3WE7A

Crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
b'FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Expression from engineered Escherichia coli chromosome and crystallographic study of archaeal N,N'-diacetylchitobiose deacetylase
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 3we7A00
4EWLA 3DFMA 1Q74A 2IXDA 3WL3A 4XM2A 1Q7TA 5B2EA 4XLZA 3WL4A 2XADA 3DFIA 5BMOA 4XM1A 3DFKA 1UANA 4XM0A 3WE7A 3DFFA 5CGZA 5B2FA 2X9LA
chains in the Genus database with same CATH superfamily
1QGUA 3AF4A 1Z7BA 3A2LA 2DP4E 4MVJA 4O1HA 4AB1A 2Q4BA 1QZZA 3KEGA 3P9YA 2YBDA 4Q4HB 5GAJA 1K68A 1NURA 4Q34A 4TWBA 1UBOS 3K5PA 5CD1A 1XD8A 3LWNA 4KVAA 4ND2A 2VZ8A 4U5QA 1T6XA 1IHDA 4I5FA 5FL7D 5JMPA 5I51A 1W52X 4A2WA 3KOYA 3K2IA 3RVOA 1LLUA 2PXAA 1ETHA 3P9KA 4MQ4A 5IUKC 4AY4A 4DLRA 1QG0A 3GLHE 2HRBA 5U4QA 3F5FA 3G2MA 1ZG3A 2LTAA 2UZ0A 2EX4A 3GLVA 1W25A 4CM8A 4RVCA 5LP6A 2ONZA 5D7NA 3TGLA 2BCJQ 1ZIXA 1VE5A 4YO8A 1TL7C 4TLBA 1T1EA 1NP3A 2JFQA 5J4HA 3C98A 2XMRA 1ZUNA 3IAUA 1C0PA 3PCRB 5CYOA 1VE1A 3ASVA 3COVA 3EDCA 1H22A 4JVOA 2DFTA 2XEDA 4IDQA 4HWRA 2J1LA 1GARA 1TIPA 4R1QA 1ISJA 3D3WA 4ONEA 1PGNA 4S0ZA 421PA 2MSEB 1ODIA 3V6MA 4KQ6A 4PF1A 3WRWA 1KR5A 3WOVA 2H9IA 5B7PA 1XDDA 1Z39A 1ZR4A 1Y3FE 3D54D 4DLAA 5BVGA 4FC7A 4KE8A 1P3JA 2J6CA 1M2VB 2B7BA 3KE8A 1EVQA 1SUPA 2P79A 1CW2B 2BZ0A 1DAIA 3IAHA 1DX6A 1GL6A 4ZQHA 3U0VA 3W4JA 1WUIS 4OL9A 4CCWA 4CQMA 2O20A 4JB0A 4NBRA 1GNTA 5BXYA 2AYXA 3PJRA 1VJGA 1TA9A 4G1FA 4HB2A 3GOHA 4O4IF 4G8JA 3KPVA 1W36B 1L4HA 3EAFA 4CL8A 3TQRA 2R86A 3VSDA 4UVEA 4WY5A 1J0AA 3GWZA 5BR4A 2Y0BA 4G3XA 5DXJA 4GPZA 3JATB 3A3YA 3EYAA 4LXGA 5KDDA 4RO0A 1LBQA 3WK8A 1M2WA 2YHIA 3BRWD 3JRWA 1D9XA 1UJBA 3AKDA 3AW9A 5E38A 3TM4A 3VSBA 4ZMRA 3BIJA 3K4QA 2WAYA 4JQCA 2FZ5A 5EIHA 1SVOA 3WTBA 1GCGA 4TV9F 3Q7PA 1XCBA 4J0KA 4W7HA 5KNLA 3P0IA 3PQEA 1CPYA 2WTAA 1JR2A 4D8TA 5CFZA 3ADPA 4YJHB 4BUJA 1RYYA 1N5MA 5JDCC 3V7NA 3R4CA 2CCKA 1ZD1A 1KDOA 3AKZA 2J6IA 1O94C 4QDUA 2C78A 4MP8A 2J9ZB 5IT0A 3HEAA 1PQUA 3AK4A 3ONFA 2C3UA 2UZAA 5F23A 1HYBA 4YDRA 4C4SA 2HA3A 2OAEA 3OT1B 2AYYA 3RAFC 2O8FB 4RA9B 5AJZA 4TMFA 1UIMA 3F3SA 1GR0A 2EF0A 1H6DA 1K3TA 3G5TA 3O94A 5H3HA 1DQYA 3VC7A 4R98A 2QVBA 1ESDA 4ARZA 1QIJA 2VT7A 3L02A 3TSZA 3L8FA 1HYGA 3MERA 3ZE6A 2F55A 4BBPA 4D9HA 5LQMA 2D2IA 1WDTA 3GH1A 1FSFA 3IIIA 4M8IA 4ZYTA 2FDCA 3Q8LA 2JCSA 1OFGA 3RWMB 5JBNA 4F45A 2FMIA 4N39A 3A1NA 3CKYA 4DUGD 3QPUA 2AJTA 2H65A 5K0LA 1BHO1 5L3RA 4BWFB 1ENOA 2F8LA 3NIDB 2PS9A 3EXEB 3NM5A 2GA8A 3SSMA 1AJEA 4LJ5A 3IRUA 1I4OA 3KSZO 3PD7A 1QZUA 3HUFA 4DV2B 2JGDA 3E9YA 1NNI1 2FW7A 4NVRA 3ZDXB 4ZGWA 5K3OA 1RRCA 1R88A 4WLUA 1WKCA 2A8YA 1ECJA 1A9ZA 4PAGA 4DCOA 1R50A 2D5LA 2QUHA 2BDUA 3H7IA 3L7YA 2GS9A 3GMSA 3OIVA 2XNHA 4RFSB 4A9AA 3UWMA 3LLMA 4IFBA 4TXHA 3UHAA 4MEBA 1E3WB 2WYWA 1ORDA 4L9RA 2UUAB 3HM9A 5E7JA 1NXPA 1JDBC 3D5TA 4QRHA 1M8JA 2BFBB 3MTIA 3D7NA 4LYJA 4KTVE 4UMFA 3LVFO 4WGGA 2PSEA 2O3TA 9MHTA 1L4EA 2P6UA 4YALA 4M38A 1IN5A 4YASA 1IZYA 1ZH6A 2JJ2D 3ELWA 5IFKA 4QJIA 1PSZA 2ZRPA 3DE2X 4YJDA 3I92A 5AK5A 4JT2A 1NMYA 2O8CA 4MRAA 2LCIA 2EARA 1TO6A 3O82A 5CVUA 3SHOA 4K9QA 4EZBA 5CJJA 5JANA 5AHWA 1CY7A 3I5UA 1A3CA 1CY6A 1T9ZA 1Z8DA 1TZBA 3D4NA 4K8RB 1J21A 4MHSA 3V1TC 4Q82A 1T1JA 5ITVA 4L22A 3T7IA 1EUCB 1JQEA 2QNIA 5CIYA 2OC4A 4J07A 1W36C 5A6VA 3HVJA 1DJMA 1XYVA 3UT5B 3SE0A 5C8YF 3PI6A 3SIWA 3U9SA 1WLYA 1Q92A 1JQ3A 1YJCA 2O52A 2YJTD 3KO8A 4XGIA 5BQOA 3E58A 5KI6A 5ITZA 3D6FA 3IQZA 2DR3A 4MDFA 4K0KB 3HK2A 2HYDA 1TC2A 1SUFA 1UZAA 3OC6A 4WK0B 4CKCB 2X0NA 2HHHB 2F8SA 4D0NA 4WBNF 2Q8QA 1TK9A 2JFUA 3VBEA 5FWXA 4ID9A 3F1LA 1YE5A 3DV0B 5GOTA 2DHEA 2NACA 2VPTA 1MJHA 2PE5A 1HEIA 1U5CA 1W35A 2SCUB 4FJ1A 2M1ZA 2W6MA 1YIOA 4UW9A 1IDOA 3IUJA 4GWKA 2M6SA 3OEED 4LF4B 1NZJA 5DHRA 2GK7A 3VX4A 2WZDA 1KDVA 2FLVA 4AXXA 2YZMA 5GM2A 2JAPA 1DQPA 5JH7F 2RJOA 3LTNC 1KZGB 3ZCRA 1XVUA 2HK7A 3F2VA 3EVAA 3NVMB 2QGZA 3OHPA 4LQCA 1K7XB 4JLMA 5H59A 4KX3A 3HCPA 4YJ2F 4I3HA 5LDHA 4JI7B 1FF9A 5TF0A 2AV6A 4TQ9A 4LF7B 4O2BA 5JC1A 1STOA 2PMKA 4REQB 5KINB 4O4HB 3QVGA 1K6MA 2GESA 2H8KA 4P6VF 1JYEA 3VR5D 4HAUA 5DI9A 5AD1A 1N2EA 4UPVA 1QVWA 4A3SA 3QX8A 2QN1A 1CJMA 1T9DA 2QM8A 2FR0A 2X0IA 3N74A 4F0JA 2RGAA 2VDWA 4JIMA 4LFCB 4OMDA 4QM6A 4YRCA 4ZJUA 2CLDX 1FLDA 5LMUB 3AVUA 1Q7TA 4JC5A 3H5VA 3U7GA 3A6KA 5K03A 1Z6YA 1SVIA 2ID8A 2ISCA 3A28A 4TRNA 5EMHA 3F67A 3TZHA 4BX8A 2Q2OA 5CB8A 2XECA 1ZN8A 1WKBA 2P6OA 1N8TA 1ZC3A 4X3CA 1F12A 1TVKB 2NUPB 3RVRA 4LGMA 1J1UA 1ZD3A 3V7WA 4QE3A 4UBOA 4WLVA 3UAWA 3RYTC 2G28A 4KR7A 2E9SA 1NMSA 1NC3A 5AKGA 5LXTA 2Q2WA 4XB2A 2IHZA 2QL7A 4ITVA 1M2HA 3FFXA 3RNLA 2OV1A 2VQ3A 3QEJA 3VISA 3KCNA 3OJOA 5DX0A 3KXLA 4MCIA 1QTIA 2WNHA 4RVGA 1G98A 3T9BA 1JILA 3W8EA 3CLRC 4AMBA 1SHJA 4WSOA 4LX8A 1Z2OX 1ADGA 3ILYA 5DBHX 5C4MA 3MJTA 3S40A 3P5SA 4A92A 4RIIA 4ZYXA 4KLZA 1GUDA 2X1MA 4L3OA 2ID7A 3VJLA 4DLLA 3BGSA 2VHEA 2WJAA 2NZXA 3JQFC 5CVVA 3FZEA 4ZA2A 3G2PA 3BJEA 3ZY3A 4OAPA 3BK1A 2QIPA 4EW3A 1MOSA 2C2MA 3ABSB 2ZRFA 3EGXA 3K09A 4XR4A 5B37A 4QDKA 1XTJA 3T7SA 4GMHA 4JEHA 1QZXA 5CDFE 1XRNA 1O0CA 1Y98A 2P2SA 3U1BA 2GT1A 2W2OA 5JSQA 4KN9S 4G24A 3L7JA 3NPMA 1ZA2A 3E84A 4KR2A 1MT3A 4KVGA 2ZRNA 1VIYA 3MA0A 4OM8A 5FOUA 3ZUPA 4CEJA 1C0KA 2ADMA 3F5DA 3Q6IA 1E0AA 5AHOA 3S2IA 4C6TB 1EUYA 3QEOA 3FPCA 1G17A 3QIVA 1BSVA 1LLQA 3AHGA 4HZGA 1KI6A 1XXHE 4EY3A 1YUMA 2XTMA 2OM2A 2X1HA 1HE4A 3BXOA 4RENA 2C5GA 4V38A 5I8ZA 3FMOB 2XUIA 1V1MB 4N5DA 4Z4EA 1TA4A 1XRJA 1MXHA 4AMUA 2ZUSA 1MABB 2VKTA 2CXXA 3A0UA 4MRVA 4E5YA 2E0IA 4KQ9A 5AI6A 1GRVA 2J3DA 1E2JA 1L4KA 3Q2KA 3LO5A 3RBZA 4RTKA 4GMXA 3PWZA 5J2UF 4FINA 3D4OA 1MJGA 4MR7A 3EVFA 5AOAA 4UHBA 2BTEA 1JKJB 3UENA 2VYND 1B16A 5ALOA 1GQYA 4NAVA 2IUTA 4XFDA 3DDZX 4R3NA 2REBA 3JQ9C 3P9SA 1IULA 1YAJA 4IIYA 5BNTA 3MGKA 4JFAA 1I7LA 1UMDA 4GBGA 2BVNA 5JMWA 1SZDA 1LB1B 2G25A 3WFZA 1YR6A 4BNDA 1C0LA 2J85A 2P67A 4UCWA 1FVXA 3NIWA 5COAA 1Z5WA 3BGDA 5IDYA 3VZBA 3VHQA 1TI7A 2XBLA 3LP5A 3W04A 3WG9A 1GAWA 1KO1A 4B7XA 2GB4A 2GRAA 3DZCA 3H1AA 3NPAA 3MB8A 4HZIA 4DJTA 4NQZA 1SQSA 4R1OA 4XGQA 3PTAA 3M1YA 4EZEA 1JMYA 1PJ2A 1T0IA 2R8OA 3EAGA 3SD7A 4HMQA 3TO5A 2X2PA 3EF0A 5JAZA 4MQBA 3DEYX 4MCJA 4EELA 4EI8A 1XMVA 5K8JB 2C3OA 3TLXA 3IUPA 4Q21A 2GN4A 2AVNA 3QXJA 3R0ZA 3L46A 3HDTA 4W6QA 4D9CA 1GGJA 3CONA 1N2XA 1YB7A 4NAHA 3WIDA 1E20A 2VDKB 2XR1A 4AFNA 1NVMB 3U6KA 2G9ZA 3EFBA 2WTUA 2EEPA 2OK7A 2C4VA 3P0EA 5EINA 3RE1A 4AECA 1YDMA 1J49A 5DJ5A 2HMAA 2WYHA 1ZW1A 3TH5A 1B0UA 4IGEA 4J3FA 4Y67A 3NV9A 4AS1A 4HQ6A 1AB5A 2YINC 4O0LA 1S2NA 2ZIGA 4Q4JA 1UEJA 2BISA 2B6NA 2E55A 3R41A 5ALGA 3H18A 3V8EA 5AP9A 1ST2A 1RHJA 2FA9A 3QEAZ 1ELOA 1SXJC 2B20A 1R0LA 2HPHA 2PCLA 2R7KA 2QV0A 3G79A 5I5GA 3T7KA 3KTOA 5KNBA 5AOVA 1SC4A 1B8OA 1CR6A 1S01A 2H08A 3MXOA 1ESMA 3TDKA 3X1ZA 2ORYA 2AD5A 2DLCX 3D6AA 4MKIA 4GR9A 4HLQB 3ZY5A 4DF3A 5K8TA 1XZJA 1HOTA 1ZH4A 4P8RA 3USES 2Q1SA 3WA7A 1EP2B 1PV4A 3LF1A 1WCIA 2QPLA 3F1KA 3ZYCA 1HDZA 3L49A 4K05A 5J59A 2AHRA 3SJ7A 2QTTA 1DIGA 3SM9A 1PUJA 4A8JA 2PUWA 1XMIA 1NNEA 3NOQA 2VS1A 4B40A 3JYHA 4ZT2A 1QH0A 2AN4A 2QYTA 4D9GA 3ORHA 1QS0A 4WOKA 1CRPA 1RC8A 1T5DX 3A7DA 4H15A 4N0DA 1T3GA 2D1SA 2C2WA 5BSUA 3UC5A 1GCAA 3BMCA 1KEKA 2YFKA 1NU6A 3DLCA 3U49A 1KMHA 4B09A 3P9CA 5H0IA 3ODGA 1H69A 4QDJA 2YHIB 3RUFA 3TTSA 3PEUA 3WE7A 2DUJA 3CW8X 5T4HA 7GPBA 1UC5B 1RI5A 2OL4A 4DQKA 4ETMA 2EXXA 4UTRA 2VSNA 4IZ6A 1FUEA 1Z12A 4HVAA 4FFLA 4PC2A 5HIJA 4UTVA 3Q15C 3A1VA 1GUZA 1KQFA 4AQYB 5KTTA 1Z3IX 2DH6A 2EGUA 3AUTA 5IZCC 2E4YA 4E0BA 1ND6A 2QTFA 3BK2A 3IXQA 3QKIA 4K9LA 1TZJA 3HPQA 4N3GA 1X9GA 4YP0A 1R12A 2VDMB 4WOJA 2PYIA 4OBEA 1DC4A 1XVLA 4KYIB 3EMBA 8ABPA 5TV2A 3RVJA 1SVNA 2EWVA 1TQ6A 4QU8A 3T06B 3ZZMA 4BNMA 1IN8A 2HIMA 1RTTA 2X7XA 1Y9ZA 1W4BA 3AFGA 3PNMA 3DTNA 4WK4B 3K9HA 1E58A 4OU5A 4QU0A 2JKZA 1CQZA 1KPIA 2OLKA 2XVZA 3L1HA 3IILA 3WBKA 4GL2A 1THMA 4TRRA 1Y5NA 2IOYA 3DT8A 5D3QA 3R8FA 2FU5C 2XRFA 2FXVA 1IOZA 2D74A 1HGXA 2IH4A 4RE6A 1QP4A 1QRDA 5AT1A 2WOJA 1U3TA 3KPWA 1M6NA 4LW8A 3QYJA 1L5SA 4KSCA 4X3OA 3DCJA 5HKKD 2CEKA 2JGDB 1NI4A 3QFTA 1LJ8A 4ITUA 4RXMA 3MC1A 3V6LA 2LZ0A 3MAAC 3IJRA 2F2TA 2Y05A 2CCGA 3TW8A 2D13A 2C59A 1ZZGA 3KAKA 2NU7A 4L73A 4DSAA 2VK1A 2XGGA 4MMYB 1PR3A 2F1HA 2VUUA 4BVFA 1LLDA 4R2HA 1G21E 4X1IB 3AEQA 4OHCA 2VBGA 3NATA 3QLUA 4D6XA 4CKEB 3IE2A 1CYEA 3BWYA 3VZDA 3GMTA 4MYTA 3DCIA 2WIDA 1HTTA 3NS7A 5HW0A 4TKLA 1E62A 3WB1A 4BY9E 3VYWA 1B76A 3CH5A 1WXXA 3WIEA 3CR7A 5B3LA 2G0NA 2GUGA 3P20A 1IWPB 4IPTA 5KPDA 3O93A 2AOWA 3FVVA 1Y3AA 3E0XA 3KZVA 4F1WA 1RC0A 5D6NA 5MN4A 4DY4A 3IUNA 3GUVA 4N0QA 2ZVQX 1VE6A 4XI9A 2RIRA 4YQFA 2QLNA 1HDXA 4DIBA 3ZBQA 1NXQA 2WIFA 2X3YA 3AESA 2GHQA 3SHQA 2ZB2A 3OMLA 4RHXA 3WNQA 1RW4A 1AXRA 1FPMA 2G71A 1Z33A 4B7ZA 2FEMA 1P2DA 5BPHA 1I94B 1D4OA 1P2BA 3EWAA 4KE6A 2AK2A 1PV2A 2QAGC 1QFMA 2V7QA 2ZI6A 3LCMA 3N59A 4ETWA 5JQWA 1E2GA 4WZBB 2X58A 4LRWA 3RLFA 1CQIA 1GOTA 4EJMA 1AN0A 1OAOA 2CNDA 2N47A 5ERGB 2VQDA 1YJQA 1QLJA 1G41A 1U7TA 2D62A 5F73A 3RRZA 5F1PA 2W2PA 3T3HA 3W3AA 4BMVA 3JVUA 2YJ6A 1FTNA 3KU4A 1CLEA 1L6IA 1R6XA 4MX8A 5JXJA 4C01A 2GD2A 4MQFB 1WMFA 4CCYA 3BIFA 3LPMA 4Z7OB 4ALLA 2VSXA 1B00A 1VJ1A 3M6XA 4I55A 2G0TA 4OSPA 5HG0A 4D81A 4EA9A 4C5BA 3D8TA 5FUWA 4PCUA 4JR0A 1WKVA 3QGMA 2IZZA 3KD3A 3RSGA 1UIRA 2FJPA 3WGQA 3QVGB 3AF6A 4XQEA 2YVUA 1WUHS 3ONNA 1C30B 4LYDA 2HQSA 4TTIA 3OQOA 3IR7A 4MI6A 3PEWA 1REQB 5ALIA 1JHRA 3GAZA 2B1JA 2XUGA 3B5IA 4RV9A 4BNYA 5KX5F 2CV1A 1H1DA 3BXEA 3VHRA 5TQ2A 4UVHA 1I4LD 2I78A 2QMQA 4GI2A 2DPMA 4MPTA 2VKQA 1QRRA 1T6ZA 5LQJA 5IM4A 3V1UA 1JJBA 4JNCA 5CH3A 1J4AA 1GKIA 3DBLA 3UJ3X 4RNCA 1AA6A 7AT1A 2A7QA 3OKCA 2AC7A 5FTNA 4JL8A 1EEXB 3CFYA 1JAZA 3W5IA 1GSHA 2WD7B 4ZJYA 2GFQA 1AMUA 1G8MA 1Y3BE 2RB5A 3PXDA 3L82B 3GZ4A 4GVPA 4MV3A 4R16A 4BYGA 1EDDA 1ZHOA 2IOFA 1JXOA 5JW6A 4PFQA 3RAEC 3Q5GA 1T5HX 1XRMA 2VDPB 1JBKA 5E1OA 1DO2A 5JO0A 2PUJA 1UXHA 5G4KB 4P84A 1EBBA 2R3SA 4E6EA 1DADA 4IUYA 1YZ3A 3W9SA 1E9RA 2Q28A 2WVAA 5IBRA 3WC4A 2DCMA 2ARKA 2IEZA 1ISGA 1X3SA 2O8DB 1UBNA 2WG2A 1CS4C 1YUNA 2GEBA 3V00A 5CA0A 2Q6VA 4H18A 3V8QA 2H85A 2ZITA 1O08A 2HZBA 3EGXB 4MWSA 1ST3A 3JAKB 1AGPA 4QBTA 4ZT7A 5CEEA 4D82A 1GPDG 4CDRA 4PLGA 1DB3A 4E2WA 2J9YB 3LQFA 2DRIA 1WY7A 2AEFA 3L84A 3DHWC 1PW5A 2NVUA 2YFYA 1W4RA 1DMSA 2FZ4A 3PR2B 2IYZA 2G1JA 4IFTA 2NZ8A 4LN1A 1VKZA 4QBFA 2B1GA 3RC1A 1TGYA 3TZQA 1KAMA 3WHLA 4E09A 1CQXA 2JFFA 4KITB 2NSYA 3L8DA 3UQZA 2R85A 4MROA 4PTZA 1JFLA 2K7FA 1JAXA 2BHSA 2D5IA 3BIOA 3DVLA 4ENUA 1JI3A 2ST1A 2FFQA 2JKYA 5GJCA 3DZJA 3LBFA 1YFKA 3K0BA 3UA3A 1Z7YA 3K3PA 1VYHA 5E95A 2IIBA 2O1WA 3WWPA 2GHIA 3DM5A 3ET4A 1PRYA 1P33A 2OZKA 3IEXA 4W7IA 1E1CB 3KPUA 4Z0PA 2V5AA 2ZREA 4PYNA 5FUMA 3K92A 1WDKA 3IP6A 1XROA 3B85A 4P4TA 5JSUA 5K8CA 1CB7A 3AERB 3WRXC 2WSSD 3NBMA 4G5SA 4BMOB 3AYZB 4R9VA 3T34A 3LPNA 1JEYA 1ZXXA 4XSVA 1RI4A 3O9MA 4MVJF 5GZ3A 1W46A 1UK6A 4MHTA 1HUQA 2PFSA 1DJLA 2NQTA 3AFHA 4GI1A 4PYKA 5TQVA 4Z3KA 5J4LA 2I54A 4F6RA 4OQLA 1IZ9A 2UV8A 1LK7A 2UZ1B 2QL9A 4R3WA 3SF0A 4RANA 4YB8A 2BM9A 4RVHA 1ONNA 4M21A 2WZBA 1WW3A 4UBLA 5SICE 1WG8A 4FYHA 1NX6A 2IYLD 1YR7A 5AK4A 2X5KO 3ZWOA 2PUDA 3BD7A 3U7QA 4Q1BA 4LYEA 2CNNA 5BN5B 3HN2A 1KHTA 4OJNA 1F20A 1I2ZA 2GPJA 1QFXA 1YQTA 3ND8A 5SY6A 3QI2A 5FI1B 3G59A 4L6CA 3J81A 1WPRA 5JYBA 2BDTA 3WOHA 2IZ0A 3LK6A 1HQKA 5LP6F 4R0VA 3GJ8A 2P3OA 3PDWA 1UJMA 3IERA 1I6LA 3P0JA 3ZWAA 4ERNA 4NICA 1N2HA 3B12A 1QRTA 1HXHA 2Q3EA 2GN0A 2V55B 1SHLA 3R0QA 4PPYA 4EJSA 3HB1A 1RAAA 1X1TA 3D8NA 3NI2A 3W77A 1HDRA 1LH0A 1TU0A 4D2IA 1S2OA 4JD5A 2CDBA 2IPMA 3U2QA 4HN9A 2R68A 2CHGA 4AKEA 3U4CA 2OECA 3BFJA 1HZJA 3E3AA 4FQ7A 3EIEA 3R9WA 3CKLA 2WJ3A 4JU8A 4NBNA 1DHRA 1SOWA 1AN9A 1C3VA 4J1TA 5C3MA 4R1MA 1OIVA 1PBTA 5TQ0A 2J31A 3PUIA 1RC1A 3G0GA 4HWGA 2WAMA 3NBZC 4QUKA 5DBOA 1PCXA 3I53A 2HHLA 1PEAA 1XTSA 1IY9A 1J70A 2AN9A 2OGWA 3T5DA 3T7AA 2V7UA 4BAUA 2VAVA 3UJNA 2WC1A 1LBTA 4PSAA 1ULAA 4CUKA 4DRXA 1Z4OA 3I09A 3GLUA 1XQWA 2J32A 3RU7A 4ZOQI 2BH2A 2FPRA 4XLTA 1TX4B 1I8TA 1Y8CA 1ZH2A 2DHCA 2J7KA 4MWOA 3U56A 3SS7X 1G5FA 3X3HA 1INLA 4G67A 4Q4JB 2BOVA 3WLOA 2SKDA 4AJ2A 4TL6A 3PHGA 1GPH1 3WDLA 1E7QA 1KVQA 3H6KA 2VNAA 2Z95A 4UBIA 4MI1A 4W1SA 5BWCA 2EFHB 3KR1A 3BHJA 2ZAMA 1V8ZA 3A1FA 4Q9HA 1MENA 5CLLA 2GKGA 3MLAA 5WRFA 4QHYA 4DCVA 2A14A 3FPBA 5F98A 1P6QA 5JAPA 3UMVA 4R54A 2XV1A 2ZIXB 3N6XA 4E31A 4FIDA 3MJ4A 1OI2A 3JTEA 4GOJA 2PQMA 2R97A 4W9RA 1MNAA 1UT6A 2UUPA 3G89A 3M5WA 1EA7A 4M8SA 5LBTA 3VGPA 5CDYA 3LOUA 4EVSA 2ZSIA 1SA0A 2DPGA 1MC1A 1N8NA 2HBYA 3DFFA 2XITA 2M9MA 3CKKA 3ZI0A 1OZ0A 4Q47A 1W85A 5J23A 2P1RA 2P91A 4KE9A 3MT8A 5A5FA 3PUXA 1MD9A 4R2IA 3KAQA 4GC9A 3V55A 4EEZA 5ENVA 3VVCA 1FP2A 1K5PA 3IMFA 2W2NA 3R5HA 1BX0A 1OW3B 2PT6A 4LGCA 5LLSA 1EFAA 3U3RA 4Q1DA 2JFWA 3HXMA 3SU8A 5H3CA 1UK8A 2NT3A 1GYQA 2GN6A 3FGZA 4GOKA 4JV5B 2QXTA 2AFIA 2F43A 1QP0A 5EMLA 5HGJA 3JS5A 4DDVA 1H42A 1EUZA 4OV6B 5JADA 1YB4A 3EF3A 4NP6A 3IPCA 3DWEX 1AKEA 1DEHA 4Y6RA 3WGHA 1CJBA 4RK1A 4LF9B 4CRWB 1XQ6A 2CUKA 2YHBA 2ZSFA 4BFVA 5CDSA 1RZRD 4LZJA 1ENPA 3HZRA 4K9PA 4TYPA 3ZXSA 5HNKA 3BDVA 2OXTA 2FSUA 2AQIA 1PYGA 3AR8A 1S9DA 2P3SA 4JS0A 1E5DA 4IDBA 4M2LA 3HGTA 1NJ8A 5I9NA 1VMAA 4BMCA 3FCXA 3KQHA 2AVDA 4HC4A 3H04A 4RGYA 3RC9A 1SBHA 4RH3A 5HE8A 1B3BA 2EGGA 5LQUA 4GRDA 5JO9A 1YH3A 3QLVA 4KLAA 4E07A 5KTNA 2DFNA 3Q85A 4MJXA 2N75A 4RXTA 4IDEA 4TS1A 1ECGA 3EDRA 5G0WA 3RS3A 3ANLA 4RU1A 4BEVA 4EP1A 2ADOA 4N3BA 1H23A 4MYCA 3WXBA 3KQNA 3RC7A 2DC1A 3FPJA 2CNKA 3CLSC 3CJQA 1BFUA 2I65A 1GKYA 4B8YA 4C4YA 4OHPA 3MFQA 3X1WA 5E4TA 4GNKA 3VI4B 2GWHA 2P30A 2XTZA 1U4NA 4B80A 1OLOA 4W9NA 1ECLA 1EBUA 2AEMA 1BW9A 1XD2A 1Y5LA 3CLTC 3G2OA 3AIIA 1RKQA 3IUEA 5IF3A 2D4AA 3Q6MA 2G76A 3TF5A 3ECAA 1D9ZA 3GRCA 3HWX1 4RULA 3F47A 1CUWA 2QYSA 4RIFA 5DGDA 2AI3A 4YMWA 2KYRA 3TW8B 4IDNA 1PNOA 1DMRA 4Y9TA 1D2MA 3ZVLA 4DYVA 5IYZA 1IXSB 4CM9D 3O8DA 4P98A 4LY9A 3REFA 4C06A 1UWKA 4DCTA 1K97A 4BB0A 1LRLA 5FOTA 2F8MA 1SUAA 2NZUG 3HKCA 4O1MA 5LOVA 1K06A 4KLNA 5FLXA 4QOEA 1A8HA 1K8RA 1NV9A 2RKOA 5JT1A 4IXWA 4RQTA 2JCYA 4UZSA 2A4KA 4LYAA 3OFND 4O02B 3SQLA 2I1LA 4IDPA 3GRUA 4M0FA 1ENYA 1W6RA 1JJIA 4YV0A 4CIYA 1OU4A 4E13A 1V7QA 1SB9A 4O63O 2YNMA 3EISA 2PH3A 1SUEA 4O2AA 3DV9A 3X1YA 4EI2A 3UMYA 1KOLA 1N8SA 3DHVA 1XNHA 2W6QA 1AA9A 4O2BF 4AJJA 1FYWA 1A7AA 1LRKA 5DM2A 3HVKA 4PICA 1L8XA 2BUAA 1V3VA 4OQQA 3UUGA 3UB4A 3HZHA 4FILA 2PRZA 1KPHA 2WUGA 1ESNA 4EZIA 2RI1A 1M3SA 1XHLA 5DNCA 4OU4A 1TAQA 4IH9A 1L1FA 3KB1A 4II3A 2SICE 3C41J 2R9VA 3C1TA 3SZMA 3PRKE 3HVHA 4FU0A 3E9RA 1FB5A 3EGVA 2JZCA 3WK5A 3ZN2A 4KXNA 3CX8A 4Q9NA 4KN6A 4S1NA 3LA6A 1RWBA 3Q9UA 3LSYA 2A5YB 1C1DB 1SUCA 1ZRNA 1K86A 1NULA 2Q3JA 2QI9F 2P2YA 5SZJA 3S2ZA 5KHOC 3FOZA 1KRHA 1KIFA 1YZQA 3PR3A 3HJHA 3B3GA 4XEHA 3RBAA 6ADHA 2IEYA 3LWZA 4CF6A 2JH8A 1GA6A 2VTBB 1NG9A 4KP7A 4NS4A 3SM3A 2QROA 3FD8A 4Q48A 1FZQA 2VQSA 2PO7A 1GFIA 1PG2A 2A92A 3FCEA 4HK4A 4IGKA 1E64A 3OPMA 1CG6A 3T0FA 1OB2A 1CZRA 4C7BA 3R5SA 3NGLA 1YBVA 4S1VA 4TZKA 5KJCA 4AROA 1K9SA 2PTGA 3KXIA 2Y6UA 4MIEA 2G1AA 4WVLA 2EP7A 4U7TB 5AKLA 1PP4A 1MW9X 3C3YA 3A9RA 1TK3A 2J67A 3W2GA 1C9YA 2FUEA 4M37A 5HQ3A 5C5EA 4GQIA 1XMPA 1L5ZA 3BSSA 1O95D 5JD5A 1TKBA 1XSEA 1PFUA 3DKVA 3IDQA 4FHZA 2Q3MA 2WZQA 3PXBA 4DYHA 1DQRA 3UAYA 1PHRA 4FEAA 4ZQEA 2XMCA 2WV9A 3SEFA 2H2IA 2F90A 2H9AA 3IKTA 1OC2A 2A9QA 1UJ2A 3ZHRA 4I4CA 3RRYA 4DC9A 3MJRA 1NX9A 1V96A 2XCIA 2FPGA 2X8JB 3PCXA 1VBKA 5T57A 2QZ9A 3RVQA 3W1VA 4Z4QA 3DEZA 2QBYB 1E9CA 3ZDAA 1B15A 3I52A 2A88A 4IF4A 3VH4A 1QSGA 2A84A 3VNSA 1JSCA 4EI7A 3FB4A 5DHSA 1GTZA 3SVZA 2DTDA 2BEUA 5KTRA 2ODBA 3SXUB 3AOEA 1MOZA 1SUWA 3T9EA 2Z8YM 1W93A 4XIGS 121PA 4RL6A 3V97A 4QKQA 1YHNA 1I1OA 5DWVA 1CNEA 2CNOA 2WY2D 2VP6A 3L79A 4GBED 4L5AA 1IJBA 5CA0B 3R5TA 3UWSA 5C1PA 4I4NA 1M74A 3UWDA 1KFBB 5BR1A 1IVYA 1WB5A 3AZPA 2F1RA 4H17A 5JYDA 1I3OA 3CCBA 4N7BA 3QE2A 1KYWA 2KW5A 4O4LB 4DXAA 5LL6P 1WF3A 2PBRA 2R1TB 2KLHA 3ONEA 1NN5A 3IUSA 1AS2A 4HYEA 1J9ZA 3JQCA 4CTJA 1IIBA 3BJRA 4ZALA 3GPCA 1FSSA 4FMCB 3G9QA 1EM6A 1NONA 1W94A 2WAXA 3LQ1A 4MWTA 5FD8A 3INTA 2QXUA 4OI0A 3Q3VA 1CXZA 1DP4A 4WX2B 1QOZA 2XCQA 3CO0S 3DEKA 1O77A 2MYPA 2NTEA 3IEUA 2I55A 2W2XA 1N1MA 2WWIA 4HTFA 2A33A 3JR7A 1D0VA 3MMZA 1A72A 4YAUA 3KHUA 4ZCIA 4B35A 5L4LA 3S8EA 5FL7A 1Z07A 3NT4A 3DP9A 1DI0A 1GADO 4WFQA 5BNIA 3IT2A 1QHEA 2HV9A 4URXR 5L7TA 4F5WA 1YC2A 3LHDA 5ALFA 2P2ZA 3C6XA 2BGLA 3D7RA 4RAQA 4RZXA 3SZ3A 4UHFA 2ADFA 1GPJA 4Y0NA 4LMRA 4ED9A 7REQB 3PS9A 4F5ZA 1ZSNA 3PPWA 3M4ZA 1RQXA 3EIOA 1XZAA 2C1EA 2PH7A 5G3ZA 3OU7A 4E51A 3GG2A 4II2A 2A7XA 4DBVO 5JJCA 2WIKA 2QRNA 1QDUA 5ED4A 3IBYA 4MUEA 4G07A 2WUEA 1HOXA 3DVQX 1SEPA 1G4AE 4M1WA 1IEVA 3FBTA 4LXTA 1QWSA 4I1UA 1Z37A 4JCOA 1N5OX 2EHDA 5I45A 3BFPA 3EVBA 3AETB 5K8LA 4J3JA 1I2BA 1JSRA 2MWMA 3MRVA 4QAJA 4WN9B 3T9DA 4DZRA 2BZ1A 1XTBA 2XQGA 4I46A 4LZPA 1PG0A 1I0LA 4PC1A 4M60A 1C3OB 2BC9A 4DM4A 1U1FA 2XUFA 4PSUA 3TTVA 2IF2A 3GRPA 1GTSA 2X1LA 5TF4A 1P5FA 1GPAA 1HQYE 1N2CE 1J07A 1QDEA 2WKPA 4RACA 4CMEC 5KZMB 2YUTA 4FKBA 3EFHA 3U3DA 3KBBA 2CYBA 4CWAA 1J23A 4E4YA 5DM60 4OSOA 3JYQA 4Y1EA 2Q2QA 4FW9A 1E6EA 1GZ6A 5BW6B 1E2KA 4ZXFA 5SZIA 4D98A 2LPMA 1KYIA 4BYMA 2Z1NA 3CLKA 4W5WA 4XIYA 3TWOA 1LI7A 4AX8A 3IMKA 3D8HA 4CIWA 3TX2A 1KP2A 2YWGA 2QLJA 3BRWA 3FPHA 4NEHB 2VP3A 2ZJYA 4RJJA 4X7BA 2HDHA 3N5CA 1KAHA 2UYOA 3TFOA 3KUDA 3MXTA 1IXZA 5FB3A 1QTRA 2B4YA 2XAUA 2E2WA 1ILWA 3AEZA 4X71A 4TQAA 3WLHA 4CHTA 2C7VA 5EWMA 4PR3A 3GDFA 2D5CA 4PGGA 3WL5A 1RLTA 2P2CA 4Y2XA 4B9EA 1B0AA 3MT9A 4I8DA 5AO9A 3PFFA 3PYMA 2XYHA 5AVYA 1PZNA 3R4VA 2AKYA 3GFGA 3GJ5A 4KJZA 4MS4A 3CRW1 3R0VA 4PO8A 4JGGA 3W6UA 1V71A 2QL6A 3VQTA 1TCUA 2H1IA 2F48A 5E9WA 3R9IA 3WK7A 2B4RO 5K0FA 2UVPA 4ZGBA 4RHTA 1B6SA 1PG5A 4Z9FA 3WNVA 4R41A 2BKAA 5K0GA 3TEJA 2YWHA 2C2HA 2OILA 4LECA 4NCNA 1NSFA 2CSUA 3OH8A 4PQGA 1X15A 5FBWB 3UOGA 1ZFNA 3H4TA 4YT5A 3ZS8A 5C8VA 5KQPA 4TYYA 1Y4UA 2CXTA 3HKDB 3PQDA 1UWCA 4YJKA 1XTKA 1U3FA 4FR5A 3STUA 3WL7A 4YCSA 4HNTA 4IV0A 5KB3A 2FPOA 3OE7A 2EKQA 3WL6A 1Z36A 1N6NA 4EFMA 1J2JA 1IBRA 1JU3A 1EVZA 1M2OB 1XCMA 2ZR8A 1X70A 2VXCA 1N0VC 1W48A 4DUGA 3AJRA 5CGZA 5ALVA 4N0MA 1NXWA 2HJRA 1NQAO 4EYGA 3OM8A 4DN6A 4GZMA 3ZGVA 3AGPA 3BWVA 3EY9A 5J40A 1UMBA 4ISCA 2HRRA 1J5XA 4KAXA 4TLEA 1KO4A 5HRUA 1YZVA 2YV2A 3E35A 4MW5A 2PUFA 5C7YA 1UEXC 3GIDA 1M9NA 2PHZA 1W85B 1YR3A 4GLFA 3CRNA 3D59A 4J0EA 4AURA 2EEZA 1V1RA 3WB2A 3HB9A 1QHHA 4H35A 4OKIA 5FI5A 2J0QA 1SIBE 1KGDA 4R8RA 3ZZ0A 4GLJA 3B78A 1GQRA 3IVXA 4RW0A 1KOGA 2JJ2A 1NHGA 2FFHA 1R4ZA 2RKBA 1OGJA 2FWNA 3HSKA 1NYLA 4LOIA 4QOGA 2XOEA 5IZ4A 3LS2A 4OIFA 1F9AA 1X7ZA 3ETCA 4MITA 5IU6A 2ANBA 1R8YA 3I5MA 1XJCA 2H31A 1V4VA 4DKJA 3ZWVA 4JJ4A 5DNYB 3AB7A 5BRJA 2LUOA 2ZTVA 3GNTA 1RXSA 5I4CA 5IHPA 3AY6A 1EK2A 1RLUA 2HXYA 1H2BA 2VP9A 3M6IA 5FYDA 2IH2A 2OAQ1 3SC4A 4AUKA 4YRKA 2ZEJA 2P7IA 1Z3CA 1ZN2A 1SD2A 2DLNA 2HX1A 3QKSA 1YCDA 2RGXA 4MP6A 2G63A 4B0OA 1AXGA 4DGSA 1N32B 2WUVA 1MG5A 1XBTA 1LDBA 2VA9A 3KV1A 1CKEA 2IIPA 4U7JA 3ZHUA 1J9GA 3PNPA 3AM4A 4X60A 5JHGB 1YC5A 3GJ4A 1JLLA 1SPXA 1S1MA 1LDYA 1EZ1A 3DXYA 5KYYB 1WBBA 3QMWA 4WCFB 5HKLA 2Z57A 4DSTA 1XVIA 2OP0A 4X20B 7ABPA 3INRA 3C7TA 3O8OA 4MPJA 4OYRA 4BL5A 5L8VA 1W6UA 2VK2A 5ES4B 1HWYA 3GK3A 1IXYA 1D03A 4MQEA 3WNBA 4KMOA 5EG5A 1P0PA 2DSNA 3OEEA 3BWDD 3ZKWB 2D7JA 2XMGA 4FYPA 4BQRA 2G88A 3DA8A 3PC4A 3LXXA 2H7XA 3BOSA 2VBCA 3I01M 3QA3E 5KQMA 1E60A 3QI7A 5GIOE 1P9LA 3PFGA 3FOFC 3NEPX 2E5WA 2WPDD 4PLWA 3O74A 3SKXA 3UH0A 5JLJA 3F8SA 2P5YA 4JUDX 5IYZB 2OYSA 3TE6A 3VR5A 1OFUA 2AWNA 1DS6A 4HDRB 4IQ4A 1KKLA 5DCYA 5EAIA 3UG7A 4B5LA 1YMVA 1F2UA 2DBZA 1OXKB 3LGXA 3GEBA 4ABTA 3HKCB 3ZGYA 3TI7A 3ZJTA 4C0WA 2GVNA 1UBJS 2GTPA 4UUBA 3S1SA 2J0UB 3HL4A 3KSMA 5F21A 1JI0A 1TXGA 3OM1A 1NNUA 1M2FA 3NYIA 4HXFB 1OFHA 3JVEA 3F0TA 1BDJA 1P2TA 1WXHA 4FZ3A 4KK4A 4EY6A 4PO3X 2HTEA 1ZNZA 4WXHA 3HA5A 5THKA 2QX4A 4HY3A 2G4LA 4EABA 4YMVA 4I55F 3PFCA 4Y2TA 4MS3A 3STXA 3ZX4A 3NJ8A 3AM3A 3L8MA 2EL9A 2Q3FA 4KXQA 4BC1A 1H8ED 4BASA 4NCBA 1TYZA 2WKQA 3U7FB 3TTXA 4B9AA 3DZKA 2NUAB 1EUQA 3BCHA 5LNK6 1AMOA 1JLRA 2BFFA 5K0ZA 3HS3A 1R0YA 3ANXA 1RHKA 2W71A 3E0QA 1PN3A 3E5HA 4YH1A 3JD2A 4ZI2A 3QF4A 1T0BA 1Z06A 3V3TA 1XPRA 1XTQA 2GKOA 2VT2A 2ZBRA 3G2LA 3Q3IA 4XUEA 1MQ8B 5KTYA 1VKHA 4LYHA 3LIIA 1AG9A 2PWZA 3AX6A 1L5GB 5EY5B 5A2QA 1U28A 2W48A 4IRUB 1KVSA 1OPRA 1LPAB 1OAAA 5FFFA 2GH1A 4XWGA 3CM0A 1CUBA 1V5IA 3VU0A 3ZDFA 1BYUA 4AG3A 1IUPA 4L5YA 1SIOA 4QPDA 1TD9A 2XA9A 5BV0A 4L0CA 1D4AA 1MVOA 5FJIA 4C6SA 3CVYA 2IUSA 2Q46A 5DTEA 4J7UA 1CULC 2M32A 2PV7A 4WEOA 3SC3A 1H4SA 2ZIFA 3BRQA 3L07A 1L4BA 3OP1A 4U7WA 3EFOB 3P9RA 3LUPA 1X1SA 5DP1A 5KJEA 5JS7A 3O84A 3TGPA 4WCFC 1NR7A 2ZRKA 2PGDA 3KIPA 1SIWA 2QMUA 1QO7A 2E4VA 3LXUX 5BWLA 3OSUA 2GEJA 3SAJA 5HKBA 4CUZA 1WD5A 2MHCA 1JDTA 2HJHA 3KOXA 2JLRA 4HQKA 4JMLA 5K0SA 4KEAA 1JPJA 2ZBFA 4G1VA 3N8HA 1GGKA 1DPFA 4GLOA 4IH4A 3VZRA 3W6PA 3WQHA 1DBQA 1FFGA 5CA0F 4KR6A 3RANA 2XQIA 3EIWA 5EHNA 1P19A 1C9MA 1QFZA 1YRQA 1DKRA 3IDZA 1N3IA 3JU3A 3LLCA 4M22A 4Q4DA 1YNOA 2XT9A 4F91B 5AUOB 3R3HA 4O4LF 4FQ8A 2H2WA 1B26A 1E3JA 4ZCSA 1J24A 3VJMA 3GJXC 5D87A 2OHIA 3BCRA 1R27A 4GNRA 3EC2A 4OLFA 1E8DA 4PAQA 4YJGA 4BS9A 5JJIA 1JQDA 3HP1A 1PIWA 2GFHA 4LFBB 4FMCF 4ECEA 4ENVA 1A5AB 3ADKA 2ECQA 1U7UA 2HPZA 4KQHA 2FN3A 1VQ1A 4OLJA 1K66A 4UHCA 4KNWA 4S05A 1DXQA 1L5HB 2QX8A 4A23A 2F3RA 2ISSD 3PNBA 3QVSA 4YUVA 1IN1A 3RRNA 1AQJA 2L17A 3UB3A 2GM4A 3AM5A 2FVXA 4DMHA 1JT2A 2VYNA 1JSXA 1NRIA 5IEBA 2J45A 3HCEA 3MWEA 4TRMA 3R7WA 3WDSA 3LUCA 1GU7A 4Q1FA 4D5EA 1K3UB 4OHFA 1GQ2A 1H0SA 3NTLA 3IP5A 5HJ2A 2NUBA 4ARVA 5A1JA 1WA5A 5EC8A 5GVSA 2GHRA 3GFBA 2QTCA 4QYWA 3S8MA 5DRYA 4K5QA 3ISVA 5IX8A 4UTPA 4JYPA 4RSRA 3FX2A 3KKPA 1E0JA 1H93A 1R0CA 2B8NA 3GLHA 5AR1A 1CT9A 4AK9A 1DQNA 3P8ZA 4DTIA 4BZQA 1OVMA 2Y3IA 1A4RA 3GIWA 3KQVA 4L57A 4R8MA 4RHUA 5BQXA 1SCUA 2RGEA 3C6ZA 3EB9A 2ILTA 2OB1A 3G02A 3CEPB 4TYMA 2ZRMA 3EZXA 1XELA 4YAGA 3OURA 3E82A 3AEYA 1U5AA 5KSZA 3QENA 4ACAA 2OOKA 4DRZA 3AKCA 4QTZA 2FPLA 4RY2A 2PN1A 1X7WB 2FW6A 2H29A 4J9VA 1KAGA 1ZGHA 4D0LB 3TLAA 3IJPA 3QLTA 2EFDB 5KYUA 4GU5A 4HTFB 2IOHA 5I4IA 3UK1A 4OHUA 1VCIA 2V5VA 2A1UB 3OSZA 5AK6A 4GSKA 1I13A 5BRAA 3DS8A 4IEEA 3N8GA 4W99A 4D6YA 3VMFA 1L5VA 2G08A 1UH5A 1RHUA 5AVQA 1W7AA 3AR3A 4FFSA 4UQOA 2WKRA 3AF1A 4RJLA 3TRDA 2XIQA 2DBRA 3NR2A 3CA8A 2PL9A 4LRQA 4TLLB 1UDAA 5BWNA 3RJZA 5FO0A 2WUWE 2PSSA 4CG2A 1NW7A 1PO7A 2LKDA 5EESA 2WR8A 3LXMA 5FLEX 3TOSA 1HYHA 4B8WA 1T5OA 2PX5A 2PUEA 3NJ4A 3RC8A 2VH2A 3BMXA 2IS1A 3V80A 3O1LA 1RKVA 4JA2A 2R5WA 5FTJA 4ZU3A 2Q5LA 2ZBUA 2ZPTX 1HMYA 3PDJA 4JEUA 1DRVA 1E7SA 3HJTA 2WILA 4RJIA 821PA 2Q6IA 1BCRA 4YP1A 3CURA 3U17A 2GD0A 1RJ9A 3QVVA 4WESB 2F59A 2I4LA 3L06A 2VDOB 5DLQC 4UKDA 4LDRA 2UYYA 1HFKA 1EP1B 3GPDG 1J8VA 1NPDA 3JARB 4QHSA 5KDOA 1NVWQ 4Z2YA 1DUVG 3VVBA 5KC9A 2I29A 5HPYB 1NXTA 2B0CA 4MRSA 1X2BA 2VYVD 4HAZA 1RQPA 4GZ5A 4DCMA 4AMYA 1OZAA 5FI0B 3QELA 2VBIA 4Z0TA 1O5TA 4XAQA 4KR9A 2V74B 3LVQE 3NAGA 4CLOB 1JJAA 1AQLA 1T6NA 4QPNA 1VRCA 3T5TA 3BE6A 2JW5A 1JTEA 1A76A 1WF6A 2RHJA 1FX1A 1NT4A 4LC1A 1AB6A 1QXSA 2IBMA 2PWPA 3M6LA 4IZHA 2FN4A 4G5YA 4KO3S 5FBLB 4CQLB 4D02A 3T5BA 1XVVA 4L5JA 5CG1A 1ILEA 4KRFA 5K6AC 2RH9B 5DI3B 1JDPA 4D25A 3PUWA 1QKIA 1Y7TA 2C4WA 3CSDA 3EEYA 3GRYA 1ODCA 1N1DA 2IH5A 4F4JA 3T4XA 4EMSA 4N8EA 3P94A 4MMXB 5LIRA 4N7MA 2CJWA 2H1LA 5JS2A 3WYDA 2FH5B 2W6OA 1R9MA 3SZUA 3IOCA 4HS9A 2YV3A 5GZ1A 5I8WA 1Q50A 3FETA 2C31A 3K32A 3P96A 4AP5A 2H48A 3AKEA 1C4XA 2QG9A 4KU4A 4MWBA 4MVJP 4UAUA 2OYRA 4D4IA 4HEQA 3TR6A 2ZRJA 2FPWA 1W1UA 1NQTA 4J0DA 1IK4A 2NU6B 2B36A 5G2OA 2IHJA 1E3MA 5CXSA 4N8DA 5T8KA 4OQDA 1G5QA 4R81A 2ZR9A 4LDQA 1XEXA 3WSTA 4D0GA 4ND5A 3G0IA 1QDLB 2X6RA 3R44A 1AT1A 1PR9A 1G5PA 3KZ1E 4F4FA 4YFVA 3E9NA 5FRDA 1NW4A 4E30A 1QAMA 3JW8A 1FFEA 5HA5A 1SCJA 3THSA 2Q6LA 2NU9B 5JXIA 3U19A 1ISMA 2Q4EA 4ZVMA 1XZDA 5COQA 4ZEOA 1OWLA 3FYUA 5DYYA 4OJQA 4R71A 1CUUA 4GT1A 1H4VB 4MK4A 3V4VB 4ZT4A 5HKKA 5DTQA 1I7DA 1GDTA 1UMBB 1KXZA 1RR6A 2DLDA 3UXEA 5B12A 5EZYA 4JITA 2H0RA 1WJGA 3DVRX 3SWWA 3G2HA 4TMVA 4NYIR 2VUTA 3VBCA 1BH6A 4HDSB 3MMSA 2WYUA 2XT6A 3I4FA 2G1UA 5EXPA 1J7JA 2JBAA 3RSQA 3ZZ1A 3T1YB 5CBKA 1NBHA 1NVXQ 1KI9A 3AIMA 1MPXA 1XLVA 4N12A 5ETJA 5B64A 4TUYB 1NRWA 1ZJ6A 4XM2A 1X1EA 2MMCA 3U39A 5FEMA 1JTFA 1X7ZB 1M6EX 1QKKA 3KOZA 4UOEA 5JU6A 2QSUA 1AX9A 3OO1A 3D7SA 2D0PB 3CV3A 5BSVA 1RCTE 3D7KA 4FUTA 2X0EA 4KIUA 4BFUA 5CU7A 3FOAA 4GM4A 1JN0A 3PJDA 1FIUA 1N3YA 4CT5A 1KZYC 1EVKA 3LBIA 3RASA 3WMGA 1VCOA 2HF7A 1L5MA 2VSQA 1CIVA 2PA0A 1IZ8A 2V59A 4OQNA 5IYZF 4AL4A 4BV3A 3KDSE 2H1HA 3K0SA 4OB8A 3PWTA 1RWOA 4AZ3B 1GFSA 1YB5A 3HYCA 3VJKA 1PR4A 1N9ZA 1USGA 4EOGA 1P7CA 5IJ9B 5K0EA 1V2HE 2YQZA 3A6LA 1B0PA 3NKLA 4BO8A 1YL5A 3WQSB 4OAQA 2VHZA 4XDGA 3T3NA 2ZM5A 1EB9A 2PJZA 4HWSA 3JQ8B 4D26A 2GBLA 3OD1A 3TR0A 4BFYA 4PHGA 4ODIA 4IILA 5JRZA 1CJSA 3K2QA 2DM6A 1JEJA 5DM70 1GDHA 2PX8A 2NTVA 4HDKA 3WZMA 4C0QC 1MDFA 2XVYA 1M0EA 4WWHA 3U60B 5ICFA 2I2AA 4X1IA 3VU3A 5EHQA 1GA1A 3ZHVA 5CXUA 4G5FA 2JEYA 3C8HA 1G20B 4JU9A 3ZDCA 1R4NA 1ZXLA 5LQRA 5AVUA 3EZ7A 1NXSA 2V0CA 5J1TB 5IDQA 4BMSA 4QWWA 3VV3A 4AIRA 3F71A 3TR5A 3GZTB 3AJEA 4ZVNA 4F96A 2J0VA 3BERA 3E8SA 3SJAA 3NHRA 4M54A 1LDEA 1RM3A 4YRZA 3KVRA 3P2JA 5LQKA 2G6BA 2A9JA 2I7DA 2OHXA 1XTZA 1F2UB 3NHFA 4RLSA 1N57A 4YP5A 5TGTA 4WH0A 4F3KA 5CLJA 3VA7A 3RREA 2J4FA 2J3EA 1E1LA 3E5NA 1XYGA 4QARA 3I6ZA 1TM1E 4V1CI 4Z1MD 4ENTA 1MEOA 3LT2A 4QUJA 3K0AB 2GAIA 3MCUA 5FR2A 3KX2A 4AKHA 1E2NA 1RFLA 3C3BA 1GYRA 4KGDA 5KSOA 4ZV4A 1Q1QA 4TYQA 3GFOA 2XNJA 2SKEA 2YV4A 5ILGA 5NULA 4LXHA 2PU7A 4MS3B 3IB3A 3REQB 4P3YA 2XY4A 3AXSA 3C7CB 1HL3A 2ZR0A 5EMKA 4MLCA 4XSGA 1OHHA 4NH4A 4ZEWA 4HLCA 2AB0A 4R1TA 3UNXA 3W2FA 3H9EO 4Z0NA 2IUUA 1G8SA 1BXKA 3OPYA 2BFFB 2M98A 4JLOA 4G25A 4MVJG 4NYMQ 1NU8A 4QJ4A 2WF8A 1DAHA 1NBAA 3IEKA 3OF5A 5K45A 5B58T 1FP4A 1VKJA 3HYSA 3OTGA 3HDVA 5J3JA 3QF4B 3A1EA 1BWQA 3A4TA 3N2ZB 3O4GA 4C6RA 4EHHA 1X9HA 1XCOA 2R96A 4ZICA 4MQUA 5L45A 3I9KA 4M0LA 4U8HA 2VYFA 4MICA 1I32A 2CKDA 4F72A 1OTYA 1JZSA 1SQ5A 3EN0A 3F97A 3M5PA 2CL7X 3QOXA 4H6PA 4IGFA 3U7JA 3FM9A 3DAPA 3SKYA 4A6XA 1SB8A 1MRSA 4PNEA 2VTEA 1CQJA 2PY6A 4I1SA 1NVAA 2Q2NA 4M0EA 4X8MA 2B4QA 4ZI5A 4NI5A 1LGYA 1PJQA 4PYIA 2YVAA 3FHTA 1DTWA 2GEKA 2FWBA 4JXJA 4JZYA 1DV2A 2HGSA 2PXXA 3OZDA 5CRIA 2W90A 2W8BB 3GCDA 4E5PA 4FKMA 4BLOA 2WMYA 3TLGB 4NENA 1Z25A 2XZPA 1FP1D 4BNHA 4FZ5A 2QT1A 2IYEA 1ARZA 2PLWA 2RIPA 2EBUA 1ZOLA 3QYFA 5A6SB 2O2EA 3ZWMA 1FXUA 1KJJA 5LKAA 4LV5B 4KWHA 2IYAA 3FCSB 3O0TA 3SY8A 4DIUA 4C89A 5EZ5A 3NIGB 3W3ZB 4MIKA 1E4EA 3VU8A 2WU8A 5SYMA 1CFJA 3T4EA 1EDOA 4ZCQA 2Q0HA 3N05A 1H2RS 1TQDA 4MV6A 4P4SA 5FLYA 4PZEA 1MVNA 1R0ZA 5C31A 2WSSA 2H51A 2PKEA 4DTCA 1CZHA 1EK1A 1EFDN 1R3UA 2E18A 2OCAA 3KC2A 3U4HA 1L5YA 3VKWA 1X0XA 2V8OA 3VR2D 2JIOA 3GN2A 3N1UA 5GM1A 3T7EA 3EH1A 5JCOC 4WZZA 2JI9A 1U9IA 2YIMA 3P9NA 4G1MB 3RUAA 4RYDA 2BEVB 2WB4A 5HIIA 4O25A 1QAQA 5ALLA 1XVAA 3MJFA 2AUMA 3GJ3A 4A2QA 3W8DA 2OZVA 1WU8A 4JYBA 1YQUA 2RGGA 4HEA6 3TVDA 1Q17A 3KKEA 3WQQA 3OQNA 5A7HA 4XDZA 2JARA 3DMTC 2C1ZA 1L7AA 4NOLA 3VZCA 1N8KA 4IHJB 3RVLA 2DETA 1OUMA 1DRUA 1M33A 5F7XA 1H1TA 5HOQA 1FNDA 1LBEA 4FNMA 4QUGA 3G2QA 5I7SA 1KSFX 2P68A 3GLHB 2Q50A 1G42A 3CZAA 4EL0A 2EFEB 4QT0A 3ZR4B 3QTTA 2JD1A 2WT4A 4Y2HA 4YIKA 3L0ZA 4ZCRA 1M5RA 3HR4A 2HMTA 1LCIA 1WX1A 1ZD2P 3NTUA 3Q3EA 1B41A 4ERXA 3K2EA 2JI4A 1UPCA 5TMEA 3V8BA 2WU4A 2Q62A 2DPLA 2N9UA 3GJYA 1H9CA 1K2VN 4S1WA 2ZG6A 4OBXA 3OE5A 4BQEA 2ODQA 2WFAA 1KQPA 1QLWA 2B35A 2WSYB 4H0CA 5MGBA 1Z73A 1E1DA 3LUKA 4MV1A 1CQPA 3W7VA 2ORED 3E9EA 1KP3A 3DVAB 5JFOA 2BEKA 2JLCA 4B85A 2A9FA 1Z5OA 5JD4A 1EGAA 4MQ6A 4N0PA 3VR3D 2XRMA 4XYEA 2REXB 3EULA 1V7CA 1JLHA 8GPBA 1QQBA 3GF4A 1Q7CA 5DWQA 2VDLB 4D9BA 4WXEA 1LEHA 3IQXA 3L8EA 3LPCA 3EVZA 2R751 1C4OA 4YRBA 1HFEL 1B7GO 2VJAA 4GOOD 4OB7A 4GMDA 5FJJA 3E22B 2I8AA 3EXHB 4D42A 1YACA 2QZZA 4MJ7A 2H1CA 4C7XA 4F4HA 6PFKA 4RDIA 2PSFA 3U3JA 4G4GA 5YASA 4ZI3A 2BHLA 5B53A 3G8AA 3DDOA 1I6MA 1U4OA 3DLIA 4HDOB 5E2AA 1KSGA 1NVFA 2RH8A 3OOEA 1RJ9B 1H94A 1CJUC 2E21A 3EOZA 1MHPA 3H9BA 3E8MA 1NUTA 4F71A 2GAJA 1GZSA 1KJQA 3EIQA 3RBXA 5DXAA 2R62A 1LY1A 4HLUC 5IXYA 2LW7A 2WKSA 2XUPA 3REOA 2NV6A 3LK7A 3HMQA 3BKWA 4YAEA 2H3HA 2XKKA 1JKIA 1BEZA 4URYR 4RTOA 1Z7EA 3SJBA 4I9UA 4K46A 2GILA 1SKBA 3ZUGA 1U7ZA 3KT6A 2EQBA 4KDRA 1WPXA 3ZK9A 4KE7A 4S12A 3EBLA 3EIHA 3QKRB 4OK6A 1V3QE 3B70A 3RVNA 4CFYA 4F1KA 5AJYA 4HR7A 4WEQA 4FYYA 1U9YA 2X5NA 3Q6NA 1H3FA 5LD2B 3O7WA 3I01A 1TUBA 1AU9A 1SC6A 1EB8A 1SVSA 3ICCA 3MTGA 1JZQA 1RXCA 1SXGA 2ZB8A 5L6LB 1DCTA 2CNLA 1W88B 4ZVKA 5JS6A 1W5AA 1JA1A 3CCCA 5B55A 3KS9A 4PW0A 1QBGA 4P92A 2CB9A 3C3JA 4JP5A 1OLSA 4JLUA 5IT9A 1SURA 5LP6C 1LU9A 1U0HC 1X80A 1J0EA 2J4CA 2VH5R 3PNVA 2ZTLA 3DQQA 3GLKA 4HBZA 5BN4B 4B17A 5IFLA 1UAAA 1CUIA 2K2QB 4CLHA 2RMKA 4EPXA 2BGGA 3K9BA 5IC4A 4PCAA 1L5OA 3ZZUA 2BCGY 1YVRA 4BMZA 5KJ6A 3KHSA 4LS3A 1FL9A 4P93A 1N75A 5JPIA 3SOPA 4BB9A 3WL3A 4RZIA 4GL4A 5IK2A 1CUZA 1K2WA 4HD8A 5A9SA 3SC6A 4XOUA 1EFRD 2FP4B 1Q0LA 2WSIA 2ZWOA 3MUFA 3N75A 1WPQA 3FRHA 3OOYA 5LA6A 3CUYA 5DXFA 2YCBA 3BHNA 3IVRA 3WWOA 3H1TA 2XBMA 2OSBA 2WUDA 3OWXA 3L01A 4PO9A 3WNCA 5AW0A 4AY2A 2PRSA 3X43A 3I04M 2FX5A 5JRJA 3HDHA 3QIAA 4N6OA 3BE4A 4A6EA 3H16A 4EYOA 1RS0A 3DONA 4CKWA 2GDJA 1A8UA 5LU9A 5EJFA 4Y2VA 2GZDA 2JB9A 1LDMA 3NVAA 4J6FA 3H1BA 3EXG2 1P4HA 2GZ1A 3EXHC 1MGPA 2PVPA 4QPJC 5BUQA 2WFZA 2F1OA 3EA5A 3PX7A 5MHTA 2HWXA 4G2NA 2I67A 1SVMA 4GGPA 3RJTA 1Z7GA 1Y6RA 4DJDC 2GA9A 2Z8ZA 1NOKA 4K9SA 2FW0A 1A9SA 4MYRA 2AJDA 1G1AA 2DWCA 1ZN7A 4MA5A 3T12A 3FOBA 1KPGA 2I6UA 3H0KA 1ZEJA 4DA7A 3F74A 2OCBA 2YXPX 4MUYA 1HLDA 2ZYHA 2H8GA 1H2YA 1YZGA 4TV8B 3VH1A 1HPLA 1P1RA 1PK7A 2B1RA 3OFNA 1JIVA 3R76A 1AC5A 4DZTA 3CVWA 1RKBA 2VNJA 4X84A 3BH0A 3SZGA 4TN1A 3GUHA 2NMVA 3RHFA 2RGNA 1C8KA 1IEXA 3K1AA 4LWQA 5DYIA 2GUWA 4C0XA 3TL6A 1EFLA 1N2SA 5ARDA 1HNNA 2GCOA 4F2GA 3D0OA 2ZAYA 3ZGXA 1U8FO 4AWXA 4EL5A 2GYUA 4D1YA 2PL3A 2QJOA 3G3EA 4G1UC 4IM7A 1NVEA 3BMQA 4AKSA 4K9DA 5CM9C 3JSXA 4MZXA 4PRYA 3L7CA 3L7DA 3V4OA 2OOSA 3PDIA 2FSFA 1RZVA 3EEOA 3FR7A 2X76A 2FG5A 2RJ3A 5TJ9A 2FQYA 5AW3A 1UP7A 4B3CA 2IYXA 5F2EA 3KZNA 5K3AA 1RE1A 4S1TA 3UUFA 1SOUA 2BV3A 4RH0A 5ADUS 1OOEA 1Q1ZA 4DIMA 3WLLA 2PBFA 3UWPA 4B73A 3GGDA 2HSJA 1W0CA 3BQMB 1ZOSA 4OHBA 4OHOA 2JI6A 5GGXA 4HUTA 3ANNA 5JBQA 4RVOA 4TGLA 2JG3A 16PKA 2VQ6A 4X44A 1T3LA 5B1HA 4YRDA 1DINA 2ZZNA 4IFIA 5EHXA 1VL1A 4OQFA 4Y2GA 2AGVA 4JKIA 5THXA 5DCLA 3EK2A 1PL7A 5FWYA 1UXIA 2GPAA 5JAHA 1B23P 3ZD6A 2F17A 3RC2A 4NIMA 5CCBA 3PD1A 4RMNA 2WG1A 1W5BA 2YN4A 4FDMA 4O5AA 1VHWA 5IWAB 1V6CA 3B82A 4IQGA 4C2AA 3AFNA 4WK2B 2DXIA 3PSAA 4NJMB 5JY1A 3JYOA 1IOLA 3ZXIA 1ZJ4A 2VJLA 1CY1A 2Z2IA 1PFVA 1UQRA 2IY7A 2ZE6A 4QSHA 4HX2A 1HE3A 1NE2A 1RLIA 3VYTB 3X44A 2X2EA 1XJ0A 1PSDA 2ATIA 2W6JD 3B1KA 3CEAA 3S44A 5JD6A 1WZ2A 1ZM7A 5AKHA 1BJTA 1O95A 4D8VA 1VKOA 4ZZIA 3GRVA 3LHFA 3N86A 3DEJA 1FP7A 3C8UA 4QTTB 4HAVA 1NYRA 1P45A 2IWHA 3HADA 3JQPA 4L95C 1PR5A 3CW9A 1GHTA 4LJ9A 1EDBA 3HCRA 3ASYA 4P9NA 3DDUA 1Q0TA 2MYUA 1IOVA 1QR6A 4D45A 1GSIA 4V0MA 5EWJA 4BZPA 4D44A 2ZJ7A 3B9RA 3M4XA 3NT2A 2H5IA 2AN3A 4CMIA 3RT9A 3S5UA 4EARA 2VH1A 5TB5A 3N8DA 2JHPA 4YDSA 4LK2A 3H2ZA 3VX3A 1IUOA 4H1WA 1SXJE 2ZROA 1FP4B 3DE6X 3TBHA 2NSLA 2QN3A 4J0IA 2J3JA 1E2BA 2QGNA 3B48A 4YJ3A 4YRTA 1IU9A 2DUMA 1P77A 2HCBA 1E9EA 1MAAA 2H07A 2KS6A 3IELA 3UTCA 2CC2A 4CLXA 3TPFA 4JR2A 3OG9A 5FUBA 5IAOA 2C0CA 1YDWA 4TKUA 1N9GB 3P4XA 3RU3A 2CFCA 5L3QA 3N2KB 1XXHB 4GYWA 5B6PA 5JTUA 1EE1A 1UAYA 1CQJB 1BIFA 3DMFA 4HUQA 4YQZA 2H1SA 5CB4B 5IS2A 5AXCA 4PAMA 5FPQA 1QC5A 2X5XA 3F6BX 3MOSA 4TLMB 1RI2A 2DE0X 5BW5A 5E6UB 2OCGA 5M34A 4ARIA 3GVPA 2JBWA 4CTOA 3THWA 1EQ2A 1GUBA 1JE1A 1ZUD1 2YJNA 4HATA 2JIDA 5F76A 3RABA 1YOBA 2J0SA 4QFDA 2ACEA 3LGSA 3PPIA 4Q3KA 1PS0A 3R8XA 1APBA 3UGTA 4NJEA 2RHBA 1YI8A 4YUAA 1UMCA 2EBHX 3DW1X 1VL2A 3HVUA 3HZZA 3OZ7A 4DDHA 2QMYA 2FMTA 1CZNA 1P73A 5TARA 2LIVA 1DWQA 3M4NA 1DJNA 5C1IA 5KTMA 2V65A 4BO4A 4MO2A 1RCUA 4PFKA 3RJ5A 3TQFA 3B2EA 2O8VA 2R2GA 1E4EB 1C8BA 2XMZA 3GNLA 4PR0A 4RD1A 4R7GA 1Y42X 1IUNA 1KI8A 2QI9C 2ETVA 3LWBA 4W1RA 1YCHA 1HDCA 1KZ1A 3GR6A 2XCTB 4B3XA 4HEA1 1A1SA 2FJ0A 3QE3A 3V4FA 1QH1B 3KL2A 5LJLA 4C07A 2AX3A 1QHXA 3JRXA 5GJWC 3ODPA 1OB5A 3IO3A 2ZWPA 1XNGA 1ABBA 3RKSA 3FMVA 4KZKA 2Q41A 5I7AA 4FFBB 4LJ7A 3CZ4A 3AH8A 1Q1EA 3CO5A 5DIZA 2P2LA 3FPEA 2W00A 4EQ6B 1YR1A 2G9VA 1QR2A 1N7IA 4HH0A 4DV4B 3KHTA 4KUHA 1YMQA 5T6MA 4E4RA 3RS4A 3CZ9A 3W90A 1LNQA 1XC7A 4EATA 4RWZA 4W63A 4FM9A 4CN8A 4C4RA 3Q0TA 4R6WA 4PG8A 2JD0A 2NM0A 3CG4A 3RIMA 2XOKA 3L9XA 3V33A 3KFXA 3F90A 3ER6A 3K09C 3UMRA 3DBHB 1M6VA 4KO8A 1GSOA 1Y1QA 2WP0A 4P38A 3OCZA 5REQA 3WJ1A 5I8PA 1BU8A 3W2EA 2XMBA 3H2BA 4FSHA 4RZHA 4BNFA 3EXFA 4OBBA 3KLNA 3FTPA 1W36D 2PKRA 1YJ5A 2AZTA 3GNSA 5EYPA 3KSAC 4NDNE 1P0MA 4KIJA 5AM1A 5HKAA 3ZXXA 4J03A 3ZDDA 4M1MA 1UOQA 4ZRNA 4A16A 4ZJZA 5B4VA 4O5OA 2WLTA 4ALJA 3SZLA 1KZ7B 2OHGA 5ANRB 5PNTA 5T7BA 1K89A 1LVHA 4EHLA 1CR4A 2H06A 2AXNA 1UKEA 2XBUA 3KQOA 3P2EA 1BFDA 2ORWA 1XCGB 4QFBA 3M3HA 3K7EA 4D4JA 4TL9A 5AOCA 4YYZA 1RYFA 2C95A 2DF8A 4YQEA 3DDNA 3LWDA 5LM3A 4MHOA 2E4ZA 4RL4A 3VVMA 2H5EA 1I36A 2ENUA 3NKVA 3ZVRA 4JOQA 2J9GA 3WLRA 1C9DB 4HWOA 1VECA 2AMVA 3EYWA 1C8LA 5BW8A 2PKQP 4HNGA 4NCXA 2EGHA 3MTEA 4KPUA 4BP3A 1M1NA 2OC9A 3TQCA 1J22A 2MU1A 2I2XB 2XTNA 1RWVA 1RIIA 3QXXA 4MS1B 4R4JA 5J5VA 1JR3E 4OLAA 4MW1A 4JT9A 3RC3A 2LWIA 5LCXA 5J43A 3IPAA 1NQVA 3GV0A 3JD1A 1WDMA 5ICGA 1IBKB 1KJWA 2V9PA 5MFPA 4WKNA 1L2TA 5SZKB 3FOWA 1NRJB 4CT4B 1VL0A 3QU2A 2JHGA 3RT7A 3DFIA 1FRQA 4JBXA 3ZDBA 4LRUA 4G85A 2FOIA 2IF0A 4UUOA 5CB6A 2Z0MA 3NH9A 4R69A 1V11A 1ACMA 1P5JA 4FI3C 4H16A 4PYOA 4WOPA 1M6WA 2PV0A 3GRKA 3GYBA 2P35A 4MWZA 4A8PA 4Q1CA 1WB9A 1W4AA 2JGNA 3DC7A 4J7CA 2HFKA 3AVQA 3PE6A 4U4AA 1L3BA 2C9DA 3RVKA 1KP9A 4U3JA 2C2KA 1GT91 2GVZC 3UCEA 3L1JA 1ZXBA 4NH0A 1O0BA 2FG6C 5TSDA 4WASA 4DLZA 5B4UA 2YKGA 2REQB 4DM7A 2KX7A 1X86B 2BR4A 4QXAA 3OQJA 5DASA 3O2QB 5EUBA 1IRIA 1XZMA 5JTTA 2MINB 4LHEA 2PZGA 2VTVA 3Q1KA 4WA8A 3UATA 4A0QA 2JJ1D 2O2CA 3T54A 4P31A 3QVJA 3Q3GE 1OXBB 2K5UA 2H0QA 3MQ4A 1ZAYA 1BGXT 3BJZA 1RACA 1OA0A 4C0AC 4G5HA 1Q21A 2PQ6A 3SLKA 2FSPA 1I7QB 3IP7A 5CW1A 2QR5A 1DAGA 5AI0A 2ZJAA 4M9UA 1D0IA 3F3KA 1I6KA 4LUCA 3ZH9B 3LX6A 3JQDA 4G5RA 4I1YA 4QQRA 3P9QA 1GAXA 2P9EA 1TNDA 1UJ5A 4EPYA 5EZYF 5HXAA 1IOWA 4V3CA 1WWKA 4L0DA 3NT5A 3RYCA 1D6MA 1FRNA 3LP6A 2YYYA 4I08A 3UJBA 2ZPAA 1IJKA 4KBFA 1JF8A 1WSWA 3U81A 1JEEA 4EYSA 2BTQA 1JHPA 3O91A 4NBTA 5K3SA 4CM5A 1NVUQ 3KCQA 3ZZNA 1ULTA 3QHPA 1XTIA 1TCCA 2PT7A 4ESHA 1HORA 2HJSA 1ZNWA 5A9SB 1U65A 1FW8A 2IIVA 5CFPA 1G21B 1FFYA 3ZV7A 2A2ZA 2P9CA 2VF2A 4JI5B 3UUWA 4ASUD 5FPSA 3AI7A 1ECCA 2C5EA 4ZJPA 3I4CA 4GUDA 2IHVA 3TFWA 1C4KA 2C2BA 1ESCA 2BGTA 1C7IA 4GI5A 2OCXA 2YC2C 3ACBA 1ZM3A 5L4NA 4IRXA 4A8JC 5DOZA 2FQ1A 4KUEA 4OIMA 1ONOA 1JG6A 1PL8A 2A9RA 2WFMA 3OQIA 3P9XA 1ZIPA 1WZUA 3R1IA 1JQBA 4JC4A 4L8YA 5AM4A 4RMJA 2RGUA 1AKMA 4V3BA 5CT6A 4E2ZA 3IBCA 1ZD8A 4IXNA 4WIAA 5CFQA 3T41A 4CFSA 5IVDA 1E2FA 1R9NA 3G8BA 2BFEA 1VRWA 5GGYA 5TLSA 4RDXA 1TA0A 3FCAA 1JEAA 4CZ2A 2WPDA 2G8NA 1DG9A 4QDOA 4D3FA 5HZGA 3T5AA 2FUNB 3TOVA 2FXIA 2GZAA 1E79D 3QUCA 4H7HA 2A5FA 2C4MA 5KHLB 2MSKA 1OH7A 2XXAB 2IEGA 3L6CA 1L1QA 1G2PA 1ADFA 2V9CA 3MWYW 3RAJA 4CM4A 1V6SA 5TQJA 4RV4A 1ODKA 3J81k 4FD3A 1BN6A 2WE7A 2DQSA 2EBWA 2VHWA 4F5DA 2PLAA 2ODWA 3MTAA 3FTQA 5AVRA 1BXRA 1II9A 2O7SA 1VIVA 4OI1A 4Z5XA 1UDCA 2HSWA 5A4KA 1IAVA 2IOQA 1VHQA 2CKMA 3KJFA 3QBTA 4KIFA 1IBCA 4M0DA 4F4DA 1I2CA 4K28A 1L3IA 2BE7A 2Q3LA 3ANSA 4C7MA 4GR4A 3L5OA 1C14A 1YVPA 4MWEA 2A35A 2ZYWX 4BFXA 5EJ4A 4TTAA 1CUVA 2AOUA 2JS7A 3BAFA 3D1VA 3EGDB 1H8EA 4H3KB 4P34A 4D99A 2BSQA 1ZCBA 4JLPA 2D0DA 1I51A 4U6SA 2YZ7A 3ESYA 3LIPA 1EWTA 1UBMS 2QU8A 2VUHB 4CIAA 4W8HA 2PZEA 2FMFA 2JAQA 1GXSA 8ADHA 3AJ9A 2GNOA 3DNMA 4L0MA 2QTZA 3LLUA 2B99A 1FNNA 3M34A 4NY1A 1GILA 3F2IA 2ZP1A 1EFPB 2VJYA 3GFTA 3GAFA 2FEKA 4ALIA 1T8SA 5JALA 2OXIA 3BD9A 4IIVA 1UP4A 2CVOA 1YDGA 2R4UA 4IVNA 4KVFA 4XIIA 4FOSA 3ZNNA 1AUOA 1XEFA 2QZJA 3LKDA 4LE1A 3D6TB 5EIOA 1U2PA 1TF2A 3HBLA 1O87A 2CFIA 3V5NA 2VRCD 2O2YA 4MXDA 1ZVMA 1SBIA 5ECYA 1AO0A 3D6VA 5ALSA 5FWYB 5DTIA 2ZE8A 4DMKA 2JLAA 3DSRA 5K3BA 3KT3A 1CUJA 1OYYA 3UV3A 5JYCA 2XMPA 3QK7A 1MTOA 1J39A 3QLUC 5B1IA 2O5CA 1U99A 2WG0A 3P5BA 4DLVA 1CNMA 5KVAA 2HA2A 2Q5HA 1WCYA 5LKRA 1XPUA 1SXJD 4MKGA 4FPXA 4V1CB 3D8SA 3PF8A 2AMYA 1SOMA 1ICIA 5FOWA 3AU8A 2DUWA 3U13A 3L6UA 3T7RA 5BYBA 4JLDA 2GHTA 1OWMA 4IDHA 3N8KA 5DHAA 4BO7A 4TT3A 5KJ1A 1DIOB 2WP8J 1T5LA 2GN9A 3E3NA 2ZIAA 1WSAA 2D7DA 2X9QA 3IQDB 4AN1A 1SBYA 1JPVA 3ESXA 4FOPA 3WLAA 1J2RA 3QV1A 4YRRA 1RJWA 5D51S 4HB3A 2AYZA 2QK4A 1C50A 1ZCZA 2RD2A 3L7OA 4PONA 2QTVA 3PGKA 4JSYA 3GRRA 2HIAA 3WJAA 2CD7A 2EIXA 4QTUB 1ZU4A 3ZVNA 3MMPA 2IS6A 4EFNA 3SYKA 2VSYA 1DO0A 4QDXA 3AUYA 4W1PA 1EGMB 5TR9A 1FFSA 3UCXA 3JQ6A 2C3PA 3AVPA 3U44A 2ZM6B 4EG5A 1OXTA 1BEUB 1OAOC 1XZLA 2WHPB 3MELA 2VLIA 4GI7A 4RPKA 2WVGA 4YXWD 1A71A 4YJ3B 4OUDA 4XYMA 3AFMA 2J46A 3DL4A 5KAMA 4KPEC 4OH7A 4JLAA 4ZRDA 3K70B 1O96B 4HT3B 5H4HA 2KSQA 4JYMA 1D2HA 4URFA 5DOVA 1QVAA 3NEJA 1Q7EA 4TKUB 4FB5A 1JNXX 3SCZA 1Y1LA 3ZJVA 2PAFA 1UANA 1X74A 2O3QA 1YV9A 1IY0A 1YT5A 2VCEA 3LL4A 3P4YA 1N0IA 4AG6A 3KEOA 1BS1A 2XDQA 4BLTA 3TRJA 3CNEA 2DEUA 1QFSA 5D5QA 2VIIA 1P8JA 2WV7A 5F2KA 5L7WA 3S27A 4QXMA 2C61A 5HDQA 1L5FA 1GD1O 3IR6A 5JXHA 3NEAA 2Y1EA 1ZMOA 4FEEA 1PWXA 3K8ZA 1JFFA 3ZCTA 3MJCA 5M29A 1GGHA 3V7UA 4DB4A 4FD2A 1R6VA 3NUGA 4J90A 2JAHA 2OV2A 4CIBA 1C9JA 4MYDA 5K3FB 3QFFA 3LDFA 4CI9A 5JCPA 2R6ZA 2QJWA 3RD5A 5C81A 3D1JA 4BQSA 3Q11A 2YXNA 2WIJA 4MNTA 5BW4A 1OBHA 3RUEA 4LJAA 4Z86A 1FMJA 1CBUA 3ACCA 2C04A 2P2DA 5G53C 5IDXA 1G6KA 3IOEA 3ZQKA 4OMFG 1E61A 4Z7NB 1IEQA 3CIOA 4W5QA 4BAZA 2V97A 2GF2A 3ND5A 4DPMA 4QC2A 3UJAA 1U0NA 3ZVMA 4Q6WA 3QA9A 5ICSA 1PNVA 4QEKA 1LPNA 5C7OO 1YS7A 2WHRA 3ZWDA 3BB1A 1LTKA 3OFVA 1KDTA 3QPDA 4FJ0A 4X1YA 2OYCA 2BBSA 3LDGA 1C7JA 2K6GA 4RQUA 2LR0A 5E4YA 1IUKA 4LMPA 4U2CA 4CV2A 3ZLJA 4R1UA 1KH3A 3VR6H 4TL7A 4R9RA 1JAIA 4RK7A 3WSVA 3L8CA 4WW0A 4XD7D 2PZ8A 2ZT6A 4KCGA 1R18A 1EX7A 3TPCA 2YYZA 3U31A 4X94A 4BKQA 4KXWA 2HSZA 4MGIR 2Q6OA 4LF5B 1BGVA 1A82A 1LDNA 2HRDA 1DCMA 3ELDA 4IOMA 1B42A 4Q39A 2KI5A 4PANA 1OF1A 2Q4OA 4QLBA 1OLXB 2Z5GA 4KFUA 4URUR 3KB6A 1DX4A 3INGA 4NZOA 1D4FA 1QUEA 3MQ2A 4UXHA 2OFFA 4EDHA 4ZDIA 2WHXA 1AKRA 4GP6A 4GWLA 2VYVA 5C35A 5BY2A 2A9KA 1IB6A 5CBPA 1AF4A 1U3UA 4G0OA 1IWBB 2DHDA 2GXQA 3E1GA 2EWMA 3TTYA 3VPXA 1K5DA 2JZOA 4WCDA 3LOPA 4MVYA 2WQ6A 4KQFA 5B3JA 5EYPB 1VIMA 3BKXA 3INYA 4DPKA 5AJTA 4B75A 4D8WA 4Q7MB 1JR3D 4L4ZA 2O3RA 1L7MA 3HXPA 4B3BA 2NUTB 1FEZA 2VPWA 2WRZA 3WAKA 3OUUA 4MR9B 2O4UX 2W6CX 2FHPA 3I04A 5JSFA 3S81A 3TUZC 2AZXA 3B1XA 1OV6A 4NOKA 5HF8A 1R3DA 4IVQA 2AR9A 2C92A 5F7ZA 3HUDA 3JD0A 3ZVKA 2ODAA 3E4CA 1ZH0A 4L3VA 3PJFA 1NJ5A 3D4BA 2A67A 1VSUA 1ORRA 1H0HA 2BJHA 3EXG1 1QIEA 2D4HA 3GJRA 3KYJB 3PXCX 4AIIA 2HWWA 2XUOA 1UQTA 4ENPA 2FZGA 4YRAA 2JATA 1WR8A 1ZLXA 4HQ0A 3U4QA 4KPUB 3UJ6A 3X1DA 1IM8A 1ULSA 1M1NB 1PNTA 1WL8A 3D2CA 2OZPA 3FBWA 3K4HA 2ODEA 2Q8PA 2O7VA 4K81B 2NYAA 5IUNC 2JLUA 3FCYA 4ZT5A 2VJDA 5SY9A 4EKDA 4CNQA 1SQFA 4KH1A 4H2DA 4LXUA 2QTRA 4BXOB 1DLJA 4JAVC 1RCFA 4OXQA 3ZCQA 1XZ8A 4QYTA 4ARCA 1YZNA 2X8LA 1N2ZA 3AUFA 5DP2A 3N76A 3HSYA 5T6BA 3TX6A 1XHEA 3EZNA 1ORIA 1RZ3A 4RGVA 5KAPA 1T4CB 2CN1A 1V11B 1Z4QA 2VR1A 2BFNA 5EPOA 4OD0A 4PZZA 4XPZA 3UA4A 2CLHB 2DTXA 4M7WA 3BXGA 5BR7A 3NUZA 1F2DA 5LIPA 4TXJA 2E6KA 3FZQA 1GZUA 5DDIP 4ZVQA 2BD0A 3UMFA 1DXOA 2G07A 2A5DA 2PPLA 2WIBA 3LZDA 4D79A 2Z08A 5KQSA 4CTKA 3P2MA 3KTFA 3IEPA 1D2GA 3EOBI 4AP6A 4UASA 1EK6A 1E5XA 3FNQA 1EUDB 5DW0A 3ZIAD 2PUCA 4IOLA 1AF7A 3ID6C 1Y3IA 2QD2A 1KJ8A 2VHCA 3HG7A 3K0EA 4BNWA 3N0WA 4MWGA 4DANA 2RG1A 2YYSA 1MJ5A 2YIDA 4V0KA 4OFZA 1E0DA 1Y63A 2JI8A 4OA8A 1M2KA 1F6DA 1Y81A 1QQTA 4XPIA 5GMOA 4ES6A 3PC3A 2BR3A 1RRGA 4P7JA 4Q93A 4RFVA 3NHMA 1BE0A 2G40A 5IULC 4LV6A 5LQSA 3V4LA 4LOAA 5KCZA 1UJ6A 5JV5A 5EVJA 1M1ZA 1RQRA 2HB6A 1CQWA 3ZBUA 4C7VA 2A86A 3ZHBA 5J2TA 3SVTA 3AZOA 4NS1A 2GN2A 3RTDA 1PT5A 1JIKA 2AMJA 4XEUA 1AUVA 2WT8A 3D3QA 3I0MA 2H3EA 4XA8A 6Q21A 3FCOA 3LX8A 4OA5A 2C7RA 2XKBA 4TMTA 3UV7A 1PK8A 2QN8A 5MDHA 1E3TA 1QV7A 1RU3A 2Q4DA 3N7UA 3OTWA 5KHAA 3ZE2B 1AK1A 2QJTA 1QAOA 3H2IA 2IP4A 3U9TA 4PV7A 3OBBA 3O0DA 4BDTA 1CUXA 1OX6A 1KTIA 3VR1A 2PLNA 4PZLA 1XZFA 1ZQ1A 1C0EA 1V8FA 4TKZA 5ARBA 3ESAA 3FWHA 5CNMA 1Q91A 1Y7PA 3ZU4A 1G4HA 2HMSA 1NDQA 3I8SA 2P69A 5BSMA 2C4UA 4E70A 1DG1G 3M1LA 4NFHA 1B2RA 4OFWA 4DWWA 3FPGA 4R9SA 5CFOA 4IY1A 3TLYA 1OCEA 1HQDA 3OQIB 4HLNA 1LQUA 2ATEA 4NMLA 1LZLA 1L4FA 5K6RA 1PUXA 2OHFA 2QE7D 3DWFA 4LWOA 3H5IA 4FXPA 5K8VA 4Y6LA 2R1UA 3T3IA 1M72A 1CUEA 5BVHB 4C2BA 1TM2A 3TINA 1Z08A 3HDYA 4L76A 5DNVA 1CB0A 4R05A 2X8WA 5BURA 5IAKA 1QFJA 1QORA 4C3OB 3CZQA 1TM3E 1ADBA 2C97A 5B3AA 4CU2A 4G23A 2JH9A 2AOVA 3ZCSA 3NZEA 1YHZA 3AVVA 3HO8A 1E9FA 4WL0A 4ZEVA 1E18A 5FBRB 2B2XA 2UYHA 1G8JA 1Z8NA 4Q9LA 4JLSA 2BRUC 2XNSA 5EMJA 3S1AA 5DW3A