1JIIA

Crystal structure of s. aureus tyrrs in complex with sb-219383
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords tyrosyl-tRNA synthetase
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 96
structure length 319
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jiiA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jiiA01
2O8VA 1N2BA 2E0IA 1YI8A 3ND6A 1WKBA 2CUZA 2E21A 1EUYA 1MOPA 3ZJVA 1N2EA 2DPLA 1T6XA 2J5BA 1GPMA 1PFWA 3G5AA 3MMXA 3DV2A 5TEVA 4ZT3A 4K03A 1V47A 4BWVA 5H16A 3INNA 1KQNA 1K97A 3RJZA 4CT0A 1U0BB 1J21A 1JECA 1IH8A 3E27A 1MBZA 1I6MA 1F4LA 2QJFA 1NSYA 3FNRA 1T9GR 5TEWA 5FO1A 4KR9A 4MUEA 4ZCRA 2A86A 1TQ8A 3VRHA 3H9CA 2E89A 1U7XA 3AFHA 3UOWA 1KH1A 2D5BA 1VBNA 5FO0A 4J76A 1JZSA 3P52A 4MAFA 5DB4A 2GOYA 5HG0A 1OWOA 4CDNA 3N9IA 4MWBA 4K0RA 2A1TR 4NAUA 4OJMX 2CT8A 4MW4A 2AG6A 1H3NA 4WNYA 1R6TA 2QJTA 4YP5A 1G8HA 2HMAA 1O97C 3CLRC 4MQ6A 3TQIA 4L2IA 4G6ZA 1K4KA 5DK4A 1OWNA 3X1MA 1M83A 4GU5A 3FOCA 4EFKA 4MWCA 1LI7A 3IOBA 1OWMA 4NATA 4G5YA 3X1JA 4MVXA 1VBKA 2QUIA 2JA2A 1B6TA 2A88A 2J07A 3D6VA 3IVXA 3MUEA 1Q11A 1U7DA 1U3DA 3I05A 1Q77A 1WQ3A 3ZJUA 3VU8A 3UC5A 3UK2A 5KCMA 1FYDA 3CLTD 4MVYA 4NX2A 1EJ2A 4R2LA 3TZEA 2TS1A 3P0JA 3CR8A 3LOQA 4Q93A 3QE4A 5J59A 4UZEA 2D54A 2H2AA 4I6GA 1I6KA 3AG6A 4AS1A 3CVUA 3RFFA 1LI5A 3HFJA 2J08A 4E1AA 3AKZA 2YWBA 1ILEA 1PFYA 3LCJA 1IQUA 2PZ8A 2PXHA 1TYCA 3N2YA 1EFVA 4YP6A 3CVWA 4L2IB 1JZQA 2CYCA 3IDFA 3MLBA 1ZH0A 1N1DA 3L93A 1MAUA 2DR2A 2WSIA 3NV7A 4G5FA 3COVA 4U63A 2IELA 4HJRA 1XNGA 5J5AA 2DETA 4WSOA 3KT6A 4EF6A 3Q4GA 1QQTA 5LLTA 1WXHA 4ZT6A 1NI5A 1QRSA 1COZA 1M8KA 5KWVA 1IVSA 2NSYA 2HZ7A 4KKVA 3KT8A 1GZUA 1YUMA 2J4DA 3H97A 1O95D 4Q16A 5H7XA 1J1ZA 3AIIA 1KKUA 3TNJA 1MRZA 1PG0A 1GTRA 2A4MA 2PFSA 4R2MA 4MUNA 5K0TA 2V0GA 3TS1A 3ZJTA 3RK1A 3RK0A 3AG5A 1KQPA 2G36A 1EFVB 1XNJA 4ZCQA 3ILVA 5HUHA 1YUNA 1QJCA 3PNVA 1R6XA 2DUMA 1VLHA 3N8HA 4EG6A 1ULHA 3H05A 2XRZA 2PZBA 2CV2A 2PG3A 2CV1A 3P0HA 3FH0A 3ND7A 2BYTA 4MW7A 1QRUA 1O94D 1CT9A 1S4MA 1MC1A 3F3MA 4MUKA 3A4IA 2EJCA 4DJAA 1NP7A 3IUEA 4MWDA 1NUPA 3HL4A 3FI0A 3KFLA 4UZFA 4X0EA 2ZP1A 2YY5A 1O5TA 3IOEA 1QRTA 2JANA 2AKEA 1NZJA 3BL5A 2R5WA 5LM3A 1WJGA 1Y42X 5DASA 4ZT2A 3QTBA 4GRIA 1I2DA 1JILA 3ELBA 4FZJA 2Z08A 2YXNA 5LFAA 3S3TA 1O6BA 3HMQA 1YIDA 1JMVA 1M1ZA 2XRYA 1VL2A 3SP1A 1ZJWA 4MW2A 1OD6A 5AHWA 3PRHA 1GN8A 3HGMA 4ZCSA 3ZGZA 4MULA 3MXTA 3Q12A 4JYZA 3COYA 2H29A 3QTTA 4NDAA 4MUJA 1PFUA 1QNFA 2PIDA 1TYAE 2YWCA 2C5SA 1WY5A 1J1UA 2CV0A 3ZUGA 3G59A 1F9AA 5TGTA 4MW0A 2ZUFA 2QJOA 3FETA 1WZ2A 1O97D 3CLRD 2DXIA 3UY4A 3N05A 4MW9A 4P2BA 1RQGA 4YBRA 1GAXA 3GLVA 1NUSA 2WQ6A 3CVVA 3PNBA 1BS2A 4J75A 1N2IA 4JXXA 4XSVA 3DLAA 2A1UB 4QBTA 2EL7A 3RBAA 3TQOA 1WQ4A 4MLPA 2GM3A 1PG2A 2JAXA 1WXFA 4MUIA 1GTSA 4QRDA 1N2GA 4NAHA 1MB2A 1KH2A 5FNZA 5TS2A 3U1VA 1TEZA 2AZXA 1WXIA 1EFPA 2Z09A 3VGJA 1IHOA 1Q19A 1N78A 1YIAA 1H3FA 4MUFA 1WXGA 3DO8A 2HGZA 1IQRA 4ND7A 4PY2A 3FG9A 5K0SA 2Z3VA 4EG4A 2V0CA 1N77A 1QU2A 3KT0A 1JIKA 1EUQA 1XNHA 1NUUA 2CSXA 1KORA 2PZAA 1JGTA 1TFUA 1QTQA 3A2KA 4H3SA 4ND6A 1FFYA 4ARIA 3OP1A 2WQ7A 1KQOA 1F7UA 1IRXA 2CYAA 3CLSC 3K32A 1G59A 3SZGA 3IH5A 3COZA 5BNZA 1MB9A 4PBSA 1P7PA 2QUJA 3CLUC 1JIJA 2X1MA 4CQNA 2VTBB 4DE5A 3RHSA 1EFPB 4RUKA 1KH3A 3HZRA 3SZ3A 1X6VA 2NZ2A 4ZT7A 5JBNA 1OWPA 3H9BA 2RD2A 1F7VA 1R6UA 1LW7A 3MLAA 4A91A 3M5WA 1V8FA 1D2RA 2QUKA 3NBAA 4KR7A 1QU3A 1GLNA 2DEUA 4ZT5A 2CYBA 2J09A 3PXUA 4DDMA 4EG8A 3K9WA 1JEEA 3CLSD 4AQ7A 3CA8A 1T9GS 2E18A 4EG5A 3ZXIA 3GUZA 2BTEA 3AL0C 3CLUD 1T6ZA 1O96B 2QTMA 1A8HA 1WOYA 3ZIUA 1N3LA 2ZUEA 1HYBA 1M8GA 3SEQA 2IJGX 1UFVA 4U8HA 1N2JA 1DNPA 1ZUNA 3TZLA 3IVCA 1EE1A 4U7JA 1VBMA 4MVWA 3A05A 2A1TS 1G8GA 2A1UA 4MUHA 3COWA 4R0NA 4OUDA 1G8FA 1TYDE 2QTRA 4ZT4A 4DLPA 1X8XA 4I6EA 1J09A 4KPUB 1SURA 3OTWA 3FY4A 4YP7A 2VXOA 1OWLA 1K4MA 3X1KA 3DPIA 3G6KA 4JXZA 4S1OA 1IFXA 5J58A 3CLTC 4MUGA 4DDHA 1H3EA 3SEZA 3IODA 4EGAA 1OBCA 3H99A 2WB2A 4XFJA 3IMEA 4MW5A 4F4HA 2B7LA 3CVYA 3FWKA 3IUBA 1XJQA 3FDXA 1PFVA 4EG1A 4MVCA 2RE8A 1T6YA 2OV4A 3A04A 2DERA 4JFAA 1JEDA 3IVGA 2A7XA 4F3RA 3GMIA 3SDBA 4I6JA 3KT3A 2A84A 1M8JA 3D6UA 2X0KA 4ZCPA 1ZH6A 4OUDB 1MJHA 4RPIA 3P0IA 4JZYA 2VTBA 1N2HA 1N2OA 2OQ2A 4ARCA 1J20A 1MAWA 2X1LA 1M8PA 4TS1A 1H1TA 4HK4A 2GKSA 4QREA 1KP3A 1OBHA 1O95C 2I1LA 2QTNA 4DNXA 4KR6A 1NUTA 5IHXA 3Q10A 5F23A 2CFOA 3ISJA 4MWEA 1KAQA 3UMVA 3HV0A 1JIIA 1IQ0A 3CVXA 2DLCX 3IMCA 1K92A 1JHDA 1I6LA 5HUJA 1N75A 1KAMA 3C8ZA 1WXEA 4MW1A 1O96A 2X3FA 3ND5A 5KHAA 1KP2A 4XFDA 1O0BA 2O5RA 3LE8A 1O0CA 4HJXA 3NBKA 4CDMA 5IJXA 1M8FA 1NYLA 4HPWA 4MW6A 4YMIA 1J70A 3SYTA 4NZPA 4ZCTA 5DEOA 3IMGA 3JXEA 5EKDA 1U3CA 1Q15A 4EG3A 2IP1A 1YULA 1O94C 4PBRA 3ZXSA 3IOCA 1EXDA 2QUHA 3L92A 4DDKA 1NUQA 4KPUA 1KR2A 2D13A 3FIUA 3PNYA 3FHJA 4PBTA 4EG7A 1TYBE 1NURA
chains in the Genus database with same CATH superfamily
2O8VA 1YRAA 3MYYA 4HWKA 4O6VA 3PENA 3HY4A 1USUA 4RYDA 1KBQA 1C1YA 2QU7A 4FILA 1K86A 4MV6A 1D2EA 4TSKA 5HS4A 3DE3X 1UM9A 5AW4A 1GUAA 4KTVE 2JEOA 3KZ1E 4DA8A 2VNIA 1LBSA 3EXHC 4AN1A 2W42A 2ZWIA 4RV5A 1ADBA 4G89A 4Y9RA 3K6SA 1KE1A 1AHPA 5FBRB 3ECCA 1EFTA 3E27A 3E3NA 4X5OA 1BJKA 3KEQA 1SG9A 5KTPA 2I8CA 2PZEA 3OQPA 1AZWA 3OX1A 2ATXA 3PVZA 3IA7A 2WOOA 1V8PA 3SMQA 3VR4H 1E69A 3LXUX 1E3WB 3DUFA 3O3MB 2OK7A 4RYLA 1CEQA 3H18A 1XCGB 2MHCA 3I62A 1IZ7A 2C94A 4GO1A 1S8FA 1JYEA 5K9ZA 1QDUA 3RVJA 3A2NA 3B1ZA 3O75A 5HA5A 5LKAA 1E20A 3O4HA 1HDEA 1JHVA 2CVHA 3L0DA 1JG4A 1ZNZA 1XAJA 1ZC4A 1KBOA 3GJ5A 2D1TA 3ZS8A 3N86A 2PS1A 1WNFA 1AKVA 4MMZB 1HLFA 3LXRA 2R8OA 1JIVA 1RPJA 3TPFA 4Z3OA 3W5CA 1X8JA 4OB8A 3R4CA 1QFSA 5CJ2A 1C4KA 4DMMA 1L7VC 3AXSA 1M1YE 3BQNB 3JRWA 3L7NA 3NRJA 4IIGA 3WLQA 5HR5A 3K09C 2HJSA 2XWPA 1O97C 3CF0A 1GUYA 1SVOA 2MYNA 4R1NA 4ZIRA 5CEJA 4ZMBA 1RZVA 2ECQA 5LVAA 3ROEA 4B8WA 3A1DA 3PQ8A 3QFCA 4NZZA 2YV1A 2WTEA 3FOCA 1E6LA 1VYUA 3T3IA 3ZY3A 4ZYTA 2LCFA 3KE9A 9MHTA 4Q4LA 1LI7A 3DVAA 5ED4A 2ISQA 3DLTA 1EXVA 4BFVA 4EK9A 2JK1A 4YRPA 3MTDA 3D6VA 4EA6A 1Z35A 1RAEA 2PGDA 1GTL1 3REOA 1X0XA 3QZUA 2PV7A 4O2RA 4PSDA 4ZRDA 3UHPA 1U7ZA 4DIDA 4IP0A 2YFQA 3VU8A 4NJMB 5DBGA 1I10A 1JTVA 2WKWA 3FVRA 3GEHA 2PWZA 2FNAA 4NEHB 2GAIA 5TQJA 1ESDA 2RGWA 2OORC 5E2IA 4YPOA 2HA6A 1X7HA 1NVGA 2WA2A 4WLOA 2O5EA 2OESA 1MV8A 2C9MA 3U7JA 2JAOA 5GVSA 4I1VA 1XD2B 2BUBA 2HBQA 4HO1X 1XPUA 2PEYA 5KVSA 2IV7A 4FYXA 1QG6A 1R0XA 3W4JA 3QRWA 2J08A 4RTJA 3SPXA 3PP8A 3QOWA 1PFYA 4IDDA 3KOYA 4M8LA 3BMCA 5TVGA 2XRFA 1E1QD 4UTPA 4DV3B 2CLFB 1OF1A 1JYSA 2FQXA 3ZIAA 1SMKA 5EZYA 4BUZA 3I0ZA 1XA3A 1FDTA 3PDIB 3D7LA 4GKBA 5FA6A 3HUTA 1N1DA 2H1CA 3TFWA 3W6PA 1E89A 4DJJA 2E49A 4HB3A 3COVA 2BHSA 2GN2A 4PQRA 3BFVA 5CFRA 1RLUA 3OIVA 2JFVA 4OOEA 4CDRA 2QI9F 2ZUWA 3G0HA 3KQSA 3PGMA 5BVHB 1Q7TA 1M8KA 2Q27A 5ULLA 2J3MA 2PTGA 2DFLA 4BC1A 2EZUA 1WCWA 3ZCUA 3MWGA 4JOQA 4L73A 1ORTA 4WKOA 4J91A 3FZYA 2WINI 4MS3B 1QBGA 1GGKA 3GEGA 1L7BA 1FFGA 2FVYA 4AECA 2QLBA 2R4QA 3ISVA 3LC1O 1XROA 1HLGA 3PQFA 1D2MA 4R1UA 1M76A 5IFKA 4IAOA 4WY5A 3JALA 4P3OA 5JXGA 5TF0A 1FDSA 1I4WA 3A4VA 4M0LA 1ZQ9A 4YCBA 5LWQA 2FN4A 4DDTA 2GK6A 5FFNA 2XMGA 3S6JA 3U40A 4PW0A 3BHMA 3U5ZB 1P18A 3IO5A 3ILVA 4RTPA 4HGRA 2C0CA 5HUHA 1T5DX 3BSSA 5TT1A 2Q1SA 3H4VA 3Q87B 4RZHA 5EQDA 1HX7A 4R7ZA 2CKDA 2R2AA 3UUEA 5HSGA 4EB6B 4NQZA 4OBBA 5ALVA 3ZY6A 2BSAA 1LLFA 2IIPA 4TTSA 1ONPA 2OLEA 2PG3A 3M33A 1OX4A 4RACA 3EFEA 3DYBA 3HHPA 2ZTSA 3RO7A 4EB0A 3VNSA 5C1OA 4BNWA 4H1WA 5DHTA 1K4YA 1CJCA 3UB2A 1ZAYA 1O9BA 5I7WA 1KFJB 1RXYA 1UMDA 3BUSA 3V1UA 1D4FA 5BXQC 5SYMA 1EFKA 2P9CA 1IOZA 4TRNA 2X3UA 4BXOA 7REQA 1JMYA 2WG0A 3EEYA 5BQPA 4WZAA 4BKRA 4X6UA 4IFIA 1I2MA 2JLCA 2QLNA 4PLVA 3N2ZB 2EJBA 4NYMR 4JLJA 3GUCA 1E5XA 2CXTA 2PAFA 2G0AA 1U2EA 4KE7A 2W71A 4J4BA 4F11A 3SXPA 5K05A 1X94A 1SBQA 2OFOA 2PLFA 1H94A 2QAIA 3WKAA 1P3JA 4LF6B 1RDFA 1U7OA 3MTIA 1X15A 3OM0A 2R5WA 4MZDA 4YB8A 5CW2A 2Q7DA 5JYDA 3OD5A 3OEHA 4M0UA 4RNCA 4US0R 3VPXA 4OK3A 3VR4A 1I4DD 4FYJA 4G0ZA 1UXOA 1T9CA 1OH7A 1C8VB 1FFDA 1DAIA 3TNDA 1KI9A 4G63A 2OG1A 3A9WA 2PE5A 1G8PA 3IVRA 3UV6A 9ATCA 3EXHB 4QDOA 1E0AA 4EEKA 1TLLA 1TT5A 1DDGA 4MEBA 1BA2A 2I4TA 3OPYI 4Q24A 5K3DA 4B85A 2GH1A 5JAUA 3LF1A 3TR6A 3R6LA 1XK7A 1NRJB 2NSHA 2HIGA 2O8EB 1W9MA 2H4ZA 5LQKA 3ICOA 2X5XA 3T3GA 2ZBVA 1WG8A 2YBDA 1JDBC 3W79A 4A7PA 2EKBA 4DV0B 3H1TA 5ELXA 1FC0A 5K45A 2W6JA 1GGMA 4LHZA 4YCNA 2NZJA 4DIUA 1VCHA 4DCUA 2VP3A 3QVTA 5TGZA 5SYNA 2FR0A 2HLDD 3N59A 3W5IA 4TMTA 3HCPA 3IEMA 4IWYA 4MRRA 2WP0A 2Q8QA 2F9FA 4BZWA 3D7SA 2OR3A 4AF7A 4BFYA 2NZYA 3UKJA 5B53A 4DYVA 4ISCA 3FETA 1MZPA 3OT1B 2GVZC 3AGPA 1XR3A 5L3SB 4MKFA 5JS1A 3UY4A 4A0QA 3B12A 4C0JA 2I7XA 1KEEB 2YZ7A 3W2FA 2VJQA 1RHJA 2ZJ4A 1E3EA 2QTTA 3VSBA 2ASVA 1F2TA 3NOVA 1P4AA 5E7IA 3T4EA 4H18A 1MGPA 3ITDA 1NUHA 1OW3B 1SVLA 3MB8A 4CEIB 4OU4A 4HL6A 3C7DB 3EZYA 1VKOA 5FUMA 1LX7A 4ENRA 5BSKA 4GYKA 3TVDA 3CNNA 3TQOA 4DEXA 5ICSA 1NULA 1P1HA 1OLUA 2DF8A 2JAXA 1V0JA 5IEJA 5IT5A 5CG1A 2OZLA 1C1DA 2HDOA 3TVTA 5JXWA 4IDFA 5TS2A 3CO0S 4G37A 1RBZA 1Q57A 1U02A 3P2MA 2M2IA 4HDRB 1DAPA 1J00A 4PXSA 1ATZA 4AD8A 3RAEC 1FNBA 3E3LA 2J3HA 3MTGA 1B8PA 3J80A 3BREA 4ED9A 4I4LA 4DSZA 3CPSA 4NP6A 3RQIA 2OD7A 4NY1A 1CB0A 2VDOB 1MV5A 2BR3A 3CUSA 3H83A 4B5KA 5K6RA 3AM1A 1RC1A 3Q5EA 3L4JA 4D8XA 2BMEA 2X5KO 2IU3A 3I3SR 1ADFA 1EX6A 3C6YA 3UXYA 2J85A 2XVMA 3K4HA 4KAXA 3CRVA 3HLTA 5EINA 1MO3A 2X7XA 2B1QA 2ZJYA 3WYFA 4ID9A 3LKDA 2P77A 5KQRA 3I30X 3LUJA 2F43A 3NYWA 4MS4B 3TTUA 1MC4A 4ARIA 4NNJA 4PPGA 4WLNA 5JH7A 2KB0A 4X92A 1Z45A 3WMFA 1S1CA 4QPDA 1RPZA 5JS8A 3MMZA 4EAAA 4BQRA 5M2QA 2IZOA 3IUSA 3P27A 3T9BA 1KYIA 5CLHA 5IBRA 2GXUA 2XVZA 3KCQA 3OH8A 2A9JA 3P2JA 3T94A 5DPMA 4ETNA 2FWJA 2VCEA 1IBLB 2J3QA 1AKNA 2BM9A 2DH5A 2FZKA 2C03A 4KVFA 5F12A 4PZYA 5KNDD 2WHPA 2I2XB 2XD9A 3LOPA 3TZHA 4Q02A 3ZHXA 4D43A 1K63A 2Z2JA 2HT6A 3MS4A 5IANA 2NV6A 4C0AC 4INOA 3AEKA 3VPDA 4WK4B 4AXXA 4CMKA 5IKOA 2QL6A 1VJGA 5B58T 4KYVA 3VKVA 4DAOA 1CBUA 3T9FA 3T99A 3ZHUA 1RPAA 2Q0XA 2SCUA 2PQ2A 3GNQA 5FXMA 1XP5A 2AR0A 2O2SA 4IYJA 1GLNA 1FFHA 3GDOA 4DSUA 1UINA 2NT4A 4PZEA 4DDMA 2K2WA 3ER8A 1ACLA 5K2MA 5KMGA 2IPLA 3B1XA 1JEEA 1NOIA 1F60A 3GY0A 3U9SA 3MWLA 1ECLA 1GA4A 5EJ5A 3TGPA 5GM2A 3ZXIA 1SUIA 2YZKA 4OK5A 4M88A 4N8DA 4ILKA 4PG5A 3QXSA 1A95A 1N3LA 3QMWA 2GZ3A 4EO9A 1JR3E 4U9HS 1M72A 1UKVY 1Z22A 2UYHA 4RDXA 1ZEJA 3ZI7A 4AG6A 5AVRA 1IY8A 1NE2A 2VYVD 3OPVA 4YROA 1KY4A 5BMVA 3OCUA 3LLMA 4UJ3A 4N7MA 5EPUA 2GHIA 3UMGA 2AXNA 1G8GA 1Q7BA 2B8TA 2ENUA 4P38A 1XPOA 3PQ3A 3I5MA 2ZKIA 5IKPA 4Q37A 2CJYA 3CRNA 4GM4A 3NHAA 3DE4X 1KSFX 2CVPA 1KYWA 2IDZA 1RI2A 1N2CB 3JWIA 2JIRA 4PIPA 2PXAA 5DXJA 2JLYA 4KPUB 2VPXA 3HB9A 4BKOA 4UVEA 3M9XA 1Y81A 3DXXA 4G8JA 1NKVA 2PT9A 1JFVA 1RZRD 3EJWA 3JD2A 3Q3CA 4B6FA 2DB3A 1CTQA 4JXZA 3ENKA 3FHLA 4YJGB 5G41A 3UK6A 4DNFA 3OZGA 2X9VA 4RENA 1PL6A 2GN4A 2ZATA 5KSZA 3M82A 4KVZA 3BWYA 3D0QA 1V16A 3NHSA 3VYSB 2D5CA 3IODA 4B83A 1J0BA 4DMFA 5K20A 3ZVNA 1EU1A 5DX1A 4NABA 3GAZA 1NOJA 2EIXA 2A0WA 2NZXA 2K2QB 4NE2A 1A4IA 3TYXA 1KZ4A 4M9UA 4BJ5A 1JJ7A 1AHNA 2W6ZA 1TZKA 2HJRA 1XZAA 4P6VF 4F4HA 2DBRA 2E37A 2CF6A 3EULA 1K8RA 2R1TA 5KCZA 2Y1CA 4QPNA 4YT5A 4EG1A 1YMVA 4QT4A 4X7MA 3K0CC 2RH8A 3A04A 4MRMA 4RXUA 1YL7A 2Q49A 4JFAA 3MMSA 3M6LA 1JEDA 1BH2A 5CVDA 4Z2YA 1E2DA 1KJQA 1G8KA 3FYDA 3HBFA 4XZ3A 3LY8A 4LF9B 4EFMA 3GP5A 2OHVA 1G20E 4KSBA 3KPJA 1W87A 3C97A 1F2UA 4A6DA 1K7FB 1NVUQ 1KOFA 1ZD9A 2Z83A 4BP1A 3K70C 1N2HA 3ZNPA 4B3MB 5LMNB 1VL1A 4DLRA 5TNXA 3GJRA 4WNIA 1OJLA 1Z5PA 3ZJ4A 4CF7A 4K6CA 1GTG1 2CZCA 3JQAD 4ALNA 2C5HA 2Q4BA 4H0FA 4E30A 3BB1A 4BASA 4DNXA 3V3TA 2C4WA 1UP4A 2JGLA 3P71T 4KQMA 4REOA 4N3BA 5FBLB 5BUSA 3E0QA 3WGYA 2ZTLA 3ZHOA 1AV7A 1UDXA 2I2DA 4LYFA 4A8JA 5ALZA 3FYSA 1NRXA 2PNJA 3UVEA 3VX3A 1P60A 1G3QA 1KAQA 1OC2A 1W88B 2ZI7A 4GFDA 4YR7A 1VGRA 2XZPA 4B3GA 4R8MA 1I2BA 5E3HA 3RV4A 1TW2A 4QO7A 3U3OA 1CETA 3C3AA 4RCVA 3GGSA 1NJ8A 5ESXA 1OAOA 4KO4S 1HDXA 2PVPA 2XNCA 1C7ZA 4FFLA 1UKYA 2QYSA 1WXEA 1N7GA 2CLLB 3TCNA 4BL5A 2XSZD 2QN2A 3MT9A 4K9NA 4M9XA 4QDZA 4ZHSA 2ZU6A 1KP2A 2RB4A 2O06A 1HQKA 2DWQA 2O0HA 2O5RA 3N58A 4YJFB 2O0LA 3CJQA 3NBKA 1V5GA 3PQ4A 3EGDB 3I09A 4RD0A 5CA0A 1BX1A 4PVCA 4E03A 2EC5A 2OXFA 3DZJA 2P9BA 3MOSA 3E3AA 4JDUA 3NT2A 4JP1A 3IAM1 2UZIR 3GFTA 1IATA 1FTSA 1L4KA 1P33A 3FWYA 3CTMA 4GSLA 1N33B 1T15A 4G23A 3H3JA 1U3CA 2IV3A 3AXTA 1JMKC 4RGVA 3KQMA 5D5HA 3ID6C 4ZAWA 5HQTA 4TTJA 4BQSA 3IV7A 5JTTA 3TFOA 1ZLXA 1ODJA 4PBRA 2ZSJA 2AJBA 3WHLA 3L40A 4G2NA 5KVAA 2Z8XA 4DLKA 3DM9B 2UZ1A 1UPBA 2HO5A 4FW9A 1GUFA 4AUNA 5C4GB 2OB1A 1GGNA 2NPOA 1E2JA 1RRMA 1KEWA 2FPSA 2QN1A 5AI4A 4NIMA 4TZKA 3CVJA 1USGA 1J6UA 2Q0SA 4OXQA 3L6CA 2ZT8A 3GCWA 1FXUA 3G2JA 2J9GA 3OAAA 1E1MA 1SG0A 3GFRA 4IO0A 2FJPA 4RQUA 3UJ6A 3ZI4A 3G5AA 3CONA 4B33A 1FSGA 5CR9A 1V47A 4HQOA 4GX0A 2FPRA 5EJFA 5IDYA 2NW6A 1BWSA 3RJZA 2ODPA 2XIJA 1GTVA 1IVNA 3F6CA 4WECA 5AW8A 4QIHA 1MBZA 3L0YA 4WW0A 1NRWA 5J4VA 3VTAA 3EOZA 5BURA 1F4LA 2HU5A 2DSTA 2O54A 4WACA 5HKBA 1RVV1 4F60A 1V8BA 4BJ1A 3OZIA 4CM8A 2IV2X 4DYDA 1ISFA 4LHWA 4JQSA 5KU7A 3K71B 2REQB 1XXHE 2QTHA 2YVQA 4M9CA 1PR4A 7ADHA 2BEVA 2O2YA 3GT7A 2B4TO 1CZHA 1G42A 4HUQB 1JDTA 3JYHA 4XM2A 5GJWC 2GD6A 1JXOA 2WJHA 4XARA 1KIAA 3WL7A 4DY4A 1U7XA 4PVDA 4G0UA 2HD4A 3UB3A 2TSYB 4QO8A 4AXBA 3TGLA 4ESVA 1K6XA 5E7QA 3O4IA 3WL8A 1B2LA 1E3SA 1H2RS 2BONA 2PZKA 4J0HA 2F2TA 3VC2A 4URFA 1CUDA 1DE0A 1KYQA 3ZVMA 2JGFA 3WWOA 4GXNA 5JW6A 1T1IA 3OWHA 4TTAA 2ZROA 1P4RA 1Z6AA 4WNYA 4Y2GA 3N7TA 2QNBA 2OKGA 2QXYA 2Y05A 4KDRA 4JFRA 1EFRD 1L4HA 2NZWA 2X1VA 4MYUA 4EPVA 1KI7A 3VHQA 3ZD9A 1TTHA 4DBVO 2R6ZA 4HZIA 4TYQA 4XDYA 1M83A 4EFKA 4O8CA 3RREA 2KWIA 4EMSA 3EVGA 1O8CA 3AUFA 1FYVA 3RIMA 1I36A 1SCAA 2YZMA 1MH1A 2FWNA 1N6NA 4ZI3A 2P1ZA 3VR2A 3SQLA 4KFCA 3DEYX 1YR6A 3KOZA 3ZCPA 5LZ2A 1RWMA 5JS7A 4OAOA 1TVKA 2K7FA 3HBAA 5IMBA 5LL6P 1YB4A 1BHO1 2H57A 2NQTA 5IJ0B 4OHKA 5HEKA 4KPEC 4C6TA 4OP3A 1FDRA 3MIIA 5ITVA 2GTPA 4I1YA 4F5ZA 1TJ4A 2LPMA 3V2GA 4DPLA 2CMHA 3AHGA 1EZ4A 3JSAA 3BPSA 1YJCA 4HLDA 1W75A 2YXPX 4MAAA 4BP9A 4E07A 5U9CA 2FGKA 2DWUA 4YCDA 3P4UA 5MN4A 1RC8A 3IOMA 3SXUA 1Q1EA 4JP2A 2AUNA 3CVUA 4DKJA 3KQTA 1F12A 2Z8ZA 4F5DA 4PGGA 1DBIA 1O95A 5EAIA 1W5EA 1JKJB 4E14A 2HDWA 2Z6VA 1TYCA 1QPGA 5F1YA 1ZM2A 2WEKA 3PNLA 3SYRA 3VC1A 8OHMA 4BNMA 2IXAA 4BMXA 1BFKA 1R6AA 2B94A 3IOYA 2N75A 3PGJA 4WY2A 5K6TA 3BKXA 1E5LA 2DR2A 3DOEA 3CNOA 4BB6A 4O5OA 1GPJA 2CW5A 2FKNA 1Z5WA 3UBTA 4WHMA 4ZOEA 2IELA 3LT0A 5EHQA 5I48A 4CMEC 3GLFE 4PYRA 3D0OA 3Q4GA 1VMEA 1Z7GA 3P9ZA 5DISB 4C3VA 2X76A 1XRRA 1B3BA 4PAQA 3B1FA 3L4BC 1NG1A 4UM9B 3I2GA 4M0EA 5THQA 4HX2A 1GPYA 1XQ6A 1LF0A 1EUCB 2QRLA 2FEAA 2W9XA 3KSZO 5FWYA 1CUXA 4OHUA 2O6LA 2UVPB 4LE1A 3Q3GE 1G8YA 1Y9DA 2IPAB 2QW1A 2AOTB 1XWIA 3HCCA 2Q07A 4TQAA 5CIQA 5I7AA 4F1KA 4H0NA 3KQLA 2FOXA 5B1HA 4IRMA 4PXAA 4R2MA 4MDFA 4Z8YA 4IX9A 1HORA 2P41A 4QLOA 4DIEA 4ZDKA 3W78A 1ISIA 1IHPA 2AEJA 2QSYA 4L8FA 4O2BA 2D3TA 3F2IA 1RHMA 2R4TA 3LQKA 4S35A 3OTGA 4UW9A 2F00A 2GFIA 2Q2NA 3UICA 2WKSA 3S8YA 2CFIA 4GMDA 4N76A 4HGNA 3TNYA 2FPGB 2RAUA 3L1UA 4CLEA 5C7OO 2LRHA 2PK3A 1L5WA 5FEMA 2NU6A 1WMFA 1QXSA 5FV4A 3T7KA 1QJCA 1M5RA 1WMAA 1YFKA 3RSLA 2A5YB 1I80A 4E94A 2RHMA 4P4GA 2QVZX 2Z43A 4FCTA 3N0XA 4GI3A 4MMYB 1I3MA 3SJZA 3ZDDA 4S2EA 4EG8A 3DEKA 3B5JA 3QE0A 1VE5A 3EWSA 2AN5A 3SBOA 1ZRHA 5FOWA 2EEPA 2IVFA 2R62A 1U1DA 3KHSA 1XHEA 1KC3A 4Z54A 2BI7A 4LNAA 5KOJA 1CWUA 5DLYA 4WOJA 1H9BA 3Q85A 2YY7A 2FPLA 2R47A 1C14A 3GLQA 1V4NA 3JQDA 3BL8A 3LSTA 3OJLA 5TQ2B 4H1VA 3A4IA 1FVHA 1W30A 4Z9YA 2EOAA 3QKSA 5AVOA 2DQYA 3GPIA 3BIJA 4A1FA 4GR4A 4B74A 5BT9A 1KPGA 3KLMX 2J3JA 1U5BB 2EXXA 3OICA 1QLWA 4QTZA 3CV3A 5KSYA 1LRKA 1BIFA 3TB6A 5IZCA 4A0GA 2QTVB 1GYQA 2IHNA 1LK5A 3MINB 4MR8A 2DE0X 3P9SA 1PK7A 4F5EA 1XIVA 2IPNA 4N39A 5IJWA 2XCRB 1AXEA 2BRUA 4JEIA 1C30B 2O07A 4FFSA 1Z83A 2WWHA 4XDZA 1EVLA 3DBLA 1IJBA 5DI9A 2JRLA 5B57C 3UYKA 4D82A 1CULC 2XMSA 4MQFB 4GRIA 4NBNA 1Q3TA 4B80A 2ZUEA 1SEPA 5ENDA 3ZHVA 1Y9ZA 5FAXA 2GEKA 4IOMA 2IHVA 4MEAA 1QUFA 1LA2A 4JU9A 4MS1B 2FP3A 4QUKA 1NXTA 3UBMA 4DG9A 2ZRDA 1IWBB 3M9WA 1WDWB 3P7MA 4CLOB 3RUPA 1BX0A 1XD9A 2HGSA 4WXMA 3ZGZA 1R12A 1LBEA 2CXOA 4HAXA 1SBIA 4MULA 1I30A 1ESNA 1BW9B 1F0YA 4URYR 2PUCA 4BCCA 3FUWA 3RANA 1DJQA 5A9SA 4HAVA 2EBHX 4NDAA 2XUHA 1UBSB 2FSVA 3W05A 4CR7A 4D6YA 4XFKA 2V7QA 4BNNA 1UMBB 1H2HA 5F1OA 3IMFA 3LSYA 3R74A 4GE3A 4LJ7A 3N3AC 4XIIA 2X8JB 4LG1A 2CV0A 3O3CA 4H3HB 1XEXB 3GNSA 2E7ZA 4E08A 3THWA 4PV7A 1L2TA 4OYLA 3ZBQA 1E3JA 4MRPA 4BZZA 2QD3A 3A58B 4MYTA 5LYYA 1EBUA 1ZCAA 3QWAA 4W9RA 1YS9A 1J8MF 1X9IA 2W0SA 3UHAA 3WFJA 1KRXA 1VOTA 1MABA 1RJEA 5K8UA 2PR7A 1XWFA 1TMOA 5F73A 1C0IA 3FUXA 3I2HA 3L43A 1P8AA 1K1EA 2F3RA 4XGIA 1Z28A 2W8ZA 3X1DA 2K87A 1YBAA 3DE0X 2BR5A 1O4VA 2QL7A 1TQ2A 4JR0A 3PXAA 1RWKA 3S2ZA 5F9FA 4W1RA 4F21A 4JL5A 4Z0TA 4WNCA 2G5CA 2F8TA 3SDSA 3QJ5A 5DULA 3C3PA 4WBNA 1HGXA 2O7NA 2Z09A 3IJ5A 4O4LA 2X2PA 4WAUA 1YIAA 4QTYA 3FRIA 1JT2A 1T2CA 2PJUA 1Y3CE 2X6TA 3BB4A 3MPUA 4J0EA 4DGQA 3QELA 1HSOA 1GPWB 5U1PA 1M1NA 3G89A 5TE9A 2Z3VA 2VP2A 2BFMA 1I0IA 1VFPA 3F71A 1QIMA 1RJ9B 1RYHA 2V3VA 2W4QA 1DWUA 2C3OA 4X1OA 1C7EA 4YCAA 3O73A 5DLQC 2JLUA 2IYSA 2J6IA 4C7OA 2WIFA 1KY3A 2FPIB 1OREA 4JSRA 3CGGA 3DBHA 4PCLA 1PNVA 4AO8A 2FDCA 1GM5A 2PRKA 1D03A 1XNHA 2VPWA 2C4TA 2CL6X 2XVXA 3B3GA 3MQ4A 1Z5NA 2HCJB 2X4IA 3FB4A 1A4RA 2BGRA 2J9FB 4H3SA 3LAWA 2AS0A 4R1SA 1KY2A 1ZMRA 4P2GA 3OHMA 1ORVA 2N0SA 2PCLA 4JZKA 3ODPA 2J33A 2W2VA 3EVCA 3OQ1A 4G1MB 4ZVLA 5KVVA 1VCIA 1Z4JA 3MWEA 4CXMA 1G59A 3S29A 5BNZA 1E1YA 2B3TA 5MFZA 3OEED 4JLOA 3FTDA 2ZIEA 5ALNA 5G4LA 2XUIA 3VZRA 1TZMA 4CM7A 3OFND 3ZXXA 4FZVA 4R9UC 3LWZA 3NW9A 3ZWVA 4BN4A 1S01A 4IV5A 3PXDA 5ISMA 2ACWA 1OHHA 4ZVTA 2Y6UA 1HRDA 1NVVR 1X6VA 4FMDF 5CJPA 3FKSD 4ZT7A 1PDVA 1YZKA 4U7DA 5ALJA 3U3XA 1C7QA 4AMZA 2IYRA 2MMCA 4PAOA 4ITUA 4PRLA 1N6HA 2BVNA 2GLTA 4G5GA 3ZTTA 2EP8A 5EQFA 3CT6A 3PB3A 3A9SA 1GU7A 3UW3A 1BDHA 3T3PB 4KV7A 4DBZA 3T5AA 1QP4A 1ZI6A 2C95A 3ET5A 1U04A 4DIMA 2RHDA 5T67A 2M6RA 4DSNA 3UHOA 1G5RA 1W8DA 1OXSC 1XXLA 3N2GA 4JEMA 2JS7A 1STOA 2I2WA 1AUOA 2Q8NA 3D8RA 2W6CX 3MWKA 3OIYA 4UBKA 4EG5A 3O4VA 3GYBA 4A16A 1RXSA 1S4QA 3PC2A 3RVQA 2WT9A 3GOHA 1ZVJA 3LZ6A 3IR6A 3TW4A 3H4MA 2YWGA 3THOA 3RYFB 1Q0ZA 1UBNA 4NE9A 3Q8MA 2AOUB 1QHHA 3BQ9A 4EPWA 2SECE 1ZZGA 1IY0A 1F2VA 1WPXA 1U1EA 2FK8A 2VKQA 2G07A 4HRAA 4YI5A 2VZ0A 4UQPA 4YTEA 2A0UA 4YVFA 3HPQA 1NDUA 3TLGB 2WICA 3PHBE 1WD5A 4CMGA 2A1UA 2IY7A 2YZ2A 3TRIA 1I14A 2ODEA 3HKEB 1LX6A 1TKBA 4L76A 3JYPA 4W5OA 1VE9A 4PSKA 4B5LA 2GBFA 2PXXA 2XQIA 4HMOA 2VCHA 3MUFA 3EEOA 3KZNA 1UBMS 3GJXC 3UA4A 1WV0A 3OJ0A 4J2HA 1P4JA 1YCGA 1CRWG 4ZOBA 3DW1X 4TMZA 3R7SA 4DLPA 3NBFA 1O08A 2NN3C 1YB6A 3CBQA 5SZJA 2HHHB 1MTOA 3P4YA 1PR6A 3A6GA 4GOLD 4LE2A 1LC0A 1F8GA 2RBEA 4HSEA 2OPHA 3U31A 1WXWA 2D5IA 3NDJA 2GZ1A 3W6NA 2RFLA 2RGXA 4HOYA 4R9RA 4GP6A 1KU6A 4TMFA 3FW1A 2JGDB 5LDDC 4ZQHA 3DOCA 4O08A 2GD2A 1WRBA 2LWIA 2WVGA 4M86A 3U0VA 2Z9DA 5IKEA 5JZVA 1LLCA 5K4HA 1IN8A 4XFJA 1W1IA 2FA9A 2Q0QA 3LWDA 5DXFA 3KBBA 5DLDA 2HUNA 1E6KA 3NWOA 4EX7A 3I28A 3RBVA 1WXXA 2YYAA 1E4YA 2PY6A 2E1PA 4D4KA 4KO2S 3G1TA 1BD3A 2OCIA 5ERGB 2QJWA 1NFFA 1QS0B 1WVMA 1G66A 2WMOB 4LEIA 4G97A 4JYMA 4M1OA 4OHBA 4V02A 3UF0A 5CA1A 3PEWA 1Z18A 3O4JA 1KDVA 1BYUA 4FMDB 2ZBUA 4HATA 1DUSA 1NJFA 3KT3A 4LW8A 2EGUA 4S3MA 4FB5A 1M2FA 1VJCA 2X0KA 1ZH6A 4OQLA 2R6FA 5A3SA 1G7TA 1UDWA 4G0PA 3IQFA 3DO5A 4DUZB 2C29D 3K9QO 3NBQA 1MAWA 1FDWA 1JHYA 5KJFA 2C5BA 2F1RA 5GJVC 3LK6A 4UOQA 5DYTA 2P67A 3F5FA 1BKYA 2R1UA 3VDMA 2JFPA 4DPMA 3LLVA 2DFTA 4ZALA 4EGQA 1G5QA 1LTHR 2P27A 2YJNA 1JHZA 1N8TA 3G2QA 2W6ID 3DXZA 3GAFA 4BV3A 1GUDA 2FFHA 4MWEA 4EHJA 4EYSA 2X7HA 4U5QA 2JLVA 4LVOA 1QONA 1RJDA 4OO3A 4AYXA 5KX5F 4G41A 2BMJA 3NCHA 3JVVA 4TLEA 1JA1A 3H11A 2V9PA 5K8JB 3U1BA 1ZITA 2Q3JA 3BHNA 3RR2A 3U0BA 1XLTC 5A1TA 1IG3A 1NIPA 2PRSA 3I01M 4RD4A 4J0GA 4HV4A 3UT5A 1K8ZB 3AUKA 3QVGB 1NF3A 3LRXA 2DWCA 1W85B 4OI2A 2KE5A 2HQRA 3E9MA 3WGLA 2VSQA 4G1FA 2GK4A 2V5VA 4GVXA 4M9QA 3THXB 2YW2A 1RD4A 1A8PA 1ST2A 4N0EA 4DM7A 3E9YA 3R4VA 3UJBA 4JI0B 3H04A 3O9ZA 3QBJA 1E1CA 4WLFA 1GT91 1QFJA 2WFLA 1U9YA 1AKUA 3A9UA 3CPHA 3ZX5A 1T3HA 1IIBA 2H52A 2IW3A 2O8DA 1LUAA 1V35A 1K5DA 2WYHA 2WSMA 1QMGA 5CU7A 2R1VA 1Z63A 2NP6A 3D31A 3IOCA 5JLAA 3R3ZA 3PL5A 2Y0BA 1KR2A 1Z2AA 3U4MA 3O8RA 1RQ7A 1MA3A 4Y1RB 2JKZA 3FHJA 2JW5A 2PQMA 3M5PA 1M2NA 3QGMA 2P2ZA 2CXHA 2NUBA 2V7GA 2MSLA 3ZI0A 4CM5A 5KQSA 1Z9BA 2PNFA 4G5HA 1JU3A 4ASUA 4YDHB 5LYJF 2W6QA 3I1JA 1CR6A 1XKTA 1IOLA 1T6XA 2J5BA 3Q6NA 4RTNA 4RADA 2PSJA 4BWGA 1PNRA 4K03A 4V03A 1FX0B 3AUJB 3JQGA 3UMRA 3WLAA 4LTNA 4GZ3A 2FXVA 3QFFA 3VAYA 5ICEA 3L1JA 2HNKA 1SC6A 3NEYA 3PG5A 4U00A 4HB4A 3WZLA 2HDHA 1EJ0A 3X2FA 3N7UA 1I94B 1I7SB 3L7JA 3WQHA 2B4AA 3T0FA 2OECA 3GJTA 1EXMA 1QZTA 3UOAB 3V7WA 4IZHA 2CHUA 3RVMA 1UJ6A 3OJFA 4PZ0A 3KDSE 1XQYA 2R00A 1CR2A 4WOCA 1KFEB 2YBEA 3IAM6 4HUJA 4WJZA 3KSUA 3R7NA 2ZBFA 3H86A 1LLQA 3L1KA 1KH1A 1D6JA 2WT4A 1A97A 3R5XA 3UT6A 4I9NA 5FO0A 3CPJB 3J81A 2E4UA 2EBWA 2F3UA 1F14A 3ESRA 2VJYA 3D6AA 4QFCA 3JATA 4EKGA 3A9RA 4FZ5A 4W82A 3PBKA 3D3QA 5F5LA 3L4KA 3HJFA 2ZBDA 5KX5B 3BRSA 4KEAA 4RZ3A 5ER9A 1YA6A 1FRFS 2QD4A 1QF6A 2HK6A 1OTHA 3AVQA 1IHYA 1C3LA 3AF5A 1NG9A 1AGYA 4O1HA 4YP5A 1H1DA 3MCAA 4LBWA 3U4AA 3HKBA 2EFHB 5B3LA 4UKDA 3HN7A 5L3RA 4JCCA 3MHPA 1CPYA 1E0KA 3P2IA 1HR0B 3D8BA 2YN2A 2F59A 2I4OA 4E3ZA 3P45A 1IPEA 1H2XA 2PBFA 4KGZA 2IEAA 1ND6A 1SZCA 4MSUA 3BD8A 1NOKA 3CURA 2RCYA 4F56A 1XXHB 1GJRA 3FVTA 5CP8A 2C7BA 2W43A 1U8UA 4CLRB 2EFYA 5EIBC 1HK7A 3JQCA 3DAYA 3GF4A 2MIIA 4XJTA 4Q9AA 2OZPA 2BD0A 1BQ4A 1LPNA 3GW8A 2GPSA 1EMDA 3SS7X 2HQBA 5KQMA 3HM9A 4FEEA 4ZI5A 2CMDA 3ZDXB 1K89A 2C7RA 2WU3A 5C8VA 1POXA 2G28A 1EGAA 3KSRA 4DLSA 3GGGA 2KLBA 4LF5B 4QNMA 1THZA 3O90A 4TLDA 4AROA 3L2OB 3M6MD 1RKBA 4JLKA 4UUMA 4FWIB 4K8RB 3TPCA 2WWXA 4RTMA 3GJ3A 1RQRA 5E4FA 2ABWA 1ULSA 2RBKA 2UZAA 5KSPA 2D54A 3QVVA 2W98A 4I6GA 4ZRMA 1SHZA 5GPBA 4F7DA 3K9NA 3FHTA 2JASA 2A35A 1V4BA 3W3AD 1QH0A 5CK5A 2W0MA 3VTKA 4CKEA 1GFSA 4GLBA 4FXPA 3PIIA 4GX5A 5EIBD 5F5NA 3TMYA 4EKEA 1EUZA 1VI6A 1QVRA 3HCBA 4FYKA 3KAJA 3EVFA 1HT1E 4CKEB 1QH9A 3GZTB 2OV3A 4LSGA 4TYYA 2P65A 2OCYC 2XNJA 1KDPA 3O31A 3R3WA 4JUBA 4RPCA 2I6FA 1TF2A 2DMRA 3AKYA 4LJKA 4Z0HO 3G5MA 4MTCA 1RQLA 4JU8A 2JFZA 3L7KA 4U9IS 3MD9A 5IJ9B 2V7EA 5KNBD 1LPPA 2FVXA 2H1IA 4WBSA 3UFXB 5IMSA 2QIOA 4DCCA 1KEKA 1IVSA 2ZIFA 1DJNA 4OI4A 1J0DA 2HXGA 2QW8A 3IHTA 3OFSA 1B8OA 3LFHA 1TMKA 1YOVB 3GRCA 5AK3A 2RAFA 1KVRA 3C45A 3B9RA 5CDYA 1ACJA 1W0KD 3WJ2A 3HXPA 3F5MA 1GNPA 5A5FA 1K3UB 2YS7A 2I7CA 2GMWA 2XB4A 4YYZA 5FJJA 2BAGA 3K94A 3ZTWA 3AY6A 3TS1A 4PWZA 1UJBA 1GPNA 4OHFA 1CJSA 3RK1A 1LPBB 5DSZA 1OVGA 3W5SA 3HJCA 1BCRB 1U2GC 3KOOA 4DMUB 1F17A 1PT8A 4NNOA 5KVQA 1G4HA 4BVJA 2G36A 1EFVB 4HXGA 3U4DA 1JSLA 4H08A 3GPDG 2Y2UA 3F8WA 4L0MA 3VHXA 2BFWA 1VZ2A 4W5RA 3KQHA 2X8LA 4Z86A 3DWEX 3LK7A 1VLHA 3IXQA 4GICA 4RMJA 5B1SA 1AQYA 1PKXA 4L7VA 3CF2A 3MERA 2RI1A 5F1KA 2A9RA 3V4ZA 3SXJA 4S2UA 1KI4A 3QE2A 4MRNA 3DZ8A 3GT0A 2C78A 2ZANA 4K5QA 4RGQA 5E6UA 3ND7A 5EHNA 2R97A 3RYCA 1R6VA 3DEIA 4B3HA 4DA4A 1Q6YA 4RIFA 3G13A 3KPVA 3OF3A 1JB9A 4E1VA 5FB3A 3NUGA 1ZIXA 1DC5A 4IY1A 1WSDA 1IB0A 4LRSB 1O94D 3HB7A 4MVJA 1QE3A 3SYLA 1QRUA 3AVUA 4EY4A 2IEDA 5AUQA 4EPTA 1YAHA 3E48A 3H9QA 5AKIA 1YHZA 3LDGA 4K6HA 4ZTBA 3JASB 5EWJA 1TD1A 3T1QA 3P2OA 3EXEA 3D7KA 3EQ6A 4M89A 3DCJA 3H9JA 3SVZA 2JGJA 3T9AA 5HIAA 1GPH1 4X85A 1SPBS 4D57A 4R1PA 3NM6B 1UADA 3CF6R 2BHLA 2P9JA 1NWCA 2RBGA 1RYZA 3D2LA 3PNQA 4NENA 4UDXX 3VU3A 4DDUA 5CURA 2Y71A 2FPWA 3GLHB 2ZUDA 2ZB8A 4X3CA 3ZE9A 1WJGA 1NZDA 2C5EA 1BC5A 1MIOB 3VSAA 3E70C 3DKKA 1AUVA 1QGYA 2XOKA 3GBSA 4H7PA 4KWHA 3PNMA 4M37A 1XMQB 2J59A 2A5LA 1CQJB 2VATA 2XB8A 5THXA 2RMKA 2MINB 2XBMA 4DREA 4CFYA 4YWJA 5DH9A 4ZDJA 4QODA 3LVFO 3K96A 4O2AA 4K1XA 3U4QB 2KW5A 1LKZA 1LPMA 1F4VA 3HGMA 1I7NA 3LH5A 3UJPA 5K4GA 1CUGA 2NAPA 3O8LA 4BB9A 4G4IA 5EIOA 4BFUA 2WAMA 1YI1A 3F5SA 4PG7A 2WOJA 3AH8A 1UXHA 2H29A 2H7VA 3DQQA 4YDSA 5CVVA 6Q21A 4BY9E 1KJWA 3R3HA 3VOAA 2VUHB 5F76A 3WAGA 1W4CA 1HF3A 2E3JA 3BEDA 2PO7A 1KQ3A 3DL7A 3EY4A 3N74A 5AKJA 3W2IA 2Y99A 1KPIA 4UVHA 4XAQA 1AX9A 1J1UA 5DV9A 4ESEA 2FEKA 2GZMA 3Q0EA 2FZEA 4LYYA 4PAMA 1EFAA 2ZUFA 2OZKA 3H8VA 3V80A 4IZIA 4M83A 3UO8B 3V6LA 1V3VA 3TF5A 5AJTA 4B76A 3EGCA 2Q99A 3G1UA 2R6JA 3R3JA 2ERCA 1U3WA 5U4XA 2JH9A 3IUMA 2FOIA 4C76A 1JQKA 2JKVA 3MMPA 4DRXA 1PG5A 1ZAKA 4YJ2A 1RIFA 1TT7A 4UFOA 4RFSA 3PCTA 3V4OA 4MV5A 2F62A 2J87A 3WL5A 4D4IA 5JAMA 3N8DA 2HU7A 1HMYA 2BFBB 3DMFA 4JVNA 2CJWA 1GILA 2Y0PA 4UUBA 1XU7A 3WBJA 3M4ZA 1FFXA 1QB7A 2JGKA 3JQ7A 1QIKA 2BGUA 4PHTA 3QXXA 5E0OA 4OX9Y 5FLYA 3WIUA 3SZLA 3RS2A 1TRKA 4F5WA 1SXPA 1FPQA 2D2XA 2YV4A 5FNZA 4I8XA 4X1YA 1WXIA 4Y2SA 4DJ5X 6LDHA 5JCJD 3D4NA 1W1WA 3DTVA 3X1XA 3ACBA 1R6BX 2AB0A 2P9QA 4MUFA 4ROTA 2X40A 1SR8A 1QH1B 2VDMB 3KVOA 3RVOA 2IUFA 3R09A 1P2UA 2W90A 2XDAA 1FUKA 3FJOA 2OVBA 5K4AA 3QHPA 1JAYA 1QU2A 3KT0A 1OZAA 4KXYA 3IV9A 5ERYA 2BFOA 1HWYA 2YH2A 4G36A 1CDEA 4WQMA 1N6IA 1D04A 4HD8A 4C03A 2D2IA 2YS6A 3C1AA 5ARCA 1S3IA 1WSWA 5EE5B 5HF8A 4EY6A 5JAPA 1WBBA 2GEUA 1DU4A 1UR5A 4BCDA 5B64A 2PX8A 3DFIA 4M38A 3SSMA 5FHQA 4Z7JA 5KHOC 4IG9A 3MBKA 3P9XA 4LVCA 4W7IA 2JJYA 4JLNA 2CYAA 1W0CA 3DTNA 3TIFA 1PGNA 2Z98A 4JLVA 2VYQA 1TTQB 1YQWA 1I5OA 1DV1A 3IERA 3O93A 4JEUA 5LWHA 5SZKB 3TLJA 2IZ5A 3H5LA 4OGWA 1BFDA 2X1MA 2B2NA 3LM8A 4IDAA 4B2PA 5A4JA 3NG1A 4ZU1X 2OLKA 3LDFA 3MQ2A 4WLEA 4ZKDA 2QT9A 4Q9DA 3MSXA 3OKCA 4X1KA 4EUKA 4DMCA 2FN7A 3QXGA 1WCYA 1BDJA 1S96A 3TZCA 5BOSB 1X13A 1J2TA 1IY1A 1QORA 1Z3IX 3PLRA 4BMCA 5IWAB 3MOGA 2HMVA 3DDCA 4U6NA 4D9IA 5LYJB 1X39A 1LY1A 1Y8QA 1U90A 1ZGBA 4W7HA 1YNSA 2GERA 3A4LA 3BAZA 1LPOA 1VQ1A 3O8QB 4KO8A 1AGPA 3IT3A 2J09A 2IIQA 3PXUA 4IJKA 1L3IA 3UMSA 3PC8C 3WBFA 4IXNA 3SIPA 4DJDC 3FTEA 5KZMB 1IBSA 3HCNA 2WWTA 3JQRA 3PKJA 2QG6A 2O6HA 2GN9A 2IBTA 2B21A 3T5GA 4UHCA 1CE8A 1RM3A 1E8DA 1TF5A 2FX5A 3KEGA 2Y3IA 4HQRA 3TIXB 5BN5A 2PT6A 4P5DA 4HLUA 2BKEA 4V2IA 4F9TA 4U8HA 3JAWB 2ISCA 1YKSA 2WU4A 4AJEA 4Y2XA 2XCIA 3AV0B 1NN1A 5E9WA 1CQIA 3FFXA 2XUOA 3BIWA 3U3KA 2G3YA 3GLTA 1QHXA 4FS3A 4CV2A 2O59A 5DZSA 3KTFA 1XZBA 1RYDA 1PZMA 2EG9A 1GKKA 1J5PA 3LQ4A 3AEUB 3OPYB 3A2LA 3HDJA 4KXWA 5E3JA 4EMBA 3M5DA 4QJIA 4TSFA 2PN1A 1XRPA 5HF5A 4WKNA 2R96A 4MO2A 2NLOA 4OQZA 1T5IA 2CGEA 2JBWA 4AO6A 4KQGA 3HXOA 3JAKB 1LDYA 3BMNB 3H2YA 3T7TA 4P53A 3X1KA 2C98A 1OPRA 2JCSA 4NV1A 4DDHA 3W6UA 4AJJA 2C2HA 4D96A 2ISSD 3HCOA 4D74A 4X65B 3URKA 3QFTA 2QTZA 1E2HA 1XGKA 4CMCA 4P3XA 4IJWA 2XR1A 3IFSA 3L9XA 3V8MA 1HT2E 3OZDA 4NAVA 3OQIB 4UAVA 3WNZA 3OETA 4QVIA 4N5MA 4GGPA 4YAJA 4DRZA 1M2OB 2I29A 3H3XA 1ULBA 1YE3A 5AKHA 1YB5A 4QU8A 2B7LA 3BC1A 4EI8A 3CUUA 3ESQA 3QJGA 4YMGA 2OGTA 5F7ZA 4RO0A 4NXNB 4I9UA 4P0TA 4E11A 5WRFA 4UE2A 1RYMA 2CXNA 3BIOA 3V8RA 1RXEA 3PE6A 3RJTA 2AJLI 2D59A 1YDEA 2WKPA 3G82C 5DP2A 2WIGA 1YRHA 1CVRA 1T1GA 4PZLA 1E9EA 2IOYA 3LCMA 4Z1MD 1D3AA 4FVTA 4MINA 4HRXA 3PJEA 4I4TA 3I83A 5IDVA 5EIWA 1NASA 2N47A 1FRZA 4XWWA 3GRPA 2XBUA 3EQZA 4J1NA 1P1KA 2VQEB 2MYTA 4WFJA 2HI0A 1ABEA 4MGKR 1LXCA 2IE0A 3CUYA 2ZWPA 3KYIB 1SB8A 4ENTA 2YL2A 4UBMA 3RQSA 5LQNA 2C3UA 4XTRA 4KTTE 2FW9A 4DBLE 4TS1A 2WJPA 3QVKA 4NPHA 1PS9A 4HK4A 3HCWA 5G3YA 3KIPA 3NMUF 2I4LA 2L2QA 1G18A 4P31A 1LNQA 5J40A 1X7GA 3JR3A 4K3VA 1C1XB 3O8DA 2V8OA 1PNTA 4EZIA 3DEJA 5EJEA 3A0UA 1QGUA 2ZJ1A 4ERXA 3Q1LA 1QK5A 2WF7A 3LV8A 1WMDA 4MA5A 1OCEA 4S24A 4TOIA 1PFKA 3DD1A 3RTEA 3NHKA 3CE9A 3OQNA 1H2FA 1HZZC 3P9IA 3IP5A 1H4VB 1PUJA 2CVFA 5K6AA 4D9GA 3K16A 3K20A 1CY2A 1RHUA 3OLWA 2ZSHA 1MA0A 1PSZA 1KXJA 1EGVB 1EM6A 2YVKA 2XKBA 2ATCA 3GNLA 4OVKA 2AMJA 5P8WA 3CMMA 3NKFA 3TEMA 2XVAA 3WYEA 1J70A 3X1WA 5TX7A 1P9NA 3OFJA 2AR7A 3C1UA 2OGSA 4DT1A 3QG5A 3SYTA 3J7TA 4C0KA 1CCWA 2GHRA 3RABA 3RC9A 5JC8A 2C2KA 2WILA 3GDHA 1Q15A 2HN9A 2QE6A 4Q7KA 4WVLA 4HDCA 1CLEA 2P69A 3USES 1R2QA 3LKZA 1NR1A 2QUHA 1YD7A 2QTAA 3IB3A 5KTNA 1JFLA 1KI6A 2RGNC 2PT5A 1OPXA 1WB5A 4RJJA 1IQPA 1ODLA 2D8AA 2IYNA 3AJDA 4RIEA 3TLCA 5IF9A 1UPAA 2JIMA 3TRKA 5DIZA 4QUEA 1G8SA 2WC1A 2OXTA 4WX2B 1IZ9A 4J43A 4YV1A 1E98A 3UUGA 1W4AA 5CB8A 1Q74A 4A1OA 3OU6A 4N0MA 1AQ6A 1PLLA 1N2EA 3IKMB 3G2HA 1VSQA 4ZYUA 4U39A 1I9GA 1JXMA 4KIGA 2XXJA 4R31A 3CCCA 1XB2A 3UMBA 2REBA 4A9AA 4Y6QA 1UOPA 4FINA 2DECA 4DZRA 1U2PA 3IAUA 3NASA 1QAQA 1PBTA 3RYIA 1D6NA 1BDBA 1A1VA 1J8FA 2Q3FA 2XKAA 1AA9A 2JFNA 1VMKA 1I6MA 5C34B 5IXYA 2BV3A 5AHOA 4DR1B 4EHIA 3SGLA 5EUBA 1DCMA 3AVXA 1NBOA 4BLTA 4UNRA 1OZGA 5DP1A 5FO1A 4WERA 3E03A 3GDGA 2JHGA 4G56A 2QN9A 4C7XA 3H8WA 2LGJA 3PUVA 1QX4A 2OSVA 1KYTA 4MKGA 2WNIA 3ICWA 2B5OA 2MMGA 3G7SA 3LC2O 2ZOSA 4JVMA 1UJCA 4ND5A 1DIOB 5GVRA 1UBFA 2HIHA 1AIPA 4K2HA 3WIEA 1YR7A 4XX0B 4N5DA 3BWDD 2YWRA 4JLPA 2GHQA 2XYVA 3MK31 3NIDB 5J4YA 4MQEA 4PLFA 3QLVC 2XTZA 4BOYA 4Q1DA 1PTJA 2B2CA 1II8A 1R8XA 3MBOA 4ZCIA 1JEJA 1PHPA 1T5SA 3AESB 3O9VA 5CDSA 1J2JA 1UIMA 2VF4X 3FNFA 2IDJA 1GKLA 3I9MA 2XGJA 4WEOA 1P6XA 1T8TA 2C77A 5A1JA 4L2IA 2W2LD 3HV2A 3R3SA 2Q6VA 3A25A 5DK4A 1XTBA 5REQA 3JTMA 1QFXA 4IVRA 1JFSA 3HNPA 2VJPA 3KJFA 4F38A 2Y66A 5BYAA 1E1QA 4ZZIA 1OWMA 4CF4A 2XZTA 1NW9B 1VSTA 2W2MA 1G21A 4FWBA 3MM4A 1SJ9A 1OGIA 2P2DA 3WADA 1P1IA 5L3QB 3KO8A 1N7HA 4H16A 5H5JA 3QVWA 5EE9A 3PE4A 2D0OB 2HWYA 4KXUA 2DP4E 4EFNA 3Q1KA 2PV0A 4B3IA 3GEBA 4A0HA 3MG9A 1LW6E 1F6DA 2A3NA 2VJDA 3HDYA 1NJ1A 1KRHA 4DLAA 1PT9A 1QWSA 4R2LA 2C4VA 1Y48E 4YJ3B 1RAGA 1ZGZA 3O2NA 3DHEA 4YP1A 2WZQA 1HEYA 4WN9B 1HTTA 3N8KA 3EISA 4JBLA 3VPFA 4ZZ0A 4B34A 5AW0A 4KK3A 2JBAA 1GQSA 3F6RA 4PRKA 1RBYA 3UJNA 2GDJA 4XA8A 1XDSA 5B6IA 4HH3C 4MYDA 3PPYA 5KNDH 3RPEA 1EXWA 4BO8A 1B3RA 3SFZA 3ZQKA 1YQ9A 1BS9A 1R9GA 3DWGA 1KPHA 3OZVA 2PKEA 2FQWA 4PO8A 2Y1EA 2HSWA 1E94E 3L7AA 5K0EA 1ISHA 1GA1A 5H3LA 1DC8A 5BUCA 4UU1A 4ZK2A 3ZWMA 5I4BA 4Z53A 5J3JA 1G7RA 4MRAA 1YACA 1FMLA 2HWUA 4ZT6A 2NUAA 4DDWA 3ETGA 1NA5A 1G291 1UC4B 3N2KA 4HXYA 1SK8A 4GMGA 1MD9A 3WKEA 4OIFA 1X9GA 1QGZA 2O57A 3QVSA 2D4HA 2HZ7A 1PT6A 3JV7A 5HDBB 5JSZB 1FK8A 4QBHA 4CBVA 4HEJA 3KT8A 5FX2A 2XIQA 2ZRPA 3QE3A 3CX3A 4AKEA 5TS3A 1R6DA 2FP4A 5DBHX 1UC8A 4EQ6A 1U2DA 2KLHA 4JJ8A 4BMYA 4CV0A 5BV7A 3WK9A 2OOSA 3RBXA 4L5CA 1U2SA 4B4UA 4IVPA 1P80A 1EK1A 3L0PA 4R6XA 1YBMA 2AE2A 3AEZA 1KDZA 1LBIA 1MAVA 3GCDA 4LQDA 1TVEA 4Z1OA 1EVYA 4TTRA 1LB1B 2VA8A 4YUXA 4KI0A 2ZSFA 1IJFA 3MRVA 2DOKA 3JQ8B 4EHKA 5AYVA 4QTUB 1VIDA 1XBTA 3PIRA 4PX5A 5CH3A 4TVOA 4NQRA 4NECA 4F9GA 5CD9A 3EB9A 4DUYB 3TL6A 1QK3A 3IQWA 4DIKA 5JDIC 3Q98A 2QD2A 1G64A 4K8OA 3DT8A 1KYZA 3P9CA 2XNSA 2ZIXB 2Q3DA 4PLHA 2NMVA 1OYYA 1WDTA 1FFSA 4MROA 1G3MA 3MHTA 2V55B 2XXAA 1RFLA 5CFLA 1FFEA 1N0IA 3OJCA 4A0FA 4FK8A 4YQEA 2BLLA 1PWHA 4KZKA 1SKYB 4JJ4A 4QUIA 3HH8A 5CJJA 4YRDA 4ZC8A 4QGBA 2NXJA 1IULA 3CSDA 1J2RA 3G8DA 1ZESA 1L4FA 4D9HA 1D7OA 1N5IA 1S8NA 4RHUA 3VR6D 1L7DA 1DG3A 3HL4A 2IPMA 4B79A 4G5QA 3UCEA 4ZEVA 1RNLA 4MB6A 4YCMA 3SKYA 3OF5A 1V43A 1GRRA 5F7JA 3NBUA 3W1WA 3P97A 3DF7A 5JZSA 2DQZA 1E77A 4P84A 4EHHA 3COSA 1EQ2A 2HLDA 3DOOA 4WZAE 5CVCA 5D5PA 4C2TA 1BNCA 1TAUA 3PKZA 4CKWB 3SHOA 1Q3HA 4B2IA 2VP6A 3E2IA 4PLCA 4GXQA 2BGJA 2P5TB 4FS8A 4JKYA 2FQYA 4XVUA 3QHQA 1HSZA 4Y9UA 1U99A 3E3MA 5D51S 4HYTA 3F9IA 3CEPB 3U7QA 5DXAA 4DWOA 1SXJE 4DIBA 3A3KA 1XFDA 2G5PA 1JKXA 1X1SA 1RR6A 5KOIA 3R3YA 1M6VA 1ST3A 3I0MA 3VH4A 2Z56A 5ITSA 3QJYA 1PKEA 1OASA 5EKTA 4ZYWA 2HRCA 3U3RA 3GRKA 3UJ3X 3W0LB 2DPYA 1TEVA 3R5SA 3WB9A 3WQBA 4BQEA 5EE3A 4TT8A 4BFXA 1YA4A 1LC3A 1WCIB 4LC1A 4PYNA 4Z49A 3AQ4A 1TYAE 2YWCA 1J07A 2PWPA 4PPNA 3DDUA 3FCCA 5LP6F 5D6OA 4BAGA 5AR1A 3ZUGA 1OKKD 3KL4A 3HA7A 2BEJA 3ECAA 2FWAA 3DT9A 4PF1A 1ZIPA 3R44A 4YAGA 3DFZA 1XKXA 4BEWA 2VH5R 1PGPA 1JDUA 3CLRD 2D2FA 3S5JA 3SQMA 5SY6A 5G1PA 2RH4A 5DRTA 2ZITA 4LNUA 4D9NA 7YASA 4HX5A 1NUSA 2I76A 2FW0A 3EVDA 5G3ZA 1ZCBA 4TV9A 1YDWA 1NQOA 1NY6A 2WAOA 1AKWA 4JJFA 1NT2A 1NXXA 4ND3A 5ALRA 4QBTA 3D3EA 2BKXA 2WWWA 5COQA 1TKAA 1PG2A 2WABA 2C2WA 5CUQA 1WXFA 4EKDA 3IL2A 2ICAA 1Y8CA 1GNVA 5DVZA 1GZ3A 2XMDA 2H7CA 2JGIA 4DBLC 4AZ3B 1UFOA 5L51A 4JP8A 4CF3A 4DR7B 2RHJA 4OLJA 2PGLA 3B7WA 3LGSA 4J0JA 3LYUA 2AT1A 2G4VA 1PR2A 4NYIR 4OQQA 2ZJ3A 3HXLA 4JJ6A 4TKMA 3OIDA 4CUKA 2IW1A 4TZTA 3TOVA 3H4IA 5K0SA 3QF4B 5KNDA 1ZA2A 3OKPA 1T4MA 4OA5A 4LOJA 4BBAA 1U3GA 1Z08A 3G9TA 3SF0A 3PZBA 2Q46A 1YA8A 2LDBA 1SUBA 3CNQS 3RVDA 1F0NA 5ITZB 3QKRA 1FA9A 1BROA 2IXFA 2Y1WA 3C8UA 3GJ0A 2HF2A 2ZB2A 5EWMB 3IEVA 3FYHA 4WFIA 5AI6A 2P2CA 1KORA 2HX1A 1FNNA 4HQNA 5EWLB 2UUCB 3ROTA 1H8ED 4Y1GA 3FDIA 1KMNA 3QG1A 2YWXA 4O59O 3WNCA 1N0VC 1XZDA 3MJVA 1NFRA 4P0PB 3GJSA 1N3YA 1N6OA 5KPDA 1APBA 2IZ6A 1XZLA 4CR6A 3WLRA 4ECAA 3CW9A 4OQFA 5KDDA 5FNVF 3VVCA 2OBMA 1Z2EA 4PX9A 4YLEA 4LSMA 4QYIA 4OHMA 5AXDA 4D45A 2Q3CA 4H6PA 2N1BA 4E21A 1H2EA 2OXEA 2IH4A 4PSCA 4TLCA 3C7CB 5MHTA 1ZO8A 1JIJA 1WU7A 2WD9A 4G8CA 4Q3AA 2GZAA 3H5RA 5K0GA 3OBIA 1PLKA 1AY0A 1ISPA 3HE3A 4IF4A 1B7GO 2ILVA 2VYVA 3DO6A 2BZ1A 1CJMA 4G4SO 1ZH8A 1LQ2A 1H85A 1EWKA 1ZYUA 3D2BA 3KVNA 4FYVA 3EPRA 4OHXA 2O8NA 3VYTB 1RU3A 3L6UA 5FI1B 5LP6B 1A98A 4OXRA 5AUOB 3EIEA 5JVDA 1V8FA 1SRQA 2CLIB 1NBIA 3HBMA 4Y2UA 3KQQA 4LV5B 5LQSA 2G8NA 4CKBB 1KFKB 1VSUA 1QOPB 1ZICA 4IDGA 5AXAA 4IKOA 4RZUA 1G2IA 1FW8A 1PSWA 1BE1A 1MQAA 1XJ0A 2ZWAA 3OEYA 4RFLA 2BGIA 5IW8A 1RHQA 3EF1A 3PR2B 3BCRA 4MDHA 4DARA 1RZRA 1IRIA 1NDQA 2BTOA 3TZKA 2Y1OA 2ZRFA 4GRAA 4R2XA 1ZQ1A 2XZLA 1I3NA 5FR1A 4KN6A 1HYBA 1L3CA 1CQWA 2GN8A 2VTKA 3MOIA 5IAEA 5JO9A 1W94A 4DF3A 3IVCA 4B4KA 3FXAA 2VFAA 2ZS7A 5FOSA 2ZIZA 2NU8A 3T3DA 4L07A 3QIVA 3ZHQA 2PBLA 3QENA 1UH5A 1XVTA 4A92A 1J8QA 4DEVA 2JAQA 4XGKA 4G01B 4LTMA 3R5HA 1QRAA 3SEFA 3QA9A 1WLSA 4M1YA 5A05A 4XIYA 1TZCA 1KFBB 2FSHA 3R3VA 3V97A 1M1YA 2G67A 3QUBA 2X0EA 3CTPA 3BRCA 1VZ3A 4XRGA 4BJ6A 5ALQA 4N3CA 5CNIA 4REMA 5FBHA 5LZ4A 1E9AA 3BXFA 3A4NA 2IYWA 2OXRA 4I3GA 1Q92A 1P2VA 2ZPTX 2ZPUA 1BXGB 4R8LA 2I1VB 1T8UA 2WB4A 1S9DA 3A1EA 1KZ6A 4LBVA 1EB9A 3I37X 5ALPA 4CQJA 3K0HA 2AEFA 4CEHB 2XW6A 1L7RA 3KYDB 3EVNA 5D3MB 3JQAA 3RRZA 4LS3A 4Z4HA 4ML3A 3AR5A 1PL8A 3PDWA 5F4ZA 5FNVB 2VLIA 3B9QA 2IS4A 3TD2A 2D0IA 2HHAA 3L8HA 4MICA 5BYJA 2DY1A 3OZ7A 2GJAA 2OUIA 1MLDA 4QLBA 2G1KA 4CKXA 1SQ5A 4NBVA 4GE0A 1V7CA 2HPVA 3PFKA 1FXWF 3A1TA 3ZWKA 3P1JA 1CQPA 1I3CA 3GLUA 3GZNB 2ZIVB 3W7VA 3OLZA 4LRUA 4UFPA 3IP7A 5GMOA 3P0RA 3PWSA 4QEKA 1CKEA 1N6KA 3FDJA 4W5TA 1R4NA 4NMLA 1VBFA 1USIA 4H27A 4BQOA 4CMJA 4D97A 5C52B 2XSZA 1MJHA 1OFTA 3BHJA 3B9BA 1DAMA 3EX7C 2PWYA 2VTBA 2FEPA 2VOJA 4H9GA 2OQ2A 3A6ZA 4N7JA 1U7UA 1Y6QA 5AW3A 1RLJA 1FTGA 1Z8FA 4R2HA 1S2GA 3HKCB 3EEIA 3QSGA 5FQNA 1XZMA 1J99A 5AXCA 2QMZA 1GZSA 4G8BA 5AFSA 3KKPA 1MT3A 4LHXA 4RK5A 5KJCA 3NC1C 1LJ8A 2QDXA 4QUGA 1SC3A 3G0OA 1NUTA 5KU1A 3DZHA 2QWXA 2XITA 4GLJA 2IRWA 3W8DA 2HXYA 4L57A 1BVUA 1A2KC 2AD5A 2BHNA 2DWPA 5FULA 3REQA 3WO1A 5KBYA 3CVXA 1T13A 2B5WA 3I1IA 4F93B 4CIDA 3AGQA 5ILGA 5JAOA 2O52A 4BV2A 2OUKA 3PNSA 2YWHA 4DDVA 1DIHA 2FH5B 1UT8A 2HJWA 2ZSIA 4FSHA 4BE7B 1OB2A 3QSYA 2BTQA 1UXKA 2H4XA 3AHIA 4GXRA 1T4CA 1NMXA 5BV8A 3CRQA 3TEJA 3ETLA 2I0FA 3UG6A 3O5AA 2J0UA 2ZUVA 1C8BA 1UUFA 4HJXA 1DAEA 2JLBA 3WHIA 2NOAA 1LVGA 4FDTA 3OBBA 4NZPA 1FFBA 4ZGGA 3F4LA 2GJ4A 3M3DA 3MF4A 5JYBA 2IODA 721PA 3W6ZA 3IMGA 5JNSA 2ZI9A 3JXEA 1WCV1 3K1TA 3JS5A 4HWSA 4LCJA 4EG3A 2FW7A 4PYQA 4RLHA 2RCNA 3ZD8A 2Q7XA 1LBTA 4IFEA 1EXDA 1OGYA 1CUCA 3NAZA 5AP9A 3EGXB 3M4XA 2VXBA 2H92A 5IVDA 1OXVA 4ZO6A 3ZDCA 2OFPA 4A3SA 5KYWB 3GLIE 3EFBA 3DVQX 3EAFA 2ZIWB 2X86A 5LMZA 3LX4A 1UCFA 1REQA 2OLJA 2V7UA 1DKPA 1G3RA 5AD1A 1XMIA 2PA0A 4IHJA 1R27A 5DYIA 3ZV3A 1QMPA 1GPMA 2QD1A 1JFFB 2QBYB 1GVHA 5KYUA 4NMWA 1QCYA 5CVEA 3ZV5A 1U7PA 3GROA 4XDHA 1AGNA 4M8KA 2ORWA 3WLLA 2SKCA 2JPDA 2V6BA 4GLFA 1WHSB 3AF3A 3FMVA 1EFRA 2WDZA 3HI6A 4XM0A 5BW4A 1BXRA 2H9IA 1ZJJA 2A9KA 4R7TA 4TQUS 4BKPA 5A6VA 3P32A 3GLSA 1G5PA 4UCQA 4KFSA 3I2YX 5DWVA 5JCXA 3UT0A 2NO7A 3E7PA 1ZGAA 4I99A 1E9VA 3BB3A 2GAFA 3RRYA 3WGUA 2RB5A 4FQ7A 1DKUA 1DHTA 3AF4A 5IH3A 5CNJA 3PXBA 3L8EA 1OWOA 2HMYB 3GEMA 4WL0A 2JKYA 3DOHA 1DKMA 3WO0A 3H5IA 3EIXA 1VC2A 4LC0A 5D01A 2P3LA 1SA0A 1Y1TA 2VPTA 3DNMA 5C46F 2QB5A 4MW4A 1QQ6A 4KQFA 5BUQA 2AI3A 1UM9B 1P2BA 5HF9A 3FMPB 3G0GA 3N6XA 4ND8B 1T29A 1UK8A 2ODTX 4TVBA 3MAJA 2ZS9A 16PKA 1DXQA 1K7SN 2ID4A 3OIUA 3TUZC 3AQIA 4ITVA 2N3ZA 1BQEA 2HNAA 2SNIE 5JBIA 3K6SB 2CE2X 3IEPA 1MO5A 3KJIA 5A4DA 1FFWA 4OHPA 3VHLB 3EXFB 3CPEA 1GNTA 2EBFX 3H5WA 3K0FB 4MVJI 2R2GA 3K8ZA 4AMBA 1Y8RA 1LU9A 1OLXA 3AEXA 3AUXA 2JA2A 3HYNA 3WBKA 2G8LA 2AI2A 2BSXA 1I6WA 1U5CA 4W6ZA 2Q4RA 1MHTA 2Z8YM 3KOWA 3DUFB 4MMXB 2IU0A 5G1OA 5JC1A 2VNKA 4ETMA 1T6NA 3K72B 2FSPA 5E3IA 1CUBA 1M67A 1SXJD 2O7SA 5J5VA 3ZGLA 3EPKA 1HQYE 2TS1A 3SF8A 3CX4A 1HQDA 4KLAA 5DCUA 2R1ZA 3ROMA 1P1FA 1NU6A 4DMLA 5G1NA 1Z06A 4HH1A 3WGKA 4U5XA 1F6WA 2V6IA 2GEJA 4LK2A 4BJ3A 5GJBA 3WWZA 1XTQA 2XTNA 2FZWA 3N5CA 4ARZA 3LCJA 5H02A 4GI7A 1NF2A 3N6VA 2L42A 4G85A 2I3GA 1L8LA 2X14A 4P3YA 1C2TA 4Q3EA 4ZIRB 1NVFA 4HI0E 4HDNA 1U0SY 5F3DA 2VNHA 4ZAFA 1YE5A 1Z07A 3S7ZA 1T3GA 5KWIA 1W36C 4QGSA 1B2RA 1L5SA 2VPPA 3C3MA 4K9OA 4AF6A 1QE0A 5FOXA 3OPXA 1EFUA 2FPXA 2EQ5A 3AETB 3DVAB 2X7JA 2ZREA 5J5AA 4AZVA 4HNRA 4F3CA 3ZVKA 2DETA 3HUFA 4L7QA 1KAOA 5IVHA 4CETA 2ID9A 1Y6JA 2IHKA 2NO5A 3KXLA 2A59A 1K8XB 4B6GA 3OZCA 4RXTA 4BP3A 2NSYA 2ZJ8A 3RJMA 1C8LA 3LPLA 4Q12A 3AV3A 4OOFA 2E9SA 3F49S 4ZQEA 3ISTA 1KO4A 1JI3A 4GH5A 4G5OA 1JPUA 2C7PA 5JJLA 4TYNA 3SY8A 3SQXA 2BFFB 1H6AA 4OMDA 5ALOA 4CMAA 4GKKB 2P78A 1NE7A 1TO2E 2H16A 3E8XA 4Q16A 3AEQA 1KKUA 3FCSB 4J94A 3HYLA 4OHOA 4YEDA 2A0FA 2BFEA 1OH8A 4JASB 2ZRIA 1GTRA 2HWXA 3KOUA 1KZGB 1EK0A 4BVLA 4YAEA 1W93A 3T7DA 3I52A 4ZV4A 4M6WA 4M9SA 2I3ZA 1GNLA 2MCFA 3ZJTA 2XJ4A 4FYMA 4MRVA 4HTFA 1JPNA 1IBKB 2VDPB 3K0KA 4PFSA 3BMCB 5EIAA 4CIBA 4RY2A 1QC5B 3CEAA 5BV0A 3RIGA 2P9HA 1QF9A 2XTMA 4E6PA 4O4HF 3SHWA 4DYHA 4RS3A 5J47A 2PLRA 1KIMA 4OB7A 2Y0CA 4R8VA 4UATA 5FL3A 3VX4A 1PP4A 4EI2A 1Y3DE 2JBHA 4LECA 4IIXA 1T1JA 3IALA 4UEOA 2GTIA 4Y3UA 5ARDA 2DR0A 1QCDA 2Q6OA 1Y3IA 5AKLA 4D8YA 2PQ6A 1U0HC 3ORSA 1QKKA 3GO4A 5ILOA 3AZOA 4JJ7A 2FW8A 1HKUA 1UJNA 1V1RB 2B3DA 2FHPA 2EAUA 5I9MA 4QG3A 3O7WA 1ZGHA 1OZHA 1PQUA 1QANA 4C1NA 1FFCA 4XB1A 3LFTA 4PNZA 1S9HA 3DCNA 1XCLA 3J7AC 1NVKA 2R85A 3WDLA 3R9XA 4MGIR 2EYQA 1MVNA 4UM7A 4FIDA 4HDQB 3FI0A 5DFAA 3JALB 1K8YB 3CX6A 3NTUA 2HQ1A 4MXDA 1ZXXA 4UZFA 5DIFA 3ZW7A 1J2EA 5TQ0A 3FNHA 1QG0A 1Y6ZA 1NZJA 2PVCA 3ONEA 2O9JA 5CPBA 4YUYA 5I7VA 1P0CA 2H2GA 4PC1A 2WUGA 2X0RA 4JDPA 5LA6A 4E5DA 1Z39A 4CTMA 2AFIA 3DOUA 3HWSA 3I92A 3ZGVA 4C4XA 4ZHQA 5HRAA 4OM7A 3B36A 3TLZA 1SVNA 1T9DA 4PLYA 3RHFA 4QNRA 3RVNA 2FMHA 2HK8A 5H0IA 5IEBA 4KGVA 1VJ0A 2J45A 3LGAA 3PR1A 1QCZA 4M8SA 1N5LA 1SQFA 3LUKA 4MW2A 1U31A 2QHXA 3AVPA 4Q00A 5EIFA 1QUEA 4AT1A 3SR4A 5C1BA 4I5FA 2OV2A 3R75A 3VJKA 4GBMA 3ZLJA 2O05A 4GMFA 1OX6A 4LV6A 1EFDN 1GN8A 1WKVA 1UPCA 4ZCSA 1ZI8A 4DHEA 5JNRA 1YC5A 3VXKA 3W4IA 3KXDA 2W5UA 3HACA 3R6GA 1A8QA 3I42A 4L8GA 1UMDB 2QIPA 1QYVA 4LXIA 2VDWA 2IQ5A 3IJPA 3AHDA 4W1QA 2C97A 3K5HA 5C8YA 3FZEA 4BXOB 4HX9A 2JFUA 1CY7A 2XOEA 7REQB 2DKFA 1VP9A 2RC5A 4CEJA 2C8KA 1T8WA 1T9HA 5K3FA 4BBPA 1JWBB 4DFDA 2C8JA 2HKIA 4GYYA 4LZJA 1FJ2A 3V32A 1QQ7A 3V55A 2QJOA 3SFVA 4E5SA 1XMJA 2WIBA 5KJEA 3MUNA 4YT2A 3H42B 1K06A 1AXGA 3GC6A 1CVLA 4LJ4A 4RSHA 1ICIA 3TBKA 1RW4A 2E6KA 3L84A 3W8NA 4BS9A 4O4HB 5CA0B 1KXZA 2DJ5A 2ST1A 2VJMA 3JTEA 3RWOA 5BQXA 2QE7D 3DMHA 3CZ9A 2QAGB 2XCLA 4TUYA 3ED5A 5F5XA 5JH7F 1BHSA 3RJ9A 1ZHHA 4Q9IA 3PFGA 1DTSA 3DVRX 4M7PA 4DCJA 1AK1A 1W76A 2EATA 4DEYA 3RBAA 1DJLA 1TT5B 5DCWA 1AD2A 1JHPA 2JJMA 4O4JF 3O8CA 2VJOA 3MT0A 5AJUA 5AM1A 3BD7A 4LQLA 4NYIQ 3A7EA 3MTAA 1S7GA 4FCCA 1EFPA 2OBLA 3MMNA 3LKVA 2VTEA 5F35A 3CR3C 3OEEA 3P5SA 2EZTA 1WUKS 2O3QA 4HNHA 4NJOA 4UREA 4ZAZA 4ALLA 4S1VA 1CD5A 5DYWA 4DSTA 2I91A 1IQRA 3OFNA 5KHLB 1SOWA 2YXDA 4GQAA 4OBWA 1U1IA 4LFAB 2ZAYA 1Y9AA 3CXUA 1RLTA 4O8ZA 4BVFA 1N77A 1WNTA 1BGVA 4R6WA 3QE9Y 1WULS 4Q01A 4FJ1A 1PUIA 3FKSA 4A8JC 1TK9A 2YMMA 3IRVA 5HS6A 3NOXA 3SNHA 3FJYA 3G3EA 5LXTF 1UBEA 3LBIA 3PGVA 2ZYAA 3NHJA 1ECPA 1RWXA 2SHKA 5HM8A 4BGDA 3C15C 4LGYA 1UWLA 4UNSA 5EG5A 1SU7A 3SAJA 4RVUA 3PNPA 4QXPA 1F2TB 5K8IA 1MX9A 4YQFA 2P9YA 2GQ0A 1CJBA 3PK0A 2UXBB 5CFMA 2J5KA 2P8JA 2J48A 3CLSC 3H0EA 3PHCA 2GSDA 2HA4A 1ZN2A 3MBIA 1W0JD 4OH7A 1W36B 4WK6A 1P0MA 3COZA 1R0BA 3DM5A 4IDPA 4OLFA 4W5QA 1OLUB 4HDAA 1QV6A 4PS1A 3DQZA 2V7TA 4TXNA 2AQHA 4DC1A 4HNAA 1P44A 2M32A 4F6RB 4QA9A 1SIUA 5GGXA 3PUIA 3VQTA 1GQQA 4AJNA 1YRWA 3PICA 3B1KA 1Q1QA 2QSUA 3AZPA 1KO5A 3B7GA 3HNRA 1IM8A 3IVAA 3HXTA 3I76A 3LZCA 4KDFA 2CUKA 4BB5A 3IV6A 2BDTA 1S3SA 1PQYA 3H9BA 3C3WA 3GARA 1EWYA 2IL1A 5J4HA 3HZHA 1YH3A 1WA5A 2C3MA 2VPQA 2GPWA 5DYGA 4XSGA 5B58C 1WZUA 5LIRA 4ABTA 1DQYA 4NBRA 1LK0A 4EUEA 1JHXA 1G8JA 1WAMA 2GF2A 5B3JA 2IU4A 4KYTA 3ZDQA 3HO8A 4WBXC 2XZOA 5CGZA 3R76A 4J16A 3ONDA 2WJZB 3SC6A 4C0XA 2CYBA 3QFHA 1NLFA 3CLSD 4JBXA 4XVCA 1J0XO 2RG1A 121PA 5HKAA 1Q7EA 2H5IA 2P7HA 2WF9A 4JJAA 1RMQA 4J90A 5JMTA 3BMXA 3G9UA 5FLKA 2J9YB 4YRRA 5HTOA 4I1IA</