3S5UA

Crystal structure of crispr associated protein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
212
Chain Sequence
RVNFSLLEEPIEIEKATFLTIKDVQSFAHLVKLIYQYDNELKLQKGLKPTELFVVTDILGYDVNSAATLKLIYGDLEAQLNDKPEVKSMIEKLTGTISQLIGYELLEHEMDLEEDGIIVQELFKALGIKIETTSDTIFEKVMEITQVHRYLSKKKLLIFINACTYLTEDEVQQVVEYISLNNVDVLFLEQRVVQNRFQYILDENFYLSYEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of clustered regularly interspaced short palindromic repeats (CRISPR)-associated Csn2 protein revealed Ca2+-dependent double-stranded DNA binding activity.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
total genus 61
structure length 212
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09711 Cas_Csn2 CRISPR-associated protein (Cas_Csn2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s5uA01
3TOCA 3V7FA 3S5UA 3QHQA
chains in the Genus database with same CATH superfamily
1OX5A 1X9GA 4DCGA 1H85A 1PNQA 4RGYA 1XTSA 3OQ1A 1OROA 4D02A 4YALA 5CEFA 3G1UA 3ORQA 4YGYA 4RJKA 1PS8A 3G2NA 2W11A 5I51A 3SVLA 2PX3A 1RBMA 2C7RA 2FWAA 2YWBA 3BDVA 3C70A 4ZCRA 4YIKA 1YR2A 3IQIX 4UAVA 4YX9A 2WAYA 1C1XB 2RDMA 3EDCA 3NIDB 2V7TA 1T1RA 4LXGA 4M2LA 5HWSA 1N3IA 6NULA 3COZA 2APJA 2J9XB 4ZCQA 1O96A 1SZJG 4EA7A 1QRSA 1SVUA 1QUEA 4E4YA 2NU9B 5HZKA 3OQBA 3DFIA 3R3VA 4F6CA 1XA0A 2PXAA 4UNSA 3GCDA 2X77A 4EFDA 5DK6A 4NDNE 3PA6A 1D8AA 2ZYAA 2FZKA 1JP7A 3VC2A 2OO5A 2R47A 4CCYA 3H9BA 5K3AA 2AV6A 3F7OA 2CXOA 2VJMB 4WNYA 4EO7A 2BBSA 4AF6A 1F20A 1OU4A 3KDPA 4MJLA 1J9ZA 1HKUA 3IUBA 1IQRA 1PGOA 2C8LA 2ODWA 1IHOA 1FMCA 1LKZA 3HQ4O 4HYTA 3N9IA 2PEYA 5AI8A 5CJ2A 3REFA 4GPD1 3PGKA 4ZZ0A 5U4XA 3DL7A 1YQQA 2C1EA 5JSUA 4OYHA 2BC9A 1OXSC 1FYEA 2EP5A 3KBBA 4CKBB 3CPEA 3LH5A 1F3OA 4ILEA 4IIDA 3S3TA 5DNUA 4BXOA 2LZ0A 5B53A 3F78A 3BTOA 3L0ZA 5D6NA 1XYYA 3AG5A 3Q3EA 1VLHA 2WKWA 4AS2A 4B2LA 2PUEA 3LQKA 3NI2A 2Q4OA 1R0WA 4EHLA 5K8CA 2IU0A 2AR7A 2IH2A 3N76A 3QU7A 5BPFA 1S5PA 1DDGA 3EDMA 4Q1BA 4RJIA 3EZNA 2AWOA 1DPGA 2KQUA 2REOA 3B6JA 3ITDA 5IAJA 3BH6A 5G4LA 2PL1A 4A0QA 1D07A 2W00A 2IHZA 2J3MA 2WG0A 2QZJA 1H94A 3H9GA 1AOXA 3H1PA 3EW7A 1H6DA 1QIGA 2GD1O 4R8SA 3G0OA 4G0WA 1UP4A 2HDNB 2NVUB 5CDHA 2YUIA 4OI4A 1U5BB 1Q0HA 5I7SA 1DJLA 1IBKB 4KNVA 3I4CA 5KKCA 3STYA 2GETA 3M6VA 4B3IA 4OQYA 2EWVA 3KQWA 4ROSA 3AM1A 5ABPA 5DW0A 1ELOA 2QXTA 3BJIC 3JWPA 4BCBA 1WJGA 4GI3A 5ALUA 4G1MB 3JZIA 4AO7A 3BH7A 2P6PA 2RKWA 3IPLA 3REOA 4B3GA 2R8EA 3ZVMA 1NBME 2WJIA 1P1HA 4B7CA 1Q44A 5BYAA 1M1XB 4ISBA 5FBQB 3LG2A 5ECYA 2VF8A 4CFZA 3I0MA 2CKMA 5LU9A 5EJ6A 5G3ZA 1OJLA 4JT4A 3I52A 3DBRA 4GM4A 4MRRA 3SKXA 3IQFA 4I1IA 5CU7A 3SSNA 4UVGA 1YJ8A 3PV0A 1P0MA 4E33A 3ZVNA 4GKKB 1OW3B 1TZCA 4BNKA 1WXIA 4YO7A 3I01M 4QEKA 1UOOA 4TLLB 1KE1A 2OBXA 2MINA 2IA5A 5KC8A 3FDIA 1F6WA 1T8SA 5F23A 2A86A 1JR2A 2PSFA 3UT5B 5J4KA 3HKCB 5KTTA 1UMCB 4HWTA 2OXIA 1J09A 1J9EA 4CRWB 1PQYA 4NPHA 3QVTA 4IMRA 5FHQA 3R8XA 4IIJB 1W59A 3R1IA 4QJIA 1KKUA 3A3PA 1V6SA 1E89A 1H0RA 1VKJA 2OWEA 4NZYA 5C37A 2NNWB 3SYTA 5JSFA 1WB6A 1OWNA 3NUZA 2G1KA 4F60A 1VLVA 4WLEA 1X80A 2C2MA 2IXDA 4OHCA 2FPMA 4QYIA 4YO8A 4QBGB 4TGLA 1JHMA 2P2ZA 4ZDJA 1QM5A 2HNBA 4QNMA 3Q6NA 5C1PA 2FUCA 1UP7A 1Z83A 2C95A 2ERYA 5EUCA 4B4VA 3DB2A 3AZOA 4Q66C 3RSLA 1ODIA 3U1BA 2H92A 1NYQA 2WB4A 3RSOA 1WZEA 2JA2A 4QG7A 5I4BA 1I3LA 2Y1DA 4XWOA 4KV9A 3CINA 4JIMA 3OJ0A 1FMFA 1DB3A 1HDYA 4J4HA 1DCFA 3VSBA 3B5EA 1W0JD 5JD5A 5CW1A 1AK2A 2DPYA 2DUUA 2PFKA 2RGNC 3DNPA 2IVZA 4N8EA 4OJQA 5CVDA 3JARA 3VR4D 4TVSA 3MMZA 3CVWA 2HC9A 4LOLA 1FLVA 2J09A 2X5NA 1QQTA 2ZAOA 2ILVA 3FVTA 4P81A 4CIVA 2X9GA 1E96A 4MRNA 3GGOA 4OGLA 2W2OA 1OUMA 3KOOA 4RWEA 1RRGA 4XQ9A 1F4PA 1XWIA 2FQ1A 3FBGA 1CSEE 3DMGA 5AW6A 5LZ9A 2GARA 4HPWA 4IMPA 3H5OA 1QH8B 4LECA 4TKMA 2VHTA 1U8UA 2GMWA 5B4VA 1KEKA 3H5LA 4NMHA 5KTYA 4MYUA 2VHJA 1HDRA 1QZTA 1K8XB 3WK6A 4I5DA 2A30A 3L7MA 1OXUA 1EA5A 2BFDB 4UARA 5HTKA 3R7WB 3RS0A 1IBMB 5LWQA 1VI6A 1VIMA 3HM2A 8ABPA 1OH5A 4YS6A 3CISA 3WWPA 2XXAA 2IBTA 4IXWA 5KEIA 3RFVA 2QTFA 3DZ8A 3U9SA 4C4PA 3HFJA 1ONPA 2C3PA 3FOFC 3CX7A 3JQ9C 3OU2A 3PX3A 4KN6A 1YZLA 3CO5A 3O38A 1FFBA 3OOYA 1E2IA 4D80A 1R4NA 1V1MB 2R44A 4W5HA 4QGGA 5FOXA 1CR4A 5J58A 1SJ9A 2OVBA 1PJ2A 2OEPA 4P36A 4U5QA 4RGBA 5JS8A 4U6QA 4ZJPA 3WL6A 1QIFA 3UJ3X 3VYTB 4GP6A 3FPLA 1IOZA 1GPH1 1M7HA 1PTKA 2Y2VA 3GV0A 4P93A 2Z2XA 4GLBA 4RTNA 4RGVA 1ZLXA 3VAZA 4Q9DA 2VBCA 3UYLA 1VECA 2PO5A 3GA7A 5CBKA 1PX0A 3SS8A 1U4SA 5J4VA 2BBWA 2HCTA 2ACKA 3RASA 1SR8A 4HFJA 2XAAA 4BO2A 4AL4A 4CM3A 4HRXA 1KVQA 1V0JA 3TOXA 3HFRA 2F3PA 2WU3A 5JFOA 4LNHA 2R00A 2YZ7A 3LUBA 2Q1TA 1BN6A 1UXGA 3CU5A 3F7MA 3K30A 2I7TA 2JZOA 4J0FA 4DIMA 2ZJ5A 4P0PB 4DYHA 1KETA 1U8ZA 4GOOD 4BMYA 3T3NA 3MFYA 5HKBA 3S6JA 5IJ0B 2HYIC 2Q5EA 1NMZA 2B5VA 4HDNA 5KOJB 1SY7A 2ZUUA 2I4LA 2WSBA 1Z63A 4XM0A 2QOEA 5HKAA 4NL4H 2F1KA 2UYCA 1GZ6A 1ZCFA 5JARA 1WR8A 1SOMA 2HN9A 4Q7LA 3SBXA 3JYLA 3VH2A 4WBNB 3QJ5A 3O73A 4XXHA 1EJ6A 1MX5A 1CEXA 1RTKA 2BGNA 1I3CA 5JLAA 2WA1A 1WF3A 4RD3A 4JYZA 2IH4A 4H4CA 3ZLJA 1JQDA 2YJ6A 5IDQA 2GPTA 1ZISA 1LI5A 2JRLA 1TX4B 3JXEA 5IT9A 4MS4A 2Z3WA 4FI3C 5I6DA 2VDNB 1ZR4A 3D0OA 1U3GA 1L7OA 3OOHA 4RJTA 2GN6A 1QGUB 4N5HX 4V38A 2E82A 4TKUB 4WINA 1VCIA 3ZWYA 1GT91 1WMSA 1A77A 3FPHA 4V03A 2QTBA 2HU8A 4TSFD 5LJIA 3BUSA 3C43A 1IE3A 5FNVB 4CMIB 2ID9A 3RUHA 2PV0A 1JQKA 4CTJA 3LF2A 2B4YA 4HSEA 4LCBA 4P5PA 1ADJA 3A7EA 4ZKEA 4E3ZA 1DXHA 2W6ID 3QBDA 3OLYA 5F7OA 4BWFB 1EVEA 1V4NA 1YBVA 1MC1A 3K35A 3RUCA 4B7AA 4ETWA 4PX5A 4BLRA 1MDFA 4UBKA 5EHGA 3BFPA 5HK9A 3AF3A 3FMVA 4LDAA 4Q82A 1RYDA 4OF4A 5ALZA 1YB7A 3ROQA 4EEXA 3NBAA 4MW1A 3VZBA 2GBCA 2JKVA 1GUYA 2LDXA 3AR3A 2JASA 2OCAA 5FUBA 5EE0A 5DI9A 2AR0A 2KM1A 4RIFA 1HEUA 1K3UB 3NAGA 1Y8QB 5ALRA 3IERA 1JB1A 1NWCA 3UATA 5A4JA 1I4WA 2PJZA 4LV5B 4IVPA 3F73A 4KQWA 4C7XA 1JTEA 4Y0NA 5E4YA 3ZPXA 4Z53A 1GNQA 5ERGB 2OKGA 2WJ4A 2NU8B 1PF7E 3AI7A 1PCXA 3EY4A 4IDEA 2EQAA 3C3DA 3T7AA 5D7BA 5AXCA 4NG5A 2VCEA 2WYUA 3MPUA 4QGBA 1BRMA 1N7HA 4OHUA 4HNQA 2UYOA 4CKEA 1F8XA 3IAEA 1DCKA 3RWBA 2JFBA 4CIXA 3COWA 5A9SB 4HUQB 4YAKA 4YUAA 2D74A 2L0XA 2A9FA 2JEYA 2XIJA 4H1VA 1VYUA 1WE2A 3RCBA 1XPRA 3KWLA 3LOQA 2Z4TA 2D5IA 2XIQA 2JL1A 3UENA 2CVOA 1SVWA 3I5AA 4M9CA 5SICE 4FOTA 3GUHA 2OB1A 3VPBA 3NHYA 4YMGA 3EGXB 3RE1A 3ZI7A 4RK0A 2HYDA 4KSBA 2QXYA 2HXSA 5B1SA 4BXOB 4LW8A 5AM0A 2IYNA 5CFLA 4Y6SA 3LUKA 4FGLA 3BMNB 4YJGB 3X44A 3R5HA 5KTNA 1C7QA 3OZAA 2C98A 2PEZA 1L7QA 2CY0A 2Y6UA 1N25A 3BOSA 4CF5A 1RXUA 1YIAA 4X3CA 4LF4B 1KAMA 4O2AB 5HCNA 5JCZA 1NW4A 1QBGA 4DIUA 2FEMA 3QKIA 1N57A 2AQIA 2X15A 3A9TA 2PGXA 3ZY6A 4BB9A 2Q27A 2D62A 1N2OA 4UZEA 1RWKA 2PZJA 2RH4A 1TKAA 4YQFA 3I9MA 2BGRA 1Z82A 1PWYE 4QASA 5FXMA 2AHOA 1JF8A 2WG1A 3C8HA 1MAVA 1U5BA 3F4LA 4I81A 4N4AA 4C30A 2HUNA 4CMKA 5BQFA 2D5CA 4UD2A 5BWOA 4W5QA 1VSVA 5FWYA 1Z73A 3OCJA 2WWRA 4KFSA 4WNCA 4ZVLA 4D0SA 4PYIA 2VYQA 2ZU6A 3Q8XB 3SXPA 1NUQA 1NNLA 3PF9A 3ENWA 2Z1MA 4YRRA 4XE5A 4ZIRB 4PBTA 5REQB 3RB8A 3RWMB 4QATA 2I1QA 3CLSD 1ZJ6A 1JS1X 5JY6A 1GVHA 3I2YX 4TS9A 3LCMA 4Y3UA 2QLJA 3ZY4A 2A1IA 4I3FA 5GP1A 2OOSA 4HLNA 4I9UA 5BSRA 4NBTA 3T52A 2GLTA 2IYPA 1B0AA 3F9IA 3RODA 4JFRA 3SYLA 5LUAA 3IPYA 2PFSA 3L6UA 1UWLA 4CM8A 3MA0A 4HDKB 1EDEA 3C2QA 1OTYA 5IDWA 1XHFA 5KYNA 1BRTA 4QC2A 3ZDYB 1QVAA 2B8WA 4GPEA 4JI2B 1UF9A 4I6EA 3VJLA 5B58C 1ZVMA 2HA5A 4D3XA 3KKPA 1V35A 3COJA 2X2FA 1G2IA 3N07A 1E3LA 2H9YA 1B76A 5FTKA 2HXYA 3UPUA 1ZNXA 4M9XA 1YHYA 2LXNA 3HDTA 5CLLA 4FKBA 3ZE2B 3II6X 1ZY2A 1QRUA 1RBYA 4YMSA 5JAOA 5I4IA 3QOFA 1YS7A 1PFYA 4YPFA 4NEHB 3RRYA 1X92A 2TMKA 1WMDA 3E81A 2PT7A 4LMBA 5BWNA 4IUYA 3OIUA 1HE3A 2VZ8A 5DULA 1F14A 5LQDA 2GJKA 5FOWA 1FSZA 3IHTA 4OOFA 2PUAA 2VP2A 4PO3X 4WJLA 2JFGA 2HMYB 1NFFA 1GDTA 4IMIB 1AZTA 2G6TA 4WLUA 4Y6LA 5ADHA 2FFAA 4RYDA 3F5MA 5A0TA 3I2GA 5HIMA 2YVUA 2HTEA 2V54A 2AN4A 3ER6A 3WXMA 3NDBB 3PRJA 5DSXA 1TVCA 2YZ2A 5E7JA 1ORTA 3UGTA 2VQ6A 4F7DA 2B92A 3BQNB 1EBUA 2A1UB 2HA6A 2I6XA 1P75A 1N8KA 1U0HC 1ORIA 4L75A 4HX2A 3FGOA 4OYYA 3MIZA 1IN5A 3DKKA 3WQBA 1G18A 4AJEA 5KNLA 2CHGA 5DX1A 3IVRA 1XCGB 3FCOA 5CYFA 5T4FA 4E22A 3ZWPA 3D6AA 3K4PA 2EZ8A 2P3LA 3PJFA 1Q1BA 2BMVA 2IPLA 2QD2A 2QG6A 3JQPA 3WLPA 2FX5A 1ZM3A 2B7CA 5AUQA 2EIHA 3DWGA 1ODFA 1RMQA 1MV8A 2J08A 2P9BA 4TVKA 4ZVNA 3VNVA 4L4YA 1J2EA 1LPAB 4OH7A 2FSHA 1KY4A 5EEGA 2GB4A 3PXUA 4EL0A 3GZTB 3OOEA 4D7AA 4QBKA 5ALOA 1GA4A 1Q7TA 1VHLA 4J4TA 2X9QA 2X42A 1SXJC 2FUNB 4M60A 4U6SA 4UTVA 4MB0A 4R9RA 2QM3A 4JV5B 3R9XB 3O4JA 3PC6A 5EMNA 4Z1OA 4D44A 1G19A 5CEJA 3OM8A 1D6SA 1VG9B 5AW1A 3K9WA 1M67A 2H8GA 4FCVA 5CIQA 4X7PA 5EA2A 1YDGA 1YZVA 3EFBA 2XE8A 4WD3A 4C88A 1CY0A 3CF6R 4IZOA 3R3JA 2NV6A 4JLSA 4XD2A 1EP1B 4EFKA 2QW8A 3B85A 5L45A 3IPAA 1UEJA 5L3ZA 1T5BA 1JIXA 1KI6A 1M34A 1PR9A 3PXXA 2HNKA 3O7WA 4M83A 5KCZA 3B1WA 4D5EA 3VO8A 2H48A 2QY6A 5ADWA 3VR2A 3CTPA 1FOEB 5TMDA 1PK7A 3I53A 4QUKA 2AI1A 4DV5B 1BCRA 2NAPA 1Z18A 4HXFB 4AC9A 2R4QA 1N32B 4GMGA 3ZDFA 5I7EA 2IX9A 1ZITA 4G67A 1QU3A 2H3EA 2XYGA 4UHFA 4D92A 4TV8F 5JEEA 5FUWA 1W25A 4WK6A 3UANA 5DV9A 3ELBA 2EDAA 1AGXA 3GNTA 1TUBA 1UC9A 4MPTA 3RRBA 3DAGA 1G21B 3CX3A 3O1JC 3HWSA 3IFSA 3OFSA 4HN4B 3SSAA 3KJXA 4B4UA 1WVGA 2HK8A 1CBUA 3GUVA 1GKYA 4ESEA 3KK0A 1P9NA 4M0LA 1KC1A 2GD0A 1B8VA 1E1RD 1NUPA 1EG7A 4LK2A 3K53A 5E6SB 2ORVA 4MW7A 3SZRA 3FNFA 3A6KA 4C06A 2BEVA 4HDRA 1NDHA 1XZDA 3TI7A 5MGBA 3R7SA 3RNOA 5KX5B 4H27A 1X94A 1ZGAA 4F2PA 4EYEA 1L7NA 2WF5A 3AKEA 3PIRA 4YRJA 4UATA 1S2NA 2X8AA 1KI2A 1DAFA 2IGTA 3DVAA 3FYUB 2BKVA 3MUEA 3W8EA 3FZQA 5K0NA 1YFLA 5C81A 3IA7A 4AMUA 4DGSA 2PKWA 5ENZA 4DQUA 2RGBA 2XDWA 1QLHA 1FRNA 1BN7A 1YZKA 2BUBA 1NDQA 2GK3A 2M6LA 1FTYA 1RJ9B 3S5UA 3W9SA 2X8JA 3BM5A 5F78A 3NBUA 3MTQA 3WBKA 4GSKA 5EOVA 2XNDA 2PAFA 2QVYX 2V7QA 1DXYA 1FFXA 4Y9RA 3E2IA 1N2CB 2JGEA 2CXTA 3IJPA 1G5TA 1Q12A 3UA4A 1U11A 1CF9A 4IDHA 1TAGA 3NRBA 4F1WA 2O59A 3PXGA 2Q7XA 3CSSA 4ZO7A 3RGGA 4YONB 3EVDA 2PMFA 1E0JA 3IKLA 1A97A 1PGQA 1NATA 2XCQA 5FOTA 4F3KA 3QA3E 4FYYA 2GCOA 1ULSA 3WJ7A 3DAYA 3NBMA 1QIHA 3DV2A 3WGYA 2HAEA 4HAWA 3FKJA 5HIIA 3NXSA 3WO1A 3ABSB 4JI7B 4O1HA 1LBIA 1BOFA 4GOMD 1QVVA 3OG9A 2ZI3A 2J0QA 2XF8A 1CQJA 3QVUA 4I36A 1VMDA 1H05A 1HE8B 1H5UA 1UQUA 1V8PA 2CJWB 2QRLA 4HGQA 4B8YA 1YB2A 1E18A 1TT7A 5GTDA 5FA5A 3E9NA 5DRTA 1XU7A 3DP7A 4JHLA 3ANSA 4DG9A 1HMPA 3HPQA 3RTDA 2GX6A 4CPDA 2OCKA 4CFSA 3HL0A 4L6AA 4WT7A 2PRYA 2TRSB 2FH5B 4DRXA 1JAXA 4DA6A 4I8XA 3ROPA 2ATCA 3EDYA 3OJWA 4KLCA 1TNDA 1DSSG 1XKTA 3P19A 1V39A 2FPGA 2NO0A 2OWDA 1NKSA 2YYYA 4ZOEA 2GCGA 1K86A 1O57A 4Z4CA 1E92A 1GV0A 3JYQA 4PQRA 5HKLA 5M29A 1ESZA 1U0FA 2BFEB 5KYYA 4K3UA 4JL5A 3IP6A 3R3ZA 4EAAA 2VK4A 1PN3A 3KOZA 3QWFA 1K1EA 2J30A 4OXQA 3NYQA 3LPCA 4TXNA 1OYOA 4PQGA 4RZIA 3IP7A 4R1PA 5IVIA 3UY4A 1GAEO 1O87A 3LQ1A 4GI2A 1KJZA 1B6GA 1L4EA 4KVFA 1NQXA 4A0SA 2JLYA 3X2FA 3F6RA 5CA1B 2EDCA 3CBGA 3N6XA 4LHZA 2ZW9A 4UUAA 1FLDA 1WIWA 3VHXB 4OBWA 4PO8A 2H2AA 4Q3EA 4F9TA 2FWNA 1EM8A 5GJWC 2VJLA 2DETA 2L18A 2QTWB 1A9YA 1RHJA 3ISVA 1Y4ZA 2DFNA 3LUHA 3K9FC 1V3QE 1G6OA 2PJDA 2PTHA 3AHHA 3BXHA 2XUQA 2JIZA 3KJZA 4UDNA 1HDXA 1JLLB 5CPBA 5G2OA 2J9YB 1L7RA 2VFAA 3KE9A 3RTGA 3EGDB 4DXHA 1DAGA 4R41A 5KB3A 3JQQA 3HP4A 2YCBA 4RHTA 5CG2A 5JMOA 2BFNA 1GYPA 4DVJA 2Y0CA 3W2GA 4OXIA 3TOVA 3M6IA 1DRWA 4QUGA 1Z7WA 3Q3JB 4P5DA 3SM9A 4EKIA 3N05A 3OPQA 5AUNB 4OV6B 2QLMA 2IPOA 1N92A 3LBFA 2QJOA 4KVGA 2RGUA 1J33A 1J4AA 1T5TA 2GXQA 3ZTYA 3PDIA 5IJ9B 5TQ0A 1TLLA 1FX0A 4PAOA 1EIZA 1L4BA 4QYTA 2P6UA 1KJNA 3QZUA 1JIVA 4F4CA 1A5ZA 1HFJA 3AEKA 5C3MA 1AGNA 421PA 1SXJE 1NXWA 4HTFA 5D51S 3WYNA 2J48A 2ZIXB 2YVKA 1UM8A 2CJXA 1SKYE 3AM5A 4FUQA 1WVIA 2BFFB 3TR5A 3GD5A 2NSHA 3QU9A 2VKTA 2R1ZA 2PJUA 2GKSA 5H0IA 4Z1MA 1JJBA 2X1HA 2H4HA 3PDWA 1BH6A 4CM8B 1QPBA 1Q1NA 2EJCA 4ZGGA 3A37A 4RTKA 1W49A 4UMEA 3WWDA 3U4QA 1NT2A 4DMUB 3RUDA 4FZ3A 221PA 2PH5A 3AK4A 1VDMA 1B8UA 3WR5A 1D4AA 2ENUA 3KJIA 3LW8A 2GEBA 3PIIA 3WC4A 5A5VA 4JYAB 2ZS7A 3T15A 4CETA 1G7RA 1TUGA 5HZMA 4DLTA 5CDUA 4S05A 3T1HB 4IOMA 1C9KA 5ALJA 3HUUA 3CCFA 3K16A 2FWJA 1XZHA 1Z47A 3LCUA 4FDVA 4BHTA 3R8FA 4Q9AA 2J6IA 3FWHA 5COQA 2E9SA 5IXYA 2RBEA 1P9LA 5EZSA 1OAAA 4ND8A 5CA0A 2J6CA 5L40A 2C5AA 3AUXA 3ZWOA 3C8UA 3OTIA 1HFWA 4HMOA 4ZPXA 2WMDA 3H2ZA 1M6EX 4FZVA 3GQBB 2Q3FA 1G8PA 1QVZA 2EVWX 2C83A 4YXWA 3D3KA 1E7WA 1BS1A 4LSGA 1V9SA 3TGPA 1CZOA 5HF6A 3M9WA 2EGUA 2J0VA 4A36A 1D1PA 1FL9A 5LIPA 4B6PA 3KZKA 5LUBA 1TCCA 3FPAA 3QWBA 4HV4A 1N6HA 2ALJA 3EXIB 4P82A 1NFQA 1JBKA 4B4DA 3KXIA 2AI3A 3DLCA 3FH0A 5I9NA 3OSZA 1I4OA 3HGQA 1F38A 4X1IB 3LECA 2JIMA 4RPCA 1O58A 2MOKA 4Y9SA 1F5SA 3AILA 3BXGA 1WSBA 4BJ1A 5ARBA 3EF3A 4Y1GA 2Q9CA 3V7FA 2NVBA 3V3KA 5EJMA 2NZJA 3G2JA 5AJYA 2FSSA 5HHTA 4UFPA 4F71A 4OXKA 4IKEA 5JZOA 1R9GA 4BNXA 1NPDA 2V9PA 3I62A 2GCNA 1ZD9A 3QUBA 1XU9A 5CVCA 2NPOA 2OMKA 3IIKA 4TMTA 2PLRA 1JQJC 1CJSA 4KXWA 3LHFA 1AV7A 4QGHA 3VSAA 1LLCA 1WW2A 2V3WA 4LKOA 4F7WA 2QL6A 4BE7B 1YJXA 3TIVA 2GBFA 3GJ6A 1PEKE 3MWGA 1PAUA 2K7ZA 2Q6LA 3A05A 3HVJA 1ZBDA 2HUPA 4Q7MB 2CL5A 3KXLA 4H7HA 1E1KA 4B85A 4MEBA 2JHAA 4RTOA 1F3LA 2GAIA 2HGZA 3EG9A 2P1RA 1XUOA 3KT3A 1T43A 5DYWA 4AJJA 4BVKA 1IUPA 3X1XA 3C3XA 4GMHA 4EA9A 3JD3A 5WRFA 4MUBA 3C5HA 1BXZA 5ALEA 5TPZA 2JHGA 4Q39A 1WRBA 1N3LA 3RIHA 4LF9B 2CNWD 1FIUA 1NQTA 3QBTA 3L7OA 3AESA 1G20B 4LDPA 5J43A 4KTVE 4TTRA 1Z5WA 3RC9A 5P21A 5HM6A 3L1VA 1PEDA 5AW5A 3PKZA 4OMCA 5CTAA 1FSGA 4OA5A 5KYGA 1SQ5A 2JLCA 4LZJA 2XOKA 3NDIA 3RYHB 3UHFA 5COAA 2FSVA 3C85A 2WSMA 2Y92A 5CLQA 3LT4A 4UFNA 2DPLA 4FHGA 4JJ8A 4GZMA 3T7TA 1LA2A 4AIIA 4PYMA 1JN0A 2PCJA 4ND2A 3OX4A 2FUEA 4MW9A 4RGQA 2J87A 3I4LA 4NFSA 1JA1A 1UIMA 4YK7A 1JEYA 1TXGA 2POQX 4Y6PA 2BGGA 5DHAA 1OYYA 4B8WA 1U6JA 2D4HA 1X7ZA 1YL6A 1CF2O 1EFRD 1NBOA 3GPIA 2A4KA 1GU7A 2XNDD 3M5DA 1XAJA 1DFGA 4Q15A 1D2HA 2DUNA 4O4LA 1CULC 1SC9A 1DKQA 4A3SA 4EJ0A 1T3LA 3N39C 2VAXA 3U31A 3JASA 4EJSC 1KEEA 1QG6A 4P83A 3WKDA 1EJ2A 2RIRA 1N9GA 3UFXA 3OEYA 1S2IA 4WUVA 3N70A 5ECDA 3RUPA 3S2IA 5KYTA 3IHKA 4RZ3A 3ORHA 1TUIA 1HFKA 3RRFA 1P4HA 1I1QB 1AQYA 1EKXA 2XDQA 3OZIA 3ZN2A 3ZS9A 4P0QB 4C89A 2RHLA 3IH5A 1G42A 2CVZA 1ORWA 2BGMA 3BMOA 1LD3A 1A82A 3AHDA 3I42A 3QUSA 3B1FA 3P94A 2IOFK 2QB5A 4JQZA 2XTJA 4WWHA 5F9FA 2HHCA 3AL3A 5DLEA 2PS9A 2GZSA 2H2DA 3M49A 2ZZKA 1NG1A 4OHYA 3L7YA 4TXJA 5CVEA 3V00A 2WUGA 1D2RA 2X0DA 3KPJA 2XT0A 1M73E 1ILWA 3AIOA 4JODA 5CEEA 1ZAYA 1Z6TA 4U7DA 3R7WA 3PZBA 1TKCA 1H8EA 2GTHA 5IJ0A 3QLUC 3L8GA 1OIXA 1JLHA 2VHXA 4JKYA 4WLOA 1UMKA 3KZXA 2WFMA 1BKSB 1YK0A 5B12A 2W2VA 3HCAA 1DAHA 2C0QA 5FPSA 1L8LA 1AHHA 2ISCA 4RV9A 3N2KB 1Y6FA 1PR3A 4Y18A 4PC2A 2XGJA 3NRCA 4RQAA 1JMYA 1XP5A 4HH4A 2QN2A 1TM7E 3LI2A 2VUTA 1XZMA 1QLJA 5H9VA 3EEBA 3ROMA 2PZKA 1U2ZA 3C97A 4BLTA 4EW6A 4X44A 4Y2VA 2VOEA 2AN9A 2Z30A 1Y5RA 1NBMA 3IEIA 2I67A 2I6FA 1RWMA 2I6UA 1E0SA 4LZZA 1QG2A 4MUXA 4GXQA 4WGFA 4WOPA 2VT6A 1EP3B 4TYWA 4B3FX 4PPNA 5K8IA 3DCYA 4ZARA 1L7DA 2R00C 3ZVLA 1TVKB 1E9RA 2BP7A 1TZ2A 4AJOA 4DNXA 1JB9A 1R5JA 2O2CA 2OHXA 1ZA2A 1FSSA 3PQ4A 1N0WA 4G2TA 1E2FA 3HJCA 1KERA 1FFWA 2PM8A 2ZJYA 3QF4B 5EY5B 2BI4A 3ACBA 4XD7D 3U56A 2O8VA 3A3KA 3P4YA 5EWLA 1IZ8A 4YAWA 5PNTA 5FAKA 2JAWA 5IG2A 1CERA 3DFMA 5LNK6 3PYLA 1N9GB 4K1LA 3UFXB 3B20A 3Q7TA 2WD8A 3FROA 1DO2A 2BFCA 1UWVA 4A8PA 4GPTA 3NUGA 1IZZA 4KOAA 4ZYLA 3O1HB 3FSGD 3S28A 2XQIA 4DQLA 2QVXX 5H5JA 5A62A 1UDCA 3VAYA 4B4OA 1SHKA 3EUAA 1A1VA 1QYXA 3RT9A 4DDUA 3KBOA 2GKGA 1TECE 3D2LA 3A4VA 1STOA 2DHEA 3L0YA 2VP6A 3O4GA 4O5AA 1EQ2A 5KSPA 2Y99A 3ZYCA 3G5AA 1BE6A 4KO4S 4MS3B 1KK2A 5B6PA 2QM8A 1YUNA 4G4JA 5DGIA 1JFLA 3EOBI 3AB3A 2WM3A 2WI8A 1OC4A 1X7XB 2JA1A 4U2KA 5ECGC 3ETLA 1O97C 2HLDD 2YHBA 4Y6GB 5ITZA 1M6NA 4NLLA 5A4AA 1GSOA 3LW7A 2GCPA 1GZHB 3A4IA 4QQ8A 3KALA 1Y1TA 1E6CA 1ODKA 4RABA 2QW1A 1I2ZA 2ZUVA 2C3MA 3D54D 5ALYA 3TJRA 1V95A 2XCIA 2D54A 4TT3A 4MYCA 2C7OA 3B9BA 4YCAA 3PR3A 5ITSA 3N2GA 3UJ9A 2ENWA 1KEPA 1EXWA 1RZRD 3S2EA 1MQAA 1Q0QA 1JWBB 2ZT8A 3T7SA 1J7JA 1TQ4A 2M6SA 3PSHA 1X38A 3QU2A 4QFMA 4YJHA 2WQ7A 4KX3A 4DJDC 1O6FA 2WRZA 3JZFA 4NY1A 5BSFA 3O03A 3MCTA 1KAEA 4HEJA 4NCNA 4YJGA 4YT4A 4MINA 3GR6A 4HWKA 4RXTA 4BP3A 3BERA 3KSUA 2WU0A 3ROTA 3OSUA 1AA6A 3AR2A 2EGHA 3M1AA 4FFDA 2PIDA 4M8SA 4EK9A 1DQNA 2A9PA 4E4RA 2HF2A 2ES4A 1POWA 1NJFA 3I34X 3A06A 5D3MA 4HRYA 3OF3A 1J21A 3CPSA 3S1LA 2XZDA 1RP1A 1PGNA 4LVCA 5EQFA 3KOYA 2EBWA 1XQYA 1O77A 3GNQA 4KQCA 3VPSA 1J99A 1IN1A 2XWSA 3LUPA 1HT2E 2I6SA 2VRNA 2O5VA 5TPWA 3QYFA 1VMAA 4KE9A 4MVJG 2QDXA 4DA0A 1IU9A 3NWPA 4IGIA 3NHZA 4KXYA 4XGQA 4EFMA 1SXQA 1T3SA 4FC6A 4QOGA 3L79A 3TD9A 3B53X 1EFCA 1R18A 3PUIA 4F0JA 2FF7A 1NRIA 4QLAA 2I8CA 3VYUB 3BT7A 1C7EA 4TKVB 4DVGA 4XWKA 1OBCA 3RANA 4DKJA 3PLRA 5EEHA 1YJCA 2SBTA 1AS2A 5DGHA 2DXIA 4YCNA 1UDWA 2Y9MB 1LQTA 3M6LA 4I9FA 5ESXA 3ZVRA 4PBRA 1UKBA 2P2YA 3M81A 1G41A 1FXUA 3IQEA 4IGAA 2FW0A 4IY1A 2N3ZA 3CH7A 3PQEA 4KIUA 1TL7C 5FBRB 3ZHXA 1AUVA 4O4IA 3M4XA 4A27A 2Z2IA 4O25A 1H3EA 3OHMA 4DQVA 5CA0B 1QQBA 3T7CA 3R7NA 3Q8LA 2YX1A 1PR4A 3T99A 3VZCA 3W9BA 2FGJA 2OCXA 1DIGA 1U2GA 1JTVA 4P1ZA 1KH1A 2G9UA 3ZCSA 1NP6A 2WIJA 1A76A 1DC5A 3CEJA 1SBNE 4C87A 4MB2A 3E2PA 2YN4A 3NDJA 2PD4A 2OY0A 4C6SA 4TL7A 4MSUA 1C7ZA 3OIFA 3VKGA 3EA0A 5BSVA 1UPCA 2WWGA 5EIWA 1CJBA 3SIPA 1DC6A 4DPLA 1JFFB 1K68A 4I66A 1Z8NA 4L5YA 4IIXA 1PVVA 1DLJA 3CEAA 2QRQA 5IAKA 1CDDA 1JQLB 2VBFA 3R09A 1IATA 1XD9A 2HFKA 3E03A 3HKBA 3NS7A 1RWVA 3WRYC 1PJAA 3EG5A 3U4AA 1BVRA 3H0CA 1SXHA 4N47A 1SOWA 3IMCA 5B1IA 4Q16A 4JJ7A 3WGVA 3OT4A 3EOAI 4KDFA 1X0XA 4KSCA 2YXPX 1R0ZA 3FSRA 2GRAA 3FLEA 2VPZA 4DBLE 4MUIA 1U65A 1GRNA 3ND9A 2N75A 5AI0A 3S2ZA 4IYRA 3FGNA 5JMTA 1QHGA 5BOSA 3NNSA 1UC4B 5EIBD 3U5ZB 2IC5A 5EZYB 1YONA 3NHLA 4MUHA 3WDLA 4DABA 8ADHA 1R37A 4XTCS 3VDMA 1T6XA 1GZ7A 3PDJA 1ECLA 4NBWA 1D04A 2O2DA 2ZYTX 4ZPJA 2A88A 2IX3A 1JH9A 1F4VA 3TZQA 1BXGB 3A8TA 3BSFA 1AKEA 4OSEA 4C7JA 4UZFA 3EVEA 5IS2A 3NM4A 1CF4A 4BYGA 1YBMA 2PK3A 5FNZA 2V7WA 4EHIA 3GLGA 2B69A 4HWRA 5BWLA 3BE5A 3AO0B 3OX3A 4Z51A 3ASUA 4XUGB 2PSJA 2QE6A 5CCBA 1ADBA 1GNRA 4L3VA 1M9NA 4ZZ3A 3KQOA 2QUZA 3NLLA 4NHEA 2WY2D 3TXAA 1K88A 1SGWA 1RRPA 2EKBA 2MSCB 3HPRA 3G0DA 1DP4A 3GFGA 4F91B 3KKZA 1FFYA 4IKPA 1X7GA 4JWKA 4ZVMA 4MQFA 1NBEA 3QNMA 1L4NA 2PMCA 1BMDA 2H5EA 1E2JA 1U1GA 3OQOA 1KP2A 2G40A 3FJOA 4GGOA 4IJVA 2G0NA 1GTSA 4B6RA 3V4VB 3G5MA 3I2HA 3NIGB 2TYSB 3GLKA 1LFAA 4GVLA 4JC4A 1GL3A 3M89A 3MILA 4V1CA 2QPLA 4L76A 1KVTA 4NBVA 4NEQA 2WHRA 3GB9A 3UMCA 4HVTA 2BR5A 4C29A 5JRDS 1NI4A 1BDIA 1YVDA 4I46A 3R4VA 1QAOA 2LWIA 1CR1A 2JB9A 4IH9A 4BTVA 1QB8A 1XQ1A 4LOAA 1WQ3A 3WJAA 2YDYA 1ZP6A 5FLKA 3TM4A 3WY9A 3A31A 3EBPA 2FI1A 1QE5A 1YIDA 4JOBA 4KH1A 5JDCC 3O83A 4RK7A 1EIWA 3OM9A 3FYDA 4KE7A 3NM6B 3MLEA 4E4TA 2RK6A 3MK31 1NC3A 4GD3Q 1W36D 5G02A 2C2GA 5IBRA 5HQJA 3ZS8A 3AF2A 4XFJA 3WBBA 2F59A 3ZGYA 3CS3A 1P2VA 1G8AA 2OV3A 3DP9A 4TV8B 2QVBA 1X1BA 1GUBA 5EE5B 3EWAA 3MRXA 1T0BA 3NP7A 1LDEA 2VCHA 3U61B 2QBYA 2QN6A 5D6OA 1KBQA 3R2JA 2WSYB 3V9AA 3A2LA 3V1NA 1E9EA 1UJBA 3DCJA 1WVMA 2JAPA 4OFBA 1W5BA 5LDDC 3IT1A 3HE3A 3QYJA 2ZUDA 3GY0A 3D3WA 3T7EA 3FYUA 3EQ2A 1X70A 3ZUPA 4AO6A 3ZLTA 5EGNA 1XZEA 2QMQA 1VG1A 1DJQA 2FZ5A 1DCTA 3AUJB 1P5RA 1I7DA 3M9LA 4RCVA 2GERA 3TBFA 3U7RA 1AZLA 2UYGA 3U7EB 1LWOA 1CUZA 3H8JA 1DEXA 3FPCA 4HMQA 4RCZA 3EHDA 1AB5A 4XDGA 4AZSA 3QJYA 3D0KA 4PC3A 2HJ9A 2P2CA 1S0UA 3QVOA 3KEQA 2FCRA 5AOAA 5CGZA 3I83A 3BFXA 5LMZA 4AMYA 4DMLA 3KJHA 3TD2A 3ZE8A 2YUTA 4G24A 2DAPA 5CK4A 4F4DA 9LDBA 3WNZA 3GNSA 2R6JA 3NCHA 2LW7A 2GM3A 3TPFA 1LLUA 4OQZA 2QQ0A 3RGWS 3AWIA 3EE6A 4QDUA 2OZPA 4CDNA 4QXRA 5K8LA 4HLUA 1Y1SA 1ILEA 1KPGA 2C4TA 2HSJA 3MF4A 4K1XA 5F3WB 4KI0A 2AKEA 3D3QA 1DG3A 1HV8A 4PIMA 4Q19A 3IXQA 3MS4A 1C14A 1IDOA 5J63A 4AULA 1NUAA 2VXBA 4JP3A 3TPCA 2IHBA 4S1VA 4G3XA 2BISA 4X95A 3VR5D 4L08A 2ACWA 1MDBA 3B3AA 4R1TA 3RH0A 4LNUB 4YAJA 3GARA 4JGBA 3OKFA 5DYIA 4OLFA 4DR3B 1JEOA 4PYRA 3CG0A 3HVRA 2PD3A 3HSKA 4JEHA 3TZCA 3GZNB 2IODA 4KPEC 3NBKA 2C3YA 4AP9A 4R9SA 4FINA 1IOWA 1PJ3A 2GAJA 1YC2A 4G63A 4XDZA 2C7QA 4V1CI 2R25B 5JSZA 3EGIA 5AVXA 1VPTA 3IQDB 4F3NA 4JBYA 5J2TA 5JQGB 1YKGA 4U7TB 2ZBPA 1GQSA 3ABZA 4B3BA 3N87A 2VZ9A 2WT9A 1MEOA 3KUUA 1J07A 3C0KA 3D8NA 4OUDA 2IDZA 2QVCA 5GGXA 5THXA 5IFLA 5LB4A 3HO1A 4P22A 2GCOB 4CLRB 5L6LB 1F2VA 2A5YB 6YASA 2Y0PA 2AW5A 4UXJA 2W70A 3H0KA 1XPJA 3NEAA 3OBIA 2OC4A 1FU8A 2P91A 1FC0A 1DBQA 4RLHA 1W75A 3IVAA 1SC4A 4WBNA 3GPLA 4CVNA 1G3IA 1P9WA 2OGWA 2HPZA 1RADA 4BIMA 4KKVA 1K6JA 2RGDA 5L9AA 4EMUA 4GNRA 1ZONA 4K03A 3UOAB 2QYHA 1U04A 4M37A 3N0XA 2XBUA 3UV6A 1SKUA 1T15A 2FDRA 2I2BA 2X13A 3BEDA 3GW8A 1ZOSA 4L72A 4PG7A 1C41A 4YAUA 4BKQA 1NNI1 1UJNA 5F52A 3DCIA 3DHWC 1TVMA 1A7JA 4FPXA 2YWXA 4OB6A 4MWSA 5CAEA 2ZRHA 4CM5A 1LQUA 1GG5A 1K4YA 2PS0A 2WFZA 3I5XA 2PANA 3DC7A 5BQOA 4FYXA 2IY8A 1J0CA 4FJ1A 3EYWA 1II0A 5D3MB 1WKVA 4RZQA 4D4IA 1GRRA 4XYBA 1CRQA 3WSTA 2MR6A 1WW3A 3LWZA 4FU0A 1LH0A 1AKWA 2C97A 2J7PA 4R2KA 4C6RA 4F93B 2PGDA 1NY6A 4L8YA 4CMEA 3GP5A 4AF7A 1R6AA 5I48A 3HFSA 4EATA 3N8NA 4L27A 4N01A 4C5CA 2EATA 3QWAA 4JQYA 2BZ0A 1Y9EA 3Q7RA 1ATIA 1M0WA 3RVPA 3AYXB 1UQTA 4WESA 3TLGB 1X1QA 2O7SA 5GPBA 2UZ1B 4Y6OA 3GUUA 1NNSA 2OV4A 3FTFA 2ZJFA 5KC9A 5KO2A 1T8PA 4I7EA 1J90A 4IIBA 5BNWA 3QEAZ 2C20A 2QZ9A 3L0BA 1NZJA 4UXIA 4C7OB 3M6FA 5CGQB 2D6FA 5K3DA 1GARA 1GTMA 2CEAA 4HX5A 5FBKA 5K45A 5AIAA 1VSBA 4NCAA 4D3DA 3N8GA 4O6VA 1H1TA 1HYQA 1VXOA 2EFDB 2BI7A 1HYBA 2JH8A 4A6EA 5TMBA 5BYJA 5BN3A 3IV7A 3PD1A 1V26A 2EU8A 2H29A 5HFJA 2RI6A 4HZIA 5DN6A 2F3UA 2COEA 3P96A 1XPOA 5TMPA 4HGZA 1N33B 4I9HA 4IEEA 1NVWQ 1HPLA 1K5HA 4OQDA 1QCCA 5F1KA 1KO4A 3HKBB 4RQBA 3SBDA 2OB2A 1I2BA 3KD2A 2AWNA 3OCYA 3PHJA 1WUYA 2A8YA 3W05A 3GLIE 1QH0A 1YS9A 2FWRA 3LVQE 4HDSA 4HGOA 4JB0A 3ZX5A 2XMBA 3OZVA 3R5SA 4YP0A 4HNAB 1EAYA 2Q50A 5LXTB 1YH3A 4IBOA 4K81B 3A0UA 1ZI8A 4X84A 3B82A 2KX7A 3GJ0A 4JP2A 4XCXA 4RMNA 4URZR 4UPDA 1IZ9A 3CEHA 5AJVB 3LXUX 5LZ8A 4BLWA 4D96A 4UPEA 1DTWB 3NTVA 3QVKA 5T3UA 5CBPA 3LL7A 4G5OA 2P4EA 1N4AA 1V7PC 3ZV3A 4ND7A 3ONEA 5DBFA 1EA7A 1HWYA 1UBSB 2HQBA 3H9UA 2QT9A 4JQOA 1AUXA 4ARAA 3ANMA 1GPLA 5E7MA 2ZIFA 4GRIA 3LFTA 1R6DA 4H7KA 1G7TA 2CB0A 1AXRA 2HQSA 4M46A 5HVNA 1GNPA 1SOUA 1E2PA 4JEMA 5EVCA 3PXCX 2PUDA 4IQGA 1G4HA 1RW4A 2B6HA 1TZMA 3M4NA 2BEUB 3WWYA 3QFFA 4RVUA 4JQSA 5HDBB 2IITA 3LKDA 4GX0A 2FN7A 2Z6QA 1Z4JA 2ICAA 2JJ1A 2YW2A 1SHZA 3SLGA 3VC7A 5CNJA 3KLBA 3HCRA 3NH6A 4G8CA 3MMPA 1ULHA 4ARVA 1O03A 1W4RA 2YJZA 2YYSA 3D7RA 1R0XA 1XMXA 1RXEA 3HJFA 3ED5A 5EIXA 1Z4LA 4HBGA 4E2XA 4EA8A 1COWA 2YV2A 1E59A 3SDBA 1HMYA 1A5AB 4JC5A 4FNMA 1R6VA 5JYDA 4OHXA 3ML1A 3Q5GA 4LJKA 4HQNA 4MJ7A 5F1OA 2RBKA 4DMMA 2YFKA 2RCNA 1V71A 5FTLA 2D1SA 4MDHA 1FA9A 1H4VB 4AUEA 1QQ5A 4IAOA 4KLAA 3H2SA 4GPBA 2WIBA 4U8HA 5LC1A 4PN3A 5JJBA 1FYDA 1QO0D 1PLLA 2R1VA 3BL5A 2V7UA 3WBFA 3W1WA 2VJAA 4ROTA 5EERA 1OFIA 1T4CA 4D82A 3WWZA 4FYJA 3A1WA 2PGIA 1QIJA 1C4XA 4TYQA 5CJPA 5HFNA 4DSNA 4TYPA 1XAHA 4MKGA 2FW1A 4F9FA 1EDOA 2ZJOA 3DEZA 4IFEA 2FDCA 2JBAB 1R4NB 4TMYA 2RHWA 2B4KA 1P62B 2D2VA 2J3QA 2Z1NA 2NIPA 4C7VA 5IEBA 2X7HA 5KNCH 1KXJA 5D85A 1F51E 5IULC 3TNLA 2BTEA 2WKRA 3VU3A 1Q0UA 2AOUA 1XIVA 5CB4A 1NWHA 3QH4A 3H16A 5KAPA 1SAYA 2BD0A 1EZ1A 3C15C 1KK1A 1LV7A 3B1YA 2QRNA 1Z0FA 3E7XA 4FILA 3UT5A 1M2JA 3V48A 4M53A 1QONA 5BXYA 2CV2A 1Z6AA 1R4AA 2GZ2A 2QYSA 5A7GA 5C7OO 4DDVA 4N49A 1R6TA 3THXB 3C3MA 2BTOA 3SOPA 3U4HA 1HO3A 5A5GA 4M76B 4BZQA 2JPDA 1QV6A 2V7XA 2XNKA 3NHMA 2BSXA 2EWWA 1N3YA 1V45E 4K6FA 4P5EA 2UUBB 1EFVB 2FSPA 2ZTHA 3GEMA 1SQ0A 1BEUB 1Z8FA 2I62A 4GIBA 1YHNA 4M99A 4OMUA 2QTMA 1BVYF 2ZE6A 1BO6A 1YR7A 2QMZA 3GG9A 3OEEA 4BGUA 4CDGA 1X9IA 2O2GA 5FO1A 3MIIA 1BQEA 3JD2A 4J76A 3QUQA 4UM8B 5B3LA 3COYA 1OLXB 3BTSA 2O8CA 2NUTA 3ZH9B 2JCBA 3I2FA 5FLYA 5HKKD 3GCZA 4IICA 2CUZA 4YC7A 3TD6A 1NR7A 1Y9DA 1NN0A 3GLFA 4TROA 2XMRA 2YYZA 4KODA 3AERA 3AVVA 1VPLA 2J85A 4X6LA 4B7UA 1XLUA 4BJHB 4ZAYA 1BNCA 5FCDA 3E82A 3W5IA 1X3LA 1V7ZA 4GM0A 2I54A 3H0EA 5HJ2A 4XOUA 2QG9A 2K6GA 4MRPA 4X8LA 4YBRA 2GN1A 5CUQA 3F8SA 2B35A 4YRTA 3HLYA 2O0HA 2GOYA 1DBIA 3HYLA 1II8B 2AEEA 2VWPA 2OK7A 4NJMA 5BYBA 4W1PA 3ZK9A 1ZS9A 2XTNA 3I04A 4DA4A 4MVYA 4X71A 2QNBA 1JMKC 1XZAA 3CKKA 5K3FB 5AI6A 3PFBA 1TTQB 4H16A 4C76A 1EXVA 2C00A 2QENA 5BORA 2UV8A 4G1VA 4MLDA 1C9JA 4XB6B 1DFHA 1MH9A 5A3VA 1RFLA 2OM2A 1PFGA 9GPBA 4Z9XA 1L1FA 5HE9A 3AUKA 3RBVA 4UDXX 3KAQA 2O4CA 3EJ6A 3DE1X 3ETCA 5F35A 3UJPA 1L5SA 4QPZA 4ZRMA 4BMSA 3M83A 4IJKA 1QVRA 2F3TA 2O57A 3ZGLA 2YBEA 3PFGA 3DNFA 2HQRA 2O2ZA 3OHSX 5K0BA 4HUQA 1VBKA 1WZUA 2FF5A 2WJ6A 1LPNA 1Z6ZA 3CB4A 3D2CA 3GN1A 3GRVA 3JWIA 2I3GA 3M1IA 5EIOA 6REQA 1XTUA 4X63A 2XGSA 5FV4A 2J3DA 2VYCA 1TFRA 1OC2A 1OFVA 5DNAA 4EELA 3C6QA 5LLTA 4J0JA 4PC7A 2EX1A 4KPUA 4UAUA 4ZMSA 1O96B 3T3OA 1K6MA 7MDHA 3SVZA 2R66A 1SG9A 5F73A 1HBJA 2Z58A 4FT4A 3CWZA 2GN9A 4FXOA 2VYND 1P2SA 2PU5A 4HADA 4HZUA 3LHIA 3VYVA 2HLHA 3O4VA 4D6PA 5AO9A 5EWMB 4NFHA 4EYQA 1Q19A 3Q7SA 3ORSA 1G5HA 4IYJA 4ND3A 1IYZA 1QHEA 3AI2A 4PGHA 1Q83A 4CE6A 1C3JA 3K0AB 4YCLA 2GSDA 3ZIAA 4DAEA 4JDPA 4F5YA 5FRDA 2UUPA 3T35A 5KOJA 1R16A 5E2AA 4Y1EA 4S1OA 1O5OA 3RQSA 4JR2A 2PBZA 3UKJA 4HDMB 2DHRA 3VTZA 1FQKA 1EUCB 3E9MA 4H60A 1IEWA 2QNRA 4W4TA 5A4DA 3A2KA 1KDZA 3LPMA 3NT4A 5AJHA 1GDHA 4CV2A 1WXHA 4DC9A 3BWBA 3HJGA 5C8DA 4ARCA 1JZQA 3I6IA 4OJTA 5K9ZA 4J9UE 1G8YA 4DJ5X 2B8NA 4BNTA 1Q0PA 2JD0A 4LTNA 4CN9A 5D5PA 4B3CA 4CMEC 3BMXA 1R8JA 5J5AA 3SZMA 4DB2A 1GRVA 3LT2A 2D5BA 1REQA 4ES6A 4YRSA 3GVCA 1IXRC 2DGDA 4OL9A 2HBQA 4RY0A 4AUKA 4P4SB 5AVVA 3PGA1 4B3RB 2AMYA 1G0OA 2ZBFA 5DLDA 2ERXA 4WLNA 3AHJA 3B89A 3Q98A 5L7YA 3UMFA 3JRNA 1I32A 3KWFA 5FNVA 1U3WA 3GG2A 3TTYA 3WV5A 4EGQA 1R1DA 1M6WA 2J9GA 3PDUA 4RPGA 4UUNA 4QTUB 4YAIA 1CUSA 4C0BA 2FGKA 3TGLA 2GTIA 3GGGA 4WOKA 3T38A 3N5CA 4R84A 1L3BA 2A35A 2W2KB 4LF7B 2JARA 4HL6A 2XJ4A 5DTMA 2AJBA 3PICA 5IP5A 3RRXA 4EECA 2C77A 1GL6A 1FX0B 3GX1A 4PWZA 2WINI 2H16A 4OP3A 2A33A 1DAMA 1XMSA 1FS6A 2YC2C 3L7IA 1GLVA 3I9LA 3G2KA 3MZ0A 3VZPA 4ENWA 4EY4A 1US8B 4HRAA 1T5HX 4HTFB 3A9WA 4WOBA 2B25A 1T9GR 1BJTA 3HXPA 1PNRA 1KJJA 3TFWA 4YCDA 2GEJA 3WADA 1Q3HA 4E08A 5D7NA 4YCBA 4QJ4A 1O7JA 3HKDB 5EN4A 3IHLA 1XDGA 4OHWA 2QL7A 4ZGWA 1ZC4A 1EG2A 4GM1A 3Q7QA 4J3FA 1RXCA 2A7QA 4WZAB 1Z75A 2XCLA 2IUFA 3GQVA 2O2YA 1T9KA 1BHQ1 1LPSA 1ZM4A 4NBKA 4NBSA 4BIIA 5LQNA 1ZK2A 5U4QA 1QTQA 3OFKA 3AUFA 4TS3A 1KZ7B 1EUCA 3N5KA 3KJNA 1X77A 2NT4A 1RYNA 4M9UA 4WZAE 4RDXA 1GTRA 3IDQA 1BW9A 4XIYA 3TQTA 4EIWA 3SS7X 3K9HA 4OKIA 3LC7O 1WXEA 1KZ1A 4UE2A 4YRNA 1HQCA 1BDHA 1YF3A 3W5HA 1NVXQ 2E3JA 2C0CA 1JHDA 4OXNA 1HA3A 3RU7A 3MB5A 3FETA 1FJHA 3V97A 2B2NA 5G0WA 1I51A 4CN8A 4BEVA 2YV5A 3TDMA 3ZIAD 4FQ5A 4PG6A 5LD2C 1E2GA 3KL2A 5AVZA 2FWMX 3AONB 2J3IA 1NQVA 5KJFA 3LT1A 3UK1A 4CMCA 3C7KA 5F4BA 1HSZA 2R7MA 3IXLA 3KZCA 4MQ4A 4CG3A 3P0IA 3QSGA 1XZCA 2ZIXA 1ZVJA 2H6EA 5DRYA 4DLKA 4OL0A 4ZI3A 1XQXA 5HUQA 4NOMA 3RSQA 4UM7A 1XCJA 4GR5A 4KFRA 2C2BA 3ND6A 4Q01A 4CQLB 5MFZA 1EGMB 1JJIA 1C30B 5CT4A 3VU8A 3FUVA 3UWMA 4FUTA 1G3RA 4HQLA 2C8KA 1H22A 2CVQA 4HSGA 3TAXA 1ZI6A 1IHXA 4PANA 1VIVA 2G80A 2P0EA 3H1AA 4CL0A 2EKZA 3GLRA 4HG2A 2H08A 2V7VA 2YRXA 3CLRC 3A2NA 5ESRA 3JWHA 1AQ6A 1T4CB 4Y6RA 4AFNA 2VPIA 4L4RA 1RWXA 2QMYA 3D0QA 4H7PA 5FAXA 2FEWB 3FF4A 3K5HA 1PT9A 3EB9A 4IFTA 4KSYA 4LZPA 2H51A 2YXBA 1CUWA 2F4VB 4O2RA 4POAA 1T4BA 4EUEA 2Q41A 3DJFA 2ID8A 4L4SA 5LPNA 1T36A 3L0PA 1QG4A 1JI0A 1NBMD 2XSZD 4U2CA 3UTDA 2DFKB 3T9EA 3U0BA 3TXYA 4FFMA 3M3DA 3HKEA 1QS0A 2YXDA 4G1FA 2OXEA 4X60A 4CMJA 4QPNA 3QLJA 1PS0A 1S2GA 3KOWA 3PU6A 3H6KA 1YZUA 4ZCSA 1N6RA 1QDUA 1F48A 4O4HB 5DM1A 2C82A 5C8YA 2FUKA 2HGSA 3I30X 1J49A 3UHAA 4DRYA 1L8XA 1KQ3A 1UPXA 1YCGA 2Q6VA 1QP7A 1NXVA 1NJ2A 4BEJA 2VTVA 1I0IA 1P2DA 3SN6A 1KTVA 2GPWA 3Q85A 5JECA 4F3RA 3U6KA 2GBGA 1OU0A 2AG8A 3R20A 2GDZA 1HLFA 4A8JB 2YWRA 1WCWA 3I3SR 4CKWA 3EFEA 3RV3A 3VTKA 4I19A 3PLNA 2E5LB 1WG8A 4AG6A 2C92A 4INOA 2MWMA 1CLEA 3DMPA 3DE7X 4KR0A 4R8LA 1Q2UA 3U2QA 1CQIA 1IUKA 2FWBA 2C2WA 1Z2EA 4JK3A 1M2HA 4M8NE 4D6YA 4JC8A 4MIYA 1Y3BE 2CXHA 1OAKA 1YR8A 3CZPA 3H86A 3UJ6A 4BX9A 5KDLA 4C4RA 3D6JA 3N7TA 5C80A 3NHFA 4FE7A 4GBGA 3Q6MA 5GONB 3R7AA 2NTYC 3R24A 3LKVA 1U9IC 3R0ZA 1L5RA 2CGEA 1I7QB 3ZBTA 1P1FA 3NHUA 4KVZA 1QAMA 1NSYA 1BS9A 3KB6A 4L51A 4MUEA 2YRWA 4TVBA 1LVUA 1Z4QA 2V0CA 2X1LA 2AF4C 4YRBA 1VL8A 2ZJ2A 2YMMA 4NV3A 2WE8A 5IT4A 2CJWA 4DIDA 2OR3A 1HDCA 2XCRB 1RI2A 3P26A 4FEYA 4CMIA 5C2JB 3LXRA 2O0LA 1TRHA 2C78A 1O8BA 1JA0A 4INZA 3NOXA 5CLFA 3C16C 4RJJA 4TM7A 5AQEA 4E1BA 3MD9A 2C2HA 2QMUA 3ND5A 2B98A 4PSAA 3CLSC 4BVAA 3AL0C 1C1XA 3RKRA 1LSJA 2WKPA 1CY6A 3GJ3A 1FTNA 1UPBA 2H1FA 2B82A 2E4UA 1G66A 1MENA 3JQ8B 3KZ1E 3MB8A 4P3OA 1QPGA 1WY7A 2CB9A 5ISMA 2NXWA 3G5TA 4N39A 4D3ZA 5A1JA 2ILTA 5CP8A 5HZHA 3L8YA 4EB0A 4IO1A 1LPPA 4QTZA 1R9JA 3RHFA 2C96A 2BSQA 1U9JA 1ANKA 2PD6A 4CDMA 1HLGA 1K4KA 4ARZA 3CNQS 2Y1OA 2AK3A 3B36A 1HG1A 2JD2A 4Q9NA 1ZJZA 2J0UA 2AFVA 4FE4A 3VMFA 2GA9A 4YRQA 2H4YA 5KYXA 2HMWA 4NDAA 1KQGA 1C50A 4YQEA 2XTAA 2PXHA 4EY7A 4FHFA 2H1SA 1DVRA 4EGJA 3CVXA 5I7FA 1W4BA 3GMDA 1AURA 4DADA 4DZRA 4CIBA 4QU0A 1PR6A 2XA9A 1JPJA 2EJVA 3I12A 5BRNA 2WZBA 1DAPA 4OKNA 2HRZA 5DEOA 1QHHB 2FFRA 3DDZX 2OXCA 2XKJE 1S01A 5EWLB 2COKA 2BSAA 2C2ZA 4H7DA 1WV1A 3RAFC 1A9XB 2P1ZA 4PFKA 3VKFA 1P0FA 3S1AA 1W87A 1E58A 2FP3A 2GK7A 3SD7A 4NBNA 3WGIA 1TVEA 1L1EA 5HCIA 4OU4A 3A9UA 3H2HA 2EFEB 2GILA 3DAHA 4E5KA 4JVLA 2F55A 5IARA 2IYZA 4I0WB 1IJFA 1U6IA 2VNAA 4O33A 1C8VB 1U0SY 4DM4A 2ZJ1A 4HNGA 1AMNA 1MB0A 3V6MA 3SIXA 5HOQA 3WK9A 3WLAA 1JL3A 1JU3A 2FZCA 4PYQA 1KDPA 1ML3A 2DT5A 2XDYA 4LIPD 3FRIA 4MS3A 1TO6A 4RVFA 2GR9A 4PHCA 1YDEA 2C1XA 4JYPA 3UF0A 5JV5A 1ZRNA 2WV9A 5H3LA 3S2SA 2WTXA 4BNDA 2DFTA 3CUUA 3IP3A 2JNWA 1JLRA 3JD0A 2RK4A 2XVMA 1RQXA 2ZM6B 3EQ6A 2CFIA 4KKXB 5GOZA 1WM1A 2QUKA 1DC3A 3HVHA 1Z6QA 4LYAA 3F46A 5TQ0B 4DR4B 3PNKA 1ONBA 4GQIA 3TQIA 2ONJA 1WD7A 1OH7A 3AF5A 2BGJA 4PNEA 5DN6D 2AUNA 3WL4A 2X8LA 4FD3A 1BWRA 1QGED 3KL4A 3VR0A 4E7PA 1LBTA 1GQRA 3A9SA 4JWTA 1I3NA 4CLXA 4RC9A 4UNPA 5DLPA 2ZUSA 4PLVA 4UUMA 1F0NA 1P31A 3QLUA 4JXXA 2LIPA 4GWGA 4Z0PA 1KSFX 2ZFUA 1VI2A 2DY1A 1JEQA 1KZYC 1O4WA 1YRHA 4R0NA 4Q4AB 4MVXA 4B40A 5ER6A 1SHJA 5CFRA 2O14A 1RKUA 3ORYA 2O1SA 4QUJA 1JHRA 3UB4A 4DXAA 1L7VC 1UM9B 1ECCA 1XK7A 2XD9A 4WK2B 3ZW9A 4ZFNA 1G4UR 1RAEA 1WSAA 2BCJQ 4WZAA 3NAMA 4ENUA 4NH4A 1IBLB 3HADA 4BVHA 3Q8MA 2JJ2A 4CCYB 3CWQA 2RC6A 1Z5ZA 5A4MS 2ZUBA 4DUYB 2OQRA 3HDYA 2J07A 5K6AC 1P33A 2VDRB 3GOQA 4PHGA 4NI5A 5HF9A 2QJFA 1YMUA 3PRKE 2QW0X 1W88A 3ZWMA 1H1DA 4G89A 3JTEA 3NBZC 1YI1A 2CSXA 2JI9A 1O5TA 3RSZA 3NJ4A 4FWTA 3SICE 2IHVA 3B2EA 2AR9A 2ZUCA 4G8BA 3NKVA 4UC0A 2J6HA 3I92A 4YDHB 2GK4A 4LWZA 4QYWA 1SZPA 4KXNA 1NRWA 1M8GA 2XKAA 5DHPA 5BV7A 1VMKA 5A03A 3SIRA 4BFLA 5T64A 3RVMA 1VRVA 5EZ6B 1FDVA 2QP4A 3V4ZA 3AR7A 3U39A 3FMOB 5JC8A 1JKJB 4WKNA 4FDMA 3N8DA 4LI0A 1CEEA 2JFVA 2CUTA 2C29D 1EBBA 1S2OA 3N8KA 4LSMA 2C99A 2DWQA 3DQZA 1OWLA 2WVAA 3CX8A 3AUYA 4XFDA 4R9VA 1ZM7A 3D6HA 4DYVA 3QX7A 5FL7A 1RJFA 1JLLA 2OQIA 1UQRA 5BNFA 5SZIA 5A06A 4NV1A 1V5EA 1O8CA 2XXBA 3N75A 1GFWA 5F7JA 5KKAA 1SCUB 2E87A 2ZYWX 5K3BA 4DWWA 1Z68A 4ID9A 3SHVA 4NCHA 4ALIA 3PENA 2H3HA 2VP5A 3LRTA 4C4XA 2XVYA 2H1OA 2DQ4A 1L5QA 3GRCA 1W4ZA 4EG3A 4F6LA 4MQLA 2RHMA 1Y8AA 3FRHA 3RTEA 3TL6A 1IK4A 4CM1A 1MCZA 4IINA 2VEOA 4IIHA 5FP0A 5JG7A 5KNBA 1S4MA 2HJRA 2V45A 2FPRA 2I34A 4IMJB 4REMA 1EXDA 1KDRA 3LCJA 3EXHA 1P2GA 1PJBA 2NYUA 2QUAA 3V8NA 3I6BA 3IRUA 1T6NA 3DZCA 4HYQA 4EG7A 2B34A 2BMJA 2H7YA 5CM8B 4AZ3B 1BZYA 3DYBA 3B3JA 3ONDA 1VMIA 3CLKA 4DKXA 5HBGA 2WZCA 2P69A 1TU3A 3PFCA 4WZ6A 2Q6TA 3ABIA 5GV7A 4EZBA 1X9HA 3FKQA 3GAZA 4V3BA 3E9YA 5AKYA 4A0HA 1MG0A 1BSVA 2C9OA 3DT6A 4MAAA 1M6VB 2X8WA 1Z0KA 3CT6A 3S8MA 2OCDA 3TW4A 5HF5A 4CIWA 4GI5A 3DHYA 1RCFA 2CWWA 1AKRA 3TL2A 3DNMA 4X3OA 4M7PA 4YP7A 2CXQA 2JIQA 4BCCA 2A1UA 4GT1A 1OH6A 4AZWA 2EJTA 2ZWOA 1GTZA 4M1YA 2IGBA 1CHNA 1H4TA 1XDZA 1U7TA 3E9ZA 5DTEA 2G83A 3IQZA 3W2EA 2IZOA 4GZLA 4RMHA 1S9HA 4Q9IA 1Z4MA 4QNRA 2BF7A 4N54A 1RLMA 4Q34A 4N12A 5K2MA 3AFOA 2A9RA 1CR6A 1TUBB 2CYBA 1UBJS 2WLTA 1WF6A 2BL4A 4I2VA 3PD0A 4KXLA 1H9BA 4QX6A 3MGGA 1SWWA 1GLGA 2NZUG 2OZLB 4JL8A 2IELA 2ZB4A 4DSTA 2AI2A 2D7JA 2QVGA 5EKTA 3O74A 4GQBA 1UFRA 7MHTA 1FMTA 3OQJA 5LL6P 1FDWA 3GLIB 4BVEA 3WAKA 3EVAA 1EVKA 1PUXA 2FEPA 5BVGB 5MN6A 4R16A 3ROKA 3A6PC 1OPXA 1DQRA 4J4BA 2I55A 1CEQA 1G7CA 4KN5A 2HF7A 5ED4A 3BE8A 2D1TA 2QLFA 2GT1A 3PHLA 4Q7EA 3UUGA 3OJFA 1E32A 5CFPA 5KUTA 1SU7A 2WT4A 3GMTA 3UWSA 5LP6B 4IJ6A 4FS3A 3OTGA 5HEKA 5JNLA 2CFSA 1UR5A 2EYUA 1YQDA 1MIOA 1U6KA 3IVMA 1Z4OA 1P1KA 3FPBA 5ILGA 4IL5A 1MABA 2OORC 4DMHA 4D26A 3EMKA 4GYWA 5IPFA 3TYXA 2HRDA 4XOIA 1JGTA 1EINA 1PFQA 2PA0A 3DW3X 3SJCA 3UV7A 5JYCA 4AQYB 3OESA 4JX9A 4ZHQF 1KYYA 4FCTA 1QNFA 3HA7A 3D4NA 3LS2A 1W2HA 1VC2A 2QTGA 2PWYA 4F4UA 3F71A 1PJZA 2VH1A 1JDUA 2ZYSA 5BYKA 2DU8A 2QN8A 4G86A 2PR7A 1SKQA 1RXVA 2I6GA 3M34A 3N0RA 3BC1A 4N7JA 4KR3A 3AR5A 2Q07A 4P6VF 3DDUA 3KTAB 4RVOA 5LQRA 1VKOA 1MB2A 5J4LA 2O8BA 1R74A 1TVKA 2PFGA 5EKDA 3BB1A 3RS4A 4YLYA 4Q12A 2DH6A 2M32A 2FR8A 4E7OA 3K32A 4B6QA 4LJAA 5HXAA 5LKRA 1T3TA 4ZVUA 1JG7A 4J7UA 1ISGA 2JFPA 3B9PA 4YUWA 2JS7A 2JJ1D 4J0KA 1FJ2A 4AP5A 3T4EA 4DG5A 2ZB7A 5TXGA 2H5IA 3AKYA 3ONNA 3SXUB 1S7GA 5B1EA 3O8QA 1EGAA 1K7EB 3QKTA 1YJQA 1L9XA 3G13A 1KH3A 3W06A 3E3NA 2WJAA 4I4TB 2BE7A 2QRZA 4JS0A 2UKDA 4M0CA 2P2GA 3FR7A 3ZU2A 2VJKA 4XYMA 4K2HA 4LRUA 3MJHA 2OQVA 1SUIA 3FWYA 3K6KA 5C5IA 1WMEA 2WZQA 4PC1A 5AVOA 1EDBA 4NDZA 2UUAB 4FYPA 4LHEA 1OZGA 2H63A 1QC5B 1L4FA 2JFHA 3CXUA 1ZX1A 3IURA 4KQ1A 1UPTA 3WLKX 3W78A 4K46A 2GUWA 5F2OA 5JU6A 1ENPA 3I04M 4ECAA 4L9RA 2D1YA 1ZN9A 1RAIA 2GCEA 1M6YA 2GQ0A 4KN9S 4QDTA 2FJ0A 3JATA 4HC4A 5AOCA 3W6OA 3CNEA 4LYDA 1XTPA 2H4XA 2RKOA 3OZBA 4WBNF 3UWDA 2CL6X 1U9CA 1XTJA 2H1VA 3QUAA 3VOBA 2BYTA 2AIRA 3OP1A 5DT9A 3W5AA 1XEXA 1PX2A 3WL5A 2PZEA 5BP7A 4KYVA 3F6SA 1IRXA 2GN0A 3K8QA 3JX9A 1PT5A 4UHBA 3ZE0B 4HQKA 4ZCTA 2GJAA 5AESA 5A0VA 1L4UA 3G9QA 1VSUA 2JFXA 2WTNA 1E3MA 5IF9A 3GC6A 4W8GA 1SIBE 3RW9A 3VR4H 1FP2A 1RJGA 1M83A 3X2EA 3TRIA 2FZVA 3GJ7A 3ZZUA 4A8TA 4EQ6A 5JNUA 3I9NA 1NY5A 3GUYA 3TK1A 3HCCA 4FW9A 4MVJA 1ESMA 5T4EA 1GG2A 5BW4A 3EXEB 1XT6A 1DFIA 4MP8A 4EVIA 3VHRA 1XVTA 2C2OA 1KR2A 1CQPA 2LP4Y 2SKCA 4MWBA 5EJGA 3FGZA 3QKUA 4LPKA 4YLGA 4ZT7A 1NN1A 1P7ZA 2QN1A 2I2FA 5L3SB 4EI7A 2OD9A 1KMNA 5LKAA 3H5AA 1ND6A 3GIWA 1LF5A 1A2KC 1UJ2A 4G09A 4QPDA 4BMNA 4X66B 2ZQYA 3EDOA 3JQEA 1TT5B 4D8TA 1OWMA 3ZJ5A 4URVR 1AUQA 1PNOA 4CGYA 1XNHA 3FN4A 1PL6A 1Z34A 4P33A 5DBHX 1PWZA 1RC0A 1U7DA 4J2HA 3DF9A 1S8AA 4DHEA 1TJ4A 4OJYA 4BN0A 1K6XA 2X3UA 4KLRA 5E6UB 1E5QA 1NJSA 2BHNA 2Z5LA 2XUKA 5CVVA 3RG2A 3CRRA 1BXKA 2J9FA 1Z6XA 3DL0A 4OUDB 4A1OA 1RXIA 1YUMA 3EZFA 4U9UA 1ZOOA 3DHVA 3DHNA 3HN6A 5KHOC 2N46A 4ZIRA 5FL3A 1ULZA 1Z37A 1T1SA 4IX1A 4EOGA 4M9RA 1SFRA 3GELA 4RMIA 2Y0DA 5E7QA 3VV2A 5MN4A 3E70C 1XCMA 2X4IA 3PLAE 4X5OA 3W8NA 4D3YA 3EGDA 3LUJA 3GVHA 4HLUC 3X1KA 3M6UA 2ZWAA 3JAMA 2CK3D 4NYJQ 4A5SA 1IM8A 1MA3A 3RIYA 3UHJA 5BSGA 4MYDA 5KQLA 4QE3A 1S2MA 1Z6PA 4I4LA 1IVYA 4BB5A 3DR3A 3ZXIA 1X13A 5A7FA 1GU1A 1TGYA 2GPJA 2OGTA 3AIMA 2KBFA 4FB4A 1YU6A 3W3AH 1VL0A 2Y4OA 3TOSA 4MDFA 5AHXA 3SF0A 1U3CA 4AUMA 2XZLA 3MWEB 4LBWA 4GSLA 2CE2X 3E8XA 4A10A 5T8KC 1CNFA 4R2LA 4GECA 2QL9A 3HZRA 3RK1A 3DFZA 5ALVA 1DE0A 1KVSA 2YY7A 1O3YA 2Z2YA 3IAAA 3F7TA 3Q88A 2IYYA 5DFAA 5EMHA 3ZQ4A 2IY7A 3G9TA 4B71A 5KHAA 1LK0A 4ZT3A 3V1MA 5H59A 3IEPA 1FW8A 3LYLA 3U37A 1Q1GA 4F86A 4HDSB 2YR0A 1O0BA 1E9FA 2YINC 3GLTA 3B8EA 2GNPA 2C9DA 1V1JA 5FOSA 3HGMA 4LSWA 3MWDB 4ERNA 1J22A 3HP1A 3U4MA 2A9JA 2B5WA 1K3FA 1K5DA 3ZDCA 1FU7A 3G02A 1J1ZA 2Q0XA 5CVJA 4BX3A 5GJVC 2ZVQX 5J2UA 3MTIA 2HW8A 2VNSA 1YMQA 3LLMA 1SA0A 4LXIA 3EPHA 2ZBDA 2FJPA 3L7NA 1DARA 5JROA 4AY6A 1KQPA 5JISA 3DH0A 3V3TA 2J9RA 3RC3A 1CZRA 1U0GA 1HG0A 1XK6A 2PVPA 4BO4A 1NSFA 1XZKA 2UU9B 5T6BA 4BEBA 4MW4A 1YDHA 3NNDA 2VQEB 1EXNA 1SXJD 3BD6A 1OT5A 3Q3IA 1RYZA 1P2FA 1J56A 4RHFA 4ZEVA 1P18A 1YL5A 1AE1A 2XITA 4RIEA 1QYIA 5BV8A 2ATEA 3DEIA 3UAZA 3E6AA 3AGPA 1SULA 2C9BA 1U94A 4ZV7A 1SUCA 5J9FA 3W04A 3WQSB 2GYYA 1Q0TA 4C20A 3ESZA 2Y8EA 5K5EA 1RI5A 1THTA 3RVLA 4IHKA 5L95A 3ZCVA 4IG4A 3IL2A 2IXFA 1YRYE 1W94A 5JDIC 4EEZA 3U7QB 3DM5A 1EGHA 1DT3A 3ETNA 1YNSA 4Z86A 3QFTA 3O8CA 3PJDA 4OHBA 5HPYB 2WIAA 3RAPR 1MXHA 2VZEA 1RJDA 1UMBB 3SHFA 3BS4A 3RYCA 1AH2A 2REQB 3EASA 3SE7A 4EBBA 1NHGA 1E2MA 2DQKA 4O4JF 2WHEA 2Z09A 3MG9A 4V0OA 4FC7A 4FMPA 4EFNA 5FX2A 1CUDA 1IY2A 4G5XA 4M8KA 2D06A 2HPAA 4QLBA 3VNQA 4G4IA 1SUDA 2QT1A 2FRXA 2ZDQA 3HHEA 3NHBA 4L16A 2C9YA 2NZXA 4X1YB 5C7YA 5DI3A 4LTMA 1N5DA 2IS2A 1H9CA 2XCOA 2P9EA 4P3NA 3T3GA 2P78A 3BMCB 3VO1A 3G0IA 1L3IA 5CDTA 1T9HA 1O95A 2QZSA 2WYHA 4M0EA 1DQSA 3F3SA 1AD2A 2XSZA 3W4IA 4EHAA 2Z5VA 5JH7A 5KVCA 1XLWA 1XEWY 1XF1A 2QAJA 3TECE 4DJEC 1YS1X 1Z4IA 3P2KA 5F5NA 1GPDG 1Y7HA 2WJWA 3BQ9A 2QZ4A 2VP4A 3BKXA 3MHPA 4JJGA 4S2EA 2C7PA 1Z2DA 4Q03A 4D8XA 4DLYA 3MWFA 4PINA 1IOLA 4QPJC 1JJFA 3KYBA 4NAVA 1D8TA 1E6KA 1G21A 3DMNA 1LDNA 2PIAA 1NLZA 3AEUA 2FV8A 3MN1A 4URYR 4E6PA 5IJWA 2FU5C 1ZNZA 2WFAA 1UIRA 4Q4JA 5TR9A 5TVKA 1I2AA 3BE4A 2PV7A 2PRZA 3AESB 3PEEA 3BHNA 4MNTA 3PFFA 4UVDA 4R1UA 2Y2UA 1T9GS 2PXCA 3RS8A 2I4MA 2NV0A 4IJWA 3GEIA 1NYLA 1ZD2P 3PYMA 1KO5A 1NJ6A 4QTXA 2X5OA 5TVGA 3WGGA 4Z2YA 3UAWA 3U1TA 3C3JA 2OV6A 3WBJA 3EVCA 3M2PA 3NTXA 2HBYA 1DC4A 4LWOA 3TE7A 4A92A 4DCCA 3MRVA 5HUJA 4UBMA 4QAJA 1U1EA 4QRDA 3VR6A 4IZ6A 2KLBA 3H1EA 1QF7A 2YZGA 1ZH8A 5ENVA 3HI6A 2CT8A 3A26A 4J1SA 4R8VA 2XZPA 2RMKA 1XJCA 1UXKA 2VHEA 4XH9B 4FLFA 1V6AA 3RR2A 1FFHA 2J8ZA 2QJWA 3FVWA 3U7HB 3LYHA 2CN1A 4MGYR 1GEGA 4Z54A 5C3UA 1M2KA 4J43A 5FYDA 4P58A 1M74A 3JSAA 4K6OA 1K8YB 5TS2A 1KPHA 2HK6A 4NFYA 4AXXA 1M76A 4NJEA 2FAXA 1A2BA 4YRCA 3N3BC 5KU1A 2AW3A 2QORA 3CEPB 4TTQA 5HFAA 4ZEWA 2W90A 5B2FA 3SQWA 2R7LA 1RM3A 1LC0A 5AK5A 4N41A 1C3VA 2Q4DA 4X1YA 4DJFC 5HDQA 4ZTBA 3WL3A 3I1YA 1U8EA 4G36A 3UKOA 1DOAA 1DRKA 2HEGA 1MHPA 2B1QA 4PLGA 3D1JA 1S4QA 2HHHB 1RAFA 3DT8A 3IUQA 3R8CA 4EUHA 4QTYA 4HAYA 4YI3A 3VRHA 1AO0A 4DV6B 1PGJA 3S1SA 1C4OA 3VSCA 1A7KA 2P27A 3DV0B 3FYCA 3V8EA 1YVPA 4D9GA 4DREA 1N5IA 1Z16A 2JFZA 1E1LA 1GGKA 3M4JA 5DX8A 3TSZA 4HFMA 1IWPB 3PC4A 1OPRA 2G28A 4PZAA 3WDMA 4E2WA 2NG1A 5IT5A 4J29A 1VKNA 1U0LA 8LDHA 5K0TA 1PZXA 4EABA 3UJNA 3K8YA 5BWMA 3JZAA 3PUWA 1E7SA 5E9WA 3ZTTA 2BZSA 2O19A 2C9MA 3BQMB 2Y71A 1CZNA 1JSXA 5AJXA 4PS1A 5GONF 1MIHA 4EVQA 4XLTA 4IDAA 2OG2A 3VH3A 1U5AA 2AOTA 3W4JA 3DA8A 3L9XA 4C1NA 1P44A 1WTAA 3PA8A 3T3IA 5DXAA 4XRGA 2G9RA 3TNDA 4ZAWA 3AX6A 4D4HA 2Y4NA 3KVOA 1MRNA 1C8KA 3O7MA 1R0RE 4EX6A 3LPLA 2E0IA 4N3AA 2V6MA 1WU8A 4XVCA 4DUZB 2YZMA 9ABPA 4HZGA 3EIEA 2H5LA 4C0WA 2R6R1 3H18A 4ALLA 2EKPA 1Z33A 4LYGA 1WWKA 1BYUA 4OEHA 4LJYA 2ZRBA 1PJTA 1A8UA 1PZFA 5CFOA 4UBOA 2UVDA 1DMSA 5JVDA 1R6XA 2Z4RA 1E7RA 2BEWA 5BNIA 1BFDA 3ANXA 3BF7A 3PPYA 3C5WP 2HPHA 4M86A 4NFLA 4UMDA 2PNFA 1P5FA 1TZJA 4MWCA 5B7GA 5KOYA 4ZYTA 4NYIQ 1P0QA 2ZVDA 5E1OA 1K7XB 2IIPA 1KYWA 4DBVO 3LL4A 3UHOA 4B73A 2B1IA 1Q1EA 1P81A 2GTPA 1BU8A 2B7BA 2GDJA 2H52A 3MJ4A 2EFHB 1N4DA 2JFOA 1I5EA 2NSLA 3OWXA 2M9MA 5LYJA 1DAIA 2ACEA 1EM6A 4LOKA 2XMZA 4WXHA 3OQNA 3GHYA 3HHPA 1UPFA 1JNYA 1XTIA 3GRYA 2FNAA 4P4SA 1SB9A 5TSDA 2JANA 3CUTA 3ANLA 2QI9C 1WULS 1Y1RA 1B74A 4XUDA 3KFXA 4ARIA 4EY6A 5KYKA 3GRAA 3I5UA 4N0EA 3W1VA 1HC7A 2J3JA 3AU8A 3R3XA 3PFHA 4FCWA 4GP9A 4MA4A 3P2EA 5E9AA 4PZYA 3KSDO 1YB5A 2B2CA 4EENA 4B45A 1C7RA 3GVIA 3PX2A 5ALIA 3RUEA 1CZHA 4J75A 4D8YA 3KR1A 4DWOA 3KC2A 3CH5A 1VRWA 1L8QA 2WF6A 3EMBA 4ZI5A 3P20A 1DHTA 4D9EA 1ODCA 2QX6A 1GUDA 3AP1A 3Q5DA 3N2LA 5HGJA 4IRXA 4Q3LA 4DS3A 3OETA 2Q21A 4R01A 4P4UA 4JUIA 2I4RA 1A0OA 2EQ5A 2FKNA 4YJ2F 3T9DA 5BT8A 2TECE 2R6HA 2WWHA 3C1UA 3CKMA 4JSTA 4Q3CA 3FDJA 5K0LA 2IEDA 1COZA 1AN9A 1FP4A 5F1PA 4DILA 2QM0A 4EF5A 5KNDH 2A67A 1XTVA 2IQ5A 3H7AA 5KMGB 3MAJA 3TQRA 3H2JA 3HB7A 5CFNA 2DBQA 4QKQA 4UTZA 4HNHA 1K5GA 1ODSA 2Q5FA 3EIXA 4KX5A 1OVMA 2YMLA 3KLPX 1TLTA 5IKPA 5E1BA 3WGTA 2OENG 4HQFA 2VYVD 4IWXA 1ZGZA 3O31A 4L8LA 3DE6X 4YYZA 3DKRA 3U3ZA 2OV2A 3A1VA 3FDFA 4YFYA 5IFKA 1XJQA 5JZBA 2BEWB 2ZYHA 5EHXA 4NWIA 3NG1A 1SVMA 1UFQA 3T5BA 1JKXA 4YH1A 3T5GA 4JYMA 2P9CA 2WUWE 4KPGA 5EKXA 1ZHFA 3KEMA 3EBLA 3ZHVA 3LIPA 2OHOA 2ZXEA 4DLPA 4B1FA 2WWWA 4TWRA 4LZWA 3L02A 2W2KA 1USIA 2C2YA 3GBVA 3IDAA 3JARB 5AW4A 2CL7X 3K1AA 3T34A 4LNAA 5DOZA 1ICIA 2F17A 2IL1A 3QPDA 5MGNA 3CKLA 4HEQA 1S6YA 3GPDG 3MT8A 4F5ZA 1Y37A 3ZZMA 4K9MA 1SBYA 6GPBA 2B8JA 3MGCA 2VTKA 4EFLA 4B3XA 5GWXA 2ZAIA 3ONWA 2BGTA 3OPVA 5CTJA 3VZDA 3WMXA 4AVYA 4EW3A 4EWLA 1E6EA 2NW6A 1SCKA 2VHYA 3IOEA 3MBKA 3HYRA 4OB8A 3RFUA 4EITA 1WSDA 3HY4A 2BFDA 2BZ1A 1ULUA 1KEVA 1PFWA 4KR2A 2PT6A 1MA0A 1CUFA 4XWWA 2PBRA 4B79A 3U3OA 3UAVA 4BZWA 4KO3S 2V7EA 4DG8A 1MLDA 2E2WA 3FCSB 3NOQA 3E84A 2J3HA 4MI6A 2AMJA 5IBCA 1R8YA 1RKQA 5EIAA 3BIFA 4AN0A 1RBQA 1DC7A 2G8NA 2VRWA 4HWGA 4JBGA 3AT1A 2WJJA 2QX7A 1PGPA 4CKCA 4E94A 2Q46A 1W47A 5IVDA 4KZPA 1AKYA 1NMEA 3K20A 3L7KA 3EMVA 4EDFA 3W5BA 3QJGA 4CEIB 3UUFA 1VL2A 1VLJA 3A1DA 3ON5A 3SI7A 5JNTA 2HOQA 4YT2A 4NPCA 4NCXA 3A58B 4QWWA 1WBBA 1W73A 4DQDA 2AZ4A 4RD1A 4TLDA 3OJOA 4ARSA 3G79A 1YA8A 3Q3GE 5CR9A 2PRSA 1E1DA 4UTOA 3INTA 1EFPA 3GPBA 4LDQA 4BO8A 1O0CA 2M98A 2DKFA 1Z88A 3AFMA 1NVVR 2YJ4A 1Y7PA 2P8JA 1WNTA 2L19A 4BNMA 5C5DA 5HKOA 1EUQA 3M1LA 4MB6A 1WNFA 2G9NA 1ZINA 2NGRA 2P5SA 4RADA 4TTVA 3V1TC 4HAOA 3WGKA 4OK5A 1CUCA 1F06A 1RKBA 4BO6A 1LX7A 1IM2A 3HNOA 1C3OA 2I2CA 4NECA 121PA 4OSPA 3H11A 4G5RA 4B4KA 4ND1A 3ZDBA 3PHGA 3S27A 2QRVB 4Y7DA 2IYLD 5DSTA 4GG1A 3FZGA 3IP8A 5DH9A 4QPPA 3TE6A 4R98A 1PJCA 1K89A </