1JIIA

Crystal structure of s. aureus tyrrs in complex with sb-219383
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
319
structure length
319
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tyrosyl-tRNA synthetase
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
total genus 96
structure length 319
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jiiA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jiiA01
4GRIA 1TYBE 4MAFA 3FH0A 4MUGA 3H9BA 4XFDA 3IOCA 4ZCPA 4U63A 1U3DA 1XNGA 1KH2A 2J4DA 4PBTA 4CDMA 4CDNA 3C8ZA 5J58A 4MWBA 4MULA 4RPIA 3UK2A 1D2RA 3FIUA 2DERA 4ZT7A 3KT6A 5TS2A 2QUHA 4DNXA 1O97C 2J08A 4MW2A 3H9CA 1NURA 2GKSA 2CV1A 4ND7A 1R6XA 4EG6A 1QTQA 1KP3A 2WB2A 1NUPA 2CV0A 1DNPA 1P7PA 1WXHA 1GTSA 3DLAA 1B6TA 4G5FA 1IHOA 4MWCA 4AQ7A 1X8XA 1JZQA 3IUBA 1J1ZA 2A1TR 3FY4A 1NSYA 4MVXA 3HFJA 1TEZA 3P52A 4EGAA 3FETA 2J5BA 3ISJA 2D13A 2PZBA 3IMGA 3D6VA 4ZT2A 2D54A 1IQUA 4MWEA 2CSXA 3A4IA 4MW6A 1JILA 1SURA 4ZT3A 3VGJA 4PBSA 2G36A 4I6EA 1GZUA 1QQTA 1VBMA 3GMIA 1FYDA 4ND6A 1NYLA 3ELBA 1U7XA 4YP5A 1JIKA 4JXZA 2HMAA 4S1OA 3G5AA 2A1UA 3LE8A 3FG9A 1V47A 1J1UA 2IELA 2CV2A 3CVXA 5KHAA 1NZJA 1WZ2A 1N75A 4CQNA 2X0KA 1F7VA 2BTEA 1M8PA 5J5AA 1NUSA 2HZ7A 4H3SA 3P0HA 1KAMA 2NSYA 4JFAA 1COZA 4KPUA 3TQOA 4WNYA 4YP7A 3IUEA 2CFOA 1OBCA 1KP2A 1M8JA 1MBZA 2DUMA 3IDFA 4ZCTA 3CLRC 1IH8A 4R0NA 1G8FA 3M5WA 1EE1A 1GTRA 3FI0A 1S4MA 1ZJWA 5EKDA 1OWOA 3AG6A 4NAHA 1GN8A 5H16A 5KCMA 3SEZA 1KH3A 3FNRA 1T9GS 4R2MA 4E1AA 1OWLA 4J76A 1WKBA 4MVWA 1YULA 3ZXIA 1PG0A 1YUNA 1JEEA 5BNZA 1I6KA 2EL7A 1M8FA 2VTBB 3CVYA 1JMVA 1LI5A 1IFXA 3IVXA 2DR2A 4F4HA 1OWMA 2E18A 4EG8A 4J75A 4MUEA 4ZT4A 2PIDA 3L93A 4OJMX 1Q15A 1I6MA 2XRZA 5LM3A 1OWPA 1KQOA 1EFPB 2DETA 1ZH0A 4EG7A 2J09A 1F7UA 4MUJA 4YBRA 1Y42X 1J70A 2O5RA 4QREA 3S3TA 5J59A 4MLPA 1WXGA 1PFWA 1N2BA 1N2JA 4Q16A 4DJAA 4DLPA 3N8HA 1F9AA 3NBKA 1KQNA 3QE4A 5JBNA 3IODA 3IVCA 3DV2A 3X1JA 1PFYA 4ZCRA 1PFUA 1O96A 5H7XA 3PNVA 1N77A 4HJXA 2A88A 3CLSD 3DPIA 2YXNA 4ZT6A 5DB4A 3RHSA 4MUHA 3TNJA 4GU5A 1K4KA 2HGZA 3SDBA 2CUZA 1LW7A 3AKZA 1M8GA 2NZ2A 1O94C 3AG5A 3COVA 1EUYA 3IVGA 3HL4A 5KWVA 1O97D 2QTNA 2VXOA 1IQ0A 1JHDA 4MUFA 1MAWA 1WQ4A 1UFVA 1T6XA 4JXXA 4ARCA 3Q4GA 1OD6A 4R2LA 2JANA 1X6VA 3CR8A 1EFVA 5FO0A 2E0IA 3ZJUA 2H2AA 4X0EA 5LLTA 3CLTC 3Q10A 3VU8A 2QTRA 4DDHA 3KFLA 3ZXSA 2A86A 1R6UA 2RD2A 4OUDA 1WXEA 1G8HA 3A04A 3L92A 2EJCA 2Z3VA 1K92A 1H3FA 2GM3A 4MUNA 3X1MA 1MJHA 1IVSA 2DLCX 1JGTA 1WXIA 2QJTA 1T6ZA 1VBNA 5DK4A 3A05A 5K0TA 2V0GA 2A1TS 3FHJA 1K97A 1N2IA 4HK4A 1WOYA 3COYA 2O8VA 4U8HA 5FO1A 5K0SA 3X1KA 3PNYA 4YP6A 4MWDA 4KR7A 4QBTA 3KT3A 4ZCSA 3U1VA 2GOYA 3TZEA 3HV0A 2A84A 1CT9A 1LI7A 4F3RA 3N05A 2R5WA 3OTWA 4HJRA 2V0CA 2QJOA 3SZGA 5FNZA 4BWVA 1WQ3A 3CLRD 3CVWA 4L2IA 1O95C 4EG1A 1QRUA 4DE5A 3UY4A 2A1UB 1GPMA 1G59A 1H3EA 3SP1A 1Q19A 2TS1A 3PRHA 2ZUFA 4KR6A 3I05A 3P0IA 3CLUC 3H99A 4XFJA 3AL0C 3UMVA 3PNBA 2X1LA 1M8KA 2YWBA 3TQIA 3UC5A 1VBKA 4KPUB 1KH1A 1YI8A 5TGTA 2PXHA 5TEVA 1T6YA 1MAUA 3JXEA 1EXDA 3SYTA 2QUIA 1GLNA 5HG0A 4EG3A 1TQ8A 3MMXA 1XNHA 1ULHA 1YIAA 4NX2A 2AZXA 2OV4A 3NBAA 1EJ2A 2Z09A 1QRSA 3TS1A 3KT8A 3LCJA 1WY5A 3LOQA 1TFUA 1YUMA 5DASA 2QJFA 2X3FA 4A91A 3N9IA 1KQPA 1NUUA 1VLHA 2QTMA 2PG3A 5AHWA 1K4MA 1KAQA 1ZH6A 3G59A 3ND5A 4DDKA 2DPLA 1NP7A 1Q77A 1N1DA 1R6TA 3INNA 1I2DA 3MUEA 3FOCA 3COWA 4NAUA 4EFKA 2WQ7A 3FWKA 1V8FA 3UOWA 1QRTA 3DO8A 2QUJA 1QNFA 5F23A 1KORA 1MB9A 3CLSC 4MUIA 3G6KA 2IP1A 4Q93A 1JECA 1JIIA 2XRYA 5IHXA 4K03A 4K0RA 4ARIA 2ZP1A 1N3LA 3MLAA 5HUJA 5LFAA 4I6JA 4NATA 3CVUA 1NUQA 1O94D 1O6BA 1JEDA 1IQRA 2J07A 2DEUA 2CYCA 4DDMA 4MW1A 1JIJA 4JZYA 1QU2A 3A2KA 2YY5A 1YIDA 2JA2A 1O0BA 2CYAA 1F4LA 1WXFA 1I6LA 2AKEA 1O96B 1JZSA 1NUTA 3HMQA 4ZCQA 1M83A 3HGMA 1RQGA 3HZRA 2E89A 1KR2A 1MC1A 2PZ8A 3F3MA 1N2HA 1Q11A 3CLTD 3ZUGA 4YMIA 4PBRA 3OP1A 4I6GA 3K32A 3QTTA 4MUKA 3IOEA 3D6UA 1NI5A 1TYAE 1J21A 3ILVA 1FFYA 1MRZA 4EG5A 4AS1A 2Z08A 3MXTA 3Q12A 3TZLA 3SEQA 1U0BB 3RFFA 3ND7A 2YWCA 3RBAA 3ND6A 1U7DA 3ZGZA 4MW4A 1EFVB 3VRHA 2B7LA 4KKVA 4QRDA 5DEOA 1T9GR 2H29A 2C5SA 1O5TA 4MVCA 1M1ZA 1PFVA 3IMEA 2QUKA 5IJXA 1U3CA 1H3NA 2JAXA 1J20A 1XNJA 4XSVA 2BYTA 2VTBA 1N78A 3K9WA 1KKUA 2CYBA 2I1LA 3COZA 4OUDB 2DXIA 1OWNA 4MW5A 4U7JA 1TYCA 4UZEA 1VL2A 3CA8A 4MW7A 3RK1A 2OQ2A 2A7XA 1EFPA 4P2BA 5TEWA 3BL5A 3E27A 2PZAA 2E21A 3AIIA 1GAXA 1MOPA 1N2EA 1QJCA 2ZUEA 2WSIA 1OBHA 1O95D 4G5YA 4UZFA 4KR9A 3IH5A 3ZIUA 4MQ6A 4FZJA 3IMCA 3GLVA 3N2YA 1HYBA 5HUHA 1ILEA 3QTBA 4JYZA 1MB2A 3FDXA 3KT0A 1N2GA 4HPWA 4RUKA 3ZJTA 3CLUD 2IJGX 4PY2A 4EG4A 1QU3A 3H05A 1TYDE 2RE8A 4MVYA 3P0JA 2AG6A 3CVVA 1J09A 3PXUA 3MLBA 4EF6A 4MW0A 4CT0A 4L2IB 1IRXA 4G6ZA 3ZJVA 4ZT5A 3RJZA 3RK0A 1PG2A 2CT8A 1BS2A 3IOBA 2A4MA 1O0CA 1WJGA 1XJQA 2WQ6A 2X1MA 1A8HA 4TS1A 2PFSA 4NDAA 3SZ3A 3H97A 1N2OA 1G8GA 1EUQA 3GUZA 1ZUNA 1H1TA 3AFHA 4WSOA 4MW9A 3NV7A 2D5BA 4NZPA
chains in the Genus database with same CATH superfamily
3DDHA 2FXVA 3LRTA 4HFMA 4P86A 1REQB 3IEIA 5ALQA 2F3TA 4L57A 4Q3NA 4G1MB 4LFCB 3CYFA 1P91A 2FOXA 3I2YX 2COEA 4R9VA 1C3LA 3FJOA 2VEDA 4CM9A 2IRWA 4EFMA 3A1WA 4Y67A 3ONEA 4DNQA 1NRJB 1K68A 3GLQA 3T1HB 4OL0A 3SC4A 1COWD 1SELA 3THYA 3FKSA 1RWBA 2QX7A 5AVWA 1QRDA 3FIUA 4TMFA 4ZT7A 2P2SA 1T2VA 1YJ5A 4KVFA 9MHTA 1ZCFA 2QE7A 4PVCA 4E22A 1NWHA 4Z4GA 3CT6A 4KR0A 4DMRA 4C4ZA 4DSUA 4H2DA 2XBUA 2QAJA 3PDJA 5I5GA 5EE3A 2SCUA 3WL3A 1E3DA 4CLRA 1FP7A 4O4LA 3FUTA 1QQBA 2E82A 4RZ3A 1VRWA 2A9OA 4G1EB 4LGMA 4IS3A 5J4VA 5FPHA 1QIFA 1VLQA 1TIPA 1Z2DA 3CWQA 2H2IA 1C7JA 4L4ZA 4GS5A 1MKYA 1ODKA 3Q7EA 1LCIA 1LPSA 3ZC3A 4GBGA 3B3GA 4ZCLA 1IPEA 1PJAA 5A62A 1V6SA 1DX6A 3AC0A 1EVEA 4NYMR 1EGVB 1SUCA 2HJVA 5TX7A 3AF3A 5CT8A 1EWTA 1YDFA 5TMPA 2WYWA 4TV8B 2P2YA 1B8NA 5LP6C 2Y0BA 1U99A 1YJCA 1WZCA 4N18A 3X1WA 5BVHB 3ZDCA 1RHUA 3OEWA 3CJTA 3ETHA 1U9YA 3A28A 5F5LA 1RYBA 2A0YA 1G6HA 2R47A 2LKDA 3ZQ6A 1O5OA 1IB0A 3QVLA 5CIWA 1HNNA 1TVCA 3RTAA 4KZKA 2IHZA 2P78A 1XD9A 2P6MA 5IBRA 2PU5A 2XDWA 5KYTA 4LRWA 3Q2KA 4LF6B 4K2HA 3QV2A 4ZAGA 1BKYA 4DQKA 3JTEA 2FN4A 2HW8A 3FFWA 4BMYA 3EPRA 3FM9A 3L07A 4Q5IA 4R5HA 3UMGA 2F8LA 1RHMA 3HWWA 2AJTA 1HEIA 4GO1A 3MAAC 3ZI4A 3LPMA 2J32A 2WYIA 5IDXA 1P2BA 5G0SA 3O2SB 2O2IA 2CB0A 4JT9A 3WSWA 4JP3A 4KFUA 1CR1A 1DBVO 3DF9A 3I9KA 3BHNA 2HSEA 3CPHA 2C2ZA 4OA5A 4KGDA 1WZ2A 3OCXA 2BTEA 2GHTA 3JALA 4F1JA 4W5RA 5ICCA 3DLBA 1X1SA 1ZUHA 4LSZA 1J25A 3D7RA 4W82A 1NUSA 2D1YA 4BFXA 1PX2A 2EKZA 3MIIA 1ECFA 4BY9E 1DDGA 4UTZA 2OKCA 3FWYA 3C1AA 3LWZA 3GR6A 3IDFA 5HF5A 4A6DA 2AFRA 4QULA 5CEEA 4IHJB 2D1TA 2BRUA 1YBFA 2OB2A 3PCXA 3HJAA 4DCTA 1DGQA 3GRYA 5M29A 2J87A 4ZARA 4DIMA 4DYDA 5CH3A 3QU5A 4EW6A 1DAEA 1Z2OX 1IXZA 1X9GA 1Z25A 2A6PA 5IJ0A 3D6NB 5JBQA 3ZS9A 3DBOB 5FA8A 5HVNA 2GBCA 3UG6A 4XRGA 1KBOA 3FMVA 1UDCA 3MOIA 1GLGA 2I2DA 2ZDQA 3I72A 4EDHA 3SYLA 3LVBA 3T41A 4AKEA 1DPFA 1OWLA 1YAJA 3QELA 4I1RA 4TOIA 1GAQA 1WKBA 3GFBA 4TZ6A 1YULA 1PV2A 1QTIA 2I3AA 2OM2A 1CUCA 1VMDA 3H1EA 1KFJB 1PG0A 3QH4A 4G0MA 4PW0A 1OMOA 4B6OA 1TUEA 4B3RB 3RYTC 2CXSA 2YV4A 1J8DA 4MLCA 3RUPA 4WFQA 4H1UA 2B7BA 4QOGA 1GPLA 1SXIA 3IGFA 5D84A 4J75A 3EVEA 3ZQJA 3F96A 2Z5VA 4CFZA 3T3DA 4ETIA 2DHEA 4Q18A 4MUYA 5J2TB 5K3EA 3FUCA 1AVTA 2QXYA 2XE7A 4EFNA 2YZ2A 5KU1A 1GRRA 4W7IA 2XKAA 3P7MA 3VBEA 3ROMA 4OYLA 4OQPA 1DRWA 2XT6A 2O5RA 2AFHB 3FZEA 4MRAA 5DTQA 4RHXA 3WIOA 4MKRA 5F1PA 4HDNB 5JJKA 1ZMTA 3HM2A 1D5WA 1WETA 1DBWA 2CNDA 10MHA 4ATNA 1N2BA 3I6MA 3O0TA 5D3ZA 3LA8A 1D1TA 1ZNXA 2HDNB 2O3UA 2OV2A 2JB9A 2C2YA 3G1WA 3QA3E 4J3FA 4WN9A 2JD2A 1PI3A 4ZEOA 3V1UA 1J9GA 5CB8A 6Q21A 1WKVA 3QE4A 1RQ7A 2JC3A 2DH5A 4ITRC 1U0SY 2G4LA 5DWQA 4F6LA 4O6VA 1CJTC 3O83A 5T4EA 1DE0A 3RARA 3GDHA 1AD2A 4JVMA 2BR3A 2GN0A 3P2OA 1UPFA 4JJIA 4ZKEA 3WGLA 3F7OA 4RC9A 2PUCA 5AJVB 4KZPA 1HF3A 3BMCB 3EFHA 4JGGA 3ST7A 3KKPA 4TWZA 1EVYA 1X7GA 4UVDA 5ESRA 4BX0A 1RC0A 1U7UA 1ZVKA 4WY5A 4HDRA 4BVEA 3EXFB 3B7GA 3L8FA 4QLOA 5ADVA 1M8GA 3Q7TA 3HCWA 1WW8A 3KXLA 3K8QA 5DF1A 4A2PA 1Y9DA 2AR0A 3WWZA 5A7HA 3BHIA 1CP2A 1XHLA 3DYVA 2PX2A 5DTEA 5LLDA 4G8CA 2CNOA 2NG1A 1XZCA 3B52X 2IYSA 1EG7A 3E81A 1KOLA 2ZE8A 3LT0A 3F4BA 1Q0PA 1UKCA 2C58A 4GOMD 1OGYA 1C0EA 2I55A 4PQEA 4UNQA 5EUCA 5I8PA 1EP9A 2FWJA 1ZJJA 2P0AA 3DB2A 4HAVA 1EVJA 2FAXA 3DYBA 3VNAA 4R2LA 3MILA 3ROEA 4Q1CA 4YRQA 2E0IA 1GGEA 1SCDA 2H2AA 5CNMA 4N48A 3LO5A 4IQ4A 2ORYA 1R50A 4QODA 2ZVJA 4XX0B 4V1CB 2ATXA 3VU8A 5COQA 5EMHA 4LOKA 4OI2A 3R7WA 5D87A 4H0FA 1EGMB 3L6CA 2VZLA 4KGVA 2RD2A 3BTOA 1CFZA 2BIFA 2G08A 3DZJA 1H0HA 1AKQA 2AMVA 2IOYA 4Y9SA 5F7ZA 3ANXA 5K5EA 2C2OA 2PKQP 1B93A 4S2UA 1O94A 2QZSA 3QVGB 4BN5A 2PGXA 3R3WA 3LKDA 1I2BA 1SVWA 2VPPA 3DT8A 4M0KA 1MJHA 4RD4A 3ZGOA 1WXIA 1RKBA 3N2NA 4EMUA 3TFWA 4JUAA 1P18A 4GD3Q 1QVVA 4KQ6A 1NSTA 3STXA 2LE0A 2CKDA 3HSSA 5AI5A 1VBNA 4E21A 3A05A 5K4HA 5FBQB 2A9JA 2ZT6A 4FQ7A 3AVXA 2XYHA 3X2SA 5EESA 3WLHA 2O8CA 1VG9B 3ZEIA 4HI0E 2JK0A 2GBIA 4N0EA 1F8FA 3KOZA 2UZIR 3Q3JB 4XPZA 5CU7A 4DRXA 4ENPA 3X1KA 4ABYA 4KR7A 4QBTA 5F2EA 3RS0A 1GCAA 3IDQA 1K7EB 2B35A 2MIIA 3JAWA 5C52B 2QRUA 4XIGS 2QN9A 2A0WA 3PGVA 5BRNA 3VSDA 5B1DA 2G0AA 3I42A 4B6PA 1OT5A 1H2AS 1J2EA 1JALA 5CNIA 5LOVF 4WOBA 2AOUB 5EINA 3VJMA 1XT6A 2Y99A 2NU9A 3EQ6A 4E2XA 2HTFA 1Z5UA 1TVEA 4OXIA 1OR8A 1JWLA 1RWNA 5CH5A 5AW0A 1OUMA 2UZ4A 2A9PA 5IWAB 4IEEA 4N49A 2V98A 5KJ1A 4BAUA 2GZSA 2JDIA 4US2R 5ELMA 2ZW9A 4YY3B 1IQPA 5A2QA 4KO4S 1HV8A 1MQ8B 1EJBA 4Q4DA 4LYJA 3UY4A 2HNBA 4EPYA 1ZIXA 2Z2ZA 5L6LB 3G0CA 3NNDA 4JC8A 2VH1A 4DDWA 1DCFA 5EEHA 5G3YA 3K6SA 2MT9A 2E48A 4M87A 2ZUFA 1MMFB 3GLIB 1JKFA 2AF3C 3HACA 3KUDA 4HATA 5J2UB 3FPKA 4HLUA 4KIGA 1D2MA 4LZNA 3ZGNA 3AR4A 5CTJA 3DVRX 5IVHA 3KETA 1SBNE 1U8TA 2E1PA 1QYDA 1KJWA 2AVNA 2FJ0A 3UC5A 1UEXC 5GIOE 2AX3A 3LHKA 3TUZC 4ZK2A 2GKOA 3ZV3A 5HQTA 5JQGA 1T8UA 4BNZA 2AI3A 2H16A 2ZZKA 5JADA 1GUYA 2BCJQ 2CJPA 3HU3A 2Q4EA 3OZCA 4D9CA 1GLNA 2R4UA 4ZAWA 1YNSA 3IKMB 5GONB 3OLWA 2AZXA 2VYND 2I1VB 2O07A 1QONA 2QRZA 3IKJA 1QGUA 3UATA 1XB2A 1AQIA 4BASA 2QG6A 1D2NA 1JA0A 1Z16A 3A3YA 4N9WA 2R8RA 4V38A 3TW8B 1EDBA 1AGYA 2PMKA 3L40A 4D4GA 5AD1A 4RHUA 1VIVA 1TJ5A 4RMJA 4YAGA 2PBLA 4XWKA 2AF4C 1N4AA 1OROA 5B55A 1SXJC 3VAYA 2BDUA 5AHWA 3VDQA 2WVAA 3G59A 2P91A 3ZWKA 2RHCA 3HDJA 1N1DA 3IDOA 4PCAA 4K3VA 4PS0A 1I7NA 2BSXA 4NDNE 1U0OC 5CLQA 3I9MA 4FW9A 4QKQA 4I5IA 4KTTE 2A14A 2QUJA 3SU8A 4LJ4A 3TOCA 3GYBA 3ZI7A 1CY1A 4AZSA 3TGLA 2PU7A 3T5CA 5LZ9A 2QD5A 1YZUA 1HEUA 3EZ6A 4P8RA 3GWGA 1DJNA 4PIVA 1VJRA 2M6KA 2FFAA 1L7DA 2HA5A 3LUBA 3EFBA 3TR0A 1NJ6A 3K0AA 3V00A 4DHEA 1OY1A 3MLAA 1N1GA 3AL3A 3EMBA 4NVRA 3WOVA 5K1ZA 3ZV5A 4DBLE 3IA2A 5LUBA 1N1MA 4PYQA 4MDFA 2NM0A 4IDHA 2H7XA 1T5LA 3QVKA 3U9LA 2ZT8A 4BNMA 2XODA 1JLRA 4KYUA 1TKAA 1XG5A 4C4AA 1BVYF 1RQRA 1DARA 5BMVA 1U0EA 3HBAA 1K98A 3VHQA 5LQNA 3TM4A 2QTCA 1NRWA 1NXOA 3F8TA 4G09A 2PUDA 2ZCJA 3DFIA 4B47A 2WHXA 4OJKA 5EPUA 1SD5A 3I5XA 5TPWB 1J5PA 3AJDA 4JJKA 2I8CA 5KCZA 5TS3A 3WMWA 4D3FA 2J9ZB 1SXGA 1YK0A 2VWHA 5T41A 5COBA 2KI5A 5GAJA 1KR2A 5BYAA 1AZWA 2R6JA 1Q11A 1N5RA 3NCTA 4PRKA 1RXIA 1Z4JA 2IY8A 5LU9A 2C03A 3QBJA 2HPVA 3BILA 3OP1A 3R5JA 4BLPA 2II6A 4TKZA 3INTA 1JFTA 1WBBA 3G3EA 5TQ2A 1TYAE 1IBSA 4BMNA 4GL2A 1O4VA 2Z08A 4J2HA 1H1DA 3KSDO 5CGQB 1CYEA 4TV9F 2J3JA 4RO0A 1W0KA 1M1NB 2BGTA 3VTFA 4ZJZA 4RDIA 1CEXA 4ZOLB 4G67A 1E8DA 3L7DA 4OSEA 1I3MA 2MDTA 3KUUA 5HQJA 1NKVA 3CURA 4A4DA 3ABOB 1RRFA 2FK7A 1RHQA 5LMZA 4X45A 4FFPA 3THOA 2IZ1A 2PUHA 1M1ZA 1WS6A 5LD2C 1QHNA 4RTKA 2C1EA 3V2HA 1RZRA 4O8CA 3OTQA 2HHCA 3L05A 4DLRA 1I24A 3G49A 2VS1A 2DULA 3C7DB 3IP5A 1K89A 1BXGA 2FPXA 2X76A 3COZA 3F5FA 4H7HA 1Y4ZA 1AE1A 2Z2KA 5KSWB 3C6QA 4OG2A 3VAAA 2QTWB 2ILTA 3L1IA 4MPRA 2NQ2C 3OFNA 3GLRA 5JS1A 2NUAA 4FIZA 4J94A 2H0QA 4JP2A 3ZDYB 3B60A 4TTIA 2Q1YA 4P2BA 4RDXA 5JAZA 2DPMA 5JJLA 4G9BA 5KOHB 4PZLA 3O2JA 1CQJA 1VXRA 1UKZA 5JSFA 4DJ5X 4RVGA 2WSIA 4YR9A 5SV2A 3N75A 2SKCA 4FHCA 4AW9A 2QMHA 2PJZA 3F67A 5KI6A 2XBMA 3ZHQA 3KJFA 2ISCA 2B30A 1I5OA 2PWPA 2FOLA 1IMOA 1CV2A 2B6HA 2H63A 2ZRIA 3PFBA 2Q50A 2XDYA 1V4NA 5IBCA 5C46F 3LBYA 1VKNA 4QFBA 3S44A 1CZLA 1N4DA 4GR5A 4L9WA 5DYWA 5JMWA 5D1NA 2WWFA 4Q4AB 4YRNA 1HC7A 2ZEJA 2C9DA 4Z9FA 1J6UA 1UKBA 3FDXA 1L5YA 3DLHA 3NKVA 2ATVA 4JL8A 5FD8A 4FTWA 2VAXA 2X6QA 3U4QB 3V4VB 1D2CA 4IHJF 1TYDE 4UM9D 1SC1A 5B7NA 2P65A 3EXHC 1OBVA 5C1OA 3MRSA 4RQBA 1QV9A 1VYUA 2RH9B 3R4VA 2FEKA 2NT4A 2ZYSA 2ADOA 1JBQA 1E9DA 3FUUA 4WCFB 3GAMA 1DRUA 3WL6A 3OPYB 2HFJA 3GCWA 1TCVA 3VOTA 4GRDA 3W8RA 4Z49A 1V2GA 1PG2A 2V9CA 2Q5IA 3T7RA 2DE0X 2AI2A 5K99A 1E79A 1T36B 2D0IA 5LDGA 3ZVLA 2OXFA 4PC2A 3UGQA 1PKEA 3JQBC 4AMBA 3LP5A 2XJ4A 1ZUNA 4IJ5A 1U8AA 3TSCA 2BM9A 2DFPA 3CCBA 4CMHA 4J03A 4AYXA 3ICPA 3NAQA 2G63A 1C50A 2OAP1 2VSNA 1TYBE 4OAOA 5FPYA 1KGSA 2AR7A 2IIQA 4B7XA 2QN2A 3RRMA 2OHVA 3VV3A 1EK5A 2ZG6A 1AV7A 2JJ2A 3HEAA 3OU7A 1CLUA 4XFDA 3C74A 2Y27A 1C30A 1RLIA 1WUYA 1U3DA 4L15A 1KH2A 1WDLA 2O8EB 5DV9A 1AQUA 5L3QA 1U4NA 1JNYA 1KMHB 3C8ZA 3R7SA 3TPCA 4HVLA 2MSNA 1KIFA 1ADJA 1XFDA 1IN7A 1WDKA 4GBMA 3STVA 1VIDA 4KLAA 1SVSA 2QUHA 2ZI6A 5I7UA 1CXZA 3AHHA 1RP1A 3AFMA 4O1IA 5F76A 2RGRA 1JJFA 5EZ6B 2P6PA 4K6GA 4OOFA 2Z8ZA 4IIDA 1BHSA 4MRSA 3UA4A 1FSGA 3OJ0A 1GAEO 5EJEA 1NVWQ 1JVNA 3EQ2A 2JF0A 3QWIA 4ZVOA 1KP3A 3R7BA 5B6IA 4XJXA 3C16C 3KZVA 4FBGA 4Q3AA 2R79A 5IH7A 3V1NA 1WLYA 2RH5A 1HUQA 5B7PA 1MQSA 4XIJA 4EFDA 4AECA 3DZFA 4C7BA 1QGOA 6REQA 4HH4A 4C6SA 5LQUA 3VNQA 5LXTB 1JHOA 2A5YB 1I5EA 3NKLA 4I4TA 4DR1B 2N3ZA 1MG0A 3R0XA 3O4VA 4MVXA 1B6RA 3GP5A 4WJLA 5H3HA 3HUDA 3ZX5A 4HOYA 1S2LA 8LDHA 2IV7A 3OC6A 3PX2A 1OZFA 4WDRA 4EHKA 1R16A 1CW2B 2B25A 2PZBA 4PSAA 4UBNA 1P19A 1EUDA 1VQ1A 4LRQA 5E7JA 2DM6A 1IQUA 4R2KA 3OY2A 3L7BA 4HF7A 1I4TD 4LKOA 4R71A 1ONBA 1XQ1A 3G13A 5CLLA 1D4ZA 1EPUA 3BQNB 5DI9A 3ZG6A 3VGJA 4PBSA 1F6WA 1XRNA 1RWQA 1LH0A 1PR6A 2RK4A 3FHOA 3MC1A 4YVFA 7GPBA 4LQCA 5JARA 3F3SA 5C31A 4I9NA 2OEPA 1GFWA 3MWLA 3AKDA 4PZPA 4U9HS 4CCAA 2I4NA 1SNYA 2ZRMA 5ALVA 4BQFA 1JX6A 4EM6A 3WGJA 3RT7A 2J5KA 4EJ6A 1OX5A 2JFFA 2MHCA 2PH1A 3LE8A 3FG9A 4IWYA 5I4IA 3MCWA 5EZ5A 1HE8B 1GUDA 2EL9A 3B5JA 3AGQA 4H59A 1K3UB 5IU6A 5KNDA 4FGUA 3TCNA 1B8OA 2A0FA 5A9SA 5CH8A 5TSDA 4HDQB 4Q39A 1NZFA 1QG4A 3H9JA 4AMVA 1NLUA 2ZPUA 4PG8A 2H5IA 3PL5A 1X2EA 3QWBA 1V1MB 4MPTA 4A1FA 3PX3A 4GR4A 2CLLB 4RGBA 2HRQA 2D3WA 1EXNA 3AETA 3BB3A 3LIIA 4IYRA 4RVFA 5EWMB 1PT7A 4E4YA 3DL7A 4E5KA 1OBCA 1GPJA 1QAOA 3CV3A 2UZ3A 1TJ3A 2YW2A 4H7IA 4INZA 4DF3A 1E2FA 2YNMC 1XDDA 3M5WA 3N28A 5BNTA 3SNHA 1SQGA 3CN9A 4RKFA 4JLJA 5IVDA 2HNKA 4G0PA 2CVQA 2G8NA 3ME5A 4QU8A 3C7KA 3LUHA 1TQ2A 2VNJA 3AFOA 3IQZA 1PW7A 1EBFA 1MAHA 1YE3A 2ODQA 2WT9A 4BVHA 4ZIRB 3OZGA 5AESA 4JGBA 4EQ6A 3O8OA 3Q9LA 3M70A 2GM5A 1LDBA 1NW8A 1TNDA 1NQ5A 1S2IA 3C3EA 3R6WA 4LSMA 5HBGA 3WYGA 5B2FA 3UJNA 4NLLA 3UQYS 1JEEA 3HYCA 3WBBA 2O0MA 4UD2A 3CVYA 1JJAA 1TKBA 3E5RA 3F2IA 3IVXA 3VPSA 4CIDA 2O2HA 1L7NA 1E1DA 2E4AA 3GF4A 4O08A 2F43B 5EJIA 3USCS 4Q48A 1F9EA 1FW8A 3CEPB 4UVGA 1OI7A 4EKNB 3DNMA 1OHHA 2O6HA 1MLDA 1YS9A 1XRRA 2ZWAA 2HU7A 3A6DA 1POXA 1T5IA 3K9GA 3QLUC 3UGTA 4JIGA 2DETA 5F9MA 2JGNA 2YXLA 3H11A 3AWIA 8MHTA 1NVAA 1J70A 4MLZA 5BO5A 1X1BA 1ZRHA 2GYVA 3VR3A 3BPSA 4JSTA 1QS0A 1YKSA 1C3EA 1ISGA 1KVUA 2N75A 4F5DA 1S8NA 2BP7A 4YJ2B 1U81A 1Y9EA 3GG2A 3N8HA 3U7JA 1JBKA 5HIAA 1PEDA 3ASUA 2Y9PB 2I6GA 4YRKA 1IMJA 3VGPA 2IOHA 3HVKA 5GJBA 2YHIA 3P2MA 2H85A 4BZZA 2PPVA 2LCFA 2V6BA 3E3LA 3HR7A 1QOPB 1NBMD 5DMHA 2P3OA 5AQEA 2PANA 2V7PA 4TT3D 4Y2YA 4HT3B 3BIXA 4TS9A 4CLOB 5GONF 3ELYA 5AICA 3O95A 5IMBA 5C0OE 2JJMA 2PGAA 3PPIA 5J1TB 1H0SA 3ZV4A 1KDPA 4K46A 5C53B 4MMXB 4DJEC 3EPKA 3S2UA 3DW3X 5DM2A 1ECCA 3UBMA 3E15A 3TVYA 4ZZ2A 2ZS8A 3IT0A 3QPAA 1O97D 2WAAA 4QFCA 1FX1A 2KLHA 1R10A 2AOTA 1GGMA 1JXMA 2F8MA 5H5JA 1XZ8A 5JY1A 4QBIA 4QEDA 4GEKA 4AKHA 5PGMA 4ROTA 4JJGA 3V6LA 3RYCA 3DZDA 2GVZC 4CTKA 2PO7A 4QL3A 1Y4UA 3T3MB 1AF7A 1V9SA 4IIJB 4KQ1A 5IASA 2V7UA 4HVAA 1E0JA 3NIWA 4ZREA 3AXSA 2A5FA 2R6R1 5BUZA 1PTJC 2Y4NA 4J3NA 3PC2A 1T4MA 1GQOA 5A5GA 2R4QA 5FV7A 1FFSA 3M8KA 3P9ZA 2G77B 1E3WB 3S2YA 4DIBA 1J2JA 3L9WA 4F46A 1CB7A 3LUDA 2LCQA 3FYDA 4KEAA 3N2KA 1QGYA 4ES6A 4PX9A 2A86A 1XZGA 4GYYA 3TI9A 4UUMA 2IZ5A 2V3WA 3CWCA 3DONA 3N70A 4JMPA 4TRMA 1R27A 1JN0A 3CKLA 2GN4A 5MN5A 1VCIA 2J7PD 1OVMA 2H4ZA 3QUSA 3AB3A 2FW6A 3JQ8A 3FR7A 3QFCA 4BFZA 4XLLA 1YZLA 4AZ0A 2QB5A 2Y6UA 2WJHA 4N8DA 1JKXA 2WFLB 2ZIVB 2BFPA 4KWTA 5DU2A 1BH2A 2QJTA 3A2MA 1KSHA 4OH7A 4CKYA 4RFVA 4N5DA 4E5YA 4MOWA 5JO0A 4PFQA 3KHKA 5A6SA 3GA5A 2CVHA 1DJOA 1FNBA 1KI7A 2Z56A 2ECOA 4B3DA 1U90A 2J6CA 4GSYA 2WYHA 2LUOA 3EJ6A 3OIUA 1YDHA 2IODA 3OEHA 1SWVA 5K0SA 1R8JA 3SYNA 2JGDB 3RADC 2G1JA 2VJMA 3ET4A 2HY7A 2AXEA 2JHAA 3MEQA 3QKWA 4BAZA 2RI0A 4EJMA 4NYIQ 3U7GA 4LBZA 4HQFA 1XMVA 3TRFA 2ZBGA 4I4CA 4UM7A 2ZOSA 1QFSA 2UZ0A 2Y8EA 4PTLA 1KJZA 4LJ8A 4BQNA 3IXQA 4IDEA 5G40A 3K1JA 3ESQA 4QUHA 1VGRA 4RK7A 2V59A 3BCSA 1A50B 1K5PA 1ZVJA 2CC2A 4E5UA 4BWVA 1Q21A 1V3TA 1P7VA 1H23A 1Q44A 1TQDA 2QDKA 3KJNA 2IE0A 4WFIA 1CS4C 1XJ0A 4ZOLF 3B3QA 2JIPA 2HFKA 4TUYB 3W5VA 3HVRA 3AVOA 4JUCA 3D8TA 4FT2A 2R65A 2D5LA 2RBGA 2QN6A 2X58A 3RSHA 3DF7A 4AMZA 3CH6A 1ZGAA 1P2DA 3GEDA 3F3KA 3WHIA 5KSZA 1Z4MA 2RGWA 4F45A 3UB3A 3IHWA 3FCOA 1AS2A 2OBLA 5C5EA 3KUKA 5LA6F 2DFNA 1A5ZA 3SR3A 1Q74A 1QNLA 4HXYA 2CL0X 4UEOA 3P5SA 1N34B 4OK6A 4DL9A 3QFHA 2GJKA 5KWIA 3R74A 3R5KA 2J6HA 2OG2A 4AY3A 1XCPA 1PVOA 4ENQA 1LNZA 3PKIA 1V4VA 4L08A 3JQQA 4U7DA 3QVVA 4ER7A 3THXA 3NJRA 3VC3A 3JXEA 2QUIA 1OC2A 1R64A 1NNEA 1EQ2A 4V3CA 1AA6A 3MMXA 4RJKA 1K08A 4BPBA 2IYLD 4DGQA 1DO0A 3HYNA 4MRPA 1JDTA 3D3EA 1YA8A 5KHOC 2PKRA 2I5PO 4AZWA 3KCNA 5GV7A 2O7NA 2GAFA 4KQFA 4X6LA 4DCJA 4TKLA 1NMSA 4MVJE 4O2BA 3R3XA 4AL4A 4CEJA 4IVNA 4DCSA 1QVAA 1VG8A 1XVTA 4OIMA 4OM8A 3ROGA 3AVTA 1JT9A 2TECE 2DU8A 3OM8A 2QS9A 2X7XA 5ABPA 3AMVA 3QE9Y 3ZD7A 3SYMA 5IAJA 5HILA 1GLVA 4JX9A 4RIGA 1T0PA 4JKYA 3FWKA 4EUFA 1GQQA 2CJYA 3H2BA 4HZUB 3USZA 1RZ3A 1QNFA 1N9KA 3H42B 4PG4A 2JLUA 3UAGA 3IT1A 2FPGB 3U60B 2OL4A 4BNJA 2GF9A 1JJVA 4LK2A 2IP1A 3QXCA 4YRAA 3JQGB 2DWUA 1T4DA 1I4OA 3O26A 4MGHA 1URPA 1M2FA 1P2FA 4KNVA 4LTMA 4XEUA 3ZJYA 4ME6A 4Z5XA 5LZ2A 3SR4A 1GZHB 1FP4B 1ZGHA 1ZOIA 1ZSYA 2CXXA 2XB4A 4PF1A 4TTJA 4RA9B 4ZO7A 3LXUX 1T6BY 3KRTA 1AUOA 4PLHA 3PUJA 1CUEA 1O9BA 4JLAA 4W5QA 4C6HA 1TM2A 1FP1D 2Y1OA 1KEVA 5AJWA 4F4DA 1AGPA 1BYUA 1RZVA 3M6VA 3QOFA 4JZYA 3S68A 2VRNA 3JVDA 5K3FB 4R98A 3VR5D 2AWNA 3L18A 3AIOA 4P32A 3G8CA 3RVLA 4I50A 5JD3A 4DR2B 3OETA 5D01A 3TUIC 5BNIA 2X1VA 1SXJA 1W75A 3BGVA 3LLSA 4G9GA 1FMLA 4KRXA 4B3GA 1DIAA 3PHHA 1WY7A 3TR6A 5EHGA 3V4SA 3OMLA 2IHUA 1XA0A 4K9SA 3CLTD 3KQTA 1ZJ4A 5KYUA 3ZUGA 2FFQA 2PUAA 2NZJA 1JHZA 1UDAA 2PUVA 2Q4BA 1J8VA 1ADGA 4C05A 3CFYA 3DOUA 4HWPA 5B2ZA 1TMKA 4PCVA 1E9AA 1VKRA 3FDZB 3UH0A 1ZUIA 1SQSA 2C2HA 4EA9A 2KQUA 3C6BA 1PD1A 3EC7A 4DEXA 1DBIA 1PSWA 4CR7A 1UXIA 3NB0A 4MDYA 2DSTA 4PNHA 2YQ4A 1EGQA 1UOPA 2YH2A 3H75A 1IEWA 1Y8RA 3MTBA 3ZHRA 4B2IA 3PVZA 4RHEA 4IPTA 4LBYA 3RRJA 2CLIB 3AHJA 4KAJA 1ZKDA 1M75A 4ALJA 3VPCA 3MWEB 1TMOA 3JYNA 4D3DA 5DTMA 2WK1A 3O9MA 4LXQA 4MQ4A 1XNJA 2QZJA 2W6IA 4XSVA 2JFUA 1HDEA 3HP4A 2WP8J 1AQLA 3PRYA 1OFIA 1YQQA 3QNUA 3G2LA 4LEIA 3TINA 3DA8A 4MWOA 1WL8A 1G20B 4H08A 3SBEA 4N3AA 3LG2A 3IP3A 4XJVA 4U7JA 3QVUA 2J3IA 3EARA 2RHWA 5TMDA 2XB8A 1P72A 3FPHA 1LV7A 2FZCA 1XYGA 5GM1A 5F3DA 3KKNA 3UNXA 4OHVA 4RF2A 5TEWA 2HREA 1XRPA 3G5LA 3I2GA 1IC6A 1WB6A 2E21A 3TL6A 2ZQ5A 1QFZA 4LFAB 4IWXA 3BH7A 5ENDA 4F97A 2ZUEA 1V41E 3AOGA 2HCTA 2QN1A 3EVDA 4ZYYA 5C2JB 3MPUA 2OCLA 1C9NA 4ZPXA 2NW6A 3W3AH 3DFFA 3WTCA 3WL4A 2XCOA 3OZSA 4KL8S 3VX4A 3QE2A 4L8LA 4DW8A 1HYBA 1VPTA 2RHBA 3RGWS 4ZN6A 2SKEA 3MCVA 4KJZA 1Q5PA 3RS4A 4LYAA 1FMJA 4C01A 3M1AA 1PJCA 1LDEA 4UARA 3T3HA 3RVNA 2Q0SA 3UHAA 1K7CA 4MGKR 1OI4A 3SLKA 4BBAA 2BHTA 2ENWA 3KPJA 4DCUA 4A8PA 1VPVA 1UIMA 3KBBA 7MDHA 3H05A 4B7AA 4W5JA 2XNKA 4Q4LA 1FYFA 4M7RA 3ETEA 2IPXA 2P5SA 4HWSA 4C5CA 1E2NA 4GWLA 3DS8A 5JZVA 2DPHA 1OXBB 4G1UC 2OHGA 4XYMA 1NXTA 4X7MA 1G98A 1WUIS 2V7GA 4GOND 4MRNA 4F3NA 3BVPA 3EXEA 2GD2A 3KOUA 4EVRA 5C18A 5DX0A 4HMQA 4C4YA 4F91B 5CIYA 2UUBB 2H5LA 1KHTA 3HCFA 1PIWA 1Z47A 1BS2A 1M1YB 1X7DA 2DZDA 2PBRA 2X8JB 3BA1A 3FGPA 3R44A 4OOEA 3WFZA 3NBFA 3KELA 2IU0A 3S2FA 4NDAA 3HUTA 1FTYA 1XMIA 1YV9A 5KAPA 4CM3A 1TVKA 4JT2A 4NOLA 3ND8A 3VUFA 4EEZA 1HE1C 1OI2A 1W1WA 4NARA 1PJ8A 3Q7QA 3WLKX 5J5VA 3VOSA 5ER9A 2ARKA 2PT7A 3ET5A 4UCQA 3KZMA 1ICIA 1BNCA 4KH0A 3IALA 3VSAA 4K9PA 4BP3A 4NJOA 1M76A 3RS8A 5J4HA 2PK3A 1V7PC 5DN6A 1VCHA 2H4HA 2DMRA 1MV5A 3IOCA 1JAYA 1I2ZA 3OZRA 1J0XO 3C5WP 4UMDA 1NYQA 1WR8A 5B7GA 3R6DA 2R4TA 3AIMA 4BCBA 3HSYA 5DIZA 4QPJC 4YCSA 3EXHA 2VP9A 2EFJA 3BORA 2OORC 3LQ2A 5ALNA 1PUJA 3UV6A 4BNGA 1BIFA 5I3CA 4UCFA 5LL6P 1YH3A 2FMXA 1GNVA 2XRFA 3BKWA 5H4HA 2GKSA 2CV1A 4G4IA 4AJHA 3N3BC 5LZ7A 3DTNA 2VP5A 2WIFA 2RAFA 2WJ6A 2DWOA 1MX9A 2ZBPA 4YX9A 1XDUA 2JCBA 4PM4A 2RKBA 2CCKA 4ZQGA 3JQBA 2XXJA 2OP1A 3GFGA 4UHFA 2VJAA 5EIHA 3F3YA 4RM3A 3IEUA 4M8LA 4D82A 3NC1C 4K9KA 3QG5A 3REOA 2CL7X 5KNLA 1MGPA 4HAOA 1PDVA 1V48A 2HMVA 4K87A 1PJ3A 2PFGA 3U39A 3DE1X 4AF6A 3BB4A 5E3IA 3IPCA 4G1CA 5AXBA 3L6DA 2BN4A 4P53A 4RV4A 4DVGA 5B64A 1UOQA 5TJ9A 3MOGA 4IHKA 1ESNA 2Y93A 3GIWA 3WNDA 3LDAA 4NZOA 3D6MA 3TTUA 4NI5A 2ECKA 3FI9A 1DTWA 3K4QA 3DKPA 2XPCA 1FK8A 2DT8A 2EEZA 3FBTA 3DW1X 3X43A 1JILA 3ZNQA 2HF7A 4E4RA 1RXSA 3SE0A 2QROA 2YJZA 4TN1A 4U2DA 5JPDA 1TXGA 2GPYA 3AR9A 3IVRA 1TA9A 3W77A 4BNVA 3GMIA 4EI2A 3U1TA 4ND6A 3FPJA 2VHTA 4IIJF 3WJ2A 1PGOA 2QV0A 5TQ0B 1GYRA 4PNZA 2CNNA 3P1JA 1WVMA 4E7OA 3AFGA 3C24A 3UMRA 1Q1QA 2W6CX 2OGZA 1FFXA 3E82A 3H9QA 4P7BA 2X0FA 5LJLA 2FUEA 4XRRA 3T5MA 2IUTA 4GYKA 4S35A 3B89A 3WQHA 2Q6IA 2BBSA 8ATCA 1V47A 1Z6AA 2JATA 5JMOA 2XCSB 1O0SA 2LPMA 2VN8A 3NC0C 4Q12A 3R41A 1N2CB 3MPOA 2WE8A 1F7VA 1TT5B 2YXBA 2D2FA 3MOSA 1SQ6A 3UENA 4LGYA 2A9RA 5J2TA 3DVLA 2VCYA 2OFWA 4WAUA 1IPFA 4QLBA 3RUAA 3IUEA 3NDJA 5AYVA 4B7ZA 3ZGVA 3U3DA 2R6CA 1XUOA 2VUSA 1F1JA 1KZ4A 1L4MA 2QVYX 4KAAA 1MHTA 1GGFA 4YXFA 3ASYA 1KQ3A 2XYRA 3OT5A 3IILA 4CTMA 3LT2A 2C8JA 3A2NA 3PPWA 2W83A 1FOEB 4I55A 4YIHA 4CM1A 5A3RA 1OXXK 1X7YB 4WVFA 4B7UA 5HNKA 3RFUA 1FTGA 1G5IA 2Q62A 4Z6KA 1H5QA 1ENOA 2WM2A 1YTUA 1V7QA 4WLVA 2PXCA 1NONA 4RVSA 1LK5A 1L4BA 3TKYA 2OOKA 3HYSA 4TS3A 4D8VA 5DBIA 1W87A 3BMCA 3GVCA 4DABA 1NVXQ 2DR2A 2AN5A 4XLTA 3SY8A 1MAVA 1DG9A 2UUAB 3LUCA 1H0RA 2FRVA 2E18A 2EU8A 3I9OA 4OEHA 5AO9A 1U0NA 1UKAA 4FXOA 1P2UA 4ZT4A 2O0KA 3L93A 3TLBA 5CBKA 5IF3A 4JBGA 3DJFA 1I6MA 2DKFA 2HOQA 3K15A 3Q3IA 4GOLD 5EZQA 4L78A 4AJPA 3L6UA 1X77A 2FW0A 2IZ0A 1T9CA 3PV0A 4TUYF 4DSOA 2MINA 4DRYA 4EG7A 5IT9A 3B1WA 4MUJA 1SRRA 2BEKA 2ES4A 3SHFA 3DEFA 3K7EA 3E23A 7YASA 4O2RA 3C5EA 4X1YB 2YNMA 2IUEA 4I1VA 4URVR 5KWJA 1Y3AA 4MLPA 4Q1FA 5AVQA 1N0UA 3ECSA 3Q85A 4M9XA 2P9BA 3EF0A 3ZHOA 3MN1A 1ADCA 1NE7A 4OPMA 4WCDA 3RUHA 2YWGA 4UTRA 2QPAA 3CNHA 2PVSA 3VYRB 1KQNA 5L9AA 3RO7A 2W58A 4R1MA 5KNCH 2PV7A 3FROA 3CX6A 3JZDA 1ZFNA 4XX0A 3ETCA 1JW9B 1KMNA 2GJ8A 5JAUA 1O96A 4TKUA 2BZGA 1KY2A 2HF2A 5D2CA 1JDBC 1SKAA 1CIJA 2VRWA 2XWQA 2H3EA 1SCKA 2JGIA 2WILA 3Q7SA 1JTFA 3V8QA 2Y2VA 2B0CA 4AY4A 3UKDA 3IDZA 1M34A 5ALOA 5FDFA 5LMUB 3PYMA 3WYAA 3QLJA 3GD5A 3VR6A 3WO0A 1W9HA 2IQIA 3D8UA 3DAPA 3S1AB 2JJYA 5KYVA 3IVGA 3QLUA 1RM0A 2HYDA 5KVQA 1AXRA 2FWNA 3KLMX 3KC2A 3IMKA 3MSCA 2VG8A 2VXOA 2IXAA 4OGWA 1BVHA 3CN7A 4X20B 3QFFA 5DHRA 5ESXA 3URMA 2C1XA 4MUFA 4OQ4A 4BEBA 2XQIA 3W4KA 3OVMA 3P2JA 5C32A 4PG7A 2B82A 2ZBVA 4ARCA 3M6IA 2QQ0A 3LW8A 1R66A 4MKFA 2OCPA 4ZJUA 3RSCA 1ATZA 2FRXA 3H1BA 4EHIA 1C9EA 1QP8A 3C3AA 3KKKA 4ZDKA 5LLTA 1CEEA 3R5HA 1VJDA 2DSNA 5HUQA 4CT5A 3RVPA 2J9FB 1OXTA 1F5NA 4FFBB 6ABPA 2Y0DA 2RGBA 3FSEA 4LMBA 3ROPA 1IVYA 4GLJA 2QTRA 1SM4A 3KPYA 2OHFA 3N3AC 4KJXA 1VJ0A 1O87A 1CJSA 3VQTA 1MW8X 2ZJ7A 1QE3A 3IIIA 1WD7A 2R85A 4LV6A 1KYVA 2AE1A 3BJMA 2NMVA 1NGSA 4DCMA 4ETNA 4Z8XA 5DOZA 3Q0IA 4FOLA 5G4LA 3HXLA 2FFHA 2QTHA 3LGAA 4MQFB 1QFJA 3HY6A 2XUQA 2ZSBA 2G9UA 4D8WA 4MH0R 2J3LA 4RTSA 4Z9AA 1T8TA 3J81A 1V7CA 1QQ7A 4LWQA 3O8QB 4NCBA 1INLA 4BLUA 2V0GA 4PQRA 4M1MA 4FVTA 1MQ9A 5J2UA 1AUPA 3NHPA 4RJ2A 2FUCA 8ABPA 2X4GA 1A9TA 2CHQA 1K97A 2WSSA 2P2NA 4I9UA 1T3ZA 2O8VA 5AXAA 4CR6A 3BWYA 5EHNA 1PTJA 1GY8A 2QQFA 4C89A 1PEAA 3LDGA 4LYDA 5E3JA 2XH8A 4ZCSA 3O74A 3TRIA 2ETVA 3PE4A 3BIJA 2JLRA 3KB1A 3QU9A 3SFTA 4BJ5A 3I58A 5B12A 1J2RA 1ZN7A 1E2EA 2E4UA 3G82C 3R3JA 3C3PA 2PTGA 4RYDA 4BUJA 3HR4A 1QORA 2D0OB 2YJTD 5HCIA 1LWNA 3VU9A 2O8DB 3TD6A 4FK8A 1XCLA 4J91A 4X6UA 3ER6A 4Y9TA 5FWYB 3ZY2A 2BISA 1P9NA 3T7TA 3OCYA 4Z53A 4OP2A 2IFTA 4BVAA 4Z3OA 4ON9A 1EB8A 4CKBB 3CLRD 1CY6A 3D54D 3OIWA 1G6KA 2XLCA 4G0XA 4EWLA 3GJ4A 1JQLB 3TBFA 3K92A 1CF4A 1MJGM 2I4RA 4TQ9A 1RNLA 1Z2NX 4IIVA 1WHSA 2JIOA 2B78A 4RIEA 3LKZA 4ZZIA 1J5XA 2JRLA 3IPYA 3FUXA 3MD9A 5HMLA 4NV1A 3GBPA 3L6RA 1U98A 2PH3A 2Y66A 5LBTA 3VPHA 4BX2A 2YFYA 3ENVA 1OIVA 3ID6C 4ZQEA 1DCTA 2XNHA 4GZ6A 4M0FA 3KSZO 3G02A 4FLMA 2X9LA 5HGJA 3R75A 5ALXA 1N5JA 4Z4CA 1I94B 4B31A 1GPNA 4PX2A 1CULC 2LNDA 1P5ZB 3GVHA 4H35A 3T0IA 3IKLA 5IAEA 5GZ1A 3FXAA 1SOVA 2I76A 3QXJA 3KQYA 5AVRA 5HG0A 2D7DA 2DP4E 2IYVA 1EM8A 3WYEA 3CF6R 4B6FA 3ZBQA 1PT5A 1Z0AA 4BEVA 5L3RA 1DJQA 4RORA 4J4TA 2ERCA 4HYEA 3TS1A 2G7MC 4PTYA 3PRJA 1NDHA 1FDVA 3BEDA 1G7CA 4RKWA 5KBYA 4B84A 4B8YA 4DLXA 5LP6F 3EPJA 4YJGB 3I23A 2F8SA 2VHUA 3BH6A 3RQIA 2J3DA 3EHDA 3VBCA 1X7XB 3USES 1Y7HA 4R2IA 2I6FA 5EL0A 2A8YA 4GX0A 1VPWA 4JOSA 1UM9B 4OI4A 4Y0AA 5FEMA 5JZSA 1Y1KE 2JZCA 2YZ7A 2ZTUA 3RKUA 1NP7A 4D46A 2Q1TA 1FNDA 4J2OA 4ZGWA 4M49A 5E7IA 1ZH8A 2UXCB 1LC3A 3F97A 4TSFA 4L4YA 3UOWA 4J90A 1EYZA 3N8KA 2FI1A 4GGMX 5BV0A 3OECA 5JSZA 1N3IA 2PLFA 4V2UA 2TYSB 3UFXB 5EJ7A 2XBLA 3ONDA 1U2QA 5BWBA 4I5DA 2G28A 1N3LA 3BMQB 3PC6A 1N8TA 2ILVA 3RSOA 4E5NA 2EQAA 1T8YA 3L4SO 4PCLA 5A4IS 1CUUA 3DMTC 4KE9A 4DCOA 3LTEA 1SXPA 4FILA 4E88A 3MCUA 1TM5E 3A10A 5DM4A 3SLGA 1H2WA 3IEMA 3VKWA 4FN5A 3PB3A 4CLDA 4HLCA 3OWXA 4NK5A 4DUGD 1UODA 2E3JA 4DMKA 1TMGE 4M1KA 3K0SA 4XWYA 1MDFA 2YY5A 4L5IA 2QTZA 4Z8YA 3LDUA 3HNRA 4EB3A 5ETJA 1E2LA 4LQ4A 3B6JA 4GKJB 4R83A 5KX5A 4EMTA 3ANSA 1UWLA 3HH8A 3O93A 4CMBA 2Z6AA 1NUTA 1WPXA 3A6LA 2YV5A 2IH5A 2ZRAA 3D4IA 1HDYA 1FUUA 3HZRA 2O2EA 5F12A 2AG0A 1CIPA 1E96A 1TD1A 1QB7A 1UFOA 2FPWA 4AB1A 4AMGA 4LRXA 4YO8A 5FFNA 4FMCB 3DZGA 3ENKA 5JYBA 4S04A 4HO1X 3OAAA 4MI3A 3RAFC 1X2BA 3R0VA 1NMYA 4CQJA 4PHHA 4B33A 3Q72A 4KW7A 3O1HB 4QUDA 5EJAA 3ZU2A 5DFAA 2ACVA 2O5EA 1K5GA 1QVZA 1TIKA 2VF5X 3UPTA 1F0NA 3WKAA 1AC5A 2UV8A 3I3SR 1XHFA 3P9XA 3QVMA 1S6YA 1XQXA 3GMTA 4P33A 4DM7A 1NTOA 2B1GA 4GBED 3I9V6 3SEQA 3G8YA 2ZJBA 2H1RA 2OAQ1 3UK7A 1A2QA 1D9XA 4ZC1A 2YWCA 4J8PA 2ASEA 2ZSFA 3O5AA 5FUXA 3S2GA 3HU2A 3DXXA 3UB4A 1XLUA 3ND6A 1NKTA 5FTKA 1RYFA 2YL2A 4G1FA 5IJ9A 4MW4A 2Q8PA 4RX1A 1LK7A 5JFOA 1F2TB 2BFBA 1EWKA 4XWWA 1UBFA 3QZUA 3D7LA 2M1XA 1P1BA 2P9CA 4LW8A 4TYYA 4YUZA 1X94A 2B4KA 3PP8A 3VH1A 2QE6A 3ER8A 4WOCA 2YN0A 3OA2A 3BAFA 1ZRSA 2X4IA 1KKUA 2CYBA 2XEXA 1JEJA 3A27A 3LYHA 4FMDB 3WNZA 4NK4A 5EMNA 5KTMA 2N0SA 3MS4A 4WCFA 4UNIA 1IZ0A 1H1LB 1GU7A 4P4GA 2I4IA 4C08A 1PR1A 4MW7A 2V6GA 5EJ6A 2Z4SA 1T91A 3LHFA 1YC2A 4DPKA 2JKYA 5BWCA 2GD1O 1YR6A 2BH9A 4FDUA 1TEHA 2PZAA 1NYTA 1XQVA 3EY4A 4L5YA 4NAVA 2A7QA 1XKTA 4URYR 4ID3A 3VR1A 1SO8A 4P34A 3F8WA 4NBVA 4DZZA 1HT1E 3D3WB 2Q2OA 1TAQA 3P2EA 4ZVLA 4EA7A 5EXSA 1AH2A 2BGNA 5FAKA 1QH1A 4KR9A 3DP9A 3EASA 3UIEA 4Y18A 4KPYA 4FZJA 3LFTA 3DMPA 4E0BA 3N2LA 3B2EA 1BHO1 1K86A 5IJWA 5A4FS 1Z2CA 2CZQA 3JQPA 3PD7A 4ASUD 1ZCJA 3JYHA 4JBNA 1PQ4A 2OO3A 2QGFA 1X1CA 3MTEA 3AI1A 3CEMA 4I8XA 1OGIA 4WBSA 2NZVG 5KYYB 2NQTA 2OTCA 2O8EA 1Z4PX 1KVSA 3EOZA 3RHZA 3KEFA 3GGJA 1ZNQO 2R97A 3B1VA 2CKMA 5AXDA 1HDOA 4CQLB 5EHIA 1Y5MA 3AIKA 3RAPR 4X3CA 1AS3A 2O0HA 5LIRA 1ZESA 3EZ7A 2G5PA 1G63A 3BXEA 3DR3A 1C5KA 3WRVA 5K6RA 3ZJVA 2JIZD 2QP9X 1GFSA 2R2AA 5CXXA 3ZNOA 1KVQA 1H2HA 1EHCA 1YR2A 2BEVB 3JZIA 4AWXA 3IOBA 1CJCA 3MRTA 4GAEA 4TS1A 3HN6A 4UFNA 2VUTA 1VMEA 1W9MA 3DE6X 3C3XA 2ZROA 3DEZA 3EWNA 4ZYZA 2HEGA 2VZEA 1Z63A 3D81A 1TGVA 3AFHA 4O5AA 2CFSA 4NZYA 4DB4A 1JEAA 1XNQB 3ETDA 1UCFA 2JHPA 4J7CA 4KQWA 3TX2A 1FQKA 4LZWA 4AKTA 3DFMA 4CT4B 5A9RA 1YCDA 1EK1A 2VRCD 4E6PA 5FT9A 1ESMA 5JDCC 2WR8A 3I5AA 3C5CA 4D6YA 4YJHB 3BIWA 1HKUA 4TVSA 2P9FA 4MUGA 1ISHA 3DHNA 5DP1A 1W36C 2VJPA 3TMAA 1IATA 3CF4G 4HB3A 3HFGA 4U63A 3DBLB 1WSDA 1L4UA 3EXIB 4FZVA 4ZCPA 3ED1A 4A5SA 3BGIA 5EG5A 3UJ9A 3BXOA 1M1UA 1U4SA 3EC1A 1CKEA 4WNCA 3H9EO 4MULA 5J58A 2C3MA 1RE1A 5ALIA 1BQ3A 5EE9A 1HNXB 2P11A 2OBXA 5U9CA 5C1IA 4IL5A 4K5QA 4F1WA 2JJ1A 2GBFA 1J56A 3VPFA 3TG2A 1MEJA 3HI6A 4KO2S 4NEGA 1QE0A 3E8MA 3M49A 4YLEA 3S5UA 3O84A 3SSAA 4UNRA 1ENZA 5I7WA 1S4QA 5LZ4A 5BT8A 3B38A 5KYXA 1A0OA 3KUCA 3ROQA 3RUIA 2O4UX 2FZVA 5EVCA 1PX0A 4YRIA 4LXGA 2CHVA 1R4NB 4G5FA 4UVIA 1JSZA 1SB8A 2ZSJA 2Y1FA 3AEZA 1U5CA 2VWGA 1AKTA 1J0BA 4BN4A 5C5DA 5KJCA 2OPBA 2G07A 1NSYA 5IANA 1J9ZA 3HFJA 1V1MA 4QGSA 2BHSA 2VIIA 1AMUA 3Q88A 3T3OA 1I3KA 2D62A 2P0EA 2DHQA 4B32A 5FQOA 3EEOA 1M2WA 1MJ5A 2D13A 1CP3A 4LPKA 1Y4AE 4R9SA 5CVEA 1ZBDA 5I9BA 1PS8A 2CSXA 4HZGA 4L6CA 2FPRA 1KI6A 2IUYA 3VX3A 1RXUA 3UHPA 3OM9A 3B13B 1TTPB 2OORA 3RTBA 5KNBA 3BJEA 4JJ4A 1XZLA 1EFUA 2KS6A 1FYDA 1U9CA 1EX6A 4INAA 4M0MA 2G9VA 5FKJA 1EEXB 2HRCA 2NXJA 1UC8A 1KU0A 2ZT7A 2Y1LA 5LZ5A 1RMTA 1WABA 2BM0A 2WSMA 4J07A 5DNEA 3NT4A 3GLHB 3N59A 1JDJA 3IJRA 1SZCA 4KCGA 2YX1A 1E7QA 3A1SA 3CLHA 4JYPA 2HWXA 2W6QA 4RA6B 4C2BA 4DG9A 4QQ8A 5E1DA 3WQQA 2CK3A 2O8FB 1GQ2A 1QWOA 3F78A 4YJKA 4Q7QA 4BVJA 5K6AA 4GICA 5G3ZA 5GTDA 4M7PA 4M1TA 4TKVB 5LNK6 1M8PA 3BQ9A 4ZVVA 4M8IA 2R6AA 3QPWA 3WMGA 5EIWA 3QX9A 4EDFA 4MK4A 3MRVA 2JFYA 5IS2A 2DGDA 1ODIA 1BJTA 3A3NA 4I50F 5BOSB 4GI1A 4WV3A 5I4KA 1QH8B 2C7RA 5CRIA 2VQEB 3WGVA 2OBMA 4GX5A 1RYHA 4QUGA 3EC2A 3M6XA 3OZBA 2QYTA 2EZ8A 2B1IA 2FE4A 3JQRA 2BSAA 1CVIA 1XD8A 2FV8A 2NSDA 3NM5A 4JBWA 2CMGA 1T2NA 3A8TA 2WZQA 1Y5IA 4KI0A 5FBHA 1R8QA 4ND4A 6ADHA 2E6KA 1J9EA 1GTL1 1I80A 1G17A 2HH9A 2PZGA 3DWGA 3ECCA 3KV1A 3PUWA 1QCCA 3R0QA 4JP5A 4NZ9A 2PD6A 5JE8A 3SEZA 1FBNA 1L5QA 4E1AA 3A0UA 3MJFA 4P82A 4F4FA 3OIYA 1FPMA 1C4XA 2RI1A 5GJWC 3IIMA 2WJIA 2NU8B 3M82A 2EL7A 3MJDA 1JMVA 2GVNA 4V0ME 1OWMA 4N5MA 3I9V1 1UT8A 2ADMA 4UXIA 4XYGA 3AHIA 3MSXA 3BWEA 4EG8A 4CQMA 3HO1A 7MHTA 2V1XA 2V4MA 3AEKA 2UVPA 4M7OA 1RPTA 3M3PA 2GILA 3E05A 2F1IA 1XZEA 1H22A 3L7JA 2XRZA 3C6YA 1U8CB 3G79A 1L4LA 2DFVA 1LNQA 3DDZX 4HNGA 4TTSA 2HF8A 1FFGA 1A9PA 4D8YA 1BJRE 1P39A 3OX1A 1LPAB 2I3BA 3KQMA 4LC9A 1IIRA 2ONKA 4RY2A 1W52X 3LCVB 3COPA 2PH7A 1ODTC 2GAAA 2NUPA 3PBKA 5FPSA 5JDIA 2BYTA 2NWQA 2OAGA 3T7DA 4REOA 1JLLA 2UYCA 1OTYA 4RGQA 3SZOA 3L7OA 4Q15A 3OA0A 3OFVA 3EF3A 4B4UA 1LSJA 4C4XA 4DY6A 3UJPA 2OLEA 4UFPA 4C5BA 5TPZA 2X2PA 3L7MA 4D8UA 2AN4A 4HG2A 2B1QA 3P9RA 1E5LA 2ZJ6A 3S4YA 3TNJA 4A0QA 5ITZB 2VDRB 1ISRA 4NCXA 3THWB 2VP4A 2XHEA 2DPXA 4PR0A 5T5QA 3HDTA 3UGJA 1N6IA 4YA6A 3M1YA 4CL8A 5I9SA 3KSMA 1UBLS 2NZ2A 3QLTA 4FJ1A 4QVKA 1NOJA 4RS3A 4UBKA 3IV9A 4KDFA 1EUYA 1TGYA 4NBSA 4JT8A 1P0QA 4BPRA 2ZRLA 5G1OA 1IG0A 3RVMA 3DEYX 4M1OA 4DZRA 4RDHA 3ZV7A 3FCSB 1M0SA 2GB4A 4LJAA 3MS7A 4EB6B 3DOIA 4FM9A 4K0KB 2ZUSA 4H17A 1NW3A 2HDOA 4UJ5A 2O59A 1IQ0A 2FPMA 2XSZA 2E55A 4YNBA 2YIVX 3HB9A 5DLYA 4EW2A 1NJ5A 1WVIA 2MMCA 4BATA 1GL9B 1IEQA 2J0QA 3IS3A 4GWKA 2P2CA 3L0BA 1HDIA 2YY7A 4RZQA 5G4KB 3PPXA 3DCIA 4IJKA 4EYEA 4BMDA 3H5TA 1CUHA 2JGDA 1EFVA 2OLKA 2O1EA 1T1EA 1G1MA 4G2TA 4HQNA 4O4HF 1YGPA 1RLOA 4R8MA 4Z54A 2J3KA 2L69A 2XMQA 3RFVA 4BS9A 3HJFA 2HU8A 4HB4A 3ONVA 3Q10A 5JTTA 4U02A 2R8OA 1E4YA 3JWGA 4KUHA 3TLMA 4AJ4A 2I1WA 3K72B 3MWDA 4GR9A 1JR3A 1V96A 4LK3A 3OO0A 1NN1A 3NYQA 5FUWA 3ZBUA 1HL7A 3EVGA 4Q01A 2PRSA 1XOIA 3GLTA 1E3TA 3HFRA 1DVRA 5D3QA 5EKUA 3RH0A 1SBCA 4CM8B 4F2PA 5ALTA 1P3JA 3M6MD 1CETA 2MYNA 3TTVA 2BBTA 1UC5B 2Q5QA 3P9YA 3TIGA 3L7IA 4L9SA 3RYHB 2Q4TA 1A8UA 2OD7A 2MSKA 2PMEA 2XMSA 1QK5A 3RSFA 1G42A 5EXXA 3P8ZA 13PKA 4H6XA 3C3MA 2IV2X 4XQ0A 3ZNNA 4HNAA 4CGZA 1GDHA 1V1RB 1ID8A 1H6DA 3IEXA 4QXRA 4TTAA 2X5XA 1I3OA 2QYSA 2XB9A 4GI7A 4FMCF 4WKOA 4ZRDA 2OR3A 2WMYA 4FUQA 4Y2GA 3KT3A 2MSEB 2XGOA 4WLFA 3ENQA 1YOVB 3Q5GA 2ORWA 4OFZA 4AUKA 2Z83A 1JHPA 1UBHS 4U9UA 3WNQA 2X4DA 5HQ3B 2F90A 1Z8DA 2FUG6 1CT9A 4BB5A 4CMJA 3SS7X 4J6FA 4RQAA 1A9OA 5FPTA 5ITVA 1G7SA 1KFEB 1QO0D 4MVJI 1IBCA 1MT3A 3T5TA 2HK6A 1A95A 3JYPA 3OZEA 3RJMA 2IKQA 2V0CA 4ZWNA 4U3JB 1YZ3A 1EWVA 2C96A 1BWQA 3TIXB 5E1BA 1GPBA 2F3SA 2Q2WA 3GUVA 3CTMA 4K26A 1IWPB 4M0DA 3AT1A 4IUBS 4AS3A 5IX8A 1UAYA 1BWPA 3G85A 4B85A 2V45A 3F5MA 2D74A 1RPJA 2C5FA 4FMBB 5KNDH 1NLFA 2BMWA 2EFDB 4N3GA 1V16B 5AOCA 3TQCA 1HETA 5BSUA 3RG8A 5A4MS 3PRHA 5HOEA 5JNRA 4AFNA 3BCHA 3DZHA 4S2EA 1A5AB 1CR2A 3KTAA 4XDHA 4FMDF 1E4EA 5CB0A 5AW1A 4XI9A 5C5IA 1FNNA 2JHFA 5TMBA 4O5OA 2PGLA 1NXQA 4W8GA 1DIHA 4IINA 4KPUB 4P7GA 2XF2A 4E5SA 3PTZA 3VU1A 3LSYA 1MNAA 3QMPA 3RRNA 1LTQA 1IOLA 1Z6ZA 1NVTA 2BKUA 2HQ1A 2PXXA 3QOXA 5CXSA 5T8KC 4YRPA 3WA6A 1NL3A 3KHSA 1KS2A 1EDZA 3BZBA 4FNOA 4QJ4A 3ZOKA 3R3UA 1E4VA 1JLHA 2CBGA 2FW8A 3HCNA 4PLZA 2CNBA 1DADA 2X0IA 5F2OA 4BAGA 3TOVA 3EA5A 3NXSA 1KZYC 1TFUA 1G8AA 2O3SA 3K1ZA 4BLTA 2LKCA 1H4SA 3MBKA 2PRYA 2YYYA 3QOYA 4GYJA 4C7OA 1QCZA 3WB1A 4MVJP 3OQMA 2CXHA 5HOQA 1CK4A 2OGUA 2EBUA 1KSGA 3BE4A 4MB6A 2OXTA 4IO1A 5KOJA 2IOFA 4YI3A 1TPYA 1U3VA 2OHXA 4L5AA 3AVVA 2J4CA 3JD0A 1I2DA 4MDHA 4OB6A 4IOKA 3LLMA 4ZV7A 3WGKA 4A3SA 4BCCA 4YMLA 5BW5A 3DO8A 1FRQA 1UMBB 2BV3A 4ITVA 3TXXA 3V42A 4CV1A 2EKLA 4C3VA 4DV4B 1DEXA 4IDQA 4MUIA 3W6PA 2BR5A 1OW3B 1SG0A 3K05A 4EPVA 4ZK6A 1ZVMA 2H57A 2VEOA 3HG7A 3QJ5A 2EDAA 4DBZA 4W9RA 2JCYA 2DR3A 1P6XA 1ULZA 2MYPA 4UBIA 3H4MA 1XVVA 1C3OA 1DJPA 3GLGE 2NO9A 3K53A 1L5SA 1CE8B 3AEXA 4H6PA 2NAFA 1IQRA 5HHTA 3A4TA 5I7EA 2GN6A 3B48A 4YDQA 5AT1A 5SYMA 3JQ6A 4Z4QA 4IKPA 1DBSA 2HQOA 4QDXA 4A7PA 5JNWA 5JCOC 1RJEA 1QSGA 4M7WA 2OUIA 1HYGA 2REXB 4NICA 2P79A 3PGA1 4K6OA 4LNUB 4B3HA 4TRRA 4D3XA 1F4LA 3NPMA 2GAIA 4OB7A 4R1UA 1W88B 2H5JA 3FKJA 1YS1X 1FQJA 3PITA 4WZBA 4CMIB 5IULC 3O31A 3ULKA 4ZCQA 1LZLA 5IN5A 3U40A 5TF4A 1ZGGA 2R1TB 4MLDA 3RYFA 4WZZA 4B6QA 4CL0A 5KINB 1G20A 1NE2A 5EZYA 2IHVA 1SOMA 2UVQA 3C14C 3F5SA 1SIOA 3ZDQA 4EKEA 2W6MA 1QZ3A 1PJRA 2RARA 2L42A 2VP3A 4E2WA 2LRHA 1R3UA 4KODA 4YMIA 4PBRA 4I6GA 3G23A 1KZ6A 2EG9A 1SHKA 3LVQE 1RWOA 3UXHA 2NGRA 1MRZA 2P9EA 2YTZA 2ZJAA 2ZRCA 1THMA 1Q2UA 1NQOA 1L8AA 2W0SA 1TIBA 4ITUA 3DMTA 3U3KA 5EOVA 1XROA 2GTPA 1AQ6A 2ORED 2EQBA 1U0BB 1QIEA 2CGEA 3VR4D 3BL8A 1ONPA 1YNOA 3A32A 3CO0S 4XCXA 3S7ZA 1AZSC 4YJFB 4DCCA 4R81A 4Y2QA 4C21A 3AVUA 4O02B 2OCKA 3PT5A 1T10A 1IJFA 1DT3A 2XMZA 2PD3A 2HA6A 3PUKA 3NBQA 2B7LA 4WVLA 4ZRNA 2FMTA 3HNPA 2I2CA 3UC9A 1KQGA 1FYXA 4GC5A 2YWHA 1IIBA 4HDKA 4EBFA 3ZWOA 3HU5A 4PYMA 5KYWB 1AJEA 1H3NA 4CFYA 2AH5A 4W1PA 4B3MB 1VMKA 2W2PA 1CR6A 4IIUA 5DHSA 2DXIA 3IE0A 2OXEA 4G4SP 2XTMA 5I9MA 1I1NA 1AKYA 1UFRA 3OJOA 4NU6A 1LS6A 2VDWA 4HWOA 2R8XA 2FPKA 2WUGA 1FVHA 3SSNA 2Q0HA 3CT4A 3OFSA 2AC7A 2AZDA 1TAHA 2Z2YA 3C8HA 2JH9A 1VPEA 2O48X 2Q46A 3Q0EA 3QKRB 4XWAA 4V02A 1HGXA 3VDMA 4ARBA 3EIUA 4PVDA 1QTNA 1KMQA 3T06B 1YL5A 5JALA 1SXQA 4PSKA 5YASA 1VKHA 1E18A 1GRVA 3SAJA 5FX2A 4GKVA 3JSXA 1P5RA 2XMGA 4HRAA 1O95D 5DI3A 5KDLA 1ARZA 1EVQA 2OCGA 5HRUA 1I10A 4ZAVA 2DT5A 3L0YA 5TT0A 2WRZA 5E7QA 2QL5A 2DECA 3W5AA 5EP1A 2XADA 1N32B 1JSLA 1PN3A 3FSRA 5CCBA 1FYWA 4GQBA 1RYZA 1O4WA 2RSLA 4EVSA 1QP4A 2NZ8A 1VJ1A 3F9IA 2LCIA 5FP0A 1E62A 1XN1A 2E85A 2IJGX 1MC5A 5BN5A 5KKNB 5JYEA 4MS3A 4FCVA 4FGJA 2CUTA 4NPHA 3NBXX 3ZV6A 3TGPA 2GXAA 1NVDA 1XQYA 1KF0A 2BMVA 4E32A 2W9XA 4NFYA 2CUKA 1KAOA 2ZGVA 3GAAA 4MINA 3NHFA 5CFMA 1Y1LA 3H2HA 5A0TA 2W4QA 2QLFA 5CFQA 1XF1A 3RK0A 1PKXA 2A4MA 3ENWA 1FYVA 2MSCB 2WI8A 3GFSA 5HZGA 1OE0A 2WQ6A 621PA 2P7HA 3FWHA 4FZRA 1Y9ZA 2R84A 1DWPA 4F4UA 1NW5A 1WHTB 5E6RA 1H1TA 2FUG1 2PKWA 2XCIA 3EVNA 5FWXB 5DNCA 1YQEA 4TMXA 2RC5A 2WJZB 5FNVA 4ZEWA 4E94A 4GQIA 2VYVD 3LO8A 3FH0A 4B3FX 3VAZA 2YRFA 1NM5A 4IEIA 5AI8A 1JYEA 3FNHA 2NU6B 3D0OA 3FYSA 4LY3A 3KJXA 5HM8A 2FWPA 2WTXA 3FMFA 3D9QX 4J1QA 5E95A 3WDMA 3QBVA 4ZHQA 2BGIA 3PDIA 4NFLA 4JWKA 4U7WA 5H70A 1G6OA 2AT1A 4PHGA 3DQQA 2DERA 1W0JA 4IGAA 3H3FA 3KBOA 3UEOA 2EP7A 4KYVA 2AA3A 3OBBA 1RJGA 1OX4B 3IR5A 4FJ2A 1NW4A 4BIIA 1Z6QA 4HWGA 3V3TA 1Q0ZA 1QTRA 3EAQA 5AJZA 2D4HA 1ZWKA 2I6XA 1E2PA 1E1QD 2IGBA 4EG6A 5BRJA 2FPLA 4HB2A 4EI9A 1L8XA 4DZTA 1FJHA 1R37A 1P7PA 1ZOLA 3C1TA 3F98A 3I12A 3TQFA 3VMFA 1R8XA 3P9KA 3QKIA 4GFDA 4GNKA 4QOFA 1OILA 4UPVA 2IT1A 2C7PA 4L6IA 4C2UA 3LCRA 2CLDX 5EJGA 5ALKA 2CDRA 2OXCA 3QEAZ 4RFSB 1T5DX 2QRPA 5IAGA 1ZQ1A 1E3LA 3PFKA 2YMMA 3DEJA 3MAGA 4NMHA 1C8BA 4DIEA 1OH7A 1SCIA 3NFRA 5LSAA 2PX5A 4CDRA 1TK3A 3FCEA 1KETA 2PGOA 1E2QA 1NPTO 4QNNA 5JFTA 2ACWA 3RLIA 1FTQA 3IMGA 3TAUA 4CN9A 4XM0A 1E1RD 3ICOA 2X14A 1XU7A 4MW6A 3L79A 4PLCA 3O3OB 4AP5A 4A16A 4IIBA 4BLOA 3OPQA 1Z5GA 2ZK7A 5DWDA 4Q6WA 1CZHA 2A4KA 1KYWA 4IDAA 2JFVA 2BJHA 3AP3A 4HHEA 3ZQUA 4L8VA 4MIOA 1B16A 3HYLA 1MOZA 4TN5A 1XRLA 4N65A 3UAXA 4AWBA 4GPAA 4EHJA 1CQIA 1ECBA 5KQMA 3RT1A 2XCLA 3ZDFA 2O20A 1TLFA 2Q41A 4JVSB 4GKBA 1BJKA 3MBOA 3GA7A 3DDSA 2W7TA 4KXVA 3S1SA 1JZTA 4QYIB 4I4LA 4J1TC 3S8YA 3CLVA 2G6BA 3EGVA 3TIFA 1DI0A 4KREA 3LC0A 4DARA 1L5MA 4QDJA 4UFOA 2FFRA 1HLFA 2RK3A 4OKNA 2J85A 1XR3A 1R0KA 1COZA 3SJUA 1KJNA 3OOSA 2C1ZA 3I64A 4YP7A 1MCZA 3TM5A 2XYGA 3M4XA 1EVZA 3KHUA 5ESDA 5HCNA 2YIJA 2QX8A 1YHZA 1G19A 5DYIA 4BFSA 3S8MA 4XYLA 3K0HA 1MB3A 3DLTA 4QTTB 3RB8A 2UDPA 3LT1A 1IBKB 1XRJA 2MYUA 4JH0A 2P41A 1Z0DA 3L84A 3L5KA 4NCNA 2VJQA 1ZJ6A 5CCXA 1ZJWA 4TYQA 1XTIA 2G1KA 2IEDA 2AFHE 1J0CA 3R5XA 4KIWA 1X38A 1WTAA 1NXXA 4BFCA 2F9MA 5AKIA 4OJQA 1S2GA 2VDUE 1UBKS 3A4MA 5D3MA 3EPPA 2HEIA 1P2VA 2QAGC 2XI4A 2GPJA 3BWVA 3Q3HA 1AKWA 4YCAA 2DH6A 4US1R 4LYYA 2HU2A 2GPNA 3MFYA 3L8EA 2C0CA 3RNOA 4DBLC 2WKPA 4LXYA 4LNAA 2UUCB 1F6BA 4LFBB 1HTBA 2JLXA 3VZRA 2DUNA 5C8XA 4GVXA 4EY4A 3NHYA 3A1DA 2ZYRA 4JKOA 3KK0A 4YI5A 5M2QA 1NPDA 1IZ7A 1LGYA 1XZNA 2R751 1CF9A 4Q9JA 4BV2A 3LBIA 1AM4D 4MXDA 4HNUA 1QHEA 2G04A 4F72A 1OU4A 2C99A 4KTVE 1A97A 5D8DA 1Z34A 4ZU6X 2XQGA 4KIJA 4QGAA 1I3LA 2BF4A 4EARA 2Z9DA 3D6TB 4HH3C 1WVGA 3U4CA 3TZBA 1L5HB 1YI0A 3OU2A 3Q5EA 4OMUA 2JIRA 5LR6A 1P75A 2GEBA 3VH3A 5FV4A 3ZW8A 3Q5DA 3L0PA 1U7PA 2Q4OA 4B4DA 2ZUCA 5LB4A 4LXTA 3R8CA 5B4VA 1VE1A 1GQRA 1U0FA 2GEKA 2O1WA 1KO7A 5H7XA 1WCIB 4S24A 3B9PA 4UVEA 4BO5A 2R0QC 4NV0A 1N77A 2GEDA 3NVKI 2YXNA 1RJDA 1A4IA 2OFOA 1XIVA 2P77A 3AV0B 3CC8A 4BZQA 4E2ZA 1JRLA 2GR9A 4IJWA 4M3NA 4XSGA 3T7EA 2LXNA 2VTEA 2F3PA 3MQ2A 2V54A 2N46A 5DLEA 3DMFA 4AROA 1BRTA 2DFLA 1WBJB 3N8DA 1CYDA 4GVLA 3G0OA 4UE3S 3FCYA 3WDKA 5ARBA 2Z6VA 4PLGA 1V9LA 3VH4A 1FIUA 4RPJA 1B14A 5FFFA 1P1RA 2B9EA 1A72A 4OLFA 3FYUB 1L5WA 1MVNA 1AKMA 1C9JA 3KSUA 3MTGA 5EJFA 3JPWA 1NYRA 2X23A 1UR5A 4BUZA 3M6UA 1Z0SA 3ADCA 1OLXA 5JNUA 4AJ1A 3IJPA 2XHZA 5DCUA 1EGHA 2FRDA 3G2JA 3Q4GA 3ZHYA 4BQRA 1T2CA 1QCDA 2ZSIA 3RJ9A 4C0SA 2WT4A 3EGDB 4WKGA 3CR8A 1GTG1 3SICE 3QUQA 3BZUA 2AYXA 1KYZA 1MJFA 1ZMBA 4I81A 4U7PB 1TUIA 1OJ7A 5JMTA 1CNMA 4GC9A 3WB0A 2ZYHA 1BC5A 2MSWA 4E11A 3ITKA 3RR2A 2WF9A 3RV4A 2VSOA 3A9UA 2B3DA 1KKLA 3LQFA 1AQYA 2JIBA 2QHXA 3PT9A 4PZCA 1NF9A 3OOEA 4P5DA 2PGJA 3UBTA 4AWAA 1E0DA 4B82A 3HBJA 1ODFA 3OLQA 1OIXA 4K1LA 4H4EA 2B9VA 1DUIA 4N82A 1PG5A 3PHIA 4M53A 4RSGA 4HMOA 1HT0A 3KPVA 4BGEA 4BO3A 2C59A 3R09A 4QAQA 4DSNA 1XTSA 2FW7A 2QVBA 1ABEA 3A25A 1XE3A 1BE8A 1QDUA 4JBXA 3BXHA 4MYHA 1AKUA 3I62A 3ZQ4A 3RAEC 1PVDA 1PV1A 3RVJA 4M1EA 1JVSA 1N5KA 2ISSD 1UWCA 1JAZA 1GZVA 3AY3A 4CKCA 4HDMA 3QWFA 3QSYA 3REFA 2IF2A 3CS3A 3H1FA 2VT3A 3NRJA 1E66A 3EG9B 5AM1A 3S55A 4BFUA 4EKIA 5I7AA 2A1TS 2W6PA 3EEBA 3GGGA 4RH3A 1NU8A 2PS3A 5H0IA 2IY7A 5L3ZA 4M99A 1IZ8A 4LDRA 5IK2D 4BKOA 2EWWA 2CVOA 2PLNA 1IN1A 3EZNA 4FP9A 3H87A 3OPMA 4MR7B 3QKSA 3SEAA 3ETNA 4X66B 1JIUA 3QG1A 2Y0EA 2GKGA 4LBVA 2YWDA 1WDTA 3HHEA 3KYCB 4D79A 1XVIA 3BGSA 3L8ZA 1X0XA 1P1IA 1Q95A 4D2IA 1MA0A 1BFUA 2JBAB 4KXMA 1ZXXA 3WLEA 4A9AA 5C1PA 4NENB 4JC0A 5FL7D 1E9BA 2QPTA 1DC3A 2OHIA 5FNZA 4ZVMA 2NU7A 2KPOA 3ZCPA 2IXGA 5KWEA 1MAAA 1NPYA 2NVUB 1DWQA 2GK3A 3DM5A 4MIYA 1IZ9A 4B6RA 1RPZA 3K20A 5C8YA 1WPGA 1O6GA 2BW0A 2QT1A 3ZE7A 1IUNA 2YY6A 1WP9A 3PI7A 4H7PA 3UZUA 1XCBA 1H3EA 2BFMA 2ONZA 1T5OA 3PTLA 3VR2D 1DOAA 2YWJA 4IWNA 3AF6A 2F8TA 4D4IA 3DTVA 1UBEA 2B6NA 1H8HD 3HWRA 3O7WA 2XD4A 1GSOA 3NTRA 4Y2SA 3TGWA 4H6WA 4QX6A 3O8LA 4D98A 4TVKA 3AF2A 5BSWA 3GD7A 2ZXFA 4P1ZA 4FSXA 3H5AA 2QBYB 1XTUA 3MMNA 3OZTA 4N47A 3FF4A 3F8SA 3Q8WA 2FSPA 1J22A 1G2QA 1D3AA 3NATA 4WI1A 5TGTA 4F2HA 2GCOA 5CFPA 1G3MA 5DX8A 4K28A 3IAS6 1XZIA 5WRFA 1DAHA 2AXPA 2HRRA 4Q24A 2Q29A 1ODJA 4QGGA 5HGXA 3TFOA 2K2WA 1ULHA 1ITZA 3HDQA 2G1AA 5LDDC 4CL3A 1KVTA 5H83A 3H4TA 1PD0A 3IAM1 5ESWA 3D4NA 1IXRC 3MWJA 1QFYA 3O3CA 2I2WA 5KQSA 3VDNB 2BGUA 3GLSA 5LP1A 4DA0A 4F85A 3FOEC 4I1SA 1IY9A 3TSWA 5L4SA 1KQPA 2D2XA 4MMYB 1M2JA 3ORRA 3TQHA 1Z18A 3OMXA 4JOCA 1DV1A 1XBTA 3PGXA 4RVDA 4Y6OA 4KDCA 1EP1B 1ZH6A 3KJEA 1WIWA 4TKMA 5AKYA 3INNA 2EFGA 3ZDDA 1P9RA 3HWX1 4ZI5A 3VYUB 3P20A 2GD6A 1XCJA 3GJTA 4L9AA 4LDNA 4FFWA 4L73A 4H1HA 1NG9A 4YQEA 2XRYA 1U02A 3CRW1 4WZAB