5SYNA

Cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
PLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Acyl-protein thioesterase 2
total genus 73
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5synA00
3F98A 3C8HA 4DTCA 4Y2SA 4KE8A 4FKBA 5FRDA 2ES4A 1BROA 4U2BA 1VA4A 1MT3A 4LXHA 3M82A 1LPAB 3RK4A 3WWDA 2XMGA 4PO3X 3IULA 3WKDA 1XRRA 5AM1A 1NU6A 4WY8A 4BBZA 1AMNA 4I4CA 2BUBA 1UK6A 3ANTA 1CUYA 4GEGA 1FFCA 4OCZA 3GZJA 5K3BA 1LBTA 3JW8A 4UFPA 4QWMA 1WM1A 3I28A 1W75A 2VF2A 4HVTA 3T4UA 4BYMA 5CMLA 4LXGA 2IX9A 3R3ZA 2V96A 4KR0A 4UFOA 1AURA 1CPYA 2CZQA 4UUQA 2VJAA 5AKIA 4BCCA 4UBIA 1K4YA 4CIBA 2HRQA 3F9CA 3M81A 4G8DA 3QMVA 4BP9A 4W1SA 3FNBA 1QZ3A 5JAPA 3EIOA 2J4CA 4GWLA 4QDOA 1N5RA 1WCYA 1CUZA 2HADA 4G5XA 1JJBA 3M3DA 4M0EA 1VXOA 3QVMA 4EZIA 4CCYA 4Q1VA 4UHHA 1X2EA 3WK9A 2Z3WA 4Q05A 1UZAA 4P9NA 3C6XA 4BAGA 4RPCA 3SC2A 3AUKA 1T4MA 2W6CX 4RNCA 4X00A 4J7AA 4MQMA 3BJRA 2W22A 5JD6A 5CXXA 4U2DA 1CFJA 4EY7A 1QFSA 4FFWA 4P08A 5J3JA 2ZSIA 1J1IA 1ZJ5A 4GI1A 5HF6A 1PFQA 4BTVA 2VAVA 2ONCA 2RGUA 2CBGA 5HF9A 3AIKA 2DR0A 3VJMA 1W52X 1FSSA 4B80A 2XMSA 1TKRA 1UKAA 5E2IA 4WCVA 5ALYA 1DU4A 3H2IA 7YASA 4CG3A 2HHAA 4BCBA 5CH5A 1EA5A 1GPNA 2VJDA 3ZWQA 4HRXA 5CW2A 5ALDA 2VA9A 2O2IA 2FX5A 4FHZA 4Y2RA 3HC7A 5D6OA 5HF5A 2GZSA 4Y2VA 3PF8A 3K6KA 1D07A 2H7YA 3GA7A 3IVMA 2JGMA 2VQ6A 1VE7A 3D5EA 4Q82A 5AKHA 1QIIA 3WYNA 2PSHA 1QTIA 4X7BA 3S2ZA 1SCKA 2BUAA 3FOBA 3WKCA 5I8PA 1UXOA 5FPQA 5IKXA 5LZ2A 3AJAA 4BE4A 4FMPA 5KWJA 4F60A 3C87A 3CXUA 3QITA 4A23A 1UKBA 1YA4A 1ZI9A 5CT6A 3IUQA 4QLAA 4Q3OA 2BCEA 3A6ZA 5ISMA 2XQIA 5JALA 3BF7A 1CR6A 5DYWA 2XQFA 4FLMA 1VKHA 2H7CA 5AOBA 1QE3A 3WK6A 4W1QA 3WK5A 2JGLA 5HKBA 1R4ZA 4AMZA 4PQEA 4H7DA 2XQKA 4DNQA 3NOXA 3C6ZA 4BDTA 5EIEA 1IZ7A 4C4ZA 5ALSA 3QM1A 5ALMA 1CIJA 3GROA 2JGJA 4PNZA 1QIJA 1YB6A 3NUZA 2OCKA 3A2MA 3O4GA 2XDWA 2C58A 2JEZA 2C5GA 3BWXA 4LIPD 3WJ1A 1P0PA 4B82A 3VJKA 1MO2A 4OU5A 1AKNA 1P0MA 3ED1A 4KE6A 1CUVA 3I2GA 4C87A 2B4KA 4B84A 4W1PA 1WB5A 5SYMA 4W9RA 4JYPA 1ETHA 1K5PA 4ARAA 1MNAA 3FVRA 3R0VA 1JJIA 2WU3A 4YK7A 5HKAA 1TAHA 3WA6A 4GLBA 2DQYA 1LPPA 3WWPA 5DNVA 2XMBA 4LKOA 4BATA 1LPMA 1MPXA 1J07A 4UBLA 1H2YA 2HA5A 1UKCA 4J3JA 1CQWA 3IA2A 1X2BA 3STYA 2WUGA 5HQ3A 2BGNA 1MX5A 3NWOA 1JMKC 2E3JA 5DYYA 1VLQA 1TCBA 1CUGA 1EDBA 4QA9A 5CH8A 3DKRA 4QDXA 5HCUA 3ESDA 2JGIA 5FPPA 4NVRA 4DSZA 2P8SA 3FLAA 4Y7DA 1P0QA 1MJ5A 1CUFA 5ALPA 4AN1A 1X70A 1ZOIA 3PUIA 3D0KA 1XRMA 2QUAA 3G0GA 4UPDA 5T4HA 4DNPA 1YAHA 3G9UA 1MN6A 2YYSA 3AZPA 5ALRA 5A71A 3STUA 1VE6A 1XZDA 3DD5A 3W04A 4GHWA 4JNCA 2I78A 4OYLA 4Y2UA 4CIAA 5LKAA 3WL5A 5IVHA 3FBWA 1XRLA 3F67A 2PU7A 5ALZA 4WFIA 4QDZA 2RHTA 3MUNA 4IHAA 1TIBA 2AJ8A 4W1RA 5HQ3B 2WJ6A 1QLWA 4K5QA 1HKHA 2WHRA 4MYDA 3EQ7A 3G0CA 5IVIA 3L1IA 3CCBA 4FNMA 2C0PA 4BRSA 2DHEA 4Y2QA 3TEJA 1G5FA 3WQHA 4X94A 2EEPA 1EDEA 3OTQA 3FWHA 2XUJA 3A2NA 1NX9A 3VXKA 5AH0A 2YASA 3EQ9A 1C4XA 3RARA 3G0DA 1HDEA 1CEXA 3FYUA 1Q84A 3I2HA 4J0DA 1A8SA 2CUTA 4NZZA 1DWOA 1ZIYA 2VSQA 5BV7A 3F97A 3UMJA 1HL7A 1DWPA 3VISA 3I1YA 4C01A 1G42A 5T4EA 5JAOA 2HA4A 3CCCA 2JF0A 3C6YA 1XQXA 1H2XA 3WL6A 2XE4A 5AICA 5AI5A 4P92A 5EHQA 4J0KA 2XUAA 3ICWA 2WG0A 3FYUC 3ZI7A 5I9IA 4X97A 2GZRA 3FLEA 4Q34A 1E8DA 3UUFA 3STVA 3SX4A 3DLTA 1N8SA 2I03A 4BB0A 2J3QA 1YA8A 1EVEA 5ALTA 4ETWA 4DNOA 2QOEA 4EY5A 1E66A 3QBJA 1G4HA 3DDUA 3OC0A 1BE0A 2R8BA 4PSDA 2ACKA 3V1NA 5ALJA 3L1HA 1BN6A 1NU8A 4N5IX 3W05A 2CEKA 4OUKX 3BDIA 2BAGA 3QYJA 3NGMA 5LZ8A 4KAAA 4B85A 1ZICA 1DX6A 1JKMA 2OLEA 1XZIA 4G4JA 4J0JA 1MAHA 4X91A 3R41A 4CFSA 3A2LA 2QS9A 1ORWA 5DNUA 4X90A 1QFMA 2Y6VA 1CUSA 3IUNA 5K5EA 1VA5A 1YS2X 2OCLA 4CCWA 1GT6A 3WI7A 3WK8A 2JGFA 4J0GA 1DQYA 1WHTA 4EBBA 1UK8A 4H7EA 1QONA 2JBWA 2O2GA 2XUOA 3ESAA 1XFDA 2GBCA 3R3VA 4H7KA 5EI5A 1FFEA 1GQRA 4HAIA 3H2JA 3RLIA 4ZI5A 4HS9A 2WHPB 2WFLB 1EHYA 1E8MA 1MX9A 4F21A 1W6RA 1RP1A 4AZ0A 2D5LA 2D0DA 1ZGBA 5CXUA 1MU0A 2VEOA 3OM8A 4XIIA 1SCQA 4MQLA 5EGNA 2J3DA 1E8NA 5D3KA 3PFBA 2Y6UA 5D7BA 4WJLA 1LPBB 2XI4A 3H0CA 4EY6A 5ESRA 1DX4A 4KE9A 5KBYA 1EDDA 2Z8ZA 5AHXA 1XZFA 1JU4A 1W1IA 4HXEB 5AI9A 1TCAA 4TPKA 1DT3A 4A16A 2CKMA 1KEZA 2PSJA 1XLWA 3V1MA 5AK5A 2XUPA 2XUKA 5H3HA 1R3DA 4H7IA 1MAAA 2HIHA 2Y2UA 3D4LA 4TVKA 1BCRA 4AO6A 1Z68A 1WB6A 3C43A 3IB3A 1AC5A 4UBKA 4QNNA 4X85A 1CRLA 2G5PA 2O7RA 5T4BA 2XUGA 3IUMA 4U2EA 3WYDA 1P0IA 1E3QA 1XZAA 2WIDA 5AKYA 5AK4A 1LGYA 1TCCA 1CV2A 1H2WA 5AP9A 1IUPA 2WUFA 3PDCA 2OPHA 4EHBA 5I7UA 5AKGA 2PUHA 4UBMA 2ZJ7A 4H35A 3DL4A 2XLBA 1OXMA 1B6GA 3FYUB 3HLKA 4BVJA 3BF8A 2RIPA 4DSAA 2OG1A 1IUNA 3FCYA 4BVKA 1QIGA 3V1KA 2ORYA 2QKYA 4BZZA 1YASA 1U2EA 3QPCA 4WY5A 3ZLVA 1YR2A 3A70A 4YASA 3C8DA 1LZLA 1JMYA 5BWCA 3DOHA 3BIXA 5JD4A 3G0IA 4EB0A 5ALEA 3ZLTA 4OYYA 2ZSHA 5FXMA 1J2EA 4UHCA 4M0MA 2GYUA 1W4LA 2HU8A 4KYVA 4ZV7A 1EI9A 4Q3LA 5AM0A 3BL8A 4K6KA 4XVCA 1QOZA 5AM4A 4F5ZA 5ALKA 2HRRA 1TQHA 4JEIA 3H18A 3R3WA 3LIIA 5AIAA 2FUKA 4ZGBA 2NW6A 5E4JA 3N0TA 2WSLA 4U2FA 4X95A 4F0JA 1F0PA 4GBGA 1A7UA 3R40A 5FDFA 1A8UA 1T2NA 2I3ZA 2HA0A 2QM0A 4S0XA 3DYVA 4Y2PA 3Q0TA 4CCYB 2OAGA 4H7FA 1UK9A 4UHFA 2QJWA 4BRZA 4KEAA 2EDAA 4UHEA 4X93A 5K3FB 4Y9SA 4PF1A 5AI8A 5EHXA 5ALFA 3BE8A 4FBLA 4U2GA 1QIFA 2Z5GA 4MWSA 4H18A 3DQZA 2OCGA 4L3WA 1R9MA 4I3FA 2H1IA 1R9NA 3AIMA 2WFLA 1ODTC 4ITVA 2AJBA 2C4HA 3FCXA 2OXEA 5ALHA 2V98A 2IITA 5AIBA 3WWOA 4HXFB 5EHNA 2HA2A 3O9VA 2B20A 4C88A 3VJLA 3AINA 4C6HA 5FV4A 4AXBA 1KU6A 4KACA 5A2GA 3O4HA 2YH2A 2QTBA 3MUOA 2FJ0A 2XUFA 2Z8XA 3BDVA 4K6GA 3C45A 2OGTA 5C7YA 4C4XA 2C5FA 1IUOA 1LLFA 4Q3KA 2PX6A 2PSFA 4FLFA 3DEAA 4DYHA 5A7FA 4B83A 1YAJA 3D2AA 4N8DA 5EIHA 5K3FA 3HXKA 3OOSA 2R11A 4U2CA 3HSSA 4B0OA 1L7QA 1AX9A 5LZ9A 1L7RA 4X3CA 1ZD3A 2Q0XA 3Q8WA 4QDTA 1HQDA 3EQ8A 4PW0A 3WKAA 2DSNA 4EY4A 1A8QA 1HBJA 3HJUA 4ZWNA 2JGEA 2WHQA 3V9AA 5JZBA 3I6MA 1UFOA 5ALQA 2HA7A 3FAKA 3ZV7A 3TGLA 4DMKA 1CQZA 2G4LA 1XQVA 1BU8A 3R3YA 4K2AA 5LKRA 2X8BA 1VOTA 4K6HA 2PKYX 4OB8A 4MYSA 3OG9A 4BE9A 1QTRA 3CN7A 4QEKA 3KOOA 1XQWA 3DYIA 4H0CA 1WHSA 3ESCA 3MVEA 1XROA 5CH3A 3WWEA 4BZWA 2WIGA 3HEAA 5AK6A 5JAHA 3QZUA 5LZ4A 3V48A 1DQZA 4ZV9A 4INZA 5AJHA 3VVLA 1USWA 1Y37A 1GPKA 4FLEA 3I2IA 5HK8A 4Y2YA 2B61A 2JIDA 4G1FA 5AKJA 3I2FA 2XMRA 3B3QA 3LS2A 3KD2A 2VAXA 2YXPX 4IH9A 5JANA 1BEEA 1W76A 3M83A 2K2QB 1BCSA 1XZHA 2CJPA 5JYCA 3HI4A 2DQZA 3C5WP 4N5HX 4DM7A 5JIBA 5CRIA 1FJ2A 3HZOA 2XLCA 4H7JA 3DKKA 1ZD4A 1ORVA 2VTVA 1RWQA 1QJ4A 3WKBA 5E4YA 5AI4A 1ZIXA 4KRXA 5AKKA 1ZJ4A 3PICA 1N5MA 3OPMA 4UBOA 5LLSA 1DINA 2PSDA 4OB7A 3FYTA 2GYVA 2XMZA 1JFRA 1WPRA 1YSCA 5EIAA 5K3AA 3WMRA 1BRTA 1M33A 3O95A 4DMFA 3H04A 3ZLUA 3G0BA 4QDUA 3STXA 4YX9A 5CURA 4X6XA 2LIPA 4M0FA 3AFIA 1BS9A 5AM3A 1QO9A 4EA6A 4J03A 2WFZA 3H2HA 4BC0A 5AO9A 2PM8A 1OILA 1IZ8A 3HRHA 1QIDA 3PE6A 2AJLI 5IH7A 5DJ5A 4E46A 4PSUA 5KREA 4LHEA 3H17A 2G5TA 2WUDA 2QT9A 2Y2VA 2XMCA 3GFFA 4J0HA 4AX4A 4BCDA 1UWCA 5IVDA 2OCIA 3D2CA 3VKFA 3WZMA 5FOQA 5E4TA 2ZYHA 3HYSA 3G8YA 3JYHA 2V9ZA 1ZD2P 2XMQA 2VT7A 1K63A 5DLPA 3TRDA 2Y1KA 1O6FA 3RKSA 5CTAA 5JZ9A 1E89A 5HFNA 1G66A 3IDAA 4GXNA 1Q83A 3D2BA 3H2GA 3ICVA 4NS4A 4FOLA 3QMWA 3E3AA 5LIPA 2WM2A 4OD0A 5AI0A 4QE3A 1VZ3A 4QLOA 5T4FA 1E5TA 4N8EA 3W9UA 1B41A 5JASA 1LPSA 3WWCA 4FWBA 5LZ5A 3QPAA 4IO0A 1C7IA 2HFKA 1QIMA 5JAUA 4L0CA 4KAJA 1SOMA 4J0CA 5K3CA 2WHPA 4BDSA 2QRUA 4UHBA 1H22A 2HA6A 1KU0A 1LPOA 2XUDA 3VDXA 5JZSA 2DFPA 3KXPA 2WTNA 3KWJA 1AGYA 4UBJA 5CT9A 1EB8A 4KJXA 4DIUA 4ZREA 4G9EA 3WJ2A 4AB1A 1XZKA 3I6ZA 1JU3A 2J4FA 1GZ7A 1YCDA 1K8QA 1IVYA 5F4ZA 1WOMA 2UZ0A 3PFCA 4CG1A 1CUIA 1TK3A 2PU5A 2EDCA 2QVBA 2PPLA 3N2ZB 1S8OA 3DCNA 5C8ZA 4B81A 3DNMA 2JEYA 1EXWA 1JJFA 3FVTA 4E14A 4DMCA 2BGRA 3FSGA 1Q0ZA 4X92A 4LXIA 4RGYA 1EINA 1XZLA 4CI9A 4V2IA 4KAFA 3IURA 4G9GA 3DL7A 3QH4A 3C6BA 2WTMA 2PUJA 4E15A 3ESBA 2AXEA 3KSRA 3I2JA 5AOCA 1GKLA 1HLGA 1WPXA 1XLVA 4PSCA 1U65A 4DLNA 3E0XA 3E4DA 4I19A 1LPNA 3E1GA 2ZYIA 1OCEA 4HXGA 4L9AA 1N1MA 3K2IA 2PVSA 1FFDA 2OAEA 1CUXA 3OURA 4KE7A 1XRNA 1Y7HA 2OGZA 3WIBA 5ALIA 2WQZA 5KWIA 5HK9A 3H19A 1XKTA 1L7AA 2WIKA 2QJRA 2WILA 5AM2A 1LNSA 2XMDA 3H1BA 5FLKA 3T52A 5ALOA 2ZYRA 3R3XA 4EUSA 5JATA 1MNQA 4B0PA 4FFVA 2AJCA 4B6GA 3F96A 2WLSA 4AMYA 2H7XA 5LZ7A 2RHWA 4G8BA 3WKEA 1H2ZA 1RYYA 3W2TA 1VZ2A 3LIPA 5FKJA 5C81A 1CUWA 1CUDA 2XQJA 3UUEA 5K3DA 1CUJA 1EH5A 2C7BA 1Y7IA 4DNFA 5JADA 3PI6A 2GYWA 1R50A 4JH0A 5A7GA 2FJPA 1EB9A 2X5XA 5JD5A 4LYEA 3LCRA 4N8SA 2WU4A 5DNWA 2HL6A 1MTZA 2BFNA 5HF8A 1XLUA 3DJYA 5CT5A 1CVLA 2XUQA 3GBSA 2CMFA 5CT4A 5AKZA 3HABA 3U1TA 2HFJA 4OSEA 1XZJA 3ZPXA 4ZXFA 4W63A 4HZGA 3L1JA 3AZQA 4MXDA 3G9XA 1GKKA 1QGED 4FDMA 2ZVDA 1UOQA 1IMJA 3AZOA 1XZBA 1XRPA 1CUCA 5K3EA 5A6VA 1I6WA 1WB4A 3EF3A 3KDAA 3DOIA 3QMMA 1UT6A 1CUHA 3P2MA 4OU4A 2QUBA 4MEAA 5DYTA 4BVLA 1FFAA 1HPLA 4YPVA 1EX9A 5HZGA 3SK0A 1A88A 3V1LA 3STTA 4BAZA 5EHZA 4WFJA 1EK2A 2HA3A 3PF9A 2QR5A 4G4GA 4AZ3A 3QPDA 5BWBA 1PJAA 1GPLA 1LBSA 1F6WA 5AI6A 2XT0A 5YASA 4CG2A 2WG2A 1XZCA 1QIKA 2O7VA 3F8SA 2HDWA 1K6EA 1J06A 4ZRDA 3W9BA 4B7ZA 3GELA 1QIHA 5JARA 1R88A 4BP8A 4X6UA 1CUAA 1CLEA 3R3UA 1VJ5A 3WK7A 3U0VA 3BIWA 4J0IA 2OQIA 3X3HA 2QXTA 5CBKA 2RI6A 3D7RA 3G9TA 4B9EA 3H1AA 2ZJ6A 2BJHA 2VJCA 2X76A 2XB6A 3B5EA 2VATA 3GUUA 4BTLA 1XQYA 3G9ZA 2DHCA 4FBMA 3H2KA 1XZEA 4UHDA 3BXPA 4KRYA 5ALUA 1YB7A 3G02A 3O4JA 1QO7A 1PV1A 5FP0A 2G63A 2WG1A 5LYYA 2HM7A 3STWA 4WDQA 5AKEA 3WZLA 5SYNA 5A62A 3O9MA 4DGQA 1SFRA 4Z49A 4XX1A 3LLCA 1C7JA 2C0QA 2HU7A 2JGKA 2QXUA 4E11A 1CUEA 2OQVA 2XQGA 4WFKA 1DTEA 2WIFA 3D3NA 2ZJFA 4Y2TA 1AQLA 1JT2A 1U4NA 3I1IA 3ANSA 1Q0RA 2WJ3A 3W06A 2PBLA 4C4YA 4NMWA 5C8XA 1AZWA 4ROTA 3AIOA 1ACJA 1GQSA 2VT6A 4Y2JA 1JI3A 5AK3A 2WFMA 2BKLA 5IVKA 2WIJA 5CT8A 1ZD5A 3AILA 4GW3A 5ALLA 2RONA 3WK4A 1SC9A 4GDMA 4OPMA 3B12A 4C89A 1BN7A 1UK7A 3S8YA 4IQ4A 1ACLA 1XKLA 4HTAA 2WKWA 2GBIA 4IH4A 5AOAA 5LP1A 1GGVA 3O4IA 4H7HA 1CUUA 4P93A 1ISPA 4PV7A 1O6GA 4RE6A 1YS1X 4B9AA 2V97A 1ODCA 3IUJA 4MJ3A 5DWDA 3WLAA 2PL5A 5HFAA 3I6YA 2XUHA 4UBNA 4A5SA 6YASA 1R1DA 4UFNA 3WL8A 4AN0A 4TGLA 2DCMA 3EBLA 5A7HA 1ZI6A 1LZKA 3LP5A 1DT5A 1F8UA 4H77A 3IBTA 1EK1A 1ODSA 3MGAA 2ROQA 4D9JA 2QZPA 2CB9A 3RM3A 1H23A 1EVQA 4QZVA 3C5VA 2VJBA 4AQDA 3FSGD 5ALNA 4G4IA 3ILSA 4GECA 2HU5A 1XZGA 2BUCA 3PUHA 4MEBA 4AO8A 4FNGA 4XWGA 3IIIA 4RE5A 2I3DA 4WDRA 1SCIA 2B9VA 1FFBA 3DS8A 2AJDA 1F0NA 1MX1A 2ECFA 5ALVA 2QMQA 4DMHA 2O2HA 4G8CA 4JUIA 3SWWA 4XJVA 5AKLA 5ALGA 2DHDA 4MWTA 2WUEA 4O08A 1VXRA 1U8EA 5AKXA 5D3ZA 1QIEA 3WIOA 1ZI8A 4ARBA 2RAUA 5C8VA 3WL7A 3TJMA 5AM5A 2XUIA 2ZYSA 1BEZA 1GXSA 3VVMA 2Z3ZA 1THTA 4BC1A 1ZGCA 4LYDA 5ALXA 5BOVA 1XRQA 1TRHA 3WA7A 4EY8A 3I2KA 4IH1A 3JWEA 2H9YA 3FLBA 5DTIA 2ACEA 3K9BA 5FUMA 3BJMA 2GBGA 4X71A 3YASA 4Y2XA 3D59A 4X6YA 4OB6A 4FTWA 5ALWA 4L72A 4AO7A 5EFZA 1UOOA 1DWQA 4BAUA 4QWWA 2GBFA 1THGA 1CUBA 1UOPA 3HACA 2PSEA 5DTJA 3C70A 2WJ4A 3G7NA 3O0DA 4HRYA 3KWFA 2OGSA 1AUOA 4JYMA 3CN9A 2IIVA 1XZMA
chains in the Genus database with same CATH superfamily
5JDCA 3FDJA 2ZM5A 2VDKB 1RE0A 4IW3B 3TIIA 2Z1MA 5FUBA 1RHUA 2EP8A 5GV7A 4BP3A 3C6KA 4HLDA 4DDUA 1KAHA 4QU8A 3VI3B 4AJ9A 4L02A 2R1ZA 3H16A 2X0FA 4KE8A 1Z29A 3CURA 4A6XA 4FKBA 4EHDA 1YE3A 3EFHA 4YJFA 3ZXSA 1Q2UA 1H8EA 3E8XA 3ZNQA 4GSLA 2WP0A 2B7BA 2C2OA 4H3SA 1XWFA 1MT3A 2ZB8A 4V39A 4R8MA 3CVYA 4LXHA 3OQBA 1BJTA 3SC2A 3MPOA 1FP2A 2I2BA 4N54A 4EB6A 3M70A 4QG3A 4CT0A 5H9WA 1VHWA 1T3HA 2QV0A 4PYLA 2LPMA 5DNAA 5JVDB 1A4IA 2OHJA 3WKDA 3FTEA 5KDOA 1AXEA 2C97A 2Y1WA 3GXOA 3U81A 3V4ZA 1IWPB 1IN1A 2EWVA 1NXOA 4WY8A 4B6RA 2MTBA 3H9JA 5HM8A 1GUYA 4CIWA 2VNHA 1TUGA 1XLTA 2I7CA 4Q1AA 4L8VA 4DR7B 1UK6A 3A4MA 1VLLA 3ANTA 1ZXLA 4BTEA 4RYLA 1CUYA 1RLMA 2GN4A 2GJ8A 2XODA 3I39X 3EVGA 4GEGA 4A8HA 1Y8RA 1U9ZA 4FI3C 5GM2A 1O3YA 4QWMA 3I28A 4JUFA 3VC7A 3O1LA 1VKNA 2BH2A 2I4TA 2ZCUA 4G2NA 4FSXA 3DC2A 3T4UA 1MHTA 5SYAA 1K6JA 1LBQA 3ONEA 5AYVA 3M6FA 1Q0UA 3QPVA 3TK1A 2BF7A 4AZ3B 4DWOA 2FW7A 1O03A 1VYUA 4JQZA 1JYEA 4AUMA 1UZUA 1V16B 2IX9A 4LJAA 5B4VA 2V96A 4FK8A 1FX1A 4KR0A 4JEHA 4DREA 5G4KA 3R3HA 3L0CA 2LW7A 4UCQA 4BFVA 4RW0A 4EGQA 2G0AA 5HVNA 4FYWA 1TM7E 1YONA 3TCKA 4RKFA 2CYBA 5KTSA 2VJAA 1Y3CE 3WYBA 1UKYA 5NLLA 4UNIA 1P2UA 4E1BA 3HXQA 2V74B 3C4VA 3KTDA 4Q9LA 4YRTA 4DSNA 3LDFA 1F51E 3AHGA 3NNDA 5DTRA 1WDKA 2I34A 4OQDA 2JDIA 1GPUA 1TU0A 3B82A 1EE1A 4JR1A 4QUJA 1Y82A 1YDWA 5ELMA 1BOOA 1I32A 1IEQA 4EG3A 5DNCA 2NUBA 4BP9A 1URPA 3FJOA 3AV0B 4W1SA 1UWVA 3E03A 3OICA 3FNBA 1QZ3A 2QMOA 3LKBA 3ZCXA 3MS7A 3EIOA 1TQDA 1XD2B 1YV9A 3IE2A 5I3ZA 3KDSE 4QDOA 4DVJA 5JEDA 3KJFA 2ZW9A 1WCYA 1VG8A 4DSOA 1UINA 1CJUC 2PIDA 1SMKA 4FGWA 1OLUA 3L1UA 2SECE 3TB4A 4D9MA 4YRDA 1PO7A 3Q5EA 4RZIA 5JSFA 3QFSA 2IP4A 4L74A 1USVA 2CW5A 1SB9A 1V8PA 1VXOA 2QLNA 1NJ1A 2C31A 4ZEXA 4CCYA 2CLHB 1X1RA 4C76A 4REQA 4FE7A 3RQSA 3JZFA 3EUWA 4NZOA 2PGXA 1Z7EA 1YZHA 2X0RA 4RPCA 5F2EA 3BFVA 2A94A 3AUKA 3MIIA 4JOCA 4TL6A 4TL7A 2GJSA 5C5EA 4X00A 4F6RB 2W6JD 4MQMA 1KEVA 2GTIA 3SOPA 1GD1O 4U5QA 1PUIA 3ZZMA 3PQ7A 4ZT6A 1QPGA 2D1QA 1SU6A 2OBNA 3RAEC 1Z25A 1OBFO 2TRSB 3MWFA 1FW6A 1G20A 1OQAA 2DKNA 3AUJB 5LU8A 4G56A 4BWYA 3DWFA 1AK2A 5CLIA 1T2CA 2QTLA 3QGMA 1JX6A 2O1SA 3NOOA 4IGKA 4IILA 4PONA 4O4JB 5DMHA 1B23P 2PTHA 2EIHA 3ADPA 2Y67A 2AFVA 1ZJ5A 5I7SA 4GI1A 3CVVA 1S7CA 2AEMA 2VRWA 1Z7GA 5HF6A 5EXXA 3VR2D 5LQJA 4HVCA 1A8HA 4E33A 4YT2A 4AS3A 3DEYX 3X1KA 3MM4A 4KAXA 2YHUA 4ZK6A 3LVBA 1JWLA 5HF9A 4KXNA 1GY8A 2HF2A 1JG2A 1T3SA 4QUBA 2DR0A 2FN8A 3VJMA 1FSSA 4LJ5A 1G20E 3FB1A 4CEJA 1FQWA 2EGGA 1PWHA 5F3WB 1PK8A 5EP3A 1P4JA 1AO0A 1WVMA 1RWXA 2LTAA 3LJKA 1FPQA 1WCIA 4WCVA 3H9BA 4P58A 2MOKA 2O48X 3P26A 4UVHA 5G4KB 4WZBA 3UXEA 3ZHRA 5LWHA 4PZUA 5DK4A 4WOJA 1Z6YA 3JQFA 4G5QA 3SPXA 4JXXA 1MO5A 3B2QA 3M49A 2QQ5A 2I7VA 2CVZA 4HQKA 7REQA 1GAXA 3CVXA 2H4ZA 2AEEA 5C5IA 3BD9A 4GOKA 4YRQA 4YV0A 3Q12A 3FDFA 3QLUC 1M67A 2MHCA 4HR7A 4OY3A 3FCUB 1O0CA 5E8JA 3RFVA 2F8LA 1L8XA 1SUFA 3HC7A 3OCYA 4Y2RA 5HF5A 5C3UA 3ACDA 4JIGA 1WUYA 4RHXA 3HO6A 4BX3A 1Y5RA 3H11B 5GY7A 1ZA1A 1U80A 2RHRA 4Q7EA 1CX9B 1ZN7A 4PG5A 2A92A 1IEVA 1KNXA 1Z6PA 2BFMA 3OCUA 3SN6A 3ZE2B 2Q3JA 4YJGB 3P5BA 4QGBA 2H7YA 3DGFC 5DGTA 4F4JA 1TTPB 3SQXA 1U2TA 3NEPX 4E09A 2JGMA 3BRWA 1VE7A 2VUHB 4G5RA 4OHPA 3D5EA 3V7FA 1JDSA 2GF9A 1NVXQ 3EVTA 3HLTA 1COWA 4UW9A 5JWHA 3E8MA 3W8DA 4GMFA 2BCGY 4R3WA 4TMVA 3D4PA 4TV8F 2PSHA 3CE6A 1XAJA 1R6TA 2BUAA 1IXSB 1KPIA 1PT6A 3FOBA 3WKCA 5DIZA 2DLCX 1G9TA 3RJMA 2ECQA 3DCIA 4AN4A 1V8OA 1X80B 3AJAA 3NBYC 3MELA 4BE4A 3ZV4A 2AT1A 4O4JF 3CV3A 2FMUA 2G06A 1CDOA 3IGFA 1RBQA 3LUDA 4B17A 1V1MA 1JDBC 2OZLB 3PKIA 2ZJYA 1WWKA 2OV6A 3H83A 1DLIA 3QQPA 4EHAA 1W36D 3T7EA 1RCTE 3G2IA 4QFCA 5TF0A 1DTWA 4V0RA 1GGFA 1HDCA 1XK7A 2ZREA 4QEZA 1QVRA 1AKVA 3KEQA 3QKTA 2BTEA 2A9PA 2VBGA 1P3Y1 2X86A 2XQIA 4YHBA 5JALA 3EFOA 5HTKA 5KJFA 3WIEA 3TNYA 1YJ8A 4PIVA 2F3RA 2ZTLA 2QLJA 5CA1A 4FLMA 2AD5A 3QVWA 4FZ3A 4U7JA 2GPYA 2H7CA 4AECA 2NVBA 4NE7A 1W5AA 1UQTA 5FO0A 3EW9A 1DAEA 4IIFA 3V8RA 2QP4A 2BKAA 3UMSA 3ZGVA 4YRLA 4NFLA 4AMZA 2XQKA 2NX2A 1C30A 5KSWB 1TQ8A 4D92A 1V47A 2A3RA 5H5JA 5J43A 1GAQA 2HNAA 2O4CA 4MOWA 2OT3B 3PWTA 3KYDB 1YZYA 4P4TA 3A1VA 1GAWA 3FH0A 1EAMA 2IIPA 4FOOA 4RM3A 1YVEI 2WYWA 1MAWA 2WM9B 3EG9A 2C77A 4Y6OA 4KOEC 5KZMB 3JQAB 4HF7A 1G55A 1PJBA 4ARCA 4D8UA 1CB0A 1K98A 5ALMA 2QLFA 2VPTA 1CIJA 5KWEA 4ZJYA 3D0OA 4U7PB 2AG6A 3RC2A 3EGVA 4MW2A 3NUZA 2JFOA 2I6UA 4M6WB 4PPYA 4ATNA 3OY2A 4P3NA 1Y63A 2F43B 3D3KA 3O4GA 2FPXA 2X15A 2J9RA 4TMFA 2ZJOA 5SV2A 1EP2B 2HLDA 1UM8A 3DT8A 1P9RA 2EV9A 1PHPA 4O1MA 4GZ3A 3EULA 5DOVA 4DA8A 4FYJA 4RZ3A 2IK8A 3C74A 4XZ3A 5JMPA 2WBLC 2ZRGA 3Q2KA 3WHPA 3LQYA 4K9LA 1HYBA 1P5RA 1W5SA 3ZXXA 5IJ0A 3F0TA 4WZAB 2MWMA 5IYZA 1AKNA 1LRLA 1O95D 2HXSA 2YY7A 3CNQS 1F14A 1G8KA 1CUVA 4QQFA 3KUCA 4QDKA 4MK4A 4TV9A 2EJWA 2EX4A 3V6MA 1AM4D 2FEKA 1VFNA 5ULLA 4RGBA 1X19A 5IYZF 1G7TA 1RADA 4HAZA 1JSRA 5T6MA 5KYYA 4FX5A 4PRZA 3PC6A 4RPKA 1OWOA 4Z3DA 3ICOA 2GZ3A 4ARAA 1S8NA 4CKBB 5T67A 2ZIWB 1ZBDA 5JRZA 5HKAA 3WA6A 4R8LA 2JCGA 4YRKA 1C4KA 1NW3A 4EHLA 2COUA 3WLHA 3RSZA 3FN4A 1LPPA 2BMVA 5DNVA 2XMBA 4LQCA 3ZEAA 3OM9A 2JJ8A 3JWGA 3EB9A 3SZUA 1LPMA 3TRIA 2ZDQA 5JXIA 4IFIA 1MPXA 1AQJA 5AW1A 3BPSA 1IC6A 2NU9A 1V8FA 1JAHA 1KKMA 1R0YA 3L4SO 3NWJA 4GR4A 3J81k 1B1AA 4F92B 3ZU6A 3FA2A 5B5SA 3HHEA 2Q9UA 3MERA 2IY8A 4J3JA 3IA2A 3K9QO 1WPQA 1XEAA 3B6KA 4M37A 4YRAA 4PG4A 3KXLA 5CXQA 5EVJA 3JQ8A 4DAOA 2WWYA 2WUGA 1XZNA 2VYNA 4RPLA 1VB5A 2BGNA 4QD3A 1DEKA 1FUKA 3MPUA 2GM5A 1GEGA 2WKSA 1P74A 3NWOA 2REXB 1M1ZA 1NBOA 3QE3A 4JJAA 4R31A 4AJEA 4TYYA 1YRQA 3P19A 1XMVA 3EIHA 4MWOA 4B40A 5HIMA 4QA9A 2FFAA 1MG5A 2ORWA 5KKNB 4QDXA 1JEYB 5AJWA 4EJSB 4KXFB 1X74A 1FXSA 4F5EA 2SKCA 4XRGA 2FPRA 2HLHA 3IT0A 3QY0A 1P6XA 4RO0A 2NSJA 3Q40A 3FZEA 3AEQA 5FPPA 4EMBA 3KETA 1J09A 1AVTA 1J8YF 5A4AA 2IXAA 1FUIA 5DHUA 4B48A 2P8SA 1AA9A 2E6KA 4RMNA 4ZVNA 2UVPA 3RTBA 1IATA 2HMVA 3SHOA 1UBLS 3B3AA 1H94A 2O0HA 2NSDA 3EZYA 3FLAA 4C07A 2FP4A 4X20B 1W4BA 5IJ9A 4I6JA 4R7GA 1RABA 3MTIA 1KVRA 2HQBA 3CRQA 1LWNA 4HQ0A 3O3MB 1QHIA 4FCWA 4LW8A 5HM6A 3ZDAA 4NMMA 4OHMA 1QZUA 5CB8A 1OIVA 3OZWA 1K2WA 2OGWA 4EHKA 4LBVA 4F2PA 4DY6A 2IZOA 5AVXA 3FPEA 3JWIA 2JI7A 3OE7A 1ZOIA 4CT4B 5A5FA 4JCCA 4MVWA 3PUIA 2ZSEA 3HEBA 3DNFA 3D0KA 4O4LF 1SWVA 2CLLB 2QUAA 3GLFB 1RQXA 1JJAA 4RD3A 1U2DC 4UPDA 4F9FA 1DI0A 4YDSA 1HQCA 2J5KA 3F3MA 4LUCA 3ZVKA 2EEZA 5CW1A 4RHUA 4NNJA 5FOUA 2H0QA 4FFOA 3QKSA 4GQIA 3WLOA 4JX8A 1TPZA 1QANA 4G4SO 2IYYA 2GRAA 2Q2WA 5ALRA 4RJJA 4UOEA 2OHXA 3CZPA 2Y4NA 2JAWA 4DR3B 1JEJA 1VE6A 1KMQA 2X13A 3T3MB 3AEKA 3COVA 1CULC 4G1CA 4QRHA 2OLKA 3DD5A 5KVSA 3HWX1 1ZIOA 3EXFA 4OYLA 3JYPA 1H8ED 2FGKA 2PX8A 2VXBA 1G5HA 2YWCA 2ZTVA 2GZ1A 3ELUA 4CIAA 4N3GA 5C7IO 1PGNA 5LKAA 2QYTA 3O92A 4LKRA 4X41A 3WL5A 4DVGA 1U0GA 5ITWA 5IAGA 4ALMA 4URFA 4P0TA 1RAEA 3H3JA 3HCWA 2XD4A 4JI0B 3EIUA 4X66B 2ZU0C 1J0DA 4E5VA 1MXHA 1Q95A 1CR4A 1QZTA 2EZ9A 1YO6A 2PU7A 5JJ5A 4R5MA 4NU0A 4QDZA 2RHTA 3BUSA 2RSLA 4I55F 3D9QX 3U40A 1JXOA 3VZDA 3P4YA 1QH0A 1XMQB 4EUNA 2VJNA 1J0BA 1NXPA 2YNMD 4UEWA 5WRFA 3GZNB 1YQGA 1B0AA 2WV7A 1QDEA 5HQ3B 5IBQA 3AVXA 5F52A 4K5QA 5IT5A 4NG5A 1SM4A 3C85A 1E3MA 5JC1A 2W2LD 1GUAA 3HVIA 5C9ZA 5HMMA 1RKBA 4BVFA 1J99A 3EQ7A 4R8KA 1KYWA 1U0EA 3ASUA 4MVJH 2R6ZA 2VJOA 4M55A 1FUUA 1NN0A 3IMFA 3W2GA 4AWXA 5CXSA 5AW3A 3GFQA 2AR9A 4E2YA 1OIXA 3SC6A 3IT2A 2OBYA 1HT1E 4LHSA 3SZLA 1Z8NA 1LJLA 3LFTA 3HCOA 4V0ME 1BHJA 2W98A 2HWYA 1BOFA 3A06A 1V0JA 1RI3A 2A58A 2XGSA 3FMOB 1F5SA 1R6BX 3NASA 4JT9A 1VTKA 4UZEA 5FTNA 3WLJA 3GRPA 4X94A 2HBZA 3KLPX 5CBPB 3VR5D 1N1EA 2ZQYA 1EBFA 1RXYA 2W8BB 3H9CA 3OIWA 4YV1A 4WN9A 5KTRA 1Q7EA 4QX6A 5J2TB 4CKEB 1FFXA 3U9SA 2CNWD 2QL5A 3IAS6 4XKJA 2VHZA 3SM9A 1YZUA 3FTCA 3BSFA 2EX0A 4R8RA 1SZPA 1EUQA 2ZWMA 3VXKA 4HPWA 3H4IA 3RDPA 3EQ9A 3DT6A 3Q7RA 1DPFA 1GSIA 1MAVA 4K87A 5I45A 1KBOA 4XR9A 1XNQB 3RARA 4TM8A 3G0DA 3CINA 1N0UA 1HDEA 3JZAA 4BEVA 1ZIDA 1IHOA 1ESDA 1KSJA 4RJIA 2VXYA 3FSRA 2P4QA 4NZZA 3D8UA 2VSQA 4HBZA 5E95A 4DM7A 2HWXA 2P41A 4TKVB 4QU9A 4XPIA 4L7QA 3UMJA 1QXSA 3GH1A 1I3LA 2YJGA 4HJXA 4ER3A 3FVWA 2HK6A 5HJ7A 5J5CA 3IAEA 3RS7A 2BWJA 1QYWA 1CU1A 2HLNA 5EJMA 2JF0A 1L7PA 2YNMC 3EC2A 1RJDA 3LCVB 3OKCA 2H1OA 3HA5A 3LKDA 2GT1A 1UEIA 2I8LA 3BGIA 4GU5A 4RSHA 3RVJA 3WL6A 4BV3A 3DKPA 5AI5A 1IJEA 5J58A 1NZFA 4FOPA 1KR5A 4BQSA 3FE2A 4TT8A 4NOMA 5E9AA 2HNKA 1XTKA 2D1FA 2FX3A 4KDRA 5E3HA 4R1NA 3HJHA 4TZ6A 3UBMA 1NQAO 3V4LA 3FYUC 5I9IA 2GAOA 3JVDA 4XUGB 4X97A 4Q9IA 3DTVB 4CPDA 3RABA 3MTEA 3BKWA 3BRSA 1HQKA 1TDJA 3STVA 3SX4A 5K8LA 4PR3A 3TW6A 2B25A 3UK0A 3LM8A 3VPBA 2PUDA 3KWLA 4ID9A 2AC4A 3IAXA 2CFSA 2KBFA 2X4GA 3F8TA 4J1QA 4RJ2A 4YECA 3LQ4A 2J7PA 2O0LA 4EJ2A 5L3SA 2GLXA 4J2OA 5ALTA 4DNOA 4U2KA 2PUVA 1EWQA 1E79A 1WF6A 5D5PA 4EY5A 1BTOA 1BEUB 1I7PA 5JJIA 2DQKA 1ZCAA 3MBIA 3MK31 4NENB 3NIWA 1Y4UA 4NZNA 2FSHA 3FF4A 1PYOA 3ZXYA 2Z8YA 4M6WA 2B34A 3NBKA 2F3PA 5DCLA 1VCHA 3OI7A 3OH8A 3DFUA 4KIGA 2E6UX 3GFSA 3PL1A 2FEAA 4IXTA 4PSDA 4HGOA 1GCGA 5FTWA 3PHCA 1M2JA 1BKDR 1K5DA 4WLOA 3V1NA 3VKUA 1DBSA 3UYLA 4KLNA 4B2LA 1XDWA 2ERYA 3ELBA 1ZY2A 3IEUA 4IQ0A 4RA6B 1Q12A 3G13A 4M7WA 3BDIA 3PQEA 2GCGA 1DX6A 5HZHA 1T2VA 2SKDA 3EXHC 3FPFA 3O75A 4HLUA 4YNBA 4DABA 5K0EA 1ADYA 4J0JA 2ASVA 4J4TA 1FYWA 5BW8A 2WE8A 3UOWA 5KAMA 5EJ7A 3RYCB 3W5BA 1NBME 2QS9A 1IIRA 1HT0A 5DVZA 1ORWA 3BCHA 2FQYA 1MC1A 5DNUA 4PVDA 4DLRA 3DFZA 4OV6B 2ENUA 1OXSC 1QFMA 3S81A 3GUYA 5LBTA 4JU9A 3T5DA 3PE3A 1FRQA 4ETMA 2JJ1D 2Y6VA 4YDRA 1CUSA 1BW9B 1J1ZA 2ANBA 2G67A 1Q6ZA 1RKXA 3DT9A 5FNVF 3TCXB 4TKVA 4NPCA 1OH6A 1VA5A 1ORIA 2HBRA 4MVJF 3R7WB 1P7VA 3OCVA 2PMEA 1GT6A 2XOKD 3RJTA 4HB3A 1MEJA 1PLLA 5JWOA 4MVCA 3E3NA 4Q7JB 3WK8A 1NUHA 5FFFA 2GMWA 4LV6A 3WMXA 1N77A 5TXGA 1T2FA 2GJKA 3LOUA 5HCNA 3I04M 4PFQA 1DQYA 4N3AA 1MIOA 3VR4D 1A5ZA 4EBBA 5BNWA 2DFKB 1WETA 4DW8A 4P98A 1NIJA 4AD8A 4EQ6B 1QONA 5FTKA 3MMNA 2QQEA 1Q1EA 2XCUA 3AL3A 2WNHA 3EJ6A 3R3VA 2B2CA 3RYHB 4YP0A 4QOSA 5B7NA 4PO1A 3U3ZA 1E61A 4E5NA 4JIMA 1AGNA 4KXQA 1FFEA 2OHIA 3E9RA 3CF2A 4MQ6A 5EI5A 1TO6A 3A10A 4YONB 1GQQA 4Q4JB 3KYCB 4HAIA 3AJ8A 5K1ZA 3NRCA 1W36B 3RLIA 1FMLA 5DNYB 5H7XA 3NONA 2ZSKA 2AMLA 2AS0A 4HNAA 4L75A 1X7ZA 3EVBA 4DBZA 4Q0MA 4FNAA 2CUNA 3CWZA 4INPA 1QJCA 2RK6A 4W5WA 4JBIA 4MUHA 4WI1A 1EHYA 1PV4A 2QRQA 5BV0A 1PRYA 2AZDA 1GCOA 2B4AA 4F21A 3FTPA 2HYIC 1SZCA 2ZWIA 4AZ0A 3LZDA 4XWWA 4A2CA 1I6MA 5FWDA 3DDCA 1N5DA 1MXFA 1ZGBA 4HWRA 3UG7A 4BWGA 3N70A 4D4JA 4XIIA 2H8GA 1SCQA 1UXKA 1O5IA 5A5VA 2BHNA 3LK7A 4KVAA 4F4HA 4D26A 2XWPA 5KAPA 2NQTA 1NXWA 2YRXA 1B43A 2R7AA 3CKLA 4XX0A 4C0WA 3K31A 4L8GA 5KU1A 4BRUA 1H6AA 1BU5A 1XKXA 4OBBA 2Y6UA 1KI3A 2WJIA 4G63A 1HA3A 4NKRA 5E7QA 4E5DA 2OXIA 2XI4A 3PA8A 1SBYA 2DWUA 1UP6A 3JQBC 4O02B 5GV8A 3V2HA 4EY6A 3RUIA 4JJKA 1T1RA 2V3WA 4NDNE 4KE9A 5C1BA 2Q3CA 3TZ6A 1JXQA 3K9WA 4UUOA 3S70A 4R2HA 3GMIA 5AOCA 4LDZA 2Y0BA 4G23A 3HO1A 2ZQ5A 3VZQA 5IUJC 3RRMA 5JPDA 4GG1A 1D2MA 1E20A 1L5HB 4PN7A 2I8AA 1GDHA 4LYJA 4YO8A 5F77A 1JFLA 3EWIA 4MVYA 2PL9A 1IBKB 2P62A 4HB2A 4G07A 4XWKA 1SOAA 3ETNA 1ZCBA 3E6AA 4KDEA 4NZPA 1Y6JA 2XAUA 3HL4A 3M4ZA 4B8ZA 3THWA 4CM5A 4XEUA 4DZTA 3V1MA 5H3HA 3A14A 5KHLB 2MT9A 1P73A 4O5OA 1X9HA 3VTFA 9LDTA 4XWTA 2O23A 2Q9AA 3NWBA 2W2MA 2P9JA 1A7KA 3D4LA 1Q2XA 2XHZA 1I2AA 2P3LA 3SLKA 1KYYA 3O9ZA 1A9SA 3OSUA 4ZA2A 1BCRA 1T5DX 2A5JA 4MP8A 1JR3E 1MRZA 3EUFA 4PSAA 3ETGA 2ACWA 2IEDA 3R6DA 4GP7A 1K9VF 3C43A 3CLVA 4I5IA 2WHXA 4QUGA 4S35A 3FETA 4QNNA 4S1NA 2WMDA 5KDDA 4RADA 1HNZB 1CRLA 2XY4A 3T35A 3ECSA 2BMFA 3DV2A 3C15C 4CLDA 4UAJA 2HF8A 2G5PA 1G0OA 4EGCB 2RH8A 4QOEA 2X9GA 2CV2A 3WYDA 1E96A 5GQSA 1UWLA 2IV7A 4KQ9A 2C99A 3AW8A 3H4VA 3OWHA 1DOHA 3WNDA 5AK4A 4GUAA 1LGYA 1NI4A 3VR5H 1TMOA 2GHIA 1T8YA 1J9ZA 5DZSA 4YCJA 2NYAA 2VQEB 5AP9A 2PGAA 2J9YB 4BGIA 1NIPA 3LDGA 5AJUA 3DZFA 2KMLA 4RD6A 2ATXA 3PDCA 2OPHA 1O4WA 4GEKA 3ZTTA 5DRYA 3G8AA 4ZAGA 4AMUA 3ES9A 3LHSA 3ISJA 4X84A 4UM9D 2RC5A 1QLJA 3M4YA 1DRWA 1P44A 5EUMA 1N75A 2QXYA 2M98A 1ZESA 3N8HA 3OM1A 4YH1A 1YJXA 1ZISA 1U1GA 1R9GA 2ZJ7A 1Z15A 1RACA 3L7YA 3WNQA 1YK1A 2EKLA 4F5DA 4DILA 2IV3A 2O14A 1B6GA 5K0BA 3HLKA 4YAEA 5FBRB 4ARUA 1EX7A 2WAMA 5JCXA 3TTYA 2KX7A 5MGNA 4L5IA 2PMFA 2UUOA 3C3YA 3DGEC 3E3LA 5EEGA 5EHIA 4DSAA 1NBAA 1T2EA 1RTTA 3PQ5A 1ICEA 1V6SA 4MUNA 4ARZB 1Z4MA 4PSKA 1I2MA 2EFYA 3AOEA 5DLQC 3Q3GE 3DB1A 3K9HA 3WRWA 1QIGA 1YI8A 3CZRA 4DCCA 1O1YA 3CLKA 4A82A 2BN4A 2MINB 4IIVA 3ZWXA 3VR3D 3JD4A 2NZUG 1O58A 1EHCA 1UWKA 2QKYA 3NJ8A 4NV3A 3T9FA 1YASA 4P0PB 1B74A 1GKUB 3QPCA 2H8KA 4MQ4A 2DQ4A 3D1VA 1QRDA 1YR2A 5KCZA 2R0QC 1RPAA 3GY0A 2F7SA 4HN2A 4OQZA 3WLNA 1YGPA 4KXVA 3UTDA 3IHKA 4JOQA 3C8DA 3J81A 3DHEA 3MRXA 5CLGA 1YRYE 2HJRA 4PX2A 4EO9A 4XD7A 3GLRA 1CXZA 1MFZA 3DOHA 3I58A 2JGNA 2YL2A 5CNIA 1XCMA 1FMTA 4EB0A 2HCBA 2G7ZA 1JLHA 3C16C 2HK7A 4RTMA 1U6JA 1ZRMA 1D0VA 1F2VA 1N3LA 3P9SA 4KPEC 1NW6A 2WKRA 2YIMA 4S1VA 1T9DA 1ZNXA 1W4AA 4FFDA 4DV5B 3GLKA 3G1UA 4BNYA 4E5UA 4BXOA 2GYUA 1MJFA 3NEJA 3WBJA 4GIBA 5DHFA 3IUBA 1X6VA 3JQPA 3HKBB 3V8BA 2CLFB 3UAXA 1TFRA 3NYQA 5B64A 1MDBA 5EZ5A 2OZVA 2OFWA 4K6KA 2RGEA 4RK0A 4U7HA 3QBTA 1U3FA 4L0MA 2AQ8A 4URVR 3PHHA 4QQKA 1WLSA 4AS1A 3DZDA 1DARA 3ZG6A 2YHSA 1IOWA 1V4VA 1VBMA 3KU1A 5B36A 3DOCA 4JP1A 1KERA 1PT5A 4WCDA 2HRRA 3KZOA 1BQ4A 1NVUQ 2FE1A 4GOND 1Z2PX 1E9SA 1DDGA 5D01A 1DADA 4KHPB 1WXIA 2AEFA 1LJ8A 2Y77A 1QF7A 1KDRA 2Q4BA 2O8FA 1OW3B 1UDCA 4J8PA 4L27A 1NRIA 3AF4A 3LBNA 2NW6A 1E9CA 4ZYTA 3IKVA 4MKRA 5E4JA 1TUIA 4PHCA 3DULA 4F0JA 3BB3A 1MJGA 3BGOS 2CGEA 3D3WA 5KSZA 4JJ4A 1O97D 2E4VA 2XF8A 3R40A 3DKIA 4J9UE 1Q21A 1YL6A 2VN8A 4JJZA 4AY3A 2ZT7A 5LA6A 2PZJA 4N5NA 5FI0B 2HA0A 2J08A 4ICIA 4B2IA 1YMVA 2D5BA 2NSLA 2QLTA 1JEQB 4Y2PA 3D7LA 3N6XA 4TKZA 3R7LA 3ZCUA 2HUNA 4K9RA 2OAGA 2ADFA 4J90A 4UNRA 4OGLA 1V96A 4FFMA 4FR5A 5KNDD 1UK9A 3AHHA 4KWHA 4MMYB 3SS8A 2OGUA 5FBZA 4GRDA 3COJA 3S4YA 3ZWCA 3P2OA 2C84A 1N2BA 1Y7PA 4KEAA 5KPJA 1JLLA 3SBXA 5BUZA 2DUWA 3G59A 3OBIA 4I9GA 3ENZA 3IP7A 5KINB 1QQ5A 3NX4A 4PF1A 1CNFA 3HSKA 1P8JA 2ZI5A 4G1UC 1M75A 4DS3A 4P86A 1VI2A 2AL7A 4U2GA 1AF4A 2H9IA 2OY0A 4K9NA 1MQ8B 1NQUA 1GIAA 1SEPA 3BDAA 1ZM2A 2ZIAA 3CHYA 4NYMQ 4RANA 2J3JA 3DM9B 3DQZA 4MYRA 1X7GA 1EDOA 1VL0A 1SOUA 2QRVA 5HQTA 1SVWA 4JLJA 2REQB 4KCGA 4LPSA 2ECKA 3I5MA 1R9MA 2O2CA 4MVJE 5H70A 4D0SA 1YBAA 1PJSA 3AIMA 3Q7IA 4AKIA 4J3NA 2C5LA 1K86A 1ODTC 1YVDA 2PWPA 3ZY4A 2R79A 3PQDA 5ALHA 5IXYA 2V98A 3E1SA 1QC5B 1R37A 1W2GA 1KY5A 3DDZX 3UB2A 3B1YA 4ZYYA 1I4WA 1OBVA 4I4TB 1A97A 3SDZA 4D8WA 4UQOA 4EFKA 3BXZA 3O9VA 4J07A 4R3NA 1JKFA 1K75A 3NHZA 2W8BA 3LQ2A 2JCXA 2A6PA 4OF4A 4EKNB 1B15A 2IZ1A 3IIMA 3Q7SA 3VJLA 3W9SA 4C6HA 3HXLA 2R25B 2O8VA 2PNJA 4WCFB 1CR2A 1N2HA 4TTAA 2ZBUA 5BNFA 3VHRA 2JLXA 1TVCA 4B47A 4GBED 1H3NA 3HJBA 3CUEF 2NO0A 4HC4A 3LT5A 1TMYA 5FV4A 2DZDA 5T8KC 1ZUNB 1FP1D 5A2GA 2X6TA 2V5AA 4FP9A 1G5TA 3C1OA 2EW2A 1FJHA 2X0IA 2DR2A 1X9IA 4NCNA 1TZMA 2Z8XA 1Q50A 1XT6A 4Y6LA 5LM3A 3G3EA 4KR7A 1IFXA 3QKRA 4XPIB 2RJOA 1MAUA 2AZMA 2OGTA 1S01A 2W2OA 2V7GA 2PQ0A 4WOPA 5DI3A 3UPTA 2DPYA 1ZL2A 4IX9A 2BM0A 1GTL1 3I4FA 4D79A 3DL0A 1MOZA 2C5FA 2Q4EA 1TM4E 3OJWA 3LP8A 4I8XA 3L0IB 5DPMA 3NIDB 4JB2A 2PX6A 4ODIA 3HO8A 4IVPA 4LTDA 1M66A 2E82A 4LSMA 4C9BA 1HETA 1Z5ZA 4QBTA 1BO6A 1TADA 1UM9A 2YJ5A 3DBOB 3L4EA 3QU4A 4OM8A 3P2IA 3L7IA 1QMPA 2YMLA 4GAEA 1YAJA 2ZE6A 4JR0A 4JUCA 1QWOA 2QUJA 1M1YE 3AU9A 3ZQ4A 3HSSA 2UZ4A 2JHFA 2NUTB 4JOSA 1GL6A 3C7TA 2EZTA 3A58B 5LZ9A 4K9OA 4GGPA 3WYFA 1ZD3A 2Q0XA 4BNHA 2DBVO 1T6YA 4X24A 4MDFA 1VPTA 2KE5A 3U2QA 4EEKA 1LW7A 5LXTA 1N2XA 2ZI7A 3TMYA 2H1RA 521PA 1FTSA 2B8NA 2P9EA 4CWAA 1WF3A 1N2ZA 4E88A 3S27A 3JAMA 1G8SA 2JGEA 1U3DA 4ZCQA 3V9AA 3I23A 3PYXA 3KQMA 2XVMA 2VF5X 1C1DA 3QVOA 1TEHA 3FAKA 4HDSA 2ZSDA 4MYTA 4AULA 3UV6A 2IF0A 3K9FC 2G4LA 1IBRA 3I1FA 5GAJA 5IT4A 1L6IA 2FQXA 5LKRA 2Z8YM 2X8BA 4JLWA 2GYYA 1VHDA 2QTWB 3GJ8A 4OB8A 1QB8A 1AOXA 2R1VB 5TIIA 3UT5B 1QRRA 3GUHA 4PFSA 4UNSA 5TT1A 1DELA 2VHCA 3UAWA 3CN7A 4OAPA 4QEKA 2ZUTA 4D5EA 4J0EA 3UK6A 1Q16A 2P0EA 5ITVA 1WHSA 5IUNC 1DXOA 2BE7A 2H16A 2VRBA 2PZFA 3D0RA 5C4GB 1Z6XA 3K0HA 2QQGA 3MVEA 1O6ZA 2REBA 4P3KA 1XD8A 2XGJA 2JLRA 3QJGA 4PGAA 4MHOA 3Q8KA 2AOWA 2NO7A 1VGVA 4XR4A 4EENA 2R66A 2PMWB 2Z09A 2WIGA 2EU8A 4RD4A 4A8JC 4CM9A 3HEAA 5AK6A 3OJ0A 4E51A 3U5TA 3U3MA 1R8XA 5LZ4A 5E6SB 2GVDC 2Q8QA 4C04A 4ZV9A 3IOYA 3OQ6A 5EIBD 5EKXA 1YNSA 3O4RA 1I3NA 1VL8A 2AFIE 3RKRA 3U7FB 3VVLA 2YXLA 4KQKA 3S2UA 4TS1A 2BFBB 1Y37A 3DF7A 4JA0A 4LEIA 1P3JA 2NNLD 4GOOD 4AKEA 4ZI2A 1BGXT 3UAGA 3AJDA 4YA6A 1XCLA 2P91A 1HTBA 2A1UA 3QJYA 3DDNA 3OIFA 5GVRA 4QGGA 1ZRNA 2P79A 3C6QA 3MD9A 2R9VA 4G1FA 1FC0A 5AKJA 2VDPB 5F35A 4ILEA 3LS2A 5LNK6 2VC2B 1OA0A 3AF5A 1SG6A 4MVJG 4ZOQI 3KBBA 2VAXA 2YXPX 1SY7A 1ZM3A 1JHZA 3KJIA 5DSTA 4IH9A 4MUJA 2WNSA 5B2FA 5JANA 2WLTA 1O5TA 2HSZA 5DGHA 2CNLA 3KPVA 1JLMA 2GDZA 3C6MA 2EBUA 4RJTA 1W76A 5BRNA 3WRXA 1GV0A 4WW0A 1GPYA 1QS0A 2FOLA 1GR1A 1HGXA 1BCSA 3AFNA 1N5JA 4XQ0A 3UC9A 1TM3E 1D7OA 1XZHA 2CJPA 4KXMA 3TRHA 3ZHTA 4DR1B 1OWPA 1AQIA 1P7WA 1RTKA 3CRNA 3T3PB 4QYSA 2NUTA 5CRIA 4A2PA 4Z0NA 1M7BA 4U02A 3HADA 5DBIA 1FJ2A 4UUAA 2RK3A 3L3BA 4JD5A 3N3AC 1QH8A 2C2ZA 3TSYA 3WP1B 2E0IA 2JB9A 4NAVA 1G64A 3SOZA 3F7MA 4UDNA 4H08A 3KNZA 5JOQA 2VRCD 4LTNA 4FE3A 5J23A 2QPLA 2WPNA 4GYWA 4KW7A 5DHTA 4LYFA 2JEOA 2YUTA 3VU9B 4Z5XA 1I1HA 1C2YA 1ONSA 2D5IA 3DYBA 3KBOA 5LOVA 3U44A 2FUG1 4P80A 4D44A 3NT4A 4QTXA 3ERCA 3OU7A 5KKCA 2PRJA 1MDFA 4Q4HA 3RPEA 2D62A 3BH0A 4JVNA 5AKKA 4BO6A 4LC1A 1GVNB 4BQIA 3EOAI 1TM1E 4YJ3A 6ADHA 1F3OA 1N5MA 2XNDA 3M6WA 3P2YA 4MYUA 3QIAA 2GD0A 2QBYB 5L3QA 2X19A 5LLSA 1DINA 3H8JA 4MV0A 4Z1MA 1I7LA 2PSDA 3JS5A 4ND5A 2EZ4A 2GYVA 3FYTA 3H1GA 5KX5F 4ML3A 3MGKA 3KQTA 5NULA 3IODA 1V35A 1Y98A 3NHPA 1Q1ZA 4IEIA 3WYAA 4AY4A 2BFPA 4M9SA 4EPVA 4ENVA 1XX6A 3E1KA 5CGQB 3IKJA 3KZNA 1T8WA 4BN0A 1ITZA 4EKYA 3BB4A 4OXNA 3K5IA 3BORA 1PVVA 3PGVA 3FVQA 3WMRA 3F49S 4MUBA 4QELA 3UWOA 4ZHQB 4WIAA 4K81B 3HXOA 4O4HB 4X7MA 2VT2A 2YQ5A 3V5NA 3VH2A 1V2GA 2EP5A 3JRNA 1PSDA 2J4DA 1C9NA 4MQEB 4ND4A 3DZCA 3GLIB 4UNQA 4ZCIA 4YX9A 4GPBA 2H5JA 3RSCA 1FVOA 3K96A 5K0NA 1QCCA 1MH1A 1V7CA 1DRKA 2JS7A 3AVQA 2FETA 3IDFA 3K1ZA 4ND6A 4C21A 3G5TA 1TZKA 1PZHA 3WHLA 1W0KA 3B1XA 5CDTA 1G63A 3JQEA 3SMVA 4EA6A 2O8CA 3V1TC 3NTQA 2PH1A 1DKRA 5JPIA 4URXR 3SQDA 2LGJA 1GFIA 3KJHA 4AKTA 4C0LA 1IZ8A 2FP3A 1GPAA 3CZMA 4D9FA 2JLZA 3CUKA 1FTNA 1OTHA 4IM7A 4UMVA 5CVTA 3OFNA 3QU2A 4YMSA 1E4VA 4DUGA 2G72A 3PTAA 5DJ5A 1QGDA 1IY0A 4PZAA 2QVGA 3MSCA 5JS6A 1NF3A 4PSUA 5KREA 1N9GA 2FUEA 1SN7A 4WXMA 1EGMB 4MUIA 2VZ9A 2G5TA 4QL3A 1J9EA 4G97A 4LOKA 4G0OA 3UA4A 5BPHA 3OTOB 1CZNA 5FX2A 2X42A 5A02A 1O9BA 4J0HA 1NQ5A 5KI6A 4MZDA 2I6QA 1QFXA 4BO2A 3LFUA 1WMDA 4UOZA 2PR2A 2IC5A 2BBSA 1BS1A 4PQFA 2HQRA 1FX0A 4RDHA 2V9ZA 2XMQA 1YOVB 3KEGA 4KLZA 4KYTA 4XB6B 5LB4A 2J0VA 1CRPA 3DWGA 4MVJM 1NTRA 1Q77A 2GJ4A 1D4ZA 3UW3A 2PRSA 1O6CA 3CEJA 5DW3A 3C7DB 3VR0A 3U44B 4O8ZA 4K9DA 2QE7A 3EPRA 2RG1A 1QGZA 5JQWA 2JCSA 5IWAB 1TKAA 2G4VA 3DXZA 4HGPA 2AB0A 1AHNA 1QVVA 4JL8A 2G9UA 1T9GR 2IUYA 2KM1A 4RPGA 2MDTA 1H1LB 2O1EA 2Y1KA 3BXOA 4YRRA 1IY9A 1LKZA 2QD2A 3PC3A 4JMLA 4X7RA 3GGDA 2A9OA 4UREA 3NKLA 2HX1A 1OC4A 1H3FA 1MV8A 1N2CB 2KLBA 5CTAA 5HFNA 1HZJA 1K7YA 1KI6A 1G66A 3U3XA 5B12A 1IN5A 4EELA 4Z2AA 5LP6F 3Q0EA 4HB0A 5CEJA 1Q6YA 3ORRA 5FL3A 4LK2A 3ICVA 2ATIA 2W5UA 3I5UA 1GZ6A 4GOXA 4IDAA 4LNUA 1WMAA 3Q6IA 5IWCA 5DEOA 3TGWA 5JFGA 2N9UA 2WM2A 4HAOA 4F3TA 1GL9B 4OD0A 4F96A 2EHDA 4MR8B 5AW4A 5AI0A 4LJKA 1T4GA 4GLFA 3PDHA 1X15A 2FF7A 1GR0A 3ROFA 1I2CA 2PLNA 3ENKA 3ZD8A 1JAXA 4CDNA 5AUOB 1JFVA 2G4CA 5COBA 1J2JA 3O8OB 2I4MA 1NN5A 2R86A 4IGAA 4IVQA 1ECBA 4QLOA 3VH4A 3NHYA 4BB9A 4HTFA 3W9UA 4EUKA 5KTPA 3G89A 4MRPA 5L95A 1HLPA 1L5MA 3NCTA 4G01B 1IYZA 4KQIA 2GR9A 2HC9A 2RGNA 4IVRA 2O0JA 2AHOA 4Z4IA 1L9KA 1MO3A 2I6FA 4RLQA 1DDOA 2BZGA 3EGOA 3GIDA 3ONWA 3QPAA 4M1TA 5LZ5A 3QBVA 1WSBA 2V3CC 5CJPA 2HFKA 4RZQA 2WVAA 3GRRA 1R12A 5FEUA 3Q3VA 4LVNA 1OU0A 3JD2A 4MUXA 2W70A 4GVPA 5IAAA 2F8SA 1NBHA 2VAPA 1MGOA 3EEQA 1IEXA 4UCXA 4BDSA 5JYEA 3EOZA 2BBTA 5KJ6A 2I91A 1H22A 2GSDA 1FLAA 1FPMA 1ZVMA 3PS9A 1GPBA 4IJUA 5EKDA 2HA6A 2ZBPA 3PUVA 5JNLA 2ZXEA 1XDUA 2DFPA 2X2PA 1PTJC 3FSEA 5B1YA 2WTNA 2EZ8A 3KWJA 3NOVA 3T4PA 2GETA 5CT9A 4KJXA 3P9CA 1XK6A 1HG1A 2XKJE 2FR8C 4ZMRA 3KYBA 1O7JA 3I6ZA 3WBFA 2PKCA 4CFZA 4DMRA 4CMGA 2WSSD 1K8QA 4IV8A 4WN9B 2O8FB 5IT9A 2XTZA 1TVEA 1V1RB 3N2LA 4B43A 4W5NA 4II3A 1X8JA 2OBMA 2OKCA 5LQCA 1OZAA 4KQXA 3DXFA 1A7JA 3IO3A 4M36A 1XNHA 3IERA 3N2ZB 5TY0A 1BYIA 1TYDE 3I8SA 2G5CA 4X3OA 1R4NA 2YOHA 3DAHA 4RA9A 3DEKA 3JZMA 1ID1A 4MULA 4DQ0A 4B81A 5IEJA 1J42A 2H2HA 2JEYA 3QUBA 3O8NA 4JUBA 2MSLA 4UCFA 1I9CA 4KR3A 4MA0A 3ND9A 4YRPA 2PV7A 3RU2A 4WK0B 5BWOA 4Z2YA 4ENTA 5KIAA 2HV9A 4E94A 1VRVA 1V11B 1LK7A 5IXJA 2LV8A 1ML4A 4P4GA 4UEJA 4DC0A 4Z3OA 2YZ7A 5I9BA 3COPA 2ZM6B 5IW8A 5C52B 4DJAA 1K7SN 4RGYA 1BE8A 4LF4B 1EINA 2O1XA 1JLLB 2ALJA 1Z13A 3A1TA 1HFEL 2D7CA 3K4PA 3EDCA 1E9BA 1XMOB 2B4QA 1ISRA 2Y9MB 4HRAA 1GV1A 4AN1A 3AL2A 4D0GA 4ZOEA 2GVNA 1C8KA 2FLWA 1EWVA 2QF7A 3ZLBA 4Z0HO 4Z6KA 3AF2A 2TMDA 4GXQA 3ZWBA 3OOYA 4FOTA 1ECCA 3T5MA 3MT7A 3IURA 1UFQA 1KH2A 1XRSB 3I9V6 1YQXA 5J4HA 1YE5A 3RNLA 4E15A 1WHTB 2OB2A 2DRIA 2L42A 2KWIA 2UZ1B 3AR2A 2I65A 3KLOA 3KSRA 3N2KB 4UPVA 4YAOA 3MWLA 5T3UA 4ED9A 2JGAA 2YMMA 3CVWA 3FWPA 2MR5A 3EC1A 3NHBA 1ZOPA 3ET4A 3NDJA 5AVQA 4WK2B 1ZZGA 2P9TA 3FCOA 1KIMA 4KJZA 2EZUA 3U48A 5I7RA 4DLNA 4M22A 2VPWA 3FWYA 4QAQA 3WHIA 2ZJ8A 4C08A 4FYIA 2PHZA 5JPCA 1MQSA 4H0FA 1P19A 1OSNA 1K06A 3PNOA 3CONA 4Q4HB 4BFZA 3E1GA 2ZYIA 1YB5A 5DNEA 2Q9BA 1OI2A 3KT0A 3UGTA 2FWPA 1WKCA 4HDRA 2QVZX 3OE5A 2B94A 3ZV6A 4X1OA 3AH8A 4KE7A 2P35A 4FX2A 4IUYA 8AT1A 1Y1PA 1KO4A 4AJNA 1Y7HA 3DMPA 5ALIA 2OQRA 4CCSA 1G1MA 5KWIA 2NPFA 2HRZA 3K92A 5FCDA 4G67A 1QBKC 1U1FA 4AF7A 1PBNA 3B89A 3ZU4A 4YJHB 4HOYA 4O2LA 5FOTA 2VYFA 1PTJA 2YJZA 4QRDA 3V7UA 1LNSA 1CZKA 3IO5A 2IYZA 3MJVA 4H31A 3H1BA 4WRRA 2BMEA 1JPUA 2YZKA 3QVJA 3RYCA 1PL6A 2R7KA 1U2SA 4N6OA 1E63A 2IP2A 2ZIXB 2BHSA 2YUIA 4Z4GA 1Y3HA 4XDZA 1U8AA 1ILWA 1IN6A 2A86A 4ZVMA 3VOAA 4IV0A 1MG0A 2GFQA 1O87A 4ETNA 4MRMB 4JDUA 4CM6A 1HM5A 4EUSA 4Y0NA 5JATA 4FD2A 3KL4A 1M6WA 2IHBA 5F76A 2TMYA 2AYZA 2VH1A 1LVHA 4JB0A 4PLYA 3IVXA 3F9IA 1A4UA 4H6WA 3VI4B 5KNCD 1RAIA 2AW3A 2QTVB 1W96A 3OZBA 1I3OA 2GK3A 2P6OA 2XOEA 3PEUA 1TJ3A 2H7XA 4PXAA 4UMFA 2GUGA 5LZ7A 1WV0A 2Y1CA 2Q2OA 4CR7A 1NGSA 3H13A 5T64A 2XMPA 2L69A 3ZE1B 1W46A 3M3HA 2C83A 2R8RA 1K6MA 2NO1A 2VNIA 2XRFA 3C3CA 3OOWA 4HZUB 3VR4A 4A0QA 4DM4A 5KOHA 3GO4A 5CB6A 3RVQA 2F9LA 2EAUA 3PLNA 3WSTA 1SA0B 3C8ZA 821PA 3UUEA 5K3DA 1CUJA 4BNFA 4TVOA 4IWYA 1IM2A 3AXTA 3ETJA 5BUSA 3NAMA 2W93A 3K5WA 4PHHA 2JLYA 3NW9A 2Z9DA 1X1SA 3UO8B 5JS1A 1QCDA 5JADA 1OLOA 4FE4A 2GO1A 4ER6A 1GEEA 3PI6A 4HATA 3ZN2A 4Z54A 3KYCA 4WL0A 1R50A 4JH0A 5A7GA 2FJPA 4K0RA 2Z2JA 1Z0KA 3NH9A 1ZK0A 3HU5A 4UD6A 1AN0A 3AXSA 1IK6A 3HR8A 1U63A 3VGPA 3N53A 3LCRA 3V2IA 4RTNA 3C3BA 3EZXA 4NAHA 2C5AA 4YUXA 2WU4A 2XCLA 5KJEA 4GH5A 1YIAA 2QM3A 1BH6A 2R6DA 2HJSA 3V33A 5FHQA 3N6RA 3O2QB 1EZ1A 4IIDA 4RC9A 1KVSA 5KWVA 5IAEA 2BFNA 2ZDHA 1I4LD 1VE1A 1Y9AA 4M8IA 5JT1A 1UMDB 4Z7JA 1YVUA 2C8LA 3H5AA 1DKLA 4GX0A 3DLHA 5H82A 2O2JA 3EGCA 2W6MA 3PB3A 5KQGA 5AKZA 3HABA 4EYOA 1L4LA 3KQOA 1JLSA 2BR3A 5JBIA 1GTMA 1QQTA 1JBQA 1M34A 4G25A 2WT4A 4EHHA 1H9AA 3ANMA 1XZJA 3A4YA 2PXCA 1U8UA 3FAZA 4W63A 4YT5A 1FSGA 1MHPA 2D00A 4IMPA 2DUJA 5IBPA 4CGYA 4UTVA 2R48A 2INGX 2YN0A 4NICA 3L1JA 1KJYA 4JAVC 3WISA 3CX7A 3AZQA 3GJTA 3FKSA 3N0WA 3T5TA 2UAGA 4RLFA 2RE8A 4M1YA 3RUDA 2I1QA 2IUSA 3EEOA 4CM4A 4OHXA 1G8AA 3JPYA 2DKFA 3Q85A 1UOQA 4D7AA 3PT5A 3VNRA 5BQ5A 2H85A 1NSYA 4TS9A 1XZBA 2E55A 3BC1A 4DDKA 4AY6A 1R8YA 2H4HA 1V4NA 4HSEA 1Z2AA 4NLLA 4YCAA 1IG0A 3KDAA 3DOIA 3KVOA 3KX2A 4GS5A 3C8UA 5CGZA 1YD7A 3E7WA 3LLUA 1K8XB 3TM4A 4JC0A 4EHJA 2RGXA 4XGQA 3DLAA 2V7BA 3TX2A 2QRPA 1T8PA 2RCYA 3DMGA 3I32A 5GGYA 1U3CA 3LUHA 1DJPA 4IMIB 3SK0A 1H5UA 3CLTD 4BGUA 1ISSA 4E3WA 4BAZA 4W8GA 4P82A 4WFJA 3K35A 3PDIA 2HA3A 4KYIB 4OKIA 4Y6RA 1O94D 5KYNA 3IKTA 2AG5A 4JL5A 4Q4DA 4N39A 4LHYA 4DRXA 3L0YA 3UJNA 3KSUA 3AY3A 4PAOA 5CVUA 3T12A 3WYGA 3ZE6A 2BSQA 1PJAA 1GPLA 3SY8A 1IHXA 1LBSA 1PS0A 2I2XB 1MTOA 3PEVA 2CZGA 5AI6A 1SIUA 2M32A 1VBKA 2FPKA 2IW1A 2WG2A 2DHRA 1XZCA 3H8WA 1L5KA 3S1LA 3ZYZA 3GJYA 2X7JA 5EIWA 3LF2A 2FPGB 3FG9A 4DA6A 9MHTA 1SVNA 4DCOA 4FJ0A 2HCTA 5DFAA 4DMGA 3AR9A 1CJKC 3L0SA 3VDNB 4ZVRA 1K6EA 3WJAA 1Y8QA 4FWIB 4QXQA 4BIIA 3VKVA 4I2NA 1QIHA 2I7XA 5DHSA 5JARA 5KX5B 1UH5A 2I1VB 4B3FX 3EIXA 4DM3A 4UDYX 3EJWA 4CLOA 1JIVA 1RPJA 4CMKA 1KMHA 1CUAA 2I2AA 3LDHA 5E9JA 1P2DA 1OA1A 3FI0A 4UEQA 1SGWA 4HS4A 5ILQA 3HYCA 4NABA 6AT1A 4TV9F 4RS4A 3K8OE 1HDZA 2OR3A 1J4AA 1GA6A 1UXJA 3K0KA 4LYGA 3WK7A 1QWSA 1GNVA 2YY6A 4HNVA 1KFEB 3GVHA 4X0EA 4AF8A 4YTEA 3I8OA 1R4NB 3HWRA 4RA9B 1TEZA 4YBRA 4OHFA 3CZQA 4MKIA 1U98A 1KYIA 2CCKA 2R7NA 9ATCA 4C7BA 1J2UA 3OMXA 2X2OA 5ERGB 1GQOA 1J6UA 4KRGA 3RO7A 1XJ5A 2PS3A 2QPAA 1I6KA 1IAQA 2IEYA 3BEOA 4UC0A 2JGRA 1Q92A 1YC2A 3AGPA 2OMEA 3QNMA 4MRSA 2BJHA 4KIJA 5FR2A 3C3DA 1IQUA 1IPHA 2VATA 3LNTA 1IZ9A 3U4DA 8ABPA 3HCDA 1OLXA 1XQYA 3F9RA 3G9ZA 4QRIA 4C5AA 4WK4B 4CM4B 4B3JA 4CMIA 3H2KA 2DWQA 5GOTA 2C29D 4GRIA 2Z6UA 3D7SA 1CS0B 4HDMA 3ON5A 3HJAA 5ALUA 1RQNA 2Q3MA 3O4JA 4FCVA 3OU6A 3VUFA 1AGRA 2YRFA 4YJKA 4D81A 3DHVA 2VTDA 4L85A 1G60A 4XM1A 3UIEA 1C0PA 2CCJA 1EGQA 2RHGB 2AOUB 2V8OA 2GZAA 2J1LA 2WG1A 3T7SA 3AUYA 4B4UA 4RU1A 1KWGA 2WSMA 4RH0A 3WVNA 2I22A 4RAOA 4CMAA 4MHTA 3QELB 4M1MA 2D0PB 2IEAA 1TZCA 3ER6A 4L8WB 4WDQA 5AKEA 3H97A 1YUNA 3N7TA 4A0HA 2FH5B 3PTLA 4JY7A 1DC3A 3FKSD 4H17A 1S3SA 1RAAA 3OPYB 3HK2A 4I1YA 4DCPA 2ZVPX 3DVAB 5F4BA 4FMDF 4PIMA 3JQ7B 4LMPA 4WKOA 5FNVB 1ESNA 3WBBA 4DXDA 2CL7X 1RFLA 1SXJB 3L01A 2CHFA 3LT0A 3MBKA 3OECA 1SFRA 4LYYA 4Z49A 2OQ2A 4HDRB 2QIPA 2C2KA 4CQLB 1W85B 4D96A 5JFOA 1G3UA 1C7JA 1GNQA 1B2RA 1GNTA 2JGKA 2ZWOA 3DZKA 3JV7A 2NTYC 3LO8A 4FGUA 5EG5A 3WFZA 1E32A 4ZAZA 4BMPB 5IKPA 5KTOA 4OX9B 1OZFA 3P0IA 4GLLA 2D54A 1DTEA 2IH2A 1KAMA 4BEWA 1AQLA 1HWYA 1KDTA 1RKUA 1EVJA 1TC1A 2C61A 2MYPA 2OP0A 3V6LA 3F6CA 4BQPA 4EG0A 2WF9A 2ZGVA 3E05A 2NP6A 1KKUA 2IS1A 1JT2A 3E35A 2DBQA 1CB7A 1QP8A 6ABPA 1V71A 3ANSA 4BJ1A 4TUYF 1Q0RA 4ENPA 2WJ3A 2O7QA 4RSGA 5FLYA 4KPUB 1WE2A 2PAFA 4M46A 3L7CA 4DSTA 4ALNA 3ORSA 2D5CA 2QQ0A 4HL6A 4M7OA 3AFHA 5KNLA 2Q6LA 1PG5A 3SC4A 2YW2A 3VV3A 3CH6A 3N8GA 4JB8A 3RRNA 1FVFA 1TEVA 3FHOA 2F8MA 2H4JA 3DJFA 1AZWA 3T7DA 3PENA 1IXZA 1LX7A 3AIOA 2WU0A 1WEHA 1QH1A 3FNIA 1OFUX 1JI3A 3IXQA 2WFMA 1QOPB 1ZINA 1ZJZA 4IF4A 2C00A 4OQQA 4F4IA 3KPWA 1VP9A 3WB1A 5KNBA 3F74A 2FZVA 3A11A 2RGAA 3OCCA 4PVCA 1EFKA 2GWRA 3JQDA 3SJBA 3FPKA 1MC5A 2F90A 1POXA 5ALLA 3RU3A 1X7DA 5IJ0B 4AJ2A 4DCGA 2QAGA 1ENPA 4TWZA 1ZH0A 5LXTF 4QBGB 3GVXA 2PSSA 3ADOA 2WJWA 1UZMA 3MXTA 2GPAA 2YC2C 2ODNA 3FMPB 5CCDA 3BMOA 1PD1A 3MC1A 3OAAA 1T34A 2QTAA 3AR3A 2VZ8A 2OXRA 1KI8A 3UT0A 2A9QA 1V8ZA 4HTAA 4EECA 2Z5VA 2X4IA 2AW5A 3VPFA 4G09A 1TC2A 4IEEA 1E6CA 2WABA 3B6IA 4J4BA 1GGVA 2R751 2OAQ1 4D4IA 3VR1A 5KOJB 4JKIA 1CUUA 2VDLB 2VQSA 4ZVQA 4P93A 3B2EA 1ISPA 1RD4A 1AG9A 3GG9A 4PV7A 4UAUA 4L5AA 4BNNA 4CVNA 4H4CA 3RWOA 2BFFA 4G8JA 3UHJA 3RF7A 4AROA 2YJNA 4YMHA 5DWDA 1US8A 3WLAA 4B73A 2PUEA 3VBEA 2GM3A 2GNPA 2J48A 1Z22A 5HFAA 3F90A 4X45A 2XUHA 3ZGXA 1PEKE 1JPJA 5C8DA 1KFBB 1ODFA 2JIRA 6YASA 2ZRCA 1R1DA 3RROA 3T4XA 4UFNA 2D59A 1U4SA 1LF0A 1P2VA 1ZM7A 4AN0A 2XYPA 4PWZA 3JQRA 4PCAA 1M0SA 1SXJA 1TRKA 2B0JA 5AWFC 5AJZA 5B1EA 1L5FA 1NRJB 1BE6A 4PC2A 4JV5B 3ZJUA 3IV7A 4TGLA 5AVOA 2DCMA 3EBLA 1P1BA 4OOEA 3Q11A 1I80A 3QF4B 5KSYA 4KBFA 4C7KA 3UUGA 3H1EA 5ANRB 4G0UA 3FROA 3PYMA 3KV1A 4HUJA 2CLOB 1NLZA 1RC1A 2ZT5A 3AR4A 4FS8A 1UBFA 2V7WA 1DXYA 2PX4A 1ODSA 3MLAA 3PNLA 3KFVA 1X80A 3MMXA 3HVHA 3SHWA 4I8DA 4D9JA 2QZPA 1KOFA 3L8MA 2OHFA 2ZAMA 2EIXA 3RM3A 3Q7PA 5BNIA 2VF8A 5E9QA 3JALA 4OA5A 5IJ9B 2ICAA 2JCYA 1ESEA 1WZUA 4IJQA 1EVQA 1N7GA 3HL0A 3DEHA 1V11A 1J2RA 1JR6A 2E21A 3G85A 4P53A 1JHMA 4O25A 2VJBA 2KPOA 1FDRA 3IR5A 4F3RA 3CTMA 3TBHA 2BTQA 4KQWA 4G4IA 5ALNA 4F8EA 5K45A 2BKVA 2GS9A 5ERYA 4LBZA 2VPQA 2FJUA 2BUCA 4W5OA 1OOEA 3O31A 3TE6A 4XDYA 3AFGA 4LBWA 3AG5A 5K8JB 3LG2A 5AVWA 3PDIB 4LCJA 2A0UA 4CM7A 3EZ6A 3L92A 3IIIA 3EPKA 2VYND 1JALA 1Q1GA 2QR3A 4WDRA 1SCIA 5C7LO 2CLEB 1ZN9A 2IEGA 2PBZA 3L6RA 1FDVA 1KHTA 5F2KA 4B3IA 4K6OA 1AQUA 1B8VA 3AESB 1MX1A 4BLSA 3LPAA 3OJLA 3LWZA 2GX6A 4DV2B 4MO2A 1ISMA 4YRCA 5DH9A 1X38A 2IXEA 4MYCA 1IBSA 1NVWQ 2JLQA 2O2HA 2VQDA 3AF0A 1W87A 3AEXA 4G8CA 5EWLB 2GM4A 3ZDRA 2H1WA 4BUZA 2NVUA 5ALGA 2HR1A 1L4YA 1WXFA 2DHDA 2SBTA 2IW3A 3GLTA 3FPHA 3PFWO 2RGDA 4MWTA 3P0HA 5DBOA 3UH1A 3ZIAD 1XTIA 5FT9A 1E3SA 1PD0A 5T3YA 3UFBA 3H6KA 5AKXA 3AETB 3JU3A 2ZE8A 4IKPA 5D3ZA 2BE9A 4NBNA 4EI7A 2IVFA 3AVPA 2HIAA 4P5EA 2WW8A 4MPJA 3THXA 1GSOA 4P35A 1QIEA 1ZM4A 2TMKA 5CPBA 3SVTA 5AW0A 3K0AA 4R16A 3LMKA 4RXTA 1JDUA 1T15A 1ZI8A 5BQOA 3LLSA 1Z8HA 3OP1A 4EL0A 4RTRA 4LF6B 5C8VA 3QIVA 4MGKR 4AP5A 5JMTA 4EKEA 1TJ4A 2Q7XA 4CL0A 3A4VA 3SQOA 1M0EA 1SVIA 1IXRC 3UKDA 4G0XA 4FPXA 4O0LA 5HOEA 5IVHA 3HR7A 2FWBA 1OYYA 1VE3A 2O2SA 1S1CA 5GJVC 3H3XA 1CDZA 4LZOA 1SC6A 1Q0PA 1JZTA 3HBJA 1NVMB 2ZJZA 1NUAA 4CV3A 2YOFA 2BELA 2WD8A 1V43A 3T3HA 4O2AF 3MCVA 5J2TA 4II2A 4M9RA 2ZJBA 3B53X 2Z95A 4AJHA 4B33A 5LQUA 4II7A 1L5GB 5ALXA 2OK8A 2CNWA 4RDXA 1G8YA 1X7YA 4PLWA 2NU9B 5EJ5A 3SVLA 3WA7A 4EY8A 2QTVA 5J2TF 4X64B 4BECA 1T9AA 4RDCA 5A3RA 1T36B 1VP3A 3CX4A 3CNNA 1WVIA 3E48A 4DFDA 4OIMA 2BY4A 4DZZA 1XD9A 1CVIA 5BMVB 5K0FA 1Q15A 1JNYA 3JQ8B 2NO5A 4XYGA 3LC1O 3FLBA 3NAZA 2ACEA 4F4FA 2ZTSA 3IDZA 4X71A 3VRHA 3VNSA 3EBOA 3RRYA 2ZYAA 3D59A 3AB3A 2UXDB 2JDID 2H5EA 4NCKA 4BFLA 3PJDA 4OHKA 4FTWA 3O2JA 4NBTA 4FDVA 3N07A 1N6OA 3N86A 4HI0E 4OMDA 2QX8A 3RS4A 4U00A 2FZCA 2IWRA 4P33A 2W6ZA 3HHPA 1AUVA 2AQHA 3BXHA 3TVYA 2QEQA 4NXNB 4QWWA 1WW2A 4FDTA 4KO1S 4RKRA 3NM6B 3ZE0B 6NULA 1G59A 1QP4A 2FDCA