1JIIA

Crystal structure of s. aureus tyrrs in complex with sb-219383
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosyl-tRNA synthetase
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 96
structure length 319
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jiiA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jiiA01
2CYCA 4TS1A 4L2IA 1QJCA 1LI7A 5H16A 1VL2A 3HFJA 2PZBA 1GTSA 2NZ2A 1QRUA 3COYA 1ILEA 3H99A 3ELBA 2JANA 2DUMA 1N1DA 3DLAA 5K0TA 1NZJA 1GLNA 5J58A 3GLVA 3LCJA 1I6LA 1IFXA 1UFVA 4YBRA 1NP7A 1NUQA 3FNRA 1PFUA 1OBCA 1ZH0A 4WSOA 3ZXIA 1EXDA 5H7XA 4ZT7A 3CVUA 4FZJA 3ISJA 3RHSA 3FG9A 4F3RA 2IJGX 1MAWA 3IUBA 5IHXA 1J1ZA 4G5YA 2QJFA 5F23A 3SZ3A 2D54A 1MC1A 2O8VA 1NUPA 2QTRA 3RFFA 3ND6A 2PIDA 2DR2A 1EFVA 2RE8A 4PBSA 2E89A 3SEZA 1N3LA 1O96B 2R5WA 3H05A 1NYLA 1NI5A 5K0SA 4J75A 2A1TR 3CLSD 1EJ2A 2AG6A 1A8HA 3Q12A 5HUJA 3N9IA 1U7XA 2VXOA 1PFYA 3SYTA 3HZRA 2A4MA 2EJCA 1JIIA 4EGAA 1J20A 4K0RA 1WQ4A 2QUIA 4U63A 2Z09A 1IVSA 2Z3VA 1JEEA 3RK0A 1KR2A 1WQ3A 1I2DA 3SDBA 4YP7A 1GZUA 1H3NA 3M5WA 1Q19A 4YP6A 4EG6A 4DDKA 3PXUA 3IDFA 4EG3A 1KP3A 2AZXA 3CA8A 3AL0C 3ZIUA 1IH8A 3QTTA 2QTNA 3L92A 3ILVA 3A2KA 4JFAA 3X1JA 1F9AA 3UOWA 3P0HA 4R2LA 3N2YA 3MUEA 1I6KA 4KKVA 3D6VA 1M8KA 1IRXA 1M83A 4ZCTA 1OWOA 1G8FA 2GOYA 1K92A 4HPWA 1ULHA 1V8FA 3DPIA 3IMGA 1M8JA 1JZSA 2DXIA 2J07A 4EG1A 3ZGZA 3H97A 1P7PA 3Q4GA 1V47A 1O0BA 3TQIA 1YUMA 3CVYA 4ZT5A 1TYAE 3G6KA 1FFYA 4QBTA 1N2OA 1WXHA 2D13A 3ND7A 3SP1A 3AIIA 3FDXA 1EUYA 2YY5A 1N2BA 2OQ2A 3PNBA 2CV0A 1BS2A 1OWPA 1JGTA 4PBTA 1QNFA 4MUJA 1H3FA 3IODA 3NV7A 3QTBA 3DV2A 1ZUNA 1T9GS 2J08A 3SZGA 5AHWA 4F4HA 3FH0A 4MW1A 1RQGA 4A91A 1MAUA 4DDHA 3UMVA 3IOEA 1WXEA 1KH1A 1O97D 3JXEA 4MUEA 4I6EA 4ZT4A 4AS1A 2HGZA 3IH5A 1M8PA 4GU5A 3X1MA 2EL7A 4PBRA 3INNA 3UK2A 3IVGA 2V0CA 4YMIA 4BWVA 3AFHA 1GPMA 3KT0A 1N2HA 2A1UB 1N2IA 1NUUA 1O96A 3FIUA 3CLRC 5HG0A 3P52A 1JMVA 1JIKA 1JECA 5TS2A 4JXZA 1M8FA 2X0KA 1FYDA 4HJRA 2IP1A 1WJGA 3VU8A 1O94D 2WQ7A 2A86A 4MQ6A 3P0JA 1MB2A 3H9BA 4XSVA 2CSXA 3GMIA 5TGTA 1QU3A 2E0IA 4ZCRA 4NZPA 5LFAA 1WY5A 3CLUD 2JAXA 1O95D 4KR7A 3IUEA 3MXTA 1KH3A 1PFWA 1VBKA 3G59A 3FWKA 1COZA 1KP2A 4ARIA 1CT9A 3FHJA 2X1MA 3KFLA 1J09A 2DEUA 4OJMX 1Q15A 5IJXA 1XNHA 4MVCA 1NUTA 1WZ2A 4UZEA 2DLCX 3C8ZA 1N77A 4HK4A 1R6UA 4MW5A 1EFPB 1X6VA 5J59A 1IQRA 1J70A 3MLBA 3N05A 4S1OA 3L93A 4EG7A 3COVA 1H3EA 1G59A 5KHAA 3CR8A 2ZUFA 4Q93A 2DPLA 2E18A 2A84A 4XFDA 3TZEA 1WXFA 3NBAA 1NSYA 4EFKA 2WB2A 4ZCQA 2H2AA 2PG3A 1U3DA 1QTQA 3CVWA 4ZT6A 3PRHA 2WQ6A 1NUSA 2YWCA 2A1TS 1TYCA 4JZYA 1T6XA 1TYBE 1WXGA 1KAQA 1KQNA 1X8XA 1Q11A 4MW9A 1XNGA 2IELA 1WOYA 4OUDB 3X1KA 2XRZA 4I6JA 1J1UA 2XRYA 1MRZA 3K32A 2A7XA 2B7LA 1R6XA 1YIDA 2GM3A 4DJAA 2G36A 2JA2A 4MW7A 3TNJA 1JILA 1O5TA 2OV4A 3A4IA 4KR6A 1OWLA 3IMCA 4YP5A 4NAHA 5DASA 3E27A 2E21A 2PZ8A 2WSIA 1QRTA 2A1UA 4CT0A 2CYBA 3A05A 1XJQA 2VTBB 2QJTA 1N2GA 2J09A 3K9WA 4UZFA 1H1TA 4MVYA 1IQUA 3AG5A 1OWNA 3AG6A 3H9CA 3ZXSA 2QUJA 3FETA 5KCMA 1J21A 1OBHA 2ZP1A 2J5BA 2I1LA 4EG5A 3N8HA 4U7JA 1MOPA 1N78A 1VLHA 2RD2A 1ZJWA 2HZ7A 1KKUA 4MVWA 4MW6A 4QRDA 1GTRA 4JYZA 1TEZA 4KPUB 3A04A 3MMXA 2TS1A 4NAUA 3U1VA 5LM3A 3OP1A 4NATA 4ZT3A 3BL5A 4H3SA 3CLTD 3HGMA 4CQNA 4MWEA 5FNZA 1F7UA 2QJOA 3IOBA 4X0EA 3FY4A 2DERA 1EFPA 3RK1A 3TS1A 5DK4A 4ARCA 4JXXA 1I6MA 1N2EA 4RUKA 4MW0A 3RJZA 3ND5A 2X3FA 1JIJA 1NURA 4WNYA 1K4MA 4MUFA 2D5BA 4CDNA 3S3TA 1N2JA 1PG0A 1QRSA 1KORA 1MB9A 3CVXA 3NBKA 1M8GA 1WKBA 3MLAA 5LLTA 5TEWA 3IVXA 5DEOA 1YIAA 1O6BA 3COZA 1PG2A 1JEDA 3CLSC 4NX2A 5FO1A 2QUHA 1HYBA 1B6TA 5JBNA 3D6UA 3CVVA 1IHOA 4MW2A 4MWDA 3VRHA 4HJXA 5EKDA 1U7DA 4EF6A 4XFJA 2H29A 1XNJA 3HL4A 4Q16A 4OUDA 1N75A 1TFUA 1GN8A 1YULA 3CLRD 4DE5A 5FO0A 3ZJTA 4AQ7A 1JZQA 4RPIA 2ZUEA 1T6ZA 5BNZA 4R2MA 2QTMA 1KAMA 2YXNA 4DLPA 4MUGA 1U3CA 1TYDE 2VTBA 1K97A 3I05A 4PY2A 4NDAA 1KQOA 2GKSA 4L2IB 5DB4A 1KH2A 3KT3A 3HV0A 4K03A 1VBMA 2CV1A 3KT6A 4MUIA 1VBNA 3LOQA 3P0IA 1R6TA 1JHDA 2HMAA 2YWBA 1S4MA 3COWA 3PNVA 1M1ZA 3KT8A 1WXIA 1GAXA 2C5SA 2PZAA 4P2BA 2CUZA 1QQTA 2CYAA 2PXHA 2NSYA 3GUZA 3TQOA 1O0CA 4G5FA 1G8GA 1QU2A 4KPUA 1D2RA 3SEQA 2CFOA 1EE1A 4ND6A 3UY4A 2BYTA 1Y42X 4EG4A 1LI5A 2PFSA 1F7VA 4I6GA 1DNPA 2BTEA 2CV2A 5HUHA 4MAFA 4MLPA 1EFVB 4DDMA 4MW4A 4ZCSA 4U8HA 4KR9A 4R0NA 1O97C 1IQ0A 2QUKA 1T6YA 5J5AA 2A88A 3F3MA 4MULA 4ZCPA 1YI8A 3ZJVA 3FOCA 1T9GR 1SURA 3TZLA 4MWBA 2V0GA 3CLTC 3IMEA 4MUNA 3G5AA 4DNXA 1MBZA 3LE8A 1TQ8A 3RBAA 3AKZA 1EUQA 3FI0A 1OD6A 2CT8A 4G6ZA 3DO8A 1Q77A 1O94C 2J4DA 4MWCA 1OWMA 1YUNA 3VGJA 4ND7A 3Q10A 4J76A 2Z08A 2DETA 3HMQA 4CDMA 4EG8A 1F4LA 2AKEA 3ZUGA 1KQPA 3CLUC 5TEVA 1O95C 4MUHA 4MVXA 3QE4A 1ZH6A 1LW7A 1G8HA 3IOCA 4E1AA 1K4KA 1PFVA 4MUKA 3PNYA 5KWVA 2O5RA 1U0BB 3OTWA 4GRIA 4QREA 1MJHA 2X1LA 4ZT2A 3UC5A 3ZJUA 3IVCA
chains in the Genus database with same CATH superfamily
1QVRA 1QJCA 4DXDA 1A5SB 4ZYWA 4IJWA 2GRJA 3LP6A 1P7ZA 2QWXA 3QI2A 4JB8A 1OBOA 1KFBB 2JATA 2OXCA 3WDLA 4U6NA 2NSDA 2DOKA 1FNMA 3B6KA 3LH5A 4GP7A 4IQ8A 2AH5A 3WXMA 4BATA 5ICGA 1CEEA 2VF7A 5AH0A 3TGPA 1QUEA 1LS6A 1KVUA 5AW7A 3W5BA 2ATVA 1CF9A 1SBYA 3RV4A 5F5NA 1OBCA 2W2KA 3B70A 4OXXA 5C5IA 1XEXA 1Z7GA 1E1CB 1SQ5A 2IXEA 1T5TA 2C20A 4BJ3A 3OAAA 4INOA 1MG5A 3UATA 4D8VA 1AQIA 4HPXB 1RMQA 1D2NA 4DQVA 3MT7A 5IC6A 3I30X 5HF6A 3AF1A 3RVDA 4BO8A 1C1HA 2KBEA 1P9OA 3IUBA 3L46A 1CXZA 3I5XA 1DTWB 1SUBA 5FFNA 3C8MA 3FPEA 3W3AD 1ZOPA 2WJJA 3SR4A 3CNQS 1MQSA 3KB1A 4TYNA 3D4LA 2JAQA 1WVIA 1E9DA 4KQ2A 3S2EA 3SHOA 4WLVA 1XNQB 4B8WA 3RFUA 4ATNA 3AHHA 2I8LA 1EJ2A 3CH5A 1Q7EA 3ZWMA 1ZIXA 1ZICA 1TQHA 1ZNWA 5LD2C 2C4VA 2RGXA 1YU9A 1QONA 1J7KA 1GZ3A 2BUAA 1PD1A 3H5LA 9LDTA 2WD7A 1WQ4A 2O1WA 5EMNA 1RXCA 3BFKA 5FH9A 1GA6A 3FHOA 4IVPA 1V39A 3RK0A 4G4SO 4HDKA 5JCPA 2OAP1 2H07A 3AVQA 4ZVUA 4FLFA 1BKSB 1RABA 2C99A 4A92A 4MRSA 3C70A 3DO6A 1WD5A 2GZ1A 2O0KA 2WSSA 4R2JA 5IJ9A 2NTNA 1A9QA 4K9SA 2JVJA 4M7WA 1YDMA 4PR0A 1MX3A 5EP2A 2HUNA 2HCRA 3S44A 4A2QA 4RACA 3CTMA 3IDFA 3HCOA 3PXEA 4EG3A 1UZMA 3PI7A 3LF1A 3NWPA 3RLIA 3EBOA 4EKDA 4LQLA 1YZQA 5F3DA 1W0JD 3AL0C 3H5RA 3W5UA 3HB1A 2FAXA 3CT6A 1SOVA 3MZ0A 3MWEA 4AIRA 3LUKA 2QR3A 5D87A 1JHXA 2QZJA 1AGPA 1PEDA 4IIJF 3ZYZA 1ANKA 3B78A 3OQHA 4IDFA 4NNOA 3TNYA 4GX2A 4QTXA 3KJQA 1NF9A 3HUDA 4HB2A 3WNCA 4KKVA 3G2QA 3KP1A 4BNUA 3OQPA 1ISGA 2C5BA 1J25A 2Q99A 1WO8A 1U02A 5DM60 4DV1B 1JG3A 4LJ5A 4HGYA 4BNGA 4LHVA 4PLYA 5JRDS 3CCBA 2FHSA 3BK7A 1S5PA 3KAKA 3GZJA 1M7HA 1VP9A 1WEHA 3L8FA 1WDLA 2N1MA 4KVFA 3RS0A 3PA8A 1VKJA 1Z0FA 3Q9NA 2OYCA 1H2YA 4P4TA 2YH2A 4Q3EA 3H97A 1NW9B 2A9PA 3E7WA 4HLUC 1HT1E 2V5VA 2E4ZA 4BMZA 3M33A 3PR3A 1Z5PA 3FCXA 1E69A 1LRLA 4QG7A 3ZLBA 3GFSA 3CX6A 4CCSA 2AX3A 3BE4A 3PGJA 1N6PA 1P7CA 3W1VA 1CRPA 4U9UA 1NVDA 1BA2A 4EGFA 2COKA 2G76A 4LY9A 3MCWA 5GMOA 1D7AA 1AKMA 1E2IA 3DV2A 1JDBC 5E4FA 4R8RA 3TDNA 3LLVA 3SZGA 1W0CA 4PX2A 3JD4A 3R7DA 2OZVA 5T4FA 4CL0A 3FH0A 4R5HA 1H2BA 2BP7B 2C2OA 4Y2PA 1AMNA 1HH4A 4DDHA 2FGKA 5JS8A 3R3HA 2JGJA 1TGYA 2O2GA 5AUQA 4BLSA 5EINA 1PR3A 3VPFA 3JD2A 1JSXA 1UBJS 2JJ8A 2J41A 1XRPA 4TL6A 5IN5A 2JIZA 3QXSA 4PGGA 4LXYA 2G67A 1JG2A 3KKNA 1IBSA 2XYPA 4MRMA 2F59A 4RHTA 4RCVA 4ZVKA 3TIFA 2GSWA 3BT7A 5I9LA 3NBYC 1G5PA 1U0HC 4U6SA 2C07A 3L7KA 5E3HA 1X7GA 4OKSA 3ZZTA 4LJ7A 4CKYA 2CFTA 3KKQA 1E9VA 3FIUA 3ZW9A 4L0QA 5J4YA 4BX9A 4P4GA 4TM8A 3M2TA 4M9SA 2JZNA 5JD5A 4BY9E 4GKJB 2FZ5A 2ZB3A 4P3YA 4H3KB 1EX1A 1DRJA 4RC9A 1C0KA 4C7KA 2R8XA 5IZCA 1MAVA 1AQLA 5DRTA 4EJFA 4MYHA 2IP1A 3IBSA 1WJGA 4LYAA 5DHPA 3H8WA 3UCFA 2ZUVA 4AY3A 4BO1A 1XF9A 2ECOA 2OHVA 4YRSA 3CX7A 2WQ7A 3W7VA 1F8YA 1RE1A 2IZ5A 4PXYA 3C1OA 5LKRA 3SVZA 4G1EB 2E0IA 3W6NA 1MW8X 3U3KA 2CNKA 4LXTA 4K46A 4P3OA 2Q2WA 4YQZA 2C5HA 3F4LA 5T64A 2A9QA 1L5RA 1KS2A 3VHQA 2B3TA 2IQIA 4HSGA 3NBMA 1OYVA 1SD2A 1ZH4A 1H2ZA 4YAEA 5D7NA 2WWVD 4H7JA 2FMUA 5FR1A 4E07A 3EYWA 1T6NA 1Z2DA 3I2HA 1G0OA 1DHRA 2Y05A 2C42A 3A27A 3WYNA 5JH7F 2P41A 5TXGA 5GJBA 1Y5RA 1TVEA 2A9RA 3C6YA 4DIUA 1EBBA 4P7JA 4JH0A 4QU0A 3T0FA 3D3WA 4N5NA 1UADA 3DD1A 4UVDA 2VPYA 3UV7A 4YK7A 3KOYA 3N0XA 1I4LD 4MTCA 5CK5A 5F2KA 2BKUA 1UPXA 4G5RA 4CM4B 4RESA 4V38A 2GD1O 2OVBA 2ZTUA 3BICA 1KRHA 3TQRA 2FN4A 1RLTA 3HUTA 3VR5D 4II7A 4DILA 4YLGA 2GEFA 2HV9A 4HXFB 5LQSA 5IZ4A 1YB1A 2IV7A 1JI0A 3BREA 1ZVVA 2IYQA 1NWCA 3AEUB 2X0NA 4Q93A 4Y6QA 3TN7A 3FA2A 2XKBA 5M2QA 4Q4LA 4RVGA 4EHJA 4HO1X 3MAAC 1ECJA 1YRAA 2GNAA 1E3EA 3DV0A 4B7AA 5AKZA 4K9OA 1AXRA 4YRBA 4EFKA 5JSFA 1Y1LA 3NOVA 2C5AA 4C78A 3RHFA 4UU1A 3EGWA 1K5PA 3RKSA 3ZIDA 1RJDA 3LW8A 3JVVA 1BEEA 1X1DA 4J7UA 3W6UA 2I91A 2ZR0A 2IY7A 3BMCB 2GK7A 3W04A 1KWGA 4Q7JB 1OI4A 2VVTA 2ZI7A 1JA0A 3LDAA 4WE3A 2A5FA 3HKEB 3LWBA 5KYTA 3T5MA 5ES4B 1PT6A 2JPDA 2L0XA 3RUFA 5HKOA 2IEAA 1A04A 3B85A 4QEDA 3F5DA 4XGNA 1C3EA 3BN3A 3THOA 5JSZB 1TMKA 4BO4A 1Y6ZA 1KJNA 1BWRA 1YQUA 1MRZA 2XRYA 3DB1A 3DVAA 1ODIA 4M8KA 5FL7D 5J4LA 3TECE 3GT3A 2VHYA 4WBNA 4QUAA 3WLMA 2JA2A 1QP4A 1OR8A 5HSGA 1A7UA 3NTUA 3WLAA 4H7DA 3FUUA 1JILA 4QDZA 4TN5A 5GOZA 4UOZA 4RIFA 1HTBA 5LLSA 2ZYTX 3UVEA 2C5EA 4O0LA 5DASA 1Q1BA 3BPSA 3IR6A 3P7MA 1MA0A 3UK1A 2GVDC 3UJAA 3CB2A 1XJQA 1F5SA 1IRIA 2JHAA 3IMFA 4GSYA 1P9NA 3BRWD 3O4RA 4I9NA 1HDXA 3OJ0A 4JLSA 1YB2A 3GLGE 5LMUB 4CM3A 2VHJA 1TTTA 3TW8A 1LFAA 2ZQZA 4EJSA 4QNRA 1WM1A 2F43A 3ENQA 1Z22A 1HXHA 1WB5A 1Q7BA 3LX4A 1S96A 3N7AA 2IE8A 1MNQA 3X2FA 1NRJB 3L8YA 4B35A 3RHTA 3M1LA 1W94A 1HZJA 2Q9UA 2YV2A 4KMSA 2DR3A 4ETWA 2AK3A 3AP3A 4ZQEA 4XE5A 3AB8A 1K2WA 3UPDA 4AF6A 1VLHA 1N78A 1UFQA 3ZYCA 3MAJA 5FWXA 1QF7A 4BWGA 1KJ9A 1QG6A 4KYIB 4F8EA 2HQRA 5KDDA 4JYZA 2GAJA 4WNCA 2FKAA 4R69A 2Z1DA 4FFWA 5HBRA 3HZHA 2V9CA 3U7EB 4D4GA 3O8QB 1XN4A 5KDLA 4UU7A 3KXKA 5KAPA 3ZCQA 4JGIA 4PNEA 1UXGA 3B1YA 1HSZA 3AU9A 4JB0A 4DIBA 3WFJA 3M1YA 3DE7X 3DOOA 1UC4B 4M37A 1YONA 2Q5HA 2J8ZA 1F7UA 2WFMA 1PWEA 4FONA 2V7WA 2VNAA 4E2WA 4EBBA 2BR3A 4J16C 1CY0A 5FR2A 1A9XB 1E1RA 1IEWA 1HDGO 3IEIA 2UYGA 1N2EA 4V0MA 1GQQA 3IUJA 5IK2A 4E08A 3HUFA 4LI3X 4X8OA 3SNHA 1IG3A 4ZWNA 2F48A 4PLGA 4ZMRA 4QYMA 3UYLA 2I3BA 1SBQA 2JLRA 4ZGGA 2BFPA 2YJNA 2D1TA 3IXMA 4KGZA 4L4SA 2Y66A 1T2CA 3AEQA 3KEMA 4GBED 2TMGA 4Y2TA 1Y7HA 4L8FA 2R8BA 1HE5A 4PYQA 2B0CA 1VHTA 3CQ9A 5CLQA 1LC3A 4DG9A 3Q2KA 2UUBB 3HU2A 2BZ1A 4XVUA 3KQHA 3OZRA 3U9SA 4MX8A 1YQ9A 1SZCA 3RFCA 3I9FA 3AF0A 3ECSA 1P29A 2C2BA 4AWAA 4D96A 3WC4A 2EP5A 3AUTA 4HQOA 4IFTA 4RJIA 4EF4A 3F7MA 4YI3A 5KKAA 4I1YA 1JG7A 1ONPA 3P5SA 1L3BA 1OFTA 1UH5A 1GFIA 2JCXA 2H51A 3AOEC 3EA5A 3EUEA 4Q16A 5JS1A 3FPJA 1HX7A 4QPNA 1CE8B 4D5EA 3OD5A 2NGRA 3EQ9A 4LKOA 1GPUA 1YULA 4QJ4A 1ORIA 1MN6A 5AI9A 1NPTO 3JVEA 3CLRD 3DE1X 3D59A 5F73A 1JR6A 1JFFB 4TKUA 3C7TA 4H0NA 2XUAA 2ZBFA 5CYPA 3MTGA 1W4CA 2XGMA 5H02A 4CMEC 3JAKB 2ZAIA 1NKSA 3HXMA 4HQ6A 4U7WA 4U4AA 2LRHA 3HZOA 4GH5A 4Y2HA 2X2FA 4S2EA 5KWEA 2IYFA 4UC0A 5EFOA 4EHNA 5L3RA 3M3DA 3W6ZA 1FC0A 3DLIA 4AVYA 2ZM6B 2OZLA 2VUUA 1U2TA 2IW1A 1DIOB 2GSDA 4O5AA 3VDXA 1RQNA 2C9DA 5JZOA 3O9ZA 4QXMA 3AFIA 3KRTA 4IINA 4TRJA 3PEVA 3LQQA 4BPRA 1AQNA 5C1BA 2CJXA 4IPTA 3OPQA 1F12A 4IH1A 1SBNE 4BAGA 4RTNA 5LCXA 1JBQA 4UM9D 2GBCA 2ATIA 1VGRA 2HSWA 1RJEA 1X8JA 4Y18A 3DZCA 4UFPA 3EVAA 1ZYUA 3MWJA 4R2WA 2GWHA 4URWR 1QQBA 2QNIA 5KSWB 1QFJA 3LKZA 2YZGA 1LLQA 1XAGA 3ZGXA 5C4GB 5A2QA 3F49S 4U3JB 2QRVA 4N1AA 3NPMA 1KO7A 1PNVA 4AF7A 2CDNA 2XDYA 3QSYA 3DL2A 1ZK0A 2PQ6A 1NOJA 3MSCA 4JP8A 4NU5A 4WNIA 1AHIA 1EE1A 1YDFA 1DKMA 1ZD4A 4TLEA 2X1VA 4UATA 4LRTB 4YJDA 1OMOA 2Q3BA 3W2EA 2E5LB 5FTKA 2PFSA 3QY9A 1N0UA 2PH3A 5AVZA 1JE0A 1MPXA 1AO3A 4EA7A 5L3SB 4LV8B 4KGVA 1KAGA 3EPPA 4P83A 3TLZA 3NHJA 1RXSA 3W79A 4BNDA 4ZU6X 2YW2A 5K0ZA 2QENA 2J67A 4FOPA 2VN8A 4RZIA 1QHHA 4YJ2A 3EF3A 3IT2A 4EMSA 1W5AA 2XYGA 4H35A 1OX5A 2HF8A 5H81A 1YACA 2SKDA 2HYIC 2ZREA 1E1LA 2ZKLA 2R97A 2FGJA 4HAUA 4V0LA 4C0WA 1WZNA 5JTUA 3NKLA 5E1OA 3EW9A 4I1UA 3M3PA 1A7KA 1Z13A 5CW1A 3FB1A 3S1SA 3QV1A 1H9CA 2QX7A 2PBRA 3FOWA 4ISCA 4OOEA 3TZLA 1C9NA 1E2QA 2VXBA 1DJMA 2IU0A 1Z8FA 3K05A 3GFBA 4G23A 3FTPA 1C1YA 3U49A 4AMUA 3ZZUA 4AJPA 3S2ZA 2QMZA 4UTNA 6Q21A 1X70A 1QWOA 1M2WA 3L7AA 2XMQA 1ZGHA 1ZN2A 3V42A 2ILVA 5I7UA 3UJ3X 4JYAB 5HK8A 3ZBPA 1RCTE 2ST1A 3JU3A 4P7GA 3EIFA 2NUAB 1P7WA 1A4UA 2G25A 4S1VA 3ET5A 5I7FA 3ZNNA 1ZSYA 10MHA 1O94C 2GLXA 4K40A 4W8OA 1Z7BA 1LBQA 2LCFA 3KHTA 4ND7A 3EAQA 4I5FA 2WKQA 4DQKA 2Z08A 2FB9A 1RP1A 3MTEA 4G0UA 2FU5C 2YXLA 1A5ZA 5IKEA 2GNPA 3B7GA 4MUHA 1U0JA 2DPYA 4X1YA 1EG2A 2VSNA 1ZH6A 2MMCA 1M6HA 4Q01A 2ZSIA 4WHMA 3BWVA 2EDAA 1N3YA 1KXZA 3GRAA 3I42A 2WTBA 3F6BX 1XZCA 3I6BA 3QKTA 4TXJA 5B53A 1D4FA 4OQZA 3RODA 3IQIX 3TPCA 5BUQA 1OC4A 1FXWF 2GPNA 4NJMB 4PRZA 5ADWA 5CIYA 1GCAA 1F48A 2PMFA 4JEUA 5IKPA 4UMFA 5FTMA 1VXRA 4P5DA 4J1SA 3D1JA 3DOCA 1G2PA 3DWIA 4BNVA 2J3QA 3EDMA 5ESRA 3K9CA 4BXOB 2NVBA 1OXUA 4XCQA 1ILEA 4GGOA 4E15A 1UBEA 2JKYA 3T52A 1OH6A 2UYQA 3Q7RA 1Z68A 1FYEA 2B8JA 3HV2A 2CNLA 121PA 4LF6B 2VHWA 4U7FA 2CLOB 1GG9A 5B64A 1CS4C 1CQJA 1PS9A 1RWOA 2REOA 2R11A 1MJGM 2WM3A 3K09A 4I4LA 5ILGA 3KDAA 5A9TA 4S1PA 4GR9A 1O7JA 3L7CA 3NO4A 2HHAA 1PO7A 1MTOA 1NF2A 2RGYA 2HBQA 1DLJA 2XUKA 3CZAA 5BW6B 4EHIA 5LDHA 1RRMA 3PHHA 4WSOA 1ISPA 1GSOA 2DHQA 1U4NA 4FYMA 4ZAXA 3X1YA 1TF7A 4GD3Q 1E2PA 1R66A 4URXR 5F5LA 4JAVC 1W1UA 3DC2A 1RXUA 4MQFA 2WHXA 1Z35A 4WW0A 2VPWA 2R84A 4Q47A 5CW2A 1EBFA 2QD4A 3DEZA 1LJLA 2VJNA 3AUKA 5KMGB 1A8PA 5ED0A 3EIXA 1GPNA 3KOOA 5BMOA 3ECCA 4F3RA 2AEMA 2X4IA 3FM9A 3MWDB 1UJ5A 4W6ZA 3O0TA 4WJZA 1PL8A 2QJFA 2IOYA 4XUDA 1BXKA 2AN4A 3GRKA 2D54A 3L04A 2QY9A 1NUPA 2MWMA 4BNNA 2I4IA 5JE8A 4BGDA 3WA7A 1RBZA 1GM5A 1ZN7A 3SX4A 1O96B 1PWHA 2IYRA 4MYTA 4QATA 3WVNA 4DSAA 2OFFA 5EPUA 3GFQA 1SBZA 4X61A 5HQTA 4YJ3B 3C87A 5HUJA 1TB4A 1U9ZA 2A4MA 3Q2IA 3SCZA 1NP3A 5FUQA 3DOFA 5IUNC 1ZINA 2DHEA 3I4CA 4JUDX 3MCAA 5G4KA 2C59A 1NBWB 3EIQA 2Z3VA 4O2AB 3VH4A 5ECDA 5KJ1A 2XJ9A 4Y7DA 4ED9A 1ML4A 4F96A 3BE8A 3R3XA 3G89A 3PRJA 4YP7A 2W70A 1QTRA 3ZBTA 4YECA 3T5GA 1E3WB 2PBFA 3V8MA 2JFQA 4DDKA 4QRHA 2DU8A 4DV4B 3OECA 3OT5A 4JL8A 4B43A 2XCOA 1OT5A 4JLNA 4WLEA 1VKRA 3U13A 1GGKA 4YALA 3ZIUA 4BUJA 2IHNA 4CKCB 1EB9A 1KQ3A 4P84A 4NZMA 1UMDB 2PKQP 1LTQA 4JUAA 4LTDA 2BSXA 4BFZA 4L6CA 4P33A 2INGX 3OLWA 5CXSA 1N7JA 4Z99A 1MEEA 3TNDA 4ALJA 1SEVA 3F47A 3U3RA 3WIUA 4B4UA 1MLDA 1I6KA 4ND8B 5AVTA 1PQPA 1TJPB 3D0QA 1TM5E 2CUTA 5DX8A 1X7ZB 2VDRB 3NHZA 2Q28A 3KPUA 2VNSA 1UJ6A 2I80A 3EZYA 3WMXA 3KQUA 1JLLB 1R37A 1MO6A 4GZ6A 2Q5OA 1I7SB 4R8VA 1SHLA 3IKLA 1MVOA 3VC2A 1MAAA 1TF5A 1NN3A 1DFHA 2HJ9A 2Q5QA 2ID7A 2V7EA 4L78A 3UWSA 1KZYC 3V7YA 3ES9A 3WGQA 4OBEA 4UDYX 5B2ZA 4O4LF 4IGFA 4MPRA 1KVQA 3FFWA 3G6KA 4Q9NA 4WZ6A 1VJTA 1WXHA 2G5PA 3K5HA 1Y9ZA 3QPWA 3I9V1 5HJEA 2C4MA 1R4MB 3L6BA 2CL0X 4IGEA 1EUYA 5ITWA 4GI3A 4F1WA 1N6KA 3U5ZB 1ZOIA 5DSXA 3RBZA 5CEEA 4DFDA 4HVTA 3DFKA 1XVTA 2FWPA 2DFPA 3PWTA 2PGOA 5DT2A 4H1UA 1W6UA 2QMEA 5HGJA 3KKZA 1YZYA 2HA5A 2I3AA 1JI3A 3HS3A 4MW1A 5P21A 3T1OA 3DD5A 1FF9A 4I3FA 1HTWA 2QA5A 4JEHA 2R66A 5GGYA 4E1VA 3WXBA 1OZFA 5ALZA 3R76A 2CNNA 3VDMA 6LDHA 2ZXFA 3JXEA 2V7VA 4K81B 4GKAA 3D4OA 4P93A 2HGZA 2KM1A 2P6UA 3B6MA 1DBVO 1SKBA 2WWGA 3OJEA 3WGYA 4ZJPA 2HT1A 1IAVA 3HXPA 1OLXB 2EL7A 3L4JA 2QD1A 1LZKA 2FW1A 1W5SA 1GTG1 4JBLA 5E4JA 3LL4A 4BWVA 2GJAA 1GPMA 5BQ5A 1SXJA 4I9GA 1VKZA 1CRZA 2IY9A 2QK4A 3EC2A 3TMKA 4A0QA 3HWWA 3IOYA 3K0CC 1KC1A 2VYNA 5TPZD 4E03A 1E2EA 3AU8A 4XQCA 4MPPA 1UM8A 1REQB 3IT0A 4MP3A 5TS2A 3RWBA 4U2FA 5G40A 4N03A 3T1TA 4RSMA 3ZW7A 1VI6A 4G1VA 1K6JA 3IPLA 4N9WA 3F6CA 1GNQA 1F51E 3NP7A 1UBTS 4IHJB 1V1MA 1JT9A 3A3KA 3JALB 2OAQ1 4MQLA 5CDUA 2X0IA 1LBHA 4OQ4A 1MW9X 2FOIA 3BWDD 3QUQA 3V5NA 2OHXA 4KK3A 3U1TA 1QU3A 3B2NA 1DAKA 1KI2A 4MYUA 3DH0A 2N46A 7REQA 1XZIA 3UXYA 2J0UA 5K1ZA 4CHGA 1QFYA 3ROPA 5A5DA 3G59A 1GPKA 1SUDA 3LPCA 1KP2A 3PNKA 2O1EA 4J3FA 3SC6A 3MS7A 4NENA 1Y4SA 3D5TA 4RM2A 1R64A 3PGLA 2PX3A 3KU4A 4FHFA 1T9DA 4U7PB 5BNTA 5AK5A 1FRVA 3UMRA 4B84A 2FSVA 4DRYA 3ED1A 1F0YA 3MRTA 1MO3A 2X6TA 4PO8A 1PR2A 3VR3A 1T3LA 2I6XA 1EXVA 5TY0A 1GKLA 3N6XA 3NBQA 2QAGB 4HVAA 1X6VA 1DEKA 2W2TA 2O3TA 5CGZA 3V55A 3ZV7A 3BXZA 4V3CA 2CBGA 1O8BA 2XLBA 4J7AA 1XZBA 2PNJA 1H3EA 4EG7A 3KKOA 3ZGLA 721PA 1M2HA 1M2GA 3ZDDA 1EVJA 5THKA 1YRLA 2ZYAA 3V1NA 4TKVB 3DR3A 2DPLA 5KYYB 2QTWB 4IIVA 3PHGA 4GECA 4BP8A 4CFSA 4CQMD 3TOVA 2WB2A 1N36B 4MVJH 2C0PA 3WGOA 2GLUA 2Y1LA 3NT4A 1RS0A 2OV1A 1NVMB 1NQXA 5GADl 4RVSA 2B92A 2VLIA 4Z3DA 4J0EA 3ZWNA 3GEGA 4A8TA 1B14A 1FRZA 4DWOA 4AZ3A 4GDFA 3CUSA 4GVXA 1MG0A 4Q4CA 4ND3A 1KAQA 3ZZMA 4RLQA 4DLKA 2CXTA 4GT1A 5DGCA 5F1OA 2WJ6A 1TCAA 4MS1B 3D3NA 5FAXA 2VT6A 4FD2A 4IVQA 5C9ZA 3OA0A 5JH7B 1K0FA 4PYJA 3B1VA 3CEPB 2PUAA 1PJ4A 2W8ZA 4QELA 1RKXA 3OZGA 2B7LA 5HKKD 1VLQA 4J9VA 4C3UA 2GM3A 5SY9A 3TVYA 5LQJA 1NC1A 2TRSB 2XDQB 3DMYA 3VTKA 3B6JA 3JQAD 2FMHA 1CUXA 1N2XA 1PWYE 2W22A 3A9WA 3WRXA 3GEPA 4EK9A 4YV0A 1Y6QA 5C3MA 5DXJA 3HJAA 3AVOA 4BLQA 1YRBA 4KBGA 4EHFA 3HRHA 1Q6YA 3HBMA 1EFHA 1OBVA 3KBBA 3R9IA 2R1VA 1RM4A 3A05A 3DMPA 4F71A 1YQQA 4XR9A 3RSZA 4JU9A 1DBWA 4XWGA 2A8YA 2HRQA 4DGSA 5KNBH 4AN1A 4AI6A 1C4KA 3IMKA 4JC0A 3P9NA 1X2BA 1DAEA 1FK8A 1G291 1QIHA 2J0EA 3OEYA 3DHVA 1NFQA 2OYRA 1IB6A 3WB2A 2WKWA 2QDXA 1U8XX 3O74A 3GMDA 5AJVB 3IEKA 3BDVA 1XTIA 2ECPA 2YXDA 4JSRA 2FPRA 4JUIA 5ALXA 2B2NA 4F21A 3L7LA 3GLFE 3BTOA 1QG0A 1BMTA 4B85A 3ETNA 5HRUA 2VJAA 1HBJA 1S7GA 4M53A 1R27A 1E92A 3FVWA 4A1FA 4IO0A 4ZARA 3V3KA 1JU3A 4RVFA 1MR3F 1ZUIA 3ZU6A 3NV9A 2O8BA 3GGGA 2RGUA 2JIQA 3PFHA 1XNRB 2CVPA 4V0RA 5DBIA 2Q4RA 4CV1A 1GPYA 3MMXA 2H11A 3QELA 4GRAA 5JD3A 5TDHA 1SELA 2CFCA 1T5DX 2IBMA 6YASA 1Q17A 3WSTA 4CIYA 2HWXA 2LCIA 5JBQA 5CT9A 2LXNA 5B3KA 5A62A 2Y67A 1QANA 4X1OA 1NBMA 2L2QA 3CUVA 2VAPA 5JO9A 1CB0A 1BWQA 3JTMA 5EIHA 3V1KA 1KEVA 3SK0A 3KSAC 4CG0A 1F1JA 3D8SA 4L9WA 1X38A 2E37A 1FX0A 2XMBA 4KQ1A 1SRRA 5CD9A 4HZUB 2XA2A 4JXXA 5IDVA 4X92A 4JASB 5CA0F 5JJIA 1EXWA 2B1RA 2YOHA 3ND5A 5F33A 3OEED 2XDWA 1NURA 3OJLA 2XVZA 3L05A 2WB4A 2XKJE 3KJGA 3WGMA 5BQ3A 4BB0A 3E9QA 1KORA 2BFCB 2E1RA 3N28A 4DV7B 1T35A 1G9TA 1WXWA 1VG9B 3QKIA 4YXWD 1XZEA 1YIAA 4MZXA 1CDZA 4PRYA 4R6XA 3OM8A 3OO0A 1SHZA 5J47A 1U2ZA 1ZUD1 1SN7A 2BFBB 2KW5A 5T4HA 4C0XA 4NX2A 3GP5A 5E1BA 4IRUB 4X93A 3D4NA 3F74A 1YU6A 4X5OA 3OEHA 1N2CE 3O95A 2ZYRA 2C95A 4M0UA 1QH8A 3JVUA 3UAVA 1GP2A 2JHGA 3IIJA 2FX2A 1VJRA 4W9MC 1UWVA 4B6GA 1Z6YA 1UMBA 1XNJA 1J2TA 1TVMA 2AYYA 2E5FA 4JJZA 4DNFA 1IBRA 5EKTA 3MYRA 2OFOA 4KH0A 1N75A 3MCUA 2ZVJA 4N5LA 4TSKA 5LBIA 2D2IA 1X7XA 4Q1CA 4YB8A 4FFLA 2WAOA 3PXXA 4R5MA 5AM1A 2QQGA 3SOPA 3ZLUA 2BFAA 4DE5A 3SDZA 1EFKA 1Z5ZA 2VPZA 3JQ7B 4GC9A 4OA5A 1E94E 2WDZA 2HHJA 2QTMA 3UMFA 1BRTA 1N5MA 4QOSA 2AXQA 2IYZA 4ROTA 5CFQA 1PVDA 1AZLA 1O57A 2XBMA 3ZLJA 4BO3A 2B5WA 3QEOA 4Q4JA 1P18A 4G8DA 3SIRA 3V1TC 3WB9A 3LLMA 3PRKE 4PIVA 3A3NA 5FWYA 1DMRA 1HORA 5DULA 2YYZA 4TPKA 4N18A 4R4JA 4WKCA 1VI2A 3ABZA 4R1QA 4NCXA 4X62B 2D74A 1CERA 1KO1A 3MJ4A 2I5PO 1NPDA 4GBMA 1TVKB 4LDQA 1O5OA 4EA9A 1Z0DA 4MUIA 1OFUX 2I6TA 4OQFA 4UEOA 3ESZA 2EF0A 2OEPA 3AZOA 4BE4A 1EFDN 1UDCA 1OI3A 2VTDA 4B75A 4W99A 4UTRA 1JHDA 2C4KA 1KZHA 3L1KA 2UZ4A 3ZGVA 3PC7A 1XL0A 2ZRBA 4LSWA 2IQ5A 2XQFA 1WXIA 2Z9DA 1ACMA 1P7YA 3CE9A 4NG5A 4RHXA 1G8YA 2GN1A 5IJAA 2VO1A 2W2KB 3BTSA 1XEXB 4R81A 2CYAA 3N87A 5FORA 4BDSA 4N3AA 2ESRA 1B15A 4FS3A 2QE6A 4DA8A 4DEVA 1NFRA 2B9VA 4QBGB 4RSRA 3VBCA 2PSDA 1MQ9A 2X41A 5JQGA 1NBHA 4MVJM 2JCBA 1B1CA 1OIVA 4QDUA 2BEWA 1TQ4A 3PIRA 1SVNA 2R79A 4IQ0A 3HBAA 2PRKA 3HKCA 5T4BA 3NNSA 4XDYA 1FYFA 3CVOA 4KTTE 4J3NA 5SV2A 3TB4A 4UDNA 3RDPA 5FD8A 3ZDRA 1OREA 3H7AA 1RQ7A 3UJ9A 5JCZA 1XZQA 2A58A 5ENVA 2R68A 2QUKA 1GYRA 3NZEA 3BRCA 3UXHA 3RBVA 1HFKA 2XWPA 2B5OA 2FRDA 5LZ4A 4B76A 2BMVA 2OLJA 1K1EA 2E85A 5HVNA 5JJCA 1U7ZA 3RT1A 2WD7B 2ZYWX 1U1FA 4E5DA 5C1IA 3ER9A 3E0QA 4HDKB 4EY3A 4MI3A 2BMDA 4MA4A 4NV3A 4P7BA 4W1RA 3PEWA 3ICPA 5IJ9B 2FPPA 2XEXA 3HM9A 3ICVA 4OKIA 3R3JA 3VPBA 3NT5A 3NOQA 4CMJA 2AMLA 3D81A 1CZHA 3W4JA 2PX4A 3GJTA 4FYWA 1UIMA 3N3BC 3P9IA 2KLHA 1GQRA 1RP7A 1EGHA 1YI0A 3V7NA 4QGFA 4EWLA 1P1IA 4KRXA 3U9LA 1TQ2A 2DJ5A 1H8EA 3EHDA 4IH9A 4MUXA 2QTTA 3MWEB 3GAMA 4WK0B 4PAGA 1AA9A 2PFKA 5IULC 3VKVA 3P2IA 2DPXA 4JLPA 1E6WA 5L45A 4DY6A 5TEVA 2F55A 3N39C 4MVXA 2W2VA 2ARKA 4KXLA 3RTDA 3RRZA 1LW7A 1V4VA 2DX7A 4B8ZA 1RWQA 3RVNA 2DQZA 4W82A 3GX1A 4QGSA 4PRKA 5ERXA 4TZKA 3GNLA 5BVHA 4Q9AA 2R85A 1G60A 4DA4A 2ZBUA 4BQIA 1U0BB 3OTWA 1JHOA 1FVOA 2HIMA 1IL0A 1U2PA 4JI8B 3DE3X 3CF2A 4ZT2A 1V4NA 4LVCA 1XQ1A 5LC1A 4ZFNA 2EARA 4AZVA 1EWTA 3LUPA 4TRNA 2HQSA 1W8IA 3LQ2A 2CYCA 1T34A 3Q3IA 5G3ZA 1QX3A 1SIUA 2DT5A 2J33A 1I9CA 3FTNA 3D7KA 3GYBA 1RW4A 3OKFA 4OBWA 5K0TA 4KR0A 2YINC 1DARA 2RBEA 1TFRA 4RZXA 4EKGA 1QPZA 5TQVA 4GPAA 1I6LA 4C5BA 3GK3A 1QGAA 3RSCA 1AF4A 1Q0QA 3AWIA 4J94A 3TLXA 1EHIA 2Y1WA 1V8BA 2Q6IA 4G84A 4GYYA 5C8DA 4Y98A 1Y5LA 2AJLI 1Y6RA 1LPOA 3GVCA 1KK3A 3ONVA 2GQ0A 3JYPA 1RIIA 1KEZA 3OZSA 1ZCFA 3ZZ0A 3DZJA 4NNJA 3ZVNA 1U7OA 2OCYC 3BYZA 3MB8A 3VR4H 4CUJA 2W2PA 3FBTA 1K08A 1KFCB 4ZO4A 1C29B 3ISJA 4F2HA 1L1EA 1I1QB 2VH1A 5AVQA 5FWNA 5L3VA 4YPFA 1ISFA 3DE2X 1N0WA 1G21E 1R1DA 3IQHX 4MRMB 4BMSA 2JAOA 1TM1E 1E18A 1NTOA 4CMGA 5B3LA 3P97A 2NMVA 5LD2B 2NT3A 2FW0A 2Z2YA 3M4NA 2QX4A 4QGBA 2C7VA 3RC7A 3L0CA 2RBGA 1NUAA 4EYQA 5I9SA 2BSAA 2IPAB 3BXXA 5E3JA 1KIFA 1FUEA 3ABQB 4AZTA 1IWBB 2VJMA 4DKXA 1DQYA 1PI3A 2HA4A 2XE8A 3H5IA 1AGNA 4LJ9A 2QW8A 2W4MA 3QBDA 3AR7A 2AMVA 1WETA 1Y8AA 1QK5A 3TMYA 3F2VA 3TYXA 4KQJA 4JMLA 4YAFA 3UK6A 4NZYA 3B20A 5CIWA 1KR2A 1P62B 1M1YA 2QAJA 4HYYA 2QN6A 3LBYA 1JTFA 5DVZA 2E7ZA 1NF8A 3OZ7A 3ZQKA 1YB6A 1V2GA 4AJLA 1ST2A 5C8YA 5IUKC 4EG6A 3WWEA 4PPFA 1VECA 3GT7A 3JWEA 3B89A 1YR7A 5DMXA 1IH8A 4ZDIA 4WGFA 4ANFA 4ARZA 1QBGA 3P9SA 2WAXA 4Z0NA 4DXHA 2B7CA 3KOMA 4FBGA 4E7PA 2I7CA 1VG1A 4CL3A 2WJIA 1VJCA 1HE3A 3D3WB 3MUEA 5CHEA 3ZWVA 2J3EA 1N8TA 3R6DA 5I7VA 2XZLA 1ENYA 2C9YA 1PQ4A 1E8MA 2E5WA 2M6RA 3CF6R 3KYDA 1B0PA 2YRFA 4X63A 5FBVB 1QGYA 4EW6A 1ZBDA 2MR6A 4AMVA 4RIIA 2D1SA 1LQUA 3TZKA 1JAHA 3WV5A 2Y2VA 3C3YA 1P6UA 1RVV1 1Q0HA 4XYMA 5GJVC 3TKYA 2OXFA 3EXHC 3ZI7A 5CG1A 2GK6A 3S1AA 1XJWA 4OB6A 4B71A 4K3VA 5IWAB 2M1ZA 3TOCA 4QPJC 2P4EA 4B3RB 1MT0A 3Q3EA 3ICOA 4TS4A 1GTVA 2P5SA 3NTQA 4ZT5A 5THQA 1GADO 5C8XA 5CB6A 1GDTA 3DV0B 2NTJA 3LDGA 1GQSA 3E2IA 4ER0A 5IG2A 4CU2A 1N5KA 3BS4A 3E61A 2HRZA 1CUIA 2ZT8A 4MV8A 1ZC4A 2VSFA 2ODEA 1A77A 5DGHA 3W05A 2AD5A 3TTWA 3B9BA 3E84A 2ZRCA 4UJ5A 3B1JA 4FHZA 2J08A 1V37A 2JJ1D 3QU9A 1QAQA 1N8SA 2I4RA 2WVHA 4I99A 4HUQA 1PWXA 2NZVG 4YC7A 4UVHA 1U1DA 1SM4A 1XRSB 1TJYA 1B2RA 2PD4A 3IOEA 3DVAB 4IKOA 3O5AA 2WMNB 2Z2IA 4PNZA 4TOIA 3R5FA 3K35A 5LBUA 4WBNB 3DEAA 3VAZA 7YASA 3T9AA 4CLEA 3FAKA 2RKWA 2VT7A 2CCGA 2P8JA 1EQAA 1VGQA 1M8PA 2XTZA 5FHQA 3X1MA 4B73A 2YCBA 1NRXA 1WCV1 1MJFA 1NMZA 4LXIA 3MHTA 1AMUA 4J6EA 4LZWA 2PWPA 2O20A 1TC2A 2MINA 4ZQIA 1CC1S 3UICA 4BMNA 4U7HA 3UOAB 5HP4A 3TTSA 3VC7A 4D0RA 4TXHA 4L8WB 5LUBA 2NO5A 1L7VC 2LPMA 4UDXX 3CKLA 3RSGA 4EJSB 2AG5A 4XDGA 4EM6A 4CR7A 4YT4A 5I6DA 1GHTA 2F43B 1USIA 4UW9A 2GK3A 3E7XA 4OQYA 5FPKA 5AR1A 2V59A 1QZ3A 4NMLA 4KPGA 5COQA 1T8WA 3SFVA 4CQLA 2AX4A 3REOA 4YCMA 4DARA 3WG9A 2X76A 3X1ZA 5HBGA 2FWIA 3S2SA 4IDEA 3O7WA 3ASZA 3IE2A 3IIKA 4I66A 2HPHA 5CDFA 1J99A 4QKQA 3G3EA 4E5NA 5FWXB 1ZH2A 4PX3A 1RHUA 1I1NA 3O8BA 1RTTA 2G4CA 4G1FA 2O2EA 4KAXA 5ETJA 3VPSA 4ARVA 2Q2NA 4FX2A 1MC5A 4G1MB 4ARIA 4M38A 4UFOA 1EVZA 1KJYA 1CT9A 2JRLA 5FWDA 4X20A 1GAQA 1RXEA 2B6NA 3NAGA 4HQRA 4DCOA 4FIDA 5A1TA 4JVMA 2Y2UA 1D6MA 1S3GA 3HCFA 1ECPA 1ML3A 2ACWA 2PWYA 3EVNA 1ZUHA 5I4KA 2F8SA 5EZYF 1WZ2A 2GUGA 4DC1A 1PGOA 2O2HA 4DCVA 4PZ0A 4IUCS 1L7DA 4BNFA 1U0FA 4C22A 2AFHE 4C08A 2XKKA 1Y3IA 1D2EA 4RK5A 3EA0A 4QBKA 2JD2A 2XEDA 5J59A 2H3EA 1ZI8A 3NEPX 4YMLA 1T24A 3FGNA 3GCGA 3LSYA 4QFDA 3VX4A 5I9BA 2VRNA 4K7JA 1GILA 1WWKA 1T5OA 2DH5A 2HSDA 4RYLA 3AEQB 1WXFA 1QS0A 3QBJA 4B6PA 4MDYA 1KYWA 5EKUA 1A2KC 4P86A 4LOIA 1OGIA 4YRGA 1I5RA 2HIGA 4K2HA 5ECGC 3GLQA 3VGPA 1OFUA 2ZSDA 2JFZA 6REQB 1YCHA 1WV1A 2LBPA 2Q0XA 2GHQA 4QC2A 2EOAA 4XM2A 4ENPA 4Z4EA 1E99A 1EESA 2GEVA 1AF7A 4G36A 5JY6A 3R0QA 4YAGA 3UJ6A 1AC5A 3DOUA 2N47A 3OCJA 1RM0A 5BMVA 2WJHA 1Z0JA 1V6AA 4PYRA 1NWHA 2C2GA 1PTJC 3QG1A 2I2BA 2JLXA 4X1KA 1A2BA 1A4IA 4LZJA 3GELA 5DW0A 3V6LA 4X3CA 2JRCA 3R7BA 3DAFA 3EQ7A 2P11A 3IJEB 2WD8A 3N74A 5I9IA 3K32A 4HF7A 3T1HB 4RYDA 1D7OA 1KBZA 1NQAO 3EBPA 2V0NA 4MWOA 4TRMA 5JQGF 4XPIA 4B8YA 4OI1A 1NI3A 3GA5A 2C5GA 4ZPXA 2ZVDA 1K6EA 3O8OA 2NU9A 4TKUB 3P9XA 4B3BA 3UKJA 4LOJA 2JW5A 4N01A 1RBYA 4YP5A 4B74A 3GNTA 3DAYA 5HDQA 1L5FA 1BE1A 1CIVA 1TCCA 3B1ZA 3IGFA 2B36A 4M7RA 4N3BA 5E7QA 2HV8A 3LUHA 3KKLA 4RD2A 3Q0IA 1KYZA 4KB5A 3PCTA 1XVLA 2OZLB 4JOQA 3T5BA 4AO7A 4UQOA 3ZX4A 1S0UA 4MV5A 4OY3A 4B6QA 2AOUA 4PC6A 4LHYA 5EAIA 1QH1A 4HH1A 1CQIA 4XSGA 4JI3B 3ZE6A 2JARA 3KWFA 3N0WA 4WX2B 4BS9A 1RAAA 1SCKA 1Z38A 2WJ4A 1EM6A 4XCXA 4A73A 3FJ1A 2SKCA 4H77A 1MOPA 4EG0A 5FA5A 4XLTA 1DV2A 2HZBA 4YMGA 1ZXXA 5EXTA 1B6RA 2H1FA 2O2SA 4B0PA 1ZJWA 4B40A 4JD5A 1NONA 1RYMA 1T4DA 2ZT7A 3DOHA 1XL1A 3KLOA 3W1EA 5L9AA 3FYUA 3WGZA 2QRVB 2LVBA 4IL5A 1V5WA 1LVGA 3OPNA 5E0OA 1PSZA 3A4YA 1JHAA 3DLPX 3CKMA 2VK4A 2GESA 3A6EA 3K31A 3VH3A 3WL7A 1R5JA 3NEAA 2CHUA 5CEFA 3KE9A 1T8PA 4RM3A 4CQNA 4PNPA 4UBNA 1NVGA 3HJUA 2WTXA 4BNDB 4II3A 1RWKA 3O73A 4KI7A 3AL2A 5IH3A 1EFPA 2NLOA 2IXBA 5TV2A 1CJKC 3S68A 5KNCA 4ARCA 3A1DA 3FX2A 1E58A 2ODPA 2BF4A 5JSHA 5J2TB 2QW1A 3EY4A 5K8LA 3WNVA 1K89A 3DQZA 1LK7A 2GEUA 4WBSA 1R74A 2HQ1A 2WYVA 2ZR8A 4XVRA 4XRRA 1K9VF 4CDNA 1ONBA 4HAZA 4LSZA 2Y6VA 4C76A 3GPIA 2XT0A 4TMTA 5DBHX 1E1QA 1I9GA 4JJFA 2JHPA 4Z4QA 2AQHA 2Y0DA 2PSJA 4MUBA 5LLTA 2VJDA 3OQBA 2OBFA 3ZDCA 1M6YA 5HHTA 1HOXA 1FDVA 1Y48E 1OI7A 2JFHA 5JZVA 3PNPA 8OHMA 1DDGA 2JI4A 3QITA 1DG9A 1E6LA 3O1JC 3FNEA 3ZVLA 2PL3A 4FFRA 3DAOA 5EJIA 5KIAA 1ZD9A 1ZISA 2Q1SA 2CJYA 3KOWA 2XD9A 2HLHA 5EKDA 4QDXA 4WTOA 1B42A 1U8YA 1JRLA 2R2AA 1ODTC 1E3LA 1MHPA 5F1PA 1QCZA 3E6AA 5CYFA 4KQ6A 4YO7A 1J8VA 4TZTA 1R0SA 3G0IA 3V3TA 1PT7A 1VBFA 3Q85A 1C7ZA 5E6UB 1KMNA 3AM4A 2AZTA 4A6PA 2HLDA 1P5JA 4HDMA 1EFRD 3PQ4A 3P0FA 3MTBA 3T7CA 2OWEA 3TTYA 2H2DA 3WR5A 4OH1A 4KG7A 2AZMA 1MJGA 2WU3A 4ZOCA 2GBFA 4W5RA 4JEMA 2YW9A 1W5BA 3D7NA 4J7CA 3C8HA 3FSGD 1T5HX 2EG9A 3UWKA 4BTLA 2DWOA 3L4BC 1GOTA 3SQMA 1RTKA 2DUJA 1I5EA 4PLZA 1VDMA 1UT5A 4ZDKA 2ADFA 3C7AA 2G7ZA 5I3ZA 2HT6A 3O21A 2P1RA 4BJHB 5EMJA 4DR2B 4AKHA 3WADA 1UP4A 4KFTA 4YCNA 3SY8A 1DCMA 3EY9A 3IJPA 1W75A 3L1HA 4PAWA 1PL0A 4FHEA 4DM4A 5C8YF 2XW6A 4W9RA 3SQOA 1EZ1A 4L72A 5BQOA 5JS7A 1A72A 2Y0BA 3ZWPA 3D02A 3QOFA 4OQQA 1TPYA 4MQFB 3HK2A 2WUGA 4GZMA 1Z75A 4FM9A 1B00A 4B31A 1CJTC 2YNMC 2KI5A 4GIBA 3WY9A 4EB0A 1HKHA 1WZUA 2H65A 3NDRA 4Z3KA 3ZXYA 4LXQA 4Y30A 2HY7A 3T3HA 5K8CA 5KTMA 3FZGA 4RAOA 2P68A 2HTFA 2JFGA 3EXIA 3FMOB 4KPFC 2Q27A 3IQZA 2VRCA 2DFLA 4B0OA 4NH4A 5HWSA 4DS3A 4KDRA 2DTXA 5GM1A 3GOQA 2G72A 5CLJA 4FSDA 3MS4A 4PGAA 1KMIY 1W35A 3DZIA 4NZ9A 1QIMA 2F67A 3R5SA 4R0NA 2PZGA 3PEEA 4MV7A 4WY2A 5FT9A 3V4VB 2IWRA 1T4GA 4D9HA 5KVSA 2DC1A 1TO1E 4X44A 1NMSA 3GUVA 3ZZNA 1C8KA 1ECCA 3U2QA 5F7ZA 2OY0A 1E77A 4AZSA 4FEGA 2YASA 1R0XA 1KRXA 1PQUA 1ZBQA 3ZD7A 1OPXA 1FS4A 5G4KB 3EC7A 3KAPA 3AESA 3ZWBA 3CISA 3F1KA 3LK7A 4XGRA 3IMEA 4LVNA 1IK6A 1HNZB 3PTAA 4TWZA 1JDPA 1W5EA 4DNXA 3RIHA 3T6KA 4HC4A 3TBFA 1KY2A 2H1HA 4ONEA 3NYRA 4LHSA 1EUQA 1YR6A 2C7GA 2BL4A 5C2JB 3NGMA 4M6WB 1E1DA 4PZLA 4LEIA 3BQ9A 4FNOA 4XB2A 2JGKA 1CPYA 3T7AA 2JBAA 4GPEA 5B2EA 3ADPA 5JSUA 4XARA 3UMMA 1FU4A 2KMLA 2VPPA 3REGA 3UFBA 1E64A 1GIAA 4EG8A 4S04A 4UPVA 4LBYA 4R0VA 4X24A 2ODBA 2DUUA 4TVSA 1PJQA 4IX1A 2YDYA 1GPWB 3GAFA 3TLMA 1Z4MA 3GEHA 1P74A 1PUXA 2G06A 3BMXA 3DE0X 3VZDA 1XA3A 1H69A 1MVLA 4FSXA 4EUHA 3DO5A 5BWNA 4LYGA 2JZCA 3OF5A 3PTLA 4NYIR 1BDHA 3H1AA 4WDRA 1IUNA 1XKTA 2W93A 4LF7B 2AMFA 2GS9A 3PX2A 4C2UA 1USVA 3CINA 3FMFA 1KU6A 4QREA 1MJHA 1L0BA 1M2NA 3RS7A 1JALA 4CV3A 4MINA 1CS0A 5KOJA 3DEJA 3U7RA 3VO2A 2GN4A 3FOAA 1DRUA 1LGYA 3VR6D 4N82A 4DVGA 5KNLA 1L5YA 1CQXA 3SQLA 1F5NA 1WZEA 1CFZA 5IJ0A 4AO6A 3DVRX 5LZ7A 4ZJUA 3C45A 1FP6A 1Q2UA 4B3SB 4LY0A 1AKYA 1SVIA 3M1IA 2UXDB 1IJBA 3LRPA 2IRWA 1FVHA 3PHJA 4YT8A 2VR1A 3K16A 4XOUA 3WLQA 1XFDA 4PLWA 1YO6A 4JI0B 3ML1A 1XTZA 1YQTA 2E49A 1O6ZA 4RWEA 1IJFA 1O58A 1UJBA 2O23A 2O5VA 3C48A 2X0RA 1EX7A 4ZT7A 4W9NC 4K3UA 2YIJA 4ZVSA 1F20A 3FTQA 3MJVA 4GAEA 1RPZA 2X3YA 2ZFUA 4JNCA 3M9XA 4CM6A 3JTEA 3T1VA 1XRQA 3LG2A 3NYQA 3R4VA 2RHWA 1DC8A 3NAZA 5E1MA 4ITUA 2QN3A 3EZXA 2NSHA 4DCMA 1M1NB 4DMFA 5KOIA 3AF2A 1SXJB 1DIHA 3QA3E 3WIEA 1M0SA 2RE8A 1DEXA 1RPTA 1ZNYA 1SY7A 1SBHA 1ZU4A 2JD0A 2W6MA 1V8DA 5IVKA 3GJ6A 4R68A 3FOEC 3A6ZA 2G09A 3GLGA 4D46A 3ZY6A 1DJNA 1FMCA 2IU6A 3BDAA 5BT9A 1I5OA 4OFXA 3WWYA 5JYDA 4RNDB 1H2AS 2QEQA 4HZIA 5CH5A 4U63A 2QQ0A 1IOVA 2BGIA 2YWDA 3TJMA 1KMCA 1TEXA 1V1MB 4B3TB 4KO1S 4R6WA 1V5EA 5ALFA 2NIPA 3DMRA 2Z2JA 2KPOA 2W5UA 1U31A 7REQB 1WKVA 3ESRA 2J0UB 2OC9A 3KKPA 1D5CA 2I03A 2Q21A 2F1OA 3JWJA 1M6WA 4YCDA 3ME5A 2QTZA 4I2NA 2UZ3A 5BMVF 4BWYA 5TARA 4Z51A 3I04A 3AOGA 2QTBA 2G1KA 3FI9A 1L5VA 2DKOA 3NBXX 5DX1A 4NENB 4F3YA 4GRDA 2PU5A 1D9XA 3P0HA 4D45A 2RH9B 3EQ8A 1K7CA 3FFBA 4JR2A 1MX9A 1M0EA 1EJ0A 1L1FA 2QIPA 3E3LA 4Y2UA 3I6YA 3MJEA 4ALMA 1DJPA 5DM2A 2WWWA 3CXRA 3OZDA 1OXMA 2Q7XA 2ZVQX 4D9CA 2QP4A 2O07A 2ANBA 2VP3A 1W73A 2CLKB 2VSXA 4ZDJA 2UUOA 3R1IA 3T5PA 4BWFB 1V8FA 3IMGA 4ESHA 3G2JA 5CFRA 1I3NA 3A2MA 2ZCJA 2X8LA 4NBVA 3QWIA 4RTJA 3Q8KA 5HJ5A 5BSUA 1XTJA 2VBIA 3H1BA 4P81A 3FHCB 3SBEA 2I3ZA 2OCAA 4JMPA 4Q6WA 1T91A 4F7DA 3V8BA 2CMFA 3CVYA 4I9FA 1GTL1 4UVIA 1I0IA 2JJQA 2D13A 3LNTA 2OQRA 1U8AA 1XQWA 4UREA 5IM4A 1HDOA 1E8DA 1JKFA 1JR3D 2Z4TA 1S2DA 1O8CA 2P4QA 1XUOA 2IIPA 4MR8B 5AKYA 1BS2A 1EP3B 2ISCA 4FOTA 4BBJA 3QF4A 4DR3B 4AZ3B 5JNLA 2A5DA 4MCJA 1TVCA 1IPFA 2FFAA 3AR4A 3PXCX 1RJFA 1GN9A 1U9IA 1MV8A 1MMFB 5KPJA 2W00A 1ZUNA 4C7BA 1O77A 3KSDO 3LWNA 3OWOA 4QLAA 3HBFA 1PZEA 1RQGA 3WQQA 3MWLA 3WL3A 4A0SA 1R15A 1VQ1A 3ASVA 5DN6A 3S99A 1SVSA 2KB0A 2ZUDA 3C4JA 2PKCA 2OC4A 3K6SA 1YS1X 1SBCA 3IQXA 2RFLA 1TUIA 3HLYA 3NRBA 1NBEA 4JP1A 3CZPA 5TMEA 1BO6A 2E4WA 2I65A 2X8AA 4IXDA 2BWJA 3RQIA 5LMNB 1ND5A 5FI0B 2C4TA 4LOHA 2BLNA 2QXYA 3B5JA 1X92A 1KHTA 4L3WA 4YMIA 5EXXA 1SPXA 4FOLA 4NCJA 3UHAA 3MM4A 3CRZA 3DEYX 1NBOA 4ILKA 1NUUA 1FP4A 2R1VB 3ZDXB 4JXJA 4EYGA 5KOYA 5A4KA 2PYDA 3OM0A 2NV2B 2JEZA 5G3YA 4Q12A 3EMVA 4X64B 3WNBA 4PSVA 2R6JA 4MKFA 1UKAA 1V8OA 4AYXA 1JIKA 4DMHA 1P5RA 4GBGA 1HFWA 1NY5A 1KPIA 3MD0A 4DJ5X 4Q9IA 3TL3A 5CCEA 2GBGA 3VV2A 4C0LA 2LUOA 1TZJA 2C1XA 5NULA 2HRBA 2QM8A 3PYXA 5ICFA 1XI2A 3HKBA 1O94D 2CJWA 2R5NA 4LXXA 2QM3A 4MQ6A 4RMGA 3TAXA 4IDDA 4OCZA 3H9BA 2YOFA 3VNQA 4NCAA 1IMOA 4BVLA 3N53A 1WNFA 4D25A 3DGFC 4UFNA 2V98A 2IKSA 3M0EA 4LQ4A 2VRBA 3WZMA 1E2DA 2QTHA 3B3JA 3V2UA 3B1KA 4KX5A 5ULLA 5A4JA 4LY6A 1LLFA 1VBKA 1KJJA 5FI1B 5DSTA 5BV2P 1GT91 1TNDA 2XPCA 3J81k 2O8BB 5JPCA 4WCFA 1N25A 2MTBA 4QPPA 4PSAA 2HU5A 1XZMA 2AYXA 3QELB 3TK1A 2A1IA 4BE9A 1DAPA 3OWHA 3QX9A 3ZKAA 1PBNA 3IBGA 1HG1A 2H31A 1PDOA 1EVKA 1V7PC 5B7QA 4ACAA 4B3GA 3U09A 2NP7A 1TCUA 2Q4EA 3JRXA 3SR3A 1G64A 3ANLA 3CH7A 2FZGA 3FUWA 2QSYA 2Q1YA 3ZHCA 5A4MS 4EG4A 1Z15A 4AUMA 4F91B 1CVIA 1UWLA 2NTVA 1TLLA 3Q9UA 4C4PA 1FX0B 5DLYA 2QN1A 1YBMA 4I9UA 2MSLA 4U7GA 4TZ6A 2C4HA 3MLBA 5IT0A 3MUNA 4DTIA 1EBUA 5KNDD 4G65A 4TXLA 5KTTA 2HMWA 5FOWA 5JV5A 3OPYA 4TKLA 2WUVA 5HCUA 4D26A 2A84A 5CG2A 2FETA 3TZEA 2BHNA 4R9RA 2RAVA 2FXVA 4QFBA 2EU8A 1ZHHA 3M2PA 4UE3S 3GGOA 5M7EA 2GTIA 1FRNA 1W7AA 1P9WA 5JYCA 4Y0VA 2Y8EA 3R6GA 4KQGA 1CCWA 2O3JA 2YUTA 1NUSA 1E62A 1SMKA 2IUSA 2QN2A 3VU9A 1YA4A 4BCCA 3EPRA 1QH8B 4B4WA 2EXXA 5LQRA 1IYZA 4H4CA 2OSVA 4Q05A 5DCLA 5IANA 2H2GA 2J32A 1UMBB 2PXAA 4LFAB 3U40A 3KXDA 3F73A 2H1OA 2R7NA 3IKTA 1KAHA 1XC7A 2IEYA 3DM5A 3ETDA 4QXRA 4DIFA 5HS4A 4S05A 4U7TB 1TJ3A 1J8YF 1X7XB 5EJ9A 1R6XA 4R2KA 4LE2A 1L8OA 2I33A 3Q9SA 1EK2A 1HDIA 2XMRA 3PCRB 4QO7A 1B6SA 3VDQA 3WYGA 1Z2NX 2XWQA 2WV9A 4KQ9A 5FI3A 2Q0QA 4HADA 4EFDA 3I3SR 4CCAA 4XEUA 1PJTA 2K6GA 3F0TA 4OI2A 3WP0A 3ZOKA 1OV4A 2AV6A 5BN5A 4OP2A 1HKUA 4Q4JB 5IYZF 1XYYA 2NADA 2P0AA 3TBKA 3RAEC 5FWYB 1MHTA 3CT4A 1I2ZA 4D3FA 5JJBA 2EFEB 5E2IA 1T1GA 4DLSA 1YB5A 4MITA 4WKOA 1P2SA 4BDTA 4EUEA 2FF7A 2CMGA 5L7WA 1AQUA 1TQDA 1ZJJA 5E4YA 2QUJA 1I2MA 4D9KA 1RZRA 2R4QA 2WYWA 2GN9A 1UPUA 1ZMRA 4QUGA 2J5BA 2RIPA 4MVJA 2YVQA 3PNMA 3N8HA 2XCSB 1T3ZA 2ZI4A 5BV7A 2IH5A 1Z6GA 4TTJA 1QHXA 2O0MA 3M9LA 3F8WA 4XIGS 4BQEA 1Y7PA 5EMHA 5BVGA 1W2HA 4FE3A 3TLYA 4FFPA 2SKEA 5DE3A 1G3UA 3O91A 2Y1CA 5DHUA 3PE4A 3BQMB 5JEDA 1U2DA 3LCVB 5JQWA 3PL5A 1DPGA 2E4AA 5CPFA 1ULAA 2OGUA 4EHKA 5JQGB 3RYCA 2WF8A 1MXHA 2BEWB 2D62A 4RXTA 1ODLA 1IXSB 2XTJA 1JL3A 1PKXA 3QFFA 3R0XA 3HKCB 4H3SA 4W7IA 4WNAA 4C05A 1SU8A 1YZ3A 2GYUA 4HNQA 1QGZA 2WIFA 3H4IA 3PFWO 4DPKA 3QF7A 4CL2A 2QJOA 3JR3A 3JQPA 1Z8DA 5C3UA 1JA1A 3UTCA 3WLNA 1T2VA 5KJ6A 5CB0A 2YS7A 5BWCA 3FGZA 1KY3A 1QVAA 1UC5B 1I4OA 4V3BA 5B58T 3PFCA 3OFNA 1QFZA 1AN9A 1W87A 3JQ9C 2OB2A 1AXEA 3RLFA 3JCZA 1JLRA 4BEJA 1GZVA 4PTYA 3QXXA 1LV8A 5TT0A 2F64A 4DABA 5BSFA 5K0CA 3WQSB 1DJLA 5J23A 3IBFA 4IRXA 3GLHE 3BHMA 4HGZA 2AOTA 3B8HA 5WRFA 3D8TA 4DKJA 2ZSAA 4FCWA 1NQUA 2IZ7A 2RGCA 3IV9A 4PZZA 3TIVA 2RARA 3CRW1 1LNZA 2XNDA 4UHFA 3R74A 3TI7A 1NR1A 2DFNA 4Z1OA 5C4MA 2HRDA 1OAOA 4J1NA 1QMGA 3E58A 4ZGBA 4K2AA 4OGLA 1PJ8A 3O4GA 4ESOA 1GA4A 2R8ZA 2XE7A 1UBHS 2WMYA 1ICEA 4YLYA 4D56A 1TLFA 2BCGY 2OP0A 2DF8A 3E2MA 3FMGA 4BVKA 2BRUC 1CK4A 2QGFA 1XLUA 3EVEA 1Z2EA 3EGOA 4G4GA 4JB2A 2OBBA 4IVNA 2X2EA 3NAMA 1IONA 3LOPA 5EJ8A 4NBWA 4IHKA 3LT0A 2EKLA 1HMPA 2FDXA 2BR4A 3C97A 2ORVA 3ETCA 4BRSA 4FW9A 2B8EA 1JPVA 4RMHA 1JX6A 5FO0A 4RLFA 2Q5FA 4Z7OB 4IMIB 3K96A 5BVHB 1SC4A 3R9KA 1AHHA 2N3ZA 2P6OA 3CNBA 2HNBA 2G9NA 5JAZA 5FTLA 2BEJA 1KRWA 3PQ2A 3KUCA 5CIQA 4KW7A 2GXAA 1X80A 1ZGJA 1JQ3A 2A94A 3G9ZA 4IGAA 1XK7A 5JCXA 1GNVA 5KSYA 4F12A 1LSSA 4E1BA 1W36C 3NHPA 1VRVA 2I6UA 4HCJA 4K03A 4B79A 3DBVO 2I2FA 4N6GA 4LQCA 5EJ5A 2IBTA 5A02A 2BGGA 1QGDA 2JI8A 2PTHA 4IZIA 1B6GA 2Q3LA 3LLUA 3HHEA 3PJDA 2VP5A 3PJEA 2XMCA 3QVMA 2CXNA 4ZQGA 3RRYA 1NC3A 1NZDA 2CLIB 4ITVA 4MA5A 4NARA 4RZHA 4BO9A 2HMAA 2QZ4A 3KIPA 3PSHA 1RAFA 4KL8S 4NEQA 3ECAA 3W5VA 1IATA 1GAXA 1KEWA 1W6RA 4IQ4A 5B1DA 1PFQA 3C6BA 4DUGD 1TJ4A 2TMDA 5IJZA 2PJRA 1I0ZA 2JDID 5FNVA 4AJEA 5JI3E 3I9NA 3FWHA 1ISIA 2O2CA 3HCNA 4R7ZA 5FI5A 4XQ0A 4AG3A 3U9TA 2WWRA 2G5GX 3ZHSA 2QP9X 1LDYA 2UVQA 3HFRA 3M5CA 1AOXA 3GZTB 3C8UA 2D0PB 4EYEA 4KQHA 4N8DA 4H1VA 4IZHA 1T4MA 1KOFA 3DDHA 3HCAA 2VP6A 5HUHA 4KREA 4YASA 2NSLA 3DCIA 5SYAA 4HBZA 1J9ZA 4E2ZA 5FOSA 5K3EA 1X15A 2HHCA 1U7PA 2YHUA 3NIFB 3PE6A 4NF2A 3QV2A 2PE5A 4JVLA 3NQ41 4X97A 1W25A 2VJMB 2Y4NA 4RKYA 2YJ6A 2VQFB 4CLXA 1KYIA 4UBIA 1OQAA 3TGLA 4L28A 1YOVA 4MULA 5JLJA 4MDHA 1AVTA 2W2OA 5KQGA 1S7CA 3NFRA 3T3IA 2GCEA 4BV8A 4DA7A 4RTPA 4RTRA 3O2QB 5IM4F 1M1YB 3UPUA 1J56A 3ZVRA 4MDEA 3KUXA 4NL4H 3H0EA 2D4HA 2X7XA 4KQWA 4J2HA 4RDXA 6ADHA 3F7TA 2ZPTX 4DBVO 2B0JA 4DLUA 1VSBA 1TQ8A 1L7XA 1HOTA 2P6NA 3VNBA 5C8YB 3HR7A 4WY5A 3FPSA 3R3SA 1Z37A 1OD6A 1ZZGA 4RPKA 2OENG 3QU4A 5FBKA 2GCPA 5EOVA 1JUDA 4LZAA 4R8SA 3ASYA 1U6JA 4JZKA 1SRQA 5CM9C 3TLGA 5E95A 4MGYR 4LWQA 4ARBA 1QF6A 2DETA 2XCRB 4HTAA 3FJOA 3P20A 1SAYA 4JKOA 3R75A 3FZNA 4J90A 2CSUA 4NMXB 4P3PA 4FHCA 5AQEA 1VZ3A 1WB6A 1BVYF 4URYR 1SUFA 3AVXA 2HO4A 3KYDB 1SEPA 2FP3A 3PZBA 1AO0A 1D4AA 1GA1A 3E81A 1PBTA 3UG7A 5DBEX 2HF9A 3TUJC 4ZOEA 5ITZA 4BGUA 3GJ3A 4C2AA 4ID9A 1SVKA 3S1AB 3QX7A 3R5JA 3L07A 3C3BA 3IL2A 1M0WA 3BB4A 4E7OA 1WXQA 3B38A 4IYJA 1GUZA 5B12A 3EHEA 2BDUA 4FJ0A 3I2IA 3IVCA 3ABSB 1GL9B 5BR4A 2YRXA 2X4DA 4UBJA 1RZUA 3T95A 3OF2A 2IYSA 4OP1A 1EK1A 1C9DB 2VHUA 3COYA 2EKZA 5I3CA 1XRNA 2FV8A 4B47A 4MGIR 2DUMA 1N1DA 5IS2A 2O2JA 3AUXA 1JAXA 2GJ4A 1OFGA 4EEKA 2OLEA 3AVPA 4I81A 3ESDA 3H2KA 1YKSA 3VR2A 3K72B 1W88A 3JQGA 4OXNA 4QWMA 3ZXIA 1OILA 4FZVA 2W6PA 4KDFA 4HUQB 1UT6A 2RC5A 4JROA 4PM4A 1Z45A 2IYAA 5C34B 1HG0A 1UJMA 3BB3A 2GAIA 3BCRA 4MWZA 5DOVA 4OOFA 2PUBA 5KYWA 2C94A 4RDHA 3H6HA 2EWVA 3CNOA 5K8TA 2PRZA 2V9ZA 4RF4A 4UBLA 4XOIA 3GDHA 3U4HA 4DB4A 3GJ4A 5DYGA 5IHXA 4E30A 2XTAA 3GRFA 3C6QA 1DUSA 4KQKA 4NBNA 3K73O 1ZS9A 2WM2A 3FWYA 3I2JA 3GCXA 3RSQA 4ASUD 2ZI3A 1KF0A 2KJQA 3SEZA 1I01A 1T9ZA 4KOEC 3GZNA 1P0IA 2PL9A 3PF9A 3N6RA 1Z4LA 4J75A 4FOOA 3OTQA 1OTYA 2C3YA 1DJOA 1UDBA 5FKJA 5CITA 3PUJA 2ZWIA 3FKSA 5TRTA 1RWMA 5IXYA 2JJ2A 2ZJ7A 3KZ1E 4M0EA 1UMKA 3VO1A 2Z0MA 4CQLB 4D3DA 3OCWA 4QAJA 4ETIA 4U9HS 1DBPA 1I2DA 1ETUA 4UXJA 1GZUA 3MCZA 4H7IA 2O1SA 5IXSA 1FDTA 2ID8A 3B3GA 1G8PA 5IARA 2BZGA 4GQIA 4IDHA 5EXSA 3UM9A 1KI1A 1COWA 2E55A 3QOXA 3T5TA 1X7HA 4Z3OA 2I0FA 2H18A 2O59A 5HE8A 1XRLA 1UT8A 2QTNA 4X20B 3LF2A 3ILVA 5DF1A 3WWDA 4LJAA 3L41A 3TD6A 4U2BA 1ZITA 5E6SA 5LMCA 1HE4A 3QRWA 1M2OA 1ST3A 5B57C 5JDIA 1KYYA 1YDHA 1ZO8A 4WK6A 3UA4A 4CCWA 5IBPA 2ZZNA 3LBHA 4KXWA 3UXEA 2OORC 5L4LA 3RUCA 1HNWB 3REQA 2JCVA 1JS1X 4LPSA 4JI5B 3A32A 1HDYA 3QVLA 3USZA 2FLWA 3E7DA 3Q3CA 4PQFA 4QOIA 4TROA 3I28A 4H7HA 4RV5A 3FR8A 3GJZA 4EPYA 1OIWA 5C53B 4KR2A 3RJMA 1KHHA 1W93A 2WK1A 1SXQA 4TSFA 1T0PA 2CEAA 3AW8A 1YF3A 2ICAA 4W1PA 1NNLA 4WXYB 4OYLA 2LDBA 2QSJA 4XWAA 4MWSA 2QGNA 3RK4A 2HFJA 1I3CA 2QX6A 2WM8A 1QS0B 4NYMR 3TQIA 5JXJA 1YZVA 3PNSA 1U3VA 1N6NA 3X2SA 2CB9A 1C4OA 1SIBE 3I1YA 1J06A 2PGXA 4KI0A 1PR0A 4NV1A 4GG1A 4PX5A 1P60A 2GDJA 4IO1A 5B3JA 3BJZA 3X43A 4LDJA 1N2BA 3JARA 8GPBA 4MVJF 1S8AA 5EJGA 4E12A 4L0MA 5AKEA 1OWPA 1N2CA 3RIGA 2CBZA 4D0SA 4OGGA 4BYMA 4Q37A 4UCWA 3A6GA 1GAEO 3AYZB 2Q0SA 1AKRA 4L74A 3E4CA 2IODA 2ZQYA 2BGMA 5KJEA 3ZWAA 3PT5A 5BMVB 5EL0A 1E0AA 3O8DA 3OMLA 1EX9A 3TQHA 4CT4B 1Y9DA 4X1KB 4D4HA 5BUCA 1TZMA 4F04A 5JC8A 1PTKA 3I1IA 4XQEA 4DMUB 1M7GA 1L9XA 2FRVA 2H17A 2W6QA 3JD3A 3D31A 4A03A 2PGNA 3G8YA 4UUNA 3STHA 4MUEA 1Y37A 1W0KD 1NQVA 3NWOA 1GT6A 3QKWA 4I08A 4XPIB 4YAKA 3QLJA 2Z1NA 1TJ5A 4FGJA 4LKRA 2F1HA 3O8OB 2NU9B 3IIEA 3U6KA 1IUOA 1KY5A 1BFDA 2WRZA 2DJIA 2WSSD 1XSEA 4S2UA 4OGFA 1CF2O 4OHYA 3UMYA 3ONDA 4LJSA 1EI9A 4JI2B 3V48A 1LDNA 1N2IA 2NYUA 3IVRA 3TKAA 1ACLA 4XA8A 3DXXA 4U2CA 1DX9A 4HMQA 2V03A 5K0NA 3DUWA 4A3SA 1Z4JA 1NXQA 1GYQA 3ILHA 2AOUB 3SLKA 1I8TA 4XWWA 2WWIA 1QH1B 1BW9A 1CQIB 2X0KA 3OOSA 4IGIA 5KREA 3RADC 1UJCA 2B83A 2AG8A 4Q1AA 5AVOA 2BGNA 4ZEVA 1GEEA 2H5EA 4N41A 4MV1A 2TMKA 5D1NA 4LW8A 4I50A 1YL7A 3FWPA 3D7MA 4I55A 3DBRA 8MHTA 3AT1A 3N70A 2EX1A 5HIAA 3BGDA 5LFAA 3TUZC 3SQXA 1BDJA 5JSKA 3W06A 1FFWA 1K3FA 2XJ4A 3KAQA 5JS6A 3PT9A 4KR7A 1T13A 3FYUB 1HQCA 3FWZA 4D4KA 1RU3A 1WPQA 2C96A 1P3Y1 1GGEA 3I5MA 4BKMA 2YV5A 1PGPA 1NW3A 3TPFA 4GZLA 5DFAA 1R7RA 1EKXA 2A9JA 3OZWA 4NECA 4XX0A 1M6VA 4RPJA 4O3FA 1M1XB 2AOXA 5FPPA 4BRWA 2FN8A 3Q6IA 1WEKA 2I3DA 2PS3A 3IUSA 5JVDF 3MWYW 2JFWA 2OECA 4LZNA 4XUGB 4OTZA 2PBLA 2X8JA 3RIMA 1H1LA 3PLNA 1EFPB 2CXOA 5JJKA 3DB2A 1QWSA 3ND8A 4E31A 1J70A 4IV8A 1P1JA 2B2CA 3H1TA 3O8NA 4LYJA 2B4YA 1LSJA 1ZAKA 5HYVA 5IT4A 1HLGA 3FD8A 4YCJA 4OHZA 2AC7A 1VL8A 1BMDA 4DQ0A 1LLUA 2QMQA 4XQ9A 1KSGA 3CO0S 3L0OA 5EHNA 3BWCA 3QKUA 2DPMA 1A88A 1L5MA 4KWHA 4RBNA 1NVXQ 4WKGA 3V8NA 3TG8A 4ZEMA 4DV6B 2OZEA 1A50B 1E32A 3U3MA 1R4NA 3LYLA 2CXHA 5KSOA 5LP6C 3KJIA 2OBNA 4TLLB 3PF8A 4EO9A 4ZT6A 3B6IA 4QFMA 1VJ5A 1RJWA 2YWCA 3VZCA 1TYCA 4JZYA 3V33A 3AYXB 2BH2A 1ILWA 1FSPA 1QE3A 4B3FX 2GAOA 3FRIA 2QI9F 3C4VA 2XCUA 1SGWA 1TU3A 3CM0A 4I1IA 4XLLA 4Y3UA 1E7QA 5KBYA 3N0VA 1WOYA 2BN4A 1CUJA 2WE8A 2MYUA 1BJKA 1Y1QA 3P4YA 4I6JA 3RASA 5KQPA 4JI4B 3FKQA 4Z1MA 3UG6A 3DF9A 1UK6A 3ONEA 4DR1B 2WJZB 3OSUA 3GCWA 4RABA 2ZIEA 1E6EA 1FRQA 2BBWA 5DI3A 3CLKA 3GC6A 3KPJA 2H08A 4HDMB 3M7IA 1PW7A 5CT4A 1HNNA 4MQMA 1K6IA 3O26A 3E1GA 2IDJA 1GR0A 2QMYA 2WIDA 3FPHA 3G0BA 4FW8A 5C31A 1RRPA 3CX4A 3B1WA 5AW2A 3KHSA 3K9FC 2BMWA 4LC9A 3MMSA 2G04A 3E9DA 4Y2RA 1SOWA 1K2VN 2C9BA 2XNCA 4RMIA 5AW9A 4TQGA 1KSFX 3WV4A 4FU0A 3DBHA 1U4SA 1SJ9A 1ZVQA 3NHAA 5TR9A 1J6UA 5JS2A 1UAAA 3D3KA 3ENNA 4MVYA 3JRNA 4MV9A 3HY3A 2GLTA 2GD6A 1DDOA 2NO0A 5BW8A 2HNAA 4P80A 1E60A 1F2DA 4RPGA 4ME6A 5IU6A 1EP2B 3H84A 2C29D 2V6BA 2V7QA 1E61A 3BKXA 4G0XA 2IHTA 5AKGA 5M5BA 1FDOA 1XCLA 3TD9A 3D54D 2WWXA 4IIXA 4QECA 4BP3A 4BE7B 4PEVA 1YSCA 2NPIA 1QH9A 2NSJA 3C3EA 1GGVA 4YMHA 4BNWA 3KZXA 5DIFA 2ZU0C 5ERGB 3LZ6A 3O38A 3A1TA 4FT4A 4NSNA 1C7IA 3LP5A 3Q88A 1V71A 5KYNA 3B1XA 3Q8XB 4YUVA 2KYRA 2MT9A 4IIUA 4NATA 4LJRA 5CLIA 4MRVA 1G21A 1CJVC 1RYYA 1XQVA 3CLTD 3EXIB 3HGMA 3JASA 3K6RA 3EPLA 2RCYA 3VKGA 4P36A 2CUNA 4QOJA 1VGVA 2ZDHA 3EODA 4RGQA 2A3NA 3RTBA 1O89A 1L4LA 4JVOA 4PR3A 4ZO8A 5HKBA 4BL5A 3Q9LA 4XVHA 3AVUA 4B6JA 1Z83A 3VMMA 2WF7A 2WU4A 1TD9A 3RJZA 4KQEA 1GKIA 3HNRA 2R87A 5BSVA 3WIDA 2XZDA 3KSZO 1VPLA 3K5PA 2FWJA 4L5AA 1U80A 1GVHA 3MIZA 2JFUA 3A7DA 3Q3VA 2H5IA 4U39A 1M8GA 3HJRA 2ORIA 5E9QA 2JFPA 3IPYA 4BBPA 3AR9A 3KQOA 2J0VA 3PWSA 1A2OA 2VA9A 4XDHA 1XAHA 4EMTA 4M7PA 3PHIA 3GGSA 1GU0A 2QUHA 5ECWA 5L95A 4OL0A 1IM8A 1TLTA 1Y8CA 3CKKA 2R1TA 2ORWA 4JLDA 4QBHA 1FDUA 5KYGA 3PDCA 1YR2A 4CEJA 2POQX 3HSKA 3M5DA 2V7UA 2YQZA 3CEMA 4PU0A 1M2KA 4PQEA 4DT1A 2ONZA 4PLTA 2JBAB 3IFSA 3I6QA