2F3TA

Crystal structure of e.coli guanylate kinase in complex with ganciclovir monophosphate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Crystal structures of GMP kinase in complex with ganciclovir monophosphate and Ap5G.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 69
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 2f3tA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2f3tA01
2Y8EA 3CIOA 4B74A 3ASYA 3HWSA 4NBSA 1CR2A 4WZAE 4EPRA 3UIEA 4B47A 1T8TA 4JL8A 1KSFX 5H1YA 3BIFA 3ONWA 4HDCA 2V54A 3N2IA 2QMEA 4NMMA 2IT1A 1Q57A 1DVRA 1OFHA 3LW7A 4JJKA 2D2EA 2VP6A 3OFND 2GBLC 4Q47A 1G5TA 2PX3A 4BQSA 3TGPA 4D6PA 2G83A 2RGEA 1TU3A 3BH7A 1F48A 5CK5A 2CVFA 2RKOA 3Q7QA 3K0AA 3S1AA 1VG8A 1RZ3A 3EXAA 3RS3A 4IRUB 4P4SB 1P5ZB 3DMDA 1XPRA 4AYWA 2ZJ5A 4Z54A 4F38A 4Z1MA 4DJTA 4BFSA 2VTKA 4ZV4A 1UBEA 1Z47A 4DRZA 2CMKA 2O8BB 4DCVA 1CS4C 3GQBA 3JVVA 2IUUA 4G5SA 1ZINA 1GP2A 4BFWA 4EKDA 1SZPA 1DAEA 2P0EA 2WKPA 4G0NA 1GM5A 3K70C 1TEVA 2ASEA 1OYWA 2N42A 1S2MA 2WMOB 4AKIA 2WOJA 2W2VA 4IJMA 4QGHA 2GZAA 4ABYA 1XDBA 1KAOA 2KBFA 1B0UA 4BLPA 1DE0A 2GBLA 4HAXA 1O3YA 1X6VA 4EFNA 1KY2A 4PAQA 2B8WA 2JLVA 1T0HB 1DO2A 2VA8A 3GFPA 2QROA 3BK7A 1G7RA 2PL3A 5JJLA 3H86A 1GNQA 5GJBA 5DI3A 2CL6X 1TUEA 4PXAA 1ZYUA 5L3RA 3O8BA 3FYHA 1E98A 1FNMA 1A5TA 5L8VA 1NMXA 5HKKA 2XTZA 1FX0B 1Z6GA 1N6HA 1UBFA 1E2FA 2FFBA 3QVUA 4JT2A 1T6NA 1W48A 1KK0A 3RRZA 3SFVA 4B76A 5GADl 1X8LA 3LQRA 1FMLA 2QSZA 1IN8A 4BEBA 2IYRA 4H1UA 1XMSA 5CDFA 5TARA 2ZE6A 3FGNA 4A0GA 1FZQA 3B82A 4QOSA 1QHHB 1XD8A 2GXAA 3I61A 4IOKA 1LS1A 5JSZB 2GEUA 3F3YA 3BOSA 1VCNA 5H8WA 1II8B 5HE8A 2IEYA 2VLIA 3TBKA 1RE0A 3I4LA 2XNDA 3VR5A 2AR7A 3SEAA 3PIRA 2WTUA 1YRAA 2ZI9A 4DUGD 3M1IA 4R7ZA 4TL9A 2QMHA 3L43A 2ZI5A 4EQ6A 3AVTA 4C0SA 1E0SA 4AY2A 1NY6A 1AIPA 1E94E 421PA 1S96A 1XB2A 2ZANA 2CE2X 4LDJA 2OCBA 3QKRA 3U7HB 2RGXA 2QORA 3VU9B 1E1QA 1VG1A 1XTIA 1NN5A 3QENA 1ZD8A 2O8DB 3MWJA 4DWJA 3EW9A 1ZVQA 1AZSC 1E2GA 4DLUA 5EJEA 1MABA 3FE2A 1JR3E 2H7VA 5EE0A 4BGDA 5KDDA 4FWIB 2R6FA 5EP4A 4M4SA 1CR1A 1NKSA 1P2SA 2WJJA 5H68A 3HJNA 4LY6A 4C0AC 2BMEA 5BN4A 3CX8A 1A2KC 1EK0A 5FPYA 2Q6TA 3KTAB 2NZ8A 4Q4HB 2YINC 2EW1A 121PA 1OFUX 3C5HA 2IS6A 4MYCA 4RCZA 4C0KA 5FUWA 3THXB 4WXRA 2QN6A 3I3SR 1E2HA 4QNMA 1XEWX 4B48A 4GL2A 1UKEA 4URXR 5EXPA 4E09A 4LV8B 3AVWA 4KI0A 2PCJA 3K0FB 4MRPA 1GL6A 2J45A 1Z6TA 4XWOA 4B35A 1M74A 1TEXA 1Z07A 4H1VA 3KKMA 2OBNA 3QF4A 4UXIA 3T12A 2PZFA 4M1YA 2VRWA 5GJVC 1ZD9A 3CRW1 4R98A 1RFLA 4DCUA 3LLUA 2J5XA 2OCYC 1Z0FA 1HY3A 2GCNA 4YMVA 2FN4A 3WXMA 1N0UA 3WY9A 2V55B 2Z6VA 4XD7A 3IIKA 2I3BA 1S9HA 3VX3A 1JR3D 4ILEA 1G8PA 1L8QA 3U3RA 1DAGA 4JLOA 5KDOA 1GZSA 1EFHA 1G8GA 2FJUA 4UKDA 4Z8YA 4URZR 4C4PA 1E2EA 5BQ5A 3FOZA 3F0TA 2EFGA 4A2WA 4RD4A 4TMVA 3T06B 2A30A 1L7VC 2C99A 1QVRA 2C95A 4N3NA 4HB0A 4B2PA 2ZSAA 1E9SA 2ZU6A 3LVRE 1SXJC 3TIFA 2F1JA 1H8HD 3BORA 4L8GA 2WHXA 1Z5ZA 4X8MA 1BOFA 1Y63A 3W34A 2RCNA 4AG6A 1Z22A 2UVQA 3QKSB 3DZDA 3ND9A 1W7AA 2R6AA 4GMXA 5DE3A 2PZGA 3REGA 5TDHA 4LGMA 3SJBA 2AFHE 4AKHA 2ZJYA 3FPAA 4QM6A 3AVXA 5TMPA 4HDQB 2IYUA 2EWVA 4KSCA 4QXAA 2J46A 4MH0R 3SR0A 4BWYA 1XMIA 1TUIA 3WHLA 1IOZA 2OT3B 2GCOB 4AC9A 3SNHA 2A5DA 3TE6A 1SXJA 4KSBA 1R0YA 5KUTA 2XAUA 4V0KA 5FOXA 5LB2A 1KSHA 2BOVA 4V0OA 1MR3F 2J41A 1XCGB 1NG9A 1IN5A 1KK1A 3U3MA 2IA5A 2HF8A 3NKVA 1XJQA 1OHHD 2WWGA 4RFSB 4EPWA 2QBYA 2QM8A 1U0HC 1WCV1 3IBGA 5HCNA 4UJ5A 4NYJQ 2QGNA 2J87A 3AVOA 4ZKEA 4A6PA 3OE7D 5JJKA 3KXKA 2AN9A 3FVQA 2Z5FA 1KMHB 3K53A 2D74A 1E32A 2OFOA 4WXPA 2O0HA 2W2XA 2MMCA 4ESHA 2YOGA 3DPUA 3LFUA 1SVOA 5JJIA 2P5SA 3SS8A 3NBYC 5E3HA 1P9WA 3QUSA 2HV8A 4Q02A 2ZJOA 4C7OB 2WIAA 3T35A 2Z4RA 1W36D 5JWHA 2X8AA 5J4KA 4C2TA 3VR1A 1E96A 3GLIB 4KYUA 1NJFA 2GJSA 1ZRHA 3PEUA 4QM7A 4I1SA 1NG1A 1WF3A 3NHBA 4FIDA 1XTSA 1XTRA 2JJ2A 2Q0HA 4JKYA 3QXHA 1YZQA 2CHVA 3NTUA 1PZNA 1AGPA 3B1WA 1G7SA 5F3WB 1Z29A 4GRAA 1YVDA 2QEQA 3OZXA 4ZDJA 1KY3A 1ONBA 1E0AA 3IBYA 1N6RA 3T1TA 5BN5A 1MO3A 2FSHA 4Q5IA 1DADA 1XFAA 3AUYA 3B7GA 4RKFA 2DR3A 4B73A 4CRWB 1O87A 3EPJA 2VHCA 4AKEA 1KK2A 1E79D 1VMAA 2BCJQ 2V7QA 1RRCA 3BFKA 2ZJ8A 1XPUA 1GITA 3BB4A 4AG5A 4DLYA 1S9DA 1US8A 1XP8A 2CXXA 4F93B 4EFMA 3U4QA 1E2JA 3PJRA 4EJSB 1TF5A 2WKQA 4LUCA 1FW6A 4F4CA 4RKEA 2AKYA 4DC9A 1IY0A 2EYQA 2ZVPX 1PLLA 4DBLC 1VCMA 1CJVC 2NOAA 3QPWA 3WHKA 2X2FA 3KFVA 5J4YA 1P2UA 4LJ7A 4EUNA 1HH4A 4OYHA 3IUYA 5EQTA 3KQHA 1W46A 5HTKA 2HLDA 1IJFA 4BRUA 4ASUD 2X19A 2G1JA 5B58C 3QSYA 3L0SA 3CRMA 1E9CA 4PX9A 1KAGA 1XPOA 3QPVA 3I72A 1KO5A 2JJ1A 1CTQA 1X1SA 1Z3IX 1JAHA 4HUQB 3U3OA 4CT4B 2O8EB 3CPEA 3CUEF 2Q3MA 2ZE8A 3RS0A 5BN3A 2J0VA 2DFNA 3H4MA 1W4CA 1BKDR 2RGCA 4KVGA 4D80A 1NMYA 3TW4A 4DB2A 1KI7A 2RH5A 2OXRA 2HF9A 2VPPA 2YWFA 4IKEA 3WRYC 1ZUHA 1ZD1A 4WBSA 4F7WA 1G8YA 1NSFA 1X8JA 4A15A 4GDFA 2B8TA 2ERYA 1WBDA 4XVUA 5GJCA 4GT1A 1R4AA 4IEIA 1ZAKA 3C41J 4PC7A 5DNYB 1EG7A 3CPHA 1G5PA 4MUBA 3B78A 2KI5A 2ZIAA 4V0NA 4TZ0A 4Q66C 3THWB 3GPLA 3TSOA 2NZJA 2VL7A 2BEJA 3KXIA 4JLBA 1G4AE 2QY9A 1N5IA 1YHNA 4X8OA 2NMVA 2QQ0A 4KBFA 1EGAA 1XMVA 1NN1A 4LZZA 4OBEA 4B34A 3AUXA 3I73A 1QBKC 3ZGXA 2LWIA 2ZSBA 1QG4A 2CL7X 4MKFA 5C1BA 1E4VA 1QF9A 2DPXA 3WBJA 4HAVA 4GBMA 4I81A 1BYUA 3HU3A 3KQNA 1DTSA 2JIZA 2ZR9A 4P3YA 2XITA 3CX6A 4U5XA 1T9HA 4BFZA 1AM4D 3OIVA 3TVTA 1DAMA 221PA 4TSFD 1M1YE 3SN6A 4NYMQ 1NLZA 521PA 3TQFA 1SVSA 2W6JD 4M1MA 3V4RA 3IKJA 1EFRD 4LX0A 5C4GB 4FI3C 4PSKA 4RD6A 4C3ZA 2FSGA 4XVQA 1E9AA 4ACBA 4NCNA 3E5HA 2VF7A 3I92A 4P4SA 5FL3A 3DOFA 4NYJR 3HU1A 4B6FA 4CGZA 2FNAA 2ZS9A 1GIAA 4ZDIA 2IF0A 3M4YA 2P3SA 2O8BA 3QXXA 4URYR 2FFQA 4I1VA 5ELXA 2WM9B 2H16A 1ZIOA 5JCPA 5CYPA 3AQ4A 3CPJB 2CBZA 2ZRBA 4PAMA 4FCTA 2KB0A 4LJ9A 4BFTA 3WMEA 2QMOA 4URWR 5DO9A 4PC2A 3L8ZA 4L9WA 3LXRA 1D6JA 3RRNA 4DEYA 5CM9C 3TVDA 3H0KA 2ANBA 6Q21A 2C04A 3UK6A 1OIVA 1AZTA 2XGJA 4DSUA 2W6ID 3LX8A 1K8RA 4I1OA 4E07A 2G0NA 3A37A 5EXXA 3SHWA 1MO5A 3L0IB 5FOWA 2QA5A 1P62B 2EFCB 4Q9JA 1Z06A 3VTKA 4H9GA 1S3GA 2GETA 2ZRJA 4TTQA 3NC0C 3W8NA 1UADA 1FX0A 4JLKA 4KVAA 4V0MA 4HZIA 2VHQA 5KNCA 4Q03A 3T1QA 1KNQA 5E95A 2J7PD 1E2NA 3WP1B 4US0R 1Q20A 3A4MA 1QHHA 3BBPA 3BC1A 4NYIQ 2Q9BA 4BLRA 4ZI3A 5JSZA 3LY5A 4HYYA 1II8A 4HUTA 4WVFA 2WZQA 4QKQA 3PV0A 2OO7A 2P5TB 721PA 2FDCA 3G82C 5F98A 5EXTA 1LVGA 2WPDA 1YJ5A 3LRPA 1OFTA 3ZIAD 5JBQA 1E9FA 4JYBA 3T34A 1L4UA 4V0ME 4JL6A 3O47A 5FTJA 2IXFA 1G3UA 4A36A 3X2SA 3CNNA 2QPAA 1NVVQ 2ATVA 4HLDA 4AI6A 1ZU5A 3FB4A 1W0KA 4HLCA 2ZAMA 3VU9A 2CDNA 4OQXA 1WRBA 5JEEA 2QSYA 2O8DA 4EPTA 1SQ5A 3PEWA 1GWNA 1N6PA 2QT1A 3KX2A 4GZMA 2JATA 3D3QA 5E7MA 1TPZA 3P27A 3CR7A 1N6IA 2C9CA 3OAAD 3PEVA 1X8KA 2NGRA 4CW7A 1FL9A 1Q21A 1CBUA 3ZD7A 3PUWA 3Q9LA 4UNSA 1RRPA 1TQ4A 4B3DA 4IDNA 4L9SA 2JLUA 4MRRA 1K5GA 4AIIA 4Z51A 3LVQE 3KTAA 3GJ0A 1W4AA 4Q4HA 1VCOA 1Z6AA 4MRSA 1BIFA 1VG9B 4FW9A 3THXA 4S35A 3VR6A 1EFCA 4RZXA 4D4KA 3EARA 1G291 2CVHA 4OJQA 3NEYA 3DKVA 1CJMA 1ODFA 2CK3A 2LKCA 2HJVA 3ADKA 1SKYB 2BVNA 4NU0A 3RRYA 3K0FA 4G5RA 2VP2A 2QRZA 2YOHA 4O2LA 4Q4JB 3EA5A 4PO9A 5KDLA 2G9NA 3TK1A 4CEIB 2ZUCA 2WV9A 4TMZA 5AJXA 2OSBA 4OQMA 1W1WA 3LW8A 4DCSA 1SVWA 2BM1A 3LD9A 4D81A 2R44A 1OE0A 1JNYA 2QENA 1KSGA 4G3XA 2F1HA 3EC1A 3J81k 2XZOA 4I1UA 3M0EA 2V3CC 1P72A 2DWPA 2EFHB 1A7JA 1F2TB 1YE8A 4IDOA 4A0RA 3BS4A 4UXJA 4PZLA 2Z4SA 1KI6B 1Z0IA 1QHXA 3GJ3A 3NBZC 3OFNA 3R9WA 3Q8XB 3MMPA 4IOLA 2R6GA 2DBYA 4NYMR 1HEIA 4GOKA 3U44B 2OEPA 2IYYA 3EIHA 1VCIA 3W6PA 2BC9A 3RS7A 2I1VB 4FXPA 1G1MA 2FF7A 4Y0VA 1M34E 3WNCA 2RGAA 4TLBA 3LH5A 4TMTA 5HCIA 2I1QA 3EZ7A 5FTMA 1LW7A 1U99A 3R7WB 3ZYCA 4JVMA 1X3SA 4KFUA 2V6IA 4ESVA 4B33A 1JPJA 1KGDA 2FOLA 2IHYA 5DIFA 2IWRA 3IO5A 3QKSA 1XNJA 3QQ5A 3SJAA 1P60A 2BBOA 5HE9A 5JS7A 2G77B 5HPYB 4DXAA 3C7KA 3TW8B 1D5CA 2ZR0A 1RJ9B 2D06A 2ONJA 2PLRA 2XXAB 1HA3A 1CLUA 1M8PA 4PQYA 4OHWA 2GKSA 3HYTA 2AWOA 4PFSA 5J4HA 2GCPA 2OAQ1 5B57C 5DN6D 2GXSA 2TMKA 1F60A 2IK8A 3W5JA 2WWYA 2GEVA 1Q0UA 1M2OB 1OH6A 1LTQA 1XTKA 1AS2A 2DWQA 5CB8A 2GCOA 1S1CA 1XEWY 3WYAA 2NPFA 2PLFA 3P4YA 1GNRA 1R2QA 1VYUA 2Q9AA 1Q12A 3MJHA 4FMBB 4B2LA 3U61B 3OEED 3QKUA 1XXHB 1NBMD 3UG6A 5CB6A 4R9UC 1TL7C 3FMIA 3RRMA 3SE0A 2H5EA 3GFTA 2Q3FA 2VHJA 3SYNA 4G5QA 4D2IA 2DY1A 3BAFA 4RFSA 3EZ6A 3NHAA 2JCSA 2IS4A 2VSFA 2CE7A 3K0EA 2WVJA 1KO7A 4UNNA 4PTLA 3R8FA 1G3IA 4AKGA 3REFA 1CR0A 2REOA 3X1DA 4E5UA 3TRFA 2XX3A 4NYIR 4ITRC 2GXUA 2XOKA 4ACAA 3RHFA 1KMHA 4PPFA 4W5HA 2X77A 1H65A 3CR8A 4BUJA 1G3MA 3NVAA 3A4LA 4DUGA 2ZRHA 2WSMA 1XWIA 1N3BA 1G3RA 2C96A 2W00A 4PO8A 4KU4A 2C9YA 2XSZD 4E03A 1G21E 4MITA 3CF6R 1FOEB 4C7OA 3PEYA 3MRSA 2G1KA 3PG5A 4ZO4A 3CF2A 3LNCA 2CLCX 5DHFA 3GLHE 1E4YA 1WA5A 1NVVR 3GLIA 1KI2A 1GG2A 2C8VA 3AVQA 3K9GA 5IK2D 3GLGB 2GK7A 4QNRA 3R9XA 1AK2A 5EP1A 2NG1A 2VH5R 1WXQA 4M9QA 3PCRB 4JLPA 1IXZA 1E6CA 2IF2A 3LBIA 3EC2A 5FBRB 2IS2A 3MWKA 1ZC4A 4IXNA 2YVUA 2JLYA 2IX3A 5HZHA 5L3VA 2QAGB 2VEDA 2ONKA 2ZYWX 1F2UB 2ZI6A 1DO0A 4IDHA 4OK3A 1E2PA 4TL8A 2FA9A 2Q9CA 4HDOB 4LHZA 3UMSA 3GLIE 2CCKA 1NVXQ 1QHGA 3DKPA 3TJZA 2FPKA 5C18A 5IHPA 2V9PA 5EUMA 1P2VA 2VHTA 2ZREA 4Q1FA 1YZUA 2ZRAA 4Q9KA 4EJSA 1W5SA 1KI1A 4MDEA 4PHFA 1VTKA 1U8ZA 3B2EA 4WOPA 2QU8A 4DLTA 1C4OA 2SHKA 1S3SA 5EP2A 4O3MA 4M9XA 3QEJA 2VYFA 1JECA 2ZROA 3T5DA 3TQCA 2XZLA 1P9NA 1BYIA 2ZJZA 3PVSA 2A7QA 2B7CA 2JDID 3B13B 1MOZA 1YZTA 4Q9IA 2MSEB 3B1ZA 1JR3A 5FL7D 4DVGA 1IY2A 2OG2A 4HUQA 2ORVA 2O8EA 1KJYA 5J4VA 4NTZA 5FR2A 4LJ4A 1W49A 2KBEA 3QOFA 4Y0AA 3L0OA 2XJ9A 1OW3B 1KOFA 3A1VA 3U6KA 4NE2A 5EZ5A 1NKTA 2ANCA 1E1RD 1GKIA 3RNLA 1W0JD 3BERA 3IIMA 1H8HA 3I8SA 3SYKA 4LJYA 4C2UA 4B2IA 3QJYA 4DSTA 4R2HA 2XZPA 4POAA 2IWHA 3ZQJA 4TLCA 3X1YA 3FWYA 4TYPA 2H18A 2QPOA 3AF2A 4UXHA 2VSOA 3H84A 3SDZA 2J1LA 3E2IA 2EFEB 3THWA 3A6PC 3WNBA 1OKKD 2AK3A 4U7DA 1AN0A 1M7HA 2YYZA 4PPQA 3FMOB 3ZQ6A 2WJHA 4I99A 3THYB 2MSDB 1J8MF 5KU1A 5LB4A 5FI1B 4LK2A 3TKLA 4BLQA 3PUZA 1KI8A 5FR1A 1D2MA 4PZZA 1FPMA 2OV2A 5AUQA 3LAWA 2J0SA 3CO5A 3QBTA 2FV8A 2ZAOA 2F1IA 2BKUA 4M1TA 1K6MA 5JHHB 1CKEA 1U8AA 5CLQA 4JYCA 2OESA 3K09C 1X86B 5ANRB 1VHLA 4QJ3A 1OHHA 4ZDKA 3SOPA 1T0JB 4TLAA 1G41A 2ZE5A 2ZRKA 4MKIA 5FOUA 2GAAA 3FKSD 2FEMA 4RJLA 4W9MC 4NZYA 1NIPA 4NCJA 4OJKA 5A4JA 1F3OA 3OE7A 1P6XA 3ZJYA 4TZ6A 4Q48A 5F9HA 1SVMA 2E87A 2NIPA 1WBBA 3PENA 3SU8A 3VNUA 4KBGA 4XVRA 1U2RA 4BFYA 4LI0A 3HPRA 4HB3A 1BH2A 2VO1A 3K70D 2JLXA 1E2DA 1W4BA 3RDPA 3ZLJA 3IEVA 4QGFA 1DG1G 3SBEA 4JIMA 4Q7KA 2GF0A 3QE0A 5BW8A 3K09A 1R0XA 3PXGA 2GHIA 2QE7D 3KUCA 3U3KA 4KXFB 3FFAA 2ATXA 3EPLA 3CB4A 3F5FA 1IXRC 1FTNA 1W44A 2WSSD 4NCIA 5DI9A 2RGDA 1AJEA 2GK6A 2GESA 4YONB 3QXJA 3KJHA 2WBLC 2R62A 3GEIA 3AM1A 2YZ2A 5SZKB 5B2ZA 1E1QD 2CLSA 4BE7B 1RRGA 1L2TA 1TU4A 1T5LA 1ZCBA 3V4FA 1T3LA 3LV8A 4TQAA 5KYKA 4B6EA 4G5GA 4TWZA 3ZD6A 821PA 3B1YA 3K9NA 4JBWA 2BKEA 3OEHD 4K8OA 1KO1A 1Z28A 1Q44A 2FG5A 2QG6A 1I4TD 1UM8A 1IBRA 2UKDA 5JLJA 1E99A 1NIJA 1ZUNB 1T5IA 4NPHA 3CKLA 3CZPA 5JWOA 2KJQA 3EWAA 4Q1AA 4J0QA 4TLEA 1ZJ6A 2C03A 4V0LA 1JEEA 1GAJA 3T1OA 3GLHB 3Q5DA 1NN3A 2BHRA 1WMSA 2W58A 2G3YA 2HXYA 2ORIA 1Z2AA 4FMDF 4ASUA 1ZMXA 2FPMA 4YXWD 4C0LA 2VP9A 2YJTD 3KKPA 1MO6A 1NRJB 3L0PA 2HT1A 1A4RA 2OCAA 1J90A 2F9MA 1GFIA 1ZM2A 1DARA 3AKDA 3GEEA 2H92A 2ZEJA 4AD8A 3GD7A 4Q1EA 1E0KA 5FUVA 5IT5A 4V02A 4FCWA 5FUYA 4YMSA 5G3YA 1PLJA 2EVWX 2BM0A 2ZUDA 1N0WA 2F9LA 3TLXA 4XD7D 2WJGA 2QPTA 2E9SA 1OLOA 3N70A 2C9OA 2QQEA 4PC6A 2AWNA 1BS1A 4DB4A 2Q21A 2P65A 5AR1A 2WAXA 4LC1A 4RSGA 2ZM5A 3LX5A 2C2HA 2FU5C 1KI3A 2DFTA 1JBKA 4LYJA 2ZI3A 1S1MA 4IOJA 2XJ4A 1ZUIA 1Q3HA 1AS0A 2X2EA 1R0ZA 3QNUA 2IYVA 3ETLA 1W2GA 1DG3A 5FTNA 5GVSA 3UPUA 3BE4A 4Q4JA 1SULA 3VMFA 4DLRA 3WBKA 3NEJA 4CEIA 3O8CA 2AX4A 4BZPA 1UAAA 2KWIA 4AYXA 3X1WA 1NF3A 3DL0A 1G6OA 2Z43A 4CVNA 2Z0MA 5CIWA 4KAXA 3BFVA 1T3HA 4M21A 4D25A 4B3BA 1QZXA 3R20A 1R6BX 3UWOA 1YZLA 4OL0A 1F2TA 5JWRA 2BMJA 1Z0DA 4NCKA 1E9DA 4TSFA 3OIWA 4MGZR 1KI6A 4TMXA 2QNRA 1SKYE 1W4RA 2V4ZA 1WB9A 4TQUS 2FMXA 1TADA 2BV3A 1DEKA 2NO0A 1GKUB 3ZS8A 3U44A 2PBRA 3U2QA 4D26A 4LHWA 2BJVA 1ANKA 2IXEA 2O5VA 2WICA 2NO1A 4C0BA 4D82A 4KLZA 3I5YA 2ZYVX 5IDVA 3W3AA 2PX0A 3DMNA 1E2MA 3KUDA 2GILA 4HLUA 2C98A 4TT3D 1SGWA 2IS1A 2OBMA 3R7WA 4RZ3A 2F43B 4YDSA 4Q4LA 4A9AA 3ZVMA 2W0SA 1OXVA 1LFDB 2J7KA 1ZCAA 5LBIA 3EIEA 4BFUA 1EFTA 5JI3E 4A2PA 2RB4A 3TUZC 4JVLA 1TTTA 2F1RA 1Q3TA 3BB1A 2ZYUX 3MWYW 1RJ9A 2XXAA 1YZKA 2F55A 4PQFA 1F5NA 4XSHA 4K81B 1OIWA 4L4UA 3X1ZA 1Z8FA 1CRQA 1I4LD 1JJVA 5F9FA 4TYNA 2GVZC 2W6IA 4O25A 1A1VA 1CR4A 1G19A 2ODBA 5JS8A 4FMDB 1BMFA 2OLJA 3TAHA 2JJ8A 2VBCA 2ZJBA 1XXHA 3C15C 3GMTA 3A1UA 3B5JA 5KPDA 4B75A 5BXQC 4KO8A 3NWJA 4B3CA 3AVPA 2P6NA 4Q1CA 4BASA 4LV6A 3TSZA 3KJEA 4JSTA 1HQCA 2CLDX 2J7PA 5FFMA 3GEHA 2BDTA 3IHWA 2ODEA 4OQFA 1R7RA 1PLKA 4P33A 3TUJC 1P75A 1LF5A 1MT0A 2ODNA 3AP3A 1XF9A 1OXXK 4LC0A 4G01B 2QAGC 3QKTA 1XXHE 2XB4A 1E2KA 4TYQA 4TYYA 3AF4A 1C9KA 3BH6A 1E9EA 4ERNA 1KI4A 2MSCB 3ZIAA 4QRHA 3TR5A 1UFQA 3ZDQA 2AXPA 3Q7PA 5C46F 3RANA 1U94A 4CEHB 2Q3HA 3IPYA 1Z08A 1Z2CA 3IEUA 1NNEA 1JI0A 3BFXA 3B9QA 1R8QA 4F4JA 4II7A 2H17A 4Q18A 1FTSA 4OHVA 3GLGA 3K0CA 4PPNA 4R2IA 4YLGA 4QHSA 3VHXA 5M04A 1VIYA 3HR7A 3KZ1E 1EXMA 3PR1A 1IJEA 4EFLA 4KFRA 3AEZA 5G41A 2FSFA 2A5YB 1W36B 3OAAA 4LJ5A 3TSWA 2HLDD 5FBLB 2B21A 2QL6A 4DZZA 3LBNA 3QVVA 1ELOA 2QAGA 1L4YA 1E2QA 5DYIA 1F2UA 4LYAA 4BECA 2A78A 4OHXA 3CH4B 1ZNYA 2G6BA 1NLYA 5DHAA 5AWFC 3GLGE 2JLRA 2CNWD 3T61A 3TMKA 4XWKA 1MH1A 2IBMA 4W5JA 2YC4C 4L5BA 1JQLB 4N0EA 3VKGA 1CJTC 1E3MA 3CZQA 3B8HA 3VQTA 5FTLA 3ZS9A 5EZ6B 1XEFA 2G88A 4CZ2A 2IHBA 4GOJA 4QJ4A 1GKYA 3BH0A 1H8EA 5KNBA 1GVNB 3KJIA 4MYUA 1QG2A 5FTKA 4DCTA 3PUXA 4DDUA 1NY5A 2AK2A 1JALA 5KTYA 5B30A 4O2RA 1G18A 2AD5A 1UF9A 2NPIA 4DLZA 3RYTC 2J0UB 4B3GA 1N5KA 3KKQA 1E0JA 1OXTA 1SKQA 2RHDA 1ZP6A 4ZPXA 3KQUA 1U90A 1IXSB 2BBWA 2VSXA 3A36A 1U98A 2VHUA 3HP1A 2FFHA 3BXZA 5HZKA 1AQYA 2CL0X 2KE5A 2GF9A 4Z8XA 3EPKA 3OIYA 3QG1A 3LLMA 1SVIA 2Z83A 4UJ3A 3P4XA 4LOAA 4TQ9A 4LYFA 1IN6A 3PITA 4JLVA 2OHFA 1TNDA 3ADBA 1G7TA 4YMUA 5JHGB 3IO3A 3F8TA 5A5GA 3CW2A 3RWMB 3A58B 3N2EA 4BPBA 1FUUA 1K5DA 5DN6A 3FHOA 2IYWA 2NO9A 2WWXA 2KSQA 5BYKA 3THYA 2NO6A 2R6CA 5SZJA 1NVUQ 3AP2A 4ZCMA 4ZIRB 1Z0KA 2PT5A 4CT5A 1CIPA 1DPFA 4HLQB 3H1TA 3CM0A 2DHRA 3ZVLA 1KO4A 1UBCA 2R9VA 2ZRMA 3P20A 2O8FB 3OEEA 4Q00A 1EX6A 1NBMA 4HI0E 4CEJB 3WRXC 5JCZA 1KNXA 2LKDA 1V43A 2FE4A 4JJZA 2D62A 2YWEA 1ZNXA 2ZUBA 1VECA 2ZRIA 4X8LA 4IHQA 3B1XA 4MRVA 5JFGA 5KSYA 1IN4A 1AS3A 2IC5A 3CWQA 2OUKA 4RD2A 3EZ9A 2ZRDA 4TMWA 3X1XA 2WWFA 1OB2A 5J40A 1J8YF 4DSOA 3MSXA 5L3QB 1P73A 3U6BA 5FPTA 3MCAA 2QI9C 1MKYA 1JEDA 2UZIR 2DFLA 2QGZA 3NDBB 2HCBA 2P67A 4GPTA 1D8TA 2PMKA 2GZDA 1GL7A 1G64A 1NBME 3GLFE 2ZRGA 1CJKC 2V8OA 1JAIA 4FD2A 2NO7A 1M6NA 2XSZA 5JMTA 1LB1B 2GJ9A 4AYTA 2CJWB 5BYJA 4TN1A 3VAAA 3DM9B 1TAGA 3HPQA 3ZZ0A 4TYWA 2OE2A 1YU9A 4GOXA 3RSLA 2AKAB 4RZ2A 3V00A 5IK2A 4LSGA 2GA8A 1TQ2A 2WPDD 3IQXA 1II9A 3E1SA 1RW4A 4EAQA 4C9BA 2GRJA 3HR8A 4QHYA 4TTPA 1OFIA 1BO6A 3DM5A 4XTCS 3K9HA 1OH7A 4HAUA 1J99A 5EE1A 1XD9A 4TL7A 5DH9A 3RABA 2IYLD 2NTYC 2CHGA 5DSZA 1DAHA 2OFXA 3RS5A 4ZI2A 5L3SB 2HUPA 2GDJA 3L2OB 5CYOA 1G17A 1Z63A 1OJLA 4Q9LA 4JLAA 3TH5A 4EDHA 3PQCA 1OPXA 4DLWA 5CLLA 4PHGA 4GZLA 3L8YA 4Q9HA 4UNPA 2DCUA 4G1UC 4LWZA 2YHSA 2YV5A 2GAOA 2W2TA 1WE2A 1XJCA 4RY2A 4Q1BA 4DIDA 5D3MB 3OF5A 5IF9A 4MYTA 1VDZA 4ON9A 1S4QA 3UMFA 2ZRPA 4RZUA 1R10A 4Q7LA 3AKCA 3AKEA 3GLHA 4JT4A 1XTJA 4PSAA 5K8TA 2JASA 4LPKA 3RVBA 1P61B 3I5XA 4KV9A 1R5BA 1AKYA 2R2AA 3ICEA 1VYVA 5KPJA 3W90A 3ASZA 5FL7A 3QI2A 3BD9A 3ZH9B 3EASA 3P26A 2FZLA 1HV8A 1COWD 2PZEA 3CRQA 3DO6A 3GJ7A 4MA4A 5TVKA 4KCGA 4DLVA 3RS2A 5FPKA 3VR3A 4B71A 1KZ7B 1KYIA 1XU4A 1Q1EA 2C5LA 4BEJA 3C14C 2A5FA 3AF0A 4Q4AB 2I4IA 5AUOB 3D6TB 4MUAA 1Z0AA 2D7CA 4EJSC 1M7GA 3CBQA 1WP9A 1E1RA 3N5CA 1X1RA 1W0JA 2IUSA 4MGYR 4PHHA 2FGKA 1KIMA 1ZIPA 3GFOA 3LWNA 4M22A 2JA1A 4MQBA 5TB5A 4R71A 1HT2E 5FBQB 1E2IA 2MMGA 2OXCA 3NH9A 3RC8A 1GTVA 4NHOA 1Z83A 4A6XA 4GNKA 2OAP1 3MAAC 1OKKA 1F6BA 1ZM3A 2N1BA 3M6AA 4OI2A 4LYHA 5CJPA 5GJWC 3Q72A 1CXZA 1JXOA 4D4LA 4LRWA 3EWSA 5EP3A 4JZKA 4QBGB 2WKRA 2ZR7A 3CNOA 3A1TA 1G16A 1N5JA 1VHTA 4P4TA 2A5JA 4QGGA 1D9ZA 4HAZA 1W5TA 1R0WA 4N1AA 3K1JA 3KJGA 1RPZA 5JEDA 2G0TA 3CWZA 1J2JA 1W47A 1QHYA 3EAQA 2WWWA 1XEXB 1KDOA 2JLZA 2ORWA 1XD2A 3CRRA 1N0VC 4QFMA 3W5IA 5B64A 3A1SA 2ZITA 1N6OA 2ZJ2A 2H8KA 1KHTA 1G4UR 1ZM4A 1N5LA 4Q7JB 4XIGS 3FKSA 2A3RA 3NDPA 4WW0A 4Q21A 4A8JB 4DT1B 4LJAA 4KHZA 5G3ZA 3U7FB 4OQNA 2QTFA 4YQFA 2RGNC 4Q1DA 2EFDB 4B43A 1OH8A 1IHUA 2F43A 4OI1A 2HCJB 2JEOA 4BLTA 2FSIA 4A2QA 2PJRA 1HYQA 3BWDD 1TX4B 4MRNA 3QPUA 1WQ1R 1TF7A 1YR8A 4EPVA 4GSYA 2HXSA 1ZM7A 4FINA 1UJ2A 1FFHA 2GJ8A 5FI0B 4CDGA 3LQQA 1Z0JA 2VQSA 3VFDA 3UXMA 2BMFA 1KDTA 1IAQA 2XTMA 2QE7A 2XOKD 3FHTA 1MV5A 5DGXA 1EFUA 3WMGA 3QEOA 1NMZA 1YR7A 3GJ8A 1NP6A 1E2LA 2DB3A 2W83A 2WSSA 5GVRA 3CX7A 3HDTA 4Q7MB 5K8LA 4KJZA 4AURA 1E69A 4A4DA 3AP1A 1Q1QA 2B7BA 4DCNA 2RGNA 3B1VA 3W6NA 4TMKA 2WJYA 5CDFE 2BCGY 2J0QA 3R9IA 1DAIA 4Z1MD 4OI4A 1CULC 1GRRA 4GI7A 1NL3A 1AKEA 1HURA 4RFVA 4ARZB 3WNDA 1WDTA 4B3FX 1T91A 2JAQA 4HZUB 3TUIC 1OB5A 4QG7A 4ZDWA 4D0GA 3CF0A 2IYQA 3IILA 1KJWA 5C2JB 1UEIA 2DYKA 3OEHA 1ESNA 1W36C 3GLFB 5AJZA 4WIAA 4ZCIA 4TLDA 2QMUA 3C5CA 1DAFA 4GP7A 2OZEA 1MRSA 1IQPA 2LCFA 4YMTA 2F6RA 4PC3A 3HU2A 1J7KA 4KFSA 4C0QC 1LY1A 4QHTA 2FFAA 1KK3A 1S0UA 1Z6XA 4F91B 1J70A 1N6KA 3SFZA 2HT6A 3BGWA 4OK5A 4CEHA 3VKWA 1ZC3A 4YXWA 1SHKA 1OSNA 1P4SA 5HKKD 3DOEA 4O0MA 4FMCF 5KOYA 1JB1A 1RYFA 4IFBA 2XTNA 1G8HA 1U0LA 2XEXA 3W6OA 4V03A 3GJ6A 1JR6A 3MG9A 4CYMA 2CHQA 1IM2A 1FP7A 2ZXUA 4QC2A 1HT1E 3ZVRA 3EPHA 4M1WA 3WYFA 1TF2A 2XNDD 2B92A 1DBSA 2OLKA 4NH0A 1XBTA 3FTQA 4KLNA 1TMKA 3K8YA 3EIQA 4QBIA 3D31A 3NXSA 4OK6A 4JLMA 1YR9A 4MGIR 1OXUA 1R5NA 1YZGA 4U00A 4B32A 4DSNA 4WZ6A 3B60A 1SVKA 5BWMA 1HUQA 3QXSA 5LD2B 2PEYA 2JLWA 3HYRA 1EESA 1VIAA 3GCGA 3JZAA 1CJUC 4U02A 5H70A 2QZ4A 1E79A 4UNRA 1P3JA 1VPLA 4EPYA 5CITA 2F7SA 1XRJA 4QGAA 1GUAA 2O0JA 4NP6A 3U60B 3NBXX 2WJVA 4IW3B 5AJYA 5JI2E 4D4MA 1DOAA 5DISB 2F3TA 1S8FA 5CIQA 3QBVA 1PUJA 1NI3A 1CEEA 3MWLA 3AVVA 2J0UA 3B6EA 4AWXA 2BWJA 2IYSA 3U5ZB 3GJXC 2ZVQX 1TQDA 1ETUA 4YDHB 8OHMA 3MFYA 1KDPA 3C16C 3NH6A 3KKOA 2PCLA 3IHLA 3AVUA 5G53C 3PUVA 2ZETA 3AF1A 4XH9B 5A0FA 4M53A 2RMKA 3KL4A 4P4UA 3SBDA 1FMJA 3B85A 3QIAA 4JLNA 1UDWA 4L16A 4TT3A 3O8RA 2DFKB 3IPXA 5HR5A 4JMPA 2V1XA 1P7CA 4DIEA 4FN5A 2R8RA 2ZRLA 4IFEA 4BZXA 1VG0B 1NJGA 3JZMA 4PSVA 3KFXA 1MRNA 3AB3A 2ZPTX 4YMWA 2YOFA 4HATA 1CP2A 3KQKA 2FWRA 3ZZTA 3ICQB 2QP4A 1I2MA 1T4GA 2P2LA 3VX4A 1SHZA 1AA9A 4PHTA 5FPSA 3GJ4A 5K8UA 2OM2A 4RCYA 1SXJE 2JGNA 1NN0A 5JRJA 5TY0A 1QVAA 2QP3A 3CNLA 1ZNZA 4ZIRA 4GP6A 4I4LA 5J47A 4HAYA 4C0JA 1FP6A 2QT0A 2ZSDA 2GJAA 2OBLA 4QJ5A 3S1AB 3K0AB 4XOIA 3W3ZB 1IY1A 3TR0A 4OHZA 1JXMA 4MKGA 3MGCA 2O8FA 1T3SA 3ADDA 1VYTA 2IW3A 3EG5A 4UQOA 4CEJA 2QUZA 4FMCB 3VR4A 4HLUC 1II0A 2QM7A 3LA6A 3SJZA 1G3QA 1GRQA 2XNSA 3WP0A 2O8CA 3IIJA 1KKLA 1EWQA 1I4DD 3AVYA 1CU1A 1N2CE 5SZHB 2A2ZA 2RGGA 4BFXA 4IVPA 2GVDC 4YC7A 3A4NA 4LBWA 5TV2A 3CLVA 3UG7A 2ZS7A 2HYDA 4P32A 5DLQC 5L3QA 4KYIB 1XX6A 2REXB 1QHNA 4PQRA 3EA0A 1DAKA 5EE9A 5EXSA 2GNOA 2RAPA 4URUR 1XD2B 2GXQA 1U8YA 3Q3JB 621PA 2DWOA 1YRBA 3V9PA 4IEEA 5E4FA 1OIXA 1AGRA 2W6JA 4JVSB 4LHYA 4F4IA 1KJZA 1EFRA 1XCPA 3DHWC 4DKXA 3VNVA 5FUXA 3EZFA 3K9LA 5J4LA 1UDXA 1YQTA 1Z6YA 4PZYA 5DI3B 1SXJD 1FQJA 4TTRA 5UKDA 2CJWA 2BJWA 4JSYA 4AK9A 5FPHA 3EX7C 1IONA 1KO8A 4LCBA 2FPLA 2IUTA 3A1WA 2BEKA 3MD0A 2EU8A 2FH5B 5CJ2A 2OFWA 1LF0A 2WMNB 1GILA 5JZVA 2ERXA 2ZI4A 2PJZA 4US2R 4GMDA 3LBHA 2XB2A 1LNZA 3K70B 3L82B 3BJIC 2P6RA 3FDIA 2FEOA 4JS0A 5E7IA 2D3WA 5FOVA 4W7SA 1G8FA 3P1JA 1KMQA 2QAJA 4RVCA 4BLOA 1HTWA 4QL3A 5KSZA 3KXLA 1R8SA 4LBVA 3RC3A 2CCGA 3GJ5A 5L3SA 1RVDA 1GOTA 1C1YA 5AJVB 2BMDA 4IVRA 3FMFA 2QP9X 1KZGB 3VKHA 2CNWA 4N0DA 4WAUA 3W8RA 4P0TA 4DLSA 4EQ6B 2WAYA 1R5OA 2BIFA 3C8UA 1FNNA 2EQBA 4OQLA 2ZQ5A 2VP5A 2HEIA 3QKRB 4RD3A 3PFIA 2WWIA 2ZI7A 3CRVA 2FGJA 3DVLA 3SQXA 2IYTA 5D3MA 1TQ6A 3SZRA 1JJ7A 3CONA 4DDVA 3SI7A 3KQLA 2AXNA 3K0CC 2O52A 2IYZA 2JJ2D 2V1UA 1MABB 1XJ0A 1G6HA 4DDWA 2D7DA 2C78A 2P6UA 4M1SA 3O8DA 2QTHA 3SJCA 2AD1A 2JLQA 4XWAA 2L0XA 1QHIA 1KSJA 3AF3A 2YNMA 1UKVY 3UKDA 1DELA 4BRWA 2ZSEA 1W2HA 3QY0A 3FHCB 1U81A 2X1VA 4PO1A 4JBYA 4WZBE 1OT3A 4CIDA 1PUIA 1T8UA 2V7QD 3OIUA 4NL4H 3RAPR 4BFVA 4URVR 1YZNA 1G9XA 4MDFA 1V5WA 4HAWA 2D4HA 3H2YA 4IVQA 3THOA 1GNPA 4EPXA 4Q4AA 2ZTSA 4ZKDA 1NVWQ 2GWHA 3I8XA 1HE1C 1XCMA 2H1LA 2PT7A 1N6NA 1RRFA 1RKBA 2O0KA 4XTRA 4LBYA 5CM8B 3A8TA 3FFBA 3UANA 1DS6A 3LXXA 1PV4A 2PH1A 3OHMA 4XSGA 5FOSA 3QF4B 3WMFA 3Q5EA 1ESMA 5EE5B 4B3XA 4F92B 3EZ2A 3IQWA 2BBTA 4JL5A 2CEAA 4IDPA 3KDSE 4A8JC 4D0LB 2D2FA 2BBSA 2V6JA 2WOOA 4GFDA 4HEJA 3LDAA 4LJ6A 2JJ1D 2ZYTX 4DHEA 3MLEA 4RD0A 3VHLB 4IOMA 3TAUA 3TNFA 2PMDA 5D3QA 3ND8A 3UMRA 3CH5A 4IDQA 1UKZA 1KI9A 2IL1A 4M1KA 4ZCLA 2AFIE 3QF7A 1XEXA 2QTVB 1A2BA 1PJRA 2REBA 4DLXA 1GL9B 2HDNB 4PAOA 2C77A 1ZM9A 2ZRCA 4JBXA 2A9KA 1GSIA 1PVOA 1UKYA 2GTPA 3QXCA 4LHXA 4M9ZA 5LPNA 4A8JA 4DT1A 3ZZUA 1RC8A 1I2DA 3D8BA 1BMFD 3FMPB 2R65A 5J5CA 4M8NE 5DYGA 3T1VA 3BRWD 2VIIA 5P21A 2F3RA 4BZQA 2A5GA 4D0NA 5AUPB 4NKRA 1JQJC 3U3JA 2GZHA 1SVLA 4A0FA 4E22A 3RWOA 3IGFA 1QDEA 3W9YA 1EWRA 2CCJA 3SC3A 4UNQA 4US1R 3I62A 2EWWA 4XJXA 1A82A 5K8IA 4NDZA 2JIZD 2WIBA 4HB2A 2E1RA 2ZE7A 1SXJB 1P9RA 4MYHA 1D9XA 3RLFA 5IRCD 1HE8B 3C4JA 1XTQA 4G5OA 4IXMA 4M2LA 1G5RA 3DEFA 1OH5A 4M0LA 1ZBDA 2QBYB 4LPSA 2YWGA 4KITB 4HB4A 4KFTA 5KO2A 3E70C 4A1FA 5KSOA 1IN7A 2AHOA 1Y3AA 1ZW6A 3B9PA 4C0HA 2NQ2C 3MUFA 1U9IC 4S2EA 3U7EB 3AV0B 4L15A 1N6LA 2FZ4A 1LS6A 2QRNA 1P2TA 4ARZA 1GDDA 1OXSC 2YWHA 2W0MA 4A0HA 4HZUA 2WJIA 2JLSA 2YKGA 4QBHA 4B44A 3R8CA 5C4MA 4PC1A 3G0HA 4D4JA 5FBWB 4JKIA 1M7BA 1OYYA 3GLFA 4JLDA 4BLSA 4HSEA 4M1OA 3SQWA 3U7GA 2O8CB 3JVUA 2J9RA 5CK4A 4M9SA 3D7MA 3G5UA 1D2NA 4C30A 4A82A 3WYGA 1KKMA 1ZNWA 2ODWA 2ZU0C 2ZSFA 1VKJA 1E9RA 2ZJAA 1YKSA 3OESA 4FWTA 1CRPA 1Q1BA 1Q22A 3NC1C 1JPNA 1QRAA 1U9IA 4DEXA 3DZ8A 4RD1A 3KKNA 3KB1A 2ZRFA 1N25A 1RIFA 4W5WA 4MGKR 2PEZA 2J3EA 3T5GA 2RGBA 3SHFA 4Q01A 1HQYE 5LD2C 2FX3A 5SZIA 1GRNA 4JLJA 5LDDC 1COWA 4NONA 5KNDA 3IDQA 1AQUA 4P31A 1FQKA 5F2EA 3ECCA 4OHYA 3NIBA 1E9BA 1NSTA 2HJGA 2J59A 1OF1A 1H8ED 1US8B 2AL7A 1MO4A 3NG1A 4LHVA 5KSPA 3U4QB 1G7CA 2HYIC 3UATA 4JVNA 2ZRNA 2GEDA 1FUKA 5JECA 2EYUA 3I32A 2OCPA 2RHMA 4PANA 4PR0A 1RYHA 3FKQA 3RS4A 3GP8A 2H57A 3AKYA 4MKHA 3RSOA 2WWHA 3UWKA 5FBVB 4WA7A 1KTVA 4TL6A 3Q85A 2IXGA 2ZS8A 2IYXA 3PUYA 4KODA 3ZVNA 4EIWA 1UPTA 4OKSA 2R6DA 4FCVA 4LBZA 1W0KD 3AGPA 5EUQB 5JRZA 1UBGA 3P32A 5E7JA 2IEZA 1U0JA 3SYLA 2VP0A 3QG5A 3KB2A 1KDRA 3DDCA 5FOTA 2YC2C 1B23P 2VF8A 1LV7A 4LV5B 1CF4A 4QBFA 3AH8A 3BB3A 4NCHA 3K0SA 1XMJA 1XZQA 1XZPA 2ECKA 2VP4A 1EX7A 4LJ8A 5TXGA 4DDTA 3ADCA 1UEJA 4OI0A 1YR6A 1QHSA 1NLFA 1ZU4A 2N46A 3LO5A 3NBFA 4K46A 5EE3A 5AK0A 2UZ3A 5KHOC 1OV4A 1Q1ZA 2JDIA 3T15A 1G20E 2CK3D 3AGQA 4CF7A 2B6HA 4X8HA 3I1FA 1D2EA 2OILA 4PPGA 2GJKA 5AJWA 5AUNB 5G40A 4A92A 5FH9A 4Q19A 3MJRA 2K5UA 3VR2A
chains in the Genus database with same CATH superfamily
1BC5A 2OOKA 3CIOA 3DCNA 1BHSA 2FSSA 3GFGA 4O0LA 2IDZA 1CR2A 4WZAE 2Y6VA 2D2IA 1AKUA 2YN0A 3DFMA 4ZXPA 3LY9A 4JL8A 2YN4A 2BFFB 3UIEA 1G5IA 3M9LA 5U1PA 1XDSA 1U1DA 5H1YA 2HRCA 1XZGA 3ONWA 4HDCA 4COOA 2V54A 4OQPA 1M76A 2ADFA 2MHCA 4H4DA 2OXTA 4ETIA 4JJKA 4Y7DA 4Q47A 2D2EA 2PXHA 1B26A 2GBLC 3W8EA 3ZNOA 3TGPA 4H59A 4HVCA 5AK5A 4YT4A 5HWSA 2E4AA 3RSZA 2QR3A 5EHNA 3NYQA 1UK6A 1QZZA 5LXTF 5CK5A 4LA4A 3E61A 4KR0A 1Q0SA 3ZTTA 4RPHA 4IRUB 3RS3A 4L57A 3HB7A 4HGRA 4XQ9A 1XPRA 1Y1PA 1ZWKA 5JG7A 3EVZA 5BVHB 2XB8A 4ARBA 4WE3A 3BAZA 3QFTA 4DJTA 1NVFA 4RTLA 5LP6A 1CYDA 1GHTA 4ZV4A 1UBEA 2W98A 3HJFA 5D1NA 4MR8A 1DKNA 2O8BB 2NAPA 3QUCA 4BNDB 3GQBA 3KT6A 5ELMA 2IUUA 4DCVA 5JAHA 2P0EA 3R3SA 1MAAA 1G2IA 1GYRA 3AB7A 4GLFA 4KWHA 5I6DA 4QDJA 2WMOB 4ZRDA 1XRQA 2HPZA 3OMXA 3SZUA 3ZOKA 4AKIA 1A72A 2GZAA 4N4AA 1A7AA 4YHBA 4CT0A 1G42A 1YS1X 2F4VB 1QQ6A 2VKTA 3KQWA 1DE0A 4HAXA 4KZKA 3R7BA 5JXWA 5JJKA 2E55A 1T0HB 2XGSA 3DV9A 1DO2A 3GFPA 5DHSA 4I5GA 3IE2A 1G7RA 2HF7A 3IPAA 5K6RA 3EGXB 2J48A 3BRSA 5JJLA 3KSMA 1XV5A 1A04A 3GK3A 2J31A 3H86A 3LUGA 4FQ5A 4EKIA 1NXSA 3FRIA 1TUEA 1UPAA 1ZYUA 3OOEA 4GMKA 3FYHA 3W77A 1ND5A 1NUTA 3L0BA 1EE2A 4FJ1A 4JNCA 2O2GA 2C7BA 3K8QA 3DMGA 3IAXA 3MTBA 4AY5A 1I7DA 4UM5A 5HKKA 2PSEA 3KDAA 5AQ1A 1UBFA 1ZSNA 1C0KA 1EK1A 1OLSA 1JLSA 3FN4A 4H6VA 4NI5A 5IANA 4JT2A 1WNTA 4UTNA 1XMSA 4A0GA 1RKVA 1GGNA 2J9XB 3B82A 3PC7A 1F0NA 4OH1A 3ZCSA 3OSZA 3I61A 3FY4A 5EKUA 2EBUA 1C0LA 3E48A 2ABWA 3F3YA 3TNYA 3BOSA 3H9CA 1UBHS 4I4IA 1L0BA 3DS8A 2DBVO 2XNDA 4PGAA 4QG3A 2ZI9A 1XA0A 2YXBA 4EZEA 3GEPA 4RKYA 2I9KA 2XCLA 3M1IA 4R7ZA 3S8EA 4CCYA 4AJLA 3H7IA 3EXIA 5AXDA 3DNPA 4UAJA 2F00A 2QMHA 2H2DA 2YXEA 3L43A 4MQEB 4L22A 3DP7A 1E0SA 4AY2A 1NY6A 4NOJA 421PA 2PX5A 3H5VA 1FTGA 4PW0A 3K5WA 5LDGA 4AF8A 3S70A 3VSDA 2Y1DA 4DYHA 2PUCA 2PMWB 3RF7A 2CE2X 3MXOA 1JTFA 3QKRA 3U7HB 2D5AA 4C0WA 2RGXA 4Y67A 1H6DA 2QORA 1VLVA 1Z4OA 2CVPA 3A1NA 3UH0A 1VG1A 4MV5A 1XTIA 1V3UA 1NQTA 2QRQA 3QENA 5I9NA 4NABA 1IOVA 1R12A 1WXDA 4EARA 1K2WA 2JFOA 1MB0A 5BT9A 2I7XA 2AMVA 4GECA 4DLUA 2ECOA 2R85A 1JR3E 1XQ6A 3Q40A 1V39A 4G9GA 2SECE 3LHIA 3HACA 5JH7A 4DJFC 5I45A 2WJJA 2WSYB 4K9DA 4LY6A 1M6VA 1Y98A 5CA0A 1FDRA 3JD2A 3MEQA 2BFAA 2FMHA 2GPYA 1A2KC 3LKZA 3QVLA 4RV5A 4X1YB 3VO2A 2E6KA 4LNUB 1Y48E 2FQXA 1DAPA 1HE2A 3Q88A 3KZOA 4OYRA 4EJ6A 2MINB 1OFUX 3U9SA 3PNYA 2NYRA 1U9JA 4WT7A 1X80A 5DBFA 2R1VA 1OGYA 3O5AA 4B48A 2GDZA 4J2OA 5AM0A 3UT6A 2ZDHA 1J8FA 5DX1A 1KPGA 1TK2A 4AZWA 1RKQA 3CQ9A 3GEDA 5EXPA 1GD1O 4S1VA 3AM3A 4BUZA 3AVWA 4KI0A 2H4XA 4MRPA 1XZDA 1SCUA 4MV3A 1XVLA 1GL6A 2EJWA 4B35A 2QLNA 1NQOA 5JYCA 3LP8A 4GKKB 1YR1A 1PNQA 3QF4A 4LNAA 1L8LA 4M1YA 4ZOLF 2EZUA 3ZXSA 4R98A 1RFLA 1ESCA 2NSHA 3ZK8A 1YU6A 4ZYTA 4B2YA 1N1EA 3I5XA 1HY3A 3NEPX 1XEAA 2EWMA 1N0UA 1CUUA 2CXQA 2Z58A 3FYUB 2Q2WA 1W2WB 1FP4A 1QSGA 1USWA 2H2AA 2I3BA 3IIKA 4IQGA 2YHIA 3VX3A 1JR3D 1Y3HA 4YGXB 2C0PA 4YUWA 4BVKA 3USZA 2FYTA 4JLOA 2CXTA 2XKAA 4L6IA 4U6QA 3RS9A 1IWPB 3VYVA 3ISTA 4Z8YA 3WZLA 5A7GA 4YPOA 5FUQA 5HJ5A 3QMVA 5EHGA 5JXGA 1ENPA 4TMVA 3T06B 1TKCA 2B4AA 3F8WA 2WMDA 2BELA 2ZWPA 3HZHA 4YB8A 3LC1O 4JB0A 1SCJA 3AR4A 3ER9A 3F67A 1XF1A 4N3NA 4XUDA 1PQPA 2FSVA 4QXMA 4B6RA 3GGSA 3HNRA 3TIFA 2F1JA 3LDUA 4EATA 1MFPA 3W1EA 5EIWA 5IYZB 3FGPA 3BORA 4EVSA 3WWOA 4TYMA 1IBCA 3R76A 2UVQA 3N53A 1OX4B 1GAEO 3QKSB 2W6PA 4G1CA 2WUWE 1WUJS 4YCSA 5ALXA 4EW6A 3M82A 2QHXA 2F62A 1LDYA 4BNVA 2ES4A 3VZBA 3SJBA 2ZJYA 1NDUA 2RBGA 1BCSA 2ZQYA 3AQIA 3NEAA 3AVXA 4HNAB 2C7VA 1NSYA 4HDQB 2IYUA 3COYA 3O91A 3K6SB 4KSCA 1RI3A 1HQDA 4QXAA 5E6SA 2P9TA 3N5KA 1TUIA 4L75A 1TQHA 1IOZA 1CFJA 1GQYA 2GCOB 5WRFA 2KMLA 3ZQ4A 3SNHA 2CFTA 4TUYF 2C4TA 3F3SA 1Y3CE 1OT5A 3ISVA 4DIOA 3LL7A 5JFTA 1JKJA 1R0YA 5LB2A 2BOVA 3N3BC 3N86A 4V0OA 1NG9A 3BGVA 3GU3A 1RSZA 3DL7A 5TMEA 2CJYA 1W76A 3QVWA 5H59A 3NKVA 1XJQA 3DZGA 3VUFA 1YCGA 1YGYA 2QBYA 3AHDA 2JGDA 1V1MB 1WCV1 3ICPA 5JOQA 4RHXA 1ZDMA 2GPJA 4FWBA 2E6UX 4UJ5A 1NVTA 2CVZA 5LLDA 1TTQB 5DTQA 1E3DA 2RHBA 4NBNA 1TYAE 2G82A 3OD1A 1ULSA 1DL5A 3GGCA 3KR2A 5CA1B 2AN9A 4MW2A 2H4WA 1QIEA 5FNVA 5K20A 2L42A 1KMHB 3BA6A 3P5BA 4EG4A 1XKXA 2CMHA 2W2XA 3W04A 3DPUA 1SMKA 1TYZA 4K6OA 3FBWA 4GR9A 4HGQA 3SS8A 5JJIA 5HP4A 2BFBA 2C4HA 3H4VA 5KAMA 3MOSA 2FHSA 3QUSA 5KWIA 1RQ2A 5KYXA 1NNSA 3T35A 2Y71A 2V3VA 2Z4RA 3V8NA 2B69A 2AZDA 4XPIB 1XYVA 2VNIA 3KTDA 3PRYA 4FQ7A 1CC1S 4E14A 4CKCB 5C8ZA 3VNSA 1GU1A 1M72A 1ZRHA 4H60A 4A8HA 3PEUA 4QM7A 4I1SA 2IQ5A 2X0RA 3GJTA 4Y7CA 4JKYA 2JJ2A 3QXHA 2UDPA 1I2CA 3EFOA 1PZNA 4AZVA 3ZHUA 4UHDA 3B1WA 3PLRA 5FWYB 3LUBA 4BB9A 1Z29A 3MOGA 1SOUA 2C8KA 4YQZA 1YVDA 3RUCA 1LBTA 1KY3A 4RDIA 1Z25A 3IBYA 4D42A 2NV6A 3OHSX 4L7QA 2WJ4A 1VJ0A 3JASA 1E6LA 4X91A 3AUYA 4RKFA 2FOIA 5KMGB 2Q3LA 3EPJA 2HBZA 3FWZA 4L8VA 4PCAA 4AKEA 4KX3A 4FPXA 3ENKA 3EMKA 5HS6A 1GNVA 2CN1A 2ZJ8A 3O4JA 4AG5A 3NTLA 1QGZA 3HGTA 4P5DA 2JGRA 1UBMS 2V5UA 5I7HA 2XQJA 3LCJA 3WL4A 1PYOA 4RTRA 2F3UA 2OD7A 3M2PA 1TF5A 1O4VA 3IDFA 3VKFA 4AJPA 1ULTA 2F90A 3PFBA 2BEUA 4BN4A 1JEQA 2AKYA 2EYQA 2DKNA 1AN9A 4JA2A 5KYWA 4UU1A 3O9VA 4DBLC 5CVTA 1ZSVA 4BNLA 2BM8A 5BSMA 1Y9DA 3Q3GE 4RU1A 5CDUA 3KFVA 4EUSA 4LJ7A 1VXRA 2HHJA 1P0FA 1QO7A 2J4DA 1FU4A 4KYVA 3GCXA 2ONCA 3TZCA 2QZZA 2ASVA 5L4NA 1XLWA 1NI4A 1Q77A 3DTNA 1GNTA 3KPYA 2GFQA 3AW9A 4EVQA 4ASUD 2ZBFA 2I9PA 2CNKA 3W2EA 1KO5A 1RXEA 2JJ1A 1P4GA 1X1SA 1Z3IX 5K4AA 2YWJA 2BGWA 3U3OA 2O8EB 4F96A 3CPEA 1I7SB 2ZE8A 3Q0EA 5BN3A 2HGSA 2J0VA 3KB8A 1K0FA 4MA5A 3EBPA 4IG4A 3ZBPA 2XT0A 5HS4A 1KORA 3JAKB 1R6DA 5TE9A 5D3ZA 2CFRA 2PR2A 2RH5A 1SEPA 3WKDA 3WRYC 2I0FA 2IZ5A 3PYMA 1IM5A 3F96A 4WBSA 3EBOA 1G8YA 4F7WA 3LLCA 4B31A 3KQNA 5KQPA 4OIMA 4ENRA 3FNBA 4GT1A 2X1HA 3CLSD 4GOND 3RK0A 4X64B 4JI0B 3F97A 3IQIX 2C5AA 1M1NB 4REQA 5DNYB 3GLUA 4MULA 2ISQA 3LQYA 2QXTA 4K9LA 1ID8A 2D1TA 3A6JA 2I99A 3LSTA 1TTHA 2ZIAA 4J0CA 3FDJA 4OQDA 1VE7A 4P5EA 3H3JA 4Q66C 4XGRA 1M1YA 2Z1NA 3CKYA 4B1FA 3SX2A 5CFLA 3GPLA 3PXBA 3T9EA 2BEJA 2C82A 1PT7A 2YFYA 3KXIA 2WJWA 2QY9A 4U2DA 2G4VA 4KBFA 3ZXYA 5CDTA 2FEXA 2YQZA 1NN1A 1YD7A 3HGMA 4CLOB 2IPMA 1P6UA 2BKVA 2I7DA 1QBKC 3AUXA 2LWIA 3RUDA 3H83A 3TRDA 1I6WA 1B73A 1L4FA 1MGOA 2W71A 5AOVA 3TZKA 3VJRA 4BNTA 2WSIA 4ZEWA 4IKOA 4PZAA 2O3JA 4P3YA 1UFVA 2OZPA 1ZXBA 2HBQA 2QXUA 4QNNA 3AM5A 5EZSA 1E5QA 1K8QA 2XITA 3K6RA 5FV4A 1CQJA 1D3AA 1W88A 4U5XA 1C3VA 1RYZA 1AM4D 1VL5A 3MPUA 3OIVA 4TSFD 5L6MB 1M1YE 4CKZA 1NLZA 3EQZA 4RPJA 1NVBA 3TQFA 3ZW8A 4U0KA 3IPCA 3MT9A 4M1MA 2RAVA 1U7XA 5DGIA 4F85A 2JHFA 3ZHSA 4XVQA 4JOBA 2PGLA 3R9KA 4NCNA 3D7NA 4G23A 1I6KA 3DAGA 1F8FA 2JJYA 4PRYA 1BROA 1NTOA 2XXBA 5FL3A 4CR6A 4NYJR 5M29A 2JJMA 2AF4C 2X0NA 4JXKA 2B94A 1Z2OX 5AW2A 3L1JA 4UTVA 1ORTA 3DWEX 1HO3A 4S1PA 4MI1A 4Q24A 1GIAA 2D59A 1VI5A 2P3SA 2NUPA 4URYR 4F8EA 4I1VA 5KVAA 2X8BA 5AVQA 1HT3A 4MAAA 2AFHB 3AQ4A 2HDOA 2CBZA 1F06A 2ISCA 2EBFX 2ZRBA 3ZQKA 2PS1A 2IV7A 3FLAA 2OYCA 3UCEA 3WMEA 2J08A 1V2HE 2YJGA 1ISHA 3IL2A 1T9DA 1RABA 2E85A 3ZV6A 3PYXA 3TVDA 4N8EA 1C4XA 1OIVA 1AZTA 1S2DA 1USVA 1KDZA 4B4DA 5AVWA 4DSUA 1WD5A 3MT7A 4DLAA 2G0NA 2F48A 3A37A 5EPOA 1MO5A 4QOGA 4UTZA 1NR1A 1NUHA 2AOUA 2JGIA 2YWRA 1CQIA 2XADA 4MVCA 4EH1A 2QA5A 5LNK1 4QYWA 4BO6A 3GRPA 1S3GA 1X94A 4PLVA 3I1IA 4DLLA 5LIPA 3NC0C 1O5OA 1XA4A 3C3WA 1FX0A 3UJ7A 3UXEA 5ALEA 3T6KA 1VIMA 4HY3A 3U1TA 4DIFA 4M37A 3LIPA 3NAGA 5H7XA 3TL6A 1R4ZA 2Q8QA 4YRGA 2JPDA 3FNIA 3H5WA 1KNQA 5T64A 2ZZNA 2O2SA 3MS7A 2P2GA 3L06A 5C3UA 3VZPA 1QB7A 4TROA 2M6SA 3QVKA 4NYIQ 3OPVA 3ROQA 3IP3A 3L0CA 4BLRA 3LY5A 4ZI3A 5AD1A 3C3KA 4XWYA 1KOGA 2I54A 4LE2A 3CZ4A 4QKQA 5BOVA 1NR5A 3PV0A 2D1YA 3HO1A 5GM2A 2P2CA 2QM0A 3STVA 3R5KA 5HUHA 2Q50A 3QE2A 3WQBA 4LF6B 3M1YA 3G82C 5JU6A 1LD3A 4LQCA 4U7JA 5FKJA 4BZZA 1LVGA 2WPDA 3QEMB 1EIWA 1YJ5A 5JBQA 1AB6A 4JYBA 4QOJA 3TZLA 1TT5A 3TDKA 4JL6A 3O47A 4AJ2A 1G3UA 3TXYA 3D0QA 3HWWA 1MBZA 5KREA 2PVCA 2QPAA 4QUDA 1XRRA 1WW3A 4ZVNA 1NVVQ 2HCFA 2CC2A 4AI6A 1ZU5A 5LA6B 4F86A 4ITVA 1INLA 3D8HA 3KP1A 1WRBA 3ELDA 1GVHA 2DQ4A 2ZSKA 4FNGA 1IPFA 2RGRA 2WLTA 3SM3A 4LK3A 5EYPB 2CUZA 3AIIA 1Z38A 3WGKA 4D8TA 4FR5A 1GUDA 2B2XA 1TAHA 5A9TA 1GA1A 2JATA 3E84A 3JQAD 4U2GA 5HXAA 5K99A 1TPZA 1Q0PA 1TVCA 5JPDA 4EITA 1N6IA 2C9CA 3OAAD 3PEVA 3Q11A 3AEUA 5IN5A 2RH4A 1Q19A 3Q9LA 3BTSA 1P7YA 4UNSA 3TLJA 2EJVA 4QEKA 2Y1WA 4L9SA 4XIFA 4ZI7B 3ECAA 3VYSB 3PXEA 4Z51A 3BN3A 3GWGA 3KTAA 4Q4HA 1T1SA 2R87A 2I03A 3BHIA 2X9GA 3S2ZA 1Z6AA 3T9FA 2G06A 1VG9B 4UASA 3THXA 3V8QA 3DXFA 3K30A 1XYGA 2WSBA 2XPCA 3ED1A 3EIUA 3RH0A 2IYNA 3OM0A 1N7JA 2LKCA 5REQB 2WJ3A 3ADKA 1SKYB 4XQCA 1WETA 1BDIA 3WB0A 2HSGA 4G5RA 3MWGA 5F2NA 5KDLA 3GBSA 1L4BA 2G9NA 3VSAA 3TK1A 5CLJA 3UGTA 3FH0A 5BR4A 2ZUCA 4NJEB 1AVTA 2WV9A 4TMZA 4U7PB 3U48A 4LX8A 4QAQA 1M34A 4TWJA 1S8AA 4UHCA 2QRVB 2M6KA 3WG9A 3RTCA 2BM1A 3ORQA 1OE0A 3ME5A 1JNYA 4J1TA 4G3XA 4XJSA 3EC1A 2C07A 2XZOA 4PINA 2I2BA 1DC8A 4Q0MA 4E0BA 4G86A 4WINA 2PRKA 4H6PA 4MWBA 4XAQA 5HKOA 1A7JA 1F2TB 2X8JA 4IDOA 9LDBA 5K0JA 1K8YB 1T36A 4QEZA 1D8AA 4FYHA 3CXRA 2V5VA 3UXHA 4ER7A 3C8HA 3OFNA 5LP6F 4G2NA 2ZIXA 4IOLA 1Y4SA 2IYYA 3EIHA 1VCIA 3DBOB 2RONA 3W6PA 4D98A 2BC9A 5DTRA 3EIFA 2I1VB 4FXPA 1G1MA 4YRAA 4HNQA 3HTXA 4W5OA 1SCKA 4Y0VA 3SC2A 1M34E 4UOQA 2ZSUA 1TW3A 4G5FA 1IWBB 3K72B 2COUA 2J32A 2I4LA 1ZWLA 3UAYA 3PNOA 4TLBA 3IELA 2YWDA 3DLAA 5DF1A 1H0KA 3D1JA 3FPLA 3G49A 4HQLA 4Z2YA 4OLBA 1LW7A 2BZSA 1L4GA 1X87A 1XPJA 4QDKA 4EW2A 5GIOE 3JZDA 1ZH4A 2BGKA 2H85A 4L5JA 1KZ6A 2V6IA 1WZUA 3J80A 1T5SA 3A32A 1A9QA 1DHTA 2B1QA 1KP9A 1WVMA 4YJHB 4YEDA 3CLRC 4RK1A 3V8BA 3PQ7A 4XYGA 1XNJA 3SJAA 1P60A 3ZDEA 1VSUA 4Q4DA 3WWEA 4DXAA 5JS7A 2IH2A 4OHRA 4NZ9A 1WPXA 2GUWA 1HA3A 3T7TA 3MW8A 1LDEA 1ILWA 3EGEA 3P9XA 4LTNA 5ILGA 3RVSA 4BS9A 4HZGA 4ZU1X 2OAQ1 3U4DA 5B57C 5A3VA 5J4HA 2TMKA 3RV3A 2D6FA 1RXSA 3W5JA 2IYAA 2BMVA 3VKUA 3ZLUA 1OZGA 1NU8A 1RWMA 2DRIA 1LTQA 5DBHX 4EX6A 1SEVA 1JP7A 1X7XB 3JYOA 3V8EA 1CFZA 2JGLA 1LPBB 3KCQA 1QAQA 1XEWY 5IN4A 1JFFB 2NPFA 2PLFA 2EC5A 3EIOA 2OQRA 3P2JA 4WGFA 4FMBB 2FZEA 3U61B 3URMA 3QKUA 4XJVA 4QQKA 1NBMD 5CB6A 3R44A 2HWXA 4QQFA 3SE0A 4FB5A 3GFTA 2GN2A 1WHTB 2PUWA 2XGGA 3P0EA 3SYNA 3UUFA 1T8PA 4X65B 2DY1A 4MDHA 5H4GA 3CCFA 2JCSA 2V96A 4RKRA 5I4KA 2VSFA 4IDAA 2GKOA 1AXGA 2GM5A 2BI8A 3QM1A 4PFKA 4CKBB 3V3KA 3HWRA 1CW2B 4KO1S 4J7XA 1NP3A 1AZLA 1IHPA 1RFGE 1Z9BA 3IAUA 2V59A 4MP3A 5I3CA 1GPMA 2GXUA 4XYLA 6LDHA 1SU8A 3AO0B 4MB2A 3H5AA 3OP1A 1YASA 1H65A 4P36A 4P93A 2RKBA 3NGLA 4W9NA 4DUGA 1I10A 5A5VA 3GDHA 4OX9B 2Y1EA 2H7CA 2XSZD 3WLQA 2C9MA 1CS0B 3C4QA 4C7OA 2G1KA 1B3RA 2C2GA 3CF2A 1WO8A 4UZEA 3BULA 1GQOA 1WZNA 2XF8A 2JIQA 5CLIA 1X9HA 4QO7A 2UUCB 1ADCA 2ZBVA 1Q17A 2FZKA 1KI2A 3K9GA 5CH3A 5DP2A 5IK2D 5KTKA 4HOYA 2GK7A 2BGMA 4QNRA 4A91A 1OGJA 3R9XA 4B6OA 2QF7A 2OMKA 3MTDA 2WY2D 5C3MA 3IDAA 2BHSA 4M9QA 3ZKWA 2AG6A 3PCRB 4JLPA 1IXZA 4D02A 2QIOA 4FK8A 4JWKA 4JITA 4XXHA 1X1QA 3LNTA 3A7DA 3EC2A 1CV2A 4LRXA 1RXVA 4IXNA 1Y7IA 1WSWA 3EXHB 2JLYA 3LSYA 1EXVA 5FBZA 4LXQA 4BMYA 3E3LA 1F2UB 4DDMA 4CR7A 1PL7A 2ZI6A 3G68A 3UJ8A 4IDHA 3IAAA 2E48A 5ETJA 4G6ZA 4FS8A 4YUYA 1YB5A 1UC9A 3PGLA 1G60A 2FA9A 2CVQA 1NVXQ 1CF9A 3TJZA 2IZOA 1TEHA 1FJ2A 5IHPA 3RYIA 1SHTX 5ALNA 4WNAB 1H1LA 1QPGA 4YJ3F 2CXUA 4QGSA 3FMVA 1OXKB 3AHEA 4Q9KA 2P62A 2YV3A 2PWAA 2WAMA 4ZEOA 2CLOB 3HJHA 5ALMA 1JU4A 2J6CA 4N47A 4EKGA 3R40A 1VTKA 2RBKA 3KOUA 3D0RA 4ZAZA 4K9QA 1AG9A 1CHNA 2BMWA 1H5NA 2X22A 4O3MA 1KS2A 5D5PA 2ZROA 4JP2A 4M83A 3LHFA 1S2LA 3T5DA 4M0EA 3TQCA 3P4UA 1P9NA 1TYEB 2PXAA 1BYIA 2AEEA 3PVSA 3I04M 4MUJA 4XASA 5DNUA 2A7QA 4LFBB 3QU9A 4MVXA 3HZZA 3B13B 4FFMA 4DLKA 1K7SN 4HS4A 4CL2A 2V6MA 4JYZA 2R6ZA 1NA5A 2BF7A 2MSEB 3MMNA 3SPXA 1FVFA 2C9DA 2AA3A 2JAPA 4OLHA 2H0RA 4QQNA 4WLUA 2ERCA 3QBDA 2OG2A 1DX6A 1M2GA 4BP3A 3A4VA 3GJYA 4LSZA 4ZTBA 4BMXA 1J6UA 4YDRA 1KJYA 5JVDF 4N82A 3K0HA 2DM6A 4NTZA 2WFMA 5FR2A 5L45A 3AY0A 1PJTA 3FI0A 2VT2A 3IP1A 4LJ4A 1H5UA 3BE5A 3QOFA 2I78A 1NTRA 2C2MA 3U3ZA 2YIDA 2P9BA 4BUCA 1OW3B 1VIDA 1B6TA 3ESAA 3LCVB 3RVOA 2AUTA 2ANCA 4YRNA 1W0JD 2YYSA 1H8HA 4GWGA 4LJYA 4L4ZA 2OM6A 2VYVA 2IZZA 3QJYA 2AN5A 4B2IA 4C20A 4L72A 2WIKA 1FLAA 4Y2PA 3NDRA 4DSTA 4NU8X 5K6AC 3U6KA 5EUCA 2Z95A 1KYWA 3OOHA 5CH8A 1YC2A 2QPOA 3AF2A 3HN7A 5JFOA 1PTJC 3D2AA 4Y2XA 5KYUB 3QELB 3THWA 1WCIA 1UINA 3RFVA 1MIOA 1A5SB 2VATA 1PWHA 3F5SA 5KX5F 1CRWG 2EEZA 3JATB 1K63A 2UYYA 4FNOA 4HQKA 4K26A 4RS3A 3UWMA 3ANSA 3V2HA 3FMOB 2QV7A 3VU1A 3I5MA 3ZQ6A 1CF2O 4L4RA 3F9CA 4DPKA 4KN9S 2EKBA 3JQRA 5EIFA 1U0FA 2VPWA 5FI1B 4HNVA 3HH8A 1PNTA 1PR5A 3KDPA 2P9CA 4BLQA 1U7OA 3C3YA 3KL2A 1EUYA 5JQGA 3L4BC 3IA7A 3LAWA 4GVXA 4GX5A 5A2GA 4H3SA 1FTWA 3CO5A 3OQIB 1MPXA 3QBTA 1K6MA 3RK1A 1U0TA 5JHHB 1U8AA 1RZVA 1HDZA 1C3OA 4JYCA 4UDYX 4B6QA 4D1YA 1UPBA 1JBEA 2OESA 3N7TA 5KEIA 2AH5A 4DKJA 1Q1GA 4ZDKA 1ORWA 3R0IA 1SK8A 1T6YA 5C31A 4RPGA 3R24A 5FUMA 4MYDA 3ND5A 2ZRKA 4MKIA 4D9FA 1Q95A 4I2NA 4NESA 4W9MC 3JQ7A 3ONEA 4NZYA 4MKRA 3ZW7A 5IKPA 1DJMA 2MT9A 1JEAA 3I5UA 4OJTA 3OE7A 3ZHCA 3DOUA 1CUGA 2DQKA 5D84A 2W70A 1QHFA 4JI4B 3VA7A 3CVJA 3CZCA 1V7QA 2H5LA 4JASB 3AY7A 1WBBA 2NTEA 3SU8A 1LDNA 1U2RA 2EJBA 3F6CA 2C2XA 4F1WA 4LI0A 3QVXA 4C01A 4OHPA 2AJCA 1YIOA 3LQ1A 3EVDA 1BN7A 3I64A 4I2VA 4P98A 4P1ZA 3TTWA 3EZNA 1UMDB 3E0XA 1HLPA 5J59A 3SQOA 4UMDA 1DG1G 2OSVA 4JIMA 4M54A 4MVJI 2GF0A 2YN2A 3F6SA 4Q7KA 4FFVA 4FHCA 4UEOA 3K09A 4N7MA 1R0XA 1YQWA 1ISMA 2BONA 2Q28A 3LT4A 2GHIA 4R3WA 3GEMA 4A23A 4P35A 1A98A 4U1RA 1DQSA 4DJAA 1WL8A 1K5PA 3PBKA 4LTMA 1ZMRA 4NXMB 5ARDA 1I8TA 4YRIA 2V0NA 5AI0A 3CB4A 2FX5A 2QRLA 4NCIA 2Q5JA 3ZY2A 1Q7CA 5I8WA 4MWSA 4I4TF 2GESA 3OIFA 3R4CA 3PIDA 4N0PA 4OQYA 1WW2A 1I1OA 2M98A 3C45A 2VH2A 3KJHA 3T7DA 2ON6A 2XVXA 3OTGA 3GEIA 3ZLBA 5HUQA 3L49A 5LJIA 3SZLA 5KOJA 1GZVA 5SZKB 2NUTA 3KPVA 1E1QD 2AQKA 1GPBA 1RRGA 1L2TA 5IKOA 1DCMA 1T5LA 3M3DA 3LYAA 3QSGA 2XKBA 1KXZA 4RTKA 2P2SA 1Q16A 4GX2A 4OBBA 1L7OA 2W2PA 3FZNA 3IULA 4X41A 1HDXA 5F2OA 3M5WA 5E3IA 3ZD6A 1RNLA 3JVEA 5DKFA 4BGVA 1KRWA 1DFGA 3M9XA 1ZK3A 821PA 1JG1A 1SBTA 2B6NA 2ALJA 2O4CA 3NNDA 4JBWA 4IMJB 4QJBA 2XH8A 1KO1A 3GYGA 5B3JA 1H1TA 4LCJA 3MRXA 2DFDA 1UM9A 3ZGNA 2E4ZA 2Q4RA 2UKDA 1Y8QB 2FETA 3Q8KA 4WXEA 5GONF 2H9IA 4Q1AA 2IOFA 2G9QA 2C03A 3EGVA 1GCUA 1ML3A 3OURA 4NNPA 4IIUA 3UV7A 1NXWA 1NN3A 1DQNA 1XLTC 1J2RA 2W58A 3QEBZ 2A9QA 1OV6A 1Z5WA 4YXWD 3L0YA 4V38A 1PWYE 5B7QA 4D46A 3KKPA 4FQ8A 5AIBA 5AKYA 5BNZA 1XZJA 1LQUA 1EDBA 4LMBA 2QQ5A 2HT1A 2F9MA 2GARA 4Q3AA 4RMIA 1Y3IA 1UJ6A 1BQEA 2VDLB 4AD8A 4Q1EA 2XNJA 1E0KA 1JHUA 5FUVA 3QQPA 4WN9A 2CD7A 1U1FA 5FUYA 3TQRA 3JYNA 4Z3KA 4BV9A 1PLJA 4EI7A 4HGOA 4G0VA 1LBEA 4ANFA 4RE6A 1DV1A 3VYWA 1JI3A 3KWFA 1M10A 4E5VA 3IEMA 5JCXA 2QPTA 1K4MA 2E9SA 2XI4A 4RULA 2WDPA 4KLAA 1AF7A 2QQEA 1J23A 1YBMA 2I3GA 1BS1A 4ERNA 3FA2A 3L6CA 2B82A 3ED5A 3UJ6A 3TZBA 1DC4A 2C2HA 2FU5C 1H2XA 1KI3A 4GPEA 5DOVA 5EERA 2B4TO 4K0KB 4YI5A 5C51B 2XIQA 2YXPX 1CLEA 3EDYA 2XJ4A 2YMLA 3FPHA 2OWDA 1G2OA 2IYVA 5FWDA 4RPLA 3PS9A 4INJA 2YJ3A 5FTNA 1T3ZA 3BE4A 3U7RA 2YUTA 4ARUA 2SICE 4ALMA 3EOAI 4F4UA 3NEJA 3G9UA 1UAAA 1ZD5A 3X1WA 1NF3A 3UMVA 3U3DA 1KQOA 4RDHA 4C4OA 4S05A 1Y6GA 1Y7HA 2EW2A 4E2YA 2Z43A 5CMLA 1JA0A 1SCAA 4MIKA 5CIWA 5K3FB 4A16A 3ZE2B 1QZXA 3I12A 4JD5A 2Y6UA 3L0DA 1AV7A 3R20A 4JC4A 4X0EA 2JFPA 1XVVA 4X3CA 3RJZA 3RTDA 4BPRA 3CMMA 4OL0A 1QKJA 1M2NA 3BXOA 4L0MA 1JLHA 3RC9A 1R8JA 2QL5A 4MGZR 4TMXA 3QWIA 5C1DA 2UVDA 3WQRA 5BMVA 5JJBA 1U28C 3QLVC 3W9SA 3EQ2A 4BNXA 3U17A 5TPZA 1DEKA 3ZS8A 5ALPA 2IS2A 4LVUA 1VLMA 1UUFA 3RRXA 5ECDA 4KLZA 4C0BA 4J7UA 4GC9A 4L5AA 4OIFA 1YH3A 1U02A 3W3AA 5AQEA 4OXQA 3N39C 1C1XB 3DMNA 3ODPA 2H00A 1GLVA 2H9YA 2BSQA 3MTGA 2FX2A 1IEQA 3R41A 2GZ2A 2OBMA 3R7WA 5INTA 3EDQA 2JEZA 4IIVA 4RZ3A 5FO1A 3ZVMA 4XUCA 5H83A 3N2GB 1S8NA 2PH3A 2CHFA 3FCSB 2O2DA 1F8YA 3UJBA 4WBNA 1DFHA 1EFTA 5MN6A 1B8NA 3GGDA 3WMXA 3ZWPA 4C4RA 3H75A 3TUZC 1TK3A 3KVYA 4CV0A 2O7VA 1Q3TA 3C97A 3TW8A 3BB1A 2J5KA 1X15A 2YZ7A 2RGWA 2VK4A 3FCCA 4IIDA 4KWTA 4B4KA 3W5CA 5IM4F 3PJEA 4JJAA 1DT5A 4FR0A 4KH1A 5B55A 4G67A 1OIWA 1Z8FA 1CRQA 5BY2A 5HM8A 4KIUA 4TYNA 4R05A 4RJIA 1DI0A 2HPHA 3M6VA 4RCVA 4IWYA 2ODPA 3MJSA 4BU1A 1U2PA 1G19A 2VUHB 3PXXA 1QU2A 1YNOA 2GPNA 3HKCA 1BMFA 2NO5A 3BMCA 3NWPA 3V4VB 4ID9A 3BJMA 3C15C 1PT6A 1EFPA 3ZHYA 4R1OA 5IX8A 4HDRA 1DIRA 1G4HA 1L8AA 1JSRA 3NR2A 4KO8A 4B3CA 1Q3KA 1BJKA 3PQ6A 2A5LA 4JV5B 4WKOA 1UC4B 2RHRA 2DLNA 2ZZKA 3KJEA 4DMGA 2GLXA 1GPUA 2XUZA 5L3QB 4L9AA 1Z6QA 1V6CA 5E4TA 1GADO 3U7QB 1HQKA 3BXEA 1AURA 1PLKA 1ZMBA 5JTUA 2QLBA 1MP0A 4JI2B 2O5EA 3P0HA 1P75A 1ZNQO 2ODNA 2FR8C 3EUAA 4K1XA 3RSGA 1CEYA 3O03A 1OU0A 3EOZA 4KPUA 4C4AA 4GZ6A 1XRMA 2QAGC 3C6QA 3QKTA 4G01B 3RT9A 3K1TA 1FNDA 1E2KA 2P11A 4X3OA 3NDIA 4EL5A 1VPWA 4TYYA 4XOUA 1E9EA 1W0CA 1NZFA 1QX3A 3G0CA 3ZIAA 1UCFA 5U4QA 5FORA 2VK1A 4D9MA 3AZPA 1ZA1A 3IB3A 4BO7A 2OZVA 4KFCA 1VMIA 3TR5A 1CIVA 1WXGA 2AXPA 2PKYX 4WFJA 1QP0A 4NSNA 3BDAA 3UQZA 1U7PA 3HM2A 3RBVA 3HJRA 4UVGA 3KVVA 2Q3HA 1XVTA 1Z08A 1P18A 4F5ZA 1PS0A 2XDQA 1A8IA 1JI0A 4BMZA 3DC2A 1R8QA 4BIMA 3SICE 1GEGA 1O54A 3GF4A 3GLGA 4R41A 4BC1A 4R2IA 2Q1UA 5M04A 3VHXA 1HF3A 1VIYA 3ZXIA 3MXTA 4QPZA 3KZ1E 1NHWA 1EXMA 1IEWA 1LRKA 3PR1A 4MLZA 2A0KA 3GUHA 3HSYA 3JVIA 5A7FA 4YX9A 1FSPA 1IJEA 3O8OB 3FGZA 1REQB 1T9CA 1DJPA 5IMSA 2GCGA 3LO8A 1DXQA 4HN4B 3TSWA 1SG9A 4RJJA 3ETJA 5FBLB 1KOLA 3ZY6A 1BWQA 5CEEA 1GJRA 2Q9UA 2R00A 5F64A 4U6NA 2EJUA 1RHKA 4FYXA 5FLYA 2IV2X 5EJ5A 1IDN1 1PNOA 2WD7B 1T0BA 1E1DA 3ROTA 3CH4B 4L51A 1ZNYA 4R0VA 2HIMA 2G6BA 3V32A 4QZVA 3H0CA 1LRLA 5DHAA 1TZ2A 5AWFC 2I4MA 3GLGE 1M2VA 3TMKA 4XWKA 1NWHA 1MH1A 4W5JA 1AD2A 2J30A 2QSJA 4ZARA 5LSAA 3HP4A 5ESRA 3TRHA 3GA5A 4N0EA 1MLDA 4RVSA 4AVYA 3CZQA 3E6AA 1DEXA 3SDSA 2HIGA 1UBLS 3KSZO 3PNBA 2Q1SA 3OICA 5GP1A 1NQXA 5D2CA 3VQTA 2VTBA 3DL2A 4L4XA 1TEZA 4CLEA 5EZ6B 4G63A 2NVBA 2P68A 2QRMA 5B6JA 4DR3B 5KQRA 3A31A 5JD4A 4Q3NA 1C2YA 4YO8A 2DG2A 1KQNA 4IG9A 4GOJA 5IABA 1B41A 3B2NA 1GKYA 1Z0ZA 2PSFA 5CGQB 2JH8A 4HFNA 3PFNA 1H8EA