3JQ8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine (dx3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFARQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
total genus 95
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq8A00
4W7IA 4OKNA 4AICA 1AUPA 4BGEA 1PIWA 2DBZA 5HM8A 4I5GA 1ADCA 2E6UX 1EVYA 1P45A 2OL4A 1B8VA 3JQDA 1PWXA 4EJMA 3OIGA 4EUFA 3JQ8B 5COBA 1VL8A 2NVUA 5B12A 3HB4X 4ZJUA 4CMCA 3ETGA 4GWKA 3ASUA 4IJVA 3L6DA 3GHHA 4Y9DA 3V1UA 1O6ZA 1DAOA 1U3WA 1NR1A 5TX7A 2JKVA 1OAAA 2X23A 5CFZA 1NQTA 4IDCA 4OXYA 3TOZA 5CHEA 3W8FA 3ENNA 1HWYA 4BO3A 4IDEA 3RROA 2Y99A 4DIOA 1HF3A 4F3YA 4Z6KA 4CLOB 2GN9A 5AXDA 1ZSVA 4IM7A 3DONA 1HSZA 2PH3A 1LDBA 2JFHA 2O7QA 3BXXA 5KVCA 1DDOA 1FDVA 1XA0A 2PGDA 3ANNA 2IE0A 1B7GO 3IKVA 1FDWA 2IEBA 3K6JA 4J1SA 4NH4A 1E77A 2ZTLA 1LRKA 3GEGA 3OF2A 3GNQA 1DIBA 2YJZA 1QV6A 5AXBA 2AQ8A 1EEHA 4BMVA 3KLPX 1EBFA 3ULKA 1IULA 3LZ6A 4A5OA 3WNVA 4CV2A 4HFRA 3IJPA 4OQYA 1PL8A 4E31A 5GZ1A 4MP3A 1DOHA 1HXHA 2FR8A 3B70A 4CQMA 4GWGA 4OOEA 5I7SA 4TQGA 1P1KA 3DBRA 1E3WB 4JQCA 5AOVA 4PLPA 3GQVA 2YDYA 3WXBA 1Z7BA 3RBVA 4BKRA 4NR0A 3RUCA 1XU7A 3JQAD 5KKCA 1U2GA 3JD3A 5JCJA 6LDHA 5ILOA 3FWZA 5C37A 4RF4A 4U8GA 5CAEA 1FF9A 3Q9NA 4BVAA 3WQRA 3OETA 2EP7A 4BMSA 2JJYA 4UUNA 1SNYA 3U49A 3JTMA 3N74A 1JTVA 1T4DA 4MKRA 4PVDA 2HRBA 5EN4A 1V3VA 4UREA 5DOZA 5EERA 4DREA 3QLJA 1P44A 3QWBA 4J4BA 1LUAA 4FB5A 1X13A 1YL6A 2PD6A 3KEOA 3I4FA 2FSVA 1HE3A 1IPEA 2VHZA 3ZH2A 1YONA 1WPQA 3NJ8A 1EFKA 2AXQA 1C1DA 4GL4A 1GY8A 4JXKA 2HO5A 2Q2VA 4NBUA 3E5MA 4PIVA 1CQIA 3K96A 5HS6A 2DPGA 1BG6A 2PGLA 3OJLA 3ADPA 3DAPA 3ZW9A 1BGVA 4YT2A 1XG5A 4AL4A 1Z74A 2RH8A 2WE7A 3F4LA 1YQXA 1UJMA 2BH9A 5ENDA 2RHRA 4A2CA 2Y93A 3RUAA 1T2CA 5BSFA 1XHLA 4DPMA 1AXGA 4C7JA 3GH3A 1DJNA 1WLYA 1GU7A 3CE6A 3ONFA 1HYEA 2JAHA 3WGOA 3MZ0A 1J5PA 1ARZA 1H0KA 2UUOA 4CV0A 3DHYA 5L40A 5JSFA 3L9XA 4IDDA 5EIOA 4NPCA 1ZCJA 3GMSA 4P22A 4RF2A 1ZMTA 4IS3A 3QWIA 3NKLA 1EE2A 1LRLA 1P9LA 1XDWA 3H5NA 3E9MA 1YWGO 3IJRA 3KYCB 4ZRNA 4QFCA 4P4LA 1KY4A 2NU7A 1LQUA 1MXHA 1OMOA 1PR9A 3SLKA 1XSEA 3FBTA 2YDXA 4W7HA 5DBIA 3NGXA 5A02A 1T2DA 2BLLA 3PQFA 2EKQA 1YQDA 2PA3A 4YQYA 4PZDA 2EV9A 4BHTA 3DOOA 3I3OA 4B4OA 4PG8A 2PZKA 1SEVA 1XQ6A 4R1UA 1R4MA 3EVNA 4MKXA 5CDSA 1GUZA 4DTIA 4ROSA 1GPJA 5A1TA 1MC5A 4F6LA 4A03A 4IDGA 5HBRA 1DFGA 3WGIA 4GGPA 1E6WA 3V2GA 4R68A 1E92A 5KWEA 2HRZA 2QZZA 4DPLA 2BRUA 3ST7A 3F1KA 3OP4A 5BSHA 3RBZA 1AN9A 1ULUA 3CTMA 4NK5A 2WE8A 1DC5A 3MCVA 3QY9A 3JQEA 3ANLA 1EQ2A 2YZ7A 2VYVA 1V6AA 1WDLA 3ZU2A 3HHPA 1P1RA 3U4CA 5IFLA 1PJTA 3VTFA 3DZHA 5L4NA 3WS7A 2QIOA 5GMOA 1E1NA 4MIOA 3PQEA 2NLOA 2O3JA 4IINA 4E2ZA 3PLNA 1ENPA 1GYRA 1C3VA 3AWDA 3GN1A 4I9NA 4XWYA 1CF2O 4KZPA 3P2YA 5T57A 2GNAA 1UDAA 2X8LA 4RDIA 1E3EA 3BMCB 3F5QA 4NI5A 2EW2A 1DB3A 1HDXA 4PG6A 1L7EA 4ND3A 4E5NA 1D7OA 2YFHA 5H83A 5HA5A 2EGGA 4HWKA 4UVIA 1KIFA 5DCUA 4NJMB 3NTRA 4R9SA 1UR5A 2ZJ0A 4JP2A 4J6FA 1IY8A 3RKUA 3X2FA 1U5CA 1A9YA 1DHRA 4YTEA 2IYPA 1YB1A 4XA8A 4II3A 3HSKA 3T4XA 3GAFA 4QECA 1KEWA 3NJ4A 3JV7A 4J2OA 4L74A 1CIVA 1ADGA 1H2HA 1H94A 4D42A 3PDUA 2VUSA 1QYXA 1U7HA 2XF8A 4MINA 5L9AA 2NADA 1O8CA 2W2KB 4BKQA 4RVHA 3B1KA 3GEDA 5IDWA 2CY0A 4RQTA 1RWBA 1T2AA 4IDAA 1PZFA 3WQQA 3ZHYA 5JS6A 1SZJG 4E13A 1A7KA 1LDNA 3DHNA 3GVCA 4L8VA 3LLVA 2GN8A 3LSYA 5BNTA 2C20A 4U0JA 1I3LA 4ALJA 3H9EO 2E82A 2YHIB 3ENKA 1Z82A 2FPPA 2SCUA 1RYEA 1MLDA 1TT5A 1K5HA 1U4OA 3OQBA 4HXYA 3DZBA 4J16A 3RD5A 4CMIB 4EEZA 1GQQA 3WMWA 4YAKA 1PQWA 2XXJA 1E3JA 5EQDA 4E2XA 5LC1A 4TRMA 4QT0A 5L4SA 2DU8A 4AJHA 4N5LA 2NVWA 2P2SA 1VJ1A 1SB9A 2FSSA 2B4QA 3D7LA 4WK6A 1IHYA 3OM9A 3KLMX 1WWKA 3PVZA 1KVSA 2PR2A 1Z6ZA 2VRCA 3AW9A 4W82A 3I9KA 1EVZA 4IQGA 4M1QA 1BW9B 3EDMA 1DIAA 1Q7BA 2CNBA 4D7AA 2DT5A 4A10A 2Q3EA 1ISMA 5AVOA 1E3SA 2IZ0A 2JL1A 3G0OA 3UF0A 5CEEA 4IBOA 3TRIA 1XIVA 2QRJA 5C7OO 3OJEA 3VH3A 1U5AA 4CMAA 4N7RA 4EUEA 2BI7A 3TF5A 1ZK1A 4XQEA 2Y1EA 2EJVA 3PHLA 2AW5A 2CDCA 3AY3A 3DFUA 1Y1PA 4XQGA 1PWZA 3QWAA 1RPNA 1M67A 3CKYA 4JK3A 1WZEA 4KOAA 3WICA 5AQ1A 5KJ1A 5JDCA 4FSHA 3RU7A 1ISJA 3PFFA 3IP3A 3QVTA 1NASA 3GRPA 5JAMA 4JIGA 4TRJA 2A92A 3ZWWA 5B4VA 5JBIA 1UXGA 1J4AA 1R4NB 2I66A 4XB1A 5JAIA 3KETA 2J5RA 2JHFA 4WKGA 3GPIA 4M49A 1RKXA 3I9MA 4NU6A 1JWBB 3U4HA 2E48A 2CF6A 3IAHA 2WDZA 1EDZA 2PLAA 4LMPA 3RFVA 5L53A 1U4SA 2VZ0A 2GN6A 4L4RA 2P4HX 1ISIA 3ONEA 3NT2A 3WIDA 5LDHA 2R00A 3W1VA 4IIVA 3GG2A 1B15A 4RL6A 3P2OA 1SB8A 1YO6A 4J7CA 2PKQO 3PHGA 3NYWA 1FXSA 3INRA 3PHJA 3SXPA 3LT0A 4MJLA 4TVBA 4W4TA 2BKAA 4BUCA 4Y6PA 1S6YA 4R9RA 3ROKA 2JCYA 2CVOA 1V3TA 3UVEA 3CZRA 1M76A 2FY8A 1X7HA 2OFPA 1I3NA 2WTBA 5CG1A 1KOLA 3DXFA 3HNPA 3JQGA 1JW9B 1WW8A 5JAZA 3MTJA 5F1OA 4ZU3A 4CODB 1DPGA 2IXBA 5H82A 2G5CA 1MXFA 3AY6A 3B1JA 3H65A 1KVQA 3KVOA 5TF4A 3L6OO 3NT4A 1T4BA 4CLXA 5C3MA 3RIHA 5I8WA 3I9NA 2Q2WA 2I3AA 3BMOB 4FOSA 1I0ZA 4R16A 3ASVA 3JCZA 4IUYA 2OP0A 1K6IA 1YXMA 4ALNA 1BHSA 4N5MA 4B3IA 5A9SA 4WOKA 3VZRA 3WTCA 2PK3A 3B20A 4HY3A 4KTTE 3KZVA 3KSZO 4WPGA 5CPFA 4DC1A 4D0SA 4CLDA 1HDRA 4Q3BA 3P19A 3QIVA 4R1TA 1ZK2A 3AU9A 5JAQA 2X9NA 4R54A 3O38A 4UEOA 4FGSA 2GPTA 4YRDA 1B0AA 3CH6A 3V2UA 2IZZA 5A9TA 1T2EA 3WYEA 2HK8A 1N5DA 2V65A 2Z1MA 3D3WB 1N9GA 2DUWA 1R16A 1PL6A 2C5AA 1KS9A 1RYDA 2P68A 8LDHA 2OBYA 1GPDG 1U8FO 2VHYA 1EFLA 2AEJA 4J4HA 3DZJA 4NQZA 4A27A 4BO8A 4EGFA 4B3HA 4PRKA 1LJ8A 1NPTO 2QYTA 4Z9FA 1KYQA 1I24A 2C82A 1IZ9A 1K3TA 3PP8A 3JQCA 2O3TA 4FN4A 3CIFA 3D5QA 1PTJA 2QX7A 3PK0A 3FNFA 5DP2A 3FR8A 1ISHA 1A71A 3JYLA 1ZKMA 3U9LA 1RJWA 3HN7A 1PZHA 2VZ9A 4M89A 4B4WA 3RC1A 4E12A 4CV1A 1NPDA 1QP8A 3NTOA 2X0NA 4JROA 4FFMA 1L7DA 2JHGA 4UUOA 1O89A 4CM4A 9LDBA 1ZK0A 1QR6A 4YRAA 4WLOA 3DBRB 3DO5A 4MVJG 4NDNE 4YJGB 5I9NA 3DDNA 3F3SA 4OH1A 4U7WA 1N92A 3IP1A 3BTOA 2ZQZA 1VPDA 2CUKA 5IDQA 4JBGA 4Q3DA 4OOFA 3HZZA 1D1SA 5IN4A 5JC8A 5CDGA 1Y8RA 1JLLA 4S3MA 3JQ7A 1KEPA 5G0VA 1B8UA 3K92A 1KBZA 3RC7A 4RV9A 4XQ9A 2TMGA 1O5IA 1U3TA 3G1UA 4CL8A 3EHEA 4B7XA 3KYDA 3CINA 4ESOA 3GGGA 4XB2A 4LK3A 2QQ5A 2ZB3A 3WGHA 1MP0A 3WJ7A 3CXRA 5L7YA 4UVHA 4JCOA 4MO2A 2X0JA 1MA0A 4ZHSA 2W90A 2C7GA 4DLBA 1IB6A 3GFBA 3VDRA 5I7EA 3SC4A 2ZYDA 3PTZA 3EUWA 4Z9XA 1A4UA 1BXZA 3ZU5A 5U9CA 4XIYA 5IN5A 4F6CA 2I76A 2VWQA 1SAYA 4RPLA 3FNEA 4YJHA 2GR9A 2PFGA 2AMFA 1HYHA 4FDAA 2DC1A 4QXMA 5JO9A 2NVBA 4GAEA 4WASA 4K9DA 1L1FA 5ES3A 2HSDA 1PSDA 3DWFA 3WSWA 2W2LD 3OJOA 4EJ6A 3S8MA 5JNLA 2O7SA 3WLFA 1A7AA 1H5QA 4BNYA 3DMYA 5BSEA 1SCUA 3UAGA 1K0UA 1HDOA 1KC1A 4AJLA 1T25A 1P1JA 4WLEA 3TL2A 3H9QA 3PIDA 4E4YA 2O3QA 3H3JA 1V3UA 1A72A 4BNIA 3RFTA 3UKOA 1B8PA 4RJTA 5HTOA 2Y66A 3NDJA 5JYEA 2HKIA 5IDXA 3TZQA 5A5FA 2YV3A 1IYZA 2R2GA 2Q46A 3O4RA 4D3SA 3H5RA 4CV3A 3C1AA 1CEQA 1E6UA 4DQVA 3UOGA 3ZHXA 2D59A 4IMPA 2FR1A 1I3MA 2EWMA 3OQ6A 4LCJA 2CDAA 2QRKA 1HT0A 4GVXA 4YVFA 1G0OA 4GSKA 4ZRMA 4WLUA 4RDHA 5A4DA 5J23A 4WOJA 3A14A 4AJ2A 1X7GA 3UCFA 4JBIA 4PG7A 4QEDA 2JD1A 2TMDA 3BHIA 4TZKA 5G4KA 4YRBA 2PD3A 5K9ZA 5KVSA 5KJ6A 1G0NA 2PZJA 5JMPA 1PL7A 3ZNPA 4IXWA 1PGOA 1C0LA 4NBVA 4W99A 4BO2A 4ZQFA 1PJLA 2C7VA 3GZNB 3NV9A 3KXDA 1X1TA 1NQ5A 4EDFA 2AG5A 1NNUA 1XU9A 4IJWA 1ZIDA 2DBVO 4TROA 4HBGA 2HJRA 3LC1O 3K8ZA 1S7CA 5L3ZA 2D3TA 2P91A 3DBLA 4KMSA 4YJFB 1GQYA 3H9JA 2PKRA 1Y8QA 3RUDA 2WD7A 3ZV6A 3QW2A 1E7QA 3GPDG 3ZWXA 3D3EA 3ZV5A 2ZIZA 4WUVA 3ZV3A 1ENZA 2XPCA 3ZNOA 4XDYA 4PGFA 3GK3A 3WTBA 3QRWA 2ZJ1A 1I3KA 1YDEA 2X86A 4OM8A 1VJ0A 5IZ4A 1V0JA 1XQ1A 1UH5A 2VYVD 2X4GA 3K31A 4CM8B 3BTUA 5FWNA 2GZ3A 1NAIA 1Y5RA 3K73O 3VZSA 5CDTA 1OFGA 4ALMA 1C0KA 2BFMA 1EUZA 1IHXA 1EBUA 3GVHA 1OC2A 3KB6A 3HFSA 1PJ4A 3DBHA 4L75A 4WECA 2BF7A 4KP7A 1T24A 1ZO8A 2IRWA 2BFOA 4J43A 1VE9A 1I33A 4BB5A 3A4VA 3LVFO 4RLHA 4BGVA 4CMJA 3G1TA 2BFPA 4R3NA 3AY7A 4DLLA 3OIFA 1HDGO 2NTJA 4NFHA 4N18A 5TRTA 8ADHA 4UAGA 2J6IA 4BO4A 3JQAB 3RAJA 1N8KA 4YAJA 2CZCA 1B3RA 3MWEB 1UDCA 3PQDA 4BNLA 4BGIA 3E18A 4I8XA 3RUIA 4UVDA 4BKUA 3VZPA 1AHIA 1X1EA 4L73A 3BTVA 4J9UE 3WMXA 2VTDA 1XYGA 3MTGA 4R01A 3Q2KA 3BYZA 2VYND 3ORFA 2UUPA 3QA9A 4H3VA 2B5WA 1HDYA 3OH8A 4WCFC 4D45A 4D79A 3PEFA 4WCFA 4PCVA 1J49A 3OHSX 3FPLA 4LSMA 3WBBA 5CDYA 5JDIC 1JVBA 3TFQA 4BNZA 5JDIA 1QSGA 1QYDA 2D1YA 1NBOA 4J3FA 4TRNA 1EDOA 2C54A 2VOEA 4XEHA 3FTNA 5GZ6A 1DC6A 1ZEJA 1Q7GA 1O95A 1B14A 5ADHA 5TLSA 4XJSA 3QVXA 1I2CA 1ZXLA 1YOVB 3CSDA 1E1LA 1EVJA 2A4KA 1CWUA 1NHWA 3GHYA 2XAAA 1RM3A 4P8RA 4U6SA 1RM0A 1CYDA 1M6HA 1UP7A 3TFOA 2CFCA 5DDIP 3WGQA 1JAXA 2V6FA 1P1IA 2JD0A 1QV7A 2BFAA 3O26A 5JFOA 3JD1A 3LC7O 2J5QA 2GCGA 3OBBA 1YKFA 3U4IA 1H9BA 4DL9A 1GQ2A 3EZLA 2BELA 3PLRA 3M1AA 5KNLA 2W2LA 3WGYA 3Q6IA 4HNHA 5C5IA 2DFDA 3SC6A 3H2SA 2X9GA 3INGA 4WE3A 1BXGA 4NBTA 2P9EA 2VRCD 1HYGA 2EIHA 4CMBA 3QQPA 2HCTA 1HZZA 1MX3A 2AEFA 3PJDA 4R5HA 5KJEA 3I9OA 4JLWA 4JNKA 3SLGA 3KEQA 1HL3A 3GMDA 4ZVVA 4WJZA 3GR6A 4YB8A 2FPGA 4HKTA 1T26A 3OJ0A 1FJHA 1XKQA 2B69A 5GY7A 3BMNA 3ONDA 2YQ5A 3EZYA 1XWFA 2Q50A 1C1XA 4I9UA 3KUXA 3AUAA 4PLWA 3GA0A 2Y1GA 5BT9A 3TQHA 1GYQA 1GEGA 1MUUA 1H6BA 4XR9A 1SEPA 4WNIA 4AJ4A 4IMRA 1V35A 5TJHA 3N7UA 2HK7A 2YV2A 4IJKA 4RPGA 1GYPA 1GZ6A 5JLAA 5KOIA 3SJUA 1NAHA 5U4QA 1JWAB 1GAEO 1NFRA 2BGKA 3NRCA 4E5PA 2Y05A 5FYDA 3RBXA 3ZU4A 4D44A 3I5MA 5H81A 2X6TA 3AFNA 2Z95A 2G82A 2W4QA 1WMAA 5BNIA 1VJTA 4KWIA 4GPD1 1ZJZA 5JE8A 3ZZNA 1G6KA 2YV1A 4WEOA 3WLEA 1WNTA 4TSKA 2ZCVA 3DZGA 3FN4A 1PZEA 3VOSA 3PZRA 3BA1A 1RM4A 2GF2A 4Q3AA 4GKVA 1DFHA 5A9SB 3GG9A 2RHCA 2EW8A 4UULA 1N7GA 5MDHA 4K28A 3GLQA 2FP4A 5L7WA 4BNXA 4E5KA 4ZICA 1P1HA 2PY6A 3WGTA 5DN9A 1E1MA 1ZNQO 1Y81A 4ALLA 2FZWA 4DIBA 1GTMA 2EG9A 4DA9A 3FTPA 3RQSA 2NM0A 4BNVA 4JJIA 4YBZA 3HN2A 2ZB8A 1TEHA 3G49A 4GX0A 2BI8A 5F3RA 3OICA 4DXHA 1GCUA 1LDYA 1QXSA 3ZWPA 3FR7A 4GMGA 4ZGWA 2V7PA 3COSA 3M2PA 5DBFA 4EYEA 4XR4A 3GT0A 4MIYA 1Z45A 4CQLA 3ZGYA 5THKA 4M55A 1PS0A 3ROPA 3W8DA 3MOGA 1EK5A 4ALKA 1R12A 4KQWA 4YT8A 3PPIA 4J2HA 1VL0A 4WEQA 5DP1A 4YT5A 3HFGA 3ETDA 1YGYA 3LC2O 4ND4A 4RVFA 5F5NA 2VT3A 4LVUA 3GVPA 3PJFA 1K2WA 1NR7A 1Z73A 4MIEA 2UDPA 4FC7A 1F14A 3JSAA 3UXYA 3V5NA 3GEMA 3K2BA 4JBHA 5TT1A 1U3VA 2WWRA 3C1TA 1BTOA 2JFFA 1N2SA 5G0UA 1VSVA 2F1KA 1F8GA 2VYNA 3MJ4A 2Q4EA 1PGJA 3L4SO 4PLCA 4B7CA 2JCVA 4MPDA 3VC7A 3M2TA 4PLGA 5G4LA 3ROQA 2AQIA 3H2ZA 3AK4A 4QO7A 3JQ8A 4WLFA 4P4GA 1CDOA 4RF5A 4XZ3A 4B7UA 1F06A 4JGBA 4HFNA 4XYMA 1PJCA 3ETEA 3JYQA 3S1LA 3DTTA 1UXJA 2GRAA 4R4JA 5IDYA 4RPKA 4BNJA 4XRGA 4AVYA 3AU8A 2ZQYA 1QG6A 1MG5A 2V6BA 3D1LA 5I8ZA 2I5PO 3ZWNA 3F4BA 4YXFA 5FI5A 1JDJA 5B1YA 1NX6A 3BHJA 3C85A 4CMEC 4CMEA 5JO0A 5JW6A 4O6VA 3L77A 4CLOA 4MKZA 1W6UA 1JKFA 3QSGA 4BQRA 5B4TA 2Z1NA 4INAA 4U0KA 1GV0A 3KHUA 3HUDA 5ER6A 3FF4A 2UAGA 3V8BA 1LSSA 4OQZA 3Q1LA 1DHTA 3PWZA 1SOVA 1E0DA 1KVUA 4LN1A 1N1GA 3P7MA 4OSOA 1HRDA 2D5AA 3VH2A 3SVTA 4H16A 2ZTMA 3KSDO 1XR3A 3ANMA 3PJGA 5ER9A 5A05A 4BNKA 1Q0HA 4AJPA 1VSUA 2DFVA 2VOJA 3KRTA 1WDMA 3GNSA 5FFFA 4IZIA 3D4PA 2R6JA 1ZVMA 1ADBA 2I65A 3GAZA 9LDTA 1P77A 4E30A 1N7HA 1Q0LA 2PTGA 4HADA 3FCOA 2JFGA 4J49A 1E3WA 3H9GA 1DFIA 2WSBA 4PFJA 2J5KA 2ET6A 4FGWA 1KETA 5HRUA 3VAZA 5F21A 2ZK7A 4OL9A 3G3EA 3ITDA 3G79A 3QE3A 4LGVA 5JCXA 1TXGA 3CZMA 4AJEA 1E7WA 2BGMA 4CMKA 1M6WA 4Z0PA 4CMGA 1P0FA 4DLAA 1HLPA 4OO3A 1BDMA 3F1LA 1WAMA 1UAGA 5TJ9A 4XYBA 2WD8A 3E5RA 3EGOA 3HDJA 4O5OA 5T8KC 3TOXA 1D3AA 3ZWMA 5T64A 1QORA 3ZHZA 1JVSA 4D0RA 1OC4A 1O0SA 1YS4A 3PWSA 2GERA 1Q7CA 4RVSA 3T7CA 3WDSA 1DIGA 5A3VA 1H6CA 4XYGA 3DAGA 1PU2A 3KM0A 3SJ7A 5ILGA 5A04A 2DKNA 3I6QA 4QTZA 2FZEA 4GX2A 4RORA 2W98A 1F8FA 1NWHA 3FD8A 3C7CB 3UCEA 2AE1A 4NJOA 3ZN2A 3AUSA 4QFDA 4OMUA 3MWDB 4YAGA 4XX0A 3DBLB 1HZJA 2HMUA 2DM6A 4DQUA 4FR5A 1CERA 4AFNA 3RUFA 4F46A 1PQUA 3BMQB 5IG2A 1B2LA 1GZ4A 3AM3A 2RAFA 1ONPA 3PIIA 4B8WA 4XD2A 1QMGA 3KYCA 4IQ0A 5F1KA 4BO7A 1UUFA 3DQPA 3RC9A 3IC5A 4XGNA 1O9BA 3GDFA 3PHIA 4MVJI 2NVUB 1YJ8A 3IUSA 2QYSA 4XRRA 4FBGA 5BR7A 1EMDA 3ADOA 3FPCA 2BHLA 2EKLA 4UVEA 4AJOA 4DBVO 1E7SA 2PGJA 2Q1SA 4O63O 3ZU3A 4HP8A 3HDQA 1QKIA 1W73A 3ICCA 3R3SA 4GLOA 3TNLA 3QWHA 3U5TA 1UZLA 2CDBA 3ZWBA 1NM5A 1EUCA 1NFQA 3TZCA 2WM3A 1PS9A 5COAA 2Y0EA 3K30A 3RUEA 3V1TC 4J7XA 1DC3A 1EK6A 4RVUA 4G2NA 4Q39A 1IUKA 3WQSB 2D8AA 2OORA 2NWQA 2HLPA 1PGNA 3E6AA 4J1TA 5DT9A 5L7TA 2VWHA 5F5LA 1UP4A 3PDJA 1R0LA 4TMFA 3W4IA 3B6ZA 2AE2A 4GH5A 4MP8A 4YACA 1OOEA 3D64A 1GL3A 4IPTA 2G1UA 1JKJA 3PWKA 2EJWA 3IKTA 4B4VA 3EK2A 3BMCA 1LC3A 3OQ1A 1GD1O 4CJXA 1LDEA 1TT7A 4CLEA 4BNFA 2B4TO 3GGPA 2J3JA 2ZATA 4XYEA 4BGUA 5EJ2A 2J3KA 2I9PA 3IUPA 4IJUA 1YBMA 4CQMB 4UUMA 2Y0DA 1DIRA 1E3LA 4G5HA 4ZQEA 3H6KA 2VUTA 7MDHA 2HDHA 2ZYGA 2DTXA 4CUJA 1ZSYA 3OSUA 4HV4A 5GZ3A 1MFPA 5THQA 3G17A 1Y5MA 3GN2A 3S2IA 3I6IA 4LRTB 4DRYA 3WOHA 5K6AC 5K6AA 4GGOA 3QP9A 3R1IA 4RO0A 3WB9A 5CDUA 3L0DA 2O3RA 1R15A 5BQFA 2IXAA 2W2KA 1EQUA 4H15A 2Y1CA 4JJGA 5CEFA 1J0XO 4D3DA 3WWZA 1Q1NA 2G0TA 3JD0A 4YA6A 4CM6A 4OAQA 1MV8A 3MJSA 1DSSG 1UZMA 2XOXA 2NACA 2WYVA 4LRSB 1DEHA 1ID1A 3H4VA 1BSVA 5JMWA 1C1DB 1F17A 1U7TA 1GEEA 1YQGA 4K6FA 4MVJF 2YHIA 5CP8A 1GCOA 4S1VA 3ZW8A 2CVZA 2H6EA 3JQFC 5KKAA 3JQFA 4CMIA 1PZGA 3Q3CA 3WIEA 3DZIA 1NQAO 1LX6A 2V6MA 3LDHA 4X54A 4Z0TA 1NPYA 1X15A 1DIHA 3UCXA 1KEUA 1ZW1A 2GDZA 4FFNA 4NBWA 4WCDA 4FOOA 4KUHA 4XIJA 1WVGA 4UEKA 3AM4A 3WGGA 1DXYA 2GZ2A 4M87A 4ND2A 3RUHA 1C14A 3K5PA 2VT2A 1IZ0A 3IDSA 4PG5A 2VZ8A 4YEDA 1ZUD1 2GO1A 1GUFA 2EXXA 3R6DA 3H7AA 1J6UA 1BRMA 2HAEA 1K6JA 1BW9A 4MVJM 3RU9A 3GGOA 3BAZA 3QVWA 5JPIA 5EQFA 1D8AA 4J0FA 5A5EA 3C7AA 4FJ2A 4GMFA 2LDXA 4RF3A 3DFZA 1DRUA 3ZWAA 1H6AA 3DOJA 4BB6A 3RASA 1LBEA 3NTQA 2O23A 1Q2XA 3TL3A 1ML3A 1LRJA 1OBFO 2ZTUA 2DVMA 2GYYA 3TWOA 1DAPA 4LW8A 2Q49A 1DLIA 1R4MB 4J4TA 3LF1A 3MOIA 4DBZA 3DAFA 4OGWA 5F1PA 4CPDA 4PLHA 4PLTA 2Q2QA 2X7HA 5BSGA 4A7PA 4ITUA 1QYVA 2Y1FA 1IL0A 4CM5A 1R4NA 4J91A 1H93A 1LSJA 3DEYX 4G65A 2X5JO 3B1FA 1BMDA 2VTEA 4O59O 3HE3A 4Y6RA 5FF9A 5CPBA 5DF1A 2JD2A 3W6UA 2PKQP 1PGPA 5G2OA 5EL0A 1D1TA 4HX5A 2ZKLA 4YQZA 3ZWVA 1SO8A 2UVDA 1H2BA 2GZ1A 2W8ZA 3LT1A 5T6BA 3VH1A 1UXIA 4Y8VA 3WNQA 4BO5A 4AJKA 4YYZA 3VTZA 1T1SA 3MEQA 3VH4A 3HJAA 3GC6A 4RZHA 1TLTA 4YPOA 4NIMA 1LXCA 1NWCA 2X5OA 3H3FA 5EMHA 2CSUA 2QRLA 4RCVA 1E3IA 1F0YA 2P5UA 3MJTA 3NGLA 5DOVA 1HKUA 1TI7A 1ISFA 3VPGA 3JD4A 2NUAA 1BDBA 1W0CA 2E4AA 2O48X 3RKRA 1YL5A 3JD2A 1YH3A 2C2YA 3R3JA 2YW9A 3CMMA 3LYLA 1NXQA 4E21A 4R41A 1DLJA 4W6ZA 3QVSA 4TKLA 4GSLA 3RC2A 3QJ5A 4E33A 3NDRA 5LCXA 3IOYA 1HE4A 3BMOA 1ENYA 4BO1A 4BL5A 3AI1A 4RPJA 4QX6A 4TZTA 3D4OA 4CL3A 5B37A 1JN0A 1XCBA 2ZCUA 5ITWA 5IAAA 4PZEA 1PEDA 4II2A 3HB5X 4CM9D 5EINA 1A4IA 3O03A 3OECA 1ZFNA 4L4XA 4MVJD 1ZK3A 2AA3A 1E7YA 3W8EA 4YDRA 3DOCA 3AI3A 4XDZA 1PX0A 3F9IA 2P5YA 3WSVA 2X22A 4O1MA 4XGIA 4E0BA 1ULSA 2WJPA 2C07A 1TT5B 1CETA 5A03A 1KC3A 3AI2A 1GFSA 2C5EA 3BIOA 1ZK4A 3S2EA 5A06A 2DTDA 3IL2A 1R0KA 4Z3DA 4PLFA 1FDSA 1I2ZA 1PJSA 3AUTA 5T5QA 4BKPA 3TZ6A 3KSUA 3D3WA 2O2SA 3QVOA 4FS3A 2X0RA 2F00A 3W6ZA 3I83A 2OZPA 2RCYA 3F5SA 4KDEA 3OEYA 1PJ3A 5EPOA 1JA9A 3ITKA 3L07A 4TKMA 1E7MA 4U6QA 2YY7A 3ON5A 3T4EA 1HSOA 1DRVA 3I1JA 5L51A 1QYCA 1NP3A 3L9WA 5JY1A 4XGKA 3JYPA 2VQ3A 4NBRA 3KYBA 4LSWA 2HMVA 3ZWYA 2HU2A 3EW7A 2JCXA 2HMTA 2DBQA 2I6TA 3NDIA 4DYDA 2PZMA 1A5ZA 1LLDA 3KBOA 4EW6A 5DZSA 4ZQGA 4AJIA 3AM5A 1MFZA 4R1NA 4PLZA 4URFA 5TT0A 3UN1A 1LDGA 5KVQA 3TZHA 2IDZA 3PRJA 4QUKA 2DTEA 4I9HA 4YJGA 1VKOA 4R5MA 1Q0QA 5KTKA 2QW8A 1H9AA 2G17A 1ZEMA 4LISA 4GI2A 5HWSA 2VWPA 4FFRA 3Q2IA 4WLVA 3BTSA 2A9FA 5HS4A 4YR9A 4CR8A 4Q3CA 5IF3A 3L4BC 3L4BA 1NVGA 5B4UA 4L76A 1BVRA 2AHRA 1C0IA 4E5MA 2P4QA 2WMDA 4UUPA 1YBVA 4MOWA 3WGZA 5KJFA 2PNFA 4ALIA 3DR3A 2PH5A 1A27A 3OA0A 1NVTA 3E8XA 3ZHBA 1QRRA 4HUJA 4E2YA 1Y9AA 2CD9A 4DPKA 3QWFA 3GUCA 4I5EA 3GRKA 3TN7A 4ZQBA 5JYDA 1IPFA 3RSHA 3MJVA 4L9RA 3IMFA 3NEPX 4AJNA 4GBJA 3PFWO 3C24A 3LU1A 2G76A 2O4UX 2XXBA 4FFOA 3HDHA 4MVJH 3IS3A 3PXXA 3VPFA 5CEJA 3M1LA 3VVBA 2D0IA 3D5TA 4K1LA 4C4OA 2OBNA 3VHRA 3DZFA 5TGDA 1GDHA 3UH1A 2P9GA 5TS3A 3DBVO 3S2GA 2EHDA 3ZCXA 3JQGB 1UAYA 1WDKA 1P74A 2FHSA 3O8QA 4EZBA 4RVGA 1P31A 4L4SA 5DCWA 2C0CA 4RQUA 1HLDA 3TZKA 1PS8A 2RBEA 1GUYA 2AEMA 5KCZA 1M66A 4CR6A 2QZ9A 2ZTVA 3GF4A 3JQ9C 3JQ9A 4KQXA 3CEAA 4LVCA 4RLSA 4YT4A 3A28A 4HFMA 2UYYA 4IQ8A 1E5LA 2NSDA 2B37A 3K9QO 4CM3A 1K89A 5G0SA 2AQKA 2PD4A 1T2FA 4IXTA 4DMMA 5TC4A 4IDFA 4IGEA 4KDFA 2CVQA 4J0EA 4J1QA 3AFMA 4AJ1A 4NFYA 3I9JA 4ONEA 2OGUA 4QSMA 4NMHA 1E7RA 1JU9A 1LC0A 2J3IA 2Q4BA 2VNAA 2UV8A 1AXEA 1KY5A 1Y9EA 2WEKA 4IGFA 4ZD6A 3F6YA 1DRWA 2A94A 2OHXA 4BO9A 3ZDFA 3GFGA 3OIDA 4D43A 5LDGA 4K6CA 4A26A 4YCAA 4B4UA 5L95A 4BNWA 1N9GB 2Y0CA 4KUEA 2PWZA 4OYRA 4CM9A 2OUIA 1NQOA 5DCYA 3VDQA 2BMAA 3PJEA 1EZ4A 1YVEI 1MG0A 4MVJA 4L0QA 3U62A 3GZNA 3T7EA 1LI4A 2VUUA 4CLRA 3KOUA 3WBFA 5K0ZA 4Q3EA 3PYXA 3DMTC 2PZLA 1N1EA 1CJCA 2WYWA 3DMTA 3PZBA 4Y98A 3LQFA 2OO5A 4P38A 2B83A 3VZQA 4YJFA 4Z9YA 2NU8A 3WYCA 4E6PA 2EEZA 4WGGA 3UUWA 4CLHA 1TVEA 1GZ3A 4FQ8A 2FOIA 4G81A 3HDYA 5G0WA 1I8TA 1XLTA 3HQ4O 3ICPA 4NG5A 3JYOA 3Q0EA 1U1IA 2I67A 1HTBA 3PI7A 2OP1A 1HETA 2IODA 3ZWCA 1E6EA 4M86A 4CM4B 4XKJA 4OIMA 3H8VA 3C7DB 4RZIA 3E9QA 2Y1OA 3RVDA 1ADFA 2EKPA 3AUUA 4B8ZA 5I9MA 3C8MA 1I5RA 4CM8A 4B79A 1AE1A 2I99A 4BNTA 2DLDA 4WNCA 1P3DA 2FPIA 5A9RA 2NU6A 4R51A 1E5QA 3OJFA 3QV1A 1VI2A 4PN3A 3VVCA 1Y8RB 4C7KA 1ONOA 1VRWA 2OOSA 1ZH8A 2WYUA 3JQ7B 3FNHA 3VPSA 4JN6B 1XGKA 5IXYA 4RVDA 4A0SA 3F46A 4KWHA 4FIZA 3EC7A 3KYDB 3LF2A 4I5FA 3EAGA 3TSCA 1M75A 1ONNA 1X0XA 2FWMX 3E82A 4JJFA 4QQRA 4E32A 4DGSA 2E49A 3DB2A 1IOLA 1W8DA 4BO0A 5TIIA 1VLLA 2AG8A 1WMBA 2EERA 3GZ4A 3JQAA 3ZV4A 4CUKA 2FMUA 3NT5A 5ICMA 3TPCA 1BWSA 3H5AA 2B36A 2CMDA 2GGSA 3GUYA 1BVUA 2Y68A 1PJ2A 4N5NA 1LLCA 2NTNA 4NZ9A 4JP3A 4PZCA 4YJHB 5JXWA 1QLJA 4PLVA 3WG9A 1YBAA 1Y7TA 3CMCO 3ZNNA 2C59A 1OI7A 5EESA 5C7IO 3A9WA 1U2DA 2DPHA 3EMKA 2H9IA 4YWJA 1WZIA 1DJQA 1LA2A 2QHXA 4P4NA 3F47A 1H6DA 3GDGA 4HFJA 4XJTA 1EE9A 1NTOA 2ILTA 2ZYAA 4N54A 1YRLA 5AXAA 3HG7A 4JX8A 4FJ1A 3I9LA 5G0TA 3EY4A 2YFQA 3UW3A 4ND5A 1UDBA 1VL6A 1PR3A 1YOVA 3LT2A 3N58A 5A3JA 5CG2A 1F12A 3EVTA 4BOYA 5L45A 2YQ4A 3JQBC 2B5VA 2RH4A 4ZA2A 3JQBA 4I08A 3GY0A 2DUUA 4DQXA 3IIEA 5I7VA 1K6XA 1R37A 1R66A 5DBGA 2Q1UA 5T8KA 1V9LA 1UP6A 2H63A 3GVXA 3IQDB 5JDCC 5I7FA 5ITVA 3KO8A 3JQ6A 1LSOA 3HWRA 1X14A 2VNSA 1HE2A 4FC6A 4RPHA 3ROMA 2NTVA 1RM5A 1E1KA 3FHLA 2Y1DA 4M54A 4R1SA 2O50A 5G4KB 2RIRA 3SEFA 2Z5LA 3V1YA 1JKIA 4MVJP 4NU5A 1ENOA 1FDTA 3CPSA 3FSRA 3MJEA 4A73A 2B35A 2O4CA 3AJRA 3TJRA 5DNAA 2GN4A 1I01A 3I52A 4J7UA 3WX0A 3BZUA 1QYWA 1ISGA 2Y67A 1TA4A 4F45A 2R00C 5KVVA 4CR7A 1X0VA 4I5DA 3UGKA 2VHXA 3JYNA 3ZNQA 4MDHA 1B26A 1X7DA 3Q11A 5JC1A 1MGOA 2D4AA 5FEUA 1Y8QB 2WD7B 1FMCA 4YAIA 2EP5A 3LT4A 4NNJA 2J3HA 3KTDA 5AYVA 4BNUA 4BKOA 1AGNA 3L6EA 4DC0A 4IIUA 1LQTA 2HQ1A 3PYMA 1TB4A 3LK7A 4YJDA 1YB4A 3SX2A 2B0JA 2X5KO 3GVIA 1EVIA 2H1SA 1C0PA 2O2YA 2X58A 4OXKA 1PJBA 1HDZA 1CQJA 3AOGA 1ZMOA 4CUZA 4Z0HO 5TNXA 4AG3A 4EITA 4GVLA 4GQAA 7ADHA 2D2IA 3MJCA 4BV9A 3E03A 1NFFA 2O3UA 1UXKA 1MB4A 3RCBA 4DYVA 3DBHB 3OMLA 3BHMA 4BQPA 2HUNA 3NAQA 4EJ0A 2EF1A 3RWBA 2LDBA 2GLXA 4DVJA 3OEWA 1YDWA 5C7LO 1FDUA 2DAPA 4J9VA 5BNFA 4EI2A 2HMSA 3WFIA 1Z75A 1GADO 3GNTA 4D46A 3A06A 2HJSA 1V8BA 4CM1A 1UZNA 3FWNA 4KUGA 1PQPA 1ZZEA 1HE5A 2GSDA 4Q3NA 2POQX 3KV3O 4TWRA 4FJ0A 3Q9UA 4GKBA 1KEVA 4BMNA 4Y67A 3U4DA 4TVOA 5ICSA 2OMEA 3E48A 4I1IA 3I23A 4D41A 1YJQA 3UFXA 3WJAA 2HK9A 3EYWA 3NX4A 2NNLD 3M6IA 4Y6SA 4XCVA 1SPXA 2DBRA 4KTVE 4FPXA 4AJJA 4PLYA 1BXKA 2HMWA 4WCFB 2AQHA 1D4FA 3CUKA 3VKUA 1LLQA 4MVJE 2X0IA 4MP6A 4Z3KA 2VHVA 1I10A 4NK4A 1MC4A 5COQA 4NJMA 3OA2A 2VHWA 3PGXA 4OJNA 3O9ZA 3UHAA 2Q99A 1VM6A 4OSPA 3WYBA 2P9CA 2V6GA 2VCYA 3DTYA 2OXIA 1Y6JA 1KERA 1CRWG 1B16A 4BO6A 1VKNA 1OZAA 3S55A 1P1FA 4OHUA 2C2XA 2NU9A 4ZN6A 1O94A 2BD0A 4FFLA 1NYTA 2A35A 1PJQA 1PGQA 1QLHA 4NHEA 3RJ5A 3D4NA 1XELA 3S2FA 3WWYA 4ZQHA 1LDMA 1HDCA 3R0IA 3ZI0A 3PHHA 4PG4A 2Q1TA 1GV1A 1GR0A 2ZB4A 4FCCA 1P0CA 4GX5A 3DL2A 1UXHA 2D5CA 4BIIA 4XYLA 2GD1O 1U9JA 4FW8A 4ND1A 5ENVA 1BXGB 5FI3A 2IZ1A 1SOWA 3RJ9A 3GOHA 3D0OA 4FD3A 4UVGA 1ZJYA 4E2WA 2QG4A 4EEXA 3C3XA 4OXNA 1LEHA 3OFSA 3A1NA 1JQBA 1DBVO 5AXCA 3FI9A 2NQTA 2GUGA 3SBOA 1LNQA 3RFXA 3VKVA 4XQCA 1B3BA 1I30A 3HADA 4QO8A 2E37A 2PV7A 3BMNB 4K26A 1U3UA 3LLSA 1C1XB 4M8SA 4CM7A 4CQMD 5TQVA 3ABIA 4TRRA 4ILKA 5IJZA 4EBFA 1VC2A 4O0LA 4E5YA 1I2BA 4LMRA 5T67A 1ZXBA 3P5SA 3WR5A 1U8XX 4BS9A 5JCJD 1JAYA 4IZHA 4GLLA 1Z7EA 2O3SA 4J90A 5L4LA 4BNMA 2I3GA 1WXDA 4BV8A 1U28A 4OKIA 1T1RA 3I4CA 4RGBA 1YL7A 2EGHA 3WFJA 5U1PA 3V2HA 1DO8A 4DMLA 2BGLA 3O8QB 2IYOA 1ZSNA 1NVMB 3AOEC 3AOEA 3FNGA 4W9NC 4W9NA 3W4KA 4GX1A 1NHGA 2B4RO 1R0SA 1P33A 2JAPA 2CF5A 4IS2A 5DULA 4UEJA 2J8ZA 3C1OA 2X9VA 3VPHA 4BNGA 1IE3A 4IY1A 1FK8A 2FR0A 1EUDA 3TDKA 3ZWOA 3INTA 2NV6A 4DUPA 1HEUA 1I36A 1I32A 1LTHR 3X2EA 4H7PA 4PRLA 3W4JA 2FRDA 3UICA 4BNNA 2YHUA 5TSDA 5IXSA 3PGJA 1DC4A 2GASA 3STHA 2Q45A 1LLUA 4D3FA 1KVRA 3FRJA 4PVCA 3DHEA 4DWVA 4EUHA 1G1AA 5KJCA 1SBYA 3FBGA 4HNGA 2VN8A 1ORRA 2Q1WA 4B3JA 1SMKA 4IDBA 6ADHA 3E9NA 2X1HA 3RI3A 5MGBA 2VWGA 1AHHA 4BNHA 3DZKA 1YB5A 1LSUA 3K2EA 1LU9A 4E3ZA 1W4ZA 4CQLB 3U3XA 2C29D 3GDOA 1WP4A 4LCEA 1KVTA 3U0BA 4FFPA 3DC2A 4R69A 1YE3A 3QHAA 2H5LA 4R3WA 2DQ4A 4CLRB 5I9LA 1M2WA 2YUTA 4DIFA 4J1NA 3PYLA 2YYYA 2VRBA 4YAEA 3E1KA 5KIAA 5JY6A 4CMHA 1ZBQA 5IZCC 3U09A 5IZCA 4WLNA 4U5QA 2ZB7A 4NFSA 3NUGA 4ID9A 1R6DA 3H9UA 2NQ8A 1XEAA 3VPXA 3BMQA 2FN7A 2IEDA 4Q9NA 1A9ZA 1SC6A
chains in the Genus database with same CATH superfamily
3RIXA 1F2UB 4AICA 4FSDA 5C35A 5B6IA 1I7SB 1XALA 2FVXA 3A6LA 5CFPA 5LZ4A 4GT1A 2VJPA 1SPBS 3U2QA 1EVYA 1L8AA 3O8NA 1KP2A 2AG0A 1JG6A 4QGGA 5H0IA 5IUNC 2CLLB 1UF9A 2AC2A 4YECA 2OB2A 1J00A 2WHPA 1CY2A 3B7WA 3RU3A 2XGSA 2WINI 4JB3A 3N2EA 3OZSA 1AVTA 4ZVRA 1B42A 1HQKA 4OK6A 3ZKAA 4DA6A 1NYLA 4EFNA 5BWNA 3QF7A 1QRDA 3ZD7A 4KB5A 3GHHA 2AD5A 4Y9DA 2OMKA 3V1UA 1O6ZA 4NMXB 2R48A 1PHPA 5CIWA 5DNUA 5CFZA 5TX7A 1GKKA 1OAAA 4C06A 2HWYA 3GQBA 3U1VA 4H0NA 4UMDA 3PUKA 1Y63A 1RLOA 1ZCAA 4IDCA 5AKHA 3TOZA 3ROFA 3W8FA 4F4IA 2Z43A 1S2LA 3KKNA 3QE4A 4E51A 4I2VA 1SXPA 2RGBA 1O1YA 1STOA 3FTCA 1SKYB 3KJIA 3RYIB 1G20E 2G6BA 4MCHA 4Z6KA 1NTRA 4D9JA 4DSOA 3U16A 4IM7A 4BY9E 1HSZA 2W0SA 3CV3A 1LDBA 5CYOA 3SS8A 4ASUA 3K0SA 2YMLA 1ZVVA 4F06A 5KVCA 3OLCX 1H22A 4IKPA 1JFLA 4OU5A 3IV7A 3A4YA 3LCRA 1A4RA 4H0CA 1FDWA 1M74A 4QJ4A 3K6JA 4EYKA 5JXJA 2J6BA 2DHEA 3WFZA 1N4DA 4NH4A 4YUAA 1DCTA 3HCCA 1J07A 4B31A 1EWQA 5JSHA 2PXXA 2E9SA 4KKXB 3JRWA 4MUYA 5GGYA 4KGVA 1DIBA 2DCMA 3WRYC 2C7OA 3W77A 1W75A 2P9BA 2AQ8A 3EXG1 3QX8A 1U1GA 3E81A 3YASA 3PA6A 4QOEA 1TO2E 5ARCA 1CDDA 1E2DA 2Q28A 2NUPB 3FVRA 3Q5DA 4AZTA 1KNQA 4A5OA 1MV5A 2IYQA 2HZBA 1A82A 3RT7A 1Z63A 3IJPA 3ILYA 1VJDA 4OQYA 5KHOC 1R3UA 2R84A 2CLMB 3ZZ1A 4FS8A 4KO1S 1AZTA 2WF8A 4OOEA 1RQNA 5AW9A 1OA0A 2ZGVA 1E3WB 1QOPB 2XRZA 1H85A 1HPLA 4C20A 3FWHA 4L6IA 3GQVA 1SIUA 1NRWA 4UKDA 2V97A 1OPRA 1VYTA 4N0MA 4PTYA 4P4SB 4L08A 4NR0A 5BMVA 1CFZA 1ZCBA 3M6MD 1XU7A 4YJ3F 1XMQB 4YP5A 3NBZC 2FEKA 1V5FA 6LDHA 4FYIA 4I50A 4QSHA 4RF4A 3AEUA 2P3OA 3KB1A 3UTCA 2QXUA 3V1MA 5CAEA 1QAOA 2D13A 5ICGA 1XKXA 3OETA 3HXMA 3MT9A 1YI1A 4LOJA 1W36C 2JJYA 3LA8A 4LJLA 4E7PA 2SKEA 5DHQA 5KNDA 2B2NA 1BS2A 1UL1X 4TLAA 1V3VA 1XTSA 4ERXA 4UREA 2JGIA 3IT2A 5E7IA 5EERA 3ZU6A 1X13A 1YL6A 4L28A 3T9EA 3WLNA 1BJRE 2WVAA 3ZH2A 4L9WA 1KY2A 2PIAA 2M6LA 3FB1A 2Q9UA 3NJ8A 2AZTA 2YW2A 1C1DA 3H2GA 3I5UA 3DEHA 2QW1A 4NBUA 3E5MA 4PIVA 2JK1A 3PRYA 4Q93A 1K2VN 2INGX 5K6TA 4F96A 2RI0A 1G291 2P2LA 3DAPA 3OJLA 4MQ5A 5L8VA 4JT8A 4EVQA 4YT2A 5H68A 3G8AA 4AL4A 4R71A 3KKZA 3BXOA 1JHAA 2V7XA 2GVZC 1UJMA 4PFQA 4ZO4A 3VRHA 4DDKA 2BH9A 5J2UA 1P7YA 4BXOA 2JCSA 3H2KA 1CJKC 1T2CA 1IN8A 1JHZA 2FDXA 2FSGA 3G2OA 2JAWA 4GUDA 1Z88A 2FEWB 3ENWA 2ZJYA 3IHKA 4TN5A 5BSFA 1DJNA 1SVNA 1P5ZB 4XX0B 3PFCA 3FSGA 2MJLA 2V8OA 4MZXA 2Q7OE 2JAHA 4WK0B 3TSOA 3MZ0A 1H0KA 1E62A 2UUOA 3CNNA 4ZP1A 3OI7A 1ZD2P 3TSZA 3OC0A 2DETA 5JSFA 4HGOA 2Y77A 3VYTB 5LLTA 1Y7HA 3ZDXB 4NOMA 4OJMX 2ZRJA 1ZPDA 2R87A 1X9HA 2B20A 2QY9A 3NORA 5CLIA 5AOCA 5M3BA 1EG7A 1FVOA 1LRLA 1KO7A 1H1LA 4RBNA 2GPJA 2OAGA 4P4LA 1AQNA 2I7TA 3UGJA 1BYIA 1OMOA 1MXHA 1XXHB 4PQRA 5ITZA 1QG2A 1Q0TA 3Q7EA 1NIPA 2OQIA 3FBTA 2YDXA 1XZIA 1C41A 4LHVA 4RD0A 1T2DA 5DBIA 3VNBA 4X93A 5A02A 3SJAA 2EKQA 1JZTA 2PA3A 1WOYA 4BFUA 5JYEA 3UMBA 2C5GA 2XTMA 3KKQA 3MYRA 5DNCA 3L0OA 2WT8A 1ATIA 2HF8A 1E8MA 3N0WA 2QEQA 3TMYA 1SEVA 4AF6A 3BSWA 5BSWA 5EMNA 2H1FA 1R4MA 3T3GA 1JSXA 4MKXA 1JHVA 3VR4A 1WMDA 1OYYA 4XWKA 2PL9A 1GTZA 5LZ8A 2ZJZA 1M73E 2QLFA 4UJ5A 1IY9A 1Q57A 1SC3A 1A9RA 2V0NA 4HGQA 1VB5A 3STXA 2IZ5A 3LUJA 4AZ0A 1E6WA 4BRSA 2RAVA 2YJ6A 4RL4A 3OU7A 1E92A 2YJTD 3KDPA 3L7BA 3ZC3A 4DIOA 1DIOB 3QQ5A 4DPLA 1RR6A 2DE0X 2IPMA 2XZTA 3OP4A 4J75A 5GM1A 3UXEA 2IK8A 3I8SA 3NNNA 4QXOA 5CFNA 2A33A 3DL4A 1QF7A 3FYUC 2WE8A 1P0MA 3LKVA 3R20A 4NK5A 5G3YA 3ANLA 1D07A 2YZ7A 3D8TA 4HGRA 1NW9B 2V4UA 3ZU2A 3HHPA 1P1RA 3U4CA 4L78A 4A92A 5KQMA 3KOOA 3GGJA 1QG4A 2Q41A 3C74A 3VTFA 1C9NA 4F71A 5HXAA 5C32A 4CKCB 2IP2A 3EFEA 1GSHA 2QIOA 5D1HA 5DASA 2FCAA 1V5IA 1PT7A 1E1NA 2PTHA 3DXXA 5K5EA 1RW4A 1VTKA 3AERA 3HBLA 4IINA 2FSIA 3PLNA 3NM4A 1ENPA 1RQLA 1FTGA 4CI0B 3EPJA 4KGXA 3CNHA 2HIGA 4KZPA 1PG5A 1V7ZA 1UDAA 1NG9A 1JIVA 1E3EA 3BMCB 6GPBA 1Q19A 5BN4B 4WZAE 1C9KA 4PSKA 3I6BA 1HDXA 1L7EA 1HEIA 1XMPA 1WIWA 4FI3F 5TS2A 6REQA 4GXTA 2EGGA 3L05A 4NBKA 3VZCA 1M6VB 1XRQA 3A1TA 4GPAA 5FL7A 1L1EA 1KIFA 5DCUA 2IU3A 3Q7IA 2ZJ0A 2ZIEA 1RYZA 4NAUA 4WVFA 2BZ0A 3SS9X 3V00A 2IY7A 4JP2A 1AIPA 1IZ7A 5B3JA 2ECQA 3GP5A 3RKUA 4DLYA 4RJKA 2RHWA 5CT6A 2G1KA 5CITA 4CF7A 2J48A 2GF9A 3ZPXA 1TAQA 1VLJA 1KEWA 3L7MA 4J2OA 4RM2A 3VR1A 2I2BA 1BMTA 4QBFA 4XJVA 4D42A 2PL3A 4ZK2A 1QYXA 5JI2E 4E07A 3PEWA 3T94A 3VSCA 1V8FA 1U7HA 3T3PB 1BX3A 2REBA 4QIHA 2NADA 2Z9CA 1RABA 5LZ9A 2D7CA 1CUYA 1ZOLA 3NPMA 4RVHA 4PX3A 4P5PA 1XMXA 1QJ4A 4AY3A 4KLRA 3AR9A 4MGHA 4XUCA 4WZ6A 5HQTA 3C8DA 4IDAA 1FOEB 3CYFA 4DMHA 3QUQA 4B73A 4B7UA 1A7KA 1II9A 1YU6A 4HQKA 4RD6A 5AJUA 4AZVA 3E5NA 4NDAA 3F4KA 3ONVA 1XRMA 2EQ5A 2C20A 1OJ7A 4NABA 4ALJA 5TMBA 3JPWA 5F76A 1G8YA 1YZ3A 4CR6A 2C42A 2FYTA 4J16C 4JHLA 3OQBA 1ESZA 2C4KA 3MBIA 3QMWA 2ZYHA 2PL5A 4I4CA 4J16A 4TM8A 3WGJA 4CMIB 5J4HA 3RSCA 4YAKA 3CLRD 5I9IA 2PVPA 2XXJA 3R0JA 5EQDA 1ZUIA 2IELA 4U9HS 4NTZA 1HOXA 1R8SA 4TKUA 4F56A 1KSHA 2DU8A 1WU8A 3SFZA 2Q5QA 4WESA 4J7AA 1P4AA 4ZVNA 2J9YB 3UMFA 2B4QA 4JJEA 1GZVA 1NVWQ 1TUBB 4WBNF 3VO9A 4N3GA 4H1TA 2I6UA 3PVZA 1RWPA 1Z4OA 3U44A 5LQAA 2H7VA 2VAWA 1NBHA 2QGFA 3O7WA 2QAIA 1ZBDA 4LMAA 3I9KA 2A4MA 3Q1KA 4RJIA 1ZR2A 2V3CC 4TGLA 1EVZA 2W70A 4MQEA 2E4VA 5K0LA 2E0IA 1WXFA 3EIOA 4Q3OA 3KB2A 4A10A 2BL4A 1BYUA 3ZY3A 2VDQB 3PFIA 2JS7A 5EIFA 4DLUA 8ATCA 2XADA 5JAUA 5CEEA 5I48A 2IP1A 1K5DA 5KNBA 5JTUA 4LSGA 5LNK6 4HJRA 4M0EA 2XKAA 3TMKA 4EUEA 3TF5A 2B7BA 4UXJA 2I1QA 1DNPA 3E70C 4MTLA 4Z4QA 1VE3A 2C5FA 2JIQA 2QOEA 3T54A 3A2KA 4C22A 1KAGA 4FEEA 4XQGA 1TFRA 1Z8HA 4IGKA 4PY2A 4FWTA 1M67A 1WZEA 4KOAA 5AQ1A 3DB1A 5KSOA 3SBEA 5JDCA 3EVEA 5ALOA 4WA8A 1EUDB 3IP3A 3PFFA 3QVTA 3R77A 4AMGA 3UAVA 3W5CA 1ZR4A 1XYVA 4MLCA 4MI3A 1W34A 3GBSA 3I09A 4OX9B 5JBIA 5AKXA 2H1WA 1UXGA 1J4AA 1R4NB 2I66A 4MUIA 5JAIA 2QTMA 1GZDA 3GD7A 3I32A 5MDHA 2NPOA 4WKGA 1Q3TA 2X3UA 5AK4A 4LOKA 4M49A 1RKXA 2AFRA 1KORA 3U4HA 1A04A 2WIAA 3EZGA 1C29B 2PSHA 1UCFA 2VYCA 3P4UA 2XX3A 2CF6A 1V8DA 3IAHA 1KI9A 4KE6A 2WDZA 1EDZA 2PLAA 4UPDA 1KQGA 1ZVKA 1JHYA 3ZQ6A 2GN6A 3L8DA 9GPBA 3WZMA 3ICVA 4Q9KA 2BF4A 2P4HX 1NLZA 3RTAA 1P75A 1U0JA 3L4JA 4BFZA 3NT2A 1ZMXA 1RJFA 5LDHA 2EZUA 3LKDA 3PGKA 5E8JA 5ILQA 1OD6A 2V9CA 4GYWA 5EIWA 1XTUA 1S3IA 4TVSA 1SB8A 1YO6A 1ZI9A 4J7CA 3NKVA 4JGIA 4A36A 1SCQA 4ZI7B 3INRA 2KI5A 1TLLA 1J8MF 4BUCA 1UFRA 5IJ0B 4R9RA 3I72A 5ITSA 2JGNA 2BMDA 3NC4A 2GK7A 2VP9A 2VDNB 2Q6VA 2D3WA 4RK4A 1L5QA 1M76A 2G1PA 2BMWA 5LUAA 3W2TA 2PUFA 3L84A 4HEA1 4C2TA 3E15A 4DR1B 3G6WA 3PX2A 2WQZA 2WTBA 1W59A 4LXQA 1GILA 1RI1A 3HNPA 3SC3A 3M4ZA 3JQGA 5GVSA 1T4CA 3VPAA 5CBKA 1MC8A 1EEXB 3N2KA 3UBTA 3TXXA 3H86A 1Z4KA 4JUFA 2IXBA 4LVOA 3CUEF 4XUDA 2G5CA 3H65A 4TUYA 3C6XA 2AH5A 4P7GA 3V32A 5GONB 1N5KA 3O94A 3SQWA 5I8WA 3VO8A 1V8OA 3L7KA 3KVNA 4FOSA 2V7BA 3I01M 2G9RA 4QBIA 4JUAA 4ZT4A 3ASVA 1W4CA 2DBYA 3HZHA 4IUYA 1B6GA 3MYYA 2R8EA 3TVTA 4ALNA 1BHSA 4N5MA 1FYXA 1T15A 4B3IA 2FW0A 4K6HA 3WTCA 3HB7A 1ZLYA 4C1NA 1ZM7A 3GLGB 1OX4B 1U31A 2XITA 2PK3A 1FS6A 3B20A 2B1JA 3B6KA 3OFKA 1XP5A 2J3QA 4EI9A 4YCJA 3PC2A 1JIJA 1PW5A 2ZWIA 3HL0A 4LRXA 2WFAA 2QR5A 5TEVA 1PJZA 3KSZO 5CPFA 5AW3A 3NIGB 4D0SA 4IF6A 4CLDA 1HDRA 4HSEA 1SQ0A 3OCXA 3S8EA 3ESZA 1ZK2A 2ACWA 4G1EB 2HLNA 1SXHA 2GHQA 4L51A 4JR0A 5JAQA 2X9NA 1DCFA 1NF2A 2CXHA 3O38A 3CR8A 3L0ZA 4REOA 3V8EA 3D7MA 3ZW7A 1B0AA 3JVEA 4URUR 3K8OE 3NYRA 4WV3A 1JX6A 4X3CA 1P7VA 4YQEA 4B6QA 1N5DA 4PHFA 4PC7A 4BWGA 1Z2CA 3SICE 3STTA 1NVVR 3ZHCA 1RHQA 3Q72A 2O1EA 4RJJA 4QYIA 4CCAA 2P68A 2ZTSA 5M29A 3UY4A 1U8FO 2VHYA 1EFLA 2Y0PA 3DZJA 1PV2A 1L2TA 1I6WA 5AP9A 4A27A 4JZKA 1SXIA 2JH8A 2ZSEA 3HACA 1QC5B 4PRKA 4QUIA 4L3VA 2WMOB 1BGWA 1MU0A 5HRAA 1I24A 1I51A 2C82A 2JJ2A 1N2BA 3W05A 4YI5A 5J4YA 1U6JA 2GFQA 4Q37A 1G3UA 3OTGA 4UD6A 3UAOA 4AB1A 4YMSA 2Q3MA 5I5GA 4FN4A 2B4YA 2GQ0A 1ZWLA 1PTJC 1PTJA 2BEWB 3IAM1 3PK0A 1SQ5A 1Q22A 4QUJA 3IIJA 4X1YA 2AYYA 2PUGA 4QPNA 1T9BA 2OTCA 4BFYA 3ELWA 4DLNA 3CLTC 3U9LA 4KL8S 4KQEA 3HN7A 1PZHA 4M89A 1UAAA 5EFZA 5C0OE 1N2CB 3LZCA 4KLNA 1QP8A 3E2MA 3F49S 2X0NA 3MCAA 3NTOA 3NXKA 1L7DA 1M1ZA 2JHGA 5AI9A 4X71A 4ZREA 3SAJA 4W5JA 2GF0A 2QK4A 2OPHA 4LDJA 4EA9A 3DBRB 1YVRA 3WLKX 3WB0A 4F1KA 1DL5A 4YJGB 1FRZA 2JIMA 4Y9UA 4FFBA 2V59A 5I9NA 3F3SA 1LPSA 4MWCA 1MO6A 2BFEA 2YC4C 2AXPA 2KX7A 3AP3A 4U7WA 4AZ3B 3IP1A 4NESA 2QR2A 3EC1A 2ZQZA 1VPDA 1KO4A 1BFKA 2CUKA 3LJKA 1FNSA 3B82A 5HMLA 1DG3A 4ZT3A 1NQXA 1ZHFA 2ZUDA 4P31A 1T36A 4KLCA 3R3VA 2IHZA 1CT9A 3EG9B 5GV8A 4YUYA 5IN4A 3IQGX 1JLLA 2XLCA 1EK0A 2CXQA 3PGMA 3IDQA 5EWLA 1KEPA 4X6UA 3K92A 5MN4A 1XUOA 3QNUA 3DWGA 3W1EA 5EMLA 2CFSA 3OQNA 1V5WA 4TTTS 2R97A 3FH0A 4B7XA 3WKEA 2HC9A 5HQ3B 1OH8A 3C7KA 2Z3VA 3ABZA 5K0BA 1FMLA 1PSWA 4EG8A 4LK3A 2QQ5A 3Q3VA 4R2HA 3R76A 1A88A 1CD5A 1ONBA 1YZFA 1CZLA 1ZKDA 5EHQA 2IKQA 4HNAA 4RESA 4MO2A 3Q3IA 4DJDC 1K08A 4NF2A 1MA0A 1O95D 4F7DA 5A6VA 1U63A 4O4JB 1P2UA 3GFBA 5I7EA 4I4IA 5IBRA 4C30A 3SC4A 1WXHA 4D9IA 2JAQA 1H0SA 4GLBA 3PTZA 3H5TA 1USVA 2GJ9A 1Y4SA 2Q0SA 3ZU5A 4ZYUA 1BCRB 3GARA 1F1BA 1TK9A 2I76A 3TQIA 3QOXA 1USUA 3EZ6A 4D6YA 1YK1A 2J07A 2PSFA 2QQFA 4JH0A 2GR9A 2X8JB 1DQSA 4RPLA 1QPZA 2AKEA 1EP3B 1NW7A 2LVBA 2GRJA 5JO9A 3BZWA 4GAEA 5CDFE 3AVPA 4L9SA 1W36D 4L5BA 4YX9A 3LA6A 2HSDA 2NYVA 2XLBA 3BJMA 5JNLA 3HUEA 4EJ6A 4Z4FA 2C94A 1XZQA 1VE7A 2Z3WA 2BI4A 3L0CA 3DMYA 3H1TA 4G0VA 4HMPA 3M9WA 2VJDA 5LB2A 1Y5NA 2YRXA 5SZHB 4WLEA 3TL2A 3H9QA 1ECLA 3PIDA 2ZE5A 4QQKA 3TKAA 2IF0A 2O3QA 4BMCA 1G21A 4I6JA 3OM8A 1ULTA 3P9NA 1GGVA 1WUIS 3RFTA 2F43A 2LTAA 4CNQA 4EY3A 1TJNA 2JFBA 1UJ5A 1YZNA 4IF4A 4DN6A 4DQ0A 3O4RA 3EZXA 1SVIA 2NGRA 3LOQA 3M82A 1ANKA 3H5RA 5FT9A 5FTKA 3UV6A 5JBNA 3LQ4A 4DQVA 821PA 4EHFA 1FDIA 4IMPA 3H97A 1IQUA 2CCGA 1Y7LA 3D4BA 3OTHA 2HCRA 1QIJA 1X1RA 2EWMA 3GJSA 3OQ6A 4FDLA 2CDAA 4B4KA 1A9OA 2QP4A 1T9HA 1E94E 4UBLA 4RK0A 5FRDA 5EJ6A 3MG9A 2BVNA 4ZRMA 1S4QA 5BSRA 4A8HA 3OOYA 4WLUA 5J23A 1Y5LA 4X7RA 4WOJA 3A14A 1Z4QA 3KQOA 1E3QA 3TIXB 4BTLA 1UKCA 3RNLA 5G4KA 4AO7A 2BT4A 5L6MB 3U3OA 3SYKA 1E1QA 5JMPA 4E15A 1PL7A 1UMCA 3FGZA 5C9ZA 1XQ9A 3NBAA 2I62A 3NHZA 1DKMA 1A3CA 1I4LD 4ESHA 2C7VA 2ZSAA 3GZNB 1YSCA 5DWVA 1MB0A 1XPJA 3KXDA 3L92A 2AD1A 1FCJA 5TGTA 4B6PA 2J5XA 8OHMA 1EB9A 1G19A 1QH8A 1X87A 2R86A 3CUWA 4FB4A 3AFIA 2HA4A 2LRHA 4AN1A 3A3OA 3B3FA 4IJWA 1QZXA 4RMJA 2FFBA 2DBVO 3AR5A 4ZO7A 4HBGA 3U3MA 3I4LA 3FGPA 3OTOB 1N34B 1JLKA 1QWOA 1Y8QA 4WH0A 1FL9A 4P1ZA 4A16A 3QEBZ 1C7ZA 3QW2A 2ZUSA 2CMKA 4BGDA 4MB2A 4YMHA 4XLLA 3QNWA 4C07A 1U3GA 2H51A 3D3EA 3ZV5A 3REQB 4CDGA 1ENZA 1I4OA 2YR0A 2XF2A 4R2WA 3MERA 4RKRA 4IIGA 4L27A 3P0RA 3W2IA 3JQPA 3WTBA 1D2GA 3QBJA 2ZJ1A 4RA9B 1WZ2A 3NAGA 4UEQA 1L3CA 1YDEA 4OM8A 4PRYA 1UWLA 4GPBA 4CDMA 5IZ4A 1V0JA 1XQ1A 5JNTA 2QQGA 4MITA 4N76A 3MRTA 4CM8B 3BTUA 2GILA 2GZ3A 5FWNA 2IW3A 3T0IA 1LY1A 2E6KA 5JSZA 1TPZA 2CNNA 5CDTA 3MELA 3VBEA 3UTDA 1QR2A 3KVYA 4HEA6 1EUZA 1QVVA 4Y9TA 2NTEA 5JS7A 1Z2DA 3GVHA 5EIBC 1G98A 1VL1A 3A8TA 4NBLA 3ZDEA 3EOBI 2LNDA 4URHA 5IULC 2ADOA 2ORWA 2CXOA 4WECA 1FXWF 2WKWA 2EAUA 3N28A 1EH5A 3JWJA 2FJPA 1J06A 1T24A 3AMVA 5IJXA 5LU9A 1D1PA 3DGFC 4TM7A 2C4MA 1WDTA 1YKSA 1I33A 1C4KA 1OWOA 3A6EA 3AO0B 3QW4B 2BMJA 4TXNA 4BGVA 4JBLA 2BFPA 3QXXA 1T91A 1CY7A 1Z6TA 2A59A 2AL7A 2XT0A 3GJTA 4JXJA 3ZXSA 4TL9A 3SYTA 1L1QA 3GFQA 1N8KA 2GCIA 4JYPA 5LP6C 3OOSA 2ODWA 2J33A 5LP6A 3MWEB 4CKBB 4R81A 2QE7A 2MINA 5K3BA 4POAA 2CYCA 1ORDA 3OURA 3RVNA 1SVKA 2Y1XA 4ZGBA 1OB2A 4TV8F 4BKUA 3GWZA 2JBAA 1AHIA 2GCOA 3SXUB 3BTVA 3W7AA 2GVNA 1LFAA 3ZD9A 1XYGA 3Q2KA 2PCJA 5DM2A 3ORFA 4WDQA 2UUPA 5J58A 4GM1A 3MXTA 1Z62A 4D45A 1J49A 2V4MA 3GFFA 5F2KA 4M22A 1ZONA 5LN1A 3J7TA 2G09A 3LNTA 1ZGAA 3E9YA 1Z47A 3KU1A 4G09A 3HS3A 3WLLA 2FRVA 2G9ZA 3H0CA 4QBTA 5CVUA 3FTNA 1XHEA 5AMXA 1UBRS 2KSQA 1Q7GA 2X3FA 4UBNA 5ADHA 4ZO8A 1S2GA 2F9LA 4RWEA 1E66A 1ZXLA 2QZ4A 3CSDA 1ZHOA 4KQ9A 1J56A 1X1DA 4P8RA 3S5JA 3B53X 4QDKA 2FW8A 3B1WA 4XOUA 3EPPA 4RKYA 4XB6B 2C1EA 1YAHA 2VJKA 2VCEA 3GUUA 3HVKA 2JKZA 4MYRA 1CYDA 2N1MA 2PMKA 3R23A 1E2HA 1JDBC 2CFCA 2EJTA 5IVIA 4PAQA 3RK1A 4YFVA 5JFOA 2OD9A 1M1UA 2P7IA 1DC8A 3JD1A 1EFRA 2Y27A 2NTYC 2LCIA 3U4IA 3SQOA 1H9BA 3K7EA 1GQ2A 2FK7A 5CJPA 3EZLA 2XODA 4D96A 1QNFA 3PLRA 3M1AA 4H7FA 4HNHA 1O97C 1JJFA 1U7DA 5C5IA 2VJCA 421PA 3GFSA 1R3DA 4BEVA 3JXEA 3SC6A 3KP1A 1M2JA 4ISBA 3ZQUA 4EJSB 4AI6A 2EIHA 3LCCA 2C9CA 3HYNA 4J07A 1N7IA 1FYEA 3D6HA 2HF2A 4B46A 2PZAA 4FT2A 4R5HA 5FNVA 5EWMA 1LPOA 2Q6TA 4EUSA 4TYYA 3PVCA 3I9OA 4KIUA 4JNKA 3SLGA 3KEQA 2IHBA 5H80A 4WXEA 1HL3A 4C7OA 4Y7CA 4D82A 3NBYC 2JC3A 1N78A 2F8TA 3GR6A 3RNOA 4HKTA 3M6FA 2XE8A 1UPUA 3TW0A 2BGNA 1KDZA 4AKSA 3AM1A 2HU7A 3VU0A 3O7MA 4HWRA 2V4ZA 4N39A 1MCZA 4XJXA 1C1XA 2R1VA 4KO4S 1JQ3A 4QJ5A 4ZT5A 3OLVA 1GYQA 3X1XA 5IJ9B 1DDGA 1CQZA 5DHFA 4F60A 3MPUA 1EKXA 2V7TA 4AJ4A 1G3RA 4PHHA 4H6XA 2I8AA 4OHOA 3UC5A 3C2QA 4U4AA 1WSAA 4IJKA 3WNZA 4HLUC 2N9UA 4RPGA 1JI0A 4HLUA 5JLAA 5BVGB 3K9HA 3IB3A 5CA0B 3AHDA 1NAHA 1Y1QA 2CLIB 4D4KA 1GAEO 2BGKA 1BS9A 1HFWA 1Z5ZA 2CWWA 2VBIA 1N2JA 4P4TA 3S2YA 3GRVA 3LHIA 4E5PA 2Y05A 3O9VA 4EPXA 2F8MA 1JLHA 3KPVA 1QB8A 1ECJA 2AFIA 2IUEA 1G5QA 2OHHA 5H81A 3AB7A 2X1LA 2Z95A 5EJ5A 1WMAA 2R8ZA 3H5IA 2BGIA 4GPD1 1YQUA 3GCXA 2FEMA 5T4HA 4DFDA 1J9EA 4MKFA 1QKKA 5KHLB 1ZJZA 3HVUA 3ZZNA 4NS4A 3IOMA 1G6KA 2BJVA 2HA5A 4R40A 4QJ3A 3EGDB 5ALJA 1AZWA 4UOZA 4RANA 1ETUA 5AJVB 2AG6A 3HFJA 4BTVA 3DVAB 3FN4A 1GKLA 3QNMA 4JLVA 1JEJA 3U3KA 5EG5A 1QG0A 4Q3AA 2PX2A 4GKVA 4GXNA 2BSAA 4AMUA 3FTEA 4IRUB 2Q6IA 3SHFA 2P0YA 1QOQB 9ATCA 1N5JA 2ZIXA 4H60A 5L7WA 3WLRA 3NW9A 3ORSA 1KFJB 3BE8A 5TQ2B 2PY6A 2SNIE 1E1MA 1B00A 5BYJA 3AF4A 4DCTA 3ZJUA 1ZNQO 5EXDA 2W5UA 6Q21A 2ZBQA 5C8XA 2H4WA 4XEUA 2DLNA 3MGKA 1GTMA 2EG9A 4DA9A 1KZ6A 1W4RA 2HGZA 5IM4F 4HN9A 2R6GA 4BNVA 1JZQA 2A67A 4JJIA 1JDNA 4Q34A 2NZ8A 3OZDA 4Z3OA 1TEHA 3G49A 4GX0A 1GQFA 2QIPA 3W6NA 1DBIA 3I9FA 1PP4A 4DXHA 3HKBA 3PNPA 3IAS6 3RM3A 4IOJA 3DW3X 3KKMA 4X64B 5GGXA 4GMGA 3UFXB 1TM3E 2BZ1A 3O8DA 4INPA 5EKXA 1WD5A 1XWWA 2VJQA 3N8IA 3UC9A 1OBVA 2PGOA 3M2PA 5C46F 3R5KA 4GP7A 1NVAA 4XR4A 3JWPA 1F38A 3P2MA 4BQIA 4M1YA 2EFDB 2FSPA 4WUTA 5THKA 1V9SA 2C1XA 3ZIDA 4MDEA 1AMNA 1PS0A 1QGAA 1AD2A 3OWXA 5JEDA 2CEAA 3EQ6A 4JMPA 5EJAA 3MMNA 1EK5A 4RELA 5AJXA 1K8ZB 2Q29A 4J2HA 4YT5A 1AK2A 5IUJC 2ZWMA 1URPA 2VXBA 3ETDA 5EZYF 3VNUA 4UE6A 4R0MA 4RVFA 4R2LA 1NJSA 5IW8A 4LVUA 3VSBA 3T3HA 3GVPA 5DVZA 2BGTA 2G08A 4KQMA 3BM5A 4JB2A 1K2WA 4O4LA 1P4HA 2UDPA 4AKGA 1QE5A 1ND5A 1XJQA 3ED5A 2AIRA 2FWBA 3N3BC 2QRMA 3ZUPA 4OM7A 3UA4A 4LXXA 3WIBA 3AUKA 2AXNA 1LJUA 3CUYA 3K2BA 2A9QA 1U3VA 3LUAA 3P0FA 3U4GA 1BTOA 3ANXA 1IBLB 1SWVA 2W2QA 2HOQA 1EXWA 2EBUA 4LOHA 4X1IB 2VPYA 4F4UA 4CIBA 4PLCA 4KO2S 4YDHB 2JCVA 5AR1A 2QPLA 2GI4A 1TK2A 3B9QA 3M2TA 1L5SA 3GFVA 4PLGA 4XDHA 5HCUA 5GM2A 3VAAA 2BM0A 1HV8A 5LQKA 1ZX1A 2WRZA 4CIYA 1A7JA 4F4HA 4YFYA 3O1LA 4WLFA 4AX8A 3R0VA 4W5WA 5SICE 1F7VA 3HDVA 1E6KA 1F06A 1YBFA 3I05A 3NO4A 4XYMA 1XFDA 1FFDA 1PJCA 3E9DA 3RVLA 5JSQA 5JWOA 1YFJA 2AFHE 2O2CA 3VTKA 5J47A 3MUFA 4RS3A 3L3BA 4RPKA 1BU8A 1II8B 1NUHA 1W5FA 2H00A 4BNJA 4QBHA 1NI5A 2AZXA 2ECOA 5A0VA 4TSRA 1WV1A 1JAHA 3L18A 3NBUA 4MS3A 1I80A 5AH0A 3R7LA 1G6Q1 1U0FA 2LWIA 1GTG1 3AQIA 2C2KA 4EGAA 4BLSA 4G1BA 5A7GA 2I5PO 2VP6A 3F8SA 3NCTA 4KQ2A 3VGJA 5FI5A 5B1YA 4RIHA 4D3YA 1NX6A 4M53A 4EELA 4ZTBA 3SHQA 5CM2Z 1COWA 3RFFA 3CVYA 2JH9A 2F9MA 3QFTA 1RCFA 3RJTA 1EFPA 3I39X 3LPLA 1QCYA 3ENZA 4I66A 4Z7JA 2C3PA 3FF4A 5HZGA 3V8BA 5J59A 1LSSA 2ZIFA 3NAZA 3LH5A 3BA6A 5JATA 3K09C 2OT3B 1DHTA 3K09A 1SOVA 2EQAA 1KVUA 2XQGA 4FEAA 4FYPA 4HWTA 4O2BF 4OXXA 1L4GA 1KEKA 4QPJC 1Q92A 5CUQA 3KLBA 4UU8A 2X4LA 3M3PA 5AHOA 3AVXA 2GCEA 5A05A 1TD1A 2G67A 1VSUA 4MQUA 3TSWA 2VOJA 4CEJB 2G0NA 2JDIA 3EBPA 4GDMA 2C8LA 4LDPA 2I0FA 1Y4AE 1ZUHA 4EKEA 2NO9A 1TAHA 2M1ZA 3DGEC 2QN7A 3EQZA 4IZIA 3D4PA 5FFFA 4D4GA 2HA6A 5JANA 4JQSA 9LDTA 2GFHA 3LGSA 1N7HA 2A0FA 3K5HA 3LUPA 5UKDA 4CTJA 1D4AA 1P4SA 2QSUA 3UZUA 4D5EA 5BV7A 1EWVA 3O3CA 5FV7A 2NNWB 1NGSA 1JQKA 2WSBA 3IO3A 4IJ5A 4J0DA 4MPTA 4PZ0A 4B74A 4Q9AA 2DHCA 4FGWA 1OGYA 3DH0A 3E3MA 3QKWA 5TXGA 5CNIA 3G79A 2PYZA 2EFHB 3GLFE 2XVMA 4EHIA 3C6KA 1M6WA 1W85B 4F7WA 1JFTA 2KS6A 2P6UA 3FMVA 3BBPA 4ZOCA 2PGIA 2F6RA 2XB6A 3OLQA 5CLLA 3H99A 4J94A 4RZ3A 3NOVA 4A2QA 1BDMA 4II7A 5TJ9A 1UAGA 2XOKA 1TE2A 3R7SA 1JG1A 4OTZA 4OVKA 4MCIA 4O5OA 5D6OA 3TOXA 1DKRA 1D3AA 4ZVKA 2YIJA 3ESDA 4FUTA 2WLTA 5FHQA 3WADA 5E4TA 1RC1A 1FE8A 1KGSA 1M1YE 3KTOA 4R2JA 4EL5A 1Y6FA 1T9ZA 4WBXC 1JVSA 4KAAA 1ODCA 4OI2A 4QGBA 2ZIGA 4F84A 3IEXA 3NM5A 5KWJA 1CTQA 5I4IA 1JYSA 4HRAA 3RC3A 2H5EA 3KAJA 5CA1B 2OAQ1 3JATA 3W5UA 3N2LA 1DIGA 3TL6A 4DVGA 4DG5A 3DAGA 1PU2A 1L7QA 4XI9A 3LWZA 3RVMA 4NLLA 1CVIA 3SJ7A 4B84A 4B3MB 1U9YA 5HIIA 5A04A 3QJYA 5KOJB 4P84A 4BFSA 1V43A 1TU3A 2IYVA 2FZEA 4ZGGA 1U80A 3KHTA 3QU4A 1NDHA 2W98A 1F8FA 3M89A 3MWYW 1XQWA 3BQNB 1QCZA 4PQEA 3KT0A 1DTWB 2FZKA 1CUEA 3AH8A 4FWBA 3IP7A 1IIBA 4DNQA 1RAEA 2O8FB 1DAMA 3AUSA 5CFMA 3RF6A 4YAGA 2R8PA 1NN3A 2HMUA 1F6BA 3KK0A 2DM6A 1I7DA 1PQUA 4BLRA 4MUFA 4I55A 2DECA 3VDNB 4MGEA 3KZOA 2I91A 4EJFA 5A71A 1B2LA 1LPAB 3UKJA 3DNFA 1IN4A 2RAFA 2VBFA 1U0GA 3BSFA 3DUWA 5THXA 1B6SA 1E69A 4YI3A 4K87A 4HR7A 1AK1A 4XD2A 3KWFA 1E1QD 5F1KA 2R11A 3IIKA 3NUZA 7REQA 3TRHA 5KSYA 1TNDA 3GDFA 3PHIA 2WHPB 4MVJI 1QZ3A 2XT6A 1IMJA 5K3FB 3A6DA 2FSFA 3K0EA 3WK4A 2QYSA 3HPRA 4FBGA 1VPTA 3GX1A 1WLSA 3T7KA 2YYZA 4DWWA 2N42A 1T5SA 4IHJF 2XKBA 1MHTA 3ZJ5A 1EGAA 4EG6A 1WZNA 3CX4A 1M7BA 4UVEA 3TS1A 1N5RA 2HFJA 3F7TA 4NEHB 5AK6A 1WZUA 2BSXA 3H87A 2IV3A 4DBVO 3G89A 2E7ZA 4O63O 4LV6A 3B2EA 3ICCA 3EUEA 3K20A 1NW4A 1ZP6A 3GQBB 1GPUA 3R3SA 3QWHA 1ZLXA 4FM9A 4EF5A 3ZOKA 2CDBA 4MRPA 4ZZ2A 1EUCA 3EIHA 4EHBA 3TZCA 2R4UA 1E9EA 1DWQA 1G20A 3K30A 3KR2A 1OU4A 4OHFA 2WZCA 4P32A 3I2YX 4J7XA 1PVVA 2EYUA 4KPGA 3KHKA 4M0KA 4G0QA 1DC3A 1EK6A 4RVUA 4Q7QA 4O1IA 3BH6A 1IUKA 1UC5B 3O31A 4NBSA 3WQSB 2OCYC 3RS5A 4AF7A 4KK4A 1JDPA 5D51S 5E3HA 4J1TC 1IY2A 3QVGA 4J1TA 5DT9A 2B8NA 3MMSA 4J0GA 1ZN8A 3B78A 1AB5A 4X90A 3OF3A 1QQ7A 4ZZIA 4O2AA 4YHHB 5M2QA 1BE1A 1G7CA 2C99A 4LZNA 3FPFA 2BOVA 4GH5A 3RYFA 1T5IA 4YACA 3FUWA 1X8LA 2WDPA 4MR7A 4BJHB 1XVUA 3D8SA 3LOPA 3GPBA 5EIBD 3EGCA 1GSAA 4DDUA 3IKTA 2G1AA 1CFJA 3OQ1A 4R1MA 1LDEA 4CLEA 2B4TO 1YDHA 3GZTB 4JT4A 2P0AA 4NNPA 1C9YA 3AILA 4OB7A 1V6CA 2PH7A 3HA5A 5LQSA 3GRYA 5TARA 4NBNA 3OQMA 5ESXA 1NQUA 2D2XA 2IA5A 3I0NA 4IJUA 4R98A 4IVNA 4UUMA 4J8PA 5JXIA 4WSOA 3A1WA 1E3LA 3T7TA 2VUTA 7MDHA 1R6VA 1E1RA 4MWSA 1RBZA 1O4VA 1XZCA 5ALMA 4BVBA 1MGPA 1OFIA 2JJQA 2ZDQA 3ZTYA 3P32A 3CZ4A 4JI6B 2YN2A 4UCQA 5BMVB 3S2IA 4G9GA 4JL6A 2PQMA 3I6IA 4YR7A 4NZNA 3WOHA 3ZYZA 1XJWA 5DEIA 1N2XA 3FLBA 4BVEA 3GLKA 2QE7D 1KJ9A 3AUJB 3QP9A 3AEUB 4I50B 2ZUTA 1Y9DA 1X7YA 2C00A 5CAEB 2BUAA 1PLKA 3R7NA 1TUIA 2P9YA 5LD2B 1SUSA 2XY4A 3MGBA 4DF3A 2RGGA 4KODA 3A37A 2CKMA 4RX1A 1OT3A 3DQZA 3OIVA 4JJGA 1W36B 2Y1KA 5A3QA 2WIDA 5K0TA 2XAUA 2G0TA 3FOBA 4YA6A 3UPTA 4A8JA 2YVQA 1Z15A 1MV8A 1FEZA 5K01A 1PWYE 1YRHA 4ZC8A 1IUPA 2VATA 1FW6A 2EKZA 3AF2A 1JG4A 4N5HX 1ZJ6A 2G70A 3ZZTA 5T41A 3GP8A 2KW5A 1GUBA 4WNAA 2Z2ZA 1C1DB 2YYAA 1UWCA 1E0SA 1UBHS 2JVJA 4MVJF 4Z1MA 2A84A 3USCS 1GCOA 3CLVA 1Z29A 3WBJA 4EGJA 5JRDS 1U8CB 2G5TA 2VG8A 2CVZA 3JQFC 1Q83A 5KKAA 4DV2B 3JQFA 5HQJA 3T3DA 3Q3CA 3WIEA 4XPZA 3MC1A 2W6ZA 2AMVA 2PBRA 3OLWA 3IV9A 2V6MA 3CG4A 3KJEA 3N5CA 3KOWA 3PQCA 1XTKA 4TWIA 1DIHA 2GDZA 4FFNA 3C3JA 4NBWA 1MH1A 5J2UB 1CNFA 1QGUA 4FOOA 3G88A 4KUHA 4XDGA 4AWBA 4DIKA 4UTPA 4BXOB 3G2LA 1KH3A 1V25A 2OHGA 2JIDA 3CJRA 4NCJA 4XIJA 4XWAA 4HEHA 2DKFA 4WL0A 1U7PA 2F64A 2Y76A 3B8EA 5AW8A 3R0QA 3GAMA 1RP1A