IC4A 2VNKA 2DFVA 3L0DA 3EG9B 4JNCA 2WD7B 3I1JA 2VKQA 3C8MA 1YA6A 2QPAA 3I53A 1U4OA 2REQB 4X97A 1DJMA 1PS8A 1DEAA 3VOTA 2YZGA 5JJBA 4PICA 4BMPB 3T5BA 5IAJA 4JIGA 4KODA 1ZOPA 3L1KA 2ZYIA 3EXHB 3PLRA 4F2GA 3U1BA 1G5IA 1PWEA 3EGOA 2X0JA 4TZKA 5EZSA 4FGKA 4B3BA 4OHYA 3O4JA 4MLZA 2RJ3A 5GM2A 3OQBA 1XN1A 3O2NA 2BEJA 2AHRA 3WJ1A 1GZDA 1XDDA 2BGLA 5F9HA 3SY8A 5KQGA 1Y6FA 5KAMA 4RTKA 1F4LA 3LKBA 2MCFA 1U4NA 1A8PA 2FH5B 5LQUA 4CEHB 2P7IA 2V9PA 4QXAA 1QQ6A 4I9UA 1KDYA 2F4NA 1LVUA 2V9CA 3H9CA 4RYLA 4BXOB 4ZVQA 3J81k 2QRGA 5G1OA 1OHHA 1EX6A 2XLBA 5K2MA 1C14A 3CINA 4OB6A 5DIZA 2VJAA 2H57A 1I3NA 1TM1E 4BN5A 2V0CA 3MWKA 1JFLA 1RU3A 2CSUA 1WSDA 5C18A 1YZYA 4KLZA 4P4UA 4DREA 1UQUA 4TTQA 4EZBA 1KJZA 1DC5A 4DCPA 3DONA 2ZRCA 3I92A 3MD0A 3BIXA 3BMXA 1VJ1A 3E9RA 4TYWA 1I9GA 1P39A 1TZJA 3HR8A 1S2OA 1UMBB 2EV9A 3QTLA 2P2CA 3TB6A 3W6ZA 2R6HA 5CB6A 3TQRA 3THYB 4J4HA 4LJAA 3EY4A 4O63O 2EJWA 2VDPB 3F8SA 3TRHA 1O8BA 3QOXA 3U7EB 3HB7A 2HMYB 3AOGA 2WKPA 4U0KA 4BVHA 2Q4TA 2PZFA 4GVPA 4D8VA 3DXZA 1W1UA 3F6YA 3QUQA 4LJ4A 4YJFB 2X2FA 4G5QA 3N75A 1HBJA 3AMVA 4P7GA 3AEUB 4QYIB 4IXDA 1V39A 1O96B 3W8NA 2PANA 1N2CE 1E3IA 3REQB 2X8WA 2FEXA 1B93A 1FTWA 1I5EA 1QKIA 3IELA 3LYAA 4M2LA 3RNLA 1P9RA 4CF6A 4YIHA 3FOFC 4NNOA 3Q3GE 4ZAVA 5SYNA 5F73A 3DMNA 3LO5A 4JYBA 4QEKA 3G2NA 3S2YA 3FYUA 4K9QA 2HNBA 4UNRA 1YIOA 3E5MA 3OY2A 1Z37A 3HJFA 1EP3B 4M1TA 4TX1A 2QZSA 3OCXA 2C9DA 3R40A 3VI3B 4DS3A 1ZU5A 2CFCA 3MJCA 1PAUA 1JHPA 3HKDA 2H1FA 3SXUB 1E89A 1MNQA 4IMJB 2JK1A 4FUTA 1Y80A 3IIKA 2I4RA 4IDBA 3MCVA 3W8EA 1SXJC 2Q0HA 4P36A 3S1SA 3GWGA 3QBDA 2F6RA 1ISIA 2A0XA 3MSCA 2P35A 1M83A 3QK7A 4YQYA 2MSNA 1LY1A 5H59A 3EZLA 3NYQA 6REQB 2E4VA 3C98A 2QKYA 1GG2A 3H11A 3QMPA 3QLUC 1HT0A 4TWBA 4DJ5X 4J1TC 3ZWNA 4B6SA 5E6UB 5F7XA 5ECGC 3EDCA 1X7HA 3OE7D 1VA5A 2SNIE 2XMZA 3DVAB 1M1ZA 2ZS9A 1ZNYA 3CM0A 1X15A 1SXHA 1LDNA 4YP9A 4B7UA 2ZYVX 3KWLA 3QTBA 1H6CA 2I2FA 2Q8NA 4XFKA 5FHQA 4OMCA 3RH0A 2BIFA 4YT8A 3HN6A 2BM0A 4LNUA 2CXHA 3UFXB 1J49A 4XPZA 3ELBA 2W70A 1L4NA 2OFPA 3N5CA 3S44A 1K75A 3G82C 9GPBA 4CQJA 1ZSVA 4MKRA 4KSYA 3X1KA 4ZCRA 1ETUA 2ES4A 1HA3A 5K09A 4M0FA 1ZVQA 1M66A 2HSJA 2VBIA 5C8YA 3C45A 2MSWA 2OGWA 4ETMA 4U2EA 1C9KA 3IAM6 1CDEA 4M49A 2IV2X 3OVMA 3UJ9A 4S1NA 3UTCA 4G86A 1CUEA 4CKBA 4O4HF 4I5DA 4JYAB 1VMAA 2PWPA 2XXBA 4JASB 2NU8A 1GARA 3TMAA 3A7DA 2ZI7A 3NH6A 2HDWA 1N2SA 4DSZA 1W4RA 3BB4A 3GFSA 1Y4ZA 1FIUA 5EJAA 3F5MA 4BNJA 1F6DA 3IUQA 4GLFA 2BWJA 1GKYA 3ZV4A 3TZKA 2FWPA 5GJCA 3KJEA 5AICA 3LX4A 1ZN2A 4PPYA 4DCMA 2HX1A 2ZT8A 3BL8A 2FUNB 2X13A 2C5LA 2OBLA 3CLRC 3RO7A 1SKAA 3UPTA 1U2ZA 1HMYA 1HUQA 2CDCA 1OLXB 4ICIA 3ZK7A 4ALNA 4BX9A 5AESA 4FDUA 3RREA 4GI5A 3LDAA 4IMRA 1IU9A 3ZX4A 4FFWA 3ELUA 2FU5C 3NAQA 4KNVA 4FGJA 2J31A 3N87A 4JUIA 3TM4A 4ZYWA 2CJWB 4J16C 4X6LA 3WMWA 2W2QA 3H9BA 5C8DA 3QMWA 2A9RA 1XTBA 5I7SA 2ASVA 4NYJR 1G5RA 1DEOA 1OC4A 1PE0A 3UWMA 3HJUA 4Y2GA 2G36A 3NHKA 4L5BA 5H3HA 3FOAA 4B09A 1TVKB 2F3TA 3KLNA 4FFDA 4MYCA 1RKQA 2XNKA 3VBCA 4BWFB 1JQBA 1MT3A 1Y4DE 5LZ2A 4WT7A 2R1TA 3C7DB 1T3TA 1U28C 2A84A 4I9GA 3V42A 1YB5A 1K7EB 1GXSB 2OP0A 5ARBA 1ZGAA 4NE9A 3R09A 4KVFA 4MV8A 2CK3D 1EGHA 4P4SA 5MGBA 2DKFA 2HYIC 1T3LA 1UKVY 3H87A 1WZIA 2BFAA 3OPXA 1Z6AA 4MUEA 2XOKA 1QRTA 3IDZA 1S8FA 3OCWA 3MM4A 2H2GA 3P4UA 4OG2A 1RYMA 4N0PA 1YHYA 3K5HA 5GP1A 1KYXA 3SVZA 3ZWCA 4BWGA 4IFBA 4L0MA 1XQ9A 1ZGBA 2R1UA 4D9IA 1KDVA 4EJMA 1VDMA 4CEHA 4OL9A 1OBFO 3HLTA 3IKVA 4G3XA 2IQ5A 4R2HA 4EZEA 1WPGA 2PKWA 2WK1A 3ANTA 1C7JA 3BWXA 3ED5A 1G21E 4L9AA 3DVLA 4QQ8A 1FX0A 2QLMA 2ZU6A 1I7NA 4YRAA 2W4MA 1SURA 4LSZA 2VDOB 3IUNA 2CXXA 4L02A 2I6UA 5DK6A 2RAFA 1CZUA 4S3MA 2IZ6A 2WAOA 3KYCB 3B1WA 3QHAA 5FQNA 2FSHA 5LZ8A 4FX5A 1VBNA 4AG3A 2UXCB 2B5OA 2V96A 3EXG2 1NVUQ 1R5OA 1VE7A 4RE6A 3WK5A 1U9CA 1YV9A 4N8EA 4BQOA 5E9AA 1T2EA 2VH5R 2WIJA 4AJ9A 3DW1X 4ARZA 3AESA 3MRXA 2ZULA 4B8ZA 3ET4A 4CKYA 2N46A 4CR6A 2GI4A 5K20A 4CG3A 2OE2A 2BE7A 2IEDA 2PZAA 2WUGA 4XWYA 5F78A 4Q4CA 4MYRA 3TM5A 1G8JA 3KJIA 1W19A 3ABSB 2QE6A 2YHUA 4MYHA 1YVDA 4OMDA 3O3MB 1XPRA 1GIAA 2IGTA 3NBQA 4JIMA 1VFNA 3BAZA 3T9EA 2EQBA 5BXYA 5TLSA 1ZRMA 2CJXA 1Z73A 2UVPA 2W4QA 4LRQA 4QSHA 5FBRB 1E4EB 4AJLA 3CZ5A 4U7TB 4C5CA 1ZOLA 2YIJA 4RKWA 3DTNA 2BHRA 3DEIA 3JXEA 4XKJA 4BX2A 4A23A 4V3CA 3NIFB 2H9AA 1CVLA 4HS4A 1JDPA 1XTIA 5IU6A 1GSIA 1PR5A 5K8LA 1S2NA 5TX7A 2RONA 1JZSA 2Z08A 4BNUA 3TE6A 3RKUA 2Q3LA 4RDCA 2B2NA 3WBJA 4BQFA 1XZHA 2WSIA 1X94A 1OIXA 2X5XA 2ERXA 1OV6A 3OEEA 5H4GA 3R6LA 1AV6A 4RMNA 3JWIA 5EP4A 2J6CA 2UYQA 3QUTA 4EJFA 2DFPA 3CLUC 3KFLA 3UAYA 3JPYA 3LK7A 1BXGB 1SVIA 2A2ZA 4ZQCB 1F51E 3V8RA 4E6EA 1U2SA 1BDIA 3IQIX 3OT5A 5CDFE 3JWJA 3L7MA 3EEFA 4M1ZA 2F8TA 1COWD 4NNPA 2MINB 4M1YA 3I28A 1TYDE 4BEBA 4P4TA 3O38A 4PVCA 1EVLA 1T2AA 2ENWA 3Q3IA 4R8VA 4YALA 4QLBA 5C8YB 5DN6D 5HNKA 4ZA2A 4JLJA 1QH8A 1CDDA 1K88A 1O7JA 1SA0B 3C8HA 4P22A 1J25A 4LJ5A 3D8BA 4WLOA 4LJ9A 5EQJB 2AN9A 2AUTA 3DZBA 1SCUA 5JY6A 1KYQA 2YXBA 1ZMTA 2FZ5A 4FI3C 2PAFA 1M10A 1Q2XA 1PZNA 4Q1VA 3W1WA 1U2QA 4AJOA 2ZXUA 3AU9A 3A4TA 2YXNA 4GWKA 3CS3A 5LLTA 3T3IA 3IB6A 2WTXA 1II8A 1PEKE 1DQSA 4R1MA 3GCZA 4KZKA 4NG5A 3ZEIA 4AQDA 3VHRA 1DIGA 3W7BA 1MOPA 1QU3A 4ZGWA 1MABA 2C5BA 5AW1A 1V6CA 4XJVA 1FP4A 2DBVO 2M6LA 5K05A 3L6UA 3P32A 3ZZUA 5JJ5A 4WZAB 2CXPA 4N5MA 3DB1A 2X77A 1LF5A 3O75A 3WGZA 2PIDA 2F9FA 2B34A 2GKGA 3C74A 5PGMA 3O4FA 5KHLB 4CGZA 1IN1A 3T8YA 4QVIA 4L78A 3LC7O 2J5KA 2JIPA 3BSYA 4K5QA 1U0EA 3WHLA 3MS4A 4HWOA 5BNZA 1COWA 4PS0A 1EFCA 1YC5A 5DM2A 1HRKA 1SUFA 4BCBA 1T25A 3EIUA 4Q39A 4BE4A 2ZQ5A 2FF7A 2WM2A 1QIIA 2ZJ4A 4O4LF 1PKXA 1WDWB 4Y2VA 4A2WA 4DLWA 4UU8A 5C53B 1VG1A 1H2WA 4MVJD 3C15C 3RVOA 1O54A 2A5JA 4B6OA 4DMFA 5DBHX 1JJ7A 2RJNA 5EZ5A 1SHUX 2BBWA 2WF7A 4HS9A 1R4MB 4Q93A 4GNKA 3OOYA 4ARAA 5J2TA 3HJGA 2FFAA 2FN3A 3HWRA 4MUBA 2FSVC 2FP4B 3E58A 2BDTA 4LYEA 4F11A 4B1FA 4EQ6A 1TM7E 1NIPA 1XP5A 2XF2A 1XKLA 3E23A 2YJNA 5J63A 1DO0A 3KO8A 4AKGA 2X3YA 3NHZA 4DLPA 1PT5A 1UXOA 2A0WA 2EDCA 1AQLA 1KMIY 4GNRA 5MFZA 1IZ9A 1NMZA 1V71A 3C5EA 4OATA 3PUVA 3HY3A 3IIJA 4P08A 4ABYA 5CDSA 1ZLYA 1XAIA 3DXXA 1YFZA 3GZNB 4K81B 4EG0A 3FDZA 1E4VA 2OORC 3G02A 4OJQA 1UM9B 3MWDA 2DH6A 4G4JA 2AN3A 4X54A 5DHTA 3HP4A 1FRNA 4YP1A 2QTNA 5FBWB 1W4LA 2JCBA 3H1PA 3SPXA 3M9XA 5ADWA 4N5NA 4UHHA 1JYFA 1EUZA 3RFXA 1K5HA 1MLDA 2AOUB 4UM5A 3VDMA 4B45A 3GUCA 4JP5A 5DYYA 5L7YA 4FB5A 1SQGA 2JFWA 5JXIA 3IIMA 1K6JA 3UJDA 2J3LA 4KQKA 2AJTA 4DCVA 3DBOB 1T1SA 3GLQA 4F9TA 3NDJA 1VSBA 1JWBB 3H1BA 1BMDA 1I8TA 2Y0BA 3HO6A 4LCJA 1TEXA 4ETIA 2Z8YA 4BZWA 3SLGA 2SCUA 2I8AA 1GLVA 3K05A 1DOHA 3IXMA 4UHBA 4KGXA 4CMIB 3HXMA 2O8FB 4LDRA 1PO7A 3W8RA 2GJAA 3BL5A 1YE8A 3TD2A 5AFSA 3EHEA 2A0YA 4ZYXA 1FFXB 1IH8A 2RDMA 5A02A 3CG0A 3WLQA 2G04A 2M32A 3L7CA 1TO6A 4KN6A 3WGLA 3I6BA 4DT1A 3V8QA 3RS7A 4DJDC 3ABOB 1SUEA 3JAMA 3TEFA 3OEWA 4V0NA 1AM4D 3WFIA 3BILA 3UMFA 2IHTA 5IHPA 5FWDA 1ESDA 4N03A 5AVYA 1NGSA 5LP6A 1WZCA 5HM6A 1L9XA 4OH1A 3QMMA 3KDAA 4AY5A 1ENYA 3CNQS 5J5CA 5DI3A 4AZ0A 2PZLA 5FOVA 3RVLA 3WNQA 5BR4A 4OI2A 1ZJWA 1UCFA 1Q14A 1HLPA 1VHJA 3R20A 3L8CA 5DB4A 2BONA 3ADDA 1G8HA 1MKYA 3EB9A 3Q7SA 5BSRA 4PC7A 3DP7A 1N0VC 5JRZA 5CNJA 3U7FB 3K9CA 3SR4A 2NPIA 3TF5A 1T9BA 1K0UA 1NP7A 2V8OA 3MLAA 5FA8A 2XOEA 1F2VA 1JPVA 1EEXB 2UUCB 1Q44A 5CA0B 3BD7A 1D6MA 3QELA 1I13A 2QI9F 4G8JA 4IDDA 5KSOA 3T7RA 3OOHA 1O97D 1Z0UA 2B4KA 1MDBA 1NIJA 2P91A 4HVAA 4IEFB 1XGKA 5LU9A 3TLXA 5SY6A 2R8ZA 1TTQB 3CR7A 5ESWA 1B6RA 1CJCA 2AN5A 2DM6A 3RS5A 4KIJA 1SC6A 3MINA 3W5JA 1M6EX 2VTBA 1EGQA 5H9WA 1TO2E 2YWEA 1RXUA 2QYTA 2REQA 1F8FA 4YCNA 1Q1ZA 3ZCVA 2KBFA 3BULA 3M5DA 3OZUA 2O8VA 1I32A 2XDAA 1SPBS 3TOVA 4EHAA 4KXQA 4M0CA 1RXYA 2BW0A 4PBTA 5IARA 2IXDA 2V7BA 3U9TA 1XZCA 4RZIA 3PWKA 2GZ3A 1G5TA 5C0OE 1AXRA 5B12A 2BEUB 3O4RA 1GPMA 1VL8A 4GOKA 4KLNA 2VP0A 2LCQA 2P4HX 4B3CA 5EG5A 2O54A 1Y1QA 3WGHA 2ZVQX 5B6IA 3N7AA 1RYBA 2F90A 3MMNA 4HFRA 4MTLA 4DQXA 1QQAA 1AJEA 1S0UA 2O8NA 3KDPA 4JUCA 2C4HA 1YE5A 5IZCA 2M2IA 4EYQA 3AIMA 1ZGHA 2QD2A 4W1PA 2WKRA 4ZV4A 4CIDA 4BV9A 2QLLA 3VR5A 1F2TA 1G0OA 1ZUD1 3H2YA 2VZ9A 1M2KA 4JJIA 4II3A 4WZZA 3FKSD 1TM3E 2B1GA 3G0CA 2NO9A 4EHNA 3TEJA 5HX7A 5KKNB 4TKUA 3GEPA 1U81A 4MH0R 4RENA 1R8XA 3BFXA 1XXLA 5A7GA 4Q9HA 2VUHB 5TMBA 2V4MA 4DRZA 1T5LA 1Y5NA 3DZFA 4C3ZA 1G7CA 1JQ5A 1UT5A 2QG9A 1KDTA 5AJWA 4G9EA 5CM9C 3N8GA 5DBEX 5GADl 4J07A 3ZE6A 4DV2B 2A86A 2ZR0A 3L0YA 3A1TA 3QJYA 1XKTA 5HW0A 4YN3A 4TKVA 3IXLA 2H1LA 4NBWA 1EHYA 2IHZA 3ADPA 4DV3B 1LW7A 4B79A 4MICA 5EWJA 1PNQA 3E15A 3PSHA 4UPEA 5BYKA 1PV4A 2QN7A 1ZHOA 3HJHA 5K3FB 4CMHA 1MJGA 3BN3A 2BSQA 4OFXA 3UKOA 4ILKA 2PD6A 3CONA 4N0QA 3WLMA 1G42A 3HA7A 1K06A 3SYKA 4BBAA 1NLMA 2PXXA 3VNRA 4E32A 3ZWKA 2R86A 4ZN6A 1VCIA 4RKFA 2BT4A 2P75A 5GONA 3OLZA 4D0LB 4PVDA 1X7YA 3M3PA 2ZBUA 4IOJA 4O4LB 1JLSA 4HSEA 2C9OA 2O4UX 4FCWA 3SKVA 2J6BA 2QSYA 1YS9A 3EQ6A 3FM9A 3HA3A 2X9QA 3OFJA 3QXXA 5CDTA 4C4TA 3FNQA 3N74A 5KYNA 4D9HA 4AP5A 3KQKA 3M4XA 2NWQA 2WJGA 3IAHA 4LJKA 5DTIA 1OW3B 3X0DA 1T8SA 4DTIA 2NZJA 1Y48E 1LJUA 2C8LA 2HDNB 1F1JA 1U3FA 3EMDA 3HSYA 5IBQA 3SQMA 2IITA 3COWA 1UPBA 2YJ4A 2BL4A 2CLCX 1LRJA 4PLCA 4QXQA 1HYEA 5JD5A 4NCIA 1JSLA 2CYAA 5EXDA 2GO7A 2EZ4A 3B6EA 1NOKA 3K8YA 4O2BF 4X41A 1U0NA 3QIAA 4TV8A 2PFSA 3KX2A 3NAZA 1VE9A 5AJUA 3QH4A 1L4UA 4HTAA 1W47A 3VZCA 3GFVA 3VNVA 4ACAA 5AT1A 5HBGA 4YMUA 3ZDZB 1XRLA 1EH5A 3ZTWA 3THSA 2DH5A 1YK0A 1JXOA 5CB4A 1TZKA 4WOJA 1KI3A 4KQGA 2GQ0A 2HRDA 3QWIA 5ALFA 4C3OB 4O3MA 4G0QA 4ZT7A 2EU8A 1PV1A 3MT7A 4FXPA 3L79A 1E7YA 1WBBA 4YXWD 4EG6A 2JLYA 4JGIA 3RM3A 2IUFA 2GJ4A 2P9GA 3AR5A 4KRYA 5TF4A 3GN1A 3DLPX 3TVTA 2ZPTX 3KLMX 1WMBA 3F8TA 4DRXB 3CUVA 1JKJB 2JPDA 3OZIA 1LDGA 2CXNA 4TV8F 3CVXA 3BD9A 4H6VA 5A3RA 4AKIA 1NBHA 1GZUA 2FPIA 2O7RA 4FFVA 4EZIA 4RV4A 4EGAA 2HA4A 1WS6A 3FB1A 5AHRA 3TMKA 2YKGA 3ZEAA 3H3XA 4MGYR 2AOUA 3FUWA 5DCUA 7ABPA 3GRCA 2Z57A 3IQXA 1W73A 4UJ5A 4LY9A 3LF2A 4M9UA 4C78A 1TJ4A 3BMQB 3EUAA 1JQEA 1KJJA 1J8VA 3SZOA 1LWNA 5ITSA 2AW3A 1GGKA 3TKAA 2CNWD 3LNTA 4L72A 4YRFA 5HA5A 1U9IC 4AZ0B 1OXSC 5CXSA 3ZCSA 3E3LA 4R0VA 1M0TA 1EBBA 3QVLA 2R68A 3H5WA 1GYRA 4H2DA 4NYIQ 4QX6A 5BSWA 5DM60 1KK0A 5LP6B 4E08A 1XVIA 1JFTA 2CV1A 3PD0A 4GM0A 1A5AB 4KXLA 1YDGA 4BZXA 2BR3A 2E48A 2XF8A 4AW9A 4ENQA 3D3QA 3SCZA 4LYJA 1M2VA 4ZALA 1QC5A 1A27A 4TLLB 1LTQA 4B2YA 1YRBA 4IQ8A 3BE6A 3MFQA 2AYZA 4HLQB 4KIFA 1VI2A 2IXFA 1B14A 3R5KA 5EAIA 3RIXA 1ZI9A 3KUCA 5GIPE 1E58A 2G7MC 2FEPA 3G8YA 5BVHA 1OAAA 3PE3A 3G79A 3PQ4A 4JA0A 1CVIA 4TL9A 1MA3A 4GS5A 3X3HA 4J1NA 3EXIA 1NKVA 1E1CB 1NW7A 3FHLA 4M1OA 2V3VA 5CFZA 2SCUB 2AT1A 3EQ7A 3V2HA 1TAGA 3EXHC 5CGZA 4YRQA 3WKEA 4BP1A 3B12A 4CKBB 5J47A 3PKJA 3LW8A 4DC9A 3QG1A 4YIKA 4JAVC 1PT8A 2QVLA 1ZN8A 2FUEA 3KKPA 5FDFA 3E8XA 3U6KA 1ODFA 3QVGB 4HUQA 2PMDA 5SZKB 4D6PA 2FAXA 1FUIA 2FRDA 1YKFA 1EUCA 3W3AA 1FVFA 1S3GA 1AVTA 2JI8A 1XZIA 2X9LA 4L3WA 5CM2Z 4DMMA 2IH5A 2F1IA 2HWWA 3GZJA 1FMFA 1M6VA 4O29A 4M7RA 1JYEA 4N76A 5KTYA 1Q0SA 2D8MA 4QJBA 4RVNA 5CR9A 4RK7A 3EEOA 5L8VA 1FFDA 4M1KA 5JNVA 4IIUA 4JCOA 4Z4EA 2AJCA 2OLJA 4QHSA 5FL3A 2G4LA 2EFGA 1Y7LA 1R6VA 5CAEA 3TWOA 2JIRA 5LQDA 3ZUGA 4DUYB 3FGOA 3MWJA 1MB3A 1EX9A 3GCDA 3KAQA 5LB2A 1ZX1A 5L3SA 4QATA 1RRCA 1R0CA 1EP9A 3OO1A 3D8NA 5I9NA 2J5XA 4F7WA 4OV6B 5LWHA 4ALJA 4R31A 3WXMA 5AVZA 3H9UA 2XUOA 4JHXA 5K8IA 5JC8A 5FNVF 4P5DA 4XARA 1EFUA 1YGYA 2GN0A 1D0VA 3KB8A 2QB5A 3GRPA 3N0TA 2MYNA 3CT6A 2Y1EA 4OY3A 5AVOA 4AZWA 4NCBA 1KEVA 2WTBA 1SEPA 2VHYA 2ZDQA 3SC4A 5E6SB 2BEVA 1QDLB 2H6EA 1L5GB 3TRDA 3EF1A 2XUGA 2VZEA 1NJ5A 4WFQA 3FLBA 4WBNB 5CDUA 4LFBB 2UZ0A 4F3YA 2P40A 1RC0A 3R24A 3KHKA 5ALIA 1DWQA 1KDRA 4KR2A 3KR1A 2JI9A 2QRHA 3S55A 3CPSA 1P1HA 2COUA 1ORWA 4B3JA 1VXOA 1O2DA 1N36B 2OBYA 1AURA 1WHSB 2GAJA 2F1KA 3K4QA 4HJRA 1YZLA 5K3BA 2DX7A 4C0HA 3R3WA 1B8VA 4J0FA 3F67A 1XZNA 3F71A 4NOKA 4REMA 3GEGA 1AKYA 3LX5A 3OEHA 2CDBA 4MKFA 1QTNA 5G0UA 5IJWA 4CM9A 1AKMA 3GT4A 5EHGA 1UEXC 2TMKA 2J07A 3B6JA 4G9GA 4OLFA 4B2IA 2XJ9A 4I6JA 2PZMA 5C7IO 3TRJA 4QLOA 2AE1A 1AD2A 1IJBA 2O2CA 3G1TA 2E49A 5KNCA 1Q7RA 2C4MA 4S35A 4YCAA 4MINA 3IMFA 1I2ZA 5J4HA 3IP5A 4D4HA 2ONCA 2I1WA 4J0JA 3ICEA 1A7JA 3B1XA 4L73A 5FTKA 3EGCA 1FJHA 5G0SA 2E4AA 5HILA 3R7BA 9LDBA 5J43A 5IC5A 4F86A 3JQGA 4XEHA 5AQEA 3RVRA 1QFMA 4C0AC 3ZXSA 4CF3A 1DQYA 3E9MA 5HUHA 5JG7A 5KUTA 1NI4A 4XQ0A 3RI3A 2GAIA 4DR6B 2Y05A 2QRVB 4QJ4A 1SOAA 2REXB 2VQ6A 2H54A 1E8NA 2HCRA 1NBIA 3WISA 2NLOA 3QI7A 3ZWQA 1QG0A 1PG0A 4AAYA 4KPEC 3MCAA 3QVVA 1Z8DA 1E94E 2ZRAA 3H5VA 3LU1A 3QBTA 1QVRA 5BY2A 4KQFA 3TIFA 4FFBB 1R0XA 4P4NA 1VJDA 1DJLA 3D9QX 1G9TA 4HFJA 1MH9A 5JARA 2JFFA 1XK6A 1KEUA 2R7AA 1C9YA 3FNHA 4MW2A 3FPCA 1DS6A 1F0KA 3ZV5A 3DD1A 3HEMA 1Y4SA 2KYRA 2PKRA 4V02A 2UVPB 5IX8A 3CSUA 1A98A 1OWPA 2HEIA 4XGNA 1OWLA 4DNFA 4PZDA 2WJ6A 3JVDA 3KHTA 2UUBB 2IEAA 1EM8A 2BGKA 1G8YA 1MORA 3T5MA 2Z5LA 3LSYA 1C9DB 1NQ5A 1ZK2A 3OD5A 4Y0AA 2LE0A 2VJMB 1KERA 3U5TA 1IHPA 2Z8YM 3QZUA 2V65A 3NBYC 2DKNA 3PWZA 1VL1A 1X0XA 1L7VC 1U0SY 4M3NA 3UV7A 4YRPA 4DLAA 1G3QA 2ZI3A 3GCGA 1NA5A 4IEIA 4U9IS 2C2BA 1A5BB 1Z7BA 2CXQA 2Z2IA 1SVNA 5HFAA 1N6NA 1U6JA 2INGX 1UPCA 3G5MA 3MMSA 3AG6A 1M1XB 2X2PA 2FEWB 2QDXA 1GGHA 2HMTA 3JU3A 2IFTA 2H11A 3UEOA 1XD9A 3UIEA 1U5AA 3VYWA 2VTEA 4DFDA 1Z75A 3CUWA 5I9SA 2VNHA 1Y8ZA 3G0GA 2GBPA 4G5OA 2FF5A 5DCYA 2C9MA 3PITA 3MJVA 2XTZA 2PKQP 1CEQA 1P60A 3QKUA 4FW9A 4RS3A 4MP3A 1X7WB 3SYRA 3SBOA 4HXYA 2ONJA 2Y76A 3SYLA 5CCDA 4MUYA 1B8UA 1YD7A 4R6XA 4US1R 2AXPA 3HSKA 5EZYF 5FA6A 2YINC 4J4BA 3LQQA 5EZQA 2J45A 3W7VA 3LHDA 3RIGA 3V2GA 4FYVA 1MDFA 1RMQA 4XGQA 1CU1A 2VCEA 1IRIA 1BDMA 4MW0A 5HKLA 4DUZB 1LZKA 1B41A 5KDDA 4PCLA 1ZINA 3MYYA 4HFNA 1RJGA 4TMFA 1CHNA 1TW3A 2AG1A 3LZDA 4RTSA 3CIFA 2JRLA 4LXUA 5I4IA 2Y4OA 1VSTA 1ZNZ