1JR4A

Catechol o-methyltransferase bisubstrate-inhibitor complex
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
212
structure length
212
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CATECHOL O-METHYLTRANSFERASE, SOLUBLE FORM
publication title X-ray Crystal Structure of a Bisubstrate Inhibitor Bound to the Enzyme Catechol-O-methyltransferase: A Dramatic Effect of Inhibitor Preorganization on Binding Affinity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 87
structure length 212
sequence length 212
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2001-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jr4A00
2YQZA 2P41A 3EGIA 3SM3A 2C7OA 2ESRA 3HA3A 1TPYA 1QYRA 3BGIA 3C0KA 2YUIA 2R6ZA 4ER3A 3LDGA 2C7QA 2OZVA 2JHPA 4JXJA 2CMGA 4GOLD 4U7PB 5K09A 5K0NA 2ZVJA 3P97A 3E8SA 4FGZA 2JH9A 2BM8A 4MWZA 1KR5A 5DM1A 2PJDA 5DTMA 4EK9A 1NT2A 1BKYA 1X1DA 2B25A 3DR5A 4R05A 3TPZA 4C07A 1XCLA 2P1DA 4L7VA 4V0QA 2BR3A 5U4XA 3LL7A 1XDSA 4R8SA 4ZTBA 1NE2A 2P8JA 3LKZA 5B1SA 3KQQA 3GIWA 3ELYA 3GRZA 4HSGA 2HWKA 3FRHA 5DXAA 1X1CA 1JQ3A 5F2NA 2IH4A 3T0IA 3TR6A 3FRIA 2ZBQA 4E30A 3HA5A 2O57A 2NP6A 5EEHA 3CBGA 4QDKA 1FP1D 4XCXA 2PT6A 3M4XA 1RI3A 4BLUA 4WVLA 2ZZMA 1JG1A 2FK8A 2ZLBA 4OBXA 2ZZNA 5D1NA 3BWMA 1R00A 4RTNA 4IV8A 3GGDA 2ZBRA 3HP7A 4ER7A 4YV0A 2ZCJA 3KU1A 1M0EA 2UYQA 3EEOA 4PGGA 1NW6A 2FK7A 3SMQA 4PWYA 3KPWA 1NW8A 3GDHA 3KPVA 4QVKA 1R74A 5K0LA 3PB3A 3QOXA 1JQEA 3EMDA 3PT9A 3AJDA 1JG4A 1KXZA 1UFKA 2QYOA 1ZHFA 1B42A 3A27A 3LBYA 4QPNA 3PX3A 4KIFA 4R8RA 4RX1A 2UYHA 4YUVA 3UJ9A 4GQBA 3BXOA 2C7RA 1G38A 2HR1A 2UZ4A 5EHIA 2YXDA 2ZULA 3O4FA 5EPEA 2VDWA 3MAGA 4EKIA 5LQRA 3TM5A 1KIAA 3G89A 2NP7A 2IIPA 3ME5A 1FP2A 4AZVA 4AX8A 1SUSA 2NXNA 3OU6A 2H11A 3EVCA 4LG1A 4PYOA 5GP1A 2VZ9A 1SQFA 1AQIA 2NNWB 5ICGA 3DMHA 2CKDA 4XUEA 2XYRA 5E9QA 3CC8A 3SSMA 3UWPA 3THRA 4BY9E 3P9CA 2CMHA 4GC9A 1EJ6A 2ZIGA 3TM4A 1KPIA 1T43A 1RJEA 3PS9A 2B9EA 4U7TB 5H02A 2I6GA 3CGGA 1L3CA 1ZGJA 2HNKA 3I53A 4BLWA 3FTEA 5C9ZA 2EX4A 4YUZA 2FPOA 3PFHA 4PIPA 4AZSA 3DOUA 4FT4A 3LKDA 2OBFA 1O9HA 5EVJA 3IYLW 2AOXA 1U2ZA 4MHTA 4PYJA 4CWAA 1RI2A 3PX2A 2Q41A 3E23A 3I58A 1V39A 3GRVA 4OQDA 3ER9A 4CKBA 3V8VA 5F2KA 2JG3A 4YV2A 2UYCA 3C3PA 4RSRA 3BWYA 3VC1A 1XDUA 2AS0A 2EJUA 1MJFA 3HCAA 3I5UA 3NWEA 3Q7EA 4PYKA 3G2OA 4EMSA 4RTJA 2WA2A 3TMAA 2PT9A 2P40A 3BKXA 3FTCA 3HCCA 3G2PA 4BLVA 5K0JA 8MHTA 1WS6A 5DSXA 3P8ZA 4O29A 3ELDA 5T67A 3FPEA 5GOZA 3TKAA 5K0EA 1P39A 5CIYA 2GH1A 3G88A 3LSTA 2OKCA 1M6EX 5HILA 4YV1A 4RTMA 7MHTA 1IY9A 1H1DA 3DMFA 3KPJA 5K0CA 2PVCA 2P3QA 4AZTA 3UJ7A 4EQZA 2EJTA 2BZGA 5CUQA 1KHHA 3P2IA 4X63A 2VDVE 2IH5A 3SSOA 4CTJA 2AOUB 2PX8A 2ORED 4CKCA 3NVMB 3NJRA 3LDUA 1F38A 3DUWA 2K4MA 3JWJA 5CVVA 3BWBA 3MCZA 4RYLA 1RJDA 5K0BA 2IGTA 3MB5A 2GB4A 3CJTA 2FHPA 2BR5A 3FPHA 3DXZA 4MQ4A 4DCGA 2G71A 4E2XA 2AOVA 2AOWA 3EVEA 3FZGA 4M38A 4E2YA 5ICCA 5LSAA 3KR0A 3L8DA 2C7PA 1DCTA 1QAMA 2JH8A 1ZQ9A 2F8LA 2AOUA 2PXXA 3A26A 4ISCA 4PYIA 1I4WA 1NBIA 5EKUA 5C1IA 3P9NA 4OBWA 3R3HA 2QM3A 2QRVA 1FBNA 1JTEA 1P1BA 5DM2A 5DRTA 4E70A 4HGZA 5DXJA 4CKEA 4OA8A 5CCXA 1KPGA 2AZTA 4C08A 1INLA 2NYUA 3LCUA 4KIGA 5E2AA 2PX4A 4GC5A 4R6WA 4FT2A 1O9GA 3ELWA 3NWBA 5CVUA 5FADA 4MIKA 4GF5A 2IBSA 4RTOA 2EG5A 2XVMA 1P1CA 4FP9A 3R24A 3M6XA 4RV9A 5EG5A 4F85A 1EG2A 5E2BA 3IEIA 4OQEA 5ERGB 3EVBA 3OU2A 3MTIA 4X61A 2OYRA 4RTKA 3P9IA 4ER0A 1YFJA 5GIPE 3CVOA 3JWHA 1FJXA 2AN3A 2I62A 4M37A 4E33A 1ZKDA 2IDKA 3LBFA 5KYGA 3X0DA 3FTDA 1JSXA 1L9KA 1XXLA 2ZWAA 2ADMA 1L3IA 2PX2A 5KQRA 1G55A 1EQAA 3IHTA 1XJ5A 3VSEA 5DM4A 1NW7A 2Z6AA 2YXEA 3SSNA 4AUKA 3NVKI 2NXJA 5EOVA 4DKJA 3JWIA 2PXAA 5CVJA 4C05A 1RJGA 2E5WA 4A6EA 1G6Q1 1R6AA 2AN4A 4AZWA 5HOQA 5HZMA 2AN5A 5G02A 4DA4A 9MHTA 4EVIA 3M6WA 5JUWA 4V0RA 5FWDA 4KWCA 4PYLA 5GM1A 2ONYA 3GRYA 4R6XA 2PWPA 5ICEA 2QY6A 4RTPA 3A7DA 3B89A 4QQKA 5CM2Z 1MHTA 2ZFUA 3B3FA 4E2WA 3GWZA 4PINA 3FPGA 5HIKA 4KRGA 5EEGA 1JQDA 3DULA 3KPYA 5C0OE 4OA5A 5EIFA 3KQWA 4PYMA 2YX1A 3HA7A 2V7EA 5EC8A 2BH2A 3O7WA 3SGLA 3KQVA 4HRAA 5DX0A 4PYNA 3EVZA 3BZBA 5E1MA 5FCDA 3PVCA 4MTLA 1DL5A 2G1PA 1WZNA 3JWGA 1ZG3A 1XVAA 2P35A 3R0QA 3HVKA 3A4TA 3KR9A 4P58A 4RVHA 3HCBA 1QANA 3I9FA 4C06A 2P7IA 3FTFA 3EVAA 3HCFA 4E31A 1PJZA 2B78A 4RTQA 3E7PA 4HGYA 2UYOA 3QOWA 4KVZA 3OFJA 4B17A 3UJ8A 3CCFA 1OR8A 2BR4A 2FCAA 2NXCA 2ZIFA 3DH0A 3FUUA 4HTFB 3VC2A 3ER8A 3HTXA 1YF3A 3MTEA 4K6MA 3T7SA 2OPBA 1NKVA 1YUBA 4FSXA 5GWXA 4ATNA 5FA8A 2P3LA 4DM3A 2AR0A 3KHKA 5E9JA 2OB1A 3TKYA 3BGDA 3LGAA 3U81A 4RTLA 1IXKA 1R8XA 1PRYA 1I9GA 1ZGAA 2ZSUA 2CL5A 3R6TA 4HTFA 2IPXA 1KPHA 2YTZA 2IH2A 3OE4A 1BOOA 3T7TA 1YFLA 1EJ0A 1JG3A 5DPMA 4GBED 4YMHA 5FHRA 5LQNA 1XCJA 2PBFA 1JSZA 5DM0A 5FA5A 5DX8A 3MQ2A 4RTRA 3EVDA 1WG8A 3C3YA 3M70A 3HVHA 3LHDA 4PIMA 1SG9A 1EAMA 2V74B 3KQSA 5E8JA 3TFWA 5BW5A 3MCTA 1AQJA 3FPJA 3GO4A 4P7FA 5T6BA 3BWCA 3LPMA 4DF3A 3T7RA 2Y1WA 3GRRA 2YR0A 5LQUA 1BC5A 1WY7A 4PGHA 3V97A 1TW3A 3ID6C 5ICFA 4E2ZA 1G8AA 4LECA 1P91A 1DUSA 2PV0A 2VP3A 4HH4A 5KS2A 2IBTA 5BW4A 5LQAA 1VLMA 3G7UA 3OZTA 5EZSA 5EMKA 3UA4A 1D2GA 3BT7A 3HCDA 3GJYA 5FTWA 2GPYA 3G8AA 2QRVB 3P9KA 1X1AA 5IH3A 1HMYA 1Y8CA 2XYVA 1TW2A 2BM9A 1VBFA 3H2BA 5DRYA 3GCZA 1JR4A 2ZTHA 2LD4A 5F2OA 2YVLA 4DZRA 3DXYA 5EMLA 4QVGA 5LQJA 3QV2A 2FRXA 4GOOD 1VP3A 2N47A 3CJRA 2O06A 1BHJA 4FR0A 1M6YA 2G70A 3PLAE 1N2XA 3B5IA 3G2MA 3OFKA 4X60A 3REOA 3MERA 4PYQA 3NTVA 2P7HA 3TOSA 4QPPA 4ER6A 3B3GA 1FPQA 5EHGA 3RW9A 2Z6QA 3CKKA 4FSDA 3OU7A 1IM8A 3THSA 5K0FA 1N7IA 3UFBA 4GOMD 3AWIA 2ERCA 5IKMA 4DCMA 2B2CA 2AOTB 2VDUE 3HEMA 4Z2YA 2Y1XA 4NECA 5FQOA 1EIZA 1R18A 2DULA 3G8BA 1VIDA 3KPUA 4M36A 5EIWA 5D1HA 1NW3A 4CTKA 3Q87B 5DX1A 3C6KA 2FYTA 1SKMA 2ZW9A 3AY0A 3RIEA 2AVNA 1JG2A 3OCJA 3G2QA 1N7JA 1Q0SA 1VPTA 1AF7A 1NW5A 3PFGA 2I9KA 3I64A 1I1NA 5FQNA 5K8VA 3MHTA 2XBMA 2AOTA 2GLUA 4QDJA 4WXHA 3E05A 3GXOA 4QTUB 5LQKA 3M6VA 3DP7A 2G8NA 4BP1A 3BUSA 2JJQA 4XUDA 1SQGA 5E9WA 4ER5A 4RVFA 2A14A 2ZIEA 2HV9A 1L3BA 1SVUA 3LX6A 4Y2HA 1JTFA 1YB2A 4PONA 2WK1A 3M6UA 2VS1A 2PWYA 4E32A 2B3TA 3LCCA 5HIMA 3OZRA 3EEYA 3UJDA 5BP7A 3B7PA 3VYWA 3R9XB 5EQJB 5GIOE 2PLWA 3P2EA 3UA3A 3HNRA 2WA1A 3SR4A 1O54A 3FUVA 4HG2A 4YMGA 3KKZA 4GOND 3ANXA 1KYZA 3A25A 3MGGA 1L1EA 1SUIA 4P7GA 3EVFA 5FULA 3S68A 2CWWA 3RODA 5K03A 3DLCA 3ORHA 2KW5A 2IDJA 3HM2A 1WXWA 3D2LA 2XYQA 3BKWA 4A6DA 3FPFA 5E8RA 3P71T 5JR3A 3UZUA 3AXTA 2HTEA 4IWNA 1X1BA 4QQNA 4KDRA 5M5BA 2Z6UA 4PCLA 4YUWA 5E1OA 3UJAA 3PTAA 4RVGA 1AV6A 3C6MA 4H0NA 4LWOA 1XDZA 3CJQA 1YZHA 3SXJA 4YUYA 4OX9Y 5FUBA 2IFTA 4M7RA 1ORIA 4DQ0A 2IP2A 1G60A 3LECA 3K0BA 3DMGA 5DLYA 3LDFA 4LWPA 4HC4A 5EMMA 5P8WA 5K05A 1UWVA 2I7CA 4Y30A 5GINE 1R8YA 5EMJA 3A7EA 3G5LA 4IKPA 3BGVA 3FYCA 3O31A 4GEKA 3ELUA 4QTTB 3EVGA 1RI5A 3OZSA 3OE5A 5LR6A 3AXSA 3EGVA 3TQSA 5HIJA 4P7JA 3UJBA 2OB2A 1RI4A 2PXCA 5BXYA 4X1OA 1Z3CA 5DT2A 3NDIA 4PNEA 1VL5A 1NV9A 5DTRA 4CXMA 3KQOA 3NDJA 5HEKA 2DPMA 3FUTA 3KQMA 3UJ6A 3KR1A 5MHTA 2O0LA 3SVZA 3GU3A 1KP9A 2EFJA 1ORHA 2O05A 1QAQA 1WXXA 2AVDA 3G5TA 2ZWVA 3KQPA 3P2KA 4KW7A 5DSTA 3LCVB 5HIIA 5CD1A 1X19A 1HNNA 2P3OA 5DTQA 3M33A 1QZZA 3EPPA 4YUXA 4GUAA 4RVDA 2GS9A 1G8SA 2OO3A 3DLIA 4C04A 3TRKA 1F3LA 5FHQA 4C03A 5EZQA 1XTPA 4UOEA 5E1DA 1VP9A 2O07A 4KDCA 2YXLA 3KR2A 3B3JA 2G72A 2JHAA 1QAOA 1Q0TA 1YZ3A 5K0GA 2GA9A 4BP3A 5CCBA 5KVAA 1D2CA 2ZZKA 3GRUA 5EKXA 1RI1A 4IV0A 1NBHA 2PKWA 4POOA 2HMYB 1UIRA 3GNLA 3NW9A 3FUWA 3OPNA 3DXXA 4X41A 4C4AA 5DWQA 3WSTA 2GAFA 3KQYA 2PX5A 2XVAA 3NMUF 3DTNA 5T64A 2NXEA 4FS8A 3IV6A 5CVEA 3EGEA 2PSSA 5CVDA 1VQ1A 5HFJA 1VE3A 3SX0A 1D2HA 3HVIA 4G56A 2QE6A 2OY0A 3KQTA 3UBTA 1NV8A 3ERCA 1KYWA 5GM2A 3EMBA 2H00A 5FWAA 4P7KA 3UJCA 5KQSA 5LQCA 2PY6A 3FYDA 4F84A 4RTSA 3TLJA 2ONZA 4XUCA 3F4KA 2JHCA 3FUXA 4FZVA 4RWZA 4F86A 3HCEA 4PCAA 3K6RA 4EKGA 5EGSA 2ZBPA 4DMGA 1RJFA 10MHA 3HVJA 2OXTA 5K01A 2R3SA 2H1RA 2PGXA 5E1BA
chains in the Genus database with same CATH superfamily
1HI9A 2JASA 1YONA 2X5XA 2O4CA 1U2SA 3UMVA 4OL0A 1UQUA 3U3KA 1R9JA 4LJSA 3VR2D 1TUBB 3Q6IA 2EU8A 1EWYA 1G1AA 4JUIA 3RTDA 4JXJA 4OHOA 2Z8YM 5E2IA 3A6DA 3F6RA 3LCJA 2C2KA 4PY2A 2J6IA 2JH9A 2OAQ1 1P3JA 4V2IA 4X44A 1L6RA 4Z86A 3T7DA 2HPVA 1ZR2A 3AKCA 1F51E 2YV2A 4PPNA 2QGZA 3TPZA 1XCLA 2WTBA 3DOIA 1FXSA 1L7MA 1GADO 2HF7A 2H1CA 3KVOA 3SBEA 1VA5A 1USUA 5CA0F 2I3DA 4XOUA 3MW8A 2PXHA 3C3CA 4OUDA 2EFEB 3S2EA 5BUSA 1YZGA 2QMYA 4BO8A 3HUUA 1XLUA 1OOEA 2CVFA 4XWKA 1UPUA 4OUKX 3TR6A 3EISA 2ZBQA 3CF6R 3LUAA 3RNLA 4DVJA 5IT5A 3RFVA 1UJCA 1XNGA 1PUJA 1K08A 1SZPA 4U2EA 1U7TA 3QTTA 2NSHA 1BS9A 3DKVA 4OQMA 1S0UA 1G21E 4DQUA 4CIAA 2CEAA 1I2BA 2F43A 3EIOA 4EHLA 3QI2A 4BN0A 2ZCJA 4KLNA 4YMWA 1JJBA 1E3LA 2BI4A 1EP1B 3PYMA 4IIUA 4CFSA 2YINC 3IS3A 1WPGA 1QP7A 2AT1A 1YD7A 3KYBA 1EFHA 5A04A 3WR5A 1XGKA 1ZISA 1W8DA 4EEZA 4FYXA 1XZLA 1WTAA 1KKLA 3EW9A 3VNQA 1OFUX 5A62A 1SCUB 2C2WA 4X90A 3EXHA 1KEKA 1JLMA 5TC4A 4LK3A 4M0MA 2QZPA 3AI3A 3C4QA 4MVJD 4ROTA 5KNCA 3EUAA 3EH1A 3F5QA 1JSCA 4PNHA 5ALRA 2ZULA 3KOUA 1DEXA 2OAEA 3FFWA 1FVFA 1W36B 4YRTA 1B6GA 1N57A 4BLTA 3LT2A 4LJ8A 1BA2A 5BT9A 1QIMA 1OLSB 3BXEA 3G0DA 4L6IA 4PYOA 1Q7TA 1UK6A 3R76A 4DDVA 5B2EA 2NNWB 3I2KA 2AG8A 4KB5A 4GYJA 5CH3A 4MI3A 1CIJA 2EF1A 3PV0A 5F7JA 5BR1A 3THRA 4PQYA 4IRMA 3WYFA 1VPLA 2ZRJA 5H3CA 3I12A 4OJYA 2B9EA 1DAIA 1NI4B 2H9IA 2I6GA 2SKDA 4BVLA 4D74A 5CEJA 3KSRA 4C9BA 4F1WA 1Z4NA 4MUJA 4YUZA 2O8DB 5LFAA 4AZ3A 2FPOA 3PFHA 4YT8A 3U09A 3BXPA 2WICA 1FE8A 2OMKA 4G1FA 2HRDA 4P3XA 4K8RB 2WV7A 4RHYA 5CCDA 1TVKB 3EEQA 3JX9A 1D2MA 2P9CA 2Q7OE 1NFFA 1QHYA 2XBUA 3KAJA 5AM1A 4BECA 3ICQB 4LQLA 3PI6A 4DLWA 4MKXA 2Y0DA 3DNMA 1J5EB 2BGTA 4QBTA 2PWAA 1KAMA 3JZDA 5F1KA 3NBYC 4OK3A 2YCLA 1U94A 2XMPA 4MGKR 5KQGA 2QYSA 1GY8A 3OZDA 3BXZA 3FTCA 3SE7A 2EQBA 2PA3A 1VHQA 3QU2A 2FG6C 4W4TA 1KVUA 2HD4A 3KLBA 3P8ZA 4M86A 4O29A 3TCXB 3GNSA 3N5CA 5BQOA 3VHXA 4NMMA 3H5RA 4UHFA 1AZTA 3W2TA 1FYDA 1YBMA 3KU4A 5GONF 1ILEA 4HYYA 1IY9A 2DP4E 2HSDA 4M1ZA 1GTJ1 4LQCA 1QIHA 1X8XA 1FS6A 1U1DA 3KKQA 5BR7A 2E9SA 2V96A 4I1VA 2C3UA 1CVRA 1GGKA 2D3WA 2EJTA 3OMWA 4R2WA 3RCBA 4AY3A 3EHEA 1JDVA 4GMGA 4FW9A 5FO0A 2ETVA 2LIVA 1C1XA 1A9SA 4ZA2A 1M75A 4IOJA 2LW7A 2ZB7A 3B78A 1ISIA 2I2XB 1T3TA 2NUAA 3W34A 4ZYLA 3NJRA 2QRUA 3K94A 1XJ0A 4ZQCB 4LF8B 1N5IA 3FF1A 2GB4A 1P8JA 2I6QA 3FB1A 1AUQA 4Z9YA 4JP8A 2FHPA 4CIXA 4Q1FA 2PPVA 1QF6A 4CEJB 1Y42X 2HWXA 2G71A 2KYRA 3ZC3A 2AOWA 4CKEB 2BFNA 3UCFA 3GLUA 1QONA 2CLCX 4NBSA 1OU0A 3R5XA 3DMRA 5JYBA 4PYIA 3SDSA 1IZYA 4DYVA 4EL0A 4M7WA 4B6OA 2IHJA 1YQWA 3RJZA 3S55A 2WFZA 3GJ0A 6LDHA 3L8YA 1SVNA 1OYVA 5CIWA 4YRZA 1KEEA 4R3NA 4CG1A 4UCQA 4RGBA 2QDXA 2J67A 4PLVA 1NJ1A 3L5OA 4RC9A 3A36A 1DT3A 2HWUA 3CM0A 4MIYA 2HZBA 2ZYWX 3JARB 2BFCB 1KAHA 3ITEA 5E2AA 3V9AA 2IBSA 1XEAA 3Q8XB 3PKIA 1X7ZA 1B73A 1PW5A 3AVPA 1G2IA 3BMNB 3LQYA 4KN8A 4ZEVA 1DP4A 4QBKA 3ZCXA 3P2OA 1LPSA 1T5BA 2JEYA 3DEIA 1J0DA 2NTNA 1G8FA 4OGWA 1JLLB 5D5HA 3OT4A 3RS7A 5JSQA 2RHOA 3N7TA 4UMVA 5J2TF 5GIPE 1RS0A 4FOPA 3PKJA 1EINA 1ZAKA 3GRAA 2ZSKA 3ZCTA 4GR5A 3LBFA 5M2QA 1UBTS 2OWDA 2YZNA 1DKUA 4TQGA 4W7HA 3NBFA 4IXWA 2ADMA 1T5SA 1WF3A 5EE9A 4WXRA 3EZNA 4J76A 3T8YA 1CZOA 1DKQA 2P2DA 2FFJA 3KUCA 3Q7IA 5HKBA 3WGUA 1PGOA 1EA7A 3BE8A 3W77A 4ZRNA 1VHDA 4MGYR 3NT5A 4DDTA 3D8HA 1RJGA 3WRYA 4A6EA 4DA4A 3GEDA 4DFDA 4FQ5A 5IHPA 2RCYA 1U3TA 3KYIB 3QP9A 1BX0A 2H1LA 3BB4A 2VO1A 5FB3A 4R6XA 4M8IA 5J23A 2PO5A 2ZTUA 4QQKA 1MHTA 1RWMA 2PS9A 3Q40A 2HRQA 3GVCA 3CUKA 3KEFA 2HJHA 4RADA 3HVUA 1BEZA 4RY9A 1M6WA 3F47A 1KZYC 1T25A 2AZDA 1U6KA 3JWEA 3NBXX 4P7BA 3W3AA 2C5LA 3MQFA 2ZWPA 3CE6A 4M0KA 4CQLA 3LPLA 3DEHA 2CVPA 1U7OA 2WJPA 2XDAA 2Z5LA 4RPJA 3O38A 1L6IA 4A4DA 4PAMA 1T3GA 5FI1B 1X70A 5EP1A 5B30A 2HGSA 4MV3A 5TNXA 2FP3A 4ILKA 3HO8A 3A4TA 2VHJA 4RVHA 1JPUA 1TO2E 3HCBA 4GI5A 1QANA 1Z0JA 3BIXA 3QF7A 4C06A 2VBIA 1Z75A 1II8B 1XZQA 3AJ8A 5HF6A 1Q2XA 1T4CB 2G04A 3AUYA 4N8EA 3EEFA 2BP7B 1P1FA 3QPUA 4YT2A 5F7XA 4LPSA 3WGGA 1WDMA 1YAJA 2OO7A 2V5AA 4WL0A 2QRKA 4HMOA 5CPBA 3ESXA 3IODA 2HYDA 4CLOA 3WBFA 3U16A 5JPDA 1U2TA 1A50B 3Q9NA 3I04A 1Y7PA 2RGXA 4DGQA 2QGFA 3KHKA 4WY2A 5C31A 3PEWA 5CTAA 1OVMA 5A6VA 1P1IA 2DB3A 1RYHA 2IIQA 4MUMA 1PRYA 1G5PA 1X8LA 2FQQA 3FR7A 3FWPA 1IEWA 4FFBB 1DINA 2CE2X 2OHVA 3NVAA 1BXRB 4IHJA 1RDFA 4ETNA 4L9SA 3STTA 5FOWA 3ZV5A 4ZQBA 5I7FA 1ZI8A 3I6YA 5K0SA 4KFTA 2P6UA 4LQDA 4FJ1A 4LRXA 2NPOA 4R2MA 5FA5A 3JZIA 3S44A 4E4RA 3AVYA 1XE3A 2QLTA 4K87A 4U5XA 2WMOB 3EXEB 4CW7A 1HT1E 3I5YA 5KOHB 5EE5B 3C24A 1GGMA 2YWGA 2D7JA 1M10A 1YNOA 1K9VF 2PUFA 4U2FA 2JS7A 2G1JA 1DSSG 1VKNA 2C8KA 3QKIA 4KKXB 4NNOA 4QRDA 4RHXA 1T3LA 3H4TA 5JJ5A 2RCNA 4ALIA 1I80A 4GT1A 3LC2O 5CA1F 1DIAA 4U2CA 5C51B 3WRYC 5BN1A 3DOFA 4ZALA 3U7JA 1RAEA 1TAGA 4OXRA 3JQ9A 1H42A 1X7YB 3H2BA 3R0IA 1Z5WA 4OMCA 5SYMA 2QTZA 4ENUA 3ISVA 1MXHA 4MUIA 2H4XA 1NN3A 1YR6A 4J6EA 5BOVA 2FRXA 3G5AA 4AZ0A 3K0FB 4LY3A 5J4HA 2DBVO 2CLDX 2R751 2RJ3A 2WBLC 3RRZA 3IVRA 1I4OA 2JFFA 3BREA 1VG1A 2FOLA 1I8TA 4I99A 1CQZA 1OD6A 1XRRA 4QASA 3ROGA 4QZVA 3ZG6A 4B2PA 3CUTA 4GPD1 4QDUA 5IJ9A 3REFA 1CHDA 4M54A 2DBRA 5CHYA 4JKYA 2HAEA 2MMGA 3EQZA 3OE1A 2HNBA 2Z4RA 4C0BA 2XUFA 1AGNA 2FFQA 3LLCA 4UXHA 3THSA 1ODSA 2I71A 4YYEA 2Q8PA 2ECQA 4D80A 4I6JA 1DQYA 2WU0A 4YA6A 1SUWA 1BDHA 2CBZA 1EXDA 4YDSA 4DA9A 1NNI1 1NU6A 3SEZA 5F23A 4C6SA 1YCHA 2J32A 4RK7A 1SZDA 4X1YB 5BVHA 2H7XA 3G8BA 4M8NE 5TS2A 5A4FS 1N25A 4ID9A 4QYSA 5KX5A 1WE2A 1Z0AA 3PR1A 4OX9B 3QTBA 1RHMA 2Q6KA 3RJ5A 4RPCA 3D7SA 5L53A 3C39A 3QFRA 3QRWA 3WJAA 3H11B 1UXJA 1C0LA 3PGJA 1GV0A 3BK7A 2CCJA 3H4VA 2HRBA 3QJ5A 2FA9A 3TGLA 2V7WA 2UVPA 3OJWA 4XUDA 1AQLA 2ZUVA 4TRMA 4ZT6A 5CDGA 3GLVA 2G67A 1NQVA 2VJYA 3AF3A 1WXDA 2IYLD 3QYJA 2OILA 4NV1A 4TLMB 2QTRA 5DGTA 3KD3A 4IIJF 1X1TA 4E1VA 4E32A 3CWZA 2FZEA 4G0MA 3HLYA 4JOSA 2GYWA 4EPVA 4DCOA 1Q1ZA 2BGLA 2LBPA 4J1NA 3PRJA 4FGUA 5TPZD 4ZAYA 5BNZA 1CE8A 4ANFA 4I1IA 2QXUA 4NC9A 2OG1A 3PVSA 2TSYB 2IHYA 4TTRA 1A1SA 3MGGA 2FEXA 2YHIA 1G7TA 2R87A 3N3BC 1PZEA 2DUNA 4MEJA 1YR2A 2IY8A 4RVSA 3U7QA 3GLIE 2W43A 5FL7D 3I76A 5CW2A 3BKWA 4G07A 4GVLA 2NUTA 1SU6A 2J9ZB 2XRFA 2H4JA 3EIEA 1XV5A 3UHPA 2QD5A 4NEHB 2QR2A 1SUFA 2REOA 1WZIA 3O3MB 2Y1CA 3T1YB 3L0OA 2YVAA 4ZVSA 4IDOA 4A5SA 3UMRA 1FBTA 1H6CA 1PJCA 5KTRA 3DLTA 1K6MA 2C59A 2J3QA 1B6RA 3DHEA 3DMGA 4HQKA 1NVBA 1JDTA 4LWPA 4Q3KA 5LXTF 3T38A 3HZHA 4XKJA 5GINE 3JQ9C 4TS3A 2VQSA 3A6PC 4LXIA 3SQWA 2FWPA 3K5PA 2C7PA 2H3EA 4B75A 2F55A 1SOVA 1GKKA 2X8WA 1TADA 3FZYA 5LR6A 3RV3A 4WBNF 1VMAA 4RXUA 3EGVA 1IBRA 4HWRA 3W0LB 2ZR9A 1T9HA 3W04A 3WYGA 4BO0A 1FSFA 1AVTA 5ALXA 3WNZA 5JQGA 4KMOA 2BJHA 4V0KA 3UY4A 5A4KA 4PNEA 1Z3CA 2X2FA 3MYRA 2DMRA 4YMSA 1XRQA 4OHYA 2A9JA 1YQXA 4MW6A 4I1SA 1TK2A 3CBQA 1RMQA 3JXEA 1A2KC 4EDFA 5A0FA 3IX7A 4FGSA 2Q3BA 3G5TA 5EIEA 5JZSA 3CWCA 3SPXA 3WAKA 4S05A 2I2DA 3Q88A 4EI7A 4LIPD 1JEEA 2GVNA 3GOQA 4X93A 2ORIA 5IDWA 2GS9A 3G0CA 3ZIAA 3R3WA 4A6XA 1IIBA 1MABA 1MEOA 2YYYA 4K0RA 3RUFA 3WQQA 2OXCA 2DLCX 3W5DA 4IX9A 6Q21A 1E2FA 4R1PA 1E3SA 1KRWA 3GMTA 4OQXA 4TSFD 4FYYA 3CSDA 1YZVA 1LXCA 3QV1A 1NSFA 4BQSA 3MGAA 1YJBA 4IJ5A 1TGYA 1MO6A 4G0PA 4Q82A 4R7GA 5EVCA 3W2EA 1F6WA 1EGHA 1UZLA 2BEJA 2GBIA 1MB4A 4KQEA 2QTTA 1RHJA 3ZXYA 1GA4A 5CA0B 2ZAIA 3EFEA 4KH0A 4GKBA 1PSDA 3QE2A 3BWEA 4IUBS 1T9GR 1ISFA 5J4KA 4R51A 1ZIPA 3TPCA 2AYYA 1YCGA 2VSQA 3OM0A 2LP4Y 2QS9A 4FN4A 2PAFA 4KMMA 5JBIA 1H5UA 3QWBA 5JIBA 3E4DA 5KOYA 3ERCA 2WLSA 3AEUB 3ELBA 3L07A 3LP8A 4TM7A 1FFDA 3UJCA 4EG1A 4ZI7F 4AS1A 2CLIB 3H1GA 3V2UA 4BKOA 1AY0A 1NMQA 1W46A 4QG7A 2C7GA 2RGYA 3MJ4A 1PS9A 4DV3B 4P0TA 3PC3A 2I1VB 3I5XA 5DO9A 3C6BA 1GTL1 1DI0A 2E5FA 2GK4A 3AC0A 1VL6A 5KAPA 5C3MA 2W83A 4MARA 4HYTA 4WX2B 4C0SA 3EGIA 4IJUA 4IMRA 4OYHA 4UMFA 3TXYA 4A8PA 3GLFA 2V6GA 1HE3A 2ZETA 3AONB 1KDTA 3CY6A 5JXGA 3L93A 1RNLA 1WDWB 4ZZIA 3BFXA 4HDNB 1D5CA 1QF7A 1RKUA 3E8SA 2ATIA 1XA0A 3E3MA 3P97A 4LJ5A 2VP2A 4Q3EA 1P5JA 4GX5A 2ZS7A 3IBSA 4DREA 4C07A 2HCFA 3HJCA 4D46A 3QNUA 5E6UB 2R5WA 4BQPA 1TQ2A 3ZVMA 1YO6A 3NX4A 4MQBA 4L74A 3N2GB 4P5DA 3WHLA 3VM6A 4TKLA 3FOZA 4PZ9A 3LF2A 4UEWA 1X1CA 4H3KB 4LX8A 1KKUA 1Y8RA 3LT4A 5J5CA 4QXOA 3BK1A 2O8NA 4OG2A 3VXKA 4A27A 1VDMA 1VCOA 2IHUA 4EY6A 2FKAA 4Q4HA 5C5EA 4BO6A 4D8XA 5CJPA 3UGQA 1KWGA 3NTQA 1A95A 3ITDA 1V1JA 3RU7A 3SS7X 1UZMA 3DFZA 3NONA 5ERXA 3VR5D 4HQ0A 2WOOA 4WH0A 5FBRB 2OXFA 5H8WA 3CX4A 2YJZA 1WUTA 3IQGX 3JAKB 5EJ4A 2ETXA 2FLKA 4H2DA 3JZFA 4RE6A 4PWYA 1LPMA 3KPWA 3EAQA 2MSKA 1TAQA 2PS3A 4TYPA 4XTCS 5ALPA 4QM7A 1OH8A 1FDTA 1WSWA 2OO5A 3BL8A 4MGEA 3A0RB 1F2VA 1K7CA 5EXSA 5BSGA 2I4TA 1E62A 3QJYA 1QFSA 2I66A 1T2UA 4V02A 5CHEA 1SXPA 3V42A 4RX1A 1VRVA 5BV1A 1UF9A 3E2IA 4KUEA 4P35A 1QZTA 4L0MA 4B7CA 4NG5A 4PC7A 1Z7EA 2MJLA 1M2WA 4JDPA 4RKRA 3Q3VA 1L0BA 1SWVA 3C8MA 4MB0A 5AO9A 3EWNA 5GONB 3RYIB 4RM2A 2P4HX 2OCBA 2AQIA 1H23A 2PTHA 3D7LA 4G5SA 4EBFA 4EFLA 2CMFA 1SUSA 4EZIA 1UJ2A 5D3KA 5LLDA 5IBPA 1UADA 1SBHA 2YN4A 1DLJA 2AFHA 2NTEA 5AW4A 1ZAYA 1JFLA 2ZRGA 5D7NA 4EFDA 1G0OA 4U63A 1GGNA 1DIHA 1EJ6A 3DZGA 2GYUA 3KOZA 4AL4A 4F5DA 4WT7A 1ZI9A 2W4QA 3KZCA 1LS6A 4L02A 4AJ1A 1GNQA 2NM0A 3D4OA 1O0SA 2BE9A 2O3JA 3FYTA 4JCCA 2JC3A 4FFVA 1CUYA 3O92A 3G0BA 4PR3A 2PJZA 2EJCA 5IF9A 2NLOA 3JQBA 3P52A 1G17A 1X3SA 3WGNA 1F5NA 4ZEXA 1XZAA 1LX6A 2QUIA 3A6GA 1HDYA 3CRRA 1Z73A 4NBWA 1R5BA 3BHJA 3EMVA 1M67A 4N0QA 1MT0A 4MX8A 3D6FA 4WUVA 2XB8A 4IZOA 1BSVA 4KXNA 4DR5B 1KMCA 1X7XA 2X23A 2YC2C 1DXHA 4YCMA 4YB8A 3UYKA 4QSMA 3B12A 2PT9A 3EDYA 1JXOA 2FUCA 4EB6A 8MHTA 1NM5A 1LPNA 1H8ED 1I6KA 1CDDA 2V65A 1HLFA 1A97A 3UK2A 3OLXA 3MEQA 1KDVA 2W8ZA 1V7QA 1KJJA 2RHWA 3BMCA 1P2DA 5ALYA 5JBQA 2OD7A 2PKQP 1GZ6A 5J2TB 3OX4A 4HY3A 3KPJA 5EXEA 5A6SB 3RC8A 2H51A 3H2SA 3O9VA 4OH1A 3BSYA 3U7IA 3P9ZA 3VJLA 1W73A 4GWGA 4S24A 4RESA 4NJMA 5C8VA 2MOKA 3PEVA 1JFFB 2IC5A 2IP1A 3KVRA 3O74A 2NWQA 1Z13A 3F8SA 1P3DA 4HAUA 4LZNA 2OZPA 3E3AA 2ZCUA 3B8EA 3N2EA 2RHLA 3DT9A 5K0BA 2QRLA 3A70A 2OO5C 2A3RA 3MCUA 4RY2A 4YBRA 3DYVA 3PHCA 1Z8DA 2QDKA 4BVJA 5E6RB 1A7KA 1JU3A 3ND8A 2PYDA 4X20B 2QAGC 1QAMA 2GAIA 2A5JA 4WZ6A 4WZAA 1GTZA 3HJGA 2R8OA 4HJRA 4HVAA 1LPOA 2GN8A 2WUFA 5BN4B 4RVOA 5TPWA 4JI6B 5K8UA 3ROEA 3T1NA 4ZGGA 2NGRA 2WU1A 2P9EA 3ZE1B 1OCEA 1KXJA 1NR1A 1Z0IA 1Z28A 1JTEA 3AZQA 1DB3A 5DASA 3MPOA 2WU4A 1AHPA 2ET6A 3GLIB 1BEEA 4EYQA 1HXHA 5AVZA 1DGQA 2GJ4A 3SYMA 3IQFA 3QTLA 3T1TA 3THWB 1XTRA 1QHFA 1GN9A 2JCYA 4UBNA 1TJYA 3QLVA 4CLHA 5I48A 1VJDA 1AA6A 3VKWA 3X1XA 4IUDS 1QRAA 2ZRQA 5BQ3A 2G76A 3IEIA 5ERGB 1HX7A 5K6RA 4IDQA 4L9WA 3THXB 1XRLA 3AEYA 5KJ1A 2EX1A 3IH5A 3M2PA 4EITA 1E1YA 3FSEA 4F3KA 3U44A 1Z37A 1QMGA 3N70A 5D3MA 4NULA 5DE3A 3ZD9A 1SD1A 2IF0A 5AM0A 4L3WA 4CMHA 5KQRA 4MR8B 2BISA 4XE5A 2P6NA 1RHRA 4HSEA 1H9AA 4JL8A 4ENPA 2A1UB 2CHVA 3AJAA 121PA 3FMVA 2PSFA 3RYTC 4YRIA 5IZCA 3NV7A 2BTEA 1Z5NA 1IY8A 1C41A 1REQB 1CWUA 4BMZA 5ELXA 1N2CE 9MHTA 5HBGA 5JUWA 3ABZA 4P4SB 4IX1A 4R71A 2N1BA 4CNBA 4LE1A 4ND8B 4J0IA 2GCPA 2QY6A 4EI2A 3HB1A 3T99A 2RIRA 3UQYS 2W8BA 3GWZA 1NJ2A 2JW5A 3QNWA 1IYZA 4PINA 1OTYA 5AICA 4B40A 5AHKA 5AVXA 2C99A 3L8MA 2AHOA 2Y3IA 1KO1A 4KAJA 5IX8A 2EKDA 2Q7DA 1T9KA 4EYKA 2GJKA 3E1GA 4FNAA 2FHSA 1Q7CA 3MRXA 1G8YA 1NBOA 4PX9A 4KR2A 4H15A 1D7AA 3M8KA 1NTOA 4E3ZA 1COWD 2KBFA 3BRWD 3LQ2A 3RBXA 3I3OA 1I6MA 1CQJA 1IBCA 2QIPA 5AI8A 4J1SA 1RWXA 2I6FA 3CEHA 4RKYA 5CA1B 1U7PA 4RTQA 5HRUA 2P69A 1Z4OA 3WDLA 4DPMA 4XQ9A 1EH5A 3VC3A 1QH1B 3AJRA 4EB0A 1SAYA 4GPTA 2XMSA 4IRXA 2P2YA 1N2OA 3NWOA 3QMWA 3EWIA 1UFOA 3QGMA 2VHXA 3A2MA 3FNFA 2O3SA 2ANBA 3N2NA 3U40A 2NO0A 1I13A 1NC3A 4PRYA 1QRTA 2Q46A 4BKQA 2OAP1 3J81k 1Z5PA 3TZBA 3BGDA 1M2KA 1QB8A 2HJRA 4MVJF 5B64A 4FONA 2RHCA 1IXKA 1D04A 1GSHA 5H59A 4CDMA 4MGIR 3CRVA 2H1IA 4ZXFA 3X1YA 1HLDA 2OCKA 4QOHA 4ESEA 3IJEB 2HEIA 3HY3A 4RELA 4Y6SA 2ZJAA 2CVZA 3OQOA 1MR3F 1NP6A 4JUAA 2VP0A 4B0OA 1OMOA 3HUEA 2HQRA 3KTOA 1B7GO 3AB7A 3HYNA 2JDIA 4K9RA 5AKGA 4S3MA 5JE8A 1WUJS 1R0XA 1ZONA 4D9FA 5AM2A 1DPGA 3ZWXA 2Y77A 1MXFA 2QU7A 5IABA 2XJ4A 4MUNA 4MITA 4TTSA 4PIMA 4YO7A 1LJLA 1CP2A 2EJWA 2VJBA 3UFXA 3FPJA 3GH3A 3H99A 4RDIA 4BX8A 3Q5GA 1OPXA 1W1WA 4LPKA 4TS9A 1FNMA 1LK5A 4FJ2A 5J5AA 2HFJA 1HE2A 2IEYA 3BQMB 3TD2A 1TW3A 3VZPA 3WFJA 1ZM2A 3ED5A 4BVGA 1M7BA 4EMBA 2VJPA 2X58A 2R68A 3GELA 3HR8A 5A4DA 1THGA 1TM5E 1FTYA 1VGQA 4XX1A 5BW4A 3AHGA 5EZSA 3GGSA 2YJ6A 5EMKA 3AEQB 3IOEA 5TGDA 2WKPA 4YCNA 3EF1A 2H2WA 2HMVA 2C42A 1K88A 1RYMA 3X2FA 2QMOA 3GP5A 4Q4JA 1YUNA 2J45A 4DAOA 5DLEA 1Z7GA 3QPCA 3GJ7A 1RLOA 2IE0A 4IIJB 4CF4A 4PV7A 4EENA 4N40A 3QV2A 2IEZA 2G28A 2NZJA 4LA4A 4PGMA 4RHTA 1DTWB 1J70A 1L5GB 1L1FA 3H9BA 3ZS9A 5JBNA 3B36A 1LA2A 3DBRA 3RYHA 1ND5A 3QELB 3U4DA 1I3LA 5HKOA 2O1EA 5ED4A 2YMPA 4ENVA 5FUMA 2QTBA 1GUFA 1QKIA 1NLZA 4WDQA 5AVJA 3GJ3A 1A76A 1ZJ4A 2EBUA 3MERA 4M1EA 1JQBA 2ZITA 4IFTA 5C5CA 4DSOA 4FWTA 4MUEA 1DJLA 2P5TB 4X6YA 1AKUA 2JJMA 1N4AA 3GYBA 4HZIA 3DZBA 4E5DA 2YZ7A 1FX1A 3DGFC 4RKQA 2AKEA 3EPJA 3UQZA 4KTTE 1Y7HA 3ZD7A 4ZAZA 5F5XA 2QPAA 1TQ4A 4MWDA 4Q9JA 3HI4A 2PUBA 1V45E 4NE2A 1JUDA 1B6SA 1KZ4A 2FSPA 4IJVA 4D8UA 3WXBA 2BGJA 1HC7A 4M36A 4FB5A 3BK2A 5LXTB 3A2KA 5AUOB 1DBQA 2AL7A 1NYQA 3IEKA 2QRZA 2QR5A 4M1WA 3DVAA 4HWKA 4BB9A 2AVNA 3K0HA 4LHYA 4WMLA 4AXXA 5HS4A 2J3JA 1PJRA 2V8BA 4BJHB 3R74A 1LUAA 2ZVQX 3GP3A 3I2YX 3I32A 3KKOA 3H0KA 3WWPA 3FSRA 4LJKA 4WBNB 3MHTA 3W6ZA 3NDPA 5YASA 2HZ7A 1JBQA 5J1SB 1NW4A 4M2LA 4ZIRA 5DNCA 3JVUA 5AW6A 2QTHA 1SHKA 2YZGA 1L9XA 3I4FA 4OY3A 5HZHA 2WKSA 4BATA 2EZTA 4ZV7A 2IV3A 3OF2A 4G5HA 5DXFA 4L78A 5IC6A 3ZLVA 5KJFA 2DH5A 5CBKA 3CW9A 3PC7A 1PG2A 1PHPA 5EQDA 5IK2A 5FPTA 5D2CA 2ZTSA 4JL6A 5DHSA 2IS4A 5GIOE 3M49A 2E85A 5JPCA 2B5WA 4ZMBA 5JQWA 2QSUA 3AJ9A 2LCFA 5FPPA 1N5MA 3B51X 4DWWA 1F6DA 4C0XA 1YDHA 3D31A 2D4AA 2HSZA 2O50A 5H70A 3VOAA 1CEQA 4OHCA 5LWQA 1U65A 1QRUA 1Y7LA 4A2PA 1RJ9A 2HIHA 3TTSA 1EU1A 3R9XA 1EFDN 3OBIA 3HB7A 4HNAA 4D0SA 4L5AA 3H97A 4QWWA 3TW8A 4D3FA 1Y5NA 4BZWA 4B47A 3MIIA 4NICA 1QQTA 3H18A 1EAYA 3RVDA 3DF7A 1M74A 2EW2A 4NENB 2NW6A 5EWMA 1U98A 4HC4A 4R83A 2R60A 5A5DA 3A7EA 4RSGA 1CXZA 2FVXA 3A6FA 3G9QA 2XWBF 3ADOA 4X65B 1CYEA 3VH3A 2QA5A 1JHPA 1K75A 1ODTC 1N9GA 4TTTS 1KFJB 1AKWA 2AUMA 3IUBA 1ORRA 2Q9AA 3OECA 4P6VF 4RIIA 1A04A 4A3SA 1PR5A 1WQ3A 4UTRA 2NZXA 3O1IC 4W1PA 1CQWA 1K8XB 5J9FA 4C21A 2AC7A 1S2DA 3OIFA 3OO0A 4YALA 4ZI7B 3KTFA 4KN5A 4LYJA 2XCUA 3UPTA 4EFMA 3IVXA 2MIIA 2NO1A 3WWYA 3KQMA 3HXLA 1UXIA 2Y9PB 3EQ6A 3EXG2 1WAMA 5KYYA 1ATIA 5DV9A 4YRAA 3IILA 1DKRA 2JD1A 2VRCA 4LOHA 3AK4A 3R7BA 2Q2OA 1H8EA 1NMYA 3D2CA 5DTQA 2IU4A 4KYVA 3WLAA 4KPGA 2WVHA 3QLEA 1RXSA 2NU6A 3PTLA 3KS9A 2G77B 1IQUA 5TF4A 1TF2A 3GT4A 4C04A 1FLAA 3PUYA 1JXQA 4UU1A 3QKRB 3WZLA 1TO6A 3BE4A 3IOMA 3O93A 4LRWA 3AYXB 2PZAA 3QPDA 5E1DA 4B82A 3BB1A 2GQ0A 1QAOA 2ZJ6A 4E12A 4MS3A 3Q72A 3R9KA 4QFMA 1M2OB 2P5UA 2ZBDA 1O6CA 2OXIA 2C2OA 5IXSA 5JD3A 5CPFA 3RVQA 1FUKA 4XIJA 4ZCMA 1KWKA 3R4VA 3RO7A 2CUTA 3R8FA 1E4VA 1U7DA 2B3DA 4RPIA 5AESA 3U7GA 1B6TA 5H4GA 1DAPA 2QMZA 4TWBA 4XYEA 4YREA 1GCUA 3E15A 5AI9A 5AKXA 2RKWA 2BKLA 4AJPA 3EC1A 5HFJA 2CFIA 1QVWA 5I7EA 2REBA 3PNLA 3VSAA 1JJFA 5HQ3B 4JMPA 3ZJTA 3CPJB 4HK4A 2K87A 4U3JB 4EGFA 2FJPA 5GM2A 3LT0A 4JP5A 4UBLA 5JNVA 3ZBPA 1Z9BA 4A03A 1RPZA 2GRJA 3IMKA 1E1CA 3F67A 5H7XA 1PR0A 2ONZA 3LGXA 2XMCA 4NH4A 2GO7A 5JAIA 4EMUA 3PQEA 2LWIA 2H48A 4E5NA 3V4ZA 1NXTA 1YE3A 1IOZA 3MOGA 4L4YA 2OXTA 3UBMA 4BMOB 4DN6A 1N2CB 1TEZA 4K9PA 2C04A 3PRYA 3VJRA 4OGKA 4EF6A 1FX0A 4ZT3A 1EWVA 1CUWA 1E9BA 1A4XA 5AW5A 1QYRA 1ZNWA 3GEMA 3TBFA 4DIBA 4HT3B 1PFVA 2JFPA 2OFXA 2JFVA 2PH1A 4LV6A 3OY7A 4U0KA 4CVNA 1A5BB 3NC1C 4Q15A 1O87A 3L7LA 1CETA 4LUCA 3L8GA 1DIBA 2HLDA 2PGNA 1OB5A 1KK0A 1DIRA 2PQ2A 3IE0A 3CLUC 4W8GA 4Z53A 1QFYA 4PZ0A 3OQIA 1DEAA 1ZCAA 3T61A 4Q19A 1W0KA 3IBFA 3IQEA 4G4IA 4Z9AA 5TEVA 1OWNA 3NG1A 4WFJA 4E5YA 3GLGE 3KQQA 4B83A 4QYMA 1N36B 2CSXA 3W2IA 4HSGA 4D6PA 1Z08A 1LZLA 3M6LA 4PO1A 2EJBA 3H83A 3RYCB 2WU8A 3CIFA 3ENKA 3NRCA 3PHBE 3IDOA 4U9HS 3SNHA 4BVHA 3HA5A 4KV7A 4WOBA 4QDKA 2OHXA 1AGRA 4CNQA 2PT6A 1RI3A 1VE9A 3LQ1A 5ARCA 2ZZNA 2Y0BA 3H5OA 3ESBA 3MMNA 5G4KA 3A4LA 3V7WA 2XUOA 3U9LA 1JJAA 1TMYA 1JIIA 3DKPA 3VH2A 3E7FA 2PDAA 3ZEAA 4KQ1A 2NUBA 2R1UA 4QFCA 4RA6A 2WG1A 3CSUA 1N9ZA 1N1MA 3EVTA 1QWSA 4YV0A 2QF7A 1OJLA 1YHNA 5K3CA 4JOBA 2BRUA 2D0DA 2X7XA 4R1OA 3SU8A 4CM7A 4M60A 3RAPR 4LMPA 3V33A 4EDHA 4DCVA 4PZDA 1YBAA 4YCDA 2D1QA 5EZ5A 5FLYA 1JQEA 4KG7A 3BRWA 1ZVMA 4TMXA 1OZAA 2W22A 5E0OA 1JN0A 2I2BA 5K3OA 3K9QO 4YRJA 2ZIZA 2XEXA 4QA9A 3S81A 3HA2A 3T1VA 4HHEA 2GHRA 5AW8A 1U3UA 4KL8S 2EHDA 1W44A 1IHPA 1KAEA 1WB5A 2HSEA 3KAPA 5EHIA 2O2JA 2UZ4A 3EEIA 4BNDA 1UK9A 4L72A 4ETWA 5F21A 1PYGA 3O8NA 4LGYA 5A3VA 3UC9A 4O1MA 1KJYA 3WJ7A 2YFKA 3QG5A 4KITB 3NHSA 3FIJA 3EVCA 3FJ1A 2ZUDA 1FP7A 3FMGA 3S27A 4DIOA 3H2IA 1FZTA 4XD2A 4F7DA 3OJXA 7ADHA 3JD2A 1GTRA 2LKDA 3H2KA 4BY9E 2O7QA 2JH3A 4FEGA 3TM4A 1N33B 4PN3A 1MAHA 3QXJA 4D9EA 2VHCA 2EBWA 3EK2A 3WG9A 1AO3A 3LVFO 4CKBB 2W2TA 2Q8QA 4EM6A 2O14A 5C35A 4FOLA 4FYWA 4GKKB 2RI6A 1U2DA 3V32A 1C2YA 1JXMA 3ZW7A 1ZH6A 5JD4A 1GOTA 1AJEA 2EZ4A 4ONEA 4ZO7A 1A98A 4KKVA 4GD3Q 2B7LA 1AZLA 2AOXA 1J97A 2EGHA 1SQ5A 2LDBA 4C20A 1NUSA 1QV7A 1XHEA 2B4YA 1XMPA 4GP7A 2FX2A 4YLYA 5I7VA 1A9YA 1HFKA 4RD6A 2YW2A 1PZXA 1E0KA 2OENG 4YH1A 4PG8A 3RVNA 4D3ZA 2X9LA 3TMAA 4AMBA 3VYTB 2P40A 5A3SA 1JE0A 1S1CA 4JGBA 2D7DA 4FQ8A 1T1IA 3KTAA 4HADA 4IHQA 2P3SA 4RQBA 1XNHA 4HBGA 1GU7A 1TZKA 4B74A 2MTBA 4UXJA 1P39A 2ZREA 4KK4A 5IP5A 3RH0A 2A0KA 2IU0A 1QPZA 4RY0A 4U0JA 2F2TA 3EA5A 3HKDA 1T8YA 1GT91 1ULHA 1K8ZB 2I6SA 3FDZA 3HZRA 5IEBA 3TF5A 3GG9A 2ERXA 2P3QA 2XZTA 2X0IA 2ZBFA 1U3CA 2BY4A 4EQZA 3KZ1E 1P7WA 1RBMA 4EW6A 3T9FA 4XVCA 4WERA 1O0CA 2HTFA 4I4TF 1KO5A 3D6UA 2JL1A 4UMEA 3CO5A 3E9MA 2V7GA 3VJMA 4BFLA 4Q39A 1CUIA 4RHCA 5HKKA 3RRJA 3LDUA 4IVRA 1F8UA 1GTVA 4MKGA 4EGCB 1X7HA 1XDWA 2NV0A 3MCZA 4WE3A 2RJOA 1GSAA 2Z5GA 3D1JA 3B6IA 1CLEA 1NFQA 1R4MA 3L8DA 2ZRNA 3GRCA 1HORA 4ZI2A 1ODIA 1E3WB 4DXDA 1GTG1 1D6JA 1U6JA 3HNOA 1Q7RA 3R3SA 4OHBA 1P7VA 1MTZA 3HH8A 4ND3A 1X77A 3PD1A 5EKUA 5HOEA 4UZFA 5BR8B 1CDZA 1H5NA 1QJCA 1CRLA 1H6BA 2ZWOA 1H0HA 2HU8A 2N1MA 5DXJA 3S2ZA 4QHTA 3L6BA 5KYXB 3BXGA 1RBQA 2RC5A 5CLJA 3L7CA 4KQXA 4DUGA 5LYJA 4GF5A 5I7WA 1N1EA 1ISHA 3MWYW 1XA4A 4KR9A 3W9BA 2W6OA 1HE8B 4B2LA 3MWJA 2OYRA 3VNUA 2Q0XA 3A1CA 3RANA 5B6IA 5IAKA 2ZI4A 4O3FA 5KO2A 4QM6A 1U2DC 3G02A 3PGKA 1TJNA 3TSZA 4DTCA 1VLZA 3BCUA 2IXBA 3W6UA 1T0JB 4DJEC 2YHBA 4DMKA 1PJ4A 4RQTA 1UBHS 3E53A 4TMWA 4J0QA 2EERA 1M76A 1GZ5A 1L4FA 5BSHA 4GW3A 3W5CA 4E88A 4BE9A 2JHFA 2P4SA 5EOVA 3GNTA 1IXSB 2CNBA 5IDYA 4C05A 2WPDA 1TQDA 3TS1A 4IH1A 2IU3A 1QHIA 2AN5A 3UPUA 2WTXA 2PYZA 3I05A 3AR8A 5JAPA 1NP7A 5HJ2A 3U3JA 3GRYA 1OBFO 2JVKA 3LNTA 4TTPA 3S1AA 3TSAA 5GJWC 2Q4RA 4IQ0A 4JOQA 4D9MA 2ZFUA 4MS1A 3PSAA 1VL1A 3PQ2A 4OI2A 4WXEA 1PLKA 1KAQA 4PC6A 3Q8KA 4GRDA 3LNCA 4YP9A 1M34E 3AIKA 4BKRA 1FFGA 4XX0A 5IYZA 3W9SA 2QNBA 4JROA 2J9FB 2I7VA 3OQNA 5DW3A 3SHTA 3QX3A 1BAPA 2ASEA 1ZDMA 2CLMB 2EX0A 2IHTA 4HUQB 4OCZA 1T9GS 3D6NB 4O02B 5DHQA 4B6FA 4XWOA 3BZBA 3RKUA 3CLVA 3MSXA 3CUSA 2X15A 1Z6YA 1SD2A 3I9V1 3A1FA 3BBLA 1WZNA 5DI3A 3A6JA 1XVAA 4Z49A 3Q12A 5AW3A 3KR9A 3F3MA 1MC1A 1RM4A 3MGKA 3DZIA 5CP8A 3WLRA 3C7AA 2NSJA 2IY7A 1DXQA 4DNPA 4OTZA 3UMJA 2UYOA 1S9HA 4W5OA 1NPYA 3WGLA 4JYZA 1OR8A 4G8BA 3MXTA 4Q7MB 2ZAYA 4X8MA 5FF9A 2A9OA 2VYNA 2YZKA 1H69A 3T7SA 5MDHA 3O6VA 1DWPA 4BUCA 4ZPJA 1U8YA 1ZIOA 1ZYUA 1EBFA 1WU8A 2QRJA 2YJGA 4NYJQ 4O2AA 4EY3A 2QN7A 3MJSA 2E5LB 5JD5A 1PJLA 1Q6ZA 2Z2ZA 3CRQA 4II7A 3RIMA 2EYUA 4AJ9A 4AUEA 4Q3NA 4BYGA 3LZDA 3UXEA 3HHEA 5KVCA 4YMHA 4LJAA 2OM2A 4XRRA 1W88B 1NQTA 4U6NA 1C14A 2WD9A 5AK4A 3ZZTA 2FRDA 5A02A 3GG2A 5FBHA 5CDYA 2ILVA 3KQSA 4QAQA 3TJRA 2L69A 4KMRA 2H7VA 5T6BA 2YXPX 4XPZA 1QV9A 1WY7A 2FFAA 2H1OA 2OFFA 2ZYDA 3WLJA 1NPDA 1C1HA 2EOAA 3QX7A 4KXUA 2LIPA 3SHVA 1AQUA 1CUZA 2XGOA 1Y1QA 5L4SA 4MQUA 1Y4SA 4X1IA 1RTTA 4H1VA 1NMEA 4YC7A 5IARA 2QL9A 4X62B 1PDWA 2RH8A 3CE9A 4AIIA 3C5WP 1Q7BA 2X8AA 4AJNA 2OV4A 3JSAA 3SQLA 1HQCA 3C48A 4DT1A 3GLGB 4W1RA 1B23P 3AERB 3AFMA 4DZZA 1WHSA 3GCZA 4HMQA 4MULA 3S2SA 3SJ7A 2HK8A 3WP1B 3PIIA 4EJ2A 1QQBA 1X7WA 3R75A 4ED9A 3W7BA 4E09A 1KK2A 5I4BA 4W9NA 1ZWLA 2GVZC 3V00A 4GKAA 5KU7A 3PNQA 3W9YA 2R00C 4FUQA 1M6YA 3CW8X 2VQFB 1BXGB 3JV7A 1PX2A 1K06A 3NAZA 3NHPA 4L6CA 5F5LA 4HZUB 1L4BA 4FD3A 4B8ZA 4ZYTA 1BQEA 1NQ5A 2L42A 4G5XA 5KWIA 4R3WA 1V9SA 1L4MA 2AE1A 3FWYA 4X7RA 4YLEA 4ER6A 1IPFA 2FWRA 4HFJA 1P0PA 3TLMA 3VAYA 3INNA 3PLRA 5K0FA 3K6SA 1WB9A 4O5AA 1V7CA 5H9VA 3AWIA 2ZYIA 3D1VA 1LBEA 2WF8A 3QA3E 5F4ZA 4D92A 1WPQA 4JEHA 3HEMA 3LFUA 2XCOA 4PSVA 1YQEA 5EINA 8AT1A 1U7HA 4DF3A 3DW3X 4CTKA 1IN1A 4URXR 3WGZA 1U3VA 3AEXA 2RGEA 4KGXA 4ZC8A 2M6LA 2YDYA 2ZW9A 4IXDA 1AD2A 3SJUA 1FP4A 5K3EA 4K9LA 4N18A 3OM1A 3HADA 4KXWA 1AE1A 5J47A 1YCFA 4N12A 2WWVD 3L92A 5DTEA 1OU4A 4MLZA 3M6VA 4L0QA 2QBYA 3L4BA 2Y1FA 2NT4A 1QGAA 1VCHA 4MUBA 2A14A 1H0RA 1CQIA 2XYPA 4EKYA 3PDIA 4B09A 2CUKA 4LOLA 2JGDB 2VS1A 4N5MA 1DO0A 1G66A 2J0UA 3NEJA 1VHWA 1NXSA 1R0CA 3OHMA 4HX9A 3UJDA 4YJ3A 4DC0A 4TXHA 1FY2A 4UAJA 5EKDA 5MN6A 2ZUEA 4DE5A 3ICPA 1TCUA 4M0FA 3M1LA 1PG5A 1KZ1A 4XLLA 2CVOA 1XTTA 3CNLA 1HR0B 3DLCA 1QH8A 4EW3A 4NDAA 1WXGA 4E15A 2VSXA 1H9BA 1BVUA 1KY2A 1FTWA 3BHMA 4IO1A 5E8RA 5FUWA 1NXVA 5EP2A 4DBLC 5IF3A 5AJXA 4UBOA 3OHPA 1M5UA 1Z2EA 2XBLA 3RUHA 3KHUA 1ZOSA 4DLPA 3U60B 1J0AA 3IT0A 4FMDB 5C52B 2CHFA 3BYZA 4LYEA 4IIHA 3OESA 3MJDA 3TB6A 1RLTA 2W98A 3C45A 3LM8A 2NQ8A 1I1HA 4ES6A 4NX2A 4AP6A 5LJIA 3IDAA 3Q85A 3E18A 3GAMA 5JTUA 4PSUA 4KE6A 4LV8B 3ZVRA 2D5LA 4BNJA 2PIDA 2IIVA 3ABQB 3JQAA 3O7MA 1U1GA 1QO7A 3EVGA 1RI5A 1W4CA 3L7IA 1ML4A 1C3OB 1US8A 4J4BA 5IDXA 1B0UA 1YJQA 4EW2A 4DANA 2IXGA 2P6MA 4WXPA 1X9HA 1Y1SA 2GXQA 4ZAFA 4LJ4A 2P27A 4F11A 4YDHB 1F17A 1OC4A 2A9QA 2GNOA 2IZ0A 5JS8A 3BF7A 3IULA 4OF4A 2OBNA 3PYXA 1QFXA 1WXXA 4ZZ3A 2YXNA 1EDDA 1YIDA 4ND1A 1N3BA 2P3OA 1DX9A 4AS2A 1RAAA 3OETA 3CN7A 2M6SA 3ZHYA 4CL8A 4DMRA 5L95A 4ROSA 4RVDA 4UDXX 1YI8A 3OEEA 2BMJA 2JJ1D 3DLIA 3IAS6 3NBMA 3TQQA 2V1XA 3TRKA 2AI2A 4IZHA 5FHQA 5BSVA 2WUEA 2QSYA 3I37X 2FPGB 3EODA 3LK6A 3GLKA 4L8WB 3RSFA 4LZZA 4IGIA 3V3KA 1I14A 1WXEA 4UUMA 3DUFA 1KETA 1VSUA 4Z7JA 4XWAA 5DM60 1XYYA 1FFXA 2IP4A 3PK0A 4IDHA 4BQEA 4WCFA 2D5CA 3GJ4A 4RKEA 5AVRA 1TU3A 1F9EA 1JPJA 5LUAA 1A7JA 3UJNA 5B58C 3HJBA 3L4BC 5IBCA 3AESB 1GZ4A 2R47A 2ADFA 4NOLA 3WTBA 2PX5A 1AKNA 1WU7A 3DTNA 3O95A 2NXEA 5DGXA 5IKEA 1Z6QA 4V39A 2HXGA 5CVEA 2PSSA 2Z09A 3N7UA 4O2BA 3MWGA 4NYIQ 3G0OA 3PRHA 4CIDA 2I7DA 4M22A 3CLKA 1DKLA 2PZ8A 2IPNA 2XHEA 4GSKA 4BFTA 1H22A 2WC1A 2WHEA 4YRBA 4YXWD 3B1WA 4MWBA 1WHTB 2VQ6A 1GR0A 1N6HA 2K2WA 3K2IA 5IT9A 3NZEA 2RI1A 1E6CA 1KSHA 3AF4A 5DLPA 1U0OC 2PBRA 2H1FA 3F4KA 4FZVA 3OOJA 1UBRS 2NU7A 3A6ZA 2PH5A 3H86A 3MLAA 4Q00A 3WLFA 2XZPA 3NRJA 2FW7A 1Q14A 4MV8A 1J0BA 1CBUA 3CRZA 3EZ9A 4Q9DA 3FA2A 4U9UA 1AS2A 2YHSA 5E1BA 2Y9MB 2R8ZA 3ES9A 3LX5A 4N0PA 5CJJA 1J09A 4GPEA 4HAOA 2OZVA 4RO0A 3RAGA 4R1TA 2CNLA 2HV8A 2JHPA 2K7ZA 2VDQB 2ZJYA 5ISMA 1M34B 2PQ0A 3S2IA 2XBMA 2IZZA 1R6VA 3JQ7A 1S2LA 4YJDA 4WXYB 4ZQHA 3VSCA 3BQNB 4R05A 1Z5UA 4QXAA 1KI9A 2QAIA 1WKBA 1DIOB 3OQHA 3V8PA 2QZ9A 3LX4A 3OPYA 4Q4DA 2ZM5A 1U4SA 3LL7A 1GA6A 3NDRA 3L0IB 4YAUA 1VMIA 4ZV9A 2G1AA 3DE5X 2OMEA 1Z15A 3OM8A 1U9YA 1JHXA 2XD9A 4R31A 1JYFA 1UXHA 1XEFA 1X7DA 1U8UA 3UH0A 3WKEA 4GBMA 1VPVA 3SR3A 3QEMB 1ZRHA 3AF6A 2Q6TA 3OKFA 2ZZMA 2D2FA 2BFEA 2WJ4A 3M4XA 4WVLA 1JG1A 4LISA 4UM9D 2RI0A 2FQXA 5D1NA 3BFVA 5IKPA 1NASA 2BMWA 1T36B 2HN9A 2YMLA 4B32A 3Q7TA 4ER7A 2GPTA 3ORFA 1ESMA 3Q1KA 4JBGA 2B1QA 2NQTA 4KVGA 3CPEA 2GSDA 1H2AS 2G36A 3Q9UA 3FKSD 1BW9A 4CU2A 3BCRA 5DBIA 2VDWB 4RXMA 2FFBA 4G0ZA 4R8MA 5EMHA 4BGEA 4C0KA 1F48A 1KI1A 2Z9DA 2IXEA 4WCFC 4HWGA 2PKQO 3PX3A 3OTWA 3ORRA 4TL9A 4UM8B 2Q5LA 4LYYA 1JT9A 1T15A 3F5FA 4H4DA 5AKKA 5FEUA 3F97A 4LF7B 3EGXA 4IGAA 2CDRA 3ZCRA 4JT2A 2ODQA 4TT3D 2I4NA 2QX7A 1XQVA 2BLNA 4RH1A 4LY9A 3AVTA 2IIPA 1SBNE 5LB2A 1KYYA 4AX8A 5I7SA 5H81A 4FKZA 3NBZC 1SZJG 2EHJA 4W5HA 3NBAA 1GAJA 2FNAA 3CUUA 3C1TA 1IH8A 4PG4A 3ISTA 5E9QA 3UUEA 3O2SB 5C32A 4I4TB 1FQKA 3M4NA 2FMKA 3T06B 3P9CA 3S5UA 4CL2A 5JNWA 3BJZA 2BKAA 1L4YA 4QUBA 1MVOA 1O08A 4D0LB 1J22A 1QNLA 1TKRA 5JRJA 1L3CA 3MT7A 1QO0A 1OROA 3K72B 1YI1A 3P0IA 2YMQA 1FDUA 1J1IA 2R5FA 2ZANA 3F9CA 1Z6ZA 4IO0A 4Q02A 2RAFA 2XITA 2OCPA 1MN6A 1QCZA 3EULA 4J0JA 1P72A 1O4VA 1JQKA 4CV0A 4QTZA 2QYHA 3ZGYA 1AGYA 1UBGA 1GD1O 4WV3A 3KLOA 1H2HA 1EX7A 4C6RA 3VC1A 1FS4A 3ROZA 3N6RA 3VMFA 3S8MA 3ZYCA 4K7JA 2GA8A 4QOFA 1XF1A 1V11A 3OUZA 3FGPA 1W4AA 2QX8A 4IIVA 2X1MA 2AC4A 2FEOA 4WNIA 1RXEA 2I4MA 5CBPB 4FE7A 4BLVA 1XDGA 1GTMA 4WKCA 4J90A 1UDBA 3KLNA 2ZPTX 3LDAA 3WWOA 1UPFA 2ZATA 2HU2A 4C5CA 3UWSA 4CKCB 1Y6FA 2DUJA 2J0SA 5ALSA 4JC4A 3UXHA 3KZNA 5JDCC 2DETA 1MKYA 4H7HA 1QCYA 2FGKA 2I67A 3H84A 1Q2UA 4QD3A 2RHBA 4DS3A 1E3EA 3GB9A 3HEBA 1T35A 3RC2A 3K30A 3ZU2A 1JDUA 3CUYA 1OXTA 1GPBA 3L06A 1RJWA 2B99A 4AJOA 4DDMA 2EAUA 3D54D 3IIEA 3OOEA 4X63A 3RFTA 3U9SA 4V3CA 4EJ0A 1RYNA 3DCJA 3FCCA 3QLJA 5EPOA 1B3BA 1EUCB 3O5AA 2R4TA 4TVSA 3F98A 1OBHA 4NATA 3G9TA 1TYEB 5CVVA 1DXOA 3T9EA 1XWFA 4GXNA 3PYLA 3D64A 3UUWA 4AMYA 3E3NA 3PCRB 3Q3CA 1RAFA 1GGVA 4YRLA 5FOQA 4HYQA 1U0SY 3P94A 3PF9A 1U0GA 3AR4A 5B6JA 1N7HA 5DGHA 2PR2A 4KXQA 5TEWA 1D03A 1ZVVA 4F1JA 1Y48E 4QIHA 3RADC 1TT5B 1ST2A 4EY5A 3JAMA 3TXXA 5B3JA 5DBGA 1Q57A 4CL3A 3E61A 1DEKA 5EIHA 1OPRA 3HUFA 2YFQA 3I1YA 3C16C 4IMPA 1FBNA 2NVWA 5AVVA 2FPPA 3DO5A 3SAJA 2YASA 3B6ZA 3GGGA 1ZOIA 4XJTA 1OX5A 5J58A 3PE6A 2JGFA 4OVKA 3DSRA 2VDPB 1ZZEA 5LA6F 4J3JA 2XXAA 3DFMA 5DKFA 2NVUA 4BXOB 4BX0A 2EG5A 2XVMA 4FCCA 1CB7A 4FP9A 5E0KB 3UTDA 4QNMA 3BTSA 1E9AA 3IDQA 2WQZA 1LV7A 1MEJA 5EUMA 3IAUA 3VKGA 4RTKA 1HL7A 5CM9C 3U4CA 2BBOA 3WLIA 1JS1X 3SSAA 4M89A 3B8HA 2BI7A 2IPLA 4Z1MD 4HH0A 4PFSA 4BE4A 4DSNA 1L7RA 1QLWA 4R9VA 1V37A 2QI9F 2C31A 3W2GA 3CVVA 4ESHA 1MVLA 1P2GA 1TYZA 4MAAA 1L3IA 4AJIA 2V7QA 4XGKA 4S1OA 4QJIA 3NS7A 3R6LA 2GYYA 2VRWA 5DCYA 1IBSA 3GR6A 3VHQA 4Q3CA 3ZHQA 4AQYB 3D6AA 4BNXA 1NLYA 3JWIA 1GKIA 3R8CA 1D2NA 3W79A 5AJWA 2ISCA 2XA1A 4D8WA 4CEIA 3AUJB 2AZ4A 3COZA 3Q0EA 3RD5A 4ZYVA 4K81B 3UANA 2YWEA 3QUAA 2PWPA 4P08A 9ATCA 4GECA 4WI1A 2P9BA 4S35A 4M6WA 1M6NA 4E2WA 3Q3HA 5BYBA 1UZAA 3ZEIA 5G0VA 4D26A 4IEEA 3VO2A 1TOAA 3MJHA 5GGYA 2IWHA 3N8GA 1F7VA 2VH1A 3DM5A 1U5BA 4MUFA 3E2PA 1KBQA 3T7AA 4OA5A 1PVOA 1YMQA 3KQWA 3CG0A 1G18A 1FFSA 1UR5A 3IIKA 5BVGB 1NXWA 4PBSA 1FLDA 1K0UA 4OYLA 4KBGA 5E1MA 1EFVB 1QS0B 1C7ZA 3G8CA 1P6UA 2WIDA 4XLZA 2R1TB 2PU5A 1IB0A 2NSYA 5AK5A 2FAXA 4FDMA 3ZXSA 1JMYA 5ALNA 3JQFA 3AB3A 4QU8A 4WW0A 3K8QA 1DAOA 4KVZA 3K70D 4QOGA 5KSWB 1Z8NA 2H29A 4ZEWA 1DWOA 4RABA 2HA2A 1XT6A 2JARA 2ZIFA 4BX2A 1IBKB 3W6PA 3O8OA 2JLXA 3PNSA 1YUBA 2J0VA 1PE0A 1CPYA 3WZMA 1NDHA 5I9MA 3SYKA 5B3JC 1CU1A 3KT6A 1KQOA 4QPDA 1XFAA 4JEMA 3GH1A 4RS3A 3JALA 1F2UA 1ZRSA 2HHCA 2X4GA 3VMMA 4B44A 1QTNA 1RYDA 1ZPDA 1LH0A 4J4TA 4NMXB 4DMUB 4F8JA 4Z6KA 2GETA 5EGNA 4DL9A 3DP9A 4L4SA 3RQSA 4OOFA 3USCS 2SKCA 2VHYA 4PO9A 1EJ0A 3BVPA 5ENDA 1PVVA 1OHHD 2ASVA 4UHCA 1HQYE 1TCVA 1QCDA 1WCYA 1XG5A 1Z6XA 2HH9A 4JUDX 5D51S 3TLGA 3HKCB 4BFUA 4YV7A 1CZRA 3G2LA 1BCSA 5KNCH 1JF8A 4G0UA 4L0DA 5FV7A 3CV3A 1S01A 2KBEA 3TXAA 2ZG6A 421PA 2JI8A 1UT5A 2O0JA 4LVUA 1XZNA 4AB1A 4JLKA 4P82A 1Q1EA 3GQVA 2FQYA 2DECA 3ESCA 3MUFA 4LECA 4X1KB 4EI9A 5JANA 5KS2A 4QJ5A 2X41A 3OZTA 1BQ4A 3CMMA 3FHCB 3LFHA 1JBKA 3LT5A 1SFRA 3PFBA 2UYYA 4LCJA 4MVJI 4DG8A 3QF4B 1F0YA 3UV7A 3RVOA 2H85A 3G8AA 1W47A 1JRLA 3V7YA 1CY7A 4UE3S 2WJ6A 2CNNA 3RHTA 1RSZA 4KPFC 5JNRA 6AT1A 1ZN8A 1YSCA 1ZNYA 4LY6A 4MKZA 3M83A 2J9YB 4JP3A 1ACMA 1J8FA 2Q6LA 3ZOZA 1NOKA 2PGIA 5A5VA 1SM4A 5JSFA 4OPMA 3O3NB 4OHVA 4FR0A 3W5JA 3UICA 1XD8A 4BE7B 1CT9A 4DLAA 3H2YA 3OFKA 2X1LA 4A8TA 3KZKA 3FOFC 4JUCA 3P9RA 5LB4A 1P0CA 2YIVX 4ZQIA 2AQHA 3HN2A 2ATCA 1PJ8A 2VTDA 1FFEA 2Y92A 1SN7A 3FX2A 1OSNA 3IXMA 3M9WA 2O2ZA 3N58A 3OU7A 4G67A 3RWBA 3LK7A 3DZHA 5IEJA 3JQGB 3F5SA 1XL0A 2F9FA 2JIQA 1ZL0A 2PS1A 1E66A 5ADUS 1F20A 4AM8A 5LP1A 3WAGA 1NOIA 3QWAA 2VJMB 5EIWA 4DG5A 3P9YA 3CA8A 4W6QA 4XQ0A 4Y6OA 1LBSA 1RP7A 2OV3A 2Q2VA 1BEUB 2JKZA 3O75A 3V4LA 3DV0B 2JF0A 2WF5A 3ETGA 4GM4A 5CRIA 2I0FA 4KIWA 4TLLB 5F98A 1BCRA 3HC7A 1ZD3A 4KX5A 4M21A 2Z8YA 4NHEA 1NZFA 4CCYA 2G1KA 3K4HA 3L1IA 1BDBA 2W37A 3QVLA 4N65A 1KY4A 1B43A 1G9SA 4B6PA 3TEFA 4DOMA 1IRIA 5TQ2A 1YVUA 1K86A 1V8OA 4HB4A 3SE0A 2IS2A 2QTWB 2AFIE 4KO8A 2F1IA 2BJWA 2UVDA 4MVJM 4MV7A 5CT5A 4XDHA 4R9SA 3LCCA 1OFHA 3NHUA 2GEFA 4M9XA 2MSDB 3B7PA 3WKBA 5EIBD 2Z6VA 1J25A 2QD1A 1MGOA 2AUTA 1M8KA 1JLKA 3FUVA 1J9EA 4P3PA 1KQNA 4NZYA 1JDSA 1II0A 5G0WA 4PHCA 2GF9A 2ZYTX 1W0JD 1G2OA 2BHRA 4K2HA 1E2UA 4EHKA 2POQX 1N1GA 1XZKA 1DXYA 1O5IA 1XMXA 4O4JA 5EMNA 1YZFA 4TMYA 1Y6GA 4O25A 3HSYA 4MQFB 4Y9SA 1BNCA 4FCWA 2H92A 3KG2A 3ZU3A 2Z6UA 1E20A 3HRKA 3TRFA 1AV6A 4LWOA 5G4LA 1WBJB 5KNBD 3KQLA 3EC7A 3M6AA 3TJZA 4NOMA 1DAFA 1E32A 3V8BA 4CQJA 3H9EO 3I1JA 4TKVB 4Z3KA 3UPDA 5LJLA 3HHPA 4QQFA 5EXPA 4L4RA 1H66A 1XOIA 2BEUB 4JGIA 2O2CA 3S7TA 3VOSA 3VZCA 3HB9A 2XWSA 4TMVA 2WAMA 1DX4A 2H17A 4KFCA 1RMYA 4QDOA 3V9PA 1QE0A 2M1ZA 3W5AA 3ULKA 2V5VA 5JH7B 2FR8A 4PR0A 3W05A 4BPRA 2YZMA 2ZQ5A 4MCAA 1XLWA 1P7CA 4J2TA 2MINB 3LCMA 5TQ0B 2KPOA 3IAHA 2ONCA 2CHEA 4WJZA 1FTGA 2AQ8A 3NDIA 1F4VA 1RXCA 3KWFA 5D6NA 1YBHA 1E9EA 4AO7A 1U90A 4IEFB 5COAA 1DU4A 3L49A 2YV3A 1T8RA 2P77A 3A9UA 1ORTA 4PBRA 4D9IA 1ORHA 5A71A 4EJ6A 5KOIA 2O8FA 3KQPA 2AK3A 2A78A 5E3JA 3REQA 5HMLA 4KWTA 1HNNA 2F8TA 1Q1AA 1SNYA 3DBVO 4ZOLA 2OFOA 3LWBA 4C6TA 1X38A 2HL6A 3WSWA 1QGED 2EEZA 3W3AH 3O1JC 2P79A 3NDBB 2QTVB 1N2BA 4C03A 1M8FA 3BL5A 3QVXA 4F56A 3AVUA 4LGCA 4LDNA 1DEHA 3KR2A 3SFVA 3W06A 3C3BA 4M0UA 5I45A 2IHNA 1KU0A 2GA9A 1GARA 2DJ5A 1CQPA 4Z4IA 2VVTA 3EIQA 1E2DA 4M46A 2ECFA 1EXVA 2O20A 3ASZA 4K46A 2R0QC 3JVEA 1SXJA 3N2IA 1C81A 3CHYA 5DSZA 3VR0A 4OQYA 4MRPA 5BQ5A 4X41A 1Z34A 3V4PB 1W4RA 3WK6A 2IDZA 3AETB 1TM1E 4W8HA 1UOPA 3U4HA 3KSUA 1ECFA 1O97D 5HSGA 5KBYA 2C9MA 4D99A 1WOMA 5IWAB 1BWQA 2ZB8A 3U17A 2H57A 4FHZA 4C7XA 3KWLA 4JT4A 2EWVA 1TMGE 1FSZA 2DKFA 2QE6A 4HGQA 5JLAA 3TI9A 2Q6VA 5I3CA 5IANA 5L8VA 1Z56C 1B0AA 5HJ5A 1MAVA 4BL5A 1UMCB 1XZHA 1JFSA 1JZTA 3CKMA 2XE4A 3UAWA 4TYNA 5LZ9A 1VIMA 2EFGA 3SZUA 2GRUA 4AJ4A 4WIAA 4YQYA 1E2QA 1FUUA 1ZIDA 1XJQA 3W2FA 4HRYA 2FETA 2OQ2A 3EG9B 5C5IA 2V4ZA 2RSLA 5ES4B 3STUA 3RIHA 1KGDA 4PWZA 3KLPX 4H7EA 1J0CA 3OZ7A 3AHIA 1QIGA 2DHQA 3INYA 5TJ9A 3U1BA 2GF0A 2HJGA 3BAFA 2FSSA 3JD3A 1QUFA 4IHAA 2IYTA 3NBQA 4UREA 3VZRA 3EDQA 4C0WA 4BVAA 5IXYA 5L4NA 4MR7B 2XQFA 2VI5A 2Q50A 1EVQA 4KEAA 4ZT4A 5JSYA 5C8XA 5HHTA 5IAAA 3TL2A 1ZSNA 1Q7GA 2JGMA 1SY7A 3NGLA 3P2MA 5DM1A 4WA7A 3D4PA 1E4EA 2E4XA 4OIFA 1F8FA 2B25A 3V6LA 1QHXA 1G4HA 3DDNA 1KO7A 3VQTA 3VTZA 4Z3OA 3ONVA 2WYVA 1M5TA 4R8SA 1H1TA 1GPUA 1OZ0A 4FHFA 5EQFA 2YQ4A 1QHHA 2ZXFA 3IT2A 4G37A 2BEVB 3E81A 2HYIC 1KJQA 2WNHA 4MIEA 3FYUC 1K2WA 5F2NA 3I9NA 1PU2A 1P1RA 3I2IA 4IDGA 1KI6A 5LZ8A 1FP1D 4J9VA 3KD2A 3WNDA 3AR3A 4C22A 2ZLBA 3CT6A 1GQFA 2QZJA 1T3ZA 2ZROA 5EXXA 1V71A 4JJKA 1KBZA 1E0SA 1R00A 2FMHA 5CT4A 4AJKA 4CIWA 1Z2CA 4BNMA 3KVNA 3MOIA 2XA2A 1SVMA 1I5OA 2PL5A 2YY5A 3P96A 3L7AA 4L57A 4OXIA 4CTNA 4NZOA 1G64A 2FE1A 2M98A 4QDZA 1NW6A 4Y8VA 2VSNA 3U48A 4E4TA 4UTNA 4X3PA 3VR4D 2JAHA 2NU9A 5AOAA 1YTUA 1XXHE 3JPWA 1PFUA 4M7OA 1ZHFA 2PSDA 4UZEA 3ZVNA 2FRVA 1N78A 4PZLA 1EX1A 3R0XA 4G9GA 1SXJC 1EI9A 1GZSA 3VPXA 4R0NA 4HQOA 3ZUGA 3QITA 1U3FA 1GNRA 2WTMA 4IIXA 2WIGA 4V0ME 3O4FA 1JB9A 1UJ4A 3G8DA 2PGOA 3M6MD 1Z4QA 1ZSVA 5JYDA 4BDSA 5K5EA 1BN6A 4MCIA 3OPQA 1XQ6A 2R6GA 4N3AA 3ZQKA 1XL1A 4Z7QB 1MQAA 5ICGA 2WJVA 1YRAA 1GXSB 3DMHA 3FBGA 4BRSA 3CC8A 2ZRHA 2BFBB 2ZIAA 3F9IA 4I4IA 2QRHA 4TKUA 4HWOA 1T6ZA 2QJWA 2V6MA 3C15C 4Q9AA 4EECA 1DX6A 1GPYA 1U4OA 1DQPA 3AZOA 3FSGD 2C98A 3GHYA 1KZ6A 4QUKA 1M1YE 2ZBGA 5C1OA 1ZGJA 3FTEA 4U2DA 2R5NA 4A5OA 3B5JA 3GJQA 5DCWA 3W5UA 1HTTA 1NUUA 3FRJA 2XSZD 4DUYB 1MPXA 1RWVA 3OZGA 2Q1SA 4LOIA 4PXYA 1CY2A 2VHQA 5ALQA 3TVDA 1TUGA 2HWYA 1GQQA 1AKEA 4I36A 2OOSA 4R8LA 2FPSA 1HDRA 3DR3A 1X92A 4E5UA 3EXG1 3V8VA 2IYOA 1IUPA 3KB1A 4E94A 4IDBA 2UYCA 3QXSA 1XVUA 4B48A 2HJSA 4S2EA 1GL9B 1I1OA 4MQ6A 2EP7A 4B45A 2B36A 3FBTA 4DMMA 2IHZA 3CSSA 5DNVA 3R2JA 4A1FA 2WA2A 4EL5A 2JZOA 2INGX 1RIFA 1NWCA 2FEAA 1U9ZA 2VJQA 3T7JA 4BLOA 5HRCA 3SEFA 1Z4JA 5LA6B 2O7NA 5AYVA 1PTJA 3FPEA 4I6EA 4CM4A 5C8ZA 4BDTA 3LSTA 1M6EX 1L4UA 2JGLA 3VU1A 4RU1A 1GZDA 4XVHA 2OCAA 3KELA 4Q6WA 5TT0A 3HJUA 4CMCA 2LXNA 4MNTA 5JSZA 3DBHA 1H1DA 3TIXB 4O4IA 1E4YA 4EVQA 1BJRE 4G8DA 1AURA 3SZLA 2AYXA 2D0IA 4PCVA 5FWXB 1ZMXA 3GEEA 1T6YA 2Q1XA 1KO4A 5GJBA 1PK7A 3IQZA 4WRRA 3RFFA 1K6XA 2QY9A 2X9GA 2YWJA 4MI1A 3A10A 3H1BA 3WL5A 2NYAA 3P45A 2PU7A 4GYYA 3WL3A 3OA2A 2K4MA 1A9XB 2BEWB 5AP9A 3TUZC 2IGTA 3CU5A 3HCPA 1J56A 4D0NA 1GNVA 5ABPA 2MMCA 2AFIB 2FDCA 4DCGA 2H5LA 1I4EB 2KSQA 3F74A 3L3BA 3T3HA 1ZHOA 2JH8A 1VE1A 3E2MA 1ZW6A 3GFOA 3L6UA 1WMSA 1I4WA 1SHLA 5JOQA 2LDXA 4GSYA 3D0KA 4Q01A 1Q21A 4PZEA 3X1DA 2AG6A 1A8SA 2JIMA 2QRVA 4DQVA 5DM2A 4E70A 2ABWA 1YASA 3NOOA 3OY2A 2PT7A 1GCIA 1GZ7A 2DOKA 5K6TA 2AZTA 3RVMA 4K9SA 5AXDA 3I6MA 4HDRA 3ST7A 5T4EA 3EPKA 5F9HA 2AJTA 2D1RA 1ZH8A 2PUVA 3IQXA 2X8LA 3F8WA 1DO2A 2OGUA 2XQIA 4HRVA 4E14A 5JS6A 4K6HA 1Q5PA 3U3XA 4G0OA 4QLAA 1A8PA 2I1LA 1W5TA 2CUZA 3C97A 1FTNA 5ILOA 5HRAA 1KOJA 2GN9A 4RF3A 2W6JD 2WNIA 4IYJA 3NFYA