3WE7A

Crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
FEDIDTFEEAFNKLLREVLEFDLQNPFKDAKKVLCIEPHPDDCVIGMGGTIKKLSDMGVEVIYVCMTDGYMGTTDESLSGHELAAIRRKEEEESARLLGVKKIYWLNYRDTELPYSREVRKDLTKILRKEQPDGVFAPDPWLPYESHPDHRRTGFLAIESVAFSQLPNFSNTDLDIGLNPYNSGSFIALYYTHKPNYIVDITDLMELKLKAIRVHRSQFPDDIWEKWEPFLRTIAMFYGEKIGVRYGEGFRIMPGLFYHITPFTDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression from engineered Escherichia coli chromosome and crystallographic study of archaeal N,N'-diacetylchitobiose deacetylase
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein PH0499
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02585 PIG-L GlcNAc-PI de-N-acetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10320 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold LmbE-like 3we7A00
4XM1A 2IXDA 4XLZA 5B2FA 3DFMA 4XM2A 5BMOA 1UANA 3WE7A 2X9LA 3WL3A 1Q7TA 2XADA 3DFKA 3DFIA 1Q74A 3WL4A 4EWLA 4XM0A 5CGZA 5B2EA 3DFFA
chains in the Genus database with same CATH superfamily
1ORDA 2RAUA 4P7KA 4PNEA 1JFSA 4A36A 3BVPA 3TD9A 2XUDA 4GS5A 4JZYA 5ESDA 5TMEA 3GG9A 5DB4A 4B31A 4WOBA 1PL0A 3MBKA 4Z7NB 2VHWA 4FMBB 3AWIA 3GX1A 4A8HA 3L8ZA 2G83A 3NHBA 1RSZA 1DQRA 1L4YA 3QWAA 4ENPA 2V1XA 3A8TA 3F2IA 2A1UB 3MERA 4JLUA 4E32A 5DTEA 4FKBA 2JIQA 2AT1A 4RMHA 4ZPJA 4K6KA 5EJEA 2GD6A 1CULC 5L3SA 4UARA 4F56A 3AEUB 2QL5A 2V7QD 1ML4A 1VIAA 2EHDA 5DK4A 3AVXA 2EZ4A 2W2OA 3FDIA 5KYGA 2ZBDA 5KOYA 4XUCA 3KYDA 3FVWA 3U7GA 4FNOA 3FN4A 3H9JA 2XECA 2ZB8A 1ZD2P 4EGAA 1ZVQA 3PFWO 3QIAA 5A9SB 1T36A 1I9CA 4FYIA 1BE1A 1E2KA 4W7IA 1EX1A 3SX0A 2HRZA 1SAYA 3KLPX 1Q20A 4LYAA 1NLMA 4ZZ1A 4RESA 2C42A 4GXNA 4HVAA 3U48A 3D81A 3DVRX 3IUMA 4MKRA 1ODJA 2YZGA 2FYTA 3AOEA 3IVGA 2I55A 5BO5A 4MK4A 3T3GA 3A3YA 2IUSA 1C4KA 4GGPA 1WB6A 1QOQB 3G8BA 3LCMA 4MEAA 1PWXA 1E9VA 3D4NA 3OIGA 5CUQA 2O7RA 4QDOA 1R5OA 1B3RA 3HCAA 4N6NA 1CJSA 1XL0A 5FB3A 1ULHA 1JVBA 1OZGA 3CV3A 4K26A 1L1FA 4A4DA 3PGVA 4Q1FA 5LM3A 3R3SA 1AS3A 2BHNA 3MD0A 3BUSA 4J0FA 4BB5A 2ZT8A 3DT6A 3H9QA 3IB6A 2GN0A 4YGXB 3URMA 4WZAB 1T2NA 2VN8A 3PKZA 4P7GA 4RVCA 4ZARA 2F8TA 3ZV7A 3DHYA 1YMUA 3Q1LA 3VZBA 3EOBI 1K88A 1AF4A 2VHYA 4P0PB 4DREA 2ETVA 1I1HA 1OJ7A 3L1KA 4QDUA 4MR9B 1ZGJA 3RVNA 4F6RA 2YQ5A 1CZOA 4FMCF 5JZ9A 1A1SA 2VUIB 4YREA 3W5BA 2IVFA 1BAPA 1FNCA 2O59A 1E1CA 1Y3AA 1UJ4A 2DF8A 3MOSA 1BDBA 1PJQA 4EHFA 2I2CA 5J2UA 4J1TA 3ENVA 5KMGB 2B2NA 3BIXA 3KTFA 4Z51A 5E7JA 4FXPA 3KFLA 3UGKA 3PEWA 1L5YA 1F2UB 2OV4A 3EAFA 4PC7A 4TN1A 2X9LA 4Y6SA 1T1RA 3BT7A 2A14A 4S0ZA 4LF7B 1P2TA 1Q7TA 1Z7WA 3BKXA 4H3KB 5KKAA 5DXJA 5IMSA 4RTJA 2G7MC 1RXYA 4NDAA 2QSYA 3G7NA 4CMBA 1QQAA 1YZNA 3GJ8A 4NZYA 2LUOA 3PFCA 2C88A 2LV8A 4YRGA 3AKEA 3S40A 3O26A 4E08A 1WWKA 1Z6ZA 2VHJA 5KZMB 1LRLA 5IN5A 1JEOA 1TA9A 3AXSA 4ZI3A 3U9LA 5JJIA 1SHLA 4J4TA 2ERYA 1GRQA 4P4SB 4JEIA 1AOXA 4HWKA 4F2PA 4DV3B 3L6DA 2B34A 2XZPA 3C3CA 4Q9NA 3LZCA 1NP3A 2ZI6A 3NM4A 4KFCA 2JLUA 2C2MA 1R0BA 3L7AA 4UEKA 3RS0A 3KEGA 4BNUA 1JYSA 1KOJA 4LZJA 1LVHA 3ADKA 3AZQA 1E60A 1ORTA 4V2IA 3SF8B 4QM7A 4MUKA 5KEIA 1YZFA 3RRFA 5EIAA 4K3UA 2D5CA 1ZR2A 1FLVA 3VOTA 4G5YA 4AIIA 1JPNA 3GA7A 4MVJD 1FRVA 4DKXA 4HTFA 4BMXA 4KK3A 1XQXA 1BMFA 1OA0A 4R7ZA 1IY8A 3JR3A 2FMKA 3A31A 1RQPA 2C97A 4ZYZA 4D98A 1XKQA 1PI3A 4KQ9A 5KHAA 3DAPA 4MIKA 3V8BA 2H16A 2IOHA 2QD2A 3EARA 4QXPA 2W2QA 2ZRKA 3WNCA 5A1JA 3QEBZ 3DKRA 1SEPA 2JLAA 1VZ2A 2DR3A 2QQ0A 3S44A 2CWDA 4Q4CA 4DR2B 3UPUA 1BDIA 5I9BA 1W59A 5C8XA 2VSOA 4R71A 1AQNA 5K8IA 2ZI4A 1VLHA 1L5RA 2NQTA 3DG9A 4I2VA 4IUDS 4ZOCA 3T9EA 1OQAA 4B33A 4QPNA 3WJ2A 3LUKA 1SCDA 1SOVA 4Z4QA 2QK4A 2QRPA 2UUCB 3CKLA 1LI4A 3HKEB 4DJAA 3GPLA 3AEZA 3O0DA 4QDZA 2KB0A 3ITNA 2HU7A 4EGJA 5GIOE 2DVMA 3BRWA 3IGFA 1DUVG 4UTRA 1I94B 3Q12A 4TKMA 5BQ3A 1HYEA 4WDQA 1XRMA 4L9SA 3OPYB 2OCLA 1YJAA 1CYEA 1STOA 1S89A 4PZCA 4HGOA 2VOJA 3A3PA 5EWMB 1HQDA 3U3ZA 2I76A 1W85A 3C24A 4NU5A 2A0YA 2NM0A 4P54A 3RK4A 3BZBA 3VX3A 3EW9A 1GPLA 5CT9A 1CJKC 1ZIYA 4P35A 3GV0A 3TOZA 1U1CA 3RREA 1KDYA 2YY5A 3RFCA 4A26A 3FHJA 3I28A 4JX9A 4HGZA 4E88A 4V1CA 3LOQA 2RB5A 1HWYA 1LWNA 1Y1SA 3QE3A 1ABFA 3WKAA 1ZKMA 1DKPA 1JHRA 2FX3A 1GSIA 3H19A 4X7RA 4GR9A 3ZU4A 1XTVA 1TL7C 1IH8A 2XCOA 4R16A 4CF5A 1AY0A 2QP3A 1SVWA 2P8JA 3GRYA 4YTEA 1NHWA 5T4FA 3D3EA 2ALJA 2EARA 2FPGA 5HFJA 4MOWA 1ZESA 1FJXA 3OURA 1ZH6A 2OUIA 4E4RA 2C61A 1TVKA 2H2GA 3B53X 1Y63A 1VDZA 4U5QA 3J7AC 4HQNA 1P44A 3QEMA 3KRTA 4QYMA 5P8WA 1NRIA 3WLIA 3U9TA 1ZJWA 4QFDA 5D6NA 4AZ3B 1Z2OX 4MQ4A 4GO1A 4EF5A 3PPYA 1UT5A 3DLTA 1I2BA 2PH1A 3SM9A 3DOOA 3O95A 2CB0A 1PHRA 4JOSA 4JT9A 3DBLB 1T3LA 2HSZA 4JJEA 2X0DA 2YRWA 3RC1A 2B4RO 2LIVA 4KLCA 4DQDA 3KNZA 1XYGA 1H4QA 2H1FA 3UC5A 5P21A 2JAOA 3E9NA 3MTGA 4MDYA 1EUDA 5JMPA 1WMFA 1EWTA 3IQXA 2EJVA 3BXOA 2FY8A 1E3QA 5CG2A 1JJVA 4OQZA 1A5BB 3HVUA 2FPLA 2C77A 4AKEA 1HOXA 1R10A 2F67A 2PS3A 1JECA 3T35A 1H23A 3FPGA 4KDFA 4CM3A 3I53A 2PSJA 3QWIA 3CN7A 1IXKA 5CYGA 3DAFA 1PFKA 4Q9AA 5E4JA 5T6MA 3DTTA 1H2FA 2QZ4A 3G89A 5ANRB 3NHAA 5HCNA 3ZYZA 1R6BX 1UBRS 4N0PA 5HJEA 1W35A 4NULA 2ILVA 2WUVA 4B84A 2JIPA 1YACA 2I4MA 3AERA 4P3KA 1V5GA 4S1NA 1F8XA 2VJOA 3IEPA 1W29A 2Y1WA 4BGIA 4IRUB 2Q9AA 1T2EA 4AWBA 2X8BA 3TQOA 1RRCA 4NBTA 4W1RA 4M0KA 3C7TA 5HQ3B 1H6BA 2YCBA 4HNUA 4FZ5A 4CCAA 3ZCXA 2CJWB 1MEEA 1NW4A 2HEIA 4KYVA 1AV7A 1M1UA 1TJPB 1RI2A 3EFOA 4QXOA 4XCQA 1YKSA 1OX6A 2RGCA 1IEVA 2GJKA 2B9VA 4FINA 4K0RA 5KJ1A 3DTNA 1E0AA 1L7OA 4MDHA 4BGDA 1KC3A 3EHEA 1UC8A 4E4YA 1V35A 2BKXA 3M6FA 2QRQA 5GWXA 4ER3A 1E0SA 2FKNA 4YUAA 3WO1A 1QIIA 3BHMA 4G1CA 1ND6A 1K0UA 2B25A 3VO2A 2QN3A 1GTSA 2ZRBA 3GEGA 2C82A 5A3SA 5D00A 1MO5A 1DKOA 1JILA 1TMGE 4YMTA 1PCXA 4IJ6A 4DIKA 4CKCA 4EVQA 4TTRA 4CL2A 3Q5DA 4H7IA 5A7HA 4QKQA 2IQ5A 1B8UA 1J8FA 1H0KA 3GJ3A 2XOKD 3OH8A 4YPVA 2IXEA 3DP9A 3R5KA 4QU0A 4QYIB 5JYDA 3N6VA 3ZBQA 4YJHB 2O8FB 3OKPA 1N6LA 3RTGA 4BO9A 1R6XA 1HXHA 1RVV1 4M55A 3Q8MA 1Y9EA 3SR0A 3WYBA 4EGCB 5IJ0A 2I8LA 2JNWA 4EZIA 3RFTA 1HL7A 2H2HA 1WUIS 2EJBA 2O57A 4UPDA 4QQNA 2RBEA 1GJRA 4AP5A 2WU8A 4COKA 5LJLA 4C6SA 1MB4A 3G2NA 1JV2B 4H9GA 2RC6A 2WKRA 1H42A 4URZR 2XNJA 1R4ZA 4HLCA 1ISMA 3AHFA 4XXHA 2K4MA 4KXMA 4D74A 1FFXA 1X70A 2IA5A 3N8KA 2CHFA 5JNTA 3LTNC 2C07A 4L5JA 4WDRA 1IEXA 3AEYA 3O9ZA 4PLWA 4J8PA 5ALMA 4EB0A 3CVYA 1N5DA 3HZHA 5CTJA 4Q7LA 3QE0A 4B43A 2FMUA 1XU9A 3FF1A 3VRHA 4BWFB 4KVZA 1XD8A 3V32A 3L92A 3UWOA 4W5NA 5ESXA 2VG8A 1XLTA 5A4IS 2LGJA 1DBPA 5A6VA 1UM8A 1RKBA 2QB5A 4KIGA 5JCOC 4M9QA 4NJMA 4MW6A 3DYIA 4Q9HA 5AOCA 121PA 2QMHA 4G25A 4LI3X 1WF6A 2BKVA 2JVIA 2XA2A 3CLSC 3EODA 3OLQA 1TDJA 1I4TD 3P4YA 3OPYA 3Q2IA 3O2NA 4H6VA 5EJ7A 4UHKA 4D6XA 2Q0XA 5KVCA 1PR6A 3P0FA 2G25A 1UPTA 2WD9A 5DLDA 3SC2B 5FQOA 4L08A 2I4OA 5DMXA 5LVAA 4MGZR 1K5HA 1IAVA 1XU4A 1YL7A 2O0HA 3QFRA 4NI5A 1NQ5A 2B4AA 3DD1A 4AZ0B 5JMWA 1LF0A 4KXUA 2J7PA 5JAPA 3AKZA 4TYQA 5CVTA 3TK1A 3WB9A 4B6GA 2BSXA 2IP4A 1B0UA 3T3NA 1RAGA 5DTMA 3C7CB 3EXHB 3O73A 4NBKA 4LEIA 2PUDA 4WUVA 2EKBA 2R4QA 1Z5ZA 5FR2A 4FFVA 1L0BA 2QUJA 4TWJA 2B0CA 5LFAA 4C07A 1WMBA 2Q1WA 1W1UA 4G1UC 4Q5IA 4Q21A 5CIQA 2R1UA 4YMSA 4EF4A 5HK9A 2DBVO 3P5BA 3NBFA 4MQFA 1W73A 5H9VA 2PL9A 3I01A 3EGIA 2HMVA 3O90A 1J2YA 4J0IA 2C59A 3H11A 5E4YA 1NVVQ 2VLIA 3WE7A 4DCJA 2CYCA 3B51X 1DBQA 4F71A 1KZ7B 2XADA 3RO7A 5IASA 2FRDC 3R3WA 4IIUA 1ZL0A 4N7RA 3JAMA 1DLJA 3NI2A 2JH8A 4Q3NA 1XBTA 4R40A 4XM0A 1XD2A 3BL5A 4MP3A 5JAQA 5BSFA 4BJ1A 1FRFS 3TQSA 5LN1A 1P7CA 2F62A 3D4PA 4AO8A 4H1UA 3HKBB 2I6UA 4YJ2F 3RT1A 3E8XA 4AS3A 4ME6A 1NOJA 3P2KA 4KXXA 4R2HA 1U3GA 3FI9A 1FQJA 5CCDA 4MWOA 3RM3A 4LX8A 2YOFA 4FB5A 1KIMA 1I3KA 3KYIB 4FDTA 2E4XA 5JXWA 1RLTA 1H5QA 2AMJA 4ILEA 1TYCA 5FAKA 4BMZA 3C1OA 4TV9F 2I6SA 4Y9DA 3FCEA 5DEOA 3HP7A 1K0FA 1PV2A 1C80A 4FZVA 5DTRA 2HJSA 3LGSA 2MU1A 5KUTA 3DFZA 1PK7A 1FFDA 2A33A 3LO5A 4R5MA 2WHYA 1XV5A 4BNKA 4O8ZA 3H9BA 3TI7A 4AB1A 2B4KA 2OXRA 4UAUA 5EKXA 1MLDA 1O0BA 1KKLA 1ENYA 3CWQA 1LI5A 2OUKA 4FD2A 5C8VA 1W49A 4DV7B 4LOAA 3ZGLA 2JBWA 1WDTA 4P7FA 4PWZA 3OC6A 4B3IA 4BQQA 2CUZA 4PHFA 5FRDA 4ZI2A 1RKVA 2GDZA 3AF6A 1N1GA 1NAIA 1SHJA 4N5HX 3O6VA 4K5QA 3UJBA 4UTOA 1HSZA 3DONA 3O4FA 2LWIA 5K8JB 1TJYA 1EEXB 1ICEA 2HK6A 4RGVA 1PQWA 3KEMA 1CU1A 2JC3A 3DTVB 1PJTA 1Q0QA 4UC0A 2BMAA 1I14A 1SR8A 5F12A 2HMUA 3T0GA 2ZW9A 4I50A 4PC1A 5D84A 2FJUA 4B48A 3ZS9A 2ZVPX 4CMAA 3PICA 1A3CA 1OT3A 1BHJA 1X2EA 5JO0A 5EJAA 5ITZA 2NQ8A 4PPFA 4QSHA 2X40A 2DQSA 1H69A 5J4VA 1ZMBA 4OHWA 3TEFA 5FOUA 3IJPA 4EABA 5PGMA 2CFRA 3Q88A 1OC2A 4DSUA 4ZEVA 5TGDA 3L7JA 3H99A 3H3FA 3ROFA 4ENWA 4FSXA 1M34E 2WD8A 3P9QA 4FS3A 2QRKA 3MUFA 4Q4HB 1KZ4A 2OV1A 3HMQA 5KMGA 2ZS7A 4DR6B 4FKZA 1L3BA 5DGTA 5SICE 3IB3A 1BO6A 3D0OA 1E9RA 1V95A 3VZQA 4GLBA 3KB6A 2PZGA 2CXXA 3DLIA 1IY2A 5EXTA 1NKTA 1OWPA 3AUUA 1AVTA 1Q14A 2ZJYA 4B2LA 1HO3A 3S2SA 3ROZA 1GLNA 4GPTA 2QJOA 3QUCA 1VMIA 4OB6A 2A59A 2DLCX 4RFSA 4FR2A 1G2IA 3MC1A 3I30X 3DEKA 3O74A 3ND9A 3QZUA 4RE6A 4WVFA 4EG1A 3KPVA 4O4IB 4W63A 3MAGA 2P75A 1B7GO 1OCEA 1O6CA 4NG4A 1SXHA 4WZBB 2ZR8A 3RJTA 2BEVA 2GYUA 3TVDA 2R8XA 1GWNA 1XYYA 3F4BA 4QRIA 5K3FB 5BSTA 5A02A 1JFRA 1ODKA 1UIMA 3M9XA 3ILYA 4K6OA 4ARSA 4M87A 1QQTA 2I99A 4R5HA 1YTLA 4LXIA 3V4LA 5IBCA 3L7OA 1E64A 4Q00A 4S1TA 1ZGGA 2VUHB 4I19A 5ECYA 4WBNF 1V4BA 3H2HA 1TZCA 1B41A 4OYHA 4QHTA 3AFMA 4BBJA 2I6TA 4DZZA 1NT4A 2XYQA 2Z5LA 3U37A 2ZM5A 2R25B 1F8UA 4INJA 1Z2NX 3VYRB 1WCWA 3OWOA 4OQEA 4N03A 3SK0A 1Q0TA 3THWA 3N2YA 2IS1A 3D9QX 1M7BA 3GUYA 4HB2A 5EA2A 5EZ6B 2VHCA 3RW9A 1GGEA 4D5GA 3Q98A 4BLSA 4IX1A 2REBA 5CB0A 2LRHA 1OH7A 2FZ4A 4RH0A 4B40A 4LCEA 2M6RA 4YR7A 4FMDF 4KN6A 2V7BA 4OXNA 5F7OA 1TCUA 3W5UA 3A9SA 3CJQA 1BHO1 1JDZA 1RXIA 2EBWA 1TEVA 1DPGA 2PWPA 2YIVX 3MGBA 3CB4A 2A1UA 5TE9A 1ES9A 1L6IA 1F2DA 2PSSA 3CWZA 4U00A 1F60A 4BDSA 7MDHA 1DEHA 4IIVA 3C5HA 1MRSA 3SEAA 1XJQA 1ZH4A 5I9LA 5J9FA 4IIEA 5HRAA 2C9BA 1BXRB 2FPIA 3RS3A 4AKHA 4DDHA 1UT8A 2FF7A 3T94A 4ESOA 2CJPA 3I6YA 4O2RA 1WPQA 2I6FA 3GAMA 4YJ3F 2YV5A 5A6SB 5JFGA 1P9LA 2QR3A 4PZEA 1BVUA 4AJOA 3WI7A 2CVQA 2HRCA 2EP7A 3HGTA 2JZCA 4UATA 5AJWA 4Q48A 1P4SA 4OYRA 3WIDA 3KX2A 2MIIA 1N3YA 3R7SA 1FFXB 1YJ5A 4ND6A 5AW8A 2P1DA 2X2FA 2BM0A 1P0FA 3V2GA 4B8YA 4UMVA 2RJNA 4YEDA 3UJDA 5C34B 1NW9B 4ETMA 2WHXA 5CYFA 2I54A 2H4HA 1KJJA 2EDCA 3K9WA 4IEFB 5A5FA 1OT5A 1XXHA 2BP7A 4YRQA 1D07A 1IPHA 2DWCA 2VTKA 5DM60 1GGKA 1I4OA 3QPWA 4PRKA 3W06A 2ET6A 3VSCA 3I2IA 3VVBA 2XF8A 1QG4A 2QS9A 2P9TA 3PA6A 4DG8A 2J0QA 1JWBB 2QAGA 1DPFA 3BIWA 1U2DA 2CXNA 4YB8A 2VQ6A 1W5SA 3ZD8A 3FTQA 3L8FA 4YFVA 3L4KA 1Q7GA 4TN5A 4LV5B 1SBCA 3GGDA 4ZYTA 1SXPA 5BMOA 1NJFA 2HCFA 3F9RA 1E9SA 2QPLA 4HDRA 5D87A 3E1SA 2GBGA 3EN0A 2MSDB 1V8ZA 3IP5A 1PT7A 1FTYA 3B9BA 3EGWA 1ODIA 4XOUA 3COSA 5ILOA 4MWCA 4UAVA 1PR9A 4KSBA 2ZTMA 3QYPA 1IN6A 1Z13A 4D99A 2ATVA 4C2AA 1W88B 4DWJA 4R83A 4XSHA 1VG0B 3ASYA 3CH6A 1WV0A 3L1IA 1PJAA 3O8RA 1D2NA 4M0DA 1UINA 2E82A 5COQA 3LG2A 2YV3A 3NYWA 4CTJA 1WXQA 1Z3IX 2VI5A 3ZBPA 3PUWA 2BH2A 3BXPA 1GR0A 2CNOA 2O3RA 3UB2A 1VE3A 2X0KA 5BQ5A 5BUSA 4IEEA 3R41A 4WCDA 4C7OA 4FFPA 1XXLA 4C0WA 3HSKA 4IGKA 3GFTA 1XKLA 1YI0A 3ZU3A 2DM6A 3ITDA 5FTKA 2PHZA 3EB9A 3MJVA 1WB4A 1H3NA 2GZHA 1OZFA 3C3EA 3LSYA 3O94A 4IINA 3IJRA 2R5FA 5I8ZA 3MTQA 1CD5A 4WFQA 1YJXA 4FHZA 1QR2A 5TQVA 2CSXA 1UMBA 4DGSA 3CLVA 1OAAA 2JI7A 3MWJA 2RGEA 3PEEA 4OATA 2ZB4A 3L7MA 3KCQA 2QDKA 1C14A 3PG5A 1R00A 4TTIA 4BVJA 1Q95A 3LC1O 4CL3A 2JBAB 1CHNA 3PQEA 2WOOA 4LAFA 3IQGX 5JBNA 1M72A 2WF7A 3I2GA 3SE7A 2X9VA 1RTTA 2J0VA 4J7XA 2WTNA 3BOSA 2IYPA 1UPCA 5I7FA 2QT0A 3IMKA 4JL5A 3HWSA 1JEJA 1O57A 4F1WA 3SNHA 4X20A 1VGVA 1PP4A 3ZXXA 1E9BA 1NI4A 2QLLA 2QY6A 2VCHA 2FWMX 4ZOAA 1BXZA 3GOHA 4GF5A 4XAQA 4PO3X 2GKGA 4P31A 3OEEA 1O58A 4S35A 3GC6A 3B2QA 4E7OA 2IS2A 3ELBA 2H2FA 2GNPA 3A4VA 3DEYX 3GGOA 1SG6A 2YOGA 1NATA 5KNCD 4XTRA 5J2UF 4ALKA 1JNYA 4HQ0A 4JC4A 3SWWA 1E2NA 2OMEA 3I9LA 1GL3A 3EVEA 1FFSA 2OGSA 3AUSA 4P58A 1BDHA 3I8OA 4DSTA 3H8VA 1OFGA 2FCRA 1WA5A 2JS7A 3ONFA 3AQ4A 4QQRA 1ZH2A 1Z45A 4K87A 4DUGD 3DV9A 3H1GA 4Y2TA 1T3TA 1C81A 1VECA 2O0KA 2YASA 1NJGA 3QBVA 5TT0A 4CIBA 1DJQA 4FMCB 1FNSA 1LLFA 5JYEA 3PGMA 5ER6A 5ADHA 1U2GA 2IQIA 2QUAA 2G1AA 2R97A 4A10A 1WBBA 5FLKA 1B23P 5HF8A 4L8FA 4LWPA 2KYRA 3H83A 4FVTA 4PLFA 4G36A 3EUAA 3TLAA 3ZLVA 1QP8A 3VKUA 4QJ3A 5JSUA 4F4CA 2OWDA 3OEWA 4NMHA 3OQMA 3L6BA 1F4VA 3KL4A 2A88A 3LRXA 1O2DA 2NUTA 2ZI9A 4I4IA 3UXHA 5ADWA 5JAUA 2OORC 5JRJA 2XB2A 3RYIB 3PK0A 4QATA 2OOSA 4ARBA 5FUYA 3LT1A 1OXXK 1GD1O 2OM2A 4QQFA 2PRIA 3NHRA 3GAZA 4J7AA 1UWLA 1OVGA 2QN8A 1KI6B 1Z0IA 2QZ9A 4U2CA 2AD1A 5FOVA 3HDJA 3REQA 3MPUA 1T1EA 5DI3A 3M49A 2FUKA 2F59A 1OBCA 3IE0A 5KDDA 1FP1D 2B78A 1XO1A 1CNFA 4CG3A 1TKBA 4GP7A 4J16A 2JHPA 2BYTA 1MX3A 3ZUGA 4RJJA 2ZTUA 1FRQA 4BNNA 2YFKA 1KQGA 2ZBPA 4ZODA 3DE4X 3NRBA 2A3NA 4BJHB 1RCTE 4TSRA 4BFWA 3FDFA 4DMGA 1J06A 1KVSA 2LCFA 3D5EA 2FFHA 2EHJA 2FW7A 3GRUA 4YAEA 4I6EA 4KUEA 3C1UA 1RJDA 4OKSA 4RZSA 2O0JA 4D82A 4DGQA 3R7NA 3RTBA 1XPRA 1QK4A 2CLEB 2VP3A 1V6SA 3PTLA 1HG1A 2E18A 2W2KB 5JNWA 1Y3IA 3OQVA 4PIVA 1K6EA 1I2MA 3ZGNA 5A4KA 1V41E 4HNAB 1XZNA 4Z4FA 5EPOA 4J4HA 3GT4A 1EG7A 2FDXA 3IV9A 3U17A 1C3JA 4CQLA 2XODA 3AVOA 2I80A 3KXPA 2D1RA 4UD6A 3U4HA 4X3PA 3SX4A 2QENA 2PR2A 2ZPUA 4BBZA 2FW6A 2G9ZA 1ZA1A 2GLUA 3THSA 2PZKA 3ZVMA 3NBYC 4PG8A 1OR8A 3AETB 2CFSA 4OGFA 2B21A 4KWIA 1UBGA 5JMOA 3T99A 3NV7A 3V4RA 2PN1A 1AK1A 3NHSA 4HX9A 3S70A 4UPEA 1L5VA 3EVZA 4Q39A 1E5XA 4FUTA 4QUGA 1W44A 3KAQA 4U3JA 4YAJA 1KJWA 2GARA 1V6CA 2Q3BA 2K5UA 2QJTA 1P1CA 4KJXA 4JNCA 4DG9A 5HQ3A 1EINA 3GLTA 4PPYA 3EDOA 4TM8A 4B79A 1TRKA 4ZT7A 4LTMA 1RJWA 3BGSA 3FMOB 3E35A 3FPEA 3I83A 3IHTA 4JODA 4C21A 1NIPA 3QVXA 4DBVO 2KM1A 4DCTA 2P2SA 5E8JA 3RR2A 1K7EB 2EWVA 1E6MA 4I5DA 4QOGA 5GADl 3M1YA 2PV0A 3DULA 2A9PA 2EGHA 1PR4A 2Q5EA 3SLRA 3SQLA 1ZA2A 1Z26A 3HLYA 4Y6GB 1F51E 4H6WA 4RK0A 2XZLA 1O4WA 1UMDA 3ISTA 4MPPA 3L0PA 1E3DA 2NV6A 1NJ2A 1Y81A 1OXVA 3Q6MA 2ORVA 4EO7A 2O8FA 1QIFA 1IM8A 1MENA 2JFUA 5LB4A 2OO5A 4GVXA 2WTMA 1SA0A 1USGA 2XDQB 2QW1A 3CF0A 4G9EA 1IRIA 3CLSD 1YUMA 2H5LA 1KWGA 1OREA 3FFTA 4I4LA 3B1YA 4KWCA 3C41J 2QG9A 5GGXA 5EMMA 1ST2A 1GGNA 1RBQA 3D1LA 1EFKA 3GRVA 4F12A 4O29A 1C8KA 4RY8A 4EWLA 2FX2A 3O1JC 3K8OE 4M8LA 2WJIA 1D0SA 2QOEA 1X8XA 2WG0A 2ZSAA 4FK8A 1RLIA 4G4SP 4JR2A 3U1TA 4BNJA 3KPJA 1VB5A 4KYIB 3WLSA 4OH7A 3WWDA 5BP7A 2EU8A 2ZB3A 3ZY4A 4CNQA 4NVRA 4RIHA 6ADHA 1J99A 4DYHA 3QLVA 1G4AE 5EE3A 4NYMR 4BAUA 5GM2A 3KQKA 1IYZA 2PJUA 4HXFB 5AJZA 4DILA 2LTAA 4DQVA 4HDNA 4X8OA 4DADA 4JBIA 2XYHA 1ZKDA 3B7GA 2WABA 4MAFA 3TTVA 1XNGA 2R6R1 1THZA 2XQGA 3N74A 4YP7A 4BQFA 2EFYA 4EDHA 3L4SO 3WQSB 4CLRB 2O8CB 2AXNA 4XVQA 2AUMA 1IBSA 3C3DA 3VAZA 3WZ2A 2HO4A 4C7MA 4OMCA 1YF3A 4A6PA 3VU3A 1A2QA 3CRZA 4A16A 2CNKA 1GAJA 1NBMA 2GBIA 3DZBA 5BQFA 3SHWA 1JTFA 1NQTA 4TT3D 2ZYSA 4IHJB 3ZZ1A 2HCJB 1EB9A 4CIWA 1GQOA 2CMHA 1ORWA 3BF8A 2HJWA 5AI5A 3BMXA 1Y8CA 3PXGA 1YS4A 3D3QA 1CY1A 3KBOA 1SIWA 1NN3A 1O5OA 2J33A 1OB5A 3F5FA 3IL2A 3KXLA 1DFGA 5F7XA 1P1KA 3P2YA 1L5ZA 2ZULA 2Z9BA 1T2UA 4MV1A 2BEUA 5AO9A 4OI2A 3RF7A 4JEMA 3KT3A 3P1JA 3PUIA 2A9KA 4DEXA 3EXHA 5DLQC 3PUXA 2Q46A 3WGGA 4YJ3B 1VE6A 4DC1A 3WGKA 3GLRA 4MZDA 1G5FA 2H4ZA 1OJLA 2ORYA 1PSWA 3DDSA 1FFHA 1FDTA 3CEMA 3HUTA 4JOCA 1E1LA 1THMA 3AR3A 4J76A 4O4JB 5EZYB 4DT1A 3K6KA 3E15A 1SVUA 2ZKLA 3FCCA 1PUIA 1E1KA 1R4AA 3QVWA 4MKFA 4RF3A 4BNHA 3L0BA 1NVVR 1X19A 2VA8A 1BH2A 3F3MA 2ES4A 4MA4A 4F5EA 5G0VA 1Q0PA 1A95A 3BWDD 2CLIB 4B17A 4GOND 2XOKA 3NTXA 1MW9X 2GM4A 2Z43A 1CX9B 2IXTA 2HX1A 5A3VA 3OIWA 3WHIA 1FLNA 2VR1A 3KQUA 1A9RA 4L4RA 1JZSA 5B64A 1GAEO 4MI1A 3VDQA 3RARA 1JAHA 1KQOA 1QJCA 4O4LA 4J0EA 1M34A 1X1TA 4URXR 1DJOA 4Z4IA 2GAFA 5BYBA 1W4LA 1TA4A 1E6LA 4ZDJA 1Y6QA 3HA7A 1UOPA 5M5BA 3ZD7A 4NMWA 1CB0A 1VJCA 1QZTA 2ZWVA 2H54A 5EKUA 4WFJA 4Q66C 2Z08A 1KU6A 2WK1A 4LBYA 2BPOA 3EAQA 1YRYE 2QUZA 4RTMA 3EYWA 3H3XA 4MHTA 1PO7A 3I42A 2WM9B 1GT6A 1UK6A 1VKOA 3PNPA 3PUYA 4GC5A 4MKGA 4JJKA 1Y1TA 4UXJA 1ZC4A 5DNVA 1YOVB 4HPWA 2QTAA 4M9UA 2HF8A 3UT6A 1YVPA 1U3FA 2BEUB 1BGXT 3B70A 1MG0A 2RARA 2ZS8A 4PWYA 4RORA 4L4ZA 5LKAA 4DLKA 5AFSA 1RWNA 1J21A 1L7PA 2VPZA 4J75A 3SJAA 3R77A 2XGJA 1O6ZA 2IZ5A 3PDIA 4EKEA 2I22A 5CLGA 3CPJB 3RYHA 1U0GA 2RHDA 3T1NA 2FOXA 3WGUA 1BJKA 3QQ5A 2Q2QA 4F2GA 3ACCA 4L22A 3ZYCA 1OFUA 4RGQA 2GETA 2XMQA 1D6MA 3NT5A 1CZUA 1E1YA 4AURA 1UBTS 2P9FA 2RAVA 3DMRA 3WGVA 2GCGA 4L4SA 3ZZNA 4GKVA 2XEDA 1BEUB 4M6WB 1D2RA 4YK7A 1OYVA 4E2FA 4YGYA 1ZN9A 3FKQA 5AKZA 2VTDA 5LQSA 2IY8A 1R18A 4GMXA 4J94A 1ZOOA 3F4LA 4IKOA 4KO4S 4L9RA 4QXAA 3FYUC 3QG1A 5H68A 1U0RA 1I6LA 1CSEE 4B4OA 2F7SA 4E12A 5IH3A 3F98A 2NX2A 2XMCA 3G0OA 5FUXA 2Q0HA 1LSSA 2N46A 3E48A 1I1QB 4TLBA 3OWHA 1YB1A 4I08A 5I4IA 4OXKA 2XD9A 2W0SA 4EKYA 5JANA 3UM9A 3JQPA 1FU7A 3AKYA 4OB7A 3UK6A 1UJBA 4P22A 1WEHA 5FOXA 2OVBA 2NTJA 4R41A 1N8SA 1ENZA 3CT4A 2WSSD 1KZ6A 4S2EA 4E30A 4I50B 1B6SA 4ND8A 4PHCA 3T9BA 2F3SA 3HCOA 1FQWA 2H1SA 2Y0EA 2Z30A 3R7WA 1IJEA 3DCYA 4L76A 1JQJC 2TMYA 1Y8QB 3BRCA 3K9LA 2BLNA 4EKNB 4CV2A 3PX7A 3HYNA 1F0KA 3DLBA 1MQ8B 3AEQA 2H7CA 3KUKA 1JKXA 4HO1X 2GH1A 2Q3DA 2O1SA 5ALYA 2ZKIA 1V7QA 3L9WA 2DBQA 5EYPA 1D0IA 1UMDB 2I65A 3SEFA 1QU3A 4C04A 3BS4A 3OIDA 1BCRA 4IV0A 1NZJA 3NT2A 5B4UA 1NKSA 2Z3VA 2B20A 4HG2A 4AC9A 2GM3A 1GVNB 1Z6AA 3IEVA 5ALTA 3AK4A 2PMFA 3H04A 4U7DA 3SVZA 2YQ4A 3HCNA 4AFNA 2ZSUA 2X5XA 3IQFA 3K6SB 4YXWA 5MFPA 3DWFA 2KJQA 2VL7A 1ZK0A 4BU1A 2Q8PA 5B3JA 3F7TA 1PT5A 1GARA 2FUG6 4F0JA 3GLIB 1KP2A 1EUCB 1KWKA 1N75A 3DO8A 2VJPA 1Q74A 4YJFB 3A6JA 2X2EA 3CZRA 3EXIB 3OE7A 4P3PA 2Y8EA 4AJPA 1XMVA 3BIFA 2VS1A 3F5DA 3LC0A 3MJ4A 4CUZA 3OPQA 5IKXA 9MHTA 3X0DA 1E99A 1QHIA 5AHWA 3IDAA 3C5WP 2GM9A 3KG2A 1T6ZA 2VJCA 1UFKA 1K8ZB 2ZIWB 3VMMA 2G4CA 1V1JA 1XQ6A 2BR3A 3ESZA 1HEYA 1GTZA 1KAMA 2P41A 3GEBA 3QELB 3R20A 4EJSA 1NF3A 2RH8A 4CTMA 2Z04A 2PLRA 3FUWA 4B32A 2OCPA 4JYMA 1DHRA 1F6DA 4NATA 1LDGA 1E98A 3RLFA 4MP6A 5KNBD 2J5QA 4ZZ2A 1ZNYA 1FP4B 2FW1A 3H11B 2CYAA 4IILA 2IL1A 1CQWA 4FYWA 2JGAA 2YDYA 3MB8A 4JUCA 5EL0A 4BLWA 1ZUD1 2P2LA 4YJDA 3PUJA 4TOIA 1DWOA 2A4KA 2X13A 4J0JA 4YALA 4BQIA 4F93B 1IL0A 1E1QD 4MEBA 2B83A 3B9QA 5BVGA 3OF3A 3T5PA 4H7DA 2A0UA 1DRWA 1BDJA 3Q3GE 3Q7TA 5E9AA 4MWSA 1MXFA 5AMXA 4UOZA 3H9GA 2A2ZA 4TRRA 3CLHA 3RYIA 3EWSA 1X7WA 4NV3A 4IHJA 3WHLA 1A72A 1P0QA 4ROSA 3D8TA 3O31A 3H42B 4G37A 5CX4A 3TQHA 2V5AA 1LRJA 4I3HA 3ZY6A 3RQIA 3P26A 5IU6A 3H18A 4PU0A 3GEEA 2A78A 3GJQA 2VH1A 2XB8A 5D3MB 2NGRA 1TZ2A 5TQ2A 2BKUA 4LHVA 2Q5QA 3T9CA 1GU0A 3R0ZA 1TM2A 4XQ0A 3ZC3A 4B6PA 4D9GA 1IZ0A 4UU8A 4U5XA 3A58B 2QX9A 4I5IA 3IE1A 1ZG3A 4QG7A 1HLPA 1WB5A 4OXXA 4TUYF 4ZHSA 3WMXA 4RY9A 3GLIE 3UN1A 1Q77A 3DFIA 4OJKA 4WWHA 5DO9A 3PSHA 5KYVA 3G5AA 5JWHA 5J2TB 2G9QA 1IM5A 2QX8A 2XVAA 3CH5A 2EVWX 2F90A 1AK9A 2ODTX 3FG9A 4O59O 5F1OA 5KPDA 1K2WA 1FU8A 1PYOA 3LI2A 4G9GA 3W8RA 2HWKA 3GEHA 3ZOKA 4EI8A 2XCLA 4DMRA 2HSJA 2YR0A 3GIDA 4E2ZA 5BV0A 1XJCA 4RWEA 1Q7RA 3TYXA 3GHHA 3T52A 5AVWA 3WL8A 1G0NA 1Q92A 1RPAA 4F6LA 1QV6A 2HK9A 1W30A 3BQMB 1BMTA 5A0FA 4PSKA 4UZEA 3GCDA 4FZ3A 2F4VB 3KUDA 1WUYA 2RGNC 2R8ZA 1XC7A 4JVNA 4RA6A 3RT7A 3DHVA 4UXIA 1N0WA 2ZK7A 5BQXA 3FWHA 5IDXA 1GADO 2Q6LA 3DZFA 3GUCA 5B1IA 4NAUA 2RIPA 4GGMX 4HZIA 2ZWOA 4RVGA 1ZI6A 4LV8B 5F1KA 4B6SA 1Y9AA 1N77A 3K8ZA 1MA0A 4BUZA 4FNAA 2YVKA 3HACA 5C52B 3DDHA 5F7JA 1RLOA 1NBOA 1T9BA 4OJTA 3I0ZA 3K9HA 3OLCX 2BHLA 4MQBA 5AOAA 5EQTA 3TN7A 1KVUA 4KG7A 1TAHA 3VDMA 3WGOA 4V0ME 4R0NA 2IBTA 3OJCA 4Y7DA 3FETA 1PLLA 5ABPA 1OV6A 5KWEA 1QANA 3U4DA 1OV4A 1SKAA 3ETCA 4L72A 2RFLA 3K0AB 4NV0A 1P2GA 1T0HB 4DY4A 3K35A 1PQ4A 3ETLA 1BU5A 2WJ3A 2EXXA 4Q7KA 4U2FA 4LSZA 4A8JB 5BSMA 1NBEA 3FUTA 1NNSA 1P8JA 4A3SA 3FVVA 4G0OA 3P71T 4BNYA 2WNSA 1E7WA 1TVEA 4LTNA 1W48A 5FUMA 3Q6IA 3DXFA 4FT4A 1ZDMA 3V34A 5DBFA 5FBLB 2ZUTA 3M4NA 5ICEA 5I9NA 3ZDXB 4F7WA 2UU9B 5AHOA 1QG6A 5JTTA 4NE2A 3RUCA 1OLOA 1J8QA 1V11B 3FTDA 3G85A 1XPJA 4M98A 2BEJA 2MINA 3VGJA 4X44A 2YNMA 2YC2C 3IXMA 3A6DA 3PR1A 2ZJ7A 2XBMA 2HR1A 4AUMA 1SHZA 3QLVC 5ELLA 2YHIB 4D4KA 4WXRA 2QM0A 4O4HB 2H07A 1FB5A 3DV0B 3NBAA 3O9VA 4MRMA 4QUDA 3NDRA 2WYWA 4GYKA 5T64A 3ER6A 2QROA 4F3YA 3HDGA 4P4TA 1NQUA 4OCZA 3GL9A 3LK7A 1FTNA 4XIFA 5KI6A 3VR4A 4CM9D 1Q0HA 1TM4E 1VGRA 4BYGA 1EA5A 5K6AC 1MD9A 4LF6B 1H2EA 1RWOA 3ZE9A 5AVXA 2J41A 4P34A 3OTQA 1U8ZA 3CRRA 3RE1A 4IXWA 3YASA 1TVCA 1GN8A 3R75A 1PV4A 4UVHA 1Y8RB 1X80B 3X44A 1FYVA 2VYNA 2XBLA 4TYWA 2AHRA 3HBJA 1SRQA 4EJ2A 2GN4A 2RBKA 4YAOA 2GTHA 2J0EA 3DDUA 4NG5A 4UM9B 2G8LA 3TW4A 1ABEA 3K0AA 1EGQA 4NU6A 4E09A 2O19A 3V1YA 2DXIA 4EA8A 2IDZA 4IUCS 2BEKA 1T4GA 3ZD9A 1JDNA 3IKTA 2VAVA 1I3CA 1KYWA 5BQPA 1XFAA 4UFNA 1L9KA 3WISA 3KYJB 1RRVA 4F3KA 3HO1A 2CL6X 1N4DA 5HF5A 2H3HA 5T6BA 4K6MA 2IZ0A 2WZBA 4EVIA 4K1XA 1QZUA 1AUOA 3T3HA 3PGJA 2E7ZA 3BA6A 2IDMA 3CUTA 1MV5A 4X8LA 5HMMA 3R0QA 1BN7A 5I7UA 2ZAIA 1Z4NA 3F6EX 4CEJB 2N47A 1XALA 2FUG1 4KIUA 4Y2GA 4U7HA 5DOVA 2VWPA 3UPDA 4HGRA 1IBCA 2QJFA 2CFIA 1Z4MA 3OHMA 3VTFA 4CCSA 4MICA 1ULTA 2BGJA 5K3CA 4L4XA 2WWTA 3LY9A 1GGFA 1NJ6A 4N3GA 1VBKA 2O8DA 4EGFA 1BWQA 2NUPA 3AVTA 1JQ5A 2E9SA 3TR5A 4R2JA 5AR1A 1E2GA 1TJ3A 3H5NA 3O1HB 1P5HA 4NCNA 1PL8A 1YDWA 4QQKA 4MMYB 3P2IA 1QIJA 4Q4DA 2XXJA 2Z58A 4V0SA 3WWYA 2HN9A 4PLHA 3L01A 4LYHA 3ZNNA 1FYFA 1E9AA 3GLVA 4NAVA 4Q3LA 3EZYA 3W8DA 5FNVB 2CVOA 2C7VA 3WGLA 3ICQB 2Q7OE 1J0CA 3PHBE 4Q1CA 5KSPA 1HNWB 4BIIA 2C9CA 4GL4A 3O0TA 3JS5A 5A0TA 4L75A 3NWPA 3WLFA 4ENSA 2R11A 2YMQA 4GKBA 1UBEA 4RTOA 1XN4A 1KGSA 2FN9A 4RW0A 3T3MB 3ZS8A 3SS8A 3VR6A 2AYYA 1WCXA 4ND7A 2DGDA 2BFNA 4U39A 3SXPA 5H4GA 5IEJA 3HYSA 3IVXA 3QUTA 4LDRA 1QTIA 4GGOA 3O3NB 4UMDA 2QTCA 1RCUA 3LUHA 3NW9A 4MNTA 1VLZA 4C6RA 4XLTA 4JI2B 5JVDB 3OESA 5AT1A 5FOWA 3BXGA 1F3OA 3IQEA 4R68A 2ZBFA 4UREA 1HFEL 1ZM7A 5B1SA 5JNUA 1JR2A 5JZVA 2R60A 1S2IA 2NTEA 3O8OB 2OFXA 4RA9B 5T5QA 3ZJ5A 1JL3A 2X15A 1LD3A 2HOQA 1QLWA 5DT9A 4DIBA 5FX2A 3C7DB 2XMGA 3O8QB 3FGPA 3UW3A 1MV8A 1TO2E 2VSNA 3BG5A 3L7NA 4GE0A 2GEFA 2HA5A 2XUZA 3GF4A 4WD3A 3TMKA 4Q3DA 3IEUA 3U3RA 1N5RA 3HXOA 5FTMA 1GG2A 1E2EA 4MW0A 1FPMA 2BL4A 4LBWA 4W8GA 5F77A 2XTZA 4S0XA 3TTYA 1R27A 2I3GA 1O9GA 1Z34A 4IVQA 4ZRDA 2BDUA 3FYHA 3NQ41 2D06A 1SK8A 4UD2A 1GSAA 4MVJE 3AUKA 4YYEA 1XZJA 4FNGA 5JC8A 1FTSA 4R8RA 1AHHA 1E2HA 5JPCA 2GVNA 1M83A 3ANNA 4M38A 4RKWA 4D4HA 5JR3A 3M81A 2HY7A 2GEUA 1Q0SA 3TAHA 4BNFA 4UNPA 3NP9A 1QKJA 5CH5A 3KE9A 1DQZA 3ANXA 1IY0A 4LMBA 4IX9A 2QEQA 3QPUA 4W7HA 2QPOA 1JYFA 5L3RA 3ACDA 3HEMA 1LPMA 1AHIA 1KZ9A 2Z5GA 1YBHA 2IYZA 3WAJA 2QJWA 4E6EA 1LNQA 1ULUA 2I2XB 3NTQA 1S9HA 4FIZA 3H5RA 1PZFA 2V6JA 3UMBA 1ZISA 2ZXEA 3EZLA 1W4AA 1A9OA 1GLGA 3ZVRA 2XWJI 2GEJA 1V5FA 1SURA 2BC9A 4KQHA 4DDTA 2W6ID 3WB0A 4CIVA 8ABPA 1BWSA 2NW6A 5EINA 2F9LA 2R2GA 1SQFA 4DRYA 4WNCA 3PRHA 1L5SA 4N4AA 2NU8B 4IQ8A 4DWVA 1OXTA 1ZGZA 2N1MA 1HETA 5FUVA 4ZDWA 4F4HA 1K4MA 2P5UA 3NHKA 1NDQA 4B81A 1JYEA 1SBZA 4QASA 4FI3F 3K9GA 2O4UX 2J5XA 1SKQA 1UWKA 2XMBA 2O2EA 1X8KA 2AFVA 2DHQA 1OAOC 3L18A 3KD2A 3UTDA 1WKBA 3SC3A 2ZRLA 4DNOA 2QVBA 5CFMA 1CUEA 3E3MA 3VVMA 5ELXA 3IYLW 4L85A 3UUEA 4F6CA 1YZLA 4HXGA 5CB4F 1HDOA 2L18A 3MGKA 2CMDA 2IW1A 1T0JB 3VR2D 2VSFA 2XNDA 3B6MA 2W93A 3IUPA 3E22B 5BRNA 5A9RA 2BHRA 4M1ZA 1TCBA 2E6UX 5AVYA 3HQ4O 3KOWA 1UXKA 3FGOA 4JK3A 1MH1A 5DDIP 2D2EA 2BJWA 2VYVD 3RABA 2ORED 1HOTA 5EYPB 1CYDA 4HZGA 5B2FA 3I6QA 1D6NA 1JLSA 1LS1A 3FTNA 5DIFA 3SF0A 4GMHA 3ENWA 4O4HA 4AJNA 4PQGA 4DLVA 3SVTA 1UDBA 1QB8A 2O3TA 2Z4SA 2FETA 2QNBA 2CEAA 2AF4C 3NOOA 1DL5A 4UKDA 3KETA 3LBHA 3QNWA 3P4XA 4NKRA 1KQ3A 3KK0A 3WY9A 2I34A 4DDMA 2HGZA 1ONNA 5ICGA 2ECPA 2WT4A 2FZVA 2HUNA 3L4BA 4HRYA 4ZOLA 5LA6A 1ZMRA 3PL1A 1ZFNA 1IATA 2J59A 2NU9B 1L7EA 1O5TA 3ZEAA 3QXSA 2C04A 2P2DA 3L41A 4PAGA 4L6CA 4K9RA 4CT4B 2WHRA 2HAEA 2HSWA 3HY3A 2ETXA 5AHKA 4NNPA 2HPAA 1KDPA 1Z9BA 2HBRA 2WY2D 1NNUA 3WLPA 1RCFA 1R74A 1UM9B 1X7XB 4JD5A 3RHTA 4ACAA 2V7WA 4AT1A 3G7UA 4IMJB 4G09A 2ECFA 3D6TB 2VK1A 4RZXA 1U2PA 1JSXA 2WSIA 1LX7A 4FJ1A 2G63A 4PNPA 5ENVA 5KX5F 2IHNA 2C5FA 2ZVDA 1U5BB 1E2IA 4WT7A 3QXJA 5JE8A 4W9MC 2K87A 2DKNA 1JAYA 3CSSA 1XWWA 3K2IA 3T1YB 2XV1A 3ESDA 3FSJX 5EWJA 3EBPA 5H3CA 3AM1A 3WGJA 5DSTA 1R4NB 4ZV4A 3KDPA 4PTYA 1DKUA 2ZAYA 2WUDA 5LOVB 1K7YA 1LC3A 4EKGA 3HDHA 1R1DA 2O48X 3BXFA 3R3YA 4NNOA 1CY6A 4NFLA 3IMFA 1UP4A 1BFKA 2K7ZA 1KORA 3JYHA 2XLBA 5FQNA 4OV6B 2IEIA 4Z0TA 1DBVO 3AY3A 1F06A 4N6GA 3U81A 3JYOA 1UMCA 3QF4B 2CLCX 3EUWA 1XTUA 1C30A 2QAIA 4DKJA 5DMHA 1I6KA 1U80A 3E70C 1Y3HA 2CW5A 2H4YA 3FWYA 1I0IA 2NPOA 1N34B 1ZVVA 3SMQA 1IULA 3AONB 4QM6A 5L7TA 2ZWAA 1JQLB 2PCJA 2G5PA 4EPRA 1U31A 2P67A 4BLQA 1PHPA 2JW5A 3PTAA 5DOZA 4BVHA 3L5OA 1VBFA 2VNJA 3RGGA 2PUFA 4QVKA 3K92A 4NPAA 2WF6A 3RS8A 4DOMA 5KYTA 1NBMD 3BJMA 1TZMA 3RVRA 4Z86A 5DHRA 1A7KA 1DRJA 4R0VA 2Y4NA 2ZJ4A 3CE6A 4AO7A 2DY0A 1COZA 4WFIA 2Q3LA 1WULS 4O2AF 1RJEA 2R6ZA 1EDDA 3ESXA 1KEUA 4QGSA 3BH0A 1MJFA 1V8OA 4QAQA 1B16A 5BNWA 3EBOA 2CLOB 3C8MA 3GB9A 3MCTA 4ZOEA 3PD1A 1Y7IA 3DZKA 4MVJM 4L1KA 4JI8B 3OOWA 1EQAA 2BEWB 4YV2A 2P30A 3FOCA 1B1AA 5CW2A 3RUAA 4HNQA 3QTTA 3AF4A 1EJ2A 4R6XA 3B1JA 3ZPXA 3TLCA 2I9PA 1KRWA 2YN4A 3K4PA 5G53C 2QM8A 3EZ2A 1WDMA 4KX5A 2G80A 1EEHA 1O94D 3IDSA 1TB4A 4WZZA 4HT3B 2BEVB 4AQ7A 1A7UA 1FFYA 3TZKA 1FXUA 3O75A 2YJTD 2GXSA 2QTLA 1RPTA 4NZZA 1Y8ZA 3BF7A 4PS0A 1EZZA 5L9AA 4JKIA 4H7PA 3M8KA 4R8SA 1OA1A 2DFNA 2G07A 4TS4A 3FCYA 4S05A 3FIUA 1KQNA 4F21A 3THYA 2O2CA 4HAXA 3R5HA 2FZWA 2H2IA 5EIBD 5LYJF 3KQQA 4GWLA 4OB8A 5EPUA 5KKNB 2UZ4A 3THWB 5IVPA 5AHXA 5G1OA 1U8YA 3EFHA 2C3YA 3FM9A 3VU8A 1DFIA 3HU1A 5CLIA 3HYCA 1OWOA 3PNBA 4DMLA 1YIOA 2JGRA 1W4CA 2Z3ZA 4OSOA 1YZTA 2OCKA 5K4HA 4Q02A 3LV8A 1AXEA 1DDGA 1XKXA 4TLAA 3IV7A 3K20A 1VYTA 1EBBA 1FE8A 1KKUA 1V5WA 4HLNA 3RVJA 4FYMA 4ZJZA 4IWYA 1EUCA 4XSVA 1YBMA 3VISA 5IAEA 1U11A 1N6KA 2PKXA 4JELA 1HK7A 1KO7A 1ZM2A 1R0KA 3P9IA 4L0DA 4TVKA 1E66A 2IBSA 3ANYB 3UMMA 4Z3OA 1B73A 2D2FA 2R68A 3MWFA 1Z08A 1CZRA 1NI5A 5IKEA 4C1NA 4MQMA 4RIEA 5FYQA 4LX0A 2AMFA 4C3OB 1XRSB 4RTPA 1RLJA 4RUKA 2BZSA 2RHOA 3VU1A 3GVCA 3OEHA 3BICA 5JXGA 2OESA 3UIEA 2QTMA 3AOEC 4EGQA 1XEWY 1AMNA 2TECE 4XM2A 1X0VA 4ER6A 2Z6QA 1WD7A 5ADVA 4PZUA 4RENA 3I1YA 1YNOA 3COWA 1JR4A 4HLDA 3TL2A 5JNLA 1Q16A 4LZZA 3UCFA 3EH2A 3OBIA 4TYYA 1SVMA 4CKZA 5HVNA 4DR1B 2J7KA 1USVA 2MT9A 1G7SA 4HNRA 1PZHA 4KKXB 3ER8A 5BQOA 3INRA 1FX0A 2YS7A 3G0IA 4WRRA 3QE9Y 2PBZA 3QU5A 4MQ5A 3AETA 2Y92A 1ECJA 1OAOA 1JPUA 4WOPA 4CDGA 5BUQA 1IHYA 1EBUA 5TJ9A 5C8ZA 1QRAA 2B7LA 2C7GA 3AVQA 1MG5A 3JD4A 4J90A 3JATA 3M6VA 1JQKA 3HY6A 1HQYE 1ADCA 2B5OA 1NSTA 3DHWC 2ASEA 3F74A 1QQBA 4X1IB 2AG6A 1IHDA 2HXSA 3RAPR 1A27A 5EQFA 4LYJA 2J9RA 3H9UA 3IAS6 3MJRA 1S4MA 5LLSA 5I9IA 2PZMA 1KJNA 3LZ6A 2G9NA 2NU7B 1F7UA 3AHJA 1TF7A 3U49A 3FHCB 5CCEA 5AP9A 4CF4A 5HW0A 4RPHA 1EUZA 2J3IA 5CX1A 4FWTA 3RAFC 5L3QB 3RC3A 4Y2JA 3D8HA 3A1SA 4IPTA 3LWBA 3REOA 3T41A 1Z0UA 1XIVA 2PSHA 1TQ6A 4FGUA 4NZOA 1GQRA 5IH7A 3E27A 3PDIB 3TZBA 3JQDA 3R9WA 2A9FA 2XUPA 3N8NA 4BVKA 1SG9A 2EKLA 4UTPA 5EWMA 2DUNA 3TF5A 1GNPA 1FRZA 3TM4A 2MR5A 3EULA 3UCEA 1XN1A 3SCZA 1L3IA 2GJAA 1AB6A 3BXXA 4FYKA 3RSOA 1QVAA 3JQ9A 3OKAA 3FYTA 4GPZA 1T91A 2PU7A 3ZE6A 4KV7A 1M0TA 2C99A 4BE7B 3ADCA 2ZE6A 4OQDA 2JGLA 2OHHA 3FUXA 5HZMA 1AIPA 2FGKA 3N05A 1M73E 3TIIA 4TZ6A 1FCJA 2V7QA 2VJQA 4GX1A 4MZXA 4IDGA 1YE3A 3Q7EA 1X74A 1UP6A 3H2BA 1C3OA 4O1IA 5KDLA 2J3MA 1WOMA 4DM7A 5K99A 1X14A 1EWRA 1P4HA 3I3SR 1FPQA 5DM2A 3F7OA 5ALDA 5DHPA 4FR5A 5JASA 2JLQA 3JYQA 1L7QA 3OAAA 3QOWA 4KPUB 4PANA 4C08A 5DN6D 3OJEA 2X5JO 1UH5A 1N9GB 2BFEB 3PHGA 4OL9A 5ENZA 1U7PA 2MWMA 4I4TA 4LHZA 1TYAE 1QQ5A 3OJOA 2YYSA 2FAXA 2WIFA 1NJ5A 5B53A 2O3UA 1N25A 4KQFA 1GZUA 3KZ1E 3S5UA 5DBGA 5ALEA 1N0VC 1KSFX 1CFZA 1KKMA 1L4BA 4GWGA 2Y4OA 3U2QA 1KYVA 1MHTA 1QH0A 3N0XA 2NUBA 5AW9A 3RPEA 4HAVA 1HG0A 3LXXA 4IQ4A 4PLTA 5C35A 1K7FB 4UHCA 3QXCA 5TV2A 4ARIA 5CNMA 5HP4A 2ZIXB 3B9RA 4EY5A 5JSHA 4G23A 1T3SA 4AZTA 4OF4A 1JDBB 2AW5A 3UV7A 1E1QA 2XUGA 5CGZA 1QV9A 3DZGA 3DZDA 5BXQC 4H3SA 5ICCA 1E7YA 1HYHA 3OO0A 1I9GA 3PC8A 3V9AA 3DZCA 1GRVA 5THQA 1H8HA 1AKYA 4LTDA 5JTUA 1PVOA 3B85A 2NO4A 3IR6A 1HZZC 1KK3A 4CQJA 4DCGA 2I6GA 4OU4A 3W79A 4Y1RB 1ISPA 3ZHOA 2D5IA 2J31A 2LDBA 3KAPA 3UWSA 2QYTA 4EB6A 1LTHR 2A0KA 1W5EA 3ZXSA 4MS1B 3W1VA 5B55A 3K5HA 2W6PA 1XMIA 2O4CA 2R6FA 1U7TA 3UT0A 3PBKA 3BC1A 3ZIDA 2QM7A 1XNQB 2AB0A 2YMMA 4ODIA 5A7GA 5FPHA 4EH1A 2MR6A 1DWPA 1XTKA 3GRCA 4FLMA 3EK2A 3FI0A 1HC7A 2VZ8A 1SWWA 2G09A 2WYOA 4JY7A 1YU9A 2AE2A 3E3NA 4M1EA 4G5GA 3EMBA 5JBQA 1EYZA 3I2JA 1OXMA 4FZJA 3ZE2B 3NWBA 5HKKA 3STYA 4X1YB 5GQSA 3CS3A 2PFSA 4HL6A 2VPTA 3N0VA 3UK1A 1U28C 2HLPA 2I4TA 3KTDA 2OG2A 4O3MA 4NR0A 5EESA 4L8VA 1QS0A 3VO1A 3ZWNA 2IZ6A 3V7UA 1YZHA 4BFLA 3H4IA 3T61A 2EKDA 4CFZA 4ZQIA 4ZT5A 5C5IA 5HS6A 1S5PA 1DBIA 2MOKA 5C18A 4BWVA 1ZHFA 2TYSB 3AIIA 3KQPA 4XM1A 1BC5A 1CWUA 2GUWA 5AI4A 3OKCA 5DSXA 3MFYA 1KDOA 3WYDA 8MHTA 3NC4A 4XH9B 5DZSA 1KXJA 1H6AA 4JLWA 3VX4A 1PLKA 2TMDA 2N42A 4MVJA 1Z4QA 2FR1A 2W00A 3ZVLA 3V1TC 221PA 1D2CA 3DZHA 3OT4A 3N58A 2WMDA 1WXWA 1P60A 4EHHA 2CVHA 3ENZA 4JAVC 3PXEA 1OILA 2NO1A 1DOZA 3P20A 1KR5A 4LE2A 3WVNA 3IEMA 3DMDA 3EGDB 4EA7A 4I1SA 4IZHA 4CGYA 4XWOA 1RKXA 1Y3BE 4ZOLB 4W82A 4AUNA 2V0NA 5LZ7A 2YWXA 3DM5A 5JYCA 6ABPA 2P5TB 2PS9A 4OMFG 3R3JA 5EC8A 4B3RB 1E59A 4G0YA 2FPPA 1ZIOA 2I4NA 1RHJA 1SZJG 3ASUA 2C1EA 3RDPA 1PR5A 4B44A 5A1TA 5DASA 5AM2A 1FMFA 1ZI8A 5FADA 1IVNA 3RCBA 4I0WB 3RU2A 1OGYA 3TBKA 3IC5A 3M89A 1ATZA 3WLOA 2ZBEA 3N3AC 5DNWA 4GBJA 1Q15A 2P5YA 2VRCD 3DL4A 3G5UA 3KKPA 4X7PA 4XYGA 3H2SA 1DG3A 1P74A 3IT3A 4DB2A 4AS2A 3DQZA 2C8VA 3ISVA 5AXBA 3JRXA 3Q2OA 3ITEA 1N6PA 3I9FA 4GRAA 4KDEA 4LWOA 4LY6A 4N39A 1NULA 1T3ZA 5I7AA 5KAPA 3SHVA 1U9ZA 3SBOA 4JENA 1XMOB 1SBIA 4NC9A 4M8NE 4NHOA 3BK7A 3COPA 3OZTA 3WHPA 2PUVA 3D54D 5DK6A 2PQ0A 4RTLA 4WV3A 2B3DA 3D02A 4XGQA 5T4EA 1JG4A 3ZHXA 4ZT3A 1L7RA 2FQYA 4N3CA 1MTOA 2BMEA 4F4DA 4GU5A 2ZJZA 4Y2HA 1XUOA 3U61B 3G2KA 1I1OA 1A5ZA 2V4ZA 2G77B 1J39A 4ZAVA 3WL3A 2OGTA 4LSGA 3FTEA 3E7FA 1UMCB 3F3SA 3JWGA 1U2QA 1KSJA 1KPIA 1PF7E 5DGCA 4D92A 2REXB 2IPLA 2Q9CA 3R09A 1GQSA 1BOFA 5BPFA 1G59A 3ESRA 5CTAA 3R6TA 5LD2B 2FK7A 3Q7PA 1VC2A 2H5JA 3RLIA 3A6PC 3HP1A 3EDRA 3PC3A 3QX8A 4U8HA 5E9JA 2EEZA 4B0PA 2DJIA 5IVHA 3L8HA 2XTMA 4M1MA 5DJ5A 2KMLA 3D43A 5DYYA 1R0SA 3RVLA 4EPYA 4G3XA 3UHPA 2YKGA 1U4OA 3D7KA 3EY9A 3WOHA 4AICA 1J09A 1IXSB 1HMYA 3DDCA 3PUKA 2YXBA 5CEFA 2GJ8A 1RR6A 1X1BA 2YUIA 3GFVA 3PFHA 4K86A 4LG1A 5DISB 3D8NA 3TNLA 4I46A 3DJYA 3CUSA 2YXPX 2RONA 1M8KA 3GWZA 3C39A 3PUZA 3ROMA 4HAUA 5CHEA 3MXTA 2N75A 3G0BA 3WMRA 1B76A 2VZ9A 4BVGA 3AH8A 3LQYA 3KOMA 1T4CB 1JIUA 4LUCA 3KSAC 3NIDB 1XMXA 1ZICA 4BKMA 3K0HA 4KPUA 4EB8A 4IOKA 2C03A 2J9ZB 3HXKA 3UT5B 4BMVA 4DCCA 4NOLA 5DCWA 2R6CA 3AVUA 4F4JA 1ESMA 1RM4A 3AV0B 3MK31 4Y6RA 3LT2A 3X3HA 5CB6A 3J80A 1LDYA 2OAQ1 1QF9A 4IGAA 3W1EA 2X4LA 5SZIA 2VP9A 2GT1A 3DNPA 4JSRA 3DUWA 4LN1A 3AP2A 3DYBA 3GQBB 5BYKA 3FOAA 1K8QA 1KJQA 3HEBA 3QW4B 3M1IA 1VCHA 2NZ2A 4JQZA 3VPBA 1Z37A 2NWQA 3HJNA 4KW7A 1XVUA 2DFVA 3FKSD 2BDTA 1IZ8A 1FFEA 4I8XA 5CVUA 1G9XA 4OH1A 3I09A 3L0ZA 3LECA 4B6QA 3SBDA 3JVIA 4KKVA 4CIAA 1DAGA 4X00A 4ICIA 4KMOA 2GCEA 5E0KB 2VJDA 3CONA 5DXAA 2OA0A 5JARA 5LXTA 1QMPA 4GEKA 3FMPB 2K7FA 1L8QA 3KFVA 4U6NA 3RUHA 2XX3A 3GR6A 3GCZA 4K9SA 2P4HX 2XQJA 3SAJA 4RH3A 3EQ2A 4E13A 3IJ5A 3UXMA 5CXUA 4GBGA 1MB2A 1NW8A 2CNBA 1PFVA 2VH2A 3MUEA 4F5YA 5KWIA 3OQNA 3TOXA 1N5JA 3JY6A 4AULA 1A88A 4ZFNA 5IYZB 4NARA 3EFBA 1LPAB 4JROA 1QO0D 5EXSA 8ADHA 4K1LA 4IUBS 2AA3A 4YT5A 1FTQA 4HYYA 1AKVA 4KQGA 1WP9A 3NV9A 4NY1A 4R1TA 4S12A 5DYIA 2H1OA 1C2TA 1A9SA 4R9VA 4FFMA 3G2JA 4LPKA 4YNBA 1M76A 1A8QA 4LYYA 1TT7A 2RB4A 3HWX1 1E5VA 4WE3A 3TZEA 1N6HA 2HA4A 1VJ5A 2P9QA 2PGOA 4WADA 5BV7A 1BMDA 1KDVA 3FUUA 1SUBA 3GQVA 5D51S 4ZCRA 1OI2A 2C5SA 5C2JB 4KP7A 3IA7A 4UUBA 3WWPA 2CXOA 2R8EA 1U63A 4R7TA 4HPXB 1J4AA 1CEQA 1UP7A 2OV3A 6LDHA 2PY6A 5IF3A 3PRKE 1M2VA 2AEMA 1M75A 1UKYA 2QTZA 3FE2A 2C9MA 3ROXA 3TNJA 2HPHA 3GRFA 1LLCA 2VEOA 3KOXA 4XJSA 1E9CA 3SBXA 4RU1A 1A5TA 2HHLA 2RGBA 3AG6A 3ROEA 1H4SA 4PSDA 3HRKA 3UNXA 1NR1A 2MDTA 3L05A 4RWZA 3PTZA 4LZLA 3A1UA 4TQUS 2HMWA 3AIOA 1U1GA 2EGGA 1C1YA 5FUBA 3OEYA 1KZYC 2KBEA 2EKQA 1SRRA 2QHXA 4ZI7A 2NTNA 2PGDA 3CFYA 3PFFA 1IN4A 4K9DA 4NLLA 3U6BA 4I2NA 5EMJA 1DARA 1V8BA 1Z74A 2VF8A 4YJKA 4GOKA 4N76A 1G291 1AM4D 3OJXA 2HA0A 2PKEA 2EAUA 3HU3A 1UXOA 1Y89A 5F2KA 4ZK2A 1IN7A 2ZSDA 4MR8A 4R2IA 3ZLBA 2PEZA 4AMUA 5JVDA 2Z98A 1IWBB 4ARCA 1RVDA 1QUEA 4UUAA 1KAHA 4Z54A 1DV2A 4QUHA 5CM2Z 3KZKA 4JI7B 3RIYA 2WVGA 1JW9B 1EPUA 4IS3A 4MRAA 6REQB 2CDBA 5CBPB 4YRCA 4BUJA 2R48A 4XCVA 5CYOA 4FDAA 2FXIA 4FI3C 4TZ0A 2O8EB 2WQZA 3KVYA 4D9HA 5TSDA 1P39A 4MA5A 4KR2A 3HDQA 3W3AD 10MHA 2XNDD 3RS4A 4MEJA 5CXSA 1WQ4A 3G8YA 1Z88A 2VRBA 3AM5A 1VOTA 4GZ3A 1HTTA 4Q1DA 2YJNA 5FORA 1IDOA 2FP3A 2Q27A 4Y9RA 3U5TA 4QHYA 4C2TA 3RVQA 3DL0A 2GZSA 3D4OA 4EFKA 3FMFA 3K0SA 5ITSA 1LVUA 4KXQA 3NB0A 3CCBA 3CZ4A 4FYYA 4GG1A 3RRJA 1SUCA 2JLZA 2ZYAA 3LPNA 3ZY2A 1CIVA 5GINE 4L9WA 2IYTA 3OPVA 1PWEA 4KC0A 4K6HA 2PTGA 2G0NA 2PGIA 3RBXA 2BFFB 1J8VA 2I66A 4B3BA 2O0MA 3VJKA 3B3JA 3N8DA 3LCUA 1YZQA 1HDYA 1VIYA 3D3KA 4BVEA 1J2EA 2H18A 3LNCA 2OECA 5HFNA 2G76A 1Y80A 2P3LA 1QGDA 2XYGA 1QPZA 2ZG6A 1OLSB 1QONA 1ZLXA 2YXNA 3MLAA 4W9NC 1E61A 2AEEA 1GZ7A 3W0LB 4X45A 1I7LA 1LDMA 5BN3B 1CZKA 3LWDA 4GM1A 2QTBA 2I2WA 4IIFA 3NHMA 2E0IA 1G20E 4QBIA 3FUVA 3I5MA 2F1KA 4C4RA 3FSGD 4F4IA 3FD8A 4CM9A 3HJBA 4KLRA 5LKRA 3FY4A 1EJ0A 1AURA 1WM1A 3MGAA 3RVOA 3WGQA 4BNLA 5BWOA 3FNBA 1TTPB 4UNRA 5BVHB 3QA3E 1IHPA 1K3FA 1P73A 1Y4ZA 1FYEA 2C3UA 1M34B 1P8AA 2YVQA 4UASA 5F3DA 2EFJA 3PF8A 4DDVA 4IIXA 1G3UA 1V5EA 3QXXA 3CUEF 5LR6A 2R1VB 5FLXA 3VR4H 4AWAA 5ARBA 3I64A 1GEEA 4KL8S 1U94A 3IVMA 4KR6A 3W7BA 2ZJ0A 4OOEA 4YPFA 4LMRA 2JEYA 4S1PA 2XDYA 4I8DA 3SKXA 3GGJA 2CLFB 1QWOA 1SOAA 2NQ2C 2PAFA 4HNTA 1T1GA 1VE5A 1UXHA 3LT4A 1X15A 1CNMA 1YR1A 1EFLA 3KSRA 5ALXA 4C7BA 2BMFA 2VJAA 3HDYA 1U2DC 3JD2A 4KH0A 4X9XA 4V1CB 3AQIA 4Z8XA 3VAAA 1C0PA 5JATA 1Z73A 3UZUA 4H31A 3CJRA 3LDUA 3K16A 3M5DA 3PDJA 2QLTA 4U7PB 5KYWB 2CY0A 3V4FA 1A7AA 4LOHA 3IOMA 3KL2A 1A71A 4RDCA 4C7KA 5BVGB 4D43A 1UODA 4NMXB 2OXIA 2F1HA 4NONA 4B3TB 4PGGA 1KPHA 2XIJA 1L4FA 3B3QA 3RKSA 1XTPA 4Q6BA 4ZREA 5AW6A 4DR3B 2IHVA 3KZVA 1O89A 2KX7A 3BHJA 4IQFA 5DULA 4A6DA 1EDOA 4XWKA 3QKWA 4ZD6A 1G8YA 4MVJI 2WA1A 1L4KA 4EP1A 3OIVA 3GFFA 3S7TA 4E3ZA 1L7AA 4LXUA 5LXTF 3WK9A 3R1IA 4KQ1A 2EDAA 1AN9A 2Z2KA 1OZ0A 4H0CA 3G7SA 2ZI5A 4KVAA 1D8TA 2Q3EA 3B7WA 4LJYA 2IW3A 4B3HA 5LD2C 2DCMA 2QD1A 2ZYVX 3T7EA 2CT8A 2XGSA 3RWMB 3VFDA 3BSFA 1AQYA 1QOZA 2YFQA 3MQ2A 3NIGB 3P19A 1NZFA 4OXYA 4XDHA 3TJMA 3EJ6A 3PITA 1WUKS 3F6PA 4MINA 3HCPA 2FZKA 3I05A 3QFCA 2P7IA 2AMLA 1LPPA 1HBJA 3JU3A 2HCBA 1ND5A 2D0DA 3HUUA 4GMGA 5ALWA 2XY4A 4AW9A 4GX0A 5A4AA 4Y1FA 3ZE7A 1IZ9A 3L7IA 2YBEA 1WO8A 1E2QA 3UA4A 4DRXB 5I7SA 4OYYA 3CSDA 5AW1A 3OTWA 1ATIA 3PT5A 1QX4A 2H7YA 4NTZA 1UEXC 4J7UA 3AUAA 4CG2A 3SJBA 1XDGA 5KNLA 1Y5RA 1M1ZA 1ECPA 1KXZA 4KDRA 1GNVA 4M1WA 4BNWA 3H3JA 4ZN6A 4R31A 1GGHA 3B6EA 1XMSA 5CK5A 2J3QA 1DT3A 3HBMA 1IY9A 3A3NA 4K8RB 1IHOA 5IBQA 3GZTB 3U16A 2EFHB 3NYIA 1AZTA 2H2AA 4XRGA 2E4VA 2CEKA 1GZ3A 1PL6A 3M5PA 4KE8A 2ODBA 1S2MA 1NQOA 1XZCA 2FG5A 3NIWA 5JD4A 2AOUB 1YJQA 4OLFA 3INGA 3PLRA 4PLZA 4ESEA 1LJUA 4PX2A 1S2OA 4PX3A 1MAHA 3VTAA 2NV2B 1KAEA 3CM0A 4LFAB 3TS1A 5B4TA 2XSZA 2ZUEA 3MILA 3X2EA 2VT7A 3WRWA 1YB7A 2DH5A 5HE8A 2BGTA 3P9NA 2VHTA 1ORIA 5DWQA 5J5VA 4B2PA 4NZ9A 2CD9A 4RXTA 3Q7SA 5AJVB 4E1BA 4AJHA 2P9EA 1HKHA 1VA5A 1LNZA 1N2HA 3T06B 4JGGA 5EZYA 5L40A 1MRZA 3OA0A 2NU8A 5FL7D 2WHPB 3ESBA 4A6EA 2OKGA 2EFDB 2XXAB 1FLDA 3AUTA 2ZQZA 5BOSA 1C8LA 2J08A 1FSPA 2XLCA 1Y3CE 2PUBA 3RANA 1ZCBA 3AW8A 4Z53A 1C9MA 2OMKA 2Q4BA 2J30A 1PNQA 3UH1A 3DOCA 5EGSA 1GZ4A 2X6RA 4RMJA 5HNKA 3CVOA 3T3PB 2E85A 2D74A 1NVMB 1UIRA 1SUFA 1X8LA 2CFTA 2W6IA 3ZHSA 1C7FA 5C1OA 3IUJA 3PC7A 1YXMA 2C83A 4A23A 1J0BA 5AW0A 1U02A 3L8EA 1JI3A 1UBHS 3CMCO 1EI9A 2F00A 3P2JA 4EQ6B 4ED9A 3IAAA 3PPWA 4JI5B 2XJ9A 2A30A 5M7EA 4PEVA 3UA3A 2DBYA 2OYCA 3I2HA 4FGJA 3UAOA 2B1JA 3DOJA 2H1CA 3S55A 4EY3A 3OTOB 1ZY2A 2WOJA 1MR3F 4MLPA 3UXYA 3PSAA 2NZ8A 3KTAB 1LQTA 5TEWA 2CMFA 2B37A 1NXOA 4FDUA 4J16C 2DYKA 3S7ZA 5IXJA 3I3OA 2W6JD 1WHTB 1CUWA 2DBZA 4G4SO 5I9MA 3JZFA 5IABA 1AZSC 2WJAA 4KIWA 4Y1RA 1WMEA 5THKA 4IYRA 5D5HA 4Q12A 3RYHB 3CLUC 2CHGA 3RRZA 3SXUB 1JHPA 4RA9A 1XTBA 4EJ0A 5AVSA 5FWXB 4Y9TA 5IZCC 1W93A 3IBFA 2H17A 4FHCA 2VYVA 4X8MA 2HBZA 2PX6A 1JKFA 2XTJA 2QIOA 3HCCA 3QM1A 4P93A 5FCDA 3CBGA 2ZSFA 4LRQA 5DWDA 3E05A 4WACA 3KZOA 1I5OA 3KB8A 1Q3KA 3CIFA 3DV2A 2A5FA 2BWJA 2UYCA 1CVRA 2V8OA 4RZIA 4C20A 4P4SA 4HPJB 4URWR 3LX4A 1Y8QA 3F47A 5E9WA 5JY6A 2GK7A 2H5EA 4L8GA 3IKMB 3EG5A 3U3DA 3ABSB 3WOVA 2GZAA 2MMCA 1SCNE 4XFKA 2XRZA 4XDYA 2NVOA 1RZUA 4HQOA 3I04A 3SIRA 2EIHA 3IT1A 4GR5A 4XEHA 4XQ9A 5IMBA 3BJZA 3Q3CA 3ZHYA 1RWMA 3LLCA 1ZBQA 4M2LA 4G5OA 2IK8A 3ZCTA 4FHEA 4OQMA 2W70A 2A84A 1LPSA 2H3EA 1KYIA 1VRCA 1X6VA 1XQ9A 3E2IA 4FHFA 5IUNC 3CNEA 3SZLA 1H2BA 2IGTA 5T67A 3HJHA 5DN6A 1ACMA 1H9CA 2P8SA 1NC1A 3JQ6A 5KS2A 3I4LA 4AMYA 1V2HE 3JVEA 5LMZA 1I6MA 1RM5A 1MX5A 1CUVA 4FBLA 2GN6A 4JJ7A 2OZLA 2HXYA 3KOZA 2XVMA 4BRSA 4IOJA 1UBSB 1D09A 1W0KD 2CV1A 5GZ6A 4KRFA 2V7PA 2QMEA 3CO0S 3JWHA 1QP0A 4X7BA 1H65A 4GPD1 1T3GA 4JI1B 2CK3D 2XYRA 3RU3A 1MGPA 3SD7A 3CVWA 3AESB 3PPVA 2E2WA 2HDOA 4PX5A 2CXTA 3ABOB 3IFSA 4XWWA 1TFRA 1VZ3A 2OCXA 4G65A 4CLRA 2O8CA 3G0HA 4Q82A 5IEBA 2JJQA 3K05A 2Q1XA 4L7QA 1ZW6A 1UFVA 2GX6A 2I7CA 2UYGA 3RUDA 3TMYA 3EPJA 4C87A 1VJGA 1NVEA 3W04A 2JDID 4L02A 5IKMA 3MJEA 2E21A 3U26A 3ZTWA 4DCOA 1EJBA 4IJVA 3JYPA 3D4LA 1M2JA 1WZUA 1P2VA 2EW1A 1ACJA 2OR3A 3CUUA 3OX2A 3S1LA 3QJYA 1GG5A 4DZTA 3HNPA 4O6VA 1I8TA 3SR4A 1NX6A 2BMJA 2IF0A 5GY7A 3OQ6A 4LY9A 1PWYE 1LV8A 1YKGA 4UUQA 1GLVA 3VZDA 3MT7A 3STUA 1SBTA 1QIEA 4NSNA 1QR6A 3IV6A 5KOIA 3OE5A 4GQBA 1TU0A 2E1PA 4X62B 4RQTA 5JH7B 3ZDFA 1YH3A 3PXBA 2YFHA 4CT0A 2PL5A 3Q9SA 2QP9X 2JK0A 2NYUA 1U0EA 1M54A 2OHIA 4RIGA 1P3Y1 3OY7A 4KBGA 5DGIA 5BSEA 3DEIA 5GVRA 5BV1A 4MGHA 2QZPA 1NVAA 1THTA 4U7WA 4E6PA 1JU9A 4OHVA 2OFWA 1ZN8A 3AUXA 3FNEA 1UPBA 3OHPA 3Q5EA 2I4IA 2QDXA 1K98A 3EXG1 4FDLA 4Z7QB 3LQ2A 3HJAA 4HTAA 4KB5A 2F3UA 4J9VA 3TBFA 2OORA 3AHGA 3KXDA 4FS8A 1LU9A 3EDQA 5LQUA 5LNK6 1N0IA 3UW1A 1ZBDA 2PAAA 4C9BA 1LWOA 1JG3A 4B83A 4LF4B 3NAQA 2ZJ1A 1YCFA 2PTHA 1E96A 3RFFA 1P2UA 3NORA 2DY1A 4DMKA 3T5AA 4LGYA 2OCIA 1YL6A 3QEMB 4W7SA 2R44A 4LIPD 3N59A 4ZT4A 3F3KA 1KEVA 3EGXA 4W8OA 2UZ1B 3MWDB 4XLLA 1XQVA 4J29A 2J07A 3MCZA 3L6CA 5FWAA 3JALA 4L9AA 4YC7A 4C7JA 3GNLA 2KI5A 4DW8A 2CN1A 3NHZA 1ZXLA 1OWNA 1P1RA 2QVCA 3HXTA 1L8AA 2W6OA 5LUBA 1Q83A 5LLTA 4DIFA 4GOOD 3UUFA 1JG6A 2P3SA 2QJRA 3LUPA 3SHQA 4JJFA 1JTVA 5FLEX 3UAXA 2C1ZA 1F8FA 3ABRB 1QE3A 3TOSA 1GQ2A 2CJXA 3DMTA 2I4LA 1DO0A 6GPBA 4GOXA 1SU7A 4XGIA 4PW0A 1E8NA 3EZNA 1P9NA 3D0KA 4UNSA 1DX4A 1R6VA 5ERYA 1X3LA 2Q3MA 3EEOA 1UBCA 2WF8A 4GI1A 1CJUC 1QGYA 1EZ1A 1T43A 4JBHA 4ZO4A 3UK0A 4DA8A 1NW6A 1JWLA 2QUHA 4V1CI 1W4ZA 1P80A 1FF9A 2Q62A 3L04A 4I66A 3K2EA 3NVMB 2A4MA 4RJKA 4JQSA 4BKPA 2JJ2D 3TI9A 3MHTA 4HYEA 1UZUA 4I99A 4FTWA 2XRFA 2NOAA 1C9DB 4NZMA 1FVXA 2A5GA 4A15A 4HV4A 5KX5B 1P45A 2BFFA 4F8JA 4WBXC 3VSAA 5LA6B 1MAAA 2C7BA 3AEXA 3JCZA 4U7FA 2FE4A 1Y98A 2PUTA 4AJ2A 3CZAA 3U4IA 4JI3B 4GYWA 5D85A 1WBDA 5DIZA 4CM7A 1SU8A 3O8QA 2CVFA 3DLHA 2J6BA 2QGNA 2XIQA 3IMEA 3OZSA 1J33A 4UMEA 5AKHA 3HEAA 3P45A 4NYMQ 3TGWA 2H4FA 5FWDA 3OE4A 3K09C 4BHTA 4DDKA 4E5SA 4PN7A 2XE7A 4I6JA 5AUQA 4XYBA 4DYDA 1ETHA 1CR6A 2QKYA 2WYVA 3ADPA 3IHLA 4JLMA 4QNMA 4GKKB 1Y4AE 3G9TA 3O3CA 3BX1A 3GJ6A 2PA3A 1EFTA 2VRNA 2RHLA 3GA0A 3OM8A 5EMNA 5JXJA 3QVGB 16PKA 2FFQA 1BYUA 4YCNA 1GO2A 2X0FA 2ZS9A 3Q1KA 2IZZA 1QFXA 1GSHA 1X1RA 1SCJA 1YRBA 1Q1NA 2O3JA 3PX2A 3EPKA 4LSMA 1H2AS 2QAGC 4U9HS 4B7UA 4UHDA 3IX7A 4O33A 4X6YA 3C1AA 5TXGA 1NRXA 2B8TA 4I9GA 1Q11A 1X7ZA 2YHUA 5IJWA 4YJFA 5A62A 2CFCA 3KB1A 3FYSA 1QC5A 4C0SA 2E5FA 3K6JA 4E03A 2OK8A 5MN5A 4HX5A 4XGNA 1KHTA 3DLAA 3JQCA 3MRXA 4BV9A 4EECA 1I1NA 3H16A 2QNRA 1YC2A 4YAFA 4CRWB 4FC6A 4LHYA 1GPDG 3GYGA 1AT1A 1FP2A 3PYLA 4P3NA 5KJCA 4UCQA 1T9GR 4WCFB 2O05A 4MLDA 1NX9A 1OXBB 2ZUVA 1U8TA 3P52A 5C1IA 3OECA 4IVRA 3O8NA 1IUKA 3N7TA 1RNLA 3DB2A 4HX2A 5A9TA 2R8YA 1Z2AA 3KB2A 4NOKA 1U81A 4HBGA 1DTWA 2P9JA 4H16A 5GJVC 2IJGX 4AY3A 5KQSA 1U7WA 3NO4A 4I55F 1ISRA 3SYTA 3TEJA 2F1OA 1DKQA 2GFIA 3VTKA 1G20A 3WJ1A 3IMGA 1DT5A 4OGLA 7REQB 1SU6A 2AKAB 4ZJYA 1GDHA 3LPCA 4JXJA 4DA6A 1EVIA 2RMKA 1IJBA 2Q6TA 2WD7B 1KMNA 2VXCA 3DE0X 3EXEB 3CVXA 4YRAA 3UPTA 2NSDA 1FDSA 3QF7A 5DYNA 5I8PA 1RBYA 1XQYA 2YH2A 4BP3A 2GHQA 5SV2A 3OU2A 2CUTA 1TTTA 4BQPA 5CIWA 4EUSA 1ESEA 2NO0A 4B82A 1ZIDA 1CXZA 4E5UA 4YDRA 3PGXA 4MRNA 3TFOA 1IZ7A 1TMYA 1B0PA 2WRZA 1UJNA 5T8KC 3F8SA 3ZHQA 4I14A 2ZATA 3EXFB 1WZ2A 4PSVA 2AFHB 3FKSA 3FNFA 3ZDEA 4AJ9A 4XSGA 3FH0A 3N9IA 3PE4A 3GO4A 4GFDA 2J09A 4AJEA 3C15C 5C4MA 2DR2A 3ZHVA 4BZZA 3B12A 3CZPA 1P9OA 4PG4A 9ABPA 3DCNA 2AE1A 2FLKA 1IPEA 2PVPA 3C74A 4LWZA 1VL0A 5B3JC 3D7SA 5CVJA 3FJYA 5H3HA 5HF9A 5LQKA 1X8JA 1PJ2A 4RMNA 3H4VA 3VHXA 4DF3A 3S68A 1U9CA 4M6WA 3TR0A 5KB3A 2F55A 3L79A 1I3LA 2ONJA 1EDBA 4X71A 3PHCA 4TS1A 2BFMA 2ZYRA 2Y1KA 3CEJA 1DJLA 3WADA 5KOJA 2VTBB 2INGX 2OHVA 4MO9A 2QRHA 1SUDA 1YOVA 4H3HB 1JU3A 4KFUA 4KR3A 3PXAA 3FOBA 5HEKA 3UWKA 4KQMA 4KGZA 4PXAA 4A0HA 3GK3A 1CF2O 5J1SB 3K4QA 1CQZA 1DXHA 1JIVA 5DHUA 4KDCA 4HYTA 4YCJA 3NPAA 5JCOA 1TADA 3DMFA 1NW5A 1U98A 1F4LA 1X7YB 3HHPA 4PO9A 4RADA 3SDSA 3W4IA 4MVYA 2RGYA 4BX2A 3INNA 1G1AA 2IPXA 1Y6RA 4WEQA 5MF6A