3JQ8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine (dx3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
247
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFARQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Pteridine reductase 1
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 95
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq8A00
1ZK2A 2BGMA 4JJFA 3TOXA 1A9YA 2CSUA 1J5PA 3I9MA 3WGIA 1KVQA 1WDLA 3AU8A 3ZU5A 3PI7A 3KV3O 4DLLA 4CLRB 1ADGA 1VSVA 3WQQA 1B8VA 4F6CA 2G5CA 4YRBA 3ZI0A 3HB4X 4MVJF 3WGYA 3Q9UA 1XYGA 1VL8A 2ZYDA 4BNLA 3EGOA 1VI2A 1GQYA 4CMGA 1LX6A 3W4JA 1ADCA 1BW9A 2ZKLA 3V1UA 2VWGA 3WLEA 3W4IA 2R6JA 3PHHA 3G1UA 2CUKA 4UEJA 3DQPA 4CMJA 2AQIA 3LT1A 1B3RA 1SPXA 3UHAA 3E03A 2AW5A 3ETEA 3I83A 3JQFA 2PH5A 1GADO 1QRRA 4IGEA 4OYRA 1O94A 5DF1A 1BXGA 2X58A 4CR6A 3TL2A 1XELA 1I10A 4MP3A 3MCVA 4CM3A 3WBBA 1HEUA 2QYSA 3DC2A 4R51A 1IPEA 2IYPA 2D59A 3CKYA 3VPFA 2AEMA 3RC7A 3BZUA 4BKRA 5TS3A 2VCYA 3COSA 1EVYA 1NYTA 1NQOA 3D4OA 5G0TA 4CM1A 2EJWA 5L7WA 1HE5A 2OBNA 4J4HA 3VH3A 3F5SA 4AJNA 2B4TO 4JBGA 3IMFA 2C5EA 2ZB4A 1X0XA 4MOWA 3IQDB 3H2ZA 5JCJA 3DFUA 4MP6A 4FFMA 2X5KO 1PJ3A 4QO8A 2NSDA 1MLDA 1R15A 2HKIA 2JL1A 1RM0A 4G81A 4ZQEA 4BNXA 2GDZA 4PLGA 3VPXA 1Y5MA 4DBZA 4GKBA 4D43A 4R9RA 4RLHA 2QW8A 3RROA 2PV7A 4CV1A 2GN6A 4CMEC 3RJ9A 2D5AA 4GSKA 1P33A 1YOVA 5TQVA 1XDWA 1DC5A 2V6FA 2IXBA 2HMWA 2Y1EA 3ROMA 1RYEA 4RVHA 2X9GA 4ALLA 3TDKA 1NPYA 1ZMOA 5HWSA 3ROPA 2HJSA 4XGKA 2PKQP 4CMAA 1EVIA 1LRJA 4XYBA 1SAYA 2FY8A 4CV3A 1NFFA 1UXHA 5F1OA 4CV0A 1ENPA 1KY5A 4DIFA 3RC2A 3PHIA 2DFVA 1TLTA 2B5WA 3ZN2A 4AJEA 5JO0A 1S7CA 3PLNA 4YEDA 3LF1A 2FN7A 5K0ZA 3NDIA 1HZZA 2WD8A 2UYYA 4WOKA 3PTZA 2P91A 4HX5A 1ZK0A 3BMQB 3KETA 3KLMX 3BTUA 5JDCC 3PIIA 4E5NA 1I2ZA 1LQTA 4LRSB 1Y8RB 4CM7A 1NR1A 4L8VA 1M66A 5A3VA 1A71A 3QVOA 5CPBA 4NJOA 4XD2A 1BXZA 5B1YA 3INRA 5EN4A 5C7IO 4W6ZA 2EP7A 1LDYA 3SJ7A 4NJMA 2PZLA 3PDJA 4IQ0A 8ADHA 3DBLA 3WGQA 5KJFA 1XQ6A 2AXQA 3DAFA 4FJ1A 5JE8A 4J2HA 4HP8A 3GVHA 1I5RA 4G65A 3EUWA 3ASUA 1WLYA 3DZBA 4CQMD 3CIFA 3L9WA 3EHEA 4MIYA 4ND2A 1YGYA 2FWMX 2GD1O 1GUFA 4YAKA 3IP3A 5I7FA 1MX3A 3OQ6A 4NFHA 3C24A 3I9LA 1UZLA 1B8UA 1DEHA 4ZRMA 2NADA 4AG3A 4PGFA 1AUPA 2H1SA 4GQAA 5KVVA 2TMDA 4JQCA 4TVOA 5T8KA 1U3TA 4AJ1A 4AL4A 2OOSA 4UUOA 5DULA 4D3FA 1I3LA 3E1KA 1R4MB 4KDEA 1LSOA 2EHDA 1X1EA 1VM6A 4RL6A 4URFA 4NHEA 2E82A 1LA2A 4KP7A 3VDQA 4J9VA 4D42A 1TT5A 1JKJA 4Y67A 5JAZA 2GYYA 1XU9A 4BO0A 3DR3A 5T5QA 2VQ3A 1OZAA 4DIOA 1G6KA 3PGJA 3PWKA 4RF2A 1WDMA 3FPCA 1ZEJA 1DC4A 3FWNA 5DT9A 3WFIA 1GDHA 4R1SA 2ZTUA 4RDIA 1DIBA 2O3QA 1YL7A 3DWFA 3OP4A 2GNAA 3PJGA 3GEDA 1F14A 4YAIA 3K5PA 3P5SA 2IODA 3OQ1A 3GR6A 2HK8A 2NUAA 1CERA 3HZZA 1YE3A 5IXSA 4AVYA 3WBFA 2VRCD 4OXKA 3GDOA 1Z74A 4II2A 1K5HA 2B35A 3INTA 3DMTC 4YT2A 1NM5A 1YWGO 2V6BA 2NM0A 2QG4A 2O7SA 2UUPA 4IMPA 5FWNA 3RUCA 2V6MA 4CMCA 4FJ2A 5L45A 1H6CA 4II3A 1U2DA 1CIVA 2BD0A 1PQUA 3NT5A 2C54A 3UN1A 2GO1A 1C1DB 3H9QA 4WLEA 2CDCA 3QP9A 3E6AA 2WM3A 3JYPA 3OA2A 4R68A 3GZNB 2EV9A 2PK3A 3F4BA 4GX0A 3V5NA 5A3JA 1XQ1A 5A1TA 3IUSA 5FYDA 3PGXA 2X0NA 5CG2A 4Z9XA 3TF5A 2B36A 3QW2A 4DYVA 4TKLA 4AJLA 2BHLA 4CL8A 2DC1A 3K2BA 2PKRA 2Q45A 5I7VA 1K6XA 2YHIB 3CZMA 4CM8B 1PJCA 2JD2A 3DXFA 1X7DA 3F47A 2AHRA 4ID9A 1I3NA 1J49A 1R37A 2UV8A 3GRPA 5C7OO 4CLEA 4JCOA 4XCVA 4N5NA 1DXYA 5KKAA 4RF4A 1GU7A 2E49A 2JD1A 2GSDA 2D0IA 4U6QA 4CM5A 4YAGA 3BTVA 1PJSA 1NVGA 1XIVA 1EUCA 2DT5A 4NNJA 3GH3A 3ADOA 3ZH2A 3H5NA 3ZHBA 1TT7A 4O0LA 1WNTA 2BGKA 3GEGA 3UCXA 3JSAA 5DZSA 3ZHXA 3H6KA 3RUDA 2GR9A 5CDYA 3JQFC 1ZXLA 3DL2A 3I1JA 4EUFA 2BF7A 3BTSA 3QLJA 1YB5A 5GZ1A 1UXKA 3I23A 3IS3A 2RHCA 3GDGA 3HDHA 1PR9A 2VWPA 2DAPA 1XG5A 4Q3BA 1HLPA 3PQEA 5CG1A 4XB1A 1E6EA 3JD4A 2DM6A 5FI3A 2Y0CA 3JQ8A 1O5IA 4GVXA 1PJTA 4W7IA 4XZ3A 4CV2A 5CDTA 2JCXA 1DDOA 4H7PA 4RQTA 2Q99A 4W9NA 5I9NA 4PG6A 4Q3EA 1C3VA 5EINA 5H81A 1ISJA 3WIEA 1T4BA 1UXIA 3MWDB 2Q3EA 3H8VA 1U2GA 4I08A 4U5QA 4FS3A 3W4KA 2GPTA 2Y93A 2JD0A 1HSOA 3TSCA 1GAEO 3GGOA 3ST7A 3RFTA 1EBUA 3DONA 2DU8A 3AM5A 4D3DA 1SEPA 3KYCA 4BGUA 4YT8A 1W73A 1WAMA 3DDNA 5B4TA 3SJUA 4RPHA 3F9IA 3ANNA 3AOGA 1ENZA 3CPSA 2I3AA 1ZNQO 4WLNA 1NP3A 3NT4A 1E7QA 2WEKA 3QWHA 3ZWBA 2Z5LA 4FGSA 3MJTA 3I3OA 1AE1A 2Q4EA 1ORRA 4EGFA 1IZ9A 4Q3AA 2A4KA 5CAEA 1HE2A 2WWRA 3STHA 3I9KA 1E1NA 4I8XA 4R01A 4EEZA 2ZYGA 3EVTA 2JKVA 2Y1FA 4K28A 4E21A 5IG2A 3D1LA 4IQGA 3CZRA 4R4JA 4B7CA 4P4GA 2FRDA 3VH4A 3AY3A 5B37A 1KVTA 4U0KA 2DUUA 4QEDA 3H9JA 3WGGA 3BMNB 5JDIA 2X5JO 2VT2A 3AUAA 4GWKA 4WOJA 1ZBQA 4INAA 3ZWNA 1D1TA 4XWYA 3VDRA 4CJXA 3JD1A 2QQ5A 3GVXA 3NEPX 4RGBA 4YJGA 4CR7A 3DHEA 4M89A 4FD3A 4GLLA 1DFGA 4BNIA 1NWCA 3L6DA 2HMUA 2E4AA 1ADFA 1E5LA 2WE7A 4K26A 5CEJA 4FCCA 5JMWA 4AJHA 3H9EO 4NU5A 3I5MA 2DLDA 2D1YA 1MG5A 4YCAA 3EZLA 1VSUA 1YBAA 4B8WA 4L9RA 2ZIZA 1NPDA 1ZW1A 1UAYA 1LJ8A 4A5OA 2VHXA 4BKQA 4K1LA 3IOYA 1U9JA 1EUDA 5JYEA 4FIZA 4J7UA 5A06A 2OBYA 2HSDA 4LCEA 1T2CA 3H7AA 4CQLA 1FXSA 4M1QA 2YV3A 1V0JA 1GZ4A 4XIJA 3LF2A 3GAZA 4WNCA 3I52A 2I9PA 3GK3A 3CSDA 4CQMA 1J4AA 1QP8A 2J3IA 1T24A 1SOWA 5T8KC 3P19A 1LLDA 1NNUA 2JFFA 3D3WA 5CEFA 4IY1A 4HFMA 2DKNA 3FD8A 3MJCA 5TSDA 3IJRA 2Y0DA 3B20A 1SNYA 1M6WA 1RYDA 2P5YA 4KOAA 5H82A 2BFAA 3AY6A 4W82A 3HDQA 5GY7A 2P68A 1H9BA 1HE4A 2LDBA 5ES3A 1M67A 4ZU3A 5A04A 1R4NA 3HQ4O 4EUEA 1PL6A 4R5MA 4Y98A 4J4BA 3I4CA 3PZRA 4EJ0A 1HYHA 3UCEA 2C2YA 5G0SA 4PZEA 5EJ2A 2PA3A 3OEYA 4D3SA 4J2OA 3HHPA 4BV9A 1A4UA 4FC6A 3ONDA 4F45A 3GAFA 1YS4A 4WLVA 4XJTA 1X7HA 4FDAA 1WZEA 4OSOA 1JQBA 3ZWOA 1ZSYA 4HXYA 4XB2A 3ZWVA 3W8FA 3PJEA 1F06A 2RAFA 2VRCA 2GLXA 3HWRA 3HSKA 4KWHA 3ZCXA 2ZTLA 1HTBA 1GCOA 3IKTA 1A4IA 4J1QA 1RKXA 1I8TA 5AXDA 3VC7A 4OMUA 5JDCA 4RVUA 3JQGA 3ZU2A 4BO6A 3TN7A 1NX6A 4L74A 3WLFA 3NYWA 1HRDA 5THQA 1DAPA 4UEKA 2RIRA 4MPDA 3OETA 1GR0A 1RPNA 1DC6A 3ENNA 2ZQZA 4ND4A 3RI3A 3GMSA 1PZEA 3KVOA 2A94A 4CMIB 4UVHA 3VPGA 5BNTA 3OJLA 2J5KA 2OP1A 2GASA 1SOVA 3DHNA 1XHLA 3RUFA 2IEDA 1H9AA 4HNHA 2C59A 1Z82A 1YQGA 2IDZA 3OFSA 3G1TA 2DTDA 4E2ZA 3PRJA 3T4XA 4HBGA 4B3IA 2H6EA 5T6BA 1K3TA 5G4LA 3WGOA 4QX6A 4RZHA 1T26A 5TX7A 2IE0A 1FDWA 1ISFA 1QLJA 3KYDA 4B3JA 4QTZA 4J7XA 1VLLA 4DRYA 4IDCA 2CDAA 1VRWA 1Z7EA 2Q1UA 3DBRB 3VH1A 1K2WA 1MUUA 1R66A 1PGJA 1HYGA 1ISMA 1CYDA 4CUZA 3KEQA 4C7JA 3UICA 1QYCA 3DBVO 5B4UA 1KEPA 4E13A 1SEVA 3EAGA 4D45A 5BSEA 2BI7A 1LI4A 3E5MA 1G0NA 1B26A 3ROKA 3BHJA 1NWHA 3GOHA 4GKVA 3O4RA 2CVQA 2Q2WA 4D41A 5JBIA 4OQYA 4U8GA 4LMPA 4BNUA 1P31A 2OORA 4L76A 2A35A 1RM4A 1SZJG 4HNGA 4IIVA 4I5EA 1LRLA 2EF1A 4RPLA 3TZKA 4MVJG 3GNTA 4KTVE 1VKOA 2UUOA 3TZQA 1Z7BA 3L4SO 1NPTO 4UUNA 3NJ4A 2P9CA 1GEEA 4FFLA 4IDBA 3AY7A 3PEFA 4XQGA 2P9GA 4Z0PA 5A5EA 2IZZA 3O9ZA 4NJMB 4BNWA 4ZICA 3PXXA 3OIFA 3AJRA 3X2FA 4EDFA 4CL3A 1HZJA 5C7LO 5F1KA 2AEJA 1B3BA 1U7HA 2I76A 2CNBA 3DMTA 3W8DA 4B8ZA 4BGEA 3U4CA 3BXXA 5JYDA 4DPLA 3SLKA 5C3MA 1E1KA 2DTXA 1GV0A 5KVQA 1F0YA 3C7DB 5AOVA 1HDYA 2BH9A 4UVIA 1L7EA 2NVUA 2C0CA 3MTJA 2ZB8A 4MVJH 5DP2A 3HG7A 4PLCA 1DIHA 1YKFA 3WTCA 3PYMA 4ND5A 4QXMA 4DBVO 4JXKA 3NT2A 1YJ8A 2POQX 4CODB 1X1TA 4ND1A 2QIOA 3C85A 4GGPA 4BKPA 5JAQA 1IE3A 1O6ZA 3H5AA 5JAIA 2V7PA 3E18A 3FR8A 4N5LA 3VTZA 1NQAO 5KWEA 1H5QA 5TGDA 1U3WA 1DJNA 1KIFA 4RORA 4CLXA 4RZIA 1VKNA 4MVJE 1PQPA 2E48A 4KMSA 5JDIC 3O26A 3RFVA 4BO8A 3QWIA 4P38A 4MKZA 4K6FA 1GEGA 2FP4A 1ZJYA 2Z1MA 1OC2A 1I0ZA 2H9IA 2O2SA 1SCUA 4DA9A 5EMHA 2CMDA 4M55A 2EXXA 1WW8A 3L4BA 5EQDA 1KC1A 1BRMA 4NFSA 9LDBA 1QYWA 3RU9A 1UP4A 3AFNA 1A7KA 2ET6A 4JJIA 3DHYA 1T2DA 4FFOA 1LDBA 5IDQA 1LLUA 2EWMA 3HDYA 3LSYA 4RQUA 3VAZA 4UREA 1B0AA 4YACA 3EVNA 3U09A 2VN8A 4FFPA 5HM8A 1Z73A 5DOZA 2CFCA 4GX1A 1A27A 3RU7A 1CJCA 1HDXA 3ETGA 1ZXBA 1PU2A 3TZHA 2B4QA 2H63A 1AGNA 4FOOA 2Q49A 1E0DA 4JK3A 1WWKA 2PGDA 2O3SA 3V2HA 4BUCA 1N9GB 4J1TA 4MVJI 1BVUA 4BMNA 5FF9A 1PX0A 1NAHA 1PTJA 1XU7A 4D0SA 3FTPA 3PQDA 2IEBA 4ND3A 5KJ6A 2VRBA 1KOLA 1MFPA 4FSHA 1YB1A 5IDWA 1Q0LA 1I2BA 4PRLA 1ID1A 4MKRA 4EW6A 2VYVD 2X9NA 1Y81A 3G3EA 4LVUA 3RBZA 4BNZA 1NQ5A 2EJVA 1EDZA 1PGQA 5L4SA 5ENDA 1VJ0A 1MFZA 2WE8A 3GF4A 1O9BA 3RUAA 2FSVA 4CMKA 1R0SA 3FCOA 6LDHA 4ZN6A 4AJ4A 1FDTA 3ZGYA 1V9LA 5BSGA 3NGLA 4YR9A 4GX5A 3RKUA 3WIDA 3ZU4A 1QV7A 2P2SA 2GZ3A 1I3MA 4XJSA 1D4FA 1GZ6A 4WCDA 3GHHA 3I9JA 2WTBA 4GBJA 1BHSA 1J0XO 5IJZA 3EYWA 1T1SA 4LK3A 3BMOA 1C0KA 1O8CA 1LDEA 2AQKA 4WLFA 1V6AA 4BO4A 3SC4A 3BIOA 4NBVA 5I8ZA 4D79A 4E2YA 4J0EA 1H6DA 4N54A 1Q0HA 1B14A 1PL8A 1ZO8A 4MJLA 1P1HA 2HJRA 2AQHA 4P8RA 4CM6A 1T2FA 4ONEA 4BO2A 3QE3A 1UDAA 4WGGA 1E7RA 3MOIA 3I4FA 1GFSA 2JJYA 2W2KA 4WCFA 1V8BA 1HT0A 1H6AA 3NRCA 3SC6A 2DTEA 3QHAA 2DUWA 1OC4A 2HK7A 3JQ8B 4Q3DA 3M1AA 1I30A 4WKGA 2O2YA 3D5TA 1BWSA 3AFMA 2AG8A 5BT9A 3CUKA 4PVCA 4BO5A 4YT5A 4U0JA 1BTOA 4GWGA 1N7GA 3EC7A 2CZCA 5AXAA 4B3HA 3OA0A 1GY8A 2FZEA 2A92A 4LW8A 1AHHA 4BS9A 2W2LD 3HUDA 3T7EA 3KYCB 1FDVA 1GL3A 3JQAB 4TRNA 4YT4A 1TXGA 3C7CB 3L6OO 3GUYA 4ZA2A 2C7GA 1ZSVA 2VYND 2Q46A 4QFDA 2R2GA 3M1LA 4CLOA 4L4SA 4R1TA 3FSRA 3NAQA 4UVEA 1S6YA 4OM8A 1PL7A 1TVEA 3GN1A 4IXWA 4NK5A 2Q2QA 1DHTA 3DTYA 1P45A 5TJ9A 3WGZA 5JY1A 2NQ8A 4WASA 2Q50A 4PLVA 4J49A 1NAIA 2JFGA 1PZFA 1Y8QA 1UZNA 4OQZA 4UUPA 4BKUA 4H16A 1LUAA 5A03A 1NFQA 5TJHA 3RASA 5IF3A 4BNNA 3KSZO 3DZIA 2AE2A 4YJFA 3V8BA 4H3VA 1YB4A 4DXHA 4O59O 3WYEA 4FW8A 3ROQA 1LC0A 1P1KA 2OP0A 4BNKA 1F17A 4A03A 3F1LA 4CM4A 4XQEA 4EJMA 1E3WA 3OH8A 4E2XA 3UH1A 3A28A 3SX2A 1F12A 3GQVA 2WYVA 3WMXA 1XLTA 4GL4A 3GRKA 2QZZA 2YUTA 1R0KA 4D7AA 1PWXA 1YL5A 4IXTA 4DLBA 3UUWA 2ZTMA 1TB4A 3MTGA 5CP8A 1CRWG 2NNLD 1LRKA 5DCUA 2O4UX 3V1TC 1UH5A 5HA5A 1BVRA 2EGHA 1H0KA 3VVBA 3WSWA 4B7XA 4CMBA 4RJTA 1H6BA 4J3FA 4JP3A 3PVZA 4J91A 3TL3A 3WGTA 5A4DA 3A14A 1N1EA 3FHLA 4G2NA 1ZZEA 2C2XA 1Y9EA 3QVTA 1QV6A 4PLPA 3KOUA 2GN9A 3WDSA 5G4KB 1E92A 3NGXA 4ESOA 4E5YA 3PHLA 4DQVA 4DC0A 3ITKA 3AM4A 3S8MA 3D4NA 2PH3A 5JO9A 4O1MA 5BQFA 2NTJA 2O50A 5ILOA 4A27A 1I01A 1DFIA 1M2WA 3LLVA 3LT4A 4B79A 3HB5X 4R69A 4CQMB 1CQIA 1JKIA 4IQ8A 3F6YA 1PJBA 4W4TA 3ONEA 2VHWA 1CEQA 1ZK4A 1BMDA 3D3WB 2X8LA 1Y1PA 3EZYA 5L4NA 1H2BA 1KVRA 3Q6IA 1YBVA 2ZJ1A 1JN0A 3PWZA 5G0WA 1KC3A 1T4DA 3SLGA 3DZGA 3GY0A 4YAEA 3OICA 3Q9NA 1EUZA 4Y6SA 5CFZA 2Y99A 4XYEA 1TI7A 5TT0A 5ER6A 5I7SA 1NVTA 2B37A 3CEAA 3C1OA 3R1IA 1R4NB 3TQHA 3QY9A 5AXCA 3WS7A 1Z45A 1U8XX 1Q0QA 1UXGA 1ADBA 3TOZA 4NMHA 4TRJA 4BL5A 4Z0HO 4GAEA 1T1RA 4BO3A 1Y6JA 5JNLA 3L4BC 1EFLA 3PP8A 3WJ7A 3RJ5A 4AJPA 1EFKA 5KNLA 5ADHA 4J4TA 1SB8A 3JQCA 2PD3A 2CF6A 3JD2A 4TZKA 3ANLA 4RF3A 4DPMA 4ZVVA 4E4YA 1HDGO 2HU2A 5JW6A 4DWVA 1IUKA 1LC3A 4QSMA 4C4OA 1PZGA 1DOHA 1XGKA 3GZ4A 2HRZA 1PSDA 1E7SA 2VZ0A 2JHGA 3OIDA 5JLAA 3VOSA 3JQGB 4UAGA 1A7AA 3DZKA 4AJIA 1WDKA 1EVZA 1NVMB 3KXDA 3IJPA 5AQ1A 1FDUA 3DBHB 5H83A 5L40A 5IDXA 4Z3DA 3PHGA 1QKIA 3JQ7A 1EEHA 3GN2A 3KEOA 3JYNA 4WEQA 5EIOA 3M2TA 1ARZA 1X15A 1B15A 2WSBA 3WYBA 3UVEA 3DZFA 3O8QB 1OI7A 4BKOA 4ILKA 4CUJA 4PCVA 2WD7B 4MINA 4OJNA 4IDGA 2VYVA 3ZNQA 4BOYA 4K6CA 1DJQA 4WLUA 1ZCJA 3KYDB 4U6SA 5KOIA 4DVJA 1GQ2A 2HDHA 4YA6A 2YQ4A 3ZV4A 2QRKA 1DIRA 4GPD1 4Z9FA 4M54A 5HBRA 3JV7A 2VUUA 3OSUA 5DBIA 2B0JA 4PLFA 1QMGA 1Y8RA 3IL2A 1P77A 1IYZA 2G82A 1LDMA 1X7GA 4XR9A 1YL6A 5T64A 4BQRA 2GN4A 4R9SA 5GMOA 1D8AA 2BELA 1LEHA 5COBA 3ADPA 1C1XB 3E82A 5ITWA 4JIGA 4OAQA 3CINA 1H93A 1GYQA 4WPGA 1EQ2A 1Q7CA 4ROSA 1R6DA 3ICPA 5I9MA 1NFRA 1E1MA 2WDZA 1QYVA 1RJWA 5MDHA 4WCFC 2PNFA 1NBOA 3OJOA 3EMKA 3WX0A 1GUZA 1PJ4A 2AE1A 2FZWA 4JX8A 3PYLA 4KTTE 3ZWWA 5BSFA 1DIGA 5A02A 4QT0A 2IZ0A 3B1KA 4NFYA 3WOHA 3IC5A 5BSHA 3D5QA 3PZBA 5FFFA 1HDCA 3GC6A 1XWFA 4BMVA 1DAOA 2FHSA 4NBUA 4BV8A 5ITVA 3GUCA 2VT3A 1DRUA 1YH3A 2GGSA 4KQXA 3WNQA 4XR4A 1OBFO 5L4LA 1B2LA 4MO2A 1YBMA 1LBEA 1JTVA 4NBTA 3ZNOA 4PZDA 4ALKA 6ADHA 4YBZA 4L4RA 3C8MA 4E5PA 3QVWA 1SO8A 1DFHA 2W2LA 4FGWA 4GMGA 4ALMA 3U5TA 4XDYA 3UAGA 3GG9A 4I9NA 3ZDFA 1Y7TA 5I7EA 2BFPA 1N5DA 2ZTVA 4DMLA 4HFRA 4HUJA 3PWSA 3ZV5A 4EJ6A 2VYNA 2BGLA 3MJVA 5L7YA 4QUKA 3RVDA 2HMSA 4Y6RA 1D7OA 3U4HA 2X23A 4MVJD 4PIVA 1I33A 2RH4A 1E3JA 3N74A 2HUNA 1IHYA 3OF2A 1ZMTA 1G1AA 4GSLA 3NX4A 5A9SB 1GCUA 4ITUA 5EQFA 3IUPA 1GPJA 3UCFA 2QRJA 4BNJA 3DEYX 5G0UA 3JCZA 2GZ1A 3F46A 1MP0A 4YTEA 1I2CA 3AUUA 2PZJA 3VHRA 2ZCUA 2P5UA 4BNMA 1R16A 2BFMA 2XAAA 3WTBA 3ZWPA 2VOEA 1TA4A 2F00A 2I65A 5LCXA 4XQCA 3VPHA 4Q3NA 1O0SA 2OXIA 1BW9B 4TWRA 2PKQO 4R3WA 4E2WA 2G0TA 2QRLA 5CEEA 2EERA 3EK2A 3LQFA 3U4IA 3Q0EA 4E30A 3RWBA 4QO7A 2O3UA 3GZNA 1HKUA 1K6JA 2C20A 4RV9A 3QV1A 4WEOA 5AVOA 3MOGA 4A7PA 2DPGA 1FMCA 3QA9A 4J0FA 3F4LA 1WMAA 4XX0A 1L1FA 3ZW9A 2Y05A 5TT1A 3C1TA 1DPGA 4LCJA 1N2SA 3BHIA 3FNFA 3OJEA 1Q7BA 2Q2VA 2CD9A 1BXGB 5HS6A 2PFGA 4CM8A 3PK0A 4GH5A 3LK7A 3NDRA 5DCYA 4B4OA 1P0CA 2X9VA 3JQDA 1SB9A 4RPGA 1LTHR 2RCYA 5F3RA 3M6IA 4W7HA 1D1SA 3MEQA 3FRJA 5EL0A 3GPIA 4GLOA 4N18A 2C82A 1HDZA 2YFQA 1UUFA 2NTVA 4BGVA 4XRGA 3OJ0A 1KEVA 1UZMA 5MGBA 4YJHA 1T2EA 4GMFA 4GGOA 4J1SA 2O3RA 1SMKA 1EK5A 4CMHA 4DGSA 1AN9A 4F6LA 4AFNA 4YJDA 1XEAA 1JVSA 2VNSA 3TRIA 1UXJA 4IZIA 5BR7A 2YY7A 4PFJA 3SEFA 4IZHA 2X1HA 4UUMA 1VJ1A 5F21A 2BRUA 3CXRA 1YOVB 3ETDA 2V65A 4ZQBA 1LLCA 3CMMA 1NHWA 3E9QA 4RPJA 3BMOB 3ZV3A 5CPFA 4UVGA 3OMLA 4Q9NA 3PFWO 2Y67A 4ALNA 2HAEA 1XKQA 3CTMA 3K8ZA 1E5QA 2EP5A 2YDXA 3D7LA 4LVCA 4QECA 1VL6A 4O5OA 3F3SA 3OECA 2LDXA 2VTDA 2YHUA 2A9FA 2W2KB 3PLRA 5AYVA 2OO5A 2VHZA 2ZB3A 3GLQA 1MB4A 3AOEA 4JLWA 1U4SA 3VVCA 3ORFA 5DN9A 2X0RA 4R16A 1V3VA 1RM5A 3T7CA 5ER9A 3ZWAA 1IPFA 2Y1CA 4K9DA 2GCGA 4XGNA 3U9LA 2J6IA 3FTNA 4E32A 1N8KA 4MP8A 1ENYA 1PZHA 5TIIA 3VTFA 5G2OA 1Y9AA 3O03A 1GYRA 1ENOA 5IN5A 4E6PA 2FSSA 2I99A 2XF8A 4HV4A 2D8AA 5IAAA 1LNQA 1ZSNA 1DHRA 2DQ4A 1LU9A 4NPCA 1LSJA 3ASVA 4EUHA 3JYOA 4PLZA 3OM9A 2CVOA 3K92A 1ULSA 2X0JA 4CLOB 1YO6A 3DBLB 2NLOA 1P3DA 3IIEA 4IS3A 3LC2O 4WJZA 1HSZA 4M87A 3DOCA 3WB9A 2JCVA 3BMNA 2RBEA 5IFLA 4R1UA 3L07A 1SBYA 2C5AA 2YV2A 4OIMA 3A4VA 5U9CA 1A5ZA 1E3LA 4QFCA 5F1PA 4NK4A 1Y8QB 3S1LA 3VZRA 3S55A 1QYXA 4BO9A 2I5PO 3CH6A 3WG9A 4OOFA 3OHSX 2ZK7A 2RHRA 4BNYA 4RDHA 1W6UA 4ALJA 5JSFA 3RC9A 3D64A 3W8EA 3LU1A 2ZATA 3NTQA 2FPIA 1EZ4A 4CM4B 4TKMA 1NHGA 1HF3A 1VPDA 1C0PA 4EI2A 3LT2A 1DB3A 4LGVA 4MVJM 1W4ZA 3UXYA 1GTMA 3Q2IA 3WWYA 4J9UE 4XYLA 3I6IA 3PDUA 3U4DA 4N7RA 1TT5B 1C14A 1K6IA 1IZ0A 3N58A 2CF5A 4E5KA 1MXFA 3WICA 5COQA 1CETA 1B8PA 4YWJA 2W4QA 7MDHA 5JCXA 2HK9A 5B12A 4ZJUA 8LDHA 4KDFA 3FF4A 4H15A 1QORA 3IDSA 1AHIA 2VHYA 3GGPA 5K6AA 5JXWA 4RO0A 3ZWXA 3AM3A 3MJSA 1I3KA 3GFBA 1I32A 1WXDA 2YYYA 1ZIDA 3MZ0A 4TSKA 3ULKA 1MC4A 2JCYA 3G49A 5ENVA 1OOEA 9LDTA 4OGWA 3ZWYA 1EDOA 2FOIA 3OEWA 1ZH8A 5IDYA 4JGBA 4TZTA 4DQUA 4YRAA 2NVBA 3E9MA 2B83A 3TWOA 1C0LA 1DLIA 1LXCA 4ZGWA 4A26A 1XSEA 2J3JA 5CDGA 2PZMA 1W8DA 1F8GA 1UDBA 4L0QA 4E5MA 1JAYA 4M8SA 5LDGA 3TZ6A 1HDOA 3OQBA 2JFHA 4YQYA 1T2AA 1O95A 3H2SA 3GVIA 4XA8A 2P9EA 5JAMA 3BA1A 3GFGA 1M76A 3K9QO 4KWIA 1JDJA 3FPLA 3AU9A 3FBGA 2OMEA 4IDAA 3KM0A 4Y6PA 3WGHA 2Y68A 2EKPA 1YRLA 3ANMA 3CE6A 4IS2A 3LDHA 3S2FA 3QVSA 5TRTA 1LDGA 1GYPA 1DIAA 1ONPA 3ENKA 4MVJA 5KVCA 4NU6A 4EYEA 1Z6ZA 3R3JA 4JROA 3V1YA 3UW3A 2HRBA 1HWYA 3ONFA 4NQZA 3UKOA 5C37A 3BHMA 5HS4A 3T4EA 3QWBA 3INGA 3RCBA 2D2IA 4D44A 4UULA 4S3MA 1JAXA 3R0IA 4DL9A 5KVSA 3I9NA 4S1VA 1EE2A 3OIGA 1JU9A 4DQXA 3AWDA 1I36A 5KJ1A 3NKLA 3GG2A 4LN1A 4RVFA 1M75A 2Q1TA 3LLSA 4NBWA 4ZHSA 3DOOA 1QLHA 3U62A 2YW9A 1FJHA 4IIUA 3JQAD 1Q2XA 4BO7A 1N92A 1EK6A 4KUGA 5DNAA 3L9XA 3W6UA 4NH4A 4B4WA 1JWAB 3G0OA 2I67A 4XKJA 1MC5A 2XPCA 5EPOA 2VWHA 4RVDA 1U5CA 3RFXA 2PY6A 3W1VA 4XDZA 4CR8A 2DFDA 1PJQA 2X0IA 3HE3A 1PJ2A 2O7QA 4YYZA 4CMIA 2X4GA 2X22A 4JNKA 4XIYA 2YJZA 1F8FA 3JQ9A 1JVBA 2NACA 1U8FO 1VE9A 2DBRA 3P2YA 4HKTA 2X5OA 2D3TA 4TMFA 4XEHA 2I3GA 1IB6A 2VZ9A 4YB8A 3DZJA 4A0SA 4MIEA 3JD3A 3RUHA 5L7TA 5TLSA 2IYOA 3DOJA 2BFOA 3K73O 3LZ6A 2D4AA 5A05A 5B4VA 3JQ7B 2VZ8A 3QIVA 1WMBA 2BMAA 2P4HX 3GMDA 3DBRA 3D0OA 4J1NA 3NTOA 3QRWA 1RWBA 1C0IA 2NU8A 2QHXA 1VC2A 3EW7A 4Z9YA 1DRWA 1P1JA 3B1JA 3WNVA 1X0VA 5IZ4A 4I5DA 1HLDA 1CQJA 3VKVA 1QR6A 2O4CA 4GX2A 3CMCO 5G0VA 3G79A 4JBIA 4OL9A 1JWBB 5GZ6A 2EW8A 2EG9A 1KEWA 3B70A 3GNQA 3S2IA 3EY4A 2NQTA 4FOSA 1PGPA 3AI2A 3ZHZA 3K96A 4KUHA 2ZQYA 5DCWA 5A9RA 3PYXA 5I9LA 1UP7A 2WYUA 3NDJA 5L3ZA 3Q2KA 3PQFA 5ILGA 3FN4A 1QSGA 3SVTA 3QQPA 4U7WA 5EERA 4B7UA 1KVSA 3AOEC 4FR5A 1ZFNA 4BB6A 5DP1A 2OHXA 2R00A 4NZ9A 4IMRA 3L77A 5JC1A 5JMPA 2J3HA 4YJGB 2GUGA 4Q39A 3ZWMA 2CY0A 4R41A 4TRMA 4B4VA 3GNSA 4BHTA 1YONA 4E12A 1GPDG 3JTMA 4WECA 1E3SA 4RF5A 4WK6A 4RCVA 1NR7A 1BDBA 2Y0EA 4A2CA 3D3EA 3MJEA 4ZD6A 3JQBA 2V6GA 1ISHA 4OXNA 2VOJA 4AJKA 4IM7A 3TZCA 1E3IA 3KSDO 2FR0A 3ICCA 1WPQA 3A06A 3QVXA 1A9ZA 1D3AA 1R12A 4LRTB 3ZZNA 3BMCA 2J5RA 3UF0A 2BLLA 1NXQA 2PGJA 4PLTA 1OAAA 3MJ4A 1GZ3A 5A5FA 2HCTA 1BDMA 2EIHA 1PGNA 3JQ6A 4CQLB 2ZYAA 2HMVA 1ISGA 3PIDA 4CLRA 5FI5A 3RD5A 1KEUA 1ML3A 5KCZA 2AQ8A 3I6QA 1Y5RA 3HNPA 3H65A 3RUIA 4TROA 3BTOA 2E37A 3NTRA 4OOEA 1U28A 4DREA 2XXJA 2CDBA 2NV6A 3HADA 4JN6B 3S2EA 3U3XA 1DSSG 3KTDA 2JAPA 3TNLA 3I9OA 3DB2A 3F5QA 3FNEA 5TF4A 1MXHA 4ZRNA 3KUXA 1MG0A 4PLWA 4YAJA 5KKCA 3WQRA 5T67A 2EGGA 4IINA 1AXGA 2EEZA 2AG5A 5DDIP 3LC1O 1P9LA 3DZHA 3HJAA 3TFOA 2PTGA 1H2HA 1HXHA 2PD4A 3E8XA 4J16A 1JA9A 5K6AC 1HL3A 2J3KA 1U1IA 2PR2A 2X7HA 1Q7GA 2AEFA 2B69A 1N9GA 1EQUA 1E3EA 2HLPA 3PHJA 4ZQFA 4D46A 3UFXA 4TVBA 4MDHA 3RIHA 1L7DA 4GI2A 3R3SA 1UR5A 1P74A 3RUEA 4CPDA 1K89A 5AXBA 4ALIA 1SC6A 2HO5A 2IXAA 1PIWA 2D5CA 5JFOA 3W6ZA 3GHYA 2NWQA 1CF2O 4NG5A 3B6ZA 1MV8A 2NU9A 3VZPA 3HDJA 5GZ3A 2TMGA 4PG7A 4YDRA 3MWEB 2Y1OA 5LC1A 4BO1A 1PWZA 3IAHA 3KBOA 4BNGA 4IJUA 4O6VA 4BGIA 3KO8A 2G76A 4FBGA 1NQTA 4FC7A 1IHXA 3TFQA 4BVAA 1LSSA 3H5RA 5ICMA 1IY8A 3Q3CA 4PRKA 5IZCA 1EBFA 1BSVA 4HADA 3P2OA 4YJHB 3ZWCA 1XR3A 3U49A 4NR0A 5CDSA 3F1KA 4IDDA 3QSGA 4B4UA 4KQWA 1XA0A 3KB6A 4IJKA 4IUYA 1HE3A 3ITDA 4Z3KA 2OGUA 4A73A 1PEDA 4EZBA 3GGGA 1QYDA 5TC4A 3Q1LA 1TEHA 1DBVO 2X86A 5A9TA 4P4NA 4F3YA 5U1PA 1VJTA 2FR8A 1IOLA 1U4OA 3M2PA 2PD6A 2B5VA 3SXPA 3WR5A 3WQSB 3BMQA 2GF2A 2Q1WA 3R6DA 5JS6A 1GUYA 3H4VA 5LDHA 4WE3A 1PGOA 4OXYA 1P1IA 1M6HA 3DO5A 4I1IA 5JY6A 3FWZA 4W99A 1PS0A 1QXSA 1DLJA 3ZNNA 1E6UA 2W8ZA 3A1NA 4NI5A 1KS9A 3JQAA 4OSPA 2H5LA 4PVDA 3TJRA 3NUGA 3PFFA 3AI1A 3UGKA 4TQGA 1OFGA 4BNTA 2O3JA 3JQ9C 4F46A 4FFNA 4XQ9A 2NU7A 2PLAA 2XXBA 1OMOA 4CM9D 5L53A 3GPDG 4EEXA 1K0UA 1MGOA 3WWZA 3K31A 4O63O 2C07A 1JLLA 2EKQA 2I6TA 3FNGA 5BNFA 4DLAA 1E77A 3LYLA 2HMTA 3H3JA 1A72A 1IULA 2CVZA 4PN3A 2SCUA 4YRDA 4FN4A 4JP2A 1Q1NA 3SBOA 4MIOA 2YQ5A 1HETA 5JPIA 1XCBA 4P22A 2XOXA 4FPXA 1WZIA 1IL0A 2J5QA 5IN4A 1ZJZA 3ZV6A 4R5HA 4N5MA 4AJJA 4E31A 4NIMA 5C5IA 1NASA 2IZ1A 5DOVA 3RBVA 1LQUA 2Z95A 4DYDA 5KIAA 1VL0A 2PGLA 1P0FA 2VUSA 5THKA 4R1NA 1R4MA 2E6UX 3GDFA 2GZ2A 3JYLA 3G17A 5ICSA 3RSHA 1KY4A 2NVUB 1E6WA 2JHFA 1UJMA 3NJ8A 5BNIA 4QQRA 1DRVA 1ZK1A 2EW2A 3WXBA 1CDOA 1YXMA 2Y1GA 2Z1NA 4OHUA 4PZCA 2GRAA 1KERA 1GD1O 4DPKA 3AW9A 3U0BA 4UEOA 3HN7A 4I5FA 3LC7O 1HYEA 3JQEA 3K2EA 4TRRA 1EE9A 4DTIA 5CDUA 3L6EA 3X2EA 5KTKA 5L51A 3KYBA 4FB5A 4LSWA 2VWQA 2W90A 3WSVA 1YVEI 3C1AA 4Q3CA 4RVSA 2FPPA 4MVJP 4DMMA 4LSMA 1YJQA 1ONNA 5G4KA 2YFHA 4G5HA 4R54A 2ZCVA 4FJ0A 4RLSA 2R00C 1U7TA 1YQXA 3UOGA 4BB5A 5EESA 4BMSA 7ADHA 2UAGA 2DBZA 2J8ZA 1B16A 3P7MA 1ZUD1 2QYTA 3HN2A 5JCJD 4ZQHA 1BG6A 3EDMA 1KYQA 1V3UA 3ZU3A 2OFPA 1C1DA 1Z75A 2B4RO 4XRRA 4YXFA 5JC8A 3KRTA 4KZPA 3JQBC 5TNXA 2YZ7A 1PS8A 4DUPA 4PLHA 2NTNA 4Y9DA 4CLDA 4MKXA 2UDPA 3BYZA 3WJAA 1QG6A 4C7KA 1JKFA 4Y8VA 3E48A 1PJLA 3QJ5A 1J6UA 2O3TA 2ZB7A 2YDYA 2AA3A 2WMDA 3C3XA 3C7AA 2YHIA 1PR3A 1V35A 3L0DA 2WYWA 3Q11A 2PZKA 4WNIA 4ZQGA 4CMEA 1H94A 4LMRA 4AJOA 2PWZA 2DPHA 4P4LA 3KZVA 1BXKA 2UVDA 4YQZA 4FQ8A 4JBHA 3RQSA 3AUTA 3WMWA 1UDCA 4X54A 4I9HA 1R0LA 1UP6A 4XYGA 4JJGA 4L4XA 2F1KA 2OL4A 4J90A 1P1RA 2QZ9A 4HFJA 4HFNA 3GT0A 2HQ1A 3DMYA 3KSUA 1KBZA 1I24A 5DBFA 4AICA 4XYMA 1RM3A 4BIIA 1E7WA 4IGFA 2GERA 3E5RA 4IDFA 2ZJ0A 3DFZA 4OO3A 4BQPA 4I5GA 3ON5A 4J6FA 4E33A 4BNVA 1EVJA 2GN8A 5DBGA 2FMUA 3IKVA 1CWUA 2OUIA 2NVWA 3KHUA 3FBTA 4PG4A 1KETA 4LISA 3K30A 4OKIA 1ONOA 3PPIA 3FI9A 3D4PA 1GV1A 4FFRA 3VH2A 2DBVO 1E7YA 4DC1A 3PJDA 2JAHA 3ZW8A 3IP1A 2ILTA 4NDNE 4WUVA 4EITA 3DBHA 4XGIA 3ZNPA 4L75A 2I66A 2P4QA 3TPCA 3GVCA 1PS9A 3PJFA 4Z6KA 2VNAA 2G1UA 4IJVA 2BKAA 5J23A 4IJWA 3DAGA 1FDSA 3B1FA 3RBXA 2DBQA 3O8QA 5HRUA 4DIBA 1YDEA 1LLQA 4WCFB 4PLYA 4PG5A 4I9UA 3A9WA 2WD7A 1X13A 2BI8A 1U3VA 3FNHA 4L73A 2WJPA 5COAA 3KLPX 5F5NA 1MA0A 1P44A 2G17A 4PG8A 4BNHA 1T25A 1B7GO 4CUKA 3JD0A 3QWAA 4OH1A 4D0RA 1DO8A 3H9UA 4IDEA 1ULUA 3VPSA 1YQDA 2RH8A 5CHEA 5IZCC 3FR7A 4WLOA 2VTEA 2AMFA 4E0BA 3AK4A 5KJEA 3LVFO 2FR1A 3S2GA 3V2UA 4A10A 1U3UA 1HDRA 1E1LA 3H9GA 3N7UA 4EBFA 2VHVA 1C1XA 2VUTA 1U5AA 3HFGA 4HWKA 1P1FA 5K9ZA 4AJ2A 3AUSA 4HY3A 3WYCA 1LDNA 3OBBA 4BNFA 1PQWA 2C7VA 5L9AA 4RVGA 3VZQA 1UAGA 3GVPA 4KUEA 4J7CA 3V2GA 1E7MA 1ZEMA 1O89A 1YDWA 1ZK3A 1DC3A 1ZVMA 2QX7A 1KVUA 3DTTA 3VKUA 4W9NC 1FK8A 2EKLA 3RAJA 2FPGA 3ZHYA 4YVFA 3E9NA 3LT0A 1FF9A 2NU6A 3GA0A 2W98A 4E3ZA 5I8WA 4YPOA 3RC1A 2OZPA 1GQQA 4YJFB 3K6JA 1W0CA 2DVMA 4NBRA 2X6TA 1ISIA 4CLHA 1AXEA 1LSUA 1N7HA 2Y66A 3NV9A 1NTOA 4M49A 1E3WB 3BAZA 5IXYA 4GVLA 1N1GA 2O48X 3HFSA 4J43A 5HTOA 1WVGA 4IPTA 4R3NA 1BGVA 5T57A 4M86A 2O23A 2IRWA 5KJCA 4RPKA 4UVDA 1G0OA 1JW9B 2C29D 1EMDA 3OJFA 4Z0TA 5L95A 2Y1DA 5FEUA 3DAPA 1ZKMA 4CM9A 3AI3A 3ABIA 5U4QA 4IBOA 2YV1A 3VZSA 3GEMA 3RKRA 1WP4A 3QWFA 3WFJA 2Q1SA 3H3FA 1X14A 5A9SA 3O38A 4OKNA 2Q4BA 1V3TA 3BMCB 5F5LA 3JYQA
chains in the Genus database with same CATH superfamily
1ZK2A 5KSYA 1FFSA 1P2GA 2V8OA 4C7OA 1A9YA 1J5PA 3I9MA 2B3DA 2Z83A 1CNFA 1Z0UA 1XTSA 3AU8A 2AJLI 1GDDA 2Y6VA 1T9KA 3BF7A 4IVNA 2O2CA 4U7JA 5GP1A 4CLRB 4DLLA 1TAQA 3ADCA 1Z0IA 2AXNA 3WQQA 2G5CA 4HAXA 4KWCA 2QE7D 1NURA 3ZI0A 3KJQA 2JFVA 3WGYA 3Q9UA 1JXQA 2IU3A 3GBVA 1UKVY 1XYGA 3S6JA 4A9AA 2ZYDA 1CQIB 1TIPA 3Q40A 2B0CA 5JPDA 1VI2A 1AB5A 1NJ8A 3LY5A 3R3VA 1HFJA 1QHYA 1U81A 3S1AA 2CBZA 3F2IA 3V1UA 2IU4A 4DR5B 4HV4A 4NVRA 2X2EA 3HS3A 4W5QA 3O9VA 4MRNA 1SHLA 4LTDA 2QUZA 3VNQA 4HUQB 3OY2A 1NN1A 3PHHA 4Q7KA 3AR9A 5FBRB 1JEYB 1WU7A 1I7NA 1B3RA 2VBGA 3WXMA 1QAQA 4IIDA 3ETEA 4KLNA 3VJKA 4UXHA 2PH5A 2V5AA 2WWTA 1QRRA 4FEYA 2H85A 4OYRA 3OUUA 3UPUA 3D4IA 2GN0A 3CWZA 3E2MA 3TLBA 4EI9A 1JH9A 2A7QA 1PEYA 3EGDB 3V9PA 1RD4A 2HLNA 5BWOA 2FYTA 4CR6A 3KG2A 2G9RA 4O8CA 1I10A 3C3JA 3ED1A 7GPBA 5AVWA 3WBBA 4R51A 3TB6A 3B13B 2GF0A 4MUKA 1XO1A 1M7GA 2V55B 3L7YA 4RIFA 4D9GA 3TTSA 4BKRA 2VCYA 1XK7A 1QUEA 1RR6A 5G0TA 3H11A 2JJ2A 1IRXA 1P17A 2EKZA 2G04A 3PKIA 3NIGB 1X6VA 3GQBA 1SKYB 2O57A 4J4HA 4R3UC 5FTMA 5BV7A 3EZGA 1D0VA 1H0SA 3VM6A 1GZ5A 2ZB4A 1X0XA 1D2CA 1XP5A 2DKOA 1X9HA 1ZWLA 2CNNA 2X5KO 4YMSA 4QO8A 3G2KA 2NU9B 2HKIA 4MDYA 4Z0NA 3RYTC 1RM0A 3U4QB 4ZPXA 1ZM7A 4HXFB 4KGXA 1D1QA 3EAQA 1JIJA 1H8EA 2W00A 5EKUA 3ZCQA 3VR6H 5HF6A 3LUCA 2NXCA 1G7SA 4H9GA 4QT4A 2PZAA 5KX5A 1RI1A 3SQNA 2BUCA 3NI2A 3MGGA 3O75A 2PV7A 2WSMA 1IH8A 3ZBPA 4DV6B 4ODIA 3DE3X 2G28A 1KZ9A 1Y6FA 1BOOA 3GZJA 2XV1A 4B6FA 2IXBA 2HMWA 1QE3A 4ZKEA 2OHOA 4FT2A 2UZ3A 1QC5A 3I0NA 4Q48A 3RTBA 2ODQA 3CSSA 2Y1WA 2YJ6A 1NPYA 4PFKA 1WXGA 4YJ2F 2PVSA 2NV2B 2HJSA 4XGKA 5K3AA 4HS9A 4CEHB 2BT4A 3RADC 1FTWA 1YHZA 2J32A 1ADJA 3DE4X 1KOFA 1LRJA 1TUBA 2LWIA 3L0BA 3LQYA 3O4VA 2QN8A 1OKKA 5CM2Z 1OFUX 1G55A 3NOQA 1S9DA 3WHKA 3ICWA 4TUYA 4DIFA 4AJEA 2DFVA 1TLTA 1T4GA 4TQ9A 4F1WA 3DGFC 4O2LA 2X0FA 5LNK1 4M99A 4YEDA 3W04A 1NUAA 3KQVA 2QI9C 1HZZA 4WH0A 3B5EA 3M6WA 2WD8A 4NBSA 2UYYA 3VR0A 1AD2A 3PTZA 2VQ6A 4HX5A 1ZK0A 2J9GA 1EK1A 3BMQB 2OHFA 4RS4A 1K75A 4RXUA 2Q3CA 3QLTA 3IJEB 4UE6A 5LUBA 4YMHA 4E5NA 5J1SB 1WEKA 3BKWA 1X1RA 2PDAA 4J0GA 1ZD4A 2OHHA 4LUCA 4QASA 3U7JA 3W5CA 5FPSA 1N5JA 3BSYA 3OTHA 4NJOA 5DNUA 1M8GA 3FXAA 4ZO6A 1WD7A 4IOMA 2XZTA 4LWPA 4XD2A 5K4AA 1E8DA 2BY4A 1KJ8A 1M8PA 4OHOA 1G8PA 3F5DA 4PX9A 4DXAA 1JIXA 4KSYA 1DUVG 1BE8A 3C4QA 2E5LB 1N78A 4W6ZA 2EP7A 4XW2A 4MQBA 2LCQA 4ZO9A 5FWXA 4S05A 1P9WA 4W7SA 5DLPA 2PZLA 3PDJA 5FI0B 4G0YA 4BJHB 1FW6A 4MGEA 1XQ6A 2AXQA 2ZUUA 3DAFA 1JECA 4HP8A 1J9GA 2I1VB 4P4SA 3GVHA 1T10A 4G65A 3EUWA 3ZQKA 3DZBA 1E62A 2X9LA 3CIFA 3D3JA 2CLCX 2IZ5A 3UAXA 3FHTA 1YUBA 4Q6BA 5B57C 4KRYA 3B1WA 1V8FA 3GFRA 3WA7A 3GLFB 1KZ1A 2E4UA 1IOZA 1MX3A 2CMKA 2WVGA 1HFKA 5T41A 3I9LA 4N3BA 4XPZA 1HLFA 3AF2A 4AG3A 4PO8A 2C88A 1AUPA 4O4LF 5I5EA 1JYSA 1R5NA 3DMRA 2OK7A 2JI7A 3U4AA 4LRQA 1LX7A 4Y0AA 4AL4A 2FP3A 2OOSA 3QKSB 5FAXA 3QPDA 1UDRA 4AMVA 1T9GR 5CCDA 4L4UA 1VJCA 4MV5A 5D51S 1X8JA 1X1EA 3G9QA 1JSXA 3BKXA 3B36A 4LJRA 3AEKA 3WK8A 2G1AA 3GJ6A 3GXBA 1VSBA 2VF8A 4IIBA 2FV8A 4HVLA 1JKJA 3ZQJA 3CPJB 4M53A 4J03A 2GYYA 2VJPA 4IIXA 3CQ9A 4LE1A 4OQFA 3FTCA 1OZAA 3GYBA 1G6KA 3HP1A 1FSFA 3PGJA 4YP5A 5BORA 2R4TA 1KMHA 1V7PC 1ZEJA 5DHTA 3KFXA 3KT0A 4BZPA 2CFIA 1DP4A 1DIBA 1M0TA 1YL7A 1ZL2A 1MB9A 1RAEA 2PRYA 1ULAA 3OP4A 4F72A 2C9MA 4FDTA 2JGDB 1RABA 2GARA 2PMEA 5JAHA 4A8JA 2NUAA 5KKNB 4JLDA 4OQNA 3TEFA 1WV0A 3HXKA 3WBFA 4AVYA 5LFAA 2RI1A 3GDOA 3QOXA 4NEGA 5TPWB 1FS6A 1K5HA 3INTA 4KHPB 1OAOC 2PT7A 1ZUNA 4REOA 2FEWB 4EABA 2V6BA 5E6UB 5K0EA 2B34A 3QLUA 1XVAA 2FXIA 5AHOA 5FWYB 5JAPA 1QIGA 1Z9BA 1L4LA 1F2VA 1LH0A 2ABWA 2WQZA 4CI0B 2NO5A 3DEJA 5GTDA 3SG0A 3T3DA 1I7PA 4HNQA 5L45A 1H6CA 4IH1A 2I4TA 1QJCA 3SSMA 3N2YA 1WBJB 4BV3A 2XMZA 3HUUA 1KYXA 3NT5A 1C3OB 2E4XA 3MRXA 2GO1A 3H9QA 4X8MA 1Q1BA 3OA2A 3AUKA 3MRVA 1PLLA 4MB2A 2OXRA 1ECCA 4ZJZA 1Q0PA 4MRMB 5LMNB 1ZGJA 1DUIA 2EV9A 2Z1DA 3F4BA 3H5WA 1Y3IA 4Z1MD 1XQ1A 4QUAA 4LFAB 5EE1A 1YDMA 4TYYA 1VCNA 4BE9A 5CG2A 3QW2A 5CB0A 2OLJA 3E53A 3H4IA 4XX0B 2D06A 3MUNA 4RKRA 1KNXA 1MIHA 5JANA 1R8JA 2PKRA 2Q45A 2UVPB 3QF7A 2QDKA 2HHCA 3AZPA 1K6XA 3M5CA 4BLSA 3CZMA 4IUBS 4EBBA 2ZUDA 1X7DA 4NZZA 2AHRA 4UTNA 2AOWA 4CBVA 3I5XA 1DBPA 3PQ4A 1NA5A 2CLMB 2H2FA 3LVQE 2BFEA 5G02A 5FPYA 4V2UA 1J49A 2BGIA 2XB4A 2UV8A 4PNHA 5C7OO 1TRKA 1G1MA 3TCNA 3VU3A 1UPTA 2H54A 5KU1A 4XCVA 3SZMA 1GCIA 4MLDA 4N5NA 4A3SA 3NLLA 5KKAA 4RF4A 2E49A 1CF4A 1QZ3A 2P6RA 1UJNA 4DAOA 2R9VA 2QNBA 1W5EA 3HVJA 1N6OA 2A1TS 3TKLA 1X70A 1OF1A 1Q91A 2GD6A 4NNJA 1AQJA 2XADA 1YRBA 3UGJA 4DV1B 3KKOA 2W6IA 3H5NA 3RREA 3ZHBA 1JVNA 2BGKA 4REQA 4KGVA 4X97A 5DZSA 3WK5A 2PMFA 4DIMA 3JQFC 5JVDF 2FW8A 2QXYA 5CYGA 3PXGA 4OMCA 4MRVA 2CHQA 4O02B 2ZUSA 5GZ1A 1CUSA 1UXKA 2Y1XA 4JJ8A 2QV0A 4L95C 5DNDA 3TIFA 4C0XA 1U1DA 1BOFA 3KKKA 2ZETA 3I42A 1Q19A 3HDHA 1EZ1A 1OPRA 4QARA 3N28A 4M60A 1VL5A 1JB9A 1P80A 2O0LA 4QATA 4X6YA 2IV7A 3AQ4A 2HA7A 4D8VA 1QQAA 5LZ8A 2AKAB 2Q41A 3JD4A 4YIHA 1Y7PA 2AOVA 2FCAA 2H4WA 1PJTA 4XZ3A 5FPQA 3OLWA 2PO7A 2F1HA 2JCXA 4MUAA 3U37A 3LIIA 2CWWA 2QN7A 3DO8A 2JIOA 1TVKA 3RF6A 4X63A 2AB0A 4KK3A 3MWDB 4QU0A 2GEUA 3H8VA 1U2GA 2P6MA 4I08A 5G40A 3LFTA 2GPTA 3W4KA 4OQDA 3WIOA 4YCMA 4ZOLF 3TSCA 5C5CA 3SJAA 3SZGA 1I7SB 1EBUA 3N2GA 4LECA 5J58A 2DU8A 2H2AA 1YR8A 1SEPA 3G68A 1WAMA 4BN4A 4Y2VA 4PC6A 3U3MA 2OQRA 3DKRA 3QUQA 4AO7A 1DT3A 4RPHA 3S29A 2HT6A 9GPBA 5KNDH 4WZZA 2XBUA 2FSPA 1M73E 1HPLA 3OCVA 1TMKA 3KK0A 4N8SA 4WCVA 3NT4A 3L8ZA 5KYNA 3LWNA 4F85A 3TBHA 3R4VA 2GEBA 2JLAA 3MJTA 3PNKA 4GP9A 4BXOB 3PUIA 3I3OA 4EHFA 2X77A 1GG5A 1Z6GA 2Q4EA 4JVOA 4QGAA 4X20A 4BEBA 2WWRA 3ODPA 1L6IA 3OIYA 2ZDHA 3K09A 4I8XA 3LBYA 4R01A 4EX6A 5A3RA 3UJ9A 3CLVA 1SCIA 2Y1FA 4K9NA 5HP4A 3D1LA 4PHTA 1LI5A 3KJFA 3DQQA 4RWEA 1RMYA 3GRYA 1QGUB 3B5IA 3F7NA 2ZWVA 3OE7D 4HYQA 1KVTA 4JELA 4PYIA 4C4AA 2LP4Y 2IOQA 2JDIA 3IALA 4P7GA 4PE5B 2PTHA 3BK7A 4QEDA 4BB0A 3TUIC 3VFDA 1DCMA 2VT2A 4N6OA 3CY6A 3P9IA 1RLTA 3J81k 2IPMA 3AY0A 3IXMA 3NHUA 3F6PA 5B5SA 1BA3A 5CNJA 4Q21A 1D1TA 1JTFA 3TZEA 2FN4A 4CF7A 2JLWA 4C03A 3QXCA 2FPUA 3QJYA 2DHCA 2G0NA 4K81B 3PDIA 4M89A 5G3ZA 4EO9A 3CRMA 4K26A 4NCJA 5C51B 2ADOA 3F6RA 1ZG3A 5AVXA 4OXXA 3ZDZB 5I7RA 4TT8A 2C2WA 4AJHA 2BM0A 1DAHA 2V59A 3I5MA 3CM0A 4LJYA 4BRUA 1MG5A 5ES4B 2IX3A 3CUSA 3IVAA 5CFQA 1Y5LA 2O20A 3AP2A 4EENA 1GTJ1 1SPBS 2CMHA 3GFPA 4L6CA 2CNKA 5TY0A 1LJ8A 3AKYA 3H5OA 1XEXA 1C9DB 4EWLA 2PFSA 2QUKA 3A3PA 2PBFA 2QVBA 3BWCA 4O2RA 2MINA 7YASA 2RJ3A 2VPWA 1BMQA 3MBOA 2J4FA 3FPEA 3MINA 4Z8XA 5LVAA 1OIWA 1H2XA 2VK2A 4J7UA 1L7RA 1P7ZA 4M1WA 1FSGA 1KR5A 3WWOA 1QDLB 4LCEA 4YRZA 1G7CA 5D6OA 1T2CA 3H7AA 4FP9A 4CQLA 2JJ2D 5EC8A 3V48A 5H3HA 2C3MA 3CNEA 3LHSA 4XIJA 1GZ4A 3CNLA 4CI9A 2C99A 4ZI2A 2WNIA 1RPZA 4QDUA 1MC1A 3I52A 5E1MA 2I9PA 2VF2A 5D3ZA 3NGMA 1XAHA 1T24A 1TPYA 3COPA 5T8KC 4EG7A 4MS1A 1NNUA 3FCSB 3E84A 3NW9A 3CLRC 2VBIA 1OV4A 1SN7A 3CB4A 1RT9A 3ODGA 5AICA 1T3SA 1SA0A 3M89A 5HQ3B 3VU9A 1SNYA 3PEWA 1F48A 3UB3A 3MF4A 1VXOA 1Z33A 4OFZA 3V8QA 2AFVA 1U7DA 2J7PA 2P27A 2V7TA 2WINI 2Y0PA 3HDQA 2P68A 4INJA 2AI1A 3DUWA 1CZHA 3JTEA 3OUTA 4JZYA 4RD1A 1XTZA 4OEHA 5C8VA 2NXEA 2NSLA 2IH2A 1AS2A 2EDCA 1YB7A 4FX5A 4R5MA 4FZ3A 1OSNA 4J4BA 1II8A 3JAWA 2BE7A 2BMDA 3S7TA 3GCXA 3IIKA 4FXOA 4DG8A 3SFVA 4LQCA 3BCSA 1ESEA 4ZV9A 3GIWA 2E18A 1C2TA 2H9YA 4GZ5A 5G0SA 5KYTA 1SXJE 4TXLA 1JHVA 4IEEA 3HHPA 4B73A 3L04A 4EHDA 4DCCA 2LCFA 2XVXA 4EY7A 1J22A 3FKQA 2IW3A 2IXEA 2IYWA 5IJ0A 1RQXA 4FDAA 5A4FS 4FX2A 4IG9A 1M2GA 3KKZA 1S2OA 4N3GA 3F98A 1O08A 1U0GA 3ROEA 5EPUA 3WNBA 5BUSA 1U8ZA 4LZNA 3ZWVA 5BVHB 2Z8YM 2EQBA 3FJYA 1PV2A 2RAFA 2YYSA 2RAUA 1BE1A 1YA8A 3CUTA 3FPKA 1POWA 4M9RA 4BKMA 3DCYA 5CX1B 1RKXA 2UXDB 1U2DC 2PYZA 2JCSA 3EEYA 3NBUA 2J9YB 2YNMD 1E2NA 3HA7A 5AXDA 5AUNB 3VAYA 2YL2A 1PUJA 1VYHA 3K8YA 3L7CA 1R27A 3ABZA 4B3MB 4YI5A 2BFDA 4AX8A 2XWBF 5AK4A 3DYVA 3BGDA 1H23A 2QVXX 2RIRA 1X42A 3R3UA 1GHTA 1P75A 1DELA 1NW8A 1DC6A 1TKRA 2W2OA 3LKZA 2BEVB 3EQ2A 5EA2A 3SSOA 3KVOA 3X1KA 4RYLA 3SMVA 4W5JA 4UVHA 1NOJA 3C45A 2J5KA 4TWBA 3DHNA 4YP6A 1XHLA 2AH5A 2W6OA 3KYJB 3P2MA 1RTTA 1YQGA 2J0EA 5ITZB 3UAVA 3FROA 3DMFA 3LUPA 2KLHA 2OO3A 3LE8A 3CR8A 3IX7A 3PRJA 5CLJA 1GA6A 4JI1B 4V0OA 1LPOA 1L4GA 2C78A 3KEFA 2ERYA 5GGYA 2EYUA 1HE8B 1NJ6A 1IG3A 5CT9A 5D5QA 1B2RA 1ISFA 3KYDA 2XXAB 3AHFA 221PA 3CO5A 1FYFA 3L8EA 2P3LA 2P40A 3B51X 3GGSA 1VRWA 1Z7EA 2AOTB 2DWQA 4OMFG 2RHJA 3DOHA 1PGJA 4CUZA 1EXNA 3CF4A 3GUUA 3KEQA 1DJLA 2RGAA 2UZ4A 5B4UA 3I8XA 2CVFA 4QAJA 1E2DA 5F2OA 1BQEA 1IZ7A 2ZWOA 3EAGA 2QP3A 3LV8A 3ABOB 2Z8YA 1Q0SA 2BI7A 3E5MA 3NRBA 1QB7A 4IH4A 1G8HA 3X1YA 5JJIA 4X94A 2BKXA 1NBWB 3FCAA 1J2TA 4QDOA 3K70B 1CQJB 2Q2WA 4LYAA 2JA2A 5JBIA 1C8LA 4OQYA 4X00A 3BT7A 4A8PA 4LMPA 4UTOA 1S1CA 2SKEA 1Z2CA 3A4TA 5AHXA 5K6TA 1ZJ6A 1F60A 2QLMA 1HMYA 3BFKA 4IIVA 1MOQA 3TZKA 2EF1A 2FN3A 4D8WA 1G21B 4EY4A 3UHJA 3L1JA 2ZAGA 2UUOA 2QBYB 2IYSA 3I04M 4L8LA 4KQIA 1NPTO 1AH2A 4D4KA 1GEEA 4IDBA 1EXVA 3AY7A 2OAGA 3LVBA 3TQRA 4B4KA 3FUUA 2XZLA 4O33A 3H19A 2CCGA 4IVPA 4V39A 2IZZA 2F3UA 3O9ZA 1ECGA 4NJMB 3PXXA 3U17A 1K4YA 4MTCA 4BNWA 2F8TA 4CL3A 4JL8A 2O1EA 3P96A 3OX3A 3AHJA 3PUKA 2AEJA 3FPBA 1VLMA 4RETA 2CNBA 2R8EA 3G6WA 3W8DA 1Q1AA 1LWNA 3BXXA 3IQEA 4N5IX 5KMGB 5LP6B 3FYUB 4DPLA 3U39A 1E1KA 4IAOA 1S3FA 1UBGA 2FWIA 3S2ZA 3AVUA 4D26A 5FL3A 1HDYA 1PWEA 2BH9A 2Z58A 5IASA 4MI9A 2G1JA 3OJWA 3HO8A 4UVIA 2H31A 4PQYA 5LUAA 1A96A 2PX3A 2J08A 2C0CA 4EO7A 2YXLA 2VQFB 1OT5A 1DIHA 1X7WB 4LFCB 4OSEA 3UUEA 3PYMA 5HPYB 4F04A 4ZC8A 4QXMA 5AM3A 4JXKA 1C1HA 2W6NA 1YJ8A 2POQX 3NT2A 2QIOA 3CRW1 3JAKA 1E3QA 1OHHA 2HBQA 3HKBB 4P80A 2BONA 3VPDA 4BKPA 1F2UA 3UATA 1IE3A 2ZE5A 3J80A 1Y7LA 3OOHA 4QUGA 5DRYA 4UOQA 2V7PA 3VTZA 4LK2A 1XOIA 2Z6UA 1VTKA 1GZHB 2H17A 1FU8A 1H5QA 4DY4A 5FUYA 5KWEA 4RTQA 3KR0A 4NPHA 3QE9Y 1LV7A 4BUJA 4BVGA 3GGDA 1USIA 3R77A 3E27A 4YJ3B 5KU7A 1BKYA 3A1DA 4O4LB 1CULC 2IX9A 1PEAA 3K2QA 5JDIC 4CQNA 1IJKA 1U65A 3PC6A 4B74A 4BO8A 1X8KA 3Q12A 3JVDA 3QKRA 4MKZA 3R7LA 2EL7A 4HEHA 2X4IA 2Z1MA 4YV1A 4MGYR 4GLFA 4DA9A 3ZD8A 2J0UA 2H3HA 4LF9B 3HYSA 4EHAA 3I04A 4M55A 2CJXA 4JT9A 3VPCA 2VA9A 5B30A 1EX1A 2BW0A 2HJHA 3ZVKA 1KC1A 4NFSA 5T4EA 1QYWA 1WA5A 2BJVA 1E61A 1UP4A 5AHWA 2ET6A 2Q8PA 4FFOA 3NNNA 4AYWA 2XITA 5IDQA 2QF7A 1LLUA 1GUDA 4S1NA 3NOVA 5H9WA 1YK0A 2CL5A 4K8RB 2G63A 3I2FA 4HAZA 2VK4A 4S1WA 4RHFA 5FV7A 3AETA 1L5HA 3T9EA 3EVNA 4EVRA 3U09A 2OV2A 5JXIA 5JISA 2F90A 1Z73A 1YSCA 2I4RA 3ICVA 1US8A 3WKEA 3UJBA 5C8DA 1CS0A 4FKMA 4UZFA 1RDFA 3T52A 3RU7A 3FOWA 2WTMA 3VO2A 3ETGA 2DCMA 2WHEA 2OTCA 3JQQA 2V9ZA 1IM8A 2JW5A 1U7XA 1J8MF 1YZKA 3I6BA 4ADSG 1RYNA 2WDPA 2OGSA 4W1SA 1VKJA 4JK3A 4W6QA 3S70A 2W6PA 4QHSA 4E22A 2O3SA 4P3NA 3AL0C 5CVCA 4YP7A 3UAOA 3LCVB 3V2HA 1ZJWA 5DASA 1NAHA 3BWBA 3P0EA 2BYTA 5DN6D 5E2IA 1OH5A 3FTPA 2IEBA 2NUTB 3RHFA 2VRBA 1IHPA 1MFPA 1PLJA 1SQ6A 5EE9A 4C76A 1Q0LA 4RTOA 2CK3A 4WY5A 1ID1A 2JJ8A 2YCLA 3MTIA 4NENB 3KB8A 4BEVA 1YDGA 4N49A 5C9ZA 4V1CI 4K46A 1N1DA 3BIJA 2XUOA 1X7YA 5EHIA 5I9BA 1U3FA 4JR2A 4V1CA 4B0PA 1XCJA 2A58A 5L4SA 2IH5A 3CVJA 1O9BA 3R5XA 2FSVA 3BC1A 4TKZA 4BRSA 1D4OA 3IMKA 5TV2A 3HCAA 2MYPA 5HE8A 3EH2A 3HCRA 3QXGA 3WLPA 5EKTA 3ZGYA 4P2BA 2D5BA 3K7EA 1NT4A 5BSGA 1XMOB 1VHWA 4YR9A 1YASA 1YJAA 1YE5A 2NPFA 3AR8A 3SEAA 1R6XA 2WJYA 2GEVA 1TZ2A 3MQFA 3WIDA 3HBFA 1R9JA 4GR9A 1U80A 2ORIA 1FSZA 4YRIA 4LYFA 7AT1A 4GT1A 1BHSA 3MFQA 4L0CA 3BXOA 1N3BA 3C39A 3EYWA 2A0FA 4LK3A 1N5MA 1C0KA 1EPUA 4Z2YA 1O8CA 1P19A 2D0OB 3D81A 3FLBA 4PU0A 4BO4A 3FUXA 5I8ZA 4D79A 2IS6A 1H6DA 3K9WA 4ND6A 3FSGA 3TG8A 2FDRA 5KBYA 1S0UA 1AKUA 4X95A 1UQRA 1YCDA 3ZTTA 1CFJA 1NSTA 4OI2A 1QS0A 4ZI5A 4PAWA 1F0PA 4BO2A 1V9SA 4LJ7A 1W88B 3G9TA 3I4FA 1XNJA 1ZHHA 2O5RA 2DFNA 2ZJ3A 4BAUA 4F56A 3LTNC 1WBDA 1H6AA 4FLEA 4M6WA 3RSQA 3NRCA 5A2QA 1JWLA 2VDWA 3LM8A 2DTEA 3PFCA 5JVDB 3BWYA 2DUWA 2WIGA 3JX9A 3CF6R 4Q3DA 2FWBA 3ETLA 4Z9AA 4DADA 1NW3A 2VCEA 3D5TA 5H4HA 4F11A 4Y2SA 3B6KA 2VJBA 3AFMA 2W5UA 4JI7B 1MB3A 1N6RA 2CZGA 1U0FA 3IEKA 3N7TA 2C4UA 4MROA 3C8UA 1ODSA 3RS8A 1DKNA 1RYYA 1T36B 2IA5A 1RKQA 3G8CA 4KXXA 3UWMA 4K0KB 4Y2QA 2C5BA 2A92A 1FNSA 3CONA 3B6JA 3CCBA 3HUDA 1GN9A 3DBIA 4FQ7A 4LW8A 1XBTA 2GYWA 5CK4A 4ENVA 1FDVA 3JQAB 4E51A 4LE2A 3BXPA 4R0VA 2VATA 1BH6A 1X1BA 1JHAA 1DX9A 4RWZA 4ZA2A 2C7GA 4YJ2A 1ZSVA 2VYND 5FFMA 1GGJA 2I2XB 2NU7B 4MWZA 2R2GA 3GRVA 1V1MA 3GGCA 4KLZA 4CLOA 3VGPA 1CSEE 2BRUC 4Q34A 3ZYCA 1KRWA 3PF9A 1PK9A 3P9QA 1S6YA 4JLOA 1JEJA 2NXNA 1T5LA 2RBKA 4ZOLB 1G16A 5K8CA 3KJHA 3PFNA 4IXWA 4KQ2A 4NK5A 4X84A 4W5OA 4E09A 3U4MA 4EEKA 1SQSA 3IB6A 1VFPA 3KZKA 1P45A 2OSBA 2VDJA 3OQIB 3WGZA 5JY1A 1ZD2P 2NQ8A 2SCUB 1M5UA 1DKRA 5EEHA 1OILA 4J49A 1PZFA 3K4PA 1UZNA 4KO3S 4OQZA 3CUVA 4PNZA 2Q3LA 4WKPA 5CTAA 5CITA 1PVDA 4GQBA 1ABBA 1KDTA 5A03A 3KCNA 4OBEA 4DR3B 2C3PA 1UBOS 1NFQA 5TJHA 3RASA 3OCCA 2JHAA 3ZX4A 4BNNA 1SUIA 3DZIA 5C7LO 1E99A 5EHQA 4DXHA 4O59O 1M9NA 1N1MA 3WYEA 1MQSA 1P1KA 4BNKA 2OP0A 4G5QA 4CM4A 1N2HA 4F86A 4F4HA 3IEMA 2EOAA 4EYKA 2ZRBA 2E89A 1MR3F 1E3WA 3OH8A 5FNZA 4IO0A 5BOSA 2P1DA 3OAAD 3ASZA 3GQVA 3ORRA 2QZZA 1UC5B 1N7IA 3TQCA 3R3XA 1R0KA 3DV0A 3AR3A 4ZAYA 2WWWA 4H3HB 4AZVA 3G0CA 3H2GA 4DLBA 3SC2B 4ZTBA 4GNRA 4PYLA 3MTGA 2ZPAA 3ZYZA 4RULA 2HO4A 4RLFA 1R0XA 4HWTA 5DCUA 5AW2A 2H1RA 3V1TC 4EG3A 1IBMB 4ZK2A 3CRNA 5AJXA 2X0EA 1H0KA 1Y0BA 3C74A 3RSCA 3VVBA 2C4TA 1H3FA 2BSQA 3SS7X 4RJTA 3MN1A 5KTSA 2IYEA 4J91A 1GR1A 3TL3A 2XI4A 2UXBB 1AUOA 1KQPA 2GK6A 2PSEA 4G2NA 3QE0A 4H6XA 2CUTA 1YJBA 1TU3A 4ILEA 2J5BA 1GFZA 1QV6A 1M34E 1L4YA 2GN9A 1M1UA 3ZOKA 3RU2A 2PWPA 3TJZA 4ESOA 5B2FA 1TZMA 4DQVA 421PA 1JG1A 4PQGA 2D7DA 3EIUA 5DI3A 4JYAB 4PYRA 3WL8A 2Q3FA 2H1HA 1J0CA 5DNWA 1AC5A 3X1MA 1I01A 1NE2A 1M2WA 3LT4A 4ENTA 3HI6A 2J30A 1MDBA 3TLCA 2QNIA 4R69A 2J07A 2AC2A 5ECYA 3VPBA 4DMFA 1OZGA 2WBLC 4MUMA 3DAOA 3P4XA 3QMPA 4Q9JA 4BQEA 2ZZKA 3F6YA 2ZSEA 3ONEA 4W4TA 5FL7D 3LLCA 1OYWA 3D3WB 2JCGA 4DRXB 3ZK9A 2XTJA 4L5IA 1H2BA 1YFZA 3QX3A 5E7IA 3OG9A 4AZTA 4AWAA 3E58A 1JN0A 1FLVA 3OT5A 1G2OA 1PT9A 3K0KA 3SLGA 3DZGA 4M3NA 1ZN2A 2HWUA 5ADUS 2OBLA 1N2XA 2ZJAA 2B94A 1TK3A 2N42A 1TI7A 3EH1A 3GFSA 5ER6A 3FWHA 3SIRA 1NVTA 3B89A 1OASA 3CEAA 4YP1A 4OHMA 3C1OA 4QOEA 3WSTA 5IJXA 2C7QA 1N34B 1S02A 2V9CA 2UUBB 1E8NA 1JIQA 2AN5A 3A37A 3ZCPA 5HM6A 3IVRA 4OQEA 1NF3A 1Y9DA 3TOZA 3BM5A 1FQJA 4TRJA 4PHGA 4D25A 3AF4A 4GAEA 2XVAA 4RZQA 3SHVA 3ZE6A 4DDUA 4Z5XA 5JSZB 3L4BC 1C81A 2QGZA 1Z0FA 4MV1A 1C29B 4S2UA 2E5WA 4AMBA 4QHTA 3IB3A 1JPVA 2FSFA 3PP8A 4K87A 1Q20A 2VP9A 3TRJA 1J07A 5F9FA 1ETHA 2DQZA 4QQKA 3T5TA 2FAXA 3ANLA 4DPMA 4E4YA 3VHXB 2WU4A 4PINA 1I7DA 5CD1A 1K7EB 4I1YA 1X86B 4I50B 1HI9A 2RKBA 2FRXA 3TOVA 3GZ4A 1QO0A 4A6PA 3L0CA 2EARA 1E7SA 5JRJA 1C4KA 1QU2A 3CX8A 2YWHA 4QHYA 4Q1DA 1BFDA 3DZKA 3ZEAA 4EQ6A 1WDKA 4JL6A 2FDXA 4OGKA 5FEMA 4FM9A 3SQLA 4AKHA 3KXDA 2ZBRA 5L3VA 1SVIA 1FDUA 3DBHB 4DM7A 3V1MA 4EJ2A 1KYIA 1OWNA 5FR1A 5IWCA 4AN0A 3IAXA 4ZI7A 4DR7B 2XCLA 4XDHA 4MAMA 1ZAYA 1EEHA 1T3TA 4YREA 1Z2AA 2ZZNA 3KVYA 3UMMA 1P5RA 3LUDA 3DL4A 3IHWA 1ARZA 2JJ1D 1B15A 4ZODA 3B8EA 3WYBA 3O8QB 3QU4A 5EJ5A 3MT7A 3CX7A 3OLCX 4PCVA 3EZXA 3PC3A 3HY3A 2DR3A 2NVOA 2VRNA 2ZBUA 1O03A 4XSGA 6CHYA 2ZB2A 3QYFA 3EZ6A 4OFXA 1OXUA 1UQTA 4K6CA 3LYHA 4BOYA 4D9IA 2IQIA 1IEQA 4QM6A 4EPXA 4JJAA 1ZCJA 5KOIA 4YA6A 4RHCA 1IZZA 1JLSA 2PWAA 3ER6A 1HM5A 1CD5A 1DCFA 1DBRA 2OBXA 2QRKA 3UKJA 4M54A 4L51A 3EZNA 2VUUA 3OSUA 5DBIA 4BFVA 1XRRA 1FLAA 2B0JA 3AI7A 1UBRS 4M0UA 1NBMD 4PLFA 8OHMA 5JH7F 1QMGA 2WJ6A 5CB4B 1P77A 3FB4A 3G0IA 5TVGA 3EQ8A 1F6BA 1CUBA 2M6KA 1FJXA 4HB3A 2NOAA 1DO2A 1X7XA 2HHJA 1D8AA 3WKCA 2BELA 5FOXA 2X2OA 2YASA 2J0SA 3WGVA 3E82A 5ITWA 1GSAA 2RGGA 3SYLA 4MA5A 4ABYA 4TL9A 1VZ2A 4Y7CA 4ROSA 1N9KA 1R6DA 3ICPA 3ELYA 1QYVA 1RJWA 5MDHA 4XLTA 1Y80A 4B17A 5BWNA 4HPJB 1K8RA 1NBOA 3EMKA 3WX0A 1WXFA 4MMYB 5EWLB 2XJ4A 3EQZA 1REQB 1D0IA 5CVUA 4ARUA 4DCGA 5JC8A 1A98A 4NYIR 4G1CA 2IZ0A 3B1KA 5BW4A 3ZE2B 2A14A 3PHCA 1CZLA 3D5QA 2FPGB 3PZBA 3GC6A 5F73A 4ECEA 4IQFA 1IXYA 1XWFA 2MTBA 1TRHA 2GCIA 2ZRLA 3DDUA 4UMVA 4BMCA 4CCYA 2VT3A 1DRUA 1MPXA 4IJ6A 4N0PA 4QRHA 3WNQA 4NFLA 1UJ2A 1OFTA 4NMWA 4RTSA 4M22A 5TQ2B 2IL1A 4B3SB 4Z7OB 2IHKA 4B6RA 3DG9A 1K8XB 2JFNA 1DV2A 2XE7A 3C48A 4NBTA 4BJ3A 2VO1A 1SD5A 4DDHA 1H1LA 3C8MA 4E5PA 3WZLA 3QVWA 1W36D 2IUEA 3BRSA 5KYWA 4L9WA 1IBSA 4NOKA 3T7DA 1AMNA 4FGWA 2VTBA 3OZUA 4ALMA 5EZYA 3DLIA 3UAGA 2HC9A 2QYOA 3U7IA 1HTWA 3ZV5A 2XKJE 3LHDA 5FI1B 4UFOA 3MWFA 4JEMA 5EJAA 3BH6A 3NNSA 2BGLA 4FWBA 3EASA 4P3XA 3DS8A 1F6WA 4RA9A 1D7OA 3U4HA 1ZM2A 3OT1A 1P1BA 5E7MA 1EH5A 1UK8A 5KNDA 1E3JA 4NG4A 3CNNA 1DMSA 1MTZA 3OF2A 3PXCX 3W9YA 1RWXA 4EAAA 3U1BA 4GSLA 3B2EA 3NX4A 5A9SB 1ZH2A 1IDN1 2PLFA 3C6YA 3CF0A 4HQ6A 1OREA 3Q0IA 4ITUA 1GT6A 3BXGA 3LDFA 1GPJA 1P7VA 5ALEA 4JXXA 3GMTA 4P36A 4B71A 2PUWA 4US1R 1KAHA 4J0CA 2EW1A 2R4UA 2WTAA 2W70A 4CDNA 3AUUA 4WESB 1IM2A 2CXTA 3BPSA 3NBFA 1XZLA 4RGYA 3ESQA 2ZCUA 3A10A 3B7PA 3NORA 2P5UA 3Q15C 2UZAA 3CJRA 3PS9A 4M37A 4YLEA 4HTFB 3A6PC 2XAAA 3WTBA 3C15C 4PWZA 1SD1A 4DA0A 2HCFA 1PFYA 2A1TR 3T7KA 3IAM1 3N2KB 5TDHA 4C0AC 1RXUA 4CTOA 1OH7A 2VPPA 3SMQA 3EGXB 1AK1A 2F00A 5REQB 3ZUGA 3WAGA 4KSCA 2GAJA 3QXSA 3EODA 5EG5A 5TGZA 1I3OA 3V4ZA 1R0CA 2XVYA 2YMMA 2QRLA 3GT4A 4E2WA 1OYVA 2KHZA 5CEEA 1QRUA 2EFCB 3I01M 1XD2B 3U4IA 3V1KA 1MNQA 1FUKA 2OA0A 5C8XA 4D4IA 3GZNA 4LDNA 3O47A 3GZTB 1N5KA 1ZM3A 2ECKA 4C04A 2XT0A 1T4CB 1UEIA 2P77A 2GF9A 4NCIA 4REMA 1RYHA 4QYMA 5AVOA 5TF0A 3RYFA 1D8TA 2DPGA 1FMCA 3N8DA 1M6NA 4LF6B 4OYYA 3OPYI 4NLLA 1CVRA 4QPJC 5LP1A 3L7LA 4DWWA 3C1TA 5BXYA 5JZSA 3FDFA 3OJEA 3E81A 2CD9A 2HN9A 5DM4A 2PFGA 3DVAB 4BFZA 5JQGF 3ZHSA 4C6RA 4KYTA 2C83A 2DJIA 1PUIA 2Z8XA 1ZIYA 4JOCA 3NIDB 4DSZA 4RPGA 2X6QA 1LTHR 2FQWA 3FCXA 4LYGA 4R9VA 4BWYA 4EKDA 4YRPA 2QD1A 2JATA 3I2KA 5E1OA 2XLCA 5EL0A 1I7QB 1J99A 3NBYC 5HBGA 3GPIA 4MW2A 4HH0A 4BFSA 4N18A 4KQEA 2VHCA 1Q11A 2C8JA 5EIHA 2G08A 1UUFA 1PZXA 2XYGA 5BR1A 4BGVA 1Q44A 5LB2A 4Q93A 3B6EA 4PZ0A 4RSHA 3K16A 3CZ4A 3GX1A 4FILA 4PS0A 1YS1X 1ESDA 2A3NA 2OGZA 4GGOA 1RJ9B 1GKKA 3EXFA 4GMFA 2REQB 4PXYA 5CLHA 1E4YA 3K70D 3AVTA 2AX4A 3AP1A 5A3SA 1BQ3A 2X9QA 4DGSA 1AUXA 1ZIXA 1V5GA 1GQSA 2FFAA 3CS3A 1KI4A 4HMOA 5TMBA 3MYYA 4GOLD 1XEAA 3TRIA 4IZIA 1Q1GA 2P75A 1FIUA 4EPRA 3PCRB 5HMMA 4GD3Q 2X1HA 2XDAA 4ARIA 1MJFA 2HQOA 2BRUA 2ZAOA 1TM3E 2PZGA 4QBTA 1PYOA 3VR6D 3MPOA 2V65A 4ZQBA 5FORA 3MJDA 3WL4A 1Q2UA 4ARSA 2A5JA 2CYCA 2ECPA 2IBTA 3I01A 3B38A 3ZV3A 5IVDA 1QDUA 2MOKA 3OMLA 4HNVA 3COYA 4EUKA 4KVZA 2Y67A 4LYYA 3X44A 3AW8A 4P0QB 4M1ZA 3QVKA 1XKQA 4MR7A 1SQ5A 5H7XA 4LVCA 4B33A 4PZ9A 4LOAA 4KSBA 2C2GA 2Q9UA 2F4NA 2AMYA 3GJ5A 3WLOA 5HIJA 4G1EB 3OECA 1N6HA 3PSAA 2LDXA 1B76A 2YHUA 2HRQA 2VHZA 2XX3A 3GLQA 5HF5A 3R0VA 4PHFA 1MB4A 3UWSA 2WICA 2W6JA 3GWZA 1Z4OA 3R24A 4PSCA 1NVWQ 3KDAA 2IYNA 4PZLA 1V3VA 3ZIUA 4AZ3A 4D82A 4KBYA 5ER9A 1LK5A 3CNQS 3FZQA 1XMPA 4P4TA 3ZCUA 1IPFA 2VT7A 3IQXA 2YIVX 4K9DA 2GCGA 4ZYVA 4UUQA 2BL4A 4KXYA 4J3NA 3THSA 4MP8A 1ENYA 1NKSA 2WRZA 2JLCA 3AF3A 4XWAA 2W0SA 3VTFA 3DHVA 3HFJA 3W9BA 2IUFA 3FUCA 1DRJA 1VOTA 3JRXA 3TVTA 4DZZA 2FSSA 4E6PA 2XF8A 5JCZA 3K9CA 2D8AA 2Y9PB 3ZJVA 3L7JA 3PR1A 2H4YA 2A5GA 2O14A 2LV8A 4NPCA 1P9NA 3ASVA 3F8SA 5SZJA 4R8MA 4QKQA 2A0KA 4QTYA 2O0MA 2GWHA 2X0JA 1YO6A 2G9ZA 5IUNC 3EX7C 2PG3A 4F21A 4G0WA 4ZQIA 5BWLA 4IS3A 1ZU4A 1HSZA 4CIDA 4E2FA 3S99A 1TFUA 2X3FA 3SLRA 1C3XA 3WB9A 1RXIA 4RH3A 3OF5A 4NX2A 2VF5X 4P7BA 4S35A 5JLJA 5KDOA 3ZDDA 4JGIA 1YR6A 5LYJA 4CG0A 1SVSA 4OIMA 4P6VF 5J47A 4ZJPA