2F3TA

Crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
b'AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
molecule tags Transferase
source organism Escherichia coli
publication title Crystal structures of GMP kinase in complex with ganciclovir monophosphate and Ap5G.
pubmed doi rcsb
total genus 69
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2f3tA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f3tA01
4TYNA 4K81B 2WKRA 4HAVA 4TTQA 4B3FX 4Z54A 4OK3A 1TTTA 3ZD6A 4LJ4A 3DKVA 1K6MA 4KVAA 2W6IA 5FOTA 3K0SA 4TYPA 4GP7A 3B82A 4NONA 3K70B 1TX4B 1DADA 1WRBA 1ZU4A 3GEIA 3AF2A 2JLUA 4Q1CA 4PC2A 5EZ6B 1HYQA 1RJ9A 3SC3A 2XX3A 2IEZA 3C4JA 5SZJA 1KI2A 1KSGA 1W4AA 1JJVA 2XJ4A 4QHYA 4BFTA 5HZHA 2XGJA 4KFSA 2ZYUX 5JWHA 1EXMA 1U90A 2VRWA 4NH0A 4Q9JA 3TVTA 3GJ8A 2VP9A 2GEUA 4DT1B 2KWIA 3REFA 3Q7PA 4B33A 1JEEA 3I4LA 3CUEF 4EPTA 3E5HA 1BYIA 1KAGA 1QHHA 1X8JA 3H0KA 1OH8A 3TMKA 4GBMA 1KK2A 1LY1A 4BUJA 3LBNA 1G5TA 3TQFA 4US1R 3MAAC 2ANCA 1SXJB 2FNAA 3GLGA 4TT3A 2VA8A 1ZNZA 3IKJA 2PJRA 1G8FA 3ND8A 2O8CB 1XEXB 1W36B 2FZLA 3K9GA 3LWNA 2AWOA 2W2VA 2R62A 1JPNA 5LDDC 2ZRFA 4CDGA 1E9CA 3NTUA 1DVRA 4GZLA 4RD0A 3TNFA 1UKZA 1KK1A 3TR0A 1QG4A 4PFSA 4B2PA 1QVRA 3SHFA 5GJCA 2QI9C 4LC0A 1WMSA 4ARZB 1OXSC 4QOSA 3LXRA 3CPHA 4S35A 1W4BA 2SHKA 3HP1A 4R7ZA 1CRPA 5LB4A 1XCPA 1RKBA 1K5GA 1WA5A 2G1KA 1L7VC 3FMOB 4HAUA 2MSCB 1KDPA 1KZGB 2WAYA 3HU3A 4UNQA 1II8A 3ZS9A 1TF2A 4NE2A 5D3MB 4JVNA 2IYVA 2C5LA 1XNJA 2BM1A 2WSSD 5CM8B 5IT5A 2IYZA 3VFDA 3IDQA 2XB4A 4HB3A 1CJKC 5F98A 3W9YA 4F38A 2GNOA 5IHPA 4FD2A 5L3SA 2O8DA 3T06B 2RHDA 1L4YA 3HDTA 4LOAA 4GT1A 4OHXA 4EDHA 1OB5A 4B48A 4NU0A 1JXMA 1HY3A 1ZUHA 4M21A 2O0KA 4OL0A 4IKEA 2XTZA 2QEQA 1BH2A 2ZS9A 2FPKA 1N6IA 4GOXA 3X1XA 4X8OA 5F3WB 2IEYA 3FTQA 4LJYA 5CDFE 2QA5A 2QE7A 3BERA 3I3SR 1OXXK 1IY0A 1Y3AA 4M4SA 3DEFA 1W7AA 1DPFA 2DWPA 2ZAOA 4UXIA 4MQBA 4BLRA 1II0A 1CTQA 1ZM9A 2VHCA 4LUCA 3NC0C 1G19A 1VCIA 2GJ9A 2ZR9A 1KMQA 3Q3JB 2WWYA 3IPXA 4V0NA 3QXHA 5P21A 1OSNA 2IYTA 3LX8A 3JZMA 2WWHA 4EQ6A 2ZE6A 1JQLB 4QJ4A 2QBYA 1KGDA 5KDLA 5IK2D 5LD2C 1RW4A 4UKDA 3S1AB 4JSTA 1Z6YA 1NG1A 5KNCA 3C5HA 3H4MA 1GUAA 1U81A 2OFXA 3FKSA 4URXR 1WE2A 4H1UA 4PQRA 3EPHA 1KNXA 2VSFA 2QORA 4B2LA 3FOZA 2B8TA 4U5XA 3VQTA 3O8DA 2D4HA 5JSZA 3TSZA 2E9SA 4AIIA 3QUSA 3THWA 1OYYA 2OILA 4WZAE 1KDRA 4TLDA 4Q7JB 3WMFA 1XJ0A 2CL0X 3VR1A 5JHHB 1KO5A 2FF7A 4GOJA 2VP5A 2HDNB 2QNRA 2WWGA 2JA1A 3BH7A 1PVOA 2ZQ5A 1YR8A 3SN6A 2FOLA 4W5WA 2XTNA 3BH6A 3Q72A 1G41A 3W6PA 1YZLA 2R6AA 2VP2A 4JBWA 2NPFA 5KNDA 1C4OA 3U61B 1J8YF 2GJSA 2R9VA 1WXQA 1ZW6A 4A9AA 1G5PA 4CYMA 2WICA 1G7CA 3DM5A 4O3MA 1M34E 3GFOA 2FDCA 1OFTA 1NMZA 4IDNA 2O0HA 5FTMA 2FGKA 3EXAA 3NKVA 3R8FA 5FBRB 2AFHE 1P9RA 3TLXA 3ZQ6A 4YXWD 5C1BA 3A4MA 3D31A 2CLCX 1X8KA 4DEYA 4E09A 5EUQB 3F3YA 5B57C 1FL9A 3R9WA 3VKWA 2P5SA 1E6CA 3G0HA 4ZKDA 4R71A 3THXA 2OCPA 1YZTA 1EWRA 4V0OA 4L9WA 2IUTA 1E98A 4URUR 4ZPXA 1JR3E 2IUUA 4B76A 3O47A 4I1VA 1QHGA 3GMTA 2XSZD 3P1JA 4JLNA 1NVXQ 2AWNA 3G5UA 2QSYA 2CHQA 4A1FA 2WOOA 4MA4A 3SI7A 1KAOA 3PR1A 2J0SA 3KXIA 3BC1A 2F9MA 4KXFB 3AVOA 3CF2A 3TH5A 3QE0A 2AN9A 2QTFA 3LRPA 2QU8A 1E9FA 1Z0DA 3RWOA 3H1TA 4Z1MD 3V4FA 5AJXA 5DHAA 1S3SA 1CR4A 4LC1A 4KITB 4D4LA 4W7SA 3LW8A 4GMDA 3VR6A 3QQ5A 4EQ6B 5SZIA 4ERNA 3BE4A 3D8BA 4IOLA 4UNNA 1S9DA 4TSFD 2E87A 4OHVA 3U7GA 4PAMA 5EUMA 4DRZA 1R7RA 4LRWA 4UNRA 1D2NA 3DL0A 1A2KC 2WWIA 1W36C 3NBFA 4GP6A 3FB4A 2YNMA 4KFRA 4LBZA 3Q85A 4FCTA 1DO2A 3MWLA 2IF0A 2EFEB 1XTIA 3P4YA 5B30A 421PA 5AR1A 2QQEA 1A5TA 4DDVA 2GCOB 1F5NA 2GA8A 4TLBA 1GKIA 2BMJA 2QMUA 3R9IA 4ZIRA 4DLWA 2ZJ5A 821PA 1RVDA 4LSGA 3TJZA 2B7CA 3I61A 1DO0A 4AY2A 4QHTA 1VG1A 1VCMA 4E03A 2EQBA 5BYJA 2NOAA 4NCJA 3LXXA 1YE8A 3CZQA 3QPVA 2VYFA 1GNRA 2IL1A 4GNKA 4UQOA 4EJSA 3PJRA 2DFLA 3A1SA 1JAIA 1G8PA 1HURA 1T9HA 3QVUA 2GRJA 1U9IA 4HLCA 1NSFA 1UEIA 2FG5A 2J7KA 3Q9LA 4L5BA 1IOZA 3CF0A 3I32A 4IOKA 1KZ7B 1ZM3A 3VKHA 5SZHB 4IDQA 3SBDA 1A7JA 4NYJR 3EARA 4HEJA 4JYBA 5JS7A 4BFUA 2ZRLA 3N70A 3EZ6A 2OCAA 4X8HA 5AUNB 3AVVA 1GRQA 3AF0A 2A5YB 1GL9B 1YR7A 4K8OA 1ZM4A 3BS4A 1ZIOA 3DPUA 2F3TA 3I5YA 2WIAA 3ZDQA 4TL8A 3K70D 1OJLA 2CL7X 4PC1A 2WKQA 1G5RA 3FHCB 3RRZA 3VX3A 5C18A 1HH4A 4HLUA 4Z51A 1ZD8A 5KSOA 3CX8A 1GM5A 4ASUA 5EQTA 4V0KA 4AG6A 3VU9B 4Q4JB 1ONBA 4ZKEA 1E3MA 3PV0A 3GLFE 2X1VA 4FCVA 4TSFA 2O8CA 1X86B 2OT3B 5CIQA 2PMKA 2IYUA 4DKXA 1Q1EA 2CLDX 221PA 3SJAA 3QIAA 3BWDD 3RS7A 2ZANA 4A0GA 2CK3D 4L8GA 2BIFA 1TF5A 3R9XA 3WRYC 1UBFA 2IS2A 3U3JA 1VG9B 1IXZA 4WA7A 4WBSA 1E94E 1M7GA 1C9KA 1NSTA 2BMEA 1R0ZA 2WHXA 1CJTC 3B78A 2F1HA 3AGPA 3MCAA 3NBZC 4HLUC 5JJIA 2RGCA 2V1XA 2B7BA 1NL3A 4MH0R 4PZZA 4D2IA 1X8LA 3FMIA 1RJ9B 2VL7A 3ND9A 4EPWA 3PG5A 5BYKA 1F2TB 1KJZA 3ZLJA 4PO1A 2PH1A 1S4QA 3B85A 4F92B 3AP1A 4Q1EA 2GCPA 3KDSE 4LHVA 3CWQA 4QNMA 2ZRMA 4HAZA 2F1IA 1BO6A 3B7GA 3ZH9B 5KDDA 4ASUD 2D74A 1P2SA 5HCIA 4QM6A 2CEAA 3A1TA 3L2OB 2ORIA 2PT5A 1GTVA 5JHGB 2O8FB 4M2LA 3GLHE 1EWQA 1OFIA 2Q9CA 2BM0A 4AYTA 5GJWC 3KKPA 1G9XA 1P61B 1DAHA 2OAQ1 3I1FA 4O2RA 1OPXA 4Q19A 2GESA 1XD8A 621PA 3O8BA 1E2DA 2HUPA 1ZC3A 2ZRGA 4OQXA 1E2GA 1XXHA 4F4IA 4LJ6A 5UKDA 3TQCA 2G6BA 2PT7A 1Z29A 2ZU0C 1LF0A 2LKDA 3IBGA 1XEWX 1H8HA 3L0IB 1W49A 3OEED 1KKMA 1GWNA 3QOFA 4DCVA 2J0UA 3RYTC 1F2TA 1FX0B 1UKVY 4L15A 3CIOA 4OQMA 4TZ6A 1OFHA 5L8VA 4JBYA 4FMCF 3WMGA 2WWXA 1IY1A 1WCV1 3EASA 4DXAA 1LV7A 2NIPA 2JJ1A 1Q22A 3MD0A 5C4GB 1MABB 5FL7A 1M8PA 3CONA 3U7FB 1VCNA 2EFGA 1P5ZB 2GVDC 1JAHA 1E0KA 2PX3A 2G88A 3B1XA 3ZVMA 5DYGA 3WHLA 2PEYA 1BS1A 1G3RA 3QKRA 1OF1A 3KKQA 3P32A 3FFBA 1U99A 2A9KA 4JMPA 4EPVA 3AVPA 4RSGA 2O8EB 2ZREA 4Q47A 1TL7C 1Q0UA 2ZI7A 1F6BA 3KZ1E 4BGDA 3GQBA 3UMSA 4QGGA 4AI6A 2QQ0A 4PSKA 4X8LA 4BZXA 4C7OB 2PX0A 3K9LA 3LFUA 4C0KA 5DO9A 1L4UA 4YMSA 4BLPA 4BLOA 3UG7A 3NDBB 4A0HA 3A4LA 3MG9A 1AS2A 4DC9A 1OH6A 4MYUA 4Q03A 2C04A 3M4YA 4P33A 1ZU5A 1II9A 1RRGA 3C16C 4B3BA 4XVUA 3BGWA 2QP9X 3TUZC 5EZ5A 2OBNA 1US8B 2VBCA 3DMDA 4MYCA 4B34A 1OT3A 5CLLA 3HU1A 5DI3A 2JIZD 3QENA 1KI9A 1N2CE 2IWHA 2C8VA 3W8NA 3AVXA 1E9SA 2BMFA 2HT6A 3A37A 1IHUA 4FMDB 4EFNA 2W83A 1LB1B 3CKLA 3NBXX 1OB2A 3HYRA 2BJWA 2YOGA 4Q9LA 1Z5ZA 4OHZA 2P6UA 4A82A 1UKYA 1W0KD 3LBHA 5CK5A 3T35A 4TT3D 3T61A 1NN1A 5FR1A 1NF3A 5C4MA 5GADl 1H8HD 3K0AA 2ZI3A 5TV2A 1JEDA 3U3RA 2C96A 2VP6A 2OM2A 2ZE7A 2J7PD 3B2EA 1UFQA 2Z43A 4Q01A 2NZ8A 1E2QA 2QGZA 2W0MA 5JBQA 4US0R 1YZKA 3I73A 4LJ7A 1Z2AA 1NJGA 4V0ME 3FMFA 1MOZA 2FA9A 1CR1A 3IIJA 3OEHA 1I4LD 3KUDA 3OZXA 3KJEA 1U8YA 3GLFA 1P2UA 1FPMA 1K5DA 2FFHA 4B43A 1XXHE 3SR0A 2C77A 5TB5A 3I5XA 2PLRA 1TUIA 4DVGA 1P72A 4AURA 3MFYA 3CR7A 4PQFA 5L3VA 1FNNA 4DIEA 1ZUNB 1CBUA 3VX4A 1UDXA 4PHHA 3U7HB 1N5KA 3QXCA 3LV8A 4HAXA 5EXPA 3EWSA 1HTWA 4JZKA 4ZCLA 1CS4C 3QF4A 4JJKA 3U7EB 3RDPA 3AKDA 2MSDB 1CR0A 5EXSA 4LY6A 1VIYA 1C1YA 2G0NA 3VMFA 1XCMA 4TL6A 1Q21A 3AB3A 4AD8A 2A5DA 3KQLA 4IW3B 1G7TA 1E9AA 1FP6A 3P26A 5HPYB 3L43A 4OJKA 2GXAA 1E2MA 4MDFA 4LHWA 4A15A 2FMXA 5JJLA 4JS0A 4G01B 5DI3B 4N1AA 2ZM5A 1KY2A 3RRYA 2BBSA 1Z28A 4NHOA 2CHVA 1VKJA 2OLKA 4HB2A 2ZRCA 3CRW1 3REGA 5H8WA 5TDHA 3SYKA 2H17A 2QMEA 4IOMA 4Q1BA 4TQUS 2CXXA 3EA0A 3EX7C 3FKSD 1R4AA 3IUYA 4C4PA 4IEEA 2ZRPA 4FW9A 4HSEA 3QEOA 2LWIA 2GEVA 4I4LA 1KJYA 4V03A 2G77B 2IWRA 1OH5A 1NY5A 3CWZA 1OHHD 1EG7A 4WW0A 1J90A 3ZYCA 2I3BA 1OV4A 1WP9A 2QAGB 4PAQA 4PZLA 1MH1A 5TY0A 4IXNA 1EFRA 5FI1B 3ZIAD 2JLQA 2ZYVX 3K1JA 4PSVA 3PEYA 1N25A 1W5SA 4LPKA 1FQJA 2ERYA 2GDJA 5BN4A 4KU4A 2V7QD 1Z22A 3ZVLA 2PZFA 4AK9A 4IEIA 4NDZA 1XTRA 1MABA 3AGQA 4JLDA 4PPNA 3TE6A 1A1VA 2XB2A 3B13B 5KYKA 4IVQA 1QBKC 1G3MA 2R6FA 5FPTA 1OW3B 4IDOA 2CCGA 4IRUB 1TEXA 3RRNA 4QG7A 2BVNA 4DSTA 2J87A 2ZJAA 4KV9A 1SKYE 5FL7D 3CBQA 4Q18A 1GDDA 2ZRDA 1SVSA 4DLTA 3A1WA 2A78A 2GZDA 1MR3F 1TU4A 1UF9A 1JNYA 4UJ5A 4M9ZA 2B92A 1NY6A 1T0JB 4EUNA 1QHSA 3K0AB 3OIYA 4JKYA 4MUAA 2JJ8A 1KI8A 2ORVA 1F2UB 1R8SA 3T1TA 2REOA 2Z5FA 3ICQB 2J0VA 4C0HA 2YKGA 4BLSA 3WNDA 2P3SA 2E1RA 4JLPA 2O8FA 2FSGA 5E95A 3L0SA 3F8TA 2JLVA 3RABA 4C30A 1AM4D 4DWJA 2RGEA 1M6NA 1N6PA 5EP2A 5DE3A 2Z4RA 1TQDA 3ZZTA 4MRVA 1US8A 4RY2A 4YMTA 1NLYA 3OAAD 4L9SA 1YJ5A 4R2HA 1G4AE 1P60A 1GAJA 1N0VC 5FR2A 4YONB 1A2BA 5DI9A 1B0UA 4QGAA 1ZNWA 4US2R 2J7PA 1XD2B 4TMZA 4KI0A 3ADKA 1TPZA 2AL7A 1P75A 1M7BA 2VF8A 1KI7A 3ONWA 2EFCB 2FE4A 2R6GA 1GVNB 1IN7A 3PEWA 4KBGA 1AKYA 3CH5A 3LD9A 2C9OA 1G16A 2JATA 1IN5A 1X6VA 2ZS8A 2GK6A 1RIFA 2IYYA 3ZZUA 5CYOA 3U5ZB 2N46A 3THYA 4A8JA 1SVWA 2BEKA 4B71A 5DISB 2N42A 1W0KA 2OBLA 4M9QA 4BFSA 1AZTA 4A4DA 5JRZA 1JR6A 1J2JA 3K9HA 1YVDA 2FSFA 2FX3A 4PX9A 2I1VB 3SS8A 1N3BA 4Y0VA 3LH5A 1W44A 2IF2A 4UJ3A 4XWKA 4IOJA 5CB6A 1AKEA 4FN5A 3X1DA 1IY2A 1E9BA 4FXPA 1V5WA 4MRSA 5ELXA 1N6KA 1GL7A 1MRSA 4TTPA 3MWYW 4M53A 3F5FA 3BIFA 3X1ZA 4LJ8A 1ZMXA 2EFDB 2WMNB 3PITA 4LGMA 3NIBA 4A0FA 3ADBA 4G5SA 1R0YA 6Q21A 2J59A 3AP2A 4XVRA 2ZRKA 1G6OA 2RGNA 3H84A 2X8AA 2VO1A 4D0NA 4I1SA 2VQSA 4HB4A 2G9NA 3UMRA 4A6XA 1N6HA 4B75A 2QT1A 4C0LA 1SVKA 2VH5R 2X2EA 3ICEA 2YWFA 1NBMA 1E1RD 4P4TA 3I8SA 3U3MA 2NO6A 1UBCA 4AYWA 1AQYA 1G20E 4TN1A 2QGNA 4BFYA 4DCUA 4MRPA 4EJSB 4A2QA 5KSYA 4NCIA 1T91A 1Z2CA 2CBZA 2YOFA 3KJIA 4URZR 2WSSA 5EP1A 1R0XA 2C9CA 4DLVA 1P4SA 1IAQA 1CIPA 2JJ1D 4RKFA 4ZIRB 1QZXA 1G8GA 1YZQA 4HDCA 2QP4A 5KOYA 2N1BA 5K8LA 2QTVB 3KJGA 2XXAB 5K8IA 3W5JA 3D6TB 1KDOA 3BOSA 1NIJA 3BORA 4NYIR 1N5LA 5DN6D 1E9EA 4ABYA 1M2OB 2AD1A 4UNSA 4DB4A 2QPTA 2QL6A 4RCZA 2GAOA 3BRWD 1P2VA 2HJVA 4J0QA 4MRRA 3JVUA 4DSOA 4HATA 1E96A 3FE2A 1UADA 1DEKA 3TW4A 1RE0A 3EC1A 4FMCB 1OXVA 3SJBA 2KBFA 2XOKD 4W9MC 1LFDB 1JR3D 2ZPTX 5L3RA 3UKDA 3Q7QA 3WYAA 3GCGA 3GJ7A 3E1SA 1ZYUA 1Z8FA 2KB0A 3NG1A 4NCNA 5AJVB 1FUKA 3C5CA 4XH9B 4Q4JA 3QVVA 5IDVA 5KHOC 3BK7A 2ODNA 1FZQA 2BWJA 3A1UA 4Z1MA 5B64A 5E7IA 3EZ9A 4PANA 5A4JA 2MMCA 2REBA 5GVRA 3WYGA 4BEBA 1R0WA 3KJHA 3THOA 2P6RA 4Q1AA 1BKDR 1I4DD 4TL7A 4FIDA 1U94A 2EVWX 1XCGB 3OIWA 1HA3A 2WPDA 5DYIA 4BWYA 1W0JA 2YC2C 3MLEA 4D0LB 2H16A 5TMPA 5AUQA 3CH4B 5E4FA 1Z0KA 4RD3A 5JRJA 3CPEA 1X1SA 1LS6A 1U9IC 2W6ID 1TMKA 3RVBA 3D3QA 3DM9B 3L8YA 3CNLA 3SZRA 3QJYA 1LW7A 3AQ4A 1COWA 2JASA 2XZLA 1MO6A 2HYDA 3LVRE 2JLZA 1O87A 4FMDF 2J9RA 2VPPA 1XPOA 3DDCA 2X2FA 3QKSA 4M9SA 5FH9A 2IYQA 1BIFA 5KSPA 5CDFA 1JB1A 1W2GA 1Q1QA 1RYHA 3FHOA 2OSBA 2CCJA 2DBYA 4CW7A 2CVFA 3O8RA 2DYKA 1EX7A 4I99A 1TQ4A 2F3RA 3GJ6A 4QNRA 4FINA 2EFHB 2CL6X 5CLQA 1T8TA 3EAQA 1E4YA 1KI1A 2DFTA 2RH5A 4AKGA 1PLLA 3A36A 5FUWA 3QNUA 3BD9A 2GZAA 1P6XA 3L8ZA 2BKUA 2XEXA 4D25A 1GG2A 2PZGA 1ODFA 1IXRC 1CP2A 4B44A 8OHMA 4RFSB 3MMPA 2XNSA 5J4YA 2ZXUA 3EZ7A 3RHFA 3S1AA 2CNWD 4KODA 4AKEA 5HKKA 2WAXA 2OCBA 1EK0A 3CF6R 3E2IA 1ZM7A 1KSHA 4ZO4A 4NPHA 2V1UA 1I4TD 4MRNA 4ZDWA 4BFWA 5KDOA 4WXRA 1I2DA 3UPUA 2GBLA 1D5CA 1UBEA 1Z47A 1SXJD 2YWHA 2CDNA 3RRMA 1EFHA 2BCGY 1E99A 2WJIA 4KLZA 4TYYA 3AKCA 1ELOA 4H1VA 3ZVRA 3B1VA 4JT2A 3RWMB 1GOTA 3B5JA 3IIKA 5FUYA 3TR5A 2D62A 4QGHA 1DAMA 2W6JA 1QHYA 1JI0A 2Y8EA 1NLFA 4TMKA 1FMJA 1KKLA 2VHQA 4E5UA 1E1QD 2A7QA 2QSZA 1KI4A 4DSNA 1D9XA 4OK6A 3LQQA 1FQKA 2Z6VA 1SQ5A 3C7KA 4JBXA 1QVAA 3THYB 5AUOB 2GEDA 4PXAA 2GVZC 1FOEB 4JLBA 5KU1A 2WJHA 4WIAA 2NTYC 4PC7A 2VIIA 1A82A 4WOPA 1ETUA 1II8B 3VR3A 5DIFA 4DUGD 4C0BA 2ZTSA 4DDTA 1CR2A 5AJZA 3U6KA 2IXGA 3GJ0A 1NKSA 2OCYC 4G0NA 1DBSA 2D3WA 1G3UA 5J4VA 2OG2A 4LYHA 2OBMA 5H68A 2CCKA 2HXSA 3QY0A 2VF7A 4V0LA 4UXHA 4DCNA 2D2FA 3T12A 1E2JA 1XB2A 1H8ED 1RRFA 1Z07A 4YMVA 2ZRNA 4LYJA 1ZD9A 5FBLB 2HYIC 2ZSDA 1TNDA 3C15C 2XNDD 4CT5A 1ZRHA 4TL9A 3BJIC 4PPGA 2O0JA 1YRAA 5JMTA 2ZI6A 3P20A 5FL3A 3VR5A 4M9XA 1ESNA 5EE3A 1N5JA 3TGPA 2OFWA 4LHZA 1P2TA 2QMOA 3SDZA 4DHEA 4U02A 3HR8A 2NO7A 2PZEA 1GILA 1NMYA 1F2UA 3PXGA 3JVVA 5FOUA 4B3XA 1VDZA 2QBYB 5AUPB 2ZRIA 1T3LA 3AVQA 2A30A 4B74A 4HUTA 2V3CC 4A8JC 1UJ2A 4PZYA 4W5JA 5D3QA 3QF7A 3B60A 4HYYA 4Q4HA 1NBME 4PO8A 1XX6A 4CT4B 3MWJA 1XEWY 3FHTA 2A3RA 3H2YA 4NTZA 1AK2A 4A2WA 4BFVA 5AK0A 2CK3A 5HR5A 1IONA 4NYJQ 1KSFX 1KDTA 4QFMA 5JEEA 2NGRA 4ZDIA 3QXSA 2RKOA 2ANBA 3GLFB 2AKYA 1BMFD 5G40A 1CJMA 4HLDA 2QZ4A 5K8UA 2QROA 1W47A 5JLJA 2CE2X 1IJEA 4Q4LA 5KUTA 4KJZA 4CEIA 3WP1B 2DB3A 1U2RA 2IS1A 4M1WA 3SJCA 1E2HA 2ZJ2A 2QUZA 1GSIA 2V6JA 1N6NA 1VTKA 3OFND 1TF7A 3IQXA 1SHKA 2DWQA 3GLHA 4RD2A 1VYTA 4UXJA 3QSYA 3CPJB 2P65A 4HZUB 1YR6A 1DE0A 5AJYA 5LD2B 3FGNA 2W00A 5JCZA 2CE7A 2IK8A 1G4UR 1YHNA 2Q9BA 3PIRA 1YZGA 3SEAA 4Q48A 1F3OA 4ZCMA 1T3SA 2O8BB 3ADDA 1BMFA 4MKFA 4TWZA 4ARZA 4LBVA 1LVGA 1SGWA 2Z4SA 4CF7A 4DLRA 4IDPA 4QRHA 4Q1FA 1FTNA 5FTKA 3SFVA 2ZUCA 1NBMD 4OI2A 1Z6GA 3W6NA 3HWSA 3LX5A 4POAA 4DLYA 1G7RA 4Q66C 2H8KA 5FOWA 4FWTA 3DZ8A 5FOXA 1KO8A 1OH7A 5TARA 3EC2A 2F7SA 2ZJOA 2R8RA 4JIMA 4D82A 5FI0B 2O8EA 3CRVA 5CIWA 3P27A 1S0UA 2D7CA 2UVQA 2IUSA 4DBLC 1H65A 2YJTD 3Q5DA 3QKRB 4L16A 2ONKA 4MGIR 4TMWA 2J0QA 4XIGS 4HUQB 3GJ5A 2FV8A 3AVTA 5JI2E 3OFNA 1AJEA 2HLDA 2FZ4A 3W8RA 4Z8XA 4FCWA 3TSWA 4GFDA 3VHXA 1KOFA 4YDHB 2B6HA 2RGGA 3LO5A 2ZSAA 4D4MA 3ADCA 3B6EA 4PHFA 2AXNA 3QXJA 4M0LA 2ZU6A 1W0JD 1DAKA 3GEEA 4IFBA 1Z0AA 2XITA 2I1QA 2YINC 1KK3A 4OJQA 2VSOA 5CJPA 5HTKA 5KPJA 2MSEB 1Z3IX 3U2QA 3UXMA 3GPLA 2ZUBA 2Q3HA 2QM7A 4M1MA 1VYUA 2C78A 4JL8A 3TUJC 3WBKA 2WPDD 1Z63A 3VNVA 3LNCA 2ZJYA 4M1SA 2G1JA 4NCHA 5TVKA 4TMXA 2JJ2D 3M6AA 4RCYA 2R44A 5E7MA 4MKGA 4BE7B 2F43A 2AHOA 3H86A 4CEHA 3AVWA 4R9UC 4TYQA 1P73A 1G8HA 2GZHA 3I72A 1R10A 2OXRA 3U4QB 1P62B 2G0TA 2ONJA 2YHSA 2HF9A 4DIDA 4JLAA 3IILA 3O8CA 3K70C 2GXQA 2WVJA 2RGAA 5JFGA 3U44B 1N5IA 4BPBA 1D6JA 4L4UA 2ODEA 3ZIAA 1IN6A 1E2IA 4P4SA 1TUEA 3SOPA 1CXZA 4G1UC 1PLKA 1KMHB 4RD6A 2TMKA 2VEDA 1OHHA 2AX4A 1JECA 1E2NA 5KSZA 1XPRA 3AF1A 2QY9A 4PO9A 1NJFA 3RLFA 3IEVA 1Y63A 5EE5B 2WJJA 4IXMA 4IVPA 1MO4A 2O52A 3BB1A 3QEJA 1SXJC 3K0FA 3KTAB 4GOKA 4C0AC 3BXZA 3KKMA 1L8QA 2FPLA 1ZUIA 4TLAA 1ZIPA 2FFQA 4O2LA 4AG5A 4W5HA 3K0FB 3KTAA 2BEJA 2RAPA 2WMOB 3NDPA 2ZETA 1TADA 1E32A 2BCJQ 4FWIB 2FWRA 2ATXA 3DKPA 1XTQA 1DAEA 3KXKA 1MKYA 4RKEA 5HCNA 4QC2A 4HB0A 1M7HA 4NCKA 4PPQA 2WJVA 3T5GA 4M1KA 2LCFA 1K8RA 3AP3A 1ZBDA 2LKCA 4GI7A 2XOKA 5FTLA 1HE8B 1XJQA 3KKNA 1VG0B 5LBIA 2BBWA 1X1RA 4X8MA 5EE0A 3C41J 1GIAA 3CRQA 3UANA 2PCJA 4P4SB 4OQNA 4GZMA 2F1RA 4GL2A 2V4ZA 5IK2A 3A4NA 3K09C 1S96A 5C46F 3PUXA 4CGZA 1X3SA 1RYFA 2O8BA 2ZEJA 5FOVA 4A36A 1P9WA 4WZBE 5DN6A 3ZJYA 4PHGA 1JALA 3U60B 4YDSA 1HQYE 4MGYR 4ESHA 2WZQA 1FTSA 2G83A 1UBGA 4CEHB 1ANKA 3LAWA 4U7DA 1CULC 2NO0A 3Q8XB 2YC4C 2CMKA 4HZUA 1BOFA 4GDFA 2IYSA 2CJWB 4LV6A 3KB2A 2UZIR 4D4JA 4RZ2A 1YR9A 4A6PA 3OIUA 4BFXA 1KI6A 4ON9A 2ZSBA 1OE0A 2WTUA 3ASZA 2VP4A 4JL6A 5KPDA 4OHYA 3PEVA 3GEHA 4Q5IA 4RJLA 3UK6A 3EPKA 4A92A 3AVYA 1RFLA 3FKQA 2GHIA 1GL6A 2XAUA 5H70A 1YU9A 5BQ5A 3X2SA 2WIBA 1W2HA 3KL4A 3OESA 3TAUA 3V4RA 2ZE8A 2GCOA 4RVCA 1HQCA 4DCTA 2IBMA 1UPTA 3ZGXA 3QI2A 4OK5A 1F48A 4DLXA 4B3CA 1SULA 3CM0A 3DOEA 3K0EA 4D4KA 3WXMA 1RRCA 1S3GA 1PLJA 4MUBA 4Y0AA 2D2EA 4QBFA 1HV8A 4LYFA 5GJVC 5F2EA 2UKDA 3P4XA 4XD7A 2JLXA 2IHBA 2QRZA 2GKSA 3HYTA 3GJXC 4E22A 1M74A 2Q3FA 1P9NA 3LQRA 2XNDA 2H57A 2RGBA 4TTRA 1TAGA 3BB4A 3KFXA 4N0DA 4WZ6A 2QAGA 4CIDA 2OAP1 1W36D 1PUJA 3GFPA 3TKLA 4D81A 2B21A 1NLZA 1IJFA 4JT4A 3FMPB 2OEPA 1CJUC 1ZNXA 2KJQA 4RD4A 3HR7A 3WBJA 2XXAA 4MITA 4QXAA 1BYUA 2ORWA 2QTHA 4JLMA 3U3KA 3PFIA 2J41A 1QRAA 3B9PA 1DARA 5BW8A 2IXFA 4JKIA 1HUQA 2WSMA 3U6BA 1J99A 4LYAA 3NEYA 3KKOA 5HKKD 2O5VA 3T1VA 2DHRA 3A6PC 1XP8A 3THXB 2FH5B 1HT1E 1OIVA 1MO5A 2QM8A 3QPUA 3VNUA 1KIMA 4XD7D 5ANRB 3EG5A 4D6PA 4ZDJA 2IYRA 1NN5A 4NMMA 4ESVA 1NI3A 5HZKA 3NXSA 3CZPA 4N0EA 1QHNA 1OYWA 3K53A 1U0HC 2KBEA 3M1IA 2NZJA 1G1MA 1W46A 4XVQA 2FEMA 5H1YA 1E2KA 2ZRBA 3KUCA 4YC7A 3IHWA 4KCGA 3PUWA 1Q12A 3DHWC 2C98A 1AGRA 2EW1A 1VECA 1G7SA 1XTSA 4LJ9A 2Q3MA 2IYLD 2WJGA 3AEZA 4G5RA 1WF3A 4NYMQ 4QJ5A 3SHWA 2V55B 4OHWA 2PLFA 3M0EA 1EFCA 1E0AA 3ZZ0A 3SJZA 4C2TA 1DS6A 2A5GA 1KJWA 1WDTA 1NN0A 3IGFA 4BEJA 3MSXA 1LNZA 2OXCA 3DO6A 3LDAA 1CEEA 1DG3A 2ZR0A 2HCBA 3ECCA 5FPKA 3B9QA 2JLYA 1E69A 2EWVA 3TSOA 2OUKA 1E2FA 5CYPA 1E79A 4M22A 2J45A 2VP0A 5JSZB 2NO9A 3T1QA 1AIPA 1EFUA 3K8YA 4Q4HB 4TMVA 4B47A 3K0CC 3PEUA 1YZNA 4XSGA 3GD7A 4Q02A 2C99A 4O25A 3LA6A 2W2TA 5J4HA 3QBTA 5GJBA 2QAJA 3LVQE 3CO5A 4PSAA 3W34A 4DLUA 1OXTA 1EFTA 2V7QA 3W5IA 1J7KA 3FYHA 5C2JB 3VR2A 2GF0A 4LJAA 1XU4A 3A8TA 3EZ2A 5FPHA 1DELA 1NVVQ 4KFTA 2XSZA 2XZPA 4LHYA 2IS4A 2BBOA 5DSZA 1E2PA 5FPYA 1Z6TA 1CKEA 5CITA 1L2TA 2R6CA 2WWFA 4PC6A 4YXWA 2ASEA 2DY1A 1T4GA 3K9NA 4XTCS 2X77A 1VYVA 3RS4A 2HJGA 1IBRA 3F0TA 1TQ2A 4TMTA 3T34A 2CVHA 4URYR 1QDEA 3B1YA 4KFUA 3LY5A 2DWOA 1COWD 1AN0A 3AH8A 3KB1A 4F93B 1RPZA 3NH9A 2ZROA 2GXSA 1H8EA 3GLIA 2R2AA 1DOAA 1JBKA 2C95A 2FFBA 2ZAMA 4B6FA 2DFKB 2QMHA 3WY9A 5GVSA 1KI3A 4JVLA 1G17A 4RZ3A 5EE9A 5L3SB 1XFAA 2IXEA 4PR0A 4Q7LA 1ZNYA 4G3XA 4V02A 4EJSC 3RC3A 3Q5EA 5JWOA 4KVGA 3OEHD 2OV2A 1P3JA 2NMVA 2XZOA 1E2EA 4QKQA 4P32A 1DAIA 2Z0MA 4URWR 2RHMA 5G53C 2F9LA 4FMBB 2MMGA 1J70A 3A1VA 1JXOA 2H18A 2JEOA 5F9FA 1S9HA 2IT1A 4EAQA 1FP7A 1CRQA 4Q7MB 2NQ2C 5B2ZA 5A5GA 2F6RA 1W4CA 2NG1A 1XMSA 2Q0HA 1XRJA 1N6RA 1FX0A 5JECA 2J0UB 4ACAA 4QHSA 4OQLA 2AK3A 3DVLA 4Q4AB 1ZVQA 3LLMA 1D2EA 2W6JD 4GPTA 3SE0A 3THWB 2IX3A 1W48A 2FEOA 4JSYA 3NHAA 5FUXA 2KI5A 3NBYC 1NN3A 4B35A 3TW8B 4P4UA 3T15A 1KYIA 3RS3A 5J4KA 1U0LA 2ZIAA 1SVIA 1T5IA 4IHQA 3T5DA 4ILEA 1GFIA 1W5TA 5B58C 2RMKA 3SYLA 3BH0A 2FN4A 2ODWA 3UG6A 1T8UA 4LJ5A 1IXSB 5EXTA 1Z83A 2AD5A 1SXJA 3C14C 3NVAA 3FWYA 3KQKA 1Q3TA 5CM9C 4MKHA 4CVNA 4ZI3A 1XDBA 2BBTA 5FTNA 1UAAA 1EX6A 1KSJA 1Q1BA 2J1LA 4DZZA 2ATVA 2ZYWX 1PJRA 4LWZA 2L0XA 3WNBA 4RD1A 1S8FA 1XTKA 2K5UA 2ZRAA 4OKSA 4DT1A 1G18A 2I4IA 1E4VA 3UMFA 1KO1A 1UKEA 2ECKA 2FGJA 2VHUA 3GFTA 2A5JA 3LBIA 4BQSA 1ZD1A 3R20A 4B3GA 1R5BA 1Z6AA 1RRPA 2ODBA 2P2LA 5EP3A 2QP3A 4MGKR 2BDTA 3EW9A 5BXQC 1WB9A 4HAYA 2C9YA 1OKKA 4B2IA 2G3YA 4F4CA 3EPLA 4H9GA 4MYHA 2F55A 4KAXA 3MWKA 1E2LA 5BWMA 4KYUA 1MT0A 3JZAA 3AKEA 3RSOA 5LPNA 3GP8A 1ZC4A 2WM9B 4TYWA 3R8CA 1N0WA 5L3QB 1KI6B 4CEJA 2ZITA 4IFEA 1GRNA 1GRRA 2A5FA 3AKYA 1GP2A 1SZPA 4JLVA 1O3YA 2CJWA 1E79D 4ZV4A 5FPSA 4BRUA 4KBFA 3MUFA 1VMAA 4JLJA 5D3MA 3OE7A 5FBQB 3KQHA 4A0RA 3VU9A 2YVUA 4F91B 3CLVA 4KSBA 4DCSA 1Q3HA 2EU8A 2ZI4A 4LBYA 3ZQJA 3RNLA 4BLQA 1YRBA 5JJKA 2QPAA 3QXXA 5J40A 4P0TA 4P3YA 1GKYA 4XSHA 1VHLA 3NHBA 1IN4A 2R65A 4NP6A 1UEJA 4LZZA 4I1UA 4IJMA 3IHLA 4M8NE 4OYHA 4B6EA 1ZCAA 1D9ZA 1QF9A 2J46A 1Z0IA 3QKTA 4A2PA 4OI1A 1D8TA 3OHMA 2CHGA 1ESMA 4EPYA 3DZDA 4LPSA 3CR8A 1E0JA 2ZJ8A 1SVLA 521PA 4LHXA 4Q9KA 2HV8A 2PBRA 5FOSA 4UNPA 3L0OA 4D80A 1LS1A 1XEXA 3ASYA 1AGPA 1LF5A 2YV5A 3ZS8A 4QJ3A 1SVOA 2IA5A 2QRNA 5JEDA 3GLGB 2GJ8A 3FDIA 721PA 5CB8A 1U0JA 2WKPA 4NYIQ 1R8QA 1A4RA 4NL4H 3AVUA 1ZINA 2IC5A 3AM1A 3UWOA 3ZD7A 3U3OA 1JR3A 4DSUA 3VR4A 3L0PA 4QBGB 1R5OA 5A0FA 5KNBA 1QHHB 4R2IA 1Z0JA 2WJYA 3RS0A 2DPXA 2BKEA 1UM8A 3WMEA 1OIWA 4I1OA 3IO5A 5CK4A 5K8TA 4PPFA 1XD2A 3GLIE 3I92A 2PJZA 3IQWA 2IS6A 2Q6TA 2W2XA 1NG9A 1B23P 1R2QA 1W4RA 4LK2A 4BZQA 3CX7A 1XTJA 1EESA 2UZ3A 4EKDA 3J81k 1G3IA 1CU1A 4QM7A 2GK7A 4GMXA 4DJTA 1DAFA 1GNQA 3V00A 2JLSA 3C8UA 4LX0A 2PEZA 3IEUA 4TQ9A 2YOHA 4B73A 1NP6A 5J5CA 4D26A 2JGNA 3GJ4A 1IN8A 3KFVA 1E1QA 1RZ3A 1Z08A 2GETA 4YMWA 4DEXA 4DLZA 2OLJA 2OO7A 1HE1C 4JL5A 1XF9A 1G8YA 2ZS7A 2OE2A 1P7CA 3PENA 3RAPR 1QHXA 2BHRA 4OBEA 1UDWA 4OI4A 3SYNA 1WBDA 2GXUA 2B8WA 2H92A 4P31A 4WVFA 2D06A 2FFAA 4Q4AA 2OESA 5DGXA 2OZEA 1CJVC 4QGFA 1KHTA 2WV9A 2HCJB 4OI0A 3WRXC 3W3ZB 2P0EA 4YQFA 3V9PA 2GWHA 2JIZA 1S1MA 1NIPA 2W0SA 4LBWA 4TLEA 5HE8A 1DTSA 4HLQB 3EPJA 1F60A 4MGZR 2PL3A 4ZI2A 4F7WA 4I81A 2J3EA 2YYZA 2V8OA 4TLCA 1G21E 3EIQA 3VTKA 2RCNA 3LLUA 1AS0A 1KTVA 1KY3A 4C2UA 3EZFA 4G5OA 5J4LA 2QENA 4MDEA 2P6NA 3QG1A 3FFAA 2QE7D 4M1YA 1Z6XA 1VG8A 1Q1ZA 3G82C 5G3YA 4A8JB 5KO2A 4V0MA 2KSQA 4BASA 1XMVA 1FFHA 1V43A 3OF5A 1G3QA 3GLGE 2JJ2A 4JVMA 5JS8A 2V54A 2BMDA 3PUYA 3VKGA 1E9DA 3GLIB 1D2MA 2H5EA 1XZPA 1NVUQ 3CRRA 3QKUA 2GJAA 4PQYA 3B1ZA 3WP0A 3MJHA 4E07A 2HEIA 2ZI5A 1T0HB 2JLRA 2XJ9A 2NPIA 4DDWA 2D7DA 1XEFA 1E0SA 5DH9A 3B1WA 3SNHA 1XWIA 4EFMA 1S1CA 1AS3A 1OXUA 2AXPA 3MJRA 2JAQA 4CRWB 2NO1A 4GRAA 4JLOA 1AA9A 1JPJA 4Q1DA 2VTKA 4PC3A 1TEVA 1QHIA 1T3HA 4C3ZA 2DR3A 3AF4A 1VIAA 2J5XA 4C0QC 3TRFA 2YWEA 1OIXA 4NBSA 3OAAA 1LTQA 3PVSA 3PUZA 5KTYA 5JCPA 4AWXA 3KQNA 4XOIA 1AZSC 2AR7A 4BFZA 2FSIA 1T6NA 3EIEA 4AYXA 3W3AA 3OE7D 3W90A 3RSLA 4BECA 4DB2A 3NH6A 3QF4B 4EPXA 1ZP6A 4LV8B 2GJKA 1GKUB 2WBLC 3DOFA 3ZVNA 1IQPA 2IYWA 5JWRA 2BC9A 4JYCA 4TQAA 1XBTA 2IYXA 3AF3A 3EIHA 3N5CA 4AC9A 4CEIB 3KX2A 1XJCA 1MO3A 2FU5C 3T1OA 2JLWA 1ZM2A 2FJUA 3X1YA 4DUGA 4EPRA 5AJWA 1Q44A 1U8AA 2RGNC 1KK0A 1DAGA 5FTJA 4BZPA 3BFVA 1FNMA 1S2MA 4DDUA 4LDJA 1Q57A 3K0CA 4KO8A 2VSXA 5SZKB 3PQCA 3A58B 4BLTA 2OHFA 5BN3A 2AKAB 3BFKA 3IBYA 4KSCA 5DHFA 3FPAA 4R98A 4BRWA 4XWOA 2RB4A 3SQWA 2O8DB 3I8XA 2JDIA 3TIFA 5CJ2A 4LV5B 1SKYB 2A2ZA 3QG5A 3NEJA 4GSYA 5BN5A 1EGAA 3WYFA 2AK2A 2ZVPX 5EJEA 3QPWA 4ITRC 1HEIA 2QPOA 3CW2A 2ZSFA 4D0GA 4Q9HA 1E1RA 4AKHA 1TU3A 4XTRA 4G5QA 3BFXA 3SU8A 1WQ1R 2H1LA 2XTMA 1R6BX 4IDHA 1N0UA 2Q9AA 4XWAA 1XMJA 2GF9A 3R7WA 1ZAKA 4CZ2A 5IF9A 3RANA 2ZSEA 2DFNA 4II7A 4NZYA 3BAFA 1SKQA 1WBBA 2ZR7A 4WAUA 1TQ6A 4JJZA 4LCBA 3E70C 3R7WB 3RS2A 5G3ZA 4KYIB 3EA5A 1NKTA 3L82B 3TBKA 4PTLA 2EYUA 4HDQB 1PV4A 1T5LA 3IPYA 2ZVQX 2X19A 4C7OA 2ZJBA 2P67A 3B8HA 1OLOA 4NYMR 2V9PA 1XMIA 3GJ3A 1KO7A 4ACBA 3AUYA 4MKIA 5FBVB 1XPUA 2VHJA 1XZQA 2REXB 1MRNA 3OIVA 1NMXA 1Z06A 5AWFC 5G41A 3MRSA 5EP4A 3KQUA 2R6DA 3UIEA 4QBIA 2YZ2A 4EIWA 4QBHA 4LI0A 1ZJ6A 1MV5A 3NWJA 1VHTA 4HDOB 2ZRJA 4HZIA 3TVDA 3RS5A 5JI3E 3HJNA 3TUIC 2C2HA 1AQUA 4HAWA 1KO4A 1J8MF 1E9RA 3IIMA 5EXXA 4IVRA 5TXGA 1GNPA 5FFMA 5HE9A 1YQTA 1PUIA 2GBLC 1NRJB 3CX6A 1G291 1XD9A 2GAAA 3CRMA 3HPQA 2Z83A 1XXHB 5E7JA 3U4QA 2V6IA 1Z0FA 2FSHA 1YZUA 1VPLA 5M04A 2JCSA 3EWAA 4DLSA 1R5NA 2F43B 2RGXA 4XJXA 1FUUA 1OFUX 1DG1G 2BOVA 1IM2A 2HF8A 4RFVA 1W1WA 5LB2A 1CLUA 2W58A 4RFSA 5FBWB 2OFOA 2HXYA 2QN6A 2ZUDA 3FVQA 4AKIA 3AUXA 2QAGC 4FI3C 2QG6A 3WNCA 1JJ7A 4RZUA 2ZI9A 4M1TA 2GILA 1SVMA 2EWWA 1FMLA 4KHZA 1ZCBA 3BBPA 5EE1A 3MGCA 3K09A 4JLKA 2ERXA 4YLGA 2YWGA 3CB4A 1U98A 1FW6A 5DLQC 4M1OA 4N3NA 2CLSA 2BV3A 2F1JA 1NVWQ 2H7VA 3HU2A 1RC8A 2FPMA 1EFRD 3IO3A 4EFLA 4YMUA 2HLDD 1JQJC 3NC1C 4Q9IA 2IHYA 4C0SA 4TZ0A 1SXJE 4HUQA 4S2EA 3QKSB 2ZE5A 2ZYTX 4RZXA 3TAHA 1Q20A 4K46A 1PZNA 3CNNA 3X1WA 2PCLA 3BB3A 4ZDKA 4F4JA 2KE5A 3WHKA 2PMDA 4URVR 1SHZA 1N6LA 1HT2E 3HPRA 1U8ZA 1KNQA 2DCUA 2EYQA 2HT1A 1YKSA 1GZSA 4ZCIA 3I62A 4C9BA 3KXLA 4B3DA 3D7MA 1QG2A 2GCNA 121PA 2GTPA 4MYTA 4O0MA 4JVSB 4HI0E 3SBEA 2ZRHA 4B32A 2P5TB 1KMHA 4PHTA 2JDID 1M1YE 2VLIA 3LW7A 1VCOA 2CNWA 3N2IA 4Q00A 5IRCD 4Q7KA 2RGDA 4PAOA 3U44A 1OKKD 3UATA 1CF4A 3W6OA 4QL3A 1GITA 2VHTA 3RC8A 4C0JA 4G5GA 3CNOA 4WXPA 3PUVA 3SQXA 3AV0B 4Z8YA 1NNEA 5J47A 5DNYB 1N6OA 1I2MA 4Q21A 3OEEA 4KLNA 1G6HA 2C03A 2WOJA 3SFZA 3ETLA 3VHLB 5E3HA 3DMNA 1G64A 2BJVA 2WWWA 2AFIE 4OQFA 3PCRB 3QBVA 2Q21A 2QT0A 3GLHB 3N2EA 3UWKA 4U00A 3TK1A 5JZVA 5F9HA 2IW3A 4NKRA 4CEJB 1NVVR 5L3QA 2ZJZA 5FUVA 3VAAA
chains in the Genus database with same CATH superfamily
4R8MA 3JU3A 2WKRA 4HAVA 4IGIA 2I6TA 2OK7A 5BMVA 4UUMA 2JAWA 4UOZA 2O9JA 3K0SA 4BRSA 3CE9A 3B82A 4IMRA 4P7BA 1LC0A 3EF0A 1KQOA 1PJ8A 4MICA 3K70B 1ZU4A 2XVZA 5DM4A 3GEIA 2FN8A 3OU7A 4HQ0A 1SIBE 1QIEA 1KEKA 1X92A 3DCNA 4AS3A 5SZJA 2PRJA 3E48A 5HZHA 2F00A 3HCOA 3REOA 1XTZA 2ZYUX 2B69A 5JWHA 1F7VA 5IAEA 2A0XA 4YJDA 5CPBA 1U90A 4TRJA 3EFOA 1QIKA 5KOIA 1DUVG 1JWBB 1B74A 2EGGA 2GEUA 2KWIA 3K8ZA 4KB5A 4ARVA 4JOSA 4B80A 2NQ8A 3CUEF 3UW3A 3I6QA 2JLCA 2VDVE 3TD2A 3WLAA 1QHHA 2HMWA 3W9UA 2KX7A 1X8JA 3PQFA 2O59A 2ARKA 3EDQA 1OH8A 4M8IA 1T9AA 1JEOA 3W78A 1QYRA 4MP8A 2HO4A 2IXTA 3T9FA 2PMEA 1G2IA 3TQFA 3NT2A 4JC5A 3CUTA 2WILA 5I7RA 4I50A 3I64A 1RQ2A 1ZNZA 1L7EA 1YVEI 3IKJA 4QUGA 1QDUA 1ZSNA 3PR3A 2PJRA 2O8CB 4PZPA 4ZT4A 4XEUA 1DTEA 2FZLA 4L3WA 3KQOA 4OLFA 3T1NA 4HS4A 2B8NA 1U7TA 2EEPA 4J6FA 4KLRA 4ZK6A 2LE0A 4LN1A 2GM9A 2R62A 4FYKA 2JGAA 3BMNB 4EKEA 5LDDC 2ZRFA 4XGIA 1AV6A 3NTUA 1PWYE 1TJ4A 2QQFA 4GX5A 4ZOBA 1BCRA 3C3MA 3SDSA 3RYHA 4F3YA 1KK1A 5E6UA 1QG4A 4H0CA 4B2PA 6REQB 1QE3A 1QVRA 2PS0A 3MB8A 4LC0A 4ARZB 3ZHBA 4HFMA 4KE8A 3ZCTA 4GNRA 2RHBA 3HP1A 2Q6VA 4GQIA 1XCPA 3VVMA 4LNAA 2AJDA 1L7VC 1LRJA 2Q28A 3FMOB 4UPDA 5E1BA 1L4HA 2CGEA 1UBOS 3MB5A 1K97A 3KO8A 1JA9A 2BF4A 1HZJA 2JI4A 1YNOA 2QYTA 5ALQA 2QTLA 1LLQA 5EJ7A 1RWVA 4TVBA 4KPEC 4XPIB 3QQPA 1RLUA 2C5LA 2WSSD 4HQNA 5AQ1A 2GARA 4M55A 4DADA 4PM4A 4EG8A 1JSLA 5E8RA 3HDGA 4BNKA 2Y2VA 3FCOA 3DVAB 3PRKE 3K1AA 4CQLA 5E1OA 5A9TA 2XYHA 3SM9A 3K72B 2HA3A 2HSEA 4AO7A 3IAS6 3MBIA 5IVPA 2O8DA 4N48A 3CSDA 3HDTA 4EDHA 1XCJA 4P5PA 2CJYA 2HRRA 2IW1A 4M21A 4IL5A 4KNWA 1CY0A 2CDRA 1SCUA 1BH2A 2P4HX 1O6BA 2QJRA 4GOXA 4J43A 3KUKA 4PG8A 1DO8A 2PQ6A 1ZQ1A 3N53A 3ZPXA 4ER3A 4DQDA 3VGJA 1VKHA 3OC6A 3U9TA 1G8JA 5B6PA 2CLFB 3A1FA 3HCRA 3IVRA 3MTBA 4QT4A 1OXXK 1IY0A 2M6RA 5KMGB 3EULA 5I4IA 2TMDA 2ZAOA 4TXLA 1II0A 2HGSA 3IAAA 1RR6A 1L5HB 1UC5B 4ZP1A 1EE2A 1FFDA 3MLAA 3OTQA 3HBLA 3R6WA 4DA6A 4MROA 3ROPA 2HF7A 4I5IA 4UCQA 2WWYA 5SY4A 1S7CA 4JKOA 1NLMA 5P21A 3SZLA 3VPGA 1H1LA 5EIHA 2PZLA 3ZWQA 5BUZA 5IKPA 3CLRD 5FLYA 1JQLB 1KGDA 4F12A 1RW4A 4UKDA 1K68A 4YJHB 3E8MA 4JSTA 1Z6YA 5F1OA 3AT1A 3C5HA 3PYMA 3JQGA 3CMCO 5ALLA 4D46A 1HLDA 1U7UA 1AV7A 3O2SB 1C0PA 1WE2A 4PQRA 4GYYA 4WI1A 3C3DA 5AIBA 3AMVA 2OK8A 3EPHA 4DA8A 1NVBA 2VF4X 1E6LA 2I29A 4FDTA 5JATA 3QU4A 4WOKA 4ENRA 1LV8A 4R0MA 3O8DA 5FNVA 1H1TA 2FRDA 2IEGA 4I8IA 4GOLD 3DLAA 3TSZA 4QYTA 3ZWVA 4AIIA 2PSFA 2XVMA 3OVMA 5BN1A 4P0PB 1E7QA 1OC4A 1L7RA 3E1GA 2E4WA 2ISSD 2P2DA 1V8DA 1N57A 2HNAA 3PUIA 2PE5A 4XCVA 5BUSA 1SHTX 2WWGA 3O94A 1ZBQA 4HDKB 4QA9A 2PTGA 4UAVA 4EGCB 1R3UA 2BSQA 1REQA 4GW3A 1RJGA 1U5BA 1E4EA 1OROA 1UUFA 1JYSA 1G41A 3CNEA 1XRLA 2CUKA 3RODA 3K6SA 2R6AA 3KQPA 2VP2A 3JARA 5F64A 2NPFA 1CY8A 2AOTA 1IEQA 1J8YF 2C4KA 2TMGA 3T7JA 4CM1A 4EM6A 5JADA 2O0MA 1O0SA 1WXQA 1ZW6A 3MGGA 4JGIA 1G5PA 1CQJA 1FTWA 1MFPA 1QFJA 3OE4A 2VK1A 3DFMA 1GPH1 2TRSB 4F4HA 3GFOA 2NTNA 5LZ4A 3TNLA 4RAOA 1D6SA 1MDBA 2QTBA 4IDNA 1N2OA 5DWVA 2AYZA 2O0HA 2XUAA 4CIWA 2FGKA 3EH2A 1ZL0A 3SQMA 1X19A 3LKBA 4L7VA 5FPQA 3T4UA 2XT6A 1P9RA 2XQGA 2NU6B 4BXOA 2I99A 1SRRA 5AKIA 3ZQ6A 1Z2EA 4YXWD 1X8KA 3A11A 4RAQA 5LJLA 4GLJA 3BZUA 5B57C 2BP7B 1B8UA 2PMCA 3NIFB 1NKVA 1PGQA 1OLUB 3AK4A 5CNKA 1JS1X 1QIHA 4W1QA 3G0HA 3UK7A 4R71A 4UHFA 2VWQA 1K2WA 1UFRA 3QE3A 1QH1B 2IUTA 2OHGA 2BEUA 4ZPXA 5G1OA 4MMZB 1KFEB 2P35A 3H9GA 1C3VA 2XSZD 4BC0A 1UJ6A 4RU1A 2AWNA 1BVHA 3G5UA 2QNIA 2J9FA 3Q8KA 3SS9X 2XECA 3IAM1 3PJDA 1HKHA 4A1FA 2WOOA 2Z30A 4MA4A 1KAOA 3EN0A 3OH8A 3BC1A 1LBHA 2F3UA 4RACA 3TH5A 3HDJA 3LQYA 2AN9A 4M0UA 4BV3A 2QU8A 1X7YA 1YO6A 2R48A 1Z0DA 2JA2A 3RWOA 1PFQA 4DTIA 1KHHA 3STXA 5K0ZA 2FPIB 2IEBA 2A4KA 1S3SA 3G8CA 5AJXA 1CR4A 5FP0A 4M98A 4KITB 1OPRA 3R3HA 3SX4A 2G7ZA 3LW8A 3VR6A 3OLVA 3TCKA 3JPYA 5SZIA 1OBVA 3ES9A 4RZIA 2R5FA 2C2XA 2FDXA 3MRTA 4JR2A 5EAIA 3N2ZB 2ATEA 3BCUA 4LRWA 4JQYA 3DL0A 4M7PA 3A4YA 4V2UA 3O6VA 4BL5A 1AQJA 4GP6A 3EMKA 3FSGA 4LBZA 3DWGA 4QYXA 2G5TA 5JAZA 3MWLA 2IF0A 3TN7A 2EFEB 1XTIA 1BU5A 5AR1A 1TT5A 5FOQA 1VE7A 2NZVG 3DE6X 1CSEE 3GJYA 1NVAA 3FZNA 3TQQA 4AZ0A 2E4XA 3DHNA 2YJ6A 3NKFA 3AL0C 5BSFA 1TM5E 821PA 5CP8A 1OU0A 2YWCA 1TW3A 1A97A 1DO0A 1VG1A 2V4MA 2FJPA 3GZJA 2CYAA 5IMSA 3IOYA 4IPTA 2NOAA 3AZPA 2G1UA 3H13A 4CTNA 1GNRA 1QZ3A 4GNKA 4J49A 4EJSA 1RYNA 2J85A 3H05A 4GPBA 4WEQA 3RRJA 3ULKA 2QZPA 2SNIE 4OFBA 3TLBA 4DM7A 2W6NA 4FS8A 1TECE 5KOJA 3GPDG 1UEIA 2FG5A 3E27A 2J7KA 3LT4A 4D0RA 1IOZA 5HQ3A 4BC1A 3N1UA 3GUCA 4URXR 3VKHA 1NE2A 1JX6A 4OM7A 5SZHB 5TMBA 2P30A 2EEZA 2ZRLA 4BFUA 3EZ6A 3RAFC 1VKOA 4YV0A 3VSDA 1LPBB 4PYLA 2Z3ZA 4M8LA 2QVLA 3F90A 2HPHA 3IIIA 3BREA 1W1UA 4K8OA 1EINA 1ZIOA 2D0IA 3DPUA 3PL5A 2BH9A 3FTEA 3K70D 2HRBA 2WKQA 4XJSA 3VX3A 1HH4A 1SU4A 3FZYA 1ZD8A 2PKXA 3HDVA 3NVDA 5ALHA 2NU8A 5ARCA 4E30A 3ND7A 1IBKB 2R5WA 4BMVA 4AJ1A 4BQNA 3IJ5A 4M6WA 3VU9B 4Q4JB 3KKKA 3NHJA 3F96A 1E3MA 3PV0A 4UU7A 2GBGA 3TX6A 3GLFE 3NPMA 2QTCA 1PK7A 4Y1RB 3TZBA 5A6VA 5CIQA 5EMHA 2YBDA 1C1DA 1RHMA 1JIVA 5BSVA 2ECPA 3DZKA 3SJAA 4I9GA 4DV0B 1I1NA 3DT6A 2CK3D 4L8GA 4JYMA 3PQ3A 3C8HA 3R9XA 2DF8A 1P2DA 2CKDA 2W22A 4LNUA 4TTAA 4WA7A 3FRIA 3U3JA 5IXSA 1C7EA 4MP3A 1Q0HA 3OQBA 2VJDA 2O2GA 2AEMA 1KWGA 3EQ7A 4P0QB 3KUUA 3PFNA 4MS4A 3B78A 2F1HA 3NBZC 2ZYRA 4TT8A 4DYVA 2CJPA 3W0LB 2YV4A 1JHRA 2QDXA 3KHUA 4QJ3A 5D86A 4J3JA 3Q4GA 1EVLA 1HRDA 3PD7A 4OMDA 3KETA 4MH0R 4P3OA 5IU6A 3PG5A 3TIXB 2PH1A 4EW3A 1S4QA 2NNLD 3B85A 3EVAA 4EATA 4FM9A 4H2DA 2D2IA 3G8YA 2H52A 1SUIA 3GRUA 4LHVA 4KYTA 1TJ3A 5ALYA 3ROXA 3VM6A 4N9WA 2F1IA 1T25A 6LDHA 2AYXA 3B7GA 3EXEA 4R3NA 5I3ZA 4ASUD 5KDDA 1CG6A 1P2SA 2D74A 4LQ4A 5HCIA 3NHLA 1CYDA 1I7QB 1GTVA 3ABOB 3VGPA 2JHAA 1UDAA 5BSEA 1PK8A 1G1AA 2IDZA 4M2LA 1SHUX 4ZTUB 3KOMA 4ONEA 1F38A 3FAKA 3SXUB 3R6GA 1YZVA 4L8WB 3PKZA 1E1KA 5JXHA 2EV9A 2XCOA 3SG0A 2VTVA 3QGMA 4C7MA 3FMVA 4EARA 1GQRA 1MX9A 2OL4A 1FB5A 1DAHA 4YWJA 4CV0A 3TLCA 1ESEA 3WV5A 5IM4F 2IYEA 3LDFA 621PA 2EJUA 2Y1LA 2HUPA 4IFIA 1ADGA 1G0NA 1U1FA 2JZOA 1E2GA 4CLOA 5SYNA 4YP9A 4F4IA 4WK6A 4W4TA 5AICA 2ZU0C 5CAEB 1M0EA 1XEWX 2MYPA 2GM5A 2H0AA 1W0CA 4E31A 5CG2A 1KKMA 1GWNA 1DI0A 3QOFA 3L4BA 4J7UA 2GF2A 2J0UA 1JNXX 1F2TA 4L15A 4GI5A 5DLEA 2Q1SA 5KYWA 1ODLA 2JLAA 4JBYA 3WMGA 1NHWA 4GMGA 4RGVA 1WCV1 1B2LA 1LV7A 2OORC 3IUBA 3MD0A 2I66A 3USCS 3W5VA 1FRNA 4ITUA 1BZYA 3X2EA 4UU8A 3ROZA 2Y9PB 1J5PA 1EE9A 2YCLA 3LMKA 1IAVA 4NK5A 3WGIA 1KJJA 4AMVA 1I3OA 3QKRA 1CDEA 4JEHA 3CC8A 3COWA 3MINB 1G60A 4JMPA 4EPVA 5KNBH 2WFLA 4RSGA 2O8EB 2ZREA 3VOSA 4QQNA 2BKLA 3WB1A 2ZI7A 4NNPA 3KZ1E 3OPYI 1CUAA 2BRUC 3HCPA 4QGGA 4MCAA 3TTYA 4IWYA 4UDOA 4PSKA 4X8LA 3ZC3A 4C7OB 3NTLA 3BWEA 5CJJA 3RWBA 4EF5A 3RJ9A 2UYOA 3PT5A 3LQKA 4BLOA 3OBIA 1YGYA 1IQUA 2HRQA 3HH8A 2XD9A 3QK7A 3ZI0A 3ZTTA 3MG9A 1AS2A 4KIJA 2H59A 4YRAA 3GW8A 3ELWA 3A3NA 3OECA 4Q03A 4TV8A 2PWPA 1YS4A 4G0VA 4MW0A 4JJGA 3WYNA 3RU7A 5AKXA 3BGWA 3TUZC 5EZ5A 1PJTA 1US8B 4MYCA 1XLWA 4NF2A 4PLYA 3M4ZA 4GX1A 1EDEA 1QFSA 3HU1A 4WCFB 2JGKA 2JIZD 3HQ4O 1KI9A 3HY6A 2IWHA 2C8VA 2ZSUA 4ROTA 3KKLA 4WBXC 4X63A 4ZQHA 1Q6YA 1YC2A 4CCAA 1GTSA 4GU5A 5KYXA 4PQGA 4TM8A 2ZUVA 2DR0A 2IPOA 2D7JA 3MNFA 4NICA 4HGNA 4NQZA 1ZX1A 1TLLA 2BJWA 2YOGA 3DDWA 1DWOA 1NNUA 5C4IA 4A6EA 3JX9A 4O63O 5LL6P 1W0KD 4O6VA 4ZTBA 3OZBA 1DQNA 1NP3A 2QSUA 4TT3D 4BO1A 2OCXA 1NN1A 4RE5A 2Y0CA 3ZGNA 5C4MA 1D0VA 2KLHA 2QU7A 2BGLA 3E0QA 4IWXA 3FPFA 2QUHA 4NJOA 3L6EA 4JUFA 5C37A 4NATA 2GFQA 3E53A 5TPWB 1Y1KE 3EXG2 3U0BA 2ZE7A 2VKTA 1O94C 2H4XA 3RJZA 3RU2A 2OBFA 1OWMA 4UREA 4ZRNA 1ADBA 3KJFA 4KQEA 5ECYA 3FI9A 2P3OA 3EVDA 3WA7A 1BHO1 2NXWA 2B34A 2H4JA 1AXRA 1CR1A 1E3DA 3E6AA 1NGSA 1YC5A 1ZS9A 2FSUA 1BX1A 1YI0A 2V6GA 3KJEA 3KUDA 4Q24A 3RVQA 5DZSA 1LBQA 4LMRA 5LLDA 3GLFA 4PNHA 1XXHE 3SVTA 2ABWA 3IBCA 3SR0A 3TQTA 2O50A 2PUFA 4RLSA 5TB5A 1GQYA 5FPPA 4HRVA 2FMKA 5EKTA 5L3VA 5IJ0B 4MVJD 1FNNA 4KSYA 1O5IA 5PNTA 4CG3A 4EEZA 4DIEA 1ZUNB 3T0IA 1FXUA 4HRAA 1UDXA 4PHHA 3O4RA 1GTG1 2QQ5A 4TWAA 3OUUA 2NP7A 2PIAA 3LQ4A 2XY4A 3OZDA 5EXPA 1XDWA 3OZFA 4Q3NA 1CS4C 2GZRA 2ZKIA 1G20B 1R9MA 1J00A 3HADA 2Q3LA 2VP3A 1CX9B 3B8EA 3RDPA 3VTAA 2X0JA 1CR0A 4H7KA 5EXSA 4BNDA 2MHCA 3MRVA 4QU0A 5J3JA 2ZCJA 3IKLA 2XA1A 1EB9A 2XT9A 5HNKA 3R0JA 4YUAA 5F1KA 5J2TA 1YQEA 5LNK1 2A5DA 5I4CA 5JJBA 2VHWA 4RVNA 5T4HA 1JRLA 5HPYB 1E9AA 4O4LB 2XKAA 2VXBA 3L43A 4MOWA 3AI3A 2GXAA 1E2MA 2AOUB 3A6FA 4JU9A 5F1YA 1WR8A 5LBUA 5GZ1A 3PI6A 4QULA 4BVLA 4FGLA 4N1AA 1UXOA 4XQEA 3A6EA 4NU8X 4NHOA 3NM6B 4HB2A 1VKJA 4X94A 3UWMA 1BVRA 4AUMA 2ZRCA 1KRWA 1RYDA 3D6AA 5B4VA 3L7AA 5HMMA 4IOMA 3TBFA 4TQUS 4LJSA 1DIBA 2CXXA 1V4BA 4YHHB 3T3MB 3IP9A 3FKSD 3IUYA 2VAWA 4JI1B 3QRWA 4GYKA 4HSEA 4NNOA 3QEOA 4U39A 5CHEA 1G2OA 1RQRA 1XK6A 3ELYA 3LUBA 3K31A 2G5PA 2H3HA 4NPCA 5GOTA 4Y6GB 5HWSA 5JDCA 3UY4A 3VJMA 2WK1A 4EX6A 4EUEA 4GAEA 5CBPB 3WLPA 3GOHA 4HSGA 3V4LA 4RCVA 3QVSA 2MTBA 5DTJA 1KPIA 4KRGA 2B83A 3K1JA 3GP3A 4DM4A 5MGNA 1W5SA 1SVUA 4LPKA 2ERYA 4JUIA 3O74A 4IS3A 3ZY5A 4AULA 4D3DA 3TS1A 4YMLA 4NZOA 5C1OA 3ZVLA 1Z22A 3F1LA 4K8RB 4IEIA 2FSPA 3JTEA 4WFIA 4NDZA 3TW6A 3N2GB 4R4JA 5CCBA 2P9YA 3L8CA 4ESEA 3B13B 4E4YA 4JQCA 2VSQA 2QSJA 3PRHA 4IVQA 4UHJA 1XP5A 2MU1A 1S7GA 3BQMB 4YQEA 4ZZ2A 2R6FA 3HI6A 3UAXA 1OW3B 4I4TB 4TM7A 1VXOA 1T8YA 1TEXA 3RRNA 4UBJA 4BQQA 3FETA 3BHIA 3AC0A 2J87A 3FF4A 1UZLA 5DNWA 2NUTA 1SKYE 1WSDA 3IMCA 5HFAA 4DLTA 2H5LA 4JZYA 4Z9FA 3KB8A 4AJEA 2GZDA 4O1IA 4CUKA 3G49A 4INZA 5CMLA 2AB0A 3WICA 1N5DA 4M9ZA 2EFJA 1J1ZA 3B51X 1N8SA 1UMDB 3WDSA 2PSHA 2EWMA 1KVQA 3K0AB 3OIYA 3S3TA 4LF7B 2JJ8A 2ORVA 3KLMX 4YFYA 2V45A 3N58A 4U63A 3KZCA 2REOA 2GK3A 3TM5A 2EBWA 5D5PA 1VJ1A 5MDHA 1W5EA 2C97A 5FA6A 4JLPA 2EG5A 2FSGA 3GLKA 4R51A 1JFSA 4EY4A 1UBHS 4WXHA 1AM4D 4IV0A 1YULA 2O6HA 4LXUA 2RGEA 1M6NA 2DWCA 3H2JA 1N6PA 3DNFA 4JB0A 5EP2A 1R8YA 3IQFA 1P0QA 3JQAA 4DV1B 1MHTA 2G9UA 4QATA 4Y7CA 5CT6A 2J33A 4KQGA 4RY2A 2OMKA 2YMPA 3IULA 2GQ0A 1YQXA 2BHLA 3JASA 2QRHA 3N6RA 4H7HA 1G4AE 1G8KA 2PZAA 2R85A 4J0KA 1KU0A 4LOJA 4Z0PA 3UM9A 4B7UA 4YONB 3WGVA 1A2BA 1F4VA 4NBKA 1XD2B 2IX9A 2W90A 3RUHA 5TJ9A 4MR9B 1FSZA 3A6JA 1M7BA 3ONWA 2CLOB 1TZCA 2EFCB 2FE4A 2VBGA 1W6RA 2R6GA 2WR8A 1Z0ZA 1WF6A 1KOGA 2X15A 1IN7A 3CH5A 2OMEA 1Y9EA 3H7IA 3SQDA 3K8OE 2ESRA 1DV2A 4HWTA 3L4BC 2G25A 2R00C 3O7MA 4L0QA 5IEJA 4E7PA 2L42A 3RTBA 1B7GO 3EVNA 1C7JA 4FLFA 5H3HA 2BKXA 4L3VA 2BEKA 1S2NA 4J16A 3FNFA 3TRKA 1PHPA 2H65A 2YV2A 4ZC1A 5DT2A 1MJGA 2BFAA 1YVDA 4X6LA 2Z6AA 1WKCA 4KQCA 2GJ4A 3ETGA 4PYNA 2JI9A 1YS9A 2EP7A 2Y0EA 2JEZA 4JC8A 3TEJA 1L4MA 5FWNA 1QQAA 1IY2A 5T67A 2GD0A 4FXPA 1V5WA 4YP5A 4BE4A 1EVJA 1EPUA 1MEOA 1EA7A 2EZUA 4MSUA 3CY6A 1W85B 1PZEA 2P1RA 1TJNA 2YHUA 3DZJA 4TRRA 5DRYA 1WU7A 3S2GA 3F5FA 4J2HA 3D54D 4D9MA 4PRKA 2C58A 3BD7A 3DQPA 4Q4DA 2EFDB 4NJMB 2WMNB 3PITA 5B7GA 4GXTA 2QJOA 5CX1B 2PUCA 3BZWA 2C2MA 1JIKA 2FB9A 4GOOD 4UHBA 4JT8A 6Q21A 1P5JA 1YTLA 4HNRA 4G1BA 2ZRKA 1Z6QA 1MOQA 1NBEA 2X8AA 2VO1A 1UJ4A 4D0NA 1SBZA 2VQSA 2G9NA 4TWBA 1J8DA 4A6XA 2A88A 3KTOA 4C0LA 3E9RA 1SB8A 5ALVA 2X2EA 3OEWA 4BNTA 3ICEA 2LCQA 1MXFA 3T3PB 2GPTA 3RF6A 1SKUA 5EVCA 2RFLA 4AYWA 3F7OA 1B42A 1KXZA 1G20E 1Q7GA 4LE1A 5COBA 3ZWCA 4DCUA 3DL7A 1PN3A 1R3DA 1X77A 4F97A 3ILYA 1Z2CA 1Z0SA 2YOFA 3JQ8B 3T41A 1QZZA 3AIIA 3C8ZA 3KJIA 5EP1A 5CLFA 2W2QA 3L7MA 4NAHA 3IDSA 3FFTA 1Q17A 3Q0IA 3R5SA 5AK3A 1P6UA 1UODA 4MJ7A 3ZWKA 13PKA 1TZJA 3RBVA 2OENG 1YFLA 4HDCA 2QP4A 5IJ9A 3NJ8A 4HN4B 3FYUC 5K8LA 2QTVB 1KA9H 1P4GA 5L53A 5K8IA 1PNVA 3D6TB 3OM1A 2GERA 1U1EA 1DQZA 3BOSA 3BORA 3VHXB 4DJEC 1N5LA 1GVHA 1YDFA 4X00A 2NZXA 3L7CA 3WIOA 3ENWA 1JZTA 2Z9BA 4BIMA 1QORA 2V5AA 3VJLA 2AD1A 4UNSA 3QNMA 4CV2A 5BNTA 1JYFA 1VP3A 1ZZGA 3LPAA 2QL6A 4DB4A 2OFPA 3BE6A 4NE9A 5JZMA 2GK4A 4DILA 4MRRA 4J9VA 4AXBA 2HSZA 2IVZA 2R86A 1YRQA 1L7AA 5JD4A 4B0PA 4K9NA 5JYDA 4HATA 1QC5A 3FE2A 1UADA 3LUAA 3RIMA 1KPHA 2OR3A 1O1YA 1YQUA 3SJBA 4DZRA 1LFDB 2ZPTX 3L8GA 5L3RA 1FDSA 3KLNA 4XWTA 3GJ7A 3STUA 1NJ8A 1JQDA 4LF6B 4IHJA 4EHLA 4QUHA 2KB0A 3NG1A 3DTVD 4XH9B 2WYUA 4JENA 5AHRA 4CCSA 3T9CA 1RI3A 4RVHA 1JIUA 5CVTA 4CTMA 4ALNA 3AM4A 4JWTA 5CA1B 2ODNA 3AINA 4HVCA 1RJEA 2BLLA 5TX7A 1NI4A 4EB6B 1J0AA 1JHOA 2BWJA 2CWDA 4AB1A 5B64A 3DR5A 4PANA 3ZDXB 3GNTA 1L6RA 1KVRA 1UKCA 2REBA 5GVRA 3LCUA 5A4JA 5KSWB 1L3CA 3V1KA 3THOA 2P6RA 3TJMA 3TDNA 2JCYA 3KT8A 4KKXB 1Z5UA 4FIDA 1U8CB 2C5FA 4YRTA 3NYQA 2OG1A 2IU0A 2OO5A 4IIFA 4OHKA 4Z2YA 2DULA 1HTBA 3M34A 5F7XA 4JXZA 2NAFA 2YC2C 1IZ9A 2H16A 3OICA 2F8LA 5TMPA 3M9LA 1X39A 2R87A 1BSVA 1XQXA 3KALA 3QWFA 5KYTA 3ABQB 4YR7A 3STWA 2P2GA 3S2SA 3JQAD 1BQ3A 1J24A 3O7WA 3B6MA 4M9UA 1D3AA 1COWA 4IJ5A 3I53A 2HYDA 3LVRE 3F7TA 1RXSA 5BSRA 3QSGA 2X3YA 1Y1RA 4KRXA 5I8ZA 4IIYA 3CSUA 5ALEA 3QLTA 3LYUA 1EVIA 2GO1A 3JQ9C 3NOXA 3S99A 2HJ9A 4PNEA 1W2GA 6ABPA 1Q1QA 3C5WP 5F1PA 3AZQA 2PGDA 1B6SA 2HF2A 3Q7RA 3O8RA 4AZVA 1N1MA 4CNQA 4LVCA 2FQ1A 2H4YA 4BMCA 3MW8A 3ETDA 4FGUA 3H3XA 4WZZA 2GYWA 2XW6A 2WF6A 2QZJA 3MJ4A 4KR6A 3FPSA 3HUTA 1B43A 1G63A 1TPYA 2C3MA 1VB5A 1E4YA 1ORWA 2DRIA 2H2IA 5JNSA 4D7AA 5JFTA 2Q6OA 3DBHB 5T4BA 2RH5A 5LSAA 4RVUA 3VO1A 2ZFUA 5JAIA 3L8ZA 2I7VA 3W5DA 1SIUA 2K6GA 5G0SA 5FD8A 1SEVA 2PIDA 4FDLA 4YRKA 1ODFA 4D3FA 1H0HA 2A0FA 4YLEA 1I3MA 5DF1A 1HOTA 1CP2A 2YRXA 4KQ9A 3BJZA 2YXPX 4HC4A 8OHMA 5MN4A 2PUVA 3HKDB 1IMJA 4JSRA 2YZ7A 3ZWDA 3BD6A 3GPIA 1J20A 2LVBA 4BBPA 4FUTA 4ZVUA 1WXGA 2C0CA 3EZ7A 3LY7A 4N0QA 1ZMBA 3S1AA 4ALLA 1JYEA 4B84A 1H2XA 4CG1A 8ATCA 5U1PA 2NADA 1PJ3A 5AW2A 3CRNA 1KSHA 3NV9A 4G4SO 4ZO4A 1JLRA 3V7YA 1Y4ZA 4DV5B 2V1UA 1MAHA 2J07A 4NV3A 4D8UA 4G9EA 3UNXA 4C89A 3ZLVA 5KDOA 2JFPA 2FOIA 4W82A 3UPUA 1UBEA 1MEEA 2VJPA 4DMHA 2VNHA 3QVLA 3KYDB 3BWBA 4CE6A 2BCGY 2ZM6B 1MJHA 1TVCA 2GMWA 4R3WA 1I33A 5AVXA 5FI3A 4OY3A 1ELOA 2QW0X 3F3MA 3B1VA 1XRQA 1W85A 3RT9A 1U3CA 1GOTA 3RWMB 3COVA 3SHQA 5JMWA 3JZFA 3VPFA 3DEYX 1JPVA 3EXHA 5LQSA 1A4IA 3MLBA 3Q10A 4N7MA 1PDWA 3TCXB 1USIA 3OJFA 1AUOA 1KMCA 2VHQA 4GE3A 4JDPA 4UVHA 4E5UA 1KI4A 1QANA 1U0NA 2DQSA 1M2VA 3PF8A 4IHAA 4OYYA 5AUOB 5AKGA 2YZMA 2GEDA 4LVNA 2X23A 2GVZC 2ZYIA 3N2NA 2FDRA 3CKKA 2A84A 4JLBA 4UMDA 1G2QA 2QMZA 4MV1A 2EAUA 2JIPA 3G0OA 2VIIA 3HCEA 5HILA 2AG1A 3PC6A 4OH1A 4WDQA 2ORYA 1SOVA 1JHDA 3L4JA 4MEJA 4LDRA 2RDMA 1X1BA 4LZNA 1AUPA 4DUGD 3LFTA 3U4DA 4C0BA 3G9XA 4DDTA 1SCJA 4GECA 3EXHC 1NKSA 4BWVA 4HNVA 2H1IA 5AW1A 2JIDA 1TIPA 2OCYC 2XDQA 2GPSA 3QV1A 1ZIXA 3EQ6A 5H81A 4FQ8A 4ED9A 2B2CA 2OG2A 4LYHA 3WX0A 1SFRA 3A4TA 1ZGHA 3JASB 2CCKA 4B4UA 1XNQB 3HCWA 1YMQA 3PGMA 3T5TA 2G09A 3T12A 3N8NA 1GRCA 1H8ED 1HL7A 1XB2A 4NBRA 3R7LA 4LYJA 2VRCD 4JGGA 1MLDA 2RBKA 4QU8A 5IDWA 1M1XB 1ORRA 3QOYA 1Z4IA 2EKPA 3H4IA 4NMHA 4RADA 4PG6A 2R97A 4R8SA 2FOXA 3A2MA 3D6HA 5LBTA 4XW2A 2NUAB 2O0JA 3BE8A 1YRAA 1T9GS 2PSJA 2YR0A 2ZI6A 3P20A 2DTDA 1ESNA 4FX2A 1N5JA 5ENZA 1I94B 3U7IA 3G0DA 3N2KA 1YB2A 3RV3A 1GILA 3KZNA 5T5QA 1CQPA 3N7UA 1H0RA 2P11A 3UCEA 4YR9A 2QBYB 1T3LA 4B8YA 1XZ8A 4ZYZA 4H7FA 4A8JC 5D3QA 4HYYA 2D1YA 2DUMA 1XQ6A 4F72A 3OQ1A 4XDZA 2VZEA 1UT5A 3GDWA 4RQAA 1L4GA 1LDMA 9LDBA 5JJLA 4GQBA 2A3RA 2IU3A 5BV0A 3P96A 4NTZA 1AK2A 4A2WA 1K08A 4BFVA 1YQWA 1C7ZA 5F5XA 5HIKA 5JZSA 1Q5PA 3R41A 5JEEA 2NGRA 3L7KA 1ZKDA 3QXSA 4YP7A 2RKOA 4DMKA 1NJ2A 2F64A 1BMFD 3L7LA 5AO9A 4MUKA 3T9EA 2QZ4A 1UJMA 3D02A 2Q7OE 1WNTA 2GD2A 2FW8A 3BG5A 1RAIA 3N2GA 4MWDA 3VPCA 1W47A 3VZQA 5K8UA 4MMXB 2CE2X 3VH4A 5CVCA 4G0OA 1C9YA 2QG4A 3P5BA 2JGFA 3WP1B 4EA7A 4WOCA 2XZDA 2BY4A 5IT0A 4NZPA 4EDFA 4DMMA 2QUZA 2HD4A 2V6JA 2W8BA 4I46A 4LZPA 3VNAA 1LQUA 1VTKA 4WKNA 4ZQGA 5IWAB 3OFND 3UMGA 1TF7A 5DOVA 2ID4A 1SHKA 4DCOA 2CV1A 1YTUA 1YAJA 1ZKMA 2V6FA 3ZWAA 1NVTA 1Z2PX 2P65A 2WY2D 4BUCA 2IEIA 1KBZA 1PD0A 3QHAA 4QEZA 3VU1A 4WUVA 4Q93A 1GZUA 5AJYA 2P9JA 3FGNA 5ALDA 3INGA 2AI3A 1YHNA 1L7OA 1SC9A 2VAPA 3BTUA 3BKWA 4HTAA 4X41A 4IO1A 1YZGA 2PO7A 1T3SA 4Z7QB 1ZGCA 1BMFA 5ECDA 3G23A 4IIDA 4L22A 1GTZA 2AFVA 1LVGA 1SGWA 2Z4SA 4YH1A 4CF7A 3GRYA 3ORQA 4QRHA 1FTNA 2RAUA 2A9OA 3KEGA 4RTQA 3SFVA 3B20A 3BDVA 3K7EA 2X42A 2H1WA 3F5SA 3NOOA 2B94A 4H35A 4ZOAA 4C4RA 3KVNA 2KS6A 2GEKA 4QYSA 3UA4A 4DLYA 1BJKA 1HO3A 1JJBA 1Z5NA 2Q2NA 1E9VA 4PSUA 3MUEA 5KQMA 4Y9RA 1JVNA 1HOXA 1QP8A 3ANTA 1PR6A 4FWTA 3G9ZA 4GD3Q 4LVOA 1J23A 3AHJA 3N87A 2FPGB 4OLHA 3EC2A 1FXWA 3FRJA 5DWQA 1DCFA 3AOEC 3EDMA 4FBMA 1XZEA 4AF7A 1GPLA 2O5RA 2HCFA 4D82A 5FEUA 4D99A 1L5RA 4TS1A 5DW3A 1S0UA 2UVQA 3PXDA 5GGXA 3ZCVA 3UHFA 3H5LA 2VDUE 3T99A 1GUYA 3E5RA 1NQUA 2IY7A 2ONKA 4TMWA 9MHTA 3CRZA 1VJTA 4YAKA 5IFLA 3P2KA 2XE7A 1K7FB 1GQSA 3L8EA 4OMCA 1F9AA 3VSEA 4AWAA 3HO6A 4W5TA 1ZD4A 2GPNA 3QLEA 1AVTA 3EGDA 5IJ0A 3EQ2A 5J58A 4TTSA 3OFNA 2HLDA 2FZ4A 3W8RA 4Y1EA 5C8YA 2JD0A 1C29B 1HNXB 5IUKC 2VDOB 3P0FA 1EM6A 3ND6A 4AMUA 4D8YA 1RI4A 1TK9A 3JWJA 3I2GA 2PZMA 2RGGA 2FPRA 3RQSA 2ZIVB 2VBIA 1GT91 3ADCA 1B26A 3HC7A 3LOUA 2XE8A 4FFOA 2AXNA 5I5GA 4AWBA 1W0JD 4E2ZA 2YINC 4JMLA 2I1QA 5BYAA 5CJPA 1YB7A 2POCA 2VSOA 4MLCA 3N6XA 3DJFA 4GX2A 3U2QA 1J0DA 3DE2X 3GPLA 2Q3HA 3FZEA 4JL8A 3P0EA 3TUJC 3NM4A 4ENPA 1BKYA 4EY7A 5C5IA 3A2LA 3GRPA 3KR2A 1H2EA 2ZJYA 1TT7A 1ENPA 1XRNA 1YJ8A 2XYRA 4M1SA 2HHHB 1X7DA 3T52A 3NATA 1S8AA 4ISCA 1PR2A 5LMZA 3NX4A 4TMXA 1DBPA 1QRTA 1H93A 1KVTA 4TTJA 5EPOA 5KJCA 4BB0A 2F43A 2AHOA 3H86A 4DARA 3AVWA 4TYQA 1P73A 4COOA 3W7AA 5EN4A 1GT6A 3GRVA 4OGFA 2X0NA 1P62B 1XQYA 2G0TA 4V2IA 2IUYA 2XV1A 1BXKA 3RUFA 3W1VA 5C53B 3O8CA 2EJBA 5C51B 2WVJA 3DP7A 4RK4A 2VTDA 3JALA 5CIYA 4L4UA 2IV7A 5T57A 3WGTA 1WXFA 3C98A 1YQGA 1SQFA 3IS3A 1A8QA 3SOPA 4DMFA 4GLBA 1KMHB 3OJOA 2LXNA 2GHTA 3KEQA 1MG5A 4PR3A 2IH4A 2G80A 4LOIA 4RF5A 4CCYB 4D8TA 2XUQA 1ML3A 4PO9A 3I39X 1Y1LA 5TT0A 4AJJA 1XE3A 4OD0A 5EE5B 4LSWA 4PE5B 4IXMA 4AICA 2C8LA 4G0WA 4ZAYA 3F8WA 4A27A 4MJ3A 3QEJA 1K3UB 2X3UA 2XQJA 2ZJ3A 1GFSA 1ZOIA 3BXXA 1JV2B 3I45A 3KTAB 4FGJA 5CYFA 2FPLA 5ER9A 5GP1A 5JLAA 2BGNA 3O3CA 5FFNA 5EWJB 2C7VA 3FM9A 2FFQA 3PGJA 4W5HA 3I58A 3KTAA 8ABPA 1AKVA 5ADVA 3VYSB 5TLSA 2ZETA 1CYEA 3ZD8A 2VT3A 2V7TA 2XGGA