4RIGA

Chimeric glycosyltransferase langt2s8ac
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
374
structure length
344
Chain Sequence
b'MKILFVAAGSPATVFALAPLATAARNAGHDVFMGAVEDMVPYIASAGIPAVATTDLPIRHFITMDREGNPVRMPETPEEELDFAGHWFGRMAAGSMDALREVTANWRPDLVVGGSMSFAAALIAAELGVPYVRQAWDTGDAWRTDPAASDELRPELRALGLDRLPDPALFVDICPPSLRPADAPPAQMMRWVPANGQRRLEPWMYTKGNRPRILVTSADMAALDAEVVIATLVRAGWVPLDVVVPTCDVVVHHAGGVTALTAMNAGVPQLIVPQGGNFVEAGLRISDFGAAITVDENTPEAVEKACGELIGNPSYAERARELSAEIAALPLPAEVVGALEGLVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl transferase
publication title Structural Characterization of O- and C-Glycosylating Variants of the Landomycin Glycosyltransferase LanGT2.
pubmed doi rcsb
source organism Streptomyces cyanogenus
molecule tags Transferase
total genus 102
structure length 344
sequence length 374
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06722 DUF1205 Protein of unknown function (DUF1205)
A PF06722 DUF1205 Protein of unknown function (DUF1205)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rigA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 4rigA02
3IAAA 2VSNA 1WW2A 1H5UA 1NZDA 1PSWA 2BFWA 3MQFA 1AXRA 3PE3A 1AHPA 3MRXA 1PN3A 3T7DA 1L5VA 2C9ZA 3BCRA 3TSAA 1FU8A 3OTGA 2G9UA 2X6RA 1NOJA 1GFZA 2HY7A 1NLMA 1QKJA 1Y6FA 1V4VA 3AMVA 3VDMA 3CUTA 2IUYA 4FZRA 3G2IA 1KTIA 2G9RA 3MBOA 3OKPA 3OT5A 1NOIA 4REMA 4NEQA 2C4MA 3EBOA 2JZCA 4X7RA 2IV3A 1Y6GA 2ACVA 4BFCA 2QRPA 3BD7A 1C50A 3H4IA 2X0FA 2QRMA 1JIUA 4KQ2A 2GPAA 3ZCPA 2F3SA 2FFRA 4F9FA 1FA9A 5I45A 1XKXA 3S0JA 1RRVA 2QNBA 4MHOA 1NOKA 3CUWA 3Q3IA 1FU7A 1J39A 4NESA 1Y8ZA 2JLBA 3ZCSA 1L5RA 3PE4A 4N3CA 4EL0A 4M60A 4X7PA 1HLFA 4WACA 2C1ZA 1ABBA 2XGMA 3MT9A 4N9WA 3S28A 3L7CA 3MS2A 2X0DA 3TAXA 5LQDA 4Z5XA 3CUYA 2PRIA 1E1YA 4L22A 4HLNA 2X0EA 3NC4A 4YI3A 4QLBA 3D1JA 3OY7A 3RSCA 4XIFA 5JTTA 3OKAA 1GPBA 3RT1A 4N3BA 4RIHA 2ASVA 3CEMA 2SKCA 3MTDA 3T3HA 3MT8A 1VGVA 2JJMA 3ZCRA 5ENZA 2H1HA 4CTNA 2ATIA 3O3CA 3NPAA 2OFFA 3L7DA 2QN7A 1WUYA 4MI3A 2GEKA 5D00A 2R60A 3OKCA 1NVKA 1WV0A 2PRJA 2XCIA 3ZCTA 3ZCVA 1K08A 1FTYA 2AZDA 2VG8A 5IKPA 1P4JA 1JIVA 2PYIA 4BQIA 2QN3A 3E3LA 2GEJA 4RBNA 2XMPA 2IEIA 1UQTA 4GZ3A 1XC7A 5JTUA 2ACWA 2O6LA 2AW3A 1A8IA 1XL1A 4X6LA 1YGPA 1FTQA 1Z8DA 4MI9A 2ECPA 1PYGA 2F3QA 2VSYA 3Q3EA 4KQ1A 2C1XA 9GPBA 3GUHA 1SXQA 3CV3A 4M83A 3ZCUA 4PQGA 2GPNA 3T3DA 1P2DA 3WADA 1F6DA 3S2UA 3S29A 3CX4A 1WUTA 3E3OA 2IYAA 3BCSA 4EL5A 1L5WA 1IXYA 2AMVA 5GPBA 1WV1A 1L6IA 3MSCA 2F9FA 1IIRA 3BEOA 3UYLA 3OTHA 1EM6A 3VUFA 5TMEA 1L5SA 4BQEA 3SYRA 1M5RA 3L01A 4MI6A 1GZ5A 2R4TA 3S27A 2XA9A 2X6QA 4GPBA 3BD8A 2GT1A 2BGUA 2GM9A 3CEHA 2VCEA 1XOIA 1LWOA 4MRAA 3MRTA 1E4OA 1NZFA 2QLNA 3COPA 1RZUA 7GPBA 3EBPA 3H4TA 4FKZA 3OY2A 2XA2A 2R4UA 1GPAA 1LWNA 3C4VA 3D0QA 3MS7A 2IYFA 4EKEA 2IEGA 1UQUA 1C3JA 3D0RA 1BX3A 3ZCQA 3G2LA 1P2GA 2XGOA 2SKEA 1FU4A 4AY5A 1JG7A 1FS4A 3NAZA 4GYYA 3L79A 3T3IA 3RHZA 3HBMA 2QN8A 3BDAA 2QRGA 5BNWA 3NB0A 1GGNA 3HBNA 3L7BA 2QLMA 4GYWA 3OTIA 4AMBA 1P29A 2GJ4A 3HBFA 1P4HA 5TMDA 3G2HA 4N3AA 1K06A 2AV6A 4F96A 2KS6A 2R66A 3IA7A 4EKYA 4XI9A 2PYDA 3C4QA 1GG8A 3BD6A 3E3NA 3L7AA 4GZ6A 2XGSA 1PNVA 3C48A 2QRQA 3NP9A 4HWGA 3NCHA 4RIEA 3WAGA 1C8LA 3Q3HA 1EXVA 1QM5A 2QN9A 1XL0A 2WTXA 1JEJA 3CUUA 2G9VA 1SXPA 3QKWA 2FF5A 2H1FA 5DLDA 2BGTA 5HXAA 5C1DA 2PQ6A 1JIXA 3GPBA 4CTMA 4X7MA 2GPBA 2ZB2A 3T3EA 1L7XA 1Z6QA 4CTOA 5TMBA 3TOVA 1L5QA 1GPYA 3CEJA 1YA6A 2QZSA 2G9QA 2QLLA 1WW3A 4KQMA 5TVGA 4WADA 4AN4A 8GPBA 3T5TA 3HBJA 3MRVA 4AMGA 4G2TA 4W6QA 2FETA 2IV7A 4RIFA 4WHMA 1UZUA 3FROA 1F0KA 3G2JA 3DDWA 4LDPA 4RENA 4YI5A 3NP7A 2IW1A 2XCUA 3VUEA 4MICA 1JG6A 3T3GA 4NC9A 3MTBA 1RZVA 4CDRA 2VCHA 4MHSA 3MT7A 3DZCA 1FC0A 2QRHA 4RIGA 3MTAA 3DD1A 1Z6PA 2YJNA 5D01A 4BQFA 3G2KA 5DXFA 2BISA 3DDSA 1Z62A 4F97A 3UYKA 4LEIA 1XV5A 4YUAA 4N39A 2SKDA 3CUVA 5IKOA 2R68A 2QN2A 3WC4A 3MS4A 2P6PA 4RELA 4EJ2A 2F3PA 2Q6VA 4RIIA 1P2BA 2F3UA 4M7PA 4GZ5A 1FTWA 2XA1A 3RSZA 6GPBA 1P4GA 3SYMA 3VDNB 4AY6A 3QHPA 1B4DA 1C8KA 2QN1A 1O6CA 5DU2A 3G2NA 3BCUA
chains in the Genus database with same CATH superfamily
1KO8A 2QYHA 3R20A 2ZRMA 1BN7A 4V0LA 1US8B 1ZWKA 4Y0VA 1KDYA 4MLDA 3AR7A 5CVJA 3LE8A 1QH8B 5EAIA 4MYHA 4R5MA 5GAJA 1UKVY 1AHPA 4D9GA 5I9SA 2VDQB 4W63A 4EW1A 4DR6B 1ZIDA 5EE3A 3KOMA 4IH9A 4AVYA 3BCRA 1HOTA 3VU8A 2O0MA 2BBWA 4FNAA 4GDMA 4X90A 2R62A 1R4NB 1F0PA 4QA9A 4IOJA 2C7GA 4P80A 2X6RA 5JISA 1T8UA 4GQAA 2B37A 3FTCA 1GFZA 5J63A 2HGSA 3O4HA 1MT0A 3PNMA 4REOA 1CY6A 1QXSA 4IIYA 1MQ8B 1VHLA 4ZOCA 1CRPA 2I65A 1GGMA 1M67A 1ZH2A 2WYWA 1A76A 3QMPA 2YC2C 1NU6A 4FILA 4FZRA 4LQDA 5IAJA 2FRXA 4EM6A 4RH1A 1YK0A 2AB0A 1D2CA 2CNWD 2QVYX 4EHLA 4KXXA 5COBA 1E2IA 4Z9YA 3HYTA 3EQZA 3LF1A 3G6KA 3IO3A 3M9XA 2FZEA 3HG7A 4R1NA 1NOIA 2DPLA 2HRDA 2Z9DA 4MS4A 3I2GA 3KJXA 1PTJC 2NXJA 1TMGE 2AYXA 3HJNA 1I3NA 3JALB 5JYCA 4DW8A 1H0HA 1QAOA 2HPZA 3D8BA 3O4RA 5K03A 2R6DA 4PNPA 4PU0A 3P19A 2ACVA 2AMJA 2AZ4A 2V8BA 4PG4A 4Q4LA 1KGSA 1WVIA 5CJJA 4ER3A 3PKZA 3HXLA 1Z5OA 4H0NA 2H9YA 1GL3A 2G8NA 3ZZUA 4U7DA 4J7XA 1M1YB 4BV2A 4HS9A 4X60A 5EHNA 3TNFA 1RT9A 1W49A 2B5VA 3DM5A 3PFFA 4DC1A 4QOIA 2DR2A 4F91B 5G0TA 4DG5A 1GWNA 2W22A 4F93B 4Z6KA 1Z33A 1SUIA 3NXSA 4ONEA 1F3OA 3VAZA 3IP8A 2XF2A 3H1PA 4AKHA 1QJCA 3IOBA 1MA3A 2EVWX 2IZ0A 3H9BA 5AW1A 3MOSA 3RNOA 4E31A 5LNK1 2WMDA 2O7QA 4JB3A 4GW3A 1VPEA 3D6AA 1J39A 1RYMA 2OAEA 2AHRA 3BBPA 3IIIA 4BMNA 1SCAA 3IJ5A 3R3VA 5B1IA 3RSOA 4L0DA 3ZY3A 3OCYA 1NURA 4MV8A 4MRRA 2Y4OA 2FPIB 1M6WA 3BTOA 2VPYA 4OV6B 1ODTC 4TSFD 5ALYA 4M0FA 4IIBA 1QCYA 1FUKA 2HQBA 5HS4A 2DECA 3FZYA 4YBZA 4YCSA 1E2UA 2C1ZA 1ZOLA 3PFGA 4XVRA 5J2UB 2FK8A 2XGMA 2HWYA 3H8SA 1W59A 2JGNA 3L7CA 1C3VA 3S28A 4A0GA 4AJLA 2XNJA 3KDSE 4RD2A 3MK31 4OGLA 4YDQA 1NUTA 1VJDA 2OXCA 1W52X 1XELA 3FJ1A 1U9CA 3DV2A 4Z5XA 1KS9A 3MGGA 4CMKA 1G5QA 1VLVA 2J33A 1JG3A 1W87A 2BKUA 2ONYA 2ONCA 4J1TA 3DDZX 5IJ9B 1BWRA 1NXSA 3O9VA 1CIJA 3B3GA 3H42B 1ZRNA 3K31A 5JEEA 3CXUA 5EUCA 2WT4A 4ITVA 4PWYA 4G07A 2YL2A 4UNPA 5ILQA 4REQA 3RT1A 1AKMA 3DO8A 3V8NA 2PKYX 4H18A 3KQOA 4RKYA 3CW2A 5A3QA 4OAPA 4TQAA 3CTPA 3M82A 2CYCA 4E5PA 3PTAA 4JI4B 1R64A 1VE1A 3CVYA 3VKVA 1H8EA 4IH1A 3KB1A 3TUJC 3MXOA 1BEUB 4YCAA 4TMTA 5TF0A 4KEAA 1JZSA 3HDQA 1Y6GA 4RXUA 4YJ2B 1ECGA 5ENZA 4O4IF 4ZOLA 4YACA 4JELA 4DNOA 1VL1A 2HV9A 1ECJA 3RG2A 1AA9A 3FB4A 2H51A 3OO1A 2FOXA 1VKOA 2ZGVA 5IJ9A 4LHEA 5H3HA 5G3ZA 1B1AA 1XNHA 3WHKA 4MVXA 2YXBA 4DG9A 3EOBI 4JIGA 3NOXA 3BFJA 4KPUB 1MJNA 3W04A 3GP8A 4ZU3A 5HJ5A 4D26A 1MG0A 1NP3A 3AR6A 3NUGA 4N7JA 1OLUA 1LSJA 1NXPA 3DUWA 2VJNA 1CY0A 4UJ5A 2JCXA 2X13A 5CFQA 4JVNA 3R7LA 4B6RA 4DUGA 3D7KA 3V2GA 1J2JA 2RHLA 4FZ3A 4HUJA 3O8LA 4D0SA 2YCLA 4HX2A 4I3HA 3TW6A 5EJ6A 2ZDGA 3E8SA 5FQOA 3V1KA 2RHDA 2EDAA 5BP7A 3EWSA 4CLOB 3HGTA 4BFXA 3T0IA 1RBYA 3N28A 3BPSA 4PYOA 2YV4A 4PQYA 3ZBPA 5LWHA 2XMPA 4FMCF 3UJ6A 4YLGA 2JJQA 4URXR 2HCTA 3PCXA 3OE7A 2H0QA 3OEHA 3ZI0A 1EDOA 1YBVA 3LSTA 1Q0SA 1V16B 3RVDA 2IYEA 4DSOA 5HIKA 2XZOA 2JNWA 3GCWA 2PSSA 3L1KA 4KR7A 2NP6A 3QEMB 3I9FA 4EHHA 1BX1A 4A03A 5CM2Z 1FRVA 3VR6D 5LQMA 4FYIA 5ALZA 3BUSA 3FCXA 2ECPA 4BBPA 2OO5A 1J8QA 2IBSA 5K0CA 4BTVA 3GBVA 4IQ4A 4RD3A 3UICA 4YV1A 3GLHA 1Y8QB 4ZIRB 4QUKA 4YJFA 5EC8A 1D4FA 1FVXA 4DMLA 4R71A 9MHTA 1NX9A 1NVAA 1RI3A 4D96A 4QVIA 5K4AA 1M9NA 3K09C 3IOMA 3PC3A 4G0MA 4O4JF 4Q4DA 5JI3E 1OYOA 2QYOA 4ARIA 5A4IS 3GJSA 3ETLA 3LH5A 4HB2A 4WV3A 4C5BA 2ZP1A 2FEMA 1T36B 2ZR9A 3Q8XB 3N8IA 3PC8A 3VAAA 4HPXB 1T25A 3VC3A 3S29A 3R5KA 4U2GA 4FGZA 4DLUA 1PKXA 1WUTA 1GQRA 3KPUA 3OZEA 4AICA 2PGJA 3W4IA 1GZ6A 1NQVA 3CWZA 3OPMA 5TJHA 1C1XB 3USES 4C4TA 3KYCA 4DR4B 3HJBA 1SD2A 3AM4A 4UU7A 1FXSA 1RI2A 2IZZA 2WJWA 1L5ZA 3EQ8A 3HKBB 4ATNA 3LUAA 1U0RA 2H9AA 4MUEA 1A50B 3MSCA 2GZRA 4BLWA 3QLVC 2RCYA 1M2JA 1X8XA 3NTQA 4HNGA 2QD5A 3KAJA 4B0OA 1SWWA 3JAMA 1YFLA 2VATA 3P2KA 1XTPA 4RYDA 5E4YA 2NO0A 1A96A 2I2BA 3R1IA 5ALEA 4Y1GA 4UM9B 4BEVA 1AV7A 1R27A 3H2BA 3C70A 5DX0A 3ZJVA 3OJCA 2VUUA 3I4FA 3S27A 4KREA 3EWAA 1X1CA 5AW4A 5BQ3A 3BD8A 4BVBA 4Y0NA 5SYNA 2GM9A 1P91A 1DB3A 3CEHA 1TEZA 3SBXA 2IZ7A 1LWOA 4HDMB 1JPJA 2QP3A 3TOSA 3UHPA 4BCDA 4WKCA 4JNCA 2BR4A 2R00C 4G25A 3JQ7A 3FUUA 3FFXA 4H7FA 1CZKA 3T1HB 4S1OA 4KLZA 2B82A 1OI3A 1WD5A 5AXCA 4JJKA 2ANBA 1W30A 3VOTA 1Y1TA 3LLVA 1JEEA 3WKEA 1RWKA 4YBRA 4AURA 2OE2A 2F67A 2PVSA 4KI7A 5JYBA 3EGXB 1N0VC 1OYWA 3X2FA 2XT0A 2CMFA 4OA8A 4MQ4A 4EMBA 1YTLA 3CBQA 1U8ZA 3RTBA 1CQIA 1P2GA 1VLQA 1JQAA 1Q7RA 2AOWA 2CD7A 3ISTA 4J0EA 3THRA 4F1JA 3WMRA 2NUAA 3URKA 1DG9A 1DC6A 1MQAA 1PR5A 2PFGA 3PJEA 3BD9A 3SZUA 3VHRA 1UPBA 2QAGC 1U8CB 1ETHA 2AG8A 2DEUA 2HBRA 1JEOA 4MV6A 1GG2A 1KJIA 2JGKA 5HFAA 3TG8A 1K9SA 2VKTA 3FVRA 1O6ZA 1QIEA 2JGIA 2H1OA 1XAJA 1GTRA 5F1OA 4CKYA 2PUCA 2BJHA 5D87A 2X0RA 4MUHA 4TSKA 1YIDA 3HBNA 1P73A 3KUCA 4Q24A 4KU4A 3U0VA 2EBWA 2GZ1A 4PS0A 1H1DA 2RHWA 3UCFA 4HNAB 3T9DA 2ILTA 4IJKA 3TR6A 4EB6B 1XB2A 4L16A 1V9CA 3FH0A 3W3AH 2R1VB 4Z4CA 3C5VA 4YP7A 5DNUA 1P6QA 1ZCAA 1PLLA 4DV1B 4DCJA 2A9OA 2CLCX 1UC4B 1CVLA 4FFWA 4CM8B 1SH7A 2EFYA 2I7VA 1TGVA 5FFFA 1HFWA 4ZEOA 1M2KA 4Q34A 1USVA 4YHHB 3OBIA 4KR0A 3N2ZB 3RIYA 4ASUA 4JYZA 3D6UA 2GRAA 2DULA 4HQLA 5K4GA 3EPHA 4O2AA 2GRUA 4D3SA 4BU0A 1X7XA 2J9FB 4NNJA 1ZVKA 4W5JA 4ZREA 3W2HA 4EF5A 4BVKA 1QG6A 3PI7A 5G0WA 2R65A 2PYDA 4JGBA 4P84A 5TEWA 3WIOA 3M7IA 3Q6NA 3QVMA 2KB0A 4IKEA 1GG8A 3DZGA 3EVTA 1MAUA 3KXIA 1JXAA 1Y5LA 2QW8A 1KVQA 2A58A 4HWPA 1S3GA 1ZXXA 2XJ4A 5AJWA 1F17A 2FDXA 4CMGA 2QRQA 1CS4C 2W2PA 4G37A 1K98A 4NBVA 3DT8A 3W4KA 1V8DA 221PA 5AM0A 3VR5A 2VZEA 3F9RA 3I1YA 1HI9A 5JD5A 5J2TA 1CERA 3TWOA 1XUOA 2ZYAA 3STXA 2Y1GA 5BPHA 2QN9A 2JFUA 4N12A 3FHLA 5JPIA 4K03A 3K0FB 3CUUA 3KQSA 4NEGA 4MV9A 2H57A 2B61A 4QOGA 3Q7TA 3UTCA 2VHEA 1CR1A 5IU6A 2Q6LA 2YMPA 1H05A 1N3YA 2I9KA 5JH7A 5A71A 1O6BA 3F4BA 4S1WA 2BGTA 1Z74A 2FN3A 1QRAA 4OB8A 2IYZA 1BKYA 4FD2A 4J07A 1E6LA 3K35A 3L4BC 1AXEA 2D62A 3O9ZA 4X7MA 3NHYA 5C8YB 3L0YA 3I53A 4DA0A 3SEFA 2H1IA 3G5TA 3HI4A 1ISGA 3KAQA 4ZCMA 4YH1A 1BE0A 3RASA 3W7BA 1H65A 2QKYA 1YZNA 1AS3A 1CQZA 4HAVA 4RJIA 1WZNA 3R9IA 3RF7A 4UEQA 3TAUA 5B30A 4C6SA 3V1UA 1QHNA 4UFNA 3REQB 5KSYA 3ZV4A 4LDQA 1CUBA 4I36A 4QTTB 2ZE6A 3I6BA 4UBNA 3ROEA 5BMVA 1NW3A 2PD6A 4FGKA 4EW3A 5JFTA 4WFIA 3ICCA 1KE1A 1B15A 1UJNA 2CFCA 3PWKA 3QF7A 3CG0A 4QBTA 4HAZA 3MRVA 1Q7CA 3TIGA 5GZ6A 3IUBA 3RBXA 1V1RA 2AC4A 4H4CA 3MG9A 3SN6A 4BNWA 4RE6A 5C81A 5CG2A 3P9IA 3RODA 5HS6A 121PA 3DDWA 1BVUA 2YZMA 4C4ZA 3AETA 1DC7A 1PL7A 2ODBA 2DP4E 4GBED 4ZTBA 4LC9A 5BRAA 1IBRA 3JQ9C 1DG3A 5BSRA 5KAMA 2ZCJA 1Y7LA 3W2TA 2HWWA 2XCUA 3FRIA 3KZCA 2X9QA 4LOKA 4H15A 3VUEA 3WL6A 2WV7A 1XZDA 3UJDA 3PTLA 3IAM6 4R8VA 4ACBA 3B9RA 3B51X 4B45A 5IDQA 3U4QB 1NN5A 1L4NA 2H85A 4RQUA 2B35A 2JFNA 3C3DA 1MAWA 1WEHA 2F1OA 2PK3A 2WAYA 3DZCA 4FNMA 4LX8A 3ZYZA 1YTUA 4O1MA 4YDHB 3SAJA 1OH5A 3W1EA 1KJ8A 4X62B 5DM70 2IYUA 2PUWA 5A4MS 2W2OA 3VPDA 4AJNA 3MT0A 4EI9A 2Z6AA 3CRVA 2P40A 4R3UC 1S3IA 3BJIC 2BJWA 2PJRA 1Y3IA 4M87A 3UMMA 2VN8A 1PNRA 2QTFA 3QVOA 2IX3A 4TKVB 1I9GA 3G6WA 4TKLA 2V7WA 4BGVA 5B36A 5AKHA 2P9QA 4I2NA 3ZDQA 9LDBA 1UDAA 4X1IA 3FTDA 3ZQ6A 2OAP1 1NM5A 2HBQA 2IIPA 2JFFA 4IILA 4E1AA 4RTOA 3AF3A 3EZ2A 5J2UF 1EVKA 1V7CA 1KYYA 2YIJA 1LDNA 3VHXA 1PZFA 1FQOA 1GAQA 2WSMA 3HEAA 1OXSC 3GPDG 5DISB 3C87A 1SIOA 1XDBA 3ZQJA 1GITA 4RC9A 3HVKA 4I1YA 3KEGA 2WA1A 2M32A 3GJ7A 5TPZD 2NADA 4Q3CA 5KOJA 4G5SA 5TSDA 2BMEA 3JD1A 4H77A 1OMOA 3JQ8A 4W5HA 1MHPA 3MTGA 4XEUA 1JQ5A 2JHAA 4ZYZA 1A9ZA 3KVYA 3NI2A 1IXRC 2VS1A 4C6HA 4EKNB 2FNAA 3MJDA 1YUMA 1H8HA 2HO5A 3UHOA 2OFWA 4DCNA 1UFRA 1CDZA 2B83A 2HW8A 2PUDA 4B34A 2WWRA 4YRSA 3H5WA 1BYUA 5EEGA 1T9ZA 4HS4A 4L95C 1UADA 4LWZA 4Q48A 3AIOA 3U0BA 4D74A 1C3XA 4EHIA 4GBJA 2A1IA 4YJ2F 3VVBA 3V1MA 1RWQA 1KA9H 4QG7A 5E1OA 1Z34A 3WYBA 3LFUA 3K05A 2P77A 1GVHA 2R47A 3ENZA 4FONA 4IIJA 2OQRA 2FSSA 2P5SA 3PP8A 2PT5A 3TLYA 2Y1WA 1JG1A 3IMKA 4ENSA 2ZIZA 1KDZA 4LFAB 4RF5A 1QX3A 3WGMA 3G8BA 1LBQA 2NAPA 5KZMB 1YIOA 1A9OA 3ON5A 5DIFA 3CF4G 4OQNA 1JIIA 4LDAA 5JAOA 2W5UA 3GLFA 2C7RA 3N2IA 1GEGA 1K5DA 2BI8A 2EIXA 2QOEA 3G2QA 4JEHA 4L57A 4N3NA 2BCGY 3RU3A 1B0UA 2JC3A 4EI2A 4WN9B 3VMFA 1YRBA 2HXSA 3FKJA 1TADA 5IG2A 1R88A 4GE3A 4FHCA 2P9CA 3D2LA 3TB6A 3QEAZ 1TUEA 3GGOA 1ORTA 5T67A 5C32A 4OBEA 3T9EA 4FLFA 3E9NA 1CJSA 4MAMA 4PHFA 4YAEA 3RJTA 5IJXA 4DCPA 3NM5A 2BKEA 4F4CA 4G5GA 1BQ4A 1A9XB 1JDVA 1KAEA 1PQ4A 1XCMA 2FAXA 3H6HA 5DP2A 3SK0A 5TR9A 5CB4A 2JEYA 3U4AA 2GCEA 4DDUA 3QENA 3IL2A 4GMDA 4PF1A 1SCDA 2OGUA 3OFJA 4PC2A 4QXQA 4UZEA 3DL2A 4MRPA 2GCPA 3T9FA 2AQKA 2Y76A 3AM5A 4GNKA 5B3LA 4BVEA 5C4MA 3N7TA 2W2NA 4PXSA 2Y6VA 4ENPA 1AUVA 3KT6A 5CM9C 5E6RB 3O7MA 1WBBA 1BWQA 3BCHA 4O4LF 1WSDA 2POCA 1EFHA 1GG5A 5A2GA 1GLGA 4ZI7B 5BT8A 1UBNA 1CBUA 5ESXA 4GXRA 1C1DB 1BNCA 1YMQA 1N2BA 3VSAA 1FU7A 3WBKA 1D3AA 2P67A 2O7VA 1I01A 1ZRMA 2BY4A 1IRXA 3BK1A 4ZPXA 2DHRA 3VC2A 2ZQ5A 3ZZ1A 4ZI2A 4AJEA 1F9EA 1U7OA 3SDZA 1BRTA 2QSJA 1P31A 2XTAA 3CEPB 4RW0A 4WACA 1P81A 5F12A 2H5IA 5IF3A 3SQXA 4R68A 5DNAA 3UMYA 1E77A 4B6EA 3AOEA 3AU9A 2RHTA 1QOPB 1U3GA 1VG1A 1KKUA 4G0ZA 4MGIR 4W82A 5KYVA 2ZM5A 4FQ7A 3G0GA 2XRYA 3GR6A 1L7EA 3SEZA 2ERCA 2QMQA 2VP4A 5GJCA 1TUGA 1ISRA 4D2IA 3O92A 5JXJA 1SZPA 4O5AA 4XH9B 1JHUA 1IHDA 3IPXA 3HSYA 3SJ7A 3U3MA 1BC5A 3A6ZA 4FC6A 1P72A 4OJYA 4QLBA 3P0RA 3TQRA 3QJYA 5J4VA 3GRZA 3COJA 2J67A 4JBGA 1SUFA 1UMKA 3OKAA 1PYOA 1Y6QA 1UBSB 4RK4A 3NFYA 4N3BA 3UAGA 4D0LB 2FSFA 2JIRA 3G23A 4HFRA 3BBLA 2NPIA 1T1RA 1SHTX 3ZC3A 1QCDA 4Q47A 3T1VA 1UF9A 3W5IA 4D9BA 2OSVA 3IDQA 2II6A 1DAKA 2VQ6A 3OLXA 3ZJ5A 3NTOA 1NNEA 3ZDCA 4JJFA 4UEWA 2I54A 1LLCA 1NW7A 2FUEA 3DEJA 3NO4A 4B5KA 4WERA 1V3QE 2X77A 1E1QA 1FDTA 2JIPA 3PHLA 3JQBA 4Y2XA 4S3MA 4Y8VA 1LQ2A 1TO2E 5HDQA 5AKJA 3VYUB 4QYIA 3VR3A 3KZ1E 5JDIC 2VT3A 4F5DA 2EARA 4ENVA 1GTZA 2GEFA 4CQMD 3H5OA 1XDUA 5I9MA 2AFHE 2VPWA 1MABB 2R44A 1IULA 1PNOA 1BMDA 1ZI9A 3WSVA 4ALJA 5K0FA 1NONA 3E9DA 2VTBB 3SQNA 1Q15A 3CHYA 1WSWA 1SCNE 2Y0CA 2ZTSA 2ZT5A 1VA5A 2PYIA 3OOYA 4H7IA 1EUCB 2MT9A 4UDXX 5DXAA 3A7DA 4QUJA 1HK7A 1ZFNA 3N7UA 5LSAA 1S2OA 3RUCA 2YTZA 1G21A 4BATA 1JR4A 4ETWA 3UK7A 5FBVB 2PT7A 2PDAA 5AXAA 2X2FA 5E4FA 3CRW1 3TVTA 1F48A 1OBCA 3L4EA 3P5SA 1H2XA 4PYNA 3ESBA 3AVQA 2OO7A 5ITZB 1OFHA 2O0KA 2QORA 3BDIA 2A92A 2X2EA 3EF3A 4LQLA 4LRQA 3VNRA 2NU7B 1EG7A 1YGPA 3DE2X 1V9SA 3DXFA 4LWQA 4C7VA 1ECBA 2FF7A 3UBTA 3EGOA 4X6YA 4EPXA 3AG5A 1AH2A 4HDSA 3WQQA 4Y6OA 3WWEA 2CLSA 4DZTA 1V8ZA 1T10A 1C1YA 3UAYA 1N2GA 5AW7A 1TPYA 3C15C 3E7DA 4BZPA 1QLJA 4LSWA 4QHTA 4NMMA 2O06A 1W0CA 4KQ1A 4DB2A 5BW4A 3H5VA 1H4VB 1K5GA 3ESCA 3FF1A 4XYLA 3I6QA 3NUQA 1ODJA 2EW1A 4DFDA 3VR1A 4AQYB 3CW9A 3A2MA 3QWAA 4KLAA 4U02A 3HYLA 4TQGA 3TDMA 4ESOA 2WNIA 1P44A 2NUBA 3P4XA 2B92A 2WE7A 2FHSA 1Y6RA 1N8TA 2ZUUA 3BJRA 3CY6A 6NULA 3IESA 1ZK0A 2CLKB 3BM5A 3AH8A 3ANNA 1FY2A 1JFFA 3UXMA 4EG5A 2GN2A 4M7OA 1KRHA 1U2DA 2OVBA 2XCOA 1XZJA 1Z2OX 4N49A 2CL5A 2R97A 3C7KA 5DM4A 4QEKA 2JFZA 2VR1A 4OEHA 4D0RA 4M0CA 3TXYA 3VPGA 3KSBC 4ME6A 2PBLA 2L2QA 4GI2A 3OWXA 4JYMA 4OXYA 3V2UA 4E14A 1ONSA 3F5DA 1TTTA 3G9XA 1WJGA 2H1RA 1OXVA 2QRJA 4GZMA 2CK3D 4CGZA 2C54A 5DX1A 5DPMA 1XFAA 3C3WA 2W6OA 1XN4A 4NNOA 5HRUA 3ZDYB 4Q00A 1L5SA 3JD0A 2NACA 3JRNA 2FWNA 1YB2A 1ZN9A 3F7OA 3NHUA 5C8YF 1H94A 4NBRA 4QJ5A 5EZYB 1V3VA 5BSKA 2GXSA 1VSQA 5H81A 1R5OA 1ZU5A 2CXSA 2ZRJA 1OROA 2D8AA 3C5CA 2YVKA 3C6YA 3EE6A 2M1XA 2ZLBA 2ZIFA 5ILGA 4WGGA 1I2AA 1UCFA 2VAVA 5CBKA 1NRWA 4R81A 4A10A 1SVOA 3Q12A 5LLDA 2B20A 2QX6A 1P60A 4FWIB 3GGGA 4ACAA 2EJCA 3C7TA 3QPWA 1VHTA 4PTYA 4BGIA 4E3WA 2VJBA 4MWSA 2ZBPA 1YL6A 2B34A 1KARA 1ZNWA 2B99A 2HSJA 1F8GA 4NG5A 1O6FA 2NTJA 1DTWB 2JFPA 3F6PA 3HPRA 4O2LA 1NTRA 3IOYA 3UM9A 4BNUA 4Y1RB 4CKWB 3GDHA 3KCNA 4KR9A 5CLQA 2CFIA 1JP7A 2PZ8A 1LVHA 2FEPA 1UQUA 1FDWA 2V0NA 4U2KA 4D9FA 1FMLA 1B8UA 1T3ZA 2GEBA 2YR0A 3DXZA 3IR6A 4IEEA 3SJCA 3VZRA 1ZAYA 4QO8A 2FPLA 3WB2A 3GH3A 4DAEA 2RGRA 2ZWIA 3KKLA 5I8PA 3A1UA 1OIWA 5FB3A 3DWIA 3ESYA 3LC7O 3L7LA 3WGHA 4WZAB 2XF8A 4GMGA 1LI5A 1FS4A 1WMDA 4J1NA 4E22A 4E51A 1X38A 1X13A 2A5YB 1HQCA 3Q0TA 4GYYA 4TVSA 4Z54A 3VOBA 2EKZA 3V1NA 2G4CA 4IXWA 1J9GA 3VSBA 4C4XA 2JVIA 1XVUA 1JHZA 3DE7X 3BG5A 4Z0PA 3SDSA 3H1BA 2Q0XA 3I64A 1YJ5A 3ZTWA 8LDHA 3CRNA 4O4IA 1R6VA 5LPNA 2VBFA 5IRCD 1ZZGA 3JSAA 2GPWA 1FNBA 4KFUA 4RF2A 3LT0A 3N6XA 2ZSHA 1NJ1A 4MVWA 1QH0A 4R01A 4EB3A 3KHKA 4Z3DA 4ZQFA 1UT5A 4BKPA 1K7EB 3K70D 2Y6UA 3A1EA 1CRQA 2R7KA 1FEZA 4TTVA 5FTWA 5BNTA 1OFTA 1I2CA 4HATA 3LXXA 2FTKE 1J2YA 2LVBA 4W1PA 1Y5MA 3K2EA 5JCPA 4WDRA 2YZ7A 4G0PA 6ABPA 4A0HA 1UMCB 3P9KA 1OLXB 1SULA 2E0IA 2QL5A 2Y1DA 3QIVA 2Y68A 4ILKA 4PQFA 5FHQA 1Y3FE 1YDMA 1EWYA 1EVQA 1L4KA 3JTMA 3KWJA 1KVSA 4NJMB 3PUWA 5TPZA 3IKJA 2JH9A 3RFFA 5LU8A 3IPCA 4DA9A 1N6KA 5L8VA 1QYXA 3P27A 4FHEA 3FCCA 2EG5A 3NWBA 4LJKA 2IEAA 3ZHRA 1DBVO 5KPJA 2GXQA 3ZY2A 2HK7A 5T5QA 2BFOA 3F74A 5GVRA 4BO3A 1Q6YA 4CFYA 1M6YA 2H5JA 2GZHA 1UBRS 3D5EA 3HM2A 2GD1O 3OMXA 3R3YA 4R9VA 4YN3A 1IVNA 3WAGA 1NVVQ 1C8LA 3E2MA 4BMDA 3M70A 4NR0A 1Z7EA 3N2GB 2UYQA 1QM5A 3JYOA 5FUQA 4QNRA 3RQSA 1JNYA 2GDZA 2BMFA 2UZ3A 4CCAA 4BNKA 2HN9A 4JX9A 4BU1A 4HUTA 4J76A 2H1FA 1GYPA 4LGVA 5DLDA 2AFRA 3L07A 2QT9A 4BEWA 2QTGA 1CF9A 3V6MA 1Y8CA 2OC4A 3G02A 1JR3D 4JU9A 1P17A 4IHJB 5IYZB 3GPBA 3BIWA 1P6UA 5H1YA 3AFGA 2WKQA 3A6LA 5DYGA 1FP2A 3S1AA 3FIJA 4Q03A 4Q19A 4YV7A 4M76B 4EWLA 1U9IA 2DFVA 3FR7A 2O8DA 2BELA 5DTMA 4EQ6B 3SC2B 3MWJA 3W5DA 3EFBA 4I50B 5FBRB 3QELA 1GOTA 3I09A 4WECA 5DHSA 3AY7A 4ZT6A 1FB5A 3BVPA 3N2NA 1CVRA 4O4JA 1G6KA 2CYBA 5LUAA 2WB2A 4MLZA 2WU4A 3F96A 2HQRA 2ZTHA 2C92A 4PSVA 5JD3A 3IDZA 3VU1A 4OQYA 2ZTMA 1WNTA 2ZJZA 1AB6A 2NVOA 1AGXA 3AJAA 3Q7RA 4FE7A 4YO7A 2HH9A 3G1WA 3ME5A 5IWCA 3E53A 1AKTA 3DONA 3JAKB 3GO4A 1Q0QA 3HABA 4LWPA 3PDUA 3WLTA 1VLZA 5L3ZA 2BGKA 1E3WA 1WUHS 1I3MA 4AS1A 3KKOA 4EH1A 5EP3A 4LKRA 2WUDA 1WDKA 3Q0EA 3F8TA 1XWIA 5D2CA 1SBIA 4L4XA 2A57A 1U7UA 1MX3A 3DOUA 1CNMA 2PPVA 1OVGA 1EFPA 5AO9A 4TQ9A 4LC1A 4PG6A 2CWWA 4MHSA 2WAMA 4ZXFA 2VEDA 2YN2A 4X3OA 4ZJYA 2BM9A 5HKLA 3MTAA 1M7GA 1NVVR 3K9NA 1RWVA 3DMHA 3MWLA 2JGAA 2DY0A 3NHZA 3O38A 3WRXA 2QG6A 5CDFE 4W4TA 3CZ9A 3UUGA 1I0LA 4ZI7F 1W1IA 2RGNA 2VAMA 5ALIA 3O1LA 4AS3A 3ZQUA 4ALKA 4AF8A 3ZTTA 5EMMA 1TM5E 2VNAA 4IZOA 3R8CA 4FBGA 5IXSA 4L9RA 5M2QA 1Z88A 4IINA 1H1LB 5ICCA 1YXMA 4DY4A 2OXRA 2WIFA 4YJGB 1N78A 1RIFA 3QYJA 2ETXA 2SKDA 2Y0PA 4IRMA 3GDFA 1Q1BA 2R68A 3NOQA 4I9UA 4JBYA 5IC6A 5TQ0B 3T54A 2FXIA 1W93A 3MYRA 3WIUA 3WP0A 1Z2DA 4OX9Y 5BQ5A 4Z3KA 4HPJB 3BB3A 1QK4A 1OXUA 2TRSB 3QX7A 2ZANA 1TJ3A 4LMPA 1C0IA 1FQKA 2GNPA 4DRXA 3ODGA 3OX2A 3QVGA 4KJZA 4RMGA 2O3QA 1L5GB 9LDTA 1Y3HA 4BFVA 4C1BA 4GXQA 2BI7A 2EZ9A 3OTOB 1IHYA 2ODNA 1FYVA 5L7TA 5A0VA 2CMKA 2AVNA 3BF7A 3DNFA 1B4DA 1DMRA 1F2DA 3HYSA 4M9UA 3O03A 4WBSA 2IV2X 4CWAA 1WP4A 4PXYA 2CJWA 4XARA 1L8OA 3RU9A 4HAWA 1QHYA 2QGNA 4RMHA 2V6BA 3IH5A 3RT7A 2GA8A 4KUEA 4LOAA 1SU6A 2QTWB 3P96A 2DFLA 2D3TA 2QXUA 3BCUA 3K1YA 3K1ZA 1RBZA 3M6VA 2X40A 1AURA 2ODAA 1OV4A 4PZYA 3SFVA 1HYQA 2JDIA 2VJQA 3MPUA 4ND5A 3HEMA 3VH4A 5JQWA 3BGVA 5LZ2A 3SSNA 5K8JB 4P4LA 5EQFA 3GFVA 2FHPA 3B9BA 1UM9A 1RWMA 3ZLBA 4A0RA 5KINB 4R2HA 3D3JA 4KXUA 4RQBA 1ADGA 1V1MB 3U3OA 1U0FA 2Q5EA 4BL5A 2QTZA 5HM8A 3KAPA 1LS1A 1V1JA 4BZQA 1F06A 4KPEC 4WOCA 1SXGA 2OAQ1 3FWYA 3QXXA 3TLMA 4GP9A 2JW5A 5FAXA 4A2QA 3DHVA 3R5FA 3ZOKA 5CDUA 1B8VA 4V1CI 4KQJA 1O77A 2JCBA 3T3NA 1SPXA 1MVNA 4R3WA 2Q4DA 3D8RA 4CQMA 4Y9UA 1IN8A 1I33A 1NJ5A 4GZLA 2J48A 4R05A 3GLGE 1COWD 2IU4A 3LLUA 1NVWQ 3I6YA 3IT2A 4IFTA 4F9EA 3DTTA 4AYTA 4D25A 2G6BA 4BB5A 3A3KA 3TQQA 5KNBH 3AVWA 3QNUA 2CXUA 3HSKA 1W34A 1L7RA 4I55B 4JS0A 3WDKA 4JB2A 4EKIA 5BSVA 1R7RA 1UJCA 3FYUB 3E70C 3QU7A 1P80A 7AT1A 4NEQA 4Q9IA 2JS7A 3OQOA 3MNFA 3E9MA 1D04A 4X93A 3ORHA 1QHXA 2ISQA 3HGMA 3RU7A 3V80A 1I2ZA 4KYTA 1HZZC 3RHTA 1FBTA 3K0KA 1GG9A 4FYHA 1UMBB 4MTCA 4CU2A 1S3FA 4NU0A 5H3LA 2QRPA 1P61B 3EJ6A 2YXLA 4E0BA 4E32A 4S24A 4G5QA 1Q91A 1XRMA 1GLNA 1XEFA 1YACA 4PHCA 1JX6A 3CZ5A 2QRMA 1SUAA 1JIUA 4U39A 2JI4A 4EUKA 5K6TA 5KSZA 1TJPB 3O93A 1LX6A 1R4NA 4M98A 1FX0A 3OIDA 4G0QA 4X3CA 3CA8A 3CRZA 4BWGA 2XUDA 4ZYUA 2JLVA 3ZS9A 2W6CX 3EXHC 3S2FA 2PKEA 2WQZA 4H7DA 3OMWA 1RMYA 4E2WA 2EC5A 3LV8A 1MDBA 2VHQA 2JANA 1CE8B 2GZ2A 2V7EA 2D74A 4ZTUB 2GUGA 4QT4A 4W99A 4BLRA 4YRLA 2XMBA 3KKNA 4Y6GB 3T5GA 4CM6A 1XD2B 4R3NA 1KFBB 4EPWA 4DSNA 3OZAA 1E4EB 2JI8A 3LQFA 4MV3A 1RADA 4RVNA 1V8OA 4X7PA 1U6IA 4NZOA 5EPEA 1C4KA 4DCOA 1UINA 3VPXA 3Q10A 3U4DA 4TWRA 1RZRA 1D9XA 1TZKA 3D02A 5I4CA 1L8LA 1PZMA 2F17A 4I9FA 2X23A 4KX3A 3SBEA 4R40A 2QUZA 3E03A 4MQEB 5JCZA 4S1VA 2A0WA 2EHJA 4TTAA 1IB6A 4RQTA 5EMNA 3ZWPA 3KQMA 4CKEB 5M04A 1Y3CE 1EK0A 4V39A 4B32A 2Q5HA 3VAYA 5AUQA 2IYRA 3RVKA 1W8DA 1DX9A 1K89A 1M8KA 4HEHA 4TOIA 5KTNA 2ACEA 2JLUA 1IY0A 2PEYA 1P19A 4AJ4A 2X9NA 2YKGA 1YZGA 2ZYRA 2H18A 4JH0A 2G1UA 4NG4A 3A6EA 4QREA 1VMAA 2IXBA 2PLRA 4WOKA 1QFYA 3ORRA 3C14C 3QLEA 4DV4B 1DADA 4RIHA 3ADBA 4X61A 4YFYA 4ZQHA 5EZYF 4RK7A 3MWYW 4GI7A 4Q37A 3DLPX 4WTOA 3EVZA 2BFEB 1IFXA 2PLFA 3D6HA 2Z2XA 3EOZA 2Z58A 4YUXA 5COQA 4EVQA 4HGNA 3ZCRA 3UOGA 1CEYA 1YAJA 4EUSA 4Y98A 3KR1A 4UNNA 3RSQA 5EWJB 3LBYA 1SEVA 3SFZA 2IXAA 4OI0A 1DCFA 2P2CA 2FWAA 2GBFA 2AFIE 1OC4A 2CJFA 2IXFA 1QF7A 2P4QA 3TRDA 3GEGA 1RP7A 4A1OA 2P2DA 3C41J 4QLAA 3L7DA 5J2UA 4KQXA 1E9RA 3II6X 3DLTA 1IPFA 1KZ6A 3DFMA 1EWRA 3F1KA 1B8PA 4WL0A 4WD3A 2HR1A 1CZNA 3OKCA 1NVKA 3WAKA 1JUDA 4YMUA 3IE0A 1RHUA 3HWRA 5TY0A 3UMBA 4N0EA 4K40A 2QUKA 4RTNA 2XCIA 1AZWA 3FNBA 1GNLA 5HG0A 1AS0A 3LCMA 3MELA 4UQOA 1SXJE 3EXEB 4JITA 4OQZA 4MO2A 3WWYA 3DH0A 5LOVB 1K08A 1WPRA 2FSHA 2JFWA 3B60A 3CVVA 3GNQA 4NJEA 4P98A 4RL6A 4GLJA 1BQ3A 1XALA 3DEZA 4U6NA 4AO7A 1DT5A 1PZNA 1K8RA 4KYIB 2C3MA 1E0DA 1JILA 1R3DA 2QN3A 3NBKA 1JBKA 1G6HA 1A7AA 3OEEA 4G56A 3TNLA 2VPZA 3OT4A 2V3CC 3MWEB 4DXDA 2P8JA 1FFYA 1SC6A 3AG6A 5HP4A 1PT5A 2R48A 2XUQA 5ALMA 1YD7A 3LDAA 2I7TA 3NJ4A 2V74B 1DARA 2W83A 5JJKA 2YCBA 4B7CA 1X7WB 2ZI4A 4J3NA 1GV1A 4P36A 4ZJUA 2PNJA 2Y66A 2VBIA 3TLEA 5T6MA 2ODPA 2J6BA 4P6VF 2YC4C 4QU9A 5JANA 1DBQA 3L02A 3M1YA 4BLTA 1SKBA 5EIAA 1W5EA 3MMNA 1OASA 3KX2A 1FFWA 3RO7A 1CUJA 2C2WA 4TT3D 4EVSA 1XDDA 3Q3EA 1GSOA 2ASEA 1M6VA 4PCUA 4ZRNA 4AROA 3CSSA 4G5XA 5B3AA 4B3IA 3C7CB 4AUKA 1JU4A 4RGBA 4CYMA 3IFSA 3CO0S 3QVSA 1MOSA 1FFHA 1J06A 4QU5A 5E6UB 3EVBA 3MW8A 1DPFA 5AVSA 5BXYA 1HE1C 3CV3A 3PRKE 4GI5A 2PYZA 5AHKA 1KXZA 2AN5A 1PGJA 1BRMA 5C1BA 1V5GA 5CT6A 5DBOA 4OX9B 4CCSA 4ERNA 3GA0A 3ZXXA 3S5JA 4ZJPA 4TLLB 2GAFA 4M1MA 2Q3HA 3CKMA 4I81A 1K7YA 4FJ2A 1AVTA 3SCZA 1AKRA 3A3PA 3GGPA 5AFSA 1DQPA 4IVQA 3ONEA 4L8LA 4NU8X 1WM1A 1Y6ZA 1LX7A 4H7JA 5EIOA 4RZ2A 2XYGA 2VJKA 1VJGA 1V16A 3BE4A 1Y0BA 2LE0A 3GVHA 2XQVA 4KQFA 5KOHB 1OFUA 1UEJA 3SVTA 1BU8A 1L7AA 2WIKA 1BOOA 1D8AA 3FPSA 3QPVA 1IBCA 1R4MB 4Q12A 5DHQA 3VZBA 4EK9A 2GF0A 2HPAA 2QU7A 2WHXA 1RS0A 3AONB 3IUEA 1UZMA 2EWWA 1X70A 1RBMA 2E4WA 2D2VA 4IHJF 4M22A 4O4LA 5CNKA 1CYEA 4UOEA 1RJWA 3OCXA 3L01A 3LNTA 2BFDA 4ZIRA 4FZJA 2BRUA 2AC2A 1H2FA 1AD2A 1EVZA 3A11A 3KOYA 3OJXA 3QNWA 2IIBA 4WCVA 4WASA 2ZE8A 2CGEA 2HHCA 1MFZA 3V2IA 4BCBA 1EUZA 4I50F 2GT1A 3QV1A 1MTZA 4F45A 1D2HA 1JKJB 2FE1A 4N76A 4MV0A 2DUMA 2FVXA 4R1UA 5G40A 3FFWA 2PH7A 2OCIA 1SKYE 1JEDA 2EWMA 3K9WA 4BMPB 4MVYA 4V0OA 4WXEA 2LCQA 1MH9A 2QXYA 1IDN1 1MJ5A 1X8JA 1C4OA 4V0SA 3C98A 5AW2A 2VUIB 4OBWA 1L7VC 4CI9A 4CJXA 1GR0A 2PZJA 5LZ7A 4DG8A 4F38A 2JFHA 5HJ7A 1CZOA 2JGMA 1Z68A 3GLUA 2HIMA 4O4HF 2QD4A 1J07A 3N1UA 5LQAA 4DT1A 1N36B 3ZD7A 4CFSA 1K27A 2Z57A 1GRQA 4RL4A 4TXNA 2XWPA 3NR2A 4M46A 4WVFA 5KYUA 3HKBA 1QFXA 3WHPA 3U44B 4K8RB 4A26A 2WNHA 5HJ2A 4G36A 4A0FA 3Q7SA 3V7NA 2ZUCA 2VH1A 1A8QA 4HLCA 5EIWA 3PQ2A 4MHTA 4RO0A 3SXPA 1QVWA 2SKEA 2CUNA 1LJ8A 4Q4AA 5JDCA 2WILA 5K0EA 5LQUA 1J0AA 4B47A 1TU4A 5CA1A 3N0RA 2ODEA 4WKOA 4XR4A 3BFVA 3NETA 3WL3A 4FEYA 3B7PA 2WG0A 3WO1A 1V48A 2VZ0A 3HU1A 2PMBA 2SECE 2XY4A 3Q6IA 1V11B 3R0XA 4KXLA 3BDAA 4XWYA 2SNIE 3D7SA 1Z5ZA 5JVDB 2VO1A 3GUUA 3OPYI 2MINB 3LYLA 4HDMA 2IA5A 2XUAA 4RVCA 2WTEA 3KELA 5DYNA 5FOWA 4DSUA 3KBOA 1EFRA 4N5HX 1N8KA 4DPLA 4FS3A 1CZUA 3WV4A 2BUAA 3HHEA 1CULC 5CB8A 4ZAZA 4RU1A 4BKOA 1P6XA 4XB6B 4P54A 1NDHA 1Q16A 5A0FA 4PS1A 2QTVB 4H60A 3F7NA 3OECA 5F52A 3KYJB 4EB0A 1EX9A 1FJHA 4HVAA 2Q7XA 3ETHA 4PZUA 2XSZA 1FFAA 3U7EB 3DMPA 3EXG1 3W6UA 4EDFA 4AZTA 4L85A 1ZGGA 3GHYA 5A06A 2X15A 3HCOA 4DCVA 3THWA 3D4IA 1XEXA 3HUTA 5JAQA 3STTA 3JR3A 4WESB 3WGNA 4RHTA 1IHPA 5I5GA 5MN4A 1CR2A 2BHLA 3NEAA 1RPZA 2IP1A 4H0FA 1Z2NX 2IHBA 1Y3BE 2C2OA 2WJIA 1QQ5A 3B6EA 3PQFA 4WH0A 2ZIEA 3G0IA 5AKZA 2QAGB 5KYXA 1G20E 1VJ0A 1I1OA 2C07A 3O4GA 3VYSB 1YR3A 1A72A 2C2BA 3UYLA 1ZC4A 1XKTA 4P9NA 3VYVA 4RM3A 1LV8A 4MVJG 1SBTA 1R18A 1XTUA 1FRQA 5GY7A 2Q5CA 4HX9A 2NZ2A 1JXMA 3IBSA 4HNAA 521PA 2ERYA 1DO0A 3I4CA 5FPPA 1OD6A 2JIZA 4EB6A 1KJJA 1PQYA 3GVIA 5EIHA 3VZSA 4NCNA 2R1VA 4LN1A 4QOHA 4X1KA 1ZUD1 1NC3A 4H0CA 1D6JA 3H2GA 4HO1X 3WSWA 4HN4B 4BRWA 1DAMA 4NPCA 4UCQA 5K0NA 1G16A 1WE2A 1PJAA 1NPDA 4B09A 1TQ8A 1MORA 2ZB2A 3GLRA 4RM2A 3T5PA 3ENKA 2JLQA 4G0XA 5TX7A 2HCBA 1BMFA 2X3YA 2ZUSA 2BWJA 5YASA 3Q3CA 4HWRA 1TZBA 1E8DA 2Q3FA 3DL0A 4H1UA 3DHEA 3P9SA 1A1SA 3DR3A 4Q9HA 3IE1A 2WE8A 1Q57A 3DMTA 1GPYA 3W8EA 4Z4HA 3G0HA 2OT3B 2P3QA 3KEOA 2VIIA 1TX4B 1YRLA 2UVQA 3F6BX 1G8KA 3DT6A 4I55F 4PX5A 3RRXA 1LLUA 2R9VA 4A8JA 3BIXA 1CUUA 4HNTA 4MLCA 3GDWA 4PAMA 2OFPA 2YWDA 2QMUA 1TW3A 2C58A 3B9QA 4OQPA 4EAQA 5HZHA 2P4UA 1MENA 1POXA 2K2WA 5C8XA 1WW8A 1S2NA 4LV6A 5C37A 1XZEA 1TAGA 4FCWA 3BHMA 1JB9A 3OIUA 2XTJA 5A5FA 4LF6B 2WW8A 1NVUQ 4HWKA 3RC2A 4W7HA 1B16A 5AW6A 3ZW7A 1ZESA 2GRJA 5CT8A 3H13A 1BXRB 4IUYA 4MQBA 4TSRA 3RS0A 4F3CA 1Y1SA 2W6ID 1VECA 2IF2A 2P65A 3NHWA 2W4IA 3K4HA 3SEAA 4EG6A 4Z7OB 4MUAA 1EGQA 1KI2A 1O8CA 2J85A 1CDDA 3HFSA 3PL1A 4KQIA 3RUEA 4PZ0A 4TKUB 1XPJA 5C8YA 2O8CA 1BH6A 1A8HA 1FC0A 3NBZC 3WQHA 1T4BA 3GYBA 4NBKA 3MQ4A 4FYXA 4F5WA 5T8KC 3WLMA 4DSTA 4JLVA 4IP0A 2FP4B 4OUDB 3DEKA 1P1RA 1DKRA 3RF6A 3WLOA 2CE7A 3DTNA 4XGRA 3NBQA 4KL8S 2C5HA 1V7QA 4YUVA 3QYFA 1N33B 3ECSA 4OP3A 3IUNA 1FBNA 3DT9A 4GWKA 3VO9A 1UXHA 5I9LA 4N5DA 2CMGA 3AVUA 4G0UA 2JCGA 1AIPA 2TMYA 4FIZA 1E92A 1XMXA 4IZ6A 2JZNA 3DV0B 4CT5A 2PLNA 5E9AA 1SQ6A 3BDVA 1C7QA 4FOTA 1F7UA 1CVIA 2DT5A 3V4VB 4Z2YA 1KI1A 3H9EO 2BFFA 2N46A 2R6FA 2XH8A 4QQNA 4CMAA 4FLEA 4EJ2A 5JXIA 1DRKA 2F3PA 2NO1A 2ZRCA 3T95A 2BTEA 1P2BA 5H83A 4Z53A 1YOVA 3E23A 1B6TA 2QMEA 1P0MA 2FZLA 2JF0A 2RC5A 2BP7B 3ADOA 3KUKA 2IXTA 4LCEA 3U9TA 3WNQA 1JHXA 4AXBA 3MJCA 1SCKA 4RY8A 4R84A 2CXOA 2FUKA 2IEBA 4TS4A 2WNSA 4P83A 3BWEA 4W5WA 3U4QA 4DLKA 4MDEA 2BD0A 2N9UA 4E4RA 1B76A 1XCBA 4ZT4A 4GPZA 3I2KA 2JL1A 3JQAD 4Y1EA 5LCXA 1NKVA 1HFKA 3S1SA 1T5HX 1JJ7A 4RA6A 4MWEA 4R8KA 3V32A 3GNLA 2NV6A 5DU2A 3URMA 1WXFA 5JY1A 1QIJA 3M3HA 4XSVA 5MF6A 3BGIA 5KNDA 2CW5A 3VVMA 3JWJA 4ZP1A 1BW9B 1NP7A 4I5GA 2JAPA 2RG7A 2WIGA 2XE8A 2QM0A 3FYSA 1V4BA 3H1EA 4IDDA 5A62A 3E8XA 4TTRA 4EGFA 1M54A 1ZD1A 3OOHA 3DDOA 3C8HA 4CM1A 2F64A 1KMMA 2FWJA 2IP2A 4IG4A 2IWRA 3VM6A 3F73A 2RGDA 4XJSA 3SI7A 2UZ4A 2G5TA 1H2EA 2CC2A 4YDSA 3SD7A 5GOZA 4KRYA 4TRMA 4TMKA 1AQUA 4P22A 5EJ7A 3S6JA 2FG5A 4PPQA 3HJAA 3VPAA 4BUJA 1J09A 3JQ6A 3K5WA 5J40A 3SSOA 3IP3A 3RR2A 3UK1A 4Z3OA 3IA2A 3X3HA 4A1FA 2Q62A 3ZNQA 2KX7A 2VAXA 2FKNA 5IVDA 3VHQA 1XCLA 4NE7A 4XUGB 1JDJA 3WLFA 1ZW6A 4P3OA 2G9RA 1NUUA 1DFGA 1N2EA 3FWKA 3MBOA 5FUWA 2MU1A 1W0KD 3SZMA 5B1EA 2OG1A 3ZH2A 2PZKA 3X2EA 1ZGZA 2PBZA 4R2XA 3VX3A 1X7ZB 1VE5A 4BFYA 3DBIA 2QJTA 2JZCA 4N1AA 4BP8A 4TM8A 4Q16A 2HUNA 4K9NA 1WKCA 3IOCA 1QS0B 1R0SA 4OHCA 5FUBA 3P2OA 2GFIA 3QBTA 1QWSA 1DKQA 1O03A 2PX4A 3QLUC 4FM9A 2ZOSA 4KO3S 2WD9A 4PLPA 3R4CA 4LSZA 2UZ1A 3PTZA 4PHHA 4Q9DA 2B6HA 3ZWYA 1JHOA 2DCUA 1OB5A 4G0YA 1Z36A 1IONA 2HREA 1YZYA 2DCMA 3AKEA 2J0QA 2RONA 3DFFA 3W2IA 1E79D 3QA9A 4UULA 4LBYA 5ECDA 5MN5A 3J7TA 1BJKA 2QR3A 5DNWA 1KK1A 1N6OA 1PG2A 2C5LA 2WHPA 3AILA 5EMLA 3GJTA 3V7FA 3WMWA 4POAA 1XKXA 3K5HA 1UBUS 2ESRA 4IIVA 5HE8A 1W5AA 2J6IA 3R3XA 3RB8A 4Z49A 2ORED 2PMCA 2NYVA 4MNTA 3CUWA 4LJ5A 3K3PA 4EFKA 3LT4A 3PPXA 5ITWA 1OT3A 3CE9A 2Q8NA 3U3RA 4KRFA 2I2AA 2XWSA 1ORHA 2GVNA 2XKBA 3F2IA 4HRAA 4TTPA 3V9AA 1KETA 3P52A 4N3CA 2JJ1D 1PV4A 4BNTA 5J1SB 3J81A 4D9HA 2ATCA 4KVZA 2Y99A 3ZHOA 4D8TA 2PD4A 2D7JA 2PZLA 2A3NA 4D4IA 5JD6A 3M81A 1S96A 3ASZA 2AF3C 3PPWA 3OZIA 1QP8A 1ZC3A 3CUSA 1SCUB 4Q7KA 4Y2YA 1Z6TA 1C8VB 2IODA 1U3CA 3KT3A 4KDRA 4C89A 3A6PC 5G02A 3EUFA 4BV9A 3T7SA 1TUBB 2BFNA 4I6EA 4DTCA 3RBAA 5IX8A 2DJ5A 3UAZA 2W98A 1KMNA 3BL8A 3MLEA 1D2NA 4QE3A 2HLPA 2NU6A 4C7XA 3DZHA 3K1AB 3PYXA 1AS2A 2VJCA 3DVSX 2P0EA 3GT7A 4FUTA 2I6GA 5D3QA 4D9IA 3OCCA 3UAOA 3ND5A 4XIFA 2OILA 4ND3A 2QBYA 1J0EA 1V2HE 3HU3A 4BJ3A 1J8MF 4PW0A 4L2IA 4IDCA 1A5AB 2G1JA 4ZO9A 4EITA 1JKXA 1QG0A 3HB9A 3OH8A 3AKCA 3AO0B 3OX3A 3RFXA 3S44A 4C4PA 3ZLTA 3DAGA 5JZBA 1C1DA 2BBOA 3CEMA 5EI5A 3B1ZA 2SKCA 2GD0A 5BR8B 1NF9A 4Y2RA 1SD5A 2JJMA 4F3NA 2SBTA 4JR2A 1DIBA 4OMCA 1RE0A 4QYMA 4DIUA 5BSEA 3R6DA 2BMJA 3DLAA 5LBTA 1KAGA 1XNQB 4WSOA 5K6AC 2ODQA 3F9CA 4OKNA 1SEPA 3FW1A 4J4HA 1JYSA 4NU5A 5HUHA 1U3DA 2CFRA 3CQ9A 2FXVA 2R8YA 4R0MA 2J9GA 4ZMSA 4NARA 1LV7A 5CFZA 5I7OA 3FNGA 4YMSA 1XP8A 3ITKA 4PNHA 2PVCA 1P9NA 2PRJA 4JV5B 4XRRA 5H8WA 1ZLXA 5F2NA 1M2OA 3KWLA 4BRUA 3KWFA 1GNTA 3ZCXA 4ZYLA 2W2QA 3ZCVA 1MX9A 4IHKA 1D07A 1P4JA 1K2WA 3SBDA 1P75A 5B7NA 1DIAA 1W73A 2R751 3D4PA 3HUEA 3RK4A 1J49A 4JLPA 4RKFA 1JYEA 3TBFA 1SBYA 2CNLA 5F35A 4L4UA 3IQIX 4EG3A 2GEJA 1H2WA 4RBNA 4MUXA 5H68A 1V5EA 1W4CA 3AIKA 3AL0C 3C43A 1ICIA 3C74A 3OKFA 1ORRA 1Z8NA 3Q72A 3LUCA 2RJOA 3O6VA 3LBHA 3RC8A 1I6WA 1RC1A 1E63A 1H4QA 1ZJ5A 1CEEA 1VB5A 3NAMA 2O3SA 5CBPB 4EAAA 4IXTA 3VR2A 3W3ZB 3CLUC 2AOXA 4FYKA 1U2GA 1U28C 4G5YA 3W5CA 4OD0A 5FBKA 3GJQA 1M1NB 3IEKA 4NOKA 3PYLA 3L0DA 4K6CA 3UJ7A 3V97A 5KO2A 1CJVC 1LC3A 2C5EA 3L3BA 3TNJA 4EP1A 2R7AA 2CDRA 4L8WB 1GQSA 2QGFA 2HHLA 2GAAA 4JFRA 4YPFA 4BHTA 4OSOA 5DOVA 2C1XA 5JCXA 1GCOA 1E3MA 3ZK7A 2YNMA 1LPBB 4QASA 1UOPA 2JHFA 1TO6A 1G5HA 1T35A 3U1VA 3PG5A 4E2ZA 5FBHA 3R23A 4DMHA 5F64A 1KEZA 4L6AA 4U6QA 4EEZA 5K7SA 1NAHA 2HMAA 1KP3A 2GDJA 4MGKR 3SXUB 4D02A 1AO0A 1EUCA 1N57A 3H17A 3PE6A 2W4MA 1FDSA 2Z2JA 3RVOA 1WBDA 1NKTA 2GCIA 2VYQA 4AJKA 2A35A 4Q4CA 1SM4A 2G1PA 4DJTA 1NR5A 4CZ2A 3U61B 4GLBA 1LTHR 3KT8A 2N3ZA 3WNZA 3ABZA 4XRGA 3FVTA 4K9LA 3S2UA 1C3OB 5ALUA 2GN1A 2F1KA 4ITRC 4JOCA 5AJUA 3WRYA 5DTRA 3N8DA 3DMNA 3UO8B 1T4GA 1JBEA 2WSIA 4U0JA 7MDHA 2JVJA 4D92A 3A31A 2CNBA 2C0PA 3Q9SA 4BFLA 1IIRA 1B0PA 2E4XA 3NNNA 2VFAA 4ZCPA 5HPYB 1F7VA 4TRNA 4OLFA 4EFDA 1WCV1 2ZB7A 2FYTA 3FNQA 4FYVA 5A6SA 4BQEA 1E58A 2PRZA 3MOIA 4UHBA 1O54A 4Q15A 3QXJA 5KX5B 4BO4A 2VBGA 4L5IA 4ZU1X 5A5GA 3KQHA 3TSYA 1E94E 1GKYA 4QYTA 1FSFA 3P4UA 5IZCC 4FFPA 1ZY2A 2HCRA 4KPFC 3O75A 3KB2A 1CRWG 5HMMA 1JTEA 3QXCA 16PKA 1EXWA 1RRPA 3CRQA 3OX1A 4ND1A 4ETNA 1TIBA 2ZSIA 2OBFA 1P9OA 3G82C 5SV2A 3OJOA 3O8BA 1IATA 3COPA 1OKKD 4XJVA 1IL0A 4YP6A 2A9JA 4DLLA 2IOFA 4IX1A 1JZTA 1CR4A 2BR3A 2D06A 1QK5A 1ELOA 3MRSA 1KQGA 1V8FA 5FUXA 4YPOA 3MTEA 4IFEA 5DXJA 1CIVA 3PNSA 3PGA1 4CDGA 6AT1A 1LWNA 1TYZA 1EU1A 1RQPA 1TD1A 3IRVA 2OTCA 3LQ2A 4P0TA 5K1ZA 1JJFA 2CXPA 4P7BA 1FJXA 1P0IA 3WP1B 4M1KA 4C3ZA 2CNOA 4EY7A 5I8WA 3I05A 3DNPA 3IV9A 3GW8A 4I5EA 3UC5A 1PX0A 3RWOA 4FJ0A 2C7OA 1SXJC 1ACMA 4F3TA 2Q6OA 1QYRA 3HKEA 4JHXA 4WQMA 2YXEA 3LL4A 1GA1A 2G08A 5E8RA 3ICOA 5AKGA 3GMIA 3A9VA 2RHRA 5AVUA 3PCRB 3QVVA 1GZ4A 4K8OA 1XMJA 4CIXA 1MZPA 2TS1A 1D1TA 1ZKDA 1M7HA 4G4SP 1VI2A 3K9BA 3BERA 3OE1A 2LCIA 1X1EA 3NOOA 4G9GA 3ZGVA 1GTL1 3P2EA 4EJSC 4KSBA 1BN6A 1EH5A 1OYVA 4AG5A 3CWQA 5KOYA 3PUIA 1ISFA 1SBZA 4RYLA 3L7BA 5FULA 2ZIXB 2HEIA 3ZUGA 1ZD2P 5G0UA 1M6NA 3RYTC 3RYFB 3UMVA 1E3JA 3COZA 4Q3BA 3KTOA 4OB7A 2GMWA 5CUQA 5EPUA 3IP6A 1UK6A 3VX4A 2DF8A 2LXNA 1VSVA 1KPIA 4KMSA 2FPRA 1WPGA 2IELA 1NW9B 4PXAA 4Y1RA 1MTOA 2AV6A 5FNVB 4H35A 2A9RA 3B5JA 3HR7A 2Y0BA 2J0UB 2B1JA 1QC5B 2R6R1 4CM4A 1I3CA 3QBDA 1KMCA 4YCDA 3SQDA 1W2WB 4V0KA 1XCJA 1EVJA 5CDYA 5DOZA 1DUSA 4ESVA 3HA2A 1S2GA 2XIJA 5C0OE 1ILEA 2IQIA 4GMFA 1U90A 3CS3A 3D81A 4P34A 3GT0A 3SBOA 4CV2A 3FPLA 2BTQB 4MVJE 4XAQA 5LB2A 4WZAA 3RIMA 1XZPA 4LRXA 3EZNA 4TX1A 4RZ3A 1XA4A 2CCJA 4YJ3A 3R7DA 3TW0A 3A1DA 5LZ5A 1ULSA 3TLJA 5EJEA 1T5LA 5ALDA 1KDRA 3RVLA 2YN4A 3EWNA 3NP9A 3WIEA 3O2JA 1YJBA 3GLIE 3NHMA 1DQNA 1A82A 2D54A 3A05A 5DHTA 3H9CA 1A71A 3NT4A 3SR3A 4B3HA 5HMLA 3UPDA 3HB1A 2XUKA 1Y8AA 4CLDA 3TAHA 1SKUA 4I1IA 4DLPA 4C2TA 1JPVA 3HACA 1B0ZA 1DC5A 2ZT8A 1SXPA 2GCGA 1CZLA 4KFSA 4F56A 1XMVA 4GWLA 1WTAA 1G3QA 2XTMA 1GTJ1 1ANKA 4MWOA 1MIOB 3A7EA 5JAHA 2OWEA 2PFKA 4D5GA 3DD5A 1JAYA 3GCZA 3SC6A 1JMYA 1IBKB 2GK4A 3K6KA 4AZ3B 4BNYA 4OVKA 5EUQB 1CHNA 4C3OB 2CNDA 2XTZA 3DTVD 1CFZA 5CVVA 2QQEA 3DPSA 2REQA 2PQ2A 3AX6A 4FNOA 4O2RA 1JDSA 4NJMA 4NL4H 4P32A 2HTFA 4G85A 1NBMA 4GE0A 1Z4QA 3IP1A 3VH2A 4C7BA 3W5VA 2A33A 3RRNA 3ZVKA 4DDHA 1Z2PX 4HNQA 3NTXA 1I4EB 5CCXA 3C1TA 3Q5EA 4LYGA 4P4SA 3AHEA 3OI7A 2I0FA 5FI0B 1I24A 4WX2B 1PWEA 3IIJA 1RCUA 2Q2OA 5SY9A 4DMUB 1T9AA 3BIOA 5J4HA 5JBQA 1XQXA 3D59A 2WHRA 3G2PA 1XTBA 2R8ZA 1S2MA 1OGYA 1CWUA 4AMGA 1O8BA 5BXQC 4QICA 3FOCA 1HM5A 2BE9A 2ID4A 1L4GA 2MDTA 2W9XA 3KQTA 3DMDA 3NVDA 4MW5A 4BNIA 3QI2A 1W581 4RQAA 1W0JD 4GFDA 1RKVA 2PSHA 1A9TA 3FPEA 2QL7A 3D6JA 1B8OA 3R0ZA 3HB0A 3SJBA 1MUUA 3P7MA 1E64A 3AFMA 5ALOA 3C3PA 4A8TA 3T3GA 3FZQA 4Y2JA 4NC9A 1I13A 4IHJA 2NQTA 2CMDA 3SU8A 3HWX1 3KHUA 2XVZA 1T2EA 1A5SB 1QQ7A 2GKOA 3GAMA 3GI1A 3BGWA 2P2GA 4XOUA 4EQ6A 2YJNA 4I50A 4J8PA 1L4MA 2JK1A 4GBGA 1Y34E 3DDSA 2QM3A 1ECLA 4ZQBA 2A86A 4IWXA 4V24A 5BPFA 1S0UA 5BORA 2YYSA 4J0KA 3OQIB 5J59A 2FVYA 1T5IA 3PEUA 5CD1A 1DKPA 3CNQS 3HDGA 4DWJA 3AYZB 1Q1AA 3TQOA 3GJRA 1QV9A 2G28A 2NTVA 4O4HA 5K99A 1GRRA 2I4MA 2QN2A 3ASVA 1XTRA 3KJZA 4DYHA 3VNUA 1SB9A 1ZPDA 2JAUA 3FIUA 5EWLA 2LP4Y 1Y9DA 2P62A 4XKJA 2FMHA 1P7YA 1ZZEA 2VT2A 4WA8A 4BWYA 4GQIA 4B73A 3CLSD 1TF5A 1GTG1 3FPJA 3LHIA 5IK2A 1X9GA 2OYRA 4OHKA 1X1BA 5K3EA 3FMVA 2ZYWX 1SOVA 4II7A 2PQMA 4QECA 4QYWA 2ZYUX 5E7IA 1HT1E 1YE3A 5REQB 1CUXA 5IJZA 3DCJA 1MRSA 4WZBE 3L7KA 5DJ5A 2DU8A 3TLCA 3VZDA 3UK0A 1QG2A 2VDNB 1J2UA 4KH0A 1FPQA 3JZMA 3HJRA 3HU2A 4WLNA 3WG9A 3ZR4B 3F7TA 1ZUHA 3NX4A 1E0JA 4ER0A 3LVBA 1U7PA 4CG2A 5ISMA 1ZN7A 3SEQA 1X3LA 1EFUA 4GICA 1YZQA 1WB9A 4QHSA 4LV5B 5B4UA 1QKKA 5DSZA 1A4IA 1AZLA 1DJNA 1T1JA 3FRHA 3ZNPA 1PGOA 3ZY5A 2HMWA 1QG4A 3GG2A 1QYVA 4JY7A 4GVPA 4WXPA 4I9NA 4YJGA 1H5UA 3LOUA 2NT4A 1PSWA 4LS3A 4NDNE 5KQSA 1I8TA 4TS3A 4YAFA 2GTPA 2QYTA 1ESMA 5TQ0A 3TLXA 1VPWA 5FV7A 4YT5A 4ARSA 1IC6A 1RJDA 1PR3A 3EW7A 4IVNA 4KGVA 3RVRA 4NECA 5JC8A 1LPOA 2FUNB 3GFPA 2ODWA 4F5YA 5F5XA 3R7WA 2HZBA 1DRUA 4K9RA 3C3KA 4NZMA 3OF2A 3OQNA 1GUYA 1H2BA 3OCZA 4KACA 3UOAB 3KIPA 3JR7A 4LVCA 4JHLA 5CITA 3VDMA 4FEEA 4F1KA 5BQOA 3CF6R 2C9BA 2XMZA 1OX5A 1AKVA 1IY9A 2B7CA 5ALTA 3FSRA 1RQNA 1II9A 4X1YB 3MTQA 1NXWA 1N6IA 3NC0C 4GLLA 3TRKA 3A4NA 2DC1A 1HNWB 1XU9A 1XO1A 1UJ2A 2F3TA 2YIDA 2R96A 3E4CA 3EDOA 3ST7A 4JIMA 3UH0A 1SD1A 4ZCLA 3CCBA 3CPSA 4F71A 4CM9D 4F2HA 1QE5A 4OQFA 2AK2A 4YIKA 1NSTA 3VU9A 4G8CA 2EP8A 4RWEA 2XPCA 1U94A 3GT4A 5EOVA 1COZA 3TX2A 2JD1A 1NIJA 1V1MA 4ZANA 3RS8A 4ZAWA 1O1YA 1GZ7A 2PU5A 2X5JO 2C57A 3GRCA 5FR1A 3QVKA 1XVIA 1PJ4A 2I6QA 3UK6A 4WI1A 3EXFA 1ZGCA 2YQ5A 5ESWA 3ZCPA 4AY3A 4IJVA 5LXTF 1DINA 1Z5UA 2PR2A 4C0AC 5KQLA 2QJFA 5DWDA 5IS2A 1ZLYA 3RTDA 2I62A 2OXTA 3E7PA 3NCTA 3CMCO 2PEZA 3RVSA 3S0JA 2GLXA 4ZV4A 1ISHA 1QVAA 1YVPA 4GOJA 1LK0A 5IBCA 1C0LA 2OEPA 4NLLA 1OBHA 2HTEA 4X20B 3EVEA 3MN1A 5AJZA 5AUNB 5HM6A 1T1IA 1MHTA 5MHTA 2QD3A 4JT2A 5TV2A 2WYHA 2EFCB 3IV6A 4TPKA 4J0HA 4B4DA 3I9V1 2P7HA 2O50A 4QVGA 2ENUA 1V8PA 1FCJA 4R1OA 3FYUA 3ZHBA 4U0KA 5ALKA 5JWOA 4PFQA 2PVPA 1HLFA 2VA9A 1KEUA 1NVMB 1N6HA 3F1LA 3MF4A 4WE3A 1J8VA 4BX0A 2ZWPA 1L3CA 1N8NA 5E8JA 5AJVB 2Z98A 2VCYA 4E5SA 4RTQA 5LQDA 3FYTA 3QGMA 1RABA 1UMBA 4W7SA 4BQQA 3EGCA 2IOQA 1OPRA 1GTMA 2OGZA 3HMKA 3C16C 3PS9A 1OFIA 2BFBB 2F90A 5DVZA 4PG5A 4BC1A 2Z5LA 3LVFO 1I7NA 4R0NA 3O8OA 3ZH9B 4IGKA 1OI4A 1A9RA 2DBQA 3E5MA 4RVSA 2YWXA 1KOFA 1TKCA 5C46F 1J5PA 3LLSA 1DRVA 1MO3A 3JQAB 1U3WA 3PT5A 4DF3A 4DQ0A 3TIIA 5BW5A 3GLHE 2PUFA 4ZVLA 1Z0ZA 1EBBA 3K53A 5LWQA 3M5DA 5KX5F 3U13A 3EXHB 4BUCA 1CE8A 4E5MA 1VJCA 2R5WA 2I6FA 1EGHA 4G9EA 5BWLA 4CXMA 2WHEA 2Q5JA 3MTDA 5J5VA 3AW8A 5IBRA 3T3HA 3N76A 2V5UA 1OFVA 1DVRA 3A3OA 2R25B 1RI4A 1XD2A 3RRBA 4CMEA 3EN0A 1FE8A 3IDOA 1E4EA 5IBQA 2ZM6B 3K9LA 1XZAA 2F1RA 3KV3O 4JP2A 1FYDA 2AL7A 2RAPA 1NJSA 1I4WA 2CL6X 3ZLVA 2LPMA 2WM9B 4DNPA 2CHEA 1BA2A 1R8QA 2RSLA 1GPLA 1NQTA 1OW3B 2FP3A 2XMQA 2ZAIA 3L7NA 3PKJA 4J0QA 4FMBB 1FQJA 1LRJA 1PTJA 2ZT7A 2PANA 2GYYA 5ADVA 1CPYA 1WV0A 3SDBA 3DOHA 4NI5A 2QMYA 1TZCA 2YINC 4BX8A 5ABPA 3CNEA 4BXOB 1O6GA 2FEAA 5JE8A 4LI0A 1U11A 3F3MA 1N9ZA 4UQLA 3L4SO 4K5QA 4CQNA 3BZUA 3BXHA 1Z15A 3L8HA 1A97A 1W35A 4JNKA 5FPYA 2GVDC 2ZTUA 2IYLD 2BGGA 2WM2A 1RM4A 4QELA 3EZXA 1BROA 1NQAO 3ECCA 4RH3A 1NASA 5AI6A 4FFBB 2Z2ZA 3MGCA 2ZRHA 1HG0A 3GMDA 2BFEA 1PUXA 3FDFA 3UJ8A 8ATCA 3LQKA 4RTMA 4GZ3A 1JYFA 2ZUDA 3X44A 5A4FS 1XPOA 3A4MA 4OLJA 1A1VA 5A4JA 2ACWA 3DMFA 2O6LA 2AW3A 2FWMX 4ZDWA 2OQ2A 1X8LA 3STVA 4XCVA 5L3QA 2VOJA 2D59A 4G5RA 4M1TA 4QL3A 4HADA 3MHPA 5EWJA 3H11B 3ZDAA 3Q2OA 2QRZA 4RMIA 4C0BA 4F3YA 2YMQA 4WA7A 4TTTS 1IQ0A 3EA4A 1BKDR 4K9QA 2FX3A 3AF6A 4WY2A 3FPHA 1WSAA 2P1RA 2P4SA 1MDFA 4LE1A 2Q1UA 1MVLA 1QLHA 4JI2B 1HSOA 3BXXA 2F3QA 3KVNA 2VSYA 4NE9A 4F2DA 2L42A 1CW2B 2ONZA 5FOSA 5JPDA 1F6WA 3A6HA 3D6VA 3GAZA 4E5VA 1HEIA 4ABTA 3RWMB 1Y6JA 2V98A 3BMQB 1H1TA 1TTHA 4Y0AA 3C1OA 2HA6A 3AUSA 4G8DA 5KTTA 1YR9A 4CTJA 1AE1A 3INNA 3EIWA 1HNZB 2C8VA 1V5FA 1J4AA 3ZN2A 1JU3A 1HZJA 2M6SA 1ST3A 3ZCUA 1SXJD 4L4YA 1LCIA 4LYFA 2C20A 3PFNA 4PZLA 4CM3A 1SBCA 1TU3A 3ZD9A 2GPNA 3IIMA 1QMPA 2V7QA 1HEYA 3AB3A 4R7ZA 5F2OA 4MITA 3VRHA 3WADA 4AMZA 3QJGA 3MWEA 4ZEMA 5KSWB 5AKIA 3CVXA 2C96A 4KVGA 4GBMA 2HJWA 1EDEA 1J0XO 3H05A 3DW3X 1FFEA 2GX6A 3OZBA 1K63A 5ESRA 2DQZA 1W4RA 1A8UA 4MW1A 4RA9B 3MINB 4X3PA 3RC3A 3CINA 2EHDA 2QT0A 3AJ8A 2QE7A 4CV0A 1X7WA 2QHXA 4EL5A 1VIYA 1Q2UA 1PVDA 4NONA 4RZIA 3OP4A 1PFKA 5HTKA 7YASA 2HGZA 4RHCA 1UC5B 3TVYA 1E6WA 4MCIA 5FI3A 3AI7A 3TG2A 1AUXA 1CUSA 2O1EA 4HLUC 4CMHA 4Y9DA 1SKAA 3HBLA 4N5LA 4KNVA 4DMGA 4NCBA 4QPCA 1L1QA 1BVRA 4WRRA 2HF8A 3I9NA 3HHPA 1GIAA 4MR9A 3RJ9A 4EJFA 1I51A 2OD2A 1I36A 3EC1A 5DW3A 4MI6A 4IJWA 5BN4B 2ECOA 3DTVA 3WYCA 1JA1A 4C01A 1KR5A 4FWBA 4OLHA 5E6UA 3ZZ0A 2PPLA 3RAPR 2PQ0A 3AC0A 4DLNA 4XWOA 5BR4A 1ZR2A 3TLZA 2NP7A 2PA0A 4ZOEA 3EFOA 4ZMBA 4R54A 3AU8A 2W0MA 1O5IA 3TW4A 5LBIA 4IGAA 4OQXA 3ZTYA 2EXXA 4AP5A 4HZUA 1KMHA 1XSEA 2ZCUA 4FYPA 2XB6A 1X7YB 1ZJZA 1NNSA 2KSQA 4LC0A 1ETUA 4F6LA 2HEGA 4RGYA 5TS3A 2R4UA 3TPZA 3FFBA 3EIQA 3UT5B 1GLVA 5K3AA 2NVUB 3TK1A 4YRMA 2GLTA 2CV1A 1K4MA 3H9JA 2ZZMA 1Z5WA 4BQSA 3Q9LA 3R9KA 3UGKA 1EFAA 2QQGA 4I6GA 3E7XA 1CUIA 4LYHA 3RVPA 4MINA 4YAOA 3G5LA 1E2FA 4WOBA 1L5KA 1T3TA 3SLKA 1PYDA 3UEOA 3DAPA 2OSBA 4KIFA 3EIFA 4D43A 2P1ZA 2DQSA 2QSUA 4QRHA 3PNBA 1QYDA 5IHPA 1GSHA 3LM8A 3VBEA 4Z99A 3CWCA 2OUIA 3C3BA 3O74A 4ARZA 5EQJB 1EP3B 4IQFA 3SY8A 5THXA 1RPTA 2FSVA 1JKIA 3OOEA 3WTBA 3TQCA 2WUVA 3P94A 1XIVA 2IUSA 1KI8A 3KTAB 2R1ZA 4G01B 2PRSA 1EB9A 2QN8A 1M0EA 3IEVA 3W6OA 2FA9A 1JKJA 4YRBA 2VHZA 3M2TA 4QGAA 5KMGB 1KIAA 1SQGA 2WFZA 2NNWB 2W43A 4Q7JB 3M6UA 3K09A 4RV5A 1ZD8A 3OTIA 5B2ZA 3NNDA 2AH5A 3NVMB 1KVUA 1MC8A 1SK8A 1Y4UA 3MUFA 2I3GA 4ISCA 4KJXA 4Q4JB 4AWAA 2AC7A 2G5CA 1ADBA 2BMAA 1QU3A 2F55A 4LY6A 2A94A 3NBAA 5M7EA 4ZZ3A 1YQQA 2FFJA 2P30A 3BQMB 1MB2A 3PITA 4TN5A 4D8YA 4C0SA 1D4ZA 4XDHA 3LIPA 3PVSA 4QJBA 5I7HA 1ZJ4A 3D8NA 5KWVA 3NBXX 5HF5A 3TTTA 4G0VA 3NRJA 4FB5A 2KS6A 3VI3B 1S1MA 2QVLA 1L1FA 1M33A 4FUQA 1WY7A 1GNPA 2AFHB 3L04A 4C7KA 4MJ7A 1SG6A 1JECA 2G8LA 1R0WA 2W8BA 3OU2A 3QLVA 1RQGA 4R98A 3SNHA 5IFKA 5K2OA 1TW2A 5F98A 5CAEB 1Y8RB 2CFSA 2PX2A 3E3NA 3HZHA 2J5KA 5CVDA 4EFNA 3U4IA 3I3OA 3QG5A 3V42A 3ZIUA 3TW8B 1VJ5A 4M1WA 4RVHA 1G9TA 1NPYA 1PWYE 4OHFA 4GIBA 4Z51A 3MOGA 2MINA 1QFZA 4NNPA 3G7SA 1XT6A 2X1LA 4M8IA 4PYKA 4C7JA 4RCZA 1Q0TA 3BXPA 3KETA 1M2VB 4S1TA 4UCFA 4J3JA 3TTYA 3W1VA 3D5TA 1R50A 2ADOA 2DM6A 1RSZA 3TMKA 4D44A 1YV9A 2FCRA 2B1GA 1K86A 1H93A 2C3UA 1UXGA 2R00A 2OB2A 2A1UB 3K0CC 1OPXA 2MSCB 3QE0A 5CNIA 1CQWA 3WX0A 4IJMA 1IJEA 4R16A 4WFJA 5FPHA 2G82A 1EQ2A 4IIEA 4DZRA 1PRYA 3GGCA 3UWSA 4Z8YA 1FQWA 1OI7A 3AY3A 3U3KA 4IEFB 4RMJA 1TLTA 3CEAA 4XIJA 4DB4A 3ZDBA 2MSNA 3LKBA 3I62A 3L0ZA 4MQUA 4E3ZA 4WESA 4BC0A 2V7GA 3ONVA 4MPDA 4ECEA 2XKKA 2IHTA 5JO9A 1D2RA 1O9HA 3HV0A 4XB2A 3ZHSA 2G06A 3BE5A 5EZ5A 1WETA 3GCGA 4MUYA 1WW3A 2C0QA 5AI4A 3ER9A 1MB9A 1KFKB 2NQ2C 5JNSA 1TKBA 1F2VA 3X43A 2QAGA 4TZTA 3RIHA 1CLEA 4RTPA 1SC4A 1R37A 2C9CA 2CNNA 1N4DA 4X94A 2W00A 1QH1B 4UAUA 2QJOA 2PXXA 4ODIA 4CM9A 3T6KA 2FW1A 1F0KA 2Z08A 2H2GA 1V5WA 1Z25A 4OCZA 1PW7A 1JL3A 4B7AA 5CDGA 3N8NA 3L7IA 1RC8A 1G1AA 3FHCB 4JKOA 3RVQA 2CLIB 3HWWA 4NZPA 3WYAA 1LPAB 2W2LA 3PRJA 4X45A 3RUPA 1OWMA 2V0GA 4QXRA 1PJCA 4DQLA 3OAAD 4CEIB 1AY0A 3TBKA 5T3YA 1VCMA 2ZSAA 3RJZA 3BTUA 1CG6A 3U19A 3AKZA 4M86A 1CUWA 1U3UA 1ADYA 4KHZA 4K9KA 1P1IA 1W46A 3V9PA 4BGDA 5AWFC 1NC1A 2NG1A 4IUBS 4BNDB 1WMBA 1Q22A 2VDWB 3BK7A 4R69A 1OJLA 3SQLA 4AK9A 4BEBA 5LP6A 1JXOA 4UPVA 1K7FB 1YVRA 5CFRA 1U0NA 1LQTA 4ZCQA 4YY3B 1BMTA 3RABA 2YS6A 4RDHA 4XGIA 1V5IA 1YKSA 2O54A 4PGFA 3FDZB 4Y9SA 1AGYA 4JJ7A 3TTSA 4LTNA 5H4GA 1PS8A 2OK7A 3L8EA 5LC1A 2P6UA 4U7PB 2CUKA 421PA 3AJEA 3GWZA 5AKKA 2DGDA 2C2KA 2CD9A 3KQVA 3ZE8A 1CETA 3AV0B 1W48A 1IJFA 1MCZA 4F11A 3PWSA 2I3BA 4WVLA 4BUZA 4P5EA 1U7HA 2F3UA 1ECPA 1Z0FA 3B1WA 2X41A 4Q7LA 4R9RA 1V71A 1VRWA 3CIFA 5EXTA 3EGDB 4MYUA 1VIMA 2HBYA 4WKBA 1QTQA 2PA3A 4B1FA 1IDOA 4Q7QA 2IJGX 3RS4A 2WWIA 2R5NA 4UKDA 3ZHTA 3TQIA 1SBQA 5HFJA 3T8YA 4TKUA 2OCX