3JQ8A

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and inhibitor 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine (dx3)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
247
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFARQSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase 1
molecule tags Oxidoreductase
source organism Trypanosoma brucei
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
total genus 95
structure length 247
sequence length 267
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2009-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3jq8A00
3JSAA 5BNIA 3GPIA 3KYBA 3IJPA 4F45A 1VJTA 3PHLA 1ADCA 4WLOA 4BNUA 2PD4A 1IUKA 2QIOA 2UVDA 3DFZA 3PIDA 1IZ0A 1I01A 2CDCA 3QLJA 4BNJA 4LVCA 4DA9A 4BKUA 3WX0A 1P1RA 3FHLA 1UH5A 2V6BA 2EW2A 4NMHA 4ALJA 1VM6A 1DRVA 3DOJA 3IUSA 4XEHA 1R0SA 1PQPA 3BMOA 3WSWA 4OOFA 1O8CA 4AICA 4E33A 3GPDG 3V1TC 4CM4A 3JQ9C 2IE0A 3HDQA 1LI4A 4XYEA 3GDGA 2XAAA 3DOOA 2Q1SA 3I1JA 1HETA 1UDAA 4MINA 1YVEI 1LNQA 4XD2A 4BKPA 4JIGA 3F5SA 4XCVA 3WGYA 3DHYA 2EEZA 1BRMA 3DZKA 4FDAA 1EK6A 1YJQA 5DNAA 1JWBB 3PZBA 1TB4A 2P5UA 1IHXA 2A92A 3MJEA 3IKVA 3LT1A 4IDDA 4YEDA 3QA9A 4CM1A 4EITA 5TS3A 1N9GB 1X1TA 3E8XA 3RBZA 3VHRA 3QWAA 3G79A 1M67A 2Y1DA 4KZPA 5G2OA 4I08A 3PRJA 2BRUA 2WJPA 3Q2KA 5B37A 4RPLA 3V5NA 1I3NA 1LLQA 2O3QA 4RPKA 4BNLA 1EUCA 2P4HX 4WCFA 5DP1A 1T4DA 1LEHA 2J5KA 2QZ9A 5ICSA 2D3TA 5DULA 2AG5A 1I8TA 3ONFA 4D3DA 3DR3A 3VVCA 1SB8A 4YT5A 1GL3A 3U4HA 4IJUA 3K5PA 1BW9B 4BUCA 5JDCA 1DIHA 4XJSA 1VC2A 3LDHA 4FS3A 1JTVA 3HB5X 2GDZA 3UFXA 4CV1A 1DC5A 4RQTA 4H3VA 1MB4A 4R1SA 1PJTA 3RBVA 1Q0QA 1MV8A 1HDCA 1E1MA 1LDMA 1YDEA 2Y68A 4GVLA 3RQSA 4J9VA 3EVNA 1NP3A 2OXIA 4TSKA 3ZV4A 2PWZA 5A9SB 3WIEA 1PJ4A 1R0LA 1OFGA 3L9XA 1G6KA 2J3HA 1WXDA 4ILKA 3ZW8A 2AE2A 2VQ3A 1UJMA 1N5DA 4BNNA 1HEUA 2W98A 4M1QA 3QVOA 4RPJA 4BB6A 3UKOA 4HBGA 1VE9A 4JN6B 1NWCA 4WLEA 4BO7A 1FF9A 1Z73A 3O38A 1N8KA 4IINA 1B3RA 1E3WB 2FY8A 5A05A 3QP9A 4GMGA 4JK3A 3W8EA 3L77A 3RJ9A 2XXJA 4HFJA 4DYDA 2VRBA 3RU7A 3TOZA 3UICA 2DFVA 3ZU5A 3G49A 1PQWA 1M66A 1YOVA 1FXSA 2WYVA 3NEPX 4LCEA 4TRJA 6LDHA 1P1KA 3H65A 9LDTA 1BMDA 3DMYA 2NLOA 3AFMA 4PN3A 3PJDA 4RQUA 1ML3A 4J1TA 4DPKA 1GUFA 3RUEA 5T5QA 3V1UA 4IDEA 3ZH2A 2ZQYA 2OBNA 3BTSA 4R54A 1J4AA 2Z1MA 2XF8A 3O8QA 4MVJF 4INAA 4Q3CA 2C0CA 3IQDB 3ADOA 2ZB7A 1EUDA 5I9MA 5KJCA 1JKFA 1VJ0A 5DP2A 2X6TA 3ICCA 3HSKA 4J4BA 3BMCB 2X22A 3U3XA 2X9NA 4NNJA 4FFLA 3UHAA 3U4CA 3I9MA 4CM7A 2JHFA 4RLHA 5EPOA 3LF1A 2EXXA 1JWAB 1F8FA 2I3AA 1LDGA 4YT4A 1LRLA 3JQDA 1QXSA 2WTBA 1XHLA 5MGBA 1MXFA 1NWHA 2HRZA 1XU9A 2GZ3A 3WR5A 4A7PA 1MC4A 2DBZA 4GMFA 3WGZA 4BQRA 3ZV3A 3JCZA 3CZRA 3MZ0A 1CRWG 2UDPA 4IGFA 5JLAA 5KJ6A 1MGOA 4AJPA 4GGPA 1T26A 2RH8A 2HK7A 3GEGA 4R5HA 1NAIA 2AQKA 4CODB 3DZBA 3GG2A 5ADHA 4IIVA 2G82A 3W4JA 3OQBA 3QY9A 1VL6A 1TXGA 1LDEA 1JAYA 2EP7A 1DLIA 3H2SA 1CERA 4DXHA 3PFFA 4WECA 1O5IA 4TROA 1C0LA 3KSDO 3IKTA 4WCFC 1YS4A 4YR9A 2HQ1A 3WBBA 4CM5A 2YFHA 2IZ0A 4CV2A 5EQFA 4Z9XA 3GGOA 1YB1A 3RFVA 4KUHA 1YQGA 5FF9A 4B8ZA 4J90A 2FPGA 2P9EA 4OSPA 2PLAA 1UXGA 1PEDA 2P9CA 5G4KA 4CV3A 3O8QB 3PTZA 4DC1A 1IL0A 1LC0A 1HE3A 1DC4A 1NQTA 3HHPA 3JTMA 5CDUA 2ZTMA 3GH3A 3M1LA 2YHIA 1C1DA 2YZ7A 1VL0A 1VPDA 2EJWA 3AU8A 4XX0A 1DJNA 4EZBA 4P38A 1GPDG 4Y6PA 3PWKA 4MP3A 4JQCA 1EVIA 2OUIA 4XA8A 5BNTA 4K1LA 2PNFA 4FJ0A 3BXXA 1NX6A 3I83A 4FCCA 2JFFA 3TL3A 3KETA 3MJSA 3WYBA 3GZ4A 3D3EA 3D5QA 1PWZA 4L0QA 2DTXA 4IQ0A 2NQTA 1GAEO 1N1GA 1CWUA 5T67A 1ENZA 4CMJA 3AUSA 2D4AA 3W4IA 3V2GA 1I24A 2EGHA 1AGNA 2NQ8A 1ISFA 3WGTA 2CZCA 5L4LA 3OJOA 5CHEA 2H9IA 1JKJA 3D64A 3PYXA 2VRCA 1D7OA 4YCAA 3LYLA 4Z3KA 2JD0A 3N58A 2HCTA 1LDYA 4CM3A 4W7IA 1XG5A 1U3TA 1A9ZA 2ZB3A 1ZBQA 3DBRA 4OQZA 3WGIA 1CF2O 5L40A 1YL7A 3BTUA 3MJVA 4B7XA 4ZICA 4IDFA 3QJ5A 3EDMA 3U9LA 1VI2A 1OC4A 2WD7B 1E7MA 3ST7A 3VH3A 1G0NA 1X7GA 4CLRB 3PQEA 3RD5A 3UF0A 5BQFA 1IULA 5L7TA 2WWRA 2VUSA 4YRBA 1RM5A 4UVIA 2E4AA 4BO3A 4BB5A 2QRJA 1EK5A 3WTBA 4NJOA 3A06A 4UVDA 4YAEA 1C1XA 1DFHA 4J9UE 3BMNB 2RHRA 5GMOA 3VDRA 4AJJA 4YYZA 4N18A 2EKLA 3QSGA 4R16A 2ZK7A 2Q46A 4J6FA 4RF3A 5F3RA 5JNLA 3RI3A 2IDZA 3FWNA 1Y8RB 4YQZA 1ADFA 3GHHA 4ALIA 1F06A 3I23A 1NPDA 2PGJA 1YXMA 3HFSA 3PJEA 1PS9A 1UDBA 5A5FA 5G0TA 3FN4A 4ZRMA 1RPNA 1K6IA 1DC3A 2O2YA 3WFJA 4K6FA 5ITWA 1DSSG 3AFNA 3DBLB 3NTRA 4EUHA 4CLRA 4GX0A 4NU5A 2B69A 2IEDA 4WJZA 1GEEA 2DFDA 3E1KA 2W2KB 2CMDA 3NDJA 4IS3A 3V2HA 1SEVA 2G0TA 4R3WA 3PQDA 4DBVO 3JQBC 5G0UA 3UGKA 2VOJA 2JFGA 1DIGA 2VTEA 1DIRA 3AW9A 3FNEA 4YJGB 3S2GA 4ZQFA 1PS0A 3CSDA 5G0SA 1E3IA 4JXKA 3AY3A 3AI1A 4TZTA 1U4OA 3NGLA 2D5AA 1GD1O 1W8DA 4XIJA 1GDHA 4DMLA 4II2A 1LDBA 4ZQEA 4Q3NA 1B26A 3GA0A 3ABIA 4FFPA 4KQWA 2EKPA 3RUCA 1I2ZA 2B83A 3HDHA 1PJCA 3ZW9A 4EJ6A 2X8LA 4IPTA 3QWFA 3FSRA 1PGQA 2O3RA 2F1KA 3W8FA 2EF1A 2JHGA 3KLPX 4BO4A 1QMGA 3EC7A 3FD8A 3O26A 2GD1O 2H5LA 2ZB4A 3WTCA 4LVUA 1NFRA 1GV1A 3DZJA 3ITKA 4IM7A 4CLDA 5FWNA 1VKNA 2X9GA 3BHMA 3U4IA 1DHTA 4L9RA 4UUPA 4EW6A 1E3LA 1LQUA 5DBIA 1V3VA 3Q11A 4W99A 3RBXA 3AUUA 3BYZA 3P5SA 3UOGA 3QVWA 1KVTA 1T2AA 1R4NB 2FZWA 4E5MA 4RLSA 3HADA 3DDNA 4W82A 8ADHA 3RC9A 2NSDA 5K6AC 4ZD6A 5L45A 4YAJA 3WBFA 5KVCA 1MXHA 2EGGA 2DC1A 4FOOA 1A9YA 2FPIA 4KWIA 4RPHA 1C3VA 4AJIA 1EUZA 4U0KA 1LJ8A 4N5MA 1EEHA 3UCFA 5CDTA 2O50A 2O23A 1HYHA 2DVMA 3UN1A 4B8WA 1PJBA 2YDYA 3BTOA 3DFUA 4YA6A 4YBZA 3ZWMA 5AXDA 4U7WA 3FNHA 4ZU3A 1YBAA 2WSBA 1E6EA 2VT2A 3KUXA 3GGPA 4ZN6A 4MP8A 1KEVA 1PL7A 3ZHBA 4GLLA 4ZQGA 2NWQA 3IUPA 3WYEA 1MG5A 2BMAA 4IY1A 5KVVA 1E0DA 4MP6A 4R5MA 4YJDA 1P44A 4FN4A 2AE1A 3F5QA 3WLEA 1O0SA 3D7LA 3QWBA 4II3A 2ZIZA 1MC5A 1YONA 1U5AA 3GN2A 3AJRA 3LLVA 5EINA 5JBIA 3G3EA 1XGKA 3PP8A 1QKIA 1C0IA 2NU7A 2G17A 5I7VA 1F12A 2H63A 2C5AA 4MDHA 3JQBA 3OQ1A 3W6UA 5IJZA 1ZO8A 3VPHA 1H2BA 2VN8A 4AG3A 4WCDA 1E3JA 3I5MA 4RORA 5DBFA 2EJVA 3GT0A 2DPGA 4XR4A 1V8BA 4D46A 2NUAA 1ZH8A 2HK9A 4D79A 3RAJA 2P5YA 1DC6A 4WEQA 3TDKA 1X15A 2BKAA 3RUIA 2BELA 5G0WA 1JKIA 2FN7A 2PR2A 2O3SA 3DMTC 3GVCA 5EIOA 4D41A 4CUJA 4GL4A 2YV3A 3PI7A 4ITUA 4NBTA 3GAZA 3K9QO 3OIFA 4J16A 1HWYA 1CYDA 5COQA 4FJ2A 1UAYA 1ISHA 3Q9NA 4EYEA 3U4DA 4IJKA 3AY6A 1LSOA 3VDQA 2PZLA 1NBOA 1U1IA 4YB8A 5B1YA 1LSSA 4DIBA 3MTGA 3PFWO 1KETA 4QO7A 5TC4A 5L7WA 4J43A 1LTHR 2JD1A 4BKRA 1R4NA 4YWJA 3KVOA 4KTTE 4TQGA 5B4TA 1FDVA 4JP3A 2VZ0A 4UVEA 4DQUA 2BHLA 4J0EA 2VWHA 3I3OA 3RWBA 3ITDA 3K8ZA 1CQJA 1Y7TA 5ER9A 1SB9A 4PLWA 3JQ8B 4XQGA 5JC1A 5A3JA 1ZFNA 3G1TA 3L9WA 5JYEA 1SOVA 3H6KA 1AN9A 2OO5A 5KKCA 2I66A 3WWZA 4RF5A 4B3IA 1M6HA 3JYQA 3QWHA 4UUMA 2PD6A 3WSVA 3K2EA 4NHEA 4H7PA 4CMKA 1OAAA 4FD3A 1H0KA 4QXMA 3E18A 5ES3A 1TLTA 1YRLA 3T7EA 5BT9A 3S2EA 4BO1A 3BMNA 4L76A 3AOEA 4GX5A 4DPMA 2ZB8A 3KXDA 4PG5A 2P91A 2I3GA 2X58A 5JC8A 4O63O 1XEAA 5HTOA 4E2WA 2Z1NA 4FB5A 3RASA 1KBZA 3D5TA 2X4GA 4XJTA 1X13A 1E77A 1GPJA 3BZUA 4L8VA 3LC1O 1BXZA 1WP4A 9LDBA 4HXYA 3TJRA 3FCOA 4DIOA 3SVTA 2HMTA 2RBEA 4WGGA 3AY7A 1ZK4A 4U6QA 2GZ2A 1TA4A 1P1IA 3JD1A 1OZAA 4HV4A 3EW7A 3JD4A 5FI3A 4N54A 1KVUA 3ZWAA 3NAQA 1JLLA 3E82A 3TL2A 3WGQA 1DXYA 2VRCD 1NTOA 3JYOA 3UH1A 4CMHA 1K2WA 4BQPA 5B4UA 2Y0CA 1A7KA 1UP6A 1UZLA 4ONEA 4N5LA 3NKLA 3HUDA 1A72A 4TRMA 2VWPA 5IZCC 3A9WA 2BH9A 3E9NA 2FZEA 1KC1A 4BNZA 5BR7A 5CDYA 1PQUA 1Y6JA 3I9JA 3OIGA 4PLGA 2IODA 4KDEA 2ZKLA 4UAGA 1RJWA 3T4XA 2W90A 4W6ZA 4KWHA 3V8BA 3DBVO 1PJ2A 1H94A 1LLUA 1QYXA 2GR9A 3AUAA 4R51A 1KY4A 5JO9A 1B8PA 2X9VA 5A4DA 2X5JO 4UULA 4DTIA 1GCOA 5K6AA 4RVDA 2I99A 4JJIA 4W9NC 1X1EA 5TGDA 3T4EA 3QHAA 2ZJ1A 1DRWA 1ZEMA 3RFXA 4BO2A 2GSDA 1HDGO 3FTNA 4R9RA 5KJFA 1ISGA 3F4LA 3BTVA 1P33A 1GADO 1LUAA 3VZQA 5CG1A 4PG7A 2HJSA 3ENKA 2WYWA 2OZPA 4XWYA 2R00C 3LT2A 4CLHA 4FPXA 2ZTUA 3FR8A 1J5PA 1F0YA 2CDAA 5F21A 4HKTA 4I9UA 1P9LA 4Z6KA 5AXBA 5KWEA 4OSOA 1GZ4A 1I5RA 2FRDA 3GVPA 4R1NA 2VHZA 2OMEA 4IS2A 3SJUA 4BGEA 4KUGA 3CTMA 3GVXA 2I67A 3X2EA 3SX2A 4ALMA 1NHWA 2I65A 1PGNA 3QV1A 2JKVA 1HYGA 1I2BA 2J5RA 2IZZA 4K26A 1HRDA 1LDNA 4CQLA 2YHIB 1O94A 4LMPA 4QQRA 1ZSVA 5THQA 5DOVA 3CMCO 4J1SA 3TZKA 1DHRA 1EFLA 2BFPA 1M76A 7MDHA 2ZCVA 2EG9A 4LRSB 4OGWA 4BNTA 3HZZA 4FJ1A 1VSVA 4HFNA 6ADHA 5GZ1A 4EBFA 5KVSA 1OMOA 2C20A 3I4FA 4XYMA 5JDIC 4HNGA 4EEZA 4YAIA 1NVMB 3Q1LA 2D5CA 3JD3A 4RF4A 4CJXA 1QR6A 5C3MA 2YHUA 3OETA 3DONA 4OH1A 3IP1A 4WK6A 1GUZA 2P2SA 3VH1A 4LMRA 1FJHA 3SC6A 3DZHA 5BSHA 3RROA 4OIMA 1ZXLA 4PZDA 3NV9A 4QFDA 1KS9A 5G0VA 1I0ZA 5C7IO 4PCVA 2YY7A 4PG4A 3MJ4A 1ID1A 1DO8A 1GQYA 3OJFA 4OAQA 2Z95A 4BNIA 1E7YA 2C29D 4GKBA 4BO5A 1B2LA 3DZIA 1EQUA 2VYVD 3TRIA 3MJTA 2NV6A 2O3TA 4RPGA 1MG0A 4BO6A 2CY0A 5EESA 1T2FA 1HL3A 3HN7A 1JVSA 4LW8A 1LXCA 5F1OA 4AJNA 5I7EA 2GYYA 3EYWA 1HE2A 3H9GA 3QWIA 4UEOA 4GGOA 4NJMB 2OOSA 3M2PA 2UYYA 4MKZA 1EE2A 5T6BA 4RJTA 3DAPA 1BDMA 4UUNA 4AFNA 2Q1TA 4FGSA 3RC1A 2J3JA 2WD7A 2Q4EA 1DJQA 1ZEJA 3CUKA 2YQ5A 3GGGA 1JVBA 4FFOA 3JYPA 4OQYA 4D0SA 1ZIDA 5A9SA 5AQ1A 4RF2A 5CAEA 1LLDA 1W4ZA 2HO5A 4TKLA 5EQDA 4E0BA 1U8FO 4RDIA 4Z9FA 4XRGA 2NTJA 5THKA 5TSDA 2YV1A 4XDYA 4D42A 4FFRA 2CVOA 2QZZA 4Y6SA 3SEFA 5IN4A 3DTTA 5L53A 4XZ3A 3VH4A 3PWZA 4WLFA 4FGWA 5DN9A 5TNXA 1NPTO 3WIDA 3ZN2A 2YJZA 4BNWA 3GMSA 1Y8RA 2DBRA 3NUGA 3FPCA 3ASUA 1TVEA 5AVOA 5A9TA 1I2CA 1PZGA 1YOVB 2DTEA 3F4BA 4M54A 3ZCXA 1TT5B 4UVHA 4A10A 2G1UA 4URFA 4D7AA 3INTA 4JGBA 3IIEA 3KBOA 2H6EA 3JQ9A 1V6AA 4PG8A 1NVGA 1ZK0A 4KOAA 4O6VA 1C1DB 2CF5A 4YJFA 3K6JA 3ZHZA 4FOSA 1EFKA 2Q1WA 1GQ2A 2VHWA 4RO0A 1X7HA 4XQ9A 4ND1A 4FFNA 3ZU3A 1HXHA 4I5FA 1IPEA 2OBYA 3VTFA 5G4KB 4BKOA 3DAFA 5JCXA 5AXCA 1YB5A 2BI8A 4PG6A 3OICA 2OGUA 3TNLA 5EL0A 3WB9A 3FWZA 3C1TA 1DBVO 2HAEA 1N7HA 3SLKA 4CMBA 4OXYA 4E2YA 3VZPA 3LT0A 1ZK1A 3TZHA 3ZNQA 1SZJG 4QEDA 4RVUA 5A04A 3TN7A 2OP0A 3ETGA 2TMGA 2Y1CA 3GLQA 1YL6A 2HU2A 4WNCA 1D4FA 4NPCA 2HUNA 3NTOA 4P4GA 3COSA 5G4LA 3S2FA 4AJOA 3GEDA 5KJ1A 2GN4A 1IPFA 1VL8A 5BSFA 2BFMA 3BIOA 2A9FA 3SXPA 4CM4B 3STHA 3D3WB 3PXXA 1WDKA 1Y9EA 1LA2A 1XIVA 3GDOA 1NR7A 1Q0HA 3Q6IA 4DLAA 1HLPA 1SC6A 5H81A 2WE8A 1SBYA 1E6WA 4JROA 1PZFA 1QYCA 4PRLA 3U62A 3X2FA 1K0UA 3R6DA 4XQEA 2D2IA 3AOEC 4IZHA 3WICA 4I9NA 3NJ8A 3ANMA 4C7KA 4FC7A 1UZNA 2AMFA 3ZHXA 2Y1GA 1UXKA 1U2GA 1DAOA 2Y99A 3OJ0A 2JCVA 4OOEA 4UEJA 4F6LA 3U5TA 3QRWA 3HB4X 5TF4A 3NRCA 5CEEA 4LSMA 2X0RA 1NM5A 1EVJA 4YAGA 5KCZA 2AQ8A 1BSVA 2PK3A 1NQAO 1GUYA 1H9AA 3ADPA 3RUHA 2AG8A 4PLVA 2R2GA 3DZGA 1S7CA 2ZATA 1M6WA 1CETA 1O6ZA 1XQ1A 3B1FA 3VPFA 3AU9A 5FEUA 1NYTA 4O0LA 5J23A 3ZU2A 1ZSNA 1BG6A 2UUPA 4F3YA 3DEYX 3CMMA 3HNPA 4P22A 4RGBA 2RH4A 5AXAA 2E6UX 1H6CA 4LSWA 4ALNA 3P19A 2TMDA 4I5EA 3E9QA 1PL8A 2LDXA 1PGJA 1LC3A 4ZA2A 4JLWA 4PZCA 5U1PA 3RC7A 4LCJA 2NVBA 3DC2A 3FRJA 4WLUA 4RVSA 1NQOA 3TSCA 4YVFA 3TZCA 1E6UA 2QRLA 4EJ0A 3FNFA 5GZ6A 4RZHA 2DBVO 2VZ9A 4H16A 1JAXA 4CMIB 4Z3DA 4R41A 3RJ5A 3K92A 4E32A 3WDSA 4AJLA 4CLXA 5ICMA 3D4PA 3BMQA 4TRNA 3VC7A 2QG4A 4M87A 5JAQA 1ZSYA 2PKQO 4MVJI 3ZWWA 1K6XA 1Z7BA 3QVSA 4B79A 4CR7A 1HSOA 1VJ1A 1KY5A 1K3TA 4NFHA 4YJFB 4CM6A 4HP8A 3VPGA 2GASA 1OI7A 3NGXA 3JQFA 5CPFA 3HWRA 2V6GA 1U3WA 3R0IA 4IXWA 1EDZA 1BHSA 2GRAA 3O9ZA 3L4BA 3TZ6A 1PR9A 3GNQA 4BV9A 2VYVA 1PJQA 2IYOA 2QYTA 1FDSA 4O1MA 2E48A 2OP1A 1IYZA 2X7HA 4Y9DA 4QO8A 4WE3A 3I4CA 1SMKA 2J3IA 3A14A 3CXRA 1QYVA 2V65A 4DQXA 5HM8A 4BV8A 3PZRA 3WWYA 2DTDA 3C3XA 4FC6A 4B3JA 4PLFA 5BSEA 4BNKA 3CE6A 4LGVA 1ISMA 1R6DA 4OKNA 2R6JA 5DDIP 1Z6ZA 5F5NA 3OP4A 1ARZA 3WYCA 5AOVA 3PJFA 1Z75A 4AVYA 3Q0EA 5LCXA 1Q7GA 1N9GA 3G0OA 3AI3A 1HDZA 2VT3A 2PGDA 3EZLA 1IOLA 1YO6A 3KSZO 4CLOA 2ZYDA 3W4KA 1T24A 3H5RA 2Y0DA 1ONOA 3KHUA 4IJVA 5TJ9A 1C0PA 1NQ5A 2DU8A 1YQXA 4A0SA 1AXGA 3KB6A 3L4SO 5B4VA 3OJLA 2BGLA 4Y67A 2CUKA 4BNFA 1D8AA 1Q1NA 4M49A 3WFIA 1ADGA 4CMIA 3MWDB 2HK8A 3KSUA 4YRDA 4WOJA 4DRYA 1MP0A 1ZJYA 2HDHA 1D1TA 3ASVA 4I5DA 3GZNB 1A71A 3EAGA 3LLSA 4R4JA 4MO2A 5IDXA 5MDHA 3PHGA 2HSDA 2FR8A 1Q7BA 1XU7A 5DBGA 4IQ8A 2ET6A 2Y05A 4JBHA 3RCBA 3JQ7B 2AHRA 3ZWVA 1NHGA 5KOIA 5LDHA 4BNVA 2R00A 3JQGA 4E5YA 1QLHA 4ZRNA 1LBEA 3JQAB 4O5OA 1R4MB 3GAFA 5DCUA 1B15A 1GYQA 3EY4A 3GRKA 3O03A 4NQZA 2I6TA 4JJFA 4DMMA 5JMPA 3DAGA 4BKQA 3OH8A 1ZXBA 4EJMA 3OJEA 4ALLA 4U8GA 1R12A 3RUDA 3OA0A 3T7CA 2JAHA 4QSMA 2P9GA 1N1EA 3FTPA 1T2DA 2O4UX 2AQIA 2Q4BA 2GZ1A 4XGNA 3S8MA 3I9OA 4J4TA 2YQ4A 1XWFA 1LSUA 3ANLA 3K96A 4R1UA 4XR9A 1KOLA 3WS7A 2OL4A 4GKVA 3KV3O 4QECA 1P0FA 2YYYA 2BD0A 4OM8A 2G76A 3WGGA 4MOWA 4XGIA 3PLRA 4MIYA 2F00A 2NNLD 5CPBA 3RKUA 2BFAA 1KVSA 1QLJA 3KTDA 4A73A 3QVXA 2AQHA 3IMFA 4XB2A 4ZQHA 1AUPA 2YV2A 3EHEA 2XOXA 4TVOA 5T8KC 3DBHA 2FR0A 3WGHA 1HDOA 5CFZA 1SEPA 4FW8A 4KQXA 1ULUA 4ALKA 5CEJA 3ZV5A 4CUKA 5K9ZA 3GUYA 5IN5A 2J3KA 1CQIA 2DBQA 3H9UA 1ZMTA 1U4SA 4LK3A 4OJNA 5TT0A 2E49A 3GDFA 3M2TA 2NADA 3C1AA 1R66A 1PZEA 3AM4A 4Q9NA 1G0OA 3VPSA 4BMNA 3OEYA 3KYCB 4IMPA 4ZGWA 1Z7EA 1WZIA 3L6EA 4D43A 2V6FA 3B70A 1UR5A 2JJYA 3ZNOA 2PA3A 5COAA 3S2IA 4J0FA 3CEAA 1B14A 1P1FA 3LU1A 4FR5A 3Q3CA 5IFLA 3L6DA 4WASA 2VWGA 1TT7A 1EVYA 1PGPA 2ZTVA 1U8XX 1J49A 1Q2XA 4OHUA 3P2OA 3E5RA 4ND3A 4DC0A 1PTJA 4PGFA 1ISIA 5A1TA 1E1LA 4YJHB 4AL4A 2D8AA 4GH5A 5JY1A 3RUAA 4NFYA 5TLSA 1P31A 4FSHA 1NVTA 2D1YA 1R4MA 1ZZEA 1J6UA 1U3VA 1I33A 1Y5RA 3C7AA 1A27A 1WWKA 5TIIA 2NTVA 3H2ZA 3H7AA 5TQVA 1E7RA 1Y5MA 2HMWA 1NAHA 3FBGA 3MCVA 1D3AA 2D59A 1Z74A 4E5KA 5IZCA 5I8ZA 4CPDA 1C1XB 1R16A 5F1PA 3GOHA 5CG2A 2FPPA 2C2XA 3GZNA 4J2OA 1UAGA 3LC2O 3NX4A 5T8KA 1GYRA 4W4TA 1W6UA 3GHYA 3O4RA 2HMSA 4P4NA 3PHHA 5IXSA 4NU6A 4OKIA 5C5IA 2WYUA 2QQ5A 8LDHA 1PSDA 4Q3DA 3P2YA 4XYGA 4JX8A 2EIHA 5T64A 3L6OO 3UXYA 1F17A 3F9IA 2YDXA 3H5AA 4XYLA 1SCUA 3FPLA 4DPLA 1ENOA 4R01A 1AHHA 1B16A 1KIFA 3DBLA 3WMWA 1N2SA 3AM5A 2CNBA 2X23A 1SNYA 4E4YA 4ESOA 1T25A 1YBVA 2EW8A 1O95A 3PYLA 3QW2A 4MIOA 1L1FA 2IEBA 1OBFO 3JD0A 1RM3A 4GWKA 5K0ZA 5L51A 4Y6RA 2V7PA 5L9AA 2VHYA 1ONNA 3AOGA 4CM8A 2GN8A 1K5HA 3F1LA 4TWRA 3WGOA 2J6IA 2X1HA 3DZFA 4XKJA 1Y8QA 3CPSA 4CMEA 2ZYAA 3L4BC 5GZ3A 3LC7O 1UXHA 2ZCUA 1B8VA 5JE8A 4KP7A 4HFRA 4TZKA 3K73O 1GEGA 2RCYA 4NK5A 5HS4A 3E5MA 3CZMA 3UVEA 2VUTA 1H9BA 2NVUA 3DL2A 4U5QA 1R15A 1IB6A 4BGIA 4BO0A 1T2CA 3ZGYA 5JS6A 1MA0A 1V3TA 4XYBA 3EMKA 2Y66A 4OMUA 1FMCA 3AM3A 1E5QA 4WOKA 4YDRA 1EVZA 1WZEA 4XB1A 2Q1UA 3FF4A 4MKXA 4EI2A 2JD2A 1XKQA 3CH6A 1RYDA 1VLLA 5FYDA 5EERA 1DAPA 3AWDA 5L4NA 2A4KA 1I36A 2QX7A 4A03A 2VTDA 4E21A 3F6YA 3PIIA 3WQSB 4B4UA 1A7AA 2JCYA 4J7XA 1PR3A 2G5CA 4L4XA 3SLGA 3HDJA 1HKUA 3ZWXA 4E31A 3H3JA 1GQQA 2Y67A 3NDIA 2PFGA 3GNTA 1XA0A 3D4NA 3M6IA 5F1KA 4PLHA 4DLBA 1VRWA 4E5PA 1P0CA 3WNVA 4ID9A 3UW3A 2GO1A 4PZEA 3GK3A 3IAHA 3ZWYA 4RVHA 4CR6A 5JMWA 4JBGA 1YQDA 1HDRA 3FBTA 3GUCA 2QRKA 3ONEA 4PFJA 1Y81A 4NH4A 1H5QA 1S6YA 2FHSA 2PH3A 3OF2A 2CSUA 2PKQP 2PZKA 3VZRA 3GEMA 4IJWA 3HJAA 2A94A 4RVGA 5JFOA 4FIZA 1DRUA 1SPXA 3BMCA 1CDOA 3INRA 3OBBA 4GQAA 1W0CA 1MFPA 1WVGA 1JA9A 2IYPA 4WLNA 4QFCA 4E6PA 2HMVA 5U9CA 1G1AA 4WEOA 5ITVA 1H2HA 1M75A 1LQTA 1OC2A 4L74A 4R3NA 4DL9A 1NFFA 1NASA 4G2NA 1BXKA 1YJ8A 3F47A 1WDLA 1L7DA 1ORRA 1UDCA 5IXYA 1E7SA 2CF6A 3K31A 1FDTA 1HTBA 3PJGA 1PJ3A 5A02A 5JDIA 3IS3A 4NBWA 3NYWA 1Y1PA 1Q7CA 4G65A 3JQFC 3DWFA 3DTYA 1BVRA 3JQCA 2EHDA 4KUEA 1E3SA 1XYGA 2PTGA 2YFQA 3D3WA 3WOHA 1CJCA 3EK2A 4BNXA 3RC2A 4OXKA 5JAIA 3ZU4A 5IAAA 3KM0A 1HYEA 5ILOA 2V6MA 4KTVE 3OHSX 2EERA 2DPHA 2D0IA 4LISA 4RL6A 2YW9A 4ND5A 4GSKA 3VZSA 4A26A 1M2WA 2XXBA 1U28A 4H15A 2C59A 4NZ9A 1QV7A 1JDJA 2C7VA 3ETEA 2DKNA 3KO8A 2C2YA 1BVUA 3AI2A 2HMUA 3MTJA 4HNHA 2B5VA 2P4QA 3ROPA 4DGSA 4D3FA 5IDQA 5H82A 2O2SA 3L0DA 4GWGA 4Z0PA 3VAZA 4IMRA 4DWVA 1HE4A 5A5EA 3M1AA 2WM3A 5JCJA 3WMXA 3ZWPA 3H9JA 4UVGA 4NBRA 5I9LA 2FSVA 1V35A 1YB4A 4Q3AA 2Q2WA 4NFSA 3WNQA 4PVCA 1V0JA 3ANNA 1E5LA 4F46A 3ZWBA 2GN9A 1KC3A 4I5GA 1XR3A 2EV9A 4OXNA 3ONDA 1XSEA 4GI2A 3WLFA 3PLNA 1WNTA 2B37A 1Y8QB 3PQFA 1O89A 1WPQA 3MWEB 1ZMOA 4BIIA 1PL6A 1ZVMA 1ZK2A 2A35A 4BNGA 2Q3EA 5IDYA 4MVJD 5B12A 2C5EA 4N7RA 5F5LA 1R0KA 3ZWNA 3DB2A 3G1UA 4MPDA 1HZJA 1LSJA 1RKXA 3DO5A 1QYDA 5KTKA 1C0KA 1HLDA 4CR8A 1IZ9A 4RZIA 1I3MA 1ONPA 3JQ6A 3LK7A 4HADA 4YQYA 3PVZA 4PLTA 1AXEA 2X5KO 3ZNPA 4XDZA 3TPCA 1HZZA 3R3SA 5CEFA 4NR0A 1YL5A 1MLDA 2E37A 4FQ8A 4GBJA 4GX1A 4K28A 3I6QA 5HWSA 3C8MA 4JP2A 1HE5A 2OORA 3S1LA 3GFGA 3JQAD 2AEFA 3QIVA 5ENVA 3RKRA 3QQPA 1P77A 7ADHA 3GMDA 1X14A 2C54A 2OHXA 5IZ4A 3I52A 1XQ6A 4A27A 3OSUA 2CDBA 4IDAA 1ZK3A 3IP3A 5HS6A 2AEMA 4JBIA 4K6CA 4YPOA 2GPTA 3PHIA 2GGSA 2I76A 3TFOA 4WLVA 4CV0A 4MVJA 1JQBA 3CINA 2BI7A 5CDSA 5KVQA 3I9NA 1BDBA 3W6ZA 4BNHA 3LF2A 3VTZA 3ZHYA 2QHXA 4F6CA 1WAMA 2Z5LA 1MX3A 5KKAA 4PRKA 1JW9B 4ZHSA 3U0BA 2O48X 4IDBA 3OQ6A 2C7GA 3WXBA 3V2UA 1GFSA 1LLCA 3JD2A 4CQMB 3NDRA 4CMCA 3E48A 2BF7A 4J7CA 5DT9A 4ND4A 2NVWA 3N7UA 2PGLA 2NM0A 5JO0A 4LRTB 1DFIA 2WE7A 1ZKMA 2B5WA 4DIFA 2WMDA 3KYDA 4QT0A 3UAGA 1JU9A 4B3HA 5LC1A 4C7JA 3CKYA 2DAPA 1GR0A 4YAKA 2J5QA 2O7QA 4LN1A 5DZSA 4R69A 1X0VA 4CUZA 2H1SA 3GG9A 3OFSA 2O7SA 4O59O 2PV7A 4B4OA 2HKIA 3HN2A 3HQ4O 3GY0A 4AJ4A 3KYCA 3B1KA 3K2BA 2JCXA 4E3ZA 2GF2A 3GVHA 3JQEA 4GAEA 4BVAA 1QYWA 3FI9A 3PEFA 4BO8A 4TMFA 2GN6A 2HLPA 2LDBA 3W1VA 1VKOA 4UEKA 4CQLB 4Z9YA 1IE3A 4IQGA 5ENDA 2CVQA 1DIAA 4JNKA 4NBVA 2PZMA 1F14A 1NFQA 1E7WA 3F1KA 4EGFA 1N7GA 3MOIA 3RU9A 1U3UA 5C7LO 2X0IA 1I3LA 1W73A 2NACA 3PHJA 1O9BA 3BAZA 4EEXA 3IOYA 1SOWA 2BFOA 5I7SA 4BGUA 5JPIA 1TI7A 2Q2QA 4CM9A 2J8ZA 1DIBA 1ZNQO 1RYEA 4AJ2A 1AHIA 3TWOA 2NU9A 3PYMA 5T57A 3UCXA 2DLDA 4J49A 4MVJE 5GY7A 1FK8A 2GERA 4UREA 3NT2A 4EUEA 3A4VA 3KYDB 4R9SA 4RDHA 3E9MA 2EWMA 3HE3A 5FI5A 2VYNA 2X0JA 4CLEA 2AXQA 4I8XA 4J4HA 5KIAA 1HDYA 3C24A 4WKGA 3ROQA 1YDWA 1WDMA 3LQFA 4UUOA 3C1OA 1ZUD1 4CQMA 4AJKA 2GUGA 3KOUA 1ISJA 4HFMA 1UP7A 4PLYA 1DDOA 3ROKA 2FSSA 4NDNE 1SAYA 5DF1A 3A1NA 2QW8A 3ETDA 2O3JA 3OM9A 1XCBA 2VHVA 1YBMA 3D4OA 4L4SA 4OO3A 1XDWA 3JQGB 1NR1A 5JDCC 3RIHA 1TT5A 5I9NA 1BW9A 4BNYA 3ON5A 2DQ4A 1LU9A 3HFGA 2GCGA 1CEQA 5TRTA 1KEPA 3GF4A 5EMHA 4B4VA 2VWQA 4XQCA 2FR1A 1IHYA 2E82A 2P68A 1ADBA 3KRTA 4AJHA 2AEJA 3IL2A 2ZJ0A 1E3WA 1EE9A 5JW6A 4OYRA 1HDXA 1LRJA 1A5ZA 2NU6A 1N92A 3INGA 1E3EA 4BGVA 1T2EA 1BGVA 1CIVA 2Q49A 4J7UA 1U2DA 4X54A 3C7CB 4WNIA 3SBOA 5FFFA 3NT5A 4WUVA 3NJ4A 2B36A 1H6AA 5L4SA 1MUUA 3GNSA 3WQRA 4KMSA 3F46A 4GSLA 3ZNNA 3TQHA 2NVUB 1KVQA 5JSFA 2VCYA 2ZTLA 3DXFA 1GZ6A 4E2XA 4CL3A 1L7EA 2POQX 3HDYA 1PWXA 4J1QA 1KVRA 2VNAA 3EUWA 3ZI0A 3LSYA 5C37A 2Y93A 1RM0A 1YGYA 1PIWA 2EKQA 1WW8A 2DUUA 3E03A 1QSGA 4HUJA 3RUFA 5CDGA 2WEKA 3L07A 3QE3A 4W7HA 2PZJA 4Q3BA 3E6AA 1H6DA 2PKRA 1WMAA 2Q50A 2C82A 3RVDA 3LZ6A 2I5PO 4XIYA 4QTZA 4TVBA 1K89A 1KEWA 1Q0LA 1WMBA 4P4LA 1Z45A 5L3ZA 2C07A 4C4OA 2BGMA 2W4QA 4NBUA 4J91A 4M8SA 1GU7A 2O4CA 4S3MA 2NU8A 3ZZNA 3WQQA 4YT8A 1LRKA 2IXBA 1AE1A 1QRRA 4MIEA 2B35A 3TOXA 2W2KA 4M89A 4YJHA 5TT1A 5ILGA 4D44A 1P45A 4M55A 4S1VA 1A4IA 3BMQB 1B0AA 3KZVA 1ZCJA 1EQ2A 3VOSA 3EZYA 3CIFA 3OEWA 4IXTA 3P7MA 4DQVA 4I1IA 4M86A 1DOHA 3C85A 4NK4A 4YXFA 3H4VA 2ILTA 2NTNA 3S55A 1B8UA 1XELA 4YTEA 1WLYA 3UUWA 1PZHA 3F3SA 2VYND 3ZDFA 4BOYA 4P8RA 3GR6A 5HRUA 2Y1FA 1P1HA 1FDUA 2B0JA 3ICPA 1MFZA 1PU2A 3H3FA 4CMEC 3GQVA 5A03A 4NG5A 5A3VA 1QP8A 3V1YA 3Q9UA 4GLOA 1I30A 4JJGA 2BGKA 5DOZA 5BSGA 4U6SA 2Q45A 2EP5A 3DBHB 2XPCA 1EBFA 1QG6A 2VHXA 3BHJA 3FR7A 1ENYA 4R68A 4FFMA 1HT0A 3JV7A 2JL1A 5DCYA 5KJEA 1UP4A 3ROMA 4MKRA 3EGOA 4NI5A 5IG2A 4MVJP 3IC5A 3PK0A 3RFTA 1UXIA 4N5NA 4BHTA 2Y0EA 4RVFA 4TKMA 4DUPA 1QORA 2GLXA 5JAZA 2PD3A 4YRAA 3K30A 1PJLA 1QV6A 1EMDA 4W9NA 1GV0A 3I6IA 3OECA 4Y98A 4D0RA 5A9RA 1UUFA 1DLJA 4A2CA 3NTQA 2HJRA 3PGXA 1T1SA 3ZWOA 4MVJG 5H83A 4IGEA 1YWGO 2YUTA 3ZV6A 4IZIA 3LT4A 3KLMX 4GPD1 4QX6A 4DVJA 2B4RO 4CQMD 1EZ4A 5HA5A 5JYDA 1B7GO 4E12A 1UXJA 3BMOB 3HG7A 3SC4A 5AYVA 1E1KA 1BXGB 4PLPA 4EUFA 3JQ7A 4YACA 2X0NA 3OMLA 4B7UA 4J1NA 4TRRA 1DB3A 1T4BA 3ULKA 1F8GA 1U9JA 4QUKA 2IXAA 4L75A 1ENPA 1TEHA 3PGJA 5TJHA 4E5NA 4WPGA 2FP4A 3OIDA 3DMTA 4NIMA 3WG9A 4CMAA 3I9LA 1U7HA 3B6ZA 3GRPA 4AJEA 4CM9D 3PWSA 4MVJH 1PS8A 1J0XO 2RHCA 3PDJA 3QVTA 4BMVA 4Y8VA 2UUOA 1GYPA 4XGKA 4HWKA 3GC6A 4AJ1A 4GVXA 3Q2IA 5U4QA 1V3UA 2WD8A 3PDUA 5LDGA 2VNSA 5HBRA 4L4RA 5JXWA 4IUYA 5EN4A 2W8ZA 4BNMA 1RWBA 3JQAA 2CFCA 4RV9A 1U5CA 1K6JA 1R37A 3TF5A 4Z0HO 3H5NA 5JY6A 1E1NA 1GCUA 3MJCA 5A06A 3D1LA 4IIUA 4ZJUA 3U09A 5CP8A 2RIRA 3MEQA 4ZVVA 1DPGA 4ND2A 1YKFA 2Q2VA 4IDCA 3W8DA 1E7QA 4NJMA 4HY3A 2QYSA 4E30A 4A5OA 4G81A 5L95A 5BNFA 4BL5A 1EBUA 4XRRA 1A4UA 4I9HA 1HF3A 1PJSA 2GNAA 3LVFO 4CM8B 1P74A 4KDFA 1U7TA 1I10A 3JYLA 4EDFA 3BA1A 3C7DB 2VOEA 1H6BA 4Q3EA 2UAGA 4ROSA 3TZQA 4E2ZA 5IDWA 3DHNA 1I32A 3JQ8A 4HX5A 2AA3A 4B4WA 2PH5A 5JAMA 1X7DA 3AK4A 3IDSA 3N74A 1IY8A 2RAFA 2W2LA 2W2LD 3ENNA 4E13A 4YJGA 4L73A 5C7OO 2DM6A 4JCOA 3ORFA 4CL8A 1OOEA 2HRBA 4G5HA 4ZQBA 1LX6A 1PGOA 3A28A 1FDWA 3KEQA 3VKVA 3R1IA 4R1TA 2VUUA 5KNLA 1E92A 3JYNA 5L7YA 4PLZA 2SCUA 1VSUA 2WDZA 2Y1EA 4OL9A 5TX7A 2FMUA 1I3KA 1P3DA 4BO9A 2VZ8A 1XLTA 3KEOA 3GN1A 4D3SA 4Q39A 2UV8A 4BMSA 3VKUA 2DT5A 1SO8A 1BXGA 1Y9AA 1BTOA 1KERA 3GFBA 3H8VA 3R3JA 3WJ7A 5ER6A 1RM4A 4WCFB 3RSHA 3SJ7A 4MJLA 1T1RA 2CVZA 3GVIA 3ZWCA 5I8WA 3NT4A 3WJAA 1BWSA 4RCVA 2O3UA 4DBZA 4DYVA 1D1SA 1GZ3A 3TFQA 2AW5A 2B4TO 4U0JA 4K9DA 1DFGA 4CLOB 2X5OA 1HSZA 3B1JA 3BHIA 3DHEA 3D0OA 3DBRB 3FNGA 3AUTA 4PLCA 2FOIA 2FWMX 3H9QA 2I9PA 1P1JA 2IRWA 1ULSA 4FBGA 4YT2A 4J3FA 4GX2A 5COBA 1EDOA 3DOCA 2CD9A 1B3BA 2Y1OA 4MVJM 1PX0A 3VPXA 1DEHA 2JAPA 1X0XA 1UZMA 1ZW1A 1H93A 3I9KA 2IZ1A 2PY6A 3OA2A 4PIVA 5IF3A 5JCJD 2JFHA 2OFPA 1JN0A 4DREA 3VVBA 1KYQA 1C14A 3PPIA 5DCWA 2ZQZA 3EVTA 4IDGA 4D45A 3MOGA 5EJ2A 4B7CA 1NPYA 4Z0TA 1V9LA 3U49A 2X86A 3H9EO 1NNUA 4PVDA 2B4QA 4CMGA 1GY8A 1GTMA 4BS9A 3G17A 3VH2A 5I7FA 1Z82A 3B20A 2DUWA 1YH3A 1NXQA 3DQPA 3IJRA 1KEUA 4IBOA 2ZYGA 2Q99A 1ZJZA 3UCEA 4J2HA 2BLLA 1YE3A 4DLLA
chains in the Genus database with same CATH superfamily
1F3OA 2NNWB 3KYBA 4CG0A 1MIOB 1Q12A 5FNVB 1VJTA 1QLWA 3KU1A 4F45A 1RLOA 2QIOA 3OZBA 3EIFA 3S8EA 3G2MA 2PCJA 1O4WA 2UVDA 2E1RA 3I8XA 3PIDA 2CDCA 2R8XA 3QBTA 4LVCA 2EHJA 2V7UA 2V7QD 4EX7A 1EBBA 2P6MA 4ZKDA 4ZT6A 2P6UA 1LJUA 1P1RA 3UAWA 1UH5A 2EQ5A 1GGVA 4MGZR 5LA6F 3T5AA 5FTKA 4K9MA 3OEHD 1YB2A 3A4YA 4PSUA 2J41A 4QEZA 1Z22A 3BMOA 4IVNA 1M2NA 1Q74A 3CNHA 1O8CA 1G2QA 2QN1A 5EPEA 1YA6A 2XMZA 1Q92A 3DDZX 3EFHA 4CT4B 1NYLA 4OBXA 4CM4A 4PGGA 3JQ9C 5CDHA 1U9IA 4P34A 3RTBA 5K99A 1LI4A 1JHDA 1JJAA 4MVWA 4YDSA 4XYEA 3I2KA 3L02A 1PG5A 2XAAA 3I1JA 2YRFA 1HETA 1NOJA 4PNEA 1R6BX 4A3SA 1JVNA 2XA9A 2M32A 1E2BA 4BKPA 4S1WA 1IDOA 2ASVA 4PC3A 1T6ZA 5CB6A 4RHUA 3B6MA 3F5SA 4O3MA 5DYTA 5EIHA 3PLAE 2NP6A 3KL2A 3DL7A 5EZYA 1BRMA 1L5YA 5E4FA 5A0TA 1IM8A 1EK6A 2P41A 4NENB 1H1LA 2FUEA 3KWFA 1Z5VA 4KPUB 3RIYA 3VSEA 3ESQA 5JNVA 1BYUA 4ECAA 5G4LA 1JWBB 2P5UA 5CLGA 5TNXA 2A92A 2GK7A 3ZDBA 1RXYA 2PIDA 4DRXB 4YEDA 4JUCA 4EITA 5FUMA 4HWTA 3EFEA 3KKQA 5A4MS 1T2UA 1N9GB 4QXOA 3L4KA 2OBBA 2FMKA 2XWQA 5L3QB 2RKWA 3G79A 1RAEA 3QWAA 1N5JA 3G89A 4FNGA 1BWPA 2QWXA 3T1OA 4H3SA 3VJRA 4MW9A 2QTGA 1DBPA 3B5JA 1VMIA 2ZANA 3LGXA 3PRYA 3LCRA 4RH0A 4B5LA 2X7XA 1I3NA 4Y6OA 1XOIA 3VV3A 4BNLA 2ATIA 1UPFA 3B1VA 1B6RA 1L5WA 1NUQA 1JBKA 1RAIA 3R6WA 4GZ6A 2QZ9A 4CZ2A 3CJTA 3Q7EA 4EBBA 4DA7A 4C6TB 5DWVA 5K2MA 4DR1B 1UODA 3O9VA 4UDOA 3ETHA 2QY6A 4YT5A 5DMXA 1A88A 3EF1A 3UH0A 5K45A 1B4DA 4IJUA 1BW9B 1JAHA 2ORVA 4X8MA 5F51A 4BUCA 5IH7A 1VC2A 3N2KB 1Y7HA 5FWXA 2CB9A 3LDHA 4PPYA 3EIQA 4YAUA 5LMNB 2QP3A 2J7PA 3P27A 2GDZA 2IT1A 3T7JA 3AEKB 3UFXA 2IU4A 3Q9SA 4G1VA 4YV0A 1R6XA 1KEEB 2AIRA 3AHIA 5KNBA 1KMQA 1PJTA 5CM8B 1Q0QA 4UU7A 1IG3A 1MV8A 1ZZGA 3B9RA 2IHTA 3DCYA 4AG6A 1BMFD 1DAMA 2ZAIA 4IH9A 5DK6A 4PZPA 2Y68A 3BUSA 2GNPA 3I1IA 3HBAA 4GVLA 2FKAA 2MSCB 4DMGA 3EVNA 1QRAA 2F1IA 4FFSA 1NP3A 2OXIA 2FFAA 3AEZA 3H1FA 3QKRA 4ENSA 1YV9A 3DLTA 5BUZA 4LTNA 2EFCB 5GINE 3G8CA 3IP8A 3QU9A 3ONVA 3OCCA 1VHWA 1WXDA 2QRUA 4G01B 4KWCA 4D8TA 4ZXPA 5BXQC 5HR5A 2FXIA 1UJMA 1V26A 3QKWA 1H3EA 4RPJA 4E5UA 4BB6A 2BDUA 2OGWA 4HBGA 1N6NA 4RAOA 2GEFA 1BHO1 2IEGA 2VEOA 3REFA 3BCRA 1Q1AA 2R5NA 5KYNA 1IXSB 2NVOA 4M0CA 4B5KA 3VDMA 4RK6A 3EIOA 3PC2A 3GDWA 4GMGA 3B5EA 3L77A 3RJ9A 4HFJA 1EB9A 2WICA 5HUJA 2V55B 5BY2A 4GGMX 3U7EB 3I53A 3BF7A 1PQWA 3QXXA 4TRJA 4KYIB 2OZLB 1HT3A 2NLOA 4KC0A 5D87A 3PJDA 2Q9CA 4WZAE 2WFLA 4RQUA 3L43A 4CWAA 2WDPA 4KXVA 3CVJA 2IUYA 4ER0A 3CF6R 2A9QA 2BFFB 4NY1A 4W8HA 3G2LA 4J0DA 4KW7A 3CG0A 5T5QA 1BDHA 2NTEA 3V1UA 4MZXA 4IDEA 3OZAA 2ZRLA 3VGJA 3BE8A 5F12A 1U0JA 3RU7A 3ZLVA 3ISTA 1JJIA 3B2QA 5BWMA 2Q3JA 3HJNA 4CCWA 2QPTA 5FB3A 4INAA 5HZKA 4BC0A 3AUJB 3TQFA 3CYFA 3PQ2A 4Q3CA 4JI4B 3OCVA 4ZVLA 5LUBA 2ZB7A 3KJQA 3L8EA 1YVUA 3P2JA 6PFKA 3U3XA 2X9NA 1MOZA 4NNJA 1V2GA 1N2OA 2QM7A 1T34A 4FFLA 3DEKA 1I3OA 2MSEB 4M7WA 1KDPA 2YVQA 4B2LA 1J90A 1MQAA 2AH5A 2XNSA 3W2HA 3LF1A 3VHQA 1T8PA 2PZBA 3IQEA 1JWAB 1LDGA 2OAGA 1Z4MA 2NSHA 2EFGA 2VPWA 5LOVB 2ZRFA 5I7UA 1XHLA 1XTSA 2XUIA 3D7SA 4RSMA 3DDHA 3IVRA 3R5TA 5H4GA 2HRZA 1JIVA 2GZ3A 4WL0A 5H1YA 4A7PA 3VSAA 4NBLA 5EUMA 1PYOA 3O21A 1NUTA 3L8MA 4Z8YA 3RS5A 3WQHA 3GO4A 4ZO6A 5AD1A 3W8RA 2EJBA 4PPGA 1T4GA 3JCZA 1V8DA 2UUCB 5FUVA 3WLQA 3KQHA 4LZNA 1CRWG 1LFAA 1CS0A 1LTKA 2ZG6A 4K5QA 4ZO8A 1QU2A 5JLAA 2BEUB 2FPSA 3GRVA 5T7BA 1RSZA 4WDQA 4GGPA 1O94D 1G2PA 4HRYA 3GEGA 3MCAA 1IBSA 3H4IA 3JSXA 1NAIA 2AQKA 5A4AA 1LH0A 1E2FA 4IIVA 3BQNB 2PRJA 4KO1S 4L78A 2PL3A 5H80A 4U8HA 3W4JA 4BJ1A 1VL6A 5ECDA 2FQWA 1TXGA 1LDEA 1DWOA 3H2SA 4FGUA 4L5BA 1WHTB 4WECA 2PX3A 5F35A 3KSDO 3IKTA 1UBKS 3R0VA 4WCFC 3RFUA 3U56A 1UBNA 1YS4A 4YR9A 4CEJB 3BEOA 3QBVA 2J9FA 4UBKA 4P5EA 5EGSA 2YFHA 3B3JA 4CV2A 1F3LA 1ICEA 3CKKA 1M83A 3F71A 4LYYA 2QORA 3OKFA 5LLTA 1SKYB 3HA2A 1YB1A 3PQ8A 1RHRA 1AG9A 4KUHA 1MV5A 3V42A 5FF9A 1JZSA 2BP7A 3TSOA 4B8ZA 2ZULA 3HHEA 4GNRA 3KU4A 4Z9AA 4Z51A 3UJPA 3IA7A 2G1PA 2BR5A 1KWGA 5H16A 4CV3A 3LW8A 3N1UA 3Q87B 1THTA 1HE3A 3J80A 1NQTA 2DT8A 3FRIA 3HHPA 3JTMA 4ZHQB 1V48A 3SQNA 3PDIA 3AHCA 4EKIA 4ZCTA 3U60B 2IH4A 3PNPA 2PO5A 1NF9A 1AKVA 5K8TA 1VL0A 3ZXXA 2ECKA 4EZBA 4DR3B 4K6MA 3TQSA 3PWKA 4KOEC 5BOSB 1RQ2A 1W2HA 1J0CA 5E6SB 1EVIA 2AFHA 2FU5C 4XA8A 2CHUA 2E4YA 2L19A 2OY0A 3A6KA 4PFSA 3ZXUB 4XWKA 4N1AA 4BASA 2JFFA 1GL9B 4XVUA 5CFLA 3MJSA 2ZIAA 1QOQB 3WYBA 4BRUA 3D3EA 3QXSA 5KWJA 4L0QA 1C8LA 2WSMA 1DJLA 2GXQA 2NQTA 4GYYA 1GAEO 2XR1A 2J85A 5T67A 2DULA 3WV5A 2VCHA 5JQGB 2PHZA 1QF9A 3DO8A 2NXJA 5I7OA 2YY5A 1XK7A 1AGNA 1YRHA 2GBIA 3LRXA 5D51S 3M6MD 3MFQA 4JBWA 5L4LA 3GLGB 1FW6A 4TLEA 1H23A 1PFYA 1XBTA 5C4MA 3SGLA 1BU5A 1JKJA 2FQXA 4GUDA 2I8LA 4EYQA 4PNZA 3LYLA 1T35A 3CPHA 4MYHA 5FUBA 1WCXA 4DILA 1OXVA 2F9LA 3KZCA 3CH5A 5FTNA 4L3OA 4B43A 1TCVA 1U3TA 2P0YA 4CM3A 2ZBDA 2ZB3A 4US2R 1GRVA 3WGIA 2JGNA 3WLSA 3NATA 3AFOA 2IEZA 1SBHA 2YZ2A 3TH5A 3ZE1B 4F9TA 3IIIA 1G21E 1RRPA 1SUPA 2I7DA 1X8JA 3GRAA 3RIGA 2PRZA 4ZICA 2JKYA 2HADA 1OC4A 3ST7A 3VH3A 4CLRB 1ZGHA 1PWEA 7ABPA 3TTXA 1SFRA 3IBCA 1IULA 1AS2A 3ESBA 3HCWA 3BZBA 4RA6A 4B1FA 4KIGA 1RM5A 3T3PB 3KR9A 2VBGA 3Q85A 4HGNA 1EK5A 3WTBA 1GSOA 2WP8J 4NJOA 1E1QA 4UVDA 3UENA 3IELA 5FV4A 2K7ZA 2EZTA 2RHRA 2WKSA 1V9CA 2F6RA 4HDSB 2EKLA 2CL5A 2B1QA 3QSGA 1U31A 4EGAA 4P53A 4D25A 2XOKD 2B4KA 3X1WA 5ALZA 2J0UA 4ZAVA 4EDHA 2RK6A 4ARZB 4ALIA 1F06A 2CNDA 4EPYA 2W4IA 3B6JA 3GIDA 1XMXA 3CH7A 3QUQA 4MQ5A 4MVXA 4ZV9A 4R8KA 2C3MA 5G0TA 5SY9A 4WBXC 3SMQA 2Q41A 1DC3A 3BQ9A 2VK8A 3WFJA 3LY7A 1DSSG 4EUHA 2DMRA 4CLRA 1KJJA 1LTQA 1L8OA 4NU5A 2IEDA 4OUDA 4QUBA 1GEEA 1UBOS 2AZTA 2DFDA 3E1KA 1XKXA 3P32A 3N2IA 3DE4X 1XI2A 3WMEA 2HMYB 5DSTA 2GPBA 1MVLA 2MT9A 2R47A 5IKOA 5MN4A 5FLKA 1SEVA 2G0TA 5ARDA 2GBLC 2JG3A 5G0UA 3E9EA 2L2QA 2VOJA 2JFGA 2L18A 4AZVA 5T3YA 1DIGA 2VNJA 5JJBA 1KXZA 3EA0A 3O8RA 1B0PA 4TQUS 5DSXA 5K6RA 4DC9A 5G0SA 1E3IA 5GJWC 2A9KA 5DB4A 1E20A 1P9OA 4KO2S 2CJFA 3KFLA 1L4MA 1Z2AA 1Z6TA 2A58A 3WIBA 3I5YA 4L5CA 2WUFA 3QGMA 4XIJA 4NMMA 4II2A 5K51A 4L5AA 3NHAA 5DH9A 2X0DA 1T5LA 1YB6A 4Q3NA 1AQYA 1P7PA 5MN6A 1EZ1A 1VSQA 3FUVA 2UYHA 1PV1A 4TUYA 4HAWA 4MV3A 2D54A 3ER8A 3Q3JB 4Y3UA 1YCFA 2FMIA 1G7RA 2PANA 2V6IA 3GP3A 5ULLA 5FPTA 1PJCA 2O8DA 4IPTA 3EBOA 3GQBB 2R0QC 1XYVA 1FTNA 2O3RA 4TOIA 3HV0A 4NZZA 4UD6A 4D4KA 4NSNA 2ZPTX 3THYA 3MTAA 3AINA 2JHGA 4GBMA 4X71A 4F91B 2HTEA 1XKLA 5B6PA 3QLVA 1J8FA 2ZREA 4BX8A 4HYEA 3FD8A 3AVVA 2GD1O 1O0BA 3H8JA 2ZB4A 3MBKA 1HNNA 3RAGA 3WTCA 5BN1A 4PCUA 4YQEA 1GV1A 2R65A 4L50A 1ESDA 1S3SA 2BC9A 2GEJA 1WB9A 3NMUF 1PKEA 3U4IA 4QLBA 4N6NA 1DHTA 2KLBA 4L9RA 2ZUTA 4I50F 4Z8XA 4UUPA 4DMHA 4YRMA 1E3LA 3C3EA 3O0TA 2RGGA 1V3VA 3Q11A 3IAFA 3AUUA 1TCCA 3NC0C 1J9ZA 3LVBA 3P5SA 1TRKA 2O8EB 4FCWA 4U3JA 3ABOB 3LAWA 1R4NB 2XITA 4C4SA 5AW5A 4RDXA 4YMHA 1HL7A 2HPHA 3DBIA 4QQ8A 3DDNA 5JWRA 1TPZA 4DG8A 2W6ID 3LWBA 4AU1A 2DCUA 3SQXA 5EA2A 2XZDA 4LDZA 2QM0A 2EGGA 1YMVA 1ULZA 2IS4A 1BXRB 1IJKA 4RPHA 3ZVNA 2DR2A 3KZ1E 4U0KA 4EHFA 1YDFA 1G66A 1PZXA 1EEHA 5A62A 2JLRA 1HYHA 3PQ6A 1UBUS 1TLFA 4JT9A 4HDQB 5ERYA 1PNOA 2HLDD 4M0MA 2UZ1B 2ZYSA 3DZ8A 1Y4DE 3AB3A 4U7WA 2I22A 1YBAA 1SCQA 1E6EA 2VT2A 4RYDA 3NHYA 1SHTX 2OWEA 4G6ZA 1KEVA 4L95C 4RQBA 3VYUB 1PL7A 1P0MA 4PW0A 3FFXA 3LUCA 1A9XB 2Q3MA 1K9SA 3IUPA 1RFGE 2PYZA 3FYTA 3NNDA 4IY1A 2XX3A 1E0DA 3VI4B 5HZGA 2DP4E 2VDOB 1NYQA 3QBDA 5JSZB 4FN4A 1QQAA 2O8BA 2WHXA 2H1RA 1C3JA 1H3NA 3QWBA 2ZIZA 4EYSA 1GZHB 3AJRA 4L28A 4MTCA 5BN4A 3SJBA 1UC9A 2PX0A 3V8PA 3ZCRA 2QN2A 3CNOA 4P33A 4HAZA 1C0IA 3QHQA 4LHYA 2JGDA 1JPVA 4PANA 2G17A 2TMKA 3CQ9A 1F12A 4LJ8A 4Y6GB 2OCYC 3V1KA 1FUUA 1F6WA 3ZLBA 3UW1A 1RLIA 1H2BA 1PW5A 4RK0A 2ZZMA 2AX3A 3I5MA 1IQRA 2QLNA 2Q2OA 3V7WA 2EJVA 2OCPA 2YWFA 3EGDB 4RANA 4XR4A 1GUDA 2NUAA 1QF7A 3SJCA 4X1IA 3RC3A 5JR3A 2OCDA 3T5MA 3ZZMA 1FQOA 3QUAA 4K87A 5G02A 3TDKA 1X15A 3H17A 3U7JA 1KJQA 4NCNA 1SUDA 2VT6A 3EXEB 3GVCA 3KFXA 5LNK1 5EIOA 1IONA 1QGOA 5KKNB 3PI7A 2CE2X 4H18A 4ITUA 4NBTA 2M1XA 3OIFA 4J16A 3BDVA 1DG1G 4OF4A 1GWNA 1IN4A 3Q9NA 3ZGOA 2OV6A 4EYEA 3FY4A 3LCMA 1GCAA 3CB4A 4Y0VA 4F9GA 1OI4A 2EWWA 2VJMA 3VPDA 1LSOA 2ZBGA 2HNAA 3VDXA 1M7GA 3VA7A 3QEMA 1TGVA 2AWOA 1W52X 1B76A 1E9RA 1ZY2A 1Y1RA 2W2XA 5B2ZA 3AEXA 4M0FA 3PFWO 5LR6A 3WDLA 4QO7A 2JJ8A 1U1GA 1Y7LA 2SCUB 4KBFA 4INPA 1X2BA 3WL8A 1INLA 2PX6A 4J43A 4TS1A 1LTHR 3UK6A 1R4NA 1ZM9A 4K6GA 5I01A 4TQGA 1TEVA 3TLKA 3KE9A 4QATA 2AFIE 1FP7A 3C3DA 4M60A 2WJGA 3H2BA 5EIEA 1CU1A 1X8LA 1W76A 2I1QA 3LWZA 3OHPA 3VR5D 1KMHB 1K0FA 4L08A 1KZYC 1I9GA 2C9OA 1QOZA 1ZM3A 3BHNA 3I3OA 4XWWA 4EY6A 4NMXB 5CX4A 5IJAA 3SXUB 1OLXB 5D00A 4EHDA 2DY0A 1RQNA 1H5NA 1SA0B 2O0MA 2VAVA 4XQGA 3ZZUA 2VRNA 3D0KA 3DEAA 3MGBA 5A3JA 5I4KA 3L9WA 4UCXA 5JC1A 1EB8A 2WM9B 5JYBA 1XUOA 5DEIA 3K0KA 2I66A 3EEFA 1AGRA 2JEOA 3HB9A 3JYQA 5I4CA 2PD6A 3T9EA 4GR9A 1JS1X 3K2EA 4BEVA 2AYXA 2EJUA 3H2IA 1TLTA 1YS6A 3HJBA 2WA2A 3KEFA 3T7EA 5K3OA 2HU7A 3TAXA 5JI3E 1GLGA 1DGQA 2CHEA 1AOXA 2I2AA 1GZVA 4OGLA 3FFTA 4MI6A 2P91A 4U4AA 1VKHA 3KUUA 2I4MA 1L5QA 2OXCA 1PQ4A 3OP1A 4A82A 3ZS8A 3PFHA 4B3MB 3CS3A 4FB5A 3LFTA 3RASA 1JZTA 1SY7A 1KBZA 3D5TA 3OPMA 2X4GA 5KCMA 3S2ZA 3W5VA 1GPJA 2XCSB 3JVUA 3DDWA 4OP1A 5GV7A 3TIIA 4L8VA 2OLKA 5A7FA 4JUIA 1Z2OX 1BXZA 3A3OA 3IR6A 1OGIA 3IX7A 2KBEA 3ZY5A 4HXYA 4G37A 1UXOA 3X1MA 1OX6A 1X7YB 5B6JA 3BGDA 2FPGB 5AJXA 5LYJF 2BISA 1ZM2A 2GZ2A 3JD1A 2CXQA 2ZWIA 1NIPA 4TV9F 5FHRA 2X7JA 1H2RS 4N54A 2VYCA 1QDEA 4HSEA 5EHXA 4ZO4A 3PTAA 4PEVA 2FQYA 2J33A 3TPFA 3CRRA 3QKUA 3LUJA 1NTOA 1JHAA 4BQPA 3ANXA 4BX3A 4I55F 5F78A 2PMCA 1F5SA 4D9FA 3HK2A 1GQSA 1ODSA 1TQ6A 1UP6A 2QZ4A 4ONEA 2ZWAA 5EIBD 2B99A 4H17A 1ZN9A 3T3HA 4TRMA 3HUDA 1QE3A 1AUOA 1GPMA 5F52A 3CVWA 3N07A 3E9NA 3OPXA 1FLAA 1Q84A 2Z9BA 3C3AA 4K9OA 5CX1A 3DGFC 1KC1A 3G02A 5DW3A 3OIGA 1NT2A 1CB0A 4MQBA 2GAFA 4WSOA 5LFAA 2IODA 4CG3A 4BQNA 4KDCA 1JJFA 4B09A 2C9BA 3CCCA 2ZAMA 5BRJA 1FQWA 2ZR8A 1FUYB 4W6ZA 3TQOA 5AM3A 1YHYA 2RGNC 4KWHA 3V8BA 3DBVO 3IV9A 1GSAA 1QYXA 3NHJA 5JO9A 1L5HA 1SRQA 3NQ41 3L6UA 4N3BA 2C8KA 4EOGA 4JC5A 1E4YA 4LOJA 2ZSFA 3T06B 1JG1A 4J0JA 5K6AA 2PO7A 4MYCA 4R2JA 2QP9X 5CK5A 1A9XA 4W9NC 1OAOC 2Z04A 3T4EA 5TGDA 1ACLA 3E9RA 4HQ6A 5CNMA 1UKZA 3N0VA 3K2QA 4ASUA 4WESB 1UQRA 1PJZA 2WNIA 4BQOA 1EEXB 2XA2A 1JJ7A 1MIOA 3BTVA 3GIWA 1EFCA 1LUAA 3EEYA 3VZQA 5LXTB 1QJCA 4CL0A 4EL0A 2X14A 4KRGA 3RSGA 3RVQA 2MOKA 3KQVA 3EHDA 3VKWA 3ZCUA 1LWNA 3ENKA 4XEUA 2WYWA 1TK2A 1RRCA 3SBEA 3SOZA 2FHPA 3MMZA 4CLHA 4UZSA 2WILA 1XNHA 3FHOA 3VTAA 5JZ9A 5KS2A 2CMKA 2PQ6A 4Z6KA 1JIQA 3HO1A 3R9WA 1K06A 1EIWA 2P78A 2R3SA 1I5RA 4DIKA 2FRDA 3EQZA 1K88A 3GVPA 2CHFA 3A9TA 2VHZA 2DHCA 3LUGA 4RMGA 5BQOA 3V00A 3LFUA 4KFUA 1MJFA 2QRGA 5AKEA 4HEA1 3UK7A 4OLAA 3SX2A 2H52A 3CVOA 3BIXA 1KKUA 2Z43A 4ALMA 2VK4A 1PGNA 1Y6ZA 3CLUD 2JKVA 2ZE5A 4YP1A 3Q0TA 2WJ4A 3L1JA 1SXHA 3O93A 4Q9DA 4QQRA 3VR6D 4AF8A 4HSGA 2O0JA 5HF6A 2I2DA 3HKEA 1DHRA 4DCMA 5KMGA 5DNYB 3HVUA 1M76A 2R1TB 1QO0A 1W29A 1MOPA 1XFAA 4XOUA 4L2IA 2IHYA 1NVFA 1JB9A 2ORWA 1LVHA 4JLVA 4FS8A 3UKDA 1D03A 1EVQA 1GA6A 2EZUA 2BP7B 3WLRA 3T94A 1GRQA 3G82C 3AI7A 3EXFA 1AGYA 4PC6A 5LJLA 3ME5A 4AB1A 1NVMB 3Q1LA 1R0CA 3JD3A 4ND6A 4CJXA 1XD9A 4OH1A 4Z4IA 3FCAA 3KUCA 3GH1A 3WAGA 2WTEA 5LL6P 2C61A 1OWMA 4WKCA 3SC6A 4TTRA 1A9QA 2J7KA 2J9GA 1FP4A 1BQ4A 4OIMA 4DW8A 3NV9A 3HJGA 5G0VA 3V8NA 4ARIA 1I0ZA 1RCTE 3DR5A 4PG4A 3VR3D 3R3YA 4PZ0A 5EIXA 1J33A 5JU6A 3ZDRA 1GQYA 4OAQA 2Z95A 4BNIA 1Y1KE 3QPAA 3U44A 3MMPA 2Z6UA 2IQ5A 3EMVA 4UBOA 2ARKA 3BCUA 2RJOA 1ZOLA 3MJTA 3TLGB 4F8JA 4Y2GA 3RKSA 4RPGA 1XVIA 3ANSA 4BO6A 3I9V6 5EESA 5GWXA 2QXYA 2OWDA 4HNUA 5KQMA 2QTVA 1J22A 1V2HE 1V3QE 1QB8A 4KQ1A 4MEAA 4JNCA 2IV2X 1QKJA 4NCBA 3L40A 4GGOA 4NJMB 4TWZA 4YIKA 4OLFA 3RYIA 4KCGA 4JGIA 1CFZA 2HBQA 2UYYA 3VSDA 4BLTA 1X86B 1EGVB 4HQ0A 5AW7A 5FUXA 1GL7A 3S81A 4DV1B 1MJ5A 4JT4A 5BR4A 3D54D 3GFVA 3AZOA 2PS3A 1WEKA 3DAPA 1BDMA 4AFNA 5F77A 1B0UA 3KPVA 5FLXA 3SNHA 2J3JA 2FG7C 1KY3A 2YQ5A 4E94A 1NBME 1JVBA 4OQYA 2IEIA 3JYPA 3RJTA 4NPHA 2FVYA 4P2BA 4JB8A 4UOEA 4GKKB 3O8LA 1ZIDA 1Z25A 2N46A 3EWAA 4UFNA 3O95A 3OD1A 1W4ZA 3ESAA 3FHTA 3K71B 1U8FO 2WSSA 3A2KA 4Z9FA 4XRGA 4JKOA 4DDMA 3S28A 4EHAA 4CIWA 2FSPA 5THKA 4Z86A 2YV1A 4XDYA 2H0RA 3VBEA 2WUVA 3C6MA 4MPPA 2QT1A 4BRWA 4D42A 1PKXA 1TJ4A 2QZZA 2YYSA 4DLXA 3AZPA 2I6QA 2FW7A 4X63A 4Q4JB 1NONA 2DOKA 3MAGA 2COEA 4K9RA 5JQGA 2OAEA 4CG1A 4QUJA 1TQ8A 5JEEA 1CV2A 1NMXA 2O5VA 4FGWA 3HVIA 4LJ5A 4LWQA 5FFNA 4K6HA 1IBCA 2GD0A 3D6AA 4UAUA 1VZ2A 3TIGA 4XWOA 2QPAA 3JRNA 1FPQA 2EKBA 1R5JA 3NUGA 3VR6H 1JAIA 5FPPA 5A9TA 1I2CA 4IOKA 2XBLA 4V0NA 1FQKA 1AGPA 1Q16A 3K0CC 1WVIA 3S5JA 3MHTA 2AVNA 2OKGA 4EMSA 1T5HX 2ZB2A 4NXMB 3INTA 2WZDA 3IIEA 3KBOA 1JG2A 4C0BA 5CB4F 1TO2E 3IBGA 3JQ9A 5A2QA 1AQLA 1L7BA 2K2WA 2QGNA 1ISPA 1NVGA 2O2XA 1II8B 4KOAA 4NULA 4EA8A 1I94B 3K6JA 2FPXA 5AR1A 5HMLA 2FWIA 2ATCA 1YFKA 1GQ2A 3OLCX 4HLNA 5B3AA 5GONB 1F20A 2X8WA 1J5XA 1IPEA 2OBYA 1USIA 4K9QA 1SOMA 3VTFA 3DAFA 3C5HA 5AXCA 1SHZA 3GARA 2DSTA 2RHDA 2HLDA 1JA0A 1L5MA 2VF5X 2Y6VA 3FVRA 1A50B 4G3XA 4BXOB 3GJ3A 5KOHB 1G5QA 1WXHA 4YO8A 4CT0A 3Q15C 3YASA 5FUWA 4YWHA 1FNSA 2VBCA 4AKSA 5F1YA 2REBA 2I3ZA 4N3NA 1PW7A 2YJNA 3R6LA 4CF5A 4KX3A 2FSFA 3Q7SA 3LT0A 5EEGA 5F2EA 3NVMB 3TZHA 2JW5A 2XGMA 3ZNQA 4QEDA 1T9KA 4RVUA 5A04A 1TZ2A 4P3XA 3D2LA 1FDIA 2TMGA 2K2QB 2JZNA 4MCJA 4WZ6A 3S2FA 3LX5A 2WHPB 4NKRA 3U7RA 3NTOA 1L5VA 3COSA 2QAGB 3NZEA 1U0LA 1SXJE 1X1SA 1IPFA 2YBEA 4HB0A 2A9FA 2SBTA 3IOEA 3NIFB 3KDAA 3RJMA 3D3WB 2BEUA 4KFCA 4HC4A 3GDOA 2FX2A 4E22A 1NR7A 4YCCA 3Q6IA 2WPNA 4Q4AA 4S05A 4DLAA 5K01A 1HLPA 1C80A 4G0OA 1M1ZA 1N3BA 3OIUA 4F4JA 1FVHA 1SBYA 3TK1A 2FWJA 2VC2B 1QFZA 4NE7A 3SX4A 3X2FA 3X2SA 5JJLA 4FMBB 2W2PA 1AC5A 1E18A 1UOEA 3OZSA 2XB6A 3NM6B 4RELA 3F8TA 2R62A 4C7KA 1CRZA 4FC7A 1XL1A 3V2IA 5DWDA 1UZNA 1M2JA 2YOFA 1DEKA 2H4HA 2WQZA 1FFBA 1PR6A 4PHTA 5AI0A 1CRLA 1DQSA 2GKSA 5C46F 1YZFA 1CJTC 1N6LA 1OIXA 2WPDA 1E4EA 3A4NA 3P97A 1KQNA 5HRAA 1NM5A 1SULA 3L5OA 3A11A 3H9CA 4HVCA 4YAGA 4NENA 5AM0A 4XCXA 1KFJB 1GAWA 2PK3A 1XZHA 1ESZA 1FFGA 1L7RA 3KOYA 4ZT3A 3VO2A 3HV2A 5SZHB 1AF7A 4FGKA 4MWCA 3LA6A 1QTQA 1WTCA 2WSLA 1UFOA 2BM8A 4PLVA 1OF1A 3DZGA 1S7CA 3OY7A 1M6WA 2JFPA 3RHZA 1Z9BA 3VDNB 4ZCIA 1RWXA 1NYTA 2PLFA 2ZZKA 2XXAA 2MMCA 3QF7A 4FYPA 3ZU2A 2VHEA 1TIBA 3NJRA 1BG6A 1M7HA 1KFKB 2E7ZA 3QF4A 3DEYX 2ZJ7A 3HNPA 3OE1A 2ID9A 4IP0A 4RGBA 4WK4B 3TLEA 4RD1A 5EIFA 2XDWA 1OSNA 4DDKA 2ZJ8A 4LSWA 1AQNA 2JGFA 5AI4A 2HY7A 3DQQA 5TRTA 2RARA 3P19A 4TTPA 1F0NA 3E05A 4FCTA 4A6EA 1PL8A 2LDXA 1DU4A 3LJKA 3EXIA 1GGNA 3H99A 4Q66C 3ZX4A 2YMQA 1GILA 2BCEA 2WVJA 4JC8A 3A3KA 2AN5A 2GCNA 4LX8A 4JLWA 4G89A 4ZYVA 4HGRA 4DLUA 3RC7A 3WHIA 2CLLB 3DG9A 1M1YB 4YONB 4RVSA 4I4LA 2WJYA 2FJPA 3TZCA 3ZTTA 1E6UA 4EJ0A 1I80A 4KK4A 1SQ0A 1U8ZA 2QVGA 4LDQA 1OJ7A 2DBVO 2GUWA 4FT4A 4LNAA 4F97A 2OHHA 3E8MA 5FR1A 5B1IA 3JASA 1IZZA 2KLHA 1N5RA 1AIPA 2VJPA 1XAGA 3KOWA 3RJ5A 1IU9A 3IAAA 2XTJA 1OIWA 3FB1A 3ZI4A 1YUMA 1HG1A 1E5VA 3DA8A 3WDSA 3QMMA 2YHBA 1Y6GA 1MEEA 1NJGA 2FFBA 2D1FA 4NAVA 3Q8KA 2ZI5A 3ZQ6A 3VC7A 2QG4A 2X15A 4FEYA 2OILA 4RY9A 2WAYA 5CFQA 1FYEA 1ZSYA 2HSGA 2RB4A 3RS3A 5B58C 2OPHA 1NMYA 2WQ7A 4MVJI 4BZPA 2BUAA 5CMLA 1DKNA 4V1CI 1KKMA 1HM5A 3QVSA 4FOTA 4M22A 1CNEA 1VJ1A 2H06A 2MR5A 5AVZA 4NFHA 5D3MB 3RNOA 2J9XB 1OREA 1QGED 4FOPA 3MF4A 4Y2PA 2A5YB 2FCAA 2P6PA 3NGXA 5ICGA 3JQFA 1IFXA 2GEVA 5CPFA 4LVOA 3HWRA 2DBYA 4U9HS 3MWEA 3QEJA 3RV3A 3V8VA 2G7ZA 1AMOA 1Z08A 3L4BA 3NOVA 4Z3OA 3GNQA 1C8BA 4BV9A 2IYEA 4X62B 1PJQA 2IYOA 3QA3E 2QYTA 5EE3A 1FDSA 1J99A 2E48A 3T9FA 5E1OA 1IYZA 4GEGA 4Y9DA 1HE8B 5EJ9A 2GPWA 4C0AC 4C29A 3I4CA 1SMKA 2J3IA 1EFDN 3N2LA 3CXRA 4PM4A 5BPFA 1NF8A 1DJMA 5A4JA 5K2OA 2XNKA 3M6WA 1EG2A 3PZRA 3SEZA 4JKIA 2DTDA 4FC6A 4PLFA 3WIVA 5EKXA 1YFLA 2O8EA 2VIIA 5B2EA 3SC2B 3SP1A 2O5RA 2R6JA 1QB7A 3N6XA 5DDIP 1H2AS 3OP4A 1ARZA 3MYRA 1OYWA 4MAMA 3SZ3A 3B3GA 4RIIA 5LCXA 1Q7GA 1GN8A 1N9GA 3MGKA 1XDDA 1CR4A 2Z5VA 1KI3A 2PZGA 2EBHX 1IOLA 2HCBA 4ARVA 2BEJA 1Q77A 1DARA 1PD1A 1HFJA 2Y0DA 3FMVA 2VPZA 1XD2B 3OLQA 3TUJC 4IJQA 1C0PA 2DU8A 3TBHA 1AXGA 3OJLA 2BGLA 3CWQA 5MFZA 5KYTA 3I0ZA 1GRRA 4CMIA 1ADGA 3NDPA 5M2QA 3MWDB 2HK8A 4RD0A 1QPZA 1ZHOA 3AMVA 4YRDA 4DFDA 4WOJA 3O7MA 3KAQA 1D1TA 1X7ZB 4I55A 3TXXA 4MEJA 1SRRA 2IQIA 3L8HA 5EIAA 5IKXA 1MU0A 4URWR 1K6MA 4IQ8A 1ID8A 2ODBA 2R84A 1OBCA 1JNXX 1U0SY 2MDTA 7YASA 5LDHA 2AHRA 3V9PA 3ZWVA 3GLIB 4TWIA 2JVJA 3ENQA 1GDTA 3JQGA 1OCEA 1TAQA 2DFLA 4EPTA 3TMAA 4M7PA 2WW8A 5JSKA 4Z99A 4CQJA 2XUDA 1ZISA 4O5OA 3K0BA 1ORTA 4GNKA 5EXTA 4B46A 2EDCA 5DIZA 3MWYW 1YC5A 3H75A 5K03A 1GXSA 2IHJA 2ICAA 3O03A 5C1IA 3V1LA 3OUUA 1KRWA 3ILXA 5K3DA 3REGA 4MHTA 1K3FA 1BE8A 3AF0A 3DAGA 5FQNA 4BKQA 4ESHA 5FNVA 2OXFA 3QH4A 3MUEA 4GMXA 1JIIA 1ULTA 1CW2B 2KM1A 4AXBA 3RUDA 4BN4A 3OA0A 1VKRA 1EWQA 2ZS9A 4H3HB 4QSMA 1F38A 1N1EA 1T2DA 2O4UX 3H5VA 3I9OA 3F6BX 5J4LA 1KP9A 1ZI6A 1DIOB 1SXJC 2DH5A 3ANLA 3C5WP 3K96A 4GBGA 4MW1A 4IMJB 4WCVA 2OL4A 1Q0PA 4WY5A 3CLTC 1GA4A 3BIWA 5JYCA 3WGGA 2BGUA 1D9XA 4XGIA 1SUFA 2PVSA 3PLRA 4R2XA 2HHAA 2YW2A 4YMVA 2GVDC 5FBHA 3G7SA 1UKVY 1T3TA 5MF6A 1A5SB 3Q9LA 2LD4A 3U1VA 1ZW6A 2A0UA 4OCZA 4HUTA 2BBSA 1G21A 3IPXA 2XOXA 1TQHA 4RESA 1NXXA 3GP8A 4YUWA 4Q1FA 1KIAA 2FN8A 3TJMA 4PQRA 2FR0A 4ZIRB 4M9SA 1SEPA 1JDUA 4FW8A 4ALKA 5CEJA 2VFAA 4BBAA 3MUNA 4KPEC 2O19A 4BTVA 1LK7A 3GUYA 4M7RA 4QTTB 2FEOA 1WQ3A 2B98A 2JS7A 4G26A 2JLUA 3TVTA 1KAOA 2E49A 3M2TA 3X3HA 3H3XA 5HIAA 4KXXA 1PZEA 4Q9NA 1G0OA 1ZP6A 4HLQB 5DXJA 5KTMA 5H3HA 4M37A 5DM1A 1XNJA 2G0AA 4ZI3A 1TAUA 5BR1A 4H9GA 2C5GA 2FVXA 4ZGWA 1I1OA 1CNMA 1ZMBA 4AP9A 3ECSA 1BCSB 1Z06A 1RVDA 3KZKA 4ZVTA 1NV8A 2B94A 2V7EA 2HIGA 3B2NA 1P1FA 3CEAA 3LU1A 4Y2SA 2XDQA 1X39A 2H1IA 3PB3A 3ROTA 4WASA 2B1JA 2VNKA 1D8TA 1U8XX 3KPWA 3LVRE 4N8SA 4OHUA 3MFYA 3A1DA 4AUKA 1AA9A 1XWIA 3H1AA 3QUSA 5BQ3A 5A1TA 2XNJA 3G6WA 5JY1A 3W9YA 6CHYA 4PTYA 2Y1WA 3RUAA 1GXSB 1P31A 1ZUIA 4ZCQA 5DYIA 3T12A 1JXOA 5HDQA 1U3VA 1E99A 1JSRA 1QZXA 1G6OA 4ON9A 4PR0A 3HYNA 4RMHA 5J63A 1LPSA 2H85A 8AT1A 4M8LA 1KI2A 1N9ZA 2IBMA 3H2ZA 3HCNA 1E7RA 1ZG3A 1Y5MA 2VXBA 2HMWA 5BQ5A 1VL2A 2ZRPA 3IKMB 3TOSA 1UKCA 5D5HA 1ABEA 4RTQA 1AK1A 3FBGA 3KYIB 3IYLW 1V39A 3D0RA 3HDGA 5CXXA 4BJ6A 1KGSA 1U1FA 1M33A 3W8NA 3IMCA 4JL8A 4M2LA 4Q9IA 3UJ8A 2QW0X 1QP4A 3NHZA 1CSEE 1CEEA 1N0WA 1S1CA 3GOHA 5KDDA 3RM3A 2VDPB 5CG2A 3DE5X 4NWIA 2Y76A 4UFOA 3ZDEA 1X7XA 5CLJA 4IHJB 4EY8A 3CTPA 1W6UA 2W6PA 4G07A 4XVHA 4X85A 4D2IA 4OKIA 2AX4A 1ESNA 3B1YA 3OQJA 1VE3A 2QQ5A 2ZROA 3E22B 1PSDA 4GYJA 4TQAA 4GKJB 4XYGA 1YR3A 2EIHA 1DCTA 1C1YA 3CZQA 3M9XA 2XIJA 1W5TA 5KHLB 1KJ8A 1AV6A 1XP5A 2JGKA 5IFKA 2X1LA 5C8YB 1WVMA 3FPLA 2LCIA 4DPLA 1Z8HA 3BS4A 5EE5B 2IC5A 3HJRA 3ZEAA 6AT1A 4I9FA 1ZUNB 1NQVA 3ND9A 5IYZB 1QVWA 1CHDA 3AM5A 3O7WA 3PUYA 4Y9RA 4K40A 2IYFA 4DJ5X 1VA5A 3TTUA 3E2PA 1T25A 1YBVA 4IDPA 1O95A 3D7NA 1J09A 4MIOA 3VU1A 3JD0A 1NP7A 2CCKA 1N6IA 4GWKA 1Z7WA 2IH5A 1ZLYA 1PLLA 5K0ZA 4PCLA 2R6CA 4B6FA 4EJSB 1QZ3A 3X1KA 4BU1A 2VHYA 3BIFA 3A4TA 3O73A 3E1SA 4U7GA 2NAFA 3ICVA 3DZFA 5CYPA 4HOYA 5GGYA 3UANA 1Y8QA 2D5BA 5A3SA 5GZ3A 1D2MA 3W5HA 3LC7O 3M6FA 2JGLA 3I92A 5E7JA 1OXXK 4KP7A 2OKCA 2ZRCA 3K73O 1X77A 1E4OA 4IFBA 4MWZA 5HS4A 1ZYUA 3UAYA 2ILVA 3BSYA 4JOBA 5CCEA 1D2EA 1OWNA 2XTAA 5AUPB 5SYAA 2WRZA 1B0ZA 2Q3BA 3FGOA 3FLBA 2QNIA 3DUFA 2ZUVA 1FQJA 1S4MA 1EX9A 1V3TA 2YXBA 3MCTA 5G1NA 3WK5A 1HQKA 1C3EA 4XYBA 3P0IA 2C8LA 3EMKA 1FMCA 5DBOA 2FI1A 2NSJA 4KVFA 3PJRA 3HZHA 3AM3A 1E5QA 4WOKA 1QGUB 1Z5NA 2OT3B 2PZAA 3HBNA 2AJ8A 2UZ3A 3CUYA