1JR4A

Catechol o-methyltransferase bisubstrate-inhibitor complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
212
structure length
212
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray Crystal Structure of a Bisubstrate Inhibitor Bound to the Enzyme Catechol-O-methyltransferase: A Dramatic Effect of Inhibitor Preorganization on Binding Affinity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords CATECHOL O-METHYLTRANSFERASE, SOLUBLE FORM
total genus 87
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2001-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jr4A00
1JG3A 4MIKA 1BHJA 3FPGA 3KQQA 4OBXA 4YUWA 3KR0A 2HR1A 4OQDA 3E8SA 2G70A 1BOOA 5K0GA 1L1EA 3UJCA 4IV8A 1AV6A 4EKGA 2C7OA 3BZBA 3C3YA 5ICFA 2WA1A 4K6MA 3I64A 3I9FA 4RTMA 3A7DA 5DTMA 5GM2A 2EJTA 3GIWA 4EKIA 4YV2A 3P2KA 2H11A 2G71A 4AUKA 5EMKA 4PNEA 1EJ0A 1JG2A 2AVDA 2IIPA 2PKWA 2UYOA 2FK8A 2JH9A 3EVFA 4HC4A 1YZ3A 3SSOA 3TM4A 3KPJA 2C7QA 3I53A 2UYHA 4M7RA 3T7RA 3AXSA 4L7VA 2BR3A 3BWCA 3G2PA 2NXCA 1M6YA 2PSSA 1R6AA 3VYWA 3UJ6A 3M4XA 3T7SA 4RTJA 4YUYA 1T43A 4C4AA 3M70A 4P7GA 5K01A 1MJFA 2PXCA 3EVDA 2B78A 3CJRA 2FRXA 4P7KA 2ZULA 1R00A 3PFHA 3HVJA 3LKZA 3M6XA 3TRKA 3P9KA 4XUCA 2ZZNA 2HV9A 2B2CA 3HTXA 2ZBRA 4KIFA 2ZIGA 3GO4A 3KQPA 4E31A 2IPXA 3Q7EA 7MHTA 3PTAA 1VQ1A 3OZRA 3T7TA 5CM2Z 1JTEA 2OZVA 3ERCA 1VP3A 4FR0A 4PWYA 3HA5A 4FP9A 5CD1A 4C03A 2YUIA 3LPMA 2OB2A 1INLA 1XJ5A 3EGIA 1KR5A 3KPUA 4ER0A 3LL7A 1IM8A 2B25A 3DXYA 1L3IA 4FSDA 4RYLA 3TFWA 1P1BA 3B89A 2ZTHA 1EJ6A 4AX8A 4CTJA 3A27A 5E2AA 4F84A 4RTQA 3NVKI 1P1CA 5HILA 5M5BA 1XDZA 3ELUA 1ZG3A 4OQEA 2HMYB 4X41A 4C04A 3F4KA 3PB3A 3KQWA 3R24A 3EVGA 4PIPA 4XUDA 2ZBPA 5HOQA 3ELWA 3KQSA 5EZSA 3G89A 3DOUA 3FPFA 4XCXA 4EVIA 4BY9E 5EGSA 5GWXA 3TOSA 4RTNA 1JQEA 4V0RA 4CXMA 5EZQA 2QRVA 3FTCA 1X1CA 1KHHA 2YR0A 3RW9A 3LHDA 1X1DA 2PBFA 3EVEA 4FT2A 4R8RA 3H2BA 4PYJA 3KPYA 3OZSA 1YB2A 4KWCA 2FPOA 5LQAA 3BGDA 5K0NA 4R6WA 5H02A 4DCGA 3HCEA 1KPIA 2VDVE 3DLIA 4G56A 2CKDA 3KQMA 4FSXA 3HP7A 3THRA 5K03A 1AF7A 4P7JA 1FPQA 3MGGA 3IEIA 5E8JA 1KYWA 4X63A 4HGZA 4HH4A 5K0EA 3G8AA 3G7UA 2PT6A 3C0KA 1ZQ9A 5LQNA 5EKUA 4QPPA 2ZSUA 3BKWA 2OBFA 2PJDA 4HTFB 3WSTA 3KR9A 3JWHA 5DLYA 1YUBA 3PX3A 3K6RA 4DCMA 3C6MA 3G88A 5KVAA 2VDUE 4KVZA 4FT4A 5EOVA 4CWAA 4GQBA 1OR8A 2NXNA 2VDWA 4OA8A 3AWIA 4Z2YA 4CKEA 5CVDA 3BGIA 3L8DA 5B1SA 2NXJA 2IBSA 2IDJA 4GOLD 4QQNA 3UJ9A 1VE3A 3LKDA 2Y1XA 3TR6A 1P91A 4BLWA 4GBED 1FBNA 3A4TA 3LBFA 3R3HA 1VL5A 3HCAA 1UIRA 2PV0A 4M36A 4DQ0A 4XUEA 5LQUA 4P7FA 5FUBA 1MHTA 3FTFA 3M6VA 5U4XA 2OPBA 4E2XA 5FULA 3P97A 2G72A 4EQZA 1O54A 2R6ZA 3MERA 1NV8A 3A7EA 3BWBA 4ER5A 3VSEA 4GF5A 3EVZA 1XCLA 1N7JA 2PVCA 2XYRA 3U81A 2GLUA 3R9XB 2ZWAA 3MB5A 1XDUA 4LWPA 1R74A 4PGGA 1YFJA 2V74B 1V39A 2OXTA 3HA3A 2PX5A 2HNKA 2B3TA 3HVKA 2EJUA 2ORED 2JHCA 2C7RA 2P7IA 3P71T 5D1NA 4ER6A 2JH8A 2NYUA 3JWGA 4O29A 1TW2A 5FTWA 2I62A 3PFGA 3A25A 3MCTA 4AZWA 2YTZA 1SG9A 4POOA 1F3LA 3B5IA 2JHPA 4PIMA 3JWIA 5MHTA 4GUAA 3LDFA 2FK7A 3MAGA 5EEGA 2IGTA 4YUXA 1I4WA 3B3JA 2PY6A 1VPTA 4OBWA 2NNWB 5DRTA 1JG4A 3CC8A 1X1BA 1ORIA 5KS2A 2NXEA 3FPEA 3RIEA 1JG1A 4DA4A 2P8JA 2VS1A 3FYCA 5E2BA 3MTIA 3OZTA 4PYOA 2ZVJA 3V97A 2P3LA 4BP3A 4RVGA 5EVJA 3FUVA 3KKZA 3OFKA 5E1OA 3GU3A 1Z3CA 3NWEA 4Y2HA 4C06A 1FP1D 2GPYA 3EMBA 3M6WA 5DPMA 5ERGB 2ADMA 3NJRA 3O7WA 1D2CA 2ZBQA 5ICGA 1L9KA 2BM9A 2ZIEA 2BM8A 3GGDA 3P2IA 4PCAA 3UZUA 3UBTA 5JR3A 2AN5A 2UYQA 3LCVB 3OU7A 1U2ZA 4HSGA 4U7TB 1KIAA 5E8RA 5P8WA 5C1IA 5EHGA 3VC1A 1PJZA 4ER3A 2XBMA 4YV0A 4RTSA 4IV0A 4V0QA 5HIIA 2EX4A 3SSNA 3M6UA 3ANXA 1RI5A 2AOTA 5FWAA 2CL5A 3FPHA 5DSXA 2HWKA 4MQ4A 3ER9A 5EKXA 3G8BA 3CJTA 5LQCA 1AQIA 3B3GA 3D2LA 5DTRA 3DMFA 4PYIA 3REOA 3KQOA 1EAMA 3B3FA 3SXJA 2ZLBA 4YUVA 3G2MA 2BH2A 3MTEA 1O9HA 2ERCA 1JQ3A 5EC8A 1DL5A 5KQRA 3UJ7A 2WK1A 4C05A 4RTOA 2O57A 3PS9A 4F85A 3G5LA 2ZZMA 4LWOA 1QZZA 3CVOA 3C3PA 3QOXA 4DKJA 5E1DA 2OB1A 1QAQA 5DWQA 1WXWA 3UFBA 4PYLA 3OU6A 3UJAA 3V8VA 2AN4A 2I9KA 4R05A 5CVEA 3THSA 4QVGA 5CCXA 5EMJA 2OKCA 3E05A 3P9NA 2VP3A 3FYDA 2HTEA 1RI2A 3FRIA 3VC2A 4E2WA 3KU1A 3R6TA 2QY6A 1KP9A 5HEKA 2PXAA 1RJGA 1P39A 5FHQA 5BXYA 2PX4A 3P8ZA 4EK9A 4PCLA 2UZ4A 3LBYA 2Z6AA 5DTQA 1ORHA 5FWDA 3LX6A 4QDJA 1XCJA 3DXZA 9MHTA 4HRAA 3QOWA 2C7PA 2O05A 1SQFA 1IY9A 4U7PB 1I9GA 5EIFA 3MHTA 3PLAE 4GOND 2JHAA 1RI1A 3NTVA 1G38A 3LDUA 2IP2A 2IH5A 4AZSA 3BGVA 1WXXA 3DXXA 4RV9A 2YXDA 3AXTA 2ZCJA 2BZGA 2CMGA 4P58A 2NP7A 3OFJA 1G8SA 1XDSA 3EEYA 4QTUB 5DX1A 3LECA 3NDIA 3K0BA 3UA4A 5HFJA 3HA7A 2Y1WA 2PGXA 2FHPA 2CMHA 3GRYA 1Y8CA 3FRHA 3MCZA 4QTTB 2ESRA 4F86A 2OYRA 3SR4A 4A6EA 2I6GA 4RWZA 5HIMA 1NV9A 3NVMB 5FQNA 3OE5A 3BXOA 1ZGAA 2V7EA 4ER7A 2H00A 5DM1A 3UA3A 3GRZA 2NP6A 5CIYA 1XTPA 2AOTB 2EFJA 3KHKA 3GRVA 5HIJA 5LQKA 1JR4A 4RX1A 4E70A 5JUWA 5DX0A 5BW4A 4ZTBA 1WZNA 5EQJB 4H0NA 4X60A 4GC5A 3GDHA 1ZKDA 5DX8A 1FP2A 4FS8A 1X19A 3G2QA 5DXJA 5DM4A 5IH3A 2UYCA 2KW5A 2LD4A 2YXEA 4DZRA 3EVAA 2OO3A 2WA2A 5DSTA 3IYLW 3FUTA 1RJDA 3SMQA 3X0DA 5EMLA 4DMGA 4FGZA 5CVJA 5F2NA 1NW7A 2AOUA 3BUSA 1KXZA 5E9JA 1NW6A 2BR5A 3EVBA 3GCZA 2FCAA 4RTKA 1XVAA 2IFTA 2OY0A 3BWYA 2PLWA 1G55A 5E1MA 1D2HA 1NW8A 3CKKA 3UWPA 4M37A 4RTRA 1Q0TA 2Q41A 4R8SA 3OCJA 3C6KA 1SKMA 4ISCA 3EPPA 3OE4A 4RVDA 5EIWA 3UJBA 4A6DA 3NW9A 2ZIFA 4YV1A 1YF3A 1WG8A 5K8VA 5GM1A 5D1HA 1EIZA 1NT2A 5DXAA 3ORHA 1NBIA 2H1RA 4KW7A 2YVLA 1QAOA 5E1BA 4KDCA 5GOZA 3DLCA 5K0JA 3FUWA 5LQJA 2O0LA 1RI3A 4E30A 4ATNA 3DR5A 2N47A 4CTKA 1VLMA 2QYOA 1BKYA 5DM0A 5K0BA 3LDGA 4LG1A 3AY0A 1RJFA 3CJQA 3IHTA 2Z6QA 1O9GA 3NMUF 4RSRA 1NKVA 1UWVA 4YMHA 1L3BA 4MWZA 3KQTA 2XVMA 3HCBA 2ZFUA 4HG2A 3SX0A 2XYQA 5KQSA 5EMMA 5BP7A 3KQYA 2AVNA 5DT2A 5GINE 1ZHFA 4X1OA 5ICEA 3BKXA 4RVFA 3TPZA 1SUIA 1X1AA 2CWWA 1VP9A 2ONZA 3DH0A 2XVAA 3EGVA 3O31A 4FZVA 3S68A 3SSMA 4PINA 3OPNA 4BLUA 1BC5A 3Q87B 4RTLA 1RI4A 1B42A 5CVVA 1G6Q1 4M38A 1NW5A 4QVKA 3R0QA 1G8AA 5CVUA 1JSZA 4GOMD 3A26A 3KQVA 4KRGA 5K05A 3OU2A 5EEHA 5BW5A 5GIOE 2P35A 1L3CA 5DRYA 1HMYA 5T6BA 3DMGA 4BP1A 4CKCA 2DULA 4MHTA 1YZHA 1NW3A 5K0LA 2AS0A 5T64A 1FJXA 3CBGA 4X61A 4OA5A 5EPEA 1SVUA 5EHIA 1KYZA 1Q0SA 5E9QA 3CCFA 1XXLA 3GXOA 2AOXA 1KPGA 3JWJA 3NDJA 5FA5A 3HM2A 2P7HA 2ZZKA 3I58A 2AOUB 2DPMA 3ME5A 4GOOD 5FCDA 3EEOA 1YFLA 3LCUA 1EQAA 5FADA 2P3QA 3HVIA 1KPHA 4PYMA 5C0OE 3HCFA 3TQSA 4E2ZA 1DUSA 4E2YA 3TKAA 3PVCA 2YQZA 1UFKA 4PONA 3P9IA 2E5WA 2K4MA 4DF3A 3G5TA 4JXJA 4C08A 1DCTA 4AZTA 3GWZA 3ELDA 2P1DA 2GS9A 3EMDA 5GP1A 5F2OA 1AQJA 4NECA 3AJDA 3HCDA 3LSTA 3KR2A 3P9CA 2AOVA 1JQDA 2GAFA 2QRVB 1M6EX 4HGYA 3KR1A 4PYNA 5K09A 5CUQA 10MHA 3LCCA 3DP7A 2AN3A 2BR4A 2GH1A 1HNNA 2G1PA 5G02A 3B7PA 3KPVA 3FTDA 4GEKA 3EGEA 3ELYA 3GNLA 4E33A 1QAMA 4PYKA 3MQ2A 4CKBA 3O4FA 1QYRA 1TPYA 3DTNA 3UJDA 5K0CA 1WS6A 4BLVA 1NE2A 3E7PA 3T0IA 2PX8A 1PRYA 3KPWA 3QV2A 4OX9Y 2XYVA 4QDKA 2AR0A 1JTFA 3G2OA 5FHRA 2QE6A 3M33A 5F2KA 3DUWA 3SM3A 2QM3A 2O06A 4GC9A 4PGHA 2R3SA 2EG5A 2AOWA 5HIKA 5GIPE 3ID6C 3GJYA 3TKYA 2GA9A 3SGLA 1IXKA 2G8NA 4EMSA 5KYGA 4RTPA 2P3OA 1F38A 3FUUA 5EG5A 4C07A 2FYTA 3HCCA 3SVZA 1D2GA 2A14A 3GRUA 2JG3A 1N7IA 4PYQA 3IV6A 3HEMA 1VIDA 3TLJA 3TM5A 3FPJA 2PXXA 5LSAA 4MTLA 3FUXA 1TW3A 4YMGA 4LECA 2JJQA 4AZVA 1JSXA 1M0EA 3UJ8A 3DMHA 2ZW9A 2ZWVA 2PT9A 5LQRA 2PWPA 3NWBA 5CCBA 1EG2A 4KDRA 2IBTA 2B9EA 1RJEA 4QQKA 2VZ9A 2AZTA 3GRRA 5FQOA 3P2EA 5E9WA 4HTFA 3PX2A 4DM3A 2IH2A 2Z6UA 8MHTA 1QANA 1I1NA 5K0FA 3DULA 2IDKA 1R8YA 1N2XA 4R6XA 3E23A 5LR6A 5T67A 3RODA 4IKPA 2F8LA 1R18A 2PWYA 1R8XA 4WVLA 2I7CA 4Y30A 3EVCA 2P41A 3CGGA 5DM2A 5FA8A 2O07A 4KIGA 2IH4A 4RVHA 4YUZA 4B17A 1ZGJA 1G60A 3BT7A 4UOEA 1WY7A 5HZMA 3FZGA 3TMAA 3HNRA 3BWMA 3LGAA 2YXLA 4WXHA 1SQGA 2ONYA 2P40A 1VBFA 3I5UA 1NBHA 1SUSA 3HVHA 4E32A 5ICCA 3ER8A 3FTEA 2PX2A 3PT9A 4QPNA 2GB4A 5IKMA 2YX1A 1H1DA 4IWNA 5C9ZA
chains in the Genus database with same CATH superfamily
4TVBA 2WI8A 3A6EA 4LF4B 4CIDA 2WAOA 3V3KA 1ZUD1 1U2SA 2Z0MA 5JROA 3MUEA 3L0SA 2IPOA 2JANA 3DLTA 3LLUA 4NH4A 1I4DD 1NXQA 5ESRA 5E3HA 4WJZA 4CDNA 4ENRA 2XWQA 5AKZA 4QM6A 1T1JA 1EB8A 3FCUB 5LA6A 1NVGA 3JZIA 3KFXA 2G71A 3ZH2A 1P2FA 4HX9A 4D8UA 4ZGBA 1P80A 1HQYE 4RKRA 5F1KA 2PKQP 3BX1A 1SKAA 2Y2UA 4J16C 5AM0A 2BR3A 3G2PA 2V5UA 3GWGA 2Y68A 4PG4A 2PL3A 3UJ6A 5DNUA 2WZBA 4RTJA 1NW4A 2PUWA 3RVOA 5G1OA 8AT1A 2ZUCA 1CDZA 3ORYA 1DX9A 2I67A 3GV0A 1P3JA 2A1TR 4G36A 4UJ5A 5FBZA 2ZULA 2OECA 2ZT7A 2XYGA 1SM4A 4RADA 2CGEA 3C3DA 2ZIGA 3WBJA 3RK4A 5CH8A 5KWEA 3B53X 3BCSA 4L07A 3ZOZA 5EIHA 2M6LA 2YZ2A 3NYQA 1I14A 4OCZA 5CM2Z 3WL6A 3NBZC 2VJMA 3C6QA 1W0KA 4Y1GA 2X5JO 2YWJA 1U5BA 4FR0A 2X1LA 4KB5A 1HE1C 5LZ5A 1ZL2A 1WSAA 5BQFA 1U02A 2R1VB 3W3AH 3AWDA 2FW8A 1DFHA 3MCUA 5AUPB 5IHXA 1IM8A 1VRWA 4NPHA 5KPDA 1J06A 2DU8A 1L3IA 1U2GA 2I2DA 1F14A 4Q1VA 1SC3A 1YQEA 1EJ6A 3B5JA 4YCSA 4F84A 4MK4A 3VXKA 5HJ5A 2AL7A 3VNAA 5ILOA 1QPZA 1K0UA 1X7XA 5M5BA 4V0MA 5LP1A 5K2OA 4BGIA 5DCUA 2VDQB 3PHIA 5CVTA 2HMYB 3G2NA 4O59O 3F4KA 4NFHA 4V0ME 3CFYA 4EVIA 4DV2B 4JASB 4BNUA 2PDAA 4A5SA 1PEKE 1D8AA 1STOA 5ADVA 1UDWA 2NZYA 1Y3AA 2WFLB 8GPBA 1RBYA 3PJGA 3KKEA 4IOJA 1KKUA 3DVAB 3RUAA 4D3YA 4KQJA 5I8PA 1BMTA 3OJXA 1JEEA 1RRGA 2CDAA 1GVNB 3WLSA 4YAIA 2OCKA 1E2HA 1NPDA 4GM4A 1WNTA 3V2GA 3H13A 2C54A 4R6WA 3UENA 3USZA 4B33A 2TYSB 3HCEA 1P0MA 1XWFA 3FBGA 2RIPA 4NK4A 3N0RA 5JWRA 4JI7B 4MAMA 2Z8XA 4J8PA 4X1IB 4JLJA 1ZP6A 4EVQA 4P82A 1BWRA 3T95A 4BBPA 4QJ3A 3BF7A 3ORQA 1NL3A 3W3AA 1N6OA 2EFYA 4YXFA 1QKKA 5KOHB 3ITKA 4MW2A 5CDTA 4TLCA 5FOWA 1RC0A 5AW0A 5LB2A 3ZWOA 2MDTA 1KBOA 1JVBA 2MYTA 2VXCA 4TKUB 4A5OA 4E5KA 2V45A 4EYSA 3ANSA 3M9XA 3O73A 2VKTA 2ANBA 3WLIA 2QN8A 4H3HB 4INJA 1H4VB 2CJPA 1C0EA 1B15A 2QNRA 3C24A 3KYDA 4IIEA 3O8CA 4HZIA 4EIWA 1CC1S 5BSRA 4X00A 4W5TA 3U40A 2DXIA 1H0HA 3UWKA 5C3MA 2I34A 1I51A 3BD6A 1QGOA 4BO4A 4YXWD 4RULA 1G17A 2GYYA 2WM2A 1UF9A 3B20A 4MA5A 1R12A 3BL5A 4AJJA 1OX4B 3A4TA 3LHSA 4UM9B 1AS0A 2A9KA 3HWSA 3LQQA 2ISQA 2OFWA 2OV1A 3UWOA 5ADUS 1XC7A 2AYYA 4MKRA 4XUEA 2FOXA 1CCWA 4BO0A 2Y1FA 2XGJA 4K9DA 4Q4DA 1PKXA 4J3FA 5G2OA 4LJ6A 4TSFA 1SA0B 1IC6A 1UC4B 2CXTA 3GJ7A 3H2IA 3I34X 4DPMA 1PD0A 4TVKA 2EP7A 3PE3A 3U81A 1ZEMA 2FPPA 2WIJA 1YBMA 5HR5A 4XKJA 3RC8A 5SZIA 1QQ5A 1E3QA 1NVVQ 4UNIA 4Y9UA 4KJXA 1DNPA 3P9YA 2EJUA 2V7VA 3PA8A 1N7HA 2Q4EA 3P71T 5L4SA 1NRIA 4MRVA 4P3NA 3D8BA 4DLYA 3RC9A 2NYUA 2ACKA 3O84A 4F2HA 2AN9A 4NXNB 3G7SA 2PL1A 4LKOA 5HPYB 1NQOA 1COWD 3AQIA 4MHSA 4POOA 1OX5A 3W1WA 4OB7A 5AVRA 4NCKA 4D9IA 2RDMA 4YUXA 3LTNC 1RZRD 2CEAA 4DDUA 4OBWA 4PTLA 4Z8YA 5CHEA 3GFRA 3LLSA 5TQJA 3CW2A 2QAGA 4OUKX 4KXMA 3RVBA 2PA3A 3FUVA 1M8JA 3OFKA 2J6IA 1G59A 2YN0A 1IZZA 4NEQA 1WB5A 1QDEA 3V1TC 4AJ2A 2ADMA 4FFOA 1BHSA 3JAKA 2WILA 3S44A 2XADA 1TF2A 1RVV1 3V2IA 2C5HA 3ZCQA 4YC7A 4DXAA 5G0VA 4XRGA 4UJ3A 5HQTA 2G77B 1K5DA 4KO4S 3ANYB 1EFRD 5FORA 2ZIWB 2QDKA 4KLCA 4ND8A 3V4LA 3ZIUA 5K7SA 2I78A 2QW1A 4RTSA 1M34B 4EHLA 4C5CA 1QCYA 2CL5A 3QX8A 4PSUA 1E0KA 1NQWA 1UKBA 2F1HA 3GCXA 3WO1A 4CIAA 3P4XA 3WGHA 2ZJ7A 5BV1A 1Q7TA 2WD8A 4F0JA 5I7SA 5B64A 1U6IA 4IX1A 3OWXA 4YRBA 1OH7A 3AB7A 1RYEA 2IY8A 4WX2B 3H05A 4IRMA 1O0CA 1FSSA 1M2OA 3OOJA 1U7DA 3QITA 1D6JA 3SLGA 1QKJA 1W5BA 1H6CA 5AOBA 3JV7A 3WIUA 3D6VA 4DC0A 3G6KA 4C7OA 1Y3IA 1CUDA 3SSAA 2OWEA 2QR3A 3C3PA 4XOUA 4P4LA 3P0RA 3AUYA 1N32B 5COBA 1VIMA 5AM4A 2V4UA 1YMVA 4CQMD 2CEKA 2YASA 1J21A 4OXYA 4MKHA 1NC3A 3RLFA 3VUEA 5FBRB 1FFGA 1MBZA 4HMPA 2VH5R 1KAQA 2Q2QA 1BQEA 2BBWA 5HEKA 3VOBA 4OJYA 3WGQA 1ZOSA 3HB9A 4EK9A 1DLIA 4MRNA 3BH0A 4TKVA 1Z4PX 2C4MA 4ZDJA 1LJLA 4N8DA 2ZJ4A 3WLRA 1TYCA 1NGSA 4OMDA 3O3MB 3HEAA 5EIFA 1GL9B 1NUPA 2BI8A 4C0QC 1JALA 2O8NA 4KACA 4KE6A 3SN6A 3K2EA 1FC0A 1U0EA 1WZEA 2NZWA 3FCXA 3N58A 4KWEA 2QZJA 4XI9A 4B6FA 2F9LA 1SXJE 4BJ5A 5KOYA 1LPNA 3AX6A 5AICA 1OAKA 2YWRA 3IUMA 2YMMA 2QTLA 4DRXB 4Z4EA 2J4CA 1FMLA 2YY7A 4P4TA 4DV7B 1KDOA 3WNBA 5AH0A 3FRHA 2PUHA 3K9QO 2RHTA 4CNBA 2NSYA 2VBGA 5DOVA 1CF9A 1YJ5A 1POWA 3QZUA 1Q7EA 1E4OA 4URUR 1WXHA 3ZHOA 3JS5A 1WO8A 5IKPA 3VR5D 3A6GA 4RHCA 2FFBA 2HEIA 3D3EA 3WK7A 4IFIA 1A8QA 3ROXA 3NDPA 4RY9A 3WKDA 1U0NA 5A4DA 2AOTB 2ODAA 3Q9UA 4O4HF 3UXYA 2V6JA 3K96A 1M1YB 1ZIXA 2HMUA 3QJ5A 3R5FA 5DX0A 3ROFA 1WCYA 4WEQA 2X2FA 4BN0A 5CURA 1A7JA 1OAOA 1UWLA 4RWEA 1PEAA 4BAGA 1GFZA 1ZOIA 5JAOA 2JLXA 1X42A 1TCAA 3B1YA 3DT6A 4KV7A 1U63A 1GTSA 1Y3FE 1QUFA 2WHXA 3G9QA 3RUCA 5JCOC 3RC7A 4CKZA 3THXA 3EQ7A 2KW5A 3B1ZA 3EFHA 2HRDA 4FE3A 4GFDA 2JZNA 4ZCLA 4RDXA 5EJ4A 3AHEA 4K6CA 2O2CA 4JP1A 1VJTA 2I2BA 2P62A 4PE5B 3NTXA 3ZQKA 1U11A 2AOUA 4XAQA 5M7EA 4F12A 2XY4A 1XQXA 3EZ7A 4KR9A 3IS3A 4KQFA 5FRDA 5JI2E 4UEWA 4RTKA 1Y7HA 3P27A 2DPXA 2ZSFA 1G55A 2IDZA 1D2HA 2SKEA 3FM9A 3NAZA 3OJ0A 3UWPA 7GPBA 2OD2A 2HOQA 1F2TB 2PGJA 5KC9A 3ZVNA 1LW6E 1Q3KA 1B74A 1XNHA 2UVDA 3J7TA 4ALKA 4CL2A 1IWPB 3X2FA 4W1QA 2QAGC 2XITA 3GLGB 1HE4A 1XQ1A 1OGYA 3ZNNA 4KR2A 4UU0A 4OM7A 1O94A 3LX8A 4OFBA 4BQIA 1PEYA 1HTTA 1XZEA 4IGEA 3N0VA 3AO0B 1WSDA 4LRQA 4TT8A 1WXIA 2BE7A 4ERNA 1BKYA 1S02A 4XGKA 3LDGA 2O0KA 2BHRA 2O2SA 2HA3A 2H0QA 2V5AA 4UQPA 1PBNA 1CUEA 5IUKC 2PANA 1WXDA 2HCRA 1Z6YA 3VR2D 2WU1A 3WX0A 3CUVA 2JVKA 4QG3A 4LRWA 2D1FA 2J3JA 1A4IA 2VKQA 5JS2A 3HZZA 4XWKA 4YBRA 2ERXA 5DXFA 1XJWA 1XZAA 2C5SA 2P9HA 3WG9A 2GTPA 4MI1A 3SQXA 4GP7A 4L8FA 4RXTA 5DF1A 2IYSA 3BM5A 1P1HA 2XUIA 4IG4A 4LZOA 3R5SA 2FB9A 4QICA 1XD2B 1GPKA 3KFLA 5F7XA 3SICE 2C7VA 4EVSA 1PFKA 3HMKA 3FGNA 3P9ZA 2G09A 2AFHB 5K8LA 1EWQA 4ACBA 1UXJA 1XX6A 1IG0A 2QTVB 3IOEA 4C0WA 1Z7EA 3HP1A 3EQ6A 2G1UA 2V3VA 3I4LA 5JT1A 4F5EA 3I5XA 3QBJA 1WZCA 2O1XA 4WASA 2C77A 3PJDA 5J40A 3G5MA 5HHTA 5K20A 2HJ9A 1USWA 2GFQA 2QBYB 3AY3A 3EA5A 1ZD8A 1RACA 2JDID 4JYZA 1CLEA 2DPMA 4M9XA 4YMVA 4FXPA 1E6CA 1S7GA 2REOA 3F5FA 1VL8A 5PNTA 2OGWA 1NA5A 4XB1A 3NHAA 2NZJA 2WPDA 5FOVA 4ZEMA 4I1PA 2CJFA 5CFLA 2BTQB 2FRDA 2NU9A 3LNTA 2IKSA 1AO0A 5GP1A 3RHFA 3AVXA 3AJDA 3WIOA 1Q0RA 1JKJA 3HDQA 3CISA 4C5AA 5FAXA 2DFPA 3HNPA 3ZQUA 2NVUB 1PS0A 3UB3A 2NUPA 5F35A 3UG7A 3FSEA 1EXMA 4O4JA 2BBOA 2Z8ZA 2QTCA 3G79A 2GAAA 4BQOA 1B16A 3KKKA 3HJHA 1G5PA 1UBKS 3A9VA 4IIYA 5KIAA 1CDOA 4M89A 4RHEA 3MJEA 3DDHA 3WJ2A 5BN4A 1A9OA 3ECAA 1RXIA 1BXGB 3NHPA 3O4FA 3H97A 4GR5A 3VA7A 1QYRA 1ZN2A 1ZMBA 3ZE8A 5KSPA 4BLOA 1GAWA 3RFVA 2CF5A 3OTWA 3O9MA 2JLAA 4IDGA 1IBLB 2XYVA 2ZR0A 3AJ9A 3JZDA 4II7A 4YRCA 2AR0A 2XDAA 4DMUB 4FMPA 4L5CA 4OHRA 3TG2A 4E5NA 1EFPA 2RB4A 4LY0A 4YAWA 3W8EA 3BMNB 4QGAA 4ARBA 4FCVA 1MV8A 4R0VA 2BYTA 3R7AA 3S7ZA 2IXFA 2AOWA 5HIKA 5JVDB 3WL7A 5IDXA 2HCTA 1PJRA 1A8UA 2R6JA 4G25A 2B5WA 3UAXA 3GRAA 5HCNA 2O8DB 4AJEA 4JC8A 1T3HA 5BV0A 2QJWA 3DWIA 1JX6A 3CH5A 4MKXA 4RJ2A 4XWAA 4Y0AA 2M98A 2X1HA 1XAJA 4FI3C 5DEIA 4MRMB 5JZVA 4DR3B 3PPXA 3Q3IA 3HEMA 3PUHA 2ZPTX 1YQDA 2ZR7A 3H11B 2GBGA 4JXXA 2PSJA 1PJ3A 4R5MA 1VJ0A 2JJQA 3EBPA 5TMBA 3DFUA 1RM3A 4N9QA 2ENUA 4P53A 1QK3A 1JSLA 1MU0A 3O2QB 3C8ZA 4RDIA 4RCYA 3WGJA 3ONNA 1EG2A 5BMVB 2IBTA 4OH7A 3F8TA 2A94A 5T3UA 1CD5A 4RIHA 1LI4A 4WTOA 3ZWWA 4KPFC 2XYHA 4Y6PA 6PFKA 3R3ZA 2WTXA 1YTUA 4NE9A 1C9KA 2GX6A 2WIKA 1P75A 4YMIA 2PQMA 4X97A 4TS9A 1VE6A 4K6FA 4BRSA 1R18A 4TMZA 3QP9A 1F6WA 4JR2A 5A9TA 3H87A 5SY4A 1ES9A 3HDTA 4IHJB 1E2JA 4M0KA 1MAWA 4AXXA 1XN1A 4CCWA 5FA8A 1QH0A 2ATIA 1VLJA 3EC1A 4LX0A 1YS6A 4MWDA 2QX6A 4YPFA 2ZRCA 4DSZA 3GZNB 4MW0A 3V8BA 3TYXA 3HNRA 3TJMA 2P1RA 1GPLA 3AONB 4JGBA 4LMAA 1Z5GA 3UAGA 4E7PA 3QKTA 2XNKA 1NUQA 3C3BA 3FTEA 1ODJA 2PD4A 5DYYA 1P7WA 1FFXA 4XIFA 4DEXA 4X1IA 4KJZA 1BVUA 5IKMA 4P6VF 2VWQA 3JQ9C 5AK0A 2JLWA 1D5CA 1GGJA 1Z16A 2HH9A 1QYIA 2WKQA 4DT1A 1HRKA 1TECE 2CKMA 1F1JA 4G5HA 4BIMA 1QU3A 3AY6A 4HNAB 1L1EA 5GJBA 3V4VB 1A98A 1YOVA 3JTMA 2IP4A 4D6YA 5MFZA 2B8WA 2NV0A 1XZIA 3AKCA 2QAGB 3KOWA 2IWHA 2H5JA 2PD6A 2P9JA 1LI5A 2GO1A 2H5EA 3H04A 1DJPA 1GZ3A 2ZI6A 3RVRA 5HIAA 1NSTA 2WAYA 3KXLA 4KQIA 3JYLA 3GUVA 5HZGA 3H5AA 4YJGA 3SSOA 2IEBA 3AB3A 1XVUA 4X6YA 1L1QA 4JJ7A 3LSYA 1LD3A 1ZIYA 1XWWA 2XX3A 4G4SP 3RUPA 3RVDA 1RHMA 4GKAA 5SY9A 1T9DA 4BOYA 5AKKA 3R3SA 1AGPA 2FOIA 2J6HA 3CE9A 1I2BA 3EPJA 4TYWA 3T1QA 1Y6RA 3FZQA 3IPLA 1WMAA 4P7KA 3S8MA 3LKZA 3E9QA 3B8HA 4WCFA 3RDPA 4DIUA 3TGLA 4F45A 2VYVD 2C7BA 3BH6A 3WHLA 3HJAA 4ZI5A 2FFRA 4EVRA 2F3TA 3OQBA 1YZVA 3HA2A 4KL8S 4X95A 5JJ5A 4LX8A 2GK6A 1XZLA 2GR9A 1FFHA 2A5DA 4DYVA 2R6AA 3IT3A 4Q1EA 4BX3A 1Q2UA 2QM8A 3OEED 3KBOA 4H7DA 1SA0A 1RPAA 3NHJA 4LE1A 4OJTA 4Q9DA 2P2ZA 4KTTE 4NFLA 2CLKB 2F48A 4K6OA 4PWYA 5HUJA 5LP6A 2ROQA 4TX1A 3LT4A 1INLA 3UT6A 1VKZA 3BB3A 3WMGA 3ANTA 2FF5A 1CW2B 2B25A 4Y6SA 1WCXA 3IUYA 4F3KA 4Z7QB 2WIFA 4RPKA 2ZTHA 3PRYA 2WUFA 3R3WA 4CTJA 3INRA 3LUPA 5EWLB 1QK4A 2Z30A 1XXHB 2E49A 2SKCA 3DG9A 3L7OA 3R0VA 5ECGC 4Q00A 3S2UA 3KHUA 1PKEA 4OVKA 2HSDA 4DB4A 4DR1B 5U9CA 1OH6A 3CPHA 3EIHA 1FFEA 4XUDA 2XUQA 1IEVA 1Y63A 1M2VB 1VG8A 1UBMS 1G41A 1ZC3A 2PMWB 4CLOB 2IVZA 1K7CA 4L95C 4UHDA 5BV7A 3EQ9A 1AKNA 1RQ7A 2A86A 4V0RA 5IEBA 5CEJA 3GEMA 4CHTA 2IYTA 3GJ6A 5IT0A 4EFMA 5LYJA 1AMNA 4PYRA 3COJA 3ZU4A 2X41A 3Q10A 4FT2A 4MVCA 4A91A 4RS4A 1A9RA 4JP5A 3AR9A 2ILVA 3MRSA 1MENA 4PCVA 1SN7A 1DQZA 4U0JA 4OOFA 3RT1A 4LQLA 1KPIA 3WA7A 4YAKA 2HMAA 2CKDA 3NI2A 4RETA 1GN8A 2QZPA 4XVQA 5BVGA 2JLZA 1WHSB 2OZPA 1K92A 5FLXA 1GHTA 1KYWA 4YQFA 5ALUA 4RD0A 2H1IA 3PLNA 3RT7A 3FFAA 3TB4A 3WXMA 4BECA 2QN3A 4DPKA 1E9VA 1L5GB 2BGMA 4JC0A 4WPGA 1VRCA 3JQ7B 2C20A 3ZTTA 3IR6A 3VDMA 1CQIB 1SUFA 4TS3A 1IPFA 2FMIA 4J0FA 5IULC 3G88A 4NBLA 2C2HA 3AHGA 1KZ4A 4DOMA 3WV4A 1AZTA 2JNWA 1SRRA 2J9ZB 2PPLA 1VL0A 2D13A 4W7SA 4BJ3A 2QQ5A 3B12A 3NPMA 4GM0A 1X7XB 2D0PB 4B2YA 1UEJA 1PS9A 3QF7A 4R1LA 3RQSA 2P75A 5I8ZA 1WZ2A 3GRKA 3ZDDA 4MR8B 1X80A 2HQBA 1ZD2P 4DVGA 3ENKA 2XNDA 4CV1A 3MRVA 5DP2A 1H2FA 1E4VA 4JUFA 3O4RA 3UUEA 4XVRA 5ELXA 3VU8A 3FGZA 4F6CA 1K2WA 2HA4A 1MT0A 4I55F 3HFJA 3NIFB 2HREA 3FLEA 3B6EA 3HBLA 3TGWA 1M6NA 3RBXA 2D8AA 3LW8A 4PGGA 4TZ6A 4GMHA 3T7AA 4Q19A 1QHSA 1E4EA 3TAUA 1TGYA 1TTQB 1UPTA 2B35A 2IHYA 3F4LA 2CV0A 3B5EA 2A7XA 3NRCA 4A36A 5CNMA 1JQLB 1HE5A 1Z25A 2R8ZA 3R6LA 4O29A 3BXZA 2VK8A 3DCJA 2FQWA 3PQCA 2NTJA 2C3UA 3PFGA 3QJGA 4P93A 4QWMA 4QT4A 3GLGA 1DIOB 1S4QA 1WDKA 3I04M 3TN7A 2JHPA 2ZRAA 4DIBA 5EEGA 2MR5A 4GXQA 4ND5A 3ZDEA 1X8LA 4YMUA 2BGUA 1P0PA 4JVMA 4BMPB 4RH3A 3K70D 5TDHA 3RS4A 4OKSA 3W5VA 5IZCC 3HGQA 2NXEA 2B69A 1MEJA 2YMQA 5AI8A 2C59A 4DA4A 4KQKA 3UPTA 2J08A 5KBYA 2RGEA 3ZDFA 5LYJF 3CRZA 5KYYB 4JLUA 3IP5A 3O3NB 2PJRA 2JJ8A 2YYZA 3B36A 4EB6B 3RV4A 3IDQA 3ZLTA 1GZ6A 3IOCA 3OKFA 4X62B 4KP7A 5DPMA 2Q46A 3NJRA 2BRUA 1C4KA 3GYBA 2BM9A 3QQ5A 5D5HA 1WMBA 2DR0A 3D4OA 3HWWA 3PNVA 4MV3A 3SC4A 2VUHB 4RXMA 5EESA 5CB4B 2VK2A 1YR3A 4UOZA 5FPKA 1U2ZA 2C8KA 2D5CA 3Q88A 5KNLA 2P6RA 2Q4TA 2YJNA 3TNLA 1I3CA 4KIUA 1RAGA 4GX0A 3ESYA 4JKIA 1QNLA 2X8LA 4WERA 3RVMA 2AOTA 3FZEA 5CW2A 1EXVA 1FOEB 2B7CA 5JSFA 4H16A 2DAPA 4LJKA 3RYCB 3BIJA 3REOA 1RYHA 1WHTB 3CF0A 4HB4A 2AMFA 2BHSA 2O7VA 5CIQA 5JSKA 3SC2B 3VOTA 5LKAA 4JLAA 5F23A 1NUSA 1POXA 3CONA 3X43A 4AROA 1P44A 4YVFA 1FYXA 1HO3A 2I76A 4IDBA 4AMGA 4WKOA 1RAEA 1QX3A 1FP4B 1PFUA 3G5LA 3EEFA 1Z33A 2FU5C 1NDHA 5FBVB 3SE7A 2YJTD 4XIGS 3VQTA 3V1KA 4XCVA 4EL5A 2QW0X 2B2XA 3I32A 3NVDA 5E1DA 5IN5A 1C7ZA 2Z56A 3HRHA 1H2XA 3AMVA 3IKMB 2R6DA 4Q4HA 3MVEA 5EMJA 4PZZA 2VTBA 3A2NA 2W48A 3L8MA 2VP3A 2YRWA 1MG5A 2E55A 2JD2A 2UUPA 1W0JA 4I9FA 5IW8A 1ZMOA 2QY6A 3EEIA 3PTLA 1JEQB 3LXUX 3OP1A 2G67A 4AO6A 5KNDH 2ZYWX 2UZ4A 2PUJA 3VKHA 1BMDA 4R98A 3N2ZB 1SIWA 1CJBA 2Z09A 3N86A 3ZE6A 3JALB 1SB9A 4ILKA 1C4XA 2C7PA 4L85A 3S55A 5KYXA 4EKNB 5L8VA 2IUFA 3QPDA 1ECJA 2EJVA 3CPEA 2JHAA 2YWFA 1QG0A 3D9QX 4AKHA 4NOMA 1YFZA 3MBOA 2ZCJA 2A9PA 2FA9A 4P58A 5KINB 1VG1A 2OHFA 2NP7A 3JVVA 1KS2A 5JH7A 5DI9A 3ND5A 5I9TA 2JF0A 5IT4A 1FK8A 7ABPA 2I33A 2HRZA 2NUAA 3T3NA 3OEHA 5EERA 3VDXA 3BE6A 2II6A 2QLMA 2ESRA 3HKCB 2NLOA 2JB9A 4F1WA 2X1MA 4EG3A 5I5EA 4EKEA 4E1BA 3CWCA 1WDWB 5BOVA 2PZLA 3OQIB 4ZQBA 3KT0A 1WCWA 1EGHA 2X58A 1V5WA 2FSIA 1MUUA 2QX9A 2YOHA 4TPKA 4WUVA 5E7QA 1LJ8A 4PQYA 5IAAA 3T5AA 2B7LA 2W6IA 2D8MA 4E70A 4FW8A 1A4RA 1OXUA 3DFFA 5JUWA 1QZUA 4I8IA 5DX8A 3LIPA 1MTOA 2A92A 4N40A 2PH3A 1JMKC 1ZSNA 4E21A 4R68A 5TF4A 4EG1A 1TQ4A 2JD1A 3OD1A 3RF7A 4HI0E 3FOFC 4XIYA 1T5HX 3PYMA 3RS8A 3DAPA 3PHCA 4GZMA 5CDFE 3EVAA 3UEOA 4FN5A 1UC9A 3SX2A 2WA2A 3M4ZA 1P5RA 2I6FA 1T8WA 2X8AA 5KOJA 1GFSA 1PN3A 2VRWA 1CQXA 1DX4A 1FUIA 3OAAA 4K86A 3WGTA 2NU8B 2RHCA 1YB6A 3HO6A 3QEKA 3ZTYA 3EDRA 3BTVA 4X1YA 4B3IA 4H1WA 2BR5A 4OP3A 4UQLA 2BFPA 1W35A 4OD0A 5B3JA 1P1JA 2IFTA 4CU5A 3U80A 1UPBA 3K4QA 1XK7A 3OJEA 3E48A 5GJVC 1EXDA 1ACMA 4ZYWA 3AOEC 1ZCJA 5E6SA 1ISGA 2EBHX 2UUOA 3JYNA 3IODA 4ISCA 5EIWA 3OJFA 4A6DA 3NW9A 2JZCA 1S8AA 3WQSB 3SXUB 4YAEA 5LOVA 2ZAOA 1TVMA 1FFYA 4G84A 1R8QA 3PEFA 3UAZA 1KZ9A 1Y5RA 5AMXA 3F5SA 4EHDA 3AJEA 3BJRA 4LYYA 2YVLA 5CA1A 2Q4OA 1RBZA 2FMUA 1MB0A 5LQJA 3O8OA 2BI7A 3IVXA 4QLOA 3ZXXA 2CMKA 4J2OA 4N39A 3U1VA 5KCMA 3Q6MA 4K0KB 3UT5B 1QMPA 3KCQA 2J33A 3H7IA 4F7DA 3WV5A 4NS1A 4C0AC 3TLXA 1E5TA 4BB0A 1IULA 4BEWA 3F7TA 4KAAA 2DECA 4TT3D 5BP7A 5CX1B 1JEYA 2DY1A 3PYXA 4RYDA 1O6ZA 4U2GA 3A4IA 3HC7A 4FDVA 4RVFA 5HDQA 2OOKA 5KWVA 3OOWA 2XMGA 1Q0ZA 1VGVA 1C8VB 3JAMA 3O8OB 3OPNA 4EATA 1DXYA 2X7HA 4RMIA 2ZB4A 2VN8A 1SK8A 4TVSA 2VQ6A 2IRWA 3QLJA 2JC3A 5KDLA 1A9XA 3NZEA 3PQFA 1TTTA 3JQ6A 2VUUA 1K27A 4IXDA 4KODA 2OC9A 1V2GA 5AHWA 3S70A 3V7FA 3A1WA 1R0XA 1HMYA 2JIMA 5BSTA 1BQ4A 1K6MA 3PXBA 3VO8A 4CCSA 1KNXA 5A71A 4U3JB 1E6LA 1GWNA 4X61A 4H6XA 3Q8LA 1L5QA 4NG5A 3M5WA 5ITWA 4RA9A 3CCFA 1FP4A 3N0WA 3TW8A 4BLPA 1OMOA 4BMOB 5ISMA 2HHHB 2GVNA 2JIPA 3WNZA 1A1VA 3DAGA 1P2DA 1SKYE 1UJNA 4OO3A 4OX9B 2FPGB 1HT1E 1NTRA 4Y9TA 3PPIA 3HCFA 3E03A 3OBIA 2JFVA 1BMQA 2FEKA 4LNHA 4B87A 4D26A 5FA6A 2XCLA 1IBRA 3VMMA 4G23A 3F47A 1DCTA 1KFKB 3L7LA 4HPXB 4QD3A 4LF6B 4XH9B 2RJOA 3IXLA 4P31A 4Y9SA 3WHIA 3AESA 2CYAA 3WLAA 1XR3A 1XTJA 4HQ6A 2ES4A 3LLVA 3ZDQA 3E3LA 1OWPA 2P2DA 4JJ6A 1P0IA 4MWEA 5K09A 1U8ZA 3FTPA 2BCGY 3H1FA 2VXOA 3RCBA 5JSZB 4C2UA 1VBMA 4NU8X 1UP4A 3OIDA 1NG9A 1U1EA 4MRPA 4RSGA 3A06A 5REQA 1HL3A 3G23A 3FCEA 1UOOA 4F5WA 1JVNA 5I01A 2OD7A 2BGJA 2JAHA 3MBKA 3RIMA 1HLPA 2XTZA 1IOZA 2BFEA 3A04A 3KB2A 5ERXA 4C6HA 3ZOKA 3BTOA 5BN5A 2IEGA 2X22A 3LNCA 5DULA 4INOA 1GG2A 1VA4A 3PP8A 3DGFC 5IJAA 3TCNA 4UZEA 1XQVA 5E6RA 2F00A 3EF0A 4OQQA 4QSMA 3U4IA 5IM4F 3DQQA 5EJFA 1IDOA 1UKEA 2QE6A 3VR1A 3GQBB 1L4MA 1MQAA 4UMFA 3UWMA 3AP1A 3NHSA 4ZVOA 5AT1A 5TEVA 1BCSB 3LQRA 2Y0EA 3WGIA 3I42A 3W6PA 3A2KA 1ONSA 4M55A 1PV2A 3RFUA 3SHQA 2P3OA 5EG5A 1RHRA 1EX9A 2WSBA 4GAEA 5DNYB 4WFIA 3R4VA 5CG1A 3CF4G 1E4EB 4M9UA 1FRFS 1DTSA 3CUKA 2Q1UA 5CCBA 3FUXA 3CZMA 5BWOA 3UJNA 2HLDA 4RKEA 2HW8A 1YFKA 3RBVA 4B3HA 3LUBA 4PU0A 4S35A 5CLQA 1GRVA 5EIXA 2OVBA 1N0WA 5IXYA 4HWRA 2ZSAA 3GLRA 1H2WA 3GD5A 3K9HA 3PEVA 3EDQA 3FWPA 3ZY2A 1NI4A 5JHGB 3FE2A 1OQAA 2JGFA 5AJUA 3GY0A 2IH2A 1BVHA 1JH8A 3CCCA 1KGDA 1PUJA 2RGXA 1QANA 2AE1A 2WSMA 3P2YA 3QPAA 4D9NA 1AXEA 5AUNB 4ZU3A 5E7JA 1G0NA 4EBFA 5AIBA 3PR1A 5DKFA 2C2YA 1JAIA 2VR1A 4LXUA 4EQ6A 1QHXA 3DNPA 5JBNA 3JVIA 4QX6A 5BQ3A 1TZ2A 4IUYA 5AHXA 2AG6A 3GAFA 1IYZA 2BGRA 5C1PA 1TM7E 4RW0A 1AG9A 4RVHA 4KNVA 1DSSG 3OZWA 1L7QA 4D9JA 2X5OA 2VQSA 3ABIA 3HR8A 1NXOA 3PQ3A 4X8HA 1KY4A 3GCDA 4NVRA 3BMOA 3AL2A 2VT7A 1MAHA 1KY2A 4XIIA 4E32A 1JIVA 1E8MA 1G2OA 2I22A 5I5GA 3ZW7A 2XKKA 1TM5E 4X6LA 3EWIA 1GTVA 3O38A 1ESNA 4XQGA 2FDRA 4FONA 3WRXC 1JG3A 1NN5A 4M6WB 3KQQA 5CR9A 2HR1A 1GZHB 2KSQA 1Z5OA 3D7KA 2I4LA 1ZVMA 1ZUWA 1ZAKA 1IB6A 4DCUA 2JEZA 2G1KA 1BKSB 3CIOA 4RTMA 4O1IA 4RXUA 2JFNA 2XDWA 3HKBB 2UXDB 3ROTA 1Y8QA 1FUKA 2EU8A 3MLAA 3ZK8A 1WABA 5F4BA 1O89A 4CMGA 2B8NA 3RUHA 2RONA 8ATCA 2C57A 4V03A 1ZM9A 2E89A 3INNA 4DJEC 2E2WA 4UM7A 1U5BB 3HJUA 2XUKA 3LHIA 2PT7A 2WM9B 3RSSA 4NNPA 3NAMA 2PUEA 4L08A 3A31A 3T9CA 2GF9A 4EUSA 3M70A 1ZIPA 3EVDA 4B9EA 1KZ1A 4FMCF 1O97C 2C88A 1QO9A 2C0PA 3KM0A 5IVHA 2PBLA 4JIMA 3PFHA 3HVJA 4XR9A 1ZMTA 1UDXA 3QWAA 1FLAA 2B2CA 2R4UA 2YIVX 3EHDA 3TI7A 4TXNA 3P7MA 5BYKA 1BSVA 1RRCA 2CVQA 4HZUA 3LGXA 1YACA 2ZETA 2WF6A 4PC6A 2Q5QA 1BCSA 5DHUA 4AJHA 5I9LA 1O8CA 4ZVVA 2JLUA 1VCMA 3MAAC 3OZRA 3VO9A 2G9QA 4JI2B 4UNNA 5CX4A 1AKWA 3FYHA 4I1SA 3UCXA 1C7IA 1PQYA 2Q45A 1BVYF 1DU4A 2RIRA 1N92A 2G7MC 2ECKA 3KPUA 2JJMA 1QDUA 2WIGA 1JA1A 3M0EA 1SWVA 2R11A 2ZRQA 3DXYA 3W4JA 7MDHA 1GTMA 1P1BA 1VMIA 2E37A 3WRYA 3A27A 4OREX 4FGUA 1GG9A 1YJCA 1K6IA 2JARA 4JLOA 5HILA 3V4OA 2REQB 4EF5A 1T4CB 1A50B 3FAZA 5FO0A 1E3SA 1QIIA 2VL7A 5REQB 4ZEWA 5JSYA 4IIHA 2BJWA 2GQ0A 1DP4A 2BONA 2QRLA 3VZRA 4DJTA 3ZEIA 2OFFA 4D7AA 2YIMA 3EGDA 3H1TA 2GZ1A 3JQQA 4X64B 5IARA 3LHDA 3I23A 4MJLA 2J0EA 4TV9A 5I7AA 3WLJA 5KCZA 1CF4A 4PYJA 4F06A 1LVUA 1IOLA 5CA0B 5LQDA 4MGHA 2FPOA 3C4QA 5LQAA 5M04A 1G8HA 2EIXA 3KZVA 4Z0NA 1MABA 4ENUA 4ZDKA 1ANKA 4G56A 2V58A 2R6R1 3AVOA 2HADA 1SCJA 1UMBB 4M0EA 1KY3A 3MGGA 1P4AA 1OYYA 5CFMA 3UAWA 1PBTA 1C29B 3FDIA 3KKMA 4HN2A 3M1LA 5LDHA 4UE6A 4JYPA 4F1KA 5K0ZA 4OP1A 4PNZA 2A5LA 1O57A 1GL3A 2OUIA 2WTAA 5CFZA 4BFVA 1Z45A 1MOPA 4B79A 4B46A 5HK9A 4JDUA 5GOTA 4U63A 3V4ZA 2HRBA 2P5SA 5JMWA 4LXHA 2SECE 1GPDG 2IZ1A 3BN3A 2IZ5A 1YVRA 3ZW9A 3VZCA 5AK4A 2VTBB 4YCAA 3D81A 1QNFA 1P4RA 4BEBA 4B2LA 2I3GA 3SYTA 1DXHA 1ZRNA 3PCTA 3RK1A 3TNYA 2GN1A 4B44A 4YDSA 1IWOA 4Z4QA 4KMRA 1OVGA 1XKQA 4DRZA 1IG3A 3QX3A 4GPBA 2YNMD 2RHDA 3ZCVA 4DWJA 4RF4A 3AR6A 5AD1A 3ZBTA 1FTYA 1JA0A 1MJNA 1ZK3A 4EQZA 5C3UA 3N2YA 1YZKA 1CR4A 1OXMA 3MERA 2FW6A 4PRYA 4ER5A 4DIKA 4GNKA 1H42A 4QU9A 3CUSA 2FSUA 6GPBA 1YFJA 1VHLA 1NBAA 3EIFA 1V39A 1SVSA 4U6QA 4NBTA 1B0UA 1XVVA 1Z8FA 2NZVG 4XJVA 4E0BA 5H0IA 1J7KA 1EK6A 1VLHA 3O0TA 1N8TA 3KQNA 4IDAA 4QAQA 3R7WB 5FIUA 4JVLA 3HLKA 1P7VA 4ZYZA 3JWGA 2HL6A 2H4WA 2JAPA 2NQTA 1H0SA 5I7EA 3QE9Y 3GFQA 2CJYA 3JWIA 2PKXA 5CJPA 4REMA 1E59A 3NAQA 4A6PA 1L4UA 1I4WA 2JW5A 1UJ4A 3D54D 4M7OA 3VAZA 4HATA 1Y5NA 2VWPA 4L50A 4JYMA 4WY2A 3DCIA 1EXNA 3CIFA 4AS3A 2RKBA 1XU7A 5KAMA 3KXPA 1F0YA 4LOLA 4W1SA 2WRZA 3W4IA 3FYCA 4DC1A 3DHWC 2GUWA 4PYOA 3K6JA 5CLLA 2BIFA 2MYNA 3IHLA 3KKZA 5IKOA 4DDHA 1NNLA 1YOVB 2V6FA 4QEZA 4UBIA 1L5YA 2W93A 3NWEA 2CMFA 4WGGA 1LW7A 1XDGA 1LQTA 1U2PA 2OGZA 1JNYA 4DXDA 4F8JA 3DKIA 4K26A 2QE7D 2YZ7A 4IJMA 4PSKA 3OM9A 2FMKA 3EK2A 5CP8A 1GA1A 4ZT7A 1M1UA 5EXTA 3V7WA 3NWOA 1VLZA 3LCVB 4L8WB 1PI3A 1A3CA 3OKAA 4MULA 1WJGA 3QWBA 4N0DA 4E03A 1QYXA 2ZJZA 3LYLA 3WHPA 2XI4A 4NYJR 4EY4A 4IVQA 1J39A 2UVPA 1WEKA 3RNLA 1NMYA 1HRDA 4K40A 5LQCA 1QIJA 2G6TA 1ZQ1A 2IPLA 2ZUDA 3ZEAA 3EOZA 2QTGA 1SWWA 3OZ7A 1QFYA 5JWOA 1QVZA 1DUIA 3BIWA 3BQ9A 4H17A 1S2MA 4H7HA 1EQUA 3C8UA 3HBMA 3MS4A 4RPHA 4UTRA 3NHKA 4U7WA 1LRKA 1Z0JA 2J7KA 1ZN8A 3BF8A 3IQGX 1P74A 4IH1A 4MA4A 1CFZA 4F3TA 2GCPA 4ZJZA 1SXJC 4RD1A 3ZDAA 2L82A 1JI3A 2AYXA 2XA9A 3AQ4A 4QEKA 3FJYA 5EA2A 1Z5WA 3H8WA 4YYZA 2R47A 1QZXA 3C7AA 3IT0A 3W9UA 4EA7A 4XVCA 4DKJA 4B80A 2GZAA 4QM7A 3ILHA 2F8TA 3H99A 1HORA 1SHJA 2DTXA 4YPVA 4DADA 1WBBA 4FDAA 5EE1A 1YS2X 4HCJA 1F1BA 1N75A 4TYPA 4Y2PA 4FJ2A 1KMMA 3OX2A 4NJMA 1GJRA 3U5ZB 3D6MA 2CLHB 1I6MA 4ZAXA 3LP6A 1XCJA 4RENA 1FU8A 3P32A 3FN4A 5LBTA 2JLVA 1T91A 1NM5C 1WXQA 2DKFA 3BGOS 4GX1A 4NKRA 4O8CA 1E96A 4TWAA 4YAJA 4AYWA 4L28A 5SZKB 3E61A 1DDGA 4OI1A 3PWSA 1T9KA 1OGIA 4GKJB 2FPIA 2HO4A 1VMDA 2PNFA 2YXDA 1XBTA 4LHWA 8LDHA 4A26A 3U44A 1PT6A 1GVHA 2ZWOA 1G8SA 1WQ1R 4NARA 3RIYA 2PYDA 2WTEA 3IQEA 2VAWA 4WOCA 5D7NA 4YRQA 4JLWA 3QEJA 2P78A 4FW9A 4IGFA 3TEFA 4WN9B 2QMOA 2HT6A 5KTKA 1E9RA 3OE7A 4LYGA 2VQFB 5I7FA 1PP4A 2IU4A 4M0CA 3T4XA 1U90A 4IM7A 2NPIA 1L5SA 2JCXA 4G0MA 4JEMA 1G291 1EFRA 1TO2E 4M3NA 3CUYA 2FMHA 1VPWA 2WJJA 1F2DA 2O50A 1EK1A 5JO9A 3C14C 5FEMA 1G20B 4OQYA 2QVCA 2CC2A 5CGZA 3BC1A 1QP4A 4MV1A 1MZVA 1C81A 1ONOA 2I6XA 4I1OA 2D06A 2WJAA 1WCIB 5IUNC 3QXXA 5EQDA 4JX9A 3WFJA 4CMEA 1YCGA 1Z0UA 4UHFA 2J9FB 4TXHA 2X7JA 3K09A 1VZ3A 1FMTA 4JP2A 3A1TA 2SICE 1L7NA 4G09A 4PHHA 1NVUQ 4G5XA 4LC0A 3VPSA 2AB0A 2PIDA 1OC4A 1PNQA 3VR0A 1AMOA 3B9RA 2HLHA 2WY2D 2W6ID 4TN5A 3VTZA 4B7XA 5CYGA 4P8RA 2CCJA 3BMCB 4IIUA 3QWIA 5HMMA 4O0LA 5UKDA 2NUTA 3TIIA 4CV3A 2QBYA 1LQUA 2BGIA 4X20A 3G5UA 2HY7A 1NDUA 5AK3A 3U4QB 5B3JC 1NVMB 1O95A 3UGJA 4CW7A 3OCJA 3TRHA 2PE5A 4GQAA 3H8SA 1IATA 5BYJA 3V9AA 2IK8A 1U8FO 1C41A 1GL7A 3SQDA 1OZAA 1Y37A 2PLAA 3F3SA 3KLMX 4YV1A 2NQ2C 4J3NA 3QF4B 4ZIRB 5JJBA 5EJIA 4JSRA 5JIBA 3QUSA 3RAGA 3RU2A 1BYIA 4QFBA 2H1RA 1OYVA 1F5SA 2XHZA 3NBXX 4YDQA 4GKKB 3VV2A 2VATA 3CX7A 3R5XA 4IIXA 1PCXA 3T4PA 1Q95A 3DFZA 4FDMA 5DP1A 1D2EA 3UTDA 2N47A 4OYRA 2Z5FA 4MUGA 1RQXA 4QYXA 3HYCA 3WP0A 4BVHA 1JLKA 3ADKA 4IY1A 2GCIA 5AKIA 4GVPA 3PHHA 4EJSA 3SX0A 1N5DA 2JCYA 2W90A 3N76A 3RS7A 1EE9A 2GCOA 8ABPA 2V7UA 1I80A 3GFGA 1U28C 2ATCA 5HRCA 4ND1A 2ZUFA 1X3LA 4KRFA 4C03A 5BV2P 1O5IA 1SC4A 2GKGA 1YJ8A 1XTVA 2Z2ZA 2YXPX 3L6EA 2I1WA 4ZEXA 2J0VA 1C3XA 1FFBA 2NZ2A 3KZCA 4D6XA 1JZQA 4BBZA 4DW8A 1Q3TA 3R8FA 1G6Q1 4M38A 2X23A 1R0SA 4D5GA 2NAFA 2YUTA 4NX2A 1UT8A 1MO4A 3JZAA 1PW5A 4MVJG 5BORA 5K05A 5CTAA 1TL7C 3I8XA 1WHTA 3SC2A 1L5HB 3LUFA 2PEZA 2YMPA 3J81A 1MEOA 2VDKB 3SNKA 2GZHA 3CZRA 5TY0A 5JEDA 4W9RA 1Q0SA 1PJAA 2LR0A 3SZGA 4KSCA 2ZYIA 3HE3A 3R0JA 1FTNA 1U1DA 3GN2A 3WAKA 4AURA 4F04A 5LZ7A 2DWQA 2IXEA 1D0VA 1CRQA 2ZZKA 2AOUB 3X1JA 3UXEA 2P79A 4KR0A 3N2LA 3NJ4A 4NTZA 4R2XA 1LPSA 4MUHA 5IT5A 1UMCB 1VJ5A 2UUBB 3KYCB 4MX8A 4WKBA 2HIHA 4AICA 1KQGA 1MN6A 2GWRA 3ZS9A 5KMGA 5ALHA 2EW8A 1L8AA 3VR6A 4H7FA 4RNCA 3K2IA 1MC4A 4JOCA 2Q7XA 1Z2CA 2QMEA 4UASA 1XVLA 1W0CA 2HBRA 4XVHA 4AF7A 5DNCA 2QRVB 2B4YA 3RTAA 4D2IA 1OPXA 3K1YA 1KZYC 3L8FA 2DBZA 3MTJA 4KK4A 5G53C 2VP9A 5CFQA 1SU7A 3RG8A 2Z1MA 2GH1A 3DE5X 4WNYA 3JAKB 2XZPA 4FBMA 3VNQA 3DUFA 1N6NA 1USIA 4ZA2A 1EZ1A 2D5LA 3R76A 3SF0A 3BB4A 3QW2A 4TLBA 3GNLA 4BQNA 4DMMA 5FH9A 4BV3A 4YJ3F 3GH1A 1NWCA 2OBBA 5FLYA 1GUYA 2E5FA 3HUEA 1DO8A 4HDQB 4R83A 2YL2A 3NT5A 4BE4A 5AVYA 2QA5A 3C6ZA 2B1IA 3E7PA 4HNGA 3T0IA 5EIEA 2P77A 1ZXBA 2BKUA 7ADHA 1FYVA 4QDKA 1GXSB 2I4RA 1XRNA 1OZFA 5KC8A 3F6BX 1HL7A 3RFTA 2UZ3A 4OAOA 3ABZA 3F0TA 1R5NA 4BP8A 1QF6A 1T25A 3DBLA 4PX5A 2XMSA 2H57A 2C82A 2RGWA 4HXGA 2WLTA 5GAJA 2H31A 2DHCA 1J1IA 4KKVA 1F06A 2AK3A 1FX1A 2I9PA 3JQEA 4MW5A 2IH5A 1UINA 2VJYA 3GFPA 3VR6H 4HNVA 3T1TA 2JG3A 1HWYA 2IF0A 4PZ9A 1SQ5A 1PL6A 4TVOA 1KMHA 2R00C 1SFRA 4UNPA 1Z7BA 2HSGA 2GN4A 5LSAA 1C2TA 1VDMA 2Y0BA 2X13A 4EHNA 2HDOA 1EFVA 4NYMR 2M9MA 3LOQA 3D2AA 4BB5A 1W9MA 4I8XA 4UUQA 3VU9A 3HY4A 5C37A 1DINA 2IITA 4IEEA 4O1MA 1XHEA 2PWPA 2NWQA 1P18A 2C9OA 4ZZ0A 1RKUA 1LKZA 2GEUA 1RJEA 1WVMA 2V03A 3KL2A 1I32A 4IZHA 3M8KA 4MQMA 3GZJA 5F2EA 5DN6D 3QELB 5ALJA 3AK4A 3MT0A 4AJIA 5B7QA 4R6XA 4ARZB 1EFUA 1VI5A 2XD4A 3ASYA 3OQNA 4G5GA 1SQ6A 1XRMA 2O8BB 2PWYA 2Z9BA 1MO3A 2CLFB 3GFBA 3ZU5A 3GOHA 1T6ZA 1U7TA 3TDMA 1CUYA 1SXGA 1TVCA 5AK6A 3H0CA 3WZLA 5KREA 4XD7D 5BQOA 3VV3A 1UAAA 5F12A 3HB7A 4CGZA 1GU1A 1NVVR 3A4MA 2J3MA 2VYFA 4CTOA 3MJ4A 3RUDA 3QV1A 3NU1A 4HR7A 1O94D 4OHZA 1N36B 1N0VC 4MQBA 1MQ8B 1PDWA 1VBFA 4BO3A 4BQFA 3L7MA 4ZEVA 4TTIA 5THXA 1AKMA 1BE8A 3JQFC 4CLEA 1H1DA 4FEYA 4Y2JA 3BEDA 1N33B 2HSZA 4XJSA 2R25B 2Y1LA 3KR0A 4OQDA 4KRXA 1LV8A 3PEEA 2CE7A 1IQRA 1DIBA 2EFDB 3C3EA 3W8DA 1M76A 1R9NA 3TDKA 2OENG 3S8YA 3TZ6A 3DVAA 1GSIA 4GVLA 4TL8A 3MZ0A 4EF4A 4P0QB 3PGLA 3GIWA 5DCLA 4RA6A 3REFA 4CEHA 5EMKA 3ICCA 4JCOA 1JF8A 1UMDB 3DOIA 1HURA 1SHUX 4F72A 3P9SA 3ILVA 4WZBA 5FP0A 2IKQA 4A0RA 1L7DA 1BS1A 2J5XA 1FTQA 4B3GA 1OFUA 4RQAA 1FQJA 2PEYA 5KQGA 3NRJA 1C8LA 3W9BA 1I1HA 1KP3A 4ZT6A 4YUYA 2OV3A 1E1MA 1E92A 1H6DA 1MJFA 2PXCA 2ZUUA 2XE8A 4RZUA 2CK3A 1LBSA 4H3KB 2FRXA 4QAJA 3MINA 2OHXA 4J7CA 2EKPA 2E85A 2P9GA 4FFNA 1F12A 1U3WA 6ADHA 1QVVA 2Q2WA 2W6PA 5K4AA 2PQ2A 1EWKA 2XUHA 3I72A 1J5PA 3OX3A 3CUWA 4P9NA 4LMRA 1GFWA 2OCLA 4IL5A 5LU8A 2GETA 1JTEA 3RU3A 3C3XA 2OQIA 3EDMA 2O23A 3IBYA 3KTDA 4MS4B 4COKA 3DBVO 3HA5A 4G0WA 3OM0A 4PZCA 3TLGB 3VSBA 1L0BA 3VUFA 5IG2A 1TJ4A 3IAAA 4DABA 5EL0A 1K88A 4JU9A 1IM5A 1F4PA 1SVLA 1GV0A 4RYLA 2B94A 5FBWB 2KLBA 2FI1A 3MWGA 4EUFA 4QQRA 1EFHA 2CZQA 1Z28A 5TQ2A 3TKLA 3FNQA 1OYWA 4RIIA 2IWRA 4JBLA 4BBJA 4EB8A 4WKGA 1TEZA 2A4KA 1BXZA 1ZK4A 3H17A 2AD5A 4WWHA 5BNWA 3RRYA 1RQPA 1G5HA 3V1YA 1M72A 3CF2A 1UZLA 2YWHA 1IE3A 3NIWA 4DXHA 3MPUA 3MJFA 1KEWA 3UGQA 4XD2A 4HBGA 1F51E 4A0HA 2CJWA 2YR0A 1HMPA 2BKEA 2AHRA 1G9XA 1LRJA 1A88A 2JFBA 5F51A 4YP9A 1FDWA 2OXRA 1OFUX 1JHYA 1I24A 1U0GA 3L1VA 3M83A 3OZSA 4PAMA 4QUKA 1SU8A 4WCFC 4RKQA 4ZFNA 2FSFA 2OFPA 2XZOA 1YE3A 3DLIA 4JL5A 2IUUA 3R7DA 3HUTA 5GADl 5CEFA 1NF9A 4I5DA 5FOXA 4QARA 2WIDA 4LV6A 3WMFA 1K4KA 4RK4A 3HZHA 3D8UA 1O8BA 3H65A 1QIGA 4RACA 5IK2A 1RWXA 3ASZA 3KALA 4AQYB 1GLNA 1G8YA 4ZV7A 3HB0A 4S0ZA 1MTZA 4PZLA 2NTNA 2NU7B 2I3AA 3C0KA 2QDXA 3EQ2A 2HK9A 1SBCA 2X9LA 2HPHA 4MP3A 3JWHA 5JS1A 5BMVA 4Q4AB 5C8XA 1ABBA 3NAGA 3AVPA 5AO9A 1G5FA 2X0RA 3BB1A 1DFIA 1KH2A 2FPMA 1HNZB 4O4JF 1B2RA 1YZLA 4OI4A 1D6NA 1TDJA 4RY8A 1EHYA 1UCFA 2BEUB 2CNKA 2NU6A 3DAHA 1UPXA 3IX7A 1LK0A 2J5KA 3GF4A 4ML3A 2VZLA 3UK7A 4BGUA 3ZDBA 5ADHA 1WB6A 2R1VA 4KI7A 5ITZA 2YDYA 5BQ5A 3T15A 5HTOA 3L8ZA 1BTOA 3TGPA 1ZJJA 5AVKA 3RHSA 3HJFA 3COPA 3WGYA 3AEKA 4JR1A 3S1AB 4ZC1A 1ZIOA 1C1YA 3UKDA 1Q0UA 2ZVDA 3W2EA 2JKYA 4YDHB 1XZNA 1M2FA 3PIDA 3KWJA 2OTCA 2GLUA 1PT8A 4GLOA 1XDUA 4LWPA 2AIRA 2QPTA 4N7MA 3QNUA 4MYCA 4OHOA 2JLQA 1BEEA 2CUZA 3FSRA 3HA3A 4GXRA 1R6UA 2DGDA 3M5DA 1H4SA 2ZQYA 2JI9A 2Z5VA 1ISSA 1RFLA 4KQHA 2ZR8A 4NP6A 3EDOA 3FKJA 4YWJA 1D07A 3IQZA 2K5UA 1N4DA 2PSDA 3BE5A 3MT9A 3R5KA 5FTWA 5AW7A 3AVWA 3UK2A 1I9CA 3RTDA 2ZYHA 1VM6A 1OU0A 1QOZA 2EBUA 1MT3A 3AINA 3MGAA 5LD2B 1UK8A 4OLFA 4MWTA 5F76A 2R8OA 5CB4F 3GEGA 3HCWA 5DRTA 1X1BA 1RPJA 1IRIA 1UDRA 4ZK2A 3UV7A 1A2QA 5HF9A 3RIEA 4BLRA 1JLSA 4Y67A 3HKBA 2VP0A 2VHTA 2XKJE 5LBIA 3SZUA 4Z4HA 1Q1AA 3N3AC 5E1OA 1M75A 1NNSA 3GU3A 4XGNA 1Y3CE 1YAHA 1K3UB 5ALXA 3CU5A 1Y8AA 2WHYA 5J2TB 2Q3DA 1XRQA 3FOWA 2J9FA 4J1TA 4DAOA 4DG5A 1UMCA 4WKNA 4ZVMA 3TSCA 1RMQA 4CMHA 2GKOA 1NFRA 3P2IA 4E15A 3EPHA 2QXYA 1Z22A 2VHCA 2B7BA 2HNBA 3JWEA 5AW8A 3ICEA 1IHYA 5B5SA 2G88A 1DCFA 2IJGX 4M1QA 3WBKA 3T34A 3FPHA 3LO5A 2C03A 5ALWA 3GEIA 3UH0A 3O0DA 1UR5A 1Z26A 1KEZA 4ZHSA 4E46A 3KQOA 4JODA 4CKCB 5KTYA 3D6FA 3HY3A 2WWXA 2BH2A 1H94A 1U7XA 2BF4A 3MA0A 4OUDB 4ON9A 4JI1B 4X94A 2Q0XA 3NHLA 3P94A 2PZKA 2OUKA 3IBTA 1SUPA 2BTEA 2IVFA 2XF2A 1IUKA 3MUFA 1N2OA 1VI2A 2QG4A 1WRBA 3VZBA 2FHSA 6CHYA 4MPTA 2NVBA 3LUKA 1YXMA 3UQYS 4CI9A 1RLUA 1W0KD 4C4ZA 5JTTA 1M66A 2JFQA 1C30B 3EGWA 3P19A 5A6SA 4LOKA 3IP6A 3L06A 1QCCA 3B70A 4HYQA 4JWKA 3B2QA 3I2IA 4N3AA 3OCZA 4IO1A 4NJEA 5GVSA 1FDOA 5JAZA 4JN6B 4B3SB 3CR7A 3E9DA 2O7QA 3E05A 1QH1A 4NMMA 3KV1A 3AFOA 1SH7A 3ZDXB 3ADPA 3CNHA 3ZDCA 2V7PA 1ECCA 4IFBA 2WAMA 1U98A 2ZWIA 1K8YB 2H9AA 2YV2A 1IJBA 3P2JA 1K7YA 3OM1A 2GN9A 2ICAA 2H17A 4FFPA 4O1HA 4MHOA 5DYNA 4IS2A 4BCCA 4TRRA 5TC4A 4IIJB 4HRAA 5JCXA 5FWNA 5HUQA 1EVIA 1WSBA 5HFAA 4HDSB 3ESDA 4LHEA 3V4SA 1RI1A 2PX0A 2PZMA 2XJ4A 4JBYA 1X74A 3OLXA 3ZCRA 1E2IA 3LFUA 4JZYA 2ZI3A 4WFQA 3VKWA 3IPAA 4R69A 2FAXA 1Z56C 5FL7A 4NSNA 2I55A 3C1OA 4QYSA 2MMCA 1FFDA 1UOPA 2RHGB 2Y1WA 4ETMA 1VKHA 3CN9A 3MCZA 4KI0A 5FR2A 4P0PB 1VG0B 1YC2A 5KHOC 4MLCA 2H5LA 4NBUA 2X86A 2HYDA 3HY6A 4G0ZA 5I7VA 3DYIA 3I2KA 3BBPA 4HNHA 3URKA 5FPYA 3D31A 3K6SB 2XDYA 3CQ9A 3V33A 4PLCA 4QRHA 3WYGA 4D9BA 2XAUA 4DPLA 3KHKA 4P80A 3EIXA 4YR7A 2LGJA 5IFKA 3ZCPA 3HSKA 4WAUA 1G20A 3PICA 3V8RA 5EWMA 5EQJB 5I4KA 2Z2JA 1OWLA 4J0DA 1W88B 2BFCA 3IKJA 4QUAA 3HRIA 5NULA 2YHUA 1X19A 4MR9A 3IJEB 3G2QA 5L4NA 1SOWA 2HRRA 3EQ8A 1MH1A 3F67A 5E38A 2I5PO 2VT3A 4YQEA 3JQFA 1CUIA 1GADO 3I2FA 3UJHA 2YQ5A 3D3WB 1GUDA 3KTFA 4RO0A 4PFQA 4ZQHA 2ORWA 3NB0A 3ZCXA 1DIHA 2ZJ1A 1W6RA 2GEJA 3UKJA 3ED1A 4YRRA 3FHCB 1E5QA 4L4YA 2BSAA 2FEWB 2OORC 2ZAIA 3NIBA 1IJKA 4XQ9A 1O5TA 2UV8A 4R8SA 1JKMA 5SZHB 4MW7A 4IHKA 4J2TA 1N8NA 2QJFA 2QRQA 2X0KA 1TUBA 2FPIB 4HYTA 5LYYA 3RJTA 1P9LA 1YF3A 3RC2A 4N3CA 2GM4A 4J0CA 1ISJA 3FNIA 2R85A 1BA3A 2GKSA 2HJWA 1JFFB 4HVCA 1KK0A 2BMFA 3HKCA 1NLUA 3L92A 3R7WA 3SLKA 4R2HA 2D00A 4KW7A 1QAOA 3ZDYB 2R8YA 2JFXA 5G41A 1H9BA 4BVKA 1P7ZA 3BWVA 3UYLA 4UUOA 4DA9A 2P6UA 4JL6A 1CZNA 1QPGA 1C3OA 4GBGA 3PQEA 3FMFA 2CUKA 3VHRA 4REQA 2MSKA 3R9XA 1KARA 3NMUF 5LIRA 3S7TA 1I94B 1KDRA 2IP1A 3UF0A 3QA9A 1BD3A 3HACA 5BSGA 3ZUGA 4YAFA 1ESEA 2VNHA 3ZHBA 4NK5A 2AVNA 1P2UA 1NJ1A 3KT6A 2FSVC 1LSSA 1ZHFA 2A0FA 5ICEA 2PR2A 1G8GA 2AJLI 3CRQA 4REQB 2BEWA 3ICVA 5AJVB 1N9ZA 2BGGA 4KXNA 4WY8A 2FZ5A 1RC1A 3OLVA 5AKYA 2P2YA 3OFND 4GSYA 2AZXA 3Q87B 4CF3A 5MGBA 3S2GA 1M2OB 2FG5A 4MRSA 1EVEA 2EZ9A 5C81A 1OBFO 2HA6A 2W83A 3DNMA 3H6GA 1D4OA 2Q8PA 2W2MA 3DDSA 3L1IA 3QHAA 4K8OA 4OL0A 3UATA 3CMMA 3V6LA 4EJ2A 1O4VA 3OQ6A 1IBCA 3LY9A 5T6BA 1FQWA 3DMGA 3ZCSA 2AMJA 3AM4A 3EXG2 3A11A 4GPD1 2DQYA 2EW1A 2PFGA 1FJXA 1MDFA 1SVUA 1JHVA 5LDDC 4X84A 2JAUA 1GNSA 4NIMA 1FTWA 3OIVA 2ID4A 4E1AA 4RZSA 4PZYA 1QGZA 5K6RA 1XLTA 5CCEA 4W5QA 3AEUA 3QVGA 4YWHA 4TRNA 1GU0A 3SEZA 4DL9A 3HCOA 3TQSA 3C3KA 1Z6QA 3KOUA 3MJDA 3BHNA 2IXDA 5CIWA 3QWHA 3DBHA 4OAPA 4X7MA 1JSRA 4O2AB 3KXIA 5AJXA 2PL5A 5EJGA 3TZQA 3HZRA 1MA3A 3EMDA 4QXQA 4KYUA 3HCDA 1SUWA 2OYCA 3D4IA 2DHQA 1JILA 2ZU0C 1VKJA 1YHZA 4TGLA 10MHA 2H2FA 3AUKA 2GNOA 3PDHA 3Q7IA 1I4OA 1ST3A 3ZHRA 2D7JA 3ISVA 4CIXA 1DTEA 1X0VA 4Q3NA 2F8MA 3KPVA 2VIIA 1ILEA 3A9RA 1QC5B 3EWNA 3OSUA 1ODTC 5I9BA 4BFTA 5KYYA 2FEPA 4GPAA 1KQOA 4IKOA 1CR2A 3ES9A 3QFHA 5DMXA 4PO3X 5ERYA 3OO0A 1QIDA 3P52A 1RMYA 1SCQA 5K1ZA 1ZEJA 1YSCA 4CDMA 2FXVA 2IW3A 1W2WB 2B1JA 4L74A 4CG2A 3G02A 2YZNA 4GLLA 3N2GA 4W5JA 1FRZA 3IPRA 4U2FA 1MB2A 4GDFA 3AM5A 2W43A 1M0SA 3DVLA 1ZOLA 3G2OA 3LRPA 4JT8A 4Q3EA 4ALJA 3DGEC 4UDYX 3CB2A 3LC7O 4XUGB 1YULA 2IQIA 3LF1A 5EE0A 2OILA 2R4QA 1AN9A 1VSQA 2QRGA 3GQVA 4F21A 1KSJA 3BQMB 3HH8A 3QOYA 4HDSA 5TPWB 1QU2A 1IJEA 2VF7A 4DMHA 4WDRA 1DAEA 5DLEA 2B99A 1NXXA 1D2GA 1KO8A 4H15A 3U56A 3TZEA 1C7EA 3A8TA 3ZR4B 5EPUA 1N8KA 5KVVA 4BIIA 2FP4B 3KJFA 1PLLA 1HR0B 1X7ZB 4TTSA 2BKAA 3ETCA 1VBKA 4I4TA 4MQEB 4PHFA 2YJZA 4K5QA 1SU6A 1DJQA 4RVOA 3C41J 1UUFA 4ECEA 4UVGA 1M0EA 3DMHA 4EEXA 1R16A 1PYDA 3KSDO 3CUUA 5IH7A 2I03A 3CG4A 2B9EA 2AR7A 1CTQA 2XAAA 3P0IA 4IF6A 4KLZA 4QBGB 5E9WA 4HTFA 4PLPA 1HY3A 1SCKA 2G4LA 5JDIA 2PKCA 1Z5PA 2O2IA 3PXGA 5K0FA 3SWWA 1SVNA 5CXUA 3QE3A 3E23A 3RFCA 3ZZUA 2X2EA 2HJSA 1UJBA 3BJEA 4F3YA 3TIFA 3EPKA 2CWDA 4KPEC 2GRAA 3T3MB 4YCCA 1WXEA 3GROA 4Y1RA 2NGRA 5LXTA 5CG2A 2QYHA 4Q3CA 1UBLS 4KIGA 4LGYA 2QT9A 2NYRA 2XNSA 3QVSA 1EUDB 1A5AB 5HZMA 1NUAA 4EZBA 2C92A 5DLDA 3OCVA 3DL2A 3AEQA 2IXTA 1G3MA 3K4PA 3Q3EA 1GPMA 1PZFA 1JB9A 4Y6OA 5D5QA 7AT1A 4O4IF 3I9JA 3KAKA 3OFNA 5ALGA 2OLEA 3WOVA 3TQQA 1Q7GA 3HB1A 3H18A 3TK1A 2QQEA 4MH0R 1YA8A 3E2IA 3E4CA 3QG5A 2A59A 1YK1A 3IL2A 4RE6A 3IMFA 1M6VA 1T3GA 3UHPA 2D2XA 1OJLA 2A1IA 3K0AA 2WD7A 4OMCA 4PVDA 1VKRA 3N8NA 1I10A 1GQSA 2EARA 1KC1A 4I1UA 3K1JA 1Q77A 3I64A 1LX7A 2WQZA 4ARCA 1Y5IA 3D0KA 4UE3S 1JBQA 5ABPA 1XJQA 4L5JA 4M99A 1R9GA 1VKNA 3H86A 1XPRA 1GL6A 2PKWA 4Q3BA 2IIPA 1A69A 5I6DA 5JECA 4NHEA 2BAGA 3DOCA 2WWYA 2HBYA 1PK8A 4NV1A 3T7DA 4GLFA 3SKXA 2F7SA 4CMJA 4JOQA 2C31A 3RC1A 3I1FA 3ZWBA 4CFZA 4D97A 4MQEA 3WNDA 2ZBGA 1N3YA 4C6RA 1EFDN 1H4TA 2B78A 3EXHA 3P4YA 3OOSA 4KQWA 1DJOA 4MV7A 4PEVA 4R9RA 3OZXA 5HF5A 4L02A 1XKXA 1T0PA 3M6XA 4CEIB 5LPNA 3EBLA 3KDPA 4RKWA 4CM1A 1YVPA 4CEIA 2VO1A 4Q1AA 5D51S 1SCUA 5F73A 3RVJA 4L0MA 4UVDA 3L6DA 1NM5A 3K0KA 4PR3A 4HEJA 3G59A 3WIVA 3EZYA 1VP3A 2DBQA 4MKIA 1H05A 2A1UA 2ZJAA 4GRAA 5AHRA 2PV7A 4LZNA 3RBZA 3CLRC 3QW4B 1F60A 1GYPA 3CT6A 4LVNA 4KR3A 1TCCA 5JG7A 5LIPA 4ZD6A 5JXWA 1U7ZA 4TLAA 2IEZA 5BN5B 1GN9A 3BD8A 3IV9A 2GN8A 1V5IA 3HJTA 4AY4A 3IOBA 3T7IA 2JKVA 1ECGA 2WUVA 1ZJ4A 5HKKA 3RG2A 3CVUA 2JFUA 1E20A 2FLVA 3PB3A 1EU1A 1FJHA 2CE2X 4IDPA 4NBSA 4BO9A 3R23A 1E7WA 3ELWA 1HDOA 1NQUA 1TLLA 1JWBB 4TWJA 4DKXA 5KHLB 2ZI7A 2J0UA 5GWXA 4JEUA 4FYIA 1QHIA 2GBPA 4HAZA 3EB9A 3QMPA 1X1CA 2Y66A 5C80A 3HNOA 4KQEA 4M60A 5ENZA 1Y7IA 3IV7A 3WKAA 1XEWX 4KWCA 2P4HX 5G4KA 1ZCAA 2PKRA 5HZHA 2J0QA 3L7AA 1GA4A 1EUDA 1XZPA 1YKSA 4Y2XA 1DRKA 4ZXPA 4EHJA 2P9YA 5ALPA 5EE3A 1RQNA 3CWZA 4EW1A 1HFJA 1T3SA 2HBQA 1EZ4A 1YL6A 2R97A 2YWGA 3KQMA 3IQFA 3KYBA 5FYQA 3THRA 3IMEA 1DUVG 1AF7A 4P7JA 3U62A 2IYUA 4XW2A 1GAEO 5A7FA 1J2YA 2X9QA 3A05A 3RARA 2UDPA 1ZMXA 3E7WA 4JGGA 4U7FA 1BE1A 4MS1A 3W5BA 3N5CA 1AZWA 4PBTA 1P17A 1SEVA 3E0XA 3H0EA 4QPPA 5EKUA 1R4NB 2GM9A 5H70A 3CPJB 4YMSA 4OXIA 4JJFA 2JEYA 1NI4B 4GICA 4PICA 5KX5F 5J23A 1LDEA 4YK7A 4X7RA 3IERA 4J0IA 1W85B 1JHPA 1NQ5A 1WAMA 2PKYX 2XA1A 4M0LA 5ALZA 3RU7A 3SDSA 3ZHYA 1CIPA 1ENZA 1YS1X 4P38A 2O52A 1SD2A 3HU2A 4FNGA 4PANA 4S3MA 2L0XA 1NHGA 1SZDA 3DEHA 1QIKA 1NXPA 2JLCA 3Q8WA 1EJBA 3SFTA 3IP9A 2EGHA 4IQ8A 1J90A 1U9YA 2WNHA 2QZ9A 3WSWA 3I3OA 2LRHA 3LV8A 1XMPA 2G7ZA 3QLEA 4P7FA 3WFIA 2WHPB 1B1AA 3P97A 2G72A 3SDZA 2QD2A 3VX4A 1NV8A 1CZUA 4I14A 5FUMA 1B76A 4DTIA 1YRBA 3I5AA 2BFDB 4KCGA 2JK0A 2ZRPA 1BHQ1 1RZ3A 4LZLA 5JRZA 3KOZA 1IZ0A 3HI4A 5K8UA 4NDNE 2CDCA 4JI8B 4PFKA 3HVKA 4HWKA 3FSJX 3S8EA 2WV7A 3P2MA 1U0OC 2NO4A 2P7IA 3P20A 4WNAB 5EP3A 4AKEA 1U2RA 4C78A 1FVFA 1SXJB 1GY8A 3V9PA 3GPBA 4RPGA 4Q93A 1J0AA 4XQEA 4OHMA 3RKUA 1Q84A 4M87A 5DSZA 4D44A 3KQUA 5AESA 4L6CA 2FJPA 4CQMA 2NMVA 2G08A 3RRXA 1CZLA 1OI3A 3B6MA 1ZBQA 3WQHA 1ORTA 1A82A 1X94A 1G6KA 2HXSA 3NHFA 3PR2B 3E9MA 2ADOA 2HK7A 5SYMA 1NKSA 4DA6A 3WJAA 1P19A 3AV3A 4BKQA 4KQ6A 4EO9A 2VS1A 1HOTA 2QLBA 4LJ5A 4ZEOA