5SYNA

Cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
b'PLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-protein thioesterase 2
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2).
pubmed doi rcsb
total genus 73
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.1.2.-:
pdb deposition date 2016-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5synA00
1Q84A 3O4GA 5HQ3B 3IUMA 4GEGA 1P0QA 1IMJA 3ZWQA 4OD0A 1M33A 4W1SA 2QUAA 4H7EA 3LS2A 3KSRA 4B7ZA 3ICWA 5JIBA 5EHXA 4BRSA 1VE7A 4P08A 1G5FA 3D0KA 1DX6A 5JAPA 1CUWA 3Q8WA 4BP8A 2Q0XA 1QONA 1DX4A 4J0KA 4LYEA 5C8ZA 5LZ2A 1THTA 3I6YA 1MN6A 4DNOA 3FSGA 1N5RA 1G66A 3HRHA 1QZ3A 5LKRA 1SFRA 2JGJA 3G9XA 1XZJA 4GWLA 1G42A 2G5TA 3WA7A 1EA5A 2VATA 5K3FB 3S8YA 5CT6A 3T4UA 4IH9A 2G63A 4MJ3A 3I2GA 2WIJA 2CB9A 3FBWA 1RYYA 4NS4A 5AI5A 3H2JA 4G9GA 1WPXA 5ALYA 2HU8A 2BAGA 2R8BA 1J07A 5EI5A 4BZWA 1QFMA 1WPRA 4EUSA 2AJBA 4N8EA 4DTCA 3UUFA 2C5FA 1ZJ4A 1E8NA 2V96A 1MAHA 2I78A 1KU6A 1YASA 1MNAA 4K5QA 5K3EA 1JJFA 4B83A 3GFFA 3DL4A 5D3ZA 1CR6A 2WHPA 4N5HX 5K3FA 5AKEA 3M83A 5LYYA 1BN6A 2Z5GA 4FLMA 4FDMA 4KE8A 2HU7A 3C6YA 4X85A 1XZCA 1IUOA 4Y2QA 2QR5A 4IQ4A 3A2NA 1DWPA 2QXTA 1XZBA 1CUXA 3N2ZB 4E14A 2O7VA 4MWSA 5LLSA 5AM5A 1PJAA 5ALSA 1R9MA 1EDDA 4CIAA 4J0GA 3V9AA 2QUBA 3C6XA 3VJKA 5T4BA 3SK0A 4E46A 1AX9A 2QJWA 4P92A 2JGKA 3YASA 5K5EA 4X94A 4J0HA 4H18A 5AJHA 3BF7A 2WHPB 1O6FA 3IULA 1CUCA 5AM1A 4FLFA 4KEAA 1N1MA 5LZ7A 1LPMA 1H23A 3L1JA 5ALWA 3QZUA 3WLAA 5E4TA 3PE6A 5IH7A 4O08A 2QTBA 4QE3A 3G9UA 3H1BA 2PU5A 1U4NA 5ALQA 1HPLA 3PF8A 4B0PA 1R1DA 4HXFB 4F5ZA 2OQVA 1QIHA 4QDOA 1GPNA 2WIKA 2XT0A 1FSSA 3WL7A 4KR0A 5CBKA 3GA7A 1CVLA 3IVMA 2B61A 3DKKA 2WTNA 3WYDA 1VOTA 3QVMA 5HF9A 3FVRA 1XLUA 3AZPA 3QPDA 1R88A 4C01A 3FYUB 3WJ2A 2QZPA 3C5WP 1ZD5A 2C0QA 2VJBA 1A7UA 2D0DA 4Y2PA 3WMRA 1CUIA 2P8SA 3DL7A 5DNWA 4ROTA 3O0DA 5ALRA 3VKFA 1GQSA 4GECA 1R50A 4J0DA 2H1IA 5AKIA 2D5LA 1VXOA 4BCCA 2DQYA 2VSQA 5EGNA 4L72A 4LXGA 1VZ2A 5YASA 2WJ4A 2JF0A 2LIPA 4I19A 2OAEA 4HAIA 1WB6A 5CH5A 3V1LA 3SX4A 1CUZA 4OU5A 4X71A 1XZIA 2IX9A 4F60A 2UZ0A 3M82A 2HA4A 2XUDA 4H7JA 3WK9A 1CUVA 3EQ7A 3G0DA 1DQZA 3IUJA 3F9CA 5EFZA 5ALFA 4LKOA 5AKZA 1LPSA 4XWGA 5FLKA 3IIIA 4H7FA 1U2EA 3I6MA 4JH0A 2PX6A 3TRDA 3RLIA 3VDXA 2IIVA 1RP1A 3WA6A 2Y6UA 4JNCA 3H0CA 1EI9A 1WHSA 2CUTA 2QJRA 4UBKA 4AN0A 5JANA 1FFEA 2J3DA 3C6ZA 3D5EA 4BB0A 1B6GA 1QFSA 4UPDA 4B81A 2HFKA 2XB6A 1SC9A 3DNMA 4FMPA 4X92A 4NMWA 3E0XA 3Q0TA 5EIHA 3BIXA 5FKJA 2XUGA 4X00A 2FX5A 4KAAA 4OYLA 3WK4A 1XZDA 4DMKA 5A2GA 3STTA 4K6GA 3CCBA 1Y7IA 4PO3X 1C7JA 1UKBA 3AJAA 2Y6VA 1UOQA 2QVBA 5HF6A 1UWCA 1CUYA 3PDCA 5JZSA 4QWMA 2IITA 3ZLUA 3ZPXA 4EHBA 4B80A 5FRDA 4G4JA 4W1RA 2RHWA 2ZJFA 5IKXA 2VJCA 1LLFA 4XVCA 4YPVA 3HXKA 3O95A 3V48A 3C70A 4KAFA 3L1HA 3AZOA 2BCEA 4BATA 3WWEA 3AINA 5E4YA 4AO7A 2XQFA 4ITVA 3X3HA 5AOCA 1EB8A 1UK6A 1QIFA 2PPLA 3WKBA 4U2FA 4KYVA 3I2KA 1JKMA 3HLKA 3WIBA 4ZGBA 1PV1A 3JYHA 3I2IA 2XQIA 1EB9A 4UBJA 4EZIA 1ODTC 2C0PA 5ALDA 2Y1KA 4Y2SA 3QMVA 1QTRA 4U2EA 1E3QA 3HABA 5LZ8A 2XUKA 4RNCA 5FPQA 1YA4A 4B0OA 2RONA 2WQZA 4KE9A 4Y9SA 2V97A 3GELA 3UMJA 4J03A 2ZSHA 5A6VA 3STWA 5AM4A 5DLPA 3W9BA 1NX9A 1AMNA 4G1FA 2EDCA 3EF3A 4C89A 4P9NA 4C87A 5CXUA 4A23A 1G4HA 2AJLI 1X70A 2OCLA 4MYSA 4Y2XA 5FXMA 1THGA 3VJLA 2ES4A 1IZ8A 2WIFA 4DSAA 1CUUA 5JD4A 4BTVA 2WG0A 3E4DA 4DYHA 4UBNA 1UKAA 4CIBA 1VA4A 3CN7A 1ZI6A 4LXIA 2GZRA 1XZHA 4JUIA 4G8CA 3G0IA 4UBIA 1LBSA 2VTVA 4BP9A 2PSHA 4MQMA 3I1IA 1MT3A 2WFLB 4BCBA 4ZV7A 1DWQA 1F0PA 3V1NA 3FWHA 2Z8ZA 2YYSA 5ALHA 5JATA 3WK6A 3I2FA 3P2MA 1AC5A 5LZ9A 4HVTA 3MUNA 4ZXFA 2OGSA 2XUJA 2I03A 3CCCA 4Q82A 5C8VA 3FSGD 4GLBA 1BCSA 1QOZA 2DQZA 2PUJA 1XRMA 1SCKA 3PFBA 1H2WA 1IUPA 1HQDA 5E2IA 4WY8A 4X3CA 4BZZA 2QM0A 3HJUA 3W06A 2ONCA 4MQLA 1R9NA 1YB7A 5A7FA 3AFIA 1A88A 1XROA 5ALUA 3F96A 5AKHA 4Y2VA 5ALOA 5KBYA 3NUZA 4GHWA 2HL6A 3G0GA 1H2ZA 2B9VA 2WUDA 5ESRA 2QMQA 2WUFA 2W22A 1LNSA 1HKHA 1JI3A 4G5XA 4BCDA 3HSSA 1J06A 4OYYA 4FWBA 1QIDA 3W04A 4FBMA 2WJ3A 2VA9A 2WIGA 2PM8A 3H1AA 3STVA 3O4JA 3RK4A 5AM3A 3N0TA 2GBCA 1UXOA 4Y2TA 2H9YA 2HRQA 2XUFA 3H19A 3G9ZA 2GYUA 3C6BA 3TJMA 4KE6A 2JIDA 5BOVA 3F98A 4ZV9A 3G9TA 3WZMA 5CT5A 1H22A 3FOBA 1VKHA 3WWOA 5AHXA 4BVLA 3R3YA 2HHAA 2I3ZA 1ORWA 1F0NA 1QO7A 1QO9A 2ZVDA 3UUEA 1UT6A 3LIPA 1YS2X 2E3JA 2RAUA 5HFAA 2PU7A 4X6UA 3O9MA 1U8EA 3LCRA 4MEAA 2O2IA 2DSNA 3G8YA 2XQJA 1JFRA 5ALJA 4E11A 2VJAA 1X2EA 4Z49A 4GW3A 5DJ5A 1XQXA 3QMMA 4U2BA 2OG1A 4ZWNA 1EHYA 3DOHA 3DS8A 3OM8A 1XLWA 1EK2A 3D3NA 1CLEA 4UHBA 5AIAA 5SYNA 3L1IA 4B9AA 4WY5A 3H2KA 2X8BA 1MJ5A 4W1QA 2DHCA 1LPOA 3ICVA 2OXEA 3GUUA 4J7AA 1TCCA 2OGZA 4X6YA 2BUAA 1FFAA 3ILSA 1BRTA 3B3QA 4NZZA 5I8PA 5BWBA 4LYDA 3VJMA 4C4XA 4QDTA 2WG1A 2WIDA 3HC7A 1H2XA 2R11A 2XMGA 1D07A 4GI1A 1P0IA 4B9EA 1HBJA 3A70A 3T52A 2WFZA 1NU8A 1VE6A 5I7UA 4RE5A 5JAUA 2WKWA 3I2HA 4WCVA 5DNVA 4CG1A 3M3DA 2AXEA 3K9BA 3R3UA 1XFDA 2PSDA 3ESCA 1CUHA 1E8DA 2HU5A 5ALEA 2XUHA 1YSCA 3WIOA 5AI9A 3KOOA 2CKMA 4S0XA 5HCUA 1EDEA 2HA6A 3I28A 3DEAA 5CURA 1ACLA 4J0IA 4OU4A 1ZJ5A 2Y2UA 4BE4A 4I4CA 1ZGCA 1YR2A 1WOMA 3F8SA 3I2JA 5AI0A 2WUEA 3F67A 2XLCA 2VQ6A 3QPCA 4XJVA 1CUBA 1ZICA 2JBWA 2FJ0A 4XIIA 3PUHA 1XQYA 1H2YA 3S2ZA 7YASA 4B84A 1C4XA 5J3JA 3A6ZA 2AJDA 5EHNA 5ALMA 4LIPD 4EY8A 4G8BA 4EBBA 4FBLA 2B4KA 4U2DA 1N8SA 4QZVA 4N5IX 2RHTA 1AQLA 1T4MA 5EHQA 3IA2A 4Q3LA 1XKLA 4X97A 1XQWA 3LP5A 3QBJA 3E3AA 5ALPA 3LLCA 4RE6A 3PI6A 4BBZA 4H77A 2ACEA 2WLSA 2GBIA 5D7BA 1FJ2A 2OPHA 1L7AA 1EH5A 5HFNA 3C8DA 1W6RA 3CN9A 2HDWA 3R3VA 1K63A 3D59A 3AILA 3EQ8A 4QLOA 1CRLA 2QXUA 1JMKC 1GKKA 1AUOA 1FFBA 5FP0A 2W6CX 1TQHA 4IH1A 5JD6A 2CMFA 3HZOA 4A16A 2JGIA 2NW6A 1EX9A 3PUIA 4ARAA 2XQKA 2BFNA 5AIBA 2ZYHA 4UHHA 2WFLA 5CMLA 2J4FA 5FPPA 4AO8A 4DGQA 4PSCA 3BJMA 5CT9A 1B41A 3ANTA 4FHZA 1ZGBA 1OILA 4X91A 2HADA 3WZLA 5ALTA 2BUCA 3K6KA 1Y7HA 1QJ4A 4K6KA 4X6XA 1EINA 4OB6A 5A7GA 1E5TA 3DYVA 1SOMA 1CUSA 3WL8A 1EXWA 4YX9A 1F8UA 1MU0A 2WSLA 4YK7A 3KD2A 5AH0A 2BJHA 3FCXA 4UBOA 2JGFA 2RI6A 3R3ZA 1LGYA 3SC2A 4DMFA 1HLGA 1MPXA 1K4YA 1VJ5A 2G4LA 4G8DA 2PKYX 4H7KA 3G0CA 3WKEA 5JD5A 4BVJA 4OPMA 1LPAB 1LPPA 2DHEA 1USWA 5LZ5A 5LIPA 1CUJA 4N8DA 4C4ZA 4PV7A 1GKLA 5JAOA 4UHFA 3DCNA 4WFIA 1ZI8A 4UFPA 3ZLTA 1VLQA 1ACJA 1JJIA 4UBLA 1J1IA 4K6HA 1QTIA 2HA5A 2XUAA 5CXXA 1ZD3A 3BXPA 1XLVA 2HFJA 1Q0ZA 3A2MA 4QDUA 3E1GA 1DU4A 5DNUA 2CEKA 2PL5A 1KU0A 1K5PA 2JGEA 3R3XA 1OCEA 4UUQA 4Q05A 5HKBA 1LZLA 3FLAA 1XZKA 3VISA 1BCRA 4CG3A 5F4ZA 5JAHA 3EIOA 2XUPA 3SWWA 1CIJA 4X7BA 1JU3A 5K3AA 4ARBA 2WU4A 3AIOA 3KDAA 3LIIA 2C7BA 2PSFA 4BDTA 3D7RA 1L7QA 1Q0RA 3DQZA 3I6ZA 4PSDA 1XQVA 5HK8A 3OC0A 2H7YA 2QOEA 1GPLA 4ETWA 5E4JA 4EY4A 2XMZA 4U2GA 1SCIA 3D2BA 1K8QA 2VEOA 4AN1A 2Z3WA 5DYYA 2CBGA 3IUNA 5T4FA 3WWCA 1AKNA 5K3CA 1MX5A 4WJLA 5JALA 4DSZA 4PF1A 1ZIYA 1AURA 3OOSA 3W05A 5KREA 4UFNA 4BC1A 3R3WA 4MXDA 3ED1A 4DMCA 2PVSA 5FDFA 1A8UA 4AXBA 3KWFA 4BDSA 4I3FA 1R4ZA 3D2CA 4B6GA 4CFSA 2V9ZA 4WDQA 1LPBB 4N8SA 5I9IA 2VAXA 1DT3A 3BE8A 3F97A 4H0CA 1QIKA 3C45A 1MAAA 1VZ3A 2RGUA 2OGTA 2GBGA 1CV2A 4GBGA 4DM7A 4Y2RA 1HDEA 3OG9A 3H04A 5LZ4A 5T4EA 4A5SA 3FLEA 2XQGA 5ALXA 3RARA 3IURA 3TEJA 4EA6A 5AK4A 3WKDA 1W4LA 3V1MA 1XZFA 3I1YA 5AM0A 5CW2A 3AZQA 1ZIXA 2VF2A 1BE0A 4HRXA 1A8SA 4UHEA 1BN7A 3QITA 3GROA 1CUDA 3QM1A 1UK9A 2Z8XA 4TVKA 1JT2A 3QH4A 4HXGA 5JZ9A 2VT6A 2OLEA 2JGLA 4H35A 5AOAA 2Z3ZA 3DOIA 4BAUA 3IDAA 4JEIA 2H7CA 1TIBA 1YCDA 3M81A 5A7HA 1ORVA 3WWPA 4BVKA 5AK6A 4KACA 1DINA 1K6EA 4FNMA 4W63A 4AB1A 3JW8A 3W9UA 5AI6A 3V1KA 5AM2A 2HRRA 1W75A 5IVDA 5JASA 4GDMA 5HK9A 4AMYA 3O4HA 4MWTA 4F0JA 3FNBA 5HF5A 3MGAA 3MUOA 2Y2VA 3BWXA 3OPMA 4J0CA 3G02A 1MTZA 4Y2UA 2ZYSA 3WYNA 1A8QA 2FUKA 2XMQA 4AO6A 4EY6A 5AOBA 3AIKA 3KXPA 1CUFA 5HKAA 1WM1A 5EHZA 1UKCA 1QIMA 4YASA 2PUHA 1GT6A 1XZAA 4HZGA 3WI7A 3VXKA 1UK8A 2FJPA 4XX1A 1Z68A 2XUQA 2ZYRA 4U2CA 2RIPA 4TGLA 2ORYA 4BE9A 4PSUA 3STXA 3AIMA 1MX9A 3WK5A 2EDAA 4RPCA 2XE4A 3OURA 5AO9A 3FAKA 5T4HA 4ZRDA 1YAHA 2AJ8A 1O6GA 3G7NA 3RKSA 4CCYB 2DCMA 5AI8A 1TRHA 5ALZA 4CI9A 4FFWA 4QLAA 1QIEA 5AK3A 2B20A 2GBFA 1ETHA 4BAZA 1GPKA 5DYWA 3H2IA 2YH2A 2CJPA 2XMDA 4G9EA 2XLBA 4K2AA 3FYTA 4AQDA 4TPKA 1FFCA 1QE3A 3H18A 3D4LA 1CUGA 1S8OA 5AKKA 5BV7A 4DMHA 3STUA 2WFMA 1LZKA 3BJRA 4M0MA 1I6WA 2WG2A 3OTQA 5HF8A 1BU8A 2GZSA 1ODSA 2XUIA 3U0VA 3VVMA 4OB7A 3ZI7A 2EEPA 2OQIA 3TGLA 2DHDA 4RGYA 4L9AA 3D2AA 1OXMA 5ALKA 3NWOA 5FOQA 4OB8A 4AX4A 4AZ3A 3HI4A 2C58A 4X95A 3WK8A 1J2EA 5CH3A 5JZBA 2DR0A 1WHTA 4QA9A 1WB5A 1BEEA 4V2IA 1P0MA 3CXUA 1ZD2P 2ZYIA 1DWOA 3HACA 4W9RA 2GYWA 4Q34A 1QLWA 4PQEA 1UOOA 3WQHA 3BDVA 1CQWA 5KWIA 1C7IA 3FCYA 4Q1VA 3ZLVA 3STYA 1UZAA 3HYSA 2WILA 1XRPA 3H17A 1T2NA 4D9JA 1CFJA 2OCKA 5H3HA 2QKYA 4INZA 4JYPA 2WJ6A 1E89A 1QGED 1ISPA 3ESAA 4FKBA 3DDUA 1AZWA 5BWCA 2YXPX 4IO0A 4W1PA 4B85A 2ZJ7A 2ECFA 2XUOA 1IVYA 5CT4A 2H7XA 2K2QB 3BF8A 3B12A 1JJBA 1XZMA 3FYUC 4WFJA 1KEZA 4Q3KA 2X76A 3RM3A 3JWEA 3DJYA 3A2LA 1ODCA 2QRUA 3W2TA 2C5GA 2ACKA 4QNNA 2XI4A 4DNPA 4BRZA 5ALVA 3PFCA 3B5EA 4WDRA 3O9VA 4QDXA 3FVTA 1DTEA 3WK7A 3ESDA 1R3DA 1N5MA 5C8XA 2PBLA 3DLTA 4PNZA 4KE7A 1YB6A 3K2IA 3PF9A 2YASA 4M0FA 5CH8A 3KWJA 4ZI5A 3C8HA 3EQ9A 5AKLA 3H2HA 1CUEA 1XRQA 1UFOA 1E8MA 3NOXA 2O2GA 1EDBA 4OUKX 5DYTA 2JGMA 5AICA 1ZD4A 1YAJA 1GGVA 3NGMA 4Q3OA 1SCQA 2WM2A 2WHQA 4KRXA 5D3KA 3C87A 5SYMA 2J3QA 2BGRA 4DNQA 5FUMA 3U1TA 4HS9A 4X93A 1EVQA 1W52X 1VA5A 3R41A 1TCBA 4KRYA 5K3DA 1MO2A 4Y2YA 5AKGA 3FLBA 1EK1A 3WJ1A 2BKLA 1ZOIA 3ANSA 3C5VA 3AUKA 5EIEA 1E66A 3H2GA 4WFKA 1AGYA 2HM7A 2DFPA 1TKRA 2WTMA 1CQZA 1YA8A 3IB3A 1NU6A 4PW0A 1UK7A 2V98A 4OCZA 5AK5A 3DYIA 5AKXA 4C4YA 1QIGA 6YASA 1UOPA 5ALGA 4CG2A 5K3BA 1ZI9A 4JYMA 4BYMA 1VXRA 1XZLA 2OCGA 5A62A 4H7IA 1XKTA 5KWJA 1DQYA 2HA7A 1WB4A 2OAGA 2C4HA 2WU3A 3ZV7A 2I3DA 4IHAA 1XZGA 3BIWA 4P93A 2XMSA 1XRLA 1W1IA 2HA2A 5D6OA 1RWQA 4UFOA 4FTWA 1DT5A 2VT7A 4FFVA 4HXEB 1IUNA 4UBMA 1IZ7A 2O7RA 3WWDA 4MYDA 1Y37A 2QS9A 4AZ0A 2XMRA 2AJCA 5A71A 1U65A 3QYJA 1GZ7A 1CUAA 4H7DA 1MNQA 2JEZA 4CCYA 2QT9A 4BAGA 1FFDA 4FOLA 3GBSA 4NVRA 4G4GA 1WCYA 5DTJA 3WL6A 1X2BA 4QDZA 3WKCA 2HA3A 5IVIA 4AMZA 1Q83A 4Y2JA 4J0JA 1TK3A 5DWDA 2ROQA 3R0VA 5JARA 1JMYA 4E15A 5ALIA 3DKRA 4DLNA 1XZEA 4OSEA 2G5PA 5AKJA 5AP9A 3G0BA 1CEXA 1P0PA 3IBTA 3IUQA 3BDIA 2PSJA 5CRIA 5IVKA 4FNGA 3EBLA 2O2HA 4LXHA 4M0EA 5AKYA 4L3WA 4EY5A 4HRYA 4DIUA 2WUGA 4L0CA 1GQRA 3R40A 2JEYA 2X5XA 4BTLA 4ZREA 4EY7A 3FYUA 4X90A 3DD5A 2ZSIA 4G4IA 4UHCA 1XRRA 2PSEA 5IVHA 4GXNA 3C43A 1YS1X 5FV4A 4MEBA 4H7HA 2XMCA 5EIAA 4HTAA 4FLEA 4QEKA 2CZQA 1QIIA 3GZJA 4BC0A 3BL8A 2XDWA 5C81A 1BROA 5ALNA 3QPAA 3O4IA 1JU4A 1TAHA 4B82A 1L7RA 5CTAA 5HQ3A 2VJDA 2GYVA 2BGNA 3QMWA 5DTIA 4QWWA 1HL7A 5LP1A 4UHDA 3PICA 5HZGA 2ZJ6A 3ESBA 2OCIA 1TCAA 2J4CA 4LHEA 1GXSA 3MVEA 5CT8A 1W76A 1PFQA 1LBTA 5JYCA 4F21A 4DNFA 2XMBA 3VVLA 3HEAA 5ISMA 5C7YA 2HIHA 4Y7DA 1F6WA 2BUBA 1LPNA 4IH4A 2VAVA 4C88A 2WHRA 4KAJA 4CCWA 1CPYA 1QIJA 4J3JA 2HA0A 1BS9A 3WKAA 1EVEA 4KJXA 4C6HA 5LKAA 1BEZA 5ALLA 1MX1A 1XRNA 5JADA 4EB0A 3WL5A 5AI4A
chains in the Genus database with same CATH superfamily
5AVQA 4W5OA 1Q84A 4E51A 1BVRA 5HQ3B 4YP9A 1CS4C 3E3MA 1EX1A 5G0VA 3S8MA 1PEDA 3OFSA 3ZHYA 3IEVA 1IMJA 2EU8A 3K0CC 1LK7A 4OD0A 3ZE2B 1Z22A 3ADOA 5AOVA 5JC8A 4NABA 1DRWA 1JB9A 1M33A 2IHYA 2BM1A 3PD1A 4XEHA 4E6PA 1AKQA 1WW8A 3LS2A 4RKRA 1OFUX 3DTTA 3SZUA 5JEDA 1BS2A 5ILOA 1X86B 3RRNA 5CEJA 3ICWA 1XCJA 5CDHA 2FGKA 4EFKA 3OZEA 1ADCA 2NU9A 1I3LA 2BMEA 3DP9A 3LY9A 4PZAA 3GAAA 5FRDA 1RDFA 2O7QA 2RHDA 1ZM2A 3ITNA 2CFCA 4KYUA 1RQGA 2BBTA 2P9ZA 3W5SA 2OD2A 1WTCA 1M83A 3KZXA 3BB1A 2PKQP 1I4WA 1TZKA 1V1JA 3G2IA 2PGOA 4RZHA 4PZEA 5E6UA 1U3WA 4B2YA 1HEYA 4S2EA 1B1AA 5JAPA 5KX5F 1KBZA 1FFWA 2QLTA 4LOJA 4B3IA 1AUPA 3NBQA 3HFJA 3G7UA 4YBRA 3WRYA 3HCDA 1T1IA 1OYWA 1K6XA 2FUG6 2X1MA 2XH8A 1UXHA 1DX4A 2I71A 1QK5A 1UF9A 3NTQA 4A6PA 4PVCA 4OMCA 3T1QA 3HO1A 3PRKE 4J3NA 5C8ZA 2OZKA 4DR6B 1JDTA 2Q45A 3D6JA 2CNLA 2D5IA 4TKZA 3E4CA 4PX5A 4RV5A 1XZ8A 3WLFA 1O9HA 2OPBA 5B55A 5AT1A 1ZN9A 2JFVA 3CNHA 1DE0A 4JT4A 1JVSA 3GOQA 4N0MA 3VNQA 1P2SA 1H8HA 3ZXXA 5A03A 2ASEA 2PL1A 5LKRA 1HYGA 3TUJC 4BQSA 1D5WA 1LC0A 4M7RA 4HNGA 4IJUA 4AY4A 5DBHX 5E7QA 1RE1A 3OP4A 2BM9A 3AETA 4WZBA 3ZN2A 2PLFA 2FXIA 4QDJA 5F2NA 3KM0A 5KQGA 5HTOA 1RAHA 3BILA 3LWDA 2FETA 3R1IA 3R7FA 5HOEA 2GPTA 3QHPA 3F6YA 1U3DA 5K3FB 2BEWA 4B17A 4B6QA 3VKGA 1P17A 2VCHA 4KV7A 5AR1A 3N87A 2EKPA 4ZI7B 2J48A 5DM1A 3O8CA 3D31A 5CT6A 1M66A 3H9UA 3T4UA 2WAXA 3WQBA 1MOPA 4ZK2A 2X1LA 2YXLA 4KQGA 1Q7EA 3W34A 4D9CA 2JVKA 5LA6B 4A7PA 1DRVA 2CXUA 3D7SA 2G8NA 2IHUA 3JQ7B 3QE2A 4L75A 3VDNB 4LTDA 1KTVA 3FBWA 3IAHA 1YQDA 3OQBA 5TMEA 2JBHA 3BHIA 4D46A 4NS4A 4V39A 3GJZA 3H2JA 3J80A 1RWXA 1WPXA 4W8OA 1EZZA 2UXBB 3JQBA 4D9MA 2ZM6B 4EMSA 1TQ4A 2NWQA 3A9WA 2JD0A 1RQRA 2OD7A 5EI5A 4KITB 1YFKA 3C41J 5E6UB 3B6JA 5K0CA 5EJFA 1XMPA 2KHZA 1WMSA 1DUVG 3H42B 2AYYA 3IMGA 2PT7A 1QDUA 1O6BA 2VQDA 3GH1A 3QWIA 1WPRA 3AFOA 4LC9A 1OFTA 1X1RA 4OL9A 4S1VA 5E9AA 5BSFA 3TRFA 2D62A 5JJLA 2K5UA 1BHJA 1PP4A 4YMVA 3U5TA 1T5BA 5KJ1A 2OMEA 3IOEA 1NIJA 1ZJJA 4IMIB 4KC0A 3BGSA 4BX9A 1YE5A 7REQB 2GASA 5H9VA 2AHOA 5AJTA 3BULA 4G1BA 4HYEA 2I78A 5GVSA 4YB8A 1KU6A 2XT6A 1MNAA 2FCAA 2NP7A 3NHUA 4K5QA 1VI5A 4GOND 5E6SA 4BQRA 1JJFA 1W5SA 4B83A 4DLBA 5HRUA 1UPUA 2ORED 3EPHA 4DIEA 3PHCA 4A6XA 2C54A 4GE0A 4I5IA 3D6TB 3AETB 2P79A 3ACCA 4E13A 3KKLA 4MI6A 4MQ4A 4OBWA 1U3TA 2RGCA 3CS3A 1VG9B 4QM6A 3QE3A 4K9MA 2WAOA 5K3FA 2BEWB 4YN3A 3UJAA 2X13A 1G3QA 4TXMA 3M83A 4R6XA 5AKEA 5FO1A 5LYYA 5CJJA 3WLNA 4DARA 4DJAA 3G2OA 5SZHB 1RXCA 2H2AA 4U7JA 4NIMA 3PWZA 1UM8A 3VHQA 4R98A 4QVGA 3K92A 3D81A 4Q5IA 2EX1A 2V7WA 2LW7A 5DM4A 2Z2ZA 1NJFA 4NBKA 5DCYA 2OXFA 5CJ2A 3ZXUB 1GWNA 4Y2QA 1QVAA 1RRVA 2FOLA 4JDPA 4TX1A 3IE1A 3VO8A 5FORA 4CLDA 3N53A 4D9NA 1QDLB 1QHXA 1SELA 2GM3A 2XD9A 4M38A 3GQBA 4XIYA 1BKDR 3O82A 1NSYA 3A2NA 4ZC8A 1T8RA 1E9VA 2I54A 3GFTA 3OHPA 4O4LA 3GLQA 3N2ZB 4QPJC 5BN1A 4ZZ0A 1FMCA 4R83A 2AZDA 4FB5A 2AR0A 2VSXA 4FOOA 1SXJA 1CNMA 1ZUWA 1PJAA 2CYBA 2VP2A 4B35A 4UASA 1EDDA 1Q50A 3DCIA 1K75A 2H31A 3HVKA 1LD3A 3BTVA 2P0YA 3O84A 1P73A 3PQ2A 5I5EA 2H51A 5C0OE 3SXUA 5I4IA 1KMHA 4LRYA 1I80A 2V7GA 3VZPA 5AW6A 4MARA 1Z5GA 3FE2A 3SK0A 2IS2A 2PLWA 4JXKA 2GN8A 2I7VA 4X8LA 5FTNA 3S1AB 4TKVB 4GVLA 4D2IA 3DT6A 4MPPA 3U4HA 1XJQA 1WULS 3Q7QA 2VHCA 3BGIA 2JGKA 1NT2A 3AWDA 4GLFA 1EVIA 2DU8A 5FYDA 1U7PA 2ONYA 1U6IA 5U4XA 1NBMD 1L4NA 2Z2KA 1HA3A 5K6AC 3LHKA 4YRPA 3UB4A 4F3TA 1WCIA 2GR9A 3EXIA 4RPJA 1ILEA 1C41A 5I3CA 3SKXA 4PAMA 3DMYA 1T8WA 2C7GA 3IULA 3ZCQA 3R3SA 1IPHA 3OX4A 1L4HA 4EG7A 1DG1G 2LPMA 2JLSA 3IEXA 1SU8A 4YJ3B 1CUCA 1U8XX 1AKTA 2AOVA 1NASA 3MJSA 4KQ6A 3U7HB 2F43B 4HF7A 4WX2B 1XA4A 4OGKA 1N1MA 2HRBA 4I1UA 5ED4A 2QRNA 3ZDBA 4AY3A 5EQFA 1M2EA 2D1TA 3HI6A 4JFAA 5LBTA 4E2WA 3L1JA 1FP6A 4FHGA 1I3NA 1G17A 4QOEA 4UVDA 5ALWA 3GG2A 4K3VA 4X8HA 3VR2A 3QI7A 4JVOA 4OIFA 4BQPA 2EQ5A 1UT5A 3MJVA 3T9FA 3R6WA 4PR0A 3U49A 4HBGA 1B0PA 1Z5WA 2J32A 1G8MA 3VPSA 5BN5A 5TLSA 1DC5A 2GK7A 2IEAA 1LV8A 3K94A 4M22A 4TMFA 5DNEA 3CRNA 1RYMA 1UBLS 2Q1WA 5ALQA 1ZSNA 3E81A 5DX8A 2A4MA 3PF8A 4B0PA 2CNOA 1I10A 1SXJB 3D0RA 2J5KA 4AP5A 4JC5A 1FVHA 4R1UA 3O5AA 2HYDA 4F5ZA 1M0EA 1DTWB 2HSGA 1DKLA 2XA1A 1LJUA 1OWMA 2XT0A 2J0UB 4WY2A 2G7MC 2IU6A 5BN3A 2PJZA 3L7OA 4P4NA 1G8FA 4GGOA 4KR0A 1CVLA 3ICPA 4E22A 1R6XA 1DMSA 1S2IA 3GDOA 1W36B 1WDTA 3RRJA 1WV1A 1RRCA 3KLBA 1ODIA 3DKKA 3GEIA 3N8IA 4YRSA 2P2SA 2J1LA 1VOTA 2WYHA 3IPXA 5F3WB 2TMYA 3QVMA 3MPOA 3DMTC 4FZ3A 3S1AA 3LDHA 2R48A 3M4ZA 3WKDA 4YRBA 1ANKA 2IUEA 3EVNA 1QKKA 4C01A 3ANMA 3BWVA 1CY4A 3CNNA 1JLMA 1M5TA 2VPIA 3AEKB 3O0TA 2IU0A 4PN3A 1QU3A 1I33A 5IZCA 4RMNA 3SAJA 4NU8X 1IE3A 4FCCA 2AG0A 5EY5B 5F64A 1ZD5A 2HB6A 2LCIA 3WV5A 1V37A 2WA1A 1MO3A 3EXIB 1A7UA 2WKSA 1T9BA 4HQNA 3HWRA 3KOXA 4U0KA 4YJ3A 3DL7A 5DNWA 1NG9A 3TIXB 4ROTA 4G0YA 5B12A 2JI4A 2G09A 2P2ZA 3KX2A 2IEDA 5ALRA 2F43A 1T9ZA 4UAVA 1NFQA 2SCUA 3VKFA 3VPXA 1QFJA 4QYIB 5CHEA 3GRFA 3NHAA 1II8A 3SCZA 3Q2IA 4D57A 4M83A 4NMLA 5EWLA 2Q62A 4G0PA 1W93A 2GXUA 4P3YA 1MFPA 1C9JA 2NV2B 4E3WA 2YOHA 3SOPA 2WLTA 1QVRA 4IOLA 3LW8A 5DP1A 1GGHA 2JIZA 3UB3A 4CGYA 4F3KA 2AFRA 3VOBA 1JPJA 3GVHA 2ZRGA 2VNKA 2BMVA 5BN5B 5ARBA 5HUJA 1KARA 1VYVA 3HE3A 4L72A 4PTLA 3T1NA 4EPXA 3DBRA 5BXYA 1CQIB 1XNQB 1PLLA 3PHHA 4O1HA 2WSIA 2EFHB 8OHMA 1N4DA 3SBXA 1VSTA 2DUNA 1NPDA 2W6JD 3RDPA 5TVKA 4D5GA 3A1EA 3LC1O 4Q1FA 1WB6A 1EWKA 4HDKB 3HRKA 4HQ0A 4YAGA 1P91A 3LW7A 4HFJA 4XSHA 5BN3B 2TYSB 2ODAA 5J2TA 1Y33E 1L9KA 3AHIA 3VFDA 3GLTA 2GH1A 1CRPA 2WWHA 1GTJ1 3M82A 1XNRB 2B1GA 2HA4A 4E07A 5A9SB 2P9YA 2FW1A 1E7SA 1CUVA 1K3UB 1NW4A 2KBFA 2WYVA 3G0DA 4J9UE 3RC3A 4CKCA 3HH8A 3S40A 4NV3A 4BEVA 1M67A 1A4IA 4BNMA 5ALFA 1KFKB 4DUPA 1F0KA 1D04A 3IIIA 2O07A 4DTIA 5T8KA 5D7NA 1YKSA 1VE9A 4RVFA 3VPHA 4PYIA 1E1YA 1JPNA 3C15C 3VDXA 4GXQA 2AH5A 3HB4X 3UG6A 3EEIA 3VKUA 4MW1A 2IIVA 2BEUB 3JQ8B 3QOFA 4NCKA 4PRZA 4XB2A 3RYHA 1LBHA 1OU4A 1L5HA 3CURA 3HCOA 4GPD1 2PWBA 2SCUB 4RESA 1RBYA 2P7IA 2F6RA 2DH6A 9GPBA 4D43A 2KS6A 2FPPA 1L7NA 3FIUA 4KQ2A 1EI9A 1WHSA 4UBKA 4YYEA 4W5QA 3OLVA 1SOUA 1ZCJA 3DJFA 3LRPA 2OY0A 3FIJA 4PLTA 4LC0A 4WK2B 4PCLA 3ENZA 2QVYX 4IWYA 1S8AA 4OHFA 2NVBA 4KUEA 4XIGS 2ZJ8A 3DBRB 4IG4A 3GCXA 4NDNE 2H1SA 4Q6WA 5KEIA 1SC9A 4C07A 1M2JA 1J21A 1EJ0A 4U8HA 4CL2A 1G4UR 5KVQA 2OMKA 4FMPA 1IBSA 1KIAA 1AY0A 2AMVA 4YAFA 2YQ4A 3NXSA 5K4AA 4UMVA 1A8PA 1E4OA 4NBVA 4Q9AA 3CPEA 1BD4A 2VHJA 3WB0A 4D02A 5MFZA 3K0HA 5EIHA 2XKKA 1W35A 2Z58A 2ZSDA 3BIXA 4V3CA 4GXTA 4A2PA 2XMPA 5J2TB 3A6DA 3TQCA 4O2BF 4AXXA 4KN8A 4E09A 4DKXA 4WBNB 1DGQA 2DZDA 2X23A 2FWRA 3B1YA 1KQ3A 4NH4A 4Q3BA 3NYIA 3R09A 4JXZA 3W3AA 4DUZB 5A2GA 2B5OA 1P5FA 4KSYA 2XAUA 3VYWA 2A0WA 4MNTA 2YZMA 1HFEL 1A50B 1V2GA 1KC3A 2Y6VA 5K4GA 4V2UA 1LH0A 3ZDAA 3D6MA 3TRJA 4AT1A 1VLMA 3QYFA 2GKGA 2HR1A 5EE0A 1SHLA 3P9XA 5CA0B 4JIGA 4JOCA 1CW2B 1X38A 2BEUA 3JQ8A 2FPOA 1BW9A 3G68A 2JVIA 1FUEA 3WWZA 2REXB 3GEHA 1E9RA 3FA2A 2UUCB 1WP4A 3W77A 3Q9SA 3OMWA 3PDCA 1GPAA 3OZSA 1FUUA 3KNZA 3V97A 4TXJA 3ZPXA 2HSZA 1BOOA 1WHSB 4DUGD 3GJTA 4PR3A 5ED0A 1PJ8A 3BQ9A 3FDFA 3HGMA 1ISRA 1RWMA 2A5GA 2CMGA 2P62A 2QMHA 2YQZA 3AFHA 3NPAA 3IAAA 4G4JA 1CF2O 1G1MA 4Q15A 1QS0B 1JHRA 3C7CB 4NE9A 4FNAA 4MR7B 2VJCA 4B73A 2LVBA 4IHQA 5EPUA 4YPVA 1CETA 2SICE 4KDEA 1YK0A 3TPZA 1RQLA 4D41A 4HGQA 1G41A 2WJVA 3O95A 5I9BA 3V48A 2WWRA 1NOKA 3L7KA 3QUSA 2EATA 5CIYA 1CRQA 2AOUB 2CHUA 3OQHA 4OM8A 3VTZA 4ENPA 2XCRB 1SN7A 2RHJA 4JB8A 4KOAA 4LDRA 3ZU2A 1THMA 2BCEA 5JATA 2ZROA 3WWEA 4G0UA 1X6VA 2ZJOA 1BFUA 2XJ4A 3CH7A 1E62A 3L6BA 1CY0A 2GS9A 1JAZA 4Y9RA 5LP6F 3X3HA 4NENB 1ZRMA 2PS0A 2W0MA 4JXJA 1M7GA 4UTRA 4HH0A 4TLDA 5HYVA 4WBNA 4ZHQF 3W8DA 2MU1A 4NLLA 1NW8A 1M1NA 9ABPA 5KC9A 2PUDA 5IDWA 1AXRA 4LRQA 1G8YA 2AEFA 2IPNA 3DWEX 2OZLB 1DLJA 1WRBA 4KYVA 4DQVA 4TQ9A 3HLTA 1MOZA 5FA5A 1R18A 2FW7A 2YHUA 3UHFA 5DB4A 1F4PA 1HOXA 5KDOA 1GGMA 1NLYA 2H1FA 2X0NA 3ORRA 1YIAA 4D9IA 1K1EA 2BDUA 2BLNA 3ITEA 3JYHA 4GPIB 3I2IA 1B7GO 4OH7A 4LZPA 4ZGBA 4EZIA 5EXDA 5CA0A 9LDTA 4ZYXA 1DBRA 2C0PA 3QOWA 4C2TA 4ARIA 1HFWA 4JLUA 5ALDA 1FDUA 1BW9B 4FB4A 4ZTZB 1BWRA 3JX9A 3K0BA 5CGQB 5KHAA 2F1KA 2F2TA 2ZZMA 4D74A 4N6OA 4BO2A 1PCXA 4G3XA 4HD8A 1Y6ZA 3ZV4A 3LRTA 2ZU0C 1DAFA 4OUDA 3NBZC 1L5RA 3GI1A 4IZOA 1Z47A 2G67A 1M8KA 2PX5A 4MUGA 4MRAA 3SOZA 3VV2A 4QBTA 4N48A 1WO8A 1Z12A 3IUEA 1Q3KA 4CM9D 1KO7A 5DYIA 1SZJG 2AN9A 4RNCA 2BJVA 2P6PA 3NM5A 4UATA 3CH6A 5CFMA 4KR6A 4EA9A 2ZBGA 3T5BA 3BYZA 3Q7SA 3WG9A 1J5XA 1VMEA 4L4XA 4L22A 4UD6A 5HJEA 2BHTA 3W4JA 4CU2A 1A7AA 2R8PA 2WQZA 3AESA 4II7A 4Q39A 4FE4A 4BY9E 1R0BA 2V97A 3UMJA 4DMLA 4J03A 3SJCA 4TVOA 1GUDA 2VP6A 4QODA 1TJ3A 2HXSA 3STWA 2AOUA 1XPJA 5A6VA 1PK7A 3IHWA 1UJNA 4JR0A 3MT0A 1E3JA 3AH8A 5DLPA 1D0VA 2FQQA 1TF7A 3KR9A 3WICA 1NX9A 1ZW6A 1GADO 2EDCA 3B85A 3RRXA 4B40A 1A2KC 3HB0A 4C0XA 2I91A 3AOEA 3DHWC 5E3HA 4LBVA 4ZAGA 3OPXA 1OLSA 4XARA 4I46A 1BZYA 3UAZA 5EJAA 3D8NA 3OPNA 3KHKA 3WAGA 1R7RA 1CYEA 5ITSA 2I2WA 4CZ2A 1X70A 1ZY2A 2OCLA 4EITA 3PB3A 3ZX5A 3T0FA 4Y2XA 1E3LA 3SGLA 4BBAA 2OZLA 4CJXA 3W6NA 1LB1B 2GPNA 3DFFA 4NJEA 1THGA 4X8MA 1YJBA 2ES4A 2F1RA 3FZYA 4DSAA 1SKMA 2YL2A 2IYEA 1MVNA 2E7ZA 4D0LB 2FVXA 3D4PA 1QHSA 3FTNA 4DLTA 1P7VA 3TAXA 4GYKA 1YR7A 5GONF 521PA 1DEOA 3ELYA 1LQUA 4DT1B 4DYHA 4BNXA 2GHIA 1X74A 1CY7A 4B5KA 4ZHQA 1U8FO 1ZUD1 3PEEA 4JP8A 4C3OB 1QQTA 2IYRA 5KTRA 3RADC 4J16A 1XD8A 2ZI3A 3HFGA 4JB2A 2EFGA 1KJ9A 1JIUA 1PS8A 1S6YA 2BMFA 3OZ7A 2GARA 4TLCA 5ILQA 2X1VA 4Y2HA 4IFTA 2R00C 2BR5A 1XZHA 1K0UA 2O2XA 1U2DC 4G26A 4TMVA 5ERGB 1JQJC 1ZPDA 3G0IA 3UMBA 1M8FA 4JOSA 2D2FA 3WJ7A 7AT1A 1YVEI 3K1AB 4C29A 3IKLA 4DZZA 4WN9B 3QVJA 1I1OA 4XFJA 1JQEA 3ESYA 4MIEA 1DBQA 5TNXA 4ARSA 2ZLBA 3CC8A 4PX9A 3MNFA 3CPHA 4TKUB 3OQMA 1T0IA 3AESB 1HTTA 4L4RA 1RWBA 3NP7A 4DY4A 1XLTA 3AQIA 1Z5NA 2WOOA 1P2BA 2XWQA 2YYSA 1JYSA 2Z8ZA 4OQPA 3TTYA 3VPBA 3WK6A 3VPAA 5IF9A 2H1OA 1AC5A 5LZ9A 3EUEA 1CT9A 4ZXFA 4ZO8A 3NI2A 2ID7A 2OGSA 2H57A 4Q01A 1XEXB 1VPVA 1MVLA 3A11A 2R6CA 3CCCA 4Q82A 4FE3A 4JX8A 3SLKA 1NN1A 3A0RB 3VR5A 2ZIUB 4GLBA 4K0RA 3B9BA 3PJRA 5ENZA 2XADA 1QOZA 4DJ5X 3D5QA 3NBUA 1XRMA 1POWA 1SCKA 1BAPA 4F2DA 1XCLA 3U3RA 1GCIA 1NBEA 1PEAA 4PCAA 3T54A 4BJ1A 4NJEB 4PBRA 2G0NA 2YW9A 2FOXA 4R0NA 1NKVA 2B5WA 3L9WA 4WY8A 3TX6A 3UAXA 3ZDEA 5FL7A 5FJIA 1AUQA 3MB5A 4UNNA 5TQJA 3ESRA 3T5PA 5BSUA 3RRZA 5JT1A 3JQEA 2H0RA 1IOVA 4LNAA 5C1BA 4HLNA 4I8DA 3L4KA 3K09A 3H99A 3FNRA 1YB7A 2OFFA 2O1WA 5A7FA 1A88A 4UEKA 3SYRA 2ZITA 4AW9A 1Q57A 1KK1A 4OHXA 3JY6A 4YDHB 1GU7A 1L1EA 3IT0A 5ALUA 3TLMA 4EHIA 4GMGA 5M34A 1Z34A 2AMJA 3NUZA 1NYTA 1IEWA 1NFRA 2V7BA 3HDHA 4GHWA 3COYA 3G0GA 2B9EA 2HK7A 3T94A 3SVLA 3RUIA 4ER0A 4UAJA 2OYCA 3P94A 5KNLA 1JG6A 1EFVA 3HA5A 3RBAA 4PRYA 1RRKA 1OFUA 3Q10A 4MPTA 4N40A 2MCFA 3NHMA 4RTKA 2V3CC 5EJGA 3D4IA 1ZVKA 3NB0A 2ACWA 2D1SA 1X7GA 3K1AA 2WUDA 1Q7BA 1QE0A 3BIOA 4WN9A 4EGAA 2WF7A 5AUOB 4F5WA 1G2IA 3P0RA 1Z7GA 2PMDA 1IRXA 4Z9YA 3S6JA 2N1BA 1I7QB 1LVUA 2Z4RA 4NE7A 4PHHA 5AVRA 1P2FA 2WUFA 5IDVA 2FG6C 1FXWF 1PNVA 4HGYA 4IIBA 4KO2S 3MOSA 4B6JA 2H16A 2FG5A 4M8NE 3VGJA 3BTUA 2SBTA 2I34A 3S2YA 4I1YA 1U3VA 4NBNA 4OA5A 5EZ5A 3W04A 4AKTA 2VDRB 1A98A 3P2EA 3Q5EA 2O3UA 4CKWA 2PY6A 2WNSA 3GJ4A 4FQ5A 1UBOS 1JG4A 4X44A 2FY8A 3VOSA 3BORA 2IZZA 2E4VA 3STVA 3PFNA 3ITDA 5JO9A 1OA0A 3I04M 4ENTA 3B52X 3CGGA 3SIPA 4GOOD 4ZTBA 3L6EA 4R54A 4Y6SA 3UJHA 4FFLA 1Y7PA 3QV2A 1B8OA 3RTGA 2HRQA 3FUWA 3H8WA 4D8VA 5IK2D 2A5JA 4AMBA 5IAAA 2WAAA 4LXQA 3SD7A 2XECA 2TMKA 1Z16A 2Z8YM 3V80A 1D2CA 3TJMA 5H7XA 5BOVA 3M6FA 3L4BA 1LS6A 5IJZA 2CNNA 1LDYA 3AHDA 1WETA 5FWYB 3WGGA 1T34A 5A9TA 1DOAA 2A7XA 3LV8A 4E4RA 1YFJA 1UJ5A 1H22A 3F2IA 1B15A 3PXEA 4JJFA 1T1EA 1VKHA 1YQXA 4MKZA 1JILA 1GNTA 4REOA 2C3OA 5AHXA 1L1RA 1EXNA 1X8XA 4O2AB 3ZXIA 1ORWA 1QO7A 4OYRA 4R1SA 1VKNA 1Y5NA 3UUEA 3UWMA 3V8BA 3MD9A 5CX1A 5IKPA 1FNMA 5GADl 4P3XA 1P7ZA 1V11B 3UICA 3RUCA 1V9SA 4KNVA 1GZSA 1IH8A 1AGNA 1LK5A 2FZVA 3O9MA 2B1JA 2OFOA 3HPRA 1U8EA 4QGHA 4E1AA 1R3UA 4XWKA 3CVVA 3THYA 1EFAA 3TLKA 2CB0A 4MEAA 5JVDA 2CXOA 4UTVA 1Z4MA 5TS3A 2DSNA 4CIXA 3G8YA 3NS7A 1C0LA 4HH1A 4JI2B 1XAIA 5KSYA 1RXWA 4E11A 5T7BA 1GAWA 1GDDA 2X4IA 5JRZA 3ZK7A 1HEIA 4LDQA 4Z49A 5C7OO 4AM8A 5DJ5A 4AG6A 3A7DA 1FRZA 2XOKD 3AR7A 4YUZA 5JYDA 1V4NA 3G17A 2O0MA 1ENYA 1R8JA 2OG1A 4KV9A 3DOHA 3E3LA 4HJRA 4QXMA 1IHDA 1DKMA 4ZZ1A 2X4LA 1XLWA 3PC7A 1TYZA 3CIOA 1H1LB 2Y1LA 1PQYA 4P7FA 4U63A 5EWJA 4QTUB 2YDYA 5K0LA 1NPYA 1WSAA 2BKEA 2ZG6A 4DV3B 4HR7A 2QLLA 1EYZA 1JNYA 3MTDA 3RVOA 4ALLA 4YV0A 4QUKA 8ADHA 5JWOA 1CY8A 4B9AA 1A1VA 2O3TA 5WRFA 3L02A 4WK4B 3LPDA 2OBNA 3KB2A 4XM1A 3KQKA 2IH4A 4LV5B 1K7YA 1MJ5A 4W1QA 2WSMA 3U9SA 5LMCA 2Y77A 3K70C 4AU1A 1J9GA 4IDOA 3FYDA 1Y8RB 3CEHA 1SXJC 4BLVA 3HL0A 4CXMA 3GDHA 2X15A 4S35A 2IDMA 2YV3A 4Y9UA 3GUUA 3ETEA 1C9DB 1PUXA 1G8GA 3I4CA 4X6YA 1RHMA 1GYQA 4ME6A 1QUEA 1J2TA 2H08A 4OFZA 2V7XA 3HXMA 1O8BA 3ILSA 1QGZA 1BRTA 1W0KA 1ZX1A 5KYVA 1RMQA 1T9GR 1YQGA 2CDRA 2CDBA 4FFMA 4NZZA 1Z8FA 2ZRLA 5MN5A 5ES3A 2DKFA 5FEMA 3CR3C 1FW6A 3MIIA 4JYCA 3KBOA 2C96A 4JITA 4TROA 5BRNA 2BFOA 4BKUA 5KWJA 2O59A 3A6GA 2FEPA 4UPEA 4RQTA 5JVDF 2H2HA 2QXYA 2WIDA 3HC7A 4ZEVA 1I2MA 1L7VC 3EIWA 3UB2A 5JVDB 2RE8A 4O4LF 4IRMA 6REQB 5KNCH 3KR0A 1D07A 2I9PA 2X58A 4FP9A 3UUGA 1P0IA 3VO2A 5I7HA 4FVTA 1QUFA 1HBJA 4NOKA 1IY8A 1WSBA 3ZDRA 1YR9A 4EW3A 3C3MA 1U7WA 4M46A 3MBKA 4C21A 5LJIA 1EE2A 3ZY2A 1OLXA 4LGVA 1G3IA 1NBIA 1VE6A 1R0SA 1Z37A 4KTVE 2X4GA 4RKQA 2X9QA 4DSOA 1O96B 1QCZA 2ZREA 4LUCA 4X65B 1E1QA 2F90A 3OO1A 4IIYA 4RE5A 1R0WA 4DJFC 5JAUA 1GTSA 2UXDB 3SKYA 3RF7A 5IEJA 5FPHA 3I2HA 5H82A 1PZXA 4BLOA 1JB1A 5EWJB 3EDMA 2WM3A 2ZIFA 3G5LA 3GXBA 4QRHA 1M1YA 1R64A 4U8GA 3S7TA 1MFZA 3SE0A 3KE9A 2HJVA 3LP8A 1JLHA 1A8IA 2M98A 4H4EA 3B1ZA 2HTFA 1B42A 1C1XB 2IF2A 3T3MB 3ESCA 1T8SA 2E4UA 1CUHA 4FMDF 2KPOA 5GIPE 1E8DA 1I24A 4F4JA 1Z6XA 3ONVA 4MW4A 2C00A 3ZOKA 3K9QO 5IBPA 3TRHA 2W4IA 3NNNA 1AF7A 5HIMA 3QIAA 1Y8RA 4ICIA 4YR7A 3N8NA 2A8YA 4I7EA 3ABIA 4MS1A 5HCUA 1ND6A 1C14A 1EDEA 3HKBB 4LPKA 2NPFA 2HA6A 4GNRA 4BJHB 3KCQA 4URUR 3O2SB 4YLGA 3NHRA 2P2NA 2C7OA 5FLEX 1UPCA 1KO4A 3IGFA 2LCFA 2Y2UA 4BE4A 2YYYA 1PK8A 5BSHA 3Q3VA 1GCOA 4IXDA 1MA3A 1U81A 3OFND 2VT3A 3UMYA 2BGUA 3FN4A 4KTTE 4FT4A 4RNDB 4PBSA 2XWPA 3KSDO 3H9BA 5CBPA 1BDHA 1MJFA 5HKKD 1HMYA 5KDDA 5J1SB 4YMUA 3F67A 3IKTA 2HDNB 3AM4A 3PD7A 4H3KB 1WD7A 4BO0A 5T41A 2DT5A 4M1ZA 2APJA 2JBWA 2FJ0A 4XX0A 5D3MB 3VU9A 1G0NA 1XQYA 3SX2A 1U1GA 5E7IA 4M7WA 4RFSB 2FR1A 3U62A 1GKUB 4YUWA 1WVGA 3FWYA 3AF0A 1IJFA 1UQTA 4MLPA 3F4KA 4U6SA 1VSUA 3MXTA 5JH7F 2GAOA 2SKDA 2EKDA 2MOKA 3JAWB 721PA 1PX2A 5CFRA 1L7EA 1Q3TA 4PG4A 1I3KA 2B25A 1UDRA 2ODWA 3FI9A 2AV6A 2IXAA 2P3OA 3KAKA 4G8BA 4KSBA 4AJ9A 2RBEA 4ECEA 1Q1GA 4NONA 4EBBA 4Z7JA 4KFTA 3EEFA 4L85A 3AEZA 2CLEB 4BQQA 5KVAA 2ZS9A 3EIHA 4U2DA 1KE1A 4QZVA 1J8DA 3MTAA 1T36B 4CR8A 1I7LA 3PBKA 3UKDA 2V0GA 2KJQA 2BISA 4UEOA 3BSWA 4FUTA 2ADFA 1XKLA 3HYCA 4X97A 4HS4A 1J22A 2KLHA 4U0JA 4UDXX 1EE9A 5EEHA 3UANA 3EVBA 3J7TA 3F47A 5EOVA 3OIWA 4ZVOA 2FK8A 5ALPA 4MS1B 3LLCA 4RE6A 1ECLA 3HKBA 1TVMA 1T8TA 3D1LA 3PI6A 4LHXA 3K2BA 3H1FA 2PJDA 5COQA 4HGPA 4JJ7A 3A36A 3U17A 1ULAA 3ONWA 1VFPA 2ACEA 3OP1A 4RO0A 3TSAA 3LX6A 1FJ2A 2OPHA 1EFTA 2P65A 1NVEA 1W73A 2JJYA 3SJUA 3Q8KA 1OH6A 2OB1A 1FSGA 1KZYC 5JWRA 1W6RA 4QUHA 3SPXA 2DQSA 2IZOA 4DSNA 2KMLA 5HIAA 2PK3A 4QU0A 3KHUA 2I2DA 1GYPA 3BK7A 5DM60 3D59A 1O6CA 5EMJA 3EQ8A 5CBPB 4HN9A 4PS0A 3KSMA 1CRLA 4YJ2F 3NKFA 3W78A 3OCWA 3EMVA 1KYIA 3D4NA 5EJIA 4DA0A 1JKXA 1P8AA 1KJZA 3K35A 1H2RS 1TYBE 1TQHA 1QB7A 2H85A 1V3VA 2BPOA 3F7NA 4INAA 1POXA 2DPHA 2HRZA 4UCXA 2BMAA 4N18A 4F04A 3R20A 1Z5OA 2Q4EA 1AKMA 1SH7A 3PUIA 2GPSA 1E3WB 1F38A 4UD2A 4ARAA 1M2WA 3DMDA 3IVGA 4PC3A 2E21A 3AR8A 3HZRA 1ES9A 4UHHA 5JCJD 2B34A 4CKZA 3V8QA 4QAQA 3O74A 3NP9A 4Q19A 3IV7A 1XUOA 3SBDA 2J4FA 2E6KA 4DGQA 4MVWA 2YWDA 1ZH6A 2FR8C 4MYTA 1E94E 2FWAA 2QUIA 4B3BA 4PANA 4EJFA 3ETJA 3ND9A 2HV8A 3UEOA 4BQFA 3ZCSA 1KEVA 3BIJA 4FHZA 1FP7A 1OILA 3NM6B 1URPA 4HATA 4C0LA 4XCXA 3GLGE 5J43A 2IW1A 3K16A 3T3GA 3MYYA 4IQ0A 2BUCA 3TSZA 1YDFA 3B3GA 4F4FA 2CHFA 4Z1OA 1LX7A 4A6DA 4X6XA 2EGUA 1QVZA 3KZNA 4Q4JB 1KJWA 2P1RA 2Z57A 4P4UA 5FHQA 1QHEA 3DYVA 3KUDA 2CDCA 2R8OA 2R5WA 2G4CA 1KOJA 3OCUA 3PC4A 4IUCS 5CUQA 2XKJE 5FI5A 3UMSA 4YX9A 1FQWA 2P4QA 3WLRA 3O3NB 4HAXA 2NADA 2GGSA 2B7LA 3KD2A 2VBIA 3KR1A 3MINB 4LQ4A 2BJHA 4LNUA 5AH0A 3FCXA 2GTHA 1JX6A 3NYWA 2AZ4A 3C3JA 2QN6A 1SUIA 3OD1A 2ZUBA 1N2IA 3F8WA 3R3ZA 2NPIA 3X1WA 3HQ4O 2RHLA 3RB8A 3I5YA 1LGYA 2FRDA 5IM5A 2G88A 4PPYA 5DEIA 1XTRA 4CMGA 3EGWA 4RL4A 2CV0A 5BWOA 1C7EA 5T6BA 3NOVA 5BN4A 3BK2A 4MVXA 5GP1A 3D7LA 1L6IA 3A58B 1Q44A 4FDVA 4G8DA 2F3RA 3SQLA 1IN5A 2BM8A 1QFYA 1BNCA 1V5IA 1S01A 1CNEA 2YWCA 3CUEF 1Z2DA 3EG5A 3ELBA 3JQ6A 2EHJA 5EL0A 3TB4A 3N0WA 4EK9A 2ORIA 1VE3A 5JD5A 2GCOB 3NTRA 1KC1A 3TLYA 3QF7A 4CLEA 3PC8A 4QNRA 2H52A 3K0EA 3LDFA 1U1FA 5CDUA 1KDOA 2PV0A 1SQ6A 3A6FA 1O1YA 1IXZA 1HYQA 1AH2A 4LK2A 5ULLA 4FMCF 1QMPA 1NDQA 1ZSVA 2A5YB 1PNTA 3RAJA 2IHKA 1AQIA 4LJRA 1USWA 1CTQA 3OZIA 3HK2A 4IVRA 2HHHB 1Y3BE 1RCFA 5KOJB 3T3NA 1NZJA 3UXHA 3DTYA 3ZHCA 1X87A 1BJKA 2QMYA 4DG8A 4PYRA 4Z8XA 4OX9B 4N8DA 4C4ZA 3N2KB 4PYLA 4PV7A 2B0CA 3RSOA 1HTWA 3K6SA 2JKYA 3QEBZ 2NIPA 3GD7A 4Q4JA 3ZWDA 5JAOA 3D7NA 1GPH1 1PJCA 1FJGB 3KQYA 3CKYA 4C7OA 3DCNA 5K01A 2FP4B 2K87A 5E8RA 1IQ0A 3P52A 1NJGA 4G81A 1NYQA 3IP6A 1PLKA 4YJFA 3ZLTA 3FDXA 3OBBA 3A7EA 2DLCX 1JHYA 3OX2A 1ACJA 4DA8A 1UINA 3IP7A 5LU9A 1FUYB 3HKDB 2XUAA 1QYDA 4DV1B 1PHRA 2KM1A 2PEZA 3DOUA 3ICCA 3H5TA 2V6BA 4R01A 4F93B 5HOQA 2PZLA 5LJLA 1KOLA 2ZTSA 1Q19A 1Q0ZA 3A2MA 3KLNA 3E1GA 4D99A 2XXAB 4JEHA 1OTYA 5C4MA 1RWWA 3DDCA 5HGJA 1L5GB 5B2EA 1TUGA 3UK0A 5B4TA 3KJNA 3OESA 1WUKS 3EHDA 4ZCRA 1E20A 5I5GA 4GQIA 5HMLA 3I9OA 3CZ4A 3KIPA 4CF4A 2YXBA 4I14A 4N82A 3NDPA 5CIWA 5EN4A 4NESA 4MR9A 4XQGA 1AKEA 1XVAA 2P7HA 3OF3A 4LVOA 5FPTA 1L3CA 5EIOA 3FSRA 2XXBA 4ZQEA 1WA5A 2AFIA 2JFYA 2BCGY 3MWDB 1OCEA 4LXYA 4Q05A 3AEYA 1L4FA 4TV8F 1Y1KE 3DTVA 3MJ4A 3EPLA 2DTXA 2I22A 3A3KA 1M76A 4URWR 1XMQB 4NK4A 6LDHA 1SBQA 4R9RA 1NG1A 3FLAA 4C2AA 4DRXA 1XDDA 3HCRA 4UEQA 1O0SA 5F4ZA 1VLVA 3MK31 3OJLA 4MP8A 4BLTA 5JAHA 4IJMA 2QL5A 3PDIA 4EUNA 1WTAA 2WWIA 3NQ41 4QTXA 4X7BA 2H63A 1ZOOA 2QDKA 3OFVA 3IOCA 1Y1SA 4L7VA 1V26A 3EIXA 3DFIA 1FDIA 2WU4A 1FFSA 3TX2A 1DIBA 3T1VA 4J1SA 2C7BA 3N2KA 2VYNA 2YZGA 1FXSA 2ONJA 5EJ4A 5JS8A 3K6SB 2UZ3A 3WNQA 1R0ZA 1MDFA 1Q0RA 4M2LA 1XTKA 3KOZA 3T7KA 1RZUA 3C3WA 4LCJA 4PSDA 3V42A 1XQVA 4LQCA 1ZA2A 2A1IA 5TC4A 3S2IA 2GFIA 1JKFA 2YR0A 5KTSA 5D6NA 3B1WA 4MQUA 1ML4A 3IBGA 4EY4A 3HKDA 3WBJA 1FVOA 1EA7A 2I4IA 2IYTA 2QVCA 2AWOA 3HCWA 1RKVA 3H16A 3NHJA 3OY7A 5DYYA 2CBGA 3WWCA 3T1TA 4PM4A 1JFTA 4I55F 1AKNA 3AM3A 3FM9A 3QFCA 3IO3A 3BVPA 4UVIA 3D4BA 5H0IA 4DSZA 3P0IA 3R8XA 1NW6A 1DJQA 1GILA 1QCCA 3VO9A 5C4IA 3PCRB 1AURA 3CISA 3PDWA 3WLEA 4DOMA 1ZS9A 1JQLB 2HF2A 3B5IA 1XK6A 3LF1A 1ZH0A 4QJIA 5C37A 1MJHA 4EI7A 3GP5A 4CNQA 1BDJA 2A94A 3IRVA 3KLMX 4PQYA 4Q7LA 4RSHA 1L1FA 3W05A 3OJEA 4BUJA 4ZCIA 1PJ4A 3GZNB 4XYMA 1XNGA 3RRMA 4C5CA 4UFNA 3HMQA 1TQ6A 3R3WA 2IYSA 3E53A 3ED1A 4MXDA 3MWDA 1N5LA 3PYLA 4IV8A 1IHYA 4XB1A 2DECA 3HJGA 4G0OA 2PVSA 1GR0A 3IUPA 2BELA 3GAFA 3NC0C 2W37A 5AYVA 4L73A 3P9PA 3MAJA 4HZUB 4AXBA 2W6NA 4PGHA 4PVDA 3ZDXB 3CF2A 2DFLA 1R4ZA 1NR5A 3STHA 3QOYA 5AHKA 3DE0X 3LWZA 4HAWA 1M75A 3DKPA 3KWMA 1U6JA 4WKGA 2GXQA 2YICA 3NRBA 4CFSA 4DG5A 1H0SA 2W42A 3DE3X 2FP3A 4QXAA 1I5OA 1Q20A 1Y6JA 2Q2WA 3N70A 5DISB 3CR7A 4YH1A 1N25A 1XD2B 1KJQA 4D8XA 1R0YA 1P4SA 2IZ5A 3L5OA 3JYPA 1KZ9A 10MHA 4H0CA 1QIKA 4MKFA 2PO5A 4F12A 1VZ3A 4TUYF 5FNVF 4IUYA 5HZKA 3C3PA 1JGTA 1P1KA 3LPAA 1CDDA 2IOYA 1V1MB 4NBTA 3WGUA 1PWZA 1GD1O 1TVEA 2JATA 2VRCA 2E55A 2Q9BA 1XTTA 1NUSA 2NO0A 2QN7A 3JZDA 1OPXA 1BGVA 3U1BA 1SBZA 2X0KA 4KBFA 2ZAYA 1I5EA 1A4RA 1A9QA 3O8NA 5LZ4A 4FWTA 3ABRB 3R3JA 4AKHA 4TL6A 2O4CA 4EA6A 3CKKA 4LDJA 1VIAA 1DV1A 1ZUIA 4OHUA 3T7EA 2BYTA 5F5LA 1GTVA 3E84A 1VIDA 1T1RA 2FE1A 2HK9A 3VQTA 2II6A 1D1SA 1OSNA 2C4NA 1W4LA 1H93A 1NURA 4OMFG 5T6MA 3WRWA 3ZE9A 5BNWA 1C3XA 3K4HA 1EFLA 1T4DA 3AZQA 2VNJA 4Q3CA 3GZNA 3AHHA 1OT3A 4YACA 1XXLA 1NF3A 3K9CA 1EIZA 2R62A 3B9QA 3VH2A 4IDHA 4BIIA 1AMUA 4MP3A 1BN7A 1SURA 3QITA 4O6VA 1W8IA 2GZ1A 3GROA 3C3YA 3EGCA 3WO1A 4HPJB 1JFVA 1O4VA 5K0JA 2P9JA 3GRUA 4N47A 5BWLA 2Q1UA 3U40A 2H5JA 2JLBA 4R8KA 3S7ZA 4ZI7F 2R6HA 1EFDN 4IIDA 3PXDA 3IMFA 1HDXA 3E7FA 1QGYA 1O94A 2JGLA 4V0MA 4C7VA 1PF7E 4PRKA 4C08A 4FS3A 1V8DA 5I7RA 4BAUA 2V4ZA 3IDAA 3JZIA 3REGA 5I4KA 4YMWA 3LBHA 5TPWA 4NS1A 3AC0A 1ZH4A 5F5NA 5FLYA 1KSHA 1Z25A 5J2TF 4BNUA 4NU0A 1P62B 1NWHA 1PFWA 3TUIC 4F4UA 1G7SA 3M81A 4WJZA 5A7HA 3RRYA 2IYWA 1HNNA 1V1MA 1MMFB 2CL5A 3BEOA 4N9WA 4V3BA 1Z07A 2IUUA 3EJ6A 3WWPA 5FUVA 4C0SA 4BVKA 4V1CA 2R1ZA 1QAOA 2Z43A 3NO4A 4KACA 1K6EA 3LHSA 4LYYA 4X20B 3IUYA 5G1NA 4AMVA 4W63A 1AHHA 3PVSA 1JKJB 4ZOEA 5BYBA 4X7PA 2JI6A 1WMDA 4JI5B 3DZFA 4NV0A 1XEFA 1RBQA 3LKDA 5AI6A 3LYUA 3W9UA 1L6RA 3OQ6A 3V1KA 4I55B 1SQSA 3E9YA 2WBLC 2HLNA 2P0AA 4JBLA 4LMPA 5COAA 4YECA 4Y9DA 1T2CA 4QC2A 3A4TA 5HK9A 1FTYA 4PLYA 3X2FA 1AZTA 5EQJB 5C7IO 5ERXA 1N0IA 3C3AA 3PEUA 3FNBA 3MGAA 2CVZA 1PFUA 2MR5A 2QTGA 1HY3A 1Q15A 4C0AC 1BKSB 5JSZA 2EC5A 4BMVA 5J9FA 3RPEA 4B32A 2HDOA 3BFKA 2IY9A 1TZCA 4G85A 3PEVA 5ER6A 1NXWA 3T99A 4DV0B 1HLDA 2B98A 3R5XA 4YPFA 5ITZA 3OPMA 3SEAA 4GKKB 3HB1A 2O05A 3CZMA 4IIXA 5C8YB 2VTKA 2FW6A 1SC4A 3K0FA 4WKPA 3I8OA 1NQOA 4Z99A 5EJ8A 5EYPB 1L8QA 1H4VB 2F1HA 1SEVA 4P38A 1HSZA 3RT7A 1V7CA 4ZVKA 3UAYA 3R8FA 2IS1A 2P6NA 1KI6A 5AOBA 1R5OA 2CK3A 5CLIA 3G2JA 3LOUA 1RQXA 1TB4A 3SF0A 3DFMA 3GY0A 4II3A 4D6PA 4MUKA 2B4TO 3HLYA 3L4BC 1QIMA 2A6PA 5DN9A 1H2AS 1K9SA 3K70B 4MLDA 2E1RA 2WM9B 3V00A 2B92A 3KZ1E 4WZAE 1L7OA 3D8TA 2EIHA 3X2SA 3ZV3A 4DR3B 4QG7A 4TUYB 1Z68A 1LJ8A 2D54A 1LBQA 5FNVB 1RYHA 4P32A 3VTKA 4LTNA 4MVJG 4OKNA 1AN0A 2XBUA 4MVCA 4TGLA 4V1CB 2FQ1A 4NNOA 1EVKA 2DXIA 3BWMA 2VP5A 4X20A 2PUFA 5JQWA 1E1MA 3OT1B 3W1VA 1N3YA 4DXDA 4UVHA 1DG3A 2CSXA 1MX9A 3H8VA 3T35A 3WK5A 5DT2A 1KPIA 2CFTA 5GM1A 3RUAA 4B09A 1IC6A 3LKZA 4X62B 1GARA 1GOTA 1K27A 2IY8A 3GUYA 3MBOA 4BMOB 4CDGA 4XB6B 5LSAA 2IL1A 1YVPA 1HI9A 5C9ZA 2XOKA 3OZTA 2C29D 4YONB 2XCSB 1SIOA 4I6GA 2J33A 3C1OA 5T4HA 5CM2Z 4HWOA 4MTLA 4A0QA 4N5MA 4ZRDA 4JLMA 2VTBB 1G8SA 1TECE 3G7NA 3RKSA 1I0ZA 2HLDD 5BY2A 1RBMA 2GEJA 3C3CA 4G07A 4GPEA 1IL0A 4N3GA 1TEXA 4K9DA 4ND5A 2BM0A 4WCFA 4X0EA 2YJNA 2G76A 4KDRA 3OETA 1U28C 5ALZA 4CI9A 5E1BA 4D80A 4FFWA 1NKTA 1KQGA 3GJ6A 3AKYA 5CEEA 5HMMA 3G8CA 3KJQA 3K0FB 3UQZA 3ECCA 2CFRA 3S4YA 3W5IA 1VCHA 1P2TA 3DB2A 3JCZA 3OIDA 4IKPA 4LJ5A 4N03A 1QIEA 3C4VA 5AK3A 1A69A 2D2IA 2YIVX 3HUUA 1H0RA 2QIOA 3IR5A 3O9ZA 4BAZA 1GPKA 1G3MA 2P5UA 1U0RA 3MWFA 4IOMA 1GY8A 3VOTA 2F3UA 3B60A 1FX0A 2CJPA 2OFXA 3CBGA 4KO1S 4G9EA 2BZGA 5TPZA 1V8PA 3SZRA 4GYYA 5A0VA 1KNXA 4MIKA 3FYTA 2DMRA 1CF9A 5B7NA 2G5CA 1K7SN 1QE3A 4TPKA 4Z4HA 5FFMA 5I48A 2FFHA 3D4LA 4LHWA 3VNSA 2G71A 2X40A 1QFXA 2P1ZA 1Q0TA 5IVPA 2HSEA 3UBTA 1SC1A 1KWKA 2A5FA 2O57A 2X86A 5A3VA 1D4FA 5D5HA 3LWNA 3QUQA 4PPFA 4RTQA 3UATA 1AUXA 3LUJA 3Q1KA 4ND4A 4OXKA 3G79A 4FONA 3OT1A 1LZKA 4KO4S 4FEAA 3HGTA 5F9HA 1UPTA 3QFFA 4JGIA 3T1HB 4QQFA 1OJLA 3OMLA 4QVIA 1BU8A 4G2NA 5FIUA 3T5CA 1U80A 4S3MA 3GLHE 3TLBA 1ODSA 2SNIE 3EOAI 4WXHA 3ZWOA 3ER6A 2W0SA 5IN4A 1XCBA 3INTA 4X61A 5BSMA 4Y6GB 3AY6A 1J90A 2QR3A 1WZ2A 5AQEA 3D8SA 4F5YA 4QEZA 4AWBA 3RC9A 2EEPA 2OQIA 3TGLA 1JIVA 4L8YA 2VYVD 4K40A 5B3JC 1X1EA 2IPMA 3HB7A 4G5RA 2AVNA 3HCNA 5DBGA 5DMXA 3HJFA 1OXMA 1D7OA 4WCFB 2R2GA 4AX4A 1OROA 4AZ3A 1P5HA 5NULA 1K06A 1CEYA 2IIQA 2GEKA 3MCTA 4LCEA 4GLLA 2DQKA 4X95A 3UWDA 2O6LA 1YTUA 4TYQA 4WNCA 5AW0A 2IK8A 1B93A 3ZIDA 4DCJA 2P3QA 2LDBA 1J2EA 5H9WA 4Q1DA 3L0SA 1APBA 1Z4NA 3E82A 5B37A 3FF1A 2PL9A 1T5OA 5LUBA 2RHBA 4RZUA 2EGHA 5EE5B 3TZ6A 2JLAA 4YUXA 5D1NA 3KRTA 3QEKA 4YQFA 1RKQA 3IP9A 3IP5A 1NHGA 3EY9A 1XTVA 2Q8NA 4YT5A 3H5OA 4ATNA 4D9BA 4M21A 4D0RA 5CA1B 4DV6B 4KREA 2ZUDA 3EVAA 3N6XA 3PRYA 5CD1A 1A27A 1DBVO 2ZYIA 3IKMB 5KU7A 1L8AA 1T13A 3JZAA 3X2EA 1EFCA 5ICCA 1RJDA 1UBHS 2GEUA 2PZGA 2VSNA 1ZWKA 2IZ6A 1R0XA 1WDMA 1YUNA 1D1QA 3EPPA 4KQMA 4FDTA 4MW0A 4PQEA 2JC3A 1DZIA 1KMIY 2HMAA 2JH8A 4MVJD 1ZDMA 1JXQA 2J59A 1SUDA 2JKVA 4R1MA 4NJOA 4D26A 3FWKA 3QBTA 1RWNA 1TW2A 2EV9A 2ZSKA 3VZQA 2VXYA 1CQWA 5KWIA 1U99A 3O1IC 3FCYA 2ZTHA 4CIYA 4Q1VA 3ZLVA 4NAVA 2OHIA 1UZAA 4UOQA 4AKSA 1YU9A 5B57C 1IQPA 3H17A 3OWHA 2GWHA 3BWYA 1E6KA 5H3HA 4CBVA 2QKYA 4G2TA 3Q2KA 3IS3A 4WLUA 4TMWA 2BONA 1H4QA 3GEPA 4E2FA 4QREA 1D1TA 4FEGA 1GV1A 2O23A 5EIBC 2Q3EA 1ADFA 1A1SA 1LF0A 3RS8A 4I3HA 4CM4A 3GLIB 2R6AA 3MWEA 1P6XA 2BZSA 5TQ2A 3C3BA 1E89A 1WABA 4KQFA 4MMXB 2Z5VA 2A0KA 3GDGA 1VP3A 3KQWA 1I2ZA 2ILTA 5JQGF 4MW5A 1RPTA 1BA3A 2ZUVA 1ZCZA 2WF6A 2VCYA 4IO0A 2EOAA 1ENOA 1NI4A 2RGNC 3A3OA 3G3EA 3PKJA 4ZT2A 2BFFA 3A05A 1RRPA 4YCAA 1UC8A 3OSZA 5KVVA 1TYEB 1R27A 4KIUA 5FH9A 2XUOA 4MV5A 1IVYA 5CT4A 4QO8A 3BF8A 4NJMB 1ZKDA 4HGOA 2B3TA 1V3QE 1XZMA 2CMKA 3RLFA 1J0CA 3UH1A 2AE1A 3CRRA 1IBKB 4P54A 1LDEA 3IAM1 4N39A 3NIWA 4WFJA 1ZK2A 1KEZA 2ECKA 1G8KA 2EWWA 1RCUA 1UC9A 3DJYA 2ZATA 4KXXA 3ST7A 3U7IA 3VAZA 4F6RB 2QRUA 3NZEA 3U16A 5IG2A 1GGEA 4WCDA 4LOIA 4MMZB 4ZT6A 1NBOA 4JKYA 2X6RA 1OT5A 3GH3A 1D0IA 2DSTA 2OM2A 4HRVA 4MUAA 1D1PA 5FBKA 4BRZA 5ALVA 1DKPA 1FS6A 2Y99A 4PHTA 5JPIA 2LZ0A 1NWCA 4MV0A 1DLIA 5KSZA 5DHPA 1TD1A 2ZWVA 3IQEA 3DA8A 1IYZA 2PAFA 3B5EA 3MCUA 2QQFA 4KPFC 2JK1A 3MBIA 4LJSA 2DB3A 4LRSB 3FVTA 1JTEA 1IXKA 2DGDA 3WIDA 4D97A 3BB4A 1RPJA 4N7JA 4U00A 1R3DA 2IZ1A 1Z4KA 4AJHA 2PBLA 2NNLD 3EH1A 1ZBDA 3QV1A 4W5TA 2MIIA 2PXXA 2B5VA 3OJFA 4PNZA 2B99A 3LUBA 4PHCA 4YCJA 3U3DA 3OE7D 4KE7A 4NPCA 1Z3CA 2JCVA 3MOGA 4TTAA 4Z3KA 3OFNA 3PF9A 2VZLA 5K45A 1PR4A 1OAKA 2ERYA 2XBLA 4JA0A 4JNKA 1E0JA 1ZOLA 4O5AA 4CM4B 3GLIA 5CH8A 1H0HA 2ECQA 1L7DA 3EQ9A 3HBAA 3NC4A 5TQ2B 3ZEIA 1YZLA 2XGSA 3FW1A 3QKRA 2WDZA 4PLVA 1U9YA 1XRQA 3L43A 4RHUA 2O2SA 4BFWA 2XCOA 3DEIA 3CG0A 4HX2A 4TKMA 2Z1NA 1II9A 2RHRA 4UOZA 2ORWA 3L84A 5DLEA 2REBA 5FTKA 5H83A 2NXJA 2XCTB 1KYWA 1UBCA 1G6OA 3ILVA 2JPDA 3DAOA 5K0FA 1EDBA 3LBFA 5T67A 4BLRA 5HZMA 1A7JA 2JGMA 3H0EA 5AICA 3DOJA 5DI3A 2YX1A 4NJMA 5J2UF 1Z33A 3T15A 1NYRA 4YRCA 4K86A 1GFWA 4KRXA 3TSCA 2R5NA 3U4MA 4S2UA 1EJBA 3L6DA 4QUGA 4BUZA 4DNQA 2OEPA 2J5XA 2Y1OA 1LNQA 5FUMA 4YWHA 1EWRA 1LTHR 3T7AA 4DCSA 2F48A 5CM9C 3KYBA 3ZE7A 1EVQA 3DXYA 2I1VB 3H8SA 5LQMA 3CZQA 1W52X 3JV7A 1M5UA 2NQTA 3I01M 2CZCA 4NOJA 1MG5A 5DV9A 2IBSA 1IONA 2JG3A 4AQ7A 1Y48E 4A3SA 1UANA 2BKLA 1BYIA 2XGOA 1E2KA 1R37A 4FYKA 3ANSA 1NW9B 4KLRA 4RY0A 1BQ4A 1UBRS 1YBHA 3BX1A 4IWXA 2WT9A 5CFQA 5I45A 3U7FB 5CB4F 3WY9A 4TLAA 3N9IA 2WU1A 5K8JB 1W49A 2H7VA 1E66A 2AX4A 3DXZA 3LUGA 4WFKA 4CI0B 3U4QB 4ACBA 2AW5A 4U3JB 2CC2A 1C1HA 1PI3A 3DQQA 3JASA 4I9UA 1G8PA 2X6TA 3KQTA 1XX6A 1GRCA 2P68A 3NV9A 2PHZA 3W2IA 4RD4A 5DSTA 2WTMA 2MSEB 3KB8A 4R8SA 4BGDA 3Q8MA 4DR7B 2GSDA 2O0KA 5IRCD 3IBYA 3VHRA 1YXMA 4PW0A 1CIPA 1YJQA 4EG5A 3HUFA 3U19A 4OCZA 2H1HA 4XGQA 3M6AA 4NH0A 4H27A 1YR8A 2D1QA 2ZR0A 2OT3B 4KX5A 4CEHA 1PSDA 2YZNA 4FKZA 1UOPA 4RIHA 1IN8A 1ZI9A 2WPNA 3M8KA 4WBXC 1JA0A 5H8WA 1X7HA 3IR7A 3UJCA 4LF7B 4PGMA 3HJAA 1IVSA 1Z28A 3IC5A 2FEXA 1OU0A 1QJCA 3GVPA 1T0JB 5DI3B 3TTUA 3BE5A 1T3ZA 1VI6A 1XKTA 2VDKB 4KSCA 1DQYA 1F5SA 2Q6VA 2K2WA 2DY0A 4KXVA 4EF6A 2JKZA 5A3QA 4BGIA 2Q41A 4ZOCA 4BUCA 4BBJA 3LLVA 2C4HA 4DC1A 5E2BA 1UZNA 4EPRA 1R0KA 2ICAA 5EEGA 3ZWPA 3DZCA 3TOVA 2QYTA 4EHKA 1XZGA 1PUJA 4OXXA 1ENPA 1BFDA 1PL6A 1V43A 2VK8A 3IBSA 1V6SA 4IHKA 1RABA 3OIUA 5EKSA 5DIZA 1G6Q1 1KYTA 1INLA 4JU9A 3TVYA 2WM8A 1CE8B 2Z56A 3IEUA 4IFEA 1F7UA 5KPJA 1U02A 4TTJA 4DR2B 3GRAA 2XB2A 3RIEA 3GEEA 2HA2A 1PDWA 3C5CA 3NBFA 4K26A 1RTTA 1RWQA 1V5WA 3L49A 1DT5A 3DEZA 3SF8A 2JLVA 2V0CA 4NYMR 3TW0A 3CY6A 4AYTA 2VT7A 1OGJA 5DU2A 2OHVA 1O57A 3U4QA 1WQ1R 3LUHA 3OF5A 3GFOA 2C57A 3P20A 1IZ7A 4HXEB 5REQA 1JDVA 1ZCFA 2PZAA 3Q5GA 4JBYA 3FHJA 1U8TA 3PC8C 2W70A 3AUSA 4E30A 1Y37A 2NZYA 5FTWA 4DUGA 4ZMSA 5LOVF 2NYVA 3DAHA 2CT8A 1RPZA 1ECJA 4POOA 4JODA 4IHJF 3NT5A 3P2KA 2EGGA 2HNBA 3QWBA 2MDTA 2AJCA 2XMRA 3I04A 3KHSA 5BR4A 4QOSA 1GZ7A 4Z2YA 4EYSA 1CUAA 4DCUA 2ZQ5A 4LN1A 4AY5A 3D2LA 4ARZA 3PPVA 2DUWA 4LJ9A 2JEZA 4Z0NA 3HJCA 2XVAA 4CCYA 1RHQA 2LTAA 3GFRA 4CEHB 5AJUA 4GOJA 1U1IA 4GICA 3N3BC 1N1DA 4WGFA 1X9HA 3AV3A 3HR4A 1HDYA 3N2IA 4ZANA 1UBEA 1XKQA 1SK9A 4MW2A 4GZ5A 3G6WA 3DGEC 4F4IA 3WMWA 4FOLA 1XC7A 4XCQA 3GBSA 5CG2A 1UXJA 1C29B 1EK6A 3L8EA 2ZQYA 4V1CI 2H4HA 3JQFA 3ZHQA 2JNWA 5DSXA 1HDCA 1KH2A 2J9ZB 1JR3E 4QQNA 1ZMXA 4ZTUB 4HFNA 1OI3A 3TS1A 2R0QC 4WH0A 3QENA 3NASA 1PVOA 2QRVB 2C2OA 4QDZA 5TSDA 2JJQA 2QUJA 2MR6A 2HWWA 2Z6VA 2J9XB 1QWSA 3URKA 3VR0A 4P84A 1Q83A 2LD4A 4Z9BA 2VP4A 5DWDA 4OLBA 3SYMA 5AW9A 3F1LA 2PUVA 4JK3A 1N3BA 1TAQA 2FF7A 2Y93A 1X7XB 5FBQB 2VLBA 2W6ZA 3W1EA 2VXCA 2QT0A 1RMYA 3LUPA 3R0VA 4XGNA 2Y0EA 1E60A 1JMYA 3G5TA 5AVYA 4WXRA 1C2YA 4PG5A 5DLQC 3ZU4A 3U6KA 3GUCA 2O2DA 4ILKA 3SF8B 3ZY3A 4K7JA 5DGCA 4QSMA 4CR6A 2BF7A 2G5PA 2RH8A 3SDSA 3G0BA 3JS5A 1PFGA 3JARB 4DV4B 1P0PA 3BCUA 1TMOA 3EVCA 3IBTA 3PFKA 3BFVA 4NE2A 4EVIA 3BDIA 4V0OA 3ZGOA 5AUNB 4DLVA 4YCLA 2G5GX 5AVTA 3PENA 2PSJA 1CY2A 1MJGA 3HTXA 5CRIA 1R66A 2YJGA 3ZGVA 2ZUFA 1YDMA 2WV7A 1KK0A 4O4JB 3LK7A 3Q7EA 3EBLA 4EY3A 4XVQA 1P6UA 2IXBA 3L8GA 3GP3A 2IOFK 4M76B 1O3YA 1ST2A 1TEVA 4ARZB 1JAHA 1Q7TA 1TE2A 2V7QA 3IT1A 4LXHA 4EY5A 1D2MA 2B4YA 2H65A 4FMCB 2HPHA 4Q37A 3VDRA 3RVQA 4ERNA 1GQRA 4LA4A 2OO5C 4ZAVA 4LF9B 3ABQB 4WZAA 1UP7A 4CL3A 4RIIA 1R6DA 3AXTA 3TTXA 4BTLA 2VYVA 4HNQA 4HQFA 1BYUA 1JLKA 3H9GA 3GMIA 4D7AA 4V0RA 2PZJA 4WGGA 4QELA 1FLAA 1KY4A 4GM1A 1T6ZA 5INTA 1FZQA 3NR2A 1UR5A 1XQ1A 2ZSIA 2BMWA 1XRRA 4G4IA 2PSEA 2W58A 3FDZA 4GXNA 3RK0A 2VRBA 3PUXA 4JWTA 4HFRA 4RWZA 4Q3DA 3L0PA 4Y67A 3UPTA 3RTAA 1XWFA 1FYDA 1BXZA 1VE1A 1VJDA 2XGMA 4W5RA 4K6MA 2MINA 2DKNA 4FLEA 3TKYA 1EUYA 1ODFA 1KI7A 1QIIA 1NVBA 3U0BA 1B16A 1Y4SA 2AD1A