3WE7A

Crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0499
publication title Expression from engineered Escherichia coli chromosome and crystallographic study of archaeal N,N'-diacetylchitobiose deacetylase
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 3we7A00
3DFFA 4XM1A 2XADA 2IXDA 2X9LA 5CGZA 3WE7A 4EWLA 5BMOA 3DFMA 4XM0A 3WL4A 1Q7TA 1Q74A 3DFIA 5B2EA 5B2FA 4XM2A 3WL3A 3DFKA 1UANA 4XLZA
chains in the Genus database with same CATH superfamily
1BG6A 1H05A 2WWXA 3BHMA 4A03A 1GTL1 3A27A 5FTMA 4IDHA 4NEGA 3K0SA 1XALA 1PUJA 2C1XA 2GO1A 4DQKA 1YU6A 4XOUA 1SVMA 1MQ8B 1DG3A 1KAOA 3FPHA 3HCDA 4OOEA 2IZ0A 1H5UA 4N40A 1N9GB 4PPQA 2DP4E 3LXRA 4PBSA 1DKQA 4HOYA 4F2HA 1JPVA 3SM3A 5B12A 3TFQA 3B3QA 4E5MA 1PKEA 5IXJA 2IP4A 5LIPA 2VK8A 4Q47A 4ZQFA 1KPGA 2ZBFA 4JKYA 5HRCA 1B4DA 2Y1KA 3AEZA 2JCSA 1FU7A 2UUBB 3WX0A 4FGWA 1KVSA 2BR5A 5ALUA 3UJPA 3O9VA 4B7CA 4Z7QB 5IXSA 1AHPA 1P2FA 3DGEC 3UUGA 1N5OX 2X2OA 1ACLA 1NNUA 2E4UA 3PVCA 5D3ZA 5JPIA 4MA0A 1E9BA 2I80A 1E3QA 3ZKWB 1UJ6A 3M4XA 4DMFA 2XVMA 4ZAYA 1OC4A 3JAWA 3L9WA 4ZYWA 4IKPA 2BTQA 2WJHA 3IHLA 4LYDA 2ZREA 1S3GA 5EXPA 4UZEA 1H2ZA 1HDZA 1K9SA 2AOTA 3CLVA 1FLVA 2YV1A 3R0XA 4KQ1A 2QM3A 4K3UA 1QHFA 1V4NA 4RUKA 2FW7A 1U0SY 2WJ4A 1G64A 1TCCA 2VJBA 1X3LA 3R6GA 2ENUA 1XELA 5DHUA 2C2KA 4LY0A 4PCLA 4DLTA 1KTIA 3BWCA 2WWIA 5E9AA 2G7ZA 2FPXA 4W5JA 2IHJA 1U98A 3GZ4A 3EYWA 3B3FA 3G8AA 1QHHB 5EGNA 5K1ZA 1Y80A 2HF8A 2OXIA 1IZYA 3OEHA 4ALMA 4TUYF 3AF0A 2JGIA 2R6JA 1Z6XA 3N2NA 3BIJA 3I1JA 3QVVA 4WZBB 5EP4A 2AOWA 5HCIA 4HFMA 2OBMA 4M1YA 4RJ2A 2W6NA 4BBPA 3PVZA 2Q6VA 3B1YA 5DRYA 1P18A 2LUOA 1FNCA 4A8JA 4DEXA 1OWLA 1W96A 2VTBB 2CXHA 1K8XB 1XMJA 1LW7A 2XF2A 1CF4A 2R6CA 3GZNB 16PKA 2GPTA 4MQ5A 4B87A 1JFTA 1ZIDA 2CLIB 1U7HA 2XNDA 3ZDAA 1DAGA 3PG5A 4IR7A 2OGSA 4EGCB 3WNVA 4C5AA 4I50A 1RHKA 2POCA 2ZCUA 3LX6A 4H6PA 4W6QA 5IWCA 1ISFA 2HSEA 2IPOA 1P5FA 1G3QA 2JEZA 3Q88A 4ESVA 2WWTA 5EFOA 4OV6B 3ZLUA 1JS1X 4JSYA 4YPFA 4OSEA 3RGWS 3TUJC 5EXTA 2NVBA 4D5GA 4RKEA 4WBNA 3HLYA 3WLIA 4IMIB 3C85A 1YZHA 3GBPA 5AXDA 3KXIA 1AY0A 1ZVKA 1N6IA 2I2CA 3IAM6 3OPYI 4PRKA 3A1NA 3R7LA 3SEAA 1RS0A 1UC8A 1Z38A 1QR6A 1XR3A 1NVMB 1TA4A 2GEUA 2QDXA 3L6DA 2YYYA 4KMRA 3EVEA 3IILA 4S0ZA 1NFFA 3NAQA 1FYEA 2FSUA 2H29A 3QFFA 4U7TB 1GSIA 3W5VA 1YHZA 1KSFX 4YO7A 5J2TF 4AJNA 2QE7D 3DCYA 1QRTA 1IEVA 4K46A 1X19A 2SCUB 1H2EA 2ZIXB 2ZUWA 1QF7A 3WRVA 5K0JA 4HZIA 3P4UA 2XOXA 4BNHA 1DDGA 4UE6A 4J29A 1UIRA 2JFOA 2QB5A 2CVFA 4NOKA 1R10A 4ZO7A 3BH6A 3SBOA 3QVXA 3AHEA 2XTZA 3U7EB 3E5NA 2AZXA 1R66A 2WMDA 2Q0QA 2R1TB 4JGGA 1P60A 2PMEA 2PT9A 4O25A 2WKRA 2VWGA 3DEYX 3USES 5B3KA 5KB3A 4Q3EA 3SR3A 1Z4IA 3WK7A 1XVLA 4MI9A 5CFOA 3OMXA 1L4YA 5FO1A 1CW2B 4BDSA 4CPDA 2DX7A 2V55B 4ZDIA 1JPNA 5EWLA 5BV2P 1A50B 1I7NA 4GSLA 2NLOA 4B9AA 5ALXA 4F72A 1RPZA 2WM2A 1TYCA 4IQ4A 4MRPA 5GAJA 2GZDA 2IP2A 4TMXA 1MOSA 3LQ2A 4IF6A 4BZQA 4DIEA 3W6PA 5L3SA 1KKUA 1V6AA 4QTTB 3UG6A 3VNAA 3G59A 4AP5A 1R4MB 3RS0A 1VPTA 5CFMA 5JXIA 4ITVA 1RWQA 2IUYA 1HE2A 5KJEA 1X9HA 2WPDD 3L04A 3VR2A 3VUEA 3WP0A 2PVCA 4X62B 3ND6A 3MJVA 4W6ZA 2B3TA 1HNZB 2B0CA 2JB9A 2WU8A 1PU2A 1RHJA 2GYWA 2H0AA 1G6KA 1YJQA 3FMIA 3G17A 3PD1A 4YCCA 4DR2B 4YRAA 2IYRA 3H8VA 1LDEA 3CVUA 1DADA 1OWPA 4XEHA 1V5WA 4M0FA 1CYDA 1ZNQO 2DC1A 1NI4B 1JU3A 3O8BA 4UATA 3CZ9A 5B6IA 1B74A 3B9BA 2IXDA 2OCLA 1QIHA 3IUYA 4FMDB 5KNDA 3M6XA 1O9BA 4KTVE 4HDKA 1DQYA 3H1PA 1XKQA 4QG7A 3H6HA 3NBQA 3VZDA 2PJRA 1VPEA 2B7CA 5H68A 4RTJA 3CVYA 2YH2A 4PZZA 4X24A 1KQOA 3A8TA 2V6MA 5FOWA 2X5XA 4OHXA 4F0JA 5A03A 3B89A 3OI7A 5CH5A 4BB9A 1NXOA 5G53C 2IUSA 1L3CA 1U8EA 2LP4Y 3JQDA 1E7RA 4QXRA 3V7YA 1P44A 1KK0A 2CDNA 1Z5NA 1NI5A 3R4VA 2YZ7A 1WZEA 1SG0A 3GEMA 3N8KA 3UK2A 1CS4C 1GCUA 3W5HA 3ZE8A 1SQ0A 4TZKA 3WMWA 5KBYA 1OREA 5MN6A 5F64A 1ZM9A 5AVVA 3UB4A 4ZMSA 1JHAA 1SHTX 1UDWA 5BXYA 1KI4A 2NU8B 2EJVA 3ETHA 2H3HA 2JPDA 5DTQA 2IC5A 1I14A 1E99A 2QZSA 3EB9A 5TT0A 2ZIZA 1X1BA 1T29A 3OMWA 4CKZA 2WP0A 3TCXB 2WJVA 1SUPA 1PR0A 1TYEB 1F48A 1VZ3A 5JO9A 3AF6A 1FBNA 4E15A 3PDHA 2H08A 3PR1A 4O2AA 3PPYA 4OMFG 1MP0A 1Y3IA 1IQ0A 3HYNA 2IIPA 4EPYA 1EFPB 2DYKA 2GF0A 3AR4A 4ND2A 3R8CA 2P4SA 2QJFA 1T9KA 3FD8A 1BMFA 1JHMA 3C45A 3C5WP 4HN2A 4UVIA 1TZ2A 2EAUA 2WZQA 3RUPA 4RTQA 1HH4A 2OC9A 5CFQA 5JMWA 5L7TA 4MWOA 3FRJA 5B6JA 4D4JA 4GVLA 3A6ZA 1Q1NA 1W47A 3JV7A 3B2QA 2EGHA 1CVLA 1AKTA 4M0DA 1CJBA 1OQAA 2J3EA 2XUAA 4OXRA 5T8KA 3ADPA 3ICCA 2X2FA 5EN4A 1JKFA 4EZIA 2RK4A 2A7QA 5SZJA 4Y1EA 4QDUA 1OIXA 4OQNA 1XVIA 5AKGA 4BDTA 2X6TA 3EUEA 4XGKA 2V3VA 4MRNA 1O54A 3SX0A 4MW6A 1GXSA 3GDOA 2TMDA 3GH3A 4HRXA 3VVLA 4C0JA 1BJRE 4FDMA 4P3OA 4PE5B 4YRCA 3DVQX 1QIGA 5F1YA 2ZJ5A 1PT9A 2QDKA 2NUAA 2W22A 2ZQZA 1X8LA 3RC2A 5HE9A 3KXPA 2DFPA 4R1UA 3WVNA 5KOYA 2R7AA 1T1RA 1MU0A 3GA5A 3JQFC 4RIIA 2FLKA 3GGSA 1AO3A 2ZRBA 3NALA 4YRBA 2AF3C 3U4QB 2I33A 1YOBA 3AEYA 3PNMA 2G70A 4DCJA 4NPAA 5HIKA 2JHGA 5C81A 3UMMA 2WAAA 1J2YA 4Y1RB 5CT6A 3F6EX 4TVBA 1E62A 3F78A 2GJ4A 1HLGA 1RAHA 4ZMRA 3TLYA 3D0RA 3NWOA 3R9XB 3DZ8A 1ATZA 3GW8A 3IIEA 2DHRA 1EE9A 2ZBRA 2ZQ5A 3G02A 2BBWA 3VR1A 5E4FA 4ZP1A 4GC9A 1DPFA 1FDUA 2LIPA 1NJ1A 1XLTA 4N0DA 4X6LA 4EPRA 1CR2A 4KO4S 1T2NA 4OF4A 2Z8ZA 1O96B 1ZGAA 1X7GA 4DBLC 4WPGA 4E94A 2WA1A 4MVJA 3N70A 1B0ZA 3IS3A 2QG9A 4RY2A 4MHSA 3ANNA 4NJEB 1W59A 1Y8CA 4OXIA 4NHOA 3NTXA 3PRKE 4V39A 4DJTA 1M8GA 1JQJC 2ONYA 3LLUA 3TZKA 1T9CA 4XUDA 5GONA 1BCSB 1FBTA 3MC1A 4BGIA 5KTOA 1XEAA 2QY6A 1NX9A 1MDBA 2XEDA 3LC1O 1X2BA 3DZGA 4CKCA 1QR2A 3BMCA 4I6EA 4LXQA 1JJ7A 1TJPB 4DG8A 3WMRA 2GEDA 4DS3A 3K3PA 3ZE0B 2CHQA 1GZSA 1U4NA 3DJFA 3OZGA 5F1KA 2NWQA 1KEWA 1WOYA 2FY8A 2WMNB 3QW2A 3WISA 5KMGB 4UASA 1XMXA 2IYWA 3HCAA 1WR8A 4TL8A 3WIOA 3NC0C 4E5UA 1PNOA 1NUAA 1OLOA 1OD6A 4RD0A 5AKLA 5E6SA 1X94A 4X8MA 3C3JA 4YCMA 2C4HA 2QP4A 621PA 2OCBA 3NFRA 4Z1OA 2Q21A 1DI0A 3PCRB 4MS3B 3S1AB 1YULA 3KB1A 4JLUA 1SUIA 2ZUTA 4ILKA 3QVLA 1C7RA 2H3EA 2QLFA 4JL6A 3JALA 5CM2Z 1WUTA 1NLZA 2JGFA 4ACAA 2CNKA 1XWWA 1ZD8A 1X9GA 3LPDA 4H08A 4GL4A 2FSSA 4RZIA 3ZCXA 4KFRA 1TJ4A 4PLYA 3BDIA 5BSWA 2J6IA 1XE3A 1RTTA 3IEUA 3LF2A 1TE2A 4HLUC 2BEUB 1E1RD 1WEHA 2XJ4A 1LS6A 2YJGA 4EI2A 3FAKA 5HX7A 5IF3A 3K70B 1U65A 2FR8C 3IODA 1K8QA 1O6ZA 1T13A 4HDNB 2CW5A 3BAZA 3MCWA 1NRJB 4RTRA 3R3WA 4D2IA 2KBEA 2R5FA 5L95A 2D1RA 2ZVDA 2JAWA 3EZLA 3EODA 1ES9A 2ZXEA 4Q9NA 4Y2TA 4PC3A 4KAAA 4I9GA 4BLWA 1QXSA 3U0BA 5ESDA 3B6IA 2ZE6A 3ENZA 1GPKA 4BMVA 2G80A 3KDAA 3I9MA 1RKBA 1RYHA 3QYPA 3THOA 3MS2A 1C7QA 1N7JA 2PMDA 4YREA 1U7XA 3NI2A 4OP2A 4YAKA 1DQSA 1AMNA 1NQWA 3INNA 4TTTS 1RMYA 4N76A 2QA5A 3O8NA 3RYIA 1MGPA 1KZ4A 1XRRA 3QG1A 3HK2A 4YP6A 4P4SB 2ATVA 3C6BA 4IM7A 1UMDB 1D0IA 1NHGA 1ZH6A 2HU7A 2VWHA 3D9QX 3ZNNA 3K6SA 3NHKA 5LSAA 3CLUD 1EBFA 3KZMA 4RZXA 1C7ZA 2E48A 3B9PA 1Y89A 4IV0A 5JQGA 1UIMA 3D0QA 3D4PA 4QRHA 1QDEA 2HK7A 4PEVA 3SU8A 2H1SA 4TLLB 5DLYA 1UBOS 1T4CA 3MBIA 5GADl 2DFTA 3MUFA 1G2QA 4CMGA 4OX9Y 3R0IA 5AJTA 2PZLA 4Q6BA 4I9UA 2ETXA 3TR0A 3UHAA 4I3FA 3V1LA 4F5EA 1XZNA 3MTIA 3LNTA 1AF7A 1E6EA 4GLJA 3GDWA 4IDDA 4MRAA 5DXJA 5KX5A 4M9CA 1DUIA 2A35A 1ICIA 2WNIA 3F67A 2XGOA 3NX4A 4XTCS 4O2BF 3FMGA 3Q6IA 4ZVSA 1NQVA 4DMMA 4KQJA 1A9XB 2B9VA 3GDHA 5AIBA 3H2ZA 4K0RA 5CDSA 5BY2A 1T3GA 1CUCA 4EG5A 5FI5A 3KVOA 6Q21A 2Q0XA 4ZZ3A 4MGKR 2ZT7A 1T26A 4TSFA 2I4MA 2AUMA 1E2MA 1S7CA 3A26A 4G86A 3OSUA 3VC2A 4D9NA 4B6FA 1PFUA 1FK8A 4HWSA 5ALOA 3RAPR 3ADOA 3IQIX 2A6PA 3KRTA 5GWXA 3RBZA 1HDIA 1WF3A 2HF9A 2O1SA 3ORYA 4KZKA 4XR4A 2AKYA 3RTDA 3RVPA 4EY6A 1ONSA 2XTJA 1T3HA 2P9QA 2ZUCA 3GLRA 4NENB 3LS2A 1CUVA 4ABYA 3ANLA 1Z17A 2OKCA 3K9FC 2H17A 1U3DA 2O2YA 2OZVA 2X8JB 3BC1A 3EIFA 1H23A 3PXCX 4GMHA 3ZKAA 3PLRA 4II7A 1P9LA 1L5GB 1K6MA 1VIMA 1NONA 2GPAA 4AO7A 2AEJA 2WF7A 4Q7LA 5GTDA 4OQPA 1SBZA 2X9VA 2VJKA 4XZ3A 4ZYZA 5AKHA 3W79A 4DDMA 3IOCA 4Q18A 3PSHA 4V0OA 2BH2A 4L3VA 1CZNA 5FWYA 1YCDA 2I5PO 1FSZA 1SCIA 2Y4OA 5ALFA 2IEYA 4CM8A 3O1JC 1JIQA 2W2LD 3IAHA 1WVGA 1YDEA 2DFNA 2WYWA 1I6MA 2XIQA 1G60A 1X1RA 2Z2ZA 4MXDA 4HZGA 4RNDB 4V3BA 1W88B 1JDZA 2W98A 1PZMA 1XT6A 1LBEA 1E77A 3A4VA 1PGOA 5G0WA 3HDTA 2ZT5A 3A3NA 1Z18A 1Z5UA 1R64A 4Y6PA 1TQ8A 2DF8A 4U7HA 1H5QA 1T1GA 1B93A 1AA6A 1KBOA 4IZIA 2BHLA 4JHLA 3GGGA 1Y4ZA 4RELA 4PAMA 1N2SA 2QTVA 1N1GA 3H87A 3ADDA 1A9PA 3O8DA 5LBIA 3WDSA 2CSXA 2WUFA 1NSYA 2A5YB 2O5RA 2ACWA 2R5NA 3SC3A 1BH2A 2P9GA 3CNNA 1EP1B 3UVEA 4D3SA 2P3SA 3PC3A 3RS2A 4FZRA 2HBRA 4CV1A 1UWLA 2PAAA 1VBFA 4Q9KA 3NB0A 2A0WA 1AXRA 3C7DB 3F3MA 3MPUA 5K3BA 1DDOA 3C6YA 4JXXA 1NPTO 3EHEA 4G5YA 2EHDA 3IMGA 2P2SA 3HYTA 4GMFA 3QQ5A 2QGZA 1YZFA 5E1OA 1SVWA 1W9HA 1H8EA 1VCIA 5EKSA 4CTMA 2AJDA 1OIVA 4Z9AA 4Q4AB 4BNUA 5IBQA 4FE7A 4OI2A 4QYWA 1GUDA 2NU9A 4KSCA 4RHTA 1CRWG 1NDHA 1KIAA 2UDPA 2GA9A 3BIWA 4KLAA 4QJBA 5A7HA 1BN7A 1G2IA 4D80A 1LNZA 1GPMA 4BCCA 1JQ5A 3Q85A 1G3UA 3I6BA 3K9NA 4RF2A 3ROGA 4BQSA 4EJSB 4BYGA 1Y48E 3E03A 4C88A 2YL2A 5LDGA 1E3TA 1CUEA 1CDDA 4G9GA 4PN7A 2AN5A 2FE1A 4CMIB 3RT7A 4FR2A 1FSSA 1QC5A 2FVXA 2GD6A 2YWHA 4CFSA 1BDMA 3QE3A 1DJLA 3SC6A 4G89A 1V3QE 3GV0A 2D13A 5ANRB 4M38A 2VAXA 2ZXUA 1XYYA 3KE8A 5F51A 1HZZC 2D0PB 5EQDA 3U7RA 1Z2OX 2IYOA 5B6PA 2QAGB 2PVPA 1M34E 1PT7A 3F4BA 5AMXA 3DBVO 3UWMA 3MT7A 4GX0A 1EE2A 1ST2A 2BDUA 2ZT6A 3ZHTA 5BMOA 2C3UA 1ZI9A 3VH2A 5FA6A 2CBXA 1SVKA 2W8ZA 4GU5A 4BKPA 3RS7A 5JJBA 1GO2A 3FTPA 4MLDA 2WSYB 2DQKA 2OUIA 3DO5A 4PPNA 3UJ8A 3DP9A 3C1TA 3FHLA 4ZYUA 5COBA 5CLJA 5C5IA 1MAWA 3GPLA 1V5EA 1GKLA 2VJOA 2W9XA 4JENA 4N12A 4M1KA 3CJQA 3HBAA 3O0DA 2QUHA 3TOXA 4UMEA 1QO0D 3WJ1A 4H9GA 3QU4A 4AZSA 3L49A 4CLRA 5HKOA 3DOUA 3VZBA 4OM7A 1V5GA 2I3DA 1ZW1A 4WADA 2EFCB 4ZGWA 1XF9A 1HQDA 3H16A 2ZUDA 4ZIRA 2BFWA 4LHEA 4R81A 3OT5A 1KYVA 2PKRA 4FCVA 1YS4A 3LHFA 3E2MA 1U2GC 3BMQB 2JZNA 3CG0A 4BZPA 1ZGGA 5FNVB 1OV4A 3WRWA 1VKOA 3QMPA 3AEQA 3RC9A 2GFQA 3EUAA 2ON6A 3NFYA 1EPUA 3AVQA 4PANA 4ZU6X 2X40A 3F6PA 3ZDCA 1XOIA 2OOSA 2QJRA 4QQNA 4IO0A 3UPDA 3DT8A 4JLWA 4Q82A 1PEYA 4CLOB 1WOMA 1Z47A 1HLFA 4G67A 1DMSA 4RD3A 3W04A 5DIFA 3I2YX 4P81A 4R2JA 2CCGA 2MWMA 3OZIA 4QECA 1TQHA 5HF5A 4TLDA 3UCFA 1QTIA 2VP2A 1MA0A 2X0JA 1BXGB 3KJFA 4IWYA 3KWJA 3U80A 3DMRA 4X8OA 4RTNA 4QGFA 3GAFA 3HACA 4V1CA 3B52X 3CTPA 5JCXA 4YR7A 2D5LA 3I04A 1H4VB 3E84A 4UFNA 1YI8A 1KH2A 1SCUB 4KKXB 3RTGA 1X7YB 4CKWB 2Q45A 2ZE7A 5LQSA 5AJHA 1YJBA 1R6DA 2EX1A 4ZQBA 5FPTA 2F8MA 3W5JA 1JRLA 1N0VC 1I01A 3W7AA 4C87A 1QK5A 4KP7A 2C3OA 2RIPA 1GA4A 3I5AA 1KDTA 1N32B 3K92A 2PS9A 2FN3A 3PNVA 1K6JA 1SKYE 5H3HA 5BPFA 3TPZA 1AK1A 2SKCA 3DTVB 1G8FA 2EP5A 4OAPA 3AYXB 5AVWA 4DR7B 2BFCB 2XVAA 1XWIA 1XCPA 1YZVA 2Y1EA 1NUSA 1O9GA 3QLJA 4X84A 3UWDA 2EGGA 5CXXA 2VKTA 3P2JA 5IJ0A 4B3SB 1FJGB 1OYVA 1SUCA 1CS0B 2QX9A 1MMFB 1IEXA 1XEWY 1QX3A 3T7TA 2DLCX 4LKRA 4IUYA 1WU7A 4AMBA 2BC9A 5A62A 3QNUA 3DFZA 2PV0A 4C0SA 1GTG1 3CUYA 2WUEA 3OT1A 5ENZA 2I3ZA 2JDIA 4OOFA 4A0GA 1RCUA 2ONJA 2GX6A 3OZ7A 4XGQA 5A5VA 2Q49A 3QY0A 5IFKA 3WZ2A 5JCJD 4W5RA 2BZSA 2X1HA 1R6AA 1XZKA 3GFTA 4HDRB 4RVNA 2ZVPX 1CULC 1UMCB 2G9ZA 4ITRC 4M76B 1HDOA 4RO0A 3FYCA 4RIEA 3J81A 1EZZA 1FSFA 2JFBA 3DP7A 4PGGA 3AEUB 4RACA 1N9KA 3FB1A 3GGOA 5A9TA 3G6KA 3ESZA 5I7RA 2RI0A 4AJ1A 4WKGA 1WZNA 1U2EA 4WBXC 4CUJA 4I2VA 1UBEA 3STWA 3BKXA 1UPFA 2CHFA 4L0MA 2JIZA 3SKXA 3DDCA 3QE0A 3DLPX 2IYTA 1ZMOA 1GDDA 4QAJA 3SJ7A 4H7FA 3F9RA 3PXXA 2GBPA 4JVMA 5CB4A 2Q7OE 3PKZA 3DKKA 2HA0A 3AQIA 5EJ7A 2O06A 2JAXA 5G0VA 3LYHA 5THKA 4DV7B 2JJ2A 3ICQB 4EFLA 4JUCA 5BSTA 4N01A 5H80A 2ZULA 1ADGA 5BNWA 1IHPA 1UK6A 1HFKA 2JVIA 2NT3A 2XCLA 1XZ8A 3JWPA 4LE2A 1HK7A 3VPGA 5JOQA 2Z2YA 2WWHA 3GL9A 4MARA 4MQ4A 1Z8HA 3MT9A 4O4LB 5HZHA 2B4RO 5THQA 4AF6A 5BOVA 4CHGA 3WWEA 1OH5A 4W9RA 1O0BA 4RMHA 2IEIA 3HJFA 3OE4A 1LPSA 1K06A 1YKSA 1W36B 3THYB 4BZZA 3R0JA 2VSQA 1H0KA 3ZDRA 5HOEA 2Y05A 4L78A 1CUSA 4LRSB 3OCCA 4KQKA 3DOHA 3O3OB 2FPMA 1MJFA 1D9ZA 3M83A 4CN8A 4Y30A 1S9DA 1G0OA 3N8DA 1SQSA 1R0YA 2WKQA 2F1HA 4DJDC 3K1AA 3LU1A 4JUAA 5BYKA 5GIPE 4DCOA 1W2GA 1H1LA 2D06A 2J0VA 3T12A 2J3MA 4PZLA 4QQFA 4B3HA 4U7FA 3OCXA 5LM3A 1KMHB 4NDZA 4FFBB 5JHGB 3C7KA 1P2GA 4IJ5A 4L2IB 1RXWA 1YTLA 5IFLA 4PBRA 4HNVA 2GEFA 1JIUA 1WEKA 5JH7F 4MAAA 3GFPA 4O08A 5BR8B 1XCBA 4D9BA 2W58A 3OAAD 2FN4A 3KPYA 3KWMA 4KN6A 3W5UA 4ZZ0A 1N9GA 5F2NA 2DOKA 3BQ9A 2JLRA 1JAIA 1JIIA 4CGYA 1QUFA 4CIAA 4XLZA 3EIWA 1K5PA 3CGWA 5CFPA 3N3BC 1OLSA 2FR0A 3C3BA 3N3AC 4C6TA 3FYTA 3UT0A 4HTFB 1ACJA 4FYXA 2Q3HA 1LDYA 4HSEA 3VHXB 4ZVVA 2JKZA 3NJ8A 3MT8A 3OOWA 2INGX 1Y4SA 1MVLA 4ND4A 5DW0A 4KRYA 1FFSA 1N0WA 2UZ1B 2NQ8A 3DE3X 3DBRB 1DMRA 3MVEA 4K88A 4UEQA 5K3FB 1IBKB 2O8BA 4URWR 4AI6A 2EKPA 2GPNA 4MZDA 2V7QD 5DFAA 3VVMA 1J24A 3ZKWA 5JZVA 4WECA 1I7QB 1CEXA 2PMWB 4RHFA 2ZTLA 3M6AA 5JZSA 2WTAA 2JGEA 4ENRA 4MR8B 1N6LA 4JROA 4C6RA 1TM3E 2OZLB 1JZTA 5G41A 1OZAA 3ONFA 4EG8A 5DSTA 3UOWA 1N36B 1E6CA 1L3IA 4Z1MA 2QIPA 4KPGA 3N8GA 2DH5A 2VTEA 4P7FA 4OJYA 5EUQB 5IDXA 3AY6A 4UU1A 4CQNA 3KZOA 1J8FA 3NJ4A 4LVOA 3A14A 3VDMA 1ZK0A 2H1HA 1PQWA 1DAOA 2VQ6A 3EH2A 4HAVA 3M6MD 4GSYA 4PYQA 1P17A 1Z5GA 3E3OA 4TQAA 1PJZA 1WY7A 2AOUB 2JA2A 3T9EA 3N7UA 4L9WA 1PD1A 1D5WA 3LPMA 3R40A 4J4TA 1CETA 4WZBA 1BH6A 1DQRA 5C37A 2PGAA 4AUEA 4DY4A 1KJYA 1IC6A 3D0KA 3VH1A 1TQDA 5IVPA 3F5QA 1P7WA 2K2QB 2XMSA 1UJMA 1SVNA 1H6CA 2RGDA 1VRCA 2Y1FA 1GPUA 1ZL0A 3AL3A 3ZBTA 4NH4A 1YF3A 2IU4A 1QCYA 4HVTA 1C4OA 3GZNA 2Y1LA 4YJFB 2RI6A 4J0FA 4KWHA 4JP2A 8GPBA 3Q8MA 4GM1A 2ZCJA 2QRNA 2NZYA 5MN4A 4GOJA 5HKLA 4EIWA 3L4BA 5H8WA 1RLOA 3ETLA 3AETA 1E2BA 4B6OA 2VPTA 4MRSA 3UCEA 1YDHA 3H9QA 5LCXA 4JU8A 4E13A 3I6IA 2BR4A 3ITNA 3O8QB 5EIBD 4D6PA 2FPLA 1Z7EA 4MS1A 3U49A 3V1TC 5PNTA 1OLXA 2YJ3A 2HZBA 5TX7A 3EEFA 3I45A 1ZGJA 3ZY3A 5C53B 3VYUB 4Y0AA 2H63A 2W6JD 3H5RA 1QM5A 4JIGA 1TCAA 4U0KA 2PAFA 4WNIA 5C5DA 4URZR 1KYYA 3CF6R 3IGFA 1ZXLA 4HATA 3UTDA 2HA3A 2NXJA 3HUDA 5CDFE 1Y9JA 4UCQA 2XE7A 3OTHA 5SYNA 3TL3A 5ALGA 4AF8A 2REOA 2C20A 3DT6A 1O7JA 4KG7A 2CVPA 2BMEA 2PSHA 1PD0A 3H5IA 3TW4A 1DCFA 4DV3B 3V2HA 3VRHA 1KC3A 3MS4A 3DHNA 2SCUA 4YRRA 2BZ0A 2ZIXA 3IAM1 1T0UA 4M1OA 4MW7A 3PFBA 1AT1A 4UU0A 5J4YA 3PGKA 1RLJA 2IYFA 3WHLA 5AUNB 5P8WA 1DQNA 5EJ5A 3NANA 4KIUA 4C22A 4MEJA 3FNRA 3I73A 3NIFB 4G5QA 3OFNA 4J75A 5I5GA 1UQRA 2UU9B 1NP3A 5ADVA 3VAZA 3CUSA 3T1HB 3BA6A 3WMFA 5LMUB 5JR3A 3AV3A 2VYVA 5ALMA 1T4DA 4IINA 4LNHA 1NJGA 4KMMA 1IOVA 3Q7IA 4PPFA 4B7UA 4RXTA 5AJUA 3VSDA 4UUNA 3KSDO 2Q3BA 3FGZA 2BFBB 2ZJ8A 3QI2A 1D4ZA 2R2AA 4NCKA 3VH3A 5AJXA 1R4MA 3OY2A 1VGRA 4XI9A 4Q7MB 2PS3A 4ERXA 2FZ5A 1VL2A 1PZGA 5GOTA 3DUFA 1Q0RA 1EAMA 4P8RA 5JD4A 3FVVA 4L50A 3QPVA 3QVWA 2BFAA 4V0RA 1E9EA 1GNLA 1U8ZA 4JJAA 5DRTA 3TGWA 4EUHA 2XR1A 2P2GA 1IIBA 4BWYA 3ZQUA 2WVHA 2YN0A 3E9QA 1S4QA 1DEHA 1CHDA 1ZHOA 1Y42X 4HNSA 1JT9A 3N53A 3G0BA 4WOKA 4JC4A 4R1QA 2OG2A 4JLKA 5LB4A 3SZGA 4KUEA 4ASUA 3H0KA 2X14A 3QKUA 5GZ1A 1FMCA 2PPVA 2VP4A 1XTJA 2ZAMA 3OPXA 1YR2A 2GCNA 4BB5A 4C4YA 2G72A 1ZJ6A 4MIOA 1E79D 1I6LA 3KTAA 2WB4A 3PFCA 4L5CA 1E96A 4TKLA 4UQPA 3WKCA 1L5OA 3G1UA 4QHTA 4R40A 3AHHA 3G0IA 3ZVLA 3MINB 2GD0A 4R2LA 2RH8A 4B2PA 4KJXA 1KOGA 1NF2A 4P31A 2XB2A 1IE3A 3T3MB 4ZI3A 2IVZA 4GM4A 1LTKA 2NU8A 2B2NA 3LP5A 3WLHA 1Z8FA 4EL0A 2WOJA 1Y6FA 2RGYA 3DMTA 2HA6A 3FMOB 2NPOA 1T5DX 4ND3A 1QYIA 3O7WA 3RYHB 4F3YA 1WBJB 3KZCA 4N8DA 3QLUA 5EZYB 2OXFA 2VDWB 3WFJA 2BFMA 4B33A 4BPBA 4N7JA 3LE8A 2DFDA 1KO7A 3VXKA 1ZNWA 1V41E 3DYVA 3GT7A 5MGNA 4BX8A 4RDCA 4BQRA 1JFRA 2OZEA 2XW6A 3SEFA 1C4KA 5I8WA 4ARZB 3D31A 3M5WA 4EA8A 1U94A 1G5QA 2POQX 5FT9A 5BURA 1BDIA 1NQOA 4LYGA 2HEGA 2WUDA 3FG9A 1CY8A 4TRRA 4G1MB 4HB3A 4IMRA 4ZU1X 4DSUA 4ZCRA 2Z83A 2RHRA 3IV7A 2BI8A 1RTKA 3ISTA 1VLJA 1XPRA 2IHYA 1GRRA 2CZGA 4HLCA 5CFZA 4F3TA 2YX1A 1MEJA 1NV9A 2EU8A 1IU9A 4PLZA 3WLOA 3WSTA 1TTQB 4HDMA 4UDYX 5CM9C 5AUQA 2FWBA 1HEUA 2ZYDA 1CLUA 2R85A 4CEIA 1LXCA 3LBIA 2WKPA 4Y18A 4AZVA 3Q3IA 3KOYA 2E4XA 1KS9A 2EBHX 5DNDA 2H1LA 5CD9A 4B34A 3HUTA 4NCIA 1E3WB 3JVDA 2CFOA 4KN9S 4XEUA 5E8RA 4J2HA 3H11A 1WKCA 3VO9A 1ZL2A 1QZUA 5HJ7A 3AB8A 4WAUA 4C6HA 3QJ5A 1P1KA 4CQMD 1RZVA 1U02A 2N1MA 5DN6D 3I4CA 1YRQA 3I3OA 3NPAA 1DFIA 4Z4EA 4Y1RA 4X44A 7GPBA 2W43A 5LDDC 3ESYA 1QG0A 3R9XA 3OCYA 1N2JA 1SPBS 1PJSA 1ZH0A 3QVUA 5IP5A 4O3MA 3DAPA 4MJLA 3ROXA 1DG1G 2XRYA 3PWSA 1X7DA 1Y9EA 5KHAA 3VYVA 1PL8A 1JMYA 3L0PA 4A7PA 3GD7A 4TUYB 1PLJA 4FNGA 5LZ7A 4ARVA 2DBRA 2I4OA 1O96A 1KVUA 5L51A 1GYPA 5CDYA 2Q3CA 3E7WA 5AVOA 1F17A 4RJJA 5TJHA 1KOJA 2QKYA 3H8JA 4IWXA 3GOHA 2WV7A 2OXEA 3K9QO 2QRHA 3Q5EA 1SELA 3AEXA 3JRXA 3MMPA 1LK5A 2VNKA 4JJEA 4L8FA 5JD5A 2X5JO 3VR4D 5CVCA 1KFBB 1JHDA 2Z8YM 2WT9A 2EBFX 4GBED 4HY3A 4NQZA 3SCZA 5BV7A 4C7OB 1BCSA 1J8QA 1ZN7A 2XMDA 3NKVA 3NH9A 3Q7EA 4HO1X 2JW5A 2HW8A 4WCDA 3T7RA 1GQOA 4HFRA 4I6GA 3ZZMA 1YL5A 2QRKA 1ML4A 4EY3A 1N9ZA 2GCPA 3BFPA 4JLJA 4NBTA 2KJQA 1SKQA 2FMKA 3DS8A 5EJFA 3SQNA 3PTLA 4YRIA 1ZOSA 1GU1A 3R5TA 2FWJA 4JYZA 3BFXA 3C43A 2P75A 2I4IA 3B53X 4WKOA 1TMOA 3FOCA 2AN4A 2ZTHA 2XRMA 4WL0A 3KQSA 3O6VA 1PBNA 2PWZA 4NCHA 1I5EA 4OQ4A 1C8VB 1KY2A 4LS3A 2R7MA 2WYIA 5FWXB 3W34A 2BH9A 4E6PA 1GCOA 3BE4A 4D96A 1CF2O 3CH7A 2VH1A 4MS3A 4R2WA 3UAOA 2CLOB 3WV5A 2JNWA 2XAAA 1Q22A 3D6FA 3O9ZA 3S1AA 5LD2B 2PDAA 3OFSA 1Z2DA 5AOVA 5B5SA 3FN4A 5IMBA 4JZYA 5J4LA 2FMFA 1JNXX 6GPBA 2Q1SA 4ZEXA 5JMOA 5KSYA 2GLXA 5T7BA 2UZ4A 4GUAA 1YVRA 3SY8A 3GO4A 2DWPA 5LXTF 5J2TB 3VX4A 2AN1A 3KTOA 3QUTA 4PQYA 2C2XA 5K8CA 2HX1A 3H3XA 2BEUA 1UZAA 4MGIR 4YCBA 2IKSA 4UPVA 2EW8A 2ZAOA 1GL7A 3FTDA 1D3AA 1ID8A 2QMUA 3DDOA 1AZTA 1A5ZA 5AK5A 1B3RA 3S1SA 1RJDA 1GOTA 1I3MA 3OZEA 4C4ZA 5KCZA 1TVEA 2Q41A 2B34A 1DAPA 4KN8A 2IHZA 1P61B 4QYMA 4DQDA 4NI5A 1GILA 4PSUA 2O14A 4K9KA 5KWSA 5AHXA 3Q2IA 2XT6A 3PC7A 1M8FA 1UT6A 4IHQA 4N3BA 4GYJA 5FXMA 2IU0A 3KB2A 1DXOA 2XNCA 1Y5LA 1QJ4A 1RBMA 2I76A 5JECA 5CTJA 3EVFA 3FZEA 1KJZA 1TZKA 1UODA 4IH4A 1HG1A 2IQIA 3JYPA 2CD9A 2JD2A 5CYPA 1WMEA 4Z0HO 3VSCA 3TG2A 5CXSA 1P3Y1 3TD6A 2C03A 4TWBA 2M1XA 1D6MA 1QCDA 3H2IA 1AQJA 3LC7O 4TMZA 3LCCA 3Q3JB 4P4SA 2WBLC 1CHNA 1UMDA 3TAXA 1GT6A 2B5OA 1Q1EA 4YMSA 3DLIA 3I83A 4CF7A 2V65A 1MIHA 1JDTA 3KEOA 3VNVA 4V2IA 1LQUA 4MUBA 1ISSA 1MT0A 3GRYA 5CVUA 1X38A 2V4ZA 4MR7B 3WGGA 3H5LA 4ZHSA 2ZRAA 3HUEA 5GGYA 5HS6A 2GCOA 1J00A 2XMQA 3N9IA 1ZONA 3KR2A 4AQ7A 2O59A 1E2PA 2XDWA 4FHGA 2ALJA 3WYCA 2TMYA 1W94A 2JLQA 2R8RA 3QUBA 5FI3A 2ZBUA 3T7SA 5ALEA 4BC1A 1BKSB 3ACDA 2HPAA 3ESXA 5CCDA 4URFA 1V1MB 4MVJI 5ETJA 1FPQA 3G2PA 1J09A 1A9XA 1BU8A 2ZRKA 4N47A 1QE0A 3HXMA 3C4JA 1GAJA 1WDWB 5JJ5A 2WF6A 1H6BA 2XUIA 3PLAE 4P7JA 4FGZA 4F12A 1ND5A 5A4IS 3TDKA 1UEXC 2B3DA 1NRXA 1N3BA 4O3FA 3G2HA 1XMSA 2J9XB 1XG5A 3CHYA 5CA0F 3WAGA 3FCYA 4MUYA 5LQNA 3WO1A 2ERYA 2XYRA 3DAGA 3L4JA 2M6LA 3RSQA 4I2NA 3A25A 3HKEB 3JYQA 5C5CA 4RQUA 3MRVA 3NATA 1Q0SA 1MD9A 3MQFA 1YC5A 1ECCA 4NENA 3SN6A 3WGTA 1DKRA 1H4QA 1E1NA 3FSGA 1WWKA 3KC2A 4OXNA 4P3PA 5AWFC 3SJAA 2BRUC 1NKTA 2X8JA 3QE2A 5J2UF 4WDRA 1VE1A 2NG1A 2WTUA 4H4DA 3GUUA 1OVMA 3MWYW 2SHKA 4RM2A 4D6XA 4PC6A 3JASB 3L0OA 4GGOA 4JN6B 2I7CA 2R8BA 1MNQA 4ANFA 4UOEA 2VYND 1OAOC 3A2KA 3CX6A 3FMPB 3RWOA 1J5PA 3FPSA 3SX2A 1N2OA 2GZHA 3FETA 4I8DA 4L16A 5LKRA 4G1UC 2NIPA 3S81A 3FUUA 4MK4A 4DA9A 3GELA 4K86A 3RTCA 5TQ0B 2IVFA 4JH0A 2C4NA 4D3XA 1J07A 4JUIA 3KFXA 5E4TA 3TX2A 5TR9A 3ZZNA 4EG6A 1W88A 5P21A 2AKEA 3NBKA 2HT6A 2NO0A 3WNQA 4X65B 5DIZA 1VMKA 2Z0MA 1BSVA 1ECFA 2Y1WA 4L72A 4HEA6 1FFCA 3LHKA 4LF9B 1ZMRA 4Q9AA 3LV8A 5AUOB 3PYXA 4KWIA 1WCIB 4MJXA 4HTAA 3EN0A 3M1LA 1UAYA 1ISHA 1DRKA 1UDXA 1W0KD 1W5SA 3IT2A 1Q2XA 4Q66C 4YJDA 5ESWA 2QRLA 4YXFA 1IBCA 4OB8A 2A8YA 3WRXC 2GDJA 2ST1A 1X13A 5MGBA 3H97A 3CN7A 4OMDA 1HYHA 5LP6A 3EXEB 3BSYA 3K9LA 4WESB 1LV7A 1R0WA 4UJ3A 4IRMA 4EPXA 2OC4A 4KW7A 1H3EA 2X7XA 5I3ZA 4LZWA 5JXJA 2CGEA 4KTTE 5B4VA 2ZATA 1ISGA 2RHBA 4QC2A 1IXYA 4Q4AA 2GS9A 2PE5A 3EH1A 4K40A 4KIGA 4F04A 4GHWA 4F4FA 1DRUA 4MKZA 1L1RA 3GEIA 4M9XA 2SKEA 4U2DA 2GSWA 1HE4A 1D2GA 3A9TA 1Z0JA 3JVEA 1E4OA 1DE0A 1QKJA 1KMQA 4ZEMA 2PX5A 1JB1A 2FI1A 2VTDA 2G3YA 2WSSD 3ABIA 2ATEA 2HA5A 1JFLA 4GLBA 4IYRA 2ZYRA 3TIGA 1JA0A 4CMIA 1YZNA 1XJCA 2C98A 1VL5A 1XTUA 3R3JA 4IVRA 4Q1AA 2CYCA 5G4KB 3RNLA 4F2DA 1JEQB 3DAFA 1N7HA 2EX0A 3RWBA 5IN4A 1M5RA 4BQNA 1TTHA 1KSHA 2C4WA 3M33A 2ODPA 5KDOA 1JKJB 1CY0A 1YBFA 1Y9DA 3M4YA 1NT4A 4HWKA 3HL4A 1K7SN 2QAGA 4A1FA 2P6UA 2PS1A 1V45E 4Q9IA 2JASA 1AX9A 2VHUA 5HFJA 1VL6A 1XPUA 4R2IA 3C3PA 2PANA 1WBDA 3S2GA 4UNRA 3JYLA 2OOKA 2A5LA 3CUUA 1D4FA 1PYGA 3O2SB 4KXLA 1M6VB 1NUHA 2ZB8A 2J3DA 3T1NA 1QGZA 4H6WA 3MMZA 1E9FA 3H1BA 1LPAB 2DVMA 4RH1A 3TRJA 4WXYB 3UMRA 3WLEA 3IOMA 3PFHA 4RD2A 3GMIA 4D3FA 1USWA 2XE6A 4HZUA 3K09C 4X90A 1AXGA 2AMFA 1PFQA 1A27A 3JX9A 2V7WA 1DJNA 3LGAA 4IV5A 4DGQA 4F6LA 2XA9A 1U7PA 4WE3A 1DFHA 3VJKA 1HDGO 1WXQA 4KO8A 2OY0A 2YHAA 3STVA 2XNHA 1OV6A 2PT6A 4PAGA 3X2SA 1ZD5A 2GPJA 4QODA 4KRGA 3FOFC 2W90A 3BM5A 2I91A 1GQ2A 1DWQA 3OT4A 3RU3A 2P2DA 1PJ8A 1I4TD 2X5OA 3G2NA 1E2QA 3BMQA 1DXHA 3BCUA 4YJ3B 2B21A 5F9FA 2C4VA 1OBCA 2ODTX 1M0TA 2QROA 1SFRA 3DV0B 4HPJB 4O1HA 3KZNA 4XIJA 5FNVA 1PS8A 2YMPA 3U37A 3GRCA 3D0OA 1BGVA 2CNDA 1D0SA 1RWOA 1GQQA 5K9ZA 2NMVA 3E3LA 4AXBA 5TRTA 1D1SA 3GEPA 3ZHOA 4LHSA 3OZXA 2UXCB 3ECCA 2Q29A 1J4AA 2FW1A 4KHPB 3CX3A 1M0SA 2HDNB 4RANA 4UHDA 2WHQA 2PRKA 1SWVA 1ULHA 3G13A 3G5AA 4FYPA 4XD2A 5B7NA 5BSVA 3FTFA 3D8HA 1W5TA 1C8BA 4LN1A 4JSRA 2E0IA 2Z9CA 3STXA 4AO6A 1DKOA 1OU4A 2NYRA 3LM8A 3NP7A 4AY5A 4F1JA 5KVSA 3LF1A 2PUBA 3WADA 3M49A 4N82A 4R16A 1MAVA 1L0BA 4YNBA 3LL7A 3EXHC 1SCUA 4ABTA 1BS9A 2ZWIA 4ZRMA 4LC1A 3HJNA 2X22A 3INTA 2RE8A 5HA5A 5HKBA 2C5LA 3ANXA 1R0RE 2P9YA 4X7MA 1QDUA 5LFAA 4GX5A 3LBAA 4IGKA 1E3SA 2AHOA 4PLHA 1CDEA 4KPFC 1G19A 3HLTA 5JTTA 2NZJA 4NYMQ 4LNAA 5DGCA 3KQWA 1FJXA 1SQ6A 3BWMA 3N6VA 4YV2A 3OPMA 1QDLB 4EG1A 1M76A 2AJBA 2EP7A 2BFCA 2PMBA 2BMDA 1FJ2A 4B3MB 3IB6A 1TCUA 4KFCA 4EVQA 1SHKA 3FY4A 3GNLA 4C3ZA 1FUIA 1JB9A 2IHUA 2P6NA 5U4XA 2QZPA 3FPEA 2H1OA 2AWOA 1YGPA 1G20A 3P5SA 3H17A 1IXKA 3BMNB 4UM7A 1M33A 2E4YA 2JBWA 4QYTA 4RZHA 5ALIA 1CBUA 3IKJA 5E1MA 2VCYA 3WFIA 2PCJA 1VJRA 3WGNA 4BFTA 4JBXA 3WA7A 4MS4B 4YIHA 5HDBB 3L46A 2QE7A 4JXZA 5KTMA 4M36A 4BFLA 4OL0A 1F4LA 4U7DA 5FUBA 3I9KA 1H2XA 1M2VB 4JJ6A 4MUMA 4V0KA 4GOOD 4JL5A 3KUXA 2WNHA 1Q84A 4NONA 3ZLTA 5HHTA 1P5JA 1UMCA 2DPGA 1GR0A 2RHLA 4I1UA 3HSSA 4YX9A 3F73A 1QP4A 2C2YA 2W2MA 3NEYA 4HGRA 2OHXA 4NL4H 3EZGA 3ZI0A 1H2HA 3AI7A 2ECOA 2ZP1A 3E22B 3NEJA 3EDMA 1YFLA 3W8FA 5KYXA 2GAFA 3WB2A 4WVLA 1A9RA 3EVBA 1YMVA 2B36A 2W2KB 1N1EA 3OETA 1EXVA 1VKRA 2HM7A 4EG3A 4E6EA 4OKSA 5JS7A 3HU2A 5GZ3A 4MMYB 4OO3A 2OM6A 5L3VA 3LD9A 1OLUB 1I5RA 1H2AS 2QRUA 3UAYA 3ZIUA 3U3DA 3EGXB 1WZIA 4DQXA 1MFZA 4OY3A 3RSSA 1W0CA 1ISIA 4QT0A 5AVXA 3R2JA 5F23A 1NBMD 1NLYA 3Q72A 3LMKA 3BE5A 3G23A 2DG2A 2WPDA 3MGAA 2J8ZA 5CNMA 3W7BA 2VJYA 1JLMA 2B4TO 3FW1A 4M46A 4O63O 4GS5A 4UHJA 4O4LA 2XUOA 2ZS7A 1E3LA 3W5CA 1UFKA 2JEOA 2ZSUA 3AH8A 3PWZA 5HF6A 3IMFA 2VJQA 2PK3A 2D5CA 3T5TA 4N5LA 4RVSA 4NESA 3RU9A 3THYA 3GVCA 5BQXA 5L3RA 1W48A 4PCUA 4DLAA 4OYHA 1ZK3A 4MQEA 2K2WA 3TNFA 3AILA 2HSWA 2I4LA 4JLVA 5TPWB 2OHJA 5TVGA 4H6VA 4MVJE 4MZXA 4XIIA 1RCTE 2H2AA 4KOAA 1FFXB 4C78A 1GTRA 1RT9A 1U04A 4C01A 2F62A 2JH3A 2QX6A 3WQQA 2EQ5A 2ZWOA 1VLVA 1GZ5A 1H2RS 1EX6A 2OKGA 3QY9A 3W5DA 2C4KA 4X7BA 5CLFA 1B00A 1C0LA 2PH1A 1HDCA 1KMHA 1NC1A 4FFBA 5JE8A 2AZMA 2AJ8A 2XEXA 4L2IA 5JLAA 4BNVA 4GPD1 3LWDA 3Q2KA 1SZCA 3BXOA 5EZSA 2G40A 3CVJA 3Q3CA 5FWDA 3T3DA 1T2VA 3W6NA 4V1CI 4YIKA 3PKJA 4XA8A 1H1DA 3DZDA 2QZ4A 2QENA 2R2GA 1UBRS 5A0TA 5DK4A 1T8YA 3KUUA 4P4TA 4R69A 1WXGA 2F17A 3V8NA 2ZRQA 1W29A 5LLTA 3IBTA 2WIKA 3UMGA 5TEWA 2VP5A 1Q1ZA 1IPHA 1QH1A 2O8FB 3W7VA 1RJFA 4HTFA 1RPJA 3JWIA 4LISA 1E4EA 1MENA 2ZJ7A 3VHXA 9ABPA 3JATA 1SXJC 3JTEA 3SDSA 4DC0A 3Q6MA 3UJ3X 1UC9A 1W2WB 2ID9A 1UJ5A 1ZM3A 2CY0A 2UZ1A 1WZUA 3DBRA 2NOAA 5K3FA 3JW8A 1D2NA 1TT7A 1ZITA 2VRCD 3BPSA 3NR2A 4IHJA 2FPPB 3J7TA 3U4GA 4FN4A 3GT3A 5T6BA 5K8JB 2XWBF 3OD5A 4LF6B 2ZG6A 4YH1A 2QMYA 4XVHA 3AR3A 1ZWLA 3P2EA 4MR8A 4XGIA 4TROA 4ESHA 1H85A 4JVSB 2BVNA 3P0HA 4R7ZA 2OXCA 1KVQA 3KKZA 2OZLA 4K7JA 3MYRA 5HFNA 2BKUA 1XHEA 4NABA 4RA6B 5WRFA 1ZIPA 3TLKA 1O6GA 1O4VA 1FYWA 2OECA 3IHKA 2H4HA 1T1IA 3ER6A 4J1TC 4M0LA 5FPQA 2J5BA 3VO1A 4B6RA 1Q2UA 1CCWA 1OZ0A 1EM6A 2QGFA 4LE0A 4TTAA 2O8VA 4WY5A 5I47A 4RKWA 3RV4A 3WJ2A 2Y0BA 3MJ4A 2IUUA 3E35A 3EF0A 3EXG1 1QZTA 1HUQA 2JIBA 3A6DA 4TRMA 5BN3B 4W1QA 5BW6B 2ASEA 1MRNA 3N28A 4IV8A 2AD5A 4B2IA 4UTVA 1T5SA 1M8PA 1S4MA 1DLJA 2AOUA 4H1WA 1VA4A 2RGBA 2JCVA 2OWEA 1AQUA 4RPIA 1K7YA 5GVRA 5AW1A 1THTA 1QOQB 1TA0A 1KWKA 4LGYA 4BRZA 1Z6PA 4CQMB 4GI5A 3H2BA 2IS4A 5TGZA 1P45A 3O92A 4E22A 4TYMA 4R01A 1VHWA 3V2UA 2L82A 4FONA 3L8GA 4XYMA 3RVDA 3RU2A 2C1EA 3QU2A 4F5ZA 5KYTA 1F8UA 1LPNA 2BKAA 3H3FA 1PFVA 2WFAA 3HEAA 4ETIA 4MKGA 3ZJYA 3PDCA 2L42A 1DS6A 1JPJA 4XFDA 4HAOA 4EEXA 4EABA 3FYSA 1IFXA 3MCTA 4CMEC 2IYAA 4HEQA 4O0LA 2Q5IA 2VQEB 4IXWA 5H16A 3R7NA 3GJ0A 1D9XA 3DLTA 5BW5A 1GGKA 1N2CB 4DV4B 2OR3A 1M6NA 4TS4A 1IY2A 4WACA 1I7LA 5FOSA 2OAEA 1BS1A 3PJGA 4Z54A 5DW3A 5J40A 2XB4A 1P0IA 3FNBA 5E2AA 5ALQA 4Q4LA 2D2VA 2R8XA 4ZI7F 2HV9A 5CAEB 4H4CA 4X1IB 4NFHA 3CLKA 3LDUA 4ZJUA 3RC8A 2UUAB 3CRZA 1F4PA 5AP9A 3AVTA 1WW2A 2WABA 4ZOLA 1GR1A 1X1QA 4WNYA 1SWWA 2VUHB 4HYTA 3ZI7A 2VDOB 1JXQA 2OVFA 4G5HA 4ALIA 5LOVF 1ZISA 4KLRA 5A06A 3UW1A 3HKBB 3HXLA 1LK0A 3VJMA 5KQMA 3OHPA 4C21A 5C4MA 3ZK7A 1XU9A 5MFZA 2BGKA 3GJTA 2DMRA 3LXXA 3NT2A 4Z4GA 4NBVA 5IVHA 1E6WA 2H0RA 4AURA 2XCQA 1SGWA 3N59A 4HGOA 4WXHA 4E7OA 3MJHA 4MKRA 3M6VA 3S2EA 1E8NA 3O8CA 1YFZA 4F8JA 4LBVA 3QLVC 1BA3A 4GSKA 3X1XA 4CTOA 2ZIAA 1DB3A 1MX9A 1E1KA 3ZWQA 2P27A 2A3RA 3FUTA 3PNLA 2X3UA 3KSZO 3D3KA 4D0GA 4YYEA 3PFNA 4QDJA 2BV3A 2YIVX 2PY6A 4QGHA 5B1DA 4D99A 1UM9B 2IYYA 3EQ8A 3URKA 1OBHA 4S2EA 2NM0A 4X45A 4U63A 1PTJA 3A1FA 1PJCA 3QJYA 5CJPA 5DZSA 1P2SA 5H02A 2Z95A 3P9QA 3VMMA 3O03A 1YNOA 1QF6A 2BFBA 1KEVA 5DM2A 2G4LA 3W8EA 1XJ5A 3X43A 1C9JA 3G1TA 1E1RA 2AL7A 1K68A 2X9LA 3Q41A 5JYCA 4XFKA 5EP3A 2PEZA 5ECYA 4UQLA 1DCTA 2QTZA 4QUJA 4I1RA 4QLOA 5AIAA 3CV3A 2NTVA 2HJSA 3O73A 4H0NA 3I9NA 3IP7A 4MV5A 4OH1A 4BNJA 1RKUA 1THMA 2FWIA 4N0EA 3SM9A 1U3TA 3VZCA 4L8WB 1HL3A 4GICA 1K66A 4UM5A 2G82A 1NM5C 2WM8A 2YYAA 5JPDA 3U61B 1TFRA 1RI5A 5DX8A 5DDIP 4COKA 3ND5A 2XITA 4UBOA 4PAQA 3ZY5A 5F7XA 4OLAA 4LFBB 2C5EA 3C3CA 2VPQA 5U1PA 1N6NA 4CG3A 2N3ZA 2ZYTX 2IQ5A 4I46A 4YFVA 1IAVA 4RPHA 4ETMA 2FFRA 3H0CA 4HCJA 3MZ0A 5DTRA 1RQRA 2BFFA 3IVMA 3MTEA 1CVRA 1G5PA 1NPDA 2YIJA 4BV9A 3RR2A 1HT3A 1REQA 1PKXA 1IN1A 3VKVA 3BEOA 1T25A 3FVRA 5DGTA 2JLWA 2B6HA 1SB9A 4OGLA 4P6VF 1SVIA 4UREA 1XGKA 1PGNA 2A9KA 2IKQA 1T5IA 2J45A 1NULA 2PJUA 3MINA 3QFHA 2QL6A 4IBOA 1OE0A 1RFGE 2CLHB 3ET5A 1WXFA 4JR1A 5IAAA 4QPZA 1ZD4A 3BHIA 5JSFA 2FZ4A 4OB6A 5DBHX 5K8UA 2XVZA 1XQ6A 2J5XA 3CIFA 1P1BA 4KGZA 5DGXA 5IAKA 3UH0A 4A73A 5K20A 3CJRA 2PIAA 3DOFA 4JJ8A 1EMDA 1DIAA 3I9FA 1G3MA 1NG1A 1U2TA 3D8BA 3N2KB 2DERA 1DAKA 1PF7E 3MGKA 2NQTA 3WLQA 3RYHA 5CLHA 3G49A 1RC0A 1DEKA 4Q0MA 4QVKA 4B46A 3GGDA 3NTQA 2V5UA 3CSSA 1Z56C 2NU7A 1C0KA 2XDYA 3TAHA 5CFRA 4Q4JA 3A4MA 3C1UA 1JNYA 4FFRA 1P6UA 2DZDA 2IZZA 2N0SA 1MC5A 4ARZA 3S5UA 3QPBA 1PUIA 4XQEA 1DC6A 3AWDA 3CX8A 5JH7B 1TNDA 4IIJA 2PGDA 1DLIA 4KL8S 5F2OA 1I32A 4J3FA 5AICA 4CKBB 1FXWF 4TWRA 5IT0A 3JQGB 3R5SA 5ILGA 5JWHA 4JDUA 3P52A 5TGTA 1NNLA 3OQJA 2GN0A 3N8NA 2CLKB 1RRFA 4BPRA 1EGHA 1NP7A 1FTNA 2QQ0A 2P9HA 1AKNA 3H4MA 3N76A 3AUYA 4PFKA 1LRLA 2XXAA 1XHFA 3QVOA 4MYTA 5ITZB 1D6JA 4AJ4A 3O4GA 4YAJA 3OJXA 2J4DA 1JWAB 1YQGA 4AJOA 2PLAA 1IXSB 1G5IA 3K5HA 1O03A 4K26A 1JPUA 1E3WA 4RKRA 3OKCA 1R9MA 2PXXA 1WB9A 3E4DA 3FNGA 5CXUA 2YRWA 2R1UA 3ZQ4A 2E1PA 1RE1A 1T43A 2W2LA 1AN0A 3O4RA 1E0JA 4NG5A 5KSOA 3T1YB 1AKRA 1M2GA 2YXDA 3HJRA 2V6IA 3OOEA 4WMLA 3KTDA 5G3ZA 2AG8A 4BTVA 1V26A 4ZJYA 3D59A 1LI4A 3N0TA 4BY9E 4WLVA 1UPTA 2FB9A 5DTIA 4GEKA 3WYAA 4PZUA 2HHJA 2A1UA 3OU6A 1N4AA 3JCZA 4JUDX 4BZXA 3MD0A 2AFIA 5J5VA 1C1HA 1NKSA 3DE1X 1IEWA 1HT1E 4EH1A 1L5QA 1AHHA 1NC3A 5BN5B 1RI2A 4DYHA 3EMKA 5C8VA 1YACA 3S44A 1M1YB 2G88A 4GECA 5FBHA 2BGLA 4TUYA 5FBQB 3DQQA 2PX3A 2WE7A 4TTPA 4EKDA 4IXMA 3RHTA 1JXOA 1TAHA 4RHYA 1L1QA 1E1MA 1HE3A 1PW5A 1BVUA 2FN7A 2OXTA 5K0EA 4YT4A 3ORHA 3SKYA 4IRUB 2ID4A 4NZNA 3C7CB 1G1AA 4LWQA 5DOVA 1VKHA 4FGJA 4M1MA 5IDYA 3DVRX 4KVGA 1YV9A 2YKGA 4C7OA 3HY3A 3H9BA 4Y3UA 1JH9A 4P5PA 3Q9LA 1AS3A 4OHWA 2O0JA 4F91B 1IBSA 1QSGA 1U1GA 4L5IA 1T36A 4PR0A 5DGIA 3TRIA 5F3RA 3H6GA 1CK4A 1IPEA 4INPA 2NVWA 1NXQA 1EXDA 2ZYIA 2QLNA 1CEEA 3JQ8B 1QWSA 1NXWA 3KTFA 4M53A 1MG0A 3G5MA 3P8ZA 1HOTA 3Q8XB 5CDTA 1KWGA 1T5HX 1UJNA 3ZWYA 2ZK7A 1X77A 4RADA 3NDPA 5AVZA 1ZEMA 3A4TA 3P5BA 4IFEA 1N6KA 5FWXA 4D79A 2LGJA 3LYLA 4TKVA 3RS5A 4G37A 3I4LA 4AVYA 2PGLA 2NN3C 1TM5E 3MTQA 4LTMA 3PC8A 4P38A 1JG6A 1M67A 1QX4A 1R0LA 2A9QA 1XTSA 4RV5A 4IDEA 3ROTA 5CVJA 2J4FA 3V1KA 1EFRD 3GN1A 3VNSA 5JRZA 4B80A 5K99A 2VK4A 1U7DA 5JT1A 1HY3A 2CUKA 2OV4A 1F6DA 5K3OA 3L4KA 3RFCA 4KGXA 3CEJA 3V4VB 4JIMA 5AO9A 3JPWA 3VVCA 1YTUA 1GEGA 4R68A 3TWOA 3VKGA 3CF4G 3L5KA 4BMNA 4HHEA 4NMMA 1H2YA 3B1JA 3RWMB 1W4LA 2ZJ4A 4L15A 1XQVA 2C88A 2BHRA 4KB5A 4QXAA 4BLTA 4U2CA 4EECA 5HEKA 4RTOA 1JZQA 2AA3A 4GPIB 2C4MA 4BQPA 1WA5A 2L17A 2Q5FA 2QAJA 2O9JA 1BZYA 2VWQA 1QO0A 1PEDA 2XVYA 3KO8A 4IL5A 4QUGA 4WN9B 1Z34A 3U9TA 3H8WA 3C41J 2VN8A 4G41A 5IM4F 4Y98A 3OFJA 1XVVA 2GO7A 1ZVQA 4UNIA 1Q0TA 4FCWA 4BEBA 3SOPA 3NC1C 5KJ6A 2H06A 4BFSA 2EERA 2O1XA 4H7IA 3THSA 3H84A 4KQGA 5BSMA 2WFMA 1U0NA 2ZWAA 2ZUSA 2HLDD 3B85A 4ZREA 2QD4A 3T7EA 3UHOA 2OAQ1 5EZ6B 1AMOA 3GLGB 5JJKA 2ZR7A 2PX4A 2F9LA 3HZHA 4IOKA 4BVGA 3AFOA 3KHSA 1O6BA 2TMGA 2X4DA 4KLCA 2W0SA 3S2UA 4BUJA 4FN5A 1T8TA 3TR5A 3EARA 2PRSA 2HMYB 5AW3A 2I67A 4D82A 1AH2A 4C3OB 3F5MA 3T3HA 1A4IA 3WE7A 5K6AC 5FJIA 5CB8A 4YRTA 4NU6A 3GPBA 5L53A 2OP1A 3DEIA 2RARA 4A5SA 3KV1A 2HU8A 1X0VA 1X70A 4Y6RA 4LGVA 4PSCA 4ZVQA 2DR0A 2IDKA 2V7TA 1UDRA 4QJ5A 3CM0A 4KHZA 3JQEA 3BZUA 1K4MA 4N1AA 3T99A 3NVAA 2VXOA 4H15A 5BP7A 4DZRA 4XR9A 1URPA 3AFHA 5FYQA 3ZYCA 4BJ1A 1T5TA 2IGTA 4QEZA 4TLEA 2ZZNA 4B8YA 3G9UA 2P4UA 4DC9A 1QKIA 5C51B 3RUHA 2O8CB 2JEYA 1N5MA 4INJA 4OGGA 4BKRA 4QQ8A 5CX1B 1V1MA 2PHZA 1YE5A 4IXTA 3TN7A 4DRYA 1CR1A 1KU0A 3ZU4A 2HL6A 1U6KA 3LQRA 5JAZA 5EZ5A 4FD2A 4ZO9A 3A4IA 3FCEA 4MULA 1G7CA 3FI0A 2Q6LA 1YVUA 4JNKA 5CYOA 2LE0A 4G8JA 2QLMA 3LGXA 5K3AA 3UEOA 4BGUA 1OTYA 1V7PC 5FHRA 2IWHA 4N5IX 1L9XA 2ERCA 3DW1X 3WYGA 5TLSA 3KXKA 3C97A 2O20A 2QSJA 4AWBA 3LGSA 1TYDE 4CL2A 3LPCA 1WB4A 2CJPA 4FGLA 2XYQA 4X66B 5ISMA 5EWMB 1ULAA 2G9UA 3L7DA 3ECSA 2TYSB 1XDBA 3ZWKA 2XADA 1EQUA 3SG0A 1RM0A 2Q7DA 1NR1A 4MQMA 2C5GA 5CT5A 2PJZA 5C46F 1PJQA 2H2IA 4KI0A 4B6JA 3DMGA 1K08A 3X1MA 4KNVA 4GZ5A 4NWIA 4WEQA 4NIMA 2BMWA 4IDNA 1DBSA 4D74A 2PL5A 3OURA 1ESMA 3JASA 5JCJA 4DDUA 4QNMA 5I48A 2C97A 1H4SA 3DHEA 3RC1A 1INLA 4JI6B 3WLRA 4ZGBA 3JQBC 1EZ1A 1M7GA 1BFUA 3JZIA 4IDFA 3F4KA 2YYSA 1FXUA 3VQTA 1QMGA 4ZQGA 1R12A 5TQ0A 1BJKA 2ZEJA 3LFUA 2GCGA 3VC1A 4DXDA 1WLYA 1HWYA 2WU0A 1KNXA 2CYBA 2YNMD 1U8AA 1W76A 2Q4TA 2QX7A 3DEHA 3F9IA 2YJTD 3OPQA 3EIQA 4WZBE 3TBKA 3FHCB 4E46A 4Q9JA 1L5MA 5CH3A 2G9RA 1W1IA 1RCFA 4A10A 3IJRA 2E87A 3F3YA 5IK2D 3IX7A 3PFFA 2OCYC 1C30B 1XNRB 5K51A 3UTCA 3KD3A 6AT1A 3I2KA 3W8NA 3ANTA 4MRMA 1JSZA 4PZ9A 1ZD2P 3UN1A 4E14A 1WCIA 4DNFA 1E6MA 3LIPA 1O95C 2HC9A 1NOKA 3D43A 3IIIA 2HN9A 3RFUA 1YJCA 4YRPA 3STTA 4F5YA 5HJEA 2ORED 2Z2XA 1ZQ1A 4FOSA 4HAYA 2WTMA 5JSHA 1XN1A 4LV6A 1AJEA 2NV2B 4PQFA 4L0DA 1J8MF 5KYWA 3EXEA 1TI7A 3BGIA 4RPGA 1E3DA 4AJIA 4CIBA 3K96A 4XCVA 3M2PA 2RAVA 3NOOA 4IEIA 3OIVA 1XFDA 3Q7TA 4HEHA 1KSGA 3BICA 3E0XA 1RDFA 2C7BA 3IVCA 3K4QA 4ZHQA 4H60A 3LVFO 3QBDA 4GKVA 4L4XA 1N6OA 4A0FA 1ENYA 2Y9PB 1QGOA 1I9GA 5IKXA 1NLUA 1YQWA 3PHLA 2OBNA 5JC8A 4CQLA 4JWTA 3F96A 3CRVA 3AIIA 2HD4A 1N2HA 1VJDA 5CT8A 3A9RA 5DYIA 5G1PA 3LBHA 3VU8A 1N34B 2NSYA 1B7GO 1PWEA 3WL3A 1EDEA 1PL0A 3SZ3A 3VZQA 1JR4A 2PRIA 2E82A 4H17A 3RVKA 2V3CC 1QU2A 1GJRA 3TLGA 5KWIA 4IILA 4RKQA 5TT1A 1QGDA 3VHRA 4PG5A 3ZWPA 4YRZA 3OAAA 5A1TA 1EP9A 5GV8A 3QV2A 1GPLA 4FKMA 1JKJA 5I8PA 3U7HB 3QM1A 3EOBI 1L1FA 3L02A 4PGHA 3CUWA 2GTPA 2G5TA 4B3CA 3OM9A 4GI7A 1AKMA 4G2TA 4M6WB 4UCWA 2OD7A 3RTEA 2PKWA 2IZ1A 1X80B 1KO4A 3OHMA 1N6RA 1FVXA 4V38A 3H65A 5A6SA 2D0DA 4UZSA 1NDQA 2I3GA 2HF2A 2GN1A 5AK6A 2OYCA 1Q0UA 3UENA 5IJ9B 2LPMA 3E1GA 2BAGA 1Z4PX 2M32A 4KXXA 1M6VA 4NOMA 2JVJA 2RGWA 3IKVA 2V7QA 1FRFS 1GG2A 2FOIA 2KLHA 4G0WA 3DB2A 3NDBB 3EDYA 1SZJG 1VG0B 2PD3A 4YV0A 4PG6A 4IIGA 3RKSA 4YUXA 4QOFA 4TM8A 2XQJA 4HNTA 3I5XA 4IMJB 1D1TA 5KWJA 3HDHA 6ADHA 3OWHA 2AG5A 4PFSA 2ZYAA 4QOEA 3LLMA 4MPJA 7MDHA 1ZSVA 1ZMBA 3AJEA 3EVCA 2DPHA 4M7OA 5H3LA 4BNFA 1ZIXA 5LXTB 2NU6B 4D9CA 2R11A 5DE3A 3KEMA 4P0QB 1NHWA 3HP1A 3KT3A 4OGFA 1P75A 2NO6A 4YJ3A 5FPSA 3ZHXA 2RGNA 3GWGA 1OFUX 3DV0A 3BS4A 3MJTA 3V7FA 2BLLA 1O58A 5JEDA 3V8PA 4KQ9A 3VPHA 2FHPA 2YC4C 3GGCA 4BB0A 3IIMA 2ZAGA 1CFZA 1JYFA 2XE4A 4XPIB 2XVXA 2ONCA 4WY2A 2HNAA 4QT4A 1Y3CE 2I2WA 3HU1A 2P6OA 2PUJA 2VHCA 1E9VA 2FRVA 2BFDB 4PR3A 1V37A 3GFBA 1V35A 3SC4A 1H8HD 3ETNA 3EZ2A 1SUDA 5C8YF 2LKCA 5A7GA 2YIMA 2IYNA 3KG2A 3N1UA 5DEOA 3WWYA 1AS2A 3HNPA 3ZEAA 4LCEA 1XDUA 1F2UA 3OM8A 2IHKA 4TLCA 4LXXA 4PZEA 4KR0A 3CF2A 1B73A 3JQCA 3TW0A 1IZ0A 3PDIB 4J1TA 1U7ZA 2DFLA 2Z04A 2VH2A 3T7DA 2UVQA 3RTBA 2LDXA 5I01A 5K8IA 4EEZA 2A9PA 3PGJA 5CJJA 4Z7NB 4CKYA 1VPDA 2OQ2A 5MFPA 4C1NA 3ST7A 1JBEA 1JTFA 1D6SA 1RQXA 2QYHA 3ZXIA 2X8WA 5JNWA 2RJNA 4GT1A 1UP7A 3H5WA 3KAPA 4ZOQI 3ADBA 3CH5A 1GZUA 1GSAA 1XZLA 4G56A 4OJMX 1YT5A 3OZUA 5EHGA 4AJHA 4BNXA 4OVKA 2D59A 1DZ3A 1VSVA 4Y2GA 2W6JA 4YAEA 3FNIA 3U1TA 1NPYA 3VBCA 1KO8A 3G89A 3GVXA 1IB6A 1UUFA 4DE5A 4DPMA 2B1IA 4MLCA 3T9AA 3ZH2A 3FZGA 3RF7A 3GH1A 2Q5CA 2ZB7A 1F8FA 4LIPD 4XVRA 5FTNA 3SHOA 5CVTA 4CIWA 4GP9A 2CVHA 4JA2A 2CXNA 2IXTA 4IEFB 4KWEA 1MPTA 3BMNA 5ESRA 3V97A 3VR5H 1WCV1 4JAVC 4EFDA 1XQYA 1JEYA 4O2BA 1YS9A 4HDAA 1OWOA 3MT0A 2BFNA 2IH2A 1M7BA 3EPHA 2P62A 3ZHZA 1WDMA 1CY1A 1OXSC 1Q1AA 1VI2A 2OLJA 5C7YA 5HGJA 3M1YA 5LR6A 1THGA 1YS2X 3AKDA 4FJ0A 3UQYS 3OG9A 1YXMA 3B36A 1GPAA 2QUIA 3QQPA 2IH4A 3A3PA 4Q4DA 5CA0B 1F3LA 4AZTA 3E1KA 2NO5A 3KB8A 1FUYB 4YUYA 3RRZA 4GKKB 4UHFA 1ITZA 2EBUA 2GTIA 5IF9A 5KWVA 3RJTA 1HYGA 2NZWA 1R74A 3WQBA 4BV8A 1Z37A 4FCCA 4BO8A 3PIDA 4WD3A 3ZDXB 3MAGA 4WLFA 4QO7A 2EDAA 4DHEA 2QU7A 1SB8A 2JLBA 1OLUA 1MX5A 2KLBA 3GJ4A 4IIBA 2OA0A 3WXMA 4IGAA 2SBTA 5J2UB 2PGOA 3L8CA 1PK9A 3VPDA 3EGXA 1KJIA 1CXZA 4LEIA 1DC4A 3I6YA 4ZPJA 4BZWA 4CV3A 3QVGB 4CF4A 4RZUA 4DR4B 1B6SA 4YJGB 1PE0A 4HAWA 3ETEA 4C3UA 4H1TA 1EK6A 1NVDA 1NSFA 2L2QA 5FEUA 4J03A 2JCGA 3PEYA 1P72A 3NHFA 3PGMA 1YK1A 5LU8A 4RVGA 1HEIA 4NOLA 4JI5B 4QBKA 3IDSA 1V3TA 2YQ5A 4IG4A 1IYZA 4AZ0B 2CHVA 3VTAA 4QZVA 1H9CA 1P7PA 3SK0A 3VOBA 5JNVA 1A77A 3ERCA 2EFJA 1OB5A 3IVGA 3T35A 5HMLA 4R1OA 2RBKA 5TPWA 4P93A 4MP8A 2I2DA 1DTSA 4ZI5A 3KR0A 2VJCA 1S01A 2VF4X 3LXMA 4YFYA 5B1SA 3V34A 4YPOA 1RXVA 2X4LA 3H1GA 3HA5A 2X4IA 3KIPA 4WI1A 3SHVA 3GJXC 3WDKA 1E79A 1OT5A 4WXPA 1F2DA 1LLCA 1EJ2A 4O1IA 2UXDB 3RAEC 1G41A 1FDIA 1G8MA 1RACA 4NF2A 1E7MA 3TBFA 4DRZA 1O5IA 1ONPA 4FR0A 1CTQA 2WB2A 3AKCA 2VYFA 1RHRA 3CCBA 2OCKA 1T6BY 2O4UX 2WOOA 2E3JA 5GM2A 1K75A 4CMKA 4LVCA 2XDQA 5DNEA 4EO9A 1ZNYA 3U5ZB 4YUWA 3QUSA 5FOVA 2PUAA 2GWHA 5TJ9A 4LHWA 2WQ6A 2X19A 2ZRFA 2P2CA 4WINA 4CCWA 3HJTA 2B4KA 4PHHA 3IEIA 4FR5A 2FNAA 4MIEA 4R1SA 1VKZA 2G1JA 2PL1A 3CIOA 3JS5A 4TKZA 2PQ0A 2ZJFA 1MEOA 3B6KA 2WWYA 2O8FA 1IULA 1TK3A 4QDZA 4JI3B 4BNIA 4QUHA 1N1MA 2F90A 3RABA 1CERA 4TYNA 2GXQA 4BQOA 4Y7CA 2ERXA 3H5AA 3FJYA 1QCZA 2O2HA 1XZAA 3LH5A 1RYNA 5F77A 3GD5A 3RVQA 4KE7A 4HGNA 3G6WA 4JJFA 4XRRA 3O4IA 3WGKA 1LBSA 2FPPA 4DIKA 4P82A 4B8WA 2GZ3A 4BKUA 5ALNA 4G1BA 2ZUFA 1BXRA 1ZA2A 1GQSA 2C31A 1CD5A 4JY7A 4ZVNA 2R8EA 1TJ3A 4D43A 3J80A 3HNRA 4PQGA 1PR9A 1VLZA 5G4LA 3CZCA 4MS4A 2Y0PA 3EGOA 4IUBS 2ISSD 1EH5A 4HWTA 1LGYA 4P4GA 3KQYA 1JECA 1KS2A 2E2WA 4TMYA 4J1NA 2I6XA 2YW9A 3WJ7A 5BPHA 2EF0A 3M5PA 1Y4UA 1LU9A 1HE5A 4FVTA 1ZGHA 2CJXA 2WIAA 5ALDA 1WUKS 2WLSA 1T2CA 5U9CA 3CLSD 3PPXA 4J9UE 2E37A 1KMCA 2PZGA 4JVNA 3DE2X 4K05A 5DXFA 1A98A 2B8NA 2V8BA 4UE3S 1W581 5DULA 1E3JA 1M5TA 1JG7A 3CJTA 3FDXA 4HWOA 5CG2A 1KJNA 1NMYA 3R1IA 5AK3A 5FUVA 4RJKA 1Y63A 4CKXA 1J7KA 4U9UA 3P71T 2BJWA 3RI3A 4CQMA 2PX0A 4H1VA 3IUPA 5DN6A 1E2LA 4LQLA 3IYLW 1YB7A 1BX3A 3R8FA 4G63A 4EI9A 5BV0A 2ZR8A 1GWNA 2BKXA 1SPXA 3Q9SA 1IG0A 2BMJA 1HG0A 1YS6A 1Z35A 4PSDA 2PT7A 3IP5A 2HA2A 1R4ZA 4BX0A 3C0KA 4J9VA 4ZWNA 4F46A 4ZCSA 2PD4A 3AONB 4XD7D 3A1EA 2H85A 4MA4A 2KPOA 4HH0A 3DWFA 3RQIA 2O05A 2O7SA 2YHIA 3B5JA 3K1JA 4FIZA 4KR2A 3G0DA 3U1BA 1CIJA 4UJ5A 5ALPA 1PI3A 1BQEA 2WY2D 2XX3A 5CG1A 3KOUA 1YQTA 3RSOA 4RENA 2V0NA 1U5BB 1XNJA 5JAMA 5JZBA 4X85A 1HE8B 5BN4B 3I0NA 3UJHA 1UFOA 3QUAA 5DNWA 2DHEA 1B43A 3GZTB 3FF1A 3AVXA 2ZTSA 4JQZA 4LX8A 5IC6A 3DEKA 3ZV5A 2ZRIA 4NBSA 3VR4A 4Q3LA 3IMKA 4X1IA 4ARUA 2YZNA 4G01B 4OYYA 3HDGA 1UXHA 1MQSA 1SVOA 1RBYA 3KKMA 2WF5A 5KI6A 5ABPA 5JSQA 2Y0CA 1QAQA 2VDJA 3T3IA 3O1HB 1LWNA 2GHQA 3P9PA 1EB9A 4P5EA 3L82B 4EG0A 2AVNA 1L5FA 1T6YA 3HKBA 4PG4A 3H4IA 4W1SA 3JWEA 4I9NA 1PQ4A 4JOQA 1MDFA 3TVDA 4ZZ1A 1P1CA 2JFQA 1ZUWA 4EUFA 1OA0A 4JC8A 3UBMA 1IUKA 3GA0A 4S3MA 1QTRA 1BQ4A 3BKWA 4U39A 1PR5A 4XUCA 2V0CA 2R65A 3BTSA 4GXNA 4XKJA 5JZ9A 1H6AA 1SXIA 1Y3AA 2HSJA 5JJLA 4NBLA 2Q6KA 2FEOA 2VP0A 3GLUA 2DWUA 2YXBA 3EAGA 4WOPA 3ETDA 1TKBA 3B6MA 1PT8A 2CWDA 5A9SB 5B3JC 2DR2A 2HTEA 3U7JA 4IAOA 1BCRB 2PO7A 5DGDA 1Z0KA 1UM9A 1AK9A 4L7QA 1K0UA 1YZUA 2A1TR 4RS4A 4WGGA 1C3LA 2OO5A 2P0AA 5I7EA 3Q87B 1JF8A 1TECE 2XZTA 3C8DA 4IIXA 4XX0B 1KSJA 2X9NA 1Z7WA 1QIJA 1R9GA 3NHSA 4DLPA 1EWRA 2RJ3A 4G97A 4FZ5A 2WSBA 3ZTYA 4R6XA 3SBDA 5JCOC 1UJ4A 3ESCA 4PNEA 2Z6VA 3AERA 1BYUA 1XTRA 2Y93A 1NU8A 3PPIA 5KJFA 5LIRA 1GQYA 2RGEA 4RTPA 4RTMA 1NUUA 1SULA 2P30A 3KQMA 3DXXA 3I58A 3MBOA 4AW9A 4POOA 4LF7B 1QYRA 4OSOA 3O2JA 4Q3AA 2OYRA 3ZXYA 3FJ1A 4UFOA 4QVIA 3V7NA 1I1NA 2GK6A 4Z49A 5KVAA 2OCDA 2JIRA 5M2QA 4W5TA 1CUWA 1KJWA 1WJGA 3KL2A 1HRKA 3MHPA 4BB6A 2D5IA 3HGMA 1W4ZA 1XQXA 3A1DA 2OMKA 5TV2A 4I3HA 4LTDA 1EXWA 2J9YB 1JLRA 4V0QA 1UT8A 1CZLA 5FPPA 3DEJA 1E9CA 4TYWA 3C87A 4EB0A 1X7HA 1NN0A 2HQSA 3L2OB 2AV6A 2I8CA 3ELUA 3VFDA 1LVGA 5BV1A 1E7YA 1C1DB 3ICVA 1N77A 1BHJA 3HV2A 4R8MA 3FTEA 1EI9A 5JZMA 4S2UA 2HXGA 1I1HA 4OKIA 4ZC1A 3B51X 3SKVA 3EEYA 4UOZA 2FPGB 2CF6A 4OQDA 2BOVA 1XMQB 2P5UA 3DV9A 3WWZA 4OLFA 3P19A 3HWSA 3VR3D 3HWWA 1IHYA 2GERA 2CMFA 4IHAA 3SJCA 1E60A 2QTNA 4JI4B 1TPZA 1WLSA 2WYUA 3QWAA 1O97C 2J31A 1JFVA 3BULA 4FOLA 1A5AB 5DBGA 1P7CA 2YQZA 4PIVA 4GRAA 2RG7A 3KQVA 2DTDA 3D3QA 3N2KA 2C9BA 2XB9A 3P26A 4MKFA 2C3YA 5SZKB 4EKEA 5LQKA 5H3CA 1NW8A 1NRWA 1GFIA 1B0PA 1XI2A 1HKUA 1WQ3A 3M82A 4GPBA 3AWIA 2VUIB 1IL0A 3G0HA 2Q2WA 2IA5A 4IJUA 4WFKA 3ZWOA 4DLLA 4ER5A 4DWVA 5ILOA 4W5NA 1JEEA 3K5PA 4BTEA 2G83A 1WRBA 4ME6A 1UFRA 2IV3A 2GAOA 4NCXA 4O59O 4OFBA 4X6YA 2YR0A 4A6EA 4AJEA 2UAGA 2BBTA 4DFDA 3UWSA 5ICGA 4TMWA 1U8YA 5F2KA 2GBFA 1A0OA 3TSYA 3VVBA 3L43A 3BG5A 3V46A 4CKBA 2CLEB 1O97D 3JQGA 2OV3A 4IICA 3H2KA 4LHVA 4HDSB 1XD9A 4O8CA 4Q1FA 1I2AA 3UK0A 2XUZA 3CYFA 4XVCA 4IMPA 4PM4A 2DPYA 3L8DA 3D1VA 2GK3A 3O7MA 4F4IA 4LJ4A 5FUWA 5IZ4A 3TB6A 2W8BB 4UUPA 5TF0A 4Q12A 5KTRA 2PWPA 2UYOA 5J3JA 2CL5A 5ITZA 1O5OA 1XZJA 2PBFA 3WLFA 1VG9B 1MV5A 2Q3EA 3PQ2A 4BNGA 4OBWA 4DSNA 5GPBA 3HR7A 4UULA 4ZVUA 4RS3A 3L6UA 3S28A 4HYEA 1B0AA 5ELMA 1KI6B 2VYNA 3TLCA 3BB1A 3AP2A 4L4RA 3C2QA 2X41A 3BH0A 3RUCA 5CT4A 3TUZC 1QRAA 1NW5A 2VRBA 2VC2B 1QRUA 1M2OB 1M1UA 3TI9A 1PLKA 5AKZA 1QZXA 5J5AA 2PH5A 5JW6A 4XB2A 3ADCA 5BSFA 3IPCA 1SZPA 3PFIA 3TJMA 1J0AA 3F8SA 5JAQA 3NYIA 1ZWKA 3CS3A 1XZEA 1GV0A 2HJHA 1VKNA 2YN4A 2COEA 1Q77A 3BTUA 3I1IA 4I4IA 4QWMA 1VHJA 4G24A 3ZK9A 1EBUA 1U0FA 2QJTA 3JD1A 4R3WA 5BN5A 1KY4A 4R2KA 2KSQA 3FNEA 1W0KA 1OAOA 1WUIS 2V7PA 3GDFA 3O47A 2E4AA 5BQPA 5TY0A 4C03A 2OCPA 3WNDA 1DRWA 1Z2PX 3GFGA 3AIOA 3NBMA 2OHVA 4EWLA 3FPAA 2Q07A 4NZYA 3FBTA 5ENDA 4AIIA 3OIFA 4QDKA 3SQXA 1I3KA 3CLTC 5AK0A 5A6VA 4YBRA 3NOQA 1ZMTA 2EXXA 3GVPA 2B2XA 4Q24A 3ZBQA 2VEDA 5CBPA 2LNDA 5F35A 4NE9A 1JG4A 4AJPA 2CHGA 2QLBA 5JS2A 3I1YA 5BT8A 4OMUA 3LQ4A 1AGPA 1XB2A 2AR7A 1Z68A 3GPDG 5BQ3A 4UKDA 1R8JA 3IAXA 3TIIA 3U13A 1GRQA 2EZ4A 1I3NA 1K2VN 2WI8A 1T1SA 2D1QA 1KP3A 3HYLA 1JQEA 3UMFA 1P62B 3JQ8A 3FPBA 1CZUA 3I04M 3PL1A 5KOJB 1THZA 1G20E 1R8YA 5J4KA 4PQRA 3RRNA 2WSSA 1W1WA 2QVGA 3F5FA 3SIRA 4EYQA 2VSOA 4ZI7B 1N78A 1CZRA 3T7JA 2E5FA 5E7JA 1U9IC 4NZMA 2VZ0A 4BX9A 4PTZA 5DM4A 4D4GA 1KJJA 1KAGA 3O3CA 4E2WA 5KEIA 3JSXA 2EJTA 1PLLA 2KMLA 1QLJA 3EUWA 4FMCF 1EZ4A 2ZIEA 5FCDA 3I53A 4TVOA 2FMHA 3K16A 1TIKA 5LOVB 2ECFA 2Y6VA 3DYIA 1G8PA 2C04A 1T9DA 2RKBA 2GBCA 3T52A 4QGAA 4P0PB 4X63A 1YUBA 5DF1A 4BMYA 5D2CA 5AVRA 1Y9AA 3AKEA 3NTOA 2RAFA 3ON5A 1GGHA 1U7TA 3IRUA 3UMSA 4QO8A 3UJ6A 2VYCA 3ETGA 5E3IA 2VBIA 1ULUA 1EVJA 1JTVA 2W6ID 3O1LA 3U60B 1A8HA 2A78A 2DUMA 4EA9A 5K7SA 2I71A 1P0MA 2FQXA 3NH6A 3GLIA 5JSKA 4QTYA 2G8LA 4AIRA 7ADHA 3CKKA 4M37A 3HZOA 5HSGA 5E2IA 4D26A 2AFVA 2REBA 1QIMA 3SXUA <