3WE7A

Crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Expression from engineered Escherichia coli chromosome and crystallographic study of archaeal N,N'-diacetylchitobiose deacetylase
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 3we7A00
3DFFA 3WL4A 2XADA 5B2EA 3DFMA 3DFIA 5BMOA 1Q74A 3DFKA 4XLZA 2IXDA 4EWLA 4XM1A 4XM0A 2X9LA 3WL3A 5CGZA 5B2FA 1Q7TA 3WE7A 1UANA 4XM2A
chains in the Genus database with same CATH superfamily
2VDUE 4U02A 1NBWB 4G26A 3RIHA 3FTFA 4X63A 1AHPA 1Q7EA 3NHUA 1JDBC 2KWIA 3O95A 5BSFA 4W5OA 3HVHA 4RDHA 1J42A 5KQPA 2GASA 2Q50A 3M6WA 3SF8A 4BB0A 4YAKA 3GLIA 1N5LA 3DL0A 4CWAA 5LQUA 5GIPE 1H6CA 1JDBB 1RHRA 1TA4A 2R751 3K5WA 2FPOA 1G0NA 4CM6A 4MQ6A 1JDZA 2QMUA 2P9TA 2OD9A 1SQ6A 2QZ9A 3HDTA 1TK3A 1CVRA 2GGSA 3IR6A 1SKUA 1QRAA 4D42A 4EPTA 2K2QB 1VRCA 3RWOA 1HEYA 2ZPUA 1ZRSA 5JAQA 4P33A 2YXNA 4RKYA 3WXMA 3D8HA 2R79A 2R62A 3T8YA 3CISA 4UUBA 5I7AA 1RHQA 1CU1A 3T3GA 2EC5A 2HFJA 1KI8A 1OD6A 2XQVA 4NHOA 1CR0A 1ZW1A 3COSA 3SF0A 5ITZB 1WCXA 2AOVA 3MXOA 4YMVA 3HJBA 1PGJA 1H66A 3CZ9A 2BJWA 4IG9A 2R4TA 1XQXA 1E7WA 3BUSA 4JC8A 1AV6A 3TNYA 4ZCSA 1E61A 1MEEA 3I0MA 3EVNA 1M33A 1XLUA 2Y6UA 1B42A 1TLTA 1MT3A 2YWCA 3LRXA 3TVDA 1XCPA 4B71A 1ADYA 3VHQA 1V9CA 1YQXA 2GXQA 3PNMA 2ZZMA 1KYQA 1ZP6A 2E37A 3CR8A 4OXNA 2O07A 1R4MA 4QU5A 2HI0A 2YUTA 2XXAB 4HHEA 4LI3X 1ZD4A 5CCBA 1SA0A 2XF2A 3ORFA 4BGVA 4RQAA 3KK0A 2W2NA 4F4JA 4A8JA 4K0KB 3DTYA 2YYAA 2JH8A 2VZ8A 4OV6B 1MLDA 1XYVA 1EFAA 5HDBB 3MGBA 1PX2A 3SHOA 2OGUA 3E9EA 3O74A 4CM3A 5JAPA 1BDMA 2J07A 3UJDA 4AI6A 1LLCA 2V0NA 2ZTHA 2J09A 1OLXA 4NMLA 4JP8A 1PWHA 2G8LA 4QICA 1TTPB 3FM9A 3ND5A 1IVNA 3QUCA 3RJMA 4FGKA 2GEFA 3SXUA 4E7PA 1HGXA 4CTMA 5IDWA 1JA9A 4CIXA 4EQ6A 1PJQA 1PR9A 3IEPA 3WQBA 4PFQA 1C9DB 1EUDB 1QIHA 3PKIA 1V6SA 4GOKA 1SBHA 1JEDA 3Q3EA 1T9CA 1JR4A 4QULA 3WL8A 3FHLA 4OJKA 3GRYA 3WZMA 1MPTA 1JDPA 2X77A 4OHOA 4Q18A 3R7BA 2KLHA 2AG0A 2P3QA 1Q16A 3UW3A 4RPCA 1DKPA 3OWOA 4G8BA 4P83A 1SXJB 4ALKA 3K1ZA 1TECE 3C8UA 4XEHA 1T6NA 2LCFA 1HL3A 1W85B 4B73A 2TMDA 4MGYR 5TQVA 2XUPA 4TWIA 4OHUA 4DC0A 2XZLA 1JEEA 4AO6A 3ENZA 2V4UA 4R1UA 4FFVA 4ETNA 4C2UA 3WSTA 5KQSA 2SHKA 3NTVA 3W9YA 2XITA 3IVAA 3EEYA 2ERCA 4FGJA 4M38A 1S3SA 3A1EA 3OU2A 4MRMB 4TWJA 5B6PA 3C6XA 3FX2A 4J0HA 2FEWB 4BQOA 4PYNA 3QUBA 5FR1A 4G81A 4UTPA 4JLWA 3WGGA 1DX9A 1P39A 4N3NA 2VSNA 2ZJ2A 1GUBA 3H6KA 4AYTA 4UREA 4ZKDA 2O2ZA 2GM5A 1RLJA 3OHPA 2HLDD 3HB5X 4L3WA 5ALWA 5E7MA 1GNSA 4FLFA 1ZVQA 3DEAA 4IDNA 4MR8A 2Q3FA 3FETA 2X9QA 3NZEA 4LXUA 4DDVA 2CHGA 4IOJA 4QBKA 1E9VA 1XI2A 2IBSA 1N36B 4QU0A 1EK0A 4A23A 2XYRA 4Z8YA 4PCVA 3BM5A 4ZZ3A 1X13A 2BW0A 3NCTA 3PJFA 5CT6A 1P0IA 4CNBA 1V7ZA 5JS7A 3DYVA 2XKKA 1GN8A 3X1WA 5LP1A 3LGAA 3TINA 3A11A 4BO6A 1M8PA 1OJ7A 4MTLA 5ANRB 4AFNA 3MPOA 1ISRA 1TGYA 1RDFA 4R51A 1L8OA 5EIBD 3ZDFA 4EQZA 3ETCA 2C99A 4URFA 1P9WA 4WMLA 4O59O 4AG3A 3SS8A 1N2CB 3P5BA 5EE9A 4QWWA 2YIJA 4OLAA 4Z7QB 3GYGA 4UVHA 1GHTA 5AW9A 4YI5A 5FUVA 1WB6A 4CJXA 5GJVC 1L4KA 4ZQIA 1RD4A 4RDXA 1GM5A 2C7PA 2X8AA 3LPMA 1ZM4A 1C80A 3D6JA 3NH9A 1KBOA 4RHCA 3SR0A 4MI9A 3T1QA 4LF4B 2B6NA 1AHIA 2BFDB 2LWIA 3CG4A 3K20A 1U7XA 4US0R 3VBEA 3AR2A 4HQFA 4GBMA 4G9GA 4IUYA 3SR4A 1Y9EA 2PIAA 2CMHA 4LE0A 4RFVA 2V54A 1YL6A 2UYCA 2DUUA 1SBTA 4M8SA 2IDZA 3CRNA 1EVLA 3B2QA 3H9JA 1G3IA 1BXRA 3UGQA 3U3XA 3ZWMA 3OBBA 3D8UA 4OA5A 1QQTA 3EBPA 4AJJA 1HNXB 2QE7D 4OIFA 3A4TA 1A9ZA 2HEGA 1E3EA 3KWFA 5CB6A 3IC5A 4LNAA 4PPGA 5AUOB 4JLMA 3BXOA 1M1UA 2WV9A 4DTCA 5H3LA 1Y8CA 5U4XA 1PS0A 2Z2YA 1UQRA 2NTYC 4Y6RA 3PRHA 3EZYA 3QJGA 1F20A 3DBHB 2C7OA 1EAMA 1FW8A 1COZA 3PXGA 1UP7A 1W5EA 4F72A 3M5PA 3HJCA 3ZNQA 2CHVA 2QL5A 1N5IA 1YZFA 4RK1A 1DE0A 5KYXB 3EUWA 4FSXA 4XGIA 1LJLA 5ALNA 1LDBA 3UAGA 3F6YA 4I46A 2YZGA 1CJVC 3QWFA 4N6NA 2QBYA 1WS6A 3UWMA 5CD1A 1HPLA 1HMPA 3FCUB 3OCVA 4LE1A 3BA6A 3SEZA 3SYRA 3WGYA 5KWJA 2Q28A 1ZA2A 4DV0B 2AUMA 3QVGA 4FNAA 3OLVA 1GWNA 1SIOA 3E8XA 3NIGB 6YASA 1IBLB 1PL8A 1UJ2A 1LFDB 4KV7A 1T5IA 1Q2XA 5EYPB 4X0EA 3PR2B 1KE1A 5ADHA 2D8AA 5DE3A 4N6OA 2ZUCA 2CNDA 2PJUA 1Q7BA 3T3PB 3QZUA 4MV0A 4AECA 1NI5A 3DMFA 3KZCA 1J8DA 2X2EA 3K1AA 1KO8A 1MG0A 4K87A 1GP2A 2ZJBA 4HJRA 4PICA 5IN4A 2VWQA 1CK4A 3Q7SA 1C9NA 3WJ2A 1ZNXA 2X7JA 3Q15C 3PXEA 4L51A 3GU3A 2FOIA 4G9EA 5FUBA 5KNDH 3L1HA 3SJZA 2AR7A 3A6LA 3WIUA 4BE7B 1UMBB 5C80A 2FQQA 4KXFB 4URHA 2IEAA 3H2SA 1P7CA 3BREA 4OYRA 3ES9A 3TRJA 3DCJA 3F6SA 4L9SA 3VDRA 4YRIA 2B2XA 1PLLA 1NF9A 5EI5A 2P9HA 5HJ5A 3Q1KA 2FMUA 2QROA 4ACAA 1DZIA 5CA1F 4PAWA 4D6YA 2WWFA 4CDMA 3GFPA 1AKQA 4K9RA 4WNIA 5ESDA 4JROA 3QLVA 4DZZA 2G1AA 1EXVA 2XUJA 3U40A 3HJUA 4G23A 1TZJA 3ESRA 1H9CA 4JA0A 3K0EA 3FUXA 2Z56A 4FCWA 1SMKA 5AJXA 4D26A 9MHTA 1AS2A 1FUEA 5BN5B 3UK7A 4ESHA 1DQRA 1FSPA 1ICEA 3ZNNA 1IFXA 3D2CA 4YRSA 2AJCA 4FHZA 3PUVA 2P5TB 3VKGA 5JCOC 2BEVB 4AJLA 3DLAA 3KYJB 3QYAA 4LOJA 2IE0A 4ARCA 3M2PA 3BSWA 3V6MA 4C0WA 4UDOA 3O47A 2HHJA 5EIWA 4KRGA 3ILYA 4M7WA 3ERCA 4G0YA 1UPTA 2SECE 1T5OA 4AJ9A 1XR3A 2VJAA 4E5YA 4NEGA 4WL0A 4ZQEA 3WLTA 1G4UR 1U81A 3VAAA 4JJ6A 1O08A 1LDMA 3IVMA 1PQUA 4AQDA 4ZD6A 2BWJA 2XWPA 4IICA 1PFVA 2H2WA 4CUZA 3PNVA 3MCUA 1SUBA 2JJ8A 2IUTA 3OJXA 5EUQB 4N9WA 4CG1A 4I7EA 5EQDA 1H42A 3F4KA 1CZHA 1R9JA 3C1UA 2PWBA 1W9HA 1H05A 1N9KA 4C3UA 5LSAA 4A0SA 4E07A 3CWCA 3LDGA 4L5JA 1OIXA 2X9VA 3GEBA 4XOUA 2WFMA 4I9UA 1Z6ZA 3UWDA 4ZO7A 3PRJA 3C3AA 3R23A 3ZI0A 1QMGA 16PKA 1CTQA 4HEHA 3AUAA 4X8HA 3TUZC 1QP7A 5LD2C 1PBNA 2ZI5A 3OZCA 4FFDA 4OQ4A 4UNQA 5K0CA 4KGVA 3VR4D 1U8UA 2JGDB 3NWEA 1QPZA 2B8WA 3UIEA 1EK5A 4K86A 5ALSA 5SV2A 5ILOA 3A7DA 2R47A 3IHKA 2C9OA 2NPOA 4NABA 3I5YA 5DNDA 5CNMA 1NFFA 1LSSA 4E1VA 1HDIA 1OF1A 2RMKA 2O8DA 2PIDA 3L4SO 2RB4A 4PYMA 1V9SA 1KAQA 1XDZA 4E46A 1WKVA 1K8RA 3T61A 2B1QA 4DXAA 1Y48E 2VK4A 1FUKA 2DFNA 3A1UA 1NDQA 3STUA 1NR1A 5DXJA 1G6OA 2AJ8A 1V0JA 4OYHA 2JA1A 3BORA 4IILA 5GOZA 3ZD9A 1HG0A 2NNLD 1K7CA 2WABA 4UAJA 3T5TA 4B3XA 1P8AA 5HKKD 3E9ZA 3SQNA 1HDRA 5E7JA 2YJTD 4M9CA 3I58A 1M2NA 2V8BA 4KIFA 3USZA 2ZCVA 1W47A 2CLEB 4A03A 1GPBA 4DA4A 5AW4A 2QMQA 1UM9B 2XPCA 2YHBA 3U4DA 5KNDA 1AMOA 2G06A 4PG8A 5EHQA 3DL2A 2X5OA 3PCTA 2ZJFA 5JY1A 3B52X 3O9MA 2R5WA 1TM4E 4YS6A 1ZIPA 5KNBD 4FCTA 3QEMB 1FNCA 5B7PA 4B9EA 3AINA 4I3GA 5ERXA 4GP9A 1K7EB 2CB0A 4HLUA 3ZJ4A 4EA9A 1I24A 3ELUA 3SKVA 2HO5A 2WICA 4PNEA 3UMJA 5IN5A 5P8WA 3I5XA 4A0RA 3SC2A 5FEUA 3QWBA 2V96A 3JD0A 1N2BA 1O95A 4IIDA 1ABEA 4GPAA 1QHXA 5C2JB 1XYGA 1COWD 1EJ2A 3KQVA 4EKYA 2RGUA 2I67A 2Y0PA 5CDYA 1N5MA 3GDOA 5BQ5A 3K31A 1K7XB 1N9GA 1XKLA 3KZOA 3PP8A 5EMJA 3ZZ0A 1BKDR 1UT5A 1FP6A 2XZDA 2PUJA 3OQHA 4ZYLA 4O29A 3HKBA 5IP5A 4D4JA 3ZBPA 1DKMA 2ABWA 4GBJA 4Y2YA 3R5JA 3TM4A 3NX4A 1TT5B 1UXIA 2E4VA 2ZR9A 3QF7A 4DGQA 4FHFA 4LTDA 3K30A 2C4NA 4Q3CA 1YB4A 1JJFA 5DVZA 1XCJA 3EGEA 4DDKA 5EGSA 1RWKA 3VPSA 1TPYA 1OMOA 1N0IA 2J4DA 1W5TA 2NAPA 5M34A 4RW0A 2VJPA 2RHGB 3H5AA 4QOSA 3SNKA 3T94A 1KYZA 4HDCA 3T9DA 2ZATA 1A9OA 4N8EA 2N0SA 3T9CA 1RJEA 1SD2A 2P2NA 4PC6A 3W77A 5K20A 3O94A 4UW9A 4XWWA 3DM9B 3NUZA 2QL7A 2B69A 4DR4B 4P84A 3BC1A 1SXQA 2I1VB 4JVMA 3LLVA 1T3ZA 4KGZA 2RGWA 4WSOA 2XVYA 1PNQA 1V1RB 2VZ9A 3OF3A 1H9BA 2C4WA 1I4EB 3V1KA 1EKXA 1K98A 3H5IA 4BNDA 1O3YA 1Q12A 3I2FA 3E3OA 2QJTA 4XB2A 2EW1A 4LXQA 4OSOA 2QYTA 4YAJA 5CNIA 1K4KA 3A37A 1JKFA 1TQ4A 4N0QA 1HDZA 2PS3A 2VFAA 1U2QA 2BMFA 3AJ8A 3C3MA 3PC3A 2NXCA 4Z7NB 2WF8A 2CXOA 3DCYA 3QEJA 2UZ1B 2XI4A 5KINB 5EP3A 1XPOA 5EJAA 2X42A 1QJ4A 1QMPA 2DLDA 2V9PA 3MJDA 3I6ZA 3ZVRA 3ITKA 4XX0A 4EAAA 3JQAD 1U7ZA 5CTJA 1YVDA 3AY3A 4ZXPA 3UJ9A 4FE7A 5BUQA 1HL7A 3EXHC 5JANA 2Q4TA 4NYIR 1Y5NA 2C2OA 2HF2A 4PZEA 5T3YA 4D3SA 3H8WA 2V7VA 4TL9A 5SY6A 2XGJA 3LWDA 1VLQA 4KLRA 1E63A 1Z75A 3DAFA 4B5LA 1SUWA 3RSFA 1L4FA 4PLPA 1ORDA 1YS7A 2Q5FA 1NU6A 4JJIA 2WKRA 2Z9CA 2NSJA 2XX3A 2ZYGA 3AHHA 4UE6A 4XWAA 2NU8B 1NYRA 1NBIA 2PD4A 2QW8A 3P0IA 4Q34A 1CY7A 2VHQA 3HVIA 5EJGA 3EGVA 4OHMA 1JKMA 3DEHA 3K8OE 2A4KA 2W93A 3GFRA 4JBWA 4RWZA 5K9ZA 2JCVA 4TXHA 3PITA 1JMKC 3TQOA 5B64A 3GJQA 3I9LA 3OE5A 3IMFA 2LCQA 1ETHA 3WJ7A 3PBKA 4HDOB 1LLDA 3TNDA 1HE8B 2QX6A 4ZYYA 1KF0A 2JBAB 1E9RA 3QU2A 3BQMB 3OZIA 3K2BA 4E5SA 1F5NA 4OH7A 3RTAA 1LPOA 1ABBA 3H6HA 2DB3A 3KLNA 2VHEA 1EX9A 2XE8A 1I7SB 2AG1A 1D2NA 2BMDA 1IAQA 1EQAA 1GADO 3M6VA 5FAXA 4BV9A 4I4TA 3IO3A 5CB8A 4PLFA 4KO8A 2ZU0C 4GE3A 3C0KA 1CE8B 2QGFA 3QXXA 4UQPA 3IULA 4WECA 3FWKA 3IVXA 3IUNA 4KXMA 4EHBA 3A6ZA 3GUVA 5CJJA 4HVLA 1EX1A 2EQ5A 3WGJA 1AKUA 5AVTA 1EBUA 2OHHA 1IBSA 2AI3A 2QPAA 2IEGA 3O8QB 3OEED 4ANFA 1EE2A 3HEMA 2F62A 2O2CA 3HYSA 5LP6B 3HR7A 2ZW9A 4RE6A 5H68A 3VR3D 3R7WB 1LWNA 3EK2A 3E7DA 3DBOB 3GD5A 3VGPA 5KTSA 4MVJI 5J5VA 2GFQA 4DM4A 1AUXA 2FZCA 2HXYA 2DLNA 1QE0A 1LLUA 1QVAA 1S0UA 1KO5A 1B6SA 1JKJA 5HS6A 2C9DA 1E8MA 2BFOA 4P5PA 2J3JA 4LQCA 2ZK7A 1Q0SA 2EFEB 1EA5A 2EL7A 2VDKB 1YQTA 4EKEA 4DA7A 4OJTA 1AC5A 2MR5A 5ADUS 1LTHR 2DX7A 1ODKA 4GVPA 4JLNA 3SK0A 3HB4X 4YT8A 5KSYA 1Q0QA 3CW9A 3ZY6A 1FX0A 2QI9C 3FOFC 2HIAA 1S5PA 1Y1LA 1ZD3A 2FJUA 3HU3A 3KCNA 2O6LA 7AT1A 2VXBA 4JT4A 2VQ6A 3IQFA 5LZ2A 3DLTA 4Q3NA 4CN9A 5CBPB 1ZN7A 2FN8A 4HNAB 4TLBA 1NVXQ 3ISJA 3NWOA 1KKUA 4N03A 3M9XA 2O5RA 2IV7A 4H16A 4PLVA 1OVGA 3DOHA 3SWWA 3IA7A 1XLTC 3LECA 3LPNA 3TSYA 4AD8A 4H3VA 1GOTA 3K0BA 1W34A 1G60A 2FPGB 3LDHA 3NBZC 3R44A 5A6SA 1Z5WA 2CBZA 3IIJA 4B4OA 1TEVA 3DMTA 1QV7A 3KQLA 2GZ2A 4M98A 2ORIA 4JK3A 2WHRA 1QGYA 2V45A 1MJGA 3CBGA 1JZTA 3W5IA 1I6WA 2ODPA 3ZV5A 5AVYA 1IBKB 3U13A 4BMVA 2QN8A 5CFRA 1N6RA 3I3SR 1NG1A 4M1TA 1P1KA 4BMXA 1S3FA 4IJMA 3IVCA 3NG1A 9ATCA 5INTA 4NJEA 4UULA 1YI0A 4GQAA 3OZAA 4NENA 4RMGA 2BFFB 4LG1A 1K92A 2NLOA 1A4RA 1F6DA 1H8EA 3G0CA 1Z06A 2QAIA 3N5CA 3ZTWA 1BQ3A 1TC1A 2J3QA 1MJFA 3TLCA 3AEUA 1D6MA 1SHJA 3BF8A 1U90A 3KLPX 4F8EA 2QMHA 1A4UA 1X9IA 5IC6A 3VX3A 2HK6A 1AB5A 1R12A 3MQ2A 2ZQ5A 3DOCA 3CX7A 2XSZA 3AJEA 2FNAA 2RI6A 3OWXA 3MTAA 5CRIA 2F2TA 2IU6A 2ZFUA 3FVTA 1ZITA 1F4VA 2PSDA 3LM8A 3Q7PA 2VH5R 2OXTA 4EUNA 1V3UA 5KYTA 4MO9A 1L2TA 2RJ3A 3NVAA 3UOAB 3GMIA 4J9VA 5KCZA 3VO8A 4BQIA 1KAOA 3K9QO 3ROXA 1M2JA 3C6ZA 4Q9HA 5JTTA 4GL4A 2C3UA 2RK4A 2M2IA 1PR0A 1PVOA 3WMRA 3GEGA 1UBJS 4OP3A 4B79A 3PFWO 5ALTA 4RFLA 5LLSA 2DPXA 4RTSA 2GBCA 4XPIB 2IXFA 4LRSB 3DHWC 4WZBE 1EXWA 4WCFA 1OWOA 3SBEA 1H2WA 2HADA 5AYVA 5LDGA 1OXTA 3TQHA 4CLDA 4JODA 1U1CA 3BXGA 4UEKA 5TRTA 4QNMA 3ZUPA 1SXJD 2W6ZA 3SZ3A 1HDEA 3CGWA 3ZV3A 3ER9A 3ON5A 3C15C 1N0HA 2RGNC 2P68A 4OI2A 1RMTA 1WJGA 4MW5A 1YAHA 2F17A 1VQ1A 3SE7A 1R64A 1E6WA 3USCS 2EJWA 3RC2A 4MW1A 4MTCA 2VN8A 4NE7A 3FWPA 2JIMA 4NU0A 2N3ZA 4RYDA 3UZUA 1G0OA 5KX5B 1AZTA 2NT4A 4YAWA 3BD6A 3D3QA 4HUJA 3VU0A 3TO5A 3LYUA 3MTQA 4HH3C 4NFSA 1UC5B 2E4AA 4FD3A 1PR6A 3ZDXB 1FDOA 3ZK8A 4XUDA 5F64A 2B7LA 1THMA 1VGRA 4PQFA 5SZKB 3OFVA 3B6ZA 3G5TA 4KXLA 1T0BA 4MIKA 1G2IA 2J9GA 4XXHA 3S2GA 4F0JA 4NY1A 4G89A 4A4DA 2E5WA 1I1QB 1TXGA 1JHXA 3NJ8A 4DNXA 4QOHA 1LPNA 5LYJB 4ZT5A 4KQ2A 3AVVA 3DF9A 4QPCA 4C6HA 4H17A 4D3ZA 1XTRA 1IYZA 2XECA 3ZLTA 2EKZA 4DCVA 2NACA 2QM8A 2BCJQ 2V59A 5JAOA 3K4PA 4NL4H 3BT7A 5IZCC 1YMVA 5FNVB 1QKIA 1KEEB 4YR9A 5AQ1A 4R68A 1GNPA 4CNQA 3O9ZA 2GZHA 4RPJA 2EBFX 3ZCRA 1IIBA 3CPHA 3K2EA 1KY5A 2Z9DA 4D81A 5GP1A 2Q7OE 2C3YA 1W581 1L5KA 2IZZA 3PFIA 1EGVB 3BTUA 3CUKA 1U1DA 3L7KA 3BJMA 5TARA 1XALA 3G2QA 4WW0A 2WLSA 1XRJA 3OPYI 1ESZA 3QXJA 3S2YA 3OIWA 1G5RA 4EBBA 5JO0A 3SQOA 2UAGA 5JY6A 2GOYA 1NZJA 3DE1X 1OILA 1I0IA 2GAJA 2IRWA 2V7UA 2OXFA 3K73O 4PSUA 1PYDA 1IEWA 4LTMA 2E6KA 5C8ZA 5EWMA 4CKEA 3PV0A 5EQFA 1JHOA 4PRZA 3GCXA 5A2GA 1NLUA 1E2DA 1EFCA 1Q83A 3H5TA 4INAA 3WWZA 4EUKA 5ADVA 1SULA 3GLHE 3X1DA 4LJ4A 2CXSA 3UK0A 1G17A 1BZYA 2B3TA 3N3AC 3VO1A 1U98A 3TFWA 2HU8A 3VYTB 4CUKA 1FJXA 1Z0FA 1XN1A 1DBWA 1X80B 2BFMA 3M3DA 2W2QA 1XV5A 1PTKA 4X00A 4JOQA 1I3KA 4L57A 2XCIA 1HXHA 1Q20A 3O6VA 2A9PA 5IMBA 4BYGA 2P8JA 2W83A 1MO5A 4GM1A 4YC7A 1DWUA 2YC2C 2GHTA 1RWXA 3FKQA 3U2QA 2MSCB 3MYRA 4RM3A 5HWSA 2JI9A 1H4VB 3J80A 3OX2A 3SFVA 2H18A 2QLBA 3LWNA 1JWLA 5KTPA 2RIPA 4H7HA 3TXYA 3H65A 1ZIXA 1ZIOA 3CUWA 5TMDA 3WTBA 1X7XB 2KQUA 5IYZA 4G1CA 1DINA 2QS9A 1FDSA 2VDWA 5E6UB 5ED4A 3RIMA 2B4QA 5IW8A 5JI2E 2HRCA 3U1TA 2GYUA 5A5GA 1OXSC 2A67A 1RSZA 5I6DA 1IJFA 2CFSA 3PE6A 1AF7A 4MQFB 4NOLA 4AF8A 1DJLA 4DCMA 1CY2A 2IYNA 3I9MA 4J7CA 4LZJA 1TPZA 1N92A 4W4TA 3WZ2A 4AMVA 1WTCA 4DCNA 1EAYA 2BBWA 2BM8A 3PFCA 1ST3A 3IOMA 4Y8VA 3L0PA 1QYVA 5DM60 4B3TB 1VHQA 1KPGA 3FN4A 2X8WA 4WXMA 5BWOA 5JMWA 3CVVA 1CERA 1E1CA 2GSDA 3FYUA 2X4IA 2LZ0A 3UPDA 4RA9A 4B2LA 5K0FA 1FRQA 2Q49A 4AY4A 4DPMA 1M2OA 2OT3B 2I4OA 3BJRA 4Z4CA 1YCDA 3FPAA 2GH1A 3QU5A 1WXFA 1BG6A 2WZBA 4LVUA 4EY3A 1UZNA 2E89A 1Z5GA 3N2GB 4G5GA 3M6FA 4FYYA 5TMEA 4L4RA 1DRWA 1M8JA 5HCNA 5ILQA 1JIQA 4HVAA 3SZRA 5LMCA 1CQIA 4FYJA 1YR8A 1OT5A 1AGRA 1EBBA 1GPKA 2D5AA 4RVNA 4QM6A 1SBQA 2GPBA 4JGBA 2ZIVB 4RXMA 4YXFA 1K9SA 2WINI 3LLCA 4HNVA 3WDMA 4QEDA 3MRVA 4DMCA 5ARBA 2VCHA 2YYSA 4YT2A 4G1MB 4KR0A 3Q9SA 1Z4QA 4HGRA 2ZQYA 3ZC3A 5DTRA 1WBJB 3E81A 1RBQA 5A0FA 3SHQA 5BMOA 2WSBA 4ZALA 1FU7A 3L0ZA 3CF4A 4RF2A 4WIAA 1E20A 2PBZA 1T34A 2QJOA 2WNIA 2Q5OA 3B5JA 3O9VA 2OO5C 2G82A 4TMKA 1GRQA 3MB8A 4N3GA 1R15A 2G7MC 4WESB 1Y6JA 1Z0IA 2HMVA 3BILA 1CDDA 4E13A 1SCIA 1U9IA 3K96A 3O0DA 3R24A 2FSVA 3SNHA 3TG8A 4UAGA 3WSWA 2XDQA 4UCWA 3SXPA 2WG0A 3OEHD 3IL2A 1V8DA 5CT4A 3GMTA 1VHJA 3JYNA 1YVRA 3MELA 4HNUA 1UPFA 3G02A 5K3FB 2ZR8A 5T8KA 2AMVA 2F1HA 1MX3A 2CSXA 1A1SA 2VOJA 3G2PA 4EGSA 3P9ZA 1HZZC 1QK4A 4N3CA 2VQDA 4OLHA 4DF3A 3H1PA 1K68A 4MDFA 2PEYA 3BSYA 1Y1TA 1ZCZA 2H2GA 2HPVA 4HAUA 5EXXA 2LR0A 2E5FA 2VAVA 2BMAA 3KP1A 4Y7CA 3V3KA 1LEHA 4A8JB 2NV6A 3MMNA 2N46A 3ETGA 3RABA 4UTRA 3AF0A 4Z1MD 1DAMA 1PT9A 1VYHA 4S0ZA 1Z7BA 4OGKA 4FGSA 4GMGA 4AF7A 1O97C 2J6HA 2VAMA 2YQ4A 4BB5A 1MUUA 3ZVLA 5KYYA 1WUTA 3K09A 3NI2A 5DOVA 2PZEA 3IEKA 1C7IA 3IQEA 3OKAA 4K2HA 3WYFA 1SB8A 3INRA 5GV8A 1Z2OX 4KQ6A 3LG2A 4X8LA 1BMQA 1WG8A 3UG7A 2B5VA 2NTEA 4HXEB 2XUKA 3HKEA 5JALA 1Y6FA 5JEDA 3NOOA 1AZSC 3IAS6 3BD8A 5DASA 4EQ6B 2QPOA 1ZMRA 1V7QA 3WAJA 4I2VA 4AO7A 4IRMA 2AG8A 2VTVA 2W4QA 5EFZA 5FKJA 2NZWA 2XY4A 1M83A 3D59A 3KVVA 3GJ8A 2BFPA 4Q37A 3AR8A 2D1SA 2WZDA 4B7CA 3CVYA 1URPA 3OOEA 1WEHA 5IDYA 3ZVMA 1F8XA 3CCFA 1U7DA 4EW6A 4B17A 1S02A 3KUUA 3HSYA 4A8TA 4BGEA 2FR8C 5DHFA 3S44A 2YN4A 3QKUA 1W36D 5ETJA 1ZAYA 2JGAA 2IFTA 2H5LA 3MJRA 5EWLB 2OGWA 5MGBA 1FP1D 1DRUA 3FSGA 3E15A 4H4EA 1UPCA 4JGGA 3GPCA 4DCCA 4GPTA 1M5UA 3PCXA 3PF8A 4GI5A 1IM8A 1JQ5A 4ZAXA 2P3LA 3L0SA 4IXTA 5CLIA 2I03A 2KW5A 1U5AA 3NYWA 1CDOA 1OBHA 3QW2A 4TSFD 1TM2A 1Q1BA 3CTPA 3PQFA 1TLFA 1GRRA 4MR8B 1A5SB 3BSSA 3WKBA 4C7VA 3EXIA 1AXEA 2QRMA 1MCZA 1SQFA 1YNSA 3UH0A 1GAWA 2W42A 2VO1A 2C4UA 1XPRA 2FHPA 4MUJA 2CW5A 4RMHA 2SCUA 3IUSA 1Z26A 1VFPA 2LD4A 2W2KA 2ZBUA 1IEQA 3BQNB 2ZT8A 3C45A 4R83A 2WJJA 3GJXC 2WAXA 4JDUA 4UMDA 3ZZUA 3KCQA 3DLPX 2JS7A 3EY4A 1ZMBA 3K0KA 3NRBA 5C0OE 2D06A 4AY2A 1FNDA 2VP5A 2Y1GA 5F5NA 4FCVA 3A1TA 4X1OA 1K3FA 3R3ZA 2CMDA 3R7NA 1Z2EA 4RVCA 3HBAA 1VP9A 1AK9A 1E7QA 1FYFA 1VCNA 3AUYA 5EOVA 5JWHA 4B3SB 2B4RO 5ALVA 4LYHA 5BVHA 1F38A 1WMEA 3P9SA 4BAZA 1A82A 1I8TA 4YMWA 1G7RA 2IWRA 3D4PA 1JG6A 3KOUA 4ID3A 3QVLA 4O4JF 3AXTA 2GPJA 4MV1A 2HBYA 1IBCA 1LDEA 3Q6IA 3NP7A 3TL2A 2BY4A 2F1IA 2VSQA 1NUUA 1G2OA 3N8NA 4FE4A 4G4JA 3KSMA 3KXIA 2HMTA 1JXMA 4Y18A 1WF6A 4Z9AA 1S6YA 5EKUA 2G9UA 3N2LA 3I5AA 1D8AA 1PGNA 2A1IA 3PPVA 4GKBA 2VCEA 4RESA 4WOPA 4XA8A 4ALNA 1ZCAA 2G4CA 3OZWA 4REQA 1GILA 3DVAA 2B5OA 2XE6A 3MJ4A 2X1MA 3LY7A 3MJVA 5JQGF 4PV7A 1TJYA 1FFHA 4BJ1A 4FMCF 4JBXA 2DWUA 1JL3A 4ZT6A 4F2WA 1MG5A 1Q95A 3ORYA 3LBYA 2YW9A 1DXYA 4JX8A 1HE4A 4M1SA 4PLGA 5DMXA 3RUAA 3RHSA 5I9MA 3G0OA 4OG2A 5T4EA 1SHKA 4XSHA 3V9AA 4LJKA 3GK3A 1KA9H 3U4QA 1CZOA 3GP8A 2IYZA 2PZAA 3B6JA 5E7QA 2OCXA 4FZ5A 3DKRA 1GSOA 1PZNA 3OP4A 5B57C 1KFBB 1EVIA 2E87A 2HA7A 1MABB 3CS3A 3D8NA 4J16C 1V48A 3LHDA 1XTZA 1B26A 2GYYA 2NSYA 2P41A 1GYRA 3MJSA 4H31A 4IRUB 1WL8A 3H2KA 4B4KA 4YV0A 2QGZA 4IOLA 2O06A 2WWXA 4MUBA 5B1YA 5JJ5A 2DQSA 2ZROA 4HNRA 1Z5OA 1WW2A 3ZKWA 4ENPA 1DARA 3KXPA 2OZVA 4ZHSA 4QGGA 4CLHA 1L7VC 4X71A 4ZODA 5F9MA 1KDPA 2YWBA 3OT5A 3RI3A 3SIRA 2GXAA 3FUUA 3IRVA 4XB6B 4YJ3A 4BVHA 4V2UA 4ND6A 2RAPA 2J33A 4ZQBA 4E5PA 3U31A 4AUNA 2AFHB 1IPEA 4MQBA 1RHKA 4I1PA 4OHFA 4Q24A 5CT5A 1N2OA 5KAPA 1KDYA 4Z3KA 3BWEA 4TRRA 4C6RA 3ZBQA 4YMGA 3IT2A 5CDSA 3PTLA 1ILEA 3K1AB 2AUTA 4OD0A 1RAEA 1MDBA 1US8A 3GH3A 1RMYA 3DMRA 3M1AA 3BDAA 4G5XA 5B58T 2XUGA 2XYHA 2KSQA 4QGHA 1T5TA 2B99A 2GAAA 3JAMA 1T2DA 2G77B 4ILEA 4QHTA 3KT8A 1FQJA 1QGED 4DZTA 4JXXA 2DPGA 1N78A 1C3OA 1F0KA 2ZSKA 4MPTA 5ERGB 1LSJA 4E5NA 1JPVA 3AI3A 3N2IA 4IDOA 5HM8A 1JF8A 2CEKA 3EH2A 2HSDA 3IDFA 4LWOA 3FMFA 4F6CA 1G42A 1W4AA 4UNNA 3S2UA 4YMLA 2FSGA 5EJ4A 2LNDA 4WOBA 2J6BA 2AQKA 5B55A 2AKAB 1C29B 2VRBA 3NM6B 5CLGA 1IWOA 3RS5A 2C4HA 1WB5A 3ORHA 3ZCSA 2XQKA 1ZD1A 1ZM2A 3Q9LA 2C9BA 1R0KA 4WFKA 1UKEA 4FXOA 3MZ0A 1GV1A 2R6JA 3L8EA 2RHHA 4YRRA 3DFIA 3IIEA 1YZYA 3KKZA 4HD8A 3DEKA 3IS3A 3W8DA 3K0SA 3DHYA 1KOGA 3W05A 3H1AA 2DERA 1J2UA 3EF1A 4MQ4A 4MMXB 2PJRA 4I5FA 1SOAA 5GV7A 4B1FA 4PSAA 1UMCA 2VJMA 3CLUC 3H2JA 1WMBA 1JMYA 1MNAA 2W6JA 5DSZA 3U56A 5IVKA 3G5LA 3T1NA 1DXOA 2QRPA 2EFCB 2ZI7A 5C7YA 3PX7A 4P4NA 3TIXB 4LXYA 4IKPA 2TRSB 2ZRCA 1KMIY 4LQ4A 5DGHA 5TPWA 1P2GA 1IVSA 3BGIA 3MHTA 2BRUA 1FMJA 2PYDA 3ANXA 5FOTA 3FVRA 3WA7A 1F8GA 5I47A 3R8FA 4RELA 4BNFA 3I2GA 3DC7A 2M98A 5EY5B 3PNPA 3RK1A 3ZQ6A 1J4AA 2OCYC 4M7PA 4N12A 5LKAA 1HBJA 1G2PA 1YS6A 2WHEA 4EHFA 1WTAA 1AZWA 3FG9A 2Z83A 4DBZA 2GRJA 1GGNA 4Y67A 2YNMA 1QBGA 1DKQA 1ML4A 4E7OA 2ZDQA 3CH5A 1ZK2A 3DMGA 2ZT6A 3HRHA 3TW6A 3ZQ4A 2AFRA 4AJ1A 4PO1A 4LEIA 3R7LA 4EH1A 4JB8A 3GCZA 5T4BA 4QYIA 5IH7A 2HIGA 2XV1A 4RO0A 1SHLA 1WVGA 1P60A 1Q1AA 1ZA1A 4MPDA 4BKPA 4D82A 4DXDA 4UPEA 2HLNA 2B30A 4CMIA 5HZHA 1QPGA 1QIKA 5IKPA 5JS6A 1KIFA 4HPXB 1SIUA 3LX4A 3GPDG 1UJCA 2OV2A 1M2VB 3FY4A 5B2EA 2RGBA 1UWVA 3LMKA 3NIFB 5AHRA 2O8DB 3LRPA 1PVDA 1LNSA 1LRLA 2X1LA 1ORHA 4KXQA 2ZB2A 4IRXA 2BDEA 1BFUA 2ZYHA 3N53A 2Q5LA 2JNWA 2AFIA 1PK9A 2R7AA 2XWJI 4OQFA 1BWQA 3PGKA 3V1TC 4FIDA 4H27A 1R74A 1TEZA 4PN3A 4AZ0A 1NX6A 1F1BA 3CH4B 3EAQA 4OSEA 3H11B 4KHPB 2PRKA 4PPNA 3ZGVA 1KYVA 4V0RA 4AZ3B 4G0WA 5KTKA 3NM5A 3UMVA 2CN1A 3DEFA 4PWZA 5TQ0B 4TYWA 3V8RA 4IFIA 2P4SA 5K0TA 2V55B 2UUOA 3MJCA 4FILA 1FSSA 1KXJA 4RZQA 3Q5EA 4TXMA 1MRSA 4PEVA 3V55A 1DKLA 4BRWA 5FBQB 3JZMA 2PXAA 3OMXA 3RVRA 4XGKA 3G0HA 1HYHA 1BOOA 1SQSA 3DBRA 4V2IA 1GDHA 1S3IA 1CX9B 1M2KA 2O1SA 2VRWA 4L0QA 3VOTA 3PX2A 4WXPA 1KQNA 2H1IA 2O3RA 4NV3A 3L05A 4ZZ1A 4AMBA 3BXZA 4GPIB 4W8GA 3GH1A 4TKUB 1PP4A 1WX1A 1MAAA 1TCBA 3D7SA 2ZGVA 3HXOA 1X7YB 4AX4A 1NPTO 1ZH4A 2ZYDA 1WR8A 5FBZA 3GZNB 4A2QA 4IXMA 1WDMA 3AI7A 4LX0A 5L3QB 1QG4A 2I9KA 1NQUA 1Q0TA 1HZJA 2AMYA 1L1QA 2J31A 2VSYA 3BMXA 3CW8X 1WB9A 4B43A 2HYIC 3SQXA 2OWEA 1QTIA 2ZB7A 2Y99A 3UGKA 5HGJA 3L92A 5I7UA 2CNWD 1G8YA 2FZ5A 4POAA 3SQMA 4EYOA 5JH7F 5G4LA 1MIOB 2WKSA 3RS9A 1B8OA 2XCSB 1D9ZA 3GQBA 1YOVA 1F3LA 1IAVA 1P6XA 1V9LA 3OZGA 4NESA 4LIPD 4WFIA 5JRZA 4ZT4A 3DHVA 1JN0A 2YV1A 4HH1A 4MZXA 5G0SA 3RVLA 5K0ZA 1SKAA 2Z2IA 3P20A 1YC2A 1YC5A 1LJUA 3CN9A 4MWDA 1E8NA 3QF4A 1Z6YA 4GOXA 2X4LA 3AJRA 2M6LA 2ZLBA 3IR5A 4IHJA 3O92A 1X1BA 3L4BA 1LC3A 5CM2Z 3PNBA 5JO9A 5JMTA 4BFYA 2X14A 1EEXB 4ASUA 3LFUA 2QENA 4ZC1A 5A4DA 3BGOS 3AFOA 4BNDB 4EUEA 3ZEAA 1W0CA 4F4UA 2ZR0A 3A10A 3HADA 1PK7A 4Y9DA 2VDJA 1H1DA 1Y5LA 1RQ2A 2Q8QA 4JSYA 2C7VA 4OOEA 3BE5A 5DM4A 2X58A 1ZI8A 3F96A 5ALQA 3COJA 1NDUA 1SY7A 2QX7A 4O4IF 2JLVA 4QUBA 4V0KA 3F9IA 5AW0A 1YONA 4BQFA 1WKCA 4ZWNA 821PA 2ZB3A 2OHJA 2MMCA 1K6EA 3LX6A 2XZOA 3IBCA 3P71T 4MYHA 5DO9A 3ORRA 2OZLA 1ULBA 2Q2NA 3HJAA 2PGLA 2OYRA 2BT4A 5IC5A 5CDUA 4OHCA 2FEMA 3FNQA 1R9GA 5BXYA 4MS1A 5H80A 3QFCA 3BKXA 1QZTA 1H3EA 3BAZA 3C97A 4GOMD 2G3YA 4QTZA 3G7SA 1PO7A 5LXTA 5BOSA 3R8XA 3HY3A 4EW1A 1BYUA 3P2OA 2HEIA 1L6RA 3U61B 1G8AA 2V7XA 3KTFA 2AC7A 2ZTMA 3NRJA 4PX2A 4RABA 5E6SA 1CS4C 1N5JA 1R0BA 2QLTA 2QUIA 4RPKA 5IS2A 4BWYA 5AUNB 3EPHA 2UXBB 3UAZA 3AHIA 4AJIA 1Q77A 2JGIA 3HPQA 4HMQA 4ZT2A 3FTDA 4JP5A 1XP5A 1G8PA 2DBRA 2A35A 3BMQB 4ZCRA 2HWWA 1RXCA 4LF5B 2Q1YA 2PR7A 1JV2B 4IZIA 5ED0A 1E3JA 4YCMA 1JJ7A 3WYBA 4YCDA 2PKYX 5EKSA 2BMWA 3ST7A 4RJIA 1E5VA 2ZIAA 2QUBA 4PNPA 1Y8RA 4FD2A 2J9YB 4G67A 1TEHA 3TX2A 2DEUA 3UO8B 2XRMA 3BN3A 3G17A 5FI5A 5H16A 4I4TB 4X6XA 1DG3A 5D6OA 4Q1EA 1AX9A 2B7CA 1RI5A 3V8NA 4S3MA 1DEAA 1KI6B 2G71A 3H0EA 3IP8A 5KYVA 5FB3A 1MC4A 5PGMA 3HHPA 4CN8A 3BD9A 2Z2KA 2MYUA 3TSZA 3D8RA 5CVJA 1EK2A 4WGGA 4HYTA 4G0UA 5L40A 5IBRA 1XMVA 3FI0A 3MT7A 5BN3A 1T0UA 3TL6A 1NMQA 2JDID 2F4NA 4KLCA 1OA1A 3W4JA 2VRCA 4FX5A 1RFLA 4WT7A 3LUAA 4ISBA 4ZHQF 3D2LA 4NS1A 4WCDA 3WADA 4X8MA 2EF1A 3SR3A 1FRVA 3SX0A 4X95A 5HUQA 3VOSA 3AILA 5ER6A 1FFEA 4LQDA 1E9SA 4P4GA 3BD7A 3L82B 4S1VA 2VAXA 2DM6A 3U7RA 1USWA 4JLSA 4RWEA 2P6RA 2YBDA 4G1FA 4URYR 2EARA 1WPRA 2L19A 2JFBA 1KH2A 1J24A 1WLSA 3T7AA 3HNRA 1S89A 1ZLXA 1BN6A 1XTKA 2H4FA 4Y2PA 2OB2A 5HKAA 1BQ4A 2Q62A 5K6TA 4IQGA 4KI0A 4PQRA 5C1DA 6Q21A 5M7EA 4BV3A 4IZ6A 4FKBA 2C2GA 1FX0B 3FR7A 1HURA 2ZSIA 3H8VA 4HFMA 4HQLA 4LTNA 4BN5A 2C00A 4XVQA 5DBHX 3ZTYA 3ZV6A 1O6BA 1Y9JA 2VNKA 3R5SA 2VWGA 4YRZA 1XN4A 4EX6A 3T4EA 1BYIA 3RRXA 2FDRA 4OQEA 2QV0A 4DNFA 4X3CA 1WVMA 3ENVA 3EY9A 1PCXA 3FW1A 3KUDA 2UVDA 2ZIGA 1NRIA 5D3ZA 3WDSA 1TEXA 1V4NA 1WXWA 1WPXA 2XB9A 4IOMA 3L49A 2BGIA 4YLEA 3EN0A 2YV3A 5FOXA 1R8SA 2Z95A 3WLJA 4B87A 1I51A 4C0HA 5CD9A 3ADPA 5A6SB 5ICMA 3D02A 4LV5B 1XNHA 2Y0EA 4I14A 4CKWB 2YZKA 3NHSA 4U2DA 4ED9A 2MSLA 4B3RB 1RYMA 4IZOA 2IX3A 5EMNA 1J5XA 1U3GA 5EXTA 4ARIA 3R5TA 4AU1A 4YY3B 2CLOB 3F2IA 3M83A 1VPLA 2Q29A 2ISQA 2Z8ZA 4HGYA 5A5EA 5EUMA 1O9BA 3JD4A 3AERA 3ZW8A 1MV8A 4N7JA 3MHPA 4C7OA 4O0MA 2A5YB 3JZAA 4HG2A 4NENB 4IGAA 4BKMA 2NO0A 4D4MA 1OZFA 5FFFA 1QTNA 2YQZA 4ZQGA 3QMMA 1UMKA 1FNBA 1JG1A 1QVWA 4FIZA 1Q0ZA 4H4CA 4EI2A 4AURA 4Y2VA 1KMQA 2MYPA 3AEUB 4NDZA 4N3BA 3U0BA 3TVYA 1N7JA 1QPBA 2MMGA 5HF8A 5JVDF 1D0IA 1HFEL 4JR2A 4Q9NA 2WSIA 1XVLA 1WW8A 2QY9A 3TTXA 1P5JA 1P91A 3THOA 5JCJD 2LDXA 3R76A 3OQJA 5BUSA 2CJFA 3O4GA 4Z4GA 2D5LA 3I01M 1UT6A 3UANA 2C2HA 3QELB 3TI9A 1ND5A 5B7NA 4BZWA 1O97D 5EIXA 1YT5A 2Y68A 5CVEA 1SB9A 5C53B 1R0RE 1OXMA 1XMPA 2B21A 4HLNA 1MXFA 1M2WA 1TUIA 5D00A 1LI4A 2FZWA 1M1XB 1OPRA 2AOXA 2H07A 3A9CA 3HCDA 3FPSA 3O8LA 4PPYA 4OCZA 1MB4A 4QFCA 4BYMA 5A4JA 2O05A 1NULA 1Q7CA 3FSRA 2OXCA 4K9QA 2VF7A 1QZUA 3I4FA 4ZQHA 5C46F 1OV6A 4MV3A 4Z7OB 4BATA 2QGNA 3C1AA 4JQCA 5GONA 1CHDA 2VHCA 3SJAA 2QTAA 2PMWB 2RGDA 4IS2A 1JFLA 2HOQA 2ZYAA 4QEZA 1F0YA 1NN5A 4LOAA 4S1NA 421PA 2GLUA 5D5PA 3PIRA 4QA9A 3Q2IA 3KQUA 1VA4A 4HP8A 4KK4A 3IKJA 1I6KA 4V3BA 1L7DA 4TV8A 2PN1A 1CNMA 2RC5A 4FYHA 2VP2A 3IAAA 5DH9A 1T1RA 4FLMA 1J1IA 3TPFA 5L9AA 1AK1A 1E0JA 4ZAFA 3DNMA 4FR5A 2PPVA 4WZAB 4YK7A 2QTVA 5DCWA 2X4DA 3D8SA 1LDYA 5HSGA 4TOIA 1C1DA 5FPTA 5A5DA 2A9JA 3I1IA 4O2BA 4EL0A 3BXFA 4EY4A 1WXQA 2VUTA 4PAOA 1KZGB 3NRCA 3I64A 5E6RB 4RDIA 1EP2B 4KPYA 4JLKA 5BWCA 1JFRA 3IBTA 3DKVA 1J25A 1JRLA 1QFMA 3TQIA 5BWLA 2HJVA 1Q0LA 3ABOB 5HS4A 2OD7A 4ZO8A 2QXTA 4TVBA 1K97A 1MHPA 2QWXA 3GRRA 4BEWA 2QYSA 3HKCB 1U9ZA 5HRUA 3R9XA 4NC9A 1RC1A 2WD7A 5C5EA 1Y8ZA 4O02B 1WW3A 4ZVNA 3RT7A 3JQ9C 3GLRA 1YSCA 4NH0A 2BEJA 5AH0A 2W2OA 2GD0A 2QVGA 3C8ZA 1GPWB 4L5AA 5ULLA 1X6VA 4BP3A 4CQJA 3UHJA 3N74A 4INZA 4GE0A 4BAUA 1ILWA 3OY7A 3MCWA 5U4QA 3NJRA 1HTWA 4OB6A 3ZE8A 3MWFA 2NQTA 3LVFO 3Q7QA 2AS0A 1NKSA 4BLVA 3B1YA 1JLSA 1KJJA 1W0KD 1RZRD 3REQB 3PDHA 5CA1B 1TD1A 2O6HA 2X15A 4GC5A 4JWTA 3WLHA 2DQZA 5E3HA 4D0GA 2J0SA 2ZSJA 4HPWA 2P0AA 4CKEB 1LF5A 3F1LA 4KWTA 3I8SA 4GRAA 2OPBA 1JT9A 1P0MA 4HWGA 5CLLA 1L1FA 2WT9A 4KSBA 1K75A 2HPHA 2R8YA 2L69A 3RANA 1GZDA 5BR7A 3RWBA 2IYVA 4C7MA 5NLLA 2P9QA 3TLYA 2W8BA 4GHWA 2FEOA 2NUBA 3EGXA 1FIUA 2O5VA 2DCMA 4DS3A 4KJXA 2FW6A 4HDNA 1AKTA 4U2BA 3S2SA 3Q9NA 1GGHA 1U5BB 3TOCA 4ZP1A 3IFSA 3BTVA 3ADOA 3UM9A 2HCRA 3RBZA 1QH0A 2B61A 3HDJA 1J0CA 2GBLA 2H5IA 4RVDA 1D5WA 1KP3A 2FRDC 2GFIA 2JI7A 3LIPA 4L08A 5DK4A 4K9MA 2Q0QA 3U16A 1X1TA 1RTTA 4K40A 1T2VA 2Q9UA 4KN5A 3IIMA 2P2SA 3OLXA 4B0PA 3L0CA 5IYZB 2C04A 2AVDA 1BD3A 2BELA 1UC8A 2XGGA 3OO1A 4QO7A 3GP5A 4NARA 1YFLA 4C4XA 3AEXA 1L5HB 2EFYA 2VDWB 4ZJPA 4F12A 3LTEA 3KV1A 1L7XA 5FQNA 4EJSA 3H04A 3W1VA 3JVIA 3P0RA 1W36C 1R7RA 2IYSA 1IUPA 4PLZA 5EG5A 2D1TA 1U9JA 1HM5A 2BYTA 2YYYA 1B43A 3NHRA 3QOWA 3SEQA 4EI7A 4YCAA 5SY9A 5F3RA 5IK2A 1EXDA 4JUDX 1W36B 1M1YE 2JI6A 2YVAA 3VSEA 3RS7A 1M2HA 1JTFA 5LDHA 4XCVA 1GTSA 4CRWB 3RFCA 1WDWB 4BZPA 5B3KA 4LPSA 5AVWA 1F2UB 3LCJA 4E21A 4HN4B 1UBNA 1E1CB 2IH5A 1VZ2A 3FYUB 3R3VA 2H92A 3ZGYA 1D1PA 5K3OA 4RA9B 1I6MA 3RC3A 3TLBA 5A9SA 3A6JA 5AVJA 3HFSA 1E6LA 4A2PA 2RDMA 3AC0A 5F7JA 3OFND 2X2PA 3IKLA 4K8OA 4C1NA 2YH2A 4MJXA 4AZTA 3V4PB 2O0KA 1RI3A 5ENVA 3EVDA 2NO4A 3T34A 2OKCA 4HB3A 4DYHA 5C1BA 1VE7A 2EATA 4F4IA 2GARA 2WT8A 3BICA 3VYSB 3QPVA 4GZ6A 5IXYA 1PV4A 3LF1A 1RP7A 3SSMA 3MOIA 2VDLB 3AY0A 4LCBA 3VHXB 3ASUA 3A3PA 2VQEB 4CLOB 1WHSA 4AMYA 1QH8B 1Z8DA 2CB9A 4DIKA 3CEJA 1NM5A 4P7FA 1TJ5A 3ANYB 5F12A 1CETA 2VNAA 1Y6QA 3ADKA 4IDQA 2ZRQA 4EF5A 1UH5A 3GQVA 2ZRLA 2JATA 3C3KA 1L5FA 3IAS1 3HNOA 1EU1A 1X7DA 1IM2A 4RK5A 2VYND 3SJCA 4OB7A 2CDBA 1XDUA 4II7A 2WQZA 2W6IA 2JCXA 1DPGA 3QKSA 4TL7A 1ZN9A 1CY4A 1CQXA 1CZUA 1CF2O 2FLKA 1SCNE 3ONFA 2ILVA 4HB4A 3MERA 1RWPA 3R7FA 4CKBA 2BJVA 3RK4A 1T5LA 4MIEA 2Q5HA 2VPYA 4M83A 2XTZA 3V7NA 3W6ZA 2B6HA 3EJWA 4L4ZA 4GZLA 5HUJA 1A2BA 2PO5A 4P3KA 3L07A 1RIIA 1V8ZA 5IKOA 1XMIA 2FOLA 4XLLA 3WGOA 1FMTA 1W2GA 1DUSA 1OGYA 4IQ8A 3PD0A 4OJNA 1TTQB 4E6PA 2C5EA 4IVRA 1XJWA 4QOJA 3IAFA 4Z3OA 3IPAA 3JWEA 3MUOA 5J1SB 4UVGA 4UMEA 1YR7A 5C1PA 4OMDA 1JR3A 3ZY2A 2WP8J 4BUCA 3AW9A 3VH3A 2G1JA 2XUZA 1P3DA 2JVIA 2TSYB 2BE9A 3JRNA 3LTNC 3WJ1A 3RKUA 1ZOOA 1EVQA 1KVUA 1SUIA 3JRWA 4Q6BA 3TN7A 4O5AA 1GTZA 1M74A 4LAFA 3ZGLA 2I6GA 4M1WA 4KR3A 3AR6A 2WA2A 1CKEA 5EHGA 4ZEOA 1KEWA 4JUAA 4L72A 2I4NA 3W9BA 3M1LA 4ZDWA 4F9EA 4QLBA 3AEZA 2PZMA 1G19A 3HR4A 1T2CA 3UJ7A 2Y4OA 2JA2A 1W4ZA 3A6FA 4LX8A 1T3GA 3C7DB 2G7ZA 2PNFA 1UADA 2XBLA 3AK4A 5DMHA 4A5SA 1Y3CE 4UAVA 4CL8A 5BNWA 3D0KA 3KJEA 5JD4A 3CIFA 3OPNA 1PV2A 4BB6A 1C30B 1FVXA 1SC4A 2VF8A 5DLPA 4WNCA 4Q93A 2JIBA 3IP1A 4AQYB 1CZRA 4MWOA 1GKLA 4WOKA 4WVLA 5CURA 4E6EA 4ZYTA 1HRKA 3C14C 4X94A 3DT9A 3CC8A 1T8RA 2JANA 2WYHA 3VSDA 4XUGB 3KAQA 4MROA 2BL4A 4MV9A 1RXSA 2GZSA 3H4IA 1NUTA 2C59A 4HSGA 4DYVA 5IG2A 5H0IA 1CR6A 3HVJA 5TIIA 2EIXA 4Q9JA 5FTWA 2C5HA 2O8CA 2I78A 5BYKA 1AQJA 2XGOA 3R40A 3VR6H 2IIPA 2X6TA 1T1EA 4I5EA 5KOHB 1ESEA 1LU9A 1ZSNA 4OH1A 5IASA 1FFDA 2FG6C 1H6BA 2VLBA 4JT9A 3IAHA 4XD2A 2BZGA 3D2BA 4FW9A 4QYMA 1DJQA 4NP6A 4KPFC 4X66B 1XXHA 2IPNA 1FFCA 1Z7GA 4KUEA 3IT3A 2NXNA 2DPYA 2H9YA 1ZH6A 1RPTA 1Z4LA 1CP3A 4TKMA 3GEMA 4BFCA 3VH1A 5JG7A 1JHYA 4CTNA 2BHRA 2FLVA 3EXIB 4CMJA 2WM2A 5BW5A 2RHOA 2P27A 1K89A 3E2MA 4OK5A 2SCUB 4LC1A 3R4CA 3IPXA 1ZGGA 1YUNA 3NBYC 4LNUA 7ADHA 5F78A 1JAHA 3IVRA 2Q4RA 3B48A 3KB1A 4RD2A 4ALJA 1WZ2A 3RC7A 1IHYA 2P67A 3G5AA 5DGXA 1RWQA 4OJYA 1S2IA 2FFBA 3B1ZA 1M72A 1NRWA 2H57A 5DHRA 1EVZA 3COPA 4UDYX 5GAJA 2FN3A 3S68A 1R50A 4F8YA 5KJFA 2GM4A 4LXGA 3QX7A 1DEHA 5CITA 3QA3E 1DT5A 1QQ6A 4MVJG 4URWR 2QTMA 4ZOLF 1U2ZA 5D87A 4YRBA 4S2UA 1V8BA 1V2GA 4F2GA 2A57A 2R00C 2ZRPA 3V2IA 1TTHA 5DYIA 2XMZA 1HE2A 2QXUA 3OO0A 1AQNA 1AN9A 1VMEA 1YS1X 3IB6A 4J9UE 1RNLA 5CH8A 3PQ6A 3S1LA 2WFLB 5F3WB 1KK2A 3RTEA 1B6TA 1CUBA 3EA0A 1BS9A 3PVCA 1VL8A 4REQB 1YQUA 4C4RA 4EVSA 4AY5A 3TPZA 4CVNA 4AY3A 1G6Q1 4ML3A 4FEEA 1A9TA 2QDKA 5KZMB 4RHTA 2AI1A 2OB1A 3A4IA 3I05A 4D99A 5JC1A 5K3BA 2MR6A 1A1VA 4MGHA 3I92A 4L8GA 3TQRA 1P75A 4QQKA 2B8TA 2Y71A 3QE0A 3HCNA 3AI2A 4NU8X 3KEOA 5BMVF 1O94A 4KUGA 2WHQA 5AKJA 1JHVA 2EVWX 4NTZA 4OHKA 3ZZ1A 1TF2A 1Z0KA 2D1YA 4W7SA 3Q0EA 3E9CA 3QI2A 3LT0A 1JHUA 3T3EA 1GTVA 1FB5A 1FUUA 2W6CX 3I3OA 1XZBA 4PXSA 3ED5A 3NVMB 4ME6A 4RM2A 3SC6A 3TQFA 2J4FA 1VBFA 3CZAA 3JQQA 4G0XA 2BF4A 2RJNA 2OV8A 2B25A 5KEIA 1Q1EA 3GNQA 4J4HA 4DV5B 2L2QA 1J2TA 1HT2E 1U99A 3ZKWB 2ZJZA 3DAYA 1S4QA 2FWMX 1SC9A 3L41A 5LPNA 1WU8A 1GQFA 2P0EA 3UJBA 2H1OA 4MVCA 4WBNA 5JNUA 1E1YA 2ATVA 2PSFA 4RZXA 4DIUA 4FHCA 2ZUBA 1I7QB 4EA8A 1YB6A 2BR3A 1N4AA 1V7PC 3UFXA 4RVUA 2DPHA 4DW8A 2OBMA 4NRDA 4DQVA 5H4GA 5IJZA 5A03A 3HXKA 3GGDA 4JL6A 2B0CA 5CT8A 4OXYA 4A6DA 2ILTA 3QMVA 3IIIA 1C3VA 1US8B 1SVSA 2GCOA 1JYFA 1T1GA 4XJSA 4IPTA 3WS7A 1JMVA 5F1YA 1DB3A 5LNK6 4DR1B 1JQKA 4TT3A 1BTOA 5A62A 5AOCA 3R8CA 1AA6A 4X3PA 2PXXA 3D1JA 4MS3A 4C2BA 4DDTA 3PEEA 4WPGA 4M0DA 3TTVA 4B3BA 4GICA 5JLJA 4IJ5A 4A73A 1NI4A 2ZSHA 1JS1X 3QVVA 5DHAA 1ZK1A 5BV7A 1MH1A 4RD4A 3JWGA 2YY7A 1NWCA 5I5EA 1SBIA 3PA6A 4BV8A 2FPMA 2NZUG 3I45A 4FP9A 4NBNA 1TVEA 4R7TA 3BKWA 4W7IA 5BQPA 5KHOC 1NOIA 2Q2VA 5KWSA 2PKEA 2X2OA 3KTDA 5I7HA 2BVNA 4PBTA 4RZUA 3DOJA 4Y3UA 5GM2A 2AYXA 5CA0A 4CG2A 2J7PD 3WB9A 2XB4A 6PFKA 1Z13A 4TLDA 1GUDA 4BWVA 2V4ZA 1R6DA 1FSZA 1A98A 2QYHA 2R68A 2QRKA 4B85A 4O3MA 2FWAA 2IEBA 1P44A 4MYSA 3L5KA 5DF1A 4EGQA 4ZGWA 4LBVA 3TRKA 3R7AA 1OW3B 5HBGA 3U17A 3NNNA 1QVRA 3HZOA 3L8ZA 1UMCB 2VJMB 5D3QA 4OHWA 3TGPA 1JTVA 1ISGA 1NR5A 1WMSA 2B92A 3O1LA 1V95A 1IDN1 3KKEA 4ZC8A 3ZD8A 1YR9A 3B8HA 4F11A 3KVYA 4GM4A 1NQAO 5CMLA 3SYMA 1G8GA 1XU7A 3TZKA 2DLCX 2HK7A 3P2JA 4JB2A 5WRFA 2WSSA 4YRPA 5M04A 3ACCA 2B1GA 1EE9A 2H1FA 4KWEA 4RQBA 2QZPA 2QJFA 3E4DA 1ZU4A 5EINA 1OAAA 4MKHA 1P1BA 1O0SA 4KQIA 4DL9A 2IYWA 2C2XA 1E1MA 2E4ZA 3Q41A 2JGFA 1EYZA 4AJHA 3FLAA 3GRAA 2X9NA 1W5SA 4KX5A 1JT2A 3PEYA 3KEGA 5J43A 2AE1A 4CR7A 1Q1NA 3DLHA 4W5NA 3U0VA 3OUUA 5IFLA 2WKWA 3AM3A 4W1SA 1U2DA 4YP7A 3RSSA 1UZAA 5KB3A 1QWOA 3V8VA 4LNHA 3BHJA 3DL4A 2QLMA 3OAAD 1L4HA 2J0EA 1UDAA 2ARKA 4MDYA 2GO7A 1RP1A 2QR5A 3AUFA 2WILA 3M9LA 2P91A 4CMIB 3M2TA 4TVKA 2E2WA 2EX1A 3FTEA 4KAFA 1L7AA 2GPWA 4G01B 4RLHA 3TF5A 5LB4A 3D7MA 1NONA 1LZLA 3UW1A 1ZXBA 4PE5B 1C7QA 3GN1A 3BTSA 3PDWA 1BO6A 3HFRA 3R5FA 4UD6A 5HZKA 1KJYA 2OHFA 3RPEA 2BDUA 4ERNA 1N2HA 1H8ED 5CGQB 1TQ2A 1CRQA 4M1EA 3ROKA 4ERXA 4TX1A 1BMTA 1VI6A 1W2WB 3A28A 3ROFA 3EIUA 2H0RA 1CS0B 3JQ8A 1WIWA 4HFNA 3W9UA 4Z4EA 4F56A 4OLJA 3UMSA 2ORYA 3OFJA 4JXKA 4MV7A 3B9PA 1GGKA 2UYGA 3ZI7A 1V5EA 1RJDA 3ZCPA 3RARA 2ZCJA 1U63A 2VKTA 2O8BA 3KDSE 2QR3A 3VC2A 5HRAA 5KKCA 1DFGA 1JBEA 1SQ5A 4TMXA 5DIFA 1RVV1 1MAUA 5FI0B 1TZBA 1RRGA 4JC0A 3Q2OA 3LA6A 4PHTA 2B34A 2X8JB 1OZHA 4HDRA 4I5GA 3FBWA 2O8EB 3L8YA 2NO1A 3P32A 3BZBA 1FNNA 1BX3A 4XJVA 4S04A 5CJPA 1LS1A 2BFWA 2AK3A 2OE2A 2SKDA 3MCAA 3DBRB 2UUPA 1XEXA 1QDLB 2VPXA 4IIYA 4P6VF 4CPDA 4EECA 1Y3AA 3AB7A 4NJOA 1XL0A 5EZYA 2GS9A 4MR9A 1KDZA 2LXNA 3OSZA 4GWKA 4MB0A 2WLTA 2PLAA 3OX4A 2W6QA 1O8BA 2Y2UA 4OP1A 2IH2A 4URZR 5JMOA 4KW7A 5C18A 3OURA 3KOYA 3F3MA 1N1MA 3D1LA 1EA7A 3DEIA 4NF2A 1REQB 2V74B 3Q6MA 5LUBA 1I4WA 2F1JA 4DUZB 1CUUA 2HUPA 1HR0B 4X65B 3GY0A 1JKIA 5JHGB 3GT0A 1GYPA 5T7BA 1XRMA 3QRWA 1V37A 2FSPA 3GLGA 5JNLA 3HA7A 4X41A 3T6KA 3A1NA 2IK8A 5ALJA 3RJZA 1PJAA 5JADA 2XJ9A 2ASEA 1KJ8A 5CW2A 1YL7A 1FX1A 2F90A 2P2DA 2O9JA 1H85A 3B6EA 5LA6A 3WMFA 4BNXA 3GQBB 3E35A 3PICA 2G4LA 3MA0A 1UEJA 1ODIA 3OM0A 4ALMA 1WZCA 1ZI9A 2QP3A 1ATIA 1IZ0A 3PTZA 5U9CA 1TM5E 3N07A 1ACMA 5K8VA 3EB9A 4NFHA 2HD4A 3G9UA 3OJLA 4X1KA 5DWVA 4A16A 3L9WA 3BX1A 2H9AA 2BHLA 2E48A 1ENPA 4OMCA 5AO9A 3RFXA 3I6BA 1FDTA 4NULA 4Z9FA 1ULTA 2IA5A 5DTJA 3UXYA 4BQRA 2BH2A 1JLHA 4BQSA 4Y6PA 3AEQA 3VU8A 4BCCA 1BIFA 3JYLA 3QLUC 4BFXA 5FUQA 2G5TA 4UEOA 4IL5A 3BRQA 1NMYA 4TYYA 4WJKB 3A0UA 1U0HC 3TEMA 1QBKC 1H0SA 4S35A 2NPIA 2GM3A 3A7EA 4XWGA 2A5LA 3D3KA 2D0IA 4LYYA 3LDFA 2I3GA 2EKBA 1MC8A 1QVZA 2I4TA 1XDWA 2YOHA 2PRIA 4FQ8A 2BR4A 1Q44A 3COWA 3WK5A 2NYRA 1KJZA 1TO2E 2RARA 5LBIA 2OZLB 2XH8A 1N6OA 4NCJA 3OE7D 5ICCA 4PYQA 2P9JA 1NMXA 3ANNA 1XB2A 3SDSA 3AR5A 3KD3A 1MZVA 1T6ZA 2Q4BA 2ONJA 4MS1B 4N8SA 1YKSA 4JIGA 3DHNA 1CWUA 4NBRA 3HCRA 2R6AA 1H2FA 2JRLA 3ND7A 3O8OA 3QKIA 1U2GC 2CFTA 3ZHUA 3NEYA 2C83A 3FRHA 1U3DA 4IJVA 1ZUWA 4ARAA 2INGX 4GYJA 4EW3A 2TS1A 2OCBA 4UXIA 4F60A 1UFRA 1TKAA 4IQ0A 4TMFA 3K8ZA 2PWZA 3UXMA 1NXXA 1YXMA 5I7EA 1R5JA 3LCCA 1DTWA 1S3GA 3MS7A 2I29A 5AJYA 4FB5A 4W8HA 5JSZA 4DV4B 3R3YA 3VPCA 4UTVA 2ONZA 4RLQA 2AN3A 3GLFA 2IYFA 3ZE7A 2DBQA 2DU8A 4FVTA 3OF5A 2QQGA 4UFNA 1YE8A 1Y8RB 3T9BA 3Q7IA 4FOPA 4M54A 2VJBA 5CIQA 1G2QA 3TW4A 4JYZA 4MPJA 2I3BA 1HH4A 1YRYE 3R1IA 4C22A 4LC0A 3ETLA 4X64B 2PLFA 1PEKE 2Y8EA 3PJGA 1EB9A 1ZH0A 1J09A 1VCIA 4QFDA 4C3ZA 1VECA 4ZDKA 1YRQA 2HTEA 3G79A 1PGQA 4M0CA 4M8NE 4KVFA 1Y5MA 1QRDA 2A92A 3HFGA 4QNRA 1I14A 3MAAC 4G4SO 3SVZA 2K87A 4IV5A 4KX3A 3ILXA 4Q3EA 3C2QA 2FX5A 4F46A 4XDZA 4JT8A 5BN3B 3HFJA 3VUEA 1AM4D 4A5OA 2VEDA 3RIXA 1VYUA 1AS0A 3PRYA 2XIJA 4FYWA 2WI8A 2HLDA 3CF6R 4MZDA 4D6XA 3W6UA 4DLWA 5JAIA 3THRA 4YV7A 1DBPA 5IBQA 1X7ZA 1DHRA 3NKFA 4NZPA 4ZV7A 2OCIA 1KZ7B 1ODTC 2P30A 2GA8A 1VE3A 3FZNA 3X3HA 4ZANA 3LD9A 2ZAGA 1G21A 2CV2A 3IQZA 4MSUA 3BOSA 3I2YX 4TM8A 3LV8A 1J2YA 2VHTA 3U4MA 1RWNA 3E05A 4RTKA 2OFWA 4Y2XA 1OGIA 4I2NA 4LGYA 5EJMA 1ZUNB 4BP8A 1YZVA 2DFDA 2P4EA 3LGSA 4GAEA 4YQYA 3RGGA 5JASA 1A8QA 1G1MA 2B1RA 1TRHA 2XXJA 3HB9A 3IDQA 4M76B 3RHZA 4C06A 2F3UA 1XBTA 4GSKA 1JHAA 4HDSA 4UBNA 4Z1OA 2XCQA 2MCFA 3KS9A 5GM1A 4DM7A 5L45A 1B1AA 2P4UA 5LQNA 2PUEA 3L18A 1YBMA 1VSBA 4C76A 1T4GA 1EGMB 3QFTA 1UBGA 1ELOA 3TL3A 1MQ9A 2BGMA 1U3UA 1O57A 2XMGA 2CL5A 3K35A 2CJXA 4UJ5A 5JDCC 1IXZA 1W5FA 2CUZA 2GUWA 3NV7A 3C48A 4K88A 3ROZA 3PVZA 5H1YA 4UOQA 4WLOA 3CF2A 2AD5A 4A3SA 3U7GA 1PZXA 4Q4HA 4D9JA 4HDQB 1R16A 3OD5A 4M0PA 3ZVNA 1E5TA 4TTTS 1GCAA 1M34E 4A9AA 4Q0MA 1ZINA 3AQIA 3HI4A 1NYTA 1BEZA 3AERB 1CUSA 1UMDA 2HJRA 2QE7A 4C7OB 4PR0A 2F1OA 2WD9A 3CUYA 1L1RA 5AK3A 3NC1C 4UTOA 3INGA 3RSLA 3DFUA 4Z4HA 5H70A 1V8PA 3VDNB 4K46A 2TECE 4WXHA 4B6SA 4JASB 2MINA 3EOZA 4EB6B 4UAUA 2AR9A 4X44A 3HA3A 4Y2SA 1U31A 3KYIB 2VLIA 2I2BA 3L8FA 3GVHA 5B1DA 3MMSA 1P61B 2G9QA 2PT7A 2X23A 3KKPA 4KSYA 3KJNA 3KL4A 2OP1A 4IIEA 5K5EA 4KQMA 3PNKA 2HA3A 4BVFA 3DP7A 4HZUB 2C0CA 721PA 4LJ6A 3TFOA 4WBSA 1L7PA 4J94A 4IAOA 3DDZX 1PFUA 3ZHCA 2IYEA 3JCZA 3EX7C 2AZMA 3DZHA 2ZPTX 4O4JB 2ZRMA 3O26A 4LOIA 5ICEA 5AW1A 5KNCA 1X1CA 3A04A 2JLUA 3HZRA 3WOHA 1UPXA 1B3BA 4ID9A 5IM5A 1GPDG 2JARA 2Q3HA 4QTXA 1W76A 3PIIA 2CXTA 1VP3A 1YVPA 2CBGA 4Y2TA 3UK6A 1JG7A 3CG0A 2FP4A 2YC4C 1FLNA 5AP9A 5HFJA 4LUCA 3A9UA 3J7AC 1LGYA 1K06A 3OTGA 4XIJA 2YKGA 2F67A 4R2KA 1N5KA 5H5JA 4M9ZA 5ER9A 3WQHA 2WIDA 2JLSA 4GOND 4UARA 4Q4CA 3H4VA 2JW5A 3BRWD 1T8WA 2J5KA 4FMPA 4FMCB 2LP4Y 4KE9A 5EIFA 4Y30A 3TKLA 3UV7A 4MW0A 5A7FA 4TS9A 1RI4A 1SCJA 4O5OA 1N5OX 4XWYA 4DA0A 3QV2A 4J0GA 2NTNA 5IUNC 1DDGA 3BYZA 1H22A 2QAJA 1CULC 2WUVA 3G2IA 1G9TA 2GXUA 3O21A 4ND3A 3TDNA 4CM5A 2HR1A 2J5QA 1UBMS 5IJ9B 1KI9A 3EA4A 4GU5A 2JFZA 2PS0A 3GBVA 4N76A 5JDIA 5JZBA 4YDRA 1C1DB 5JSYA 3KE8A 3ZDEA 3ZYCA 1UAYA 4B3MB 1QONA 2Q3BA 2EKPA 3FYDA 2XTAA 1YJXA 4I08A 3ITNA 2IYLD 2D13A 2PU5A 2QM7A 3A2MA 4RZ3A 4YA6A 3U3KA 1SRRA 4IGIA 1FMFA 3A32A 3TR6A 4OFBA 1T6XA 1EFVA 4E1BA 3L4KA 2AF3C 3OIYA 1E3QA 1DCKA 2PG3A 4FI3F 3E61A 4DREA 3HWWA 4Z51A 4CETA 1EHCA 1A5TA 4E30A 2WIBA 4WN3A 4CBVA 3GYBA 1ACLA 3P9XA 4L76A 4UNPA 1ONPA 4MVXA 4PW0A 3I53A 2XWSA 4RZIA 5EEGA 1E4EA 1ZEJA 2FPWA 2QVLA 2PWYA 4IFBA 3U4CA 1P0FA 3OZTA 3ZOZA 4HV4A 4I6GA 2QG9A 1GFZA 1HDYA 3EFOA 2QVCA 1QIJA 2IP4A 2Z6VA 4JBIA 1QDEA 3FOZA 1QF9A 1ECFA 2W71A 3F73A 3R9XB 3DO8A 5IJXA 4W9NA 3CPJB 1D04A 1Q6ZA 3NT5A 4PANA 3G5MA 5J2TF 2I6XA 2Y92A 4YQFA 5KC9A 3TQCA 1QRTA 2DSTA 3LQKA 4U2GA 2QORA 3OECA 5JNRA 1IPHA 4ECEA 5IT0A 3DAOA 1CB7A 1J49A 1DAEA 2SKCA 1HRDA 3AJ9A 3G6KA 4WV3A 1KYWA 1NW9B 2G5GX 2I2XB 2K6GA 1KOLA 3SVTA 3N2YA 3KLMX 1XHEA 2ZVJA 1U0RA 3VR4A 2ATCA 4HNSA 1D2EA 3KSZO 1N2ZA 4LI0A 3JSAA 4X1IA 3UMMA 3Q3CA 1U2SA 2NO5A 2IEZA 3I42A 3NXKA 1OAOC 3OM9A 5FOSA 3DLIA 3O84A 3UFBA 3VI3B 4CCYA 1EWQA 2PT6A 3TQQA 1U1FA 2O57A 1MDFA 4W5RA 3C4QA 1ZJWA 1JH8A 4X7PA 1KBQA 2DXIA 1DFIA 2X8LA 1ZLYA 4IWXA 4JXZA 2R6ZA 3EZGA 2AC2A 3F3KA 2IPAB 3NB0A 3UGJA 4COKA 4ZEVA 4G84A 2BEUA 1Y63A 2OFOA 3JPYA 2W8BB 1T3LA 4MQEA 3VZRA 4DG9A 1VRVA 4M88A 1VLHA 3C3JA 1IHPA 4R4JA 2VG8A 4RPLA 3JPWA 4HDNB 1ZN2A 1TU3A 3DJFA 3V4VB 3WDLA 1D4ZA 1HEIA 2X8BA 3WWDA 3IESA 4IV8A 2HJWA 5LYJF 4QLAA 1J99A 5TQ2A 2HL6A 3QUQA 1HT1E 4L85A 4LY6A 3C6BA 5FFMA 2YASA 3LKZA 4YP1A 4IHQA 2QE6A 3CZCA 3DZIA 1NNLA 2LDBA 3PGMA 4PINA 3KOZA 4A91A 4OATA 4ITRC 5C35A 4FFNA 3VQTA 5FOQA 1G16A 3AX6A 3NBQA 3OUZA 1M0WA 2NU6B 3CA8A 2IHTA 3CLSC 1FUYB 5DYYA 5FBLB 5FJJA 2ODNA 3ZI4A 4KYTA 3B3JA 5KNBA 3BB3A 1KP9A 3F6EX 3TD6A 2D2EA 3D0OA 4LVNA 3D6HA 3DPSA 2WW8A 2BTEA 2PRSA 2W90A 3I72A 2HT1A 4I8IA 4JYPA 4Q7EA 3G7UA 1DO0A 3KDAA 3V00A 5IHPA 3E6AA 2A30A 3EGDB 5AHWA 3MT9A 2E4UA 4B3CA 3K1TA 1KFKB 4HGOA 5KYGA 1V1MB 3O75A 4UUAA 3GL9A 1COWA 2A59A 3QE9Y 3WGIA 4OGLA 3RVPA 1JG2A 1ZJZA 1NP3A 3KB2A 4L27A 4O2AF 5EZSA 4EI8A 2WNSA 2FKAA 5F2NA 2IV2X 5KYYB 3COVA 4QQ8A 1C1YA 5DYWA 1Z5UA 1Z4KA 4YR7A 2Q6OA 2QN2A 2X5NA 1IY0A 5F35A 4YHHB 2VJQA 5EAIA 3EZ9A 4YO7A 1P2SA 4DA6A 2GBFA 1Z0ZA 4JELA 2PX3A 2HLHA 1E1RA 2BKLA 2I54A 4O0LA 5HF6A 1L9KA 1WY5A 3ICOA 4OMFG 1G20E 2Y1DA 4ZGGA 1RKVA 1IQPA 2N42A 4ENRA 2Z6QA 2Z8YA 4TRMA 3JVDA 1EB8A 1WHSB 3JZDA 1ZJ5A 5CW1A 4CGYA 1QM5A 1HOXA 2HRZA 3PWTA 1OWLA 5AW6A 3N6XA 2YMLA 4KZKA 3E1GA 3FNFA 3P2MA 3ML1A 2AMFA 1A2OA 1E4YA 1S7CA 2V3WA 1SXIA 1NKTA 2MJLA 1KY2A 1JE0A 3KX2A 4MYDA 2EW8A 5CP8A 1M7HA 5D3MB 2NWQA 1KFJB 4D45A 5J4KA 1TYBE 1NNEA 5BN1A 3KYCA 1S2DA 2MHCA 1GNTA 5LMNB 2X0EA 5CB4A 1PL0A 4RKEA 5M3BA 2MYNA 1EG2A 1DQZA 2XLCA 1KZ1A 3PUWA 3WAGA 3QKSB 4B0OA 4AAYA 5CDFE 1NWHA 3FJ1A 3NONA 1B14A 3ZDAA 2PDAA 1ZNQO 3E53A 4KE6A 4N5NA 5BXQC 1E8DA 3WYCA 5CVTA 4E15A 1QIGA 3WR5A 3W5UA 1D09A 3JQAA 3VVBA 5F76A 3K7EA 5CEEA 2QYOA 2BGLA 1P5RA 1PFYA 4R9VA 1TK2A 4TSRA 2E9SA 4JSTA 2R97A 1R0CA 2B4KA 1VMAA 1XMOB 3ELYA 3N0RA 4ZIRA 5GMOA 1CJMA 2WP0A 2K2WA 3N5KA 3RYIA 2O3UA 3FGOA 4RTPA 3SDZA 1W5BA 1D1TA 4TPKA 3ZW9A 5JH7B 3FHOA 4ZYUA 3SDBA 3COZA 5IJ0A 3O91A 2IYUA 2QD2A 4JOBA 2OORC 2C3PA 3ESBA 4OUDA 3UAOA 3HM9A 3EIFA 1OU4A 1JFFA 2YRWA 2GK6A 2NUTA 2BFAA 4MI3A 2NZXA 3CH6A 3LGXA 3PQ5A 2OESA 2QJRA 2W7TA 4DR3B 3OWHA 1X15A 5ELMA 1QK5A 4CMKA 3CZ5A 4JXJA 4P81A 1SUDA 5DM2A 4B76A 1QG6A 4D97A 1G6HA 4M86A 1JLMA 5JPIA 3RRBA 4EJMA 2ZS8A 4QBGB 2OQ2A 4QVKA 3M6XA 4XM1A 5A71A 3SC3A 1USUA 1XOIA 1MPXA 3L5OA 3IOYA 1MJNA 3DDHA 2IHBA 1SK9A 5IAKA 4UU8A 4JR1A 5FT9A 5SYMA 1D5CA 2DAPA 2K7FA 1IY1A 2I4LA 1QV9A 4BO0A 2AZDA 2IS2A 1VBMA 1B6GA 3F67A 4MEBA 2HV9A 3HJRA 1B6RA 1MTZA 3DOEA 5F3DA 4ZVLA 3CJTA 1N8TA 2JJ2D 4J1TC 4JNCA 1VSVA 4Q1CA 4TKLA 2EDCA 4TXNA 1RZUA 3GF4A 4HS4A 4D9IA 1Z0AA 4N54A 2O8CB 3OEEA 3UAWA 5GOTA 4IP0A 4DCGA 5AM3A 1R0XA 3QUSA 4O3FA 3CWZA 2VJNA 4R9NA 2PFGA 1UJBA 4RYLA 1RE0A 3GZTB 3RBXA 5FPKA 4Y1EA 5CPFA 3C5HA 2AJBA 1PJCA 3VR3A 4EM6A 2C9CA 2ZIXA 3QBDA 4KIUA 3WLOA 4AP5A 2V3CC 4DQUA 1T25A 1KETA 1THZA 3AT1A 2ZXFA 1E1LA 3ESZA 1I2BA 4KAXA 2FVYA 4ER3A 2QW0X 1XZJA 3AZOA 4ZYWA 4RVFA 2VATA 4AL4A 3GO4A 3L9XA 3NNSA 5H59A 2D1FA 4B6PA 4P4UA 2AT1A 4XLTA 1Z45A 3GDGA 3HEAA 2A9OA 1XCOA 3V34A 5JZ9A 2I8LA 4IKEA 4HI0E 3EG5A 5B2ZA 4PCLA 2BGUA 2YXEA 2VZEA 3ZWVA 1AO0A 4MLDA 1VMIA 1JJVA 2A58A 4OLBA 4A82A 3WLQA 2EFHB 2R2GA 3PIDA 4BLTA 2Z8XA 2QVZX 4FMBB 1OBVA 3PPXA 5CXSA 3V1UA 3WGUA 1FQKA 1L7OA 3HYRA 3L7LA 1FOEB 3IEIA 4FN4A 4XSVA 2RH5A 3RTDA 3V6LA 3FPJA 4R31A 3WK6A 1DCFA 4FKZA 2Z4RA 2EL9A 3ONDA 3LWZA 3LCUA 3GARA 2YDXA 2GCIA 3IXQA 4BN4A 1PUXA 4Y1RB 4JI6B 5MDHA 4W1RA 4AZSA 3S2EA 2WF9A 1UBCA 1Q0HA 1NP6A 3TS1A 1EFRA 3KHSA 1BA3A 3FLMA 3FUVA 4IIGA 2GHIA 2Z9BA 3LP6A 4MH0R 3UUGA 5KTOA 2OUIA 4EUFA 5B5SA 1ONNA 1VPWA 4JOCA 5H7XA 3Q5DA 2PGJA 3ZWCA 1OBCA 4CEHB 4P7BA 1NVDA 1B41A 3PF9A 3DG9A 4JYMA 4V38A 1DFHA 4C4SA 1BCSA 3FDXA 5IEJA 1DC3A 4GP6A 2NZYA 2OAP1 1ZBQA 1UBTS 5A6VA 4PX3A 2AX4A 3B20A 5ITZA 1OH8A 1T15A 2CMKA 3R74A 4WZBB 2PV7A 4ZHQB 3R0VA 4OQYA 5LNK1 1YDMA 2ZCUA 4CU5A 5DNYB 1JIUA 2Y0DA 3BXHA 3IQDB 1ZL2A 3CO0S 1T1JA 2QMYA 5K01A 5AICA 1YGYA 3LCRA 3R6LA 3VU9B 1QORA 1QFSA 4FR0A 3V4ZA 3CNQS 3U80A 5FWYA 1B76A 1YZ3A 3U4HA 3AR9A 1N34B 1Q1GA 1VL1A 2OK7A 1GLNA 3RSHA 4J6FA 3CNLA 1TFUA 4GMHA 2EGGA 2FZGA 2QZ4A 1T4DA 4JDPA 1RYBA 2VYFA 1HLPA 2V5VA 3E9NA 1XMSA 3Q87B 1XCBA 2OV6A 5K8CA 3X2FA 5DB4A 8ADHA 4OXIA 1GITA 1GZ3A 2PV0A 3A6GA 5CYOA 3R4VA 4H7KA 1XZLA 4JC4A 4RGQA 2EBHX 1SQGA 3EE6A 3V5NA 3ZS9A 5C5CA 5CLHA 1I0LA 3I32A 4RXTA 5TC4A 2XQFA 3TX6A 1P77A 2QL6A 3Q85A 1G7TA 2WHYA 1YZNA 3G2JA 4B6EA 3CO5A 1TYEB 5IU6A 4WBNB 1UEIA 1YV9A 1EESA 4KACA 3Q4GA 3TW8B 2FP3A 3CE6A 4IJ6A 4FOSA 4CM9D 4C5BA 1EUDA 5EHNA 3H9EO 1GNRA 3A25A 1OFUX 4UMVA 1NXOA 3V4RA 4ND2A 3JATA 3IV6A 4RSGA 3AGQA 3OETA 4NJMB 1IXKA 4JP3A 1HDXA 3CVJA 5BT9A 1Z2PX 2VBIA 1U80A 1N3YA 1UFVA 2NGRA 4BO5A 1SXJA 3ELBA 2VK1A 4XKJA 1LPMA 2OCDA 3RAPR 4FOTA 2PH7A 1QS0B 4V0MA 1K7YA 4H6WA 4MS3B 4R2HA 1XRLA 1P5ZB 1NNI1 1DTEA 4M9XA 4Q3OA 4X93A 2D2IA 4E3WA 3MB5A 3SEAA 2EX4A 4G0VA 4Q01A 3BA1A 4MRMA 1V96A 4N4AA 2QJWA 3WFIA 3EPLA 4L6AA 3S5UA 2IODA 3X2EA 2I2DA 3CONA 2CCGA 1FFXA 5A05A 2E55A 5JVDB 4PU0A 5G2OA 5CFLA <