3ICPA

Crystal structure of udp-galactose 4-epimerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
295
Chain Sequence
MRIVVTGGAGFIGSHLVDKLVELGYEVVVVDNLSSGRREFVNPSAELHVRDLKDYSWGAGIKGDVVFHFAANPEVRLSTTEPIVHFNENVVATFNVLEWARQTGVRTVVFASSSTVYGDADVIPTPEEEPYKPISVYGAAKAAGEVMCATYARLFGVRCLAVRYANVVGPRLRHGVIYDFIMKLRRNPNVLEQRKSYLYVRDAVEATLAAWKKFEEMDAPFLALNVGNVDAVRVLDIAQIVAEVLGLRPEIRLVGDVKYMTLAVTKLMKLTGWRPTMTSAEAVKKTAEDLAKELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal Structure of UDP-galactose 4-epimerase
rcsb
source organism Pyrobaculum calidifontis
molecule tags Isomerase
total genus 106
structure length 295
sequence length 311
ec nomenclature
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3icpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3icpA02
1U9JA 1IE3A 3DMTA 3NV9A 1W6UA 3BMCB 4XX0A 4YT2A 3NEPX 2FPPA 2YDYA 2W98A 3A06A 4PLPA 3GGOA 3DBVO 3NUGA 4AJ2A 1LC3A 1UXKA 3COSA 1Y8QB 4EJ6A 1B0AA 3RSHA 3VPHA 5KIAA 3AM4A 1KVQA 3GNTA 5ENDA 4BNXA 4OOFA 4DWVA 5HA5A 1DC3A 2C7GA 4BNNA 5THKA 1LC0A 4BNIA 2AQHA 3PWKA 3K96A 5AXBA 5JMPA 1H2HA 5I9MA 5F21A 2VZ0A 4S3MA 4E3ZA 1UP7A 4FD3A 3GG9A 5L4LA 2VYVD 1CETA 4FGWA 5JDCA 4ND1A 3OJ0A 1GUYA 2VHYA 3DR3A 2O3RA 4CMCA 7MDHA 4OSOA 4R51A 3VKUA 1YOVA 3IKTA 3GVHA 4NPCA 2IODA 1I01A 3JQFA 1BG6A 4WLVA 2HMUA 3GGGA 5ITWA 3JD1A 4ID9A 1A27A 1X7DA 4I8XA 3GDGA 4EUHA 2BGKA 3L9WA 4RJTA 1O6ZA 1LLUA 2QRLA 5COQA 2JHGA 4J0FA 3WBFA 3AM3A 5DBIA 5F1KA 1NQTA 1I32A 1YB4A 1P0CA 3KLPX 1Q2XA 1RM0A 4Q3NA 2IXAA 5ER9A 1A4IA 4ALMA 3I83A 1NYTA 3OMLA 4MVJD 4NIMA 3GH3A 1IHYA 2X0NA 3B70A 3BHJA 3JQ8A 2ZTMA 4GGPA 3SXPA 1KVTA 1NVMB 4KP7A 4ZICA 1E3LA 3ZZNA 3OQ1A 1KBZA 1EVIA 1FF9A 2JJYA 4BUCA 1YJ8A 2EGGA 4QEDA 3JD2A 3ZWNA 4Z3KA 1DLJA 5J23A 4AVYA 3GLQA 5KKAA 3TZ6A 2HKIA 2XXBA 3EUWA 3JQAD 3MOIA 4TRNA 4M55A 2HMVA 2FR1A 3C7CB 3HNPA 4Q3EA 2X0JA 4HFMA 1EZ4A 2Y1GA 4U5QA 3ONDA 5ILGA 4I08A 2Q46A 1D8AA 3DC2A 2Q1UA 1N1EA 3JCZA 5T6BA 1M6HA 5L3ZA 3F6YA 1OI7A 2AEJA 1ZBQA 2HDHA 4MP3A 1QLJA 1V9LA 4R9RA 3HJAA 4BGIA 2PNFA 3EAGA 4GVLA 3FR8A 1SEVA 5AXDA 4CM3A 4AJOA 4G81A 2PA3A 4BNWA 3F46A 1U5AA 3KETA 4CM9D 2QYTA 1WW8A 4ND2A 4CODB 1NPTO 2CVOA 3GPIA 2VHWA 3I9OA 3QWIA 5IDQA 2WD7A 1IUKA 2C7VA 4XQCA 3QV1A 1K3TA 2FR8A 1YXMA 1Q7GA 1PL6A 1LQUA 3RFXA 4ALLA 4R41A 3WGGA 1IY8A 3O03A 3TFQA 1R4MB 3GHHA 4AJNA 3UH1A 4U8GA 2CVZA 2O3TA 3VH1A 4UEJA 4CUKA 1YVEI 1A5ZA 3GDFA 1B8PA 1NWHA 2VHXA 3AUTA 1T2AA 1OOEA 3B6ZA 3E8XA 1I8TA 1VJTA 3LF1A 1IOLA 4D0RA 2GZ1A 5A04A 5TX7A 3ZWVA 3EK2A 3E03A 5EJ2A 4YAGA 3MOGA 2B0JA 4IDCA 3W4IA 3PJDA 3I23A 4YRDA 3BMQB 4CM7A 1WVGA 4HFNA 4E6PA 1HLDA 1E1LA 1RWBA 3TPCA 3WX0A 3FPCA 1I3LA 4PLZA 1C1DB 3K2EA 3UKOA 1VJ0A 1ONPA 2DKNA 3ZCXA 2ET6A 1JKFA 3KBOA 4B4UA 2J5RA 4Y8VA 4DPLA 4J1QA 4AJJA 2BI8A 2Y93A 4DUPA 2CSUA 5AYVA 1LRJA 1YDEA 4DGSA 4WLEA 3M2PA 4PG6A 4BO6A 4BVAA 2CZCA 2ZTLA 4U6SA 2CMDA 1IZ0A 5KJCA 2AMFA 2O48X 2PY6A 2JD0A 4IQ0A 1KOLA 5C7OO 1LBEA 2RCYA 1CF2O 4QFDA 4W9NC 4CMAA 1JKJA 1GD1O 4QT0A 2J3HA 4RCVA 1E3SA 4B8WA 5JO0A 5JS6A 3GAZA 2I3AA 4B7CA 1AXGA 3DZFA 5HM8A 3AFMA 4GSKA 4BNFA 3NYWA 4YT5A 4YXFA 3AOEC 3MCVA 4FJ0A 1YB1A 4BV9A 4BMNA 2GN8A 3DOOA 3FTPA 4W4TA 4X54A 4OXNA 5L40A 3UVEA 5MDHA 3K92A 5JDIC 2EG9A 3GAFA 4RPGA 1FDVA 4R5HA 1AN9A 1YE3A 1DIHA 3F3SA 4II2A 4CR6A 4Q3CA 3KYCA 1FDTA 4PG8A 3LC7O 3WG9A 3TZKA 3PLRA 3E9QA 2Q1SA 1EQUA 4XR9A 2O2YA 1QXSA 1ULUA 4GX2A 3QY9A 3IDSA 4NBVA 4PLCA 3GOHA 3LF2A 1YJQA 1PQPA 3L6EA 3JSAA 3Q2KA 1D1TA 3U5TA 4HX5A 3KYDB 4Z0TA 1YRLA 5A9SB 3PLNA 4ALKA 4CMIB 2D0IA 4J43A 5COAA 3ZDFA 1GZ4A 1PWZA 3LSYA 4MJLA 1DFHA 1CJCA 3NJ8A 2QX7A 1T2CA 4BO5A 3HB5X 3LQFA 2A35A 3IJRA 4NBRA 3RVDA 1TA4A 3TF5A 2BFOA 3ZV3A 2DU8A 1DIAA 1F17A 3K30A 4FQ8A 2POQX 1Q1NA 3A1NA 3NGXA 1PJTA 4WLNA 4D3DA 4ND4A 1Z6ZA 2OP0A 4J1SA 4E5YA 1EE2A 2EEZA 2IXBA 1PJSA 4DBVO 1NP3A 3HQ4O 2DUUA 1Z7EA 3R3SA 4AFNA 3R6DA 2QW8A 2XXJA 4LN1A 1ADFA 4YDRA 3PZRA 4ZQEA 5HTOA 3RAJA 2QQ5A 3RFTA 1YOVB 4I5GA 5AXAA 1N1GA 1ZVMA 2Y68A 4BO7A 1YO6A 3TNLA 4BNVA 1R15A 1N8KA 3ITKA 1XQ6A 2EF1A 1MC4A 3QIVA 4XYBA 3HN2A 3I4FA 4BKPA 3OJFA 4E2ZA 3RQSA 5DZSA 4JK3A 2C82A 3GK3A 1H0KA 1FXSA 5EQDA 3QVSA 5LDGA 2UUOA 2ZQZA 2X86A 2VRBA 1Y5RA 2GR9A 1MP0A 4OQYA 3RKUA 1GYQA 3H2SA 3JQ8B 4W9NA 4C7KA 3ZWCA 2IRWA 2JAPA 4Z0PA 4BNZA 2FZEA 4FCCA 3JQ9C 3ICPA 3LDHA 3RI3A 2ZB8A 1E0DA 1KC3A 1U2GA 3R3JA 4LVUA 4FGSA 3AOEA 3HG7A 2EV9A 1LQTA 1ZIDA 2HLPA 2RH8A 3DOJA 3KUXA 4XIYA 2BI7A 1U3VA 1B16A 5H81A 3Q3CA 5BNFA 2W4QA 5A02A 3DZJA 5L95A 5A9RA 4L0QA 5KOIA 1NHWA 2D8AA 4U6QA 5JDIA 1NASA 1N7HA 3EY4A 4JN6B 2VWHA 1RPNA 3ZNPA 3AFNA 3ZGYA 5KKCA 3BTUA 3GT0A 3SBOA 1H6CA 3M1LA 1V35A 4HWKA 1HL3A 3JD4A 3ZV6A 5CP8A 3WMXA 1DLIA 1GPJA 4E0BA 1BWSA 1Q0QA 2UUPA 2Y1FA 4N5MA 2ZK7A 2O3QA 1KEWA 2O2SA 4J4HA 4CLEA 1A71A 2WD7B 2F1KA 3NDJA 1NHGA 5TNXA 5JYDA 3PHGA 3W4KA 2BLLA 4JNKA 4TKLA 3T4XA 2Y67A 1X7HA 1QYXA 3LK7A 5CDYA 1X14A 4OO3A 2YQ5A 2NACA 3D0OA 2WE7A 4IDEA 5EQFA 2JCYA 3NT4A 1WDMA 1VM6A 4RPJA 1GEEA 2VHZA 4RGBA 4WLUA 3KM0A 4KUHA 5ER6A 3D5QA 3PEFA 5CPBA 3DZIA 4BB6A 8LDHA 5G0WA 4TWRA 3IJPA 3ZU3A 4FR5A 4ZQBA 1GQQA 4QX6A 1DJNA 4EEXA 1FJHA 3OQBA 1TVEA 4A27A 2E82A 3DHYA 1LSJA 2I65A 2ZYGA 3FBTA 2FPGA 1R0LA 5CHEA 3QLJA 4FPXA 4JIGA 4ROSA 3PQDA 4H7PA 5B12A 4PLYA 4XB1A 3EW7A 1LX6A 5BT9A 1PR9A 1ZK1A 5C5IA 1Y9AA 2EKQA 2I99A 3F5SA 4HFJA 1HDZA 2EWMA 1XG5A 1UXHA 1YS4A 3UN1A 4WJZA 4OGWA 4CL8A 3L77A 3UAGA 1U8XX 1E3IA 4XGKA 3OECA 2LDBA 1ZK0A 2JFHA 4KMSA 5JC8A 3DFUA 2P5UA 1YL7A 4BQPA 4AJ1A 1EUDA 2X5KO 3PZBA 3VPFA 1DOHA 2AEFA 1MXHA 3DBHA 1MFZA 4D0SA 1YBAA 2CVQA 3RJ9A 4BO0A 3JQ9A 2X5JO 4NFHA 3RCBA 3N74A 4YB8A 4O1MA 3PI7A 1U4SA 2ZYDA 4GKVA 1KEUA 3P5SA 2OL4A 1QMGA 4URFA 4DC0A 2H9IA 2JHFA 3WIEA 1DHRA 3GVXA 1U28A 3P2OA 1NFFA 3VPGA 3HN7A 1PX0A 4LCJA 3WYCA 1I2BA 4I5EA 5IDWA 4E21A 1E6EA 3MJTA 3KYCB 4NU6A 3PHIA 3OSUA 3ZWOA 3BHIA 3OETA 4KQWA 1F8GA 2IZ1A 3GRKA 3GPDG 4J0EA 4L4RA 2RIRA 1QYCA 5JXWA 2Y99A 1J49A 3QA9A 5JCJD 3S1LA 2D59A 4A03A 1RM3A 2FR0A 2GLXA 5G0SA 3FNFA 1V0JA 1K6XA 1MLDA 1P9LA 2D5AA 2FZWA 1C3VA 3F47A 3H5AA 3GQVA 1SOVA 1YONA 3SLGA 4AJKA 5ES3A 4CMJA 1PZFA 2OORA 3CE6A 3BA1A 2P5YA 1U3TA 3PIIA 4A7PA 3FWNA 1KY5A 5TQVA 3M2TA 1WP4A 4XZ3A 5JW6A 1QLHA 2PZJA 5DULA 4GWKA 4MKZA 3SJ7A 2O23A 2RBEA 4YBZA 4Y9DA 3FD8A 2O3JA 4RVHA 1TT5A 1U7HA 1LDEA 5BSEA 5CFZA 1DEHA 2JL1A 1D4FA 2YFQA 3VTFA 1XWFA 2C07A 3PYLA 1NPDA 1IPEA 3C1TA 3FHLA 1EUCA 2AG5A 4OKNA 1D1SA 4LK3A 5IXSA 2NU9A 1A72A 3GFGA 3WGYA 2CF6A 4GMGA 4N54A 2J5QA 2VRCD 3ETDA 3PYXA 3NTQA 4FBGA 4IUYA 3X2FA 4DQUA 4J6FA 2OO5A 1UZNA 7ADHA 2IYPA 1ZK4A 1F12A 2VQ3A 1C14A 3QE3A 4Q3AA 1E3WA 5GZ3A 2GSDA 5B37A 3T7EA 1EFKA 1H9AA 5IDYA 3QWAA 3LC1O 1G6KA 1C1XA 2GN9A 1DIGA 3AU8A 3X2EA 2VNAA 2NV6A 4YJDA 1JU9A 4QFCA 3ROPA 3WLFA 1LSSA 3PPIA 2J3IA 1O89A 2NQTA 1LNQA 2QZ9A 1UAYA 4WCFC 1C0LA 1R16A 3S8MA 3EDMA 3FRJA 5IN4A 3NTOA 1PGNA 4PN3A 4R3WA 3HADA 4R1NA 4CMBA 4NJOA 3JV7A 5G4KA 2ZKLA 3CZRA 1ZNQO 1BSVA 3ZWYA 2HMSA 4CMHA 1JVBA 4ZN6A 4DQXA 5DT9A 4IMPA 1Z7BA 3C7AA 3WGZA 5DDIP 2B35A 3KV3O 4Y6RA 2PV7A 4IXWA 2VOEA 4MO2A 2Z95A 4GI2A 5G0VA 4K9DA 5BSFA 3GEDA 4HKTA 3C85A 4IGEA 4B8ZA 3EMKA 1Y8RA 4NMHA 4IIUA 5AVOA 2PK3A 3JD3A 5A06A 5JLAA 1BXZA 1IL0A 2YV1A 5KVQA 5IAAA 2V6FA 4AJ4A 1QYVA 5FEUA 1DAPA 4BKOA 3V5NA 3FNEA 3ZW8A 1ZKMA 1R4NA 3ICCA 4YJHA 5HS4A 3MEQA 5F1OA 2C2XA 3SVTA 5JPIA 4KUEA 5KJEA 2D5CA 4PFJA 4ZRMA 4OYRA 3AY6A 3H3JA 4FC6A 4DMMA 3H9JA 4F6CA 3OF2A 3PFFA 1VSVA 4I9HA 1MGOA 3I9NA 4TVOA 1SO8A 4R4JA 4M86A 1PGPA 4QXMA 2DBVO 4NK4A 1VE9A 4NNJA 3G0OA 3C3XA 4B7UA 5JC1A 4IINA 1B2LA 1OC4A 1X13A 2YV2A 5F5NA 3ZWXA 3DAFA 3ULKA 5CPFA 4OOEA 1UAGA 4GAEA 1PGJA 1DAOA 4A2CA 4CQMA 4KWIA 4XCVA 1BW9A 4Z6KA 3H9QA 4ZQGA 2X23A 3D64A 5L7YA 3TDKA 4BO1A 1FMCA 1I3KA 1CYDA 3ETGA 1PR3A 2Q45A 3PQFA 3RUIA 5I7SA 3CKYA 5I8WA 1ARZA 2H5LA 2FP4A 1DIRA 1LDMA 3HWRA 3K5PA 3LLVA 1JW9B 4IPTA 3KSDO 4PG5A 3L9XA 4FFLA 3STHA 2HMWA 4CPDA 1DO8A 1O0SA 1O94A 2IDZA 4P4LA 3SJUA 3E9MA 3ZI0A 1PL7A 2HSDA 3GUCA 4DIOA 2D4AA 4LMRA 4E5KA 4MVJH 4JBHA 2AQIA 3L4BA 3PJGA 4DXHA 4IXTA 3ROQA 2WYUA 3QWHA 2OZPA 2E48A 1BDMA 4U0KA 2G17A 4CJXA 1ZSNA 2VNSA 4WCFA 2PGLA 2I9PA 3WLEA 3H7AA 1U2DA 4WE3A 4WLFA 2X58A 1F8FA 2AA3A 2EHDA 3GR6A 4F3YA 3DBHB 4HNHA 1NQOA 1PJQA 1XDWA 4YTEA 3WTBA 4PVDA 1DC5A 3MJVA 3I9MA 4P8RA 4TRRA 3UF0A 3VPXA 1A7KA 1XKQA 1H6BA 4ZHSA 3PIDA 2UDPA 1VJ1A 2W2LD 3E82A 4YRBA 3KOUA 4YJFA 2BGMA 2NVUA 1MFPA 3GDOA 4YT4A 4XQ9A 1A9YA 4J91A 1N5DA 3D4OA 1BDBA 4L73A 5IZCA 2VTEA 3GHYA 1DXYA 1O8CA 3GMDA 1LDYA 1S7CA 2AE1A 2NWQA 3LZ6A 5HS6A 5A3JA 2AE2A 2ZATA 3KB6A 4C7JA 1UXJA 5CEFA 1QYWA 4BHTA 1LJ8A 1T4BA 3GZNA 2JCVA 1YQGA 3IMFA 4NR0A 1SBYA 4UREA 3Q2IA 4CLXA 1PQUA 2VT2A 2ZCVA 4IGFA 1ZO8A 3IS3A 1P1JA 3IIEA 4XA8A 3WNVA 1QKIA 2GN4A 1WMAA 3CEAA 4U7WA 4DYDA 3PTZA 1HDRA 2GUGA 4ZQHA 4Q3DA 4RVDA 4RF2A 4JGBA 3U9LA 3JQGA 3WBBA 3H2ZA 4OSPA 1T2FA 1VL0A 4KDFA 3T7CA 1I5RA 3WJAA 3PHHA 3G79A 1XU7A 3TN7A 1E77A 1TT5B 4ND5A 1Z73A 4YAKA 1ADCA 4YRAA 3KRTA 2B37A 2Q2VA 3L07A 4W6ZA 3RIHA 2C29D 2VWPA 4R16A 3F5QA 5IF3A 4J7XA 3HE3A 5H82A 3L6DA 1T25A 1WMBA 4P4GA 1UDAA 4W7HA 1Y1PA 3FNGA 2FSSA 4AJEA 1EMDA 4YAEA 4BNLA 1YKFA 2NSDA 3LU1A 3OFSA 4Q3BA 3T4EA 3ASUA 4JJIA 3WGIA 2EERA 1CEQA 4QSMA 2GPTA 4XDZA 1MX3A 5GY7A 5KVCA 2DBQA 3DHNA 3DONA 5K0ZA 3GUYA 4J2HA 2B36A 5DP1A 1Y6JA 4R3NA 4BKUA 4OIMA 3ANLA 4CLOA 4EDFA 1SCUA 1ENPA 1XEAA 3EZYA 4BIIA 3A14A 3ONEA 1DB3A 2EJVA 3OIGA 3K2BA 4B4VA 1JTVA 4D46A 3I52A 3JQBA 2W2KA 2NVBA 3JQ7A 4U0JA 5DCUA 5G4KB 4LVCA 4A10A 2VYND 4IQ8A 1E7SA 4IDGA 3DZHA 2Z5LA 4GLLA 5T5QA 3CZMA 3DL2A 4L9RA 4S1VA 3ENNA 1HSOA 3G49A 3PDJA 3WTCA 4GBJA 2PZMA 2YV3A 1JN0A 1ISMA 4UULA 2E4AA 1Y8RB 3W1VA 3ZWWA 2WMDA 4PG4A 5DCWA 4OKIA 5JSFA 4BGUA 1LDNA 5ICSA 1O95A 3BMOA 3HDQA 2WJPA 3RC2A 2VUSA 3EC7A 4YQZA 1HE4A 3KTDA 1IYZA 1LRKA 1R4NB 4YJHB 1P44A 3VZPA 4EUEA 4D41A 1YH3A 4RF4A 1GPDG 5DOVA 3NDIA 5T8KC 4XR4A 5EIOA 4CR7A 2NU7A 3ZWMA 1B26A 1XSEA 4AJHA 4N5NA 4IM7A 1H9BA 1GZ6A 1QYDA 2WD8A 1X0XA 4YQYA 1PJLA 3F4LA 3N7UA 3UGKA 1P3DA 1KEPA 2JFFA 5TIIA 1PL8A 1J4AA 2Y66A 3H9EO 3WICA 1EVJA 2ZB3A 4QQRA 5EPOA 1YB5A 1NX6A 4XRGA 2HQ1A 2VWQA 3UCFA 2WSBA 3UHAA 2Q4BA 5IG2A 4XGIA 2AG8A 3JYNA 4KOAA 4CQMB 4J9UE 1BW9B 2FHSA 2EJWA 1KS9A 1Q0LA 3FSRA 4L8VA 4RORA 2OBYA 3GGPA 4PLFA 1JWAB 4BNUA 4BMSA 5GZ1A 1ZXLA 2J3KA 3DZKA 3FR7A 3FPLA 1F14A 1ISGA 1ZMOA 2EW8A 3JYPA 3MJCA 2QYSA 5TC4A 1MC5A 1PZGA 3VZQA 2JD2A 4BL5A 3KSUA 2Y1EA 1E1NA 4D45A 2PH5A 1KVUA 1XELA 4UEKA 3WYEA 1KC1A 3ANMA 2C0CA 1WXDA 4J7UA 3MJEA 3MTJA 5A4DA 3TWOA 3M1AA 1B14A 2ZTVA 2B83A 2PD3A 4D3FA 1CQJA 1E5LA 1L7DA 4QO7A 1ZSYA 2PLAA 1Z45A 4PCVA 2V6BA 4WLOA 1XCBA 1G1AA 1D7OA 2HRBA 3PVZA 3QVWA 4NDNE 4WNIA 3IOYA 1BVUA 1P33A 3FTNA 5JAIA 2J8ZA 5C7LO 3O9ZA 4ALNA 1I36A 3VH2A 1R0KA 1GV1A 1CERA 1G0NA 1MG0A 2BFPA 2BMAA 2H6EA 4AG3A 3BMNA 2HMTA 1LUAA 4WCFB 4E5NA 2FRDA 3MZ0A 3ST7A 5KTKA 3I6IA 2V6MA 1ONNA 4W82A 1OZAA 4RVUA 1RYDA 3LC2O 1X15A 1SEPA 2FPIA 3KLMX 2EW2A 1UR5A 3W8FA 4UUPA 3C24A 3OM9A 5FFFA 1GCUA 4E4YA 4MIEA 3CSDA 4IDDA 2Y05A 3B20A 1I24A 3DB2A 3P2YA 3ADOA 3WS7A 3RFVA 1Y5MA 4R1TA 4KTVE 2NVUB 3DZBA 3GNQA 3GC6A 4J9VA 5L7TA 2X6TA 3D1LA 5B4VA 2RAFA 4J90A 3UICA 3W6ZA 1XR3A 1ZSVA 2VN8A 1BXGA 1GZ3A 4NI5A 2X4GA 3C1AA 4PRLA 3H65A 1H94A 4RVSA 4Z9YA 4LISA 1ULSA 1XIVA 2DFDA 4MVJM 4R1SA 2Z1MA 4CV0A 2PH3A 3L0DA 3GZNB 3OJLA 3GN2A 5T8KA 3RUDA 4FFPA 2GCGA 2R2GA 3ZU5A 1VSUA 1T1SA 1ZZEA 1P0FA 2B4QA 2Q1WA 1W73A 2O3SA 1NBOA 3DBLA 3DXFA 3U4IA 3GZ4A 4J2OA 4Z0HO 4EBFA 4FFRA 4XB2A 3OICA 4NBUA 4RZHA 2HJSA 3E18A 3HUDA 1V3VA 3JQGB 4OL9A 4CV1A 4E2YA 4GLOA 3C1OA 3KSZO 1ZK3A 5HRUA 1ZXBA 2A9FA 3WDSA 5EMHA 3BHMA 3WGOA 3WGHA 4YACA 1AUPA 3QHAA 1GV0A 2A4KA 2JFGA 5TRTA 3WB9A 4JX8A 3ZHYA 3O38A 2VYVA 4XQEA 4II3A 3RUAA 3HDYA 1ZCJA 2XF8A 4D79A 3QVOA 2ZTUA 2VWGA 4IDBA 1OBFO 1PS0A 2ILTA 3I4CA 4LCEA 3WWYA 3BTSA 3WFJA 1Y9EA 3QW2A 3HZZA 4IDFA 1FDUA 4Q9NA 4RZIA 2BELA 2IZ0A 2E49A 2UV8A 3BYZA 3RU9A 4BNTA 1J5PA 1PWXA 3GNSA 3H6KA 2X0RA 3Q1LA 4HFRA 3ABIA 3KEQA 5U1PA 1FDSA 2X8LA 1T1RA 4CL3A 1N7GA 5IDXA 4Z9XA 4CLOB 3AY7A 3E5MA 4HBGA 4W99A 3CUKA 4MVJA 3V1UA 1GUZA 2DLDA 3PWZA 4D7AA 1E1MA 1F0YA 6LDHA 3SX2A 1BRMA 1ZEMA 3NKLA 4B3JA 4L74A 4B79A 1VI2A 2W2KB 2PZKA 3JQ7B 1AE1A 1EEHA 2J3JA 3INGA 1WLYA 1V3TA 1Y7TA 5FF9A 5TJ9A 3JQAA 3Q6IA 3VKVA 4J49A 1PZEA 4R68A 1ADBA 1NWCA 3GVCA 3TOXA 3G3EA 4BNKA 4B3HA 1R66A 4YEDA 1WPQA 3OHSX 4YT8A 3RUHA 3JTMA 4MKRA 4LSMA 1VC2A 2NUAA 3NRCA 2VUTA 4DRYA 3PP8A 4RL6A 4BO3A 4CMKA 3PWSA 3OA2A 1GADO 4WCDA 2HK7A 3BMOB 2DAPA 3HFGA 4ALIA 4ESOA 5DF1A 4CM9A 1HDXA 3AW9A 1U4OA 1N9GA 1NM5A 3U4DA 2PKQO 1UZMA 3HSKA 5CEEA 4ZD6A 2Q4EA 1EK6A 1B7GO 1H6DA 4GSLA 1WDLA 4EZBA 3GVPA 3WOHA 2QG4A 2WYWA 4Q39A 4Y67A 4EITA 2FSVA 2YHUA 3KZVA 3I1JA 3ROMA 4QO8A 1EE9A 5KVSA 2GYYA 3UXYA 5I9NA 5KNLA 4FFMA 3WFIA 3PHLA 1HTBA 2WTBA 1E5QA 5TGDA 1YGYA 1U3UA 1W4ZA 3G1TA 2B5WA 3AOGA 3H9UA 1HYEA 1P45A 1QSGA 1JKIA 4A0SA 4G5HA 2ZQYA 1X1EA 3H8VA 3HB4X 1HDOA 5I8ZA 2OBNA 3U4CA 4GX0A 4K28A 4WECA 4XJSA 2OFPA 5KJFA 1PJ4A 2D2IA 3AUSA 5ITVA 4K1LA 1GL3A 4UUMA 3ZHZA 3ZNQA 3ON5A 4OAQA 2A92A 1X1TA 2P91A 2Q1TA 2GF2A 5C3MA 1HE5A 1N92A 3GFBA 1PJ3A 4M89A 5EN4A 3DQPA 3PJFA 5MGBA 5IZ4A 1C0PA 3ZU2A 2X1HA 1O5IA 2I66A 4J4TA 5K9ZA 1PS8A 2WE8A 2W90A 1JA9A 1TEHA 2NTJA 4W7IA 4DIBA 2IE0A 4NJMA 3HFSA 2EGHA 4WASA 4R54A 1EFLA 2BGLA 2A94A 4I1IA 4YA6A 4A5OA 2PZLA 1DRWA 5JAQA 1E6WA 3BMNB 2NTNA 1HSZA 3L4SO 3H9GA 4J16A 3Q11A 2AW5A 4RDIA 4H3VA 5FYDA 2PD6A 3F4BA 4R01A 4DREA 1MV8A 1UJMA 3MJ4A 4EGFA 1HYHA 1ONOA 3FN4A 3A28A 1JAYA 4NU5A 3L4BC 1KYQA 3JYQA 4OM8A 1O9BA 1U5CA 3WXBA 4DPMA 1PEDA 2W8ZA 3I9LA 4WGGA 3AI2A 4H16A 2DT5A 5THQA 1I30A 4BKRA 4FB5A 3VAZA 2IZZA 3BZUA 3D3WA 1IZ9A 1IPFA 1XLTA 4WOKA 4FSHA 1KY4A 5B4TA 4UEOA 5JBIA 4MVJP 2AHRA 1LSUA 4KWHA 4WKGA 3WMWA 1C0KA 3TL3A 1SC6A 4FDAA 4IJKA 1BXGB 3NT5A 3I3OA 2VCYA 3SC4A 4F45A 1H6AA 5JAZA 3GEGA 4Z3DA 4CUJA 3WR5A 1PSDA 1FDWA 5JNLA 3E9NA 2G0TA 4BNYA 1SOWA 4CMEC 3OIDA 2GRAA 3KO8A 4TSKA 1HEUA 1DDOA 2CF5A 1C1DA 2CFCA 4KUGA 1UXGA 2OHXA 2UVDA 3RU7A 3JD0A 4R5MA 5H83A 3DBLB 5IZCC 1QG6A 1GQ2A 2P68A 1ENZA 2O3UA 3OEYA 4FFOA 4XRRA 3VZRA 3Q0EA 3PQEA 3D4NA 3FI9A 3U49A 3KHUA 3IP1A 4O63O 3ENKA 1L1FA 4KQXA 2HRZA 3G1UA 2GDZA 4LRTB 4BB5A 4E5MA 2OUIA 3EYWA 1M76A 1QP8A 3K9QO 4IDAA 4N7RA 4YAJA 5IJZA 3SLKA 4IJWA 5JE8A 3O4RA 4Y6PA 4GQAA 1A7AA 2NQ8A 4UUNA 4ZQFA 4D43A 1SB9A 1ZUD1 2X9VA 4CLRA 1NNUA 1P77A 3V1YA 1DSSG 3H3FA 1KVRA 3WQQA 4BNGA 5JO9A 3TRIA 1DPGA 3AM5A 4WEQA 4E2XA 4XYLA 4C4OA 1WZIA 2QHXA 4E5PA 4GH5A 3DOCA 3TL2A 4MIYA 4DLLA 4DLAA 4E12A 4MVJE 2D1YA 4LGVA 1LDBA 2Q2WA 5FWNA 2PFGA 2V6GA 2O7QA 5BSGA 3ZW9A 3IKVA 1R0SA 1XA0A 1Z74A 3S2IA 1I10A 2OP1A 5T64A 3JQCA 4TVBA 4L76A 3ASVA 5KCZA 2Q49A 4CQLA 2PKQP 3DMYA 3VVCA 3CINA 1HLPA 4EJ0A 3WQRA 1NR1A 1OMOA 1QORA 3D3EA 1MXFA 5G4LA 3AY3A 4ZRNA 2WYVA 4JROA 1GCOA 3U09A 1XU9A 4P22A 2VUUA 1UDBA 3A4VA 1LU9A 1NVTA 3JQAB 4TMFA 3KYDA 3S2FA 3JYLA 2HK9A 2UYYA 4TZTA 1GYRA 4ZJUA 2Y0EA 2JKVA 2OOSA 4F46A 1JDJA 1QV6A 1RM5A 4KZPA 2WWRA 5KVVA 3AK4A 1ORRA 1JAXA 2RHCA 4YWJA 3JQEA 4DVJA 2B69A 2IYOA 4INAA 3JQBC 3QP9A 2C59A 3AI3A 1ZEJA 1GUFA 4IMRA 4IS2A 5TF4A 2PWZA 1LI4A 1M75A 3WSWA 2DM6A 1I0ZA 3ZU4A 1PGOA 3WNQA 1N9GB 1L7EA 4NHEA 4M8SA 2ZYAA 2E37A 3QWFA 4FIZA 3ZWPA 1BMDA 1E7QA 2DTDA 5TJHA 2NU8A 2AQ8A 2QIOA 4MVJF 1B15A 4RLHA 1D3AA 1ZMTA 4CMEA 4EW6A 5L51A 1E3EA 1Q7CA 3R1IA 5DP2A 4A73A 3IP3A 1E3JA 4YAIA 4WK6A 1ISHA 1C0IA 1LLDA 2ZCUA 4NQZA 1V8BA 2VZ8A 1K5HA 4PIVA 4ZU3A 4MP6A 1PU2A 3B1FA 1XYGA 4J1NA 5F3RA 4JBIA 2XPCA 4BO2A 4BMVA 2FY8A 2YYYA 4ALJA 4GL4A 3RC7A 3ZWBA 3DTYA 5L4NA 1PIWA 2FMUA 4RLSA 3ZV5A 4CMGA 5A5EA 2JAHA 2GO1A 1KETA 1E92A 2QRJA 4RV9A 4N5LA 4I5DA 2YZ7A 3OIFA 4FW8A 3DWFA 2CDCA 1YQXA 3PFWO 3VH3A 4DLBA 1ZK2A 3WYBA 4UVGA 4GPD1 3V8BA 2QRKA 2CUKA 3I9KA 1YDWA 1VKOA 1A9ZA 4CM8A 1VKNA 2NM0A 3AUUA 5JY1A 1VL6A 4K26A 4UAGA 3WWZA 4IS3A 3ITDA 1YWGO 2P4HX 3LYLA 1HDGO 2HO5A 2Y1OA 4O5OA 4XDYA 3S2GA 4I5FA 4BNMA 2X7HA 3DEYX 4NJMB 1HETA 3TOZA 4GGOA 2DTEA 3ZNOA 2BRUA 1HE3A 4BOYA 3INRA 5IFLA 2HCTA 3OJOA 4BO4A 3BIOA 4YVFA 2YY7A 5HWSA 5EERA 4XQGA 5CG2A 1HE2A 4MVJG 2PD4A 1DC6A 4J3FA 4XIJA 4BO9A 3DAGA 5B4UA 2JD1A 1Q0HA 1P1FA 1WDKA 3FF4A 1DBVO 3HHPA 4MIOA 2DBZA 4YYZA 3O8QA 5AXCA 1E3WB 3ANNA 4A26A 4B3IA 1ZH8A 1KIFA 4KDEA 3V2UA 5ILOA 4RPHA 1E7RA 1DFIA 3LLSA 1C1XB 2DC1A 4QECA 4UVIA 2V65A 4HY3A 1ADGA 4JJGA 2YFHA 1UH5A 4RPKA 3U3XA 5JAMA 3F9IA 2Q3EA 3D3WB 4HUJA 2CY0A 3CTMA 2HK8A 3WQSB 2CDBA 3A9WA 3TJRA 5T57A 4HV4A 1YBMA 3MWEB 1RJWA 1GR0A 2G82A 1KVSA 4K6FA 2NU6A 2OXIA 5JCJA 3U4HA 3AUAA 4MP8A 2ZJ1A 1RM4A 1UP6A 1GFSA 2GNAA 5ICMA 2V7PA 4RPLA 3LVFO 2Y1DA 1LA2A 1B3BA 3WGQA 4XYGA 4PLWA 3GF4A 1V6AA 4BGVA 5L4SA 2EP7A 3ZNNA 3LT2A 1R6DA 4P4NA 1KERA 1GQYA 1MUUA 3DDNA 1HWYA 4EYEA 1ML3A 1GY8A 4OQZA 1Q7BA 3K8ZA 1B8UA 4IY1A 4EUFA 1G0OA 1QR6A 2AXQA 2B5VA 4DA9A 4E32A 1BTOA 4WOJA 3F1LA 3IAHA 2BHLA 4PLVA 2GZ3A 4XKJA 4OXYA 4UVEA 1PJ2A 3DBRA 3MWDB 2R00C 1U7TA 4XJTA 3ZV4A 9LDBA 2G1UA 5GMOA 2YW9A 1HYGA 2I76A 2CD9A 5I7FA 1HDCA 4RF5A 3U0BA 4CLRB 2PKRA 4TZKA 2VRCA 1ZW1A 4D42A 5AQ1A 4PLTA 5IXYA 1HKUA 3QQPA 4DTIA 4BV8A 1ENOA 1K6IA 2F00A 1SMKA 3B1JA 3VDQA 1X0VA 2OMEA 3D5TA 4DYVA 3WJ7A 5KJ1A 1R37A 4I9NA 1OFGA 5L9AA 3NTRA 1ZJYA 3FWZA 4HP8A 4MOWA 3IL2A 1NVGA 4XD2A 5A1TA 1LEHA 1LXCA 1H93A 4JXKA 1EBFA 1UUFA 5LC1A 1M66A 5CEJA 2NADA 3W8DA 2FWMX 4CQLB 4AICA 1XHLA 2C5AA 2BFAA 4JCOA 5BSHA 3EVTA 3PRJA 2DBRA 3PJEA 3NX4A 2R6JA 3BTOA 3H5NA 3I5MA 4ZVVA 3RC9A 5BNTA 5ADHA 4WEOA 2VOJA 4YCAA 1HF3A 2GD1O 2E6UX 1NR7A 3EGOA 5A03A 1VPDA 4RVFA 2B4RO 9LDTA 1T24A 1FK8A 2FN7A 1EUZA 2ZB7A 2HAEA 4J7CA 2H1SA 4GX5A 2BH9A 1QRRA 4M87A 2Y0CA 5EINA 5IN5A 3KVOA 5I7EA 3GRPA 1NTOA 2Y0DA 4GKBA 4DPKA 1E7YA 2BD0A 3VDRA 1BVRA 3CIFA 4FC7A 3KYBA 5F1PA 2DTXA 1NAIA 1W8DA 4NBTA 5TT1A 1DC4A 3AJRA 2XAAA 4BNHA 1NFRA 4D3SA 2OGUA 3GA0A 4IQGA 1BHSA 4D44A 1CWUA 4TROA 4YJFB 1F06A 3PK0A 3D4PA 2BFMA 4LMPA 2ZJ0A 4GX1A 1J6UA 1LDGA 3AI1A 4FFNA 1SPXA 2Q99A 3HDJA 4NK5A 4PZEA 3S55A 1P1RA 5A05A 2NNLD 3E5RA 4CQMD 4L4SA 2X9GA 4UVDA 3CXRA 4OMUA 3IUSA 3K6JA 3VC7A 2LDXA 3TZQA 1CQIA 2YHIA 4R9SA 3UUWA 4DMLA 1AXEA 2VHVA 2R00A 1VRWA 5A9TA 2I67A 2C20A 3NDRA 4CM5A 1NAHA 5DBGA 2EP5A 1SNYA 1DRUA 3EHEA 4NFYA 5T67A 3M6IA 4PGFA 2O50A 4L4XA 3TFOA 4IZIA 3BAZA 1ISIA 3AU9A 2P9EA 3GVIA 2YDXA 3ZN2A 4CM8B 4IJUA 1UDCA 1NPYA 2J6IA 4YJGA 1K6JA 5BQFA 1BXKA 1SZJG 1EQ2A 1M67A 4DL9A 2B4TO 2WDZA 2Q2QA 3LT1A 5G0UA 2Z1NA 3K31A 3MJSA 2DPHA 5CDTA 3N58A 3VZSA 4YR9A 3ADPA 5JY6A 2BKAA 4EI2A 1DHTA 4QUKA 1T2EA 3Q9NA 1WZEA 1P74A 5LDHA 4NH4A 4CM4A 2QZZA 1SB8A 3VH4A 1SAYA 1E6UA 2G5CA 4JP2A 4P38A 2HJRA 4TRMA 4N18A 2X5OA 5DCYA 4NG5A 4XWYA 5C37A 1EVZA 4RQTA 1LTHR 2YQ4A 4CV3A 2EKLA 4NBWA 4ITUA 4CV2A 3K73O 3O8QB 3QJ5A 5CAEA 2ZB4A 5TSDA 1IB6A 3DO5A 2VTDA 3R0IA 2W2LA 4PZDA 3GN1A 5U4QA 3GG2A 4BO8A 1NXQA 3UOGA 5AOVA 2P2SA 1W0CA 3EVNA 3RC1A 2WEKA 1K0UA 5BNIA 2X0IA 1I3MA 1UXIA 2TMDA 3AWDA 1WAMA 4H15A 4ZA2A 4FS3A 3RUFA 3W8EA 2HUNA 2C54A 1AHIA 1I3NA 2IEBA 5JFOA 4EEZA 3RBXA 4ND3A 2C2YA 4WNCA 1ISFA 3HDHA 1M6WA 4ILKA 3JYOA 3OEWA 1T4DA 3GEMA 4LSWA 5FI3A 4B4WA 2YUTA 4DQVA 5KWEA 1YBVA 2PR2A 3LT4A 4RVGA 3RASA 4KTTE 4RF3A 1I33A 4FOOA 4TKMA 4XYMA 3TSCA 1VL8A 3ORFA 3OH8A 2O4CA 4EJMA 1I2ZA 3CH6A 3BMCA 1EK5A 1ID1A 5CDGA 4NFSA 3C7DB 4BS9A 1J0XO 5JCXA 4PVCA 1Y81A 4Z9FA 1Y8QA 3INTA 1HXHA 1V3UA 4M54A 4IZHA 1DJQA 1RYEA 3V1TC 5BR7A 2PGJA 2GN6A 3OJEA 1GU7A 3I6QA 4MVJI 3LT0A 4E31A 5U9CA 4MDHA 3TZHA 1PJCA 4O0LA 2P9GA 5A5FA 4CUZA 5G0TA 3DAPA 1LLCA 3QVXA 3RD5A 3DBRB 1TXGA 4R69A 5KJ6A 1R12A 1A4UA 5DN9A 2YJZA 5L53A 4JBGA 3O26A 1GYPA 2FOIA 2AQKA 4G65A 4M49A 2Y1CA 4MINA 4GWGA 3GMSA 5G2OA 4RDHA 3CMCO 3B1KA 1EDOA 2GGSA 1P31A 3NAQA 4LW8A 4MKXA 2NVWA 4AL4A 2VZ9A 5COBA 1K89A 1B3RA 1TLTA 4HADA 4JLWA 3V2HA 4GMFA 1TT7A 1JLLA 4HXYA 1TI7A 3RUEA 3ETEA 2X9NA 3SEFA 4O6VA 3I9JA 3QRWA 3OP4A 1AHHA 3D7LA 1IHXA 2C5EA 1RKXA 2DUWA 3E6AA 1U8FO 3L6OO 4JJFA 2CNBA 1EVYA 4E33A 4AJPA 1LRLA 1K2WA 3V2GA 2GERA 2HU2A 2BF7A 3ROKA 1IULA 3G17A 3JQDA 4FJ1A 1N2SA 3UCEA 3QVTA 4DIFA 3P19A 2I6TA 4IJVA 5TS3A 1JQBA 1TB4A 1CIVA 2EXXA 2VYNA 1YQDA 4AJLA 3CMMA 1OC2A 2Q50A 3FNHA 3WIDA 4E30A 4OHUA 1HZJA 2DFVA 1KEVA 1PJBA 4J1TA 2X22A 3MTGA 3ZHBA 3TQHA 4MPDA 1AGNA 2DQ4A 5LCXA 3C8MA 3RKRA 4ONEA 4BQRA 5TLSA 5F5LA 3RWBA 2IEDA 2PTGA 2TMGA 3PGXA 3NJ4A 5A3VA 3TZCA 2H63A 4PZCA 4CR8A 4M1QA 1HZZA 1HRDA 4CLDA 4WPGA 4Y6SA 5K6AC 4WUVA 1GEGA 4PLGA 5CDUA 2J5KA 3IC5A 3QSGA 3PGJA 3VTZA 4LRSB 2NLOA 5DOZA 5L7WA 3IUPA 4B4OA 4DC1A 1LLQA 4E13A 2D3TA 4YPOA 2GASA 3IQDB 1XQ1A 3DMTC 3KXDA 2AEMA 1CRWG 5JMWA 1GAEO 5EESA 4FJ2A 4QTZA 3ZHXA 3H5RA 4XEHA 1HDYA 1R4MA 1WWKA 1PGQA 1U1IA 2PGDA 3PHJA 3PYMA 4DBZA 1Z82A 4UVHA 1H5QA 1ENYA 3PDUA 1S6YA 3BTVA 3VVBA 5DBFA 4PG7A 5CG1A 4K6CA 2I3GA 1NFQA 2WM3A 1PQWA 3H4VA 4PRKA 3UCXA 4J4BA 1CDOA 1GTMA 2YHIB 1XGKA 3UW3A 5CDSA 1HT0A 3BMQA 3E48A 5JDCC 3WGTA 4BGEA 3PXXA 1E7MA 4TQGA 5ENVA 1LSOA 1JWBB 3ONFA 4GVXA 4R1UA 5I7VA 4OH1A 3JQFC 3EZLA 1M2WA 5FI5A 1U3WA 4RQUA 3W6UA 3DHEA 4ZGWA 1JVSA 3ZH2A 2VT3A 1X7GA 4OJNA 4OXKA 2I5PO 1NQAO 4Y98A 1PS9A 3RJ5A 1Z75A 5HBRA 3KEOA 4B7XA 3VPSA 4YJGB 3F1KA 1VLLA 4NZ9A 2UAGA 3GY0A 3ZWAA 4XGNA 2P9CA 4L75A 1H2BA 3DFZA 1YL6A 2XOXA 3E1KA 1P1IA 4TRJA 3VHRA 5C7IO 4JP3A 5JYEA 3OA0A 1UP4A 5B1YA 3Q9UA 4CLHA 1PTJA 5DNAA 1E7WA 2NTVA 3RBVA 3WSVA 4CM1A 4O59O 2ZIZA 1ZFNA 3NT2A 1YL5A 2O7SA 4FOSA 8ADHA 3NGLA 1T26A 1MA0A 5TT0A 3W4JA 4CM4B 1WNTA 1ZJZA 4IIVA 4AJIA 3RBZA 1T2DA 2RHRA 4RO0A 3DZGA 1MG5A 3FBGA 1DIBA 4CM6A 4G2NA 1EDZA 3SC6A 4F6LA 1GDHA 1E1KA 6ADHA 3UFXA 4UUOA 3DTTA 1EBUA 1ISJA 3S2EA 2O4UX 1MB4A 4BNJA 3FCOA 2P4QA 3JQ6A 2SCUA 4PLHA 2DPGA 4E2WA 3QWBA 1DRVA 4HNGA 3RUCA 2G76A 3RROA 2EKPA 1BGVA 4I9UA 1PZHA 3U62A 1P1KA 5I9LA 1B8VA 2DVMA 2JCXA 5GZ6A 3VOSA 1OAAA 2GZ2A 3OQ6A 4FN4A 1P1HA 5EL0A 5K6AA 4XYEA 1DFGA 3P7MA 1I2CA 5L45A 4JQCA 3BXXA 1QV7A 4IBOA 1NQ5A 2RH4A 3OBBA 3CPSA 1UZLA 2CDAA 5A9SA 4BKQA 4CMIA 2EIHA
chains in the Genus database with same CATH superfamily
3NWPA 1MF7A 2O20A 1FS6A 4XX0A 3PQ8A 1X92A 3LY9A 2CLMB 4P08A 4DQDA 4YT2A 2FPPA 1F4PA 5K1ZA 5JD6A 2W98A 1EEXB 3A06A 3FSEA 3A58B 4IIBA 4YLYA 1LC3A 2EHJA 5AVXA 1THZA 3RSHA 5KIAA 3GFPA 3REFA 5ENDA 3WVNA 1OROA 1JJFA 1UBTS 2N0SA 1T0IA 2PDAA 4DWVA 1DC3A 4BNNA 1QFZA 4PW0A 5FQOA 5K03A 4P32A 4ER3A 2WIAA 3FYHA 2Z8XA 2JPDA 4GPAA 4V2IA 3UMMA 5F21A 1Q1ZA 5K0EA 4U2BA 3BFKA 4DLYA 2BW0A 2H8GA 2OYCA 3UPDA 4BE9A 5IJXA 4E3ZA 1IHUA 1UP7A 4TOIA 4NV1A 4XTCS 5K4AA 1W88B 3SVZA 1CETA 2A33A 2W2OA 4EO4A 1U0RA 4ND1A 5TY0A 4O8CA 2PQ2A 4J94A 1NBMA 2YTZA 2AMVA 1KRXA 3IQWA 3VKUA 1Z0JA 4YYEA 3DS8A 3KWLA 4YUYA 3WAGA 1OLXA 3MYYA 1WV0A 4WLVA 2HMUA 3GGGA 4GECA 1SR8A 1BYIA 3E9ZA 3JD1A 1UC4B 2BONA 4HLDA 1X7XA 5IMSA 5ITWA 4ZTBA 1A27A 2OWEA 1QRTA 2CSXA 3CHYA 2WTMA 4MARA 1ODLA 1SXJD 3L9WA 2R7MA 3B1YA 2YJ5A 5LIRA 1XNJA 1OWOA 2G0NA 3JZAA 4WADA 2HDOA 1SVIA 5JD3A 2CT8A 2F8LA 4UASA 5B1IA 4EKYA 4LTNA 2IYVA 1RM0A 2QL6A 3BIWA 4FR0A 5ICCA 5JFGA 2HY7A 3HKEA 4EKGA 5KS2A 4MW4A 4U00A 3I9V6 1A4IA 1D7AA 4B6PA 3I83A 1PQ4A 1TJYA 4YDSA 2X0NA 2OD9A 4DGSA 2IYTA 2ZTMA 3U1TA 5IM4F 2QGFA 2GRJA 4TT3A 1PKEA 2H7CA 4LJ5A 5AW8A 4PZAA 1DKMA 4YP7A 1JA1A 3K6SB 1U2ZA 2RDMA 1FF9A 2A0WA 3KDSE 5ECGC 4LBZA 4DZZA 1ETHA 5TS2A 1VG9B 4HZUA 4QEDA 3GBVA 3MYRA 3OAAA 4Z3KA 5B30A 1B43A 3EFOA 2IBMA 4WX2B 2MSDB 1QO0A 3GLQA 4AVYA 3THWA 3HSSA 3DCIA 5KI6A 3ZLTA 3LY8A 5E8RA 3C7CB 3NAZA 5FOUA 3WK7A 4HFMA 2Y1GA 3K9CA 5DNCA 4DBLC 5AM5A 1I9CA 1E5DA 1ZGCA 1D8AA 2C2WA 4UZFA 4ZO8A 3OEED 5DM60 4RK4A 3A8TA 1N1EA 2QJWA 1COWD 1OI7A 4ZO9A 4Z9FA 1UWKA 4BGIA 3FTFA 2BPOA 5FFNA 1L5SA 3FR8A 3AERA 3H4TA 1K8YB 2EWWA 5BN1A 5BXQC 2Q5LA 4G2TA 4UBJA 1Z13A 4D1YA 1EFVB 5K3FB 4MHSA 1NW6A 1Z6GA 2AJCA 2JJ2D 3FUWA 3EUEA 4KAAA 1QKJA 3F46A 4RHEA 1HUQA 1C9DB 1U5AA 3KETA 4W5OA 1P4GA 4A15A 1P9WA 3K0EA 4LOKA 4ND2A 4X6UA 4MH0R 3ILVA 1Y9JA 4X94A 4R1MA 1YQWA 4PQGA 1OH7A 4QOIA 2QE7A 3A27A 3IVCA 3L84A 1IUNA 5IM5A 3IPRA 4EY5A 3QV1A 3ZGOA 2W2NA 4FYJA 2YOFA 3KHTA 4NATA 4UDXX 4A3SA 1Q7GA 1YI0A 2AK2A 1L4BA 1PL6A 1LQUA 3MB5A 4ED9A 5BW5A 5KQPA 4DR2B 2VAVA 1YK1A 4R9UC 1IY8A 3GHHA 2XQJA 4MWDA 3RGGA 3SLRA 1PUJA 3EFBA 4GYWA 3VHLB 1NVVR 4MA0A 1MOZA 5MDHA 2H08A 3L0YA 2GEBA 4O3MA 5TPZD 1OGJA 1OVGA 3QOXA 4MEAA 4Z86A 5A04A 5BPFA 5AVYA 4FW9A 3E03A 5EJ2A 4B3MB 5F52A 1CR0A 4Q47A 1LBIA 1NLYA 1UZAA 3JX9A 3MOGA 4FK8A 4D57A 2YNMA 5BQ3A 3Q87B 4YRDA 4QOFA 3IGFA 1G4AE 4G3XA 4E6PA 1HLDA 1O97D 3LWZA 4IEIA 3WX0A 4Z5XA 4UMEA 4Q05A 1C1DB 2HLNA 3M4YA 1QRAA 2BFBA 1V45E 3HU3A 4M0LA 1ONPA 4FHGA 5CT9A 1J1UA 2XKAA 3LAWA 1CJBA 2DJ5A 3D6FA 4TWIA 4TS1A 5CLLA 4DG9A 2YIVX 4AJJA 2BI8A 3KR0A 5KOHB 2RGGA 2ZEJA 1E8NA 1G42A 5DGIA 5JOQA 4MRNA 3R7WA 4D6XA 1YDEA 1Z6TA 3OLXA 4OB7A 2FMXA 2D13A 4UE6A 5IAKA 1UM9B 3IAUA 4BVAA 1DKOA 2AR7A 2CZCA 4DOMA 4TTTS 5KJCA 3OE1A 2CKMA 2O48X 2PY6A 3N8NA 2LIPA 2QAGA 4F3NA 1E3TA 5EIFA 4MKHA 2QTZA 2R85A 1N36B 1F1BA 1LBEA 2PHZA 2RCYA 4W1QA 5JI2E 4KR6A 1FFCA 4G4SP 4LE2A 5EWMA 4CMAA 1GD1O 4R2IA 3DZ8A 4RCVA 1E3SA 4EWLA 1DDGA 1EIZA 1BEZA 4GEGA 4X85A 5LB2A 5DHAA 4Q6WA 3IQEA 4M60A 5HM8A 3IDFA 3AFMA 3C6ZA 4GSKA 1DC8A 3NYWA 4YT5A 4BNFA 5BN3B 4OI1A 2QWXA 1IQ0A 3O74A 1JB1A 2QMEA 2MHCA 2P5SA 5HEKA 4C5AA 3SAJA 1SY7A 3FTPA 4W4TA 2ZBRA 4LF5B 1POWA 1FJXA 4LWOA 3HZOA 5A5VA 5L40A 1ZOIA 3UVEA 1T29A 4J0JA 2LWIA 3UFXB 4ZJPA 3UG6A 1ISSA 5JXWA 2V8BA 4GXTA 3V46A 3AL3A 4DLRA 2ID7A 1NL3A 1BA3A 2SCUB 1ZNXA 1K27A 1C9JA 2GAFA 4ILEA 3V8MA 4MS1B 1ZJ5A 3WLJA 1DIHA 2RJOA 4JLMA 2VCEA 1VIMA 3CH7A 3EVAA 5CVVA 1FDTA 2AOUB 2VSFA 3LC7O 3WG9A 1VI5A 5CNMA 4C21A 1N5RA 3PLRA 3O8BA 3GLTA 4XR9A 5ICGA 2VQSA 2E1RA 2XIQA 1QXSA 3REGA 3UUEA 4GX2A 3E22A 3OTGA 4IEFB 5JEDA 1EK0A 3QY9A 2G1PA 3DQZA 4NBVA 3G5AA 4Q9HA 3O3NB 1OU4A 1Z6PA 2YH2A 3GOHA 3CR3C 1PD1A 4ZCLA 2NTYC 3L6EA 1KXJA 1SC9A 3JSAA 4KYVA 4LJAA 5KWIA 1XVTA 3A3PA 3KV1A 2NXCA 3L5OA 1S3SA 4BQIA 4HX5A 4WNAB 3VU3A 1YRLA 2O2JA 4RMJA 5A9SB 3PLNA 4CMIB 1EU1A 2B8JA 5FR2A 4CTNA 3RK4A 1GCIA 4MQBA 4XX0B 3HP1A 4PR3A 1PK8A 3LPDA 4MJLA 4UZEA 2FPPB 4MMXB 1M34A 2QX7A 4EKDA 2CJFA 2WNIA 3QX3A 1Q77A 1TA4A 3OM8A 4KXQA 4ZO4A 3TF5A 5UKDA 2OHOA 2YOHA 1H2AS 1E2PA 1QVVA 1RWXA 2POQX 4CIDA 4N48A 2BISA 2ZZKA 3BM5A 3L7LA 2TMYA 3PR2B 4REOA 1HNWB 2HLHA 4ND4A 4GDFA 3WRVA 4E5YA 4L1KA 5AI4A 1EE2A 2HQBA 2RHMA 1PR1A 1NBME 4ENPA 3HQ4O 1IN4A 2DUUA 2GAOA 5ALKA 3EMVA 2W22A 5FTNA 4YASA 3IKLA 2QI9C 1PFGA 1NR5A 3FDJA 1OHHA 4EGAA 2QW8A 1ADFA 2P6UA 5AUNB 4L5YA 3ZHCA 4DE5A 5EZ6B 4EPTA 5K3AA 3LPMA 3WISA 3OX1A 4F1WA 5ED4A 4I5GA 2FK7A 2Y68A 1R2QA 2C4HA 1OLXB 2IY8A 2QTGA 1YO6A 3H5TA 4MYRA 1PFQA 1EINA 2IYWA 2I3DA 3DMRA 1X7XB 2BEKA 5K8LA 2GJSA 2XOKD 2FKAA 2PJRA 3WK5A 1MC4A 2FGJA 1HTTA 1RKBA 4FQ7A 1TM1E 2ZVPX 4OXXA 2ZSJA 3A9VA 1KMNA 3I4FA 3KZKA 4Q9LA 5JYBA 5LU8A 3GK3A 1Z26A 1H0KA 3PEVA 3QVSA 3HKEB 1XZDA 2JIPA 1Y5RA 2GR9A 5U4XA 2KS6A 3VSCA 2QSZA 4PAOA 4OQYA 4JAVC 3RKUA 4FYVA 5A2GA 4W9NA 3NC1C 4KYTA 3ZWCA 3SYTA 2IRWA 1FFEA 3I05A 2O8BB 5ILQA 5KUTA 1RW4A 2WAOA 3OZXA 1LB1B 3TIIA 5KCMA 1WBBA 1X8JA 1NJSA 2Y77A 1U2GA 2HV9A 2WJZB 4HZUB 4AMVA 1ULHA 3AOEA 3HG7A 3LCMA 5DV9A 2W7TA 1KFBB 5F3DA 5CITA 3EFOB 4ICIA 3THWB 2BI7A 1U3VA 1KQNA 4F9EA 3SHWA 3U56A 1T3ZA 4YFYA 2QLFA 1AV6A 1V9CA 3DZJA 4GPIB 3VI3B 4OMFG 4L0QA 1QCZA 1Z5GA 2IUFA 3G6WA 5HGXA 1XMOB 2OFXA 1N7HA 2F1HA 4IP0A 1WD7A 4ENTA 2AD5A 2VWHA 1OTXA 1Y6ZA 4Y1FA 1PFKA 3ZGYA 3ZNPA 5KKCA 2V4MA 3GT0A 3HXLA 1W0JD 3AERB 3K32A 3ZGZA 3RC8A 1H6CA 3OQVA 4JYBA 3OZFA 3JD4A 3V7WA 4YRMA 3EVEA 5CUQA 4G5OA 3WMXA 4PX9A 4ARBA 4GM0A 3ZE8A 4HDRA 3SM3A 2ZYTX 3QHQA 4H7EA 1OAOA 2Q0QA 4LDJA 1THTA 3TQFA 2UUPA 5JZMA 4N5MA 4M22A 3DDWA 3GZJA 4H3HB 2NMVA 2O2SA 2O3QA 3I8OA 3OPMA 4QYXA 4LOJA 4D9IA 2UUBB 2F1KA 1NHGA 1VKZA 4TQ9A 4F4DA 3ENZA 3KR2A 5FL7D 2IDJA 5DWDA 2Y67A 5H70A 4C2AA 3OM0A 3NWEA 1F7UA 5CDYA 4M0CA 1I2MA 4KJZA 2LV8A 2WHQA 2Z08A 2ZE7A 3MLAA 3KFXA 3HB9A 4PO1A 1VM6A 1CB0A 3OKAA 2D1FA 2X13A 2Z3ZA 2BHSA 5ECDA 5EKTA 1J99A 3I2KA 3KM0A 4KUHA 1G6HA 4WLUA 5ER6A 1V8DA 4Q4JA 2H0AA 2VXYA 2BJHA 2GEDA 1WIWA 3A1TA 1UWCA 3DZIA 3IURA 3ILYA 2Z3VA 4FGKA 2CV2A 3ZU3A 4EFDA 1IBKB 4FR5A 5IUNC 3BWXA 1ZM3A 1GQQA 3HXOA 3OZCA 2WF6A 2QLTA 2XBLA 4RA6A 1XJWA 6REQA 2ZTSA 5JS1A 4EEXA 2NO7A 3OQBA 4YLEA 2BFBB 4EF6A 2UUCB 2OKCA 1COZA 2Z5VA 2AJTA 1GIAA 2JS7A 3G0CA 5G02A 4HWRA 4CHTA 3MBKA 4QQKA 1NZDA 2R68A 2XWSA 2XWJI 3LXUX 3M5DA 1GP2A 2VDOB 3DMDA 3R9KA 4UFPA 5B12A 3PX7A 3ACCA 4L9WA 5ELLA 1RXSA 1QYRA 5AM4A 1MORA 4X24A 4XB1A 1RRMA 5DX1A 3EW7A 4WD3A 1EFDN 3V3KA 4F1JA 1M2JA 1N3BA 3KKPA 2MYUA 4G85A 1PR9A 1ZK1A 2BEJA 2X15A 4RPCA 4J0DA 5KTYA 2FJPA 1NYRA 4A0FA 4HAWA 1H65A 1UXHA 2ZUEA 3J7AC 2QAGB 3UAGA 2O19A 3WZMA 1EPUA 3KX2A 3R0XA 4Q00A 5JNUA 2VPZA 3H0KA 1G98A 2B98A 4U9HS 5EWMB 1YT5A 2PEZA 3BD7A 3WDLA 1N5KA 2XUJA 4LY3A 4RTKA 4YMHA 4PN7A 2EFEB 3R3ZA 3UTCA 3TLGA 3OQOA 3DBHA 4HH4A 2C84A 3DEHA 3ZQJA 3UWMA 1TK9A 3CX4A 3KUUA 4M9XA 2ZETA 3RYHA 3JQ9A 3MG9A 4JNGA 3ETLA 3QOFA 2ODEA 4AS3A 1L7XA 1WF6A 4KQ1A 3WKCA 1K7YA 2NW6A 4KFRA 4NOLA 2BR4A 4AULA 1CY4A 1U0EA 1VIYA 2CBGA 5GOTA 2QA5A 3U09A 2QY6A 1A8PA 4FR2A 4DC0A 1XNQB 2JHFA 1GZ5A 1A69A 1DHRA 4Q15A 1JQAA 1V5WA 5AKHA 1NFFA 4Q93A 4F2PA 5A4AA 2VP3A 3RODA 2AZTA 5F2NA 5K01A 3WYCA 2ACVA 1I2BA 2NZJA 3IQHX 3RVSA 3UAOA 4JB0A 1E6EA 1WQ3A 4NU6A 3RQIA 3RV4A 3OSUA 3DAOA 4DA8A 3FVTA 4DMFA 1G4HA 3BHIA 4ZMSA 1XJ5A 3OETA 5CDFA 3GD7A 5T7BA 1F8GA 1K7SN 4HDOB 4O4HA 2IZ1A 2W2PA 3GRKA 1VFPA 1I14A 1ZC3A 3L8MA 2OCGA 2QGNA 3E22B 3GPDG 4J0EA 4H6XA 4Q7KA 1KH1A 3M3DA 2QT1A 3QA9A 3NKVA 1D6NA 2JIMA 4RTQA 5JCJD 3LP8A 1EK2A 3RS7A 2EEPA 3S1LA 2D59A 4A03A 1IVSA 3B3JA 1CPYA 4IGKA 2D5AA 1W7AA 3VR2D 3HWWA 1M34E 4IOKA 1DO2A 4TPKA 2ROQA 5G1PA 3ITEA 5J5VA 3WIBA 3ZZ1A 2FZGA 4BC0A 2PKCA 1SOVA 4C4RA 4C0KA 5ES3A 1OT5A 4BX8A 3N70A 5ARCA 1PZFA 2OORA 3BA1A 3SR3A 1N5MA 4A8JC 3RVOA 4DILA 4A7PA 2TRSB 1M34B 5D3KA 1AZTA 1O7JA 5TQVA 1QFJA 3ZZUA 4EBBA 2QN1A 4TTJA 3I0ZA 3KWJA 4Y1RA 5JW6A 5DULA 1H3FA 4J0HA 1CW2B 1W1IA 2JH8A 2HA0A 4E5SA 4GWKA 4MKZA 2GN1A 2HIHA 2O23A 4ETNA 4B47A 1NP6A 4GUDA 1Q7TA 2O3JA 2IPAB 4UNPA 1TT5A 3FPSA 4KK4A 5CFZA 1JJBA 4MUGA 4EEKA 4OUKX 2I7VA 2G7ZA 1XWFA 4PTZA 3WLAA 3F8WA 4BVJA 4F0JA 4A8PA 5CLJA 2RSLA 2ZBVA 2F67A 1IPEA 1E18A 1X77A 3AVQA 1LPNA 5GJCA 4LK3A 1G2OA 1A72A 3GFGA 5JMOA 1TJ5A 1BDJA 1JXOA 2IGTA 2WOOA 4N54A 5D5QA 4DCTA 2XHEA 2VAPA 1UT8A 4DQUA 3ZZMA 5K8TA 2OO5A 1WMEA 1AURA 4BFSA 7ADHA 1HA3A 3NV7A 1ZK4A 2VQ3A 2NAPA 1M83A 2P90A 4P54A 3S68A 2FXVA 4CCYB 3H99A 5CB4A 3H8JA 1E3WA 2QYHA 5GZ3A 4NYIQ 4DDVA 1H9AA 4R8MA 2MU1A 3NRBA 5D3MA 2H11A 2WJWA 2ZBEA 3WGJA 4YCSA 4AY6A 2PLNA 3NOOA 2QUIA 4GHWA 5I7AA 3AFGA 2BFEB 3O8LA 4JITA 4N49A 3FOAA 5LBIA 5BQPA 1LSSA 1Y3DE 3EQ7A 4IJ6A 3GUZA 4Q37A 5FBRB 3STXA 2J3IA 1WY7A 2FEOA 4QFBA 1BMFA 2YWDA 4WCFC 3V9AA 4C05A 4KQHA 1N32B 1U8ZA 1R16A 2I3ZA 3MVEA 3W3AH 1SA0A 4JJ8A 4QHYA 1TU0A 5FPSA 2VJMA 3HADA 2R9VA 3X1WA 2ADOA 4BLQA 4RC9A 4Q4HA 3JV7A 3SC2B 4J76A 1QGOA 3HBFA 1JDUA 1L3CA 1Y63A 5FV7A 1II8A 1BSVA 3JTEA 2X0FA 3ZWYA 1G2PA 4EHIA 4CE6A 4WL0A 4YMGA 1PFWA 3QI2A 4ZN6A 2LTAA 3C98A 4G41A 3VBEA 3KJFA 1FTQA 2GAAA 3ZQ4A 5A6VA 3WGZA 3EPJA 5KVAA 1UT5A 4AECA 2VOEA 1NX9A 2PYZA 2Z95A 1NXWA 1X8XA 2E4VA 5EQTA 3W0LB 4DC1A 4FN5A 3JAMA 3GEDA 4HAIA 4DJEC 3AR6A 1R8JA 2FW9A 3EMKA 4JUDX 2QX9A 5DK6A 3ZPXA 5B1DA 4B4DA 4YRIA 2JBAA 3F67A 3A4NA 1NLUA 4AJ4A 1ZHHA 1QYVA 5FEUA 1DAPA 1HORA 1RQXA 5DEOA 5AW1A 3P32A 1LQ2A 3N2YA 3V5NA 4OIFA 5JWOA 1ZKMA 1VFNA 3ICCA 2OK8A 1WU7A 4O8ZA 1HRKA 4EFNA 4QT4A 5HS4A 4UBIA 2DYKA 2J31A 5IU6A 5FPKA 4Q48A 2A9OA 4HDRB 1BOFA 4XVHA 5DLEA 4B3XA 5JYCA 2Y9PB 1EB8A 2Z6VA 5L3VA 4MWSA 3CS3A 4JGIA 3D02A 1IM2A 4K0RA 4RM3A 4Z7QB 1H8EA 3E9RA 3SZUA 4ZKEA 1A9TA 1UDXA 3PFFA 3QY0A 3E58A 2G88A 2PSJA 4I9HA 4TUYA 5DLYA 4YV1A 1LY1A 3UG7A 3FX2A 3A3YA 5C18A 4LGCA 1NW9B 2XDYA 3P0HA 5IT4A 1QQAA 1L8LA 1VE9A 2PRKA 1TYEB 5B3JC 2ZRJA 3MWYW 5INTA 3DCJA 2CK3A 1B2LA 3LBAA 4JZKA 3ZWXA 1CNEA 2Y3IA 2EG5A 4C0LA 4OOEA 1ESDA 2J67A 4GAEA 1S96A 1YKSA 4CQMA 3O1HB 5GIOE 1HOXA 2V7GA 4JJEA 4KWIA 3H9QA 5JBNA 1CU1A 3D64A 1OJ7A 5L7YA 3AF2A 4Q4JB 3G8BA 4H7IA 2XLCA 3CRMA 2IV7A 3LFUA 1PK9A 1EFPA 1SU7A 1A1SA 2AXPA 2G5GX 3KHSA 1C4KA 4OHZA 3D3QA 3WK9A 1PR3A 5JNVA 2V45A 3T7IA 3UQYS 3RSFA 3TB4A 1G9XA 5I7SA 2AR0A 221PA 3A1DA 1YU9A 3CKYA 2H5LA 3SZMA 5EXSA 3TX2A 4UNRA 5I8WA 4RA6B 6REQB 2VSXA 1LVGA 2ECFA 5J4VA 5BSRA 3CLSD 2IVZA 3KSDO 1M5UA 5AVKA 5BQOA 4DIEA 4OF4A 3H19A 1N6NA 1FUEA 2JZNA 3L9XA 3QKIA 4JQZA 1GTSA 4EO7A 1XT6A 3IRUA 2W6QA 4HEA6 2D5BA 1O94A 1O0SA 1E1RD 1JSRA 2E7ZA 3RK1A 1I4DD 1IPHA 2GBLA 2ODWA 3LGSA 4RKQA 1YU6A 1U2RA 1UBJS 1KKMA 2D4AA 2P1RA 3IALA 3IVMA 3JWJA 3RVQA 3E3LA 2J46A 1GPLA 2J48A 4E5KA 4XTRA 2VZEA 4MVJH 4JBHA 2ZRNA 1NG1A 5CTJA 1Y1QA 4CFZA 4IMIB 5ALFA 5EJ4A 4IGIA 3RSZA 1FNNA 1RAIA 1A5SB 2C8VA 1L5VA 5L6MB 3H2KA 3IIKA 4CT5A 1T1IA 1TFUA 1NN5A 2VNSA 2C9YA 4FGLA 2PGLA 3IEVA 3WLEA 4DUYB 2GEUA 4ITRC 4L8YA 5EMMA 4LECA 4MROA 5ESRA 1EXVA 3AZOA 4LC9A 3ETCA 1T9GS 3TLGB 1F8FA 3L41A 2GCOA 4F3YA 3DBHB 1TM5E 3NWOA 1YKGA 3GYBA 4QIHA 3RYHB 1QCYA 2OC4A 5LLSA 3TS1A 3U3KA 4YTEA 4H9GA 2ZWPA 1VBNA 3MJVA 4MV8A 2H7YA 1F4VA 4US1R 2QSYA 5B53A 4OFWA 4E70A 3LKVA 1H6BA 4ZHSA 6NULA 2ZSIA 2OEPA 3E82A 3LQQA 2FF5A 1TCVA 3W7AA 1P5HA 3VJKA 5FD8A 5CDFE 1L4GA 3GDOA 3ZD7A 3ZY6A 1E1QA 4XQ9A 1DXQA 3AO0B 1QU2A 1T8SA 2OQIA 4NPHA 2OYRA 3O4HA 1QO9A 1Z5VA 3GHYA 3NM5A 4U1RA 5I7RA 4MA4A 2WNSA 1LDYA 1P7PA 3OM1A 3R5XA 2UYGA 1Z9BA 4NYMQ 3PD0A 3JATA 4IFBA 4LOHA 1PDWA 1X70A 4O4HB 4G67A 3OD1A 5KZMB 1SBQA 1T3TA 2WDPA 2RGUA 5GPBA 2ZJ7A 3ZZ0A 5H3LA 1YQGA 3RNOA 2JDIA 1SQ0A 3P2EA 1XHEA 4RANA 1B41A 1WDTA 3IR5A 4GYKA 4NR0A 1MBZA 3HTXA 1VE3A 1VL1A 1L4NA 3T3IA 2VT2A 3UH0A 4OHBA 1Z0SA 1ZO8A 2JI4A 2XCUA 5SYMA 4G5YA 1NUTA 3WNVA 1QKIA 5LQCA 3CVXA 5H02A 3Q4GA 4HI0E 2O07A 3BWDD 3RIXA 4DYDA 4F9TA 4ZQHA 4IVNA 5CJ2A 3U7RA 4AP6A 3JQGA 2P2ZA 4Y1RB 2E18A 3LMKA 1JFFA 1CV2A 3MMZA 4KDFA 1N6PA 3T7CA 2JJ1D 3M1YA 4GLBA 4B32A 4UTPA 1MA3A 2X8BA 1SKQA 1XU7A 1TT5B 1WZCA 3FFBA 4HGOA 3UC9A 3UA4A 1PYGA 3KRTA 1XQYA 1CEEA 2QEQA 4Q1CA 3TIGA 1V16A 1U02A 3Q9LA 4OKSA 4DHWA 4ARCA 2Z2IA 3NB0A 5H82A 1T25A 1WMBA 1V9SA 5JUWA 1FRFS 3FPGA 2W2XA 3CWCA 1Y1PA 2APJA 3F6BX 1J07A 2FSSA 2PS3A 1EUYA 4AJEA 4DV6B 1EMDA 3RTGA 1GPMA 4CKEA 3LH5A 2PUEA 5E2IA 1JI0A 1W35A 1Y3IA 4O4HF 4N0PA 4OQPA 4DCCA 4JJIA 3M6FA 4HN9A 1RRVA 2VH2A 4YRKA 1ATZA 4WY5A 5KMGA 5CB4B 4QU0A 1NT4A 4GXRA 1MRSA 3A6JA 1MX5A 3GX1A 3DHNA 3DONA 3PC6A 1BQ4A 5D3MB 4EM6A 2ZXUA 2FZCA 4AZSA 4BN4A 1RRGA 4JEUA 1SJ9A 3BF8A 2NZYA 3EQ9A 1JEDA 1KI1A 1G41A 4X0EA 4YHHB 3Q88A 2CXRA 2FUG1 3VAYA 1BE1A 4CLOA 5KNBA 3H2IA 2VDPB 4G1MB 4GW3A 4IZ6A 3DWEX 3EZYA 4GI3A 4UBLA 1BZYA 2CHUA 1VCHA 1SA0B 4G8JA 2G9UA 5CVEA 2RGNA 1CY6A 2VJMB 2SKDA 3JQBA 1GFWA 4IKPA 4Q4HB 2J3DA 2NVBA 4LTMA 2IDKA 1L5YA 3SJBA 4JQSA 1WUHS 1II8B 1RXEA 1G16A 3CZMA 5C7YA 1GG8A 1MOQA 1HQKA 1U3GA 3MT7A 1Q7EA 1M2KA 2XDAA 3E27A 3ENNA 3KEFA 3CONA 4LJ6A 4KFCA 2H7XA 4NBKA 1RAEA 3WTCA 2PZMA 1UADA 2P3SA 2JGNA 2YV3A 1UMBA 4I1UA 3KHKA 5KSPA 2WY2D 2E4AA 2Y2VA 3WKEA 1R0WA 4D9MA 1OZGA 1JNYA 2IKQA 5JSFA 4IJMA 4JIMA 1DTWA 1ZHFA 4BGUA 3ICWA 1YS6A 4K86A 4P3XA 1O95A 3GEHA 1N0HA 4L8WB 4RIEA 5CB4F 1O57A 4HQOA 5BN4A 4HJRA 1J8VA 2EKDA 1J23A 4YQZA 3W7VA 3KTDA 1IYZA 3NTXA 4IIXA 3VNSA 3ZVRA 8ABPA 2W93A 3K4QA 4X61A 3AFOA 5T8KC 3N2KA 4KIJA 4R8VA 4XR4A 4Y2HA 4BRUA 2D06A 2NU7A 2IXGA 2V7EA 4RCYA 1RMTA 4MUYA 3ZWMA 5HUQA 5IWCA 3OCUA 1ND5A 2ASVA 5E6SA 1K9VF 5B2FA 4Z4QA 1GZ6A 1O6FA 1TMGE 2WD8A 1RACA 1PJLA 2P2CA 1E3QA 1QKKA 3F4LA 4TUYB 3DOFA 3WLLA 5JXIA 2ORYA 2YKGA 4DJTA 1UQUA 1W6RA 2JFFA 4G5XA 4I3HA 4ZALA 3OCCA 1FY2A 1J4AA 2Y66A 2DFTA 1EK1A 1N4DA 2ZS8A 1ORDA 5EPOA 1GZUA 5FUBA 3F5FA 1DTEA 3PJRA 2YFKA 3LYUA 5HCNA 1DADA 5T4FA 1ZCZA 2FCRA 5IVDA 3UHAA 1FNSA 1W581 3SMQA 3JYNA 4KFUA 4KOAA 1YNSA 4CQMB 1EYZA 1DUSA 2VL7A 1WHTA 1XVIA 1KS9A 3EEIA 4LVOA 2CLSA 5TC4A 3A6EA 2RBGA 1HDEA 3LIIA 4RORA 2OBYA 1EFPB 1C4WA 4HNTA 2J7PD 1U8EA 1I13A 1ZXLA 4W9MC 3FR7A 4GE3A 1GNSA 2JAXA 3FPLA 3K6RA 2OBMA 3G89A 4G0NA 4AQ7A 1GFIA 3KKLA 4MIKA 5NULA 1Z68A 4AJ9A 5FADA 3ETNA 4ER6A 4GOOD 4K9QA 2J32A 3MGAA 2XNDD 4RTMA 4JUCA 3KQKA 2Y1EA 2HK6A 3P2MA 3R8XA 4D45A 1XELA 4FVTA 1KC1A 4J7UA 5CA1A 1JLSA 1WXDA 3MJEA 1YHZA 3MTJA 4HNSA 4EQZA 2PBFA 1JJ7A 2B83A 1W4CA 2PD3A 4LDNA 2Z43A 1CQJA 1E5LA 1G7SA 3C3YA 4OD0A 1FMFA 1ZSYA 1Z45A 4MGKR 4TUYF 4QHTA 1G1AA 2HRBA 3QVWA 4MYSA 4WNIA 5H59A 4IEEA 3TGPA 1F7VA 1X42A 1QOZA 5IVHA 3AWIA 5LM3A 1DCMA 4JL8A 4ALNA 1I36A 1QPGA 4W9RA 2CFTA 3QYFA 1NDHA 2PUCA 2O05A 4KHZA 5BSKA 4YDQA 4I9GA 1KWKA 3A6LA 3LWBA 3MZ0A 4BVLA 2VUIB 4QVGA 2GJ4A 4W82A 2XDQA 1OZAA 3VZDA 1CYEA 2GCOB 1T3SA 2WD9A 2B78A 1XRLA 2C42A 2A8YA 2EW2A 2H1FA 2Z4TA 3H97A 2AH5A 1GAWA 3GUVA 1AHNA 3W8FA 3WY9A 3ZWDA 3KXKA 1R6AA 2GZRA 3DBOB 3WL7A 2C4TA 2JVJA 1I24A 1J5XA 1OFTA 2EFJA 3DB2A 1T6XA 3ACDA 3L1HA 2R47A 2QV0A 4Y6QA 3RFVA 4G5RA 1C3EA 3GNQA 4J9VA 3GC6A 5L7TA 2X6TA 2EJCA 4XLLA 1Z2AA 1RIFA 3D1LA 3IOEA 1GTVA 4C4TA 5CB8A 2F9MA 2WZCA 1M72A 1PHPA 3WKAA 3NQ41 2JFBA 3ZY3A 2GUWA 721PA 1FJGB 2A9PA 4C76A 1AC5A 4NI5A 1T15A 3JATB 1P2TA 3QFCA 1H2RS 1P3JA 4N39A 3J80A 1NUSA 2NUBA 3I01A 4MB0A 1EFHA 1UBRS 2XT6A 3CUYA 3PICA 5BR1A 1CKEA 1ULSA 2C83A 2DFDA 4OTZA 5K8VA 3RUDA 3BCRA 2GCGA 2ZE5A 3BXPA 3O0TA 1NTRA 3R41A 2PNJA 1VSUA 4MGEA 2B4QA 1F6DA 1GG5A 4FE3A 3FRHA 1GKKA 1JI3A 3LC0A 3IAS1 4U7GA 3DBLA 3DXFA 4BYMA 4RFLA 3E9YA 1Y8AA 3TLAA 4ZCIA 3OTOB 1KAMA 1S2OA 4J2OA 4WESA 5ULLA 4FFRA 3SYRA 4HGQA 4EBFA 5HJ7A 5LIPA 4DSUA 5L3RA 2HFJA 1OX5A 2B9EA 3C6BA 3HUDA 3JQGB 1TZJA 3PD1A 4GLOA 1JFFB 3KVRA 2RGAA 4RIIA 2E9SA 2RC5A 3U7JA 4WTOA 1T36A 1Z37A 4Q01A 2OMKA 4IIYA 4YRJA 3WDSA 4HVLA 1ZA1A 2UZAA 3KAJA 1Z4QA 2J85A 4B17A 4YMWA 4ZXFA 1E5VA 1V16B 3DYBA 3QHAA 2A4KA 2I87A 4KVAA 4MB6A 4JP8A 5FTWA 4J1GA 4XQEA 2BM0A 3GLFA 2AS0A 4PZZA 5JRJA 3CEJA 2QPLA 2VYFA 1CX9B 2YMPA 1RXYA 3I1YA 4L78A 4LC1A 4FXOA 1ZCJA 4R9NA 3AW8A 3DTNA 2VK1A 4FYWA 3KQMA 2VWGA 3DEZA 4CKEB 3DE7X 2EGUA 4CGZA 2E89A 2ILTA 1PS0A 3I4CA 1US8A 1LK7A 3TECE 3EAFA 3ER9A 4QDZA 4WY2A 1IC6A 3R77A 1EKXA 4F4JA 3HZZA 2DWOA 1QQ5A 4Q9NA 1PV1A 3RVBA 1P18A 3K53A 5KMGB 4C0SA 2I91A 1XK7A 1G5PA 1Z33A 1J5PA 1PWXA 1XNRB 3W5AA 1MJNA 5C1PA 4YRQA 3LE8A 3DGFC 4HFRA 1AGYA 2MDTA 3ABIA 1OKKD 5AJYA 1FDSA 4REQA 5TQJA 1M10A 2ZJ2A 4EGCB 5IDXA 4CLOB 3E5MA 1XYVA 3GRZA 2WFLA 4HBGA 4C5CA 4EELA 4PAWA 3RV3A 4DWJA 2DX7A 3H7IA 3KJGA 3DLAA 4FE7A 2FPOA 1IY2A 4U9UA 1E1MA 1RJGA 5C51B 1F0YA 1QF9A 6LDHA 3SX2A 1BRMA 3B13B 2BEWA 1ORHA 3EVDA 2H59A 1KPGA 9ABPA 3BGIA 3R4VA 1G5TA 4MGIR 1AE1A 1EEHA 4PBRA 2WM9B 2K6GA 4XIIA 4R1PA 1SHUX 1ADYA 3X43A 2IUEA 4PGHA 4CG2A 4ENSA 3GVCA 3TOXA 3G3EA 3K09A 2NPOA 2I54A 1DQRA 1R66A 5BNZA 4FWBA 4YT8A 3GJ8A 4O4JA 3RUHA 3JTMA 3OEEA 1PBNA 4NABA 3TGLA 2B9VA 1UMBB 1COWA 1OLOA 2NUAA 2H2FA 1TYBE 2QP4A 1F9EA 3ECSA 4MQ5A 4NOKA 1L7BA 4DY4A 4B3BA 4PQEA 1ITZA 1XZHA 5BRNA 2HSZA 1DTWB 1C7RA 1K8RA 3KOXA 5F33A 2J6CA 1KE1A 3Q5DA 5JQGB 5BN4B 2DAPA 2JJ2A 4JR0A 4S04A 2ONYA 4PONA 2HA7A 2JLCA 3O91A 5DF1A 2B7LA 4ESOA 3F8TA 1MNAA 4AO8A 1WKBA 3AW9A 4JR2A 1NM5A 3NYQA 1SU4A 4A4DA 1UZMA 3HSKA 4DCNA 2FJUA 2NU7B 1UODA 3DXYA 4EZBA 5E6SB 5HG0A 4Z4FA 2YXPX 4QUIA 3TZLA 3OZWA 2WYWA 4D5GA 3HJHA 3NXSA 4X97A 3FMIA 2FSVA 1BRTA 4GOMD 1XMPA 4PO3X 4IG9A 5CVDA 5C4IA 2BGNA 2YBEA 3RJMA 2HT6A 1ZAKA 3ROMA 4QO8A 3ZJUA 4F96A 5KVSA 3EXHC 1N34B 3AG5A 1XNHA 3O21A 2W2MA 4LDRA 3Q3JB 4H77A 1CUFA 1MCZA 3G9UA 2YVKA 3MWLA 3WFIA 4OMDA 4EW1A 1HTBA 1PI3A 1E5QA 1YGYA 2ZWOA 1CUDA 3OE4A 2B5WA 1VBMA 5TPZA 3QVGA 1ZUHA 1JRLA 1CHDA 1P45A 1WHTB 4A0SA 3AHHA 3EIXA 1XBTA 5LLDA 3COJA 4AKTA 1ZJ6A 4PPGA 1TAHA 3DYIA 2ZR7A 1PJ4A 2D2IA 4LY0A 3QF4A 3D43A 3RE1A 4BQFA 2M98A 3WWEA 3J81k 2X4LA 1PEKE 4OHCA 3LCCA 4F4IA 2KBFA 4UUMA 4PTLA 1N5JA 3B6MA 3H9BA 5JQGF 4QGAA 1Z4IA 4OAQA 3RAGA 1VKJA 4RABA 3UTDA 3E0XA 2GF2A 1EAYA 3AC0A 2YWJA 4UD6A 1C1YA 5D5HA 1R00A 3GJZA 3OZ7A 4L50A 3TL6A 3V1LA 5CA1B 4M89A 4YMIA 1CR1A 2BFFA 1BVHA 5P21A 1CQJB 2J0EA 1MOSA 2C5LA 1NYQA 4MW1A 2JI8A 5HW0A 2K7FA 4B2IA 2WE8A 4WNYA 1ZOPA 4LYEA 4W7IA 1Y4ZA 2W2VA 3S29A 4H1WA 4N82A 1NQWA 4F04A 4C88A 4Q4AA 5JD5A 2J7KA 4WASA 5EJIA 2G5TA 4L08A 1ADJA 1SIOA 1XMXA 2PZLA 5CXQA 4FIDA 3I1IA 3DKVA 4N1AA 4URVR 2DFNA 1E6WA 4RS4A 3ETHA 4EIWA 4OHYA 3CCBA 3L4SO 3H9GA 2D0OB 4J16A 2BDEA 4F46A 2WKPA 1RAAA 4RDIA 1BQEA 4A92A 2PD6A 5KTSA 4TMXA 3NEJA 5ADWA 2XDQB 4DREA 2R87A 1UJMA 2EFCB 2HSGA 3BORA 2Q7OE 2PZAA 3N59A 4BVGA 4E4RA 3UJ9A 1JQJC 4CU2A 3IR7A 3FWYA 1T13A 5BUZA 1ZZGA 3I64A 5FBHA 2W8ZA 1SRQA 1ECPA 5THQA 3ZJYA 4H16A 1L8QA 3A10A 1Z39A 2FSGA 2WILA 3U3MA 4BFWA 2IZZA 1KO5A 3K2IA 1YULA 1ZP6A 1ZGBA 2PMCA 1IPFA 3G6KA 4M38A 4WOKA 1VXOA 4FSHA 4MCAA 5CA1F 5B4TA 1EA7A 2IUTA 5F77A 3PPWA 3V4OA 1UBUS 2ZT8A 1LSUA 3SF0A 4BRZA 1C9EA 5T41A 4HDNA 4IDPA 4QGGA 3I5XA 3X1MA 3C87A 3I3OA 4N0MA 1SFRA 3SC4A 3VM6A 5JAZA 3GEGA 4Z3DA 2XNKA 3WR5A 1AGPA 1FX1A 1PSDA 1FDWA 2G0TA 2XBMA 1K9SA 5CFQA 2P0EA 2Q3BA 2IZ5A 2L69A 3PITA 2Q3FA 2F48A 3I09A 4HX9A 2CF5A 5LQRA 3D8NA 4KGDA 4KUGA 4PU0A 5B36A 3GCDA 2V3CC 4LJRA 4MVYA 1FMTA 2PRSA 121PA 1RBMA 3JD0A 4OQFA 2D1QA 4HQNA 1OA0A 3DBLB 2PSEA 1QG6A 1JHXA 1UK6A 4QQNA 3KT6A 4WESB 3L7NA 2QMZA 3OTHA 3L1VA 1KSJA 3Q0EA 3U49A 4D82A 3QTLA 1EP9A 3DVSX 2F8TA 3ENKA 1L5ZA 1ZD8A 5M3BA 2HRZA 4U02A 3QNMA 4MUEA 3GLFE 2KBEA 4HQFA 4M2LA 4Q1DA 1T36B 2OUIA 5CIQA 1Y3FE 3CCCA 4G1CA 4DA6A 2BVNA 3GLUA 1CHNA 4PYOA 1JQ3A 2RIPA 3B8EA 1EXWA 1A7AA 4ITVA 5AOCA 4ZQFA 1SB9A 3GLFB 3E4DA 1ZN8A 3MLEA 1REQA 4JD5A 4C4SA 3PGA1 3PRHA 3VC1A 1AQUA 4JZYA 3CJTA 4W63A 5KPDA 1JHPA 2HUPA 2B61A 2L18A 4H17A 1E59A