4QT4A

Crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, streptococcus pyogenes at 2.19 angstrom resolution shows the closed structure of the substrate binding cleft
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
189
structure length
189
Chain Sequence
b'MVKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYLQENDFEKTMQKFNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Crystal structure of peptidyl-tRNA hydrolase from a Gram-positive bacterium, Streptococcus pyogenes at 2.19 angstrom resolution shows the closed structure of the substrate-binding cleft.
pubmed doi rcsb
source organism Streptococcus pyogenes nz131
molecule tags Hydrolase
total genus 58
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 4qt4A00
4Z86A 4DJJA 3OFVA 4JWKA 2JRCA 3TCKA 3KK0A 4JX9A 2PTHA 4LWQA 4QT4A 2NAFA 4FNOA 5IVPA 4QAJA 4ZXPA 1RYNA 4QBKA 1RYMA 4FOTA 3TD2A 2Z2IA 2Z2JA 5B6JA 3P2JA 2LGJA 3TD6A 5IKEA 4HOYA 3V2IA 4P7BA 4JC4A 4JY7A 4YLYA 4OLJA 5IMBA 2Z2KA 4FOPA 4ERXA 3KJZA 4DHWA 3VJRA 4QD3A 1RYBA 4FYJA 5EKTA 3TCNA 3NEAA 4IKOA 2MJLA
chains in the Genus database with same CATH superfamily
1WUJS 4M9RA 4QBGB 4R9VA 4XJSA 3W0LB 3WKAA 4AY5A 1DEXA 1Q0QA 1Y6JA 1LXCA 3CO5A 5IUKC 1F9AA 3T7TA 4EQ6B 3UVEA 4QYSA 3TMKA 1AHPA 3A3PA 3OMXA 1DMSA 4ZJYA 1H8HD 3ILYA 8ATCA 4M0DA 3C7CB 3EIWA 2WP8J 4HB0A 3RWMB 3G6WA 4DXHA 3RIEA 1H23A 5CVDA 4Q7EA 1O95D 1Z82A 2IZOA 2RGRA 3UYLA 1Y7PA 3OU2A 4I5FA 4GP6A 2XOXA 4M54A 1ENOA 3F6EX 4X91A 4GICA 4LDRA 1SBQA 1DAIA 2HA4A 4WUVA 3WOHA 3F6BX 1E3MA 1FSSA 1EM8A 3FKSD 1DG3A 2PL9A 3BEDA 1PV2A 3HCNA 4R8KA 3TQFA 3P2IA 3WGZA 5K20A 1PEDA 3A9VA 1T0HB 4WXEA 3AVYA 3AEQA 1UXKA 5JFOA 4NYJR 2PMEA 3I2JA 1L4GA 4QELA 3HWSA 3IP7A 4DWVA 2H2IA 1US8A 1Y9JA 1U2TA 1MVOA 4PG7A 4PONA 1P19A 1DQPA 4KN5A 4RYLA 1HYBA 4GPD1 4MEJA 3ICWA 1LNSA 4MMZB 1SVKA 1OLSA 3QEJA 3U1VA 3V2IA 1TZMA 4O02B 1WSWA 1MO3A 3FBTA 2OWEA 1W0KD 2FW1A 4FGSA 4NE9A 4QTZA 4WY8A 5E9AA 3UOGA 3VBCA 3WDKA 1NP6A 3GWGA 1T1SA 1EHIA 4ICIA 4DMUB 3BSFA 5EJ5A 4AX8A 2XJ4A 2FYTA 4AUKA 4C08A 5EJGA 3T1QA 5E4TA 3DLIA 3U09A 4JITA 3U60B 1LDGA 5CLGA 1WXDA 1PR0A 5IC5A 2P1DA 4ZC8A 4H1TA 4CLXA 3DZBA 1JBEA 2ESRA 2C88A 1H5UA 2FLVA 3G2QA 2J9XB 4OJMX 4ZGWA 1P7PA 2NSHA 2X9VA 4CL8A 1TL7C 2QRMA 4MMXB 4OMFG 3OEWA 2Q6KA 3LCUA 4KX3A 4RA6A 3VPAA 2IU0A 4CEHB 4LXUA 2Y6UA 1V5FA 3RJMA 4AYTA 1K4MA 1SXPA 3PE3A 3QOWA 2HMAA 5AI0A 5BSMA 3U4QB 3K1ZA 2H1IA 4JK3A 1O97C 4L08A 2YRXA 1YA8A 5KX5F 1JN0A 4YRFA 2CNBA 1RQPA 4PHHA 3LX8A 4IR7A 2WDPA 5AVJA 4D9CA 2NW6A 2XNCA 2J85A 2JL1A 1DX6A 3C74A 1PJSA 3ESDA 3G9TA 3PPVA 3KQLA 3H0CA 2O3SA 3DE1X 1PLLA 2HNAA 4OHRA 4Q4JB 3GRAA 4JJEA 3WICA 4TKVA 4V0LA 2X6TA 1I7PA 2GSDA 3RS0A 1UK7A 1VP3A 3KCQA 4QGAA 1NLUA 1WMEA 5CH5A 1E2UA 4Q1BA 4MDFA 1GQQA 1M6VA 2GXUA 1UKCA 4PHTA 1TC2A 1KNXA 1RHKA 1NUUA 1XKLA 3N7AA 4QFMA 2BM9A 1ESDA 2AI1A 1CVRA 2R44A 1JIIA 4WLOA 3I2GA 2FHPA 2AL7A 3PCRB 1FNCA 4GMFA 4HDNB 3LGXA 2A92A 2XQGA 4UFPA 4C0SA 2PVSA 1NBME 5FTLA 2VDMB 1E64A 3KHUA 1Y7LA 1AHHA 5J40A 1RYZA 3T9AA 3TW8A 1SB8A 2HSDA 1EWKA 2BFDA 2VR1A 1W88B 4FIZA 4JX8A 5J1SB 3L7OA 1KAHA 3WMEA 1WB5A 4LDPA 5AOCA 3OT5A 3DAHA 2ONKA 3AJ9A 4LDQA 4ARBA 621PA 1V8FA 3AUYA 4KL8S 5CP8A 3TW4A 4AXBA 1TU0A 3CW8X 3MERA 3P19A 3QV2A 3B1WA 1SBYA 1U1CA 4D96A 2J3IA 1S6YA 4YAKA 1GTSA 2PV0A 4S0XA 4XDZA 5AW2A 4LUCA 3TQHA 3OWHA 1T2NA 3MINA 4TSKA 4ZI2A 3EFEA 5EWMB 4Z4QA 2I4RA 2IEBA 4JJAA 1EP1B 3D2AA 1XCGB 3UKOA 1KJNA 4NCKA 2ZUFA 2OP0A 2RG7A 3A7EA 1S02A 2G9RA 1Q84A 1G9SA 2QUZA 4JLVA 1VSBA 5HX7A 1D4FA 3DLPX 4MH0R 5CW2A 1GCUA 5LYJA 2ZE8A 4WASA 1QIHA 2DPGA 3WO1A 3DE2X 1XYYA 4A0GA 1PFYA 2GKOA 3IEUA 2WPDD 4GQBA 4PZLA 2SKEA 3E2MA 1ZH0A 3P5SA 3VJLA 1P0CA 1P9WA 5A5GA 5DLDA 2BDUA 4KLRA 3R9KA 4G1FA 3O8BA 1CZLA 4Y8VA 3IE1A 2HDWA 1EDEA 2WMDA 1JVSA 3GO4A 1SBNE 2H7XA 2YKGA 2QTCA 1JFLA 4XDGA 5F1OA 3VZRA 1J49A 4XZ3A 4ARZA 4BJ6A 3JQ6A 1E0DA 1ZD2P 3HV0A 1T8YA 4Q00A 1HDZA 1XAIA 2HJRA 5JJ5A 1JR4A 4U2KA 1NNI1 4HH0A 1BTOA 1T34A 2ZVQX 3DKRA 4IG9A 4NV1A 4E46A 4S04A 2J5KA 3AVPA 4I1VA 4OKSA 5DM1A 2FPLA 5CMLA 4MV1A 1PNVA 1SCUB 1HDGO 2F00A 2IY9A 3PC3A 4R1LA 1DIOB 4TTQA 3RQSA 3DA8A 2VJCA 3S2ZA 3CUWA 5JW6A 5BMVA 2QS9A 2KLBA 3IAFA 1CCWA 3LTEA 4QQ8A 4X7PA 2O4UX 3GJ8A 4BUCA 2JANA 4CT0A 2P6RA 2IS1A 4TROA 1JA0A 3AFHA 5TQ0A 1XZJA 4ETNA 4F85A 3F74A 5CG2A 1C0IA 2H17A 3IE0A 1ML4A 4FSHA 3H84A 1W2HA 3K7EA 3E9EA 3EH2A 3JD3A 1N2BA 3QE2A 4Q4LA 5FTNA 5CCBA 1TGVA 4BASA 5AW3A 4YP6A 1UBHS 1XA0A 3TTUA 3NTLA 2AFIE 2D7CA 1QHIA 3O47A 4H6VA 1XD2A 4ALLA 1YOBA 1OZHA 4DV7B 3ZS9A 4WESB 4ZT3A 1B42A 3A1TA 3GJRA 4N5IX 3COVA 5D5QA 3PEEA 4YRPA 1OZAA 2VNIA 1R8QA 4U7TB 3T1HB 2I7CA 2K6GA 2LGJA 3IR5A 3IPLA 3DSRA 4N6GA 2JJQA 4J1NA 1V16A 3VHRA 4ZU6X 1JJVA 2XGSA 2ZS9A 3O3NB 3CJTA 4RMGA 3L0ZA 1QYDA 2PYDA 1MQSA 2GX6A 3M82A 4GVXA 4PGFA 4RY0A 1A7JA 1BWQA 3OTIA 3ZQ4A 3TIGA 2JNWA 5HWSA 2R4UA 3AUUA 1ZQ9A 2JK0A 1G1AA 1D4AA 3EVAA 4ALMA 3OPYA 4BKOA 1UT6A 4BQSA 4C6HA 1QYCA 4ITVA 3H5NA 3VDXA 3BJIC 1VYHA 1KAQA 3O21A 2Y1WA 2GF0A 3EXIA 3PFFA 1CVIA 1IRXA 1Z4QA 1NQTA 2CNWA 2G63A 2IDJA 2Q9CA 3EMBA 2M1ZA 4R69A 1VLZA 4W1QA 3FFXA 4KWTA 2YYZA 4WW0A 5HBGA 4BO0A 2HBYA 4R68A 4MV5A 1VPWA 2HJWA 2BOVA 1SKYE 4MR9A 3F97A 1DTWB 2YMPA 1NV8A 1XAHA 4JY7A 5K0LA 5GQSA 1AN9A 2GAOA 3DW3X 3AEYA 1QWOA 5FOTA 2XTAA 4E2XA 3FGPA 4D97A 1H22A 2A4KA 5EEGA 3ZV6A 4DB2A 1UJMA 1ZD4A 3SIWA 1BJKA 3IPAA 4YWHA 1G8JA 1V5GA 2FP3A 3ZJVA 4GD3Q 2ZIXA 1W6RA 1CB7A 3AHHA 3HNPA 5AVRA 1JH9A 1E3TA 2ZIFA 4YCLA 2YWEA 3KLMX 3I01M 1TCUA 2EBUA 1XMSA 1ZK0A 2W6QA 1JHOA 2I2CA 4ARSA 1DMRA 1D7AA 3W2GA 2I6QA 2ZYSA 2P67A 2NU6A 1RBYA 2QUAA 3ND5A 4MUGA 3VI3B 4WNAA 4C4ZA 1CY2A 2HUPA 2CUTA 1NXOA 1OX4A 4OCZA 2FQ1A 1Y37A 4ZVMA 5ITSA 1OR8A 2IF2A 4R7GA 5B55A 2OZEA 4JLJA 3KYBA 1H0SA 2C8JA 2AOUB 4D43A 2W5UA 2P75A 2VLIA 1H2XA 1PSWA 3K6RA 5ALHA 4XR9A 3AJRA 3QBJA 1M2OA 1KO4A 4OB6A 5LR6A 3C3MA 2XKBA 4YFVA 1PJ2A 4TN5A 1U3CA 2YWRA 1SBHA 2J87A 1Y8QA 4REQA 1D2HA 3BXHA 3ZY5A 2V3VA 3T5TA 4B4UA 2X0JA 1JKXA 5AW9A 1WO8A 3N07A 3GRPA 3SBOA 1IZ8A 3KSMA 1ZI9A 2BGNA 3PEVA 1M5RA 5G0TA 4I2VA 1NKSA 2OCKA 1X1AA 2SBTA 2WZCA 4ENUA 4GRAA 1IE3A 3KP1A 4HLDA 1A95A 3DEFA 1JHZA 1F8UA 2FB9A 1CIVA 3SZLA 4BVEA 4BX2A 2W2OA 5IT4A 1DZ3A 3FRJA 1HBJA 2OCLA 2QTVA 4X00A 1O6FA 3I1FA 2DC1A 5CNIA 1EB8A 1PVVA 3DTVB 4DDMA 2A4MA 1E2BA 2FVYA 3L4EA 4BZZA 1VE9A 2X0NA 4LXXA 3V1TC 1LD3A 1MNQA 1AZSC 2AXQA 3O38A 3PNYA 4NBUA 3RSZA 4B74A 2FWAA 3I45A 3NWEA 1JKJA 4NENA 2G4VA 1TTTA 1CR4A 2AMVA 4FOSA 5LWQA 1ZGAA 1LS1A 2HNKA 4XQ9A 3S28A 3Q7RA 1FU7A 3H1AA 1P61B 4XWWA 4JB0A 5K8CA 4P0QB 4MVJG 4QDKA 1RPNA 4QUAA 4B3XA 4P5EA 2OXTA 2B0CA 1CSEE 3AF5A 1OX5A 2QU8A 1V1MA 5FWXA 3VYSB 2R6FA 3AKZA 1SHUX 2R9VA 5ICEA 5JTTA 3ASUA 3PC2A 2FOXA 4A0HA 2WLSA 2IXDA 3DB1A 1IU9A 3EJWA 2QTFA 4J0HA 4DTCA 4LQDA 3CZQA 1CX9B 3VR6D 2AFVA 3Q88A 1FTSA 2QRLA 2RJOA 2Q9AA 1L7XA 1O9GA 3KTAB 4JI5B 2PWPA 4EY7A 4URXR 4REOA 2I91A 2OGZA 2OYRA 3E22B 5ENZA 3P2JA 1JIUA 1BYIA 3AWDA 3KU4A 5BYKA 1R6DA 4CFZA 4P81A 1OLOA 1X8LA 2VDWB 3DZDA 2FEPA 2ZLBA 4MI6A 4WXRA 1JZSA 2WJJA 4JI7B 2ZT8A 1YWGO 3TOVA 4KQ9A 5A06A 3AEZA 3KTOA 4W6QA 5J23A 2QWXA 3K9GA 1XEWY 1NUQA 4UC0A 3HLYA 2HHHB 3JQGB 3H2BA 3LJKA 4ZDKA 1C1YA 4CWAA 1G2IA 4JLMA 4UOQA 2RMKA 3QLUA 5AJXA 2VF2A 4J6EA 3DZIA 5GMOA 4UNNA 1FMCA 4HC4A 4ZN6A 1LU9A 4QGSA 1LGYA 1L5LA 2ZWPA 4M1MA 1GPWB 4B0OA 3Q85A 4G24A 1AQYA 5K6TA 2Q6VA 4F9GA 3Q6MA 3GNSA 1UAGA 1M8FA 3TDKA 1FYEA 2JLSA 4R1OA 1G2QA 1L7OA 5WRFA 2R4TA 3P71T 3V7YA 2IX9A 4IDCA 4Z8YA 4BECA 3QX3A 5K45A 1LDMA 2J6BA 3A26A 3LUKA 3OX4A 3LZ6A 3R0XA 1P7CA 3KUUA 5TQ2B 1TQHA 2E85A 2FCRA 1BCRA 5IUNC 2OFFA 4F84A 3WISA 1CY8A 1PI3A 3TF5A 4UVEA 1CU1A 4ZVLA 3ICQB 1JRLA 1UXHA 3CM0A 5KI6A 3MOGA 2H3EA 2NYVA 3NIFB 3AW9A 1XNGA 2V74B 3PNSA 2JLRA 4I0WB 4RIGA 1I2CA 2HXSA 1QP8A 3BTSA 3S0JA 3NJRA 4PXAA 4WFJA 4AZ3A 4JP2A 1KHHA 2CY0A 2JD2A 3F4KA 1IEXA 3RS4A 5B2FA 4NBWA 5E1OA 1M3SA 3NC4A 1LX7A 4MI9A 3HCEA 1N5RA 5DU2A 2JGDA 4QPCA 3NLLA 4G8JA 2XWJI 4KDFA 1I36A 4DCSA 2JLQA 5EFOA 1HUQA 5J2UA 2VS1A 5KINB 2V54A 1SVOA 1P1HA 3QM1A 4NH4A 5EJIA 4ALNA 1KYTA 3BQMB 3E8MA 3P94A 4AYXA 4BWVA 2NVUA 3R5JA 4MQ5A 4EHLA 1Z8FA 3SQXA 1ISFA 3IT1A 3KQNA 4HEA1 1IXRC 3AP3A 3UJ3X 2NUTA 3THSA 3R7BA 1L7AA 1GNLA 2G70A 3BCRA 3H6GA 3PBKA 4I1SA 4LHVA 3QW4B 3FDZB 4TKLA 5DYTA 1FU8A 4C5BA 4EX7A 3QF4B 4XIIA 1JP7A 4KQMA 2VTEA 4ZCLA 2JLBA 2QR3A 3HDQA 3NGMA 4KXLA 1SG6A 1G4AE 4OXIA 4RKQA 4KPUA 4RZ2A 4TS9A 3KQVA 4UAJA 4DC1A 1V3QE 1RT9A 1BRMA 3HVKA 3REFA 3JAMA 4AJNA 2VC2B 2C7PA 1R12A 4V0NA 2VAPA 4H0NA 1T35A 3T9DA 2AG5A 2O8NA 4W5TA 4IJWA 5JATA 4M55A 3T5DA 4AJJA 4AM8A 4PYMA 1YUMA 1NMQA 1WTAA 2JCXA 3ZGLA 1VJ1A 5LOVB 1VG9B 5JAMA 1Z0FA 4WCFA 3MTIA 1NQUA 3NT4A 5BSVA 1ODTC 1USIA 4XYGA 2ACWA 5DO9A 2D0DA 4K3UA 2EOAA 3MGAA 4QIHA 5EE3A 2VJAA 5EN4A 3RUHA 4BLVA 2Y3IA 4XR4A 1MRNA 4D3SA 1Y8RB 3ABQB 4HNTA 3BJEA 1JHMA 3FVVA 4JNKA 4N8SA 4NULA 2V58A 5FNVA 3DNPA 4Q5IA 3ZHTA 2I4NA 4U7FA 4RQTA 2BZ1A 1UAYA 1W49A 2HXYA 3BC1A 4JT4A 2RHOA 2A9VA 4C03A 1TA0A 5BWNA 4F12A 3MJRA 4G56A 5BQ3A 1E1RD 3FYHA 1MC4A 4M4SA 3VC3A 2O2ZA 2HBZA 2Z8YM 4A8JC 1TM4E 3VR4H 4UOZA 1UBTS 1P60A 4HUQB 4C4OA 1QGUA 1E60A 3I9V6 3X1KA 1WETA 3PRYA 2ONYA 2VIIA 4BMPB 4G5GA 2Y67A 2NZJA 4KK4A 4A7PA 4I5IA 2RHBA 2WI8A 3C5VA 4TMTA 1KE1A 3FBGA 4NOKA 4G3XA 3V34A 1W0JD 3EQ6A 2IBMA 1HR0B 2Q07A 1A3CA 5FBHA 3TLXA 4BB0A 1LTKA 1HXHA 3FTPA 5HK8A 1QYIA 4TXMA 1XZIA 4QHSA 3KDPA 2OZKA 4BBAA 1GY8A 1WWKA 3LBHA 1O54A 1LBHA 3MELA 4K9OA 1Q16A 2J5XA 3KX2A 4QFBA 3KYCB 3FSGD 3K9HA 2O3JA 1HH4A 3PNPA 3TEFA 2H54A 3PUKA 1KWGA 3LVQE 4I1UA 5MF6A 1ISSA 2H5JA 4QJBA 2P77A 4RCYA 3ZBQA 4HYYA 3KR9A 1CRWG 3CUVA 3UFXB 1I7NA 3Q0EA 2D5LA 5AWFC 2HD4A 4H1HA 1POWA 1X8JA 1UCFA 2ZCJA 3T54A 4IIXA 2ZREA 2HZBA 3NNNA 4TT3A 3ZDZB 5DYGA 4BNNA 2BSQA 4DA7A 4US1R 4HNUA 4GGPA 5ELMA 1G98A 1EVKA 3KE8A 3M5DA 3C7AA 4HLUC 1ETUA 4QM7A 5F3WB 1PZMA 3KKLA 2RH8A 3KLOA 4NE7A 4ZKDA 3PQ7A 4JI4B 2P3SA 4JFAA 4LTMA 5CA1A 2RHGB 5CVCA 5E1DA 3TRJA 2P2LA 4XQEA 5LXTA 2Q8QA 1YVDA 1ESMA 1KKLA 2F67A 2P4HX 2ZZKA 5DRYA 1L5ZA 2G8LA 4ZRMA 2HQOA 2ZRIA 2QE6A 3U4IA 2DJIA 1R6VA 3HCWA 4RA9A 2EFCB 2PL5A 1V37A 4YGYA 4WKCA 4CKXA 2MSDB 4RJ2A 3RSQA 2DBZA 4MCAA 4BMZA 2QD1A 4IZ6A 1VGQA 1I7SB 4GZLA 1U0SY 4UUPA 2C61A 1ZM4A 4JP8A 1Y34E 4KXMA 1LZKA 2NQTA 3G13A 5FIUA 3KLPX 4OA8A 2NV2B 2VYCA 3UCEA 5M34A 1WF3A 2O2HA 4QTUB 1HYGA 1YQXA 4W1RA 1IN1A 2X86A 3VSEA 2PDAA 2NG1A 1KVQA 1R5NA 3GT7A 2WIBA 1FP4A 3FA2A 2UUBB 3IQIX 4JUFA 2P40A 2VEOA 4KAJA 3TAUA 3NATA 2Q3BA 1KEUA 2O9JA 1XRQA 3K35A 3LYUA 1YA4A 2Y27A 4DXAA 5IM4F 1OGJA 1FXWA 3I72A 1EK0A 1T3TA 2E1PA 4I4NA 2RD2A 3MWLA 1F8YA 4RABA 3IVGA 3OQIA 4CPDA 1KSGA 1VYVA 3AQIA 4RANA 1T9HA 1GPH1 3NDJA 4X8HA 2Z6AA 4I9HA 1ZH8A 3GGPA 2YWBA 3AKYA 4JUAA 1B16A 1AT1A 5JH7A 3K0CC 2Q4EA 4HWSA 4ND7A 1TFRA 1SVSA 4J1TC 4B6QA 1RZRA 1P3DA 4I9FA 4YCDA 5BMOA 2YWDA 1UC9A 4DLAA 1J6UA 1FFSA 2CE2X 4LMRA 4WBXC 4TZTA 4ZHQB 5TQJA 3K8ZA 3LRXA 5LJLA 1RRCA 2B7BA 2ET6A 3CX8A 3DFKA 1CYEA 3FWHA 4QE3A 3QGMA 1FXSA 1ZM3A 2QI9F 3ER9A 2V7QD 3ESBA 2B78A 2A0UA 2VK1A 3DZFA 1A7AA 4J2TA 5HOQA 1YHNA 2VI5A 3FMGA 2W2NA 1V48A 3THWA 3W8FA 5AFSA 1EFHA 5ERGB 4HX2A 1WPXA 2VPQA 2MR5A 5I5EA 4EUEA 3CBGA 4WZ6A 1GGFA 1OBVA 2AW5A 3OE7A 3WG9A 4X5OA 2OHGA 5CXQA 2IRWA 3RU9A 2QTLA 2QENA 1M34E 1JV2B 2C94A 4B82A 2E5WA 3O8OB 3LNTA 3FPKA 4Y0VA 4XDYA 3LVFO 5AESA 2VF5X 5CT4A 2IBTA 3HKCA 3L8GA 1BMDA 2HHLA 3MBIA 4OBWA 4PGHA 1Z5UA 1F0PA 1QFMA 1U7DA 3RSFA 1ZQ1A 3IO3A 2ODQA 1Z56C 3BTVA 3RTEA 1K5PA 1G8PA 2JHPA 3O8QA 1TO6A 4LHWA 4FYKA 2VG8A 2DYKA 3LE8A 3JWPA 1E9AA 3ULKA 2WAAA 1OAAA 1CY6A 3AEKB 3R8CA 4MROA 3WJ1A 1YQTA 2WG1A 1VJ0A 3DXZA 4HYTA 5DGTA 3N2LA 4JT2A 3S1AA 3K70B 4LBVA 2ZATA 2RGGA 3P1JA 1DQSA 4EHFA 3CURA 2ID8A 3FZGA 3IQEA 2P9TA 4KE7A 4UEJA 2AZXA 4HTFB 4JA0A 4N8EA 5AJVB 4ZO4A 2HA5A 1Z7WA 4E15A 1QONA 2JFWA 1MF7A 3AYXB 1DAPA 3GRZA 3QBEA 3QEKA 3T7JA 1G8AA 3ENWA 4BWGA 1W34A 5DV9A 4HL6A 4BDSA 3GFPA 1P6QA 5AW6A 5KYNA 4JUIA 5ALFA 4IX1A 3QEOA 3PXEA 4AO6A 3CF4G 1K6EA 3QF7A 5IEJA 2YZNA 3IKLA 1X1RA 1N57A 4R7TA 1W44A 2AOTA 1XU7A 2HK6A 3FLMA 1B93A 1P3JA 2BP7B 2JFQA 5KUTA 3GCDA 4QYIA 3QU4A 1NVMB 3HO8A 4KLCA 4FILA 1RAFA 3BRSA 5B3LA 2HSEA 2YZ2A 1WEHA 4C6TA 1TM2A 3I9MA 3OC6A 3OURA 2HL6A 4EB6B 4FI3F 3D1LA 1PUIA 2IA5A 4MV6A 4YJGA 4TYPA 1RMQA 3O74A 3A3KA 4DF3A 1OQAA 1QXSA 2ONZA 4NONA 4M87A 3V9AA 3AUAA 3B3FA 1GCIA 1LTHR 3IAAA 1CG6A 4TXJA 2H9IA 4LGMA 3DDCA 4NFSA 3AY3A 3H5VA 4BV9A 3QRWA 3P4XA 1Y5RA 2J45A 3WK9A 3CUKA 5LDGA 4A27A 1GG8A 5CYPA 4UPVA 1ZCZA 4K1LA 1E6KA 4E31A 3FCCA 1VDMA 4NBTA 1E2GA 1RJWA 1USVA 4AF7A 4LV5B 4DXDA 5GAJA 1NXWA 4CTNA 1GKIA 1CT9A 2POCA 2BHLA 1OWPA 2QTZA 4C01A 4R31A 5JT1A 3GDFA 1R50A 5JYEA 1NP7A 2EP5A 3NH6A 3P0EA 3PQ5A 5JMWA 4M1QA 1DFIA 4BNLA 4C0LA 1R8XA 4ATNA 2YWCA 3ITDA 1GUBA 3AM1A 3MGKA 5AM0A 3DMTC 5TPWA 4RMHA 3TBKA 2ZUVA 5IDYA 4FYVA 3K5HA 1GQSA 1Z4NA 5BXQC 4JLOA 4PQFA 4EO9A 2MT9A 3HN6A 2JIMA 3VYWA 3NVMB 5A5DA 4LECA 1F2TB 5H9VA 3OE5A 3VI4B 4H6XA 3R74A 3UK2A 3COJA 3V3TA 4RO0A 5LBIA 1EMDA 1V9LA 1VG8A 4RAOA 2OHJA 4XJTA 1D03A 2AK2A 4Z9AA 2UYHA 2PQ2A 4KR7A 3QVJA 1G4UR 5DEIA 3VU9B 4FFDA 3HG7A 2CNLA 4AW9A 4HVCA 3RREA 4Y1EA 2K87A 2O50A 4A6XA 1JJAA 4PLTA 5AH0A 4KVAA 4EW3A 4KAAA 5LWHA 1I7DA 3THXA 2GBCA 1IN8A 2HMWA 2L0XA 2OHIA 3I39X 1BYUA 3OIUA 4PYKA 5HRCA 3PI6A 2PS3A 2WD7A 2JATA 2BKLA 2ZRPA 3H8JA 4M0LA 4NMXB 1THZA 1Z7GA 2GZDA 2OO5A 1UQUA 3BGDA 2H1CA 3SOZA 4D74A 1PW7A 2OSVA 3LCRA 1EP2B 4O25A 5EQFA 5BOVA 4ZDIA 2ZK7A 2O19A 1IY1A 3IULA 4ZO6A 4O2AB 2RFLA 5DSXA 1T6YA 3SQDA 2VHQA 1I6LA 2WIJA 4GKVA 1W25A 2R8XA 3B12A 4S3MA 3W77A 2OCDA 4A91A 5DBOA 1M66A 2IPOA 3LQKA 2F48A 1PNRA 2I1LA 4MCJA 3D4BA 1IB6A 4ER0A 2DU8A 2Q0SA 1CZOA 3DP7A 2Q1XA 4CKZA 1A2OA 2HF2A 1FNSA 3SVLA 3D59A 5LKRA 2BI7A 1OAKA 1MX9A 1T25A 1Y3AA 2V5UA 4K2HA 4PBRA 4TXNA 1CQPA 4NLLA 3ZKWA 2P6UA 3ZWYA 2CVHA 1LPNA 4L0MA 2E4ZA 1TRHA 5B2ZA 3OC0A 5T7BA 4JSTA 1YZQA 4PLFA 3L6BA 5FA8A 1ZIYA 3SWWA 3K6JA 4JWTA 5CB4B 3PQ4A 2QL6A 3T0IA 3PGJA 4M0PA 5HS6A 3K9NA 4EG4A 3TUIC 3MJ4A 3GPBA 5A1JA 4I08A 2GQ0A 1J8MF 1T0PA 3ICEA 3A4IA 2W8BB 2V03A 3B1YA 1YD7A 2H08A 3I6QA 4W9NC 4WKNA 3UJDA 4DYVA 1ORRA 1TEVA 4G4IA 1A76A 1BJRE 2YIJA 1SHKA 2YN2A 4C7JA 5A1TA 1MW8X 3I5AA 4L2IA 5ED0A 2BGMA 5DCYA 2R6R1 2V9ZA 4IW3B 4LRUA 1SUBA 3PHLA 4S1PA 3SS9X 2B5OA 2GFQA 2XGGA 3R6LA 2JFBA 5FPQA 2XCIA 3H65A 4YP1A 3RJ9A 3M8KA 1IOVA 3D2LA 1N2JA 1XCOA 1IJEA 2DERA 2UKDA 4MUAA 1MG0A 1W0JA 1QP7A 4KYUA 4BLOA 1TNDA 2HIAA 1ZICA 2XUHA 3TL2A 5THKA 1GV0A 2BCJQ 3ZBUA 1YQWA 3HA5A 5FI1B 3QNMA 3K15A 1KJYA 1NF3A 5DGDA 2RH5A 3SZRA 3JATA 4DBLC 4L3OA 2N1BA 3M6LA 2DMRA 3A32A 3G5UA 1GA4A 3JQ7B 1DKLA 2QK4A 3NV7A 4LJYA 3TOZA 4EVIA 1ZW1A 1TCBA 3M6VA 2IX3A 1ORDA 4G2NA 3E3OA 1MFZA 1JSRA 4GKBA 3RASA 1R9NA 3DD1A 1RADA 4OSPA 2QVGA 1P6UA 3BCHA 4OQLA 3UV3A 5JZMA 3HWX1 3JARA 1BFKA 1GQOA 3WIUA 4MZDA 1T6XA 4LC9A 3VJMA 4AJKA 2H1HA 1M2FA 1NATA 1WR8A 1U4OA 3CVXA 1VKNA 3ZDDA 5JD6A 5BUQA 1CERA 4BY9E 4CKYA 3CY6A 4XGRA 1G5PA 3BSWA 5ALOA 1BU8A 4ZYYA 3WAJA 2J30A 4W5NA 3CEMA 4QOHA 1U7UA 2BEKA 1R9MA 2D3WA 2RGCA 1BDIA 2W6MA 1M2KA 4JJ8A 5EJ6A 1CPYA 2AF3C 2BMDA 1N7JA 4B6RA 3RYIA 4TS3A 3PLNA 2GN0A 1K7FB 4Q9DA 2Q3MA 3AQ4A 3T1VA 1ZVJA 3VHLB 3GUVA 1Z07A 3DV9A 3LCVB 3BMOB 2PX6A 1JKMA 1QLJA 1SBTA 3EF1A 3HZHA 3PGVA 4OP2A 5DXAA 1JU9A 4UNSA 1SCIA 3TFQA 4BEBA 1JHYA 4MV0A 3ZI4A 1NI4B 3IAS6 5KDLA 5BUZA 5JY6A 3IKJA 1PGPA 2HQRA 4R3WA 5CT8A 3V2HA 1Z6QA 1XB2A 5J5VA 2PZMA 2NLOA 2O2EA 4MKRA 4ZJUA 4N6OA 1Q3TA 4EUFA 2LBPA 2ZBPA 5LUAA 4KIFA 5CIYA 1ST2A 1GCGA 5E6UA 1YK1A 1NVVQ 1YB7A 4FFNA 4Q4AA 3UHPA 1UC5B 4M1SA 2QE7D 2WTEA 5C4IA 2QLBA 2QZ9A 3UJPA 1ZWLA 2BKXA 1S01A 3CG4A 3GVIA 1VIVA 3SF8A 1CUAA 1FMJA 1BE0A 2M32A 3E1KA 4I50F 1P0PA 3DONA 1ZUD1 1DU4A 2ZRQA 3KS9A 4BEJA 1G291 4L8VA 3I6YA 1EQ2A 3GG2A 1X7WB 4JKYA 1SA0B 1T5SA 1GZ3A 4TVSA 2MU1A 2DE0X 1TRKA 2J7KA 2JGKA 1X7GA 2L19A 2HCRA 1O6BA 1DG9A 4WHMA 5K2MA 4HBZA 2Q2NA 1XO1A 3BXEA 4GZ6A 2ZSEA 2RHRA 1RQGA 5K3FB 5AUPB 1I6MA 1O89A 6Q21A 3FRHA 4AS2A 4PYJA 3Q8WA 1F7UA 3DMFA 5D1HA 2YZKA 1MJHA 2AD5A 2YH2A 1Z8HA 3FKJA 4DCPA 4AKTA 2V7QA 3BL5A 3LMKA 4Y2QA 4E5MA 4OH7A 4NNPA 5T41A 5LYYA 5CDUA 1VYTA 2D5AA 2H06A 5IAEA 3FLEA 2O0LA 1JAZA 4IJMA 4BVAA 3TM4A 3OFKA 3G0DA 1N9GA 1AV7A 5A5FA 2ZKIA 1HT3A 3CVOA 1NVVR 4IQFA 3D0QA 2BTQA 1RWXA 1G6KA 4I1RA 4KMRA 4HXEB 3UM9A 4RXUA 3ECAA 3A0UA 3P2YA 4KKVA 4MKFA 2VWGA 1MKYA 4FR0A 2JGLA 3FPCA 3I9NA 1I3NA 3K2IA 1L4UA 4H7JA 3CNOA 5SY9A 3A4TA 2ZE5A 3T7RA 3ZDFA 3KNZA 5EHGA 4UE3S 4L74A 4O6VA 5DX0A 4JOSA 4GL2A 4ZOQI 2ZITA 3DHEA 5CIQA 2QUBA 1F38A 4MQMA 4CF4A 4RTRA 4FHGA 3KDAA 3CUSA 4NAHA 4K0RA 2Q4DA 2M98A 1OB2A 4C3UA 4OM8A 1C9EA 1LRLA 4LXHA 1KYQA 1N8SA 4RZXA 4IGFA 2VHUA 5DLEA 1UFOA 3MB8A 2FGJA 1VKHA 2VH1A 5IAKA 2ECKA 4QDZA 1T0IA 4ARCA 1MAVA 2PLFA 3AEQB 1WUHS 5KQRA 1L1QA 3H16A 1D2NA 2IYNA 4RPKA 3RTAA 1US8B 5SYNA 2EGHA 4CMEA 1LJ8A 1G55A 5A71A 3ZE2B 1PGQA 5ALGA 2ACKA 2OBNA 1ZSVA 4IV0A 4PBSA 5TB5A 3ETHA 3UMCA 4YRDA 1OLSB 2PO7A 3SX2A 1CS0A 1CUHA 1ZP6A 2HWXA 2JJ2A 4ND5A 1I0IA 5B4TA 4X65B 4NZ9A 3ZXXA 3MT8A 4II3A 4TXHA 1XQVA 1Z6YA 1FLNA 4W7SA 4ERNA 1PJCA 4YP7A 4IP0A 1LZLA 4BNJA 3PXUA 4C21A 1ZN2A 3N2KB 5KJEA 4ZEMA 2CHVA 3NUQA 2P2ZA 3L7NA 4QREA 1YIAA 4PAWA 1EFKA 1Z2PX 1T5BA 3PB3A 3NTQA 5UKDA 3ZWQA 1H2ZA 4ALKA 4BGEA 1GEEA 4K9NA 1IJBA 2YS7A 4PR0A 3WL5A 3O31A 3OFSA 3GLGE 2YWFA 1RIFA 2JI8A 1KMNA 3CONA 4NWIA 3B20A 2CLOB 3UKJA 4ZMBA 5MDHA 1HL3A 3UAZA 3VVBA 5L40A 3W5CA 1NXXA 1O94A 1ZOLA 3DD5A 4WXYB 1JQDA 3UXHA 3LPAA 1C4WA 3LQ2A 2WSSD 3L3BA 4RA6B 1D0VA 1UJ2A 3QIAA 2PRIA 1OZ0A 1E3WA 3G1TA 3F5MA 4AMYA 4CBVA 5BSWA 1XD8A 3T1TA 4D9GA 1VCNA 1Z0SA 3AZQA 1EWVA 1YS9A 2R6GA 4AMUA 3A6DA 2ZBFA 2WKSA 1JDBC 1J7KA 1NLZA 5EAIA 5B3JA 3CCBA 3TL6A 1XP8A 4R1PA 1XZBA 2OK8A 1LWOA 1NMEA 2FN9A 1RYEA 3LX6A 2H4XA 2R2GA 3AG6A 1FVHA 2OOSA 2VYND 3QYFA 5J2UF 4L8YA 5JZBA 1EAYA 3L7KA 2XTZA 4TKVB 5AKKA 3FTNA 2EKDA 4Y9RA 4F8JA 4Q7LA 1M6VB 1V1JA 4OOFA 2EVWX 3FCUB 1DC7A 4BGUA 1KE2A 4Q39A 2FPMA 5LQRA 1SM4A 5F3RA 3ONVA 3FNBA 1GSHA 4P3XA 4HSEA 5JNLA 2QQGA 3W8DA 1PW5A 1KPHA 1TQ8A 5H9WA 1OJ7A 3UIEA 3MJDA 3VU0A 4KSBA 2QJFA 2FGKA 4EFLA 3PUXA 4GXQA 1XKXA 1MOZA 3QPUA 3QUCA 3C3XA 1X42A 4JSRA 4L16A 5DGHA 3LQ4A 2PQ6A 2VQFB 3TW8B 3U16A 2I1WA 2GBLC 3V8MA 3NYQA 2MSNA 2BFBA 5COQA 2VJLA 2XE7A 3D4LA 1IULA 4RWEA 5TEWA 1KMQA 3M9LA 4MHSA 2W0MA 4CQMD 4B3SB 3F71A 3B3AA 5ALQA 4AF6A 3G5MA 3S1LA 2O2GA 4IKEA 2VPYA 4LGVA 3LD9A 4RIFA 2GBFA 3G9UA 1LFDB 3ID6C 1G20A 1VSQA 4I5EA 4MWEA 1SPXA 2O23A 1YDMA 1DPFA 3K1JA 4FR2A 1UF9A 2DUMA 1FTNA 4G1EB 4XUGB 4ZEVA 3MINB 5HM8A 2BEVA 2DFNA 2PUJA 4IIGA 4RESA 2ZJ5A 5ARBA 3RAJA 4ZYXA 3C15C 2IYYA 2Y92A 1C7FA 1R4AA 2BBSA 2QMZA 4NQRA 1U94A 4XVHA 3WK4A 5EJFA 1SAYA 5HGXA 5LYJB 5KAPA 3UAYA 2GS9A 1YGYA 2FRVA 5HZGA 3MEQA 1VCMA 5AM1A 3K2BA 2JJ1D 4JXXA 1SD2A 1ONNA 3AVUA 4PS1A 4UCFA 3HB7A 2WJAA 1YMUA 1BWSA 2YY6A 2GILA 2ZB2A 3TTTA 1ISGA 5ADUS 1YBAA 5JEDA 2DWPA 4QUBA 1JL3A 2B7LA 3ROTA 1XFAA 1ND5A 4BYGA 2AXPA 2AJDA 2X1LA 3ZUGA 4CMHA 3CU5A 3K5PA 3KB2A 2FX5A 1BS9A 1MC5A 2HH9A 4WCDA 2XCSB 3BBLA 3RS7A 4ARZB 2LCFA 4RW0A 1BG6A 1JZQA 2IU3A 3L5KA 1KFBB 4DIKA 4CLOA 1ZW6A 2A78A 3SYKA 4N40A 4F9FA 1NASA 1VMEA 2V7VA 4GPTA 5KJCA 5K3OA 3UUFA 3RIYA 3ZZUA 2EF1A 3KFLA 3FUTA 4N5MA 4XVUA 3AW8A 2NACA 3HUEA 4B6FA 3RABA 1UKEA 2WKRA 2WV9A 3WYNA 2BI8A 3DE6X 3CZMA 3L7JA 4FJ2A 4A6EA 2D06A 2HM7A 3AOGA 4NDAA 2PX0A 1H4QA 3HXPA 1Q7CA 3DXXA 3NRCA 4CM3A 3NOQA 4U2CA 4YCSA 2AN1A 2EZ8A 3QI7A 2XXAA 3JQFC 1PVOA 2NXJA 2XVMA 1THMA 1J9EA 3ZU2A 5A2GA 5BMVB 3BAFA 5AOAA 3LC1O 5I8WA 1Z7BA 3E48A 3ZY2A 3NEYA 1CY7A 1TA4A 2CCKA 2AA3A 3OKCA 5JMTA 3OZXA 1JQEA 2HU5A 2O8VA 3S8EA 1U63A 3LQRA 3FDIA 5LA6A 1DRKA 1WPQA 3ADOA 4WZBA 1HG1A 3LC0A 1E1NA 2GD1O 4LYAA 3PFHA 4JYPA 1C3VA 1KZ7B 1TD9A 4ZVKA 4YJ3F 3B6JA 1D09A 3R3JA 3GAAA 4X8LA 5H59A 1GDTA 2II6A 2I9KA 1XD2B 2J4CA 3L41A 3VOTA 4DDHA 5JUWA 1AKQA 1M74A 2YHUA 3TD9A 3KXPA 1XTJA 3RVPA 1H6DA 5T4HA 3WFJA 1B3RA 3NGXA 4L50A 1IOLA 1KI4A 1ZMBA 3JWJA 3RRXA 3WZLA 2C4MA 2VRWA 1XNQB 1SO8A 4DMLA 4XIYA 3I23A 1BVRA 2OB1A 1VSVA 5FBQB 5FOVA 3TGWA 4YH1A 3RU2A 2EXXA 4V0OA 3VH3A 4KHPB 3L7IA 4X62B 1V16B 1C1HA 3O7MA 3RVJA 2UAGA 2ZUDA 3E0QA 3OEHA 4ZZIA 4JLUA 1YU9A 2H8KA 2ECOA 2W71A 3OD1A 2PUAA 2ZYHA 1DLJA 3ZLJA 4EGFA 4F2HA 3U3KA 2G1UA 3OPYB 1LC3A 5AJYA 3GEGA 2E87A 4GOOD 3QW2A 3L6UA 5D3QA 1J8YF 2F17A 2QD2A 3N59A 2O06A 4ZI5A 2JGMA 3EXIB 3CWCA 4LZWA 4OXQA 3ZNQA 4C0XA 3NBKA 4Q1FA 1RWWA 5IN5A 1C1XA 4UUNA 1GPYA 4PAQA 2BLNA 2RK4A 3M70A 3AVTA 1EGHA 2TYSB 5I7RA 2ZJ1A 2J46A 2OUIA 2ZP1A 4HFNA 4LRTB 4P82A 2DQZA 2PXAA 4DGSA 4C1NA 4IIBA 1GPLA 1P3Y1 1QIIA 4MR9B 1NG1A 4N47A 3N39C 4G86A 2PQ0A 3KEMA 3T7CA 1JSLA 3O3CA 1FBNA 3PK0A 5SYAA 4MGEA 3HVIA 1G19A 4RKYA 1A2BA 4Z9BA 3H4MA 4CU2A 4CLDA 5BURA 5EOVA 1YI1A 1UPCA 2DM6A 4L76A 1E9CA 1LV7A 1HTTA 1QORA 1Z4MA 2J7PA 2NPIA 2PMBA 3VNVA 2WBLC 3AH8A 4LVOA 4I99A 1QHYA 1H9CA 2ZIXB 1NI5A 3OP4A 1D2GA 2FUKA 3TO5A 3OM8A 1FS5A 3RUPA 1QIEA 3N9IA 4AJLA 1KK1A 2WK1A 3MPUA 4HZIA 1HDCA 1OI4A 2N0SA 4ON9A 1QCCA 1JBKA 6NULA 4V1CA 4Z9XA 3MMZA 3WWCA 4BRWA 5AI9A 1HQKA 4BGIA 1OX6A 4HAYA 4C6RA 4S1VA 3PE6A 4MVCA 3FR8A 3RHTA 5IKOA 1USUA 5LN1A 2XAAA 1QIMA 2NU6B 3FB4A 4JSYA 3G0IA 3RTCA 3H83A 2QE7A 1GGMA 2YW2A 4IHQA 4OIMA 4WNAB 3ZXSA 1OX4B 2VH2A 3TIIA 3W34A 1LKZA 4L7VA 1DX4A 2AUTA 1HETA 3O75A 4OXXA 1WXXA 2DJ5A 1O7JA 4LDNA 1HNWB 4FKBA 3OZUA 2B5WA 2AJ8A 2VUSA 2GPWA 2H2WA 1QR2A 2PS9A 2EKPA 2X6RA 5KU1A 5LLTA 2CNKA 3GJ7A 1M2OB 5EXDA 1OAOA 5KQLA 1NBEA 1ZI6A 4C88A 4UOEA 1Y8QB 3GFTA 4R8RA 1I5RA 4REQB 4AWAA 1ZKDA 2X15A 4C0BA 2YWGA 2GD0A 4HUJA 1HQYE 2QGNA 1ZM9A 1GZUA 3M5PA 1PR6A 3U6BA 4R1MA 4NS1A 5D2CA 2ZAIA 5FAXA 4BFLA 2FF7A 1OXMA 3D54D 1MLDA 4JP3A 4CIXA 4I3HA 2AG1A 3KPYA 1NN5A 3Q3GE 5B6PA 2OCPA 4W82A 5A05A 2SCUA 2ZAGA 3FB1A 1PR1A 4YQEA 1NR7A 4GNRA 3WL6A 1UWKA 1BWRA 2QTVB 1Y1QA 5CX4A 2IHZA 5EFZA 1ZK4A 2GJKA 1BHQ1 3RU3A 1QQAA 2IEGA 3ABSB 3K9LA 4XQGA 4FYJA 1CY0A 4AMVA 3GXBA 1T2FA 1WCWA 2H52A 3N2GA 4HSGA 2H92A 1Y7IA 4NENB 4P5PA 1JKJB 1KJIA 1YR3A 2AEMA 1YZVA 5C1OA 1W1IA 1OFHA 2XOKA 3VKFA 3R9XA 2I3BA 4M8IA 2VJNA 1ONBA 3S8MA 3ASYA 2IEDA 3I04A 3LDHA 3MFQA 4XXHA 1ZJ5A 4PY2A 5EZ6B 1DSSG 1XVLA 3JYOA 5A6VA 2GHTA 4IJKA 5DHPA 1QBGA 1XG5A 2ERYA 5TLSA 3JQ9A 1V1MB 1PHRA 5FWXB 2H4WA 3OIVA 3TZKA 1BD3A 1VMKA 2QZSA 4FFOA 2ZIUB 4NK4A 1TUBA 1R00A 3KZMA 1VMDA 4LBZA 221PA 5CXSA 1HSOA 1U9IC 3DQZA 1P5JA 4BRZA 3VM6A 1N2OA 3HE3A 4N18A 3OJLA 1RM3A 1TW3A 3OOHA 5KTRA 4ZQHA 2RKWA 3B8EA 3WHLA 2GOYA 3QMVA 3T95A 4Y2RA 3LUAA 4HV4A 3LKVA 2OLKA 3M3HA 3ER6A 4JL6A 2J8ZA 2R87A 4V24A 3SIPA 4W7IA 2GFHA 2RAFA 3GA0A 4Y2YA 3KB1A 3PUVA 5H16A 4DC9A 3DEJA 1IB0A 2XXJA 4C4YA 2QDXA 1BQ4A 3D6VA 5HVNA 4K6MA 1G41A 3N6XA 1ZNQO 3IAHA 3GELA 1AGYA 4QDXA 1F4LA 1H5QA 1YXMA 4S12A 4WZAE 4KREA 3G8YA 5CGQB 5JJIA 2C97A 2CLSA 1DJMA 1DRUA 2XYRA 4UFNA 2QQEA 3PHHA 5FTWA 5LIPA 2OVBA 1Y9AA 2OPHA 2IS2A 5JECA 3FTCA 2FTKE 4OREX 3MAGA 3S5UA 3U9TA 2WVHA 1VC2A 3PT5A 3KJIA 5LKAA 2Z2YA 4BLSA 3NFRA 4TT8A 2ONJA 4MUNA 1YULA 2JAUA 4KGZA 2QRUA 4B6EA 3WL7A 2D7JA 2AD1A 1N6OA 2R6ZA 4IWXA 3RKSA 2YJGA 3WMGA 4GDMA 4CF3A 3O95A 1NJGA 4NS4A 1CUUA 4QVGA 5E2IA 4DARA 1K6MA 3I83A 3L06A 2ORED 3U37A 1HORA 1ZNZA 2YWXA 4I4LA 1HSZA 1OI3A 4F4CA 1A5TA 4PCVA 3EB9A 3FZQA 2G9UA 1BCRB 2EFGA 3V3KA 3OQOA 1HE1C 5DI9A 4K05A 4EZEA 4ESOA 3M4ZA 3ZHQA 3SHFA 5IT5A 4P83A 2A33A 3IEKA 4DJEC 4HP8A 3OQHA 2IIQA 2WHPA 2G17A 4MS3A 5AYVA 1FFGA 3DTTA 2DAPA 2BVNA 1RD4A 3QMPA 5K0TA 3CVWA 1V2HE 1QS0A 4M9UA 4AZ3B 1OI7A 4G97A 4N8DA 4B35A 5BVHA 4P3OA 3Q98A 5JCXA 3MRSA 1JDZA 3I12A 4DQXA 1Q7TA 4B76A 3V4FA 3LHSA 1X3SA 3WYFA 4CN9A 2XMSA 3B78A 2NTVA 2JGDB 4BYMA 2KM1A 4MW0A 2WV7A 3TTWA 1RM4A 5MFPA 1Z7EA 3GXOA 3A4NA 1Z2CA 5J2UB 2VO1A 4UULA 4NNJA 2WWTA 4FGUA 5HJEA 1MX1A 5KNBA 1NM5C 1ORHA 3LUCA 5E3IA 1RI3A 4WMLA 2QRZA 3HVJA 3R7FA 4UUAA 2NVUB 3ZZ0A 3SFVA 4P4NA 2OBXA 3QA9A 2NUTB 4IIJF 5EMKA 3SZOA 4E5YA 4DYDA 1EINA 3IR6A 4TSRA 5DF1A 5FFNA 5TARA 3ZXUB 1W48A 2IIPA 1AF7A 4ZFNA 2CNOA 1KBOA 2H48A 3PDCA 4EO4A 1N5LA 1IN7A 4C2BA 4US2R 2DKNA 4GW3A 3AL0C 1CFJA 821PA 2LRHA 2YHBA 1J00A 3IH5A 1DKQA 3Q7SA 4JVMA 1PJAA 4G01B 4KPUB 2QGFA 4QAQA 5DLYA 2ZRJA 3BKXA 4X84A 4ZVUA 4CLHA 4DJAA 1J7JA 3NTXA 3IX7A 2JFGA 4JIMA 2RKBA 1SXHA 2B8TA 2PX8A 4FW9A 5IPFA 2A88A 1NBHA 5J59A 1M2HA 1T5OA 2CFSA 3IBCA 3ISVA 4ZIRA 3A6HA 5JCOC 1VA5A 2R68A 3JPYA 3IVAA 4Q18A 5K8JB 4MP6A 1DAMA 1P7VA 2H85A 4LGYA 5AM4A 2J0VA 1QVVA 4HWRA 3GLFA 1TIKA 4WCFB 2HPHA 3HU1A 2FRDC 3ESYA 4UZEA 2ZE6A 3UHFA 5JQGF 3W6NA 3RI3A 3KETA 2PSEA 4MVJD 5JSYA 2XQFA 3IODA 3O4JA 2GXQA 2ETXA 1GTVA 4J0IA 4Z7OB 1RI2A 4KWEA 3GCGA 3QPAA 4Q0MA 5CDFE 4AJIA 4H08A 1K3UB 2HREA 3LYAA 4IF6A 4D79A 5FNVB 1UT8A 2JIDA 2VPWA 5H83A 3PG5A 3OLYA 5B12A 4OX9B 3RSCA 3WMWA 4PC6A 1QJ4A 2R11A 4P36A 2EP8A 3LW8A 4FYHA 3ZV4A 9ATCA 3KXLA 3WSVA 3ZVKA 4YJ2F 3A05A 1EUCA 3AY0A 1ANKA 1PBTA 2XDWA 3IOCA 4PXSA 1QGUB 1O6ZA 3VO2A 4AS3A 2HJ9A 1M7BA 1NKTA 3UMBA 3S5JA 2P65A 1YZ3A 3L8EA 3OLWA 4DS3A 3QOFA 2YVUA 1QSGA 1E5XA 4G0NA 5H1YA 1M1XB 2PNFA 2VQ6A 2W22A 1Z2EA 4RZ3A 3W6UA 3FPGA 4U2BA 4QJ4A 4X61A 1AKEA 1VYUA 1IBLB 2IZ6A 3F9IA 1HT0A 4JENA 4YRBA 5KYVA 1OE0A 4N0DA 5DNWA 3T7KA 2D54A 2CB0A 5AK6A 3SYTA 3VR4D 4RACA 1JG2A 2JAPA 4JGGA 1NLFA 1X0XA 4EA6A 4E7OA 5AVOA 1TI7A 5ER6A 1EUQA 2AS0A 4KRGA 2YHIA 1FFYA 2JGFA 3KAPA 4MJ3A 5SZKB 3TI7A 5IC6A 4ZU1X 2CXSA 3WY9A 5AVSA 2F9MA 3H05A 1L8OA 5E9JA 4KLAA 5DHTA 1OBHA 1O96A 4LE0A 2YJZA 3JQBC 4KP7A 4HAXA 4UAGA 3RS3A 1DJQA 3CIFA 3UT6A 4X71A 1RYDA 3U0VA 2QX7A 1P72A 1Q83A 1ZONA 4NZOA 1CEYA 2JZOA 4F96A 1YS1X 2ZDGA 5COBA 5L7TA 2QRVA 3GAFA 3DBRA 1GN8A 2PJDA 3VR2D 3C2QA 5CA1B 4HD8A 1EA5A 4NI5A 5JFGA 3WLEA 5FT9A 3GBSA 3HJCA 5LXTB 2XA1A 3IEVA 4FXPA 1I2MA 3CYFA 4OY3A 1FS4A 2YY5A 5K8TA 1CDOA 2GLUA 1Q1BA 4MV4A 5KTSA 2V7WA 4RA9B 3FWNA 3EIXA 4MPTA 3GJ0A 3OI7A 4UU0A 5LDHA 3QLTA 1M2JA 2JCSA 2V55B 4MRPA 3RNLA 2GBIA 3KK0A 3Q8XB 4PZ9A 4XLTA 1MO6A 2A8YA 3TIVA 1OH8A 5T4BA 3T7AA 2B6HA 3JQCA 4L7QA 1ZN7A 1QG6A 1ZNXA 1ZSNA 2D4HA 3IC5A 3PGLA 3MTDA 5EXEA 3R8XA 2K2QB 4XB1A 5CCEA 2G76A 1GDHA 1S8AA 3RHZA 4MUEA 3S2SA 4G5SA 4TLLB 4GLLA 1UMKA 2BY4A 2YZGA 8ADHA 3NBFA 1J0DA 4FFWA 3CRW1 3HACA 1CUYA 3E05A 3N2YA 1RFGE 2A94A 3FWZA 4FOPA 4NMMA 5ALNA 3EXEA 4AP9A 4GEGA 4EFDA 1RIIA 1FP4B 3KC2A 3Q10A 4MUIA 1A4RA 1Y5MA 4M7RA 2I2FA 5C46F 1VL2A 2FEOA 5KSYA 4KHZA 1GPNA 1R0WA 4Q1AA 2BZGA 4Y9DA 1Q7BA 1FS6A 2PWAA 3Q2IA 1EP3B 5ULLA 2KYRA 3NHMA 2H7YA 3GPDG 3A1WA 4I81A 4C22A 5F9HA 3H9EO 3OQIB 7GPBA 1XNRB 1FDWA 1XKQA 3KQMA 3THRA 2WJPA 1K7SN 3DAPA 4C4AA 2FQQA 2BIFA 2C42A 1YS7A 2WOOA 3LA8A 5CX1A 4KLZA 4A26A 2DP4E 4F5DA 5F9FA 5JH7B 4JXJA 1PWZA 2IXAA 3SDSA 2ADFA 3KZKA 1AS3A 4RE5A 3RUDA 5C1IA 2Z83A 2UYOA 3OM0A 4CMAA 2FQYA 4HG2A 1QX4A 1A2KC 3S2IA 1K9SA 3WC4A 3R6WA 5U1PA 2BGRA 3IPXA 5E0OA 3W5BA 1PL0A 5G53C 1NY6A 4V0KA 3KPJA 3L01A 1PDVA 3OCVA 1YBVA 2P1RA 4UNQA 3ZV5A 2WB2A 4NG5A 1DADA 1TMGE 4C1BA 1IM8A 3A2KA 3KTFA 3LQ1A 4I2NA 2BEUA 1KZ6A 1P9RA 1SXJA 4GPAA 4OMDA 4BKQA 4LY6A 2GEBA 2XNDA 4LNHA 2IIVA 3THWB 1HDYA 3ORSA 1ZBQA 4PNHA 3KHSA 2C2GA 1JYSA 3M33A 3ORRA 2A59A 1E20A 2ZRFA 2IXFA 1IEWA 1PGNA 1CETA 3RYTC 2X6QA 3H6HA 2Q3LA 1PQ4A 3TJMA 4EF5A 1CQWA 3EPHA 1UP6A 5HHTA 2WHYA 2JAQA 2Y1OA 4R8SA 3JZMA 3FDXA 4YJKA 5IANA 3PHIA 2JAXA 4JL5A 1NQWA 1Q6YA 2B1QA 5EQJB 1WZ2A 3QBVA 4DTIA 2BFWA 3HKCB 3DOHA 3V2UA 1IPHA 3BH6A 3LC7O 3QVGA 4X85A 5CM2Z 4BIIA 1U0EA 3HLKA 4OBEA 3S2FA 2ZTLA 4BLWA 3BFPA 2ZWVA 1BCSA 4FZ5A 1YRWA 2I71A 3O8QB 3KZNA 4FIDA 4QODA 3GF4A 1ZK2A 3OHPA 4Q02A 4D2IA 5F35A 3ZKAA 4D0SA 4F91B 1LJLA 1OW3B 1P4JA 1FFHA 2C2HA 2IYWA 3NWBA 3K0SA 1ZR4A 3S1AB 1K1EA 1AVTA 3AESA 3I53A 1IDOA 3K0BA 3R1IA 2EDAA 3P2EA 2GI4A 2R7NA 4RMNA 4TTSA 4P84A 4JC4A 3HK2A 1H66A 3R5SA 2OFPA 3O8NA 4W8GA 4YMVA 4OI4A 2VXYA 1T5IA 3F6PA 4HEA6 1YGPA 1L5QA 1Y4UA 2PIDA 5IBCA 2Y05A 3WTCA 4TWIA 2AMYA 2FU5C 4DIBA 1C3LA 3WL3A 5LMCA 2GETA 2ODBA 5IEBA 1RZVA 2E2WA 4DNFA 2ZUWA 4C7XA 4P4LA 3P2MA 2P9BA 3ZJUA 2AOTB 2ZYRA 2Y0CA 2MYUA 1JX6A 1KVRA 3AGPA 4IFEA 4MO2A 4H27A 1V35A 1E79D 1AQNA 2VYVD 4X1KA 4QYIB 2OA0A 4IZHA 1UBSB 4XWKA 1YV9A 2AE1A 1B8NA 3QE3A 3LQFA 3P0JA 4RNDB 3DOJA 4C6TB 3WYDA 5BV0A 1RKXA 3CRRA 1W36D 1P9LA 2QXUA 3WKEA 4YJGB 5M7EA 2FLWA 3E1SA 5JLAA 2PUFA 1PE0A 4ISCA 1IWBB 1LPMA 4U8HA 3PGXA 1JJBA 3EZXA 1QIGA 4DADA 3A6GA 1B41A 1R8YA 2QZPA 4DLSA 1OGYA 2V9PA 5JD3A 3TL3A 4W5JA 3FGNA 2IIBA 3EAGA 2XT0A 3A2NA 2H2AA 5C7OO 1U0HC 2ZVPX 3R7NA 2I8LA 2EFEB 2VDVE 4GMHA 4X6UA 1XEFA 4BNUA 2JC3A 1AA6A 2DLCX 2HFKA 2PO5A 1I1OA 3JWHA 4NK5A 5KWVA 1E5TA 1B73A 3R7SA 2I7TA 5IVHA 3K53A 4D3XA 2HA3A 4E5UA 1L4HA 3E23A 4KAFA 4UHHA 2XGMA 1FYXA 3I42A 1KFJB 3IIIA 5A4JA 5J4VA 3EK2A 2PRZA 4EF6A 1WDKA 1M1YE 1Q2XA 2CUNA 2MSCB 2V6BA 1Q92A 2OKCA 2ZJBA 3AOEC 1P44A 3OJWA 4BWFB 5JI3E 2AQ8A 3T9BA 2W4QA 5FULA 2QMEA 4CIVA 4F3KA 5TPWB 4KE9A 4KEAA 4WXHA 2WT9A 4FYXA 3E7WA 1L9KA 1VPVA 2B4AA 4UTPA 2I87A 3OP1A 2FG7C 2XMZA 3BTOA 1QFYA 2ANCA 3HJUA 4O8CA 1PJ8A 5K0ZA 4RJKA 2AJBA 3I5MA 3BMQA 3NTRA 4FCCA 1YR6A 2NU9A 4F97A 4JELA 1GUFA 1RRKA 2GCOA 1Q74A 1UDRA 1G8MA 5DH9A 3SEAA 1I4OA 1XXHE 5CT6A 5LQSA 4BVKA 2IQIA 4ZVOA 1U0RA 4EITA 3T41A 3U5TA 2QTWB 1K6JA 3NRBA 1QGDA 3BXXA 3THXB 5I4IA 2I9PA 3K70C 1TM1E 4PEVA 4TSFA 2RK6A 3DCYA 4AG5A 2WD7B 1E5DA 1NUPA 5DEOA 3VTFA 3A1CA 3QLVA 3MTAA 2XKAA 2H8GA 3QJYA 4I3FA 1KY2A 1RHMA 2CUZA 1CUCA 1H1LA 1KTVA 3BUSA 1R10A 4L0QA 2WA1A 2FPOA 4M21A 2I78A 2V0GA 4CGZA 1PG5A 3KPWA 1BWPA 2HX1A 3HM2A 4WLFA 1M8KA 4WX2B 3HY6A 1QVWA 1XVTA 3BE4A 1N4DA 1WX1A 3QWHA 3CXUA 1YJAA 2X2FA 3IQFA 4ZTUB 1N25A 2N46A 1LH0A 1DC8A 4BMSA 5BT8A 1GA6A 1MUUA 1TAGA 1U2DC 3QY0A 5LU8A 5EPEA 2A0YA 1ZCAA 2J4FA 2OPBA 2BV3A 5F3DA 5JBNA 3ZE9A 1SK9A 3R7LA 4IINA 3FPFA 3ZKWB 4Q7KA 3GFOA 4NEQA 3X1WA 2QXTA 4PSAA 4F04A 4RD1A 3VNAA 3UOWA 4WT7A 3EUFA 4OMUA 1BEUB 1PFUA 3D0OA 4EECA 4QRHA 2BM8A 3PQFA 4MVJA 1U11A 2Q2OA 4OL0A 4RFSA 1JSZA 5HUJA 3M0EA 1BOOA 1W29A 5AVYA 3MWYW 5J2TF 3ELWA 1P74A 3BHJA 1P9NA 1Z29A 1U5AA 4NHEA 1FJ2A 2ZAYA 1LFAA 1CQIA 4OUDA 1EDOA 3RFVA 2FW6A 4C0QC 4DA4A 2GN4A 3D43A 5LPNA 3BEOA 3EIUA 3OHSX 1VIDA 2PUGA 3PGKA 2Z1NA 4GXRA 1NN3A 1R4ZA 2NZVG 4K03A 1TYBE 3E7DA 1L5NA 2QLJA 4Y9SA 4G9EA 4L2IB 3HCBA 4XIGS 3SHTA 4EZBA 1XF9A 3W5IA 3RRZA 4BKUA 1U9YA 2WEKA 3MMPA 3LQYA 3DEAA 5JSUA 2QVYX 2JHAA 4GUAA 1J2TA 1OXUA 1CR1A 4QDOA 4JBHA 1WMFA 4EPWA 1LI5A 4H4DA 5D84A 1PWEA 3KVOA 1B26A 1J5XA 3KQYA 1FRNA 4QVKA 3AB3A 3S70A 3FPJA 4P53A 5C8YF 4QVIA 1K08A 2HHAA 4MWGA 3U4CA 2W48A 1V0JA 2VDNB 1PWHA 4LJ7A 3V4SA 3WNZA 2VDPB 3MT7A 3V8QA 4CV1A 4MOWA 5LD2B 2WWRA 5TX7A 3P2KA 3ZDBA 2OO7A 2P9QA 3WA6A 1RWMA 1ODKA 1UADA 3ACDA 4EY8A 3JATB 1DDIA 3HNOA 1Y42X 1T8SA 2DTEA 1OU4A 2GPBA 2XZDA 3QH4A 2A35A 4OHPA 4YI3A 1PZEA 1MGOA 1DCKA 4YUAA 1GQ2A 3LGAA 4YV1A 3DOCA 4WERA 1UR5A 4HAUA 4ZDJA 4ER5A 1KZ1A 3ORQA 3OZAA 4H1VA 1BMFD 3VR1A 3QVLA 4QFDA 4CL2A 1KORA 4I66A 5C80A 3P0HA 2C4UA 4XCQA 1IZZA 1T13A 4DR5B 1RKVA 3JARB 2ZIAA 5IVKA 4J43A 2YS6A 2HB6A 3B38A 3ZCVA 3EIQA 5IDQA 1I2ZA 4L3VA 1Z83A 4Y2GA 1YL5A 4TVOA 3AR9A 3WJ2A 1U81A 3HB1A 1XCLA 2J33A 2WJGA 3VR2A 1F6BA 3WSWA 1KL7A 1GAEO 1VKZA 1J99A 1FJXA 1SCNE 4HGNA 4U2FA 3EULA 1TMOA 2FWJA 4NFHA 3WIOA 4L22A 3UA4A 4BQOA 5KJ6A 3RYIB 2CFRA 4I8DA 4D42A 4ZI7F 1BE1A 2X8JA 1ENYA 1N1GA 3HKEA 4N7BA 1CJBA 2FEAA 3A1FA 2NO1A 2XUOA 1DHRA 3G7SA 3MOSA 4OB7A 3IQGX 4JJIA 4R8LA 1T4CA 3OJXA 4FNOA 4N0QA 5CLHA 1USKA 4MIYA 2EATA 4NATA 2B1GA 4EQZA 3PNKA 3GGOA 4GF5A 4NPAA 4TXLA 1LPPA 3ED1A 3EFHA 4DRXA 1MPTA 1YJXA 2X3YA 2YJ6A 4G36A 5F76A 4R3NA 3LBAA 2AYYA 3QE4A 4GOKA 3VSBA 1F0YA 1ADGA 1OXTA 2HMUA 2O2CA 1EFTA 1M34A 1V96A 3AI3A 1S0UA 3DHVA 1H4VB 4KPGA 1IY2A 3F7TA 3BS4A 4XB6B 2GEFA 5E6UB 1RAHA 1Y9DA 1WUYA 2IE0A 2XYGA 3IOBA 1FTWA 4Q4AB 4RZUA 2FFRA 1DINA 2ALJA 4YROA 4OF4A 2TMGA 3V1YA 4KVGA 2XSZD 5CFZA 3Q8KA 2NPFA 1MV5A 2HRCA 1G66A 2FR8C 3A25A 1GZ6A 2FX2A 2EZTA 2O3TA 4PQYA 5FF9A 1MTZA 3SF8B 2PRYA 3VTAA 4CDNA 4JI8B 1UOQA 3PKJA 5E7QA 4A5OA 2HI0A 1SBCA 1Z18A 3DP9A 5IVIA 4D5EA 3JSXA 3VPCA 5JDIC 2XHEA 1JEQA 1VDZA 1P1IA 3IILA 5KEIA 3KOMA 2BJWA 2RH4A 3S2EA 1X7DA 2IVZA 2DHEA 2LW7A 3KKKA 1T9CA 1XRMA 1OTHA 2C58A 2Q6IA 1KAOA 4G23A 5DYWA 1V5WA 1YMQA 3OX3A 4HNAA 3NV9A 4HQFA 3RK1A 4ZVRA 1N5JA 1RXUA 1H4TA 1WD5A 2VQ3A 2W6ID 5EP3A 2CHQA 1PJRA 1ZIXA 2EDCA 1ZBDA 1FRVA 3AWIA 4XI9A 4KTTE 1NWHA 1YSCA 2PKQO 4LYHA 5CVJA 3W5UA 5M5BA 3NIGB 3VZPA 5KS2A 4PLCA 4E4RA 5EESA 3KKQA 5C5CA 1QX3A 2XGJA 4PX9A 2FE4A 4KQJA 4L4ZA 2REOA 4D5GA 1OZGA 3NI2A 1I24A 1MIHA 1DXOA 1UZLA 2F1JA 1WU8A 2BR5A 3KR2A 3V48A 1N9GB 1JE0A 2DCUA 1SOUA 5BN3A 2B4TO 3C3EA 2BTQB 3GA7A 4AG6A 1CQJA 3H7AA 3GMIA 4RKWA 2IYRA 4BX9A 1PNTA 1EQUA 2E55A 5CIWA 2O0MA 1TZ2A 1NN1A 5I7WA 1XZGA 2Q28A 4XPIA 3WQBA 4ER3A 4C2TA 3RODA 5TC4A 2X5JO 2G5GX 5DP1A 3C97A 3U7EB 2KQUA 1NNSA 3L0OA 3P9IA 4IO1A 5HKAA 4XTRA 5FR2A 3TGLA 3T12A 2IWHA 4PLZA 1ZINA 2IYLD 3LXMA 4RVNA 3ESXA 1ZXBA 1KIMA 2Q5QA 3ANLA 4H7KA 3R7WA 3AJ8A 1N3BA 1GT91 5I8PA 3QEBZ 1Z62A 3LPCA 1TO2E 1CE8A 4HQ0A 5DBHX 5BSHA 3EPLA 4TV9F 3W2FA 2X5OA 3JRNA 2ZUBA 3B1KA 1AO3A 3OOEA 2R66A 4P2GA 4Y7DA 4CT4B 3INYA 4D3YA 2WJYA 4C0JA 4BJ5A 1JKFA 2CBZA 5H3CA 2YRFA 1BN6A 3WGYA 1MC1A 1P45A 3VJKA 5CJ2A 4AD8A 4RTNA 1EGVB 2MSKA 1FUYB 3DW1X 3I8SA 3R6DA 3ZGOA 1WE2A 3ENNA 3P26A 1C8LA 1E8DA 4L85A 5A6SA 1KXZA 4BO8A 2RAPA 2XZOA 2NSYA 3QHPA 4A0FA 3AG5A 1DP4A 3KO8A 4MCHA 3VR5H 5KYUA 1C2YA 3N7TA 4Y6QA 4ILKA 2O5CA 4OKIA 2Y8EA 1M33A 1CS0B 1SN7A 1G3QA 2I1VB 4ITRC 4LJ4A 4P8RA 1DDGA 1E1CA 1AS0A 1M6WA 1MABA 2QSJA 1O1YA 1C41A 3MFYA 3IP6A 4FNGA 2WJZB 4PR3A 1QRSA 1FMFA 3BE6A 4N9WA 3VAYA 1LNQA 3O1HB 4CV0A 1RACA 5BT9A 1V8BA 3GROA 1FDTA 1KJ9A 4FS8A 4U0KA 3T06B 1H2WA 3L0PA 3TKAA 1R16A 1Y1SA 3T3NA 1TEXA 1X77A 4LFAB 2AQHA 1QJCA 3BSSA 3M6IA 3TZHA 3WIEA 1P4GA 2ISCA 3GUZA 1SZPA 2QPTA 3QVMA 5ARCA 5ALSA 1P1CA 3W5HA 4BNTA 3UHOA 3N0WA 1EE1A 1Y3DE 4OQZA 4ZALA 5JSHA 4YP9A 4M98A 3A2LA 4F93B 1PF7E 2GGSA 5AICA 1E3WB 5F1KA 3HB4X 4D9EA 1FP6A 1NIJA 2V3WA 4H7PA 3KQSA 4O4LA 2AI3A 2HT6A 3L07A 3V8BA 4E13A 4XGNA 2JASA 2DWOA 2LZ0A 1IN6A 4HN2A 3I34X 4D80A 2I54A 3V97A 4LFBB 3BD7A 3WI7A 1WRBA 2BPOA 4B9EA 4NU6A 3ZHYA 4J4HA 4RD2A 2FW9A 3B3JA 2AOVA 2VT7A 3ETLA 3H75A 3MCUA 2DFDA 1D2EA 3MJTA 4JUBA 4PF1A 3EA4A 4M7OA 4CHGA 5HNKA 2ZBVA 1WB9A 3B2NA 3A58B 1NTOA 3ON5A 3KT3A 1U2PA 3M1YA 5A7GA 3EGEA 4TX1A 1JDTA 4HDRA 4DZZA 5I3CA 4TRJA 1BGVA 1WW8A 4Q9NA 5FKJA 3C6XA 3HMQA 2VTKA 1W59A 1X8XA 2GZSA 3DEKA 1IBSA 4LVNA 5LQMA 3QVTA 2QVLA 3K31A 2YC4C 4PZDA 4A2QA 4JT9A 1UBKS 4BLPA 3DDSA 3ZU4A 4BNDA 4RLHA 5LP6C 5GIPE 2ONCA 2G88A 4HR7A 5DN6A 2BRUC 4I46A 5DBEX 5KNCH 4H1WA 4GR4A 3C1TA 4RBNA 5FD8A 3AUTA 2BFBB 3LF2A 1B0PA 1JTFA 4U9IS 3TB4A 3C3PA 4M88A 3E7FA 1SGWA 2QP3A 2ZT7A 2R8YA 2XVZA 3C1OA 3STTA 3ZWVA 1EVQA 4EEXA 4BHTA 3DBLB 4ZC1A 3L0IB 3TZBA 2C8VA 5C51B 3NEAA 1Z3CA 5GZ6A 5A9TA 1JYEA 5GOTA 2JHGA 1XZHA 1RYFA 3V7NA 2CXRA 4BBZA 5MN6A 1PR4A 2XIJA 1G20B 2WF7A 3C45A 2J4DA 5TPZA 2QVXX 4NBRA 2COUA 1IPFA 4Z0HO 4FUTA 1SHZA 1IHYA 2BEVB 2DZDA 3MTJA 1APBA 3VOBA 5FPTA 1RYNA 2VAVA 4PLGA 3GYBA 1GGJA 2JA2A 1LLUA 4HQLA 3LY8A 3OF3A 4Z0NA 3E9QA 4MULA 3HS3A 2XMBA 4NSNA 5KKAA 3WGLA 5EHZA 1QH8A 4AU1A 2ZJ7A 4KFUA 3C39A 4NKRA 5A5EA 5J4KA 2GDZA 2YHAA 5JISA 4JJFA 2TRSB 3HMKA 1U3UA 3QX7A 1V2GA 5SYMA 4ZJZA 2YN0A 3KV1A 3KKZA 1MCZA 3MRXA 4RHTA 3OOSA 4TRMA 4MIKA 1NQVA 1WSAA 2JKZA 3HB0A 2P4SA 4IIHA 5JEEA 5HRAA 1G21E 1AKUA 3LBIA 1PX0A 2WSBA 3AHGA 4Q1VA 1TYDE 3CEPB 1BGXT 2E49A 2XR1A 4GGMX 4KMMA 4WJZA 4CLOB 5JY1A 2WQ7A 2OV3A 1UKZA 4F5ZA 4K46A 3ZU3A 3O4GA 4BE7B 2KLHA 4FONA 2IUEA 5JJKA 1G4HA 9LDBA 3OWOA 1GITA 2A1IA 4IOMA 3R3XA 5AKEA 4A2WA 4PLWA 4UXHA 1VOTA 2AVNA 2IYPA 1EVIA 1GAWA 1MORA 4TWBA 1V26A 2AYXA 4G9BA 4WOKA 3SICE 5JWOA 3ZNNA 4BNFA 4ZAFA 3N6RA 2XXAB 4PAOA 5CAEA 4HDQB 4TUYF 5AKJA 5FFMA 4DLPA 2QG6A 4BNHA 2WM9B 1CUZA 3OPMA 5FORA 3VSCA 2VP5A 5IT9A 4M76B 3QE9Y 4Q24A 4O4JF 1NFQA 1L7DA 2ASEA 5LA6B 5KJFA 1P2FA 2ZYAA 2HRZA 3H2IA 4M1ZA 4P4TA 4WZBB 1SQSA 4TMVA 4ADSG 1JG4A 2IY8A 4FZVA 3L4BA 1RABA 5B6IA 3NHKA 1UH5A 2Z08A 1CNFA 3DE4X 2WSYB 2ZU0C 3FZEA 2ZRCA 3ZCUA 4QEDA 3CX3A 5IWCA 2X22A 4JROA 2QRQA 4A4DA 5KOYA 3ZIAD 2ZDQA 4ACAA 1YAHA 2OGSA 2UXCB 3HDYA 4O0LA 2FFBA 2XE4A 1A9SA 1ADFA 2HC9A 1P6XA 4YRJA 3H9JA 1GNTA 4IEFB 5DCUA 2QB5A 4JQOA 2CKDA 3NC0C 3TZQA 3HEMA 4IVRA 2JRCA 4DLRA 5FUQA 5K99A 3CXRA 1NZJA 3HVHA 1JH8A 4MYUA 4DR7B 4FFPA 2JJYA 2WU4A 4IYRA 1EFPA 3AM3A 4LOAA 2EP7A 1OA0A 1V8OA 3T5CA 2ZBGA 1C30A 2DBQA 2YCBA 3NIDB 1W1WA 2Q0XA 3DVSX 4FGZA 1KFCB 1T8PA 3ZNPA 1E2QA 1E4YA 5B30A 3IB3A 3ZHBA 1GZDA 1BN7A 1X74A 5P21A 3LLSA 1KMCA 2A86A 2R48A 1C1XB 3CLSC 4HN4B 4YPVA 2NQ8A 3DOFA 2I0FA 5E7IA 4WSOA 2WHEA 2A0KA 5EZYA 4IAOA 1B76A 3IP9A 3PFNA 3KG2A 1AM4D 2FX3A 3ZNOA 2W2QA 1YUBA 4DDKA 3CVUA 1J2YA 3HY4A 3DTVD 1WP4A 3JSAA 4BMXA 5FHRA 3KKOA 1F8GA 2I3GA 5DHSA 4OLAA 2XD9A 2C78A 4JLKA 2O2XA 4X24A 3A37A 1FPMA 3E7XA 5DWDA 5IX8A 3CW9A 5EE5B 1U31A 4YVFA 3KEOA 4MGKR 2CYCA 3N8GA 4UFOA 5IAJA 5FBVB 1XR3A 4NFYA 3KLBA 4E2WA 2YQ5A 1F14A 2ZB8A 1ZRMA 2XQVA 1NPDA 1QKJA 5F7JA 3WNDA 3KJNA 3ZI7A 5TJHA 5HIKA 2FN4A 3S6JA 3L9XA 4QDUA 2UUAB 4PM4A 5EXXA 5FP0A 4UBNA 2CSUA 3E1GA 3FNFA 4JHLA 4LCJA 3SBDA 3OQNA 4YRQA 1LEHA 5BOSA 5EQTA 2HU2A 3DQPA 9LDTA 3NHUA 4ZXFA 2IUSA 3R23A 2YBEA 4WKGA 3KUKA 3NWJA 1QE0A 3TVYA 3WRXA 5BN5A 1Z2AA 4HFJA 4HT3B 3B9BA 2YOHA 1AGNA 3QKIA 3OFNA 4MI3A 4BQRA 3EPPA 1XDWA 4X3OA 4KITB 2XDQA 4UATA 1ZGCA 5K0FA 2IXTA 3AXSA 4FK8A 2DHRA 1ZCFA 4XD7D 4KMSA 3NB0A 3QKSA 4D92A 2BGUA 2YL2A 4M38A 5DYNA 2VJBA 4JEIA 3CT4A 1E77A 2R6JA 4B4KA 1EIWA 1KMIY 3QWFA 4UW9A 1ZMXA 1GTL1 3PHBE 4XRRA 3GLIE 1FYVA 4A6PA 1XL0A 2O5EA 2QUHA 4WNIA 4KXQA 4PHCA 4F45A 2D5CA 1TVMA 5ICFA 2FHSA 3TOXA 3W4IA 4EB0A 5CFOA 1C8BA 4CG0A 3COSA 1DI0A 2GZMA 4RPCA 2E89A 1JPNA 4W5WA 5DIFA 1UPFA 5DOZA 1S9HA 5GPBA 1E2JA 1ULAA 4IFBA 3OESA 1H6BA 3QNUA 4J1QA 5DK6A 1EK6A 4MLCA 3WL8A 4DUGA 2JI4A 2OGWA 3BJMA 3MG9A 3RIGA 3BIXA 4ZYWA 2GZ2A 5IAAA 2Q3CA 3BXGA 3E5NA 3QQPA 5D8DA 3TNJA 2YN4A 3F9RA 3E61A 3ELYA 1N2IA 4DLVA 1PLKA 3TUZC 1SBIA 3DLTA 1VJ5A 3SMQA 1EWTA 2BISA 4NU5A 3Q5GA 3N2GB 3EGXA 2VP9A 4QRDA 3RVDA 2Y1XA 3GLGA 1OGIA 2QTNA 1MRZA 3G8DA 3QTLA 3IR7A 2CNDA 1U0BB 4D46A 3PHCA 1KGDA 1E1QA 4JHXA 1I6KA 2X3UA 3R9XB 4LYEA 3FMIA 4EARA 2BGWA 3AF4A 3GT0A 3MMXA 4BU1A 2LNDA 4UMVA 3G3EA 1DXQA 5DGIA 3KL2A 3BB3A 3QWIA 2ZJ2A 5AVZA 1JKIA 5A7HA 4PRZA 1BDMA 1XQXA 2DH6A 4Y1FA 1JW9B 4G26A 1V8ZA 4IFTA 3W6PA 1CULC 5TS2A 3PVCA 4HDAA 4D8VA 1TUBB 2WPNA 3FAZA 4D02A 1DBIA 2DFVA 1CUBA 4KO2S 5DX8A 4P3YA 4E22A 1DGQA 1WHSA 4HBGA 3DZHA 5K0JA 4FYMA 2HF9A 1M8PA 1Q77A 2C2XA 2C5SA 2QX6A 3BHNA 3GYGA 1TZBA 3I0ZA 3UAGA 1NUTA 1MA3A 2BFOA 2C5GA 5JG7A 1ZJ4A 4BO2A 3QPWA 3M3DA 1NJ8A 3PICA 3SC6A 3WKDA 1ZM7A 4NXMB 4E1BA 1U1EA 3B7PA 4A6DA 4YY3B 2P79A 4E03A 4LRSB 1DAOA 2V96A 4JBNA 4M9ZA 3U7RA 2ZJ0A 4M8LA 5DLQC 4CUKA 4DLKA 1DWQA 4EDFA 3BXOA 3ND7A 1A9XA 2WVJA 3TZEA 4RV9A 2PL1A 4A0QA 1TT7A 4PFJA 4WQMA 4OGWA 4H7IA 5E38A 5ED4A 1YZNA 4XYBA 5B1YA 1E2FA 2O52A 5JIBA 4MIEA 5SICE 4DSZA 5EKUA 1PFGA 5AI5A 1WSDA 3FBWA 3K5WA 1O9BA 3PEUA 3GUUA 3IUQA 4J2HA 1P9OA 2W2MA 2WWGA 1B8VA 5KSPA 4ZCSA 2CNNA 2QPLA 4BFXA 4BUJA 2QW8A 1PYOA 2GA9A 3UGKA 3PNOA 2D2IA 1ECCA 3D8NA 4LBWA 3IRUA 3CUYA 1UK9A 1GKYA 1TF5A 1E7MA 2Y4OA 1Z6XA 3PDHA 4NICA 4X7MA 3WAKA 1QHSA 2D8MA 3FRIA 2OL4A 4RY8A 4XVRA 1NVDA 3FG9A 4IFIA 4JKOA 3AVVA 1RM0A 2O2JA 5EKSA 1JA9A 3MMSA 1Z4OA 4F1KA 1VECA 4DLLA 2FQWA 2G36A 4DSAA 4GG1A 2YYYA 1X7HA 2XQKA 3Q7IA 3KZXA 1CJVC 3CRNA 4NCIA 4QFCA 5JS2A 4CMIA 4CRWB 2V6FA 5CDGA 4PC1A 1UBJS 1RVDA 4LS3A 3KZCA 2HR1A 3CR7A 3A6KA 1Q17A 1KOLA 3V1MA 3BA1A 5JMOA 2XCTB 2FFAA 2EKZA 1EX7A 4QUIA 3LKDA 3RHSA 3UK1A 3ZCQA 3GT4A 3KJZA 3WBJA 5CFPA 4BMYA 2WHPB 3R3ZA 4J76A 1P75A 4MS3B 1BD4A 3FROA 2Y0PA 4U1RA 2WD8A 6LDHA 2AHRA 3AY6A 1MMFB 2DBRA 2GNAA 2QTHA 1QS0B 5BVHB 3EA5A 3ZTTA 1L5MA 3F8SA 4TYQA 1GLGA 5JNVA 3GFGA 2HRBA 4P35A 2V4ZA 4BQNA 3N86A 4RF4A 4DQDA 2D1TA 2O2DA 1MDFA 2FWMX 2P7HA 3LH5A 3LQQA 3R6GA 4D0RA 1H0RA 1OYWA 1ODCA 3D3EA 1SIUA 1XLVA 2A0WA 4ABYA 1KMMA 1WV0A 3MXOA 4M1EA 4DFDA 1RR6A 3S3TA 4M86A 3T9FA 5C32A 2RE8A 3ONEA 3BFJA 5F51A 4BEVA 3H0KA 3EUAA 2FZVA 2WFAA 4OFBA 4DZTA 3HP1A 2P4UA 3Q3VA 1P4SA 4TYYA 5IAOA 1QGAA 4MKIA 4LIPD 2PSSA 4L5IA 3SD7A 4ER6A 2P3OA 4DDWA 2J09A 2UZIR 5CVUA 3K4HA 3U3MA 1PJBA 1YJQA 1ZJYA 2JCBA 3O91A 4ZT7A 5KDDA 5KYYA 2REBA 3K6SA 5HQTA 5BWMA 1U7TA 3VPDA 5MHTA 1Z4JA 3GBVA 1T3SA 1R66A 2J67A 3F1LA 3FVRA 3NOOA 1JUDA 1XVUA 2QAIA 4BV8A 5BQFA 3LT1A 3U7QA 3I9KA 3EJ6A 3TR0A 2H2HA 1UBLS 2N47A 5C1BA 7MHTA 2H0AA 3RT1A 2O7QA 3JTMA 4ZIRB 5E7MA 1BXGA 4PO3X 2CF6A 4CQLA 1VXOA 5AJZA 4P7GA 4E12A 1PYDA 1SR8A 3GLFB 2OBMA 2P11A 3EGDA 1R6TA 3MCVA 3KXKA 1IZ9A 2C9OA 3MJSA 1NVBA 3G89A 3N2IA 4WTOA 4CG2A 3DNMA 2B6NA 3AJDA 3FAKA 4J94A 3G2LA 4OGFA 1GFWA 4LJSA 2P6MA 1JFFA 1Q50A 3QLUC 4JWKA 4AIRA 2OCGA 2KI5A 1LPOA 1YOVA 3FD8A 4Q3LA 3ROMA 4ZCPA 4CNQA 2GZHA 4RVHA 4A73A 1FLAA 4YACA 4IZIA 1TYEB 2BM0A 3CH6A 4YRRA 3RANA 1RYMA 5AOBA 2POQX 1EWQA 4OQQA 3B1FA 5DHUA 3ZHOA 2I8AA 3WRYA 3F2VA 4OPMA 3G85A 3O93A 2BW0A 4B83A 2ZUUA 1EUCB 4JD5A 4AZSA 4U8GA 1YQEA 3CF2A 1NVTA 2AX4A 2BFEA 5B53A 2AC2A 1TD1A 2DBYA 1Q7EA 4JVNA 10MHA 3RYHA 2RHWA 4ZKEA 4M8KA 4Q1DA 3FOAA 4K26A 4TWRA 2CDNA 2QX8A 3KALA 1PKXA 1R0KA 1ZN8A 4KUHA 5FH9A 4MYHA 1ULUA 3LVRE 4FOOA 4FS3A 5FNZA 2J0UA 4C29A 3Q7TA 3P9KA 1Z7YA 3DL7A 4IS2A 2NV0A 3UCFA 3H86A 4N0EA 3EVTA 4CM9A 2HCJB 2Y71A 3TVTA 1W6UA 2ZI6A 2J48A 2A9QA 3HL0A 4G1BA 2WKQA 2DFPA 1OSNA 2QKYA 2E18A 4J0KA 3QVOA 3CN7A 1MQ9A 2YHIB 1PLJA 4IV5A 1W4CA 4KQKA 1CIJA 1WXHA 3PV0A 2ZUEA