3JQ8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine (dx3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFARQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
total genus 95
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq8A00
3EMKA 2EGGA 4PVDA 3VDRA 2ZTUA 1BSVA 1ID1A 1P0CA 2B83A 1ZVMA 1H6BA 3OJOA 2E6UX 4CV0A 1Q0HA 1H2HA 5GZ6A 1BDMA 3G3EA 3KHUA 1AGNA 2NWQA 2UAGA 1PL7A 3PQFA 4E13A 1ADCA 3HADA 3QWAA 1T26A 2O3UA 4PRKA 4JBHA 5CAEA 1IZ9A 1V3TA 3C24A 2ET6A 4E5KA 1NBOA 2NVBA 4GH5A 3KV3O 5JCJD 3F47A 3HE3A 1M6HA 1T1RA 3BHJA 3AOGA 3D3EA 5JDCA 1PWZA 1NQ5A 3KSDO 1P1IA 4IGFA 2P9GA 4GKVA 3W4JA 2O2YA 1JAYA 2O3SA 2D8AA 5JW6A 3LQFA 3H6KA 2IODA 1Z74A 1L7EA 5G0WA 1MC4A 3BZUA 3GOHA 4FFPA 3FTPA 4BGIA 1N7HA 2D2IA 2V6GA 1UXKA 1D4FA 4QO8A 4A2CA 4DMLA 2Y0EA 3JQGB 1X1EA 4PG7A 4CQLB 3HDQA 1N5DA 1ISFA 4RDIA 2X58A 4E2XA 2PZMA 3QVWA 5GZ3A 3PVZA 4IJWA 5G2OA 1E6UA 2Q45A 1DFGA 1HXHA 2IE0A 4G81A 1NFFA 2PH3A 1I3NA 4Y9DA 3JQCA 3B1FA 3BMOB 3JQ9A 2Y93A 1MUUA 2AA3A 3RBXA 3VHRA 2YHUA 4KOAA 1ENOA 5DCWA 4OXKA 3GR6A 3GRPA 5AVOA 1B14A 1ZZEA 4B3HA 1VL8A 1O0SA 4UAGA 1ULSA 3DZHA 4YAIA 3KUXA 1PGJA 4MVJD 4KTVE 2GGSA 4YCAA 3VH4A 3VPHA 5IDQA 2CD9A 1JDJA 4JX8A 4MP8A 1DOHA 4YQYA 4BNIA 3WR5A 3WGHA 5G4KB 4GX5A 1SEPA 2VYVD 3PHIA 4L74A 1UDAA 4ID9A 2XXJA 2PA3A 3ZWXA 1XQ1A 2FOIA 3IKVA 1DO8A 5HRUA 4EEZA 4E30A 4OIMA 5KWEA 2O3QA 1SAYA 3W1VA 1IOLA 2P2SA 4KZPA 3WTCA 1U1IA 3R0IA 1GYQA 2D5CA 2WDZA 2OHXA 4IQ0A 4CL3A 3ZU3A 1OOEA 1ZFNA 4XYGA 3LU1A 4YAEA 4CLRA 1H93A 1E6WA 4CMHA 5DBGA 4ZQEA 3UH1A 2DU8A 4IDAA 4UVHA 4PLCA 4A73A 3BTVA 4U8GA 1LDBA 1YKFA 5KKCA 1LSSA 3H65A 4ZRNA 2BI8A 3CPSA 4DWVA 3MZ0A 4UREA 1QP8A 2ZCVA 4RVUA 4CUJA 4L8VA 4K9DA 1A7AA 4BL5A 1P1KA 4BNMA 4P22A 3MJCA 2V7PA 3NTRA 1I8TA 3DBHB 3FR7A 1D8AA 2BH9A 3AI3A 4OM8A 4WNIA 5DOVA 2BFPA 4FD3A 4PRLA 4YR9A 2AG5A 4KWHA 2DBQA 1WZEA 1DIAA 4HP8A 2NU6A 2VHXA 2IEBA 2PNFA 3RIHA 4OJNA 2IZ1A 4IZIA 1DJQA 2BD0A 3S1LA 1Z6ZA 4OHUA 4BUCA 1JVBA 4A7PA 1E3JA 3ZW9A 3RCBA 2DVMA 3SJUA 4ZGWA 1PZGA 4J7UA 4AJHA 4EGFA 4QQRA 1UXIA 3L6EA 3GG9A 3WGIA 1JW9B 4OAQA 4OGWA 3C7AA 4ND4A 4A10A 4J4BA 2HK7A 1NWHA 1YL6A 2ZTMA 3KM0A 5T8KC 1R12A 1QV7A 3AJRA 1RJWA 4CR8A 2VWHA 3T7EA 3CE6A 2PV7A 1QLJA 3V2HA 1GV1A 2GN9A 3T4EA 4FJ0A 1U8XX 5LDHA 3A28A 1CF2O 2B4QA 1DRVA 1D1SA 1RKXA 2GZ3A 3WOHA 3BMNA 5BNIA 1WMAA 2RH8A 3E48A 3VH2A 1O89A 4JBGA 4XX0A 3UF0A 3NV9A 4BMSA 1VI2A 5CEFA 4XGIA 4D43A 3IJPA 1TT5A 2J3IA 4I5GA 3DHYA 4CM5A 1WDMA 1GYPA 2FHSA 4MVJE 1GU7A 5AXBA 3ZWYA 3H9JA 2XPCA 1F14A 4WE3A 2VYND 1RM0A 4ZA2A 1CEQA 3PLNA 1R16A 1WZIA 5L7YA 2GERA 3GH3A 4O59O 2VRBA 4YWJA 1Y8QB 1LI4A 2RIRA 3OEWA 4GLOA 1DRWA 5JAQA 4J91A 2DPGA 2VZ0A 2AG8A 2LDBA 3AUSA 3ZWCA 1PJQA 5IXSA 2WTBA 1HE2A 1XSEA 4MKRA 3SEFA 2GASA 5MGBA 4TRMA 1T24A 2XF8A 1EK6A 4NBRA 1PGOA 3DR3A 4E3ZA 4EUEA 3ZWOA 2X0RA 5JO0A 3CH6A 4HFRA 3DZKA 1CRWG 3PRJA 4QEDA 4WCFA 4JJIA 4XB2A 3ZHBA 5C7IO 1LX6A 3EK2A 3WJ7A 5TX7A 4HV4A 4XGNA 1NNUA 1JLLA 4L75A 3PZRA 1KOLA 4BNVA 2OMEA 1U3WA 1Q1NA 3NTOA 2VWQA 1UP6A 2BLLA 1SCUA 2RHRA 1A9YA 2G5CA 3OHSX 3KETA 5ITWA 4RO0A 1SPXA 4LN1A 5A05A 4UULA 4F46A 4AJ4A 1G6KA 2C54A 3ZU4A 3F5SA 3PJDA 4R9RA 3HJAA 3GPIA 1QYVA 4YVFA 1EE2A 3OQ6A 5JLAA 2JKVA 3R3JA 3IIEA 4IGEA 3GRKA 3QWIA 3A1NA 2CVOA 3EYWA 3SC4A 5TJ9A 4E31A 1LNQA 4YJHB 5EPOA 5I9LA 3STHA 3BHMA 1UP7A 4HFMA 4BO9A 3LYLA 2WYWA 4DIOA 4AJLA 2OL4A 4ZQHA 2P9CA 1JWAB 1KYQA 2YUTA 4IDCA 2A92A 4CV3A 1QRRA 5BSHA 4CM9A 3ABIA 3I52A 1F0YA 1YJQA 5JCJA 3RVDA 3C7DB 3EGOA 4E2WA 1T2CA 1EK5A 1U5AA 3DBLA 1Y6JA 1PJ2A 1PL6A 3PHLA 1GAEO 4JLWA 1Z75A 3LLVA 1P1JA 1E7SA 1I32A 1DLJA 4Q9NA 2QIOA 3D1LA 1U2DA 4OL9A 1A5ZA 1E3IA 1K2WA 1KVSA 4Q3DA 4PVCA 2AE2A 2VT3A 5THKA 2J5QA 3T4XA 3JD4A 5DCYA 1E7QA 4ILKA 4Z0HO 4B3IA 1LBEA 4OXNA 2O50A 4NJMB 1BVRA 2POQX 4D41A 5H81A 3X2EA 3H3FA 3HFGA 2HMSA 5JFOA 3G1TA 4CMAA 2Y1OA 2C07A 4IDBA 4MVJP 4GX1A 3OIGA 4R1TA 4C4OA 4DLBA 3PQDA 4BKUA 5EQDA 3GZNB 3NGXA 4YB8A 4QUKA 1AN9A 3AK4A 2VNSA 3H3JA 2IXAA 2VCYA 3LC1O 4AJNA 3VVCA 2VN8A 1E7WA 3WQQA 3AY3A 3S2IA 5A9SA 4NDNE 3WGYA 5BSEA 4HBGA 4HWKA 3ZV6A 3HDHA 4E5PA 5I7FA 2FSVA 2X1HA 4LISA 2PWZA 1QYWA 4EEXA 4HNHA 4PLWA 5IFLA 2LDXA 1NR7A 2W98A 3WFJA 4BNNA 4EUHA 1DC5A 4MOWA 2YYYA 5ENDA 5JYEA 5DP1A 3C1OA 3FSRA 5IZCC 3ANLA 3O8QA 2FZWA 2AQHA 2J5KA 3D0OA 3FNEA 3JV7A 3IAHA 3NRCA 1U28A 4XKJA 3MEQA 2VOJA 3EVTA 3JQDA 3ZZNA 3RKUA 1GEGA 2NQTA 1CQJA 5L40A 3WSVA 4GX2A 3WYCA 3KXDA 2W2LA 3OQBA 1T2FA 3W8DA 4LW8A 2HRBA 5A02A 4HY3A 2B0JA 4TSKA 1T2EA 3DMYA 1T1SA 2JJYA 3W6ZA 1LSJA 3MJVA 4IMRA 1B16A 1MB4A 3AY6A 3VPSA 2G0TA 1KBZA 3ICCA 5ES3A 4BOYA 1SOWA 1GPJA 2AEJA 3RSHA 3Q1LA 3QWBA 2H9IA 1HSZA 5FFFA 3M1LA 3WGTA 4IBOA 5MDHA 3JQ9C 5JMWA 4OQYA 5ER6A 4Q3BA 4FS3A 3U4CA 2YZ7A 2FR1A 1E1LA 5KKAA 3IUPA 3BTSA 5F5NA 4DXHA 2VUUA 5LDGA 4TKMA 1OC2A 3PHJA 4ZJUA 1B3RA 2J3HA 2DLDA 3O8QB 4IS2A 1NHGA 4WASA 1EE9A 3WGOA 4BO6A 2D1YA 3KBOA 4DIBA 1XHLA 2DC1A 3DZFA 1P3DA 1HZJA 2DBRA 3V1YA 4IY1A 3CSDA 2GPTA 2PGLA 1XKQA 3NDJA 1OAAA 2OOSA 3D4OA 3W4KA 2JL1A 3OJEA 3NKLA 4YAGA 5L4LA 3JQFA 3PGJA 1EMDA 2B69A 2RHCA 3U4DA 2GD1O 4J1SA 4R16A 3QRWA 4G65A 5ER9A 4FIZA 5I7SA 2NTJA 5G0VA 3INGA 3HUDA 4RDHA 1O6ZA 1ZK0A 3Q2IA 4J1QA 1YQGA 2W2KB 5TQVA 4D3FA 4W7HA 4RJTA 5DOZA 3DXFA 4FFRA 1D7OA 4ALJA 5JC1A 2WD7A 5FYDA 8LDHA 3S8MA 3NJ8A 1SMKA 1FF9A 1PL8A 4W6ZA 3D5QA 1H9BA 1QYCA 1KC1A 5L9AA 4BNFA 3ADOA 3F3SA 3E03A 9LDBA 3KLMX 2GN6A 1T4BA 1R37A 2R00A 1I3KA 1JA9A 2JD0A 5G4LA 2C82A 5T57A 4PG8A 4ALNA 3DAPA 2R2GA 4CM7A 1ZMTA 1IUKA 3C3XA 3BMNB 5AXAA 3KZVA 4ALLA 1UP4A 2IEDA 2TMDA 1WW8A 1ADFA 4FQ8A 4LRSB 3WNQA 2PD6A 3WYBA 4UVIA 1W6UA 3TF5A 2C5AA 4GQAA 3O4RA 3CUKA 4XEHA 1YGYA 3ZU5A 5T64A 3VTZA 1Y5RA 2AQIA 2GYYA 5AOVA 4FCCA 5C37A 4S1VA 4J6FA 1HT0A 3GFBA 4XDZA 1YQDA 2NUAA 1U7HA 4BKQA 1KETA 1SB9A 3QVOA 4WECA 2VRCD 5CEJA 4NFYA 5DDIP 1K0UA 2B4TO 4CLHA 2PZLA 1Q0LA 4WK6A 4DYDA 4ND1A 3A9WA 3PPIA 5ICMA 2EKPA 4MIEA 4CR7A 1MX3A 2O7QA 1ADGA 3F9IA 3RC2A 3L9WA 4J16A 3U9LA 1UXJA 3NX4A 4DQXA 4NI5A 3EZYA 1B0AA 1EBUA 3E82A 3DBRA 3P2OA 2DBVO 3PLRA 3IP3A 4R9SA 1LJ8A 4ND5A 1YJ8A 1GY8A 2QRLA 3PJEA 1LDEA 1ZK3A 1KERA 4I5DA 3VOSA 4AICA 5IDXA 4XIYA 1YH3A 3E1KA 3GF4A 4IDFA 1H0KA 4P4GA 4XQCA 4GGOA 3DFUA 2C2XA 3TSCA 3JQGA 2G17A 4BS9A 5JY6A 3N58A 2W2LD 6LDHA 1ENPA 2O7SA 1N7GA 3ROKA 3B70A 1UJMA 1WVGA 3RI3A 1GL3A 5DZSA 4E0BA 3JSAA 2ZATA 3G79A 3OICA 4JJFA 3IP1A 4CQMB 1VPDA 1A72A 2E48A 2OP0A 3QWHA 4M1QA 2FY8A 4E12A 4EITA 1ISGA 3BMQB 4J9UE 1JAXA 4BKRA 4MVJH 3ONFA 3ZHYA 4CM1A 1V3VA 4MIOA 3RFVA 4PIVA 4EDFA 3GFGA 4K1LA 1ZK4A 2IXBA 1Z7BA 4IQ8A 5G0UA 2VOEA 1P9LA 1OFGA 4WCDA 4YPOA 3BMCB 1S7CA 3K2BA 4AVYA 4J7XA 5B4UA 3TFQA 1X7HA 3GVXA 4O1MA 4Z9FA 3G0OA 4ZRMA 1P74A 3RJ5A 3FCOA 3GUYA 4BGEA 3AU9A 5B1YA 4FPXA 1RM3A 1E7RA 2GCGA 2HU2A 3KYBA 4TZKA 3WICA 3ZNQA 2CUKA 4B79A 3E18A 1OC4A 2Z1NA 5KVQA 2W90A 4R1SA 4YA6A 1LDMA 4R68A 3H5RA 4EZBA 4F45A 3MTGA 3JD2A 4UEOA 1V6AA 3PEFA 4JROA 4BNUA 3GNTA 2IYOA 3Q0EA 2I65A 1MP0A 3DTYA 3DOCA 4CODB 1G0NA 4U0KA 3I83A 4MO2A 1P45A 1QMGA 3WGQA 3ZV5A 4NBTA 4YJGB 2D3TA 2NQ8A 1ZH8A 2EV9A 3HZZA 3ON5A 4N54A 3RKRA 3V5NA 5B4VA 2AEFA 3ZHZA 2Y1EA 1BXGB 3D5TA 5JC8A 5KOIA 3Q9UA 1NPYA 1B3BA 4OO3A 3TL3A 4J1TA 1NTOA 4YT5A 4U6QA 5JYDA 3GC6A 1XLTA 5A03A 7MDHA 3DZBA 1PWXA 2E4AA 3VPGA 1WDLA 2Q1WA 1LLCA 1WP4A 5EQFA 3WXBA 1PR3A 3FNFA 3G49A 1GQYA 5BSFA 2VHWA 2HJRA 2Y05A 3GUCA 4MVJM 4XR9A 4D0RA 4E2ZA 1JKFA 5A9TA 4TVOA 5L3ZA 3TNLA 3ZV3A 3OJLA 4N18A 1GTMA 5BT9A 2HCTA 1W0CA 1PU2A 2NACA 3CXRA 1LEHA 2QHXA 3DFZA 3JQ8A 3GHYA 4HFJA 4WOKA 3JD3A 4Z9XA 5L4NA 3L0DA 2ZTVA 2OBNA 5B12A 1TEHA 5CDGA 4CMGA 1C14A 1ZK1A 1E5QA 3JQ6A 5TJHA 5U9CA 3GEGA 4B4VA 4R69A 1E3WA 2CVQA 3PZBA 1R4NB 4IJVA 4D79A 4NBVA 4RV9A 2PGJA 5I9MA 4FFOA 4AJPA 1UR5A 1XCBA 4GAEA 3OQ1A 4PZDA 2GNAA 4BMVA 3K2EA 5F3RA 4PG5A 4R1UA 2FWMX 3LSYA 3S2EA 2EWMA 2G76A 3GMSA 4NHEA 2FMUA 1BXGA 3GN1A 4ZICA 5JCXA 3ZN2A 4PGFA 1L1FA 2Q49A 1DIGA 1NYTA 4LRTB 4YJGA 3W4IA 4BMNA 2Y99A 1FDVA 3JYNA 1YONA 2BFOA 2SCUA 5T8KA 4WUVA 5L45A 5JBIA 1IB6A 1EUCA 1I3MA 1C1DB 5IZCA 1QSGA 3IUSA 2NTVA 1LU9A 4L0QA 1V9LA 1BW9A 4XJSA 4TRJA 2OXIA 2IRWA 1F12A 3H8VA 3E5RA 4PLTA 2OZPA 3PFFA 4TRNA 2Q3EA 1Q7BA 4KUGA 4Q39A 2X22A 1YB4A 3I9MA 3TZQA 3GN2A 3WMWA 4CQMD 1I2CA 3ROPA 2GF2A 1SEVA 3JQ7B 1LTHR 5HS6A 4CM3A 2V65A 3GG2A 3N7UA 4IIUA 1E1MA 5KCZA 1YXMA 3M1AA 2DT5A 1NVTA 4BO2A 2GRAA 1BHSA 1E7MA 3GEMA 3ZWPA 1PSDA 4JCOA 5HWSA 2ZB7A 2A4KA 4CM8A 3H7AA 4LVCA 1HE5A 1VRWA 1DC3A 1Z82A 3WIDA 2Q2QA 4CUZA 1HE3A 1LLQA 4XR4A 2EP5A 1EFKA 4GX0A 2EIHA 2P4QA 1SOVA 1U4SA 5L51A 2QQ5A 4ITUA 2OFPA 5EMHA 5A5EA 5IN4A 3TFOA 1CETA 4W9NA 4JIGA 3F46A 1NFRA 5TLSA 5LC1A 4LMRA 5TIIA 2DAPA 3PYMA 2PKRA 5CPFA 1WWKA 1IHXA 1FDTA 3F5QA 1Y81A 4QO7A 3KEOA 1UZNA 2WE8A 4KQWA 2X5JO 1QR6A 4GWKA 5DN9A 4P38A 5GZ1A 1T2AA 3OJ0A 2JAHA 4GVLA 1ISMA 4JP3A 1TB4A 2VWPA 4CQMA 1R6DA 3RU7A 1H2BA 2ZYGA 3RFTA 1F8FA 4I9UA 3VTFA 3ROMA 2IZ0A 5KVVA 1Y5MA 2UV8A 5F5LA 4GLLA 1IHYA 1QG6A 1KVQA 4MVJF 5TSDA 1AXGA 1U3TA 3COSA 1YOVA 3I3OA 3AWDA 4BNHA 1PS8A 3E5MA 4GPD1 4NFSA 4DQUA 4G5HA 4YBZA 4IM7A 4JP2A 4N5LA 1BGVA 4YJHA 4WLNA 3MCVA 3ENNA 3OM9A 4FR5A 3ZU2A 5C5IA 1W73A 3U09A 4Y6PA 1ENYA 1C0PA 2FZEA 4TZTA 5IG2A 1GQ2A 3PXXA 4PG4A 5F21A 1SBYA 2C7VA 3JD0A 2JHFA 2VUSA 4D42A 2BHLA 1IYZA 2PGDA 4OH1A 3E9MA 1NQOA 4MPDA 1X7GA 3NEPX 4CQLA 3VPXA 2FP4A 1BXZA 1TA4A 2Y1GA 3T7CA 4M87A 4FSHA 4R5HA 3GK3A 4H3VA 1CJCA 3I5MA 4X54A 1HDOA 4A26A 1GUYA 3V1UA 4B7UA 2Q2WA 3OP4A 4R3WA 3VPFA 4CUKA 4IXTA 3CKYA 4CM6A 1DFIA 2EJWA 2Y1CA 3OBBA 2YDXA 3MJ4A 4B8ZA 2EEZA 2FRDA 4IS3A 2JD2A 1R4MB 1WPQA 1KY5A 3BTOA 3EC7A 2G82A 3RUCA 2VYVA 4O63O 4KDEA 2NADA 5KJCA 2VHZA 4BQRA 3WLFA 1P1RA 4RL6A 1LDGA 1KEUA 1O8CA 2NVUA 3LF2A 5A06A 2RAFA 3TQHA 1PJLA 2B36A 4CLRB 3PWKA 2OUIA 3GA0A 1AHHA 3VH1A 1Q2XA 3ANMA 2PZKA 3VAZA 4PLGA 3ZNOA 1HLPA 2BI7A 4KUHA 2WSBA 1YDWA 3ZH2A 2O2SA 1EVJA 3GEDA 2P91A 2YW9A 1E1NA 5ADHA 4DQVA 2E82A 4Q3EA 2BGLA 3OEYA 5CFZA 5A9SB 1RM4A 5CP8A 1OI7A 3B1JA 4DC1A 1I2BA 1NP3A 4XWYA 3RUAA 5K6AC 2Y0DA 3GVIA 3QP9A 2VTDA 2ZB8A 3NYWA 3NGLA 4CJXA 3L6DA 5JDIC 2W4QA 3GNSA 1J4AA 1OBFO 2O3JA 3QW2A 3RU9A 4OOEA 4R01A 5G4KA 4HFNA 2C0CA 4OXYA 1YVEI 2I66A 1K89A 3ANNA 3Q2KA 1EDZA 1FDUA 1ZEMA 2GUGA 4UEJA 3ADPA 3KSUA 4NBUA 1HRDA 3UOGA 2Q1UA 1GD1O 5I8ZA 1Z73A 1VLLA 3UFXA 4J3FA 1NM5A 1AXEA 2A35A 2Y1FA 3DBHA 2HMUA 1L7DA 1VJ0A 1OMOA 4GI2A 4URFA 5A3JA 3I23A 4WEQA 4JBIA 3JYLA 1FDSA 5EERA 2GSDA 3GT0A 5IAAA 2HO5A 1E7YA 4DL9A 2YJZA 3NDIA 3SJ7A 1KEWA 2I3GA 4TKLA 2Q2VA 2QRJA 4W82A 2NU7A 2P68A 2YFQA 3DQPA 1YOVB 4BNTA 2AQ8A 4L9RA 1R4MA 3B20A 3E8XA 4TRRA 5F1KA 3A06A 1W4ZA 3RWBA 4DBVO 1BXKA 3OETA 3IMFA 5KJEA 3DBVO 1GR0A 4DIFA 3K9QO 3WJAA 2V6BA 1U9JA 1VL6A 1GDHA 3FWZA 1DB3A 1PJ3A 2WMDA 3FBTA 5JAMA 2EW8A 3KYDB 3QQPA 1F8GA 4LGVA 5H83A 1ENZA 5EIOA 4PLFA 3EZLA 1M75A 3U0BA 3C1TA 3NT4A 1H94A 3TDKA 2YFHA 1AUPA 2HQ1A 3KB6A 3CIFA 1CQIA 1ZK2A 5A4DA 1YDEA 2J6IA 1LXCA 1P33A 5K0ZA 4K6FA 5KIAA 2YV3A 3D3WA 2J3JA 2X0JA 5U1PA 4MP6A 2AMFA 3GMDA 1HDRA 5GMOA 1YE3A 2BFMA 3PJFA 2CDAA 2EW2A 1P31A 4BB5A 3IL2A 3FD8A 4FC7A 4D3SA 2AQKA 5EL0A 3PHGA 1B26A 3ETGA 3F4LA 5THQA 3A14A 3UXYA 1DEHA 4HX5A 4ZQGA 4D7AA 1JU9A 2HSDA 2O23A 1YB1A 3JQFC 4GL4A 3L9XA 1JKJA 3WNVA 4IDGA 4RQTA 4XGKA 5G0TA 3UVEA 1U3UA 1VSUA 4MVJA 3QVSA 3ASUA 4UUPA 3R3SA 3KYCB 1EFLA 4TQGA 3RFXA 5JDCC 3TPCA 4H16A 4RPKA 3QLJA 3DONA 3WFIA 4Y6RA 1X0VA 2H1SA 2EERA 3FN4A 2H6EA 5EINA 1HDCA 5CDYA 4RLHA 3H5NA 1V8BA 2ZB3A 3KVOA 1NPDA 1PQWA 4XJTA 3BMQA 1TT5B 3AUUA 5KVSA 1UAGA 2D0IA 5ITVA 1HTBA 4ALKA 3EY4A 2EKLA 3WS7A 5HM8A 1PJTA 4F6CA 1G0OA 3I9OA 1X14A 2WWRA 1IULA 2WYUA 4WNCA 1I5RA 2O48X 3Q6IA 5CEEA 2B5VA 1LDYA 4L76A 1GADO 4EI2A 3ITDA 4B7CA 4O0LA 3SC6A 1PEDA 4FC6A 3VKVA 1X15A 3DTTA 4II3A 2ZTLA 3PFWO 4BGVA 4YAJA 3ZDFA 1ZCJA 2NM0A 4CMIB 2X0NA 1R4NA 4NPCA 1IE3A 4AJJA 4EYEA 3QJ5A 3SLKA 1LRJA 1Y8RA 2C59A 4CM9D 2A94A 4AJIA 5A5FA 3C8MA 2P5YA 3BIOA 1E92A 1LSOA 2B35A 3ICPA 2VUTA 3R1IA 2HJSA 2YQ5A 3HNPA 1DFHA 3D4NA 4EJ0A 3PDUA 3UCEA 3JQAB 5DF1A 4GWGA 3GGOA 1GEEA 4KP7A 3RBZA 1IL0A 1BWSA 2RH4A 2XXBA 1ZNQO 1GZ3A 4J0EA 1C0IA 1E3SA 2W2KA 3PP8A 4ZU3A 5IJZA 1BDBA 4A0SA 4MJLA 2ZYAA 3IQDB 4UVEA 2Z95A 2BGMA 3EW7A 4RF2A 4UVDA 1YL5A 3DAGA 3HHPA 1H5QA 3RAJA 3VZSA 1ARZA 4YQZA 2O4CA 4KWIA 4YJFA 4ZD6A 4WJZA 4XYMA 3X2FA 4FW8A 5CPBA 3DEYX 1LRKA 1I2ZA 4YT4A 3OECA 5JAIA 1C1XA 2ZQYA 1WXDA 1PJSA 2IYPA 4RF3A 3L07A 1K6XA 4ZQFA 1GYRA 4BO4A 5IN5A 4LMPA 3ASVA 4R4JA 3LC2O 1NQAO 1XG5A 1YBAA 4JGBA 4JN6B 5FEUA 4PLHA 1PZEA 1HZZA 4LCEA 3ZNNA 2PZJA 4QXMA 3L4BC 1ISJA 4YDRA 2VHYA 3B6ZA 5GY7A 3GAZA 4IIVA 3AI1A 4DYVA 5KNLA 2HUNA 3ZWBA 3QSGA 1J5PA 4HKTA 1LUAA 3U3XA 1HE4A 1E3LA 1NAHA 2EGHA 3NAQA 4Y98A 2XAAA 3F6YA 1KVTA 3FPCA 3H4VA 1EUZA 2OO5A 2X5KO 5I7VA 5K9ZA 3WTBA 2AE1A 1F17A 1H9AA 2CZCA 4E21A 1UZMA 2DKNA 5L7TA 1CIVA 1SO8A 3WSWA 4J4TA 1LC3A 3QE3A 1DHTA 2X7HA 2BF7A 3OA0A 6ADHA 1N92A 1CYDA 1FDWA 1UXGA 1MGOA 1ZW1A 3WYEA 4OQZA 4BO8A 1FJHA 4FGWA 5BNTA 1GUZA 3W6UA 4BNYA 1E6EA 3D7LA 2VQ3A 4BIIA 4PFJA 5COBA 4BKPA 3P7MA 4A27A 1O9BA 4AJ2A 3TZ6A 4NK5A 2BRUA 5AYVA 3ETDA 4ALIA 3MJTA 3INRA 2Z1MA 1Y9AA 4JJGA 1GPDG 2PR2A 3QVXA 5I7EA 1T25A 4GMGA 2JHGA 3FNHA 5LCXA 3BMOA 2B5WA 3JQEA 4DPLA 2PY6A 1Y8RB 3DL2A 4M8SA 2JCYA 1QORA 1RYEA 4D44A 1LRLA 3GDGA 2HLPA 3WWYA 2GR9A 4GVXA 2C29D 1E3WB 4DMMA 4M49A 3KOUA 1NPTO 2QYSA 3PDJA 1ZXLA 2WEKA 2E49A 1Z45A 2WM3A 4CLDA 4C7KA 3GDFA 4FOOA 3JQAD 3EDMA 3UAGA 4IUYA 3UGKA 4E2YA 1IPFA 3PYXA 1UUFA 4PLPA 2GZ1A 2FN7A 3R6DA 1NXQA 3HDJA 1M2WA 3QVTA 5K6AA 4Q3NA 4JK3A 1SNYA 3OMLA 1A71A 1R0SA 3NT2A 4AFNA 2EF1A 2W8ZA 1N2SA 3LDHA 4CMEC 5KJ6A 3TL2A 3V8BA 1UDCA 2FPPA 3VDQA 1DIRA 2Z5LA 3ENKA 4JXKA 1E1KA 5JSFA 5C3MA 2CF6A 3OIFA 2B37A 3DHNA 5L7WA 2ZKLA 3WWZA 1NWCA 3TN7A 1SZJG 2FR8A 3MWDB 2WJPA 2I9PA 1Q7GA 1U3VA 1GQQA 3E9QA 4QT0A 2PTGA 2Y68A 1J6UA 2EKQA 2R6JA 2DPHA 4KDFA 4DA9A 1MG5A 1T4DA 3JQ7A 5JXWA 3ONEA 5HA5A 1R0KA 1PJCA 3D3WB 4DREA 2BGKA 3QHAA 3OJFA 3K96A 2YV1A 1QV6A 2PLAA 3EAGA 1P1FA 1ISIA 4WPGA 3LF1A 4NNJA 5JY1A 3AOEC 4EJMA 3NJ4A 4RCVA 4M55A 2Q4BA 4IQGA 4LCJA 2JD1A 1JQBA 2GDZA 1RYDA 2QW8A 3AOEA 4CLOB 1HEUA 4IJKA 2PKQP 4DLAA 1C3VA 3I9KA 3OF2A 4OMUA 2I99A 1JWBB 5U4QA 5ILOA 4I8XA 4WGGA 5DBIA 1U2GA 5CHEA 1XEAA 1YQXA 4BKOA 5BQFA 2DUUA 1BRMA 4PN3A 3PJGA 3RQSA 1P44A 1HKUA 1KEVA 1FK8A 2ZB4A 2ZIZA 4RZIA 4XCVA 1O5IA 1Z7EA 1BVUA 2Q99A 5B37A 4AJOA 4RVSA 2CDBA 2DBZA 3FTNA 3E6AA 1U7TA 2VYNA 1MV8A 4O6VA 1AHIA 2VWGA 3INTA 4BNWA 4FB5A 4QX6A 3L77A 1B7GO 2PD4A 1K6IA 3O03A 5BR7A 3ZV4A 1H6CA 1I30A 1X0XA 3HFSA 1R66A 1MXFA 1EQUA 2H5LA 3PTZA 4K6CA 1ZSNA 1PQPA 3H5AA 5AQ1A 1A9ZA 4DC0A 1K6JA 2I6TA 3H9UA 5KTKA 2ILTA 3VVBA 4O5OA 4DVJA 3QIVA 2OBYA 3LVFO 3JD1A 2BKAA 3P5SA 2Y0CA 1XU9A 1DRUA 2DFVA 1LSUA 5JDIA 1ZXBA 3WGGA 2ZK7A 5DCUA 2NU8A 2F1KA 3LC7O 4ESOA 4NBWA 4W4TA 3FBGA 1ONOA 4NR0A 4CLXA 1XQ6A 4U6SA 5CDSA 1F06A 1J49A 4ZVVA 1A7KA 4J43A 4NJOA 3DBRB 4JQCA 1EEHA 4D46A 4XQEA 1DC4A 1UDBA 3EUWA 2JCVA 4CV2A 5J23A 1N9GA 3QA9A 1VE9A 3RASA 1QLHA 1MLDA 1FMCA 3ZCXA 2X8LA 3PQEA 4CM4A 1PTJA 3P19A 1CWUA 3AFNA 2Y1DA 1ZMOA 4KMSA 4MDHA 2HK8A 4J4HA 4Y6SA 3TOZA 1C0KA 4FBGA 4TMFA 4FFMA 4A03A 2HRZA 3AFMA 3H9QA 2QYTA 4CLEA 3L4BA 5IDYA 2CSUA 3JYOA 4BB6A 4E4YA 2NVWA 3QV1A 5H82A 1HYEA 4I9NA 4BNXA 3AY7A 1ZJZA 4I5FA 1IY8A 3K92A 5C7LO 4FOSA 4KTTE 1KS9A 2J5RA 3FF4A 4RPJA 1IPEA 2D4AA 3RUFA 2X6TA 1JKIA 4E32A 2Y67A 1LDNA 3GY0A 1JTVA 3BYZA 4RVDA 3WGZA 1QYDA 2RBEA 4L4XA 1MA0A 1DPGA 1ZIDA 4W9NC 1I0ZA 1VC2A 3FI9A 4UUNA 5KVCA 3PIIA 1C0LA 3K6JA 3WBBA 4II2A 3I9NA 5CG1A 1K5HA 3DZIA 2BELA 2VZ9A 4B3JA 1ML3A 3DMTC 4RPLA 3DDNA 3TZCA 1DDOA 3D64A 2X9VA 1Y1PA 1DAOA 2ZJ1A 3WBFA 3JQBA 3H9GA 1EDOA 2NTNA 3S2FA 2YDYA 3M2TA 4G2NA 4R5MA 4EBFA 3DB2A 4XRGA 2VNAA 3RD5A 3ROQA 3FPLA 4AG3A 3UCXA 1PZHA 3SLGA 3RC9A 3ZW8A 4WKGA 3ZWMA 1MG0A 4HNGA 4K26A 4IXWA 2J8ZA 3VZRA 2WD8A 4E5YA 3PGXA 1PZFA 1CDOA 4CMKA 3WQRA 1B8PA 1YB5A 4XQ9A 3H2ZA 1EQ2A 1LLDA 4FJ1A 3TRIA 1N9GB 4YXFA 3RUEA 1EBFA 3PK0A 1MFPA 2G1UA 4WLUA 4U7WA 4YYZA 5TT0A 3FNGA 1WDKA 1U5CA 3U4IA 1PIWA 1IZ0A 3F4BA 1J0XO 4UUMA 4QTZA 1NHWA 1ZEJA 2F00A 4B4WA 2JFGA 3MWEB 3GGPA 3LT4A 2YV2A 4TROA 3ST7A 2D59A 4LK3A 2CY0A 2IZZA 3KYCA 5IF3A 1P0FA 2HKIA 3WDSA 4XA8A 4DUPA 3OFSA 4CV1A 5EJ2A 1ONNA 3PYLA 4IPTA 3AU8A 2HK9A 5TF4A 1BTOA 1ADBA 1X13A 3HB5X 3CEAA 3I4FA 2EJVA 4FN4A 4U0JA 4DTIA 3D4PA 3N74A 3NUGA 4YACA 3F1LA 3AUAA 3O9ZA 1G1AA 3AUTA 2I67A 1NX6A 1X1TA 1YRLA 4C7JA 4UVGA 4CMIA 4TWRA 5KJ1A 4OSPA 1M67A 3BMCA 2NV6A 1XA0A 1DLIA 3PHHA 3UHAA 1HF3A 1VSVA 2DTXA 2WYVA 3H2SA 4BO5A 1KC3A 1V3UA 5A9RA 1AE1A 4RF5A 1P1HA 1KIFA 2HMTA 4I9HA 4MKXA 3K5PA 2OP1A 3ORFA 4QSMA 2OORA 4RQUA 1I36A 4BO1A 1X7DA 3DOJA 1D1TA 4MVJI 3DBLB 2A9FA 4UUOA 3SBOA 4DLLA 4H7PA 3GPDG 2E37A 2VTEA 1XDWA 2GN8A 3NT5A 4FJ2A 3OIDA 3DZJA 3PIDA 1LQUA 1GCOA 3PWZA 1NR1A 4U5QA 3RUIA 3QWFA 1HLDA 4Z3KA 5A1TA 1HDXA 7ADHA 1NFQA 2DFDA 3L4SO 5JS6A 4YAKA 1EVIA 2X0IA 2B4RO 4WEOA 4XIJA 5EN4A 3Q9NA 3GVHA 4P8RA 3U4HA 4N5MA 3A4VA 1PGQA 5FI3A 2GO1A 1ZJYA 4H15A 1K3TA 3TWOA 1LA2A 4I5EA 1EUDA 4WLFA 2O3TA 4FFLA 3CZMA 3KTDA 1TXGA 3BXXA 4R51A 1B8VA 4W7IA 3RC1A 4XRRA 4Y8VA 5CG2A 3HN7A 1Q0QA 4XDYA 1H6AA 4NQZA 2PFGA 3LT2A 4QECA 4CM8B 4YJFB 4MIYA 4MP3A 4RVFA 4J2OA 1VM6A 1HETA 5BNFA 1DXYA 3QY9A 4CPDA 3FHLA 1H6DA 4RZHA 3TZKA 4OKNA 2Y66A 3U62A 3W8FA 3U5TA 1U8FO 4B8WA 4YRBA 3CINA 1B15A 4IDEA 1DSSG 1I33A 1YS4A 3C1AA 4KQXA 4NH4A 4RPGA 1M66A 4LVUA 1RPNA 4CM4B 4RGBA 1MXHA 5TC4A 3SVTA 4YT8A 1I10A 3KO8A 2Q50A 1XELA 4D0SA 1ONPA 4YTEA 3UUWA 4E5MA 4YRAA 3BA1A 4IZHA 3AM4A 3ZGYA 3GHHA 3ETEA 4ZN6A 5B4TA 4DBZA 4DPKA 2GN4A 1VL0A 4MVJG 1HYHA 1FXSA 1N1EA 4TVBA 2I3AA 1YO6A 5HS4A 3VZQA 1ZO8A 1Q7CA 3BTUA 4IJUA 1C1DA 5ICSA 4NU6A 1E77A 1NVGA 4XD2A 1BMDA 2PH5A 2D5AA 3BAZA 1GCUA 2DM6A 2P5UA 2QRKA 2Q4EA 2UUOA 1NAIA 5TGDA 5AXCA 3OA2A 2O3RA 3M6IA 1A27A 3K73O 4D3DA 1PX0A 3NDRA 3TZHA 4FFNA 3HN2A 2FR0A 3SXPA 4BNLA 3B1KA 3I4CA 1LC0A 2BMAA 3K8ZA 3UN1A 3PI7A 3EHEA 5COAA 4E5NA 3ZNPA 3ZWAA 4OOFA 1YBMA 5TNXA 4J7CA 2O4UX 4B7XA 3VC7A 3HG7A 4NU5A 5I9NA 5C7OO 5JO9A 3HSKA 1W8DA 1VJTA 2Q1TA 4JNKA 3E9NA 4XZ3A 1EVYA 1PJ4A 1WNTA 2NNLD 3VH3A 4QFCA 1XWFA 3I6QA 3JQ8B 1ZBQA 4Z3DA 1NASA 1C1XB 1QKIA 4QFDA 4BQPA 5KJFA 5G0SA 2FPIA 3KLPX 1VKOA 2J3KA 4EJ6A 1DAPA 2FSSA 3MJEA 4J2HA 3TJRA 1CERA 3AW9A 4XQGA 4BNKA 2Q1SA 4F6LA 5F1PA 1PR9A 4OKIA 3SX2A 3ZI0A 3FRJA 2PK3A 3HQ4O 1YBVA 1Y8QA 3DZGA 3Q11A 4EUFA 1DHRA 3IKTA 4GBJA 3MOIA 2X23A 1MFZA 4I1IA 5FWNA 5JPIA 2XOXA 2CF5A 1D3AA 3IS3A 1QYXA 4Z0TA 2CDCA 2X5OA 2WE7A 2HMVA 1MC5A 1E3EA 1WLYA 1V0JA 3JQAA 3V2GA 1TLTA 1YWGO 3LT0A 1XR3A 3S55A 5HTOA 4GMFA 4AJ1A 3DMTA 1N8KA 1OZAA 2C20A 2EG9A 5JE8A 4W99A 5IXYA 2HDHA 4DPMA 3I9LA 1WMBA 4WOJA 5IZ4A 1TI7A 2DUWA 9LDTA 2AXQA 4BGUA 4L4RA 1B2LA 2QX7A 3VZPA 3NTQA 4DRYA 1HL3A 4XYLA 3HWRA 5DBFA 3CMCO 1HSOA 4J90A 1Y7TA 4I08A 5L53A 4N7RA 1DIBA 1Y9EA 1DBVO 4NIMA 2R00C 3ZWVA 4M86A 1KEPA 3V2UA 1HDZA 2CVZA 4PZEA 3MOGA 4ZHSA 3ZHXA 1GZ6A 1JN0A 3W8EA 3I1JA 4NFHA 4WLVA 5COQA 4LSWA 3CTMA 1NQTA 4ZQBA 1HWYA 2AW5A 4HXYA 3Q3CA 2NSDA 5T5QA 2GZ2A 4PLZA 4R1NA 2YQ4A 3GNQA 3HB4X 4GKBA 4P4NA 3GAFA 1UAYA 1ZSYA 2P9EA 2UYYA 4GSKA 1KVRA 5JAZA 4GSLA 3LLSA 2RCYA 3M2PA 4IMPA 4ONEA 1PS9A 2Q46A 1HDYA 1RWBA 1VJ1A 1XU7A 3C85A 4ROSA 2VT2A 3L6OO 2YHIA 3ULKA 1E5LA 2YHIB 3OH8A 1BG6A 4WCFB 3RBVA 4Z0PA 2X9GA 1VKNA 1SB8A 4ND2A 2EXXA 3LT1A 4M89A 3I6IA 4WCFC 2UDPA 1P77A 3IDSA 3I9JA 4NG5A 1KVUA 1KY4A 4PCVA 3EVNA 3UCFA 3ZWNA 4RORA 2X4GA 2DQ4A 2NVUB 4S3MA 5TS3A 3KYDA 5L95A 4E6PA 3HDYA 5F1OA 1PGPA 5DNAA 5JNLA 2JFFA 1JVSA 3P2YA 4M54A 4XYBA 3MTJA 4PZCA 3V1TC 1NVMB 2C2YA 1O94A 3AI2A 5HBRA 3GLQA 2TMGA 4D45A 4FDAA 2ZYDA 4INAA 3WLEA 1HYGA 2H63A 4FGSA 3GGGA 3K31A 3RJ9A 3C7CB 3FWNA 1N1GA 2EP7A 4IDDA 3RUHA 2X9NA 1XGKA 2PKQO 1ZSVA 1EZ4A 2V6MA 4Y67A 2QZ9A 1I24A 4YRDA 1I3LA 1M76A 2V6FA 4R54A 4CR6A 4N5NA 1PGNA 2GLXA 2ZQZA 2CMDA 4MKZA 3U49A 4KUEA 2DTDA 4RVGA 1DJNA 2BFAA 4PG6A 3ITKA 3UICA 2I76A 1R15A 2X86A 4J49A 1T2DA 3WX0A 2CFCA 4BVAA 4CLOA 4BV8A 4L73A 3AM3A 1PS0A 4J9VA 3UW3A 4CMJA 4NK4A 3PWSA 1RM5A 1I01A 1M6WA 2WD7B 2I5PO 4YEDA 2C5EA 1EVZA 3OSUA 1GV0A 4Q3CA 3GZNA 3LK7A 1ORRA 3DWFA 4E33A 2CNBA 4Z9YA 1U4OA 3H9EO 4IINA 4BO7A 4PLVA 1PQUA 4WLEA 5L4SA 1WAMA 4EW6A 4RF4A 4K28A 1LLUA 4L4SA 4OYRA 1O95A 4HUJA 4NMHA 4RPHA 4ALMA 1UZLA 4BHTA 5CDUA 1LQTA 2NU9A 1V35A 2HAEA 1E0DA 1UH5A 2NLOA 1UXHA 2HMWA 1A4UA 5DT9A 1GZ4A 3WB9A 8ADHA 3WG9A 4BNGA 1B8UA 4DGSA 2JFHA 5TRTA 3WQSB 4XYEA 5DP2A 5T67A 3K30A 4R3NA 1S6YA 3KSZO 2AEMA 3FR8A 3O38A 4NZ9A 4Q3AA 4BNZA 4J1NA 5CDTA 3MJSA 5JMPA 3DO5A 2VRCA 3TOXA 1ULUA 4A5OA 2ZCUA 3DAFA 1SC6A 4B4OA 4F3YA 1ZKMA 3GZ4A 3IJRA 5FI5A 2EHDA 4B4UA 2UVDA 4PLYA 1R0LA 4RLSA 3ONDA 4XB1A 5ILGA 2IDZA 5A3VA 2FPGA 2UUPA 3DC2A 3GVPA 3UKOA 2QZZA 3G17A 3DHEA 5TT1A 4AL4A 4BV9A 3KRTA 3GVCA 3AM5A 1HDGO 3ZWWA 4YJDA 4MINA 3RROA 1XYGA 3LZ6A 1DIHA 4HADA 3RUDA 3KEQA 4OSOA 4Z6KA 4P4LA 2C7GA 4AJEA 4WLOA 2VZ8A 2ZJ0A 3RC7A 2DTEA 4UEKA 1GUFA 3JYPA 3O26A 5FF9A 5T6BA 2VHVA 5A04A 2JAPA 5BSGA 4BNJA 4NJMA 3F1KA 3GDOA 4AJKA 4R41A 2QG4A 2YY7A 1ZUD1 4GGPA 4YT2A 5EESA 4CMBA 4CMCA 1YL7A 3BHIA 3JTMA 1BW9B 5ENVA 4RVHA 3GQVA 2P4HX 4BO3A 1TVEA 4BO0A 4CMEA 3IC5A 2PD3A 5DULA 3CZRA 3G1UA 2AHRA 2OGUA 1QXSA 2JCXA 3IOYA 3VKUA 4LSMA 3DOOA 3WIEA 5I8WA 1DC6A 5IDWA 3S2GA 3WMXA 5AXDA 3JCZA 1TT7A 4CL8A 4J0FA 1XIVA 3JQBC 1GFSA 4ND3A 1PJBA 1A4IA 3JYQA 1ISHA 3CMMA
chains in the Genus database with same CATH superfamily
3GLUA 3VDRA 2ZTUA 1P2SA 2HHCA 3E8SA 4BZZA 3FSEA 3KKMA 5D1NA 4Y1RB 2E6UX 4XVQA 2R86A 1I2AA 1ICIA 2NU8B 1U8CB 1K66A 3W05A 5LQJA 3CONA 3G3EA 3O0DA 4E13A 1E6MA 1SC9A 4ZTZB 3CLKA 3T1OA 3HADA 5LQUA 4WKBA 1TUEA 3SU8A 4C1BA 1T26A 2O3UA 2Q5CA 4LY9A 4EA9A 4UD2A 3IUBA 2ZRKA 5BPFA 1CW2B 3C24A 2ET6A 4FUQA 1NBOA 2NVBA 4GH5A 4K9LA 4DSOA 4F9EA 4FQ5A 1M6HA 3BHJA 4NF2A 4EA8A 3A2MA 2NX2A 3UUEA 5JDCA 3RIEA 1MAWA 2J6BA 5LIRA 4GKVA 3W4JA 1VG8A 4MW2A 3L06A 5J4YA 1WCIB 3ANTA 4HQRA 3DEZA 3CRQA 1TVKB 2ZYTX 1L4MA 2OZLA 2WDPA 3NZEA 3AMVA 4MYRA 2IODA 1IRXA 1L7EA 2JBAA 2QE7A 2GETA 2J0QA 4AMZA 4BNDA 2KWIA 1LBTA 1J33A 1JS1X 3ZZTA 4UBIA 1H1TA 3M83A 1E8NA 3QKUA 4BGDA 2OY0A 1LK7A 2R7AA 2YHSA 4A2CA 4DMLA 4ZYUA 4ED9A 2Y0EA 1L9XA 4ZDJA 1PT6A 1RHMA 1ZAKA 1WXFA 1ZM3A 2CNDA 2QPOA 4FI3F 5EIFA 4JQSA 1EM6A 1UQUA 2G9ZA 2V4UA 4IOJA 3VV2A 1CDDA 2CNLA 4RS4A 2FWRA 3FYDA 1A8IA 3QVWA 2QY6A 1P6XA 2X8JB 1Q11A 2LXNA 1WD5A 2YWRA 2AJDA 1E6UA 1Z07A 1AUXA 2OOKA 1HXHA 4EF5A 1HX7A 2UYOA 4G81A 4EKIA 2PH3A 4DN6A 4ZO9A 4CIBA 3EGDB 3FRHA 3GLGB 2JFZA 2WWYA 1X7XB 2XUPA 1P2BA 4HWTA 5FAXA 2A33A 2MSWA 2WSYB 3TM5A 3TPFA 5LVAA 2QRUA 3A4TA 1OE0A 1A9QA 4B44A 4M0FA 4MYHA 3NS7A 1WXGA 3GR6A 3MWYW 1B14A 4AD8A 1ZZEA 3DTVB 3MM4A 1YKSA 1P0IA 2G1AA 5K51A 4KBFA 2Z4SA 3G82C 4F5WA 3KUXA 1Q17A 1H2WA 2XUGA 2B30A 4I4NA 3O5AA 4JX8A 3I2KA 2I9KA 3WR5A 3IP7A 1S0UA 3I04M 3K05A 3PR1A 5U4XA 1DO2A 1MVLA 1W96A 5J2UA 4FGJA 5IM4A 3AF1A 3F73A 5HF6A 1UDAA 1GTG1 2H4XA 2Q41A 2G9UA 2XXJA 3NIDB 4ID9A 4U7PB 4UOEA 4C6SA 5CM9C 4MDEA 3ZWXA 4UDXX 2OWEA 4QEKA 1N5IA 4B46A 5ARCA 4C0WA 4BMXA 3C3PA 4U7FA 5HRUA 3CVWA 4E30A 5CRIA 4XM0A 1HY3A 2BV3A 2OXFA 2O3QA 4GR9A 4LWOA 4F84A 5KWEA 3FOFC 1JKXA 2C5BA 2P65A 2MHCA 3L0YA 2P2SA 4KZPA 3WTCA 4BGVA 4C6TB 1Q7RA 1V95A 3LOQA 3N7AA 1SKYE 1GYQA 4EL0A 4KIWA 2OHXA 4CL3A 4YRKA 5HP4A 4XYGA 3DHVA 3EH2A 5E38A 4HDRA 4OA5A 3EG9A 2ZSHA 1E4OA 2CXPA 3IMKA 3HEBA 4MWSA 1N2IA 1S7GA 3AXTA 3RSSA 4U8HA 4UVHA 3TINA 2PMDA 3DCNA 2BAGA 3WIVA 4A73A 5DSTA 3OZBA 1ISRA 2BEKA 2C88A 4QPPA 1D2MA 1LSSA 4LECA 5K4AA 1J24A 4BLUA 3PL1A 4MQMA 2V7GA 3AR6A 3ZBUA 4CUJA 1RQGA 3FUTA 4QRHA 5J5AA 1WSDA 2H51A 4K9DA 1A7AA 1AKVA 4OK6A 4LJRA 2G25A 5AHOA 1XCLA 3ZYZA 1ZOSA 1FRFS 2V7PA 2ORVA 3N0XA 3JY6A 2RGAA 3LQRA 3NTRA 5GV8A 2WYOA 3ZE6A 5HX7A 1D8AA 3NHBA 4OM8A 4HC4A 5LFAA 2GD2A 5ALFA 3PFBA 2BFPA 2UXBB 4YR9A 4ZZIA 1YZNA 4QASA 2K6GA 3RS8A 1WZEA 4HP8A 4FMBB 3H0CA 2GXQA 2IEBA 1GARA 4I55F 1RJ9A 4I50F 2CEKA 4MKFA 2P9FA 4POAA 4OJNA 3BB4A 3RIHA 4EFNA 1AUVA 4EVQA 1DJQA 2BD0A 2VCEA 3MQFA 5FNZA 3S1LA 1Z6ZA 1U63A 5JQGF 1FX1A 2ZQ5A 1TGVA 4KQEA 4QHTA 3TAUA 3Q7EA 1JVBA 1V1RB 5KTYA 4A7PA 3D5EA 1E3JA 1PEKE 3RCBA 5JD6A 2DVMA 3SJUA 1Y7HA 3UOAB 1Y8ZA 1Q22A 3S5JA 2W6JD 4AJHA 4IHJB 4QQRA 5EJEA 1D1QA 4J4BA 2HK7A 1JXMA 2WVAA 1YL6A 3GD7A 3ZX5A 4QDJA 2QZJA 1YTLA 1R12A 1UBHS 1FOEB 2OO7A 4Q1CA 5I01A 3MTEA 1RJWA 3QEJA 4CR8A 2VF5X 4HNQA 3CE6A 3T7EA 1E2GA 3DTNA 1QLJA 1TVKA 1GV1A 1BGWA 2PLWA 2XHEA 1E4EA 3N8IA 3O1IC 1NW6A 1E63A 4FNMA 2D5BA 1UT6A 5JIBA 1U8XX 3WB1A 2HRQA 2VJDA 5LKRA 1CF2O 3WOHA 1D1SA 2O2HA 3JR3A 1M2FA 4B9AA 1SZCA 3A3YA 3FLBA 4O25A 1WMAA 4S05A 1TZMA 4JV5B 4J16C 3VH2A 3CU5A 4QOHA 2UXDB 2IHVA 4P80A 1E2EA 5AVWA 4XX0A 4Y2SA 3U7FB 3NV9A 2C5GA 5CEFA 1Z2NX 3GLVA 4XGIA 4Q19A 1ZIPA 2M32A 1TECE 2J3IA 4I5GA 3DHYA 1XAIA 4JH0A 5EP3A 5JAHA 1KMHA 5DHAA 3Q8WA 1BA2A 4Q7JB 2VYND 4ROTA 4G8CA 1BMFA 1CEQA 2YVKA 1N6KA 4CF5A 2NXWA 1KI7A 1YV9A 1T0HB 3SOZA 3KKQA 1E2NA 2BEVA 3IPCA 1ESMA 1R0CA 2WSSA 3GH3A 5A7FA 4D4HA 4JLUA 5KAPA 8ABPA 4DQKA 4ZO4A 1X7XA 4ZAFA 5FYQA 3AERA 2AW3A 2Y1KA 1DRWA 3CV3A 1GGMA 3DO8A 3HGMA 4RK7A 4B7ZA 5LMCA 4FFSA 1A8UA 2LDBA 5JECA 2G63A 1HE2A 3OCJA 4MKRA 3SEFA 3PCTA 2WK1A 4TRMA 2R62A 4TVKA 1T24A 1QBGA 1JI0A 2D2XA 3EXHC 4XGQA 1WHSA 2CWWA 1F4VA 2B34A 4ZAYA 3RNOA 2XDQA 3ZLUA 1C80A 2I7CA 4DNOA 2IPMA 4XGRA 1FVXA 3FAKA 4RV4A 2X0RA 4EUEA 3U40A 2IY8A 4WVFA 4ABTA 3FIUA 4OBEA 3DZKA 5F4ZA 4XB2A 4QBGB 2OQRA 3B13B 4BP3A 3R4VA 1Z13A 1S2IA 2JCBA 5DO9A 4C4XA 4URHA 2ZR9A 2I0FA 5TX7A 2EJCA 3LUJA 4WFJA 5FNVA 5B3LA 1PV2A 3H75A 4L75A 3NBYC 4K9RA 4PO1A 1KOLA 1PSWA 1R0XA 5H4GA 2OMEA 4GMHA 2CE7A 4OP1A 1FTYA 2HFJA 1B43A 4X6UA 4C0LA 3OHSX 1UP6A 3QX7A 1PW7A 2G5CA 3Q98A 2OBBA 3EIQA 3N2LA 5NULA 4F2PA 3KETA 1KS2A 3AL2A 2D0PB 4O2BF 5IPFA 2ZRJA 2HBQA 1AA9A 4K05A 5A05A 1PR2A 1JQEA 2DFNA 1NUSA 2XIQA 4AJ4A 3ZU4A 4HEQA 4PGMA 4AUNA 5ULLA 1MPTA 5JSZB 3PX2A 4QM7A 3N2YA 4NBLA 2GOYA 1BQEA 2GM9A 5B58C 2R7LA 3MT7A 1ATZA 1QYVA 3FE2A 4RETA 4YVFA 2H3HA 4GYKA 1AF7A 1HYBA 3R3JA 4L95C 4MTLA 1DZ3A 1Y1LA 2FLKA 2IBTA 3A1NA 3SC4A 4E31A 1VIAA 1QC5B 1WW3A 1YK1A 2V7QD 3ELDA 2OECA 2QF7A 3JWGA 5DMXA 5EPOA 5I9LA 3BHMA 1RJEA 3LYLA 4YPFA 1VLQA 2WYWA 4DIOA 1VMAA 3CR7A 1YE8A 3VPBA 2DHCA 5TXGA 2A14A 4IDCA 4NBSA 5BSHA 3CHYA 1SUCA 2JJ1A 4CM9A 5KYUB 1QIEA 3CBQA 4F4IA 2GNOA 3H5IA 4TWAA 1T2CA 4UBOA 5HTKA 2G0AA 3DBLA 4ZVQA 5C3UA 3M4ZA 4LY3A 3L7YA 3M6VA 5K4HA 4MYUA 2PMBA 3CEHA 4Z7OB 4BXOB 4OUDB 4DCTA 2C9OA 2XB8A 4UBNA 3P9NA 1BMTA 4JLWA 1Z75A 3O8NA 4MKGA 3RTBA 3SJAA 4A91A 4MB2A 4G24A 3PWTA 1DLJA 1FUYB 5IVKA 4XUCA 4OL9A 1OBCA 2ATXA 1KVSA 2XYHA 3LW8A 3OEED 4QC2A 3UQYS 2OHFA 4PVCA 2AE2A 5THKA 3KR0A 2VTBA 5BY2A 4GXTA 4HQOA 5F64A 1VYTA 4US0R 1JHVA 1VYVA 2D7DA 5ED4A 2FH5B 3I12A 3PC2A 1I9GA 1IWBB 2IXFA 5KAMA 1G3QA 3H3FA 2IXEA 2HMSA 3HFGA 3PC4A 1EXNA 1UMDB 4CMAA 2Q28A 2FQWA 2C07A 4BX3A 5JFOA 1QO0A 1Y6QA 2ID4A 2GXSA 3FHJA 3PQDA 5EQDA 2OR3A 3VM6A 3IO3A 3ESCA 1JEYB 2O2ZA 1AN9A 3B82A 3MF4A 3NW9A 4JUAA 4MUNA 4DLNA 4EGAA 1RXWA 3LC1O 4DCPA 1IM2A 4EB6A 5I6DA 2ATCA 1SKQA 4YREA 3AY3A 1EG2A 1TPZA 3EAFA 2C2MA 2QAGC 1F8YA 2ZSBA 3DCIA 3E8MA 2VL7A 3N07A 1EDDA 2JPDA 4LE1A 4JDPA 4QE3A 4HD8A 5DHRA 3X0DA 3ZV6A 3E58A 1DKMA 4PTYA 4NCNA 2GM4A 1QYWA 1Q91A 4PLWA 4CKBA 1BFUA 5IFLA 2LDXA 1NR7A 4NONA 5B3AA 5FWXA 1Z8NA 3GRCA 3WFJA 4BNNA 1OBOA 1DC5A 4FXPA 1ETHA 5DWVA 3VSCA 5KNBH 4Y2PA 2ZS9A 4OHXA 3CJQA 1ZQ1A 2AQHA 3JV7A 5HHTA 3VKWA 2Z6AA 3GI1A 3NRCA 1U28A 4LRQA 3MEQA 3JALB 4WXYB 1VXOA 3GROA 3ZR4B 5FPKA 1ZD4A 1VPLA 3WYNA 2EX0A 3LL7A 1DELA 3CLUC 4EFMA 4N5DA 5HQ3A 4NZMA 4HYYA 3QF4B 4LTDA 1V2GA 3N8KA 3QLVA 4OLJA 2H18A 4GUDA 2Q3LA 3MTDA 4YI3A 4IFTA 5EXTA 4MW5A 2IHYA 4H35A 1GTSA 2PUEA 1CUHA 1G16A 3U3JA 2ZRDA 4IMRA 3MJVA 4O4JF 4IMIB 1VHJA 3VPSA 3PG5A 4Q02A 3M6AA 4O3FA 5IAOA 3ABOB 3ICCA 2H0QA 3QIAA 1TIPA 4WV3A 4BU1A 3RG2A 3M3PA 2AEJA 3RSHA 1JV2B 2ZXFA 3L7BA 3O90A 3Q1LA 3QWBA 1C9NA 2QXTA 4G5SA 4A0FA 5IC4A 2O0HA 1ISPA 3M1LA 4GECA 4KG7A 4PZUA 4EY7A 2ZVPX 4OQYA 4Q3BA 3WL4A 5CYGA 1JX6A 3L7OA 5BSWA 3BEDA 4BFVA 3PTLA 3A6KA 1K2VN 3U9SA 1E1LA 1WX1A 2VDUE 3IUPA 3QI2A 4TLBA 5KKAA 1UWCA 3WLLA 5A4MS 4TUYF 2XKKA 4DHWA 5EQTA 2BEUA 3QBEA 3CG0A 3CZ5A 3ANXA 2Q5IA 2ZIWB 1L5GB 3LCCA 1X6VA 5LDGA 5ARBA 3TKYA 1Y7LA 2X76A 3MJDA 5I7AA 4ZJUA 3OWXA 4B6SA 5JASA 3I8SA 2PX5A 3UPTA 1B8OA 1VHLA 2P8JA 2RHWA 2RGXA 3GT4A 2BGWA 4B2YA 2UU9B 4HGRA 2H3EA 5AM0A 4GR4A 2NZYA 2YYZA 5GVRA 5HIAA 1JPUA 4DIBA 1IN8A 2BONA 2OAGA 4OSEA 3U4AA 2QR5A 3NTUA 2ZVQX 2FMKA 1JR3A 2YXBA 2PJUA 5DNCA 1HZJA 2FDRA 3HCOA 3IELA 5IJ0A 2OVBA 1GGNA 4OHYA 2O6HA 2XDQB 3SFZA 4L5YA 3PQ4A 4TTJA 4P3NA 2OOSA 3W4KA 1F20A 2ZUEA 2IP2A 3WDKA 1O97C 2EJTA 2B69A 1ZITA 2RHCA 4NMXB 1YR7A 4ENWA 3ZD8A 3RHFA 2CZGA 2A9PA 2GD1O 3FDIA 4J1SA 3GLTA 2LCIA 3DMGA 5CBKA 4ESVA 1B2RA 2OK7A 3QRWA 4G65A 3FZGA 4G4JA 4MLDA 1JNYA 1MVOA 5G0VA 3UXMA 2XV1A 4FHEA 1I7LA 4JVSB 2ZYIA 4IIJA 4A1FA 5DNUA 3HUDA 2JK0A 4DCCA 3H11B 1C30B 4LQ4A 4URWR 1FTWA 2Q27A 5HDQA 1O6ZA 1QGYA 3E3AA 3L7CA 3SIRA 2W2KB 3BD7A 4D3FA 5LLDA 4DV5B 3FMVA 1BKYA 4EM6A 4P6VF 5IWAB 1W36C 2PVPA 4H77A 5T3YA 1RHKA 4WKNA 1V39A 4YROA 1T6XA 1GSOA 3LLCA 3VDMA 4LBVA 3AIIA 3R9XA 4N3CA 3P0IA 3IUMA 4N6NA 2CK3A 3EXG1 3NJ8A 3HU3A 3D5QA 1H9BA 1ZMBA 1PZMA 1O4WA 4RL4A 2I4RA 5G1NA 3W3AH 4UMVA 3KLMX 2GN6A 5G4LA 2X7JA 3U7QA 1I3KA 2I34A 1SXIA 3RRBA 2C82A 4EO9A 5F23A 1D6MA 1XRJA 2QK4A 4CM7A 3NC1C 1X7YA 1IUKA 2WLTA 3SYMA 1QHGA 1L5OA 3C3XA 3NKFA 4RGYA 3M9XA 5AXAA 4Y2YA 2ZJBA 3R24A 2Q3CA 2PQ2A 1ZU5A 1M2HA 2PS9A 1AUOA 3RGGA 3WNQA 1J21A 4YAUA 4D2IA 1JDUA 2Q8PA 2WJ3A 3BWBA 3HVUA 1T5TA 1BS9A 2VJMA 3WYBA 4ABYA 2W2OA 4RVOA 3TF5A 4JNCA 3E3MA 1S2MA 1B76A 2LD4A 1DKQA 2J07A 3O8LA 3UK0A 4DB2A 3ZU5A 3W9UA 1Z5UA 4ZT2A 3IXMA 4NWIA 2Z9BA 5EXDA 3AHFA 2Y1LA 3DT8A 1XCPA 1PJAA 1JHRA 4S1VA 3FLEA 4TL9A 4JT9A 4J6FA 3Q1KA 1LPAB 2B25A 2QDKA 5E3JA 1Q1AA 4BKQA 3SXUA 3NANA 5HXAA 4HRAA 3WL5A 4WECA 1PK9A 2XCQA 3KYIB 1JXAA 4H7HA 3D7KA 4NV3A 2I78A 5EZYA 2B4TO 4B85A 3EGDA 2PZLA 4D92A 2YCLA 3HKCB 2VJYA 1K6EA 2WFLB 1V5EA 3AYZB 4H4EA 1QFMA 1FMLA 2VC2B 4E5SA 4MWGA 4BP1A 5CBPB 2F1IA 2EFHB 5K0JA 4BN5A 2TSYB 5JQGB 4MA4A 2OQIA 4NI5A 1NI4A 2OESA 3E82A 3R7FA 3WGLA 3IP3A 5D3MB 4R8KA 4ND5A 2XTNA 2JRCA 1YJ8A 1GY8A 1BA3A 4ZI5A 5BUCA 4J29A 1P8JA 4YUWA 1IQUA 5EFOA 1GUBA 3VOSA 3QV2A 1YH3A 2DBYA 1GL9B 3GF4A 1H0KA 4P4GA 1D0VA 4BLSA 4C01A 3HXQA 3TKAA 1PLJA 1P6QA 3DAOA 3TSCA 4EPXA 3JQGA 2G17A 4Z99A 1NONA 1N2ZA 3I9FA 3JWPA 4ECEA 2VS1A 4RQBA 2PNJA 3DMDA 1UJCA 2PQMA 1OXTA 2ZSKA 5DYTA 1GL3A 1ZD8A 2ONKA 1RCTE 3G6WA 1F2DA 3ID6C 3FLAA 1LD3A 2Q9UA 1V71A 1JP7A 1EJBA 1A50B 2PSSA 2RHHA 2Z0MA 3G79A 4D0NA 4D8VA 1DI0A 1UANA 3U7GA 5F73A 3RJZA 4WXMA 4CQMB 5TMDA 2ZREA 4I1RA 1A72A 4M1QA 4Q48A 4E12A 3LX8A 2W6CX 1PVVA 2WILA 4B43A 2CHVA 3DV0A 2O14A 3TOCA 3F5MA 4UOZA 4CM1A 3HYLA 4DA6A 1V3VA 1C8LA 3HR8A 5IF9A 5EWLB 3NXSA 4EDFA 5CGZA 1ZK4A 4EMSA 1RXEA 1QS0B 2QN8A 3S2YA 3IPLA 2AR7A 3H2HA 4B40A 3GP8A 4WCDA 3H2BA 3CF2A 4ZAXA 3M70A 4E2FA 4J7XA 1USVA 1X7HA 4LSZA 2XE7A 2BFCA 3FIJA 3NHKA 1Y9ZA 3COWA 3KJZA 3KLNA 4R1PA 5IMBA 3DQQA 2OHVA 2SNIE 5FO1A 1JGTA 1RADA 1SXJB 2VDPB 2RI6A 1J20A 4TZKA 4Z9AA 5TMEA 2HA4A 3W5VA 3OCZA 2J3QA 2OB2A 4JEIA 4NU8X 3T9EA 4R1SA 1THZA 2OXRA 1MVNA 4RZ2A 3UM9A 3QLTA 3VYRB 1TZJA 3GUUA 3DGFC 5IK2D 2ZM5A 2JIRA 2I65A 1E59A 3DTYA 5ERGB 1OHHA 2XE6A 1G0NA 3OE1A 3I5XA 1UK6A 1WLSA 3A3NA 1LPSA 1HMPA 4RMHA 2NQ8A 4N54A 5F51A 2BFFB 3RKRA 2X5XA 1KXJA 4X7MA 5B4VA 2IUTA 4GXRA 2CKMA 5C7YA 1LJUA 4O2BA 3OF5A 1CS0B 4MITA 1URPA 4LFBB 1SCQA 5C46F 4XASA 3TL3A 4E08A 4TPKA 4HR7A 5JYDA 3FDJA 1BWRA 3L4JA 5AVQA 3CUUA 2A30A 2JLRA 4FOTA 4QOSA 4ZRDA 1WDLA 4R8LA 1LLCA 5JAPA 1PD1A 2PUVA 4BWFB 1PWHA 4UNPA 4Q9LA 1NLFA 1PR3A 2BMEA 4YP6A 3FNFA 5BSFA 1GQYA 1OA1A 3CX4A 2GXUA 2HSJA 3QE4A 1DAMA 2BEWB 4BP9A 4XR9A 4C05A 4D0RA 4E2ZA 1II8A 3RPEA 4GKJB 3T1YB 2W83A 3V8VA 3MWJA 1ODFA 1WM1A 4TYYA 1AKWA 1QGUB 2H8GA 1XDSA 2YIVX 4DZTA 1T9GR 2NACA 2QHXA 1YB2A 1V7CA 2YWJA 2ZBPA 2HF9A 2R79A 5K5EA 1Z25A 3FHTA 4HFJA 1MOSA 1TAHA 1AO0A 4Z9XA 3W3AA 5B2ZA 1IY1A 3EGIA 1KZ7B 1CUAA 3IURA 2EFDB 3ZOKA 4AYTA 2POCA 1C14A 3PV0A 4XI9A 3ZWQA 1WR8A 5JSQA 5TJHA 1TKBA 4HTAA 2Y1WA 4EWLA 2PV0A 3AVXA 3AEZA 3UWSA 1F7UA 4JUCA 4LHYA 5BUQA 1FCJA 2GVZC 2Z5GA 4GAEA 3OQ1A 5FA5A 3RHSA 4C21A 6REQB 2GJSA 1Z0ZA 3HC7A 4QU5A 2II6A 4NCIA 1FEZA 1XTIA 4DS3A 1V8FA 1MTOA 2GT1A 4U2CA 5F3RA 3S28A 4F0JA 4PG5A 4KBGA 1FXUA 2R8PA 1ZC4A 3S2EA 2WMOB 3KJHA 4DTCA 1QH1A 2VXCA 1AQYA 1SRRA 1CS0A 5K7SA 2BWJA 4D0LB 5EJIA 3UJ9A 1W5FA 4PGFA 4V3CA 1L1FA 2Q49A 5K0BA 1NYTA 3OKPA 4LBWA 3W4IA 4ZFNA 2V59A 2Y99A 3AHEA 1FDVA 3ZK8A 1YONA 5KYYB 1JT2A 3GB9A 2O0MA 2SCUA 4XDHA 4DANA 3K0EA 1VG0B 5T8KA 2WYIA 1CEYA 5TQJA 3LKBA 1I3MA 2HRRA 4PIMA 4EG7A 1SXQA 2IOQA 3O4JA 2O0LA 1B74A 5GM1A 2CXUA 2AI2A 2FJPA 2BI4A 1GNVA 2GHIA 3GCDA 2REQA 3GFTA 5CNIA 5IAEA 3UWKA 3IAAA 4XJSA 4TRJA 3SQMA 2O2EA 5JRDS 4PLTA 4MV7A 4RHFA 4PCUA 2OZPA 1R5OA 4NICA 5AKJA 3IQZA 3SZOA 3U31A 1S8AA 3VYWA 3KC2A 1U8YA 3IAM6 3M9LA 4JHLA 4DV0B 5LU8A 3AETA 1XTVA 2X22A 2Z8YM 4Q39A 4YAFA 3RRMA 3TQSA 3EPPA 3ROPA 3OLCX 3X2SA 2QXYA 4DMFA 1P18A 1O4VA 1LTHR 3NR2A 1VSQA 1XC7A 4CM3A 4YAOA 3SM9A 2JIQA 4KFRA 4MUFA 1USIA 4YP7A 4WXRA 2AD1A 1E1MA 1OD6A 1W48A 5EVCA 3JX9A 2WYHA 5JCOC 3D43A 4YCJA 3NB0A 2FW8A 2JFYA 3ICWA 2ZBUA 4BX8A 2XCOA 1BHSA 1E7MA 3GEMA 2NGRA 4IDPA 3B1WA 1PSDA 4JCOA 2JDIA 5HWSA 2M1XA 1KKMA 2VJLA 1C50A 2WJAA 3O9VA 5LD2C 5DTRA 3ZQUA 1KE2A 4LWQA 1H69A 2ZBQA 3I4LA 4TL7A 3WIDA 1P5ZB 1XMJA 3VUEA 2W0MA 3O1HB 1HE3A 1LLQA 1D2GA 1O08A 1YC2A 5I3ZA 1YJCA 2EP5A 3MUFA 2C5SA 3OLVA 3OO1A 4KZKA 2EJBA 4GX0A 2EIHA 4BWYA 5LN1A 5FV4A 3W5HA 3DH0A 4ITUA 4QREA 3K4QA 1XDZA 2QAIA 1EEXB 2ZSUA 1Q21A 1OLSA 1Z16A 2G8NA 4L3WA 4C0HA 2MR5A 4GOOD 2Q6VA 1SUIA 5F52A 3SR3A 2G5PA 5KC9A 5TLSA 1GPWB 1HA3A 4FZ5A 4H0FA 4LMRA 5GPBA 2V96A 4XTRA 3RRXA 5TIIA 3KQHA 4Y2QA 1A88A 1NBEA 1Y81A 3IMCA 3KEOA 4C04A 5I4CA 2ARKA 2I80A 4MTCA 3O47A 1N9ZA 1V1MA 3BGIA 4O4HF 1QR6A 3T34A 1T2AA 3L41A 5T4FA 3JATA 1HFKA 1R6DA 3LLUA 4Y6OA 1UBUS 1H2BA 2ZYGA 3VTFA 2AJTA 4RH1A 2IZ0A 3GRVA 1IHYA 3RANA 1QG6A 1Y3DE 2EKBA 1AKMA 5BSEA 2NUTB 4MVJF 4PW0A 1AXGA 3GZTB 5AM2A 3NI2A 3ZTYA 1OJ7A 3CWZA 3P52A 4DCUA 3AWDA 4GPZA 3E5MA 4NFSA 1EUCB 1Z6TA 4N5LA 2RK3A 3B12A 3MCVA 2R84A 3TCKA 1GNPA 3QPCA 1THGA 3V4RA 2QBYB 4HAOA 1QOZA 3MBKA 2R6DA 2B98A 2FZEA 5IUNC 3B51X 4JMLA 2A9OA 3DKPA 1NVWQ 1RQ7A 1QNLA 1MR3F 3QKSA 1E1RA 4P93A 1SBYA 2C7VA 3JD0A 1J97A 1HGXA 3TB4A 2BHLA 3T5DA 4MPDA 3PI6A 4JT8A 2QRNA 1R8XA 2D74A 4GG1A 2FR8C 4GM0A 4TLLB 2CV1A 4RZXA 2QV0A 5BN4A 3DLPX 3VPXA 1BYUA 1NI3A 2WM2A 3DTVD 3KJQA 2BKXA 5HK8A 1GVNB 2Y1GA 3QPWA 5IJAA 5TB5A 1QK3A 1J2EA 3EGWA 3P9RA 3VR6H 2YWDA 3C3MA 3GK3A 3KKNA 4R5HA 3GARA 5DASA 4ZT3A 2HW8A 4WK4B 1SWVA 3EZ6A 1HDOA 1VLZA 1A4XA 4A26A 4S1PA 1GUYA 1K7FB 1KJNA 4QOEA 2AFIA 5K6TA 4R3WA 5IH7A 1AZSC 1G2OA 3DWGA 3M0EA 4IXTA 4JJ7A 4LYYA 2I62A 1HT3A 2ZR7A 1N57A 3CKYA 2QSZA 3IT2A 3PQ7A 4YCSA 2Y1CA 2YNMA 3MJ4A 1BE1A 1TFRA 4ARAA 4HAUA 3T7DA 2F3SA 2JJ2D 4K87A 2PZAA 4JEHA 4WMLA 4ZP1A 1L5NA 1N8NA 1R4MB 1EP1B 1RAEA 2AFRA 2IU3A 2WOJA 3BJZA 3BTOA 3N2KA 1JE0A 1P7ZA 3IVXA 5ALMA 3T9CA 5KJCA 4P5PA 1RI4A 3CVOA 3K2IA 4KLZA 4M7OA 4G6ZA 1LDGA 4GOJA 3CNNA 4OGLA 3LF2A 1NLMA 2O2CA 3P20A 1ICEA 4O4JB 2V55B 1PJLA 1EWVA 3I2YX 3AR3A 4DCJA 2OUIA 4B5KA 5K8IA 4IDOA 3F8SA 1NT2A 5L3SB 4G1EB 1WKVA 1YZQA 3DKKA 3CIOA 3SHQA 4BJ1A 4XSHA 1F3OA 1HLPA 1TX4B 2BI7A 4HDMB 1AC5A 1BN7A 2GH1A 3OKFA 3A37A 5DIZA 2Y76A 1H42A 3ZH2A 3B2EA 4LNHA 3FWKA 5HUQA 3GEDA 3M6LA 2GM3A 1ZA1A 3G2OA 4UFPA 4DQVA 4G1UC 1S4QA 4DC1A 1SXGA 2P3OA 5GJVC 3AF3A 3UB2A 3F8WA 1SBIA 4ACAA 3I64A 5K6AC 4QD3A 2JK1A 3EDRA 4MB0A 4BWVA 3ONVA 1OH6A 4CJXA 5JT1A 2LIVA 3L6DA 2W4QA 3GNSA 1K27A 1C3EA 1M6NA 4KACA 4LG1A 2M6LA 5I7WA 3RU9A 1DBWA 4LHSA 4CN9A 3TLCA 1XZKA 2C0CA 4Q4HA 1KAGA 2BC9A 1I2MA 2I66A 3O95A 1IMJA 2GB4A 3ANNA 3NHYA 3DOEA 1Z2DA 2G6BA 4B0OA 4NBUA 1NY5A 4G26A 3UOGA 4DV3B 1UBMS 1W2WB 4B76A 2O2DA 3UUFA 4L4UA 1CF9A 1NM5A 1AXEA 3BZWA 2FEWB 1KFCB 3OX2A 2Y1FA 1G20A 1RKVA 2ZGVA 3DBHA 4W8GA 1G19A 2XITA 4AMGA 2JH3A 2ZUBA 4M7PA 4BBZA 1YA6A 1VJ0A 1O5OA 1NZDA 1R5BA 1GR1A 4MUGA 4WEQA 1CJKC 4HB4A 5JOQA 1KGDA 1ULZA 2QMEA 3I2IA 1OZ0A 2ZJYA 4L7VA 4P4UA 4P81A 4QGAA 3TLJA 2B3TA 2GSDA 3IESA 1C41A 1GAQA 2Z58A 2GVNA 2HO5A 4FS8A 5JSKA 3SQDA 1UPCA 3ORYA 2YJZA 3EQ6A 5F5XA 3SZ3A 3SJ7A 2R1UA 2J7PA 3NXKA 2NPFA 4DXDA 3F6SA 4Q9IA 5I51A 4FQ7A 4KV7A 3WQBA 1IQPA 1WO8A 1VPVA 4BNTA 4L9RA 4V39A 1Q5PA 4EG6A 2W11A 3E8XA 4PNHA 4JVMA 2BHSA 3ZGVA 1G59A 1D07A 4TYWA 4QDUA 1Y8CA 3DE5X 2V6BA 1G2PA 1U9JA 4P3OA 5H02A 3FWZA 3R41A 1DB3A 1GCAA 2ZBFA 1Y4UA 1F8GA 1IIBA 3NV7A 3LQ4A 4P4TA 5C8XA 3A9SA 4Z2YA 2R0QC 3PXDA 1XI2A 1M75A 5IJ9A 3C1TA 1H94A 1ZIOA 2YFHA 1Q74A 4W6QA 5DJ5A 2IPLA 4GRIA 4Y9RA 2JF0A 2QTFA 2H5IA 1U9IC 3C70A 1YDEA 1LXCA 4X85A 2JLSA 1TUBB 3FY4A 4MCIA 7MHTA 2ZAMA 1D2CA 2ZE6A 4GE3A 4CQNA 1EJ6A 2VPIA 2JVJA 2C4TA 4W5RA 4P4SB 5E9AA 3REOA 2EW2A 5CTAA 1I6WA 1JMVA 1P31A 1U7ZA 3EDCA 1QOQB 1PWYE 4KE8A 4WESB 2EX1A 4WNAA 3RBAA 3K1YA 2C77A 4DSAA 3ETGA 4LZNA 4B3TB 3A14A 3PNPA 3ZCPA 5JQWA 1DEHA 1V26A 4HX5A 4LDPA 1FVHA 1JT9A 4OF4A 5GIPE 1C4OA 3BVPA 2HSDA 3JWJA 4RJIA 1FFXA 5J43A 2GFHA 4D8YA 2OHIA 2VUIB 4JU8A 1KH2A 5ELLA 2JGNA 2Q21A 1U3UA 2QRHA 4ARCA 1EIWA 2H00A 2NSJA 1VSUA 5EG5A 3OT4A 4MVJA 1RWVA 2OLJA 2PMEA 3EEYA 3UFXB 2AJCA 4DAOA 3KYCB 1I4EB 3GAAA 4I3GA 3ZE7A 1JWLA 1QRUA 3OUZA 5JDCC 1DV2A 1EYZA 1CKEA 3D4LA 4H16A 4FNOA 4Y6RA 5ALQA 2H1SA 2O54A 1XRRA 1IONA 1C4KA 1S02A 3USZA 1V45E 2Y6UA 3HRKA 1NP6A 2VPYA 3HYSA 4A8JA 1KOGA 4A8HA 3LYUA 3W79A 3NYIA 1MX5A 3R3YA 1ZPDA 4GF5A 2X77A 3LFUA 3DVLA 3NORA 5EINA 3K8OE 2B3DA 4RLHA 5CDYA 1V8BA 2F3TA 3KPWA 2AJ8A 2ZB3A 4AMUA 2QM3A 2CVHA 3MW8A 1OTYA 1R27A 1V3QE 2W4MA 1J7KA 2R1ZA 4EYOA 2BEVB 3KQKA 3R8FA 1OW3B 1E18A 1SK8A 3HA5A 2VH5R 2L69A 4S1WA 1PG5A 3CX8A 2ROQA 3EY4A 1CP3A 1L2TA 3KSRA 5HM8A 1K8XB 1G0OA 2DJIA 3I9OA 5HUHA 5J2TA 2BPOA 1OLUB 2WWRA 3KCQA 2P67A 1IULA 4L22A 2WYUA 1IOZA 2O48X 4TLEA 3W9YA 2PIDA 5CEEA 2B5VA 3QMVA 1X70A 4HNTA 5FUBA 1GADO 4UBMA 4FIDA 3KZCA 3PGMA 2AS0A 2CW5A 2ZI4A 4H3KB 4B7CA 4JWKA 2FSUA 2P9HA 1CUBA 2WTXA 4O0LA 3SC6A 1N6LA 3ANYB 4L5JA 3BL8A 4EK9A 4II3A 4UTOA 1T3LA 4C0AC 4F4CA 2HDOA 3QOYA 3U1VA 1LPNA 1B42A 3UQZA 4CMIB 1QGZA 2J7KA 4PRZA 3SJZA 4NPCA 1T3ZA 2B8EA 4BEWA 4ZJPA 1L7QA 3WLQA 4LNUB 3BERA 1CV2A 3QJ5A 4RMJA 5BUZA 1O95C 2A94A 4AJIA 3ND7A 3C8MA 1CQWA 3UKDA 1G5HA 2RI0A 5GOZA 3ICPA 3R1IA 2WWXA 4D5EA 1RCFA 4FSXA 4F2DA 3ZX4A 3OOWA 5HR5A 3UCEA 3JQAB 1RD4A 3F7MA 4GIBA 2O8FB 1G20B 1GEEA 1DV1A 2PZGA 2XMSA 4JGIA 1BWSA 3JZMA 3Q3EA 3RBZA 2GD6A 2H2IA 5ERYA 4IVRA 3GT3A 3VJKA 3GJ7A 5HZMA 2W7TA 1C0IA 3H16A 1E3SA 2W2KA 5IJZA 1PAUA 3UMFA 2A78A 2HNBA 4JYBA 4YMWA 3CZ9A 2DH5A 2BGMA 3EW7A 5KQRA 1LH0A 4RF2A 1U2ZA 5CA1A 4UVDA 3GEHA 1GSAA 1U7DA 3WO0A 2APJA 2OZEA 4CGYA 3MAAC 3WLSA 4WN9B 1M7GA 1DMSA 4RDXA 2OA0A 5EZSA 5M34A 1A2QA 1ARZA 3H5WA 3CFYA 1MAVA 1JSRA 1QQTA 1D9ZA 2C3UA 3E7WA 3QNWA 1QZUA 2X6QA 4FDUA 5CPBA 5ALXA 5DBEX 2C42A 2RBKA 2XNHA 2BP7A 2LTAA 4YT4A 1SPBS 1N36B 2ZVDA 3KSBC 1SCKA 4JLVA 4RENA 5EOVA 2KX7A 2R6R1 3Q41A 1JHPA 1S2NA 1T8PA 4EPWA 3EF0A 2PZEA 3L07A 3SKXA 4ZYWA 1GYRA 2GBLA 4P08A 4BO4A 1QKKA 1W87A 1GLNA 1YZVA 5D85A 3ASVA 4R4JA 4MJXA 5CFMA 4H7JA 5I9BA 3H5OA 2GJ4A 4MYSA 5J2UF 2XADA 4I5IA 1RC0A 3SEAA 1DG3A 2HDNB 1HZZA 3SZLA 2HV8A 4MV1A 4QXMA 1DT5A 3L4BC 2NAFA 1KSJA 3BB1A 1B6RA 1R9NA 4BAUA 3B3FA 1YI0A 5D3KA 3TCNA 3SNHA 3H4TA 3SQXA 4RA6A 2D3WA 3U81A 2AFIB 2JGDA 2EX4A 3F5FA 4P0PB 4V1CB 3DNFA 1TO1E 1FYDA 1HBJA 7AT1A 2D8MA 4LUCA 4JR2A 4EI9A 3HO1A 1MO5A 4DUZB 3F6YA 3H4VA 3IJEB 1R2QA 4L8WB 5ALGA 3TEMA 1EUZA 1HLGA 4IJQA 5EHGA 1FFBA 5CX4A 3PXEA 1QGED 3X43A 3H6GA 2FZ5A 3H2JA 3BILA 4PRYA 4M2LA 3IE2A 1SUEA 1YZTA 3CYFA 2IUUA 5D7NA 1NJFA 4PN7A 4YMHA 1CFZA 1ULHA 3GLHA 3WTBA 3QF7A 2QQEA 4A0HA 3T38A 1RPTA 5L7TA 4J4TA 1LC3A 1QVWA 2JATA 3QE3A 2N47A 2QD4A 2FPSA 1PWEA 5JC8A 4I4TA 3OPNA 3A1DA 2BFNA 1N92A 6ADHA 2AKEA 1A3CA 2QUZA 2H2DA 1V16A 4KQJA 4BO8A 7GPBA 5KOJA 5CCXA 2XWSA 4BNYA 1E6EA 4Y2TA 4PFJA 5EE5B 1CEEA 1E4VA 2V8OA 3GJXC 5H7XA 1L4GA 4FMCF 3VU9B 4A27A 4AJ2A 1KAMA 2ZDGA 1I4WA 3N5KA 4NK5A 4UHFA 1F2UB 3FZQA 1F6DA 1JU3A 3A1VA 1NZJA 4R9NA 1NVVR 1SQ0A 1XEFA 3R3VA 3INRA 5C5EA 2CXOA 4X90A 2BM1A 1N5RA 5C1DA 4EX7A 3QVXA 10MHA 4ZCLA 5GONF 5CFOA 5KDDA 2G67A 4GMGA 1QHHB 1PE0A 1IVNA 2HV9A 2QYOA 3Q15C 3U56A 5FQNA 4JXXA 4FLMA 1CY0A 5KNDA 5K2MA 1RYEA 4CYMA 4D44A 1LRLA 1LI7A 2F43A 3AGQA 3GDGA 2GR9A 4AO8A 3WK6A 4I8DA 4N8SA 2C29D 1E3WB 4DMMA 3QKWA 5IKMA 1DKOA 2DSNA 2IIPA 2QYSA 3SYKA 4DSTA 9GPBA 1Z0SA 4OXIA 2WZCA 2FZCA 1ULBA 2HZ7A 3HJBA 3P4UA 5ELXA 4V2UA 3GDFA 4BNDB 4PYLA 3UAGA 3PQ2A 2VDOB 3GLSA 4XOUA 4JI1B 3UGKA 2LW7A 4E2YA 4LI0A 3RLIA 1FQWA 4LAFA 3R6DA 1Z36A 3ABZA 1OIWA 3N1UA 3PF9A 3A6JA 5JWRA 2PT7A 3LWBA 1T34A 2AEEA 1GU1A 3DP7A 4LEIA 5SYAA 2O8DB 1GDTA 1ZRSA 3OMLA 4X64B 4ZO7A 1A71A 3BK2A 1TQ8A 3TIGA 3CKKA 3UAVA 2P69A 1XF1A 3NT2A 1M2OA