2F3TA

Crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanylate kinase
publication title Crystal structures of GMP kinase in complex with ganciclovir monophosphate and Ap5G.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2f3tA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f3tA01
1OHHD 1ANKA 1IY2A 1UJ2A 2PX0A 5GADl 3TVTA 1FX0A 2XJ4A 3SE0A 3PIRA 4GT1A 2FEOA 4L9WA 3RSLA 1XD9A 1Z5ZA 1KY3A 2OE2A 5JSZB 1MV5A 1M7HA 4WAUA 3CKLA 3PQCA 2VF8A 1OXUA 1R5NA 1UEIA 2FSGA 4DIDA 3WHLA 1GILA 5JI3E 3RRYA 4D4LA 2ZJ8A 3QG1A 1G8PA 4P33A 4IOLA 4I1OA 4B33A 2H16A 2GVZC 2W6JA 3I8SA 3AF2A 4MGIR 3T12A 3NEYA 2ZU0C 4M1SA 4DSNA 1MH1A 1YZGA 2FFAA 4D6PA 5EQTA 5KO2A 4MKHA 3GQBA 1ESNA 2JJ2D 1NN3A 4DUGA 1KI3A 3AP1A 5HR5A 3GJ5A 3HP1A 4QHTA 2ZYTX 3KZ1E 4JS0A 4URXR 2ZJZA 4TYYA 4URUR 2HCBA 1N5IA 3TSZA 3WXMA 3Q9LA 5AJXA 5FUWA 3IGFA 4US2R 2ZUDA 3O8DA 1NJGA 4BLPA 5HZHA 1GKIA 4UNRA 4C0HA 1OIVA 1KKMA 2KWIA 4HLUC 4ON9A 4RVCA 1J2JA 3IILA 3MRSA 1GSIA 4LJ7A 3B9QA 2J7KA 2X1VA 4MA4A 4C0SA 3L0PA 2WIBA 3QBVA 2ZRNA 4II7A 2P0EA 3AVYA 3MUFA 1P2VA 3EZFA 3LVQE 5HKKA 3PR1A 5LB2A 4AY2A 1Q3HA 2IYWA 4JJZA 1ZVQA 2WMNB 3QQ5A 3X1DA 4CIDA 2WVJA 1JBKA 1NSTA 2F1RA 2J87A 2G0TA 2J3EA 4QOSA 4IW3B 3QKRB 4TZ6A 5JRJA 2ZS8A 2VHQA 1G16A 3LA6A 2VHUA 3GJ8A 2WJVA 4BLOA 2Z83A 4KLZA 5FBQB 4KO8A 2CHQA 1P72A 5FTJA 4NYJR 1TQ4A 3SBEA 2JLRA 4HZUA 1P2UA 1NI3A 5JI2E 1MKYA 2G6BA 1SKYE 1IONA 3VAAA 3IIMA 3L43A 5KNBA 3LNCA 1E2EA 2O8FA 2ZRFA 2OG2A 1Z0FA 1P9NA 1LVGA 5KHOC 4XWOA 3ADBA 2CE2X 4ESVA 3P27A 4I81A 1WA5A 1II9A 2GBLC 2PCLA 2CL6X 3CPEA 4QM7A 3BOSA 4A9AA 2AWNA 1WMSA 1I4DD 2FPMA 1QHGA 4MUBA 5DSZA 3QEJA 2FU5C 1G5TA 4BQSA 4LOAA 3CH5A 1IBRA 2FJUA 1W0KA 2IF0A 2XSZD 1G41A 2FFQA 4V0ME 3R8CA 2FWRA 2WSSD 4YMVA 4FMDF 4NDZA 2IC5A 4XD7A 1D9ZA 4A0HA 2X8AA 4HLQB 1EESA 2ORVA 4NCNA 2JA1A 4MH0R 1YRBA 2FZLA 3G82C 2PCJA 2NO6A 4U00A 1Q21A 3MWKA 4XOIA 5IT5A 2FSIA 3QPUA 1E69A 1G4UR 2WWGA 3B5JA 3DZDA 2KSQA 3RRZA 1G291 1GITA 3Q5EA 3JVVA 4TL8A 1WDTA 4Q4JA 3OFND 2HLDD 3PUZA 2C9OA 4EKDA 3DVLA 2BCJQ 2ZU6A 2JAQA 4P3YA 2WJIA 4BFUA 2XNDD 5B64A 2JLZA 3ZH9B 2V4ZA 3LBHA 4X8MA 4DKXA 3B1ZA 4RJLA 3DM9B 4BLTA 1TTTA 2EFCB 3RHFA 4LV5B 4PC7A 2BDTA 4URZR 1IN7A 1S96A 1QDEA 2Q21A 3LDAA 1VECA 3AEZA 3OEHD 3AP3A 1DAIA 1MO3A 1XTJA 2R62A 5G3ZA 5K8LA 3HU2A 4UXIA 2VH5R 2CDNA 3CONA 4FCWA 1KI7A 1E4YA 4NONA 1E9EA 3ZZ0A 5CB6A 2QL6A 2RH5A 1E9DA 3AKEA 5DHFA 3CRQA 2IYVA 4QBFA 2VBCA 3FE2A 3KKPA 3SQWA 4M1TA 2JEOA 1Q44A 2AKAB 2PJRA 1AS0A 2KB0A 1G4AE 3M0EA 2PMDA 3CNLA 3K0FA 2GEDA 2GESA 4PAOA 2G1KA 4DB4A 3AF3A 3K09C 1GVNB 1P2TA 5BN3A 3LXXA 1CJMA 4Q1BA 1EG7A 4UQOA 4DVGA 1FMLA 1S0UA 1ZU4A 4F93B 3KXLA 4A8JA 2O5VA 5EE0A 3M1IA 2C9YA 1ZIPA 5E95A 4WVFA 5FOUA 3FKSA 1M2OB 5AJYA 4G1UC 3EWAA 2D74A 1E32A 2VP0A 4TTQA 4KHZA 4L15A 5C18A 1KMQA 1ZM7A 2NO0A 3IQXA 1NVUQ 1OIWA 1OW3B 3VNUA 2G9NA 3O47A 1SXJD 4JYCA 4Z51A 2XOKA 4BGDA 1HURA 1F48A 1KO1A 1Q22A 3BWDD 1UDXA 2QRZA 2Q9AA 5EE9A 5EP2A 1JECA 2ERYA 3WRYC 1L2TA 3C16C 1HE1C 2OAP1 1Z29A 3EIHA 1YR7A 5JS7A 3SZRA 4CW7A 3CB4A 4D26A 4MGKR 3SJAA 1AJEA 1UM8A 5G41A 1TUEA 5DIFA 3W8RA 4OBEA 2J7PA 1X86B 2QNRA 4NCIA 5A4JA 2ZRIA 1F2TA 4Q18A 3GLHB 3TQCA 4UNPA 5JS8A 3ETLA 3ND9A 4B3BA 5J4KA 1JEEA 2REXB 5J4YA 1H65A 1GG2A 2O0KA 4CT4B 4OQMA 1UBEA 4HYYA 1W1WA 4ZKDA 2W0MA 2ZE8A 5E7JA 4MGYR 3E5HA 2D2FA 3CF0A 4YMUA 4A6XA 1TMKA 3VX4A 1LF5A 4M9XA 5KPDA 2WWYA 1OH8A 3Q7PA 2MMGA 1GTVA 4EFNA 4EIWA 4YMWA 4P31A 1OB5A 4C9BA 4I4LA 1XB2A 3UMRA 4OKSA 2J0UB 1P2SA 2VSXA 3RWOA 1GWNA 4DDVA 4ZDJA 2F1IA 1MO5A 2FN4A 4M53A 5CK4A 4A6PA 3E2IA 1KIMA 4JLMA 2ZVPX 2B7CA 2C9CA 4F4IA 4B2IA 4I1SA 4DSUA 1HH4A 2R44A 4M2LA 4AK9A 1NY5A 2IW3A 3CBQA 5DGXA 2B21A 5BWMA 1T9HA 4M21A 2O8DB 3I3SR 1NL3A 4PPNA 1US8B 3PXGA 1D2EA 1EX7A 1SKQA 2V9PA 3B60A 3BORA 3W3AA 1N6OA 4RD3A 3A8TA 1QHHA 3NH6A 2B6HA 3RRMA 3N5CA 3KJGA 4OK5A 2CL7X 4RY2A 1TEVA 2IBMA 3THXA 3UWKA 5FFMA 4MRRA 2Q3FA 3OEED 3H1TA 3FFBA 4FMCB 1C9KA 3GJ6A 1N25A 4AI6A 1LF0A 1EX6A 3QIAA 4PHHA 1ZC4A 1W2HA 3AF0A 3NKVA 3HYRA 4QBGB 1T5LA 1UAAA 1CEEA 1TL7C 3HR8A 1KO4A 1XD2B 4D4KA 4UXJA 5KSOA 3WYFA 1VPLA 4M9QA 4KFRA 1CU1A 1CJVC 4IOKA 4BFWA 1ZNXA 4ERNA 4NCKA 1G3MA 2BBTA 3CNOA 1G3QA 4CF7A 3AM1A 5TY0A 2F1JA 4ASUD 4I1UA 1L4UA 1SXJC 4Q9HA 4X8HA 4PZZA 1L8QA 2ZRBA 3D3QA 1OSNA 4JLKA 1K8RA 1VCNA 4JVSB 4Q7JB 3CRVA 4B3DA 2FX3A 4OHVA 3ADKA 1R2QA 2YWHA 2KBEA 2D4HA 2IHBA 2XZPA 2ZYUX 2V7QD 4M8NE 1SZPA 5K8IA 4DLSA 4OL0A 4TL7A 1KJWA 4C0QC 1DTSA 1LNZA 2GHIA 4DBLC 4A82A 3OE7D 1N0WA 5FOTA 3UMFA 2CJWB 1DAEA 3K0SA 1Z6TA 2FOLA 3UANA 3K0AA 3Q5DA 4AC9A 3G0HA 2QTVB 2AL7A 4CDGA 1ZAKA 2V3CC 3QENA 2J46A 4HZIA 2WJJA 2AR7A 1ODFA 1NF3A 2NTYC 2PL3A 4L5BA 2XXAA 4Q1CA 4EDHA 2O8EA 1KNQA 3ZJYA 4Q4HA 2VO1A 3I5XA 2UVQA 1GRNA 2R9VA 2VSOA 2ZRHA 2XX3A 4OK6A 3N2EA 1NN1A 2QQEA 2WM9B 3BFVA 4AKEA 1FFHA 2FSFA 2W6ID 2Z5FA 1CR0A 1L7VC 4RFSB 4ABYA 2ZYVX 1SVIA 1U0JA 4XVQA 4ZCLA 3W3ZB 1KO8A 3KTAA 3MCAA 5SZHB 3RWMB 3BD9A 4JLBA 3MSXA 2FG5A 1SXJB 4RD2A 2ODEA 4W5HA 2IEYA 1NBMD 3CO5A 4K46A 4PHFA 4DLRA 1VYUA 2G77B 3X1WA 3IQWA 2FPLA 4NYMR 4WZAE 4JT4A 3AVXA 2FA9A 5J5CA 3A4LA 4TLEA 3M4YA 3FPAA 2ZI4A 2OCPA 4XTCS 3U7EB 2WOJA 4QHSA 1R0WA 4IVPA 2E87A 3ZIAA 2OESA 4HATA 3CLVA 1VHLA 2ZTSA 1QHNA 4EPWA 2F7SA 4Q4AA 1N0UA 5IDVA 5FH9A 2QGNA 4B3XA 2CBZA 1ZW6A 2UZIR 5EUQB 4LBZA 1M7BA 3FOZA 3VR2A 4TSFA 1BO6A 3IDQA 2GXQA 1K6MA 4CEIA 5EJEA 3RS2A 2C99A 4HZUB 121PA 4CEJA 2IUSA 3CRMA 4JSYA 1GOTA 5A5GA 4OYHA 4R2IA 5AK0A 2D7CA 3HU3A 1R7RA 1ZU5A 4ZPXA 4QJ4A 4DCTA 3RDPA 3W6NA 1Z6GA 3OESA 2YWEA 4XVUA 4EJSA 4EQ6A 3QNUA 4OI4A 3MMPA 2EFEB 1IY0A 2GTPA 3I61A 1CKEA 2MSEB 2UKDA 4Z1MD 4GMXA 2IYTA 1EFRD 1FUKA 1A5TA 2HUPA 2LKDA 2DFNA 3DMNA 4M1OA 4R2HA 3PEWA 4PC1A 5EXPA 1G5PA 2GZDA 4CGZA 4FCVA 1S3SA 4GSYA 1Z6YA 1KKLA 3B1YA 2I1QA 5C46F 4AKGA 1IM2A 4FMBB 1QHSA 1II0A 5JHHB 3U6KA 1XDBA 4GOJA 1W4CA 4PC6A 3IUYA 1QG4A 5J40A 3U7FB 1NNEA 1COWD 3LBNA 4TMTA 2WWIA 3BK7A 5A0FA 2JASA 1ZP6A 1S9HA 2GJSA 5EXSA 5D3QA 4EAQA 2NOAA 3NBXX 3LLUA 3UG6A 2G1JA 1A1VA 3B7GA 1VMAA 1RRCA 3K9HA 1UKYA 3I32A 4A8JC 2QRNA 1N6HA 5E7IA 2A9KA 2QT1A 3TAUA 1E9BA 1MO6A 5DI3A 5SZKB 4N3NA 1CJTC 3B2EA 1KDPA 2IHYA 2XGJA 4DLYA 1WBBA 2J59A 1CIPA 4ACAA 3KKMA 2OEPA 1VIAA 4M4SA 3L0SA 2QMHA 1W47A 2GRJA 3SJCA 2PT5A 2OFXA 2IYQA 2HT6A 1U94A 2EYUA 4LDJA 1CLUA 2ZS7A 2ZJAA 3TE6A 3U7GA 3SYKA 4OI1A 5TVKA 1XMVA 1HYQA 1P3JA 2OT3B 1G17A 4YDHB 4TMXA 4IJMA 3V4FA 4Q1EA 1OXVA 4HAVA 2QEQA 3U3MA 4B71A 2PLFA 1GIAA 3KXKA 1PV4A 3C5HA 4IEIA 4Q1DA 4HB2A 5EXTA 1YQTA 4FD2A 4D0NA 1WQ1R 5CDFE 2IYLD 3QVUA 4DB2A 3VKHA 1OKKD 1E2KA 3K0CC 2JJ8A 2RKOA 1J70A 3K0EA 4ZV4A 2OHFA 2VHTA 5LPNA 4O25A 5GVSA 2IS6A 1Z0IA 2CHGA 1DAFA 3BBPA 3W90A 4ARZB 4KFTA 2H18A 4QGFA 4A8JB 2J1LA 2ZJ5A 3DPUA 4DSOA 5IK2A 4D81A 4YMTA 5J4VA 4TMVA 2Z43A 2IYRA 3C8UA 3T61A 3CF6R 4RFVA 3A58B 1KSJA 2CE7A 4LZZA 4LHYA 2WICA 3KJEA 4LJ4A 5CM8B 3TIFA 1P6XA 4OQFA 5IHPA 4B3GA 1FOEB 5F3WB 4DRZA 1GKYA 1BMFA 1G7SA 2EYQA 2OSBA 2OXRA 3I92A 3EPKA 1N5LA 4HDCA 5EXXA 5AR1A 4ZIRA 5KNDA 2ODBA 4HLDA 2V6IA 2GILA 4G5RA 3R9WA 1R8SA 1GNQA 1XNJA 1WCV1 3BH0A 1Z07A 4BASA 2GEVA 2H1LA 1VG0B 1YZQA 2F3RA 3ASZA 3FB4A 8OHMA 4DEYA 4V0MA 2VSFA 2YJTD 2E1RA 3MLEA 4HI0E 2VTKA 1T91A 5JFGA 1RVDA 5EP1A 5D3MB 2WPDD 1UPTA 1MRSA 2XAUA 3C41J 3T5DA 2OM2A 1I4TD 5DH9A 4DLVA 3LW7A 2ZJ2A 3ZD7A 3I4LA 2W2VA 5DO9A 2ZI7A 4V02A 3FVQA 2PEYA 3AVTA 4LJ5A 4POAA 5DISB 2ZROA 3W6PA 1AS3A 3I62A 5DNYB 4PO1A 1QHYA 3F3YA 1GRRA 4Q7MB 4IXMA 5BYKA 5TB5A 1LS1A 1TUIA 3R7WB 3KUCA 2RGCA 4TWZA 3EWSA 2IXFA 1FP7A 4QNMA 1BS1A 3BH7A 5JJLA 2P5SA 4HUQA 2QSZA 4M0LA 5LDDC 4JL8A 1YU9A 1R10A 4WZBE 3LX8A 3OIYA 2QM7A 3U6BA 5IRCD 2VLIA 1CTQA 4D0LB 1XJQA 1Z47A 1V43A 1CJUC 2RGBA 1RYHA 1E1RA 1BH2A 4F92B 4MRVA 3QF7A 1U8ZA 1U98A 2XTMA 3A1VA 4PQYA 1ZNYA 3TGPA 1E0SA 2REOA 2J41A 2RCNA 2RGNA 4TL6A 4PZYA 1N3BA 3NVAA 4F38A 2BEJA 1DELA 1KOFA 1QF9A 3P20A 1NVVQ 2YOFA 4AD8A 1EXMA 2NPFA 3LAWA 2FV8A 1KSGA 3ICQB 1FNMA 1ZBDA 4KI0A 4IDHA 1N5KA 3QF4B 4L8GA 2GXAA 4OHWA 2CL0X 2EWVA 4C0AC 4D80A 2GJ8A 2VP9A 3UPUA 2QU8A 3L82B 4ZCIA 2GK7A 4TT3D 1NIJA 3ADCA 3LFUA 2YOHA 1XEWX 4Q7LA 4LK2A 3IIJA 1ZCBA 2CEAA 1H8HD 3WBKA 2NZJA 3VR3A 1DAHA 1H8ED 2BMDA 4MRNA 2YV5A 2IK8A 4IOMA 5BYJA 4C7OB 1QHXA 3RS7A 2JDIA 3GLIA 1OXXK 5HPYB 2PJZA 2WWHA 3K8YA 5CYPA 2GETA 4YQFA 1HTWA 4A2PA 4V0NA 2ZM5A 3LO5A 2VHJA 4PTLA 3AH8A 2B8WA 3EA0A 1B23P 4R98A 4Q01A 2V6JA 4QFMA 4DIEA 1QBKC 3F5FA 1ZM2A 2ERXA 4PHTA 3GFPA 2QE7A 5BN5A 1NLFA 1YRAA 3TJZA 3IHWA 1HQCA 1G3IA 5JEEA 1W44A 1G19A 4AURA 3VX3A 3HU1A 2R65A 4LJ6A 1R0XA 1AQUA 3P4YA 2QAGA 2PT7A 1P62B 1KK1A 2QMOA 1Z0JA 4BZXA 1Z06A 3TW4A 3ZVLA 4NCHA 1PUIA 4LC0A 4X8OA 5EE3A 4OJKA 3SR0A 5CYOA 3BFXA 4PC2A 3UG7A 4HEJA 2P5TB 3ZVRA 4DT1A 2O8CA 3IEVA 2QBYB 3AV0B 1KMHA 3BRWD 5P21A 3WMFA 2KI5A 2ONKA 1ETUA 1VG8A 1ZINA 3AVWA 3RS4A 5FR1A 2CCJA 3EZ7A 1RW4A 3THWA 1Z8FA 1NSFA 3L2OB 2JJ1A 3QSYA 1J8MF 1X3SA 5EUMA 3AP2A 3V00A 2ZRJA 1OH7A 1NLZA 1N6PA 4MYCA 1Z22A 1OPXA 1V5WA 1A2BA 1II8B 1VCMA 2TMKA 3LXRA 1HA3A 4JLVA 2BMEA 1IQPA 4IVRA 3RRNA 4B76A 4L9SA 3U2QA 5JCZA 2BJVA 3E1SA 4GP6A 2SHKA 3MJHA 1X8JA 2ASEA 3TR5A 3OAAA 1P60A 1XX6A 3FTQA 1D5CA 4DLTA 2GF9A 5L3SB 2J0QA 4PO8A 2XITA 3CX8A 2BIFA 2GCOB 1JQLB 1KSFX 2F6RA 1E79A 3UATA 2PX3A 4BFTA 4O2RA 3ZVMA 2PZFA 4C0BA 4HUTA 4A36A 4PX9A 4WOPA 3HPRA 4LHWA 4NU0A 2J0SA 5G40A 4JVNA 4M9ZA 1RRPA 2VP2A 3DMDA 3MWJA 1JNYA 1RJ9B 4KXFB 2H57A 2J9RA 3KQKA 2GCNA 4KODA 4Q4AB 3RS3A 1KDTA 3RLFA 3RVBA 1KI1A 1HY3A 3RAPR 4JBXA 4KBFA 4OHZA 3ZD6A 4TL9A 1Q20A 1UDWA 3IHLA 3TAHA 2IEZA 4JSTA 4CEIB 1JEDA 4LHZA 1XWIA 4DCVA 1NY6A 2ZI5A 4JLAA 4MDEA 3WYGA 3GLGA 3S1AA 4RD4A 4O0MA 1KI6A 1ZC3A 2OXCA 1Z63A 1UEJA 4IOJA 1OYWA 5AJWA 5DYGA 3QVVA 4DCNA 1G7CA 1SVWA 2C04A 3NC1C 1YZKA 1M7GA 1NMYA 3EC1A 3TSWA 3U7HB 4JLOA 2NGRA 3RNLA 5LD2C 1AZTA 3EW9A 3KXIA 4KU4A 3VTKA 3ZQ6A 2ZRAA 3U44B 4M1KA 2P6RA 3W8NA 3NTUA 5L3QA 3F0TA 2H7VA 4JBYA 2GZAA 2Q6TA 1Q3TA 1IJFA 3REFA 2QPOA 2KE5A 3FWYA 4JL5A 4PSKA 1PLKA 1E0KA 1MOZA 5FOSA 2OO7A 3L8ZA 3THOA 1AKEA 2CVFA 3CPJB 4FI3C 2W6JD 3H4MA 4Q9JA 1CS4C 4P4SB 1R4AA 4US0R 1ZNZA 5SZIA 2ZQ5A 3WRXC 4DUGD 1RE0A 4LI0A 4O2LA 2FZ4A 2JGNA 2IYSA 4CVNA 5AJVB 1DO0A 3UIEA 3W9YA 2J0VA 4WXPA 5FL7A 1KI2A 2ZR9A 3GLIE 2P3SA 1GRQA 3L0OA 4XH9B 2JLQA 2QM8A 1E2IA 3MWLA 3NWJA 4YMSA 2JIZA 2W58A 5B30A 4DLUA 1XTKA 5FPYA 3O8BA 4LC1A 4LBWA 5CIQA 1ZIOA 3VKGA 2CCKA 2BV3A 1AK2A 1TPZA 4DLXA 4DWJA 5FI0B 4NL4H 2C95A 4RD0A 2A30A 1ZUHA 1GP2A 3AKDA 5HKKD 1TF7A 5JLJA 5UKDA 4E07A 5LD2B 5F9HA 2MSCB 2O52A 1XBTA 1Z2CA 3DHWC 3UK6A 3X2SA 3BGWA 2WSMA 3LQQA 1TX4B 2BBWA 3DO6A 1T4GA 3LQRA 4CEHA 1RRFA 1Z08A 3THYB 5FUVA 1M74A 3CX6A 1MRNA 2H17A 4YDSA 5K8TA 1S1CA 4Q4LA 2EFHB 821PA 2AN9A 2CK3A 1GKUB 1R6BX 4S2EA 1CP2A 2Z4RA 4LUCA 3SYNA 3TMKA 4PR0A 3ASYA 3GLFA 1OV4A 4E09A 1SHKA 1Z0AA 2I3BA 1XEXB 1AM4D 3VR4A 3QJYA 3AUXA 4LY6A 4N0EA 1P4SA 2J5XA 3BS4A 3ZS9A 4W5WA 3C7KA 4NE2A 4YONB 1MABB 2R2AA 3T06B 2VP4A 4LJYA 2ZRDA 5CJPA 2OFWA 2ORIA 3CR7A 3QKSB 5EP3A 1Z0KA 1Q1EA 2GF0A 2XEXA 1W7AA 1GNRA 1DVRA 4QGHA 4B48A 3VR5A 1E2QA 1R8QA 4IHQA 2D3WA 3UXMA 1UKZA 1FZQA 5LB4A 1G20E 1IXZA 2O8BA 3R9IA 1T3HA 3NEJA 4R71A 1JAIA 1VDZA 4PPGA 1YVDA 5GVRA 1MO4A 3EPLA 1SKYB 3E70C 2QI9C 2QROA 4OHXA 1T3LA 5H1YA 1W0KD 3EG5A 1EFHA 2W0SA 1DAMA 3B13B 2RHDA 2F43B 1OE0A 2QUZA 1LV7A 3BAFA 4XD7D 3TBKA 4DDWA 4K81B 1JPNA 4GDFA 4BZQA 1XXHB 3GFTA 4MDFA 5GJCA 4I99A 2HV8A 3W5IA 3V9PA 3N70A 5F2EA 1CRQA 1M1YE 2YZ2A 3RSOA 1CJKC 3RC8A 5B58C 4AG5A 4DJTA 4KYUA 3SHFA 2Q9BA 4G5OA 2ZANA 4KBGA 3AF4A 4HSEA 1KI9A 5HE9A 1VHTA 3DM5A 2B7BA 3TUIC 3TSOA 5JSZA 2C2HA 2V55B 4QRHA 1OLOA 3TUZC 4Q9LA 3GLGE 1A7JA 1YE8A 4QBHA 2ODWA 3Q8XB 2BHRA 3LW8A 3PUVA 1YHNA 4D25A 1N5JA 3PEYA 1DOAA 1OH6A 3X1XA 2OBNA 4C2TA 4HAZA 2GWHA 1EFCA 4LJ8A 4ZI3A 5FR2A 1YR6A 1XD8A 1CR2A 5SZJA 1X6VA 4QGAA 4JIMA 1IAQA 4FW9A 3O8RA 2CNWA 3QPVA 1G7TA 2V1UA 3MWYW 1J7KA 2AWOA 1DARA 4H9GA 1RYFA 3KQHA 3CIOA 2I1VB 2YC4C 5FPTA 3UWOA 4KITB 5BW8A 1KYIA 3KB2A 3SN6A 1JI0A 1IJEA 1E9FA 1FX0B 1KGDA 3KKOA 4BLSA 4LYFA 4HAUA 4KVAA 4PAMA 4QM6A 4MRSA 4KCGA 1XCPA 2CLSA 1WXQA 1FPMA 1P75A 2WAYA 1YZTA 3B9PA 2H8KA 4XSHA 2GK6A 4OHYA 4WIAA 4Y0VA 2IS2A 1HE8B 1KHTA 4BFSA 5FBVB 4URWR 1JR3A 1W2GA 2C8VA 1ZD9A 2C98A 3FKSD 2P65A 2VL7A 2ECKA 4NYIQ 3U3JA 4A1FA 4BRWA 2QAGC 4D82A 3ZVNA 4TYWA 2NZ8A 4R9UC 4TTRA 2X77A 2YWGA 3FYHA 5CDFA 5HTKA 1FUUA 3BE4A 3LV8A 1GM5A 3CUEF 2P6NA 4MRPA 1NIPA 2XOKD 1AZSC 2F9LA 3QKTA 1T0JB 2ZUBA 4YC7A 2JLXA 2A5JA 2G88A 4KYIB 1UKVY 4GPTA 1NRJB 2GZHA 4MQBA 2XB4A 2WBLC 1U8AA 1KI4A 4FN5A 1VKJA 3ZYCA 2NMVA 3W6OA 5B57C 3I1FA 2WTUA 3ZS8A 2DFKB 3AVOA 5DYIA 2AXPA 2YYZA 4TLDA 1XP8A 2J7PD 3TW8B 3GLFE 5FOXA 3I8XA 1ZMXA 4KSBA 2IUUA 3ONWA 4HLUA 1G6OA 2WKRA 5G53C 1KZ7B 2KJQA 1FTNA 1WRBA 3K9NA 1XCMA 3Q85A 5JRZA 1VCIA 3FHCB 5FUXA 1SULA 4OQXA 2OCAA 1YZNA 3CRW1 2QA5A 1BIFA 1CRPA 2GCPA 1EWQA 3BB1A 4TLBA 1QZXA 4P0TA 3AF1A 2EQBA 1XMJA 2IT1A 2K5UA 3NHAA 4TQAA 4Q9IA 3JZAA 2A7QA 5KUTA 4G01B 2OLKA 3NHBA 2EVWX 3FHTA 2AK3A 2Q0HA 1W5TA 1RPZA 1SGWA 1P61B 4A0FA 1TF5A 1DO2A 3Q72A 3WNDA 1W36C 1LB1B 3VFDA 3A1UA 4K8OA 4TYNA 2O8FB 4JKYA 4RZ2A 3SS8A 1FQJA 4HLCA 5KOYA 3EIQA 2QMEA 3WHKA 1XFAA 4B43A 1KZGB 3CRRA 3CWZA 4ILEA 1F5NA 3NBYC 521PA 2AHOA 1G7RA 3K1JA 3SBDA 4G5GA 3VR6A 4P4TA 5JWRA 2XTZA 1A2KC 1W4AA 3U3OA 3DOEA 1ZNWA 5H68A 5CJ2A 3TH5A 3AGQA 4YXWA 2DPXA 1W4RA 2GBLA 4FWIB 2OCBA 2E9SA 2R6GA 4EPVA 3LWNA 4LCBA 4IDOA 1E6CA 3HWSA 3VHXA 4BLRA 1ZUIA 4RCYA 2NIPA 3QXSA 2BBSA 4FIDA 1EFUA 1NVWQ 3QUSA 4Q03A 4ZDIA 1PUJA 3LY5A 5AJZA 4HDQB 5KYKA 4B3FX 3GMTA 4MYTA 4AYXA 3K70D 4DHEA 2G3YA 1OHHA 421PA 3ZLJA 3U61B 1O3YA 2Z4SA 4Q4JB 1JXOA 5FTKA 4UNSA 3IPXA 3BC1A 5FTMA 2IUTA 5GJBA 4KAXA 1W48A 2XJ9A 4EFLA 4IRUB 4B44A 4R7ZA 1W36B 1Q0UA 3ZZUA 1T8UA 1EWRA 1NP6A 3ICEA 3VKWA 2WAXA 2VIIA 4JT2A 3HYTA 3R8FA 3ZQJA 2Q3HA 4NH0A 1S2MA 4TMWA 4LSGA 3IPYA 2BM0A 2BKUA 2JJ2A 3C15C 3UKDA 4MYHA 1S3GA 2NPIA 3OIWA 1G18A 1N6NA 5KDOA 2XB2A 3LRPA 3VNVA 4MKGA 1HT1E 2HF9A 1YZUA 1JR3E 4NMMA 2R6AA 4C0KA 1JJ7A 3QOFA 1KDOA 5AUPB 5JWOA 5FUYA 2LKCA 2REBA 3AGPA 4XSGA 1NN0A 2DCUA 1OB2A 3R20A 3A6PC 1DPFA 1NVVR 2G83A 2RB4A 3HR7A 3K0FB 4FCTA 4B32A 1UKEA 4IXNA 1AKYA 4Q48A 2ZAOA 4FMCF 4PSAA 4FMDB 4D4MA 1W49A 2YNMA 1D2NA 2YHSA 5TMPA 1YJ5A 2FH5B 2ZE5A 3H0KA 3K09A 4E03A 1SVOA 1EK0A 1OJLA 5DLQC 3H84A 2D7DA 1R0ZA 2IA5A 3RC3A 2ZITA 3EIEA 4GZLA 4HAWA 4A2WA 1Z6XA 1ZM9A 3A1SA 3H2YA 4LWZA 5DHAA 2BBOA 2QAJA 1D6JA 2PEZA 2QORA 2HT1A 1IN4A 1OFIA 2CMKA 1RFLA 2AFIE 3HJNA 1RIFA 1NVXQ 4TQUS 2G0NA 2J0UA 2ZRLA 1VCOA 1T0HB 2RHMA 2ZI9A 3SYLA 5KSZA 3EARA 3AVUA 4TQ9A 1PVOA 1P7CA 2HXYA 4NHOA 3QY0A 2WWWA 4Q02A 4RD1A 1WF3A 1G3UA 3H86A 4LYAA 3ZIAD 3PUWA 3NDBB 3TUJC 4BFYA 4LHXA 1DE0A 3EASA 6Q21A 1CBUA 1VG1A 1A4RA 1F2TB 1US8A 4OI0A 2QTFA 4TSFD 2KBFA 4G5SA 1E2JA 2NO1A 1OT3A 4AG6A 1G8HA 1SVSA 2WSSA 2B92A 4IFEA 3K70C 3SC3A 4ZI2A 2WJGA 1ESMA 4M1YA 2GAOA 1F6BA 3SHWA 5CITA 4BEBA 1I2MA 2X2EA 1FMJA 2C78A 2ZSBA 1ZUNB 3PEUA 4F91B 2QP3A 5ELXA 3EZ6A 3RANA 2YWFA 3O8CA 4FXPA 3C14C 3P1JA 3OFNA 2HLDA 1F2UA 5JBQA 1G5RA 1XD2A 1P9RA 2DYKA 3KDSE 1J8YF 2DR3A 5CLQA 2XNDA 3KKQA 3SOPA 5J47A 4PAQA 4N0DA 2ZVQX 2QSYA 2GA8A 3GFOA 2ZRCA 5AUQA 3CH4B 1OFHA 1KSHA 2W2TA 1XEWY 2Q9CA 2AFHE 4XJXA 1UF9A 2DHRA 2JLYA 3OEHA 3U60B 2XZLA 2WIAA 4QGGA 2DFTA 4Q9KA 4WW0A 2Z0MA 4MITA 2WWXA 3MGCA 2QGZA 4EPTA 1XCGB 3B1VA 1QHHB 3REGA 1W4BA 4GBMA 1LY1A 5DI9A 2EW1A 5EE5B 2ZSAA 2CJWA 3VU9A 2N42A 3IBGA 4ZDKA 5C1BA 3THXB 1W0JA 4GRAA 2W2XA 4IDNA 4JKIA 4IDQA 3K70B 4Q5IA 4KSCA 2FNAA 4TYQA 5AWFC 3BIFA 2IXEA 4NCJA 5TXGA 2ZETA 3P26A 3QEOA 3FMFA 1Q12A 5FOVA 3BERA 3QE0A 2FFBA 4C30A 3UMSA 2O0HA 1IN6A 1NJFA 4KFSA 4NTZA 5JEDA 4RFSA 2CLCX 3WP1B 5DN6A 3I5YA 1OFTA 1R5BA 3R9XA 4PXAA 5AUNB 5BN4A 4C3ZA 2HDNB 3NIBA 5H8WA 4B73A 2WKQA 2DB3A 4OJQA 3A36A 1SXJA 2IYZA 1XMSA 3GLHE 4XWAA 5FOWA 4B6EA 2A5GA 3WNBA 4D0GA 2DBYA 2ZSFA 2VP5A 4B34A 5KPJA 1M8PA 1KO5A 5L3RA 4B35A 2MSDB 3NBZC 3OZXA 3T15A 2OBMA 4TLAA 1U2RA 1GNPA 4DXAA 4G5QA 1ZM4A 3K0AB 1VTKA 2WJYA 3SJBA 2FF7A 1OXSC 3TKLA 2ZR0A 2OFOA 5TV2A 5FTLA 1F60A 3AKYA 1GL7A 2UZ3A 4NP6A 5IK2D 3EZ2A 2ATVA 1G3RA 5H70A 4LPSA 3GJXC 5B2ZA 4EFMA 1MR3F 2ZPTX 2JLUA 2XXAB 1FL9A 2O8EB 4LYHA 5KSPA 1XTQA 3KB1A 4Q4HB 4UNQA 4Z8YA 2OV2A 4TN1A 3B85A 3GEEA 2H5EA 1E2HA 1SHZA 4CT5A 3BJIC 2GDJA 3SEAA 2C03A 2OZEA 1BMFD 3VMFA 4EJSC 2GNOA 3DL0A 2YOGA 1E9SA 4DZZA 4W9MC 5JJIA 4DCUA 5EZ5A 3KTAB 3SFZA 5C2JB 1ZD8A 1E0JA 1G8GA 4D4JA 1U0LA 1E9AA 1G6HA 1KAGA 2AD5A 4C0JA 4CZ2A 1XXHE 3AVPA 3ND8A 5FPKA 2XTNA 4V0OA 4U7DA 4DSTA 2ATXA 1T3SA 1G1MA 3D6TB 1G21E 3U5ZB 1DEKA 1IXSB 4ITRC 3EX7C 1GDDA 2ZRPA 1E9CA 1KY2A 3B1XA 4Q1FA 3U4QA 1HV8A 1Y63A 4M22A 3SDZA 1SQ5A 4UJ5A 5JZVA 2BM1A 3WYAA 1TU3A 3PV0A 3PJRA 2ONJA 2BMJA 1I2DA 4ACBA 1BYIA 3EPJA 1DAGA 1UBFA 2N1BA 2HJGA 1UADA 1LS6A 3PUYA 1OIXA 4LGMA 4Q47A 3GJ7A 1VIYA 3IBYA 4H1VA 1RC8A 1E99A 2PLRA 3PITA 1KJZA 2VF7A 3HDTA 5FBRB 2ZI3A 4G3XA 2ZJOA 1MT0A 2BC9A 5JCPA 5FBLB 1Z28A 2WZQA 1AS2A 3DOFA 1OXTA 3M6AA 4MKIA 3T1VA 1XTIA 4CEJB 3GJ4A 1JQJC 4JLDA 2A5YB 2QTHA 3KX2A 4OQNA 2OBLA 2Z6VA 4JLJA 4EPYA 3P32A 3OEEA 4TMZA 2A78A 1Z0DA 2Y8EA 3ZGXA 4EJSB 4EQ6B 2VA8A 4PZLA 4XIGS 4Q00A 3X1YA 3MD0A 3GJ3A 1CR1A 2R6DA 5K8UA 1VYVA 2IL1A 1E1RD 1J90A 4LBYA 5FBWB 1S1MA 2ZS9A 5C4GB 3B82A 4RKEA 2NQ2C 2VEDA 2HCJB 5HCIA 1TEXA 5E7MA 1U0HC 2PBRA 3SQXA 2BWJA 4ASUA 1EGAA 1GUAA 2MMCA 3IEUA 1M34E 2ANBA 4TYPA 1YZLA 4DEXA 1D8TA 3LBIA 4IFBA 5EZ6B 1QG2A 2QG6A 4NPHA 3U3RA 4HB3A 4RZXA 2ORWA 1TAGA 1W0JD 3A1WA 2V7QA 3QKUA 1Z2AA 2VPPA 4M1WA 1XPOA 4UJ3A 2QPAA 1QVRA 5ANRB 2CVHA 1TQ2A 3WMGA 2A5DA 1J99A 4KFUA 1F3OA 3CPHA 4M1MA 3LH5A 4RKFA 4XWKA 3OE7A 4TZ0A 2IYYA 3RS5A 1HEIA 2WHXA 2ANCA 2B8TA 5DI3B 4UNNA 1S8FA 5JJKA 4F7WA 2FEMA 4HDOB 4ARZA 5JWHA 1KDRA 2AK2A 2LWIA 4MGZR 4NYJQ 3CF2A 2RGXA 2HEIA 1SXJE 2JDID 1L4YA 2WWFA 3QG5A 3ZDQA 2FDCA 5DN6D 4DDUA 5FL3A 1PZNA 2JLWA 1T6NA 2BJWA 1M6NA 1RZ3A 4B6FA 3ADDA 2YINC 2Q3MA 1BYUA 2W6IA 3NBFA 4KV9A 4BFXA 2IX3A 5J4HA 2QE7D 4I1VA 3B1WA 2DWPA 1SVKA 1ZM3A 4PHGA 5JHGB 2XZOA 3KJIA 4A0RA 4MKFA 4P4UA 2L0XA 5E4FA 3NC0C 4AIIA 2BMFA 2DY1A 2OUKA 1NBMA 2X19A 3FFAA 3KKNA 4NYIR 4Q7KA 5KDDA 3GP8A 2C96A 4JMPA 2QP9X 2OCYC 1S9DA 1FW6A 4MUAA 1QVAA 1ZD1A 3IIKA 5F98A 4Z8XA 2RGEA 3LX5A 1XZPA 3NXSA 1XPUA 1Q1QA 3KUDA 3CZQA 5D3MA 1NMZA 1AGRA 4J0QA 1KTVA 3K0CA 2JJ1D 3KQLA 3A37A 4LBVA 3VQTA 5CM9C 1E98A 3PFIA 4M9SA 3B6EA 1IOZA 3KFXA 1I4LD 2GVDC 4LJAA 3FMIA 1ELOA 4IVQA 3G5UA 621PA 3OF5A 1TQ6A 4YLGA 4V0LA 3PCRB 4Y0AA 1X8LA 1OF1A 4V0KA 2H92A 3R7WA 2EWWA 3WNCA 1VG9B 1UFQA 4B3CA 2PZEA 3OAAD 1QRAA 3OIVA 4B74A 2IXGA 2NG1A 2NO9A 3PUXA 2RMKA 1R0YA 3GJ0A 4NKRA 5CIWA 1E79D 1HQYE 3IKJA 4WBSA 2P2LA 4LJ9A 2IYXA 3FDIA 1T5IA 4ZIRB 5KNCA 721PA 2QY9A 1U9IA 2LCFA 1E9RA 4GOXA 2C5LA 4ZDWA 4QXAA 3SI7A 4A2QA 4PSVA 2WKPA 3QI2A 2RGNC 1GFIA 1K5DA 5CLLA 4Z1MA 1EFRA 2ZJYA 3TNFA 3P4XA 3K53A 1TF2A 1W36D 4FWTA 1ZCAA 2GEUA 1DG1G 2C77A 2RGGA 2F3TA 1W5SA 1P73A 4LRWA 4PQFA 2W00A 4PPFA 2BKEA 5EE1A 4XTRA 3TQFA 1Q1ZA 221PA 4F4CA 1Z6AA 2ZRMA 3CR8A 1N0VC 3PEVA 1DBSA 1E2DA 4JBWA 1LTQA 3QF4A 4BECA 1COWA 1UBGA 3SU8A 2OAQ1 2ZSEA 4RCZA 5HZKA 3HPQA 4BZPA 4JLNA 4ZKEA 2YC2C 3X1ZA 1JPJA 5FTNA 3EAQA 3GD7A 5FPHA 3EZ9A 4P32A 2N46A 4Q19A 3EXAA 3N2IA 5GJVC 4HUQB 1D9XA 5E3HA 1F2UB 4W5JA 4URVR 2FGJA 1FP6A 3GPLA 2ZE6A 1OFUX 4AYWA 4FINA 4C7OA 3QBTA 3KL4A 4DC9A 2PMKA 2V54A 3QXXA 4JL6A 1LW7A 4U02A 4C0LA 1P5ZB 5IF9A 1PLJA 3GEIA 1Q1BA 3NDPA 4B75A 4A4DA 3QXCA 4Q1AA 1XPRA 4L4UA 4EPRA 3QKRA 4MYUA 1KJYA 3TLXA 1X1SA 3W5JA 4AYTA 1JR6A 5AUOB 3A4MA 5FL7D 4EPXA 4EUNA 3VU9B 4GP7A 2D62A 4QBIA 1BOFA 2FPKA 2QZ4A 1XEFA 5EP4A 3EPHA 1GL9B 2JIZD 1C1YA 1XF9A 4JVMA 3SFVA 2IF2A 1U81A 2A3RA 2ZRGA 1OKKA 3AUYA 4LX0A 4ZO4A 5BQ5A 4E22A 4ZCMA 5KTYA 3AVVA 3SNHA 1XJCA 4Z54A 2JLSA 1FQKA 1AGPA 1IN8A 3GEHA 4HB4A 4CRWB 4DLWA 2QBYA 4PFSA 2GKSA 4IEEA 1FTSA 2ZSDA 4OI2A 2ZE7A 1CULC 1WBDA 1X1RA 3J81k 1U90A 2GJKA 2ZREA 1Z3IX 3CX7A 3PENA 5HCNA 3F8TA 3LD9A 4IDPA 1KO7A 1NMXA 1NKTA 4L16A 3GLIB 3K9GA 1N2CE 2XNSA 4QJ3A 3D31A 1NBME 1II8A 2D2EA 1D2MA 4A92A 4BUJA 3JZMA 2CK3D 1EFTA 1E3MA 2DFLA 4Q21A 1ZJ6A 1WP9A 4NBSA 1E2NA 2AD1A 2FSHA 1R5OA 3RABA 1HT2E 2F1HA 4RZUA 2F55A 4G0NA 1DS6A 2OLJA 2CCGA 4KLNA 4URYR 5J4LA 1TNDA 3BB4A 1NKSA 2P67A 3CM0A 4QHYA 5L3SA 1SVLA 1NN5A 3NH9A 3BB3A 2GCOA 2GJAA 2A5FA 3OIUA 1JXMA 1CR4A 3CZPA 5KDLA 1CXZA 2NO7A 1G8YA 2QP4A 4KVGA 1XTSA 3CNNA 2QAGB 2EFDB 2EFGA 4XVRA 1N6RA 1RRGA 2VP6A 2ZIAA 2IYUA 3KJHA 4HB0A 4F4JA 1E1QA 3V4RA 2QENA 2GJ9A 3QXHA 4WZ6A 5G3YA 4BFVA 4DT1B 4PO9A 2O8CB 1RJ9A 4BE7B 1GAJA 1KMHB 4PPQA 1G9XA 2FFHA 2ZI6A 3A1TA 1UBCA 2WPDA 4QJ5A 3THWB 1G8FA 3FGNA 2I4IA 2DWOA 1Q57A 5JMTA 3TK1A 2QPTA 4GFDA 4AKHA 3WP0A 3QXJA 4GZMA 1XZQA 3DKVA 2WOOA 2CXXA 1U99A 5TARA 3AB3A 4DCSA 4NZYA 3EA5A 2V8OA 3NG1A 1DAKA 4GI7A 3VHLB 4QNRA 1VYTA 1JALA 1W46A 1PJRA 3U44A 1E2MA 4KJZA 5GJWC 2IWHA 3ZZTA 1ZRHA 4RZ3A 2CLDX 2JLVA 3C5CA 1GL6A 1U8YA 2HF8A 3DEFA 3A4NA 2IS4A 4V03A 1CF4A 1XJ0A 4AKIA 2A2ZA 2FGKA 3U4QB 1QHIA 4PC3A 2IWRA 1WE2A 4W7SA 3DKPA 1HUQA 1KI8A 4LV6A 3FKQA 4RD6A 1NG9A 1RKBA 4GNKA 4TMKA 5L8VA 4B47A 4BRUA 1TQDA 2YVUA 2ZEJA 4P4SA 2FMXA 5CB8A 4C2UA 1E94E 2FE4A 4QKQA 1NLYA 3KFVA 2QT0A 3CW2A 4UKDA 1O87A 4RSGA 3T34A 2VHCA 2ODNA 2RAPA 2CHVA 2CNWD 3GLGB 2ZAMA 3MJRA 3S1AB 4S35A 1KI6B 4O3MA 1K5GA 5CK5A 4LHVA 3RYTC 3CWQA 5FPSA 1JB1A 2BEKA 5F9FA 2J45A 1OYYA 2BVNA 4QG7A 2R6CA 4TT3A 4N1AA 4IKEA 3B8HA 5L3QB 1PLLA 3PG5A 1YKSA 3MFYA 1E2LA 3DDCA 2YKGA 3PVSA 1Y3AA 3LLMA 1H8HA 4TLCA 1E4VA 3T35A 1AA9A 1H8EA 5KU1A 2QMUA 4DDTA 1NG1A 2BOVA 4AWXA 2BCGY 4A15A 1XTRA 3I72A 1JR3D 1AIPA 4US1R 2WMOB 4DLZA 2HYDA 1BKDR 4BLQA 3GLHA 3EC2A 3MG9A 3K9LA 3SJZA 4E5UA 3THYA 2V1XA 1KK0A 4LYJA 4NYMQ 2ZJBA 2GAAA 1AQYA 3FMOB 4OQLA 2JATA 5TDHA 4B2PA 2HYIC 3U3KA 3AQ4A 1FNNA 1XEXA 3FHOA 2ZR7A 1XRJA 2F9MA 2WJHA 2O0JA 4BPBA 1MABA 4D2IA 3WMEA 1S4QA 4C4PA 1ZYUA 3B78A 1TU4A 5FI1B 3IO3A 3QKSA 1E2PA 3T1OA 3I73A 1N6KA 4WXRA 1JJVA 2VQSA 1OH5A 1Z83A 4HAXA 1KK3A 1XMIA 2HXSA 4GOKA 5HE8A 3D7MA 4U5XA 3C4JA 1YR8A 3AKCA 4H1UA 2VYFA 1E96A 2AX4A 4TTPA 4BFZA 3OHMA 1DADA 2PH1A 5DE3A 2AKYA 1XU4A 2PZGA 1KAOA 4OK3A 3BH6A 5L3VA 2ZYWX 3D8BA 3TR0A 2HJVA 3Q3JB 3RS0A 1ONBA 2F43A 4HAYA 3T5GA 3WBJA 4CEHB 1JAHA 4X8LA 2O8DA 1U9IC 3JVUA 4JVLA 2R6FA 2WV9A 3TRFA 5M04A 1SVMA 1XXHA 2IS1A 3TVDA 3QPWA 5BXQC 1N6LA 3VR1A 1B0UA 2XSZA 4BEJA 4PQRA 3GLFB 1IN5A 3GCGA 3BXZA 1WB9A 3WY9A 1YR9A 4ESHA 1E1QD 3Q7QA 4QC2A 4JYBA 3T1TA 1C4OA 1N6IA 1IHUA 4WA7A 2GXSA 4GMDA 4PANA 2OILA 2X2FA 2QQ0A 2ZUCA 1E2FA 3LVRE 4Q66C 1AN0A 1E2GA 5JECA 3MAAC 5C4MA 4BWYA 4GL2A 2ZRKA 2P6UA 1IXRC 1KK2A 1TADA 1X8KA 4JLPA 2GXUA 2O8BB 4QL3A 4JJKA 4YXWD 4UXHA 1IY1A 2AXNA 2VRWA 4LPKA 2QN6A 3AVQA 3KQNA 4LV8B 1E0AA 4JZKA 4B2LA 3KQUA 3FMPB 3ECCA 1DG3A 1G64A 4CYMA 2ZXUA 1KNXA 2JCSA 5LBIA 2R8RA 1GZSA 3W34A 3L8YA 4A0GA 2W83A 2RGDA 1T8TA 2RGAA 2DWQA 1LFDB 3DZ8A 3IO5A 3L0IB 2D06A 5KSYA 1P9WA 2EU8A 3BFKA 3T1QA 1A82A
chains in the Genus database with same CATH superfamily
5BMVB 3EGEA 2XJ4A 3FCCA 3HUEA 1E5VA 4J0FA 2WHPB 1RQNA 4KXUA 2OLEA 1XD9A 5AHKA 3RSLA 1AUVA 1Q0RA 1QX4A 3Q7RA 3ZE7A 1DNPA 1COZA 3QW4B 4CMJA 4HX5A 3RK0A 1M7HA 1WXHA 4I4IA 2V7PA 1IQ0A 1WVMA 3NGMA 5HJ5A 4ZOCA 1PSWA 4C87A 4F3NA 1C2TA 1DX6A 3VKUA 4X91A 1U11A 2EQAA 3P52A 3W8FA 4QQ8A 1LJ8A 3RRYA 2AXQA 1ZX1A 1G8PA 3QG1A 2FMIA 1JDSA 3PL5A 1IZ0A 4EA6A 4I1OA 1L1QA 1L5RA 2H16A 2FPPB 1U3WA 2HXGA 3LFHA 4H3VA 4D45A 4LFBB 3CJRA 4YRRA 4U3JA 2DUWA 1NVAA 2I4RA 3NQ41 4MS3B 3GQBA 4OJMX 3BZBA 3DUWA 1KRXA 1A95A 2EX0A 3ZN2A 1KI3A 4PLFA 3RC7A 1KYTA 1KYZA 2IHKA 2QN7A 3MC1A 4RIFA 5F1PA 2HZ7A 3KOZA 2PWBA 4OHOA 1SIWA 1CP3A 2Y92A 1DWOA 1WXXA 3HP1A 4INZA 4QHTA 3Q98A 4URXR 3NTLA 3PDWA 1THTA 1XF1A 3TSZA 1JSZA 3Q9LA 1UJCA 1OLSA 3R5TA 1B42A 5HZHA 1XHFA 2M1ZA 1SCKA 1GPH1 3K6JA 2QX9A 3MGAA 4D57A 4ED9A 3HXMA 7MHTA 3IR5A 3TW8A 5DM60 1J2JA 1TK9A 2BFNA 3ECSA 2JZCA 4J2TA 3MRSA 2O5RA 4BNDA 1WW8A 4LJ7A 5CTJA 2X1VA 2VF2A 1UJ6A 4MA4A 1H0KA 3EZNA 3L0PA 2WIBA 1GZ6A 2P2SA 3EE6A 4Y6QA 1HETA 3IDOA 3AVYA 4B2YA 3F46A 1E6EA 2F59A 3ET5A 2NZWA 2NAPA 1OROA 4U2GA 2C9BA 5D1NA 1MXFA 2A8YA 3UJHA 3TLMA 4CG3A 3PSAA 2ZIUB 3B3FA 1HTBA 5A5FA 2ZDQA 4GYYA 2VBGA 3TZEA 2RDMA 2G0TA 2XWBF 3T7CA 4QOSA 2HQ1A 3FNQA 4QUHA 3QKRB 4PZDA 4EM6A 2I6TA 2ZS8A 4EUEA 1G16A 2DT5A 4BLOA 1AT1A 2Z83A 1K8YB 5FBQB 5E8RA 2MCFA 4Y2VA 3SBEA 3WKDA 1JTFA 1XQXA 1IBKB 3RVNA 1MKYA 1TTHA 3DBOB 1BSVA 1ZVKA 1I3NA 4YMIA 5LBTA 5HRCA 3V6LA 1MVLA 2Q8NA 5F4BA 4AIRA 3IIMA 3SSNA 5IJAA 3VKVA 1ZCZA 3O83A 1NJ8A 5KNBA 4J7UA 1W0CA 5GGYA 2O8FA 1Y5RA 2GRAA 3PNVA 1LVGA 4Z9FA 5D3KA 2J33A 2NM0A 5GWXA 3HBJA 4AZ3B 2FLWA 2ZAYA 5JPCA 4ESVA 4NFYA 5HIIA 5KYYB 4I81A 2CUKA 1IPFA 2LIPA 3OTQA 2CL6X 3LC2O 3IMCA 5JTTA 1SCUB 3JPWA 4EYQA 4A9AA 2W6PA 4YJFA 2AWNA 2P6MA 1CUAA 1I4DD 1NF8A 4EO9A 1QHGA 4MUBA 1PGJA 4M0FA 3T9AA 2HBZA 1T5DX 2JD1A 4X24A 1JWBB 5A5EA 5JDIA 5JS1A 2VJMA 1G5TA 1Q7BA 3D7KA 4G81A 5DX8A 2X22A 3MJ4A 3TQHA 1JQAA 3UV6A 2XSZD 1SRQA 2FFQA 2J6IA 4RJIA 2WSSD 4V38A 4FMDF 4NDZA 2IC5A 4YLEA 4XD7A 3UB3A 2G8NA 5BSKA 4A0HA 1RP1A 2BMAA 3RSZA 1P4RA 1LDGA 4HLQB 3K05A 4NCNA 3IURA 4Y2HA 4MH0R 1ACLA 2FZLA 4HNAA 4KNWA 4BVLA 3FLBA 4F6CA 4U00A 4FZRA 1Q21A 2PXHA 1GVHA 3FVWA 4K1LA 1M6YA 4XOIA 1P81A 4J1QA 3QPUA 4HPWA 1E69A 3DZDA 3RRZA 2YZ7A 3SQOA 4J0CA 2Z08A 3JVVA 3PWSA 5AKKA 4E5SA 5GQSA 5JAQA 4EGSA 1UPFA 2C9OA 4EKDA 2IODA 1PGOA 4EUFA 2J9FB 4YCSA 3PC6A 4S1TA 1RM5A 4RMHA 3WGVA 2JAQA 2JI6A 2WJIA 4XJVA 2WC1A 4BFUA 4MWTA 2I7VA 4RTPA 1V7QA 3AI7A 3ZH9B 3V1KA 5KQMA 1BMDA 3B1ZA 5I3CA 1V3VA 3UENA 4QPPA 5FTWA 3L7DA 5AOCA 3TBFA 2IIVA 4EVQA 6REQA 5MN6A 4NCBA 1BDJA 4XM0A 5JT1A 1UFRA 1SD5A 2B2XA 3HDGA 1VECA 1KL7A 1NW7A 3SQLA 3DZHA 4ZVTA 4M0PA 1PK7A 2VH5R 1J23A 2DUJA 2CDNA 3TPFA 5I45A 1YJCA 2DHEA 4DUYB 1V1MA 1E4YA 3FR7A 2V5AA 4ZHSA 1E9EA 4PBSA 1XZIA 5EMJA 3ZZ0A 3IAHA 4DZTA 3OOEA 4BQNA 4MI1A 2BL4A 2QL6A 2RH5A 5ALXA 4CKEA 2WVGA 3GW8A 4QBFA 4QVIA 3I04A 5T6BA 3DQPA 1VE1A 2E6KA 4UAJA 4M1TA 2JEOA 1F8FA 1M0TA 3IULA 5DRTA 5REQA 4EZIA 2KB0A 3A2NA 3F98A 1G4AE 2XYHA 3HH8A 5K6AA 3K0FA 4PAOA 4WGFA 3MQ2A 4A2CA 3LXXA 1BD3A 4M76B 1WNFA 3R23A 4N5MA 4DVGA 4XYEA 1P5RA 1X2BA 1Z6QA 5C1PA 5LIRA 1UIRA 3AFIA 1P44A 4F93B 5ARDA 2PU5A 4A8JA 5CDUA 3OETA 2XE6A 5TQ0A 2O1SA 3V48A 4WVFA 3FKSA 1PS8A 3WE7A 1AGXA 1QS0B 2JKVA 1M2OB 3OTHA 3PFBA 1U9YA 1DJLA 2XDWA 4M46A 5JBNA 5KOIA 1QRDA 1T9DA 2HAEA 4ALLA 3L4BA 4MUEA 3KD3A 4L15A 1KMQA 2NO0A 1PWEA 2ZUUA 3N39C 1C9DB 1VP3A 4JT9A 1JHVA 3JALA 3O47A 2BT4A 1SXJD 3MS2A 2G9NA 4Z51A 3T9EA 1BHO1 3JTMA 1Y80A 5C5EA 1QJCA 3JAWA 1EDZA 2RAUA 1KO1A 1N1GA 3ZXYA 4L0QA 2BMVA 3L7CA 4F4FA 1JSRA 1ZGCA 4KAJA 1O0BA 3EH1A 1X7YA 1O9GA 4CM1A 2ERYA 1CIVA 3WRYC 4UQLA 1L2TA 3JQ6A 3EGXB 1Z29A 3STTA 3UUGA 1DC3A 1CNMA 3D8NA 3OD1A 3HV0A 3LUHA 3ESRA 4FMPA 4D26A 4DV0B 1SCDA 3WGZA 4LF7B 1EVEA 3GX1A 1AJEA 2QJWA 3TTTA 1PFYA 5DIFA 5EG5A 1DPGA 1L3BA 4NBLA 1L5QA 2J7PA 1B8OA 1TJ5A 4NC9A 4NCIA 1C3OB 3FDZA 4ENTA 2I8CA 1KFEB 2JPDA 2OTCA 3RAEC 1J7JA 1K5PA 1BJKA 4BQRA 1YHYA 2PS9A 4L27A 2BMWA 3ETLA 4UNPA 5JG7A 2P11A 1SK9A 3S6JA 4B3BA 2REXB 5J4YA 3K9CA 1GG2A 3KPYA 1P8JA 2O0KA 1KMCA 1J8QA 1DC4A 3IAS1 4UEKA 3D8TA 1U6IA 1EDOA 4NH4A 2ZE8A 3MT0A 2R25B 4YRIA 3R3WA 4DGSA 1C1XB 3E5HA 3BRCA 1J9EA 2V6GA 4YMUA 3H65A 2HMWA 1LF5A 4M9XA 3HUUA 3DV2A 3ZI7A 5F2KA 1CG6A 2QT9A 3BCRA 3Q2KA 4EGAA 4XJSA 2XMRA 1K6XA 3BE6A 3O8NA 4PN7A 1PX0A 4YMWA 2JRLA 4RX1A 2IOHA 3VU1A 4QFCA 3U7QA 2FPOA 1P2SA 3UH0A 1WMBA 5C8ZA 4DDVA 3WWOA 4P0PB 4ZDJA 2W8BB 3ZTWA 1MO5A 3C1UA 1HORA 2VQDA 5CK4A 4OLAA 2A58A 1K97A 2ZVPX 3NAQA 4MUNA 5A6VA 2IIPA 4F4IA 2XDQB 3ZWMA 4AQDA 5LXTB 5TS2A 4Z4QA 4GDMA 2PTHA 3NKFA 4D43A 4M2LA 2ZAIA 1U0OC 4JUFA 5GONB 2AH5A 3N75A 4G1FA 4RCVA 2FN8A 2PUVA 2YN2A 5BWMA 3I6ZA 3LL4A 4PPNA 4RPIA 3PXGA 1QQ7A 3FZNA 4Q15A 5TIIA 1XA3A 1PTJA 2D0IA 2VPZA 4J43A 4RD3A 3P9IA 1NYLA 1A96A 3PDJA 3PFKA 3RRMA 4OY3A 3H5TA 3N5CA 4XQEA 5B7QA 1DFIA 5HK9A 2HU8A 4RY2A 1Q83A 4J07A 3X2FA 3THXA 1GN8A 2FP4A 3OQOA 4IFIA 4U7FA 4MRRA 5FFMA 2Q3FA 3SIXA 3KQVA 2GBFA 3MHPA 2QRGA 3B89A 5IJ0B 2HFJA 1JKFA 3UFBA 5CIYA 1WCXA 4QUIA 1GPUA 1RXEA 4FHCA 5ALLA 4M9RA 1LF0A 1U2PA 4BATA 3DFZA 4W8HA 5FLEX 2A9QA 3DXFA 5GM1A 3USCS 1ESDA 2BELA 3HYRA 4QBGB 1T5LA 4M0CA 2BFPA 1KY4A 4DNQA 1CEEA 1HC7A 3HR8A 4RM3A 2Q5QA 4WDQA 2IHVA 4JXJA 1DLJA 3LZDA 3LVBA 3WYFA 1VPLA 3A1CA 4KFRA 2AA3A 4FYYA 4KAAA 4M9QA 3DTNA 4ERNA 3DAOA 1OUMA 4IBOA 5ALGA 3GVXA 4AJEA 2WUEA 3AM1A 1Z34A 1U2GA 3HVJA 1J1ZA 5TY0A 3QMPA 4RLQA 4AY6A 1IUPA 3GUUA 4PZZA 4QO7A 2B25A 1L8QA 4KZPA 4AMVA 5ALRA 4TKUB 5C1IA 3HY6A 2PLWA 1PT8A 3DCYA 2H85A 4JVSB 4LNHA 5D84A 4B3DA 3DL7A 4RHYA 3TOZA 3ADKA 4HADA 2ZBDA 1UZLA 2IHBA 3SM9A 2CNOA 1EYZA 1GKLA 5K51A 1M76A 4IHJB 1S2OA 3VZBA 2YIMA 4OHKA 4ZT5A 1C30A 3IELA 5K8CA 1VE9A 1WAMA 4ZZ0A 4NS1A 1N0HA 3TEJA 3TXAA 4YJKA 3OE7D 1N0WA 3UN1A 5FOTA 4DBLC 5FWYB 1ECLA 1D6SA 3QVXA 2O8NA 1L4MA 3L1UA 3OT1B 4Z4IA 2G71A 4PCLA 2FOLA 3UANA 2V5UA 4AC9A 3QV2A 1MLDA 2AL7A 2QTVB 4P35A 4C7VA 1YB6A 1DOZA 4HYEA 3BTUA 2G06A 2QHXA 1EH5A 5IAJA 1TZJA 4HZIA 3BEDA 4KQ1A 5I9NA 2NU7B 3ES9A 2PIAA 3JCZA 1SKAA 2O2CA 3P94A 2UDPA 3M4NA 3RYCA 1ODFA 3AV3A 2YV2A 4L5BA 2OGWA 5EZYF 4I46A 3DOJA 3F7NA 4LXUA 1GRNA 4N7BA 4YP0A 4BAZA 5A6SA 1GGHA 1GFZA 1M6EX 4EARA 3OQNA 3BFVA 5DIZA 3RC9A 1FFHA 2W6ID 1QH8A 2X4LA 1V25A 3BREA 3OWHA 2XADA 4RFSB 3K16A 1T4MA 1SVIA 4XUCA 4DJ5X 5BN4B 5TQVA 2PZLA 3QM1A 4F3YA 2ZCVA 3KNZA 1KJJA 3B12A 4JHXA 1ZW1A 3RWMB 5E9AA 1G8JA 1ZMTA 3L7BA 3MSXA 2FG5A 4RD2A 4WCFC 2NQTA 2ODEA 2IEYA 1PQPA 4N47A 4PHFA 4MJXA 1Y8QA 4JB8A 1MT3A 2I91A 4Z9XA 5SYMA 4AKTA 4C0SA 4NYMR 3OOHA 4JT4A 5HS6A 4QG3A 1WKVA 2ZLBA 1JYFA 3M4YA 3FPAA 1N2OA 3TCXB 5DXJA 5C0OE 3OZDA 2Y2VA 3MUEA 5F5NA 3S5JA 3WZLA 5DEOA 4OH7A 1JAZA 3NLLA 5EIHA 1MB0A 4D9EA 1R0WA 5I7RA 4RTRA 5EEHA 4P3PA 2OESA 4RJTA 1XUOA 3CLVA 3CNEA 5BSMA 4IX9A 4UREA 4FIZA 4EPWA 5C9ZA 1WQ3A 4QLAA 1N0UA 1PT7A 5FH9A 4RTKA 4FOOA 1ZW6A 3GMIA 5LOVA 4RSRA 5TEWA 1RRMA 3PHIA 3VR2A 4DA7A 4D0SA 1XO1A 1BO6A 1V16B 4UZSA 4CEIA 5CAEA 3RS2A 5I4KA 2IUSA 4MZXA 5ALYA 3ONVA 4E5PA 4M9CA 3CEJA 2BFDB 1GOTA 1NT2A 4R2IA 4BGEA 4ZPXA 4JEHA 5IMSA 4OJYA 3A1NA 3A6FA 2VPIA 4HN2A 2ZSHA 3B7WA 2R7KA 3QELA 3EY9A 2QG4A 1G20B 4GZ5A 1IZ7A 4EQ6A 4OI4A 3MMPA 1ZBQA 3CKMA 3PPXA 1UKBA 2GTPA 3I61A 1TPYA 2XDYA 5ICGA 4NU5A 5D7NA 2WTXA 1C3JA 2COKA 2PGIA 1WUTA 4X9XA 3B3GA 2W6NA 1EP1B 3EGOA 4CKBA 4EITA 1U8FO 2HUPA 3DMNA 4OHUA 4R2HA 2FMHA 3F90A 4M1OA 3PEWA 5CBPB 2Z04A 1GDTA 1HOTA 2GZDA 1E58A 5JCOA 4FCVA 1S3SA 3RVMA 3RVKA 1CB7A 4HNUA 3B1YA 4H6PA 5C46F 1AO3A 1V95A 5LNK6 2A86A 1QBGA 1QHSA 3I6QA 4JXKA 4MKZA 4N6OA 4RUKA 1QK4A 1NTOA 4UDOA 4H1HA 5EN4A 3ZW7A 4PC6A 1QGDA 3RFXA 3IUYA 1QG4A 5AOBA 4TV9F 1JDJA 1QTRA 2E5FA 4MJLA 5HA5A 1JX6A 1S9HA 5EXSA 3G3EA 5IN4A 4YAEA 3QRWA 1EB8A 1YFKA 1XNGA 4DLPA 2VYND 1OBVA 1MTZA 5EA2A 1D0SA 1RRCA 3JQPA 3IQZA 4A8JC 3BTOA 3LGAA 3T9BA 2OFFA 2A9KA 1WUIS 4OXQA 5AXDA 3HGTA 3JD2A 4WADA 4DARA 1E4EA 3S99A 1IDN1 3B2EA 2IHYA 5EOVA 2IP4A 4DEVA 3I37X 3ECAA 5ESXA 1CIPA 4ACAA 2IH2A 2OEPA 2I71A 3QKIA 1O95D 5DTMA 5FNVA 1VIAA 1UJ5A 1WEHA 2GPJA 3RI3A 2O0MA 2O20A 1YQGA 1QAQA 2B0CA 2BONA 3I2JA 5DOVA 1I5OA 3SJCA 2OFXA 4QQFA 2WYIA 2IITA 1ZKMA 2GA9A 1C3VA 1Y1SA 1TCAA 1NYQA 1XZMA 2C2OA 3KPWA 4LDJA 4Q24A 4Y6GB 3JX9A 3RJ9A 3U7GA 5IVHA 5TVKA 1K98A 1U0RA 2AV6A 3DAHA 3HXKA 1G17A 5B1SA 5JIBA 3V4FA 1J6UA 5T3YA 1RBMA 4BDTA 1IIRA 5I3ZA 1ABBA 4YY3B 2GK4A 4DZRA 3NUQA 2YFKA 1GIAA 1VIVA 1HE2A 3H5OA 4ECEA 1KZ4A 3KSAC 4ARIA 4IEIA 4HJRA 2OQRA 4GBED 2WF5A 2GHQA 2IYNA 3EQ9A 1OKKD 1QYWA 3IYLW 2IU4A 2O7SA 1VA4A 3AB8A 2UXDB 5ALJA 4FB4A 3TQOA 2G63A 4LDPA 3T3PB 3Q7SA 2QL9A 2M9MA 2RKOA 1J70A 3H83A 4GC5A 4Q4DA 4RTSA 1AKWA 3ZU2A 1O5TA 3PE3A 2VHTA 2NUBA 4L9RA 4RZHA 2Q6IA 4NI5A 3GT0A 1XDUA 4MULA 3JQAA 4DMUB 4JJGA 4RSMA 5DM4A 4F8JA 3R5FA 1JEQB 3BBPA 2EJUA 4IZHA 4QGFA 1KEKA 3L0ZA 2J1LA 4WOJA 4M0EA 2ZUTA 4CCAA 1VXRA 4ZYXA 3OICA 4YRQA 1GXSB 2I80A 2YS7A 3EVGA 3OZUA 4ZT6A 2CKDA 2H0RA 2JL1A 2MSWA 3IX7A 4RFVA 2Q29A 2VWQA 1DRKA 3VJKA 4AO6A 3MOIA 1KSJA 2CE7A 1XU7A 3D5QA 5C7YA 1E1DA 3QWIA 1O54A 2NO5A 3A0UA 5CM8B 3RB8A 4YP7A 3O03A 3KB8A 4DLLA 1Y34E 2DBRA 3M6WA 1A4UA 2NSJA 5IEBA 2R1TA 4FOSA 3S55A 4YR7A 3I92A 3EPKA 4PX3A 1AMNA 2P91A 4UTXA 3USZA 3GN1A 4B3HA 5TT0A 4ZIRA 4PIPA 5IFKA 1JDZA 1G60A 3D3WB 3HJCA 3S68A 1PNQA 1TO2E 3HJRA 1L7PA 1N2CB 3FBWA 3K0BA 4M89A 4NBUA 4CM5A 4F3TA 1NNI1 1WCV1 2NTNA 3DBHA 4PG5A 1A9PA 1JJIA 3QLVC 3BH0A 3ZY3A 4BASA 5ICEA 3AZPA 1KRWA 1NFFA 2QTWB 4II2A 1KERA 4UUOA 4P08A 4CFZA 4NRDA 1MC5A 1PTJC 1ECGA 1G8MA 3OX4A 1JP7A 1A4IA 3PPVA 7GPBA 2YJTD 2C83A 2FEKA 5LMUB 3QFTA 1JLHA 3Q10A 1PQUA 4N3CA 4DOMA 2VTKA 5CDHA 1RVDA 2XAUA 4QFDA 4D3ZA 3ZWCA 5KJFA 4JITA 4XQGA 4ZTBA 5DH9A 5IVPA 3OLZA 2ZJ2A 3ZD7A 1XJ5A 3HI6A 4INJA 1SC4A 1LVHA 4P93A 5CVUA 2W2VA 2HL6A 2O3UA 4EZBA 2YXLA 4KNVA 3ANXA 1WHSA 1GQSA 3FVQA 1EFPA 2A9JA 2I54A 4PYRA 2B94A 4GL4A 4POAA 3RUAA 3EIFA 3MJEA 2R11A 2F4VB 3M5PA 1TJNA 2FRXA 2ZROA 3KYBA 2J4DA 3P0HA 4KO4S 4ZAZA 5BPFA 1AS3A 4XUEA 5C51B 3ASUA 5DNYB 1QHYA 2ERCA 2QR5A 4P7GA 4LXHA 3NATA 1LS1A 2UUBB 2B4AA 1A8QA 3PGVA 2Q1YA 4LXIA 3T8YA 4KQMA 4TWBA 2RGCA 1AUXA 3EWSA 1YDWA 1BS1A 3BH7A 3RYFB 3SXJA 3KLOA 3AEUB 1HFJA 1U2GC 5EAIA 1P31A 3T7TA 4M0LA 4D4HA 4HGQA 2IPLA 4LYGA 4JL8A 1YU9A 4TSKA 3G0BA 4HY3A 4U8GA 3S0JA 4D3FA 5BXYA 4KYTA 2QM7A 5AKEA 2Z2ZA 5DNUA 1OYVA 3LBYA 4L50A 5GIPE 1XJQA 2CJXA 2I3DA 2WU8A 1WTCA 4LK3A 2O9JA 4RTMA 1X7HA 2ZJ3A 2JBAA 3VGJA 3N0TA 3WL8A 1L0BA 3L9WA 2G28A 2YWDA 1MOQA 3A3KA 13PKA 3C8HA 2RGNA 4CF3A 1CQZA 3CNHA 1N3BA 5CDSA 1T0UA 2WTNA 2ETVA 3BXXA 1QF9A 3IHTA 3ENKA 4HH1A 1NVVQ 2YOFA 4AD8A 1MHPA 3TIIA 1LU9A 1EXMA 2Q0SA 1FRFS 1U28A 2G7ZA 1KSGA 1DMRA 1HQKA 3WQQA 4UTPA 3ICQB 1ZBDA 3C3PA 5U1PA 1PE0A 4BO8A 4FZJA 3O94A 3A2KA 3WDSA 4RW0A 1QTNA 1DWQA 3BULA 4WQMA 4D80A 1NQVA 2JHCA 3KOMA 3RC1A 1QU2A 3UPUA 1RAAA 2VPYA 4C7BA 4BMXA 1QR6A 1QG0A 1O2DA 3E53A 4FGJA 3KT8A 2ZXEA 4L73A 1NBWB 2X1LA 3DO8A 3VO9A 1RZRA 5BORA 3IIJA 3O0DA 5TSDA 3FTCA 1PDWA 3E3LA 3ITDA 2C82A 1H2RS 1ZCJA 4OGLA 3DEZA 1CDOA 1C9JA 1QYIA 3OJXA 3PYXA 4DM7A 2HQBA 1EK6A 5BYJA 3SS9X 5AVRA 4C7OB 4GKKB 2QX8A 3AEXA 3L8CA 4I5DA 2YVAA 4HN4B 5HPYB 2IQ5A 3RSFA 5C7IO 4YQFA 2PRKA 4V0NA 3AR2A 4N8EA 4B4KA 4YUZA 3A9WA 5AK3A 3C6KA 1PT9A 3HMQA 4Q01A 5DSTA 5HSGA 1U2EA 3T7KA 3D7SA 2WD7B 1K6IA 1NBOA 1FNSA 1B73A 1NWHA 1QBKC 1ZM2A 3HFGA 3ZV6A 1ZD4A 4X1IA 3BDIA 1VHDA 3AJ8A 3I9FA 5T5QA 5L4LA 1KZHA 4QJBA 4K0RA 1RMTA 1W44A 1M2JA 2VDOB 3SBXA 3ZDYB 2WTBA 2NUAB 2QAGA 4B81A 2E1PA 1KK1A 4BZXA 2UVDA 1PJTA 1Z06A 1Z5GA 3ZVLA 1ZR4A 2K87A 4LC0A 4NCHA 4CXMA 4XLTA 5EE3A 4ITVA 3SR0A 3BFXA 4ME6A 3TGWA 4DT1A 2OFPA 2R1VA 1XTBA 3GYGA 3ENNA 3TE7A 4EG8A 1DKOA 1E5XA 2MT9A 3C7TA 2V7TA 3BRWD 3Q7IA 1GARA 1M6WA 2KI5A 4I1RA 3WK5A 4KO1S 5TE9A 1XVAA 3WMFA 4B84A 3AVWA 1L7XA 5FR1A 2CCJA 3EZ7A 4NEGA 2PWPA 1Z8FA 3L2OB 4LZAA 3EVNA 4G0ZA 5EHNA 1J8MF 1EUYA 4Z0PA 3V00A 3DL4A 4E5KA 4D97A 2FW0A 1XROA 1Z22A 1L8AA 1V5WA 2EHDA 1A2BA 4UHDA 2XMDA 3MJVA 4ZRDA 1V4VA 2ADFA 4RKRA 4AJ9A 2O54A 4JI7B 3F6CA 1DWPA 2G76A 4FNAA 1IQPA 1LPBB 1NXSA 4GOND 5JCZA 3NOQA 4JJ8A 3ISJA 3K1ZA 5M5BA 5BR8B 3MJHA 1QGAA 1HI9A 3UOWA 1WX1A 3QK7A 4OYLA 1D5CA 5ECWA 4DLTA 5L3SB 5LYJB 2G7MC 2E5LB 3ASVA 1YMVA 3MTIA 5E1DA 3T3HA 2HIGA 5JCOC 2VNHA 4AM8A 1LDMA 3SHTA 1WCIA 4D9BA 4OSOA 2ODAA 2FQQA 4A26A 5HRUA 1GAEO 2R5WA 3DOOA 2APJA 4J94A 3U3DA 3LL7A 2QW1A 4PX9A 4LHWA 4WOPA 1KZ9A 1TEZA 5G40A 1NJ5A 2AI1A 2WJAA 3LT0A 2QVGA 3FVRA 1RJ9B 1SU7A 3O1IC 4KXFB 1HZZC 3KQKA 2N75A 4UAUA 1H6DA 2GCNA 4OXXA 4AZ0B 3RS3A 2WTAA 4MDHA 1KI1A 1PJAA 4JBXA 3L6BA 2RHHA 5JVDB 5KTRA 3RREA 1UDWA 3A6HA 1MB9A 4C6TB 1JEDA 3KP1A 4RGQA 1YZ3A 5WRFA 4DCVA 3BGSA 1FNBA 1TM7E 4Q6WA 4RD4A 3GLGA 3EAFA 4AECA 1FW8A 3A6DA 4CTKA 5LFAA 1SWWA 1PJQA 1OYWA 5DYGA 1U65A 3QVVA 1SVWA 2O2IA 4GYKA 4XZ3A 3AR5A 3UPTA 5KCMA 3HLYA 1QX3A 5C3UA 3BEOA 4YCLA 2JA2A 2WUGA 4RDXA 2H2IA 3PT5A 4JJIA 2MYNA 3ZQ6A 4KU4A 4QOJA 3AJEA 2IU0A 4WXMA 5F21A 3PLAE 4BO2A 5FA8A 5L3QA 3NTUA 2HHLA 3F0TA 1PGPA 4PFQA 4BNHA 2FR8A 3LCUA 2GZAA 4KG7A 4QUJA 1SC6A 5D86A 3REFA 1Q3TA 1O9HA 1ZISA 3IV6A 3JR3A 1IL0A 1JKIA 1DOHA 2QPOA 6GPBA 2AFHB 1YB7A 3GNSA 2TRSB 3H7AA 3ORQA 4DY6A 1V26A 1R37A 4PTZA 1HYBA 3COSA 3MK31 4UUQA 1MOZA 1OWLA 1SHTX 1UEXC 2GJ4A 3D81A 1B0AA 2V0NA 2ON6A 3L8ZA 1KYYA 3MELA 4Y9UA 5DM1A 3THOA 3U81A 3VO2A 3CPJB 3ZOKA 3NHUA 3GQVA 3CE6A 3FDFA 1RMQA 3RRFA 4G37A 1O0SA 3UUFA 5IKMA 1QPZA 1YDFA 4MS1A 4HNSA 1X7WB 1ZNZA 4O2BF 1Y3DE 3RTCA 3ZWQA 5M29A 2DPLA 1RE0A 3QE9Y 1M2FA 2HDWA 1RHMA 1LQTA 3B7PA 3QX9A 2LV8A 1P1RA 5DGCA 3X0DA 5AJVB 3AFGA 1PK8A 1EKXA 2HIAA 2LDBA 2XUFA 3PNPA 4IO0A 4KLRA 1KI2A 4LECA 4WXPA 5D6NA 4MV0A 1J97A 1T2CA 2QM8A 4BNUA 5K0JA 1TI7A 3D4PA 1OLUB 4YUVA 2W58A 3H9QA 4G09A 4DL9A 4IJVA 3RGWS 3O74A 2CCKA 3EGDA 3N9IA 4CCSA 1NWCA 1XL0A 1H9BA 1PVVA 7YASA 3L46A 1TPZA 1V7CA 4U39A 3FY4A 4NL4H 1UP7A 4FONA 1GSHA 1BCRA 1SCJA 4GOOD 4RD0A 3N7TA 4INAA 4DMLA 3GOHA 1Z2CA 3X2SA 4ZJYA 1QSGA 1LPOA 4KQFA 2P5YA 2WSMA 3NT5A 5K3DA 4DQKA 4ZK6A 3HRIA 4NMWA 5K0FA 4ZICA 1KRHA 4TUYB 4UOQA 3THYB 4ZTUB 1DZ3A 4IQFA 1S1CA 4DV2B 1NGSA 3W5UA 4CL8A 4NDNE 4E5MA 1YE3A 1QR2A 3SYNA 1Z8NA 4PR0A 2OP0A 3LI2A 4TRRA 3D3JA 2C4HA 3ZEAA 1AM4D 3VR4A 4N0EA 4GO1A 3ZI0A 3BS4A 5AH0A 2ZTMA 3HY4A 3JSAA 3V34A 4HH3C 2VRCD 4OLHA 5IBRA 2YJ4A 1Z45A 4LJYA 1L9XA 1QGYA 5IUKC 2JD0A 3AUAA 1RT9A 4JOQA 3QU4A 5AI0A 2HSJA 1KJIA 3SZMA 2FLKA 4QGHA 1W7AA 4B48A 1C1DB 3GPCA 3W2HA 1RAFA 2D3WA 1UKZA 1FZQA 2P9ZA 4P4GA 2HWYA 3NJ8A 1G20E 3I5MA 3O2SB 2VZLA 4BX0A 2BGTA 4GS5A 4TXLA 2B34A 3L1KA 5ARBA 4F6LA 1FFXA 4RJJA 3ZTYA 1HDRA 5C80A 3IQFA 5DB4A 3PGLA 3HXOA 2XMSA 3OM9A 2BP7B 2FAXA 1YI1A 2Y1KA 3HCEA 3M49A 2JGDB 3D6MA 3FNIA 4DCGA 1KQFA 3QWBA 1DAMA 4FZ5A 3ZHBA 3ZNOA 3F3SA 3WQRA 4B4OA 1E8DA 3TBKA 2W90A 1E1MA 4K81B 1JU4A 4M1QA 2FSPA 2FEPA 4FHFA 4EHDA 5B5SA 4BZQA 4MUMA 5EWLA 4J0EA 1AF4A 3KQQA 2VAMA 1H1TA 3N70A 3LY7A 3V9PA 1WXGA 3G8DA 1M1YE 2RHLA 5BV2P 1R9GA 4N3AA 1CJKC 3O2QB 4ALIA 4XWWA 3VO1A 5FEMA 3PHLA 3ODGA 2Z30A 3FPBA 4KDRA 1EUCA 5FWNA 2Q9BA 5AW4A 1JIJA 1XJWA 3HB5X 3QUCA 4KBGA 3P0EA 4CFSA 4Y2YA 3GEMA 3REQB 2OCIA 1LPAB 2O50A 5ALDA 5JSZA 1P4GA 2V55B 1OLOA 3HCRA 4Q9LA 3GLGE 1A7JA 1YE8A 4ZOLF 2BR5A 1NRWA 1U28C 4ZCPA 3RF7A 3MWEB 1SCNE 2FFRA 3LUCA 3PFNA 4J4HA 5KHAA 2RC6A 3ADOA 3HCFA 3X1XA 2E3JA 2BAGA 2OM6A 4BN4A 2OWEA 2Y27A 4G0WA 1U8EA 4HAZA 4YJGA 4LWQA 4BJ5A 3I5AA 2GWHA 3OU6A 2Z3VA 3RYIA 1Q6YA 5E6UA 4CMBA 2JRCA 1DO8A 2RI0A 1VL0A 1WB6A 1D2AA 3T7RA 1WETA 4BP1A 1H3EA 4GICA 1SMKA 4QGAA 1FFDA 1SUFA 4P5EA 4Y1EA 5EP3A 5TMBA 4LXXA 4BV9A 4JIMA 1IAQA 4FW9A 2ACWA 3KEOA 3LXUX 4LOHA 4PAWA 3O8RA 2GARA 3L7IA 3F6EX 4NOLA 1BEUB 5J43A 3R7NA 3CIOA 1AQNA 1ZXBA 3BK2A 3WRWA 4IP0A 1J1IA 3H9CA 3UWOA 5JZOA 1NMSA 1JH8A 5BW8A 1G59A 2BFEA 5DTJA 3KZNA 3SN6A 1IJEA 3CN9A 3F4KA 3GGGA 4JU9A 1FX0B 5JCJD 3CV3A 3DKIA 1D4OA 1MAAA 3CEHA 3ZJ4A 4ZI7A 3I5XA 3BMXA 5JW6A 4KVAA 2Q8PA 1KFJB 3PDIA 5TMDA 3EMDA 4DWOA 3TG8A 2GCEA 1VMIA 1YZTA 1J2EA 2H8KA 1B4DA 1I2BA 1NONA 2GK6A 4OHYA 1W29A 1WNTA 1QFYA 5EXEA 3VM6A 1OU4A 4EG1A 2LUOA 1JR3A 4R84A 4BMVA 1N3IA 2C98A 2CWWA 1JZSA 3NM5A 3TGLA 1Y7HA 3AJDA 4A1FA 2QAGC 3HDJA 3RW9A 2SKDA 4D82A 3OJCA 5CDFA 4TYWA 3RFFA 2BD0A 4D4IA 1NZFA 4ARCA 1U0TA 2HA3A 2WSIA 2VK8A 3AZOA 1FUUA 3LV8A 3MS7A 3CUEF 3MM4A 5A9RA 1N4AA 1C9MA 2P6NA 4MRPA 5ALPA 1T2NA 1MPTA 2P77A 2XOKD 1AZSC 2F9LA 4CTNA 2ZUBA 4YJ3A 4P2GA 2CXSA 1BQEA 3LT4A 3TIGA 3VSEA 4BO0A 1ZN2A 2V6MA 1YONA 2QXYA 3A9SA 1AB5A 4FR0A 3UW1A 1SH7A 3NV9A 1FRZA 3C43A 2Z8YM 4ZV9A 3UGTA 3MUNA 4Z4FA 3HHPA 4P98A 4AW9A 4E2YA 3RSGA 1T2AA 2WIKA 3JQFC 2YYZA 4TLDA 1YT5A 3I8OA 3S8MA 5FOXA 4I50F 5DV9A 1C14A 2QTCA 3U4HA 3R7LA 1AMOA 4EHIA 4KSBA 2IUUA 1A7KA 1ZUD1 2CLOB 1LW6E 1NBHA 2WKRA 4YRCA 5G53C 3ZV7A 5JD5A 5JRZA 2KJQA 1RCTE 1OGJA 2ICAA 4KV7A 2H1RA 4PU0A 1VCIA 3FHCB 1EVJA 3KVVA 2AFVA 4FNMA 4MCIA 4V1CI 1QVVA 2DUUA 2QA5A 2WP8J 1BIFA 1XZJA 3A2MA 1I2ZA 2GCPA 2H2AA 3KZXA 2LIVA 3PHJA 3KETA 1EWQA 3BB1A 5GZ6A 2ZR8A 3QNWA 1QZXA 2EZ9A 1JDUA 1WL8A 2Z2YA 3AF1A 4P0TA 2K5UA 4V0RA 4TQAA 3TTUA 1XAJA 2VP3A 2A7QA 3IR7A 2YCBA 3F2IA 4G01B 3HCAA 2OLKA 2C2BA 1H5QA 2MIIA 1A2OA 4ND2A 3FHTA 4Y6LA 2AK3A 2Q0HA 1U8XX 1UBRS 2WQ6A 5TQ2A 4K9RA 4P2BA 3Q9SA 4F4UA 2QN3A 1P61B 3IUJA 4A0FA 4GBJA 1R4ZA 3JWPA 5AVSA 2CFRA 3KZMA 3WOHA 3A1UA 3AIKA 2GSWA 2BM9A 2J31A 4TYNA 1EZ4A 1LWOA 1C9EA 4A10A 4CR8A 4ENSA 5KOYA 3EIQA 3UAWA 4DC0A 2WF8A 3Q3EA 4WBNF 1KZGB 1CT9A 1OI4A 3OOJA 5AI6A 4JN6B 5EIBC 3GGCA 1F5NA 2Q4EA 2EKLA 3NBYC 521PA 1U3TA 2VPXA 4DMRA 3DBRA 3SBDA 3VMMA 2NPOA 3PQ6A 2Q3LA 5CNJA 4S05A 2OCGA 4EJ0A 5CJ2A 1BVHA 4LMBA 1O6FA 3AERA 1W4RA 1QIIA 2X4GA 4XUDA 1LK5A 1SC3A 2R6GA 1KOJA 3MCVA 2NUPB 3V7FA 4EPVA 2YIVX 1VPEA 1TTQB 5ICMA 1NULA 1Z5NA 1OI3A 1E6CA 3O1JC 5BSWA 1EXVA 4O4JF 1H6CA 3VHXA 2LDXA 3AEYA 4QPDA 3SZOA 4BO3A 5BT8A 3NFYA 1V2GA 1OZHA 2O3SA 4LOKA 2QSJA 3O3OB 3SQMA 4CUZA 1JHPA 3NVKI 1W30A 1JHOA 2BBSA 4YT4A 2R00C 4Q12A 4PS0A 3IEIA 1ODLA 4E7OA 4I50A 3LY5A 2P9HA 3JWHA 2D54A 4LSWA 2ATCA