5SYNA

Cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
PLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-protein thioesterase 2
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 73
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5synA00
2G5TA 1YA4A 3AZPA 4F21A 4Y2PA 4LXGA 2WLSA 4G1FA 1BCSA 2G5PA 3NGMA 1MPXA 1Y37A 2VJBA 5AM2A 3KWFA 3CXUA 3AINA 5DLPA 1R3DA 3R3WA 2BJHA 4OYLA 3U1TA 4UHFA 1UZAA 1ZIYA 3R0VA 2QRUA 5FKJA 1CUJA 5FRDA 3DEAA 3ZLTA 4P93A 1WCYA 4FDMA 3BIWA 5T4BA 2FX5A 2DR0A 2HM7A 5DJ5A 3R3ZA 2VT6A 3QH4A 4JYPA 1G66A 3WLAA 1HBJA 2O2GA 4UBNA 2Y1KA 1IUOA 2VSQA 3F9CA 3M83A 5CURA 1QFMA 5LZ8A 2WJ3A 3AIKA 2WTNA 4G4IA 1MT3A 1WB5A 3RLIA 3AUKA 4J0GA 2BUBA 1X2BA 5E4JA 3U0VA 4G8CA 4FBLA 4MJ3A 5EI5A 4X85A 5FOQA 5C7YA 4J0DA 2K2QB 3KSRA 3OPMA 1WHSA 1EA5A 2G4LA 3R3XA 1IVYA 3I1YA 4QDOA 1UK6A 2WUFA 4BC0A 4OPMA 1MAAA 5E4YA 2HFJA 3HC7A 5AKHA 1CUWA 5IVHA 4MYDA 2WIKA 1F8UA 5C81A 4J03A 2WHQA 1UT6A 2XUPA 4GECA 4YX9A 2ACEA 4B85A 4ETWA 3FVTA 1GT6A 3HXKA 4QDZA 4K5QA 3WK6A 2PX6A 1EB9A 3R3YA 5JANA 2ZVDA 4BDTA 5KWIA 3UUFA 2BUCA 4QEKA 4XX1A 2OPHA 3E0XA 1Q83A 2PKYX 5SYMA 3RM3A 5AJHA 5DTJA 2Z3ZA 5I7UA 1DTEA 2ZYHA 5JD5A 3IA2A 3L1HA 1JI3A 3A2MA 4GEGA 4Y2SA 1TCCA 4WFIA 3E4DA 4BRZA 5CT9A 5AM0A 3DNMA 2ZSHA 4XIIA 1K4YA 3ANSA 1ODTC 1HDEA 1GQRA 3D59A 3Q0TA 2QKYA 4BE4A 2HDWA 5JATA 4PQEA 3I6ZA 3O4HA 2XUFA 4G4JA 5ALHA 4WY8A 1XRNA 4OD0A 1QJ4A 3WZLA 1THTA 2ONCA 2DHDA 4ZI5A 1R1DA 4KAFA 4XWGA 5HFAA 2HRRA 5AOAA 4UHCA 4I3FA 1LZKA 5AOCA 1VLQA 2O2HA 5ALTA 5AK5A 3FNBA 4MQLA 1BS9A 5FUMA 5A71A 1QOZA 1AGYA 5ALSA 5A2GA 4P9NA 2Y6UA 4B9AA 1P0MA 1CPYA 1LBTA 4W9RA 5JAHA 1QZ3A 5A6VA 3WYNA 3AJAA 2Q0XA 2JGKA 5ALYA 4Y2XA 5FV4A 4NZZA 4A23A 4B0PA 1PJAA 4WY5A 4WJLA 2VQ6A 2WIJA 1XZAA 1CIJA 2OCIA 4ZV7A 3C8HA 4KRXA 4Y9SA 5DYTA 3FYUC 2Y2UA 3R41A 4OU5A 2JGFA 2EDAA 1XZEA 1WPXA 2WHPB 4WCVA 4FLFA 4H7IA 3QPCA 3W06A 2HHAA 3B12A 2C0PA 4AQDA 1ZJ5A 1LPOA 2GYUA 4H7HA 1RYYA 4RE6A 2V98A 3MVEA 4N5HX 2WFZA 1T4MA 3H19A 5AK6A 4HZGA 3WJ1A 3H2IA 1OXMA 1GQSA 1FFAA 5LP1A 4OSEA 1ZGCA 1P0QA 1SCQA 1UXOA 3F96A 1U8EA 1QGED 3AILA 1IUNA 4K6GA 4AMZA 5A62A 3C70A 1QIEA 1Z68A 4Y2JA 1YS2X 1DX4A 4ZRDA 2XMSA 1ZD3A 2XI4A 4BCCA 4DNPA 4N8SA 4HXGA 2ACKA 4B81A 3FSGA 2CB9A 2XMBA 1Q84A 3NOXA 4HVTA 1CQWA 1UOPA 2WHPA 4DNFA 4Q3KA 5AKZA 3D4LA 2J3DA 1XZJA 1M33A 1UFOA 3I6YA 1VXRA 4GXNA 1MX5A 1MU0A 3PFBA 3ED1A 5FXMA 4L3WA 3OC0A 1IZ8A 1SFRA 3A6ZA 1ACJA 5AHXA 1XZGA 2B61A 3ESDA 1TCBA 1DQYA 1LPPA 1AUOA 5LYYA 4DMHA 2PSHA 1K8QA 4QA9A 2QJRA 4BAUA 1TQHA 1Y7IA 1QLWA 3PUHA 4B80A 2DQZA 2WIGA 3VXKA 3I2IA 4BP8A 1A88A 4LXHA 5HF5A 1TCAA 5ALIA 4UHBA 1XRRA 4ZV9A 3I1IA 5FPPA 5LLSA 2IITA 1SCIA 2H9YA 4Z49A 4H7EA 2CBGA 1H22A 1Q0RA 2DHCA 2ZJFA 4JH0A 5AI0A 5ALKA 5CXXA 3QPDA 3GFFA 3HI4A 4XVCA 3WWEA 2O2IA 4NVRA 1XZHA 4BAGA 4HRXA 1J1IA 4I4CA 3IURA 1CV2A 2HA2A 3V1LA 2BKLA 3SWWA 1QIJA 4F60A 2XUIA 5E4TA 4C01A 6YASA 1D07A 2XUKA 3S2ZA 1THGA 5CH3A 3V48A 2WKWA 1GKLA 1VZ2A 4RPCA 4B7ZA 1ZI6A 2HFKA 3WYDA 1TKRA 2H7CA 1I6WA 1ZICA 5K3AA 1BN6A 5IVKA 2WU4A 1G4HA 5AM1A 4MEAA 3C87A 4WFJA 4X6UA 2JGLA 3EBLA 2WU3A 2J4CA 1AMNA 4PNZA 4OB7A 2XMDA 2VT7A 2VEOA 3UUEA 2WJ4A 3AIOA 1MX1A 4FMPA 2XQKA 1XFDA 1PFQA 3DQZA 3H04A 4EA6A 1YSCA 1UOOA 4KR0A 5ALVA 2JF0A 4GHWA 4BCBA 1U2EA 2HADA 1TK3A 4A5SA 3STWA 1CUBA 2D0DA 3H2JA 4IH1A 4G4GA 3H18A 3DKKA 4K2AA 3DOIA 3O0DA 2HA4A 3VJMA 3TEJA 1CLEA 1W52X 4ZREA 2QOEA 1HLGA 4V2IA 3VJKA 5YASA 1CFJA 2XDWA 1Q0ZA 3FLBA 4BVJA 2WIFA 2IX9A 3AZQA 3WL6A 3FYTA 3QITA 4BC1A 3TGLA 4K6KA 2OQIA 4G9EA 4E15A 4QDTA 5ESRA 1BN7A 1QO9A 2QXUA 2ZJ6A 2WFLB 5D7BA 3O9MA 3C8DA 2RHWA 1WB6A 4UFOA 5K3FB 4C4ZA 4X97A 3GROA 5HQ3B 1A7UA 5ALRA 1QIHA 1UWCA 2XQGA 3A2LA 4Q34A 2H7XA 1XZIA 2VA9A 4KE7A 2Y6VA 1EX9A 3PICA 3H17A 1DT5A 1VZ3A 5AKEA 1MJ5A 3WIOA 1MNQA 3SC2A 4U2GA 1W75A 2DSNA 5BOVA 3IVMA 3B5EA 1KU0A 5CT6A 3G0IA 1UK9A 1FFCA 3WK9A 2HA5A 1J2EA 3WMRA 3G7NA 4CG3A 5ALXA 2GBFA 1CUDA 5AKIA 1XKLA 1H23A 3E1GA 4KE6A 4IH9A 3GUUA 3STXA 1SC9A 4H7DA 4TGLA 2WFLA 4AX4A 3MUOA 3KD2A 1TAHA 4H7FA 2QM0A 1RWQA 3ICVA 3NWOA 5JYCA 4MWSA 1R9NA 4QDXA 5K3FA 4PSUA 5HQ3A 1DX6A 1A8SA 4QZVA 4FLMA 2XMQA 2BFNA 5AK3A 3HZOA 1GXSA 1CUVA 4YASA 3LLCA 4UHDA 2BGRA 5ALQA 2PSJA 4HTAA 1NU6A 2JGEA 4MXDA 5CTAA 4ARAA 4UBMA 4M0MA 3T52A 4UPDA 1R9MA 4DGQA 1CRLA 3F97A 2CUTA 3LS2A 2Z3WA 1W76A 2HU8A 3ICWA 1CUZA 2QJWA 4AZ0A 1B41A 3K2IA 1RP1A 5A7HA 4QDUA 2QZPA 1O6FA 3HRHA 1CUXA 4QWMA 1CQZA 2H1IA 3AIMA 1PV1A 3PF8A 1P0PA 2EEPA 1CR6A 4AB1A 4CIBA 2J3QA 1J07A 2PUHA 3VJLA 1TRHA 1AZWA 2I03A 2OGZA 3QYJA 4MEBA 1XZDA 1MNAA 5ALWA 4X90A 5DYWA 3IDAA 3I2KA 1ODCA 1ETHA 3FVRA 4GWLA 1DQZA 5AP9A 4Y2UA 2FUKA 5CH5A 4KRYA 3ZPXA 4UBJA 3NUZA 5JASA 2J4FA 1BU8A 1ZGBA 3EF3A 3DYVA 4QLAA 1JJFA 5DWDA 2AJLI 2XUGA 1P0IA 1YAJA 1XZBA 4Y2VA 2LIPA 1C4XA 2WM2A 3KOOA 3KXPA 1W4LA 2QS9A 4BAZA 4DMCA 3EQ9A 4G8DA 1XRLA 4OB8A 1R88A 5DYYA 3W05A 5DTIA 4EY4A 1XQVA 4OYYA 4UBOA 5T4FA 4DYHA 2O7VA 5AKLA 5ALJA 3YASA 3WI7A 1ZIXA 5JAPA 2FJ0A 3D2BA 2OXEA 1F0NA 4KAAA 1R50A 4BE9A 4BB0A 3D0KA 1XZFA 3CN9A 1OCEA 2BCEA 4X3CA 4KEAA 3H1BA 3O4IA 1EB8A 3OG9A 5J3JA 2HU7A 4C6HA 3KWJA 2I3ZA 2XLCA 4J0CA 2PSFA 3IUJA 1JMYA 2HRQA 3F67A 4H18A 1K5PA 1MTZA 3G0GA 1EINA 4UBIA 1NU8A 5BV7A 5K5EA 2VJCA 1EK1A 3RARA 3PFCA 2WUGA 2XQIA 1H2YA 5HK9A 2QT9A 2QUBA 1VE6A 4CG1A 1FFDA 4FNMA 4FOLA 5K3BA 5HF9A 4DIUA 1WB4A 1ISPA 3BF7A 2WJ6A 3WK7A 4C89A 2OCLA 2DQYA 5AKXA 4QLOA 4EB0A 3FCXA 4CCWA 2WUEA 5ALMA 4Q82A 2OLEA 3BL8A 3G0DA 1XZKA 1BRTA 3N0TA 4FLEA 3ZV7A 4EUSA 4GI1A 4MWTA 3G0CA 2ZJ7A 2BGNA 3C6XA 3V9AA 3W2TA 4TVKA 2XUAA 3WA7A 1XLWA 2RI6A 4N5IX 2PPLA 3WL8A 3A2NA 2JGJA 4ARBA 1LPSA 3CCBA 1UKCA 1TIBA 4L72A 3VISA 1U4NA 1N8SA 2W6CX 4X92A 3W04A 2GBIA 1EXWA 5KBYA 7YASA 2IIVA 1K63A 5JIBA 1CUGA 4UUQA 3FSGD 3CN7A 1WPRA 4NMWA 3R40A 4KE8A 3QMVA 1GKKA 4H35A 1DWQA 2H7YA 3I2HA 4L9AA 2QVBA 3STUA 3C43A 1E8MA 3GBSA 2ZYSA 4S0XA 1QO7A 1AURA 4EBBA 5EFZA 3IBTA 2XUQA 5HF8A 4M0EA 3MGAA 4AN1A 1U65A 4INZA 3I2FA 2P8SA 5ALLA 1JKMA 4BCDA 1QIKA 5EHNA 1IMJA 5EHQA 5AM5A 3E3AA 4AO8A 4DSAA 3DJYA 5ALPA 2VJAA 3G0BA 4PSDA 2G63A 3IIIA 1CUFA 2WHRA 4X6YA 1XZMA 3ZWQA 3VKFA 4X71A 1EDEA 5K3DA 5AIBA 3ESAA 1DT3A 2B9VA 3WA6A 5BWBA 2GZRA 2OCKA 5K3EA 1QIFA 4JYMA 4K6HA 3D2CA 4TPKA 3T4UA 5ISMA 5KWJA 2OGSA 5T4HA 1JU4A 2VTVA 3G02A 2RONA 4P08A 3O4JA 1JFRA 5AI5A 4UHHA 2WUDA 1EK2A 3M3DA 2XE4A 3G9UA 3WWPA 1UK8A 1EH5A 5CT5A 4U2FA 2GZSA 1O6GA 2PSDA 3IUMA 4IO0A 3W9UA 3EQ8A 4C4YA 3D2AA 4BP9A 4W63A 3PE6A 3VVMA 1ZOIA 1ZJ4A 1UKBA 3STVA 3VDXA 1IZ7A 4X91A 4CI9A 3OOSA 4AMYA 2JGIA 1QTRA 1W6RA 2ECFA 2JGMA 4NS4A 1HL7A 2GYWA 1ZD2P 2GYVA 5LZ7A 4O08A 4UHEA 3FLAA 5LZ9A 1JU3A 3QZUA 4BTVA 2I3DA 3LIPA 5A7FA 5AICA 1CUSA 3WKAA 3O4GA 3OTQA 4AO6A 1FFBA 2WG0A 1DWOA 5EIAA 3G8YA 1LNSA 1UOQA 1C7IA 1HKHA 3L1IA 2HA6A 5AM3A 2W22A 4FKBA 3WKBA 1XQXA 2R11A 3FBWA 2E3JA 5C8VA 3H0CA 4H0CA 5AOBA 3BWXA 1A8QA 4HRYA 5FPQA 4UFNA 4DMFA 3D7RA 3DDUA 4GLBA 4EY6A 5AKKA 2XMRA 1GPNA 1XQYA 1K6EA 3QPAA 1AX9A 5C8XA 1H2WA 1QIGA 4B82A 1XRPA 1E5TA 3HACA 4Y2TA 2C7BA 4DNOA 2Z8XA 2OCGA 1FJ2A 5HCUA 1VJ5A 3I2GA 5ALGA 3STTA 1JMKC 2PSEA 2XQJA 2HA3A 1XZLA 2JIDA 3ANTA 4B0OA 4DNQA 5ALDA 4DLNA 3BDIA 3FWHA 4C87A 4FFWA 4Q1VA 5JARA 3STYA 4FBMA 3PF9A 5D3KA 5EGNA 5AH0A 3WK4A 4Y2RA 3WKDA 3I6MA 5CW2A 2CJPA 4KE9A 4IH4A 2DCMA 3FCYA 4PW0A 1X2EA 4BDSA 3DYIA 4QWWA 3ZLVA 4U2BA 1ZD4A 4DSZA 3AFIA 3WL5A 1QIDA 4E14A 2V97A 2JEYA 4GBGA 3RKSA 1YA8A 1F6WA 4BBZA 5JZBA 3G9ZA 1GPLA 4ZWNA 4LKOA 4OB6A 5I8PA 4BYMA 1LGYA 4U2CA 2RHTA 3EIOA 5CH8A 4UBLA 4C88A 3ILSA 4BVKA 3ESBA 3ZLUA 2PL5A 4Y7DA 4RNCA 5LZ4A 4GW3A 1B6GA 2VF2A 5JAOA 1YASA 3HABA 1XZCA 2X8BA 3O9VA 5AO9A 4XJVA 2HL6A 2XMCA 5AI4A 5IH7A 3BXPA 2CMFA 3DL7A 1J06A 5JZSA 1JT2A 3MUNA 5H3HA 3EQ7A 3QMMA 1WM1A 2YH2A 4Q05A 3WQHA 5EIHA 5CRIA 1SCKA 3C6ZA 1LPBB 2CEKA 4U2DA 4IHAA 5BWCA 3DL4A 4HS9A 2PM8A 4CG2A 3DCNA 3C5VA 4CIAA 4Y2YA 4IQ4A 2WTMA 3W9BA 1W1IA 3V1MA 3JW8A 4BTLA 5AKYA 5AI8A 1GZ7A 1ORWA 2Z5GA 1KU6A 4PSCA 3KDAA 2XUDA 1XROA 4J0HA 1HPLA 2WFMA 1JJBA 5CT8A 4PF1A 4LYEA 4U2EA 5KREA 3PUIA 1LBSA 4RE5A 5DNUA 4AXBA 1N5RA 5LKRA 5LIPA 1BEEA 4Q3OA 3X3HA 5CBKA 1L7QA 4B83A 4GDMA 3I28A 2QMQA 3O95A 3ESCA 5AM4A 1EI9A 3LP5A 5ALUA 1XLVA 2PBLA 4J3JA 2AJCA 2VAVA 3G9TA 4PV7A 4WDQA 5LZ2A 4BVLA 2XUHA 4CFSA 5EHZA 2X5XA 3H2HA 1BE0A 5D3ZA 1X70A 2XT0A 1L7RA 4A16A 4YPVA 3WWCA 4WDRA 4X00A 1H2XA 4BRSA 1L7AA 1DINA 1N1MA 4DM7A 4X6XA 5DNWA 3OM8A 4UBKA 1BCRA 1MX9A 5IVDA 2AXEA 5JZ9A 1NX9A 5AK4A 3Q8WA 5DNVA 1GPKA 2BUAA 3SK0A 2QR5A 1ZI8A 4ITVA 4B9EA 1E8NA 4MQMA 3K9BA 2XUJA 1C7JA 2B20A 1VKHA 3FLEA 5AI9A 2I78A 3GELA 1LPAB 3H2KA 4B84A 5EIEA 3HLKA 2NW6A 1QONA 4HXEB 4H7KA 3G9XA 1YCDA 1XRMA 4EZIA 5JALA 2ZSIA 1SOMA 4G9GA 4W1PA 3K6KA 1CUIA 4EY5A 2ORYA 3FAKA 1QFSA 3OURA 5JD6A 2YYSA 4RGYA 1UKAA 2PU7A 1DWPA 5F4ZA 1XRQA 3M82A 2QXTA 3V1NA 2GBGA 4F5ZA 4KAJA 2RGUA 1EVQA 3D5EA 3BF8A 2QUAA 4AN0A 4P92A 1E8DA 4JUIA 4OUKX 2OQVA 3JWEA 3TRDA 5ALNA 3WIBA 5JADA 4WFKA 5LZ5A 2OAEA 2V96A 4HXFB 2JBWA 2DFPA 4FWBA 4KJXA 1IUPA 1YAHA 1F0PA 1CUUA 2RAUA 3C5WP 3F98A 2V9ZA 1OILA 1WOMA 3WK8A 2AJBA 1LLFA 2D5LA 3LCRA 2XB6A 5AI6A 2OGTA 2OAGA 3QM1A 1QE3A 3WJ2A 2QTBA 1MN6A 4FTWA 2AJ8A 4LHEA 4FNGA 5FDFA 2BAGA 1CUEA 5T4EA 1E3QA 1ZD5A 3HSSA 5JD4A 5IKXA 3A70A 3IULA 4C4XA 1EDDA 1EHYA 2EDCA 4LIPD 2O7RA 1FFEA 1ORVA 1GGVA 3DS8A 1LPMA 1LZLA 1YS1X 3C45A 1Y7HA 3GA7A 4W1RA 1E89A 5IVIA 4BZZA 4ZXFA 3FYUB 3FOBA 3JYHA 4AZ3A 1HQDA 2VAXA 2WG2A 2HU5A 4B6GA 3WKEA 3LIIA 4X93A 4J0KA 3SX4A 1YR2A 1JJIA 5LKAA 5C8ZA 1XQWA 1A8UA 5ALZA 3L1JA 1QIIA 5SYNA 2R8BA 3WZMA 3WKCA 4I19A 4E46A 3C6BA 1ZI9A 4JEIA 4W1QA 4D9JA 3PI6A 2Y2VA 4HAIA 4M0FA 4X95A 3DKRA 1T2NA 4QNNA 3HYSA 4KYVA 2FJPA 5I9IA 3R3UA 4L0CA 4QE3A 4X7BA 3B3QA 2HA0A 4CCYB 5D6OA 4BZWA 3ZI7A 4J0JA 2PU5A 4FHZA 1VA5A 2CKMA 1USWA 3FYUA 3V1KA 3QVMA 2YASA 4Q3LA 2WSLA 3HJUA 3IB3A 3H1AA 3M81A 2WILA 4JNCA 1YB7A 3WWOA 3PDCA 1KEZA 2ZYRA 4YK7A 4G5XA 4H77A 2C0QA 3H2GA 1R4ZA 2ES4A 3BJMA 5HFNA 3C6YA 4J7AA 5FLKA 2YXPX 2HIHA 1VE7A 1VXOA 2XUOA 3DOHA 2JEZA 1BROA 4EHBA 3IUNA 1ACLA 5HF6A 3WL7A 4W1SA 4N8EA 5JAUA 1AC5A 4CCYA 3CCCA 1UK7A 1XLUA 3BDVA 1CVLA 2UZ0A 5FP0A 4OU4A 4FFVA 5HKBA 5ALFA 1CUAA 3F8SA 3S8YA 1MAHA 3BIXA 2XQFA 1QIMA 4PO3X 1ODSA 2ZYIA 4G8BA 3WK5A 5E2IA 2CZQA 4DMKA 4F0JA 3AZOA 2XMGA 1H2ZA 3I2JA 4OCZA 5EHXA 4ZGBA 2X76A 3UMJA 1AQLA 2PUJA 4Y2QA 2HA7A 1N5MA 1LPNA 3HEAA 1WHTA 4J0IA 4DTCA 1YB6A 1VA4A 1G42A 3DD5A 1EVEA 3RK4A 2Z8ZA 3IUQA 3R3VA 4X94A 2GBCA 2WQZA 4LYDA 4E11A 1CEXA 1CUYA 5K3CA 5A7GA 4H7JA 5HZGA 2VATA 2WG1A 5HK8A 3VVLA 4EY8A 2C5GA 1QTIA 2OG1A 4KACA 5AKGA 4BATA 3QBJA 3GZJA 5AKJA 1EDBA 2ROQA 5ALOA 4AO7A 2WIDA 1S8OA 1XKTA 2C5FA 3N2ZB 1DU4A 2RIPA 2C4HA 4MYSA 4N8DA 2AJDA 4EY7A 5AIAA 3DLTA 3TJMA 2B4KA 2DHEA 1CUHA 1MO2A 2XLBA 5CXUA 3BJRA 3BE8A 1FSSA 2PVSA 2XMZA 2C58A 3WWDA 1G5FA 5CMLA 4UFPA 5HKAA 1CUCA 1AKNA 1VOTA 1E66A 5ALEA 3P2MA 3QMWA 1BEZA 3D3NA 4ROTA 5CT4A 2VJDA 4LXIA
chains in the Genus database with same CATH superfamily
1JSLA 3DO5A 3OZUA 4M38A 2Q28A 4HVAA 4Z1MA 4F92B 4W5QA 4KR2A 1TU3A 3HK2A 1YA4A 1ZPDA 3AZPA 1B8NA 1OI7A 1TEVA 3BG5A 3OZTA 2I6FA 1P39A 2EZ4A 4IIJF 3SDZA 2BELA 4Y2PA 4LXGA 2O2XA 1T9KA 2P9YA 5DXFA 1WBJB 2XTNA 1N3LA 1GPJA 2SICE 3NGMA 4CM7A 2O3RA 4FMDB 1GYRA 2G4CA 2UUOA 4UVDA 3TLCA 2VJBA 1CQJB 2QB5A 3CXUA 3ND5A 1OAKA 1OV6A 3ORSA 4ZQBA 4HNVA 3WAGA 5KU1A 2PR2A 4FZ5A 4RYLA 2YW9A 3SX2A 2IHKA 1SPXA 3I9FA 2AK3A 1ZBDA 1UZAA 5KTTA 3LK6A 3MB8A 2ZDGA 3C6KA 1QG6A 2WLTA 1TA4A 4RVUA 4TM7A 1PFVA 1L8LA 1IVSA 4EFMA 1X8JA 3S7TA 1LSSA 1DKMA 2R6AA 3CKYA 4GGPA 1CUJA 3PG5A 4RMGA 3PNKA 4WECA 4JIGA 5FRDA 4H6XA 4MW5A 4DMMA 3VZPA 4JYZA 4M9SA 4N5MA 3A9CA 4ZCSA 2WQ7A 3LTNC 1NMQA 2G1KA 3N05A 2ZSUA 3IELA 2DE0X 2J6HA 1PJ2A 1C1HA 1THZA 3A4NA 1YJAA 4UHKA 4WEQA 4DRXB 4MVJG 2AEFA 3LUBA 1U2GA 2VT6A 2HHJA 3G7UA 2ZUUA 2RHRA 3QH4A 4RZHA 5FFFA 3GLIA 2JLXA 4TV9B 2WVHA 2DJIA 1R0YA 1FXWA 2OC4A 4XRRA 3II6X 1EQUA 1R4NB 1Y1SA 3Q5GA 1YL6A 2AG0A 5FUYA 3TTWA 1EHCA 2QUHA 1NP6A 3U4AA 4CF7A 4FGJA 5LJLA 1KTVA 3WQBA 2VSQA 3JAWA 2GD6A 1YB4A 4I81A 2Y66A 4BIMA 1KZ7B 1V6SA 1LSOA 4G0OA 1ZGHA 4QBIA 3O4RA 1SG9A 3I9KA 5FEMA 5TQVA 3RQIA 3WXBA 4DB2A 4BJ5A 1KZGB 1PJCA 3BGWA 4B71A 4DDKA 5LZ8A 4LDZA 3GLGA 3AM1A 1PSDA 3DHVA 1X77A 2ZI6A 3TI9A 4GC9A 1NYTA 2KM1A 4IAOA 3RLIA 1PUXA 4IWNA 4DMUB 3VNAA 3T9DA 4OI4A 2WF5A 1KC1A 3AUKA 1H1LB 4Y6PA 1G8HA 3VR2D 1DRJA 3L3BA 1K68A 4WNYA 3OJWA 1X2BA 2O05A 1PVDA 5K3SA 3GJ3A 1NNI1 2EV9A 5FWYA 4LOIA 4E30A 4QBFA 3NX4A 2Z43A 3LM8A 3KO8A 3ZXXA 1N78A 3GLGE 1NC1A 5K0GA 1IU9A 1VHWA 4ZXPA 1SXHA 4L95C 5FBZA 4J0DA 3CZRA 4FC7A 4OMDA 2PKEA 3IKTA 2JLSA 3KR0A 4JB8A 4GGOA 2Q0QA 3AK4A 4TQGA 4E4TA 4X54A 4N82A 3OPMA 4QX6A 4EDFA 1AHIA 1P7VA 4WZZA 4WZAE 2C78A 4KRFA 2XA2A 1YRBA 2WM9B 1FLVA 3CX3A 1IVYA 2ERCA 1K3TA 2QUIA 3L7MA 4ACAA 2F8TA 3IUPA 3EVEA 3I62A 1JIQA 4NH0A 4RIIA 5EKXA 1FQWA 1SM4A 3GXBA 5M2QA 3K71B 2RAVA 2XRYA 3HCWA 4IIHA 4LGVA 1RZRD 2HEGA 5EXXA 4BC0A 3VC2A 3JQBA 4TLAA 4MIKA 2FLWA 3DZHA 1L3IA 2HFJA 3UGQA 5AKHA 3ZGZA 4LNUA 1PL6A 1RBZA 2EKDA 1JLSA 1PR0A 4ERXA 1GG2A 4PR0A 3NM6B 3T99A 1X7GA 3O75A 3BZUA 4CT0A 4EO9A 5LR6A 2ZSDA 1EX6A 1EWKA 2BL4A 2BSAA 5A05A 2HWUA 5C81A 2CXSA 3PWTA 3X1XA 1GL6A 2C7VA 3BCHA 3T3IA 2YZNA 4N48A 2BEKA 1EP1B 4HHEA 4BKQA 1ZJZA 3K53A 3KUCA 2XUPA 3IT3A 2ETXA 4PG5A 1JALA 3PUKA 1NZDA 4LRQA 1OB2A 2ACEA 1R8QA 1PTKA 2ZITA 3N28A 4ETWA 2OCAA 3PQ3A 1CDDA 1WCXA 4LQLA 1GT6A 4QBTA 1YFZA 1XMJA 2DUNA 4D98A 1P61B 3D3JA 3THXB 2I4IA 1K0UA 3H7AA 4RHUA 3WK6A 1KJ8A 1R18A 4COKA 3ZD9A 5DBEX 4CNQA 5BW6B 2XXAB 3AVUA 3KWMA 4R1PA 3IYLW 1NMEA 1UBJS 4PX2A 4Q1BA 4DT1A 5HVNA 2BUCA 1RCTE 3VTFA 3E48A 2GVZC 2ILVA 4BWFB 2CV0A 4GRAA 2DTXA 2D1RA 5EUCA 1XKXA 1Q83A 2M6LA 1BC5A 4FGZA 3IILA 4U9UA 5LQUA 3QEMB 4MICA 4BZPA 5DNYB 3HG7A 4PYRA 3GHYA 2QRJA 5SY9A 4R3WA 3L43A 1AS0A 1ENYA 2VPWA 3QKSA 2C94A 4ZQEA 1DTEA 3VNVA 1PDOA 2F55A 4D9GA 2V7UA 4CLEA 2I7DA 5HP4A 1R8JA 1ZGAA 2ZYHA 1LY1A 3BMXA 1B4DA 1IATA 4LVNA 4TLCA 5FUBA 2RMKA 4HLDA 4A6EA 4MS1B 1CR4A 3WHIA 3RE1A 5JI2E 1DRKA 1G9TA 4OMFG 3DPSA 3A2MA 4YS6A 4J3NA 2A1IA 1V71A 4JSRA 1W5FA 1X7YB 4WFQA 3WDLA 3PWKA 4BRZA 3MHTA 3OZEA 4EL0A 1Q22A 2R7LA 1WDMA 2VJMB 4X20B 4B34A 4O2AB 3DNMA 4EKYA 1X1CA 2J5QA 1WZUA 2YZ2A 4JB3A 2EFHB 1HZJA 2OB1A 4QBGB 1WWKA 1U0NA 3ZWXA 5KX5A 1S8AA 1W8IA 2NXEA 3SBXA 4BQOA 4HO1X 3USCS 2EQBA 1K4YA 2HF9A 3E27A 1D6NA 2ZIXB 3K8OE 5LDHA 2YQ5A 3P20A 1V16B 3VAYA 4RCZA 4WI1A 5JSYA 1CXZA 5TQ2B 2UU9B 2LV8A 4M3NA 2QKYA 5JATA 2AOXA 3GOQA 1NP7A 4IHJF 3KYCA 4TSFD 4B46A 3LY5A 3O4HA 4IM7A 1WUIS 4MQEA 2BT4A 2SECE 4G41A 1I8TA 2BZ0A 4QELA 4YCAA 1FUYB 2HDOA 3IVCA 3L5KA 5BN5B 5K6AC 1KH3A 1MO6A 3MF4A 5JAMA 3UMMA 3UUWA 3S68A 3WZLA 2Y0CA 3DC2A 2HSZA 4QODA 1MRZA 1THTA 1J0BA 2P30A 3I0NA 4MW0A 3VR6H 1JFFA 1V8DA 4HDRA 4OQDA 4S2EA 3AEZA 5DHRA 1B0UA 2IUTA 1R1DA 1SXJE 3JWPA 3A3YA 5GJVC 4LK2A 3C48A 2AW3A 4MAFA 1DJLA 1YNSA 4FYMA 4RTLA 2ZJZA 5MN5A 2HRRA 2X5KO 4QOFA 3SKVA 3A58B 5AOAA 3LYAA 3UICA 4N3AA 4JP5A 2N1BA 1Z39A 2R6ZA 4XUCA 2BFOA 3L4SO 1U9ZA 5CA1F 3ZH2A 4IDAA 4PPGA 4RGVA 5H5JA 1NF3A 4KGZA 5L3RA 1VLQA 3W6PA 1QVWA 4WGFA 4IIGA 4NK5A 4XGNA 4O2RA 5BRJA 4NTZA 3T35A 3K1YA 5GAJA 4XH9B 2MR6A 2PPVA 4PGGA 1QOZA 3RU3A 4KLNA 3A3KA 2BBWA 2J5RA 2PT6A 5A2GA 4UM9D 5ARBA 5FUMA 4XM0A 4NXMB 2QL7A 2VTKA 3EVDA 1P0MA 3A4IA 2IV7A 2XOXA 2C29D 2CK3D 5E7JA 3IJEB 5B2ZA 2JIRA 3BJEA 3WYNA 3AJAA 4KSYA 1E2HA 2HT1A 4BX8A 2WF8A 3M49A 3WL3A 4ER6A 3DLPX 4RCYA 5TT0A 2K6GA 4YRLA 2P7IA 2ZP1A 3W5SA 3DT8A 2FG5A 5ALYA 5EOVA 4OG2A 5JCOC 1WXEA 3F6PA 3H3FA 1BD4A 3TINA 2YFHA 4A23A 4QOSA 2QGFA 4Q93A 4RMNA 4B0PA 1SIOA 9LDTA 5KTMA 1KOJA 4MWGA 2NGRA 4O3FA 4WJLA 1IK6A 2WWIA 2ZB3A 1EKXA 3AFMA 3EUFA 1SXJA 4LYFA 2FU5C 3PFGA 1INLA 2GDJA 3PR1A 4OLJA 2WP0A 4OHMA 1KDTA 1UKZA 3KOXA 4YRTA 3MG9A 4B76A 1F7VA 1Z2CA 1DXHA 1V2HE 2ATXA 4GUDA 3AVVA 1E2KA 4AG5A 1H9BA 2RHOA 1R0WA 1T1IA 1EZZA 4XQCA 5IAJA 4UDYX 1OXUA 1G5QA 1DDIA 1PJLA 3W4KA 3B7WA 1JI0A 1XZEA 4JQCA 3W5UA 4H7IA 2XYHA 4JX8A 3QUAA 2XBMA 4DCCA 3KZNA 1GILA 3EZNA 3QPCA 5I4CA 2I4TA 3RK0A 3UN1A 3KLBA 4Z3OA 2QRVA 3BRQA 3N07A 1DBIA 1HX7A 4MULA 1DUSA 4D9HA 4JLJA 4PSAA 4RE6A 3EUAA 2PQMA 2CHEA 1GCIA 4N5HX 1NVFA 1P77A 5JSFA 4LZLA 2GJKA 1O95D 1T9DA 2EBFX 3GJRA 4FS3A 1IN8A 4HUJA 3REFA 4HZGA 1VHQA 1KEEA 1H1DA 2FPXA 4MUNA 5AJWA 1OXMA 2H1VA 2OL4A 4ARUA 4EPXA 4UNSA 2WV9A 1GQSA 2RAPA 1X6VA 2P6OA 2IPAB 3IMCA 5CFMA 1DKPA 1NJ8A 3ECCA 3GPIA 5DM60 3K6SB 2LVBA 1R3UA 3GPBA 5EXSA 3V8RA 2FUEA 5CLIA 1YACA 5T8KC 1DSSG 1AQ6A 3HBJA 1C0KA 1XXHE 1HDYA 2XCSB 3CMCO 3L04A 2HNKA 1WMDA 3FWPA 5E6RA 1QIEA 4CKCA 2X1HA 4Y2JA 4M1KA 4YO8A 4ECAA 5LLTA 3E2PA 1EX1A 1GRNA 2C95A 3M6UA 2G9ZA 3I45A 1XNJA 2QTWB 2WM8A 3GT7A 4H4EA 3EOBI 4BNUA 3C7AA 3FR7A 1QC5B 4BCCA 2Z2YA 3DF7A 4JL5A 4YWHA 2AE2A 1P2UA 4FINA 1D7AA 1VFPA 3T7SA 4B3IA 4V1CA 4WQMA 4F4JA 2I4MA 2AQIA 3R6DA 3WSTA 3KZKA 3LCJA 5CLHA 2HYIC 3IQIX 3VYTB 1D6SA 1RQ2A 2J5BA 3H6GA 4RD3A 1VCNA 2P3SA 3PXAA 4WZBB 4BNYA 2NUAB 1OX4B 3A7DA 1FA9A 1VG1A 3GGDA 3NHWA 3GIWA 1OFUX 3R5FA 1CP2A 2J3DA 1VSQA 1M33A 1T8PA 2Q5IA 1HC7A 3I6YA 3LT1A 5IJZA 5CFZA 4OFWA 5DASA 3UIEA 2WI8A 1R6AA 1G8KA 2D74A 2A9KA 1OVGA 3VDQA 3GT0A 2NYVA 5KYWA 4DV1B 3C3CA 1ZN7A 2GPNA 5M7EA 2CLMB 4C2UA 16PKA 1D2CA 1YCFA 2CNLA 2CLOB 3ULKA 1DAOA 2PJUA 3CNOA 1IZ8A 3KT3A 2PRSA 4MK4A 2WE8A 3RYIB 1XXHA 3CWZA 3OEED 4ZVPA 3HTXA 1C0EA 3Q85A 4Q3DA 1BX1A 3FOAA 4OHPA 5BT8A 2UVPB 1W34A 3VQTA 1J00A 3O93A 3QVGA 4M8KA 2I8CA 1GLGA 5G0UA 3TB6A 1UWVA 3ASYA 4HDQB 1VJTA 2PSHA 1LSUA 1K8QA 3U4IA 4NWIA 1Z8FA 4V24A 5BSRA 4TMZA 5L3ZA 4F3YA 5KNLA 1WDKA 3M8KA 4BAUA 5BVHB 2RCYA 4HVLA 1GR0A 1KYVA 4LMRA 4AU1A 2O0LA 3EZ6A 4FMCB 3PUHA 4JASB 2VUIB 3WLNA 4LF9B 4KWHA 2DQZA 3FTCA 3L0PA 3P71T 1G3MA 1UODA 1U9IA 2GCGA 2QENA 3A1CA 3LI2A 1F2UB 3SJUA 3ZDYB 1BXRA 721PA 2W58A 2QTCA 1IZ0A 4J94A 4M0LA 2Q99A 4B79A 3IOYA 4Q9DA 3GGPA 3QU2A 5HPYB 2FOLA 1C9KA 3DHYA 3AKDA 1ISJA 3D8SA 5KWVA 2ET6A 2PFSA 1M2OA 1XRRA 1RKUA 1U7ZA 4L78A 3U3RA 5LLSA 3V7UA 4HFJA 3KL4A 1SCIA 4N3GA 5M3BA 3H9BA 3IIJA 2CBGA 3OE1A 1H22A 3BXFA 5HJ5A 3USZA 1ULUA 2ZJFA 2G1AA 4G89A 3UAVA 8OHMA 1L5YA 3LDUA 1PAUA 2V03A 4R9UC 3K30A 2FW9A 1ES9A 5ALKA 2F3RA 3VPXA 1RJEA 2GLUA 1FUIA 3JQFA 1TDJA 3NRBA 4XVCA 1JQKA 1AKTA 4I50A 1UIMA 1M10A 2C2OA 2O2IA 3OHPA 2H8KA 4PZCA 5IEJA 4AYWA 4BAGA 7ABPA 5ER6A 3EIUA 3DKPA 1TYCA 1UM9B 3LECA 4I4CA 4NMXB 4ZJUA 5JYDA 3AF6A 3HO6A 1H9CA 1OXVA 3B2NA 1NJSA 1XE3A 3CZPA 2HA2A 4GMFA 4RPKA 2YKGA 1F1BA 3MERA 4AYXA 2Q3MA 3W6ZA 2VF4X 2BVNA 4K6FA 6AT1A 4MUEA 4XVRA 5BWMA 1H69A 2XUKA 5IXJA 1K3UB 4BLWA 1E3SA 1NKVA 2F90A 1L4BA 1THGA 2HTFA 1E94E 3C7KA 3EISA 5I5GA 5IC4A 2DM6A 3P2EA 3QIVA 3CVUA 2QX8A 3EFBA 3OHSX 4D5EA 2C3PA 4PLYA 1N1GA 3DV9A 3SKXA 1J23A 1TA0A 4P58A 4B7ZA 5JRJA 1P8AA 2N1MA 3T0IA 4RCVA 3AKCA 3CZQA 5ESXA 4NF2A 1G7SA 4JDUA 4NNPA 4O59O 2V3WA 1I6WA 5HE8A 1V11B 5E4FA 3JASA 3PPWA 3SR0A 1J2JA 2DFDA 1Z47A 2JBAB 3CM0A 3MOIA 4LW8A 5CR9A 4DCSA 1GG9A 1L4KA 4I66A 4DE5A 1Z0UA 5T64A 3RSHA 5LFAA 2H5EA 3CZ5A 4GP7A 3WGIA 2GA9A 3K05A 4C04A 1P1JA 2I9PA 2WU4A 4CQLB 1G4HA 1ONBA 5AM1A 3IT2A 4IXNA 1PT8A 1T15A 2WT4A 3ILVA 3USES 1G5RA 1WSWA 3CRRA 4FHFA 3ZU5A 5T7BA 2NNWB 1BHQ1 3DVLA 3GH1A 4WFJA 3I01M 1UQTA 3CUYA 5H1YA 4X6UA 5JS6A 4XWKA 5KQGA 5JISA 3OTIA 3QFCA 3ZVNA 3HCRA 1DJQA 3OQBA 3V4VB 1GLVA 2WU3A 1HDRA 1LK0A 3S2GA 3CU5A 4F1KA 3LRTA 1U5CA 2V0CA 1FRNA 3QLUC 1TF7A 1E1CB 4WOJA 1AOXA 4XTCS 5LQKA 2XIQA 1LBEA 3F4BA 5FPKA 2WJ4A 2OXRA 3NALA 4W5OA 3BPSA 2INGX 3UMFA 2CV2A 1NATA 2ORIA 2CBXA 3A1WA 3HA7A 3QKIA 3LDFA 5EXDA 1JRLA 3U7JA 3UT6A 3U5ZB 3IUBA 2P0EA 2RK6A 3RSZA 2IYXA 2GXSA 1NQAO 3ZHRA 3GB9A 1BE8A 3HXMA 2YWHA 2C5HA 2QT0A 1K8ZB 2UKDA 4KR0A 3W5BA 2JF0A 4FT2A 1XDUA 1AKWA 1J21A 1P4AA 4XM1A 1D0SA 1IEWA 3TR6A 1WF3A 2NMVA 4V3BA 4IHQA 3EMKA 4AWXA 4ZO8A 1IRXA 3BUSA 3PJEA 3QOXA 5ADVA 2WZDA 1DTWA 1U0SY 2GMWA 3STWA 1RYDA 2E9SA 4Y1RB 2GVNA 1Y4UA 1YIAA 1UEJA 3IJRA 3FN4A 5LYJB 1XCGB 3H2JA 4FCTA 3DOCA 3MWYW 4OMUA 4WKBA 2UZ4A 3ADDA 1ZD8A 4K2AA 3SYNA 3N6XA 4B3GA 3O0DA 1Q50A 4Z4QA 4OA5A 5JQGB 1P5HA 1NWHA 1FDUA 1M6NA 1E6LA 3GFTA 3SC2B 5J1TB 3CSUA 3TG2A 1PZMA 3U61B 2CGEA 3R0ZA 1BQEA 3VJMA 3TEJA 2GJ4A 4F38A 3GFRA 1VI2A 3LC0A 4JT8A 1W52X 1G8MA 1IL0A 1NMYA 4ZREA 1IWBB 1XIVA 1Z6QA 1GADO 2P75A 2XB9A 3DXYA 3EDQA 4UULA 3L06A 4QEZA 4X1KB 1P8JA 5F2KA 1N5JA 3NHUA 4V2IA 4NLLA 5BSTA 3RSLA 3SHFA 2D7JA 1RQNA 3M1YA 1SCAA 3K3PA 3BB4A 4K0RA 4MLDA 5ECGC 1CFJA 1EHIA 2GAFA 2XDWA 1MO4A 3EJ6A 1FMCA 1OZHA 1P33A 2GEFA 3RTAA 5MF6A 4DSOA 4BVJA 2YVKA 3F8TA 2WIFA 4BXOB 4OQNA 1LI4A 2ZYTX 3WL6A 3HU1A 4RFSB 1FDVA 2W2TA 3U3DA 1JEYA 3F1KA 3HDGA 3GFGA 3AHHA 4Q4DA 3TGLA 2N9UA 1MORA 4K6KA 1F4VA 4TYQA 3S2IA 1AZSC 4G9EA 3ORQA 4HX5A 1HL3A 1VIMA 2LW7A 1MG0A 4NENB 3C3DA 3RBVA 4MPTA 1STOA 1OLUA 1ZGJA 1LDEA 5G41A 3VH2A 4DKXA 4F72A 1YOVB 5A0FA 3C1TA 4PN7A 2FWAA 2QXUA 1N8NA 4B6PA 2WFLB 2H9IA 3AHCA 4X1YA 1O6CA 2IOHA 3CV3A 1PGNA 4HQLA 5JAQA 2BTEA 4ZJYA 2FFQA 3C8DA 4M99A 4K40A 1YR8A 3ZVMA 3AUUA 1VL6A 2WBLC 1IOVA 1BQ4A 2EBWA 5DBGA 2HGSA 3AJ8A 1P60A 3L7YA 3K1JA 4IINA 2EGHA 2JFZA 3HCOA 4X97A 4MINA 3WGYA 3G2JA 4LJYA 3WL7A 4WCFB 5EP1A 4CV3A 2XQGA 2E5FA 3KXDA 4D3XA 2BEVB 2KMLA 4JC5A 1PBTA 2H7XA 5HYVA 4U5QA 4F4IA 4DR6B 5KJEA 1L4HA 1JH8A 5M34A 4JQSA 5FJJA 4KFSA 2VDNB 1C9JA 1DIHA 1AQYA 2H1LA 2W4MA 2Z4RA 4WAUA 5D3QA 2R47A 1JF8A 2IZ7A 2Y6VA 3QFFA 4MP8A 1EX9A 1T9HA 3E0QA 2X19A 5CPFA 5I51A 3JD3A 3G2IA 1V5WA 3GCXA 4NFSA 4XM2A 4YCMA 2BKEA 2RHHA 3K2QA 3G0HA 4CQNA 2ZBPA 2W0SA 4NCXA 4J1QA 4UW9A 2P67A 3I4CA 1T0BA 2BFDB 4QOIA 5HMMA 2QRMA 1FPMA 3UHOA 2B2XA 2ISCA 4LYJA 5IX8A 3PQ8A 1ZAYA 3R9XA 5DP2A 3SY8A 3NANA 2Q2WA 4CIWA 1JPNA 4A0FA 3NFYA 2WF6A 3OEWA 4OXYA 5L45A 2KB0A 4AQ7A 4DC1A 3N2KA 1YRYE 2GESA 1MEJA 3IAS1 1FFCA 2QF7A 2XT9A 2CDAA 1WA5A 4S1WA 5K0EA 4CEJA 1GZ6A 3CUEF 1L5HB 4ZI3A 2UUAB 4Q03A 2O8CB 1MA3A 4EJ0A 5JY1A 3Q3HA 2A1TS 2D5BA 3GL9A 5ALXA 1Y1RA 5E8RA 1W4AA 4YUVA 3ZG6A 5B3AA 1T2CA 2UZIR 1CDZA 1B23P 1KQPA 2PS9A 5F3WB 2D7CA 3H05A 2J0UB 2PMFA 3RJ9A 3R7NA 1YHZA 1XYYA 4CKZA 2CNKA 3VO8A 4IH9A 1MIOB 2ZTSA 1IHDA 3DF9A 4KXMA 3GUUA 5KHLB 3VX3A 3O8NA 3LKDA 1JKXA 1BXZA 1CRWG 2FFHA 4TGLA 4MRNA 5LXTF 4HWTA 4B35A 3MUOA 1POXA 1GPUA 3B8HA 3MQ4A 1EX7A 3PRKE 5CXSA 4D4IA 3H2ZA 2QGZA 4S1OA 1TIKA 2QN9A 4MWSA 1ZJ6A 4XGKA 4GI3A 4C43A 5HQ3A 4CGYA 5DIFA 4QZVA 4TKUB 3FW1A 2K5UA 3W1VA 4OQEA 2PXHA 5A1JA 3U31A 4QPDA 3PD0A 1GXSA 3BBLA 4KXLA 4DLTA 4F93B 1GQOA 3LLCA 3QEKA 4W82A 5CDUA 4X62B 3DCIA 3FSEA 4X64B 1NNEA 2FUNB 4BFTA 1YJBA 1Q77A 3VOBA 4DBLC 3CKKA 3RUDA 2JGEA 1C81A 4QIHA 3H4MA 2MYTA 4E13A 3D6MA 4K6MA 3EGDB 4C2AA 4JSYA 2AXPA 3MTJA 1GUDA 1SA0B 5BNZA 2VT3A 4DGQA 1CRLA 2QE7A 3SDSA 5TQ0B 1E7WA 4F4UA 1ZISA 2ZVJA 4IG4A 4OQQA 1S9DA 3MN1A 1V7ZA 1W76A 3NH6A 4AP5A 5G0TA 3TIVA 3ICWA 2R6GA 3LW7A 1A8IA 1IY0A 3O8QA 1NUTA 1VCIA 2PL3A 5COBA 4TTTS 1AHNA 1PR9A 2JAUA 2BIFA 2Q6TA 3D4OA 1EFRD 1TM3E 3Q3JB 4I1UA 3L7JA 1KKUA 4QUIA 3E3LA 2IOFA 3NWPA 2CJWA 5C2JB 1NX6A 2EZTA 3UT5B 4MWZA 1SCUA 1CR6A 2AFVA 2V58A 4GFDA 4ND8B 3B6EA 2M6KA 1CDEA 4HDSA 3UWKA 3ZEAA 3H5OA 4B75A 1QH8A 3RAPR 2WIAA 2L17A 1BXGB 4EPVA 4CIBA 3LK7A 1MXHA 1TXGA 1J07A 4KWCA 1XN4A 2QTHA 1BMTA 1UCFA 3WDMA 5CGZA 2I03A 1C0LA 1WY5A 3MTDA 3HVHA 4UZSA 1P17A 1XV5A 4OXRA 3R8FA 3KPJA 1NUQA 1XTVA 1YB2A 3MWDA 1G4UR 1PW5A 4GH5A 1QDUA 3ZGYA 4HJXA 4MI6A 1VL1A 2V9CA 2ZCVA 1HK7A 2I55A 4FE3A 2G04A 4QECA 1GTG1 1ARZA 3AUSA 4L3VA 5DYWA 3ANMA 4G9BA 4IVRA 5DT2A 1PU2A 1ETHA 4UVHA 4PYIA 1E9FA 3C0KA 3FVRA 3T7AA 5GINE 2AK2A 4F6RA 2YJ6A 1M1YB 2GM5A 4Y2UA 2FUKA 3I5UA 3LAWA 3DE7X 3MRXA 4PZYA 1PTJC 5C53B 1DAGA 3PFNA 4KRYA 3IEVA 4UBJA 2O57A 1Z4IA 4PYQA 2ORVA 5E1DA 2Q0SA 2BZ1A 1Z7EA 3DYVA 1O96A 1OWPA 3QE3A 3UF0A 4ZOBA 5DWDA 1H94A 1DNPA 1U5BA 4RHYA 1DC8A 1W36D 3HADA 3HEBA 2OXFA 4GSLA 3RTEA 4I2NA 1NXWA 3OZBA 1P0IA 4CQJA 4EARA 1YAJA 4PTLA 4JLAA 5CFLA 3ZK7A 1RD4A 4J75A 1Y8ZA 1SXIA 4EI9A 1C4XA 3KXPA 3LBFA 3RUHA 2O5EA 3LUAA 3KHKA 3BXZA 2FY8A 2ILTA 2V8OA 4N76A 4TMWA 1MZPA 1G5TA 3MXTA 2CFCA 4BAZA 3OQMA 3AKYA 1XPOA 2H0RA 1GL9B 1ECLA 1ILEA 3FTQA 3NBXX 4NATA 4BPRA 3EQ9A 1LBHA 1IG0A 3BBPA 1JYEA 1TNDA 3DB1A 3PC6A 4Z0NA 4BFCA 1BVRA 5FWXB 1IQ0A 2FWPA 1DMRA 4GO1A 3SE7A 1QP0A 2XNSA 3UFBA 2O8EB 4RK5A 4ZAZA 2Y1WA 4C0HA 1RQLA 3HJNA 1Z0DA 4EZEA 4EY4A 3LT0A 4BQSA 2KHZA 3PQCA 5KU7A 1L7MA 3A37A 1ZZGA 5T4FA 2O7VA 4CMBA 4LNAA 5F2OA 1YR7A 3E84A 2HMWA 5ALJA 2BEWA 4G0XA 1DIAA 1B73A 2VKQA 3T95A 2PGDA 1KVTA 1RLOA 2FJ0A 5EMLA 1ZKMA 2JAQA 2YNMA 4KQJA 3D2BA 3WYEA 2OXEA 3HWRA 3B6IA 4ZAYA 1A5SB 3CRW1 4D2IA 3UNXA 1MC5A 1ZUD1 2X86A 1XZFA 2B4RO 1MGOA 2YHBA 3O3MB 1W2GA 4M9QA 4H1WA 1EG7A 1RRKA 4RA9A 1QPBA 4X3CA 3GLFB 3H1BA 5DYNA 2JARA 4BMSA 2WWYA 3O2NA 3O4IA 4I14A 1EB8A 1MABB 3ZE2B 3BCSA 5J3JA 3IPYA 2HU7A 2XZLA 2PUGA 1YVUA 2TMGA 4XGQA 3K32A 2X3FA 3HS3A 4TROA 3TTTA 3C3XA 1D9XA 2C00A 2YOFA 1PLLA 3NR2A 4INAA 3W4JA 1OGJA 3V32A 5ICMA 3LOQA 3F67A 3ONVA 3GRPA 5FBRB 2H59A 3ABOB 4S1NA 1HLDA 3V8VA 4GG1A 1VIDA 3AR7A 4NP6A 1ESMA 3KZ1E 2WWHA 1MJNA 4XDHA 3OTHA 1IWPB 3S99A 1NFQA 1NU8A 2J3KA 3KLPX 2PYIA 3K1ZA 4NFHA 3A1UA 3M6AA 4ZYWA 3RREA 2IYYA 1HEIA 1IN7A 2R2AA 4CLRB 2UUCB 2WUGA 1ZIPA 1S3IA 2GD2A 3FBGA 5HM6A 5AJVB 1Z13A 3K8YA 1UZUA 4B33A 4RULA 4DPMA 2X1LA 3P2YA 4L50A 1ECGA 1T91A 2G08A 1AA9A 1GCGA 1SXJD 3JQ7A 1N5DA 3KB8A 4MUKA 3U39A 2QT9A 3H97A 1BWQA 2FPSA 4CG1A 3DCJA 1FFDA 2C2GA 4FOLA 4NQRA 4UOEA 4MJ7A 3L4EA 5F5XA 1EXDA 4R8MA 1CNFA 1WB4A 3WK7A 2IS6A 4C89A 3UFXA 1TK9A 4LWZA 5LOVF 2XWSA 1SHUX 3LXRA 4O8CA 1R8SA 5A6SB 4B2YA 1T8SA 1GRVA 3SOPA 4DY6A 3PC3A 1RI5A 3EF1A 4YMSA 1AMUA 3AR9A 3ICPA 4Z7QB 1FX0B 2CNNA 4Q7KA 2O8BA 2FRXA 5DLYA 3W5JA 3EXFA 2FCAA 2B5VA 3W6OA 5KQRA 3LD9A 3GLHE 1ZMXA 4HD8A 4QNRA 1PDWA 4Q24A 3U2QA 1ZM3A 2O59A 4QRIA 3E9ZA 3FCSB 2OWEA 4Q82A 3TJZA 2OLEA 2Y1EA 3CLTD 3EPPA 4CTKA 4GYJA 1Z2OX 4M9XA 2X4GA 3BL8A 2QMHA 3IHWA 2FG7C 3I76A 3G0DA 3OQ1A 1BRTA 1QO0A 3N0TA 4MVJE 1KK1A 4FLEA 3I05A 2Q6LA 4UPEA 1J5EB 2GAOA 1RYHA 3RASA 4A15A 3GVXA 1WULS 1QHNA 4BLVA 3ZWPA 3G0CA 1WX1A 4TLDA 5DBIA 3ZV6A 5DPMA 2DUUA 4I55A 2JHGA 3EE6A 3QY0A 4M55A 3JS5A 1A9SA 1GSAA 1XEWX 1YJ5A 2K2WA 3DCYA 4GOMD 3V9AA 3W2TA 1ZM4A 4BVHA 3X2FA 1REQB 4NV0A 3SKYA 2HR1A 4IXWA 3WA7A 3JATA 1EP2B 3IX7A 2RI6A 4JJZA 2GJ9A 2PD6A 3K7EA 3P2KA 3A2NA 3C7TA 3ZKWA 1HYQA 4MARA 4DZRA 4IOMA 1X42A 1Q1GA 4LMAA 1SCNE 2HSEA 4MX8A 2FPPB 1LPSA 5I4IA 5CFOA 2K7FA 3CCBA 5EIOA 1EFUA 4MHSA 1YKFA 3MD9A 3JD0A 1WDTA 4L72A 2EAUA 4TWZA 2GN9A 1JHMA 1CYDA 3U1VA 1P0CA 1CLUA 1GNLA 2AG1A 4FDVA 4D80A 5CPBA 2KPOA 2QX4A 4OTZA 2DX7A 3JVIA 4G5GA 2X2FA 3FPSA 4YHBA 4D6PA 1S0UA 2IIVA 4JEMA 3GLHA 4CWAA 3M0EA 3PQ4A 2GNOA 2WVAA 4AROA 3CNEA 1Z9BA 1ZY2A 2UZ1A 4M2LA 4LCJA 4H35A 3TTSA 1CR0A 3PT5A 1DWQA 2H2AA 5DSTA 2H4ZA 1FNNA 2CLDX 2MCFA 2WYVA 3T4XA 2ZIZA 3I2HA 4L9AA 1KZ4A 1MC8A 2G1UA 2ZAOA 4JIMA 4Y18A 2J6IA 3PNLA 5BV2P 2BE7A 3HUUA 2FYTA 3W9SA 1SC3A 3K1TA 3WNQA 5JJCA 1ZOPA 3S1AA 1SK9A 2AI3A 1L8XA 2OWDA 1PT9A 3WV5A 4YUYA 4EHLA 5A06A 9GPBA 5DI3B 3PI7A 3GY0A 4O2BB 1W96A 3EIXA 4TUYA 5J4LA 1T10A 4M0KA 1OV4A 3R8CA 5BYKA 1N0UA 1SU8A 1CF9A 3UK1A 4OFZA 1U65A 4INZA 1I7QB 1JHAA 4P86A 4E0BA 3LNTA 2IFTA 1JKMA 4J6EA 1Q5PA 5JYEA 1QGDA 4JZYA 1GUZA 3COVA 3ZNPA 1K8RA 1Z25A 5AW4A 1NJGA 4QU5A 4KIJA 3ZHXA 5EHQA 1LSJA 3BE4A 5KTNA 1VI6A 3S4YA 2PS3A 2OVBA 5DF1A 1CT9A 4TTAA 4XLLA 1G98A 2B4AA 3KSAC 5DHUA 1HQCA 4HNRA 4AS3A 1XRJA 3DJYA 4M46A 1PSZA 2FPIA 3KQQA 1QE5A 1YFJA 3ADOA 5BUZA 4Q9KA 2PD4A 5BMVA 4RETA 3MWGA 3RYHA 4NU6A 2O52A 3P9NA 4TL9A 2YXLA 5BR8B 1H66A 4UNPA 5ED0A 3UWPA 4QOHA 5J2UA 2BGMA 2CFIA 4X6YA 2P1ZA 3G85A 2BM8A 4TWRA 5ETJA 1WB9A 3LPMA 2PLWA 5ELMA 1AD2A 1OWOA 2C9MA 3ZWQA 3RT7A 3U7IA 1EDEA 3SAJA 3N2GB 3FPGA 3V7WA 1UBLS 2WAXA 3BMCA 5C9ZA 3OKAA 2Q62A 4YRIA 1PCXA 2PQ2A 1T0JB 3FXAA 3D6FA 1GNRA 1LW6E 1NGSA 5JCOA 3ZN2A 5DGTA 1XJQA 2Q5OA 4I4IA 4BNMA 3PX3A 4UTRA 4MITA 3MGGA 3VVCA 5BWBA 1J9ZA 1NVKA 2A4MA 3EPRA 1N2GA 3HU3A 3RBZA 4EENA 3DQQA 3D3KA 2IODA 5JCJA 3HCEA 3U4QB 4Y2GA 2EKBA 1FW8A 1QX3A 1Q21A 4P3YA 5TGDA 2SBTA 5ISMA 2M1ZA 1G19A 1G3IA 5KWJA 3PS9A 4EATA 4E03A 4QFCA 3IVAA 5F76A 4KUHA 4LHWA 3S2YA 1XAGA 1T6XA 3OPQA 4JXXA 3UYKA 2I66A 1I6LA 4ZVLA 1S3GA 1SCJA 3TSAA 4ZQGA 5FFMA 3S5JA 3GLRA 2X0RA 2VXYA 3PUJA 2BFFB 4EHIA 4I6EA 2WV7A 1JFRA 1JXOA 1UEIA 1XXLA 3MXOA 4TTPA 3P0RA 5AI5A 3WQRA 1W2HA 5DTMA 2GASA 3GFQA 1R5NA 3JVUA 4PG8A 2R86A 5BUQA 3M3DA 2N47A 2XE4A 3A6GA 3RUFA 2WJIA 3K5HA 4J4BA 1IJEA 1GN9A 2VHCA 4N4AA 3UA3A 4DJEC 1LWNA 2J9FB 4OAPA 4JI0B 1XK7A 2FWIA 5BQOA 5KTPA 1YFKA 3PR2B 1C50A 1W88B 4IVPA 2DWUA 3NCTA 3NOQA 5CT5A 2VP5A 2WF9A 4U2FA 2PSDA 3GWZA 1UINA 2NQ8A 3UMYA 1Y80A 2HBRA 4PYNA 1OX6A 4K8OA 4FCWA 4G5RA 1MA0A 1ZLXA 1TRKA 2XA9A 2A84A 3GQVA 3NWJA 4NBLA 4OHVA 3W1EA 3CA8A 5CGQB 1QKIA 3Q3EA 5EMHA 3VR0A 3L7LA 2ZBGA 3D2AA 1J0DA 2IYEA 5E1MA 4YP1A 2XCUA 3TZ6A 2PXXA 4JI6B 5IAGA 3EC7A 2BBSA 2Q27A 5K4AA 3O1IC 2H16A 3ACCA 3RR2A 2R62A 3S70A 1TJNA 1UPBA 4Y1FA 3TBKA 2B36A 3PE6A 1GZ5A 3AEUB 4QTZA 4U5XA 4YUXA 3ZDDA 2JLZA 4BU0A 3QVOA 4OP1A 1ZOIA 3TSOA 2NPOA 3RF7A 3K35A 1AN0A 4I4TB 1GU0A 4MUIA 2ZJ0A 4KMSA 1IZ7A 3UJDA 4DL9A 2GK7A 3OOSA 5CA0A 4AMYA 1BJRE 1U4OA 3T1NA 2EJBA 4MRAA 2BHNA 3EDYA 2OYRA 1QTRA 4RIFA 1FYXA 2A59A 5GY7A 1W6RA 2FCRA 3P4XA 2AFHE 3HXTA 3O8LA 3TQFA 2HSDA 1E3EA 3UK2A 1Y3BE 1ZK0A 1EUDA 4NS4A 5C8YB 2GZMA 3PGVA 2CL7X 2Z0MA 3LPLA 3A27A 1X74A 1IN5A 2ZT6A 1A4RA 4UHEA 2FFBA 4YMIA 2D62A 5BY2A 1U7XA 3AVYA 1ZUWA 3W5VA 1JQDA 2A5FA 1Z4LA 3P2OA 3QZUA 4F8EA 4XEHA 5HUQA 2DKOA 2ZRIA 3NP9A 4P3OA 5IJAA 1HEYA 3WAJA 2QSZA 3ZQ6A 1BAPA 3R6WA 2CLIB 4PLFA 3E82A 4CTJA 4EX6A 4FYIA 4JBXA 4A8PA 5L40A 2Q41A 2D54A 3VA7A 3OTQA 1AY0A 1MV5A 1X3LA 2XQVA 3U60B 4CL2A 2Z58A 3THYB 2WE7A 1T2DA 3I3SR 1DS6A 1LNSA 1MW9X 1UOQA 3BGDA 3FPJA 3IH5A 1N25A 5FO0A 4EK9A 3GC6A 3WYFA 4IDGA 1HKHA 1OXXK 3L1IA 4C3VA 4G65A 2ZATA 1LD3A 1N6IA 3PJGA 3PPIA 2VWHA 1Z7BA 2PH5A 2WK1A 3AW9A 4DCPA 3KIPA 2W22A 3U19A 1SVOA 4M8NE 3IBCA 1XQXA 2QVLA 2RGYA 4R1QA 3AYZB 2E3JA 1FP4A 2AFHA 3N8KA 3V4PB 4RVOA 4ALLA 1QYRA 2VJNA 4XWAA 1AKYA 4H0CA 2VTDA 2GEKA 4KVZA 5KSPA 3HMQA 1A8QA 3DUWA 3D7RA 1QBGA 2RH5A 3AGQA 4D4MA 4LOAA 2FNAA 2G6TA 3DDHA 3HN7A 3TTXA 1YI0A 4ER3A 4RPIA 4WLEA 1UBUS 1XQYA 5A0TA 5CITA 1BMFD 4MUAA 1QF6A 1EBFA 1MUUA 3NJ4A 3VTZA 3DP7A 4LISA 4WBNA 2R2GA 4A2CA 1EUQA 4GPBA 4TYPA 3PUXA 3E5MA 4KQGA 5H7XA 2AMVA 3HACA 3MJSA 4DNOA 2C1EA 1T1RA 3C3WA 1KDRA 1ONOA 3BHMA 3HPQA 3H9JA 2JLAA 4RD6A 1SHZA 1O77A 5HCUA 3TFWA 3I2GA 3WJAA 5LMZA 3DO8A 1YTUA 3C1OA 2DU8A 5JO0A 3FCEA 5JVDB 2EF0A 5AVJA 1U0BB 1GTZA 2XQJA 4P36A 1RYFA 3OOEA 3DZJA 4FN5A 1J0CA 2GF0A 4U3JB 1A4IA 2JIDA 3SGLA 3G8CA 2NP6A 1PDVA 2RBKA 3ANTA 3R3SA 1GD1O 1GZHB 3TJRA 2Q3DA 1G64A 4B0OA 4DNQA 2J7KA 5CXQA 3HJCA 1R64A 1CJKC 4LBYA 4DHWA 1VYTA 3TM4A 3V4FA 5HS4A 2ZZMA 1RM3A 5FL7A 4J7UA 1X1BA 4C87A 3O8OA 3VYRB 5AVSA 5JARA 3INNA 3T9FA 4FBMA 4X61A 4URXR 3PF9A 4FFBA 4F12A 5JH7B 4JLKA 1I2ZA 2OZEA 3JQPA 5D3KA 2P9GA 1XCLA 3MT8A 5FUXA 1OTYA 3B89A 3FZGA 3GRVA 3HZHA 1HY3A 3P4UA 2SHKA 4MMZB 4BUCA 1QFJA 3MRTA 3Q2OA 5CW2A 1VKZA 3S3TA 1JPVA 3HBLA 5F52A 2ZWPA 4ALNA 1SVLA 1PUJA 3T12A 5JZSA 5KNDH 2Q8PA 3SLRA 3EEIA 3ZDZB 5JC1A 4PG7A 3DE6X 4QUKA 4R54A 4RVFA 1DEKA 4GI7A 1X2EA 4FDTA 5FI5A 2GF9A 2R1ZA 1MJGM 1P80A 4IJQA 3L4KA 2AQHA 1XDBA 3AFIA 4HLUC 3T54A 3WL5A 5HMLA 1ZN2A 1NVBA 2ISQA 3W6NA 3F5SA 3I58A 4NMHA 3SQMA 1P74A 5KNBA 3ZJ5A 4E14A 2F7SA 2JEYA 2V97A 1TYEB 4JHXA 2OESA 5J58A 1YA8A 4BBZA 5JZBA 4LN1A 5I7HA 1GPLA 1T5DX 2P27A 1W47A 4ZWNA 1U8FO 4A82A 1SCBA 1QYVA 3L8DA 2JIOA 4IFIA 3N6VA 4DDTA 5I8PA 2JPDA 2V7EA 1LGYA 4FZ3A 1U80A 4BMZA 5F7XA 2UYCA 1DBRA 2Q6VA 4A8JC 2ID8A 1KYTA 4KVFA 2N42A 4D0SA 2ODBA 2JI6A 3KQOA 4YGXB 3UB2A 4Q4AA 4BGEA 1AKRA 3W5IA 3W90A 4DIMA 2A9PA 2WYOA 4OJMX 3ROEA 1QAOA 4BQNA 2IYFA 4B4OA 5CB0A 2JL1A 5EZ5A 3C5HA 5IXYA 1IJFA 4N7JA 1FS6A 3DMPA 5F5LA 1H6DA 1CETA 4GBMA 4MQFA 4UNIA 5BQ5A 3HYRA 4O4IB 3W77A 4XDGA 2ZZKA 4K9OA 5LBIA 2B9EA 4YJ2A 5EUBA 1Z73A 3JYQA 1GRCA 3V00A 3RRNA 4X7RA 3QOYA 3V4ZA 5C52B 3L82B 1GNSA 2C4MA 4JJFA 1PRYA 4FFSA 3BQ9A 4JXJA 4JR2A 1UF9A 1UPTA 4KGDA 1V7QA 4V0RA 5LZ4A 4P34A 3GW8A 4BMVA 3NM4A 4E7OA 1P5ZB 3KZMA 4Y0NA 5GVRA 5ELXA 3FFXA 2ZROA 1DMSA 3CEJA 2GR9A 4DG9A 3IV9A 5LDDC 1L6IA 4R2HA 2WIBA 3AVTA 1DIBA 4FGLA 2FR0A 5AXCA 4ZHQB 1AIPA 1Y33E 1YE3A 3G49A 2W6NA 3Q9LA 4PX9A 2WTAA 4WK4B 1LEHA 1EVLA 1UAGA 3DE0X 4YQYA 1N3YA 2ZCJA 4V0NA 4ROSA 2LKDA 3VX4A 1PQ4A 3WIEA 5AVRA 2WZQA 4OQLA 1HE1C 4TVBA 2CMFA 3DL7A 4X3PA 4EYKA 5IH7A 3HFJA 1U2DC 3H83A 1FZQA 5FCDA 3GZ4A 2GUWA 3MILA 5L95A 4J16A 3ZE7A 3IJPA 3D1JA 4RHEA 3EQ7A 4Q05A 1WM1A 2YH2A 3PSAA 4IDEA 4OV6B 4F3KA 3THWB 4DARA 1RMYA 4P4SA 2X1MA 3WQHA 3KT0A 4M86A 5JZVA 2VIIA 5CX4A 4ZVQA 5CRIA 1SCKA 1US8A 2ZJ4A 1LFDB 3Q6MA 4HI0E 4IJWA 4I1VA 3UW1A 1G8GA 4CT4B 4DQUA 5F9HA 1GCUA 1XGKA 4OMCA 3TQSA 4U2DA 2O8VA 4WASA 4B4KA 3N7AA 4RELA 3RSQA 4EY3A 2DWQA 3SBDA 5AVUA 2QTVA 2WWRA 4ALJA 3AEXA 1PKEA 4HF7A 5K8IA 3KTFA 5CJPA 3ACBA 4HDNB 5EC8A 2DWOA 3KRTA 5E9JA 5LQRA 3EPJA 2JCSA 3C5VA 4ZVRA 2WKPA 1H65A 1W0JD 3O82A 4XQGA 3AI2A 3DV0B 3P9KA 4IQ4A 4BFXA 3INRA 4CM5A 1A2OA 1GHTA 1N9GB 4B4UA 4D4GA 3W9BA 3UWDA 3V1MA 2W6PA 4MYCA 3H11B 4IMJB 2OBYA 3X0DA 5AKYA 5D86A 5E95A 3R7WA 3QJGA 2G0AA 3UATA 1EFHA 4Z4EA 5AI8A 4I55F 4LBWA 1D1PA 1G21E 2PZBA 3P0EA 4X6LA 4E5KA 5CHYA 5DEIA 3FVWA 3QLJA 1KU6A 4YEDA 1U1CA 2GNAA 3OP4A 2EKPA 4QYTA 3U44B 4IHKA 5JAIA 1RXUA 2XUDA 3N70A 1RHKA 3Q12A 4XCQA 1CEEA 1CF4A 4KN8A 4DWWA 2H7VA 1R4AA 4TMTA 3PKZA 2VHYA 2WFMA 4GRIA 4PNPA 4BQQA 3MJFA 3IPRA 4MUGA 4ZZIA 1C29B 1QYIA 1A3CA 4HH1A 3D43A 4P0QB 3ELUA 5DNUA 4PS0A 1XTRA 3F4KA 3DG9A 4RA6A 4Q3OA 2XD4A 3X3HA 4YAGA 5EJMA 1XD2B 3VBCA 3WSWA 3DC7A 2IYVA 2VG8A 2QTAA 3I92A 1W581 3LG2A 4DBLE 3C2QA 2BGKA 3KJXA 2JI7A 1SVWA 4IJ5A 3UJ6A 3TIFA 3V8EA 3I28A 1NLZA 1XYVA 1M67A 3RT1A 3AM3A 3MAJA 1N75A 2JI8A 2XRMA 1G6OA 2YNMD 3DMNA 4OJNA 4BFYA 3BGSA 1QQTA 3NXKA 2CF6A 2YTZA 4PQRA 4UEWA 3LP5A 5IVPA 3ZLJA 2I3GA 4QPJC 5D7NA 2RH4A 3JD4A 4BB5A 1M8KA 2H48A 4MVJF 5K8VA 1DAPA 1G20E 4TV8B 2YDXA 4YRAA 5A4MS 1HFWA 2YWBA 4NESA 1KZHA 1Y5RA 2BSXA 2CCGA 2A5LA 3H2YA 2H57A 3MMPA 5LZ2A 1G21A 2PX8A 3IFSA 2ZJ1A 1DBWA 3L6RA 4RPLA 1AKUA 1FIUA 5BWLA 3U16A 3UOWA 1CX9B 2ZRJA 2XGGA 4TUYF 4ETMA 4BMNA 4D9IA 5P8WA 5JWRA 1VB5A 1XDZA 2V0NA 2W2KA 3H2HA 4GP9A 2B6NA 3QE4A 1NXPA 1H5UA 1NSTA 2WUVA 4NULA 1Y89A 5K6TA 3VNUA 3NHLA 3CYFA 1MFPA 1GYPA 2PWZA 3LTEA 4H0NA 4PWYA 4YPVA 5TC4A 2CE2X 4FKMA 1B3BA 1AN9A 1UBGA 1TT7A 2VHTA 2XJ4A 5DBOA 5TPZD 4WDRA 5ITZA 5FTLA 2XCRB 4NS1A 5IBRA 5ICSA 4PE5B 2O7QA 1H2XA 4YT4A 5GV7A 2VDWB 4KB5A 2NIPA 2QSJA 4L75A 3WY9A 4DM7A 4LZOA 5K4GA 1J99A 4DA0A 4YV2A 5DNWA 3PWSA 3D5QA 3OEHD 2OK7A 4L8WB 1VHDA 4BNFA 4RTMA 2EWWA 2MINB 1OIXA 3KJEA 2VHQA 4I99A 5TIIA 1B1AA 3AY7A 1T6BY 3FY4A 2AN1A 2I34A 2IIBA 1GUYA 4HEA6 4JOSA 3R5TA 5INTA 5JJBA 5JZ9A 4ZEWA 5DCYA 3Q8WA 4CBVA 4A9AA 4ABYA 3SK0A 1G20A 3FTDA 3QXGA 4MUFA 1GAQA 3HDTA 2Q4EA 2R66A 3WB9A 4B9EA 4JYBA 1YS6A 1TU0A 4JJKA 4MV7A 4MQMA 3RFCA 3K9BA 2FSUA 5IJ9A 1W8DA 4MR7B 7AT1A 1WPQA 4YT5A 1C7JA 3GU3A 1VKHA 2HZBA 3OZCA 4ZMRA 1XF9A 4OUDA 4B32A 4US0R 1PL7A 4CR7A 2BI7A 3GFBA 2LPMA 3K15A 3WLPA 4B84A 3HLKA 3ZWVA 2V1UA 1QONA 4AY2A 1QP4A 2J3LA 1Q91A 3OPYI 2X5NA 4OHOA 3G9XA 3ZE0B 1Y3DE 4YLYA 1DJMA 2RHLA 4FXOA 4IX1A 1JP7A 4BFLA 2X2PA 1W1WA 1R4MA 1YBHA 3UEOA 3VV3A 1VKRA 1JLLB 1XRMA 5JALA 5DM70 5DGCA 4CEHB 3WGVA 1EE2A 4YDRA 4IICA 1ISFA 1QO0D 1O08A 1TM2A 3CB2A 4WXMA 1RS0A 1SVIA 1B0AA 1OKKA 1VMKA 4DLYA 4DXDA 5ES4B 5IFLA 3EXHB 4EY5A 2QROA 4YTEA 2ORYA 3FAKA 1AE1A 4RL6A 2O6LA 4LRXA 5I5EA 4B3MB 5JD6A 4QGAA 3RCBA 1NUSA 2V6FA 3TQOA 1KYYA 1PJTA 3MWEB 1QWOA 2C3UA 4QC2A 4K86A 4E4YA 4AZ3B 3DOFA 3M82A 3FOEC 3HWSA 5LN1A 2QP9X 4FYYA 4BNHA 4ARSA 3C3JA 3V1NA 4QYIB 2PUDA 5F98A 1PZGA 5JBQA 4JI4B 1MOSA 4C0BA 1EVQA 3D5EA 1E62A 3KQYA 4UARA 1GDHA 4QUHA 1M73E 1FNCA 2FXVA 4WNIA 5FNVA 3OUUA 2R00C 2OQVA 3JWEA 2R8XA 1YD7A 3K09C 3N58A 3O1LA 4U7TB 5F3DA 1Y9DA 3B9QA 3INYA 3TIIA 2ISSD 4J1TA 4HZUA 1G18A 1EP9A 1NDHA 5LZ5A 4R1OA 2YICA 3NHBA 3NHSA 2BBTA 4WWHA 4MV6A 1C1XA 4NOMA 4X0EA 1P3DA 2DFPA 4FWBA 4WLNA 4MS4B 4NYIR 4S05A 1YAHA 1F0PA 1CUUA 1IFXA 2BFCA 3C5WP 5ILQA 1OILA 1JXMA 1WOMA 2QVYX 4ME6A 2NUTB 1V5EA 1TTTA 3RIYA 4MGIR 3WK8A 3WLJA 3RG8A 4BFSA 2ZTLA 5E3HA 4L73A 2XITA 3EXIB 5HEKA 1LLFA 3EZFA 2ZXEA 4EITA 1CFZA 2QQFA 5ESDA 3QM1A 1QE3A 1AH2A 2CHQA 4MWDA 4KV7A 3T5DA 4XFKA 2AT1A 2AH5A 3HY3A 4FNGA 1CIVA 2BAGA 1CUEA 4PHGA 1E3QA 4G01B 3I34X 5T4EA 2OUKA 3ENKA 3HSSA 5CYPA 5E3JA 3TW6A 5CA0F 1HV8A 1UJNA 3R5XA 4ZOEA 4DQLA 1B0ZA 1T24A 3U3XA 4A7PA 3B1FA 4JVLA 5IKXA 1EHYA 4UEQA 1TO2E 1DJNA 3SQWA 3M9XA 1RXYA 4L8VA 3FNRA 1WZNA 1Q0SA 3N53A 2AYZA 3MIIA 4JA0A 1ZGGA 3V5NA 2J8ZA 1ZJYA 1ORVA 3AL2A 4DLLA 5KYTA 1GGVA 4MKZA 2QXYA 3QWBA 4WN9B 5DTQA 4AZWA 1LZLA 1MH1A 3B53X 1CB0A 3DTVA 3GQBA 4MVYA 4AVYA 2IEZA 3WRXC 3GRZA 2AFIA 2PIDA 1L4UA 1Y8CA 3FOBA 3T4EA 5FV7A 1UKEA 2WWVD 1ZVVA 2F62A 4UAUA 3QIAA 3SCZA 4M1MA 3UXYA 5JSUA 4YV7A 2L19A 4OJQA 1ESZA 3JRXA 4BO9A 5IC6A 4YT8A 1CS4C 2RGRA 2FG6C 3EGXA 2D13A 1YC2A 2H4JA 5BXYA 3CE9A 4RY9A 1E1RA 3NEAA 1W4CA 3I2YX 1YR2A 3MRVA 5BQ3A 5BWOA 1I94B 1G7TA 1SGWA 4TQ9A 2I62A 2JVKA 2ATVA 1IQPA 2P9TA 5C8ZA 2FEAA 3OY2A 1VCOA 3FI9A 4G1UC 4MHOA 5DVZA 3JWHA 4L22A 3BL6A 4C78A 4CETA 3WGTA 4JKIA 1XEFA 5BSKA 3WFIA 3DUFB 4GNRA 3TWOA 1J24A 4EW3A 1GNQA 3GR6A 4KKVA 2VPXA 3OF3A 4AS1A 3HFGA 5WRFA 2CLEB 3BXGA 2VHVA 3ZDBA 4B3RB 2A0FA 2YHIA 2JJ8A 2R8BA 4ENTA 4IKEA 4BECA 1V8FA 1P9WA 2Q5FA 1ZI9A 3A4VA 3BMQA 4JEIA 3MCTA 3ENQA 4TL7A 2PZEA 4X8OA 3VHRA 4AURA 3PFIA 5C7LO 4DJAA 4HAIA 1J49A 1W30A 3EC2A 5BORA 3CLUD 1F2VA 1U28A 1Z8HA 2Q7DA 2F3QA 5JCJD 3OLVA 4IQFA 4AULA 3W2HA 2G9RA 4X95A 2BGGA 2G07A 2VHWA 4LJ8A 4O4JB 2B0JA 4WV3A 4DGSA 5IJ0A 2BKXA 2FJPA 3R3UA 4N9WA 2MSCB 1NVWQ 2QN8A 2XZDA 5DGDA 5B6IA 2W83A 1PWHA 4LMPA 4L4ZA 1LI7A 1KQOA 1DG9A 2H2GA 2O7SA 3EW7A 3V2GA 4ZV4A 5LMNB 3ETNA 2XGJA 3AVQA 2Q3JA 5A5DA 2R4UA 4MA0A 4PO8A 2JRCA 4Y6RA 3EXEA 4R2WA 1MQ9A 3GN1A 3X43A 3KHTA 5CVJA 1T1GA 2HJGA 2CUKA 4IFBA 4TT8A 1RLUA 4ER0A 1TT5B 4PNHA 3S5UA 2OZKA 2RJ3A 4N03A 4WOKA 4OVKA 4F2GA 3J80A 1IXRC 3FYUA 3IP9A 3M70A 5BN3B 2H07A 5IAOA 5AJTA 1AU9A 3QVMA 1UC9A 1L1FA 1J56A 3AW8A 3MBKA 4NPAA 4EI7A 1YQDA 1NR1A 1KEVA 1NDUA 5BVGB 1T26A 2HV8A 3Q72A 4XJSA 2DMRA 2R5FA 4HGOA 2HXSA 2XKBA 3AESA 1OJ7A 2H4XA 1U7DA 5JC8A 5EG5A 3IB3A 2AYYA 5EJ5A 4BKRA 4AP6A 5KNCA 2HJVA 4PRLA 5C1BA 1ICIA 2WJVA 1U7TA 1I7DA 4ERNA 4V02A 4JNCA 3ICCA 3WWOA 3IQZA 4JOBA 2ZYRA 5ILGA 1PV2A 4Q4CA 5CB4A 3B36A 4MJXA 2O06A 3I3OA 1FK8A 5KOJA 1G17A 2V5UA 4H77A 2C0QA 3CLSC 5A2QA 1F8YA 3RYCA 1WCIB 1YBVA 2Z1NA 3NTXA 4Y1EA 2N0SA 5IS2A 1WW8A 1C9MA 1TI7A 3KP1A 3QPVA 4DV4B 5HFNA 3IODA 1EVKA 1ZVQA 2AG5A 2VDMB 4JFAA 5FLKA 1ZH2A 4ACBA 1IHUA 4HQFA 4TXJA 4YREA 2WQ6A 3EXG2 1JL3A 3WLMA 5HFJA 5DSXA 1XLTC 2GD1O 1JDNA 1P9LA 1VXOA 2ATEA 2KQUA 3DOHA 3LKVA 1A4UA 4L9WA 2QNRA 4WNAA 1X1TA 1J9GA 1XCBA 4CCYA 1VGQA 1NBWB 1FZTA 4HUQB 2NTEA 4KPGA 5EXTA 3GHHA 3ROPA 2I22A 2ZR9A 1J1ZA 2QV7A 1X7XB 3G82C 3KQNA 4GPIB 2XDQA 5EE1A 2XDAA 1NC3A 1PJ3A 1TEXA 2P5UA 3RKRA 4LF8B 1DPFA 4LG1A 1V4VA 1CUAA 3FETA 4F04A 2GGSA 4L6IA 4YR7A 1CE8B 4WKCA 1PVVA 4X45A 1ORHA 3RT9A 3W34A 3EGCA 4PO3X 1ZNYA 3N9IA 4PRYA 3TMKA 1O8BA 4LDQA 5ITWA 1FYEA 2ZM5A 2RE8A 4KR6A 3OX4A 3PCXA 3CUUA 3FUVA 5ECDA 4GXTA 5J2TA 1JDBC 1GYQA 4IIBA 1BA3A 2ZS9A 1U9CA 3L5OA 1VI5A 4Q9JA 3CPJB 5IKMA 4F0JA 2NU8B 3AZOA 2XMGA 4LOLA 4DBVO 3R44A 4N01A 4G36A 3A4MA 4ZGBA 4R1TA 1JMVA 3QU9A 1UMCA 1W9MA 4UPVA 1SB8A 2X76A 3OMWA 1F6DA 3GAZA 1O03A 3A14A 3KQVA 4LJ9A 5CK4A 4RPGA 1ODLA 1EGHA 3TZHA 3JAKA 1GITA 2G88A 3I8XA 1X7DA 1JHZA 1NKTA 3ROKA 4Y2QA 1C4KA 4G85A 1F20A 1M75A 3P94A 3U4GA 3AETA 1LPNA 5IW8A 2YWEA 3F5FA 3RVPA 4D0NA 4EQ6A 1R6UA 2AOUB 1QR2A 2BM1A 2ZYWX 4YR9A 4GOKA 3I5YA 3EFOB 5KYXB 1FSFA 3UTCA 3MMXA 4TTRA 4DTCA 3P8ZA 2C9DA 1XVAA 1QHFA 2IYWA 2YY6A 1KY2A 2YMQA 1G42A 2VWQA 3DGEC 3IR5A 3PHJA 4EO7A 4HBZA 1TQ6A 4DF3A 4Q47A 3DD5A 4D44A 3GJ6A 3RVKA 5B7GA 4TWBA 3AIIA 3I83A 1WQ1R 4UC0A 5JOQA 1NA5A 3BAFA 3HB5X 1PN3A 1YS7A 1Z82A 1MQSA 4LGMA 4ZOLB 1E2UA 2FPMA 3NV9A 1D5CA 1FYFA 1Y3CE 2VF7A 4FGKA 1EWYA 4O33A 3RUAA 4GQIA 2AKEA 4LYDA 2W6ZA 3E4CA 1NN1A 1CEXA 4W8GA 1M8GA 1AQJA 3LQYA 5K3CA 3D31A 1I4WA 4H7JA 4B4VA 1OLSA 5LD2C 1MR3F 1P19A 3IO5A 3TMAA 3WWZA 3PQFA 2D0OB 3I30X 4PC1A 4BFWA 1H2FA 5HK8A 3DPUA 4FBGA 5EHIA 3TRIA 3ZUPA 4EY8A 3NASA 3Q8LA 1GAXA 4MRVA 1BCSB 5KVSA 3P0FA 1QU3A 3R5KA 2OO5C 4E5UA 2UVDA 3S1SA 3CCFA 3KTDA 1FS4A 1AKVA 4RVDA 1PJSA 2NZYA 3ILHA 4GLLA 4AO7A 4ZODA 3TPCA 1GGKA 1X15A 2C5FA 2XF2A 5LNK6 4AP9A 1DU4A 1NW4A 1B2RA 1TPZA 3BILA 1BHSA 4HGZA 5DXJA 4JI5B 1P6QA 2C4HA 1OY1A 4N8DA 5FL7D 3RFFA 2YC2C 4TYNA 5EE9A 4AICA 3GPLA 3CSSA 3L8ZA 2B8JA 5GTDA 1CCWA 1OC4A 2A4KA 1M8FA 5F78A 2Z5LA 2DHEA 1I2MA 2J5XA 2NZ8A 4YJ3A 1JBKA 4QYXA 1FC0A 1IG3A 2X58A 4M87A 3NTUA 4RZUA 5EQTA 1QYCA 1ZSYA 3BJRA 4RV9A 2PVSA 5H16A 4K05A 4NZ9A 1W7AA 3EWIA 1WXWA 2XMZA 4UTVA 3LDAA 3ICEA 3ADPA 3Q8KA 4C7OA 1D9ZA 1EFCA 1WLSA 1E4VA 2RCNA 3OJEA