5SYNA

Cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
PLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acyl-protein thioesterase 2
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5synA00
4FBLA 3BE8A 3ANSA 2WTNA 1LGYA 3AIKA 3C43A 4QZVA 1P0IA 3WI7A 1CPYA 1DU4A 4YPVA 5AI8A 2XUGA 5LZ5A 3T52A 1W1IA 4PSDA 2WU3A 3A2NA 4OYYA 4ZI5A 5AKJA 1B6GA 2XMCA 1QTIA 5ALQA 5FLKA 3AILA 2XQIA 4WDQA 1ORWA 1ISPA 2RGUA 4OCZA 2WG2A 3R3XA 3HXKA 1QFMA 2JGEA 2HFJA 3R3WA 2Z8XA 3O0DA 3Q0TA 1Q0ZA 1YS2X 4C4XA 1G5FA 1FFEA 3HSSA 3A6ZA 3FLBA 2WM2A 1CUCA 3E1GA 1QLWA 3DEAA 2AJDA 4M0FA 3B12A 1XRMA 1J2EA 1VZ2A 1BEZA 1ODSA 3D2CA 1EX9A 2CMFA 1XLWA 2OCIA 4P93A 1O6GA 3TEJA 3DOHA 4W1QA 5FV4A 2WU4A 5CH8A 4FLMA 2ZJ7A 1IUPA 4RGYA 5AIBA 1XRQA 5BV7A 3YASA 1CUAA 4AQDA 3IURA 3EQ9A 1QIJA 3KWFA 4LKOA 3PUHA 1EK1A 1UXOA 4M0EA 1ZJ4A 1YA8A 2HFKA 5LZ8A 2BJHA 3LLCA 4WJLA 1ZI6A 5AOBA 5K3FA 5ALTA 5ALRA 4EUSA 1WB5A 1J06A 2CKMA 2PM8A 5C8XA 3O4IA 2VTVA 5AM2A 4S0XA 1AQLA 3VXKA 3G0GA 5AP9A 4K5QA 3C87A 2O7VA 4I19A 4N8DA 1WCYA 1ZGBA 4ARAA 3WA7A 2HU5A 4B81A 1Y7IA 4WDRA 2WTMA 4H7JA 1DINA 1X2EA 2C5FA 1BU8A 2CEKA 2BUAA 4WY8A 1F0NA 4GDMA 5DNUA 4DNOA 3FVTA 2JF0A 4FKBA 1L7AA 3DOIA 5AKGA 4IH4A 1GKKA 4UBIA 1ZI8A 1C7IA 4KE9A 5CH3A 4P08A 5DTJA 1RYYA 3WL8A 4BAUA 1DWPA 4DMCA 1THTA 5FOQA 2HA7A 5LZ4A 2GZSA 1EDBA 1KU0A 3D0KA 4PSUA 2RIPA 4EY8A 1OXMA 4AN1A 3ZLVA 3PDCA 2HA6A 3IBTA 1AUOA 3BWXA 4L9AA 3MUNA 3R3ZA 1XRPA 1DWOA 4H7HA 1W6RA 4N5HX 3B5EA 3GROA 1BEEA 2QM0A 1LPMA 2VJBA 4X94A 4X91A 3C8DA 1QIHA 3DKKA 2OQVA 4H0CA 4Q3LA 2DHEA 4OPMA 1H2YA 1R9NA 4F5ZA 1DQZA 2QUBA 3RLIA 1A7UA 3QPCA 1WHTA 1MX1A 1JI3A 4H7KA 4X6XA 4GXNA 2OXEA 3BF8A 5K3FB 3VKFA 5JAOA 1WHSA 4UFNA 1QIDA 4B9AA 2VAXA 4B84A 4FOLA 4BB0A 3PI6A 5AK4A 1AMNA 1CUIA 2NW6A 4G5XA 5FRDA 1XZHA 4K6GA 5AI9A 1MAAA 1VXOA 2WFMA 2HL6A 2YASA 4PQEA 1T2NA 1NU8A 4BC1A 3QPDA 1GPLA 5I7UA 1CUSA 4BZWA 1QIGA 3I2IA 4G1FA 3H18A 1VOTA 4OB8A 5AKEA 1BROA 4Y2XA 3SWWA 3ILSA 1TQHA 2HRRA 1YB6A 4OB7A 4QEKA 1ZD2P 5ESRA 2DHDA 3G7NA 1K63A 5ALGA 5CXXA 3SX4A 2PU5A 5K5EA 2PX6A 2BCEA 2Q0XA 2H7XA 2QTBA 4EHBA 5ALWA 3R3YA 5DTIA 2O2HA 1QTRA 2OQIA 1EI9A 1SC9A 2JEYA 1LBTA 3WYDA 5IKXA 5AJHA 3PICA 3VVLA 1W76A 4UHHA 2I78A 3KWJA 5HF8A 3ZI7A 4FTWA 4A16A 3L1JA 4BRSA 3FVRA 1TIBA 2C5GA 2JGKA 2XUDA 2ONCA 3SK0A 1BN7A 4Y2SA 2H7CA 3AZOA 4OB6A 5ALHA 4BVKA 5JANA 3DYIA 4G8CA 1A8QA 4UBJA 3ICWA 2OG1A 1ZI9A 4RE5A 5E4YA 4AO6A 2PPLA 4EA6A 3W06A 4X71A 3IUJA 1VE6A 4AXBA 2Y1KA 2BKLA 2HA5A 1K8QA 2I03A 1AC5A 3WL6A 1YS1X 2PU7A 3FCYA 4FFVA 3KDAA 3FSGD 4DSAA 2QR5A 3WK5A 4P9NA 1JJFA 1JFRA 1UK9A 3ZLUA 1AKNA 3C70A 1EVEA 5A7GA 5HKAA 1U2EA 4DM7A 3C45A 1JJBA 1CUEA 1XZFA 2X8BA 2RHWA 2IITA 4C6HA 5IVKA 3HC7A 4A23A 2EDCA 4Q3KA 2YH2A 1T4MA 2WHPA 3WK8A 4CG2A 4OU4A 2HIHA 3W04A 3WZLA 5JD5A 4GI1A 2QJWA 1HL7A 2WQZA 2WIDA 4JEIA 3VVMA 2JGMA 2JEZA 2JGJA 1JT2A 3R3VA 3I2JA 5SYMA 1YAHA 1QIEA 2W6CX 3D2BA 3D5EA 1J1IA 4BCBA 5K3EA 2OLEA 5LZ9A 1P0MA 1VZ3A 4QDOA 2QVBA 1CQWA 1CUBA 3WJ1A 4ITVA 3AUKA 1G66A 1A88A 2WJ3A 2J4CA 5T4EA 2JGIA 4CCYA 1TCCA 3L1IA 4C88A 2RONA 3ESCA 3V1MA 1JU3A 5EHXA 3F9CA 3HLKA 5DYYA 5AKLA 1LPNA 5JZ9A 3IA2A 1EDEA 2XMDA 3NUZA 2QOEA 1EB8A 1QIMA 3UUEA 3G9ZA 4MQLA 1MO2A 3EF3A 2V98A 1ZIXA 1IMJA 4BCCA 1VA4A 1FJ2A 3HACA 4AO7A 2WJ6A 1SCQA 3EIOA 3DL4A 5D7BA 4U2FA 3WWDA 4W1RA 3QVMA 5EHZA 4DNFA 2WILA 3WJ2A 3H2JA 3R41A 4GEGA 1QONA 3H19A 1TCAA 4F21A 1QIKA 4B82A 4Y2YA 5HFAA 5JARA 2WHPB 5JAPA 1M33A 1EHYA 1G4HA 2H9YA 3QBJA 5D3ZA 2HM7A 1BCSA 5A6VA 5H3HA 1XROA 3H2KA 4V2IA 3VISA 4QWWA 1ACJA 1XZGA 2WUGA 1XKTA 3MVEA 4NMWA 2CJPA 2X5XA 4Y9SA 3FCXA 5EGNA 1O6FA 1C7JA 2HHAA 3TGLA 1MAHA 5AICA 5DNWA 3V1NA 2B9VA 4ZREA 2VEOA 3WMRA 1EVQA 3FYUA 1ODTC 4BP9A 4UHFA 5IVDA 1F0PA 2GYWA 5HQ3A 5CT4A 4X97A 1WOMA 2C7BA 5FXMA 3VJKA 1YA4A 5KWJA 3E4DA 4CCYB 4DMFA 3WIBA 3G9UA 1N5MA 2ORYA 1C4XA 1QIFA 1FFCA 2XDWA 5DWDA 1W4LA 3PF9A 5ALXA 2FUKA 4I4CA 3ED1A 2BFNA 5HKBA 1XLUA 3HI4A 2CB9A 3G0DA 1XZAA 3K2IA 4GW3A 2OCGA 1XLVA 2D0DA 1BCRA 1TAHA 3FLAA 4MEBA 2XMBA 2O7RA 3EQ7A 4F60A 3I2KA 4MWTA 4C4ZA 1EXWA 1NX9A 1DX6A 3DLTA 1EK2A 1XQWA 4CIAA 1K4YA 4QDTA 1L7QA 4UFOA 1CUVA 2XMZA 2ACEA 1SOMA 2CBGA 3WWCA 1JMYA 4ZWNA 4WCVA 4CFSA 1DT3A 4G4JA 1H23A 4AZ3A 2R11A 5CH5A 2WKWA 1AZWA 1U4NA 2AJLI 1N1MA 2GBCA 3F96A 1UOPA 1ZJ5A 3O9MA 4NZZA 5K3AA 4EY7A 5ALMA 2V97A 1ORVA 1BS9A 5A62A 2XMGA 2DR0A 4JYMA 5ALSA 4LIPD 3M3DA 1P0PA 5ALDA 5ALKA 3IUNA 2PSFA 4UUQA 5AI4A 5HF9A 3WLAA 3F97A 1QE3A 4J7AA 5AOCA 1E66A 2VA9A 4D9JA 5HQ3B 2XMQA 2XI4A 5HF6A 3S8YA 4H7EA 2Z8ZA 5CURA 4WFIA 4B0PA 4Z49A 3GUUA 3FNBA 2UZ0A 4BTLA 4BE9A 1ODCA 1CR6A 4J0DA 4KE7A 2WUEA 1LNSA 1WPRA 4Q34A 3EQ8A 1E8DA 4G9GA 5J3JA 1CUYA 5CT5A 4XWGA 4UBLA 4LYEA 3HZOA 4X85A 1MNAA 4C87A 4GWLA 1CRLA 4HRYA 2JBWA 4FNMA 3D7RA 1MTZA 2IX9A 4RNCA 4E46A 3FBWA 3E3AA 3OURA 4M0MA 2QKYA 4X7BA 3W9BA 3D3NA 3WQHA 4MQMA 4ROTA 4BVLA 4PNZA 1ACLA 2WJ4A 1YB7A 1JMKC 1XZBA 4UHBA 1PFQA 3O9VA 3WWOA 4AB1A 5ALUA 3B3QA 2Z3ZA 1CIJA 4I3FA 2PUHA 3O95A 1UK6A 3FSGA 3O4GA 1BE0A 1OCEA 2VQ6A 2K2QB 3QMVA 3LP5A 4HS9A 1XQXA 3H1BA 4HXFB 5AM0A 4KAJA 3WKCA 4GLBA 5EHQA 3WKDA 5AKXA 3LIPA 4DIUA 3DCNA 2RHTA 2QXTA 3K6KA 5AI5A 2VAVA 1BN6A 2BGRA 2XUQA 2OAEA 1YCDA 1VA5A 4DMHA 5AM1A 3SC2A 1LPBB 3UMJA 5ALEA 4XJVA 3LCRA 2VSQA 5AM3A 1GT6A 2ZYIA 4MJ3A 4J03A 2ZYHA 4WY5A 2QUAA 2HA0A 3AIOA 3DNMA 4KE8A 3ICVA 5ALIA 3STTA 4AMZA 1QZ3A 1CUJA 1LZKA 3VJMA 4DTCA 4KRXA 1FFAA 3W9UA 1DQYA 2WLSA 4CG1A 2XE4A 1H22A 1CUZA 3K9BA 3V1LA 1OILA 3L1HA 3F8SA 1YASA 3C6ZA 3H2GA 1X70A 1MPXA 2WIGA 4RPCA 1CFJA 1ZD4A 4PF1A 5IVHA 3C6BA 2C4HA 4RE6A 3BJMA 4HRXA 2ROQA 1VE7A 4HXGA 3AJAA 4AN0A 1CUFA 4K6KA 2G4LA 1I6WA 1S8OA 2VJCA 1A8UA 2W22A 4QDXA 3QYJA 5HFNA 4QNNA 1R4ZA 2J3QA 4N8EA 3IIIA 3OOSA 3IVMA 3AZQA 3STUA 2XLCA 5AOAA 4U2BA 3QH4A 2CZQA 5AM5A 3R40A 1HQDA 5CW2A 4U2CA 3HEAA 2IIVA 1E8MA 4GHWA 4N5IX 4ZXFA 4XVCA 1ZD5A 2QZPA 2ES4A 3LS2A 4J0CA 1XQYA 1HLGA 4PSCA 3H2IA 1CUUA 3RK4A 1FSSA 1RWQA 5LLSA 2FJ0A 2FX5A 1U8EA 1LPOA 5FUMA 4BP8A 1CUGA 5CT6A 5FKJA 1CQZA 3C6YA 4IH1A 4Y2UA 1EA5A 4DSZA 2XUJA 2DHCA 2OPHA 3QMMA 4Y2RA 2PSEA 5C81A 2BUCA 4AZ0A 3GELA 3DDUA 2JIDA 1HBJA 3QMWA 1W75A 3STXA 4X6UA 1XZKA 3WWPA 3QZUA 3I28A 3VJLA 4C89A 4LXGA 4WFKA 3MUOA 4BVJA 3X3HA 1DTEA 1H2WA 3IB3A 4BYMA 1XZIA 1PJAA 1SCIA 1QGED 5IVIA 4MYSA 3W05A 5D6OA 1A8SA 3ESBA 3PE6A 2VT6A 4NS4A 1AX9A 5CRIA 3HJUA 4H7DA 4FFWA 4FHZA 2PSHA 5JAUA 2V96A 1LZLA 3CXUA 2BUBA 5ALVA 3EBLA 3OTQA 4Q3OA 4Q05A 3E0XA 4IQ4A 4UBNA 5ALZA 1B41A 4B7ZA 4J0KA 2ZSHA 5EIEA 5EIAA 3BJRA 5AKZA 1KU6A 3QPAA 2H1IA 5JAHA 5AI6A 3RARA 4J0HA 1LPAB 3P2MA 4ZGBA 3GA7A 1UOQA 3G0BA 2DFPA 2OGSA 4LYDA 3RKSA 1VJ5A 3GZJA 5JIBA 1HDEA 4PO3X 4GECA 1CUXA 5HK8A 5AK5A 1YSCA 2ZSIA 3H1AA 5T4FA 2WUFA 2RI6A 3I6ZA 1CVLA 3UUFA 1HKHA 4KAAA 3QITA 4QDZA 1TKRA 5AKYA 2VJAA 2B61A 2GBFA 5AH0A 4QLOA 4UFPA 1TRHA 4UPDA 1E8NA 4JNCA 5A7FA 3OM8A 2PSJA 3DD5A 5EI5A 3ZLTA 4ZV7A 5HF5A 1QO7A 1XZLA 2Y2VA 1IZ7A 1MX5A 4DYHA 4ZRDA 4G4GA 1SCKA 1IUOA 1UKCA 4WFJA 1GQSA 4IHAA 4LHEA 1QFSA 3O4JA 4KAFA 2H7YA 4J0JA 5ALLA 2WIJA 5A7HA 3CCBA 1KEZA 2HA3A 4DNPA 1VKHA 1Y7HA 3G0CA 2JGLA 1IVYA 2G5PA 1YR2A 4FMPA 4KR0A 1GPNA 2I3DA 4X6YA 3R3UA 5LIPA 4OU5A 2WUDA 1CLEA 3F67A 5CT8A 2Y6UA 4OD0A 3FOBA 3C8HA 1QJ4A 4EB0A 2AXEA 4FDMA 4O08A 4HXEB 1W52X 1LPPA 5CTAA 2YYSA 4G8DA 2BGNA 3C6XA 3RM3A 3WZMA 2PUJA 2XUHA 2QXUA 3V9AA 5K3CA 5YASA 2Z5GA 4TGLA 4PV7A 2PBLA 2G63A 4DLNA 2ZYSA 2CUTA 3STWA 5AO9A 2LIPA 1GZ7A 1F6WA 1H2ZA 3IULA 2C58A 1GKLA 3CCCA 5C8VA 5CBKA 2GBGA 3WL5A 3I2GA 4EY5A 2DQZA 4J3JA 6YASA 4X00A 3DJYA 1UT6A 1UFOA 4CCWA 3M81A 4AO8A 4F0JA 4L72A 2OCKA 1EDDA 3WKBA 4JUIA 3FAKA 3PF8A 4BC0A 3U0VA 4KYVA 3NOXA 2XUAA 1CUWA 5JD6A 5AI0A 5E2IA 4Y2TA 5LKAA 4J0IA 5ALNA 1WPXA 4XX1A 2ZYRA 4MWSA 4GBGA 2G5TA 2WG1A 2XQJA 4H18A 5AM4A 2DCMA 3T4UA 4N8SA 5ALYA 5F4ZA 1QIIA 4BBZA 2XUPA 3H17A 3KOOA 4L0CA 3BIXA 1SFRA 5DNVA 3KSRA 3BDVA 1GGVA 5AK3A 1JKMA 5FDFA 1R88A 3JWEA 4NVRA 4U2GA 1E89A 3H0CA 4Y2VA 3I2FA 5LZ7A 1MN6A 2D5LA 4Y2JA 2JGFA 4UHCA 4LXHA 3STYA 1MU0A 1EINA 4UHDA 4FLFA 1CV2A 3FYUB 5CT9A 5D3KA 4BAZA 4BE4A 2X76A 2WHRA 2C0QA 4AMYA 4QE3A 3AIMA 5AKHA 4BZZA 3NWOA 4KE6A 1VXRA 1R1DA 4X93A 3BXPA 4K2AA 3DYVA 3I2HA 4X90A 5C8ZA 2XMSA 3GBSA 5BWBA 4BAGA 4G9EA 4QDUA 5ALOA 2O2IA 1XFDA 2QS9A 2QJRA 3G9XA 1XRRA 4IO0A 4EBBA 2GZRA 2WFLA 3AINA 1CEXA 1XZMA 3AZPA 3HYSA 4EZIA 1XRLA 2HRQA 1QOZA 4JYPA 4KJXA 1UOOA 1G42A 5HCUA 5E4JA 4E15A 2O2GA 5AK6A 1IUNA 2XQKA 3G9TA 2OCLA 4H77A 2ACKA 4IH9A 3V1KA 1E5TA 2DSNA 5SYNA 4E14A 1N5RA 3FYUC 4CIBA 3TRDA 2Z3WA 4KACA 3A70A 2HA4A 3A2LA 2ZJ6A 4FLEA 1MJ5A 2ZVDA 5K3DA 3FWHA 3D2AA 4FBMA 3ZWQA 4EY4A 2VJDA 3I1IA 1N8SA 5EHNA 4QLAA 4BTVA 1XQVA 3LIIA 4FNGA 5DYTA 2GYVA 1RP1A 1UK8A 5FP0A 3WYNA 1EB9A 2B20A 4G4IA 3S2ZA 1DT5A 4UHEA 1WM1A 5A2GA 2PVSA 2HADA 5CXUA 1P0QA 4TPKA 1TK3A 1LPSA 1XZCA 5JZSA 4AX4A 4P92A 3VDXA 5T4BA 1GXSA 4BATA 4HVTA 1ZICA 2OAGA 1EH5A 2WIKA 3I6YA 1YAJA 3PUIA 1ETHA 1THGA 1X2BA 4B80A 3BIWA 4X3CA 3WKEA 2WSLA 5JATA 1J07A 1Z68A 3V48A 4HTAA 1BRTA 3PFBA 3R0VA 4DNQA 1IZ8A 5I8PA 3D4LA 2WFLB 2Y2UA 3C5WP 1UKBA 2V9ZA 3M83A 4HAIA 2DQYA 5ALPA 5HK9A 2QRUA 4W1PA 2HA2A 5AKIA 4Y2QA 2AJCA 4BCDA 1DWQA 2AJ8A 5KBYA 5LP1A 4YX9A 4B9EA 5JYCA 1USWA 2VATA 2ZJFA 3C5VA 2ECFA 1Q0RA 2R8BA 3IUMA 4BDTA 1AGYA 5JASA 5K3BA 2XUIA 1VLQA 2QMQA 5DLPA 2XUKA 3ANTA 2AJBA 5JADA 4MEAA 2XB6A 1UZAA 2PKYX 2PSDA 3WK6A 2C0PA 2XUOA 3WK7A 4EY6A 3WL7A 3HABA 3G8YA 4X95A 4DMKA 4MXDA 1D07A 5T4HA 5KREA 2HU8A 2HDWA 2FJPA 7YASA 1MT3A 2B4KA 4OSEA 2P8SA 3U1TA 4TVKA 1GQRA 4Y2PA 4MYDA 3Q8WA 3ESDA 4UBKA 1H2XA 2J3DA 5A71A 2VF2A 4FWBA 1DX4A 1ZGCA 1XZEA 2EDAA 4XIIA 2EEPA 5FPQA 3DL7A 4G8BA 3DS8A 4K6HA 1UWCA 1AURA 3G02A 4INZA 3ESAA 5LYYA 4OUKX 2HU7A 3IDAA 5BWCA 4KEAA 1R9MA 4CG3A 3ZPXA 1R50A 1ZIYA 3FLEA 2XUFA 3O4HA 4H7FA 5AIAA 1ZD3A 2GYUA 5ISMA 3A2MA 1FFBA 4H35A 1QO9A 1XKLA 1XZJA 4L3WA 5FPPA 3I1YA 4J0GA 4A5SA 1UK7A 2Y6VA 4B83A 3H2HA 4W9RA 4BDSA 5HZGA 3WWEA 1XRNA 3N0TA 3BF7A 3WK9A 3AFIA 1U65A 2E3JA 2OGZA 4H7IA 4YK7A 4HZGA 3CN7A 1E3QA 2WG0A 3I6MA 4X92A 3BL8A 1FFDA 2VT7A 1MNQA 1TCBA 2PL5A 4QWMA 3HRHA 4BRZA 3G0IA 5DJ5A 3D59A 4Q82A 4DGQA 4C01A 3WA6A 3BDIA 5JZBA 1R3DA 1K6EA 5AHXA 5BOVA 5AKKA 1GPKA 5I9IA 1Q84A 4UBOA 4Y7DA 4E11A 5IH7A 1JJIA 2XQGA 4ETWA 4W1SA 3NGMA 1Y37A 3PFCA 2BAGA 5LZ2A 3OC0A 4C4YA 1F8UA 3DQZA 1WB6A 3N2ZB 3IUQA 1L7RA 2J4FA 3ZV7A 3QM1A 3WK4A 3OG9A 1CUHA 4B0OA 4B6GA 4U2DA 1MX9A 3JW8A 3JYHA 3DKRA 4PW0A 5DYWA 4UBMA 3STVA 5LKRA 5ALFA 1NU6A 3TJMA 1ZOIA 5C7YA 2QT9A 5JALA 3W2TA 3KXPA 1UKAA 1WB4A 2XLBA 4YASA 2WHQA 4ZV9A 5CMLA 5ALJA 3MGAA 4ARBA 1HPLA 1LBSA 1CUDA 3CN9A 3FYTA 1K5PA 2XT0A 3F98A 2XMRA 4JH0A 4KRYA 2YXPX 3WKAA 2WIFA 1Q83A 2I3ZA 2XQFA 3KD2A 4LXIA 2GBIA 1LLFA 5EFZA 2RAUA 5EIHA 5JD4A 4OYLA 4U2EA 4CI9A 1XZDA 4W63A 3GFFA 4QA9A 2WFZA 2OGTA 1JU4A 3M82A 3WIOA 4Q1VA 4B85A 3OPMA 5E4TA 1PV1A 3H04A 5KWIA
chains in the Genus database with same CATH superfamily
3QEOA 4FBLA 3BE8A 4YCAA 5HP4A 2Q5IA 1RCFA 1LGYA 3D7KA 3LFTA 4K87A 4BKMA 2OM2A 1HZZC 3QTBA 1I51A 2V6JA 3ZHBA 3KDPA 5H0IA 2GCNA 2WF8A 1ZESA 3L4EA 3RFCA 1JEYB 3WI7A 1L5ZA 1NI4B 1HNNA 1B4DA 3U1VA 2YDYA 4KN5A 1GZSA 2R1VA 2DBZA 3GRFA 1LLCA 4J8PA 5LZ5A 4BVBA 1XVLA 2NN3C 3BERA 2P5UA 3CLRD 3MIZA 5EJFA 1TUBA 1Z6GA 4L5AA 1TCUA 4RZ2A 2VNHA 3ZE9A 4PSDA 1GFSA 3MCAA 4DUPA 3KOWA 3A2NA 4YREA 4FXPA 4OYYA 4TKVA 3BWYA 2OBMA 3Q5DA 5AKJA 1B6GA 3RB8A 3TRJA 1XA0A 3MJCA 2I6UA 1A04A 2AFIE 2NVOA 1Z6QA 4LYFA 4LZLA 3RAFC 5JFTA 4Z4GA 3UG6A 3AILA 3HNOA 2W83A 1N57A 2AEJA 3MTQA 3DMPA 5F1PA 1KZ1A 3HO1A 2RGUA 4OCZA 1QORA 1QBGA 3O74A 4ZAWA 4BNHA 1ZRHA 3DUFB 5A4KA 4YPOA 3HXKA 1QFMA 1ZONA 3LVBA 2PS9A 3UAOA 4GMFA 1KDTA 3KELA 2IF0A 4TMVA 4S2UA 3CRMA 3K53A 3CW8X 4ZYZA 1XMSA 3IUEA 1VFNA 3O0DA 4PZZA 4CTJA 4B87A 3HB9A 4DSOA 4MUIA 5CDSA 2WTAA 1XMPA 2VJYA 1C3OA 4E5UA 4DV2B 4LOJA 3LOUA 4XOUA 3NYWA 3F7MA 4BP1A 1J0CA 5JPCA 4RLQA 4TYWA 3BX1A 3FLBA 2WM2A 3IAXA 3BB3A 4ZA2A 5DNYB 3DDZX 4L4RA 5IAEA 4CLDA 3K9LA 1N6LA 5SZKB 4HWOA 2JKVA 3GF4A 1VZ2A 2BBWA 1MIOA 3LBFA 5EZQA 1ODSA 3I5UA 3TE7A 5KX5B 1M1UA 4F3KA 4V3CA 2OCIA 2ZDHA 2ZVJA 2V7UA 1HYGA 1O6GA 2R84A 4KYIB 3B53X 3ZI0A 2AMFA 3TEJA 4AD8A 1X3SA 5IUJC 3L92A 3NV7A 1XCJA 3C0KA 3NUGA 1DAFA 3OJWA 1B0PA 5JPIA 2QTTA 1MJGA 2O54A 5ILQA 4DQUA 1CJMA 1TKBA 2FPSA 1PR9A 2P35A 1I33A 5DK4A 1SB8A 1C50A 1PFGA 2LWIA 4EKDA 4YBRA 4W99A 3DULA 2EATA 1SVNA 1HG1A 3ZZ1A 2DUJA 3OOEA 3L6DA 5FEMA 1N9GB 3N9IA 1JR3A 1X1TA 2R25B 3DE7X 3D3WB 1N36B 3T3DA 3TDKA 3BXFA 1UXKA 5JJCA 1NT4A 2E48A 4HLCA 3FWYA 1P1JA 5EJ6A 3SJBA 3SF8A 1GM5A 1RRMA 2CXTA 2QN2A 4JLJA 1YQDA 1OWNA 3Q2KA 1C4KA 1DRUA 5DTEA 5I4IA 2HJGA 2GBPA 5LYJB 4MWBA 1HOTA 3G0OA 3MCUA 4H15A 4DDKA 1V95A 1U3FA 1W5SA 2DFLA 2IYWA 3D8SA 1EK1A 3OZCA 3FUXA 2WABA 3G17A 3P2OA 5J59A 3A7DA 4FE3A 4X3OA 4X41A 4M0EA 2AT1A 3VSDA 1YA8A 2HFKA 4EGAA 1QQ7A 1KI3A 2QSUA 3LLCA 2IXDA 2JJ1A 3RFVA 1F4LA 5K3FA 2HY7A 2E5WA 2PGLA 4WJZA 1I5OA 4X1IA 4EUSA 4E51A 1WB5A 1XEAA 3UT6A 5GADl 3UNXA 2CKMA 2ZBEA 1GLVA 1LF5A 1NVVQ 3NGXA 1N2SA 5EAIA 1ZM3A 3V8QA 4F4FA 4EX6A 5A06A 2P8JA 5GONA 3INGA 3QELB 1CQXA 1CJCA 2B21A 3I3SR 4JODA 5FI0B 5IJ9B 4HO1X 1AQNA 4P83A 1A69A 2OXTA 3D6NB 3GUZA 1PZMA 5HUJA 5FUVA 5AP9A 5BSRA 1TM7E 4KWHA 2E18A 2J41A 3TCXB 4BO2A 1XN4A 2DVMA 1Y63A 2O7VA 4I14A 3A2KA 4S0ZA 2TMGA 2M9MA 2XAAA 3GFRA 1ISRA 1ZGBA 4HFMA 3E15A 4MV8A 3RABA 3T7IA 1YMVA 4ARAA 4EUEA 1J1UA 2YZGA 1Y7IA 3L7YA 4WPGA 3NETA 4ANFA 5H9VA 1X2EA 4CKXA 2PWYA 2A94A 2IK8A 2BUAA 3UY4A 4B1FA 5DNUA 2PT6A 3O92A 4YH1A 1GPAA 4RD1A 5BW8A 4BNXA 1DBSA 3MTJA 1T3HA 2OV2A 3WGOA 1WDWB 1VM6A 2JF0A 4FKBA 3FNEA 4BFTA 2RHCA 2YY7A 1L7AA 1C1XB 4NX2A 3SBEA 4HUTA 5LP6F 2F3TA 5FA6A 3RVBA 1GAEO 1XEWY 3T7JA 1STOA 3SC6A 1Z9BA 1C7IA 4U8GA 3TPFA 1Z7WA 1ZH4A 1DIGA 1WBJB 2ODEA 1HEUA 2WE7A 5BSHA 2RH8A 4TWRA 5DW3A 1CQJA 1N5IA 1NSFA 3WIVA 4DMCA 5FOQA 2X41A 3CVVA 2HA7A 2HHHB 3I37X 3H11A 3IOMA 4WZBE 3OCWA 2GZSA 4FGZA 2QTAA 3NW9A 1PG2A 4PC1A 1LUAA 2C7VA 4PSUA 3SSOA 3CISA 1OXMA 3KJHA 4Q48A 4UUMA 1SIOA 2O8EB 4AJEA 2FSVC 3O1HB 3L1KA 1R12A 1MQSA 2CHGA 3NDJA 1HT2E 1Q15A 2ZSJA 3PD7A 3PXUA 1PHRA 3PDCA 1K68A 2O2DA 5HCIA 1JQJC 5KU7A 2VAWA 3AUSA 3TMAA 1VDMA 3U4AA 1ZSNA 5AW4A 2FE1A 5BNTA 3A11A 3BTVA 3ROEA 2O1XA 3PUZA 2XUZA 3CIFA 3ISJA 2M6SA 1DKQA 3R3ZA 5THQA 2A2ZA 5IT9A 1SHJA 2QN6A 4W5QA 2H54A 1NQVA 1W6RA 3LT5A 4GSKA 4N5HX 3LZCA 5HKLA 3Q3EA 1M72A 3GROA 3I5YA 2PUEA 4XH9B 4FINA 4RL6A 5HG0A 1NQWA 3H1PA 6ABPA 4RVSA 1A2QA 3ILHA 4CKCA 4EHFA 5KSWB 5C1DA 4JLDA 3SIRA 1ZH6A 4DT1B 1VSTA 2BFEA 2QSJA 3NJRA 5T41A 4L9SA 3DKKA 2AMYA 1Z2PX 3DAGA 3PVSA 5KTRA 1XO1A 3D7LA 3TCNA 2W0SA 1DAGA 4FDAA 1XJQA 4FSXA 1EMDA 4NIMA 1PR0A 4K46A 4DTIA 3A6JA 1CNEA 2DHEA 4OPMA 2DPXA 3KPUA 5E4FA 1DAOA 2DWCA 5JYEA 4UDXX 3HCPA 2QUBA 5G0UA 4C7MA 1M6WA 5JZVA 1TZKA 1B00A 4Q02A 1BO6A 1L7VC 4I99A 1QDEA 3CSDA 2VHQA 2ZI6A 3QPCA 3U4MA 1VJDA 2XYHA 2XXJA 5GIOE 1KDPA 1R64A 3ROKA 5BURA 1U8YA 3O7MA 4U6SA 3AQ4A 4ILEA 1N7HA 1YA6A 4IICA 5LA6B 3SNHA 2OXEA 3BF8A 3CX6A 2PKCA 5CM8B 4EMSA 4F38A 3AOEA 1G21A 1W5BA 1GPH1 1IJFA 5FX2A 4S1OA 4B9AA 3CF4A 4GX1A 2VAXA 2Z6UA 1N5JA 1T9GS 3A4TA 1VRCA 2X8JA 3EZNA 2GUWA 3QP9A 5AVOA 4BB0A 4DLRA 4UQOA 3S8EA 1N0WA 1WD7A 2H0AA 1G64A 3AIIA 4RY0A 4U3JB 1YDEA 2RGCA 2GM4A 1NZFA 2ZUDA 4K6GA 1C9MA 1NFRA 3A4LA 4JP5A 1YTUA 1VXOA 3PVCA 3RHSA 3QV2A 3CWZA 3IBSA 2G67A 1E2PA 1T2NA 2R1UA 1Z37A 2QT1A 4LK2A 5F1OA 3QPDA 4BFLA 2QK4A 4I1VA 1BOOA 5KDDA 1VIVA 4A1FA 2DECA 2XCLA 3IO3A 5GM1A 1QIGA 2A7XA 2MYTA 3H18A 5AKEA 1OAOC 3K0BA 2I3BA 4R16A 3U7GA 4TL6A 5DYIA 4Y2XA 2RKWA 1YD7A 4XEUA 5DLEA 3WTBA 5KPJA 1N1EA 3SWWA 3KB1A 1KQPA 1NY6A 1YB6A 2BMWA 2HRRA 2MWMA 3LQRA 4U7WA 4F1WA 3AGQA 4IW3B 4REOA 5D5QA 4IP0A 1E1CB 5HWSA 2J0SA 2JVJA 4MVYA 5CDYA 1JSLA 4PBTA 3U80A 5CBPB 5ESRA 5LLDA 3AW9A 1FDWA 4HMPA 1AM4D 4IMRA 2P40A 5CXXA 3IAM1 2YC4C 3DNFA 4DEVA 1CZKA 1CRQA 2JA1A 4QELA 1W4ZA 5HFJA 5A6SB 4XUDA 3MD0A 4AUMA 5J4KA 3NS7A 5K8IA 5EIFA 2BN4A 4EB6A 3A1SA 4C7JA 4FYWA 4HZUA 3VDRA 3JWHA 2KSQA 3JVVA 5DCUA 2QIOA 1NYLA 1P9NA 3TLBA 3K31A 4EHBA 4UE3S 1MDFA 4YGXB 2AOWA 3IHWA 4QOEA 2VDUE 4TWZA 5ALWA 4N0DA 4OSPA 4E7OA 3ZYCA 2C5SA 5GONF 4M0DA 1M1NB 3KL4A 4DIEA 1Z6YA 4MW7A 3V6MA 5IN4A 5AJHA 1CETA 3PICA 4IRXA 4KPFC 4E32A 1WP4A 2ZSDA 2QVYX 3E5RA 1W76A 4FZ3A 1C7FA 1JE0A 3KWJA 1FX0A 2XVXA 3M89A 1TE2A 4TLMB 4XD7A 3ZD9A 4L76A 1Z06A 3AUJB 3VKWA 2EJWA 3L1JA 1GQ2A 3P4XA 1YZLA 4Y9RA 4EG3A 5IASA 2C5GA 3NBQA 4OL9A 2ONCA 2OHIA 3JQ7A 4GVLA 3SK0A 3SQNA 2ZKLA 4KHZA 3B3JA 5DHTA 3V4FA 3BORA 2VQDA 3DYIA 3ICCA 1E6KA 2O2JA 1BXZA 3EVNA 4G8CA 5HZMA 1IPHA 3Q41A 4PQGA 3RW9A 1GFZA 4ENRA 1QU3A 3S6JA 2OG1A 1ZI9A 2AR9A 4KG7A 4MS1A 4C4TA 3GLQA 2B30A 1LRJA 2H11A 3I53A 3UJ7A 4CIYA 4GYYA 2PPLA 4AO6A 3AYZB 3VH4A 3ZHCA 3G85A 2ZT8A 5KVVA 3KB2A 2DH5A 3GRPA 1NRWA 2R4UA 3H16A 2WWRA 2B99A 3BRWD 3DFFA 1X7GA 2JIPA 1SPBS 3R5KA 4I55B 2JDID 3IUJA 2XDAA 1VE6A 1DFGA 4A73A 2HA5A 2Y77A 3LA8A 1JF8A 3O2NA 4GX2A 4IQ8A 4QPDA 1VGRA 5KSZA 2P3OA 4YO8A 1WZ2A 1VHDA 3N05A 2BH9A 4RD6A 1SKYE 2PU7A 3GMDA 3PGXA 1UZNA 5DBEX 1GGJA 1MG0A 1P77A 2OYCA 3FCYA 4EA9A 2W70A 4FDLA 3PQEA 5EG5A 1VBNA 2YWDA 2AN1A 4QPPA 5J4VA 2A0XA 2HLNA 2X5KO 4KN8A 2CC2A 4Q39A 2GD0A 4RYLA 3WK5A 4DSAA 4MI1A 3ICEA 3CWQA 3PNSA 3PR1A 5KOJB 1E9DA 1UK9A 3CKYA 3FNRA 3CUUA 3KJEA 4HYEA 4IDOA 1L5LA 1GCAA 5F5NA 4INOA 1P4GA 4KWTA 3BGVA 1OTYA 4FMDB 4MS3B 5HKAA 3EWAA 5JPDA 4BEVA 4YHHB 3S44A 5JDIC 1YVEI 1W36B 3CYFA 2Q28A 4RZHA 4X6LA 1HOXA 1MQ8B 1QV9A 1JJBA 2XOKA 4P82A 4RSHA 1XZFA 2X8BA 2GETA 2VPIA 2W2TA 4HMQA 3B6KA 3ZS8A 1ST2A 2NSYA 4IR7A 2IITA 4C6HA 3DP9A 1ZIPA 5AUOB 3QEJA 1HI9A 1W0KD 1WUJS 2CL5A 4FZJA 2EQ5A 4OQEA 1X1CA 1ABEA 1E2JA 2ENUA 3HUTA 3KX2A 2P4UA 3OY2A 2P2GA 1F60A 1OA0A 4ZVSA 4A23A 4CMHA 4Q1DA 4EEKA 4PGGA 1YE8A 3WSTA 1RLOA 4GICA 3KR1A 1E1KA 1G2QA 3CLVA 4WBNB 2HIHA 4CDNA 3MYYA 5CDGA 2ERCA 2QHXA 5B6JA 3B1ZA 4JI4B 1Z4PX 1RQNA 1KMQA 2WD8A 3FDJA 5CJJA 4YRJA 5JD5A 4GI1A 2BHTA 1SAYA 2QJWA 4RANA 3ZC3A 1HL7A 2E87A 3FAZA 1KPHA 4G1VA 1J56A 2O5EA 1JX6A 4U00A 1ISMA 2LIVA 5DCWA 3EGDB 5EYPB 1D8AA 3K9HA 3LBHA 2WIDA 2PGIA 3E2MA 3GRYA 5A3VA 5CDFA 3GLFA 4QM6A 1UDXA 2JGMA 1LDMA 2JHFA 2ZAGA 3GLRA 3IMKA 3LSYA 2YY5A 4XB1A 4YJ2B 1WPGA 4UM9B 3QW4B 2IUUA 1GAXA 2HBRA 4UUAA 5KSPA 5DX1A 5FV7A 2RKOA 4WT7A 1FXWA 1UBGA 4FHEA 4OYHA 2IH2A 5DHSA 4MIKA 1WKBA 5IHXA 1ZPDA 4PC7A 4AP9A 3Q7RA 3ZE8A 4MTLA 3M8KA 2GHTA 2R1TA 4F1KA 3NVDA 4DQVA 5FQNA 1C7EA 4IFIA 3BD6A 1ULUA 2ISSD 2PR7A 3L93A 3D5EA 4ZQCB 2WAYA 2X22A 3ZWCA 821PA 1GTZA 4YWJA 4QPJC 2OLEA 1ZS9A 1CE8A 1Y1RA 1NI3A 1SVMA 3JYLA 3WGJA 4URVR 2BEUA 1OLXB 5CLJA 1NNUA 1G2IA 4L2IB 1Q1GA 2W2XA 3JWIA 4N39A 3NC0C 4UVIA 3HJCA 3VBEA 3VR0A 2HOQA 3GJZA 3TIXB 1TC2A 2VZEA 3VPDA 3WJ1A 5E9QA 1NXQA 2QVZX 2V3VA 4FZRA 4PX3A 3TFQA 3N53A 3EVGA 4RTOA 5IAKA 3ZX5A 3DBHA 4DUGA 1J5PA 4HQFA 4U0KA 5DULA 2H2DA 1QHYA 5JV5A 5J1SB 1PGQA 1M2VB 3FA2A 1P4SA 2B83A 2GM3A 3OVMA 1NG9A 3DEHA 4JA0A 1KYWA 1Y5NA 1RQGA 5LN1A 1NBHA 1VRWA 3G0HA 1NURA 4FWIB 4CCYA 1XELA 2OZLB 3HLTA 4OK6A 1J97A 2ODWA 2WM9B 3ESCA 4MGZR 3BMNA 2GZHA 5CCDA 2CLOB 1UXHA 2VO1A 2QPAA 4O29A 1K66A 1Y42X 3SQMA 2EX4A 3R1IA 4KX3A 1WZEA 1G6HA 1Q1ZA 3OLQA 2B4YA 5AKLA 2CXUA 3SEQA 1ID1A 3IA2A 4G8JA 1QLJA 2FPPB 3ASZA 5IKOA 5D86A 3RWOA 3EISA 3I42A 4ND8A 4XYBA 3ELYA 4O4JA 2I80A 4ZT6A 4RHFA 4M76B 5G4LA 2ANBA 1R8QA 3RS3A 3UUEA 3QPWA 1BOFA 1J25A 3PL5A 2X0IA 2UUCB 1MO2A 3AY0A 3A6DA 3LFHA 3D3QA 4J7CA 2ZROA 4J07A 3NVKI 2V98A 3PEFA 2WMYA 3SFVA 1RWMA 2J33A 4MV9A 3AH8A 4J3NA 4P0PB 2QTHA 3SIXA 1FY2A 1RADA 2BFBB 3T1VA 4V1CI 2QTLA 2CXNA 2PDAA 2DFKB 2WJ6A 3THYA 2ZBGA 3COSA 3KKOA 4IUYA 3FF1A 4BO7A 2I2AA 2Q3JA 1HK7A 1SA0A 3LLSA 1WEHA 5D7BA 3WWDA 1RW4A 2AH5A 2QTVB 3GVPA 3IH5A 3QVMA 3REGA 5EHZA 1MHTA 4JUDX 2B5OA 5CLHA 3MG9A 4MWCA 3WJ2A 3LVQE 3K4HA 3MGBA 2VJPA 4G86A 4WK0B 1FMCA 1AHNA 3U13A 3UJ9A 4JJ8A 2NTYC 3FXAA 4OHOA 1IXYA 3R41A 1VKOA 3K7EA 2OOKA 4TT3D 1EHIA 1YBMA 2J3MA 1DKRA 1GITA 2FMXA 2YV4A 3H19A 4AF7A 9LDTA 3RTEA 1UXGA 1QIKA 1T4CB 3WJ7A 1RTKA 4Y2YA 3TL2A 5HFAA 3MWKA 3EUFA 5AJTA 4HH1A 4LV5B 2VQFB 4PX5A 1K89A 3M6LA 5AT1A 1W59A 4FMBB 3TEFA 1XMOB 2PFGA 2H9YA 4CNBA 3QBJA 2HM7A 2P9EA 2Q4OA 5AJXA 4R8SA 1DGQA 4GRAA 2FZCA 1U3TA 5JI3E 4P3NA 1B2RA 1UQUA 4PFJA 1RBZA 4V2IA 4YCNA 1NVWQ 4FZ5A 4ZOLB 1TA0A 4JQYA 3UGJA 3BWBA 3BZUA 1TIKA 1WCXA 4G0WA 2FOIA 3TKAA 1N5DA 1YZFA 2AQKA 3EZ6A 1OJ7A 2NMVA 3KZVA 5G0TA 1YJAA 3WLTA 4MYUA 2POQX 2JGNA 4NYIR 4CMJA 2Z4TA 3FPCA 2DX7A 3ND7A 4YP0A 5K05A 1O6FA 2I7DA 2FG7C 1NSYA 3GYGA 4WZ6A 2IY8A 2V4UA 1O5IA 4BTEA 5CLGA 4E6EA 4C76A 2W8BA 4JI6B 2H1VA 3K1TA 1BDIA 3H83A 1TF2A 1FP7A 2V7EA 4M0PA 1DUSA 3D4PA 3EFOB 2FQWA 5IYZB 2VJMB 1NUAA 3V1NA 5KNBA 2XKKA 2F59A 4XUGB 3KOUA 1H1TA 1N6HA 1XCGB 221PA 2OTCA 3DOFA 1T5LA 2I4RA 4EUNA 5I7EA 2VP4A 4MS4A 1SUFA 4OATA 3OO1A 4TTSA 3T4XA 5C53B 1UMDA 1ZOPA 5EXPA 4UTPA 2I1LA 2R8EA 1E1RD 2QYOA 4ILKA 2BSAA 1F0PA 1SKAA 2OHJA 4V38A 5E3HA 3U39A 5CT4A 2AZTA 3VJKA 2C7BA 4E31A 1I2CA 2IIBA 1RR6A 3RC3A 3WQBA 1KYQA 1S8AA 1ABFA 3T5DA 4F3YA 1U9CA 3MS2A 2Q3FA 2DTEA 1F12A 1E4YA 2FPOA 4F3TA 3JX9A 4DMFA 1PS8A 4JVMA 3WIBA 2NU6A 1EM6A 4V0SA 2RGYA 1GN8A 2G4CA 1N5MA 3E9EA 5FFMA 1C4XA 3TL3A 2VS1A 1MQAA 3RFXA 1S5PA 3H84A 4XFKA 3AB7A 5C5CA 4PM4A 3AF6A 1LI4A 3AX6A 3GEMA 4F46A 5MN6A 3QE9Y 1FXWF 1M2OB 2REOA 3QU5A 2DMRA 1W4LA 3W0LB 5H3CA 1A4UA 4TLCA 2HYIC 3OCCA 2FUKA 1EWKA 3MS7A 2OYSA 3AHCA 1P2SA 2BP7A 4I4CA 1CJUC 5IAGA 5HKBA 1XRJA 3Q8KA 3HI4A 3G0DA 5JLAA 3NQ41 5JC8A 2JCBA 3JQEA 4GW3A 3SKXA 4DPKA 3IAS6 4R0MA 3GPLA 1XMVA 3OQHA 1XLVA 4A0QA 3U60B 5F23A 2PD3A 4XIJA 2BGLA 1EFUA 3LM8A 3SXJA 1ADBA 4IUBS 3O93A 4JOCA 3RANA 3RK1A 2XBMA 2OV8A 2GD2A 2DH6A 1N2ZA 1K7CA 4UZFA 4CU2A 1FP6A 4OMFG 3I52A 3FB4A 1UWKA 1JIUA 1A9RA 3RREA 1V26A 3PQ2A 3ZCUA 4F60A 4YMHA 3C3YA 1Y0BA 2LNDA 4RF5A 5FUQA 3TQRA 1KAEA 3K5IA 1SCUB 1Z2NX 2GKGA 1E4VA 4MP3A 1RLMA 3EGXB 4KMOA 2ZJAA 4H3KB 2GTHA 5HR5A 5JMTA 1GAJA 3PDIA 4YHBA 4B75A 4R1SA 4UVHA 3JVUA 4NBLA 3DLTA 4AMVA 4AYXA 4DEYA 4RVNA 4FB4A 4CIAA 1RXYA 1YCHA 4HUQB 2FSGA 2BEJA 4REMA 3I2YX 4KO4S 2XMZA 1AQUA 2JAQA 2Q1SA 1S3FA 2G77B 3D31A 4ETIA 3FCAA 2BZ0A 2EWMA 5EJ5A 1U99A 3HCAA 3W2GA 1ZD8A 2P6PA 5DLQC 2PLWA 2D1YA 2XTJA 4RKEA 4C5BA 4CFSA 2C7QA 4JGGA 1Z5VA 3D6JA 4O4JF 1JPVA 1M0SA 1MUUA 2J07A 2W43A 4G4JA 2XMPA 1UJNA 4QYWA 3WRWA 2YCBA 1G2OA 1Y1TA 1YL6A 2R11A 3NT5A 5JWRA 1IM2A 4I1UA 3E48A 2AJLI 5LWHA 1N1MA 2GBCA 3M6MD 2P3SA 1DO0A 5KTSA 1JH8A 1JV2B 3FOWA 3IQHX 2WF6A 4TRMA 3HA7A 3KUXA 4Q4JA 4NZZA 2EZ9A 2J8ZA 1H9AA 1GA4A 4GQAA 2VNJA 4MRVA 3DA8A 1SELA 2O3SA 3PSAA 3WB0A 3S4YA 4PG7A 1BGWA 3O8QB 4WBXC 1ORVA 4P80A 4ECEA 4EPRA 1PK8A 2AIRA 4IX1A 4CM3A 3LDGA 2W11A 1NVBA 1I9CA 2XMGA 1W2HA 3P32A 5K2OA 2I6SA 4EPWA 1IQPA 3IOYA 1XD2A 2WSYB 4JP1A 4LJSA 5ALSA 1EXNA 1XGKA 3A1CA 2ZRFA 4HGNA 1YIOA 1I3MA 2I54A 4LIPD 1KFCB 5ALKA 2FFBA 2OORC 1I2ZA 2QYSA 1AB6A 4IOKA 2G40A 3EW9A 1QG6A 1MC8A 3EXFA 4XEHA 2PSFA 4EYOA 4UUQA 2ONJA 4GEKA 3VRHA 5HF9A 3EG5A 1UH5A 3F97A 1QMGA 3DM9B 4MAMA 4RSRA 2J87A 3GEPA 4LJ7A 5KQRA 1P7WA 5AOCA 4ROSA 2ZBUA 2VA9A 5GV7A 4DSUA 4N12A 2XMQA 1WBBA 2WJGA 3ZEIA 2XI4A 2YJGA 1PJZA 2ZT6A 1XV5A 1PFVA 4HDCA 3WDSA 1N5LA 4NKRA 4B4VA 4QGGA 4BX9A 4EPVA 5IAAA 4H7EA 3SN6A 1C0EA 2B78A 1VE3A 3UJHA 3KSAC 4DABA 2Q1WA 1BW9A 4Z49A 3T4EA 4QSMA 1ECBA 3FNBA 2VYFA 2UZ0A 3HUEA 3ZNPA 4QLBA 4BE9A 1YUNA 2FUG6 1CR6A 4J0DA 1CR1A 2WUEA 5LMUB 5IUNC 2QN1A 1LNSA 3ETGA 1V41E 2C84A 4EKGA 2JLUA 1EZZA 5E1BA 3EQ8A 1W2GA 1ZH0A 4C0QC 2QM8A 1BHQ1 4UTXA 1Q16A 1SIUA 2DTXA 1F9AA 3C7KA 1Z39A 1KAMA 3WMGA 2A7QA 3HA3A 5BRAA 4J0EA 2WZBA 1AKTA 3DNPA 4A1OA 2BMAA 5JXHA 5TQ2B 2NQ2C 3HZOA 3ISVA 4O3FA 2GEUA 2FZKA 5KYYB 2N46A 2Y05A 3VUEA 1SPXA 2CKDA 5B3JC 4OHMA 1HYHA 4Z86A 2BF4A 5FH9A 4BNWA 3SSMA 1WUHS 3KLNA 5FL7A 3IE1A 1PVOA 1CRLA 1G8YA 4FNMA 3BMCA 1WW3A 1OC4A 2EV9A 4NBVA 2IX9A 2RJOA 2SKDA 3C6MA 2PCJA 3E3AA 4MQ5A 1OHHA 4YONB 2J31A 1RHRA 2X0EA 2QKYA 1VGVA 1NN1A 1QLHA 3D3NA 1J49A 3MMSA 2CDAA 4ROTA 4PNZA 4KBYA 4JZKA 2UVQA 3NWPA 3ZH9B 3F6BX 4I3GA 3I9MA 4ABTA 3FVWA 3RIYA 1SU8A 3SHTA 1XZBA 4NV1A 3UUGA 4KXYA 4A8TA 4BB6A 2DOKA 3FNFA 3ZUPA 4MYCA 4M0KA 3JQBC 3TKYA 3RC7A 1WNTA 1RZUA 2D1RA 2V9PA 3PBKA 3S5UA 4D3SA 4DILA 1QOPB 3T3EA 5A3QA 3K6SB 1WSWA 2V7VA 3ZK7A 3EMDA 4DARA 2Z9DA 3EYWA 1NQTA 2FPIA 3NHJA 3NPMA 4YCJA 5FF9A 1J90A 2UUPA 3UJPA 4CF7A 3TE6A 1DQNA 1I13A 3V33A 1UM9B 5K0FA 3GCGA 4JQOA 1OTXA 4FHCA 3IIKA 1DUVG 4U8HA 4P81A 1BE0A 1OCEA 2K2QB 3FNIA 4PTZA 1H6BA 4E09A 3HDHA 4G37A 2ST1A 3LKBA 1D1QA 4XSVA 1UBNA 4YNBA 4CKEA 2PNJA 1V45E 4DQXA 4IGEA 5AM0A 3WRXA 1P45A 1CB0A 1U1CA 4AX8A 1ZBDA 1IB6A 3ZZUA 4RD2A 1NM5C 1EJ0A 5BYAA 3I73A 5EPUA 4DIUA 4UDYX 5TE9A 2BR5A 2CLDX 1TJPB 5KSYA 5AI5A 2VAVA 2HAEA 3R09A 4OXKA 5LP6C 1GCIA 5DF1A 1XIVA 2WWFA 2GHIA 4WCDA 5LL6P 2BGRA 1WCWA 2WJPA 4N49A 4S1PA 3NDBB 2OP1A 3MN1A 4OI0A 4ZOQI 2WT4A 1U9ZA 1YCDA 1VA5A 1QYVA 3K35A 2BGUA 1CRWG 2Q29A 4LDQA 3HO6A 2VXOA 5DHPA 2CF6A 3IS3A 3T38A 2Q3MA 4ZCMA 3IPRA 1S2MA 5FO0A 1G5IA 1PEKE 1FUUA 3UJDA 2Q3DA 1RS0A 2QN3A 3DFZA 4JCCA 3WLRA 2BFOA 2CV1A 3V8BA 2JJYA 2JCGA 3M2TA 4MJ3A 3D1VA 3LP8A 2VNIA 1D2GA 4CLRB 4HLUA 2GK4A 3OT1A 1UDCA 1QHHA 2HA0A 3AIOA 3DNMA 4R2KA 2DLDA 3MTGA 2IYEA 3OQPA 4G0ZA 5LD2C 1F7VA 3PIDA 4I1YA 4KE8A 2DJ5A 5JS2A 1OXVA 2GS9A 1J7JA 2PWBA 3HKBA 1V4NA 5ALIA 4I3HA 1N77A 3BT7A 1P7VA 3GG9A 4Y98A 1LZKA 4NH4A 3JQRA 1YQUA 4H0FA 5EKDA 4YAUA 1F1BA 4A3SA 3MWLA 3WICA 3BXGA 1NVGA 4MRNA 1N2CE 3HVHA 3OFVA 4X20A 5HBGA 4Z0NA 4A6EA 2CV2A 1DQYA 4BFCA 2OHOA 2JZOA 2V8OA 3ZVNA 4DCTA 1KO1A 1DCKA 1TD1A 2GPWA 2HRCA 4OX9B 3AG6A 2R8ZA 3GLVA 4WADA 5K0GA 5AW6A 4J90A 3QVSA 4OREX 4P36A 3FB1A 3RVJA 3V1LA 2ZT5A 3W5JA 4NFLA 1XK7A 3C4JA 1ZJYA 5B6PA 2CJYA 3GLGB 1OB2A 4P7BA 3DMFA 4R01A 3WLQA 3L1HA 3LF2A 3OEEA 4DY6A 4EJMA 3OX2A 4R5MA 4DLXA 3PE4A 1U3VA 2PKEA 2LDXA 3NNNA 4CEIB 4P35A 5DX8A 1BXRB 3UQYS 1MFPA 2QVCA 2WIGA 4D8XA 1CFJA 1T2EA 1X7XA 1SUPA 3H5OA 4TTVA 4DC0A 3UUWA 1P9LA 5IVHA 3C6BA 3GGPA 2C4HA 3OF5A 3A6PC 2QLBA 3A3OA 3AESB 1ILEA 3DWEX 3OZFA 3Q1KA 2PH1A 4YJ3A 3HYLA 4AC9A 2IPAB 3UW3A 4AN0A 1G21E 3H2SA 3N07A 1IOVA 4KO1S 2RGWA 1C4WA 4MK4A 4P7KA 2UYCA 2C3OA 3S7TA 3UT5B 2GAOA 3ZJYA 2ZITA 4BLOA 4ZT4A 3THWA 1I6WA 1QC5A 1NMXA 3GVIA 3IFSA 1A8UA 1H2FA 1PL7A 3G2JA 2QLTA 4MKXA 5IC4A 1FBNA 1IY1A 5KTNA 1K92A 4AKHA 1ZVQA 2MSNA 1QHGA 1MG5A 2X5OA 3MAGA 5HFNA 5A3JA 4QNNA 2DJIA 3B1YA 1R4ZA 4O1MA 5F7XA 4B5LA 5EC8A 3IP5A 1GG5A 4I5DA 1R4AA 2IVFA 1ZISA 3IIIA 4MZXA 3ZDRA 4EFMA 2I7VA 1Y7TA 8GPBA 4PWZA 3A36A 1Y9EA 1H2BA 2Y4OA 4EUKA 1X0VA 5E8JA 2Z43A 2NZ2A 4GYKA 5AOAA 5EESA 4NECA 1G7SA 5LCXA 4ZHQB 1B8OA 1VECA 4IZHA 2CZQA 2ZJ8A 2ZFUA 5BQ3A 1XNQB 1E4EB 4XW2A 4C1BA 4BGDA 2WF9A 5CW2A 1P1IA 2IIVA 3U31A 4GAEA 3A10A 1IY8A 5HIKA 1A0OA 1ZL2A 1DBWA 4N5IX 4ZXFA 1ZD5A 3A1WA 4XVCA 2WIAA 2P6RA 1FUIA 4B45A 3GO4A 3LS2A 3MERA 4PC6A 2D0PB 3BFJA 3CRRA 5FWYB 1UODA 3NBZC 4RK0A 5B1HA 1WXEA 2C5LA 2GF9A 3AJDA 2HXSA 2MR5A 1X7HA 1K5HA 4I5IA 1WQ3A 1GAWA 3DDSA 4W5TA 1P1KA 1WXIA 4L8WB 2QZZA 3RK4A 1FSSA 3LPNA 3MBKA 4D3DA 3IT2A 2MCFA 1CVIA 2FJ0A 4MVXA 1RXWA 2UYQA 2HEGA 4JC0A 4ZT7A 5C2JB 5CFRA 1WCIB 1XDSA 1IBKB 2TECE 4HNAB 4EYQA 5CT6A 5D84A 4QRDA 4HNUA 3C6YA 5AUNB 4Y2UA 1OX4A 2EAUA 1EEXB 2BVNA 2PHZA 3GEBA 2Y68A 2J9YB 3KP1A 4MO9A 1JR4A 4W9NC 4OXYA 3HVIA 2EXXA 1H1LA 2PSEA 4XVUA 2JIZA 1KEEA 4JI1B 4CLOB 3C24A 3VR6A 3CF6R 3GELA 3DDUA 4AZ0A 4D7AA 2JIDA 1JA1A 4GBJA 1UJ5A 3L4JA 3EYAA 3WSVA 2ONKA 5IXYA 1NC3A 1M73E 1WTCA 3JWPA 3K3PA 4IQFA 4XLZA 3ZOKA 1U7XA 1RJ9A 4BKUA 2C3MA 3G5AA 2WYVA 4CODB 1SQ5A 1AKYA 2LPMA 4Q37A 1NVEA 3WWPA 3CLKA 2BM0A 5TF0A 4B3TB 2NU9B 1CB7A 2V58A 2F1HA 4C89A 2R4TA 3K16A 3BD9A 4GD3Q 2ASVA 4LXGA 4WFKA 1XJ5A 1NOJA 1Z0UA 4NPCA 1GPUA 2IYQA 4YRSA 2IU0A 3A9RA 2R2GA 3SM9A 1NF2A 4NICA 5TPZA 2IWHA 1H2WA 3IB3A 3JQFC 2ZE7A 1EU1A 2OM6A 1WXWA 3JQ9A 4L5JA 4BV3A 4ZFNA 2C4UA 2GEBA 2QR2A 4CM4A 4E4YA 3ITEA 1ZCFA 2XPCA 4DW8A 4P4UA 1YV9A 5D6OA 1JHRA 1MAWA 3OKAA 3G5TA 1O97D 2HMVA 1POWA 1X74A 4GGOA 4LE1A 1CZRA 3RU2A 3IV7A 1YE5A 2W6IA 1U0EA 3PHJA 4BVFA 2QTMA 2JH9A 3OX3A 4JT2A 3K6JA 4GI7A 3MOSA 1AX9A 4L75A 1LKZA 1IG0A 1P1FA 1V1JA 4BNVA 1JKJB 4WLOA 2F1JA 4DAEA 5ECDA 4G41A 3QVJA 5DNAA 3DG9A 5K51A 2ZJYA 4H7DA 4HFJA 2BTQA 5F2OA 4PG8A 1GNVA 1LZLA 2V96A 3WFJA 2QTNA 5TR9A 2J45A 3ZBQA 4OXQA 4QIHA 1I5RA 3T1YB 3N2EA 3KUCA 4B34A 2H52A 1ZH8A 1ES9A 3NONA 3OTQA 2C8JA 4U1RA 4D2IA 3E0XA 4IQ4A 3D7MA 3LX4A 2YYYA 4E13A 1A8PA 5IKPA 3LHKA 3CEAA 4LVCA 1FQOA 3QVGB 2EJCA 1KIMA 2HO4A 3N6XA 3W5UA 1EG2A 2CLFB 1ZAYA 4FYXA 4PZEA 1W73A 3UFXA 1GRQA 2KI5A 3ETEA 4X1KB 1N4AA 4WKBA 3O1IC 5I7VA 1BQ4A 2IUTA 3VPAA 1Z5OA 2H1RA 4XB6B 5EIAA 3KE9A 3BJRA 3RVQA 5C3MA 1UBSB 1AKEA 2H1IA 2Z1NA 4RW0A 2ZXEA 3DFMA 2E7ZA 3NIGB 5AI6A 5SY9A 3QVUA 1NZDA 5HIMA 1SN7A 4LTDA 2Z83A 2ZUTA 3ONFA 3CNQS 2WMOB 1WJGA 1LPAB 2Z56A 1FS4A 4KXMA 4LXQA 3DDCA 4PHGA 1UOQA 4HX2A 4ZGBA 1RQ2A 1X0XA 3GLFE 2FKAA 2Q50A 3BCHA 2IX3A 4YJ3F 1F0YA 2Z5LA 3CPHA 5AHKA 4R4JA 3EARA 1SUSA 2JLAA 4WOKA 3DP7A 5H8WA 4NEQA 4P3YA 4PO3X 1OREA 2GRUA 3A27A 3V7WA 4IILA 1B23P 5KOHA 3P96A 3UPUA 1Y9ZA 3L5KA 1GLNA 3H1AA 2XD9A 4HDMA 3GFTA 1WE2A 2W42A 3CU5A 3CEJA 2Q7XA 3EGCA 3ZU4A 2PRZA 4X8OA 1WZNA 3ND8A 1CVLA 1PUXA 1R6TA 1Q1NA 2ZRJA 4M0UA 5CHYA 3TZCA 3U0BA 2PUTA 3OU7A 3VU9A 5TGZA 3KSDO 3N3BC 4MWZA 4TSRA 5JG7A 3C15C 3F7TA 3ZZMA 5DOZA 1VJGA 1W88B 4I5GA 4RXTA 4LOKA 4BMXA 4KXVA 4CT0A 2RGNA 3HXTA 4GM1A 4MYHA 2YMMA 4KHPB 4LHWA 4QLOA 4UFPA 1HE4A 1TRHA 4CKWA 2P4EA 3E8MA 1M7GA 2XGOA 1R6BX 2JJ2A 3UF0A 3ADPA 2HREA 1JHAA 2JFWA 3AFNA 3GFSA 5HXAA 2WWVD 2EGGA 3P2IA 1QHFA 1VL2A 3DD5A 3QX3A 5DHUA 1SZDA 3ZLTA 4XVRA 2VDOB 2FPLA 3IMFA 4TWBA 4GXQA 4ZV7A 4COOA 3HM9A 1GSAA 4U5XA 4JUBA 2CE7A 2JD0A 1QP4A 4OSOA 2D1SA 2VYQA 3BE6A 4UEWA 1Y8CA 1YB4A 1FRQA 3QKRA 3QUTA 5F64A 2J9FA 3T7DA 3WOHA 2F43A 2FXVA 4YJKA 3M70A 3X2EA 4AWBA 4EJSC 4KMSA 2KLHA 5EP2A 2VWPA 3OEHD 2AKYA 2PRKA 4HJXA 3TCKA 4XYMA 5ADWA 4S04A 4NZ9A 2A84A 4XI9A 5EKUA 4DJFC 1K97A 3P0IA 4LHEA 4MUFA 4Y3UA 5JSQA 2PZEA 2OBYA 4KAFA 1MR3F 1T2CA 4BYGA 4ZMSA 1KZ6A 1ZDMA 1ZW6A 1BC5A 2WIJA 4HN9A 4MR9A 1L1QA 2HA3A 2VSNA 1VKHA 4Q0MA 4GR5A 1HTBA 3N39C 1IVYA 2G5PA 2HH9A 5J2TB 1KVQA 1GPNA 2I3DA 1KIFA 3CNNA 3CGWA 1OXXK 3ECCA 3ZHTA 5ICGA 1MGPA 4D9EA 3CPSA 5G0WA 1ZYUA 2GH1A 1DLJA 1F2DA 1LBIA 4OL0A 3HGTA 4OU5A 5JROA 3C74A 1A9XA 4GP9A 1CLEA 4MICA 2ZETA 3LG2A 4KOEC 5BNWA 2C9BA 2XXAB 5DWVA 1R4NB 3OECA 3CBGA 3FOBA 1E0AA 1X1BA 3KYJB 2HEIA 1Z6AA 2JFYA 2GPTA 3KNZA 3RS4A 2IHVA 4GYWA 3ZIAD 1BH6A 2ERYA 4R9SA 2IEYA 4Y1GA 3T7TA 2A9PA 2D2EA 4RY8A 1OZFA 2QI9F 6LDHA 1BD4A 4HF7A 5TS2A 4WN9B 4I5FA 3ZKWA 2Z0MA 1RLIA 2MSKA 2BGNA 4KIFA 5LQRA 1XR3A 1C2YA 3QLUA 1PCXA 4ARUA 3B8EA 4YAFA 1WZCA 2JJ8A 4ZJZA 4UU1A 2CD7A 1COZA 4ZCIA 2J4DA 2PUJA 1TYAE 5JS1A 9MHTA 5I7HA 3OMLA 3LK6A 4AS2A 1DQRA 3M6IA 1S8FA 3V9AA 2ZXUA 2QQEA 3GJ0A 4MX8A 5YASA 2Z5GA 4CG0A 2GZ2A 2VAMA 5CK5A 3LTNC 2ATCA 5DBGA 4C2TA 1ZR2A 1JNXX 1T9ZA 1E9AA 4IIXA 1KIAA 4GOLD 1P73A 1YH3A 2FJUA 4MJXA 3M9WA 1CY2A 3JSAA 1H3FA 4U9UA 4D5GA 1ULBA 2G63A 2VSOA 3A4IA 2XVZA 3TI7A 2Q6TA 4MCJA 3CUKA 5TV2A 1BJRE 3NKVA 3RADC 4YACA 4RJTA 1CYDA 4JP3A 3P2YA 2GF0A 1NV8A 1OYOA 4TLEA 1J99A 2R8RA 3ILYA 4QTTB 2PGXA 4YN3A 1Z6ZA 4JBYA 4HDNA 4O59O 3TD9A 2HMUA 3RS9A 4Z99A 3TLGA 3KPJA 1XNHA 2Z3VA 1UJCA 3CCCA 3OPXA 5AR1A 5C8VA 5CBKA 1Y34E 2OCBA 3QE2A 3VHRA 2IIPA 3ASUA 4CL2A 1RTTA 2AK3A 3HB4X 2HWXA 4QPCA 3BTOA 3WL5A 2QAIA 1AZLA 1GYQA 1R7RA 1Z2DA 4I4TA 4LZJA 4WOBA 3V8MA 5BVHA 1L8XA 4J3JA 5CGQB 4IYJA 1ULZA 4MLPA 1E18A 1O89A 1TZBA 2YRXA 4L8LA 5F3RA 2ANCA 3Q6MA 4IZOA 2YWHA 3THSA 2ZE8A 3AL2A 1G18A 1ZH2A 4QBGB 2ENWA 5F3WB 5A9TA 1S1CA 4BWGA 4P98A 1KDYA 4PVCA 2B4AA 4L72A 4B3SB 4ZODA 3KJIA 1SRRA 2AOUB 3DMRA 2F1IA 1JAHA 3FY4A 4WOCA 4HDKB 5I3CA 4P7GA 1GPDG 5LQAA 4FOTA 3S2YA 2Q3HA 3DV2A 3KAKA 4FT4A 4XIFA 5FWAA 5BWOA 3ETCA 1EZ1A 5EPOA 2C94A 3OZEA 3B9QA 3Q3GE 4B4UA 1E61A 5L6LB 3D54D 4NAHA 5KOYA 3L7JA 5H02A 4GKAA 1I0IA 1IHDA 1JZQA 2C3YA 5DBOA 3PQCA 2N9UA 5LKAA 5H70A 4EKEA 2UZ1A 4GZLA 1FPMA 2FUCA 2GEJA 2P6UA 4LVOA 3CVYA 2AEEA 2D3WA 2HPZA 5I9TA 1F20A 3TVTA 4FP9A 2R7NA 5JFGA 3FPHA 1G98A 4OAOA 4BFVA 4IS2A 4MWSA 1COWA 5CYFA 5CX1B 2XTZA 2QVXX 1DJPA 1N75A 1N0IA 2QGZA 3ANXA 2G5TA 3GLIA 4JWTA 2C7PA 2WG1A 3KBBA 4OUDA 3N6RA 2G82A 2QX7A 2R68A 3NNDA 2QNIA 5ICFA 3G2IA 3R5SA 5FBRB 1J0DA 5H83A 3RRNA 3UJBA 4FGUA 1E3TA 3S2UA 4U9IS 5AM4A 1T8UA 3HL4A 4B6RA 4EW6A 3T4UA 4RY2A 4MWOA 4IHJF 4L8YA 4ED9A 4N8SA 1Z26A 5FWXB 1B8VA 1HDRA 4UREA 1L5HB 4MB0A 2IZ0A 4KB5A 1T5HX 3O4VA 4RNDB 3Q7EA 4EFDA 2AI2A 1H42A 1EVKA 1XTIA 2VC2B 4E21A 4L0CA 1GTJ1 3CRVA 2H06A 2I5PO 1U7HA 2ZBDA 1L9KA 3AEUA 1IQRA 3EZLA 4DZTA 5DO9A 3KSRA 4MHSA 2AKAB 5BMOA 3B9PA 4KOAA 5FLYA 3PX3A 4OY3A 3FFBA 5FDFA 1Z75A 2GERA 1MIHA 4TXHA 2PTHA 2Q6IA 3C1UA 4MVJI 4DR6B 4YAWA 4BKQA 2QRMA 3PYMA 5THKA 2PN1A 2XDYA 2Y1DA 5B58C 2I2FA 2WNIA 4EKNB 1AS2A 2DBVO 3AXSA 1A9YA 2D5LA 2CVFA 2VYNA 4V39A 4Y2JA 3FKSA 4NV3A 2F1KA 3BWVA 2ZWPA 4UHCA 3N74A 2QE7A 3GJXC 1P8AA 1XLTC 2C83A 5IMBA 1S02A 4IUDS 3BS4A 2IZ7A 2TMKA 1ND6A 4H9GA 1HGXA 5CT9A 3ZJVA 1KS9A 4QKQA 2ADFA 5IT5A 4K86A 4OJYA 1D0IA 2B1RA 3HKEB 5LDDC 2VTBB 2HSJA 4V0RA 1JFSA 1O5TA 4QASA 1CLUA 4EATA 1V43A 1RT9A 2WHRA 2XCUA 3PWTA 4IIDA 4XCXA 3W2FA 2FE4A 5L4SA 6NULA 4M1EA 1CF9A 2BFDB 2C0QA 2X4DA 4WKOA 4KTTE 4JEHA 4AMYA 4JELA 1ZMBA 5KYTA 2J6CA 1LF0A 5HQTA 2BCGY 1OI3A 3T5AA 2Q5QA 2XF2A 1QCYA 3TK1A 1L5RA 1QF6A 4Z2YA 3IJ5A 4BZZA 1HDZA 3NWOA 3I05A 3MF4A 1NBIA 1Y5IA 1NR1A 4RESA 2ZUFA 1C29B 3PWSA 2XT9A 3VH1A 3WDKA 5K6TA 5D3MA 1QVWA 4ZVRA 5BW5A 1Y98A 3HXLA 3ZGNA 2GEDA 4LE0A 1W44A 3LBYA 5C8ZA 3F3MA 5KU1A 4JVOA 5KVAA 5KHAA 2NXEA 2Q4TA 2RHGB 3PQFA 2G1AA 4QDUA 1XFDA 2JD2A 3G9XA 3TF5A 2B34A 5BN5A 3DE2X 2NTJA 4EBBA 4BXOB 2W2LD 1C1DB 3BMOB 4MR7A 3GJSA 3AF4A 4DSTA 3A1VA 4EGFA 3VOAA 1IMOA 1IN4A 4LJ6A 4GVXA 3UC9A 3L0BA 5DDIP 4AULA 3HCWA 3K9FC 1LBHA 1VLHA 1B0ZA 2PX3A 2YUIA 4F11A 1XRLA 3NRBA 4D9IA 3PNQA 3ANYB 2JAHA 3UJNA 3IALA 3ANNA 3ZHRA 1FYEA 3PTAA 2OHFA 3IIJA 1V6SA 1CHNA 4JYPA 3S99A 3U44B 2PUFA 4GBMA 2ZSBA 4PYLA 3L7IA 5F35A 1O2DA 2X2FA 4B2LA 1MA0A 1VLLA 4Q7MB 2QMYA 4RLHA 4E15A 5KMGA 1NYTA 3CX8A 1ZL0A 2O2GA 3IPXA 3WQSB 1L5QA 1JXAA 2A58A 3BD8A 3K09A 2LUOA 4CMCA 5BRNA 1YB2A 1NHWA 4KPUA 4TZ0A 2IXAA 2XQKA 2Y67A 3G9TA 4UM7A 2O7SA 1NAHA 4OGWA 4ECAA 1T35A 1XZ8A 2OCLA 4I4TF 4RO0A 1QVZA 1ZRSA 3D6VA 4H77A 3DBLA 1BTOA 1JEEA 1JSXA 2HSWA 1OC2A 4Q21A 1ZY2A 5GOTA 1VCHA 3V1KA 3WTCA 4JNKA 1U6KA 3IJPA 3UKJA 5I7RA 2GXQA 1PTJC 1J8FA 2HMSA 4OOFA 3WGZA 1DPGA 2QQ0A 3T3IA 4CL3A 5FPKA 3BSSA 4AJ4A 1PT9A 2IHYA 2QQGA 1OKKA 1C8KA 5JSFA 5K0JA 3IAAA 1YRHA 2A8YA 2J3HA 3KCNA 4A8HA 1KJ8A 1QK5A 1GCOA 2FF7A 2WF5A 2ZJ6A 3JPYA 3Q72A 1MJ5A 4RDHA 4BU1A 3ORQA 4OJTA 3HTXA 2A9OA 2QL9A 1XXHE 2ZPTX 3KSMA 3FWHA 4LZZA 4QUDA 3VSBA 1CJSA 1U0BB 4FBMA 3TGPA 2OC9A 2VUIB 4G5OA 4NLLA 2IS6A 3ZVKA 5C37A 1KF0A 1SXPA 2GARA 3OMXA 5CX4A 1BMDA 5EHNA 5CFLA 5KNCD 2IW1A 3TZEA 1N1GA 1UBJS 2G36A 4GM0A 4JQSA 4QLAA 4B6PA 1E7SA 3QW2A 1A27A 2OG2A 2WA1A 1CZNA 4FK8A 4FNGA 3TAUA 2RGEA 2VYCA 4CL0A 5B7PA 3U40A 2WWYA 2JPDA 3O03A 3GN1A 3S2ZA 4X1YA 1V1MB 5BYKA 1GZ6A 3AWDA 1JJVA 3AVPA 3DKIA 3IDOA 2J5RA 2ZQYA 2G1JA 1P80A 2PVSA 2BEWB 1NJ1A 4JB3A 4KXXA 2PAFA 4HVAA 4EG4A 4TS3A 4BZXA 4ZCTA 2Q6KA 3LKDA 1SUWA 3LXUX 4IDCA 4M49A 1HKUA 3MTEA 4W9MC 1XZCA 5JZSA 4AX4A 1N6RA 3LDAA 5KNBH 4P92A 4YMUA 3W6OA 4XCVA 3WYFA 1G6KA 1R4MA 4BATA 4HVTA 4MGYR 4R9RA 1LLUA 2JCXA 3M6VA 2WHXA 1WMDA 2OZPA 5JAQA 4JXZA 1EH5A 4JGIA 1I1QB 1CHDA 3C6QA 1GZ5A 2R5FA 2ILTA 3NTRA 3S0JA 3ZTTA 3PITA 4ICIA 1RE1A 4UVEA 3GJ8A 3N2NA 1FEZA 3IJEB 1E64A 1LDBA 2BH2A 1YAJA 2ZWVA 2VDNB 4IG9A 4RTNA 1X2BA 3KPYA 3OF3A 1XYGA 2BSXA 4HRVA 1E2MA 4H4CA 2YN4A 5CITA 3FYHA 2I87A 1E7MA 3CWCA 3H0EA 3QUQA 4LWOA 3I0ZA 3U7RA 1K27A 3UJCA 1LQTA 4UAVA 1Y3IA 2FQQA 2VHEA 3EMVA 3IVRA 4NULA 4PZ0A 1J2JA 4QGFA 1DADA 2C2WA 4IOJA 2HMAA 4L27A 2O2XA 4Q3AA 4RA6A 2A5JA 5BMVB 2Z2KA 3SJUA 3N58A 3P94A 2NO9A 5LMNB 3PLAE 5JMPA 3B78A 1DKLA 4RDCA 3PFBA 4OMCA 1SKBA 2P5TB 3D4LA 1M3SA 1OASA 2AZ4A 3JD0A 3D6MA 4K6FA 3C5WP 1PNOA 1LDYA 3IVGA 1JLLA 1U7PA 4H17A 3LRTA 3EBOA 4HAIA 3DDOA 1H0RA 2J1LA 3PSHA 1NBEA 4R1TA 4E6PA 3U6KA 2NZ8A 3B6IA 3ETDA 3UTCA 5MFZA 2JB9A 1VKRA 2IY9A 3Q7QA 1MVOA 2I6TA 1D04A 1Q95A 3AUAA 4B4DA 1IFXA 2IYSA 1EE2A 4H4EA 2VUTA 1DDIA 1FFHA 3MMNA 1NAIA 1E3WA 4I6GA 2GTIA 4LY9A 2XDQA 1NN3A 2ZR9A 3FFAA 4FUTA 4JS0A 1DXYA 3GLHA 4QSHA 3UKOA 3OFSA 1FX1A 4PQFA 5CA0B 3PB3A 4IHKA 4W6QA 3OJCA 3C7TA 5I4BA 1F48A 1Y33E 3LC0A 3U7QB 1X1SA 1MENA 1XCPA 4OQ4A 1ZNXA 2ZWMA 3ZU3A 3NHKA 3FRIA 3P2JA 1KARA 2I8LA 1Z34A 3LO5A 4ASUD 3KZCA 1JYSA 2A57A 5C46F 1Q0RA 2R8BA 2FMIA 5G4KA 2GN8A 4EJ0A 2IYZA 1PK7A 2XVYA 1NVKA 4KMRA 4CIDA 3ELWA 3WV4A 5J5AA 2RAFA 4C4RA 4MB6A 1ZN8A 3NYQA 4Y6RA 3CSUA 5K3BA 5CVTA 3FVQA 1DC7A 1ZK4A 1R6DA 4MKIA 3AF5A 4YIHA 1HZJA 3VYSB 1RNLA 2QMQA 2WP0A 5IS2A 3H6HA 2OL4A 2QD3A 4OYRA 2V1XA 2PNFA 4TMYA 2JJ1D 1F1JA 4MEAA 2XB6A 3NOOA 2PKYX 3OHSX 2PSDA 4Q3BA 2NUTA 4PYRA 3WLFA 2OKCA 4GO1A 1KQOA 2XUOA 1N9KA 1HTTA 1PJLA 1Z83A 5JHHB 4UAUA 2PANA 1EHCA 1F8GA 1D9XA 1GRCA 1RWXA 4W4TA 4EY6A 4EKYA 1YJ8A 3H97A 3FCCA 1J21A 3V97A 4IXMA 3OUZA 4B74A 9ABPA 2VDPB 1UPCA 3MWDA 4DG8A 4X95A 1ZUNB 3M49A 4GXRA 5EZSA 4MO2A 3IKTA 5TB5A 4OOEA 2Z5FA 2I3AA 2AZXA 4LX8A 3ZWKA 1X1QA 5AJWA 4N82A 2EF0A 1ZXBA 1JS1X 5A5VA 3ESXA 4NYJR 5KREA 1CZHA 5ELXA 1U9JA 2HU8A 1Y8RA 4IWYA 1UKYA 2HDWA 4JLVA 3SDZA 7YASA 5K45A 4F9EA 4LJ4A 5H59A 5BWNA 4DLVA 2ARKA 1Z4QA 3R77A 1UP4A 4KVAA 2P8SA 3VPFA 1KR5A 4ZOAA 4H3SA 4HBZA 1B3RA 2VF7A 1IM5A 1N0VC 4GPAA 3LFUA 5KO2A 5A0TA 3EZ2A 3K0KA 3GGDA 2OXCA 3QXJA 4B4KA 3OZIA 2FWPA 4ZPXA 5FFFA 5A4MS 3A6GA 4GNRA 5EJ8A 2J3DA 1A7JA 4MRSA 1I0LA 5A71A 1A1VA 4IUCS 2C7RA 1DKMA 1E2NA 5A3SA 3CRZA 3QNUA 1H8ED 4S1VA 3G8AA 2QSZA 1Z08A 4NSNA 4V1CA 1LX7A 2XNSA 1D4ZA 2Q1XA 2X15A 5F7JA 2CUNA 3L41A 3W6ZA 1QQAA 4G8BA 1A5AB 1C5KA 5HKOA 2ZZMA 1Z8NA 1Y81A 1JPNA 5G02A 3QBTA 4HD8A 3AONB 1JIKA 2I66A 5CFMA 3JRXA 3BMQA 3OD1A 2X42A 3AVUA 3JARB 2GCPA 1WDTA 1EX1A 3QOYA 3NM5A 1AKUA 2BKXA 3AVTA 4G5RA 3UZUA 4RTMA 2OZKA 3LUCA 3NEYA 2VFAA 3N2LA 1UDRA 4IWXA 2MYUA 3QY0A 3WRXC 4L28A 1YI1A 2NSLA 1GPMA 1YJQA 1A76A 3A4YA 4C7XA 5HBRA 1R50A 3K0CC 2C95A 2YOGA 3WLLA 1DEAA 1X15A 3QE0A 5AIAA 1GV1A 3VV3A 2Y1XA 1WDLA 3HJTA 1DEHA 4BN4A 3BXXA 3KQPA 2P9ZA 2J9XB 5SY4A 3RYCA 1N33B 1YZYA 3NDPA 2B1IA 3BJEA 2JBAA 2HC9A 4OQNA 4UTZA 2FQYA 1FFBA 1QO9A 1XZJA 1DAEA 3INRA 4L3WA 3N8DA 1U2PA 4EX7A 1E6UA 1O7JA 3OPYB 4D26A 2Q21A 2ZJ3A 4XSHA 1JDZA 1ZG3A 4UDOA 3I1YA 3TW0A 4A5SA 5IT4A 2GZMA 2WTEA 1T9CA 2YXEA 4MUJA 3IELA 3ABRB 2OLKA 4HQLA 4QRHA 3KT6A 4W9RA 2AFVA 2BIFA 2JFFA 3LLUA 2VJQA 2FN7A 2L2QA 5HZGA 4EI9A 3WWEA 2H9AA 3BF7A 4P33A 3WK9A 4KI0A 2OFWA 4HLUC 2CDRA 2HCFA 3ZDCA 3B1JA 2G4VA 2R00A 4R2HA 2OGZA 4I4NA 2R79A 4G3XA 5FOWA 5FOTA 4FM9A 4RETA 1NC1A 3BULA 3A37A 3I23A 1ZN7A 2DHRA 3FKJA 3PRJA 2AF3C 3AJ9A 3RU3A 4YRGA 3GVCA 1H2AS 2W6ZA 2VT7A 2MINB 2Z98A 3B48A 2B2CA 5B5SA 5B57C 1J2RA 1O6ZA 1WMFA 3DLAA 3ZCXA 3A8TA 3TLAA 1R5BA 2PL5A 3WLMA 4IF4A 1L4YA 3RR2A 3VZSA 3W9YA 4CQLB 1GCGA 1NULA 1NFQA 1D6MA 3HRHA 1C0LA 3TR5A 4A82A 1N2GA 3SJCA 4FMCF 1KMHA 1VB3A 3CZ4A 5JSHA 1SXJB 3HK2A 4NQRA 5EMLA 3PXBA 5K8TA 2C9MA 4B31A 4M54A 2A1TR 1ZUHA 2D06A 3SHOA 3SSAA 3U4CA 1PNRA 2DEUA 4Q9AA 2H1OA 1SB9A 1XN1A 2BBSA 1J8MF 1KK2A 2HQRA 4IDEA 4M3NA 1FP1D 2R47A 3RS5A 3QSYA 4AK9A 1LD3A 4DGQA 5CJ2A 3NGLA 4IOLA 3E9YA 4HY3A 4JR2A 3P2EA 3BL6A 4W8HA 3ZZ0A 5K8VA 1OW3B 1XFAA 2YBEA 4C01A 4YRZA 3BDIA 3L7CA 2POCA 2IBTA 3EQ2A 4RELA 1SWVA 2BL4A 5JDCA 2PIDA 1DKPA 1P18A 4LX0A 1YNSA 2J7KA 2WZCA 3N8HA 4IIGA 1UKEA 5HKKA 2AW3A 1U0JA 1B1CA 4TVSA 1P75A 2Z04A 3SQWA 1JEYA 2CL7X 1NI4A 4P22A 1XT6A 5TQVA 1U9YA 2R4QA 4DKXA 3FHTA 3RPEA 4Y7DA 4Z9AA 1NRXA 4G1MB 4JV5B 1VHWA 2NGRA 4PU0A 3V8EA 5C52B 4F4UA 4UATA 1E3IA 1Z45A 1XU9A 2XQGA 4MQEB 4HWPA 4MMZB 3COYA 1LK7A 3ASVA 4OI4A 1CP3A 2D1FA 4IDFA 1Y37A 3F5MA 2BAGA 3MS4A 3MT8A 2PD4A 4C4YA 3RFTA 3NT2A 2WWWA 4UE6A 1EJBA 3JAWB 5JBQA 2CBZA 1NVDA 3IUQA 3S1LA 1JSCA 4IWNA 1J8QA 1Z6PA 1DUIA 4RAQA 5LXTB 1QFXA 4OM8A 4MWEA 1O57A 4XD7D 3SU8A 3VJRA 1NNLA 7MHTA 3QM1A 2D3TA 3DUFA 3WK4A 2VKTA 3RODA 4GLLA 5IANA 2ZQ5A 3QE3A 1JBEA 2H5IA 2PGDA 4B6GA 1GT91 1USVA 5F2KA 4WKCA 3CMCO 3AUUA 3PEWA 3WC4A 1CKEA 1ISSA 4BNMA 2Z6QA 4KDFA 2LV8A 4P54A 4F7WA 1E7RA 4UBMA 3STVA 3UJ3X 2GK7A 1UBTS 2FI1A 2O1SA 3TPCA 3CUVA 3TJMA 1SXHA 1XL1A 2ZUBA 5EKTA 4UNNA 1AT1A 2ASEA 3PFIA 1GL3A 2IC5A 4KGZA 3PE3A 4X0EA 2XW6A 3W4JA 1WXQA 2DLNA 1RVDA 2WVHA 3B2EA 4U7GA 5C7YA 4DXHA 2NTEA 2GDJA 2ZIAA 1ATIA 4ZVKA 3T7KA 3UH1A 1DHRA 3AEQA 1B0UA 2XCQA 3GWZA 5FA8A 4BASA 2WRZA 4BX0A 5J5CA 3ROGA 2I2DA 2WHQA 4XXHA 5LQNA 3K1ZA 4KWEA 1HPLA 4GZ5A 4DCJA 4F5YA 4C3ZA 4RWEA 4HX5A 4WVLA 2CGEA 2BPOA 5GY7A 1CUDA 3VHQA 4EG8A 3RF6A 1MOZA 1BYIA 2QORA 1L4MA 5E7JA 1M0TA 3ZXSA 2AF4C 2GBLA 2TMYA 4JKOA 1U31A 4B6FA 2YXPX 2WIFA 1K3FA 3HWRA 2BZGA 2ACVA 2AFRA 2WI8A 3EGEA 2W4MA 3P9IA 4P4NA 2P30A 1CQIA 4G9BA 3DLPX 3TW4A 1VQ1A<