3S5UA

Crystal structure of crispr associated protein
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
212
Chain Sequence
RVNFSLLEEPIEIEKATFLTIKDVQSFAHLVKLIYQYDNELKLQKGLKPTELFVVTDILGYDVNSAATLKLIYGDLEAQLNDKPEVKSMIEKLTGTISQLIGYELLEHEMDLEEDGIIVQELFKALGIKIETTSDTIFEKVMEITQVHRYLSKKKLLIFINACTYLTEDEVQQVVEYISLNNVDVLFLEQRVVQNRFQYILDENFYLSYEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of clustered regularly interspaced short palindromic repeats (CRISPR)-associated Csn2 protein revealed Ca2+-dependent double-stranded DNA binding activity.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Dna binding protein
total genus 61
structure length 212
sequence length 218
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09711 Cas_Csn2 CRISPR-associated protein (Cas_Csn2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11940 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s5uA01
3TOCA 3V7FA 3QHQA 3S5UA
chains in the Genus database with same CATH superfamily
3BOSA 2XD4A 3EZGA 3WAKA 1UDCA 3L4BC 3H2KA 3UENA 3IEVA 1DEXA 1OV4A 3DDNA 3ZXIA 1O0BA 2F48A 4PX3A 1AKEA 4ARBA 5EZYB 3WLRA 2DAPA 2I1QA 1EXWA 3LRTA 5EZSA 3GC6A 2EBFX 5A5VA 4QYIB 3NBFA 1BSVA 2ZBDA 3R8CA 2K2QB 3B60A 4FFNA 2QZSA 3JZMA 2GTPA 4LQDA 2J87A 3U3KA 4QQ8A 2VHQA 2GVDC 4DLSA 1PL6A 4JK3A 1QV9A 1M0TA 4WKNA 3ZH9B 5AT1A 5K0ZA 3QBEA 5LZ4A 1MDFA 3FXAA 3HP7A 4AIIA 1IVSA 2FDXA 3AZPA 1GSOA 2ZDQA 4L3WA 4QICA 2VT7A 2Z6QA 5LKAA 3KLBA 5BWLA 4B09A 3QGMA 3EEOA 3KJEA 3H2JA 4QNNA 2JD1A 1XIVA 5DHFA 3L8FA 2X1HA 5BW5A 4FHFA 4MLDA 3E58A 3UJCA 3IYLW 4ZZ0A 1GEEA 3MBOA 1E3JA 1ZXXA 4DRYA 2HWUA 3RCBA 3F4LA 4MV6A 2ECKA 1PJLA 1YRHA 2RHHA 1GVNB 4CN8A 4N48A 3RGWS 1NR7A 3RADC 1AS3A 3DBHA 4DCOA 3UBTA 3C7KA 3W2GA 2CE7A 5CLFA 4OL0A 1XDGA 1KFCB 2E48A 3QXJA 4DAEA 4GYJA 2IYSA 1YCHA 3B78A 3EZLA 5ERYA 3V42A 4YRSA 4CEIA 1KO7A 3DYBA 2CYAA 3WDKA 1UPCA 4ZU3A 4J03A 1EDEA 5HHTA 4JI5B 2VKQA 3A4LA 4WA8A 1IUNA 1EFVA 4OX9B 5IDQA 3B3QA 1ZJ5A 4EMBA 2HR1A 4AROA 2X23A 2RAFA 4HAVA 2MCFA 1V6SA 3L6UA 1LLCA 1G18A 1NVGA 2AA3A 2H0QA 2VO1A 3ZDXB 2O7VA 3PJEA 3QX9A 2CUNA 5CNJA 5LXTA 3DP9A 3HJCA 3I72A 5D6OA 3LP8A 1KYQA 1ISFA 3H2YA 3HB1A 5FH9A 4FFVA 5HQ3A 2DH5A 2XVZA 4NPCA 3S5JA 3I4FA 1TCVA 5B37A 4BVFA 4J0JA 4DVGA 3EUAA 5EIAA 1O03A 1A4RA 2O3SA 1QP0A 2WJYA 4ZV7A 2ODBA 1UBEA 4XFDA 3VA7A 3JYHA 1MH1A 1RE0A 3Q3CA 4GSYA 3WMWA 4JYAB 2N75A 1RYMA 3WNDA 2WNIA 2OCDA 4AXXA 4GDMA 1E79A 2VC2B 3GT4A 1XTJA 5ALWA 4NG4A 5HTKA 2X8JB 1D7AA 1JZQA 4YUZA 2ZM6B 3G2HA 3RT1A 2G5CA 1M1ZA 1II8B 3BCUA 3N5KA 4ZO4A 4OUKX 4LY3A 4E5MA 2FZ4A 5I7VA 4NVRA 3M3DA 3DAFA 1OBCA 1HQCA 3VNRA 2O2DA 1OASA 3G02A 1DJOA 1XDSA 2WAXA 3INTA 3JU3A 1ZJZA 3D1LA 4WXPA 1K86A 4OX9Y 3PUXA 5G1NA 1G1AA 2FMFA 1QVRA 2YQZA 3BFJA 5EMNA 4KHPB 4LWPA 4AURA 1HE4A 4OI1A 2UXCB 1QC5A 4IP0A 4P4TA 1HDGO 5TGZA 1SXJA 5SZHB 4RKEA 1DJLA 2YCLA 4NK4A 2RHOA 3DV0A 3QITA 4K26A 5JS1A 1RXUA 3T5MA 2DQSA 2F17A 2IPLA 3F9IA 5BWBA 3RSGA 1FMJA 1RSZA 4V0RA 1A5ZA 5DTQA 2C4WA 4B6RA 4BVGA 5KX5F 3OPYI 2EQBA 3K2EA 5FX2A 1RXWA 5I3ZA 2LDXA 2LR0A 2FPOA 2GLTA 3CUEF 1GJRA 1QRSA 5E4TA 4X64B 4QRHA 2OCXA 4CLOB 3AJAA 3EIUA 1K88A 3V8BA 4GD3Q 3ZHUA 5I45A 2IHBA 5DLQC 4WCFC 4KGVA 1FFXB 2HX1A 3ITNA 3MINB 5L3RA 1GZUA 4E2ZA 4BY9E 1KWGA 1ZWLA 4WXHA 1HSOA 5FTJA 3THYB 4F12A 4GDFA 3IDQA 4UDOA 3A2LA 2DERA 3FR8A 3BTSA 1AKRA 1AHHA 3AESA 2DLNA 1UL1X 2HFKA 4ZYUA 4PCAA 3KSAC 1QGED 4RJ2A 5EN4A 4EFLA 2AMLA 3ZD7A 2O3TA 1UOEA 1U1GA 4HL6A 3HBMA 1FDWA 1I2CA 2VTBA 2PZ8A 2Z1MA 5AVSA 3OI7A 1D2GA 2O1SA 4LGYA 1MFZA 4DY6A 1V96A 1VXRA 4RNDB 3T3HA 2XMCA 3RUPA 1V2GA 1COWA 3OIYA 2LKDA 1N1GA 3CGGA 4G5GA 5TQ0A 2PSJA 2QTVA 3ILXA 3EHEA 3PIIA 4BC1A 4BV9A 2NACA 1I2MA 2JK0A 5EMKA 3DONA 5KWVA 3AVVA 3RIMA 1YB6A 5IJXA 3KKZA 4J16A 4UNSA 5CDUA 5JWOA 1NMSA 1D6MA 1XAJA 3F6SA 2IBSA 1GUFA 3OIDA 3Q7RA 1OC4A 5I4KA 3C3YA 1Z06A 3A6LA 3UCFA 3RAFC 3AP2A 2FPXA 1PQPA 4FMCF 4X85A 4PWZA 1HTWA 4JVNA 1ZIOA 1W88B 3CWZA 4A8TA 5ICGA 5KYYA 1U5AA 1FLNA 3MTEA 1J6UA 5ANRB 1Z0FA 3NVAA 3WK4A 1JVNA 4MPTA 3BL5A 4MULA 1DDOA 2E6UX 3L6CA 1QK5A 2CMKA 4FFBB 4MW1A 1OH5A 2IYRA 4H3KB 1MD9A 2W0SA 3TQHA 2AQIA 1IFXA 3ABRB 3GF4A 1P3Y1 2ZSFA 1K6MA 1O6BA 2Q99A 4YRKA 4FBMA 3QOXA 1FFSA 4XPZA 3G0IA 1YA6A 3IPXA 4HDQB 4PFJA 1RZVA 1KETA 4IICA 1W5SA 3ZXSA 4X20B 3QPCA 4HZGA 1E3QA 2A7XA 2BGNA 3NIDB 2RKBA 1Y6FA 1SQSA 1COWD 2YVKA 1PSDA 3W9SA 2G76A 1EHCA 2MWMA 4V02A 1Y33E 4G23A 3SE7A 5IWAB 4L5AA 3UJ6A 5EJ6A 3HTXA 1ZINA 4FMPA 4M4SA 2G04A 3P2OA 2O1WA 1PR9A 1V4VA 2ZI9A 3OP4A 2B20A 4Q1DA 1V8ZA 2AI2A 3WV4A 5HS4A 1JDJA 3OHMA 1NRJB 1VP3A 2QI9C 1NJFA 5H3LA 8LDHA 4IXWA 3S4YA 1NT4A 1Z18A 1T1JA 1WABA 1T9BA 2WTXA 3KOYA 4D9NA 2GN1A 4F4HA 5TDHA 1NY6A 1BH6A 2IXDA 5JS6A 4ZREA 4NBWA 4PW0A 3OCUA 4N3GA 1M7BA 2ZWIA 4RCYA 3MJDA 3IVRA 4X7MA 2HQ1A 4RH3A 3VKUA 4DCGA 3ZY4A 1M34A 2PS9A 3DL4A 1M6VB 1SOUA 1NBMA 1X70A 4RZ3A 5T57A 4EB6A 1L3BA 2PRYA 4UOZA 1O6CA 3PE3A 3N86A 4ZIRB 2UYCA 2VBGA 3AIKA 1GOTA 2IIBA 1ZMOA 4A8JA 3V6MA 1J56A 3LI2A 2CC2A 1E3TA 3UA3A 3V4PB 4HVTA 2WQ6A 3MJVA 2I33A 2OYRA 5EWJB 2F8SA 4EHKA 1HK7A 2RGYA 1E5XA 2BFFA 4HLNA 2VNJA 4F3NA 3TYXA 4JGBA 1XZIA 3O82A 3VR0A 4UUOA 4BMSA 2H7XA 2WYVA 2ZT6A 4J1NA 3FMGA 3IV6A 4M8LA 3LMKA 3R24A 5LP6F 3AXSA 5DGDA 4CL0A 3IP5A 1FFAA 1P18A 2DPYA 2PMEA 3WKBA 2D5BA 3GY0A 2C84A 1IZ7A 3A1FA 4UFPA 1OVMA 1EK2A 1KAHA 3HCEA 1JEJA 4P36A 1USKA 1OX6A 4BQRA 5F7XA 3U80A 1UBLS 5IJAA 2B25A 3KQMA 2R96A 3PD0A 1JU9A 2ICAA 1GCUA 1N6PA 2WUGA 4HCJA 1P7PA 1QE0A 2LBPA 3BMNA 5EXXA 4CKCB 1N0WA 1DXQA 5JMPA 4EB8A 1BDIA 2LDBA 1GN8A 2VWQA 5GONA 1L7MA 1QFZA 1IU9A 1DJPA 4KE7A 1E9FA 2P0EA 3G1TA 3FPSA 3R0XA 4IIXA 5CB8A 5KNBA 2H59A 2J45A 1NBMD 3UHOA 2CWWA 2Y1EA 1C9DB 1S5PA 4HJRA 4P1ZA 5ALSA 2OXTA 4BVJA 4Q7MB 1JA0A 1SGWA 2Z6VA 3O3CA 4UBMA 1E2KA 4HVLA 2VRNA 5MF6A 2DFTA 1NSYA 3I6QA 3PIDA 3UYLA 4ZOLA 5HUQA 1JPNA 3E8SA 1Z4KA 2RHTA 2AV6A 4RV9A 3DEJA 1HNXB 1S2MA 3D4NA 5G02A 5CDFA 3DBOB 3KQUA 3K6SA 5KMGB 4JLOA 1SVUA 2XEXA 3PC4A 1D8TA 1E5QA 3L0BA 3LLMA 3WLAA 4PN3A 3VKGA 1G55A 5BMOA 2IITA 4O4JB 3VJRA 1GA1A 5HIIA 5A5GA 4YRBA 1SD1A 1L8XA 3BILA 3WHLA 3AVPA 1WQ3A 1HKHA 4NYIQ 4QUIA 4D02A 2CSUA 1TU0A 4YRAA 2ZXEA 2VA8A 4CM8A 3ZZ1A 2Y27A 3MOIA 5EXTA 2Y92A 3WYDA 2CDNA 1XT6A 3AUUA 3L7KA 3THXB 3MD9A 521PA 5KYVA 1VJRA 2FETA 3VC3A 5KKCA 4D8WA 1ZI8A 3T6KA 4BLRA 1QHHB 2FK7A 3CLUC 5L8VA 1K3TA 1XRNA 5F5NA 1TQ2A 2WHQA 2B94A 4KNWA 2WWRA 5TY0A 5JECA 3DE2X 5BPHA 1ZRNA 2G36A 4MWEA 4Q3NA 3LY9A 4BNGA 2B21A 4WKGA 3IJ5A 4MYTA 1VBMA 2EVWX 2MR5A 2BPOA 1DAEA 2BZ0A 3M5PA 5EHZA 5KNBD 4E7OA 4A7PA 1RWQA 1V7QA 2V6FA 3UGKA 4G65A 4ZDWA 3HYSA 2OR3A 4BNWA 3QK7A 1SZPA 3BD8A 1P2GA 1YR2A 2CXPA 2H5LA 5CIQA 3LLVA 1JYEA 1KQFA 1QCZA 3KFVA 3SF0A 1XZFA 2RGNA 3CZ5A 4HGQA 4QBFA 3T06B 1TYEB 3WHKA 2JLWA 1R4NA 3M4YA 3EYWA 1B73A 2QS9A 4ALJA 5C35A 1ZCZA 4GBGA 4GUDA 5JXIA 2ABWA 4IS3A 4HRAA 2XGGA 4DXAA 1KYYA 1T9AA 1GNQA 1IL0A 2FSVA 3M4ZA 1QGDA 2OCPA 2RIPA 3B9RA 4L6AA 4Q4HA 4WZAB 3MMZA 4X54A 3BM5A 2PKYX 5TMEA 3VNVA 1GG9A 4CTMA 2W58A 2HMVA 3HVHA 1LD3A 3CCCA 2M1ZA 4K6KA 3TGLA 2VP0A 3I12A 3CS3A 4I36A 2AMVA 1NT2A 1Y34E 1CNFA 3L7AA 2HUPA 1DVRA 1S1MA 1G7SA 5CJ2A 4UM9B 5FEUA 4XTRA 3RU2A 5A3VA 3VYRB 3K16A 1XK7A 3E9EA 2GK4A 4YY3B 2VDVE 3N8IA 2HJRA 2HUNA 5BORA 4QJ5A 5L4NA 5BUZA 3NBYC 4LE2A 5CB6A 3HJAA 3WSVA 3LSYA 1NN5A 4LSMA 3TKAA 4IQ4A 1SG9A 3WR5A 4DBVO 1WXQA 4Q9LA 3F6PA 3G2PA 4HGNA 1IJEA 1WDLA 1U2EA 1SUAA 1N75A 2JPDA 4MAAA 4MRNA 5CPFA 4DTIA 1IWPB 2IPOA 2Q4BA 1ZIPA 3ZZTA 3LC7O 4EHDA 1CB7A 1O95C 1F2UA 2EWWA 3F5DA 1IQUA 5BXYA 1UR5A 4W99A 1IK6A 3WLJA 4JENA 3BHIA 4BX3A 3NRJA 1O89A 3NM4A 5IBQA 3G1UA 2D0IA 4GXRA 1L5SA 4N6GA 1X7HA 4EUNA 4DJ5X 3L7CA 1A9RA 1OA0A 2EZUA 3C24A 2RGBA 4H77A 4O5AA 3T99A 3I5MA 2OCKA 3R23A 3JZDA 5IKOA 3TOCA 4BRUA 2VHCA 1FYXA 3K1JA 3OA2A 3VFDA 4ZEWA 4F96A 4AU1A 2BFMA 3HNRA 3TQTA 1CY0A 1RYNA 2YYAA 1DGQA 4PX9A 2WY2D 3BN3A 1T4CA 3CSUA 4JUFA 3ROKA 1GTMA 2YASA 4X1YB 1U3UA 2FMUA 1U98A 2GJKA 4B34A 4CG0A 2DJIA 2F1IA 2WLTA 2ZXFA 5KOHB 5D2CA 2VHUA 3KKEA 4PSKA 3R3YA 1MIOA 3CRNA 3A2MA 1VJTA 1T3HA 3DM9B 3E9DA 3I6IA 3LKVA 3TGWA 3O7MA 1VE1A 1PR6A 3PQFA 3MG9A 3F7OA 1UT8A 3GD7A 3IPCA 1KZ9A 2ZB4A 3QF7A 3ZNNA 2JLXA 1IHUA 4I1YA 4CG3A 4M1QA 3GRRA 4E11A 5K0EA 5HGXA 1VYUA 2QRNA 3HWWA 3R1IA 3VR3A 2HTFA 3RWMB 3PNYA 4O0LA 1AQLA 2Z3ZA 5JMTA 3UICA 1GPWB 1K1EA 2V8BA 3NAMA 1KKLA 4QOSA 4I4TA 3P0EA 4G1VA 5JD4A 1I24A 4NH4A 3A4VA 3OFNA 4A91A 2ZG6A 2ZB2A 1VJ5A 1MT3A 1XRRA 3DWIA 3Q7QA 4D4JA 4DLNA 3BCHA 2I8LA 4EHBA 5CG1A 2ZRLA 3TF5A 1WB9A 1U2SA 1XDBA 4YQYA 1VRWA 3FCUB 4D0GA 1GPKA 2ILVA 3W8DA 3OCXA 5C46F 2P4UA 1NG9A 3MJTA 2BIFA 2DFLA 2GKOA 2AUNA 3TR0A 3QLTA 2G5PA 1HEUA 2YJTD 1L4UA 3FVVA 3VSEA 4YPVA 1OLXB 1J9GA 4M7RA 4ZI5A 5MN5A 5DW0A 3H1GA 1TM5E 1OYOA 4LOLA 2Q3CA 2BT4A 1N9KA 4AO8A 1ZU5A 4D3YA 3COWA 1SBQA 1AV7A 4O1MA 3Q12A 2JJ2A 4HXEB 3ADPA 5T8KA 2I3GA 3QLVC 4D8XA 2KSQA 2OHOA 3D1VA 3OCYA 1UPBA 1JAIA 3E1GA 3FKSA 4TTQA 5IZCA 4K9LA 4X91A 2I7XA 4CG2A 4KXLA 2PH7A 1UBTS 1CY1A 3CUVA 1QIMA 1ST3A 5DT9A 3VR3D 2EP5A 4C7BA 4G6ZA 5E9WA 6NULA 4B35A 1Q84A 1YULA 4OIMA 4AL4A 3PHBE 3SAJA 4JI4B 2YR0A 3BDAA 1YNOA 1MG5A 2QTHA 4MWGA 5F2EA 1D2NA 3CRQA 5AM2A 2B36A 1O96B 2JIOA 4D81A 5I47A 3AR4A 2PRJA 3FPAA 1OGYA 2Y0CA 3OFND 1Y4AE 4GYWA 4YECA 5CT5A 1EE9A 2DFNA 3WRXC 3LZ6A 5ALOA 3WQHA 5MN6A 4N5NA 2NU7B 3F46A 5CR9A 4NBNA 4QQNA 2JG3A 1R5OA 1YIOA 4Z99A 3FWZA 2AXQA 4H7PA 3CVJA 2HCBA 2XWSA 3HC7A 3K05A 3LF1A 4M9ZA 5CU7A 2CHQA 1EMDA 2D1SA 3QXSA 5KSZA 3VGJA 2WTMA 1P1RA 5J2TB 3TDNA 4N0PA 3BXPA 2I3ZA 3KL4A 3PX2A 1T9KA 1TYZA 3CBQA 1FIUA 1YRLA 3IQHX 1XZ8A 4UMDA 1YS4A 4YRZA 3PFBA 1ONOA 3O9MA 4MVJI 3ZHQA 5CFOA 3I6ZA 1F4VA 2EKZA 3PC8C 3SHOA 2AX3A 3L8YA 4JUBA 3RYCA 1X92A 4HD8A 1BKYA 1ZJJA 3ZI7A 3I2KA 1BRMA 2JJ2D 4MA5A 1ACJA 4RVFA 2EZ4A 1Z34A 1JR3E 1RMQA 4BLWA 1ZZGA 5GV7A 1AQYA 1E5TA 2J07A 4TMZA 3UN1A 2X14A 1VOTA 1P5FA 5IAGA 1C14A 2C2GA 3D4PA 3OURA 1Z5OA 3LHFA 3RSOA 5KX5B 3V1MA 1ID8A 4OMCA 2BY4A 1E62A 2HEIA 5FTLA 2OECA 3U5ZB 1HI9A 4FOOA 4NAHA 4ZDKA 1DCFA 2ZI5A 4RENA 4X1KB 3TCNA 1E61A 1LW7A 3UJDA 2GWHA 3RFVA 2Q3FA 5AI5A 3IGFA 1ABBA 2JGNA 1V26A 1XAIA 1W35A 1WDMA 2ZBRA 4YXFA 5H81A 2ODAA 3AILA 4YDHB 3RRXA 2MMGA 1DBRA 3T7JA 3TL6A 1KVUA 4J7XA 2BCJQ 4N41A 1NNI1 2FUKA 3V5NA 3PKZA 4C6TA 1HEIA 2WA2A 5CT6A 1IH8A 4JSTA 3VYSB 3ZY2A 1DAMA 4KAAA 2PJZA 4V0NA 3UT0A 2GPWA 1HM5A 2O57A 1TXGA 2AEMA 1HDXA 3HFSA 3DFMA 4GI5A 4K9MA 4R1OA 1UBFA 2ACEA 2ZI6A 3LQ4A 4RCVA 5DNCA 1Z4MA 3WRWA 3GDWA 1QHFA 1RJ9A 4YUXA 3S1SA 2WIBA 3ESAA 2XYRA 2XVYA 3KLPX 1KSFX 3QYAA 4L3OA 4P82A 4RPCA 1GPDG 1NI4B 3RK4A 5GZ3A 1C1XA 4PYMA 1N5RA 4CM1A 3TO5A 4DQVA 1BAPA 3HUEA 3QF4A 1GT91 1YR3A 3U48A 4EHAA 1L4FA 4Z9XA 1Q0HA 3EVBA 3WGUA 3ICVA 4JA2A 3U19A 1QGZA 1B2RA 2Y1GA 3KUUA 2D2EA 3F5FA 3MYRA 1MN6A 4M0MA 2I80A 4UZFA 1U1IA 3TTTA 1QTQA 1O77A 2JLVA 3NOOA 4QSMA 3MPOA 1IQPA 2B4AA 3DAOA 3P9CA 5FBWB 3Q88A 4RK0A 3EB9A 2H5IA 4E3ZA 1SVNA 1V5WA 1EDOA 2NVWA 4E31A 5IP5A 3AFHA 5T6MA 3TZLA 2QLTA 1G2PA 2C29D 5LLSA 3GRZA 2IH4A 4TTIA 4RY9A 5FPYA 1TKCA 1YDEA 2W90A 4G37A 2WJHA 5BSMA 1JZSA 2K6GA 4IDNA 3D4BA 2PT5A 3UWDA 1KOLA 1KU6A 2AMFA 1QANA 3KO8A 4KO4S 1ESMA 2I2AA 2ORED 4HAOA 4QEZA 4Y9RA 5HBGA 4LDJA 1W5EA 1Z47A 2OORA 4WINA 2GJ4A 1SA0A 3OX1A 3MC1A 2DETA 3MUNA 4N54A 4K8RB 4K9DA 1QV6A 4HEQA 4LQ4A 2R8ZA 4DV6B 5EIOA 1XEXA 3B13B 4ZVPA 1INLA 3CEHA 2Y1KA 3DE4X 3ETCA 4UTOA 3TAXA 4QPZA 3RIHA 3BMCB 2VHEA 2B35A 3H5TA 3L4SO 1C7FA 5EXPA 1P9OA 4F86A 5F33A 5DM70 1MH9A 1NW7A 2BFOA 1ZLYA 2O8VA 3NR2A 1RHQA 3WMEA 1XU4A 1Z7YA 1E9BA 1UCFA 4FHGA 4K6CA 4L74A 5ALDA 2JZOA 3SXUA 2J3LA 2ZBGA 1UXHA 4ISBA 1SJ9A 1IULA 4LPKA 4DCSA 1K5GA 3T5AA 1WP4A 2ONZA 3EF1A 2D06A 2IYOA 3MSCA 4JVOA 3EULA 4UTPA 1DAFA 1IC6A 1V7CA 4CNQA 2E1RA 2W6MA 2OHHA 3F6RA 3L7DA 4Q02A 4OFBA 4CDNA 2PUFA 3K70B 1UBKS 3R6LA 4M37A 4YMIA 1F7UA 1DBSA 4QAJA 3MAGA 4U0KA 2FN3A 3QM1A 4W7SA 4XSGA 4KYUA 1NVEA 1U2ZA 5JAHA 4BXOA 1JNXX 4NNPA 1YQXA 5KYNA 3PNVA 1IIBA 1P6UA 1Y3BE 4WZAE 1GGFA 1UBOS 1WHTB 4KO2S 1C7JA 1UFQA 2VAPA 4LV5B 2VPPA 4UU8A 1MB0A 1UAYA 4ARZB 1IXYA 2ZS8A 4JBGA 1U8YA 5AKEA 1JH8A 5HSGA 1XI2A 1TX4B 1P2VA 1K7FB 2A86A 2KBEA 2VK1A 4CFSA 4CRWB 1JDTA 3AY7A 5ITZB 3COYA 1AKTA 1D3AA 4IIHA 2AN5A 4R6WA 1PZNA 3RAGA 1QVWA 1UEIA 2Z5FA 3O3OB 5AJHA 5DFAA 3MWFA 4HK4A 3KB6A 2HV8A 3AT1A 3Q85A 2ODTX 3DPSA 2C96A 2ES4A 3D64A 3LPAA 4M0UA 3U3JA 5FOVA 3DOHA 4BNDA 3NGLA 2BN4A 3I30X 5CA1A 4NZOA 4XAQA 3ZD8A 1JEQA 2GCIA 4IMPA 3ETJA 2GARA 4PCLA 3UWOA 1B8PA 4E2WA 5I7RA 4YCJA 1D0SA 3FCYA 4ZQFA 4L1KA 5I4BA 1GRVA 1U28C 3N8GA 4I3HA 4L4ZA 1Q0SA 2H63A 2BOVA 3DUFB 4UEJA 4X7BA 4DR5B 2X4LA 2VXOA 5CFMA 3BZBA 4FYIA 1IB6A 1WXXA 5KAPA 4ZT2A 3HADA 3HP1A 5TT1A 1QZZA 1R6UA 3PE4A 4DT1B 3IVXA 1F3LA 4DNQA 4OQNA 1ZI6A 4EOGA 1IBSA 3DJYA 3L1VA 1BJKA 1E20A 4HYQA 3QU4A 3LDAA 3MWGA 1CP2A 4H6PA 3EPJA 1XC7A 3GN1A 2DOKA 3GA7A 3OTGA 5D3QA 2YW2A 1NTOA 2VDKB 1K8YB 3JVVA 3P9PA 1FSPA 3UCEA 1A96A 2V5VA 2DE0X 1YZGA 4KMOA 1TKBA 3MMPA 4I6EA 4AD8A 1OLSA 3L8GA 2A4KA 3LXRA 1PJTA 3KOOA 2LCQA 4DQKA 3KRTA 3GRCA 4BFXA 4C43A 1T3LA 3KQWA 1EPUA 3KTOA 3NB0A 2O2CA 4BWGA 2WP0A 1E4EB 4XXHA 2V0NA 1TT7A 1W47A 1HMYA 1BCRB 1C3JA 2QF7A 4EF6A 1NJ2A 2FKAA 1CDEA 4AN0A 3ERCA 3KT8A 3CVOA 1SUSA 5J4VA 4HGOA 2DHRA 2H00A 1U2TA 1J2JA 2X8WA 3FPKA 4PBSA 4X6YA 4XOUA 5HCNA 1PN3A 3HS3A 1WKCA 3LIIA 4B4WA 5IKEA 3C45A 3LLCA 3S81A 1ZHOA 1JX6A 1EBBA 3WLLA 3BL8A 1MZPA 4Q21A 3FNEA 2AZ4A 4WY8A 2HW8A 1ZKDA 2DHDA 1UK6A 4JC5A 1KI6A 1ECPA 1QH1A 2X5KO 3EF3A 2VEDA 4S0ZA 1CDOA 3OQBA 1BH2A 1C7EA 2DWUA 5CAEA 4MYCA 2M98A 1W6RA 1E99A 4Z0PA 1GG2A 1LK5A 3I9MA 4UTRA 1I33A 4RZ2A 3IL2A 1EWYA 3VTAA 4DG5A 3SZRA 1RWPA 4D4IA 5CT8A 1RXEA 4LC1A 1NASA 2HLDA 1NDUA 3B8HA 1TA0A 2AB0A 1POXA 3ZY6A 4YR7A 1JRLA 3OCVA 3ZV5A 2BE9A 3AZOA 1RXCA 4GZLA 2B5OA 4Y0AA 3AYZB 4MS1B 4LZJA 2XNSA 4PLPA 3MJCA 3QEMA 3CRVA 3ONVA 3QTLA 3NHAA 5JLAA 3TLKA 4J90A 5MGNA 1RXVA 4LJ4A 4UPDA 1PT9A 2EJBA 1OWNA 2YVAA 3E4DA 4QREA 4QXMA 4RSGA 3N8DA 4OREX 2BAGA 1O6ZA 5CIYA 3GJSA 3HKEA 4XI9A 4QVKA 4EJSB 3WZMA 2ZJFA 1DWOA 1Q11A 1VE7A 5GVRA 1HFKA 1ODLA 4XVUA 2LW7A 5A2QA 1P31A 1E3WB 4GRAA 1JF8A 2HIAA 3K8ZA 1WZCA 2FG7C 2ZYDA 5TB5A 3P8ZA 4EGCB 1JSZA 1GRRA 4KNYA 1KKUA 4ESOA 1PL0A 1CXZA 2FFRA 3K72B 1LJ8A 4DC0A 1N92A 3KKMA 4JBIA 5AVRA 2XIQA 1JLLB 3BGOS 3TJMA 4IZOA 3ZXXA 4D9JA 2FP4B 3D7KA 5FWAA 5GTDA 2NYRA 1I36A 1Y6ZA 5JANA 3AGPA 3KU4A 1LI4A 5CLHA 1X94A 1X7YA 3AB7A 4C6SA 2I71A 3PQ7A 2HI0A 4YEDA 4MUJA 4ZCQA 2PEZA 2V6BA 2HLDD 3KJIA 5CNIA 1VG0B 5LIPA 5IBRA 3WWZA 4Q3EA 3DEYX 2XWBF 3KEOA 4JLSA 4PLGA 5BOSB 2PRSA 4P92A 3L8HA 2IYVA 2Y9MB 4D9EA 1YBHA 1L5ZA 4C0AC 4A2CA 2Y4NA 1XDZA 3WWOA 2GKSA 4KREA 3FHOA 3N1UA 3ZGXA 3KLNA 4HQRA 3F5QA 4D3FA 1W0KA 2FW6A 1YKGA 2WU3A 4WXMA 3E7DA 1TK2A 1SU8A 4EG3A 2W2VA 1SCIA 4Q4CA 2RI0A 1HFWA 1Z45A 4RPKA 5FUQA 3SIXA 5HRUA 3I6MA 5IDXA 5HIJA 1ZD4A 2DECA 5M3BA 4M9RA 2RKWA 2QIPA 4A26A 3GJ3A 1CE8A 4DRXA 4GGOA 3ORFA 1GU1A 1E1MA 5FWXB 4FW9A 6CHYA 1EA5A 4AZTA 3DMNA 1E1NA 1MJFA 3ADOA 3SZLA 2A0YA 4GNKA 4RGQA 3KYCB 2UAGA 2XSZA 4EA9A 2O7QA 2XA2A 4AYWA 5BSGA 4UCQA 3VKWA 2OG2A 3IKLA 4MJ7A 2BELA 3ROZA 4ROSA 4UVHA 2Q5LA 1DTWA 4RU1A 3VC1A 3MHPA 3TH5A 1Y1LA 2O8CA 3UUEA 3G9XA 4C76A 3D3WB 1LX7A 4TYYA 3E35A 1AGPA 4QYWA 3IURA 4IUYA 3PNLA 4F56A 1X80B 4JYPA 3ZWKA 4EITA 4JJZA 1YZ3A 2OM6A 4G5SA 3JZIA 3ZWDA 3GG9A 4CZ2A 1VIMA 6ABPA 2ZVQX 2CLKB 1RP7A 5TPWB 1XBTA 2R60A 4KI7A 3RG2A 2VDUE 2I7TA 2VDMB 1E63A 3N7TA 5EIWA 1QAMA 1VHJA 2C8JA 5JXJA 1W0KD 2CCGA 3U7JA 4NESA 2EU8A 3V8NA 1ZRSA 1E2LA 1GFSA 1Q1EA 1UBNA 1W5FA 4F9TA 2BBSA 1S9HA 5AVTA 2RHJA 1FB5A 2QAJA 3HDYA 3TPFA 4E5PA 1RRVA 5CLJA 2E9SA 4IIJF 2ETXA 2NO4A 3IODA 3HP4A 3QVWA 3R2JA 4PO3X 5BYAA 5AVZA 2Z1DA 3AEXA 5BV0A 1TM7E 1BQ4A 3CVYA 1Z36A 2GUWA 1ITZA 2WF7A 5IXYA 2PXAA 1E64A 4I5IA 4D97A 3GJ0A 2ZQ5A 2PPVA 5HS6A 5DMXA 3PUZA 4BX2A 5JSUA 1PGJA 1UKCA 1FYVA 3KAJA 4TXJA 4DCPA 4H35A 2XSZD 3NETA 5HWSA 4G0NA 1W4ZA 2JAHA 1ECLA 4RH1A 5FAXA 4B32A 3KTAB 4XEUA 5AW6A 1NZFA 1NXSA 1OWLA 2Q49A 4DNPA 3PUYA 4YP7A 1JEYA 3OQJA 4BO2A 4TVSA 3T9BA 2FFHA 2A92A 2AX4A 5A6SA 1M7HA 3TX6A 1XEAA 3LY7A 3QFHA 2IV2X 1OXTA 2BHRA 5JQWA 2TYSB 1LSOA 2X6QA 5JCOA 4NENA 2HBQA 2P9JA 2PBLA 2XADA 3I76A 4Y9TA 4ZVLA 1IHOA 1KH2A 1J09A 1SVWA 3PDIA 4CIBA 5HDQA 3UM9A 1OXSC 2WHEA 3HA2A 1L5NA 1CLUA 1TJNA 5IM4A 3RM3A 4OKNA 2DSTA 4PHGA 3T61A 2CJWB 2YHBA 3DLCA 1KSGA 1DKUA 1CJTC 2O14A 3EY4A 3BRQA 3LRPA 5FI0B 3SXJA 3AZQA 3O26A 3PL1A 5C2JB 1K2WA 1L7NA 2G8NA 3DFZA 2XDWA 1X77A 1Z8NA 2YX1A 5IMBA 3Q9UA 2FPWA 2DBZA 3B1KA 1H65A 3I1IA 2GPBA 3K5WA 1P5JA 1DU4A 4KLNA 3EXEB 3RNLA 2YZKA 4I81A 5DKFA 3JAWB 1B6GA 1P7CA 4R7TA 1D04A 2PWYA 4D41A 2H57A 3K2BA 4MQ6A 3OSUA 1O0SA 3OT4A 2PZAA 5E38A 3OJEA 2JHFA 3HQ4O 4MZDA 4ZCTA 4LISA 3NKFA 4H31A 3TW8B 3C5VA 2HQOA 1YUNA 3CKLA 2NZXA 4IO0A 3ZJTA 1PL7A 3QX7A 2IYYA 4JBLA 2IS1A 4ARUA 4B6PA 2O6LA 3Q98A 4R9RA 3O9VA 3QSYA 3VX3A 1GGHA 3BF8A 5HRAA 4NK5A 4OSPA 2F64A 2Q9UA 2QVCA 5H70A 3FTNA 3MERA 3S55A 5B64A 4F92B 1CJKC 1PWZA 2JI8A 1PNQA 2X4IA 4UE6A 3TLJA 1J9EA 1XNRB 3ANSA 4CCWA 1AKWA 4YT8A 3WFZA 5A5DA 3GLIA 2XGSA 1YASA 1NU6A 1QQ7A 2AZXA 2VT6A 3N7AA 4Z9BA 4U00A 4BVBA 1SBIA 1FDRA 1Y3CE 4NZMA 5TARA 2NTJA 1Y4DE 4F7DA 2QSZA 4ARSA 5H4HA 5IU6A 2WF8A 1VCMA 2ZREA 5DW3A 2XB9A 4HKTA 4L2IA 2BFDB 4WNIA 1MTOA 3MBKA 1JHQA 1U02A 4HS9A 3RRZA 3PSHA 2QENA 3ENKA 3ENNA 3FGNA 1OFUA 1ZOPA 2CMFA 2EFYA 3A32A 1GAQA 3FX2A 3AFOA 1WJGA 3O8NA 4O4HF 4F84A 4IG9A 4QODA 2PSHA 2Q7XA 1EGVB 5K2MA 2J3HA 2OV1A 1RQXA 4AKSA 3AKDA 2IHZA 1LQTA 3DDZX 2B8TA 2OSBA 3OLZA 4MDYA 3CGWA 4RETA 3ZIUA 1FMLA 3EVGA 3T3OA 1RU3A 4TTSA 1Q0UA 2PX5A 4PQRA 5DHUA 1ZOLA 4JQSA 3DOFA 4J2HA 5AICA 1XXHB 5DM60 4JWTA 2IHKA 5HIKA 3F8WA 4ZPXA 5ADWA 2J9FA 1A7KA 4N7RA 3AFIA 4RACA 3NIBA 3R9WA 2I1WA 4ND2A 2W2KB 1W48A 3AHJA 4YJ3B 2VHVA 2H31A 3CZRA 3ISJA 5F7OA 4JUIA 2ATVA 4D46A 3BWYA 2ZAGA 4K9NA 4Y6LA 3K4HA 2YZ7A 4DYHA 3SF8A 5C5DA 3HCBA 2YIMA 3PG5A 1ILEA 2QEQA 1TEHA 5YASA 4LFCB 3UMFA 1TPZA 3H8WA 4BN5A 4E6EA 5SICE 2BGGA 3RFCA 3HXMA 4KQKA 1DO0A 1Z4QA 2DUUA 3MJRA 1QGAA 3R3XA 3KKQA 3OU6A 1EGMB 3KELA 3TSOA 1U81A 3GCXA 2R1VB 1VLVA 4MINA 1XQ6A 4XRGA 5KOIA 1JT2A 3CT6A 3LO8A 3PJFA 1P2TA 1N5JA 1TCUA 1VI6A 2QL6A 4ZJYA 3RIEA 2WSMA 3G8DA 2ZSUA 4FB5A 2FX3A 3VPCA 3BD9A 2I4MA 1GL9B 1Z2EA 2C5EA 2QM3A 5GIOE 3KZXA 2ZYTX 4NFHA 3LK6A 4HV4A 3EVDA 2IYZA 4E30A 4D44A 3KYBA 2CKMA 1A9PA 2FVYA 2TRSB 5KDLA 3S8MA 2O06A 3QUCA 5CFRA 3AERB 2W6JA 4EBFA 4JX8A 3TIXB 5LL6P 4PIVA 4PGGA 1XHLA 3ZE7A 2HREA 2NZUG 2PH3A 2RONA 2VUSA 2ZYUX 5THKA 1RYEA 2P2SA 3C1AA 3FI0A 3JCZA 3ML1A 4I1RA 2I91A 5FPSA 2X8BA 4IV0A 1DADA 1RYFA 4O1IA 4L8GA 3CG4A 1RWXA 4CLRB 4RM2A 2R1UA 1ULHA 1FX0A 4JGIA 1AKQA 2ZJAA 4HNTA 1W85B 1Z0ZA 3HGQA 3X2EA 5LBTA 2YBDA 3CBGA 1O97D 3K1ZA 4BBPA 3KAPA 2GLXA 5A7HA 1IBKB 1S8NA 3BMOA 5AWFC 4OGFA 5K51A 3JALB 2XT9A 2Q46A 4MAFA 1QPZA 5JARA 1MNQA 3RVRA 4DR6B 3GNQA 2QTCA 3ONDA 3GZ4A 4KO8A 1V6CA 3HWX1 4LQLA 3X1XA 1J7JA 2HMUA 1DKMA 1LTHR 1O6FA 5TEWA 3REQB 2H4ZA 4AZ0A 2B92A 4YI5A 2WAMA 4D6XA 1UC4B 2B4TO 3K0FB 4R3NA 1PWXA 2Y76A 4DJEC 4O4LA 3QH4A 3OVMA 2CWDA 4OJNA 2C3PA 2HWWA 3VC2A 3H83A 2H1SA 3HKDA 1RJDA 4JKOA 4PY2A 5B3AA 4DIFA 3QEAZ 1DIBA 4GBED 4BNIA 2PG3A 2JD2A 4LYJA 4F46A 2GN4A 1L6RA 3R9XA 4F7WA 1LPSA 1PZEA 2MU1A 1ONSA 3SQDA 1Q1BA 3FY4A 1T5LA 2W6JD 1W581 4F4DA 4A10A 4BFVA 3CUUA 4EFNA 3E3NA 3FMPB 3ZXUB 1H4TA 1L7PA 1SUBA 2I2BA 1Q5PA 4OQPA 3T7DA 3QX3A 3C0KA 1KE2A 1BXKA 1G41A 3GN2A 4P4SB 4RY0A 1I4WA 2JCXA 3O93A 1J8MF 1UJ6A 3I34X 3SM3A 1NM5A 2UV8A 4DIUA 1U0SY 3A1NA 4LOKA 1DQYA 1H2YA 1UOPA 2CN1A 2QT0A 2XNCA 4LNAA 3ZN2A 4US1R 1NUPA 2YNMA 3O5AA 3IBYA 1C8BA 2PRKA 4WZZA 1P8JA 3C8ZA 3ZYCA 2Q5CA 3HDVA 1NI5A 2ID8A 2YIVX 3HGMA 4ZYTA 4H1VA 2ADOA 3HYTA 1VL2A 2ADMA 3ROXA 1UKEA 2QG4A 1UJ5A 3UK6A 3CR8A 5JAMA 3PPVA 4XZ3A 2OM2A 4MV3A 3GXBA 4ITUA 2P67A 2RK4A 1CZNA 2ZIGA 3GCDA 4UE2A 5E3HA 5FLXA 3PITA 1SKYB 1ECGA 3FD8A 3O3NB 4RESA 3UAXA 1AQ6A 4F4FA 2W37A 2P2CA 2XODA 4PAQA 1FXUA 3FUWA 2GJ8A 4NBUA 1EX6A 3GIDA 4Q82A 3L0CA 1ADYA 1FOEB 1WUIS 2IDMA 4IFBA 2V65A 5FAKA 4WLOA 4V39A 3JTMA 1XMSA 3WL4A 2O59A 5FTNA 3U1BA 3TJRA 1NN1A 3JVIA 3OH8A 2VYCA 4DZZA 3H2IA 4GEGA 4CGYA 3EMDA 1TK3A 3EXHB 4II7A 4ZPJA 4IEIA 3M5WA 2WHXA 4P98A 4OA5A 2NW6A 1VLJA 4ZAGA 5LQUA 2NM0A 1JV2B 3FUTA 4H7KA 1R64A 4J2TA 4RANA 2O3RA 4G0ZA 2QGFA 2YNMD 4W5HA 3E9CA 3QMWA 4GWKA 1SU4A 2G4CA 2HRZA 2PX6A 1UJ2A 2CVZA 3HR7A 3MT8A 4FKMA 5DV9A 4ZI3A 5J4HA 3S8YA 4FWTA 1T0PA 4CM9A 5LUAA 1U0EA 1IN7A 4URFA 1R0YA 1MEOA 3OA0A 4X8LA 1M2EA 3GA5A 2P90A 1PR4A 2QM8A 2OZPA 4EPTA 4L9RA 1XJCA 5AW9A 4ENPA 1CY7A 4R2WA 3ICQB 3W5SA 3RYIB 4XWYA 5JVDF 1AMUA 1ADJA 2Q7DA 1V39A 2ZIXB 3DHWC 4QC2A 2DCMA 1C41A 1F2DA 1TI7A 1LH0A 1NVMB 2HHCA 2XBUA 1FPQA 1UJBA 3QE2A 4G5XA 4OJYA 2Q5HA 3T4EA 4Y9UA 2YWEA 2BUCA 5TF0A 4ZJPA 1P39A 4BX8A 2BMVA 3BIJA 2ZVJA 3HDTA 2DLDA 3DOUA 2IUUA 4X6UA 1PBTA 4NZ9A 5IK2A 4KK4A 1N32B 2FSGA 3IRUA 4WQMA 4C3OB 1V9CA 4M88A 5AKKA 5K3CA 5JT1A 1M2FA 4YACA 3V4LA 3ZWXA 3E5NA 1TYAE 4M0PA 4YQFA 1HFJA 1VL8A 4G3XA 4K1LA 3ZHZA 5K8CA 4PVDA 2Z9CA 1JNYA 3GNSA 4JYCA 3HNOA 1G3IA 1VPLA 2VF5X 1A4IA 1MC5A 3F4KA 4MGKR 4X92A 3N2KA 1GFIA 1EUDA 3VNSA 1THZA 4JHLA 4ZAZA 1EQAA 2NUPB 1FNNA 4QDJA 2XCSB 5HOQA 5BNFA 4FXPA 5G0WA 4JIMA 1TZBA 3UC9A 4CM9D 3MUEA 4WUVA 2GOYA 2PUEA 1F17A 3N3BC 2QJFA 5ALMA 1Z6YA 4YLEA 2COKA 1UOOA 5AP9A 1BXGB 1OA1A 5EWMB 2K7FA 2COEA 4FGWA 4FHEA 1S4QA 3AHEA 3OQPA 1RHUA 3IOCA 5IW8A 2C2XA 3HXOA 1TZJA 4XYMA 1OWOA 4PXSA 1N7GA 3NAQA 1FRFS 3LPLA 4LJSA 3E3OA 3AJEA 3UOAB 1ZUNB 4GPD1 3IXMA 3NVMB 1CK4A 3C3PA 3OCCA 1SHKA 1X7ZB 1XEFA 2V7WA 2PUDA 4JYZA 2IS4A 1T4BA 4Q16A 5AJTA 1N0UA 3VR5D 2GH1A 1NOIA 2ZTVA 2QI9F 1ZD1A 4M9SA 1O94C 5IK2D 2E5FA 1BMTA 2GHQA 2OMEA 3KV1A 4HDSA 1P7VA 4KGDA 1ODKA 3C3WA 3UV7A 1ZCFA 3C3CA 4Q7JB 3ZWVA 1YI0A 4RA9B 1JQAA 2WWIA 3STVA 4EVIA 3HNPA 5I01A 2LTAA 4JC4A 3QTBA 4II3A 3WGVA 3MXTA 4US2R 5K09A 4UM5A 2H1OA 1EH5A 3MUFA 5K8UA 2W6OA 4PNPA 4DDUA 5F64A 1GPNA 2AEJA 2JAXA 3FUVA 4CL2A 1WZIA 3GA0A 3NTUA 3NTOA 1BVUA 4CLHA 1WQ4A 1PUJA 3OPYB 2N0SA 3C3XA 4EUSA 2FJPA 3DHYA 2ERXA 2WJIA 5BN4B 5CHEA 4DARA 4FGSA 1V37A 3C1TA 2F90A 2O52A 1GTG1 1SC3A 4U2KA 1GR1A 1KMHB 1Z68A 5E3IA 2CVFA 2C98A 1H8EA 2VSYA 2AI1A 4O63O 3L5OA 3MD0A 4PZCA 3GPCA 4BNMA 4Z4HA 2JIZA 3QKSB 2OCGA 5MGBA 2IA5A 5BSKA 1XJQA 1RPJA 3ICEA 4FCVA 5B58T 5EHIA 3T0GA 4JLMA 5CW1A 3JWHA 1DXHA 3WYNA 4QBKA 1TVMA 1L7XA 1Q7GA 2JLCA 1KPHA 3AK4A 3DKRA 3G7UA 3ORQA 4KQ6A 4QYIA 1YB4A 4A1OA 1WZ2A 2HSDA 4MQ5A 1PGOA 2QTLA 4N47A 3E82A 3UQYS 2CLOB 1Y0BA 3TNYA 1PKXA 4HLUC 2ZCVA 1LLUA 2P91A 4HQ0A 1PJAA 5FULA 3KEFA 4F71A 4IIJB 2H1WA 3C7DB 1M33A 4WNYA 5FLEX 1A97A 5DYTA 1XXHE 1I4EB 2AFIB 2VJPA 2W6QA 3CWQA 3ZTTA 1EBFA 2QD4A 2EFDB 3KOUA 3PNQA 5DJ5A 5A6VA 3ZCXA 3EVCA 4QO8A 3MLEA 1MRZA 3KBOA 4ZCIA 2SCUB 4L5CA 2H1FA 5GGYA 3DS8A 3ISTA 1G3MA 2AOWA 5J3JA 5ISMA 1MENA 4YRTA 6PFKA 2IDKA 2PD3A 3QU5A 1GCGA 2ZYSA 3P9IA 5E6SA 5BO5A 3TJZA 4YHHB 2ZSAA 2QR3A 4MICA 4RV4A 5HX7A 4XYEA 2FN8A 3SDBA 4XD2A 3MCVA 5T7BA 5IVHA 1XWIA 4WERA 3NDIA 4KHZA 4B48A 2IYWA 2TSYB 3BUSA 2O5RA 2WRZA 3EUEA 1CQJB 2E4UA 4PONA 1E2MA 3K1AA 1H8ED 3OJLA 3IUJA 4H7DA 2NXEA 2JIZD 3TNJA 3HR8A 1AKVA 1TNDA 1UJ4A 4YRPA 4BNNA 1DKLA 4IHKA 1BHSA 3OQOA 3FCEA 3A4IA 3PXAA 2ZYAA 4NJEB 1UZMA 3ZDFA 4G4IA 1QCCA 4BB0A 4TRRA 3O3MB 5BWNA 1XWFA 3IAEA 3WLOA 4EZEA 3NNNA 2ACVA 4F5WA 3RC9A 3R75A 1K5DA 4L4YA 5BWOA 3SBXA 3HO1A 1AQJA 5H59A 1C9YA 4CM4B 3RRBA 3JRWA 1PJRA 4IMRA 4OXQA 2LPMA 3ZHVA 5EJGA 4KYVA 4RLSA 4MR8B 5ED0A 3ZWWA 3WIBA 2IZZA 4LXQA 4L5YA 4PFSA 3AUJB 4ESVA 4HNVA 4JLUA 5EUQB 1KMQA 3WWYA 4FYPA 5JAOA 4AWBA 3IQFA 4G85A 3HUTA 3VTZA 2ZDGA 3M5DA 1IM2A 2C2OA 1LVUA 3GGCA 3N05A 4G4SO 5DSZA 3TOSA 1SUCA 2H17A 4MV7A 3DCYA 1PTJA 4U6SA 4BNTA 2B30A 1DQSA 3LX4A 3SIWA 1AU9A 1VL5A 4N12A 1RTKA 1ONPA 3DEHA 3C48A 1ACMA 4D9BA 5KTYA 4F3TA 4Y2UA 3KU1A 2DFKB 3KL2A 2NXNA 1EWVA 5CDSA 1S0UA 2XNKA 2AN9A 3NCTA 5NLLA 2X8JA 3WIUA 5IVKA 3DLHA 3G2LA 4EJ2A 1A2QA 2AXEA 2BTEA 4BE9A 1PFWA 2W6ZA 4HJXA 5IXSA 5J4YA 5D6NA 4CMBA 1QG4A 2A9VA 2M1XA 4QUDA 1G20B 5EP2A 2IIPA 3BSFA 4INPA 1XMOB 3M9LA 4RZXA 1R0LA 4ZOQI 4R81A 3IE0A 4NG5A 2NAPA 4QULA 4YB8A 1MCZA 1S9DA 2RHDA 2X22A 2M6LA 5L6MB 3BXXA 4XB2A 3EEIA 1MOZA 3N7UA 3U3XA 2NXWA 3MWJA 4M22A 2WDZA 3VYTB 3FFWA 3QUQA 1NRXA 2ZULA 2ZAYA 1EDBA 2EKLA 3RU9A 3GL9A 2A5YB 2FPLA 3A1UA 3W2EA 4DG8A 5AKIA 5JSHA 5TXGA 2HHAA 1BOFA 1J0CA 1ZK4A 2B2XA 3SX2A 4HI0E 2P6RA 3IAXA 4GKJB 2OK7A 2PYDA 4E1AA 4AG5A 4O4HB 4Q1FA 5LYJF 4ODIA 4RK4A 2RFLA 2YN0A 4E5UA 4Y7DA 3LUGA 1MXHA 3OT5A 3TUZC 1OXKB 1A27A 1XA4A 2VP3A 4J7AA 4KQWA 4CLOA 4DADA 1I01A 3RREA 2CNOA 3GVXA 1ZX1A 2FLVA 1R4AA 2PMDA 2R8PA 1TQHA 1FFXA 4OK6A 4UKDA 4X71A 4DMCA 4ZXPA 4EF4A 1HYBA 2P4HX 1OKKA 5ALVA 1M8JA 1PJBA 4KRYA 5M04A 3THYA 3FUUA 2NNLD 2PKRA 3PCTA 2VDJA 4Y6GB 4CEHA 2OO3A 4XSHA 1SKYE 4PYNA 4U4AA 4PYIA 2GR9A 4WUTA 1R4MB 1WZNA 1QSGA 3KQOA 4BNXA 5HUHA 4N65A 1GPLA 5DLEA 4LYHA 5KDOA 5D1HA 2QVZX 4G0QA 1DFHA 4B71A 4KMSA 3WQQA 2A9QA 3G9TA 4YH1A 4J3JA 4IXDA 4H7HA 2Q0XA 5BV2P 5CITA 5K0BA 2F2TA 3DR3A 2CYBA 4TS9A 2H11A 3B1VA 5EJMA 3DC7A 1RQRA 2BLLA 4RKQA 4EY4A 1WUJS 1C3OB 2ZP1A 3WJ1A 1P6QA 4D96A 5KWEA 5JD6A 1PD1A 3H5RA 1ZKMA 1VHLA 3OJCA 3HU5A 5THQA 3EJ6A 1PJ2A 4IOLA 2E1PA 1FQWA 2A14A 4YRDA 4YHBA 2G88A 1OUMA 2YJ4A 3CY6A 4CKEB 3G2NA 1HLPA 1HLDA 4XLTA 3OTQA 3AR5A 2BC9A 1NSFA 4MKXA 5FFNA 2XD9A 3BXOA 1NQAO 1ZNXA 3GLRA 4L85A 1L9KA 1ORHA 4HWGA 1LRLA 2I62A 2ZWVA 9MHTA 1W88A 2VZ8A 3DNPA 3MTQA 3FGZA 2B61A 3O8CA 3AR9A 3ADDA 3QVOA 5B2ZA 3AVWA 5JADA 1FVFA 1U0RA 4RTKA 2HJHA 2M2IA 1OKKD 1Z33A 1DOZA 4TGLA 5I7WA 2MOKA 4RC9A 2F55A 1I7DA 4Q1BA 2JBHA 4EPRA 1SY7A 4FFBA 3UCXA 2X76A 1GAWA 1FUUA 1G3QA 2I4LA 2WD7B 3Q6IA 1PWHA 4V0ME 1GYQA 1Z0SA 4ZD6A 1JYFA 3FBWA 3ABZA 4D0RA 2EC5A 5KYKA 3S2FA 3LX6A 3I53A 5BN5B 4D4MA 5JISA 4R83A 1TFUA 4AT1A 5KWJA 1A8UA 4MUAA 4GKKB 1Z4IA 2ZWPA 3GYBA 4Z9FA 4BATA 5A2GA 3Q1LA 3CUTA 2HWXA 3CQ9A 1DHTA 1KH3A 3MS4A 3JYLA 1BE1A 4EEKA 1GY8A 3B9PA 4PCUA 1GGNA 3H19A 1UAGA 5ALJA 3KUKA 2H3EA 4EJSC 4O2AF 3C4VA 4XARA 2GPJA 2Q07A 2PUJA 1ZIYA 1T35A 2JIQA 4Y1RB 3LQ1A 3PKJA 4HX9A 2JKVA 3GFGA 5DB4A 4ZANA 3KB2A 1Z39A 4A92A 2NTVA 4G81A 4LHWA 1NVXQ 4GP9A 5F9HA 5EP4A 4YCMA 1O4VA 3OLCX 1X0XA 3Q7IA 1FFGA 3HCCA 1DCKA 2WSIA 1JR3A 4NYMQ 4OQQA 4JR1A 1YIDA 3KSUA 3T0IA 4KR9A 4DFDA 4A2PA 5AKZA 2C03A 3V1TC 4KO3S 4RWEA 1M6VA 3FRIA 1B6RA 4KR6A 1WTCA 3LIPA 1V2HE 3IKVA 3ZUGA 2B9EA 2FG5A 4PO8A 1XNHA 5EE0A 4UAGA 4TV9F 3WGGA 4BNFA 1NN3A 1W0CA 4ZIRA 1PLKA 1X74A 2WOOA 3HDGA 3VNBA 2QBYB 3U56A 5ECYA 3OZCA 1KK0A 4N8SA 2CF6A 5JEDA 4F9GA 2C2YA 2MYTA 5A9TA 1QF6A 3O2NA 1AUXA 3F3SA 5IF9A 4OL9A 2H52A 3PB3A 4IF4A 3B51X 2GNOA 3VISA 2CXNA 3HE3A 1OTHA 3BE4A 1KORA 4LKRA 1F8GA 4QXRA 2GPNA 5EWJA 3TS1A 1E7RA 2BJWA 3VI3B 2WHRA 5EIFA 1RYZA 1KI2A 1V7PC 2Z57A 3GEPA 3FMIA 4C04A 4X1IB 5KTOA 3WAGA 1TDJA 3IOMA 5J5AA 1Y98A 2A9RA 4R8LA 3RI3A 4FYWA 3EC2A 5JCXA 4AN1A 1V9SA 2G09A 4FMDF 1YGPA 2RAUA 3CN9A 3IJRA 2J9YB 5HM8A 3GH3A 2B98A 2Z8ZA 3LDFA 4HGZA 1ZIXA 1EFCA 4J1TA 2NYUA 4JLDA 1XQWA 1UP6A 4L8YA 4CKCA 1TYCA 4G2TA 2DXIA 3H2ZA 4P2BA 4Z0HO 3ZQUA 3I9FA 5EC8A 4BPBA 1JR3D 3HDHA 3KB8A 3H4TA 3ZQKA 1Z8FA 3NM6B 3WLHA 3ODPA 2O0HA 1UWVA 3QPVA 5FV4A 5I7EA 1H3FA 2YV5A 3JQBA 5JS7A 3K9FC 3FFBA 1RCFA 3RK0A 5TPZA 2VSXA 2CJPA 3WWPA 2VQ6A 3V80A 1LLQA 2FSPA 4YMHA 4ZO7A 4L08A 1G8HA 2O05A 1LZLA 2IV7A 3WK8A 2GBFA 3GWGA 2XUQA 4NCHA 4CKWB 1IUKA 3MFQA 4PPYA 2CV1A 3ZGNA 2WSLA 2XT6A 4J1QA 1ZXLA 2X2EA 2MSWA 1ULUA 1PS0A 2P5UA 1VPVA 3ND6A 4RVOA 3R7FA 3T5GA 5KMGA 3S0JA 4FJ2A 3HY4A 1MMFB 5JVDB 4HATA 4NE2A 3BFPA 2ENUA 2JCBA 4R9VA 3ILHA 4G1MB 4O4JA 3HSYA 4EWLA 4DDVA 5EJ5A 2AFIE 4WACA 4RKWA 2P1ZA 1T34A 1S2DA 1J20A 5JSZB 5KYWB 3RVPA 3BJIC 4UEQA 1GZ6A 1JHAA 4XE5A 5KQMA 3KFXA 1KYTA 2UVDA 3WLQA 4ZVSA 1YB5A 3BSYA 4OGGA 3THXA 1ZC4A 5E7IA 3D59A 4FOPA 2NTEA 3D8RA 1JEOA 1QHHA 1F4LA 4TSFA 5IEBA 4A6PA 4E5NA 3KIPA 4JZYA 1A5AB 1Q74A 2A84A 2AK3A 5I51A 3PFIA 1MOSA 5BOVA 4R2LA 4Y1GA 2QN8A 4J43A 1OT5A 2AC2A 4HZIA 5AI4A 3WL3A 4URXR 3ZGLA 2QDXA 2ONJA 1JAHA 2EFJA 3TZ6A 3K4PA 4AM8A 1A9QA 2C8VA 1Z0IA 2GASA 4HPWA 3HU1A 3U7RA 2OAP1 1ZCBA 3M2TA 3R3WA 3FZGA 4V1CA 2AI3A 2C99A 3BWVA 1T6BY 2NZYA 4CUZA 1HT0A 4XYLA 4PQFA 3H6HA 2B8NA 4FC7A 2IL1A 4LS3A 1IONA 4YCDA 5KSPA 3U39A 4QYTA 5HA5A 2I4RA 3EDCA 2OGTA 1Z56C 1CRQA 1MO6A 3OZGA 4U63A 4WA7A 3AKZA 4KFTA 2QTZA 4YJHB 5LQAA 2WJ3A 3IUSA 2JGDB 4HNSA 3JZAA 3ZV6A 3V1LA 2BDEA 3HACA 4WZAA 4GMFA 3BWBA 5D85A 1P1CA 1Q19A 3IP6A 1N34B 1I6KA 3K20A 3OJFA 2Z9DA 5T67A 1KZ7B 3PXDA 4F21A 4N0EA 5JCZA 5K6RA 5TEVA 1SPXA 1G5TA 5CA0A 4DMMA 1EIWA 1LLDA 1QHEA 4YC7A 5I3CA 3RC8A 4KXNA 3DVQX 4OG2A 5A4AA 4OHZA 4KITB 4AF8A 1QRDA 4B4DA 2YWDA 1P1JA 4TSFD 1EK1A 1AY0A 1FCJA 1KI7A 4TN1A 4ZARA 4MA0A 3EGXB 2EERA 2XUPA 3K94A 3IUEA 4R2JA 3PDUA 2PGOA 3O8LA 1TJPB 2V59A 3AU8A 2E4AA 1TVCA 2AJCA 1JDBC 1AVTA 2OENG 2QXYA 2W6ID 5FYDA 5GOZA 5J1TB 3VR5H 2JATA 1ACLA 2YQ5A 1Z22A 1T2FA 3GCWA 3TGPA 1A7AA 1MB9A 1FTNA 3JYPA 2V7QA 2XUFA 3RBVA 3BZWA 1WDWB 5AQEA 4KVFA 2QR5A 3B6MA 1CZKA 1J1ZA 3C8UA 4JEUA 1XG5A 4MB6A 4N7JA 3SNKA 3WK9A 5J58A 3LHDA 3WAJA 3LHSA 2IS6A 4BDTA 5KPDA 4YYEA 3KTFA 4AY4A 4CUKA 2ERYA 3D6TB 3ES9A 4QWMA 4LNHA 4DCCA 2JLRA 2YFYA 3BXGA 1Z0UA 1P72A 3IP7A 2P2DA 3IEPA 1NFQA 1N33B 1MT0A 3OFKA 2R2GA 3OD5A 2Z2IA 4HTFB 4PZAA 2QRVA 4TV9A 4KIWA 1S3FA 2V4ZA 1RXSA 5D1NA 4ZI7F 3BKXA 3D7MA 2BGLA 1RACA 5FIUA 1P1IA 4ZVVA 4A5SA 4KJXA 4EW1A 4QFBA 3U4AA 1FJ2A 4S12A 3IUQA 3ZZNA 7ABPA 3J81A 1SBZA 3L2OB 1P2UA 4RF4A 3UXHA 5DOVA 4E33A 3CUKA 3MWDB 1Q91A 1QG6A 2IGBA 3ZBQA 1NVVQ 3P27A 1U7ZA 4H1UA 2WYUA 1HTTA 3HDJA 2BKAA 1E8MA 1O08A 5SYMA 1RWWA 3AETB 2QUJA 3AP1A 4PQGA 3EZ9A 4NU8X 4NQRA 4RFLA 3S44A 4C20A 2P3QA 4XX0A 3UVEA 2IOYA 4PHTA 4OHYA 1RJFA 2V7QD 3B20A 5IC5A 3ROPA 1BHJA 3SDSA 3WNBA 4EMSA 4QGBA 1NGSA 2A30A 4TVBA 3U7IA 3OZVA 3ZCVA 1LDNA 4NJOA 1IN4A 2Z5GA 2PZBA 4LZOA 3H05A 3R8XA 1NQOA 3FCSB 3MRXA 1T3ZA 3THSA 5AVJA 4D9CA 3IELA 2HLNA 3ZDEA 3ZX4A 1BG6A 3G6WA 1K9SA 2QD2A 1B6TA 2B7LA 4PLCA 1DI0A 2Q3EA 2V7BA 3LBAA 4KTTE 1QLHA 1XK6A 1KTVA 1ODIA 4HAZA 1C0LA 2N47A 2GN2A 3VPBA 4Z4CA 3GDFA 2WVAA 1OLXA 1XRSB 1C3XA 1F5NA 4JL8A 3LA8A 4N5HX 4R5MA 1ZU4A 2ZTMA 2HK7A 3ESQA 5JZBA 2SHKA 4JI2B 4J16C 1JFFB 1XGKA 4YMVA 3NEPX 1C80A 1CF2O 1P2SA 2GESA 1W87A 2X0JA 2GBIA 5ALLA 3BJMA 2O3QA 4LSGA 3JQ7B 4LECA 4LPSA 3VSDA 4AO7A 4KEAA 1JVSA 5FA8A 1Y8ZA 1QKIA 2FK8A 3E1KA 4MIKA 5KVQA 2VBIA 3SQXA 4HH0A 3KKOA 1NNUA 1Z0DA 5IS2A 2H92A 3KD3A 4N3CA 1H0KA 2M6RA 3IOEA 2JFVA 5I9LA 4LHZA 3VU8A 3I6YA 3I2IA 3OO0A 5IF3A 5C53B 4V0OA 3H87A 2ZUSA 5MDHA 1U65A 2A59A 2ZETA 2GPSA 1GDDA 3HZHA 1HO3A 3LUJA 2P8JA 1O96A 2FEMA 2FWJA 4HEHA 3NASA 4QFMA 3TLBA 3OUZA 1GCIA 3DGEC 1AGNA 3D0KA 1N2IA 2IP1A 4AULA 1MRNA 4JLPA 2ECOA 2Q5FA 5KC9A 3D5EA 1TEVA 2NU7A 5J47A 3FDJA 4OV6B 3ACCA 1CDZA 2CUZA 3M4JA 3NXSA 1U6JA 1UKZA 2WU8A 3OIGA 1R6BX 1KK3A 3A6ZA 3C3DA 3KOMA 3OJOA 2GLUA 2SBTA 4Q1AA 4WMLA 4DN6A 4DSAA 4LXYA 4JQCA 2EX0A 1PLJA 3N2YA 3O6VA 4CETA 3TSZA 2JFYA 2RBGA 4KN5A 4EYQA 1VSBA 2BZ1A 1LDEA 2C4TA 1JIVA 1PJ8A 1PSZA 1IOLA 3D6MA 3MM4A 4OMUA 1EFPB 1ISRA 3T9CA 4F85A 1GPUA 3JQ8B 4JOCA 3GB9A 5DN9A 5AVOA 1XPUA 1Y8AA 3PXCX 1YBVA 3AJ9A 4GLJA 4LYFA 5BNTA 2O20A 3DZBA 2BMDA 2KW5A 3QSGA 4MWSA 1KDZA 3TLAA 4BO5A 4ZHQB 5L3SB 1FNCA 2I9KA 2QM0A 2IPAB 3QVJA 1Q16A 5KX5A 5LYJB 4RLHA 5CVVA 3OKCA 4KXQA 3GWZA 5F51A 4NOLA 3UO8B 4G1UC 1FBTA 3ZVRA 5A9RA 2NTYC 2FG6C 5DULA 3F3MA 4LYEA 1T5HX 3EIFA 4MLZA 5F23A 2WFZA 3CE9A 1WCXA 1SRQA 2NUTB 4IIBA 1DQZA 4GXTA 3NOQA 5A3QA 4DQLA 1VE6A 5IX8A 2B9VA 1BYIA 1K4MA 1UFKA 3ZDDA 1XZHA 3GIWA 3HJNA 5DE3A 4A8JC 4EHIA 2JJQA 2XMDA 3R5FA 1K8RA 4N8DA 4TT8A 1M8GA 5D3MB 3L0SA 2X7HA 1BIFA 2R87A 3BC1A 2WKSA 3BWXA 2YN2A 2VCHA 3P2KA 3PD1A 3ZI0A 1RQLA 2OYCA 3E2PA 3EIEA 3ZHCA 4AG3A 4BN4A 4HDAA 1XVAA 3F3YA 4RD4A 3O8BA 5CCEA 4B3HA 4DV2B 4X9XA 1C9KA 3N2GB 1SIWA 2OQ2A 2YN4A 3GI1A 1U2QA 4XOIA 5TQ2B 2CL5A 3LWBA 4B6EA 3PTAA 4MPPA 5SY4A 2AJTA 2HKIA 2F59A 2WYHA 3P71T 4U2BA 2VT3A 1HZZA 3IJPA 2VJMB 2MT9A 4BP3A 3HL4A 4H4EA 1W96A 4UHFA 1NI4A 3EGOA 2J3JA 3OZXA 9LDBA 2GCPA 2ZCUA 2Q5QA 5C1IA 1EDDA 4QTXA 3L7MA 1B74A 2P2ZA 1YONA 3TI7A 1SM4A 3ANXA 2YJZA 3SZOA 1AHNA 1BJRE 4D82A 4FEAA 3DBLB 4CT4B 3PWZA 1CRLA 2DP4E 1MO2A 1Z4NA 4M0FA 4MQEB 4R1SA 2WE7A 5HKAA 3HMKA 3I3SR 3TFOA 2GF2A 5AM5A 1SEPA 2P35A 3R7BA 2WHPB 3W1VA 2WG2A 1POWA 4C4XA 2MDTA 1PJSA 5LZ2A 2LCFA 2IK8A 1OX4B 1OZAA 2G4LA 3Q3JB 2ZVPX 4KWCA 4XUDA 4B4VA 4R54A 4ZDJA 1K5HA 1TGYA 4OP2A 4ZYVA 1JXOA 2VWPA 1U8TA 3WV5A 4CHTA 3TM5A 1ZO8A 1Y9AA 2P2NA 1NWCA 3RS5A 2SECE 4MYSA 3ED5A 1D1SA 3PA6A 3QVGB 3GJ6A 4B3JA 3AEYA 2PL3A 4IEEA 1YFLA 1KQPA 2QAIA 1M7GA 1WDTA 5FCDA 2NSLA 4GPIB 2PLNA 3UEOA 4E5YA 2W70A 1RYBA 3AEQB 2V58A 5DRYA 3ZJ4A 3Q3IA 5LMUB 1U80A 5A06A 1W36B 2HYDA 2AD5A 2QTTA 4HQNA 3IVCA 4JN6B 3WIVA 1KI1A 1THGA 1UM9B 4DM7A 4ND4A 1EWTA 3KEMA 3DC2A 3BMCA 3U3DA 2YXNA 1JHMA 4ALMA 5CVUA 1R6XA 3P9XA 3K0CA 1J0XO 4EG0A 3AUSA 1G17A 1QJCA 2P5SA 2HXYA 1WPGA 3DD5A 4RVDA 4AI6A 1MAVA 1XELA 1FEZA 3KVNA 4W7IA 3CZAA 3T8YA 2EG5A 5GADl 2RGCA 2CNWA 3DVLA 4DG9A 4F2WA 1U4NA 1DKPA 1SCQA 1PFYA 3GGSA 1V25A 1ZUD1 2H9AA 1P2FA 2WD9A 3ASUA 3R40A 1OVGA 2YS7A 3O8DA 5F73A 5HDBB 2D7DA 2YWFA 4N76A 4UBIA 1C8VB 2RGNC 2XHEA 5F4ZA 1OI4A 2G82A 1OBFO 3NHUA 3MK31 3JATB 4MQUA 1KBOA 3MS7A 2X1MA 2CB0A 3LT1A 1ADCA 2ZBUA 2QLLA 1FDSA 5EGSA 3P97A 2AF3C 4UC0A 4WL0A 2F9MA 4BZQA 4BYGA 3EVTA 1Q7RA 1FMTA 4L22A 4CF6A 1RM3A 3BAZA 3CPEA 4ZVMA 4ARZA 2FSVC 3VH2A 1OXUA 2WM3A 2I55A 3KTDA 1DO2A 2FDCA 4CMIB 1P2BA 4JJ6A 5JEEA 5C8YF 3LU1A 5HTOA 1WL8A 1WWKA 1M66A 1W59A 1SKAA 4IHAA 4MPRA 2GS9A 1P9WA 1EDZA 3HUDA 1O87A 1DWQA 4C2AA 4JXZA 3A9CA 4CIVA 4YMSA 1X8KA 3FUXA 1U3VA 1V3UA 4DV5B 3KSRA 5AR1A 1DBPA 2PJUA 4MTCA 4KR7A 3E23A 5LP6A 1TOAA 1GTJ1 1UPAA 2ZUWA 3B2NA 3K7EA 4NBLA 5HBRA 1DAKA 1PSWA 1C9EA 2EJTA 4DDKA 2QMYA 4CLEA 4FMDB 4XGRA 4LK2A 2CNWD 3PUHA 3AW8A 2BLNA 1P77A 1E2BA 3NP7A 3WQRA 1ISGA 1Y1SA 1IEXA 2TMGA 3ODGA 3RSZA 3P2EA 3TZCA 4KC0A 4GMDA 3JWIA 2C4VA 2XYHA 3NHFA 4J6EA 3S6JA 3W3AD 4Y2TA 2NUAB 4DT1A 1QQ6A 2J08A 1X3LA 2SICE 4FE7A 1KBQA 4LZWA 4A73A 4JJIA 3G8YA 4P8RA 4C3VA 4DY4A 5GVSA 2FB9A 2O2GA 1AGRA 3FSRA 3PUIA 2RJ3A 5KDDA 5B1DA 1ESNA 1L5VA 2A8YA 3F6BX 4GPZA 3INNA 4IR7A 4EPWA 1RLTA 1ZISA 3SJUA 1RFLA 1I1NA 2KWIA 4LJ6A 5GOTA 1CUFA 1R9NA 3BIXA 1BHO1 1XUOA 4HAUA 3ZE6A 1KYZA 5F3WB 4MB0A 1TJYA 2EHJA 4I3FA 4OHWA 2J0UB 5IAKA 4FDVA 4UNRA 3T1TA 4AJPA 4FWBA 1BEEA 3GPDG 4EF5A 3AIMA 3UMCA 2XGOA 2G83A 3U81A 4UTZA 4CDMA 4DREA 5LQJA 2PEYA 3H3XA 1E4EA 3SYMA 1BCRA 3DZFA 2YJ3A 2YJNA 5ALZA 2IUEA 3O8RA 2J5BA 2C5AA 4E13A 3D6VA 3DHVA 1NQWA 3DV9A 1Z4PX 2A1UB 3JWJA 3KYJB 1AKNA 1OB2A 4I8XA 4IKEA 3WYFA 3GMIA 1RXIA 3DO6A 5BSTA 2AFRA 4C7XA 4G41A 4U8GA 3LQRA 4R1LA 1DPGA 3KKPA 4Q66C 4C03A 4BRWA 4CL8A 3V2IA 1IRIA 3LUHA 3ZYZA 5EI5A 4YONB 2CXUA 2G63A 2B82A 2WJAA 2X4DA 2VATA 1N6OA 3PNPA 5F4BA 1SRRA 2B6HA 5DWQA 3ONNA 4GZMA 1X7WB 1U1DA 2WUEA 3VVLA 3E7FA 3O03A 4PVCA 3AM5A 4RTMA 1NBWB 1ZR4A 2YXPX 3B6KA 3NC4A 4ZU1X 3W7BA 4B4OA 1G0NA 3IAHA 1FP2A 1QAOA 2G77B 2IHUA 2Z3WA 2ZJ0A 4FYXA 4B6SA 1KNXA 1ODCA 1O0CA 2C94A 2FPUA 4R8VA 2BHTA 5HYVA 1RJEA 2GK6A 1P5RA 2F9FA 2FFBA 4JU9A 4RX1A 2HMWA 4KG7A 2JAWA 1BVHA 5KNCA 2ASEA 2FZ5A 1TTQB 2REQB 4QTYA 2QW1A 2P7IA 1NW4A 2SKCA 5BNWA 2GSDA 5IKMA 3NDRA 3G0OA 1F6DA 2KX7A 3AFNA 4BLOA 4NJMB 3QFRA 4JOSA 5EKSA 5KREA 3CF0A 3H04A 1NXVA 2FSHA 5JI2E 2JVJA 2ZRCA 1LDBA 3WGOA 3HM2A 3JV7A 3PEFA 1MF7A 1H94A 1IEQA 1SVMA 4OXNA 3OEHD 1N8NA 1R3DA 2HCRA 1FYFA 3R3JA 1E3WA 3V4SA 4ARVA 2JCVA 2QPOA 1IQRA 3GVIA 3PU6A 2OILA 4PC3A 2J6IA 3RVBA 3U4MA 3GU3A 3RVQA 5FBVB 4POAA 3M34A 3EAFA 1PFUA 4FKZA 1NVFA 1DO8A 1QE5A 1Z5GA 2WJ4A 3OTHA 3RO7A 3HPRA 1B4DA 1Z2DA 2RGWA 2AZTA 4ZT3A 2CVOA 2LP4Y 1S2LA 1JLLA 5FD8A 3H2GA 2FP4A 3C8DA 1WVGA 3SHWA 3P9ZA 1JFLA 4GSLA 3INGA 1G2OA 1SH7A 3G5UA 4WNAB 3W8EA 2IVZA 2PLFA 3NHMA 5TS2A 1NLMA 1C29B 1FRQA 3GLUA 2O9JA 1WU8A 2V97A 1OZGA 3PXBA 4WJZA 3T3DA 5BXQC 1XTKA 3ANYB 3R5KA 3TFQA 3DNMA 2F1RA 2Y9PB 1IAQA 2GI4A 2J3EA 1WOMA 1RBMA 3QBDA 4GOND 5DBOA 3IMGA 3MTGA 5JALA 4QZVA 1QIKA 2FGJA 1E1KA 4GOXA 5KNCD 5BQXA 1U9JA 4NMLA 5HILA 1BX0A 3LGAA 2O2JA 2JGIA 4O2BF 3KBBA 3WYCA 1WSWA 4ZEXA 1N6RA 1ZIDA 5T4HA 5JJLA 3I58A 4QOGA 4EPVA 1ZN9A 1QS0B 2ODQA 4EG8A 4ZAYA 1E0JA 1VTKA 2R5FA 1RAEA 2A5DA 2RGDA 1IJFA 1IY0A 5C8ZA 2I67A 2CBGA 2CCJA 1PS8A 1KHTA 2R97A 1M83A 4NBKA 1MXFA 4P3YA 3KS9A 1AK9A 5EHQA 5FRDA 4F4JA 5CD1A 4OYYA 2YY6A 2ETVA 1VIVA 3NT2A 1C7QA 4MSUA 4ENVA 4ZI7B 2PZGA 5DNAA 3K2QA 4JMLA 3QPDA 4UU0A 2BP7B 5FWXA 3TW0A 3YASA 2GF0A 4DDHA 2VUUA 4PO9A 2P3OA 5ALNA 1MJGA 2XUZA 1U7TA 4A6EA 2C2KA 3BB3A 4JLWA 3PI6A 1W7AA 2BF7A 3PPWA 4FCCA 5DRTA 2XDAA 1IY2A 2QQGA 4W9RA 4J4HA 2PIDA 3T5TA 3PQCA 4MXDA 5A4DA 4R05A 2WUDA 4HDCA 4P53A 1NKTA 5CEJA 1YDWA 4F4IA 1D4OA 4CLDA 1X80A 2HF7A 4DHWA 1L7RA 1ODSA 5L53A 2Q6KA 4TLEA 4Z53A 5FPKA 1Y8QA 3T4PA 1BWPA 5IHXA 2VNIA 4IKOA 3ER6A 5CK5A 1FDUA 4XVHA 1EWRA 5JSQA 3SQOA 4BRZA 2QHXA 3V3TA 4CI0B 1ESEA 4PPNA 2C7PA 1DG3A 5DP1A 1M76A 1XEWY 3A6GA 4E51A 1X13A 1U4SA 4MS4B 1AN0A 3DYIA 2Y0EA 3GDGA 5GGXA 1ZQ1A 1Q7TA 3K8QA 2G3YA 5LD2C 1VKRA 4OUDB 1XAGA 2C78A 2Y66A 2BF4A 1AHIA 3EWNA 1Y7LA 2PSDA 4DA0A 1EJBA 1XYGA 1Q21A 1HNNA 2W11A 3E15A 1CUZA 3E7PA 4FSHA 7MDHA 2BI7A 2OG1A 2GWRA 1UBMS 3FSGA 3LKBA 3JPWA 4INZA 4DPLA 4MV1A 2W2LA 4OHMA 1I1QB 1TM3E 2ZRJA 1NJ8A 2JIPA 4GR4A 3AHFA 3IC5A 1JAXA 2JRCA 2QMUA 3TCXB 4PG8A 3AUKA 3CNLA 1ZMRA 4H27A 3TOXA 1SC6A 5M34A 1T8RA 1A1SA 2HPZA 2BMWA 1JS1X 1RPNA 4GRIA 4RBNA 4WCVA 1C4WA 2ZTSA 4K6HA 5GJVC 3UXEA 3EGEA 5IASA 2IZ0A 3U44A 1QGUA 4OPMA 1NVBA 4LJ9A 3FGOA 4RK6A 2ZI4A 3KUDA 5IC6A 3H1EA 4GKAA 3IDAA 1DTEA 1CUJA 3KYDA 1NQ5A 1PZXA 4M2LA 1H2EA 3K15A 2RH5A 4WESA 3T7IA 4NZNA 4WGGA 4KYTA 1Y5MA 3BWMA 2B7CA 3TQRA 3DAGA 3FHLA 1XF1A 1SG6A 4MVJH 4YQEA 2HCJB 3GPLA 1EIZA 4PXYA 4L4UA 2C3YA 3G2IA 4TQ9A 3TRKA 3U3ZA 1ELOA 1JQBA 1X8JA 3GAFA 3QYFA 1RI5A 4MRSA 1H2AS 2XLBA 3Q2OA 1H9AA 3C87A 3OEEA 1ULSA 2OCAA 2R1ZA 4H2DA 1AK1A 5EE1A 1FQOA 1XTPA 2CJWA 2PJRA 1WHSA 3FHJA 5DX8A 4CVNA 3PHGA 3VU9B 4BJ6A 1X87A 4W1PA 3E2MA 4FXOA 2P1RA 5AQ1A 1G1MA 1AZTA 2Y77A 3FSGD 3U6BA 1RP1A 4IGIA 3TVTA 2W2LD 1DARA 1RFGE 1X3SA 3EBLA 5E1BA 1I0LA 2Z56A 1DX6A 1JLMA 2OP1A 2QD5A 1WMAA 3EXEA 4IPTA 4OY3A 2PGDA 5ARCA 3G49A 3LYAA 4ZT6A 1OJLA 4P4GA 3FUCA 3FZQA 4Z0TA 5CTJA 1B43A 3PXUA 2WD8A 4U3JB 5IVDA 3FH0A 1PW7A 5GZ1A 5C52B 2PMWB 3CLKA 4AS2A 3RANA 3SQMA 3AVTA 1Q1QA 3TW8A 3V4VB 2P3LA 2GM3A 3G2KA 4IQ8A 3FSEA 2X13A 4MOWA 4PAOA 5JSYA 4M49A 4BQSA 3ZDAA 1XMIA 4DCNA 1YZQA 2ZRHA 2D5IA 2C8KA 2VXBA 3LQ2A 2GZ1A 3LT4A 2O4CA 3BDIA 4JDPA 4EPYA 3A1VA 4P5PA 4UDXX 4XTCS 1DOAA 2BVNA 5CCXA 2Q6VA 1V8PA 3M9WA 2P75A 1GNPA 1NVDA 3GMSA 3B2EA 3GDOA 3L79A 4BUZA 1YJQA 4ALKA 3Q8KA 3KKLA 1QIFA 2ZB3A 4IJWA 3VQTA 5LP1A 4K88A 3H4IA 1FUEA 2O8BA 1BE6A 3F7MA 4ZAXA 4Z7NB 5J2UF 2YL2A 5EHXA 2OGUA 3PVCA 4OQLA 1MV8A 2CNNA 3D31A 3NRCA 4UFOA 3OEED 2V74B 3TVDA 1OBHA 2NO6A 2YXLA 4JVLA 4PX5A 3MGBA 4X93A 2LVBA 2GMWA 1ZP6A 2GO1A 1Y89A 2FX5A 4DNXA 4GLFA 1DV1A 1R5JA 4HNQA 3NC1C 3BRSA 3QX8A 4WFJA 4HFRA 2JDIA 2ALJA 2XQJA 5J1SB 4BZPA 5LU9A 1XA3A 1UFVA 4ILEA 4MHOA 1GUAA 4JLNA 3R09A 4LZPA 4ZQEA 2GN0A 3M0EA 4BMVA 3GG2A 2WJJA 3JR7A 4GPTA 4QELA 3TR6A 3WWEA 1XX6A 2V9PA 1KJ8A 1XXHA 2I2XB 2HTEA 3WLPA 1W2WB 1LPMA 4MX8A 2QZZA 2W2KA 4MIYA 1Z5ZA 4XWKA 3DCNA 4X45A 3RUAA 5IMSA 5DXJA 1R3UA 4UULA 3N2NA 3E9MA 2QXUA 3GFBA 2GBLA 2EDCA 1RBZA 3JARB 3R5TA 2QRPA 3AR2A 1E3EA 3DTYA 4GGPA 4V2UA 1YIAA 2Q0QA 3MWYW 4YDRA 3D81A 4K03A 4TLCA 1G4UR 1CQWA 1A2BA 1IPHA 1OYYA 5JJCA 4GPAA 2R1VA 3MOGA 4AKTA 3LSTA 4ATNA 3FRJA 2XCTB 3SBOA 4P4UA 3GJ4A 1E6KA 1T3SA 2H51A 3EY9A 3M4NA 1TO6A 4DLUA 4ETMA 5DZSA 2JI6A 5D84A 2D74A 5F2NA 1MPTA 1ZMBA 1TTTA 1U63A 5AIAA 2I78A 4OQYA 3D7SA 4BB6A 5LMZA 2A5GA 3WQBA 1V9LA 2CLHB 4X63A 1EAMA 1GSAA 1CB0A 4GXQA 4CODB 1CUCA 1NNLA 1WX1A 1ZDMA 1RC8A 2JDID 2FPPB 2DM6A 1GUBA 2CL7X 1T36A 3G5AA 2XE8A 4TL9A 1PZHA 1U99A 1W2GA 3H5WA 3QYPA 4JL6A 3VHXB 5F35A 5K6TA 1OB5A 2YQ4A 1E6WA 4HPXB 2QD3A 2FXVA 2DEUA 3LD9A 1XF9A 4B6QA 4FN4A 2CDBA 2V7PA 4G4JA 4MEJA 3SDZA 4BO9A 2C5LA 2E55A 5I9SA 4QLBA 2OD9A 2XCIA 5LDHA 1EKXA 3BE8A 4YJGB 2IYLD 1W85A 4XPIB 3X1KA 5AW7A 3QENA 1QHIA 4M9XA 3H5AA 1PGQA 1U1FA 4YAOA 3ELWA 1FQJA 3JALA 4KXYA 2QTMA 2ZRMA 1BYUA 1P0MA 2ODPA 3H0CA 2X42A 3EVEA 2FMIA 4XWAA 5K8IA 4P7JA 1QK4A 4LZZA 5JQGB 2RHRA 4RTJA 1QVAA 1OLUB 3REQA 1V3VA 1FQKA 3V4ZA 4J0GA 1R8QA 1LPAB 4P3KA 1OU4A 4ZVOA 1JH9A 3FJOA 4XA8A 2R6JA 3K0FA 1XZGA 4HRXA 3RS3A 1R5BA 4DLKA 5C8YB 2IU3A 1CUBA 1RHMA 2AOXA 4YUVA 5BSHA 2FE1A 3UG7A 2P6OA 1N3LA 1YL6A 4AJ1A 1QHYA 1ZH4A 2H2AA 4KVGA 2HK9A 3P9YA 5K0JA 2O5VA 3QMVA 3T5CA 1TECE 1PF7E 3JYOA 3N59A 2QRGA 3NOVA 3R0VA 1VMEA 3HN7A 3O4GA 5JZOA 3WHIA 1U0OC 1YTLA 2H1LA 3UPTA 4X41A 2AW3A 4ZU6X 1JWBB 2DFDA 1IY8A 4OSEA 1OGJA 1NDQA 4NAVA 1UP7A 2A0XA 2H65A 2DFPA 5L4SA 1SG0A 1H2FA 1UBSB 2CNBA 2WIJA 3E84A 4LGVA 5IFKA 1G64A 4O8ZA 1XLTA 4EQ6A 1LRKA 2XT0A 1JLSA 3IUMA 1E9CA 4PS1A 2ORIA 4K9SA 4XQ0A 5FOSA 5AXBA 4EJFA 1SXPA 3C16C 4IOJA 5ALEA 3T1YB 3K4QA 1CZOA 1LKZA 3IHLA 1CFJA 3RJMA 3VRHA 4B6OA 3QZUA 4PSDA 4U5QA 1N6LA 2F9LA 4DIBA 2HMYB 2QE6A 2VJLA 4LNUB 4GH5A 1T1IA 1W9MA 1K9VF 4J7UA 4NATA 4OK3A 4UM8B 1ECCA 4LV6A 1ZRMA 5EXDA 4ZXFA 1V1MA 1JP7A 5FWYB 2PXXA 3GJTA 4XDGA 1ORWA 2FWPA 1BVRA 3FGPA 5T4BA 1D1PA 4F5YA 3W6NA 3J81k 1BN6A 1JPJA 3W3AH 1GHTA 2EHDA 2CXQA 3R44A 4DWWA 1TO2E 3GFTA 2B2CA 3OOYA 4FFPA 3M6AA 1Z5UA 4QOHA 1HTBA 1Y9JA 4U39A 2O2YA 4XR4A 3LRXA 3SYNA 3OE4A 1GL3A 3LY8A 4XQEA 2OFXA 2V54A 1RM5A 4BJ3A 1R7RA 5G3ZA 3QBVA 1UIMA 1ULAA 1TEXA 2OT3B 3PUKA 2DULA 4UEWA 3VVMA 2B37A 3A1DA 4ALIA 1QRAA 5CD9A 3CZ9A 4NARA 1S2OA 2A5JA 4M46A 2VYQA 4UUNA 1HZJA 1KRHA 2HSWA 2Q62A 2NZ2