3S5UA

Crystal structure of crispr associated protein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
212
Chain Sequence
RVNFSLLEEPIEIEKATFLTIKDVQSFAHLVKLIYQYDNELKLQKGLKPTELFVVTDILGYDVNSAATLKLIYGDLEAQLNDKPEVKSMIEKLTGTISQLIGYELLEHEMDLEEDGIIVQELFKALGIKIETTSDTIFEKVMEITQVHRYLSKKKLLIFINACTYLTEDEVQQVVEYISLNNVDVLFLEQRVVQNRFQYILDENFYLSYEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
publication title Crystal structure of clustered regularly interspaced short palindromic repeats (CRISPR)-associated Csn2 protein revealed Ca2+-dependent double-stranded DNA binding activity.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 61
structure length 212
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09711 Cas_Csn2 CRISPR-associated protein (Cas_Csn2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s5uA01
3S5UA 3TOCA 3V7FA 3QHQA
chains in the Genus database with same CATH superfamily
3E53A 1YRBA 4BMSA 2XF8A 1A9SA 3VR6A 3C3MA 4EELA 1SKMA 2JJQA 4U7WA 3I9V1 3QWFA 5I47A 1NE7A 1CF9A 3OCXA 4OHMA 4AYTA 4GX1A 1GXSA 2LIVA 2ET6A 3KVYA 1OILA 3I30X 4KHPB 3SHFA 3RVLA 4C2UA 2QXTA 2BSXA 4JNCA 1AS3A 3AP2A 4IXNA 4YJ3F 2QORA 4DCJA 4E33A 4ZAZA 4Z5XA 1KH2A 3TKAA 2H06A 2P9EA 3DVRX 4UUQA 1C0LA 4N39A 4P08A 2J5RA 1IOZA 1IYZA 1L5HB 1WF6A 4C21A 2AMVA 4L85A 1G17A 3B9RA 3EZLA 5CITA 3B1XA 1Y82A 1ORTA 4YP7A 4K6HA 3K9FC 4EMTA 3BGDA 4ZO9A 3I8SA 3T4UA 3CZMA 3PNOA 3QLVA 4IXWA 3A3OA 2JS7A 4TQ9A 3SWWA 3R40A 2NU8B 1VP9A 3W2IA 1OGYA 4MIYA 3HN2A 3MQ4A 3E7DA 3LBAA 3EXG2 3TXXA 3A9CA 4D8XA 1VLLA 3H1FA 3DOIA 3FTCA 5K3BA 1BEZA 2JK0A 3GJ6A 1O4VA 3A4YA 5HTKA 1R4ZA 3D6AA 4RSMA 1XCMA 2RG1A 3OBIA 3DBVO 1T5LA 1Y8RA 4MUJA 5I6DA 4FDLA 5KYYA 3TNYA 1F4LA 3ZYCA 1ML3A 2CLDX 1CE8B 2GMWA 2W00A 3R7BA 4CM4B 2HWWA 2QP4A 2E37A 4EL0A 1A8UA 3GT4A 3VOSA 3VC2A 1VL0A 3UGKA 5JO9A 1I9CA 1CJVC 1F2UA 2FV8A 2Y8EA 3D2LA 2NUAB 3V1NA 1YOBA 3LT5A 3GQVA 4IFTA 4DWOA 2ECPA 4QDZA 2VHQA 4MS3A 4F1KA 7ABPA 1TT5B 3H5WA 1N2CB 1YZVA 4TVBA 3ON5A 2GVZC 3A58B 3PCTA 3QY9A 5CW1A 4BIMA 3G6KA 5FPSA 2W2LD 1WLYA 1IN1A 4C3ZA 1T2AA 4FXPA 2HNBA 1Q1ZA 3LSTA 5FAXA 3LHKA 3KCQA 1PTJA 3I62A 3VDQA 1KOJA 1JLLB 1O95A 1U9CA 4JJGA 1VCHA 4Q4AA 2YQ5A 1JWLA 1WY7A 3GH3A 2HGZA 3JD2A 4PPGA 3C2QA 4IP0A 2O0MA 4EJ6A 1KJQA 2YZKA 1GPLA 3ID6C 4C7OA 2PCLA 1GOTA 3D0QA 4R6XA 1EK6A 5SY4A 2X8WA 1XRRA 4MDYA 5B2EA 1NFRA 1WLSA 4CMEA 2EKPA 1ZGAA 4EG3A 5HF8A 3VV3A 4YMIA 3DZJA 4DWWA 1D1QA 4LI0A 5C8DA 3RGGA 3WOHA 5K0BA 2VA8A 1CFZA 1HDEA 3IFSA 2NU8A 1LK5A 4I9FA 3WIDA 1H2FA 1QIHA 2HJWA 1HG1A 2Q3EA 1V1JA 3I5XA 4AY2A 1NVGA 3PXAA 1TZ2A 2VPTA 4IQGA 4R83A 2PH1A 4X8MA 2GETA 4NH4A 4ZCLA 1H05A 4KH1A 3FFXA 4L5JA 5A2QA 4U9IS 3ZH2A 2Z6QA 1ZMBA 3ADBA 5C8ZA 1ZINA 3RT9A 2F17A 1C1DB 1MVNA 2P3OA 1DEXA 4LY0A 4RL6A 1CE8A 1LJUA 3S2FA 2V0GA 5TGTA 4CM4A 1Z7BA 1KDTA 2EJVA 3KYCB 3QTLA 3QU5A 1MZPA 2H2WA 3L7DA 3QOYA 3OX3A 2SECE 2VSXA 1BCSA 1DU4A 2WI8A 3E5MA 3SKYA 5HQ3A 2NUAA 1R15A 1LCIA 1K3UB 1NF3A 2QLMA 2BM9A 1RZVA 4GXQA 3W5DA 3COSA 4D0NA 2FPIA 1RPAA 2G09A 4PLCA 1LJ8A 1N5RA 1TT5A 2C9ZA 4BDTA 4OB7A 4X8OA 2A9FA 5BW4A 4JL8A 1KJNA 3FBWA 3DMTC 1JKJA 1M2VA 1ZM7A 3KLOA 3E82A 3TE7A 4UNPA 1ADJA 5H0IA 3L7CA 4BN4A 2PLFA 1VCOA 4CMCA 4LJ4A 2H8KA 1JLLA 2H17A 3HKCA 3JARA 2P75A 5EJIA 2I66A 3NHKA 1UKYA 2C7BA 3OU7A 4MW7A 3NAMA 4EZBA 1WB4A 2HA7A 2QPAA 4TWBA 2UU9B 4DIOA 5FWNA 3H2IA 1D1PA 1XLTC 3QYJA 3Q3GE 5GTDA 4LG1A 5KYGA 2VF4X 3ZIUA 3SOZA 4QUIA 5CIQA 1HG0A 2FZCA 3OF5A 3ROPA 3UCFA 2JGNA 2HU5A 3D9QX 3X1XA 3CTMA 2WZCA 1KEEA 1KAEA 2IOHA 2MINA 4K9NA 5ALPA 4ZVOA 4Z8YA 1HNZB 1L5SA 2D8AA 5T8KC 2P27A 1STOA 2QW0X 5EKDA 4D8WA 1SQFA 3D8HA 4JX9A 4KMRA 2BUBA 3W8RA 2G0TA 4N3CA 2ZVJA 3EDYA 4KYVA 2BGLA 3KQMA 3G5MA 4GR4A 4LOKA 3EZXA 5IXJA 4ILKA 1E2MA 2JFXA 2OCAA 2VJCA 3CPJB 3GY0A 3AMVA 4FEGA 3EGIA 4P38A 2PZGA 1RP7A 2F90A 3BH6A 4RV9A 1PL0A 1YZUA 2WNSA 4G9BA 2MDTA 3II6X 5ALFA 2ZJ1A 3NGLA 3UWPA 5TNXA 3AC0A 3IMCA 3T06B 4LTNA 1SQ6A 5C7IO 4YRNA 1DKPA 3SS9X 2Q9BA 5IZCC 1C1DA 3O3NB 2IQIA 5BUQA 5IFKA 2P90A 1DKLA 1RKUA 2B9EA 2FSFA 3BWVA 1KIMA 1QE3A 4KR2A 5EKTA 1X2EA 5IRCD 2F3UA 1R18A 3GJ8A 4Y9TA 1UWVA 4KSCA 4YRAA 2VF5X 4ZDJA 4NG5A 1TI7A 3RIMA 1P2UA 1Q0HA 2GCPA 4H1VA 3RTCA 1GZ6A 1T1RA 2OKCA 2PZ8A 1SIOA 3RKSA 3B8HA 1IWPB 5JTUA 1KIFA 1SXJE 2BGUA 3O9VA 5DI3A 3IAEA 3UW1A 3EGEA 4WINA 4PYLA 5EKXA 4N4AA 1YO6A 3RAEC 3GP3A 1BWQA 2WPDD 4ZO6A 1JZQA 3A6DA 1Z7GA 2V45A 4XJVA 2H4XA 1FYFA 3HYNA 3FETA 4YJ2F 4V1CB 4DUYB 2P8SA 5KVQA 1AZWA 2IH4A 4YRIA 1UAGA 2WQZA 5D01A 1ZGJA 2XYQA 5BYJA 1RNLA 3ELWA 3ZVRA 2H11A 1Z4QA 4J7XA 3W5HA 1FMFA 3RRXA 5KREA 2JAHA 1NVDA 2QXYA 2GAOA 4YONB 5H82A 4IV0A 3LIPA 2EW2A 2QVXX 3H7AA 4X54A 3PFGA 3KZVA 4KITB 3SG0A 3DS8A 5J2TB 3NWEA 1RU3A 1AA6A 4C4YA 1AMOA 1SOWA 1DLJA 4KSYA 5JUWA 2EC5A 5LVAA 4CKZA 3DDCA 1WW8A 3AUSA 2I6UA 3E7WA 3PKIA 1E3LA 4GM0A 1QORA 1UT6A 4N9QA 1JV2B 5TPZA 1SR8A 3ROXA 3EF1A 4FHFA 2AT1A 4Z4GA 5FWAA 3W5JA 3U7RA 3TAXA 4MPPA 4NENB 3W6UA 5CDGA 4RD2A 2PUHA 4LFBB 3LDFA 1LPSA 4KVGA 5FBWB 3PFFA 1EP9A 2X7XA 1IZ8A 1BVHA 1F3OA 2VAMA 2EKZA 4ZAFA 5CM2Z 2TYSB 5C34B 3HXLA 4XWTA 2WT4A 2YRFA 5DXFA 4Y98A 2QZ4A 1D4OA 1QYIA 3ZCUA 3RV4A 3PD1A 4GKBA 2FPMA 2OECA 2R3SA 4M8LA 2QRLA 4JP5A 5CFNA 4DC0A 1D2RA 3DONA 1FBTA 2UXBB 1JPJA 1GCUA 1MGOA 2CXTA 2ZRLA 5AUPB 4KPYA 2V8OA 1BN7A 2IZ7A 4PYJA 3OA2A 4DHWA 2H9IA 3IUYA 1DRWA 4WDQA 3RASA 4PR0A 4AJEA 3DHEA 4EEKA 4ZJPA 1YDMA 4ESOA 5TDHA 2ENWA 1SOVA 4O3FA 4B3MB 1YZHA 2GPBA 1XTZA 2D0IA 3IT1A 2IUEA 4P2BA 5IEBA 5TR9A 4COOA 1G5PA 4C6HA 4GDFA 1RHUA 4UUOA 2CT8A 4B2PA 3GLHA 4Q3OA 3CT6A 4B2LA 2QRJA 3FSGD 2XX3A 3OZFA 3AGPA 4IIGA 4CHTA 3GJYA 2YV4A 4IO0A 3KAQA 1KAGA 5T4HA 4GYYA 2AW3A 5EJ6A 2JJ2A 4YBRA 3F8TA 1XDGA 4HTAA 1W96A 1QP0A 1YS6A 3HCRA 4IH1A 4EHKA 3RS3A 5KNDH 1E4OA 2W83A 2Y3IA 1TIBA 1UDXA 3IAAA 3TL3A 3C1AA 2PA0A 1RTTA 4IIYA 4QIHA 2HZ7A 3AIMA 4EVRA 4L07A 1FOEB 3R8CA 1SY7A 5AM2A 1T0IA 5E6RA 3BQ9A 4RZIA 1GAQA 2RGGA 4JLKA 5E38A 2W7TA 3OKFA 1HKHA 2P0YA 4NENA 3WLTA 5EJ7A 4HXEB 2YFKA 4K6MA 3LIIA 1HI9A 3HC7A 5BNWA 3QLVC 3U7FB 3CZ9A 3ILYA 1MMFB 1IY2A 2WT8A 3DO5A 4I46A 2Q7OE 3SSOA 1A9XA 2FDCA 2PUBA 3LPCA 4IOLA 2ZJFA 2A58A 3FUCA 4QLAA 1FYDA 5DGTA 5LYYA 2Q8QA 2H1HA 4NL4H 2H8GA 4AUKA 1JQJC 4D0GA 3DLPX 3S8YA 1FTYA 3DUWA 3EAFA 4JJKA 3VZCA 3ZD7A 1TAUA 1FFYA 5EMLA 1IHPA 3EFEA 3EPRA 4UCQA 3WQRA 1PEAA 1YDGA 1Y7IA 3UMGA 4WESA 4C7MA 1SAYA 3KOXA 1X0VA 1B0AA 1QDEA 1NNUA 1QFZA 2WM3A 4C2BA 4EY8A 1NBWB 3PUJA 1SK8A 4QUBA 4WBNB 4B3SB 3Q9NA 4LYJA 5J40A 3IHTA 3I01A 1ZA2A 5AJZA 2NXJA 3RTGA 2BF7A 3NV7A 3EXHA 1XDWA 3QXHA 4MP6A 4QUAA 3NOQA 2C59A 1U0GA 4UM9D 2F3SA 2WIGA 2FDRA 2ODEA 3FMFA 2RAVA 3TNFA 1OQAA 2WYHA 1EESA 3EA0A 4OQMA 3W9UA 4RABA 2WD8A 1PTJC 3IP5A 2RI0A 3N2EA 2YS7A 4GQIA 4BCCA 2L2QA 1O95C 3K5HA 3TPCA 4UE2A 5MN5A 2RGXA 4FE7A 1YRYE 3MJVA 4BAUA 5JNVA 1WF3A 4TLCA 3D4OA 1Z16A 1C41A 1I9GA 2ZE7A 3NH6A 1Z62A 1P7ZA 1ZN2A 2ZYDA 2AKEA 4LHEA 4M1EA 4UBMA 2IHTA 2MR5A 3VYUB 3Q7IA 5DGXA 1JJVA 1O94D 5LBUA 3LQQA 4CMEC 2FG6C 4NBKA 3NC4A 3VDMA 1TZCA 5IXSA 1Q11A 2C77A 2JJ8A 3PBKA 1FLAA 3D1LA 5JO0A 1VL2A 2JFHA 3QVUA 4CCWA 3AI7A 4DIUA 4IIHA 4MQBA 3BH0A 1U1EA 3DLTA 3G89A 2VNIA 4UDNA 1MAHA 4UNSA 4ZV7A 2HY7A 1LSJA 4EY3A 3C70A 5AVKA 2ZQ5A 4CKEA 1Y4DE 3EDOA 1V48A 2B8TA 4I1RA 1JR4A 1UM9B 2XMZA 4JLPA 4OSOA 4QJ4A 4CV3A 4BXOB 1S89A 1I4TD 1I6LA 3GEBA 5B12A 1RLTA 4EYKA 3ETEA 3DBLA 1KMQA 4IR7A 1E59A 2OV8A 1EPUA 1XMIA 2JEOA 2YIDA 3HXPA 3TX6A 1XZDA 3KB2A 1JDUA 3KJNA 2I0FA 3PFKA 1JU4A 4PVDA 5K3CA 2HI0A 3VJKA 1VPDA 4NH0A 2ACVA 2EGGA 3UJ3X 1H9AA 2ISQA 4JQOA 2PBLA 4MRMA 4E5UA 2JK1A 1O6GA 4U2FA 4DEVA 5A4KA 3L6OO 4B87A 4O8ZA 2B98A 3TEFA 2PX0A 4RDIA 2CMKA 1YOVB 2P3LA 3GVXA 1GQFA 4GP9A 5TXGA 2ZUEA 2FRVA 4QHTA 4RD0A 3S81A 2J6HA 1UJCA 1CP2A 2NZWA 4TKUA 3Q3IA 3F6RA 3DV2A 1X2BA 2AZ4A 3OJFA 3CE9A 4GI3A 4RGYA 4RZUA 3TAHA 4CM9A 5C1OA 2CXUA 2DFTA 5EQJB 2G4VA 2XMSA 4HRAA 4AMZA 3PEEA 4X94A 1Q1NA 5EIBD 1QPZA 1Y6JA 2IT1A 2YOFA 3ZG6A 4BFUA 3M4NA 4GOLD 3DDWA 5F2OA 4TTQA 2GLXA 3N74A 3ZGNA 3ZW8A 3WLKX 2QI9C 2ERXA 1Z6AA 3DUFB 1SG0A 3CF4A 1ZD5A 1IVYA 3ZLVA 1YK1A 2Z08A 5G0TA 2X9QA 3MTGA 2GRJA 4RY8A 3OQIB 1GPDG 2HFJA 2BMAA 1B0UA 3FCYA 1QANA 3F47A 1YI0A 2CLHB 4Z6KA 5LWQA 2QTTA 4KACA 2I2FA 3CF0A 3D02A 1ZK3A 1RLIA 4MEAA 5CP8A 2RGUA 3GJZA 3V46A 1HE4A 4UZFA 1PR5A 2OBNA 4MMXB 4FZ3A 1G4UR 1UM9A 2B5OA 1LA2A 3JZDA 3PVZA 3ZDQA 3HU2A 3L1IA 3QU4A 3WGIA 3BWCA 2EZUA 2C8KA 3C6XA 1Q0RA 3LCRA 3ZHZA 3S0JA 2P9JA 1H0RA 1LBSA 2UZ1B 2GBCA 4Z51A 2DAPA 2UYCA 3CLUD 4E2YA 1N5KA 4QYTA 3KE8A 1H2XA 4IOMA 2VAWA 4NBWA 5CM8B 4LJ7A 5DNYB 2H5IA 3HCCA 4B82A 2GHIA 4MGHA 1DFIA 3G68A 1E1QA 4JNKA 1JXOA 2P65A 1XELA 1V3UA 3LZDA 2C2BA 1YOVA 3P0IA 3NDPA 2NW6A 1KDZA 1ONSA 1GVHA 3H6GA 4BB5A 1W4RA 4ZOCA 3VO8A 3ZEIA 1HDIA 1P2VA 4FIZA 2AEEA 4PSUA 2XRMA 2VDKB 4L02A 2Q8NA 5CFZA 2OK7A 1R74A 3CR7A 4M9XA 4RXTA 4BC1A 4POAA 2X86A 3T7IA 1NJ8A 3FDXA 1XTPA 4H2DA 4H7HA 2NUTA 1JFSA 3FNRA 4Q3NA 1L8AA 3HU5A 4CKXA 3P45A 1B7GO 1WM1A 1ENPA 2GAIA 2GYYA 2C3YA 2XA1A 3JS5A 1M2FA 1Z56C 3C8HA 4CPDA 3DUFA 4CEIB 3L3BA 4M1TA 1RHQA 5HW0A 3VVLA 5I5GA 2F8MA 3PQ4A 3IVMA 1NYTA 4IMRA 4U7FA 5I4KA 3RC9A 3O2QB 2EERA 3I2JA 2V7UA 1RHJA 4CM6A 1RQ7A 1W93A 3QZUA 5ALDA 4K9PA 4X7RA 2HHLA 1PJ4A 3WYDA 4BNDA 3C6QA 1YWGO 2QE6A 3CA8A 2Q5IA 3DXFA 3QUTA 5JASA 1EXDA 7MHTA 4KVFA 4RTLA 2Y05A 3I4CA 4K0RA 4LK3A 4E30A 3NOVA 4HX2A 3P94A 2ZJAA 1H2AS 4A8TA 4TQUS 2ZRCA 4LXQA 3K30A 3DHNA 1MO4A 4FBGA 4F4HA 4HMOA 4B7UA 1O77A 1MGPA 1PAUA 4AQDA 1RQXA 2GGSA 1R2QA 4AS1A 1FFAA 2XWPA 2J45A 1RXWA 3I45A 4RDCA 4M7RA 1BNCA 2HRBA 2Q7XA 3CC8A 4GKJB 1CZOA 2WTBA 1Z6PA 1NGSA 1M74A 3PWKA 3Q10A 5FTWA 1EZZA 2E21A 3T5DA 2R8RA 2FQWA 1GFIA 3K9NA 3NETA 4X44A 1SK9A 5K0SA 3FFAA 4ATNA 4LOAA 4OHRA 3PDWA 1RMTA 3S44A 2XADA 4EY6A 2G08A 2H85A 1DG9A 2N46A 3O9ZA 1LV8A 1IH8A 3EXG1 3EFBA 4CETA 3H9GA 4U39A 4E6PA 3GFVA 3FVWA 2KMLA 1ZGCA 4FCVA 1NI4B 1DV2A 1ZZEA 2AG5A 2CNWA 4Q9DA 1B43A 4WL0A 4LE1A 1G41A 2IZ5A 5JG7A 5JAQA 4XCXA 1Z12A 2RB4A 3HDJA 4U0KA 3FYUA 1A2KC 2XYRA 3EIQA 4M9QA 4YFYA 2IYFA 3I58A 1A8QA 5KZMB 3O83A 1O96A 1H2RS 3IQWA 4QHYA 3T7KA 3FNGA 4MIOA 1E2UA 3B5EA 2PKQO 3GZNB 3QFTA 4FFWA 3ZZ0A 4R71A 4E6EA 4FLMA 3ZXUB 2Q1WA 4U2BA 4DLTA 3UHFA 5L4LA 4UU0A 3OI7A 4JC4A 2FZWA 5SZKB 1D9XA 4WKCA 4CLOA 1YFLA 1UK8A 3CR8A 1U31A 3DOCA 5ER9A 4XLTA 1QH8B 4G1BA 4HDAA 2XUQA 2AXNA 5TMPA 2CVOA 3ZI0A 2VJMB 4NYMR 3W5UA 1XZLA 3AO0B 4FTWA 4ZPJA 1EX9A 2Q8PA 4OMFG 2GASA 4A8JA 1UQTA 1LBQA 1EI9A 3COVA 3FHLA 5DLDA 4HWOA 1J5XA 2NG1A 3LVBA 4RHYA 3ZGYA 1LC0A 4GI1A 1N6RA 2C00A 2QD4A 1G16A 1K98A 1N8TA 4D8TA 1K88A 4K86A 3QE4A 3PIRA 3RBXA 3OMWA 5TS3A 2V7PA 2Z1DA 3FRHA 4XQ0A 3VYSB 1ZFNA 4KXFB 1LFAA 1RI1A 4TTPA 1JYSA 2NZUG 4GAEA 2HA4A 2MU1A 5ECWA 4BLTA 3J81A 4QDOA 4RVUA 3GLFB 5IFLA 3GEHA 3DEKA 1ZC4A 3D31A 1N5MA 3EXHC 5FI0B 2VTDA 3ZWXA 1NI4A 3NGMA 3A14A 4H6PA 5KQSA 3AM5A 2W42A 1I7DA 1WE2A 5CPFA 2YJ6A 5JSZA 1CUZA 1E2FA 1WB6A 2FOXA 3LFHA 4PZAA 3FOFC 5JQWA 1DDOA 3FLMA 2YWEA 3KZCA 1TMYA 2VHXA 5A4AA 5CA0B 1F2TA 1Y3AA 2WMYA 2XTNA 1IBSA 1Z5GA 2EHJA 2QI9F 2NXEA 2PS1A 3N2KA 3QMVA 2O4UX 3SC6A 4NV1A 4DMLA 1DPGA 3H83A 3KDAA 4B6OA 1QFMA 2BFMA 4E3WA 3LNTA 5K8IA 3TD9A 2QK4A 3BWXA 2PLAA 3B6ZA 4KQ1A 3E7XA 4LV8B 3U44B 1ZRSA 3JWPA 3QE2A 4F46A 4PC3A 1NDUA 3NWBA 2F1OA 1PJQA 5IJ0A 3ZX4A 4C1NA 1K7EB 3Q2IA 1PJLA 3CVWA 2O7VA 3P0HA 1JHAA 4PICA 1KAQA 2ANBA 1Z4IA 2ZIFA 3G2QA 2GZMA 1K92A 2CK3D 2NYRA 2SNIE 4LV6A 3FG9A 1QE0A 3N28A 4MAAA 4A2WA 3ZQUA 2IQ5A 2JFGA 4KL8S 2Y93A 2AI3A 3OCUA 2O1XA 5DCYA 3QLTA 3V5NA 4BMCA 1Y9EA 2FVYA 1OYWA 3H5IA 3LYAA 1X8LA 3I9LA 2F4NA 3EVDA 3K09A 4JJZA 2J5QA 4D3DA 1WSBA 2C2ZA 1XD8A 1PFWA 3OWXA 1IM5A 2BTQB 4AN4A 1M2WA 4EMUA 1ISHA 1X8JA 2G4CA 3MTIA 4PTYA 5GWXA 1WMSA 1H0HA 5B2ZA 3HWSA 1OT5A 1XROA 1YK0A 4MV8A 4OM8A 4XAQA 4AROA 4AXXA 3UYKA 3GLFA 2XQIA 5TQVA 1LLQA 1WVGA 2GD6A 4PW0A 2PGDA 3HRHA 5BV0A 2QUKA 4AN1A 1GTSA 1Q95A 2WWWA 3ANNA 1SRQA 2L82A 1J1IA 1MVOA 1ZHFA 5DX8A 1ZONA 4JOQA 4ZI3A 3U5ZB 4BC0A 2ECQA 2XYPA 3OLXA 1O7JA 2WA2A 1QPGA 4EG1A 2JKVA 2ZIAA 2BELA 1KSJA 4XDYA 5DULA 4RAOA 4GXNA 3WMFA 2R1VB 4B6RA 2RGNA 1AUVA 1AN9A 4JLAA 4ND8B 5FL7A 3W4IA 1JEEA 5DHRA 5JSKA 2CYAA 2PANA 3IH5A 5DYWA 5K01A 1OH8A 4PWYA 2QR2A 3O8DA 4MI6A 3BE8A 1K06A 4QWMA 1S9HA 4N0DA 1I2BA 4U3JA 3AVXA 3CZ5A 4QAJA 2X0JA 4XFDA 3ESQA 1N2GA 4QXRA 2AA3A 1QQTA 4DANA 1FW8A 3HHEA 1T2NA 5GV7A 3DT9A 3Q11A 2B0JA 4MJ3A 1SULA 2H52A 4MKIA 1G7CA 1VM6A 4DGSA 3C43A 3LL7A 5D7NA 5JRDS 2PKYX 1BH6A 4FYWA 1GA6A 3PL5A 2QYHA 4CEJA 5KYVA 4NV3A 1RZRA 2XDQA 4AWBA 4BRUA 4JN6B 4EFLA 3RT1A 1P0CA 4CI0B 4AMYA 2R00A 2AZDA 3FNBA 3FPSA 2DBRA 2CLEB 3EWAA 2AR7A 3JWEA 3QIAA 4LK2A 2GEBA 4J2HA 2PWBA 2E89A 2HA0A 1URPA 5KKCA 2R7LA 4BMPB 4CF4A 1PJSA 2ZIZA 3JV7A 1XMQB 2V3WA 4JEUA 1B42A 1J42A 4ZZ0A 5IYZB 2O2HA 5HQTA 3AFGA 1E2JA 1XCOA 1GL7A 3UAYA 5IM4A 2D74A 3A6LA 3PNSA 2FW1A 2R1UA 4KAJA 4U9UA 4DDKA 2AVDA 5D3MB 2AI2A 4CR7A 2JG3A 3G9UA 4YV7A 3HJTA 1UDCA 2FR8A 2JB9A 1T5OA 2JFVA 2WKRA 2PV7A 2YYSA 3WYEA 6REQA 4NZNA 3QXXA 4JU8A 3IPCA 2VNKA 3EIWA 3W6ZA 1CUHA 3FZEA 3RQIA 5K03A 1UWLA 4GIBA 1UOOA 1CDZA 1XSEA 5EZ6B 3VKVA 2XCLA 2YJ5A 2F64A 1EXVA 3VR4H 4D46A 1XVLA 3CPSA 5J2TF 4NMXB 1HSOA 3ZUPA 5HZMA 2Z1NA 4RK4A 4P7FA 3F4KA 3QUAA 5CVVA 3PC8A 1TTHA 1ZIDA 3F7OA 1GPH1 5L3SB 3WL5A 1L5YA 1G55A 5FOWA 4N0MA 3R7NA 3S1AB 4G89A 3WKAA 1D7AA 2VYQA 4KE8A 2JFWA 3D6HA 3DV0A 3E48A 3QXGA 3E4DA 2OGWA 1ABFA 2WD7A 4NXNB 3K1AA 3L0CA 1D03A 4ODIA 3O0TA 3TCKA 1HMYA 4MROA 2VJKA 4BZZA 3HXMA 1R64A 1G291 3OLZA 3LVFO 2IWHA 2I6FA 2YOGA 3UB3A 5EUBA 5CUQA 1N6PA 1XZFA 3JYNA 3OTHA 5BR1A 1X7ZB 4C6SA 1KDPA 1VSQA 1SHUX 1G18A 3N2YA 3O3CA 4PSCA 1XQXA 3QWBA 1RCUA 2GJ4A 1QYWA 3L7MA 5F1KA 5FV7A 3CKLA 4QFBA 3LNCA 1JEAA 1MABA 4IMJB 3VU1A 4RKEA 2WRZA 3HGQA 3HUFA 4DCTA 1H5QA 5A6VA 3KIPA 1N0UA 4HLDA 5JC1A 4TYNA 1VPEA 1O9BA 2GEVA 3FB1A 3B51X 4TUYA 4F45A 3BXOA 1AK9A 1RQNA 3QBTA 3G0OA 4IX1A 5AKKA 5LQJA 4QLOA 1GADO 4M54A 3MIZA 1PZHA 4Q48A 3CGGA 1XNHA 1RHRA 2NVUB 3ZDRA 5D3QA 5BN5A 3KELA 3PLRA 1BRMA 1WDKA 4YCAA 4CKCB 5CJJA 5ALSA 4TMYA 5H02A 4OGWA 4AZVA 1LI5A 2OG1A 4CYMA 5HFNA 4F85A 1T2UA 5J1SB 1C30B 2P5UA 3QQPA 4LKOA 6CHYA 4RTNA 2Q3MA 3FYUC 3L6RA 1C7QA 3EG9B 2JFUA 4DLPA 3VAAA 1IXYA 1PE0A 1XPJA 4NK5A 3AK4A 3ANTA 4WKOA 1JA0A 2CBGA 2C0PA 4V1CI 4W5JA 3ICVA 4KR0A 2EBUA 3OCJA 3S1AA 3F3SA 3CR3C 4UDYX 1GITA 1VFNA 3E3MA 2YWGA 4NV0A 1CB7A 3TVDA 3MUFA 4H77A 5I9IA 3P8ZA 3QSGA 1YCFA 4F8YA 5KWEA 1U3UA 1Z75A 3K0FA 5FA8A 1BQEA 3GDWA 5B4TA 1R4MA 1QX3A 3HVHA 4CKWB 4C4RA 1YJ8A 2DECA 1ZJZA 2BGKA 5A7FA 4PZCA 1UP4A 5FT9A 3BXXA 3MGGA 4IDDA 4NNJA 5TB5A 4FCCA 1ZEMA 2OG2A 3SE7A 4B81A 2YJGA 1Z25A 2P78A 2Q6OA 4ZOBA 2F43B 2H5JA 1X0XA 4HEQA 3FI0A 1USGA 3REGA 3SYMA 4ALMA 1EP1B 1VDZA 4A8JC 3FDIA 3RR2A 3HQ4O 2GN1A 4YS6A 3SOPA 2JVIA 3JR3A 2K4MA 1OCEA 1HFEL 2CD7A 1JPVA 1L8LA 2I7CA 2CLMB 3KL2A 4PRLA 4D74A 4KE7A 3ZS8A 5FBZA 1AHPA 2YN4A 1SUAA 4DRXB 1G8AA 1J9ZA 2WTEA 3PSHA 2ILTA 4WPGA 1CS0B 5J5VA 1WEKA 1NAIA 5CFLA 1OUMA 1B8PA 2P2CA 1TC1A 2Y6UA 3EFHA 1UXOA 5JHGB 2Z6UA 1SZDA 3UAGA 1M7GA 5C7YA 4R8LA 2HU8A 1GL3A 1WBJB 2QRHA 3H9JA 3CNQS 3C7TA 4AJ4A 3MJEA 1G21B 2HF2A 3WBBA 5JFGA 3TLXA 3ZQ6A 5EE9A 4KXUA 2X4DA 1PEDA 4NYMQ 4XD7D 5GMOA 4BEJA 5LP6B 4MQFA 1NQOA 1REQB 1IDOA 2Y4OA 4QXOA 4YAGA 1Y3FE 1XZAA 1IMOA 3EG9A 1I2CA 1EUDB 1VFPA 1SO8A 1X1RA 4WJLA 1C9KA 1TM5E 2NYUA 4DVGA 1U2RA 1GP2A 3NVAA 4OL9A 2BGNA 3CPHA 3UMMA 1XVTA 5KINB 2D7JA 3H5NA 2OHIA 3COWA 4RH0A 13PKA 4ZQHA 2WWXA 4PG4A 1UCFA 5EEHA 3G2LA 1A8IA 1P1FA 2LE0A 3GPBA 4HGOA 3IJ5A 1JQAA 1KA9H 1H2HA 4JH0A 1EGQA 1U7XA 2RHOA 3QVLA 4B71A 2I80A 3ENVA 3O3OB 3MCUA 3O91A 1MA3A 3PA6A 3MYRA 4LJ5A 5CLQA 1AN0A 3OEED 3TZLA 4CKWA 3K8YA 4HFNA 3HRKA 4RDXA 4B33A 1Z0UA 1F8GA 3O6VA 4XJTA 3Q8KA 5CNMA 1DXYA 1I6MA 1NF9A 3DMHA 3GZ4A 4DPLA 1Z07A 3AKCA 2JH9A 2HMYB 3C7CB 3CMMA 3I1FA 4HH4A 3WE7A 4CMBA 1Q0UA 4FFNA 2F4VB 2IS6A 2VBFA 2VWGA 3UV7A 2V1UA 3R3UA 1XB2A 2A0KA 2D6FA 3C6MA 1OLSB 3RCBA 1M1YA 1X7XA 1C0EA 3TSZA 5CYOA 2UV8A 2E85A 2CL7X 3NTVA 3GW8A 4AKHA 3KT6A 3K09C 4D98A 4EUSA 4HEA1 1K7CA 2AV6A 4TT3D 4CIYA 1G6Q1 1YTLA 1MX9A 2OUIA 2RGYA 4OAQA 4B40A 1G2QA 4DARA 4AUMA 5F2NA 1NVMB 4DCOA 5LXTB 4H7KA 4UE6A 1YKFA 1DFGA 1NN5A 2VH1A 3G8CA 4DYVA 4WECA 1DUSA 1MRZA 3SR4A 1JDJA 1REQA 2ZI4A 5JSHA 3BWDD 2VYCA 1ND5A 1JL3A 3Q7RA 4M37A 2J3DA 5EIWA 1SELA 4PLZA 1W76A 4MGKR 5LJIA 2AEMA 1GG8A 3F1KA 1UJBA 1DE0A 3IUJA 5E3IA 4PZ0A 1L4BA 2RGNC 5LB4A 3KSAC 5HK8A 1D1TA 2PAAA 3KU4A 4H9GA 4NPHA 1GG9A 1KOFA 4PCUA 3TRDA 4ZN6A 4Z0NA 4HRVA 1GTJ1 4BJ3A 1PGOA 4ZQIA 1XPOA 4RU1A 2IUTA 2NYVA 1NUPA 3D8RA 1CERA 2HB6A 1Y9DA 3PC3A 4FYPA 3G2JA 3RHSA 4D0LB 3UMYA 3LUHA 3OUUA 3E9YA 3MXOA 4QAQA 2HCBA 4K6CA 4DB4A 1LDEA 4EFKA 3AV0B 1J99A 4N54A 2NSDA 2XWBF 4O3MA 1P19A 2Q2QA 3P97A 3EHDA 1ZRHA 3PHJA 4G5RA 4OD0A 3R7LA 4C05A 2VXOA 4Y1RB 4MUFA 3WK4A 5IC6A 4BX9A 1Y4AE 1WZ2A 3UBTA 4C08A 3GDOA 1MP0A 4D9CA 3ECCA 2CZCA 3EFOB 4U8GA 5L6MB 1RYMA 2C92A 2VSFA 3WOVA 4IIVA 2V96A 4M9UA 4WZBB 4A2PA 3K6SA 1QOPB 1J0AA 1DHTA 2R00C 3DR3A 4DWVA 1C3EA 3TRHA 3CRMA 1PKXA 2FZVA 4KLZA 4CIWA 4ZK6A 1A4RA 5JDIA 3DGFC 3HM2A 3A2MA 5TIIA 4C06A 1K8YB 3PNMA 2ZIXB 3TBHA 1B1CA 4J29A 1NMQA 2QLBA 1UK7A 2VL7A 4Q37A 4Y7DA 1SHLA 2WIBA 4G1CA 4PG6A 3OT1A 1MH1A 1N2BA 4EY7A 2IXTA 3LQ4A 5I7FA 2C61A 4LC0A 5FUWA 1H6AA 4B9AA 2FR8C 4NNPA 1F6BA 2VATA 2OWDA 3AY6A 1U0TA 3UA4A 1JJAA 1W4AA 4XOIA 2VVTA 3O8QA 3KP1A 4R84A 3AFNA 1PG2A 1U9YA 2IP1A 3U7QA 1HTWA 4N6NA 6AT1A 4WX2B 5CIWA 5JSFA 3G1UA 4KFTA 3L77A 3UK0A 5DHPA 3VPGA 1WCIA 3KQUA 2OBFA 3GUYA 4X6UA 2V8BA 3BFKA 2HXGA 3BE4A 3PK0A 1NIJA 1ND6A 3RFVA 2O3UA 2B1JA 1ZM2A 3PC8C 1O6FA 3E9QA 4RK5A 5LOVA 1KYIA 1XCGB 2IV7A 3WS7A 2NGRA 4BMNA 2QZ9A 4C43A 3HJGA 2B78A 1Y1RA 4TQAA 2J3EA 3TSAA 4BV3A 2HUPA 3DSRA 3PYMA 1KH3A 3ZE2B 4Z4IA 2OKGA 1ESDA 2AQHA 3WBKA 3WWEA 2J3JA 2OZLA 7YASA 3WNVA 3MGKA 4CUJA 2QN2A 3UQYS 3NS7A 3GLQA 3GD5A 1Y89A 3K5WA 3M5WA 2FPOA 3VR2D 3VMFA 2NVWA 3Q40A 3UV6A 1QHSA 4KFUA 1P61B 1QS0B 4XRGA 3WV5A 1C2YA 1HNWB 4IIBA 2I4IA 2FE1A 1L3CA 1SVWA 5EP2A 2CXRA 1R50A 1XZ8A 3I9FA 1ZW6A 5NULA 4EG5A 1ISPA 2AJ8A 2I6QA 2RGAA 3HR8A 1M66A 3PCRB 2RGRA 4KRFA 3E2IA 3O8NA 4JLOA 5TT0A 4EBFA 2PKRA 4IDGA 2CDBA 2ZIXA 3RO7A 1FDWA 3ZZTA 1PG5A 2X15A 3GLHE 2OM6A 4KQ6A 3RWOA 2IV3A 4DXAA 4ESEA 4F4CA 1NV8A 5TC4A 1JQLB 5HUHA 2QQEA 4YAJA 4A73A 3QBDA 5IF9A 5JARA 2OHVA 1U8ZA 3QEJA 2YWJA 4YRLA 3G1TA 5C32A 2XUPA 2JDIA 1GSOA 3OU2A 2OB1A 4F5DA 1R6UA 3GJQA 1U94A 3PR2B 4CMGA 2JCSA 3R9XA 2PXCA 4YUAA 3L93A 3EOZA 2WKPA 2M6KA 1QRSA 1JFLA 4JHLA 4KDCA 1QQAA 2LWIA 3ZXSA 1RADA 4FK8A 4JK3A 4FE3A 2Q41A 2PN1A 1GD1O 4O1IA 4PSDA 1DAEA 1PBTA 1QIKA 2X2EA 4ZT7A 4KYIB 4ZV9A 4ZWNA 2GX6A 4AKTA 2VNHA 3A1CA 4XH9B 3PDUA 3OM0A 1K3FA 4J76A 5EMKA 2WWTA 3DO8A 3RTDA 4BMVA 3FMIA 5K45A 5CVJA 2IOQA 4RH3A 5M5BA 2O06A 2ZAGA 2ORED 2Q4EA 4B43A 3VSBA 4M38A 1D5CA 3INTA 2JEYA 1UK6A 3JQAD 1I6WA 4CM8B 2AHRA 4HKTA 5HUQA 3QK7A 5FNVB 1VLVA 1XZIA 2R4TA 1LDBA 3LGAA 1E4YA 4CQLB 2F55A 3EQZA 1V5IA 5FOVA 1FDVA 2UVDA 5A9SB 5JADA 1L5MA 4QOJA 1QS0A 1OBOA 1OXBB 4D9NA 5EZ5A 2V7XA 4WLUA 3IC5A 2E1RA 4KIWA 2QUJA 3K31A 1DPFA 2AN5A 2J9RA 3C98A 4IDPA 3VNQA 3HNOA 1APBA 3RK1A 3U3DA 1R8SA 2RH5A 4S1NA 5HKAA 3QEBZ 4KXVA 1J9EA 2QX9A 1OWNA 2NNLD 3OZDA 4NS4A 2P67A 3H2JA 4Q3CA 5LP6A 1JE0A 3ZKWA 3DE3X 2HJVA 3SVLA 4DV7B 2NQ8A 2ODAA 2XTZA 4R31A 2HRCA 2XR1A 1P9WA 1RPTA 3DAOA 1VE3A 2FAXA 3KVRA 1KEWA 4QATA 5FTJA 3B6KA 3A4LA 2G67A 3L0IB 1XDSA 1IG0A 2POCA 5KJ6A 3CVVA 1QH1B 2OD9A 2IL1A 5DM4A 3L01A 4IZHA 5AP9A 1ABEA 1GQQA 1S2OA 1D04A 1TJYA 5LU8A 3MG9A 3RSCA 2CL6X 2ESRA 2FLKA 3N7AA 4PBSA 1MVLA 3DF9A 2YZGA 4H3KB 4EI2A 2RGEA 4P3KA 4PNEA 2QRNA 1F51E 1DX6A 1X7HA 2QDKA 5CA0F 4K3VA 2DFVA 4GZ6A 4PYNA 2DLCX 5LD2C 1PP4A 1W87A 2EKQA 2I54A 5CHYA 4DQ0A 1JHVA 3JZFA 3AXSA 3GFBA 4UARA 1IY0A 1BEUB 2P9BA 4M46A 2W2LA 3CEJA 4NU8X 4FIDA 4W1RA 5A2GA 4FFMA 4QDXA 3SHOA 2OM2A 3ZHVA 3DHWC 1WWKA 5BWLA 4TLDA 1RLOA 1KYWA 2COUA 2VRWA 3P0FA 3BORA 1LW7A 2EX1A 4KQFA 4KX5A 1Q20A 1XWWA 4CM8A 3C6YA 2CLIB 4CQLA 1S3IA 3TAUA 1K7XB 1C29B 4HDRB 5JMWA 1CC1S 1VMDA 2GZDA 2R86A 3OTGA 3OKAA 2BFBA 4FLEA 2IZ0A 2WUDA 4LOJA 3KB1A 2AJDA 4R8MA 5EWMB 2MYNA 3D4LA 3L46A 4XTRA 4MO2A 4EZEA 1FVFA 4GNKA 1WU7A 1FMLA 1ZCFA 2Q49A 1FMTA 3MILA 1IG3A 1GNPA 2X0KA 5F1PA 3ZK7A 2CFIA 3ANYB 1J1UA 3LMKA 1MJNA 1MIHA 3GLIB 5JJIA 1MOPA 3BJIC 4UMFA 1M67A 3T1HB 1AQYA 3SR3A 1VJTA 4MAMA 4G84A 2Y1WA 3EXIB 4UZSA 4YP1A 4U9HS 3NKLA 5FBVB 4G97A 3OSUA 1M8FA 1EZ4A 2ISSD 1Z39A 4R9SA 3QEMA 4DYDA 1C9JA 1QH1A 2BF4A 2DPGA 3HFSA 1G3RA 1QSGA 3C8UA 3KYJB 3E05A 4MUEA 3V9AA 5U9CA 4P0PB 1KDYA 1THMA 3CX4A 4CGZA 5U4XA 3UXMA 1YQXA 1ISRA 1UEXC 4EGSA 3W06A 1DX4A 3C1TA 4JQSA 4PO1A 2JZNA 1I3MA 5HMLA 3CJTA 4FD2A 4CBVA 2WLSA 5KB3A 3A6FA 2JC3A 3EVBA 4O4IB 2GEDA 4UD2A 1NLMA 2YINC 1E4EA 4N7JA 3NEAA 4FOPA 4DR6B 3Q8LA 1DTEA 1HH4A 2DFLA 5D5HA 1YL7A 4G5YA 1Y5RA 4S24A 2JH3A 3RK0A 5HK9A 1ESEA 1DWOA 2OESA 1FSGA 3ZXIA 4A1FA 1KQGA 5AW9A 4B3GA 1L3IA 1KYQA 1ZJYA 2A1UB 3T4PA 1E77A 1V8ZA 3CSUA 3WMGA 3EEYA 2JH8A 4P1ZA 4TM7A 3QGMA 1XMJA 1FXSA 4BO5A 5FH9A 3ICCA 3TS1A 5KWJA 5TJ9A 4ZRNA 1C7FA 4K40A 4ALLA 1GPMA 3V00A 4HDRA 2OXEA 3ZW9A 2ETVA 4FMBB 5LYJA 3VAZA 1QR6A 1WXIA 4BKOA 3EH2A 2PUEA 1Y3BE 4LGMA 3ZJ5A 1KRWA 3Q8XB 2QUBA 5SY9A 2J41A 2W6JD 2ACEA 2R6GA 4MPRA 3GARA 2AJCA 1EA7A 1N2OA 4M1SA 2BYTA 2PMKA 4TLAA 3B3FA 1SVKA 3Q85A 1Q2UA 4OYHA 4BMZA 2QD1A 1U7WA 4PZUA 4Q9JA 1IAVA 4IHAA 5AXCA 4BNXA 1TM3E 3HM9A 5TMBA 5LYJB 3DDOA 1C3OB 3BAZA 3KJQA 1RYDA 3RIEA 3EXIA 1E1RD 3PQFA 4TUYF 1ZICA 5H3CA 3KLPX 3RS2A 1XA0A 4CFSA 1CUJA 4DBVO 5JDIC 1MENA 2V3VA 1U2GA 3Q0IA 5KKAA 1ETHA 4KR3A 3NASA 1AC5A 1LD3A 5IYZF 1ZD8A 4MVJP 3OE7D 4R68A 3CUYA 2H3HA 5I7AA 4DSTA 4FGUA 1OIWA 1IN8A 1GPNA 2KLBA 2R8YA 1RWQA 4KIGA 5J58A 2POQX 1G5RA 1LSOA 1PQ4A 2EX4A 4H0CA 2YY5A 4CODB 3UM9A 5JBQA 1IJKA 3GPDG 3AEKA 3V6LA 3UENA 1P5RA 1ZSNA 2PLRA 2WPDA 1L4HA 2IXBA 1EVJA 4JEHA 2ZIEA 3I34X 4EJSA 2J0SA 4N3BA 4BAZA 2PSEA 3N8GA 5AFSA 4PQEA 2PS3A 5TPWB 2JFQA 3SYNA 4PLVA 4CEHB 3C8ZA 4X6XA 3T15A 2PMCA 1E0SA 4E2ZA 2XKKA 3DMPA 4AY4A 1JA9A 3IP9A 3LGXA 3LWBA 4N03A 4PGHA 1P1HA 2IU0A 3ZWQA 3TUZC 3HEAA 3SFVA 3KYBA 4C0LA 3E9ZA 1ULZA 2GM3A 4DGQA 5LQAA 2FA9A 2I4LA 4WK2B 3V8QA 3ISTA 3RS8A 4GGPA 3UHOA 3ICQB 3KQPA 4FB5A 1JF8A 4N12A 2EL9A 2DF8A 4WNYA 4QEZA 3EVZA 1NRWA 5DN6D 1ZL0A 2XMGA 3HSSA 1AKNA 1GL9B 1YVPA 1Z3IX 2ZIGA 4G5GA 1MF7A 1X7YA 4RF3A 3CLTD 1TOAA 4PYKA 1F7UA 1QF9A 4QBIA 3I64A 4L2IA 1C3OA 3OY7A 3KUDA 3LWDA 2D13A 3E15A 4LZOA 4WOPA 3ELBA 1EX6A 2W6MA 3A9SA 2OO7A 3PHHA 1OA1A 2NV6A 1E3EA 3TB6A 5JPIA 1CUGA 1FP4A 5IBPA 5M34A 2OXFA 2CN1A 2DJ5A 1ECGA 3OZCA 2I99A 2OLEA 2ARKA 4Z86A 1UC9A 1OTXA 2XA2A 3C16C 2C5HA 3F97A 5JD4A 3RSOA 1E8MA 2O2JA 4GBJA 1W75A 4M89A 4URFA 1AIPA 1OVMA 4GMDA 2BM0A 3GFGA 1M6EX 3DP7A 1R6AA 4KFRA 2JHFA 4HGNA 1MTZA 2Y77A 1NXOA 5TV2A 3SS7X 5EFZA 4YACA 2H2IA 1EM8B 4REMA 4ZYYA 3AJ8A 5EP1A 4QXQA 1N4AA 4ER6A 5HKOA 4ABTA 2A9QA 4KUHA 3WLSA 1RI5A 3JQRA 2OYRA 1GAJA 4B8YA 3G6WA 3AUKA 1L5WA 2WF9A 1Z2PX 2ZDGA 4P7KA 5AJHA 4DLBA 1MLDA 1THZA 1FUUA 1DXQA 5JYDA 1NF2A 1R0RE 1UBJS 2HD4A 1LNSA 3K6JA 2GZSA 3PCXA 4L15A 4PIPA 1E7RA 4U8HA 1RC8A 4X0EA 1FFDA 5TF0A 4BIIA 1D6NA 4CEHA 3RTEA 1TECE 4UM9B 1LB1B 3FSGA 1C80A 4X95A 4U6QA 3K94A 5LP1A 2H2GA 1U0BB 3OECA 3NBAA 3WIBA 1C8KA 2ILVA 2FX2A 2YOHA 3COZA 3GI1A 1M6HA 3JVVA 3JALB 4MMYB 2WP8J 3O1LA 3ZK8A 3OEYA 1HNXB 3UZUA 1SCKA 1ZCJA 2PAFA 3AL2A 4IDBA 4AJ1A 2GD1O 4FFSA 3S2YA 4YYEA 4BV2A 4MWDA 1QBGA 4PX9A 5BP7A 5B7GA 2V6MA 1GGHA 1EVYA 2RHWA 2YMQA 4BFYA 1IZ7A 5K4HA 5LKAA 4H7JA 4F6CA 4CG0A 2E4YA 1EVQA 1T3ZA 4CQMB 2VUTA 4MQEA 3U9LA 5E0KB 4OX9Y 4KNWA 3TRIA 3T3EA 3HDHA 2B35A 4B45A 4B6EA 2Q50A 3WSVA 2P0EA 3LP6A 4C78A 2Y1LA 4L22A 4F3TA 4H4EA 3HI4A 1E6LA 1SVIA 4OBWA 5SY6A 3WGVA 1VRWA 1VIVA 1ZL2A 121PA 4G5QA 2JD0A 1I6KA 4D3YA 2FPLA 2BUCA 2V9PA 3H9QA 3KLMX 4Y2SA 3DTVD 4NBSA 5LP6C 3WLAA 3LTEA 1Z6QA 4O4LA 3UANA 2WY2D 3V7NA 1WO8A 4PN7A 2HR1A 4HNUA 4A0RA 1TKRA 3KT8A 1CETA 2P62A 1L4EA 3HYSA 4N47A 1JQKA 4CV2A 1ZC3A 4RVDA 4V3BA 4Q47A 1RYBA 1R5NA 1EWVA 1X3LA 2Y67A 4OA5A 5CLIA 1QAMA 2Y1XA 4LWPA 1NJSA 2VDWB 3GK3A 4Q9NA 4RD6A 3DLIA 2OSBA 5E1DA 3NR2A 2D0OB 2XMRA 5CB8A 3COYA 4C01A 1J39A 3I42A 2X0FA 4WNAB 4L3VA 1RWWA 1CUYA 1OGIA 1T3LA 2IF2A 3AR3A 1OJ7A 3INRA 2B1RA 5E7QA 3RJZA 1WZCA 1S02A 1UXIA 2Q3JA 1XRNA 2PBFA 5CRIA 4E14A 3KT0A 4JJIA 1L5GB 5KC9A 3A2LA 1YL6A 2I91A 4R1QA 4DXHA 3ZR4B 3AEYA 3P32A 1U9IA 3DXZA 4D9KA 4D97A 1ORRA 1YJQA 3GMIA 3JALA 4AQYB 4II3A 2IGBA 3GGJA 1Y8AA 3AVTA 1D9ZA 4LF8B 1K6XA 2RI1A 2VNSA 2Z5FA 5TGZA 1I0IA 1PGPA 4IG9A 1DOHA 5G0UA 3FM9A 3X1DA 3PA8A 3MTEA 1SCNE 4HUTA 3QX9A 1S9DA 2GYWA 2ZDHA 2RONA 1O94A 4LYAA 4URZR 2ZB3A 3RRBA 2GJSA 3BDAA 2D3TA 2WSLA 3IDQA 3LRXA 4GPTA 4EX6A 2Q07A 2WSYB 4CU5A 3OIDA 4BZWA 4F71A 1V37A 1QYCA 2J8ZA 4F12A 1AD2A 4QARA 1GFWA 1N0WA 3JD0A 5J3JA 4WK4B 4TWAA 4EVQA 3T3OA 2CUNA 4OI1A 5SICE 2F7SA 4UFNA 3ZGXA 2V7BA 1ZIPA 4YC7A 1XE3A 1JU9A 1KMMA 2RHCA 4ZIRB 3GJRA 2GKOA 1WP9A 2G4LA 4F06A 4Z3DA 1C7IA 3BWMA 5F35A 1U04A 1ICEA 3W6NA 2ECKA 3EGVA 3HZRA 4XGQA 5KDDA 4W5QA 3LU1A 3DOUA 4X90A 3TLZA 3EH1A 1Q7CA 3NXKA 2ZTLA 1SWWA 2XV1A 2HLDD 2VDWA 5KJCA 1O89A 2I76A 2R60A 3DDSA 5IBRA 4YNBA 4LYDA 3R3YA 3SK0A 1T2CA 2EWWA 3THXB 1DKMA 3BAFA 4GMGA 4ML3A 3BA6A 5CLLA 3R75A 4BNUA 1PT9A 5DYTA 1T1IA 1T4BA 2FN8A 2LR0A 3I8XA 1U2PA 4J94A 1FY2A 5KAPA 1V26A 4I4TA 3GFSA 3VOAA 3S7TA 3SIRA 4E1VA 1JH9A 4ZCSA 2DHRA 2Y1KA 5H83A 2KBEA 5KOIA 3ZDFA 2VXCA 3UCXA 1VYUA 4UBNA 2GD2A 2GN6A 1SPBS 3QF7A 1SCUB 5IUNC 1FA9A 2WFZA 3KU1A 2HSEA 3HP1A 3LP8A 4GOKA 4K1LA 4OAOA 5IT5A 1HSZA 4HZUB 4DCSA 2PQ2A 4IVRA 4DAOA 1YRHA 5ICSA 5JYCA 4QNNA 1SZJG 3G85A 1RKBA 1ZITA 5FADA 4BNFA 1Q92A 3GDFA 4AM8A 4C7KA 4ESHA 3FIUA 1TK2A 1CUWA 3RNLA 1E0KA 2HQ1A 1Z37A 2HSZA 1QNFA 1VE6A 1UPXA 5SZHB 4BP1A 3MBKA 2LTAA 3I5MA 1AQUA 2ERYA 3DFZA 5AW0A 1E7MA 2FUG1 5AVWA 3WLOA 2HTEA 1XU4A 2FVXA 3G2MA 3T6KA 2FWPA 2HJ9A 4ZC1A 1PK8A 4L0MA 3WP1B 5D51S 2PD6A 3L8HA 5AVJA 4B47A 4ZIRA 1HE3A 1EDEA 2PJZA 2ZULA 3MTAA 5CT8A 4M0CA 2C78A 4IJ5A 4XX0A 4DA0A 4JR2A 5JZOA 3MOSA 4MUBA 3MXTA 4CV1A 1C8LA 1U2GC 4JWTA 4Y2PA 5JZMA 3N76A 1NWCA 1ZKMA 4DIDA 4BN5A 4HI0E 2HNKA 3DEAA 1JSZA 4EA9A 4YAWA 5ALKA 3EK2A 4KMSA 3PI7A 2HF7A 5IT9A 1ZUNA 2J5KA 4OXKA 2EU8A 2CD9A 4QOEA 5FWXB 3BULA 2XQJA 1JHRA 1KI6B 1K89A 4GS5A 1VMAA 4ZHSA 5AT1A 5CJPA 1W0CA 2ORVA 5DU2A 1BJTA 2M1XA 3OFND 3L1JA 2JGKA 2OGSA 1TZMA 3NBXX 3CG4A 1U1IA 2C5LA 3H3FA 4OUDB 1YZYA 2QIPA 3WADA 5CMLA 4MVCA 3WQSB 5CIYA 2B4RO 3MPOA 1ZRMA 2ZVPX 1WXEA 3OU6A 3PDIA 4EJSC 5ALVA 1U63A 1CRPA 4IFBA 2H4ZA 2JGDB 4HAZA 3MWEB 4CIDA 4XWOA 2UZ3A 4YMUA 5AK5A 2XCTB 1CVRA 5ICGA 1HTBA 1Z28A 2G5TA 3TLCA 4MWOA 5JBIA 3LY9A 1D3AA 4RNCA 1YQWA 3WLPA 1Q12A 4LYYA 5L3VA 1LZLA 1TCAA 4P36A 1UWCA 1T0BA 2D5CA 2Z5LA 4LYHA 2NPOA 4XUDA 3AZOA 4I50A 1KQNA 2A0XA 3QH4A 2F62A 4D9GA 1GGNA 4TXHA 1VJDA 3M4XA 3WGOA 3U0VA 1SEVA 3OIWA 2C9DA 2BSQA 3B1FA 3E35A 4PAGA 5DBGA 2O3SA 1WDMA 1ST3A 1XXHA 2AFHB 1ZLYA 2B5WA 3OURA 5IAEA 3BN3A 5KTTA 1NX9A 3NV9A 1X1EA 1OXTA 3AJ9A 3IPRA 5E3JA 1M34A 1OXUA 2C3UA 2WG0A 4N3NA 4YMLA 2ZJBA 3DOFA 4JBLA 1VPTA 4RCVA 3L6EA 5BRNA 2GLTA 3IALA 3VDRA 4BO6A 5LP6F 2WQ7A 1ITZA 1P4SA 3C3AA 4JV5B 1Y6QA 5DM0A 2ZBVA 4LDPA 2WWYA 4TXJA 5CFOA 1JBQA 3FUUA 1Q7RA 1DQPA 1UBHS 4NLLA 4OP3A 3WRXA 5HRCA 3HO1A 4FUTA 5CX1B 3ABRB 1JMKC 5FWXA 2VK1A 4QBGB 4FEAA 1N77A 1KI6A 1CRZA 1GCAA 1K6MA 1SMKA 2GARA 3N0WA 3NC1C 2NZ8A 4UAGA 2XOKD 4WLNA 2V03A 4BRSA 1GDDA 4DSUA 1DTSA 1QJCA 5GZ1A 1U3GA 1NW3A 2PKXA 5ALLA 2VTEA 5J5AA 2VT3A 3FUXA 3OPQA 3O4IA 4CV0A 1YRLA 4GPIB 3F5FA 3ABOB 4PZLA 4XM2A 4EPXA 1V11A 3LK7A 3NCTA 4D9EA 5D1HA 4GKVA 4CCYB 1KK2A 4H7PA 4QDUA 1D1SA 1ULUA 5C46F 3OESA 3ZDYB 4Y2UA 4I4IA 2SKEA 1L8OA 1KP3A 1JUDA 3HCBA 1FQKA 4PXSA 3WB1A 1BDJA 3MN1A 1DBQA 3GROA 4M0UA 3HKBA 1JVNA 1KO5A 4Z1MD 3CUKA 1CX9B 5DTJA 1AXGA 5F9HA 2RHJA 1YR2A 3NJRA 5KWVA 1OI2A 2BEKA 1CD5A 3AHGA 1OBCA 1DELA 4ND6A 1ZXBA 3QXCA 1C9EA 3VUFA 1Z47A 2QZZA 1P3Y1 1QFXA 3MWGA 4XDGA 1K3TA 3QMPA 5JS6A 2BISA 1F8YA 2H7XA 3FOZA 1PFKA 3VYWA 1PK7A 3U13A 5LPNA 1QHIA 1KO7A 5ALOA 3L8DA 1QHEA 2ZBGA 5AQ1A 1RYEA 3B9BA 3R9KA 2APJA 4QO8A 5HF6A 4PFSA 1J7JA 2D5BA 3SCZA 3DV9A 4M76B 1G7RA 5JXWA 1EJ6A 4M4SA 2J87A 2QMEA 5G4LA 2L17A 4Y2HA 5EYPB 1GR1A 2FHSA 1WS6A 3CB4A 5ENDA 2NTVA 4KUEA 3EZFA 3TM4A 5JT1A 1MNQA 5LZ7A 1PZMA 3TNLA 4LNAA 4L73A 3LXUX 4Y1EA 3LPAA 1ODKA 4FI3C 4ER3A 5C8VA 2MSLA 1I36A 2PLWA 1VMKA 3SQNA 1GDTA 3TI7A 3AVWA 5ARDA 4JT4A 3UHJA 3IOEA 4AW9A 5BQFA 1J23A 1GRQA 4WKGA 1Y63A 4OL0A 5TQ0A 5AI6A 1ZUIA 1M75A 1A5AB 4ZVVA 2EXXA 4G0QA 5F7JA 1NN3A 3AF4A 3U7JA 1JHPA 2AK2A 3HYRA 4ALJA 2VTKA 1UBSB 1CZNA 1U9IC 2OMKA 2X7HA 2XVAA 2NXCA 1KMNA 5ALUA 5BSMA 3UJCA 3FTNA 3KAPA 1UPCA 2G36A 3HU1A 4GMKA 4Q4HA 4NK4A 3EVCA 4OHCA 4AIRA 2WD9A 3SQOA 1QNLA 3TZKA 3RSHA 5AIAA 5C1BA 2VHZA 4LRSB 1M1YE 2FFRA 2ZB8A 1K6IA 3JPWA 1IWBB 1AA9A 4B0PA 1YFJA 3CRW1 2IW3A 2YVQA 2E2WA 3OIVA 4II2A 1G3MA 1O94C 1MO5A 1QGUB 4BFCA 1OFHA 1W5AA 3CRRA 5HIJA 1HLPA 1JKFA 2PL1A 1IHXA 2DH6A 2PQMA 8GPBA 2C7RA 1EUCB 5CYFA 2D1SA 5J59A 4TZ6A 1ZMTA 2BE9A 2JGJA 3WRYA 3EQ9A 3SPXA 4C7JA 2NSJA 4WLFA 3BIOA 4RPLA 1JE1A 1E96A 4YVFA 3W3AH 1TCUA 2GSWA 1DKUA 2CK3A 2VFAA 1YR3A 3TH5A 3ZBPA 1N1EA 5BWCA 1E89A 2X9GA 2LP4Y 5TARA 3PNLA 4WADA 4G6ZA 2GM5A 3PQCA 5K3AA 3I39X 3VPSA 3A10A 1L7MA 2HHCA 2OAP1 1JEQA 4MGZR 1IONA 4MLZA 4RETA 5CBPA 3CH7A 4LDZA 4EDFA 3ADCA 4JEMA 2B7BA 2W4QA 3ACBA 2RHRA 3DPIA 3EVAA 3GN1A 2NYAA 4RGQA 3IEIA 6Q21A 1R9GA 1Q1EA 3TTXA 5IJZA 5LWHA 2A59A 4FBMA 3WBJA 4EF6A 1WUJS 4AF8A 4O4IF 3C5EA 3D6NB 4RIFA 5SZJA 4BB0A 4KIUA 2BCEA 1BROA 3ZOZA 1A50B 1U3FA 2Q45A 2VQDA 4N1AA 4C4ZA 3TDKA 1XCBA 3TTSA 2BTEA 3PQ6A 1G4AE 1R88A 4PBRA 1KS2A 3VH3A 1JP7A 4OHKA 3A36A 1C1XB 1II0A 3D54D 4DR2B 5FPYA 3NH9A 4FLFA 4Q00A 5J4VA 5EIBC 5INTA 4M0KA 4HX5A 3TGWA 3BD9A 2AE2A 2IS4A 2OCLA 1AX9A 2VIIA 3OPYI 4H15A 4KR9A 1E5QA 2ZYGA 1UOQA 4OF4A 3EZNA 2IYXA 3KZMA 1XHLA 4IQ4A 1H2ZA 1LPPA 1N0VC 3OSZA 2V4MA 1A04A 1FFEA 3L49A 5EWLA 2XNHA 4GZMA 4C2TA 1Y7HA 2ZT7A 4P0TA 5KYUB 2FFBA 2V6FA 1U5BB 4YN3A 4HFMA 2FUCA 2ODPA 1EUCA 3TLGB 3IIKA 4TS3A 1UXKA 3UJHA 2KE5A 4DCUA 3OZUA 4TLEA 1JA1A 4JFAA 5K3FB 3LAWA 5AKGA 3KR1A 4DV0B 4BE4A 1XWFA 4RV4A 1GGJA 1YKSA 5IN4A 2IODA 3PNPA 2A5DA 3QVMA 1IEXA 4RJJA 2D1FA 1CNEA 5FWDA 2PPLA 4H1UA 1EHYA 2E55A 2NO0A 4J4BA 3CX6A 3CZCA 1GGEA 5AXAA 1ZNYA 2HPZA 3NM4A 1C14A 1CJKC 2BEVA 3A1NA 3O3MB 3P96A 3QFFA 3R0VA 4Q9IA 3BHMA 3CLUC 1GVNB 1S8FA 3GCWA 3UA3A 4QUGA 4DLVA 2GO7A 4X62B 4L8FA 4RQTA 4CLRB 1QQ6A 4M1OA 1E9SA 2ZSIA 3BZUA 1GLVA 1MC8A 3DW1X 4E46A 2CFSA 1FFXB 4PHCA 1HX7A 2JBAB 1V7PC 5HNKA 2R6R1 3DZBA 1M8GA 1QHGA 1EFKA 3AEQB 3HXTA 4XVRA 4M3NA 3KAJA 3OPVA 4H4DA 5K2MA 2PHZA 1TU0A 1E2KA 1QCZA 4KQ9A 1ZJ4A 3SE0A 4PG8A 1Q16A 5JXGA 1UBRS 4RTKA 4OI2A 1Q44A 4G65A 1CQJA 1C1XA 3CLVA 3EDMA 1ACMA 2YHIB 4ARZB 1V1MA 2YVLA 4RFVA 1FJGB 3M4YA 5E4TA 3OCYA 2G28A 5F12A 2DFKB 1J2YA 1WNFA 1K6JA 2FZEA 4KLAA 1POWA 4QUKA 4KQEA 2O8DB 4UHKA 2HDOA 5KQLA 3DOJA 2FK7A 4XRRA 1Y1LA 4CW7A 4MS4B 1XHEA 2FZLA 4JVNA 3R7FA 2GBIA 4K9SA 4WSOA 5SZIA 4YEDA 2Z8ZA 3NHPA 4X3OA 2PXXA 3RAFC 2PX6A 2CNDA 3I53A 4RSHA 5A62A 5HS4A 3NTRA 3VTAA 4W9NA 4MYTA 4QHSA 2WM8A 3BMCB 3HNPA 2BWJA 4BY9E 4RMHA 1WV0A 2X23A 3E0QA 2MJLA 4RE5A 2XE6A 2EW1A 2PUAA 4QFCA 2CJFA 3KYIB 3MS4A 4LHYA 4YCLA 5L7WA 1ES9A 1NWHA 2R7AA 2Z8YM 3C7DB 5BVHB 1VJCA 4D6PA 2QJWA 1ADBA 2H4WA 2BFEA 2GPSA 4HC4A 4ND3A 2WA1A 4L4SA 2Q4BA 5F21A 1U0SY 1NLUA 1OBFO 1KBZA 1SVOA 2HYDA 2DHDA 2QN3A 3LUAA 1UBLS 1Z08A 3CO5A 3F98A 3NBFA 4FD3A 3LCJA 3NWPA 4IUBS 5ANRB 3WRXC 3EEOA 3KKEA 2BHRA 1C1YA 4UPEA 1IN6A 1P1CA 5FAKA 2HCJB 1FFXA 3QX3A 4FI3F 2X0DA 3BF7A 3IQIX 4EKIA 2IHVA 1C9MA 2ABWA 2BGJA 3H13A 4RMIA 3TFWA 1UKEA 1N3BA 4XIIA 4YP0A 3K6KA 4QICA 5AM4A 3T7RA 1GZDA 3ZV7A 1AZTA 4OLFA 4AN0A 4DMMA 1OFIA 2OEPA 5JW6A 3WAJA 3K6RA 3AR2A 3DVAB 5DI9A 4EPVA 2FPGB 2ZWPA 3DLCA 3RSQA 2YHIA 3P9KA 4G4JA 4DIEA 2F1KA 3KX2A 1EXMA 1JH8A 1FQJA 3AILA 2AWNA 3DWFA 5A9TA 1HGXA 4M7WA 1SH7A 2GERA 4DLWA 2Q27A 1CRQA 4MWZA 4R8RA 3TUIC 4B4UA 4O2BB 1PL7A 1XAGA 4E4YA 1EE1A 2JGFA 4ZGGA 4BGDA 4UXHA 4FGKA 4OM7A 3V4LA 5A5FA 5J23A 4RVCA 1XHFA 4IDQA 4BNLA 1SB9A 4DR7B 3TL6A 3U19A 2GBGA 5A3QA 1ZBDA 2PQ0A 5ALEA 2J32A 3FW1A 3GJ7A 1QVVA 4MUIA 3Q7QA 5HP4A 4OXRA 5K0JA 1ZN9A 1L7OA 3IEXA 4F9FA 1LF0A 3HCOA 3JYOA 4LW8A 1VCMA 4ALKA 1AZSC 2IKQA 1KK0A 1D6MA 2ZRIA 2O6HA 1PO7A 3MLBA 3CF4G 5H68A 2PKEA 3QLEA 2R0QC 4O2AA 2FX3A 1K27A 4I0WB 3TNDA 5L95A 2NV0A 4HRYA 1YF3A 2FMXA 1A77A 4IXTA 4WOBA 3GWZA 3TDNA 2AXEA 2PH5A 3RVKA 4WA7A 3VH4A 3HA5A 1QKJA 2OUKA 1YZGA 4FYKA 1US8A 3IRUA 4N01A 4Q7LA 3BGWA 1N25A 5AJYA 3UMRA 3KXKA 3V97A 1L5OA 3N3AC 4AZ0B 4JS0A 5BUZA 3T54A 3CXRA 2F3QA 2VP6A 2HDNB 3TSWA 1EUZA 4H7DA 4IJUA 3IAM1 1G42A 2J6BA 4UHJA 3NBYC 4DHEA 1T35A 4OSPA 5ALGA 2LVBA 5CD9A 1XEWY 4RTRA 4OQZA 1OI7A 4TMVA 4E11A 1GAXA 2VH2A 3LUPA 1K4KA 2BOVA 3DVAA 5AHOA 3I1JA 2JVJA 4DLLA 1IULA 2AYXA 2YUTA 3ZTYA 4JJ7A 2B8EA 2QVYX 1SNYA 2ORIA 3N07A 3QKIA 4XD7A 4J3JA 4XWAA 4KDRA 1FXUA 1NULA 3GT3A 4ZMRA 4KPUA 5EMMA 2FJUA 3LX8A 1RMYA 1U80A 2EQ5A 3NEJA 4KQMA 4Q6WA 3T61A 2DB3A 4O4HA 5YASA 1USVA 3W1WA 5IAOA 5D2CA 4O2BA 2N75A 4FW9A 4XSGA 2HSDA 5H7XA 2MOKA 5DJ5A 3GC6A 5EXTA 5L3ZA 4GMFA 3TIGA 2BR3A 3L04A 4IIJB 4YJFA 3K96A 4CXMA 4G0OA 1E9BA 4K9OA 3QITA 3L6CA 1BE1A 4PAOA 4K88A 4WKNA 3B3QA 2EWVA 3MQ2A 2YYAA 1PUJA 3V4PB 1DEAA 4Z9AA 1P0FA 3OEEA 3KQQA 1AQNA 5AKHA 4E51A 1H9CA 2N1BA 4Q1AA 1RLJA 2Y68A 1W73A 3D7SA 3EE6A 4S0ZA 3N2IA 4O02B 3WRYC 4EHHA 4GL2A 5ENZA 3KB8A 3CNHA 2ZE8A 3NALA 3AQ4A 3D7KA 3ITDA 4MW2A 1A5ZA 3RKUA 5JNUA 1TYAE 5EESA 1DDGA 1CUVA 1VSTA 3CH6A 1ECCA 4U7TB 4EP1A 1AGYA 1JVSA 3DBOB 3IVXA 3U48A 2O8VA 1T4GA 3NXSA 3AI3A 4B2IA 2E3JA 4ENPA 2R6FA 4KQKA 3Q3VA 2YC4C 2WHXA 3C5HA 1KI3A 2EBHX 4PHFA 4QDTA 2GTHA 3RIXA 1TLLA 4AECA 4JI7B 4R2KA 1BKYA 4DDUA 3UPDA 2BJVA 4Q7MB 4TT3A 1VCIA 2HA5A 4JBGA 4D9JA 2V4ZA 3DAGA 3WI7A 1J21A 3LA8A 1Z5OA 5CB6A 2C5SA 2CV2A 1JG2A 3MBIA 4PWZA 2FPXA 3FNEA 1Q3KA 2CJWB 1OLXB 2V6JA 2YCLA 4LZAA 3KNZA 4LGCA 3UVEA 4YPOA 4DSOA 4BKRA 3PFNA 2JLYA 1D2GA 2AIRA 4NCNA 1LRJA 3RM3A 2H63A 5C4MA 5F7ZA 1UIMA 1PS8A 2Q1XA 1LI4A 1W49A 3L5OA 1OFTA 4L4RA 1QCCA 2XKBA 4OOFA 2EKDA 4IWNA 1ORHA 1SHKA 2BEWB 3VNAA 4EDHA 1YMQA 1E3WA 1GQRA 2EP7A 2QL7A 1U7PA 2VF7A 4KRXA 1MH9A 3VZQA 3WYFA 4ZD6A 1W19A 3ZE0B 1N33B 2QEQA 4A0HA 1CYEA 1G2OA 4IIJA 4PX5A 4S35A 4PX3A 4R0NA 3FTQA 3KJHA 2ZSUA 4I50F 3SVZA 4LXGA 4UU7A 3SX4A 4HWPA 2VT2A 2ZETA 5KYTA 3VC1A 2NUPB 1UODA 4M0PA 5J9FA 3ZJVA 1QIMA 3FPKA 1M2KA 4OKIA 2RB5A 2WSSD 1A9TA 4Z8XA 4MMZB 4YRJA 3HL0A 3HLKA 3K1TA 1QPBA 2A92A 4B2YA 2XNSA 3PQ7A 3D5TA 4ZYVA 3RHFA 3K5PA 5BVHA 4BBJA 3LS2A 4UVGA 2WHRA 5AW6A 2AEFA 1J25A 2DEUA 4ALIA 4PSAA 4R2IA 4IQFA 4MRPA 1RLUA 2IXGA 4Z2YA 3MGAA 3N2NA 2WAMA 3M6UA 4LBWA 3Q87B 1AO0A 4C0KA 3FBTA 5GY7A 3V8MA 3FFTA 2AC7A 1MB4A 4FMPA 1NRIA 4F3NA 1XTKA 1VGQA 5SYAA 1AZLA 3PJDA 4CIAA 5FR1A 4OHZA 2H57A 2ZJ5A 2AFIA 3HCFA 3KKQA 3BGSA 1DLIA 1Z15A 3FKQA 2C4KA 1P7CA 4U02A 5CDFA 2XXBA 4MVJD 1H3NA 5FRDA 1QC5A 4FWTA 4KUGA 3V2HA 1QONA 4O4JA 1KJIA 4URYR 3EXFA 1TYCA 3DDNA 3R3XA 4HWGA 4YRTA 4ETWA 5K8TA 3OJ0A 4GUDA 4MYSA 2CJWA 2VNJA 3JQ8A 3QQ5A 4BECA 4PRZA 4A9AA 3RVPA 5BUSA 2VSOA 4GSLA 3L92A 3HYTA 4CLRA 2GN2A 3ED1A 4CG2A 1SQSA 3HABA 4GX5A 4R0VA 4WW0A 3BFXA 3BS4A 1L4FA 4ZC8A 2BEWA 3VU3A 2O2EA 2BKLA 4OJNA 4GPD1 2OT3B 2XQGA 4DJTA 1Y34E 3H6HA 4AY3A 1S8AA 4PC7A 2ZWIA 4D0SA 2IYAA 2ZGVA 1SKYE 3ETCA 2BGTA 3EUWA 3AI2A 3F78A 5AKXA 1OT3A 2IUUA 2PFGA 1FMCA 3CEHA 3E9DA 4QQNA 3JZMA 4LDNA 3G13A 5FEUA 3TLAA 2NUPA 1NLYA 5EN4A 1U6KA 3VTKA 1J2UA 1HBJA 2IZZA 2JASA 2NVBA 3CCFA 3KYDA 1VMEA 3PLNA 4W9NC 3RYIB 4ZYWA 5T7BA 2G82A 2V54A 3IUSA 1EEHA 3RF7A 3SD7A 2P4UA 3O0DA 2CCJA 5D5PA 3AHIA 5G1NA 4DTCA 1H2YA 1V95A 4KJXA 5JAOA 3BQMB 3S40A 2CEKA 5JWHA 3JW8A 2VEDA 1TVKB 1XN4A 2FFJA 4MKXA 2BEUB 3SYRA 4W5RA 1E9RA 1EWYA 3FTEA 1JPUA 4IVPA 1WCWA 3AVQA 3QYFA 1AXEA 2A9OA 2MSDB 1IIBA 9GPBA 3IJEB 3NORA 3IO5A 2J0UB 4OOEA 2N0SA 4NP6A 4WTOA 2DBQA 2M6LA 5C3MA 1SBCA 5FQOA 3DKRA 1U65A 3EZGA 2ZJ0A 2Q5QA 3DQQA 4X97A 5BV8A 3ET4A 1OKKD 4DQXA 5EL0A 2PM8A 4TYMA 4HNAB 4X24A 3S1LA 3WL7A 1MPXA 4B6JA 3GUVA 4OBXA 5AK0A 5DFAA 5IUKC 3VJLA 2JEZA 1BXGA 1PDWA 1JIIA 3DEJA 3A9UA 5JWRA 2QVBA 3ZCVA 5ESDA 4KNYA 1LLCA 4MH0R 1EA5A 4GRAA 3WJAA 4JI5B 3CX3A 1PR6A 3H4IA 4YI5A 2W6QA 4DSAA 3KOMA 4C4OA 1ML4A 4OHUA 1B6TA 3E61A 1GPUA 3DXYA 1V7ZA 2MSCB 4TVOA 1P60A 2XWSA 4W4TA 3SMQA 3JAMA 5JQGB 1KI2A 3OLVA 4UNRA 1KS9A 2REQB 3KXIA 1O57A 1ZWLA 4BRWA 1B4DA 5JSYA 3P9PA 3IDOA 3UXEA 4B6GA 3PWSA 4AK9A 4ZKDA 4RGVA 2JNWA 4G0XA 2VRCA 4IIUA 4X8LA 5AKIA 4CNBA 2X5KO 5IW8A 4WWHA 1U3VA 2NADA 5CHEA 1SBNE 4HAYA 1JEYB 1CHNA 1LX6A 4E32A 4K6GA 3JQAA 4AG6A 1YBVA 4MVWA 2ASEA 1E2EA 2XHZA 3T95A 3CE6A 3D3EA 1NVKA 1XNRB 4R9UC 4B3DA 2YNMD 3HFGA 2F3PA 3ME5A 2Q0QA 3TXYA 4DQVA 3R44A 2OFWA 1VA5A 3QMMA 1DAFA 1M72A 1UKCA 3C7KA 5AJTA 1WKVA 3ZWBA 1CIVA 3EMKA 6ADHA 5U4QA 3WLMA 1XBTA 4HAIA 2Q4OA 4EL5A 3O7WA 5EJAA 5BV7A 3WL4A 2VP4A 1NVWQ 1UJ2A 2QA5A 3I9JA 4N5NA 2YHUA 2IPXA 4UCWA 3NKVA 5E6SB 1CZKA 1T8TA 1KEPA 2ACKA 2BFDB 3AR6A 4CEIA 1E2LA 5IC4A 1GPKA 1U6IA 2CB9A 1CJUC 2RHBA 4LWOA 4M21A 4Y2RA 4ZYLA 3IQXA 2JLUA 2O7SA 3RTAA 1ZN8A 3B7WA 4B3RB 3GA0A 4YAKA 3IMEA 3G0CA 1UPAA 2MSNA 3FDJA 1JWAB 3HJHA 2ZW9A 3QX7A 5TGDA 2XEDA 1Z33A 2DFPA 3FPAA 3U4HA 1TEZA 3D4PA 3B7PA 5LQUA 3KG2A 3OTQA 4URWR 3GFFA 3O7MA 1QRRA 1E9AA 4KR7A 1GG2A 3V4RA 4YJHA 3SIXA 4EB6A 2G83A 2H1LA 1LS6A 1OPRA 5FPTA 4OYRA 5CNIA 4GWGA 5KOHA 1U7UA 4M9RA 1LTQA 3EMDA 1ADFA 3ZPXA 1M54A 1NRJB 1IQRA 2PVPA 3VNRA 2V0CA 4D45A 2O7QA 1U8EA 1DMSA 3TTWA 4UZEA 4YQEA 4I3HA 2E5LB 1X19A 4LYEA 1U81A 5JQGA 1MQSA 2GKGA 1KC3A 3GOQA 4EATA 2H54A 1RM0A 1RJ9A 4TKVB 2OLJA 1PEYA 2BMWA 4M8IA 3ODGA 1MZVA 1J97A 3QNUA 2HMSA 4YK7A 4AUEA 3ENWA 1JHXA 2QXUA 4HB3A 1QV6A 5E8RA 4EKGA 3C5CA 5A4IS 3D8SA 4I4CA 4QYSA 1NIPA 2FCRA 2FPSA 3WA6A 1Q0ZA 2GRUA 4R51A 5DNDA 1OXXK 3KVVA 4IOJA 1EM6A 3H3XA 4RQAA 3ZHSA 4D9IA 4LSWA 1TLTA 3H2GA 4HS4A 4MPTA 4RWZA 2IDJA 1P1BA 1A76A 1DG1G 4HEHA 3ONVA 4MW6A 2ZUTA 3F5MA 5I9BA 3SYKA 1FXWA 2JFBA 4PZ9A 1V1RA 5SYNA 4EKDA 1A27A 4TMFA 3LSYA 4BNZA 1Z73A 2J4FA 4K2AA 3U1TA 4MNTA 4B8WA 1JJFA 2OORA 2X8AA 4JLDA 1RD4A 5H3HA 5B1YA 3ETNA 3IMFA 2CXOA 2QAGB 2R751 4BQNA 1T1SA 1P2TA 4JJ8A 5AICA 1RXYA 5I3ZA 3S29A 3I04M 1KFBB 4E2FA 3NPAA 2Q5EA 3IBGA 1EGHA 2O8FB 4CTKA 4WKPA 4V2IA 1RT9A 5LLTA 1W88A 3R5FA 4DZZA 4PYMA 4PV7A 3DTNA 1SIBE 1E5TA 4MIKA 1T0UA 2REOA 5GV8A 2HRDA 1EEXB 1AB5A 1J2EA 3R5SA 3FMPB 1GCGA 4RE6A 1TTTA 2C83A 1C9YA 4MRVA 2IYVA 2D2EA 1N1MA 3ICPA 4PGFA 3JATA 1ZK4A 4OH7A 1CQIB 4I4LA 3VC3A 5KBYA 2VHTA 4KN8A 3W8FA 4PC2A 5HCNA 1KORA 5AO9A 1UZLA 1VIAA 2AK3A 2E5WA 4M2LA 5HTOA 3C7AA 1NKSA 2KW5A 3ITEA 5H4HA 5K1ZA 3TRJA 2VF8A 4JUAA 5KSZA 1LRLA 3PIIA 4RA9B 1IWOA 1G7TA 5AKZA 1E3MA 2CW5A 1E1YA 3RHTA 4RO0A 3ZCTA 4MQLA 4PG5A 2ZYUX 1ULBA 2HWKA 3C41J 4KQWA 3DZCA 3WK5A 3C3KA 3TB4A 4F6RA 4Z4CA 5FPQA 3NBZC 1H66A 3K92A 3FZNA 2QTBA 5DHAA 4KPFC 3TRFA 1DFHA 3IIMA 5LA6B 5HS6A 2DE0X 1C0PA 2HL6A 3FNIA 4BVAA 3LF2A 1KVQA 4RVHA 3W5CA 1I1NA 3KTFA 3IE1A 1KY3A 1RFGE 3A06A 3AUUA 3ZHTA 5BMVB 4ZO4A 4I2NA 1KVRA 4DXDA 4EEZA 4GEKA 1FIUA 1OHHA 1YCGA 1SCBA 2DC1A 5REQA 3TJRA 3PT5A 3KSMA 1NP3A 1W5BA 1SCJA 4FZ5A 4UOQA 1JB9A 5DSZA 2W6JA 4X9XA 4B4KA 2I6GA 2PWPA 2P9FA 5BY2A 2I78A 3JD1A 3SJAA 4Z9XA 1EG2A 4GLFA 1HDGO 1UJNA 3RVRA 1E6UA 4O63O 2XCIA 1U28A 5EZYB 2AOUB 4DCNA 5KTPA 1QRTA 1EAMA 3MK31 4OHVA 1HLFA 3A05A 1SVMA 3QJYA 3P71T 4KGXA 4XSHA 1R8YA 1IPEA 2HQBA 3D4BA 1TM1E 4MI9A 1VP3A 4KWTA 1E1RA 1XZPA 3PYXA 4XZ3A 5KQRA 3Q72A 1OZFA 2ISCA 3JAKA 3LA6A 4I1OA 2BR5A 3ESAA 2W4IA 1FTNA 4IVNA 1U2SA 3CGWA 4C03A 4N76A 4BPBA 5ECGC 1C0IA 1R6VA 1T9HA 1P29A 2J9FB 3F1LA 5C8YB 3D3WA 1XWIA 1F9EA 2A0YA 1ZQ9A 2XQFA 1CIPA 3OE7A 1VLHA 3G7NA 3V9PA 3RKRA 1N36B 3AFMA 3DWEX 5C5CA 1RYNA 1PW7A 3PHLA 5IVIA 5JS7A 1QLHA 1E2DA 3GU3A 4X3PA 1IQ0A 4B3CA 3G82C 5AMXA 4AUNA 1UKBA 4UEJA 1QWOA 2HK9A 3EXEA 3KR2A 2HJHA 5KCMA 1V71A 2NP6A 3A26A 1QHYA 2OENG 1RPNA 2YZ7A 5ELMA 4OK6A 4XWYA 5JAIA 1XXHE 2OP1A 4GE3A 3HO6A 3N6XA 5FUBA 1CSEE 1C5KA 4GEGA 4OQLA 4KWEA 4EZIA 4NQZA 3IUQA 3TLBA 1FSZA 5A03A 4KNVA 1CS4C 4Z49A 1LS1A 1E9VA 1FU4A 4HDOB 5JOQA 4DV5B 1WUKS 4H17A 1M34E 3P20A 2FQ1A 2PBRA 4KAFA 1I1HA 3IV7A 3M83A 4NHEA 3ISVA 5DIZA 3ROGA 3T99A 1NMZA 4ME6A 1E1KA 1L1EA 3IBCA 1NN1A 3KTAB 5GONB 3IR5A 3T5CA 2C54A 2OXTA 1YQQA 4O2AF 1CUCA 5DN6A 1CRLA 3GCDA 2RJNA 5KOYA 3R7SA 2XD4A 3L18A 5CD1A 5EZYA 2AOUA 2FZ4A 2HA2A 3CN9A 3SZRA 4MJ7A 1TIKA 2MIIA 3WB0A 1HLDA 4G9GA 3GQBB 4Q03A 3U3RA 1SN7A 3ZHOA 4A92A 1TAHA 1UWKA 1G9XA 3ASYA 3WRVA 1J2RA 4DLKA 2FRXA 1YVRA 4RXUA 3E3AA 4UBIA 5F23A 1W581 1BZYA 3K0SA 3DT8A 4UVIA 3I9NA 3DTVB 4HVCA 1NSTA 2GN4A 1GZVA 2ZPTX 3JQ6A 3WISA 3X44A 4EKEA 4ZJZA 3FCOA 4QEDA 1NMEA 1WMBA 4I8DA 1KNQA 1PL6A 2ZEJA 1NXSA 2NU6B 4LS3A 3TVTA 3FLEA 3VHXB 1U1DA 4ARVA 4RA6A 2WUWE 1NJ6A 5E9WA 3UFXB 4XDHA 1ISMA 1YU6A 1O4WA 3SZ3A 4QO7A 4HY3A 1XX6A 3GIWA 3UMJA 3WHIA 3QWAA 1ELOA 1AQJA 3QYPA 4Y1FA 3LT0A 1PT6A 5FHRA 3GRCA 4O2BF 1AV6A 4N7BA 3BMOB 5EHXA 2X0NA 2DKNA 4NCIA 1U3TA 1LK0A 3LZ6A 3NTXA 4GBGA 1MX1A 4IIXA 4B4WA 3KSUA 2ZR7A 3B70A 5IAKA 3T7CA 2AOWA 5B55A 1W35A 1ZMRA 5GJCA 5L3QA 4BVKA 1FFCA 5HGXA 2NU7B 4A5OA 1P2BA 3AIIA 3SAJA 1KKMA 3T41A 3PQ8A 5BSWA 3ZWCA 4Y6RA 5KNCD 1T8UA 1IXSB 1S8NA 3JSXA 3P2OA 4JVLA 4CT5A 5ITWA 3IE0A 2DY1A 3RSLA 1HXHA 1P81A 2AX3A 2ICAA 2HADA 3KTAA 3NWOA 3V1KA 3H87A 2GBPA 3VQTA 4OY3A 3TJMA 3TCXB 2V4UA 2YWRA 3KKLA 4JOSA 5KPJA 2CDAA 3DEYX 1Q74A 1GEEA 3HMQA 3HUEA 1XVAA 4MWEA 3X43A 4OU5A 5H59A 3Q3EA 4M22A 2ZRGA 1SXJB 2VG8A 2PZBA