5SYNA

Cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
b'PLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-protein thioesterase 2
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 73
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5synA00
1MNAA 4ARAA 2PSJA 3BE8A 5AJHA 2G4LA 2V98A 2BUCA 3R3ZA 4KE7A 1AUOA 5ALWA 4BBZA 2JIDA 3G0IA 4EY4A 1R9MA 2G63A 1QO9A 3R40A 4LXIA 2I3ZA 2HA3A 1L7AA 1QE3A 3A2MA 1QTRA 2VA9A 1J07A 2J4CA 1W6RA 3WYDA 2VAVA 4AN0A 4PSUA 2GBGA 4MQMA 4H77A 4EBBA 4ARBA 2DCMA 1JFRA 4KRXA 3C5WP 2IITA 4N8EA 2C7BA 1Y7HA 4KR0A 4M0EA 1XQYA 2QR5A 3BDVA 3GZJA 2V96A 4N5IX 4JYMA 5FP0A 5ALRA 2QTBA 1XZDA 2Z3ZA 3UUFA 1CUFA 2HA6A 5AK4A 3QBJA 5AI8A 5ALHA 3STUA 3DS8A 1C4XA 4BAUA 3UMJA 1XLUA 4MYSA 1ODTC 4XVCA 2VSQA 3FOBA 3GUUA 5AI4A 1E8MA 3OM8A 1AKNA 4AX4A 2VJCA 2BGRA 2OCKA 4OB7A 5DYTA 4DIUA 5DNUA 4U2FA 3T4UA 4B83A 1YS2X 5CXXA 3U1TA 1N5RA 4Q05A 3IUNA 4BC0A 2QVBA 5ALOA 1QZ3A 5FPQA 4DNPA 5D3KA 4X6XA 1QFSA 4DMKA 3QPCA 1A8QA 5ISMA 4O08A 1TK3A 1EVQA 4UBNA 3RLIA 1U2EA 3BXPA 4HRXA 1BN6A 1QIMA 1CV2A 3ANSA 2Q0XA 5KREA 3ICVA 5K5EA 4C4YA 1IUPA 5CRIA 1XQXA 4RE5A 1LPOA 1E8DA 4Y2VA 4MJ3A 4JNCA 2OGSA 4A5SA 2XUKA 5AKIA 4WCVA 1DU4A 1HL7A 4NVRA 3QZUA 1A8UA 4PSDA 3KWFA 1JMYA 3PDCA 4EY5A 1CUZA 2PPLA 5HF9A 4ETWA 4H7KA 4LKOA 1ACJA 3KSRA 1G5FA 3IDAA 5LP1A 3A2NA 3L1JA 4G8BA 2OCLA 1R9NA 2JGLA 4CCYA 3VJKA 4PF1A 3WL6A 5AKKA 1ETHA 2E3JA 2DHCA 3E1GA 3WL7A 5IVKA 4OSEA 1W76A 3RKSA 5AKGA 1TCAA 2C5FA 2HU8A 2XE4A 4X71A 4FBLA 4CI9A 2C0QA 4PO3X 4X92A 4DM7A 4J3JA 5KWJA 1BU8A 1GPNA 4LXHA 3D2BA 5EIAA 1TRHA 1FFCA 1TCCA 5C8ZA 4ZI5A 1Y37A 1LZKA 4OYLA 2ZJ6A 4PSCA 5LKAA 5ESRA 1JU4A 5E4YA 4EY7A 2PSFA 3V48A 5ALZA 3AZOA 3WJ2A 2OQIA 4BAZA 4G9GA 4OPMA 1XZAA 3G0BA 5HQ3A 3SWWA 3QPAA 3FSGD 1XRNA 3BL8A 3OURA 4AO6A 2Z8ZA 2R8BA 4H7DA 2XB6A 4EHBA 3G9XA 3H19A 4CG2A 3STWA 1RWQA 1BRTA 2I3DA 1UOPA 5FOQA 3R0VA 2LIPA 4OB8A 1HPLA 3ZV7A 1YCDA 4Y2SA 2WKWA 4Y2TA 3DNMA 4X94A 2WHPB 3HJUA 1MNQA 4W1RA 4FOLA 5HFNA 1XZBA 1CUDA 3A2LA 4FLEA 1L7QA 3A70A 4Q3LA 4BP8A 4FHZA 4QE3A 2HFJA 3PFBA 3CN7A 1QFMA 1VKHA 1Q0RA 4RGYA 2B61A 4BP9A 4PV7A 3G8YA 5ALLA 5LZ5A 3VXKA 2WJ4A 1CUAA 2AJLI 2XQGA 1VE6A 4PNZA 1VLQA 3W9BA 3PF9A 3K2IA 1NU8A 4ZV7A 5SYMA 1DQYA 3HSSA 3KD2A 5IKXA 3PE6A 1K63A 3M83A 1MU0A 3IULA 1SCKA 1R88A 4Y2JA 2WJ3A 4BE4A 4P9NA 4IH4A 2PU5A 1EDBA 3FYTA 6YASA 5EGNA 5CXUA 3C70A 3WL5A 1XLVA 1VA4A 4C01A 4FMPA 4KYVA 5LLSA 1QIHA 5DLPA 1EK2A 5AKZA 4AQDA 1WPXA 1CEXA 1BCRA 3IB3A 1R4ZA 4KACA 3VKFA 3KDAA 4AZ0A 2GBFA 2EDAA 3WZLA 3D5EA 5JAHA 1K5PA 2BKLA 2JGJA 2GYVA 1JT2A 4GDMA 5ALNA 1ZIXA 5JASA 4JH0A 3ESDA 3H04A 2VJAA 5K3AA 1JU3A 4XX1A 4QLAA 2WSLA 5FRDA 4UBLA 3I2HA 4FKBA 1DT3A 5AK3A 1LPPA 3DYVA 2PX6A 1MX5A 4Q82A 4N8SA 4K6HA 1KU6A 2ACEA 2RAUA 2DQZA 1CUSA 3VVMA 5ALMA 4TVKA 1A88A 4L0CA 2QJRA 1UFOA 1D07A 2RHTA 4Q3KA 4C4ZA 4X95A 5LYYA 4Q3OA 3ESCA 3K9BA 3MVEA 4DMFA 3JW8A 1SOMA 1XZIA 3F9CA 1UXOA 1ODSA 4G5XA 2Y6UA 1XZJA 2FX5A 1WB5A 3STXA 3WYNA 2HU5A 4BCDA 2ZYIA 3VJLA 2VEOA 3R3VA 3T52A 3I2KA 1U4NA 5EHXA 2QXTA 1DTEA 1DQZA 3C6XA 2OQVA 4GECA 4J0CA 4TGLA 1XKLA 2RIPA 3G9UA 5BWCA 5ALGA 2RI6A 2WHRA 1EB9A 3VJMA 2Y1KA 5C8XA 1UWCA 1CUEA 3D3NA 4UBJA 1O6GA 5K3DA 1VOTA 2QM0A 3WIOA 2X8BA 4H7JA 2HDWA 3MGAA 5ALSA 4DLNA 2DSNA 5K3CA 1AGYA 3WIBA 2OAGA 5JAOA 1ZI8A 5JALA 1AC5A 3IUQA 3H2IA 5AKEA 1CFJA 2YYSA 5ALPA 4MXDA 3V1LA 2PU7A 3WKDA 3STTA 2Y6VA 3OC0A 1HQDA 1ZOIA 4J0GA 2OCGA 2Y2UA 5JANA 1ZJ5A 1T4MA 1YB6A 1VXOA 4IO0A 1O6FA 3ANTA 1CRLA 1WPRA 5AK6A 2ROQA 1JKMA 1R50A 5FXMA 2EDCA 3LS2A 4MWSA 1UK8A 1WB4A 5DWDA 3PFCA 3WKAA 3B12A 2WIKA 1F8UA 1MX1A 3CCCA 1R1DA 1QO7A 1H23A 4BTVA 1P0IA 4FDMA 5AI6A 5JAUA 4BZZA 2QT9A 3VDXA 3FLAA 3LIIA 1RYYA 2VJDA 1QTIA 3QITA 2C0PA 3MUNA 4BC1A 4L72A 5AI9A 2J4FA 4BATA 4WFIA 4J0HA 3OPMA 3HLKA 2WTNA 1CQWA 1BEZA 1FFAA 2ZJ7A 3W2TA 5JADA 1MO2A 3C5VA 3V1NA 1EH5A 1OCEA 3O4IA 4GXNA 2XUFA 1H2WA 4L9AA 1H2YA 1K6EA 1EB8A 4QNNA 4Y2XA 1ACLA 3E0XA 2XMGA 1ORVA 5CBKA 4EB0A 3R3UA 1Q0ZA 2QMQA 1XLWA 4RNCA 5T4BA 2ZSHA 1EXWA 1VZ3A 2HHAA 3O0DA 5AM4A 2UZ0A 1X2BA 1XZHA 2WILA 1XRPA 2VJBA 4FLFA 4INZA 2V9ZA 3QMWA 3I6ZA 3WWOA 2XI4A 3STYA 1XZGA 1VA5A 3FYUB 3FWHA 1EA5A 3GBSA 2I03A 1MX9A 4M0FA 4WDQA 4H0CA 1S8OA 3FVTA 2XQKA 1MAAA 4LYDA 4QZVA 3BJRA 5A71A 1THGA 4KAJA 4MEAA 1DWQA 1X70A 2FJPA 2ACKA 3IIIA 1ZD5A 2ORYA 1RP1A 2OPHA 5LZ8A 3WA7A 1WCYA 5LZ4A 4EY6A 1WHSA 1P0PA 2WIGA 4I3FA 2VF2A 1N1MA 4C4XA 2XQFA 4ZXFA 1AQLA 4ZV9A 3WK5A 1DWPA 4J0DA 4WFKA 2XMZA 5JATA 2FJ0A 3FBWA 4HTAA 5FPPA 3I6MA 5LZ2A 2H7XA 1CR6A 5AP9A 4Y2YA 3FLEA 5AKXA 1TCBA 1JMKC 1LPNA 1J1IA 4EZIA 4E11A 1E8NA 2WJ6A 4BDSA 1QIIA 3V1MA 4UHFA 2G5PA 3FYUC 2XQJA 1QOZA 3FAKA 1CUIA 4ITVA 5IH7A 1EK1A 1E5TA 3TRDA 2ZSIA 3AILA 2Z3WA 3VVLA 5J3JA 1VXRA 3ED1A 4UBKA 3V1KA 4HVTA 5DNWA 5EHQA 1FJ2A 3B3QA 1YS1X 2HL6A 3Q8WA 4OYYA 2B4KA 4UHHA 4W1QA 5T4FA 1QIDA 5ALYA 1EDDA 5EIHA 4KE6A 4CG3A 5HK8A 5LKRA 3ZPXA 1XRMA 4AB1A 1U8EA 5A7GA 3DL4A 3DYIA 2WUDA 3DL7A 2YASA 3G9TA 5A2GA 3L1HA 4B9EA 2WIFA 4DYHA 3AIKA 2HU7A 4DSZA 1EX9A 4YASA 5AI0A 3EIOA 2FUKA 3F98A 2WU3A 4GI1A 5HCUA 3DCNA 1P0MA 1ZJ4A 5LZ9A 1CIJA 4UPDA 3BF7A 3C6BA 3AIMA 4QEKA 4DMHA 4AMYA 4DSAA 1B41A 2H7YA 3G0DA 5A7FA 3AINA 5HKBA 4FNMA 4H7EA 1LPMA 1X2EA 3TEJA 3QYJA 2OAEA 5D3ZA 2WTMA 3U0VA 2QZPA 2JEZA 2XQIA 1ZIYA 1EVEA 3BF8A 3SC2A 2BAGA 3STVA 2YH2A 3E3AA 5JZSA 2PBLA 3W04A 2ES4A 1PV1A 1QJ4A 3DKKA 1Y7IA 2G5TA 2WLSA 1F0NA 4X90A 3ZLVA 2C4HA 4QWWA 2O7RA 5T4HA 1UKBA 3NOXA 4QWMA 4PQEA 3FNBA 2AXEA 4W1SA 1YB7A 2PKYX 2XUQA 2WHQA 4HZGA 1CUXA 2D5LA 3WK9A 2J3DA 5K3FB 1H2XA 5ALFA 4GWLA 1GZ7A 1G4HA 2HFKA 1B6GA 4UFNA 4BZWA 1UK6A 1EDEA 1P0QA 3FCYA 5CT6A 3CN9A 4B85A 4LXGA 2RONA 3DLTA 3EQ9A 4Q1VA 4BRSA 3O9VA 2DHDA 4F0JA 1CUVA 2P8SA 2WHPA 5CH3A 2EEPA 3F97A 2ZYRA 3H18A 3EF3A 4V2IA 1XRRA 3R41A 5CH8A 5CURA 3C43A 1VJ5A 1UKAA 3H1AA 1WM1A 1AX9A 3HACA 2AJBA 5IVIA 4CIBA 2XUOA 1LPAB 1ZI6A 2NW6A 5BV7A 2WUFA 3C87A 3DJYA 4E46A 3P2MA 2H9YA 1DX4A 4ROTA 2WFLA 4KJXA 2ZYSA 5AM0A 1LNSA 3LIPA 3WZMA 4WY5A 5LIPA 2ONCA 2V97A 5ALUA 5JZ9A 3HRHA 3WQHA 4JUIA 2OGTA 2PUJA 1HBJA 4CG1A 3BWXA 3CCBA 4Y2UA 3OTQA 2X76A 4U2GA 1YAJA 3QH4A 4G1FA 1GXSA 2BUAA 5EFZA 5FLKA 4BRZA 3WKBA 1BS9A 3QVMA 2CMFA 1LPSA 1FFEA 5CT8A 3NGMA 2XMDA 2GYUA 1YA8A 1QIEA 3F8SA 1JJIA 2JGKA 5K3BA 4X00A 4FFWA 2XDWA 3SK0A 4N5HX 5HFAA 5E4TA 5AO9A 4HS9A 5FDFA 5DTJA 2VAXA 1ISPA 2PM8A 4W9RA 3ZWQA 1W75A 2WQZA 1UZAA 2W22A 2AJCA 2VQ6A 4QA9A 2QUAA 3X3HA 3DD5A 2RGUA 4HRYA 5AM5A 3PF8A 4KAFA 4BB0A 1TIBA 4UBIA 4MEBA 1KEZA 4UBOA 3HZOA 3WWDA 4ZWNA 1CUWA 1LLFA 4KRYA 3W05A 4CIAA 1LBSA 1QIKA 1GGVA 2BJHA 4GW3A 2GZRA 4B6GA 3DEAA 3ZLUA 4Y9SA 3N2ZB 5HKAA 2HA2A 4MYDA 3JYHA 1LZLA 5EHNA 3EQ7A 2XUHA 3V9AA 3VISA 4Y2PA 2W6CX 5IVDA 2PL5A 3RARA 1OXMA 1IUNA 2GBCA 3GFFA 2JGMA 4DTCA 1BE0A 3EBLA 2WM2A 3G9ZA 3FLBA 1KU0A 4J0IA 5EIEA 4XJVA 1GKKA 4D9JA 5K3EA 1W4LA 1CUGA 1BEEA 5HZGA 1H2ZA 1A8SA 4QDTA 4UHEA 3HEAA 1GPKA 3I2IA 4UHCA 2XUJA 1TAHA 5JAPA 1J06A 5D6OA 4B7ZA 2WUGA 4E14A 3AZPA 4B80A 3WWEA 5JARA 5AKLA 5CH5A 4I19A 5AOCA 4G4JA 3G02A 3G0CA 4H18A 5DTIA 5EHZA 1CUCA 2XUIA 1QIFA 2BUBA 3TGLA 3LCRA 3F67A 2GYWA 4ZGBA 3SX4A 2XUPA 5FUMA 2BGNA 4AO7A 5CT4A 1M33A 5JIBA 2PUHA 1G42A 2XT0A 4L3WA 3WKEA 3I28A 1MT3A 3N0TA 5JD5A 1HLGA 1ZD2P 1IUOA 4CCWA 1C7JA 1XZLA 3IURA 3F96A 2WU4A 4U2CA 4BCCA 2QKYA 3ICWA 5JZBA 3RM3A 1UKCA 4UFPA 3ZLTA 3A6ZA 4QLOA 5ALTA 3I1IA 1XZCA 1XRLA 3R3XA 2HA4A 5SYNA 1CUBA 2CKMA 4I4CA 5BOVA 2JBWA 1LGYA 4P93A 2JF0A 2WG0A 1LPBB 1W52X 4H7IA 2HA7A 3S8YA 3FCXA 4KAAA 4X85A 3ILSA 1XZKA 3DOIA 1ZD4A 5KWIA 4UBMA 2O2HA 1JJBA 3WI7A 5IVHA 4DNQA 3AJAA 1A7UA 1BN7A 4UHDA 4P92A 4B0OA 1YR2A 2XMSA 3LP5A 4FFVA 4X93A 2CBGA 2QXUA 3QM1A 5D7BA 1QLWA 5E2IA 3WMRA 4H7FA 4W63A 4EUSA 4BCBA 4GHWA 3UUEA 1UOOA 1CQZA 1MTZA 3WJ1A 1UK9A 5AOAA 4X6UA 1IZ8A 3R3WA 4B81A 1MN6A 1UT6A 1GQSA 3ESAA 5CT5A 4X6YA 3C45A 4WDRA 2Z5GA 4NZZA 4NMWA 1TQHA 5DYYA 3DDUA 3M81A 3FYUA 3I2GA 4G8DA 4F5ZA 4C6HA 5AHXA 2BCEA 5FV4A 3K6KA 3I1YA 3TJMA 3I2FA 3WK4A 5ALXA 2H7CA 4CCYB 5T4EA 2OXEA 3HABA 1HKHA 2X5XA 1XZFA 3GA7A 2VATA 4OD0A 3PI6A 4C87A 5EI5A 1XQVA 1XZMA 2R11A 1EHYA 4LYEA 4FBMA 3WWCA 4KE8A 4GLBA 1XKTA 1WOMA 2HRQA 3W9UA 1XFDA 5A62A 1JJFA 4U2EA 5AM3A 1UK7A 3H2HA 4TPKA 4X91A 4A16A 4WY8A 2WG2A 4FLMA 1GKLA 1L7RA 4G4IA 1SFRA 5AIAA 3KOOA 4CFSA 3D2CA 5JYCA 4J7AA 3H17A 1ZGCA 1NX9A 1N5MA 3WLAA 1DX6A 4DGQA 1Z68A 3M82A 5HQ3B 3I6YA 3DKRA 5HF6A 2DHEA 3H2GA 7YASA 1SCQA 2H1IA 2ZVDA 4G8CA 5A7HA 3HI4A 1CUYA 2PSEA 3AZQA 4EY8A 4J0JA 1I6WA 1XROA 2B9VA 5A6VA 4BYMA 5AH0A 1MAHA 2RHWA 5ALEA 3D4LA 3IUJA 4U2DA 3WWPA 5F4ZA 4PW0A 1Q83A 4YPVA 1CUJA 1WB6A 1WHTA 2D0DA 2IIVA 4FWBA 4X3CA 5KBYA 3E4DA 4BE9A 5I8PA 3IA2A 3KXPA 1IZ7A 5I7UA 1DINA 3G0GA 3OG9A 2HIHA 3JWEA 3H1BA 1MPXA 1W1IA 5AKYA 4F21A 3WK7A 4OUKX 1U65A 2I78A 4C88A 4RE6A 4B82A 4H35A 4BTLA 2PSHA 4S0XA 3ZI7A 2B20A 5ALKA 1Q84A 5AKJA 1GQRA 5ALVA 1THTA 3AUKA 1C7IA 4C89A 4OCZA 2CUTA 2AJ8A 3G7NA 3O95A 1XZEA 2C5GA 1H22A 5ALIA 3DQZA 3H2JA 1QONA 5LZ7A 5AK5A 4QDOA 3BIWA 4JEIA 5HF8A 4W1PA 2WFZA 1K4YA 1E89A 2QUBA 1CUUA 1T2NA 2VT6A 1DT5A 3HC7A 3QMMA 3L1IA 4AMZA 4J0KA 1R3DA 4QDZA 2OGZA 4A23A 1BCSA 1AMNA 2ZYHA 4IHAA 1AURA 4F60A 1J2EA 1ZD3A 2OCIA 2IX9A 1OILA 5AM2A 4P08A 2JEYA 5ALJA 5DNVA 3GELA 4Z49A 1N8SA 2OLEA 2XLCA 2DR0A 1E3QA 4NS4A 2WFLB 4JYPA 2GBIA 2ZJFA 2Z8XA 3O9MA 4FNGA 3C8DA 1CUHA 4QDXA 3EQ8A 5YASA 1CPYA 4K5QA 3AIOA 3IUMA 4XIIA 2CJPA 4B9AA 4FTWA 5K3FA 2ECFA 3HYSA 3WKCA 4J03A 3D7RA 5AICA 2XUAA 4BVLA 2XMRA 2XUGA 5DJ5A 2VTVA 1QGED 3NWOA 5ALQA 1ZGBA 3FVRA 3M3DA 1E66A 3PUHA 4RPCA 3IBTA 2YXPX 4AN1A 2QRUA 3D2AA 4Q34A 3H0CA 2O7VA 4HXGA 3IVMA 4X97A 5HK9A 1NU6A 1GT6A 1F0PA 1FFDA 5AM1A 3BJMA 3I2JA 2BFNA 5I9IA 4DNFA 2J3QA 4DMCA 3WK8A 3FSGA 1QIGA 1FFBA 3HXKA 1USWA 4X7BA 2WIJA 4Y2QA 3RK4A 1PFQA 3O4HA 2QJWA 2WFMA 5AI5A 1CVLA 5JD4A 1K8QA 2QOEA 4WFJA 3LLCA 1MJ5A 1G66A 1ZICA 4G4GA 4E15A 2OG1A 3D0KA 1JI3A 5AKHA 3Q0TA 5DYWA 2HM7A 3B5EA 4LIPD 1HDEA 2HADA 1UOQA 2XLBA 2HA0A 3MUOA 3QMVA 4K6KA 5H3HA 1AZWA 5AOBA 2Y2VA 4UHBA 3KWJA 4K6GA 2O2GA 5CT9A 4BDTA 4H7HA 4M0MA 2CEKA 1DWOA 1FSSA 2CZQA 3C6ZA 3W06A 2JGFA 4ZRDA 1CLEA 5CTAA 3PUIA 4ZREA 4IH9A 4IQ4A 4Y7DA 4BVKA 4K2AA 4DNOA 4OB6A 4LHEA 2C58A 1YASA 4WJLA 3ESBA 2XMCA 1F6WA 1IMJA 4IH1A 2DFPA 2VT7A 4B84A 1EINA 4AZ3A 5E4JA 4BVJA 3OOSA 4YX9A 2CB9A 3GROA 4OU5A 2O2IA 1ORWA 4XWGA 4N8DA 2WIDA 4GEGA 1XQWA 4UFOA 3WK6A 4QDUA 3CXUA 4OU4A 2K2QB 2WG1A 3C6YA 2QS9A 1VZ2A 3O4JA 4HXFB 2JGIA 4G9EA 4BAGA 1ZI9A 4YK7A 4U2BA 1TKRA 5AIBA 1EI9A 1SC9A 5C7YA 4Y2RA 4AXBA 3D59A 3BDIA 2AJDA 5ALDA 1IVYA 5CMLA 4B0PA 3WA6A 3AFIA 2PVSA 5BWBA 3PICA 4KE9A 1BROA 5C8VA 3NUZA 3C8HA 1ODCA 1YAHA 5HF5A 4GBGA 3S2ZA 1YSCA 2JGEA 3O4GA 2HRRA 2XMBA 1LBTA 1XRQA 3WL8A 4HAIA 5FKJA 2WUEA 4EA6A 3DOHA 3H2KA 2XMQA 4KEAA 3R3YA 2DQYA 1SCIA 2HA5A 5C81A 1GPLA 2GZSA 4HXEB 2XUDA 1VE7A 1QIJA 4UUQA 2PSDA 4MQLA 1PJAA 3YASA 3BIXA 1YA4A 4MWTA 5CW2A 4AO8A 3QPDA 5JD6A
chains in the Genus database with same CATH superfamily
3JD0A 4L6IA 1O94C 4ARAA 2ZRCA 1NMYA 4KXUA 4NTZA 4PAGA 1JR4A 3KZVA 4IZ6A 3M5DA 1WP4A 3R3ZA 2VLBA 3P9QA 5IUKC 1NQAO 2PKRA 4R7GA 1UDRA 3V4FA 1BWQA 1TZBA 3MLBA 3WLQA 1U3TA 4KE7A 5BSKA 2GLXA 2P2CA 2FZGA 3VR5A 3T1OA 3G0IA 2P9BA 4CMJA 4LMRA 1DRUA 1FVHA 2J7PA 3OPYB 2B8EA 2EP8A 2VF7A 1K7YA 2NSDA 1E2DA 5E7IA 2J07A 4B6FA 4BNIA 1UEXC 1INLA 4BMXA 3FUWA 2G5CA 1Z5WA 2FV8A 4MUXA 4PQRA 4WGFA 5KJ6A 4F06A 1DJOA 3E1KA 2OXRA 5LU8A 5KPDA 4YY3B 5CNKA 1R0CA 1M1YB 3RH0A 2I3ZA 3UGQA 1ZM4A 5B4VA 4MS1B 2XV1A 2FR8A 1QE3A 4J3FA 4J9VA 4P82A 3DKVA 4DUZB 3SDZA 3LPNA 4JLDA 2YMLA 2QD2A 1NAHA 1OFHA 3SSMA 4U7PB 4RQUA 4JL5A 3IT1A 2QTZA 1F3LA 1UPUA 2D0PB 4PSUA 3S8MA 4A91A 4HWKA 5HP4A 1Z6ZA 3LWBA 2ZIWB 1ABFA 3UJPA 1WZ2A 3AY7A 2N3ZA 3RIHA 5KYYB 3EULA 4LNAA 3WLKX 3E23A 4H77A 4EBBA 3K8OE 2HIGA 2GO1A 5I3ZA 3C74A 1NFQA 1P9NA 2J5QA 2JCBA 3BSYA 1JFRA 4CKBA 1R00A 4R41A 4RJKA 4JVMA 1O5TA 2WYUA 3NASA 5B3JA 1UBNA 1OSNA 5CYGA 1L4YA 4JMPA 2OM2A 1Y7HA 2PGAA 3LL4A 4U4AA 5CB4B 5MN5A 2Y1GA 3UJAA 2BFOA 3F6BX 1QXSA 4F4JA 2C4TA 2C2GA 2WWGA 1C0EA 1C1DB 3GZJA 1PR3A 3PVZA 5EIBD 1E0JA 1EWRA 1E2IA 3K0EA 3HEBA 1EFVB 2ZRHA 3PEEA 1RWNA 3OM1A 4G0OA 4WJKB 1NVUQ 1VPWA 4KL8S 2A9JA 2A1UA 5LC1A 2E6KA 1XZDA 4GLLA 4OJKA 3RWBA 5KINB 4AP6A 1V9CA 3CVJA 1YBAA 3EEBA 1I2DA 1KJJA 4IHJB 3ANNA 3QBJA 1ST2A 5AI8A 3DTVA 3OCWA 4LOKA 1CB0A 4S24A 4BB5A 5A03A 5AW7A 1T0UA 2Q1TA 3STUA 3DBIA 1UDXA 2CNDA 1XLUA 2HJSA 3FX2A 3LVFO 2A4MA 3PNVA 3TFWA 1YOVB 1JLKA 1QYRA 3TQIA 1GP2A 1KSGA 3LBAA 2C2BA 5G41A 1GVHA 2ZAMA 4GMKA 2GKGA 1Z83A 3GUUA 4KQCA 1SKYE 4NFYA 3TINA 4HJRA 5B30A 4N3CA 1IDN1 4UU8A 4R05A 4BLSA 4IM7A 1QVRA 3OTHA 3RSLA 5K0JA 3BGDA 5T3YA 2VK8A 3ABIA 3V4PB 1G5HA 2R47A 5G1PA 4LA4A 4NS1A 2RCYA 4U2FA 3RBZA 3T4UA 1X1TA 3WRYA 4B83A 4D25A 3KKPA 5CXXA 5A9TA 3IT2A 4W6ZA 3EIFA 2B36A 2VH2A 3DCYA 4QXRA 1FX1A 2FHSA 2I80A 4BC0A 4LOHA 4KJZA 1MJGM 2G76A 2EKLA 1UXHA 3OFVA 4AL4A 1DQPA 1S7CA 4GE3A 1E20A 2VWHA 3VC2A 5EUBA 3ZDFA 4WASA 5F52A 1XN4A 2PMCA 3IKVA 4DMKA 2JDIA 4MCJA 2GXSA 3LOPA 2NGRA 2JH3A 4JLWA 3U7QB 1TK3A 4HYQA 3J7AC 1XMPA 4S12A 1RYHA 4UBNA 4V0MA 1PJQA 3DZ8A 4O8ZA 3E70C 4ICIA 4UULA 2O54A 3VVBA 1PJ4A 1MV8A 1U2EA 1B8UA 2GESA 4TMZA 3LUFA 4G86A 2JS7A 3DO6A 1QIMA 2ZFUA 3EFOA 3M6LA 4BMVA 3VU1A 3GCZA 2AC4A 2IU4A 1M0WA 3B5JA 5CX1A 3P4XA 5KREA 4ME6A 4RVFA 4URYR 4WY2A 1LDBA 2J31A 2FWBA 4FMDF 2OBFA 1PT6A 1ZY2A 3FWKA 4C4YA 1OOEA 4QG7A 1OQAA 3CPJB 4GGPA 3AP1A 4RE5A 2PFGA 1M6EX 4BXOB 4AKGA 1KJNA 1B00A 4CJXA 2BH2A 1B93A 1VKJA 2WWWA 2IT1A 2P11A 1P62B 4JNCA 4MJ3A 1KTVA 2OGSA 1L7VC 2XUKA 2ZRDA 1RJ9A 4G89A 2G80A 3SFZA 2R6CA 3GA5A 3JQ9A 1V25A 4BFCA 5C80A 3TAHA 1CEQA 2ZWMA 4RPKA 1N6KA 4QKQA 3I8OA 3GDFA 2Z6AA 4KG7A 4YI5A 5DSZA 4UUMA 2GHTA 3EVCA 1V8FA 1OAAA 1RHQA 1ACJA 2JI7A 4H7KA 4MO9A 1P72A 4QYXA 4RY0A 4EHFA 3DOUA 4H4EA 4RO0A 5LP1A 3KQNA 1P1JA 3BE6A 3RIXA 1E1DA 1R8SA 1SVNA 3PVCA 4U0KA 1FRVA 3CPEA 2X4GA 3TQHA 1ITZA 1EZ4A 2JGDB 3OWXA 5H5JA 4C0HA 3ZGVA 2FPIB 4HC4A 3OCJA 5FNVB 1X9GA 3T3NA 1YO6A 1XL1A 4CCYA 3HFRA 2J5RA 3G2OA 3PITA 4GWGA 4BNDB 4QVIA 4PF1A 2BEJA 3WL6A 4TM7A 2R6ZA 4HXYA 2G07A 2IVFA 2QD5A 2CXNA 1RVDA 2EOAA 3ZWXA 4YA6A 4DSUA 1AB5A 2XR1A 3NTXA 4YCJA 1OXXK 2E4VA 2DHCA 2FK8A 4GYJA 4ZALA 4M1YA 1EESA 4DYDA 4IO1A 1COZA 4CM4B 4YRIA 5ITZA 2WNIA 2R8EA 4LFAB 4I50B 4X54A 1LK5A 3FZEA 3QSGA 3VNVA 3BX1A 4GU5A 5F4BA 3REOA 1SRQA 4J0QA 5AKGA 1TCAA 4KQEA 3ZI4A 1ULZA 2DKFA 2VTKA 2CFTA 1P1HA 2C5FA 3NP9A 3QXJA 5EL0A 3QLEA 1WHTB 1GO2A 1KAEA 4RD1A 2RC6A 4EYGA 1NVVQ 1D2EA 2HJWA 2PZJA 3AM4A 4NNPA 4WN9A 3W79A 2FPKA 2IE8A 3FMPB 3QHAA 2IEAA 2QTHA 1IQRA 3HMKA 1EKXA 3RRFA 2BMDA 2I4RA 2WTAA 4GQIA 4LDAA 2CXRA 2QXYA 4O1HA 4PQFA 2GX6A 2C0QA 4TQ9A 1P60A 4IEEA 1D6MA 3DHYA 4XQEA 1WZUA 3KOYA 3MINB 4YUZA 1J09A 1L1EA 4H1TA 5IRCD 2Q6LA 1GPNA 1YMVA 5K1ZA 5CLFA 4LXHA 2WVAA 3MF4A 4ZN6A 3C8ZA 1CJUC 1TRHA 4BGEA 2VUHB 3UQYS 1OPXA 1U0OC 2BI7A 2GEUA 3BSWA 4MULA 1G5IA 5C8ZA 1GIAA 4D4IA 2ZJ6A 1G20E 5CVCA 4BKQA 3CEHA 2M2IA 4J0EA 4TV8B 4ZIRB 5LKAA 2VRCA 5ESRA 4P0TA 3EK2A 2IKQA 1DOAA 1JU4A 2PKXA 4IPTA 5E4YA 1VIYA 4A8HA 1C0LA 3PPWA 5BMVF 1J5PA 4NJMA 1ZK3A 4MI1A 1QAOA 1MJHA 3KTAA 5AXAA 1T2AA 3UMVA 4E5KA 1SBQA 3G2MA 3FI0A 3L8MA 3VU0A 4BFYA 2GPYA 4R9NA 3ZEAA 4DAEA 3BERA 2IYSA 3ZHXA 1O9GA 1AA9A 1TVEA 2VHXA 3R8CA 2AZDA 1A9YA 1CJCA 1Y42X 3P9PA 4YPFA 3VPGA 3N7AA 2CY0A 4J29A 2CUKA 1Y9AA 3F6RA 4M8LA 1DRJA 1DQRA 4EPTA 5C37A 1YMUA 2GPJA 2OV3A 2F2TA 2OV8A 3Q7RA 4AY5A 2NO7A 4WWHA 3IP9A 1KEPA 4ND7A 4AO6A 3A1NA 3RU2A 1HX7A 5BN3A 2R8BA 5KCMA 3AY0A 4H7DA 4I8DA 3JQ6A 1BX1A 4PC2A 2JNWA 4F3YA 4CGZA 1GPH1 4EHBA 1IRXA 3H19A 4OUDA 4CG2A 5BWNA 3MRSA 1JR3D 1OA0A 2P3QA 2Z04A 1HE5A 4ZYUA 1ECFA 1ZP6A 3ISTA 3KZXA 4AJPA 4FYJA 3HCEA 5BO5A 5L4SA 4RW0A 1FW8A 1GYRA 1YKSA 1Z5OA 3R0VA 5AMXA 1ZLYA 3D8RA 4XW2A 4OB8A 5FOUA 1HPLA 4LC1A 3PQCA 1KFKB 4OM7A 3GJ8A 3PDIB 3VYTB 4J75A 4JYZA 5E1OA 3A9SA 4BQFA 5A5FA 2G36A 2WKWA 4Y2TA 4IJVA 5FAXA 3FMOB 1VJ0A 4IDQA 1N3YA 4MK4A 2HRDA 4X94A 2GWHA 3E82A 3MXOA 3NTQA 1K7CA 2NQ8A 4X65B 4GZLA 1P31A 2PH3A 3OQHA 1IAVA 1XZBA 1CUDA 2NZWA 2XEDA 4WKBA 5C31A 2PRKA 4DB2A 2HMUA 1MIOA 3TXAA 3TDMA 4YXWD 4M9UA 2W2TA 1WBDA 1J8MF 2J08A 1RYNA 1NMQA 5JEEA 3BRSA 2REQB 3IO3A 4TKVA 4KPYA 3CN7A 4XLZA 4D4LA 2GKSA 2ZUSA 3C3EA 2IBTA 1AUVA 4NBWA 3TSAA 1RIIA 4K9PA 1TO2E 1W0CA 2Z5VA 1SQSA 3FYSA 3TIXB 4JHLA 5E3HA 4FT4A 1OAOC 1Q7GA 1E60A 3DOJA 4JDPA 1FUYB 3T7SA 5LZ5A 1I80A 2WJ4A 4QBIA 3AHFA 2HSWA 3MWJA 1VE6A 1RM4A 4YJHB 3V8BA 1OTHA 1N3IA 3IUEA 2EBFX 1A5SB 3K2IA 1NU8A 3VX3A 5SYMA 5IF3A 4NL4H 2BONA 4Y1FA 1YRWA 1K06A 5ECWA 3I72A 3KD2A 2W6MA 2X4IA 1G7RA 4WI1A 1U1DA 2O1XA 1KEEB 4BKUA 1SBNE 1BE1A 4LE2A 5FIUA 1SVSA 1SU6A 4EYEA 3EH2A 3PE6A 2C4UA 5EZQA 4LPSA 3KQOA 3CT4A 2VXYA 1KFJB 2ASEA 2NUPA 2P3OA 4PXSA 2BTQB 1N2BA 2QYTA 1M7HA 5DSTA 4EG4A 3L40A 2QP4A 4LY3A 4WNCA 4DZTA 2RHLA 1KO4A 4D6YA 3G7SA 4KSCA 4P9NA 3IVRA 1GSOA 2Z2XA 3E84A 3PR2B 3UV7A 4B43A 4RLQA 4DE5A 2QUJA 3KRTA 4GOND 4BNHA 1ISIA 2PU5A 4DTIA 3EVBA 3VR6A 4XVRA 5B3KA 5BWLA 2WEKA 3LBHA 1EPUA 2FSGA 5IKEA 4ZHQF 3HXMA 1Z7BA 1XK7A 2SCUA 3GLSA 1XLVA 1W4BA 5JROA 2YVUA 4FMPA 4YRPA 3O8CA 4FIDA 1OFVA 3AHIA 4UNNA 5KAPA 1PDVA 1SOVA 1QIHA 4I66A 1YB1A 4PVDA 2GM4A 5DWVA 3E6AA 1Z0UA 4HOYA 3DE3X 1K92A 1YJCA 3EZNA 4WOCA 4M8NE 1B6SA 3S6JA 1LBHA 3IB3A 2CXUA 3VPHA 3O1JC 1M67A 1PQYA 1WWKA 2A92A 1RI3A 1Z63A 4Q9HA 4YO8A 2BWJA 4NOMA 2FUG6 2GBFA 2FZEA 1IOZA 1RYEA 4KLRA 3IMCA 4UMDA 1CZHA 3QU4A 3ZCRA 4F12A 2BDTA 1L7DA 2HC9A 1C0PA 2VYFA 5CA1A 3NBAA 1EGVB 2IXEA 3H4TA 3L7OA 4FC7A 4G01B 4GOLD 4TMTA 4TUYF 3A6PC 5FNZA 3CKMA 4GDMA 1YQGA 1PJBA 4JH0A 1GTVA 1NMEA 3JWGA 1ML4A 4CNBA 5C7LO 3H5AA 4GPD1 3NH6A 3WLLA 1SKBA 4M0PA 3FUUA 4E5UA 4M46A 5FYDA 4R2WA 5IBCA 3OMXA 4KQHA 4HLDA 2BMVA 1U8TA 4FKBA 4KFCA 4MV9A 1RJFA 1T5DX 1F2VA 1ZK0A 2GD1O 5KC9A 5KYTA 3MWEB 1YGPA 3FCUB 1G9XA 4A9AA 3VVCA 2NQTA 2Q5QA 1MB9A 1MX5A 1SUWA 4RPLA 3QKSB 2FPPA 4K6HA 1TZJA 4WXMA 2V8OA 2PKQO 4IRUB 3LMKA 3W3AA 2HWKA 4NABA 3RRZA 2X8JA 4C2TA 3VVMA 1A88A 2AUTA 1UFOA 1N2HA 1TYAE 3FW1A 1W88B 2E6UX 3AYXB 3FLMA 3JWIA 1SN7A 2WRZA 2QDKA 5KMGB 2ZZNA 2A0UA 3SEFA 3IEIA 2LZ0A 2QD4A 4XYLA 1EHCA 2RHTA 1E3WB 5BV1A 1JILA 3UV6A 3TMAA 4X95A 5L3QB 3AOEA 2ZI3A 7ADHA 4Q3OA 3TQRA 3P0IA 4RS3A 1F8XA 1SOMA 3JW8A 4HDMA 4S1TA 2MSKA 3REQA 1K86A 1RRKA 4C22A 8ATCA 5CJJA 3V46A 1BVHA 1SVLA 1XI2A 2GJSA 3VR5D 4XWKA 4LOAA 1MD9A 1QHNA 2J7PD 3UWDA 3SSAA 3BULA 3C5CA 3MS7A 3JAWB 2Y6UA 1JXQA 1E5LA 2CXSA 3BJIC 4P2GA 1I4OA 1GZSA 5IF9A 4C7BA 2HR1A 1JGTA 2XA2A 2WF6A 3AP2A 2ZXEA 2ZYIA 5TMPA 2XRMA 2VEOA 1W5TA 3EA0A 3EFBA 2UKDA 1UBLS 2CLMB 3R3VA 4K1XA 1QKIA 3T52A 2E0IA 2RB5A 2BFMA 3OPXA 4TMYA 5K6AA 1KQFA 3IR5A 1YONA 3T99A 3SDBA 4ER0A 1NIJA 1FFXB 1E3JA 3E7FA 1JL3A 4O4JA 4Z0NA 5LYJF 2H7VA 4JELA 4TT8A 2ZYGA 3H1FA 3TLKA 1DG3A 3VAZA 2C0CA 3HBJA 4QXPA 1BX0A 3CLUD 4YALA 1H4VB 1WMBA 1YDHA 2YV1A 1ST3A 3BREA 5J5AA 2Z4SA 3OUUA 2B92A 1FNCA 4GECA 3U31A 3DPSA 4RWEA 4EW6A 1JDSA 4QGFA 4D7AA 1OH5A 4UUBA 1RNLA 1PFYA 1Z33A 2C2MA 1Z22A 4KLAA 4RD4A 5ENVA 3VOTA 3KSAC 1WCWA 2VT3A 4TGLA 2XYGA 3AVVA 1TJ3A 5J23A 4M0KA 4RTJA 1KC3A 2QNBA 3E22B 3VJRA 1TT5B 3IB6A 5H1YA 1CDEA 3FHJA 3VJMA 1UBCA 1FUKA 1UWCA 4RVSA 1VLMA 5C8XA 3C6MA 3D3NA 3WQSB 3NHKA 4KWEA 1UM8A 1IZYA 5TY0A 3VPFA 3W6NA 2DWPA 4ZJYA 1O6GA 2VPPA 4NYJR 5K3DA 3OCZA 5A9SA 4DS3A 4S1WA 5GVSA 5EIOA 1EFLA 3WIOA 3L4SO 2P2LA 4NCAA 5ECGC 1Y5RA 2DSNA 3D7NA 3ROFA 3HBFA 3QE3A 3UTDA 4A0HA 4JFRA 1U63A 2ZKIA 4U1RA 1N7HA 5ENDA 2H92A 2IGBA 2H4YA 4RIHA 3WV5A 3ZK9A 4PG6A 5KOJB 3GDHA 3HNRA 1YQTA 2W6NA 2C2HA 2OAGA 3JWPA 1H1LB 4KH0A 2LE0A 5JAOA 4KR3A 3NORA 3ROGA 5JALA 1JQKA 1L5SA 1FVXA 3DTVD 1FBTA 1CF9A 3JYOA 1CFJA 1YZYA 2IEZA 3JQFA 3QUAA 4FHFA 5CIQA 5AKEA 4PQGA 1RAFA 1X7YA 1VSUA 3STTA 3K6SB 1L4LA 2QYHA 3ZNOA 5TT0A 3IBFA 2Y6VA 3C6KA 4YMGA 5HKKA 3CV3A 2B7LA 1V16B 4H6VA 4RPGA 1N8KA 1N75A 3THSA 4J6FA 4FSXA 1C1YA 5D6NA 2IOFK 3T3MB 2Y2UA 1GU7A 2QT0A 1ZJ5A 2PR2A 1OVMA 1T4MA 2QK4A 2HQSA 2YUIA 3FIUA 4M7PA 1O03A 4FUQA 1O6FA 2E49A 4PLVA 2ZYAA 1LQTA 1SUSA 2BH9A 3AJDA 3RE1A 4QRDA 3KQTA 1KDOA 2QRVB 3VRHA 2W48A 3ANTA 4R0NA 1CRLA 4ES6A 1D1SA 3EGIA 5FWXA 3IEUA 4FKZA 5H8WA 3CVWA 3GPDG 3TZCA 5AK6A 4NY1A 1KZ7B 4EP1A 4WE3A 3P2EA 3ZG6A 3C1AA 1ZK4A 1GGHA 1R50A 2QUIA 3Q4GA 4LTMA 2EDCA 4Q7KA 1O6CA 5FXMA 3SJAA 2JDID 3FN4A 4OAPA 5AHKA 3TQOA 4Z4EA 4YS6A 3TZKA 3PA8A 1UBGA 3ANMA 4OBXA 1SG0A 3EPRA 3PJGA 4M9XA 4ZDKA 3ZDRA 4ERXA 1F8UA 1FTSA 4B2IA 4MQ5A 5CXSA 1PF7E 4DABA 3CCCA 4XWYA 1RLTA 5E7JA 3UAVA 3RTAA 1U7TA 2FWRA 2W7TA 4NYMQ 5AJXA 3U3DA 3FGNA 1S3IA 1OW3B 4IUYA 4BTVA 4DQ0A 4CEJB 4BZZA 2ODNA 2QT9A 3TRHA 3AERA 2HBQA 1WDMA 3LIIA 1I01A 3OSUA 1CY0A 3BKWA 3NLLA 4XDZA 2ZWVA 1GPMA 1CBUA 3UF0A 3PWKA 3BUSA 3K09A 1E1NA 2WD9A 4D1YA 4E6PA 2F59A 4ETWA 1F2DA 2BFAA 2C0PA 2XDYA 3MUNA 3A6FA 3R6TA 3RBXA 3SP1A 4C14A 5CG2A 2ZJBA 1JAIA 1DUSA 3IMGA 1X7GA 5AHRA 3CBGA 5GM1A 1RRVA 3CX7A 2VK4A 5DNAA 2QAGA 4C3VA 3FPKA 4M83A 3FOAA 2LXNA 1RYFA 4BATA 1T0JB 2IH2A 3A4LA 4XWWA 3BH7A 4F38A 3HLKA 1Y1PA 2WTNA 3C7TA 1CQWA 1JDTA 2I2WA 3EZGA 2JK0A 2GZHA 4Q3AA 2IYVA 3UA4A 5JADA 4MWEA 4YAOA 4XM2A 1FX0A 4US0R 1RZVA 2BFCA 3R5XA 4DRXB 3N2GB 3C5VA 1NUSA 4ENQA 1EH5A 3OZTA 4HGRA 1OCEA 5LXTA 3O4IA 4G0VA 1O77A 2XUFA 4R8SA 1Z6XA 3LWDA 1H2WA 3ZYCA 3W1WA 1TVKA 1BGWA 2BCGY 3PQ2A 2ID8A 2TRSB 1E4EB 3I9LA 1H2YA 2IHVA 2VBCA 3OVMA 1K6EA 4L9AA 1EB8A 5LBIA 4QNNA 4ZO7A 2A6PA 4Y2XA 1RWMA 4ZOBA 3AKZA 3RANA 4CUJA 2H5EA 4WNIA 2RGAA 3CM0A 3LXXA 5CFZA 1FSZA 2VBIA 4R1PA 3GRUA 4EB0A 1Q0ZA 3KEMA 3OQMA 1XLWA 2WVHA 3LK6A 4QPZA 2O20A 5JNUA 3OZAA 1QFYA 3GGDA 3RYFB 4BRUA 1DKLA 4M6WA 1NQTA 3FNHA 3RTBA 2IUSA 2ZSHA 4M3NA 1R6AA 4Q1DA 2XTMA 4U6QA 3RVNA 5ADWA 5C52B 3HFGA 2W6OA 2ZPAA 1O8CA 4UTXA 1YVEI 4PHCA 5B37A 1X86B 4MJLA 4ZVUA 5ESDA 3ZXYA 1XHEA 5SV2A 4FHEA 4E1BA 4MUYA 2HHAA 3RIYA 1PL6A 2QTMA 2UZ0A 3AUAA 2PEZA 1Z8DA 2FFQA 5KYWA 3AF2A 2EG9A 1PQUA 1EGHA 1XRPA 2AV6A 5CJ2A 3BD6A 5ELMA 1VMKA 2AGVA 4FLFA 3WAJA 2V9ZA 3TCXB 1E2EA 1PGQA 3I0ZA 1RQ7A 1UEIA 4AP5A 4UCWA 1MJNA 5I7WA 2KHZA 3OX4A 4R0VA 1XZGA 5JSYA 3DUFB 2CNKA 3GRRA 2C95A 1VA5A 3NR2A 5CFPA 2Z95A 4Q39A 3UOGA 5EJ8A 2ZB4A 1OBHA 1QBGA 3CMMA 3H5WA 4PHFA 5E3JA 2GDJA 4FDVA 4JLMA 1ULAA 2W70A 2J32A 2YY5A 5LU9A 1MQAA 4IICA 2Q3MA 3PC8C 3PSAA 4KO4S 3VH2A 1MX9A 1AM4D 1GFZA 1NIPA 4ZVTA 3A9VA 3MWGA 4FN4A 3SMQA 1E0DA 5JZVA 2RGWA 4AY2A 3EVEA 4IMRA 3BA6A 2Q9CA 4HH4A 3DFFA 2GJ8A 2Z8YM 4R9UC 2I76A 1M1YA 2BELA 1PVOA 4MS1A 3DNPA 3MW8A 3FVTA 3UYKA 1JIQA 4WA7A 2XQKA 5JLJA 1GKYA 4I55F 2BEUB 1U7HA 2GILA 4C05A 4DIOA 5JMOA 1LF0A 2P6OA 1GG9A 1KZYC 3BXZA 1C7EA 2V6MA 4Q15A 1Z26A 1QF9A 5THQA 5EMMA 3H1GA 4G6ZA 5CUQA 4E2FA 1Q1QA 1S5PA 2W2OA 3HO8A 3NVMB 4ENRA 1QRSA 4TRJA 1W8DA 1X70A 1R27A 3HCCA 4FQ8A 2VDLB 3M9LA 5DI3B 1Z35A 5LUAA 4UASA 4ZFNA 3LTNC 1UXJA 5A9RA 2IE0A 2IZ6A 4U0JA 2XTNA 5C34B 3R76A 1JHRA 5A0VA 2ORYA 2YJTD 2R7KA 2PFSA 5JH7A 4E2ZA 4HUTA 2X9VA 2AX4A 3AUYA 3DVQX 3ORQA 2VNIA 2B8JA 3ITEA 4ENSA 5CB4A 3WA7A 2Q21A 1EA7A 1N2XA 2PUBA 5BQOA 3RU9A 4MRPA 4EFKA 1F5SA 2B34A 1XVTA 1C1DA 1W4ZA 3U3RA 4LJ9A 2WKRA 3KKQA 4I3FA 2AMLA 4TS4A 3BK2A 3O93A 2FU5C 1PEDA 1WU7A 1E69A 1EG2A 3ECAA 1RW4A 2ZT8A 3O75A 2YY7A 4ZXFA 4ZV9A 3C16C 4IJ5A 1D4ZA 3EAQA 2OV2A 1I51A 1ZEMA 2BGTA 4PVCA 2H1CA 4Q12A 3WRVA 4BN5A 2O19A 5B57C 2CZCA 1HI9A 1P2FA 5HJ2A 3R4CA 4IHJA 3CVVA 4POOA 4K0RA 2QW0X 3GJ5A 3FDFA 1Q77A 4QECA 9ABPA 2R00C 1T2VA 3GBPA 3H5IA 4PNPA 4ZQHA 1QHIA 1X39A 2ZIGA 4G0XA 4B2LA 5LZ2A 3GLFA 2H7XA 1IN1A 1CR6A 1YOVA 2NUBA 4LZOA 2VL7A 1OHHA 1LSUA 3PGXA 3MWLA 3GEBA 3ZCTA 5AKXA 1CCWA 4D26A 4YP6A 4BNWA 4X7RA 2HTFA 3VA7A 4PLTA 1QYIA 5B2ZA 1T9CA 5KNCD 1J4AA 1DAOA 4Y0AA 1J5EB 1WMEA 2UXBB 1WTAA 3A6HA 3DKIA 1LPNA 1UAAA 1V45E 5IWCA 1XPOA 3BAZA 5FADA 2IUTA 3GDGA 1Z2OX 2F3PA 1RI4A 1TEXA 1TQ2A 1RCFA 1WL8A 3GPBA 5FPTA 3HCAA 3VO8A 4D4JA 3COPA 5E3IA 3WGZA 5JHGB 4JP3A 4M7WA 4O4IF 2XQJA 1ZRNA 2BBTA 4B45A 4NDZA 3L4KA 2XOKD 1QOZA 1XCMA 2PT6A 2HYIC 4B3BA 3R7BA 1EK1A 1PWZA 1T10A 5H4HA 3D3JA 2ZWAA 3BZBA 3T3EA 4F86A 3NNDA 4EF5A 4G5YA 3TRDA 2ZSIA 3GU3A 4XKJA 1KWKA 1WP9A 2G67A 5E6RA 3UBTA 2Z3WA 3U7QA 1MO5A 5D3MB 5CFMA 3AY6A 3GFQA 5J3JA 5COBA 1VXRA 2B30A 2H07A 2QPLA 1VBMA 4LX0A 1Z37A 3OIYA 4CKWB 1V2HE 1JG6A 1TJYA 1M7BA 1FDWA 1VBKA 2A5DA 3QOFA 3A25A 4BMZA 4TZ0A 5L51A 4M87A 4PYRA 5LOVB 1FJ2A 2OP0A 2K7FA 2VOJA 1P3DA 2YIMA 4K8RB 4NPCA 3TL2A 5DFAA 3AXTA 3UKJA 3ADCA 4OQXA 1RI1A 3IPLA 4OYYA 2CVZA 1ORTA 3LUDA 5K0GA 1C8VB 1HWYA 2GTHA 4PG7A 4XWOA 2QE6A 2ZQYA 2AG8A 4HAZA 2ERYA 1A96A 2QP9X 3QGMA 3ZDEA 3N5KA 1ICEA 3B3AA 5FBRB 3UUWA 5EZ6B 4DG9A 2G9UA 2I7XA 5T4FA 4KXFB 5JJ5A 1QIDA 2YHIA 4LNHA 3MWYW 3WGLA 4BMYA 1B23P 1C9JA 4K05A 4GG1A 1ZM3A 3T3PB 1DEOA 4GVLA 3DMRA 5DK6A 4F4CA 1ZM9A 4LHVA 4XASA 4BQEA 4PV7A 4RK0A 4URHA 3VR6D 1U8XX 3ZVNA 1WBBA 1LLDA 1U8EA 2YQ5A 3ESXA 3H5RA 1P3Y1 3TTXA 3EEIA 1QGDA 5H83A 2A0KA 2X2FA 8GPBA 5IM4A 3E35A 4TTTS 4KN9S 2PUCA 3DUWA 1TMYA 3DYIA 2PA0A 4F7WA 1H9AA 3GEMA 2D00A 4G8JA 1SVWA 2C96A 1C8LA 2MMGA 4N3NA 4GM4A 5HOEA 5P8WA 2Y1FA 5KNDH 2FPIA 3BK7A 1F4VA 3AIKA 4FFLA 4OFXA 5FNVA 4ZVQA 3U3OA 2HXYA 4FJ2A 1NJSA 2HU7A 5LMNB 4PRLA 4BNDA 1PJRA 3QE9Y 3SS8A 5FORA 1L8OA 4YASA 4EEZA 3U7HB 2PUVA 2ATEA 3RVKA 1O6BA 4HG2A 3FA2A 1IZ9A 2HLPA 2FZWA 1G5QA 3K30A 3QA3E 3F98A 3F74A 4GQBA 5BSTA 2QJFA 1GCOA 1PUJA 2AR0A 4G36A 1ZJ4A 4QJIA 1MO3A 4C1BA 3OUZA 3KO8A 4CM4A 1CIJA 4JZKA 4UPDA 1GNPA 1QF6A 1N5LA 4I50A 5T8KA 3VC1A 1J97A 4FGSA 2ZI4A 2R7LA 3C6BA 3WXBA 1NA5A 1K7EB 3EFEA 4P7JA 1NSFA 4IKPA 2HK8A 3ENKA 1KAOA 2DPXA 2GLTA 2ZW9A 1TLFA 4AMYA 3X1MA 1XA3A 2H7YA 2C9MA 2FW1A 3FFWA 3L8YA 3UAZA 3G2PA 5A7FA 2ZQ5A 4PG4A 5HKBA 1VDZA 3E0QA 4I4LA 2JD1A 4F5WA 3GGOA 4G0WA 4R5HA 2I6XA 4H7EA 5EE9A 2X0FA 2W5UA 1ZL2A 2DWCA 4UE3S 5TQJA 3TIGA 2VDRB 2AMYA 1GG8A 1SIWA 3QYJA 4N82A 1EFTA 2QSZA 1VCNA 1CVRA 1W59A 1PWXA 1Z0ZA 3NEYA 3U0VA 2C5BA 4ARCA 4Z0PA 1YNSA 5LQMA 5FUYA 4F3KA 2I4TA 3SDSA 3ZY6A 2HNAA 3PG5A 4B8YA 5JS6A 3W3AD 1EVEA 3Q15C 3F4LA 1RXSA 3QPWA 2A9FA 4A6DA 2YH2A 4C0XA 3ICOA 3HB5X 4ZIRA 1XR3A 5DX8A 1HTTA 3PC6A 3TIFA 4FGUA 4FT2A 2XECA 3D54D 5I8ZA 5JZSA 2WNSA 3FCOA 3HUUA 4R8VA 1N0HA 2WDZA 4QARA 2Q3LA 1BHO1 4XDHA 3T41A 4EMTA 4UTNA 1QPZA 4JGBA 1WX1A 1Y7IA 2VPYA 1A7KA 1OXKB 4R1UA 3FGPA 4R2IA 4BO1A 1LU9A 4NENB 3AHJA 5JNSA 5J9FA 2P27A 2Q4DA 3LPDA 4WZAB 1KK1A 3K1AB 3GCDA 5JPCA 4BQIA 2NO0A 2VIIA 3IAM1 3NBXX 4PQEA 3NAGA 2DJIA 3FCAA 3K73O 3MIZA 4QQRA 4XJSA 5KOYA 1EFDN 2WHQA 5EUQB 2JAUA 1CUXA 5G0TA 4F97A 3ETCA 4JC5A 4P34A 5JJKA 2J3DA 3QUBA 2R3SA 3CJQA 4KVZA 2X8LA 3ANLA 4GWLA 4QDJA 5C8YB 2DLCX 5F3DA 3C24A 3U9TA 1SHUX 1HURA 4EL0A 3BQMB 1WABA 4QRIA 4PHTA 4UQOA 3NALA 1QQTA 1PT7A 3MSCA 3HKEB 4Y6GB 5FV7A 1JDPA 4P58A 2C1XA 3TOZA 5KVCA 5GIPE 4LY6A 5HWSA 1VI5A 2IYRA 2OHHA 1QLHA 3Q12A 3C3DA 3PRKE 1U7OA 3BXGA 4NE2A 5F9HA 2EW2A 4P4SB 4PGAA 5LWHA 4D8UA 3FCCA 3ISJA 4P38A 4MR8B 1AB6A 4ZJZA 1PGNA 1HF3A 1PIWA 3PDIA 4Q1VA 2ISQA 4EM6A 3MPOA 2VSXA 3LUAA 5G02A 4DJEC 5C1PA 1SB8A 2P8SA 5IJ9B 4E5YA 1R6VA 2L69A 4GSLA 4ZDIA 3MTDA 3K0HA 4P31A 1QCYA 3PXGA 3NG1A 4EB6B 5IG2A 3F97A 4YDSA 1Y1RA 3ZNPA 4QXOA 3EF3A 1II8B 1W7AA 4NXMB 3BHMA 3DFKA 5TLSA 4TSFA 1IM5A 4HT3B 1SXJE 4H3VA 3UO8B 3HUFA 2PX8A 3FWNA 3C43A 3WOHA 3GFRA 1YZQA 3Q3JB 5KZMB 1Z45A 1IPFA 5H16A 3SZUA 4QYTA 4AZ0B 1Z6GA 2VBFA 2REQA 4E70A 3KZMA 4MV4A 5DEOA 4C3OB 2NM0A 3IO5A 1F20A 1TZCA 3T3OA 4EJ0A 3HACA 4QQ8A 1LA2A 3TE7A 4BNKA 4EMBA 1C14A 3AKYA 3JVEA 3PFKA 5TMEA 1HSOA 4UMEA 1S01A 3IHWA 4EBFA 3DB2A 4Z9YA 1IIRA 2OHGA 1ZI6A 2NW6A 2FAXA 5CVDA 4AUNA 3C87A 4YPOA 4FYXA 2DPLA 1W4RA 2WE8A 5HKKD 4YJHA 2Q0SA 2YIDA 3FFBA 3CLSC 1JR6A 2O8FA 5EJIA 3UH1A 4MW9A 3F1KA 1FZTA 3H3JA 1J25A 3EVAA 3ASUA 2D62A 1IK4A 1Q11A 2XE6A 5KQLA 2AK2A 2KI5A 2WFLA 3DOOA 4L4YA 3SHFA 4X66B 4AMVA 2E4XA 1I3MA 1WSDA 1U1FA 3VKGA 4WY5A 1MXHA 1P2SA 1QANA 3HUDA 4YP7A 2XWPA 2AB0A 1NKVA 2YFYA 2E5WA 2J87A 1KJIA 1N6LA 1OFUX 3QYAA 1SCBA 3U49A 2BTQA 4WVLA 3UXYA 3RJTA 5A4FS 4QU5A 3WQHA 3U3JA 1U7WA 5TQ2A 1ZIPA 2EFCB 2PUJA 3KVRA 3QFCA 4JUIA 4NYIQ 1HBJA 2Z0MA 3QF4B 4HLUC 2OYRA 2WSSA 1RPAA 3UAXA 4V1CA 2RG7A 4RXUA 4HAWA 3RRMA 5C4IA 3H2ZA 3QH4A 1Q57A 3T95A 3DZKA 3JQAB 4R1QA 3S27A 4BFXA 2E37A 5PGMA 2RFLA 2ATXA 3OZWA 3WKBA 2RAFA 3BL5A 2WHEA 2P5UA 4IFIA 1G8YA 2I6UA 3KZOA 1PVDA 3QVMA 1F2TB 4JLKA 2P4HX 4JP2A 5DHPA 3UPDA 2NP6A 4WCFC 3GP5A 2ZBDA 4MQEB 1N36B 1J56A 3MJEA 2JC3A 3NGMA 4LTNA 2JIOA 1YA8A 3NW9A 3VYSB 1GL3A 1VDMA 1GJRA 4XGIA 1JJIA 1CETA 2FW9A 4LEIA 3V7WA 2V74B 4OKSA 5EEGA 4YRJA 1TEZA 3MS2A 4II2A 4FFWA 2ZRIA 3CHYA 2QV7A 5TGZA 1XDGA 5HFAA 1Z4NA 3DEFA 2BLNA 3T15A 3LDHA 3QXSA 4Q4JB 4TKLA 1GGMA 2G1PA 2XNCA 4BVAA 1P4HA 4LOLA 4JAVC 1TOAA 2PM8A 1M2GA 1UCFA 1GNVA 4F2GA 3GJ6A 1Y1LA 1TUBA 4TTSA 2I8LA 4LQ4A 1W30A 4K6FA 5GJCA 1Y8CA 5JV5A 1JJ7A 3WMEA 1HK7A 2O48X 1VIDA 1DZIA 1ZK2A 2NYRA 3BXFA 1KJYA 3IOYA 2HX1A 1M2FA 3KXLA 4OQYA 4RVDA 5EQFA 3T54A 2BYTA 4F46A 4RGVA 2CVOA 1A9XB 4ND8B 3K0AB 1AF4A 4JI8B 4TKZA 3BTUA 4RJTA 3PF8A 5CR9A 2NZUG 1TIBA 4R69A 1FCJA 4UBIA 1NM5A 4L9SA 3DGFC 3BH6A 4H2DA 4YDHB 1KEZA 4CKCB 1P5RA 4BS9A 1LDNA 2B3DA 4MGHA 4ZWNA 4JL6A 2VHZA 4KRYA 3ETEA 3FYHA 4LVUA 1SHKA 3W05A 1OLSB 5K9ZA 3F3MA 3KZ1E 2YXLA 1GGVA 5J2UB 3DTYA 4OX9B 1XJ5A 3MWEA 3O31A 3L0DA 3CNNA 3DZHA 1ZAYA 4I5IA 4E3ZA 4UAVA 4H1HA 3KLBA 1A72A 3HLTA 3QKSA 2V58A 4MVXA 1RXVA 2P9HA 3KALA 3LCUA 4US2R 3KR9A 3EVDA 2HA2A 1RS0A 4U3JB 2UXDB 3JYHA 3EVNA 2XBUA 4KIUA 5EHNA 2BKVA 3CVOA 1PUXA 3HP7A 4Y2PA 4LJAA 1NJ5A 2PL5A 2CCGA 2XHZA 1E3WA 1JMVA 2GN4A 1LRJA 3CUYA 1Z6YA 5L3QA 2DBYA 3JYQA 1P9LA 1IUNA 3KUCA 3SC6A 3TMKA 1E1YA 3ZE8A 2UYOA 4DARA 3Q6NA 4ZI7F 4ZK2A 4DDMA 1IN4A 1BE0A 4BWYA 2QSJA 3EBLA 3OEYA 4OHVA 2JVKA 2PE5A 3ONVA 2WM2A 4Q1EA 4M8IA 4BB9A 4D3XA 4U5XA 2NZYA 5EIEA 3QPUA 3JAWA 5K3EA 3WADA 3AJEA 4JI3B 1W4LA 3ELYA 4OOEA 1BEEA 4HPJB 4DMRA 2GZ3A 2VDNB 1K4MA 1XTTA 1YT5A 2PJUA 2ZAYA 3I92A 3NNNA 4L22A 4MW2A 3EOAI 4BZPA 4XDYA 1A8SA 1WTCA 2QD3A 3WFZA 3WSWA 1DDIA 3KOUA 5AFSA 5B6JA 2NMVA 3RV4A 5I7FA 2P2SA 1H5NA 3I2IA 1QLJA 2CKDA 1CR4A 1QH0A 2WT4A 4U7GA 4DA7A 4YCCA 4J2HA 1QH8A 2XUJA 2Z43A 1TAHA 1FFXA 3UC9A 3WLMA 1J06A 4Q1BA 2FFJA 4B7ZA 4JLSA 2Y4NA 1NE7A 4BWGA 3V1UA 3DM5A 1DFGA 4B80A 3WWEA 3W5AA 4D97A 4D8TA 3NANA 4NDAA 3SGLA 3NHWA 1OR8A 3D7LA 5C18A 4JI6B 5FUQA 1GEEA 3GOQA 3BGIA 3SQMA 2GZ1A 4RAQA 2IS6A 1FU4A 2P9JA 3S2FA 5AOCA 2JCSA 1M74A 2ZZKA 3IUBA 1YDWA 3DT8A 3GWZA 4IV0A 1XP8A 4G09A 4MB2A 5BUCA 3LUGA 3OPQA 3HCOA 2Y9PB 5JPDA 2TMYA 4UATA 2HCJB 4LRSB 4RMNA 2HWWA 4PCLA 2FUEA 4ZOLB 3WMXA 5JFTA 5EHZA 2IUYA 2C04A 1JB1A 4B3SB 2Q3HA 3R7WB 2JIBA 3MRTA 4V0ME 1IE3A 1COWD 5F77A 4E1VA 1NNI1 1P73A 4I3HA 3Q85A 4F5EA 4YUYA 4YCNA 3LCRA 4TSKA 3F67A 4BNZA 4E31A 3DZBA 3D3QA 1EFPA 4PYKA 3Q98A 5LQNA 4GR4A 4BFWA 3ASZA 4J49A 1G6Q1 2WTXA 2P41A 4P3KA 3T8YA 1QE5A 3WG9A 1A8IA 2WQ7A 2OBXA 2Z2KA 4WBXC 3PXBA 4PYQA 5KOJA 3W77A 3TE6A 3FGZA 3KTOA 3S8EA 4ZKDA 2PJDA 1H1LA 1GV0A 2AXPA 2EGHA 2ZRFA 3TBHA 1IXYA 1KDVA 2AS0A 1SJ9A 2UZ1B 2XT0A 4L3WA 3WKEA 3I28A 2OHIA 4OAOA 2WW8A 3PDJA 3JAKB 1NLMA 2GBPA 1ZD2P 2HRBA 3QVSA 3ELUA 2J41A 3NO4A 4FWTA 3K6SA 1R0WA 1ZKDA 4Z0HO 1E92A 3AI3A 4ITRC 4NZMA 3KIPA 1V16A 4GRDA 5IYZF 1N0VC 1XZLA 3WBJA 3FTEA 3IDFA 3TKLA 1GT91 3ODGA 1KOGA 1I7NA 4UKDA 2WU4A 1MRZA 1YUMA 2NO4A 2PXCA 3L7CA 4KQGA 3WVNA 3I52A 4IFBA 4C0SA 2H65A 3I30X 3RC2A 2QRVA 1RM5A 4A0FA 3SY8A 3PENA 1BDJA 1OFTA 3OA2A 2UV8A 5FA8A 4RLHA 5TQVA 3S2GA 1QU3A 2FMKA 1WDWB 3OQ1A 5HTKA 4CMHA 2CXTA 3A6ZA 1Y48E 1QG4A 1XRLA 1G21B 2Q3DA 4RELA 3TJZA 2C8JA 1FXSA 4OKIA 3TI7A 2NX2A 2JD2A 1XWWA 3X2SA 1FTWA 3ONFA 1TK9A 3K05A 5CXQA 1BXKA 4AICA 3RIMA 2OV1A 3RKUA 2LRHA 5IHXA 4I4CA 5BOVA 2JFFA 4X3OA 3FNQA 4HQKA 1LK0A 4HQFA 1X77A 2FSSA 3NWEA 4HVCA 4YAWA 2X6TA 1L8QA 4FINA 2C4KA 2QR2A 1N6OA 2ZB7A 4EW1A 3GT0A 3QI2A 5JO0A 1E9DA 2XCLA 1HY3A 2KLBA 3CCFA 2IUUA 2WHYA 1YZVA 1KYZA 3A1FA 4CEJA 4WTOA 5CCXA 4V0SA 4PO1A 3FE2A 3K0FB 3AETB 1Q15A 3OLZA 3NKVA 1NN0A 3GQBB 3MRVA 3ILSA 2A0WA 1USVA 4A26A 1XZKA 3DOIA 5DP1A 2JLZA 1P2TA 4WGGA 4E30A 5LM3A 2BGJA 2NZ8A 1S8NA 2O2HA 3LX8A 4EZEA 1YS9A 1GRVA 5JVDF 3AJAA 3ZKWB 2X1MA 1H6BA 2P9QA 1Y7LA 4K28A 3RS8A 1JFTA 2PAAA 5BSRA 1B16A 1R10A 4IW3B 5L3ZA 3K20A 5F1KA 3R9WA 4ND4A 2YJ5A 2AFIE 2NYAA 4QELA 2GN2A 4FX5A 4CBVA 1OREA 3D3EA 1H0HA 1DC7A 1OU0A 3IKLA 3K5HA 3N2GA 4HBZA 4IV5A 4CM5A 2ONYA 3QEAZ 2WY2D 2X15A 4HK4A 1I8TA 4DWWA 1Q95A 5FL7A 4DLYA 1IH8A 4MS4B 2XWBF 4PLCA 5KQGA 3IEVA 4NOJA 2F62A 5AESA 3U19A 1Z36A 4LN1A 2W2QA 1E4EA 3TZLA 4FYIA 2CBGA 3QM1A 1U3WA 4CTNA 1RQRA 5E6UB 1VFNA 5DBHX 1P44A 1DJPA 3FNGA 3E2PA 3HA5A 1MVOA 4D42A 1VG8A 2X23A 2P9YA 2YJ4A 4AUEA 1ZM7A 4DJAA 1YQWA 2FJUA 1ZUD1 3UUEA 2X9NA 3FUVA 1UOOA 2A14A 4YB8A 4DKJA 2JIPA 1T1RA 1MTZA 2AG6A 2GSDA 2KW5A 5EVJA 3SHQA 4TN5A 2AHRA 4MR7A 5AOAA 3K35A 4EO9A 4P3PA 1FYXA 2JA2A 2JATA 3PZBA 3U48A 3IAM6 2C5SA 3DBHB 3NHPA 4UUPA 1SEVA 2H0QA 2J48A 5FF9A 4GT1A 3TXYA 3HUTA 2FQ1A 4WAUA 3F73A 3C45A 4X6YA 1ZR4A 2Z5GA 4L1KA 3NMUF 1SVUA 3OD1A 3V8VA 1CG6A 1N33B 3ZNQA 1RYBA 1TQHA 4KZPA 2DXIA 4BRWA 2C4NA 3DUFA 1V8BA 4XGRA 4ZYWA 2RGNC 4V0KA 5AW0A 5A0TA 2A59A 3I2GA 4OMDA 2ZT7A 1WXEA 2XGMA 3WYEA 1J2JA 4LMPA 5CDFA 3UAWA 5B6IA 2RGRA 5IN4A 1KL7A 4Z54A 2OP1A 1ML3A 2VJMB 5EFOA 4YR9A 3Q0IA 3I61A 1FC0A 2KMLA 3OMWA 4W8OA 4FI3F 4O4HB 1PZEA 1WW8A 3AF0A 4PGMA 1W2GA 1Q20A 2IU0A 3TJMA 4RMHA 3IUPA 1NYTA 3QTBA 5E2BA 1QFJA 2GH1A 2O52A 5IT0A 2NP7A 2BR3A 3PU6A 3PHLA 3LKZA 4QXAA 5ALXA 2HV8A 5BN4B 4MIEA 1L5FA 3NYQA 2AEMA 2BEUA 4TMFA 2RGDA 4I1YA 5HRCA 1HKHA 4F3TA 4Q1CA 2A9VA 2ZI7A 2ORIA 2L19A 4BHTA 5HJ5A 2OFWA 4HDSB 4LY0A 3C7DB 4B79A 4OQPA 3CVXA 1PR6A 4X60A 2UZIR 4RTPA 2APJA 4OD0A 3PI6A 2VJKA 3QLVC 2ODPA 3HB4X 5IU6A 1YK1A 1L5LA 4C87A 2CL7X 2PTHA 1PHPA 2YDXA 5DI3A 5EI5A 2Z98A 2XNJA 3JQBA 1EK0A 2MHCA 4L78A 1XQVA 3UVEA 4C08A 2X7XA 5FBZA 2EARA 5D7NA 2IP2A 4I2VA 5ICGA 2MSLA 1RI5A 1R4MB 1XD9A 1MG0A 2XZPA 1ZNZA 1PW5A 3JS5A 5KS2A 3VBCA 1DXHA 4PBRA 4QPDA 1E6CA 1I94B 2OSBA 2CGEA 3LHDA 1P7VA 1WOMA 1SXHA 4C43A 4ZYLA 3GEDA 3WTBA 3EPJA 1JJFA 1XMJA 4U2EA 2A5JA 1IHDA 1C4OA 2BR5A 2X7JA 5K05A 4LKRA 5IEBA 1R2QA 4HYTA 1L8XA 1CP2A 2ZULA 3IJ5A 4UJ5A 4IG9A 5B2EA 5LIRA 4ZT7A 2HMTA 5IMBA 4FD2A 3MGKA 5CM2Z 2I9KA 1IOVA 4ZU6X 1UBOS 2W8ZA 1OY1A 1EXNA 2G5GX 2Z30A 3DO8A 2GMWA 3GDWA 2RK3A 3Q7EA 3UEOA 2ODQA 3Q8KA 3GEGA 1QG2A 3CBQA 5IZ4A 1T35A 2Z56A 3HZZA 5T57A 1V7CA 1ECCA 2C7VA 1Z0DA 2ZJZA 3GD5A 2IKSA 4TSFD 3ZDYB 1UUFA 1ZGCA 4A0SA 3DSRA 1NXSA 4ISBA 4YRNA 4H3KB 3W78A 3BB4A 3DEKA 5I5GA 3BWYA 1RLMA 2VR1A 2VRBA 2WF5A 4I0WB 4E3WA 2CXHA 1WLSA 3VPDA 2HQBA 3ROZA 1U8YA 1ELOA 1X94A 5C35A 1L6RA 4EJ6A 4F5DA 1EZZA 2OBYA 3AI2A 2I71A 2IUFA 3IIKA 5GMOA 4CT0A 1RKVA 4LYFA 1F6BA 1FFSA 1QV9A 5HQ3B 2GPAA 5KJCA 1F3OA 1G8PA 3EW7A 3KPVA 5CVEA 2DHEA 5I6DA 2FTKE 1D2HA 3FB1A 3K8YA 5FD8A 2OPBA 2RIRA 5M2QA 2CCKA 2RJOA 3KETA 1T91A 1S89A 2YJZA 4PZYA 1KNQA 1U0FA 2QI9F 3M9XA 4HN9A 1C81A 2VUTA 3K0SA 4P32A 1JS1X 3HVRA 3N1UA 3HI4A 4D45A 2K2WA 3IX7A 5K3SA 2RHGB 5EXXA 3UGKA 9MHTA 4J0JA 4ARIA 1UBMS 5D3MA 3P5SA 1GLVA 4MITA 1JI0A 1NRWA 2VDVE 1XTZA 1UDBA 2WICA 5ADVA 4LRXA 3DEHA 5F64A 4BYMA 1V8OA 3QLUC 5LQRA 2GBLA 2W43A 5AH0A 4CKWA 2F4VB 3SICE 1MAHA 1G3MA 1DDGA 1K6IA 4FCWA 4JR2A 4YWHA 2J9XB 3W8FA 4LYAA 3ZK8A 4DG8A 2WR8A 5CFOA 2GPBA 5DNCA 3NGXA 5ALEA 4RXTA 3IUJA 2X58A 4ZCRA 4NJOA 1UKYA 2R85A 1GGFA 3ZW7A 2WU1A 1PZFA 3AX6A 4C2UA 1ZNXA 3I1JA 4KWTA 5K7SA 2YS7A 3L8DA 4QNRA 3FHTA 3TR5A 4HLQB 1H3EA 3ESRA 2V6GA 1Z2EA 5KWEA 4YCSA 4O5AA 4X3CA 4CEHB 2WSSD 1ZNYA 3VZCA 2YV4A 4YJ3B 3OZCA 3E4DA 3SJZA 4BE9A 2C78A 3IA2A 3RGWS 3KXPA 1HFEL 4G97A 3SQNA 4DQDA 3GWGA 3Q3HA 4I6JA 2CB0A 3G0GA 5HSGA 3JTMA 2HIHA 4JL8A 3MMPA 4MVJH 3V2HA 3CRMA 3HDJA 4NFLA 4QNMA 4GPEA 4QXMA 4XE5A 3AF5A 1OAOA 3UN1A 3WIEA 1MPXA 2GK6A 2E89A 2ZBGA 3VPCA 4B35A 3W5CA 4U7TB 2J0SA 1I3OA 1GVNB 1O95C 5KUTA 2WPNA 4M9RA 2WA2A 1U65A 4F8EA 4PINA 4YAEA 2I78A 2YL2A 1RFLA 3H3XA 4CQJA 4C88A 2V7BA 1T5HX 2VTEA 2UYYA 4BO7A 4B82A 2ZBEA 2HOQA 2I7VA 3Q72A 4ER5A 1M75A 1TMGE 4KN6A 1S7GA 3WS7A 1TUGA 5JZOA 3K1YA 3MMXA 1Z39A 2DU8A 1Y82A 2XE7A 2B78A 5FQNA 3H2YA 1NY5A 1KKMA 4R1MA 1RHMA 2H4FA 3JARA 3P71T 4NI5A 1U9IC 3QMPA 2EQ5A 2V9PA 1C7IA 3PNOA 2ZBQA 3PC7A 3UJ3X 4BO3A 3OIWA 4EYOA 2ZS8A 2PLFA 2QSUA 1EUZA 5AW6A 3TEMA 1AA6A 1GN8A 1L7XA 3H4MA 3UK6A 1Z17A 4P0QB 4LJ5A 2C5GA 1R5NA 3A9TA 2C88A 3OH8A 3CE9A 1C41A 2JIRA 2GTPA 3R6LA 1LUAA 5D86A 5B55A 2DOKA 2N46A 2PGIA 3ANXA 1U5CA 3SBDA 1L5YA 4IWNA 3W2IA 3AKDA 1I7DA 1N0IA 2E48A 3NKFA 3SR3A 4COOA 5IJWA 1Z4QA 4OLHA 2G25A 2X5JO 4IF4A 5DGDA 3S2EA 4HNTA 3DO5A 1PRYA 4ZVMA 4PAQA 1CY8A 1N7GA 4XOIA 5CLHA 1XVVA 3M6FA 1HMPA 5FLEX 2A33A 5C1IA 1M1XB 1ORHA 4JUBA 3KQLA 3AG6A 1YU6A 2QUBA 4QPNA 3R1IA 4PS1A 1FYVA 2HHJA 5TJHA 1OZGA 1CC1S 1XDZA 1ARZA 3ZWMA 5BNZA 5ELXA 1JXAA 3RROA 3HR7A 4IIYA 3G5MA 2ZIAA 5B1HA 3L1IA 3I3OA 4CFZA 4TTAA 1O89A 3DEJA 3OE7A 3C4JA 3UFXB 4BGVA 3X44A 4BX3A 1X1BA 2YYYA 3HCDA 1Z88A 4L07A 4I4IA 4ZHSA 1AMNA 1TJ4A 2B69A 1KEWA 2RKOA 3WGYA 1XMOB 1NX6A 5HCNA 1T8PA 3VR4H 4DQVA 4E5SA 4QJ5A 2VS1A 4MSUA 1OILA 5AM2A 1PI3A 1WOYA 2QUHA 1JIUA 2QRQA 3OLVA 4NBUA 3GELA 1E1MA 1XTVA 1N8SA 2XLCA 4NENA 4Q47A 3QVLA 3EXG2 4MVYA 2QPTA 5JSQA 4ZK6A 2C82A 4ZAVA 4Z4FA 4JYPA 1G8FA 1AKTA 2YWCA 1VTKA 2EJCA 2QM8A 2Z8XA 2ZJFA 3K1AA 4NBLA 3UT6A 4GI5A 4QDXA 1FDSA 1VFPA 3KQVA 1CPYA 4K5QA 4LDQA 2KS6A 1XG5A 3DF7A 3REGA 3E81A 4PYJA 3OOWA 1NPTO 3OKCA 3B7GA 4XIIA 2CJPA 4B9AA 1VG1A 4DILA 4ALNA 3TWOA 5C8YA 1J21A 3LWNA 3MUEA 1E3LA 1NI4B 1C8BA 5SZIA 4J03A 4A03A 3HKEA 1Z7GA 2WP0A 2DCUA 2QRPA 1OGYA 4WXRA 5AICA 1O58A 5G0SA 5BYKA 5JRDS 5FWYB 4IJKA 3HDYA 3GRVA 1XKQA 3EY9A 4BVHA 1LTHR 1ECGA 4Y6QA 3O8OB 1D2MA 1MOPA 2ABWA 4P4SA 2N1MA 2VTVA 4RVOA 2PBRA 3W2HA 1CHNA 4WCDA 3A7DA 3QFFA 4MR8A 3RBVA 2RJNA 5C51B 4DCCA 1V71A 2B21A 5PNTA 1ZGBA 4G65A 4LE1A 2XXAA 3EC7A 3Q3CA 3NM5A 2R8OA 1GQ2A 1VKNA 3EZXA 1PD0A 2IPNA 1BO6A 5IJ9A 3A1WA 1NI5A 2ENWA 3CG0A 4DCJA 3RF7A 2Q2VA 5KSOA 5FTWA 1I3LA 2PBFA 2V6FA 3IQHX 4EB6A 4NR0A 3D2AA 4KQ2A 2I8CA 1X1EA 5F5NA 1GDDA 4BVGA 1ZUWA 4RA9B 1II8A 2LKCA 2O7VA 1VLJA 5DHQA 3IVMA 3T7CA 1IQPA 1BXGA 2GN9A 2QTCA 3T38A 3BTOA 1YVRA 1ETUA 1Q19A 2PT5A 1QZUA 4M49A 1ZBQA 3BJMA 2PMEA 2YWFA 2DJ5A 2HN9A 4DT1B 3WB9A 5G4KB 4GZ5A 4B6QA 1N2SA 1GQYA 1U6JA 1LTQA 1ZINA 3TOVA 4M21A 2QQ5A 4CCSA 1R4NB 4PHHA 2J3IA 3TS1A 3B3JA 2A5GA 3EVGA 3AFMA 5F1PA 1IBLB 3AY3A 3DMDA 5BPHA 1ZX1A 2ZRPA 4DNXA 1PX2A 3AUTA 3ZV5A 3HXKA 3MGBA 2IYQA 1USWA 5CDUA 4Y2QA 1KRWA 5ITVA 4EIWA 2C84A 1JLRA 1PFQA 1RT9A 4AYTA 3O4HA 4RHCA 4PXYA 4JI5B 2BHLA 1GEGA 3M6AA 4BIIA 1F2UB 4W9MC 4EUNA 1E6EA 1F4LA 4WFJA 2HWUA 5LQCA 4DCNA 3CVYA 1I1QB 4GL2A 1MJ5A 3IS3A 4CHGA 1G2PA 2PNFA 4YBZA 1NURA 1ZICA 4G4GA 3UWMA 1W4AA 5DP2A 1H3NA 2OG1A 3GJ7A 3I39X 4IVPA 1ZXLA 2OA0A 3LVQE 4RTQA 1SK8A 4Q4AB 2XUZA 3CZ4A 5DYWA 4AJIA 4KPGA 1P2VA 1NNEA 3B5EA 3PQDA 5DLDA 4UEWA 2V1UA 1ZH0A 1R9GA 3QF4A 2Z2IA 2DECA 4L4UA 1GCUA 1M10A 5AVTA 1BDIA 3RSGA 2HADA 5DYGA 1DO2A 4Q9JA 2XLBA 4F11A 1T8TA 2DUMA 2C2OA 4FW9A 3LX4A 4QULA 1A5AB 3ISVA 4K6KA 1QTQA 1AZWA 3LNTA 4GRIA 5AOBA 2Y2VA 2PNJA 3KWJA 5BN1A 4JJ4A 5BR7A 4YYZA 6Q21A 3DFZA 4MHOA 3LSYA 3MB8A 4DDHA 4CZ2A 4B3JA 2ZR9A 4MQEA 1JRLA 3NHLA 4NIMA 4OBWA 4M0MA 3KEQA 1FB5A 2F67A 3JASA 4M1WA 2VJPA 3WGNA 2V6JA 4K6CA 1ZUNB 4QU8A 4EQZA 5IS2A 1IY1A 1Z2PX 5HXAA 1FXWF 1FSSA 1LH0A 2JAOA 1UWVA 1F6DA 4BBPA 2JGFA 2QZZA 2YN0A 1CJKC 3FJYA 3INGA 1Y1QA 1VJCA 3JRWA 3X1JA 3HYLA 4BO6A 1QQ7A 4Z1MA 3HN2A 3Q1LA 4LHEA 4Q4JA 4EJSB 1FS4A 5CW1A 1PLLA 5T6BA 4WJLA 1FFHA 5KHOC 1ZN9A 1Y6RA 2VQSA 4RFLA 3G2KA 3S7ZA 4O0LA 3UAGA 2XKKA 5HZMA 2F9FA 1IMJA 1XDSA 2JFYA 1VGVA 5JBNA 1SG6A 1Y3DE 2O8NA 1PG0A 4Y9DA 3U3MA 2VT7A 2QNIA 1L4GA 3KQPA 4JJKA 1QF7A 5DBOA 3VO9A 5I4BA 4YX9A 1QGZA 2CB9A 4ND8A 1JTVA 2GERA 3KJFA 3CLRC 3K0AA 4OU5A 5FL7D 3WJAA 1VLVA 4L0MA 4AUKA 4YV1A 3B70A 3W5JA 1U7PA 1E4OA 2DLNA 3M5CA 5JXIA 4N8DA 5HA5A 1T34A 1V6CA 4GEGA 4MINA 3Q11A 4MQ6A 1XQWA 1F12A 3QBEA 3NHUA 4CKCA 4QFCA 1ZDMA 5DM70 3EJ6A 3OZXA 3PD0A 4QDUA 5KNBH 1BKYA 4RZSA 5AVSA 2YFQA 3AUJB 1WKBA 3F4KA 3P1JA 4ZP1A 2NUAB 5J2UA 3VI3B 4ABTA 3WRXC 3O4JA 4V0OA 2P68A 4JXJA 1JEEA 1YL6A 1Z15A 3QNWA 4QQNA 4HXFB 4G9EA 5JZMA 2QAJA 1WXHA 4JUCA 1YL7A 4HF7A 2FUCA 1ZI9A 1OLXB 2IUEA 4YI3A 1XF9A 2XXBA 1XAGA 2VH5R 4PG5A 3B1FA 4AJEA 3LM8A 3Q2KA 1YQDA 2CLCX 1LC0A 3QTTA 4K1LA 5TMDA 4C21A 4B75A 2OOKA 3QVVA 4KDCA 4F91B 4MA5A 3PQ7A 5EUMA 4JLNA 3BDIA 5EKDA 5LB4A 5JFOA 1E1LA 1R5OA 4WQMA 2DETA 3OF2A 1P4AA 1U5AA 3VSEA 2IHZA 1HG0A 1LBEA 2EX1A 5FUWA 3U56A 4XGQA 3FOEC 5A4MS 4MYRA 4FQ7A 5I3CA 3R0IA 4D99A 4CHTA 2F8TA 4F3RA 1XCOA 2ZKLA 3PDWA 1LVUA 3PQEA 3AFIA 5K8TA 2AG5A 3CUWA 1Q0HA 2AKYA 3KFLA 4OXXA 4HGZA 4KE9A 4EFDA 3NUZA 4HWSA 4LZWA 3C3KA 3T4EA 1MC1A 3SCZA 3ZZMA 2BM9A 4O4IA 3CEMA 4DDUA 1PLJA 1Y9ZA 3ON5A 2JPDA 5KTKA 3S2ZA 1R6TA 1YSCA 3RYIB 2FI1A 2A5FA 4EUHA 2JGEA 4P7KA 1JDNA 1LBTA 4TWRA 2N47A 5KHLB 2Y93A 1TPYA 1Q1EA 3AHHA 1XD8A 4ZAZA 3SMVA 2OQRA 3R2JA 3EMKA 1GPYA 1QO0D 4NV0A 5EYPA 1Y4ZA 1KEVA 3DC2A 3OO1A 5DGTA 1IEQA 3SIXA 1SAYA 2HNKA 4I6EA 4OFBA 3AM1A 3FOFC