3ICPA

Crystal structure of udp-galactose 4-epimerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
295
Chain Sequence
b'MRIVVTGGAGFIGSHLVDKLVELGYEVVVVDNLSSGRREFVNPSAELHVRDLKDYSWGAGIKGDVVFHFAANPEVRLSTTEPIVHFNENVVATFNVLEWARQTGVRTVVFASSSTVYGDADVIPTPEEEPYKPISVYGAAKAAGEVMCATYARLFGVRCLAVRYANVVGPRLRHGVIYDFIMKLRRNPNVLEQRKSYLYVRDAVEATLAAWKKFEEMDAPFLALNVGNVDAVRVLDIAQIVAEVLGLRPEIRLVGDVKYMTLAVTKLMKLTGWRPTMTSAEAVKKTAEDLAKELW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent epimerase/dehydratase
molecule tags Isomerase
source organism Pyrobaculum calidifontis
publication title Crystal Structure of UDP-galactose 4-epimerase
rcsb
total genus 106
structure length 295
sequence length 311
ec nomenclature
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3icpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3icpA02
4GVLA 2X9VA 2PK3A 4WJZA 4NK5A 4J43A 4DWVA 4A26A 3U49A 3TZ6A 4Y8VA 2IXAA 1VSVA 4Y6PA 3P19A 4U7WA 2IYPA 1ADGA 4O6VA 2OOSA 1B7GO 1B3BA 1K0UA 1I2BA 1ZK1A 2B4RO 3Q2KA 1XELA 1JKIA 4I9NA 4CR8A 2J3KA 4P38A 3L9XA 2P4QA 1YB1A 1E7RA 1U3UA 4IPTA 3WNQA 1AXGA 1YB4A 3W6ZA 4FR5A 3QVOA 2VUUA 3QWHA 3FTPA 3I4CA 1F17A 1H9BA 3DL2A 2DU8A 4W4TA 3IIEA 3FR8A 3EMKA 3A9WA 3T4EA 3EDMA 1I3NA 4J9UE 4BO6A 1YDWA 4FFOA 4OXKA 4L74A 5JS6A 5HM8A 3PLRA 2EG9A 5EINA 5DP1A 1GZ3A 4HFNA 4DQVA 1BVUA 3O03A 1QG6A 2QX7A 1H2HA 2WYWA 1ULSA 1W6UA 4JIGA 1ADCA 3LC2O 2WE7A 3AI2A 2EXXA 3GFGA 1HDRA 3QJ5A 4IGFA 1OI7A 1JN0A 4F3YA 1IE3A 1BVRA 4CM7A 4P4NA 4NQZA 2NVBA 4CJXA 1XEAA 2EP5A 2G76A 2GCGA 3FCOA 1U9JA 2EKQA 3OJOA 4IBOA 5EESA 4B4WA 5FI3A 3LVFO 1MGOA 1E7MA 4YRBA 1QR6A 1R6DA 4R5HA 2PY6A 4FDAA 1LLUA 3ROKA 1JW9B 2Y1EA 1PSDA 4Q3BA 4OOFA 5JXWA 3NDRA 3IKTA 5DBIA 4EJ6A 3L6DA 1C1XA 1DO8A 1UXHA 2G5CA 1BW9A 5B37A 5LC1A 2X9GA 2H6EA 1CQJA 3NTQA 1QYCA 4YJFA 5ER6A 5ES3A 2HMWA 4RV9A 3RC2A 1Z82A 1W8DA 1KVQA 4CV3A 4DQUA 4R1NA 4ZN6A 4XGIA 1YE3A 4L73A 3B1KA 2P5UA 4HKTA 5MGBA 3AJRA 4QEDA 1E3WA 3M1LA 3LC7O 2AHRA 2CMDA 2I66A 1R16A 4L9RA 4BOYA 4IDCA 4N18A 4PLFA 5L3ZA 4RDIA 3VAZA 1PS0A 2C82A 4QO7A 4W7IA 4E5PA 1KETA 2G1UA 5TGDA 4RZIA 2HMTA 3MJEA 4FFPA 4MP3A 1P44A 4Z3DA 4D41A 3TPCA 4YRAA 1I01A 2J5RA 2X5KO 5C7LO 3BTUA 3PWKA 1WPQA 4BKOA 1MP0A 1NNUA 1R37A 3CH6A 4MPDA 4DVJA 1X0VA 1P1JA 1L1FA 4TRJA 3COSA 3ASUA 4TSKA 4YJHA 5ADHA 1ZBQA 1JU9A 1G0NA 4M89A 1U4SA 3KLPX 3HFGA 2QQ5A 4BNGA 5BNTA 3LDHA 2P2SA 1A7AA 2ZB4A 3U0BA 4M54A 1XYGA 3INTA 3HWRA 2VZ0A 1V8BA 2O3JA 3ANNA 2WSBA 3GMSA 3OIGA 5KVSA 1TT5B 1PJCA 4XRRA 2CNBA 2P5YA 4EZBA 5JAIA 4WLUA 3A14A 1DC5A 4R1UA 3GFBA 4ALLA 3F1LA 4RVHA 7MDHA 4TRMA 2ZJ1A 1Y6JA 5COAA 4O1MA 3ZHYA 2NNLD 4FOSA 4XGNA 1KVTA 3GVIA 3H9JA 3NUGA 1NR1A 4IY1A 4NJMA 3IQDB 2IRWA 1MXHA 1WDMA 2D0IA 2D5AA 2E4AA 4CV2A 5TX7A 1UUFA 3D64A 2B5WA 3O8QA 5THKA 5BSEA 1WMBA 3U5TA 4H16A 5F21A 3JQAA 3JD4A 4OSOA 3U62A 4BO5A 3TZQA 1P0CA 2O7SA 2OMEA 4J1QA 5AXBA 4CMAA 4OKIA 4D43A 2WYVA 1ENYA 2WE8A 2YHIB 5I9LA 4MO2A 3PEFA 2DAPA 1I10A 4LRTB 1E5LA 1T2FA 3GG2A 4GSKA 1DC6A 3ZU2A 3LSYA 1A5ZA 1NX6A 2IODA 3P5SA 4XA8A 5GY7A 3RC9A 4DMMA 3ZZNA 3INGA 2Z95A 3PK0A 4RL6A 2VN8A 3JQGA 4I1IA 4CM3A 3VPXA 1I2ZA 1ZCJA 3W8FA 4PZEA 1LC0A 1H93A 2ZJ0A 1Y5MA 2PA3A 1CF2O 5ER9A 1LSUA 1GUYA 5JMPA 2WM3A 4RCVA 2CVQA 4CR7A 4XIJA 2FWMX 3LLVA 5FFFA 1X15A 1BRMA 1DRWA 1CETA 2ZYGA 3UH1A 4Q3AA 1XCBA 3VHRA 4XWYA 2VYVA 4PZCA 4QFCA 2NWQA 4TKMA 4FIZA 3NT2A 8ADHA 4OM8A 1EMDA 3DZJA 5JAZA 4WEOA 3UCEA 3RUFA 5I7EA 1P1RA 5L53A 5IDYA 5EQDA 3AU8A 1JA9A 3V2GA 1RM5A 1XR3A 2AE1A 3OHSX 3BTVA 3G1UA 3NYWA 1WZIA 3RJ9A 1M66A 4CLDA 5L4SA 3GN2A 3ONDA 2JAHA 1P0FA 4KWHA 2IYOA 1VJTA 2AXQA 3WYBA 1IPFA 3EYWA 4OMUA 3ZNOA 3WWZA 1HT0A 5B1YA 4NBVA 1ZW1A 4CMIA 3KLMX 1DFGA 3CTMA 4RF2A 1D4FA 1T2CA 3ITDA 3H65A 3LU1A 4LRSB 3V2HA 4KQWA 3HG7A 5JFOA 1HLDA 2DFDA 1ZK4A 1VRWA 1XSEA 1O5IA 3TFQA 2VOJA 1D8AA 4NBRA 3H9GA 1ENZA 1WW8A 4CLRB 3WGQA 4D7AA 3JQBC 2X58A 3AOEC 2HRBA 4E3ZA 3A1NA 2B5VA 4CM9A 3JQGB 4MP8A 4CQMD 4BO3A 3EZYA 3I83A 5A9RA 3HB5X 4M87A 4CM8B 1X7DA 2PWZA 2AEJA 2HMSA 3Q9NA 3IL2A 2OHXA 5IDWA 2R6JA 4FB5A 4UUMA 1HDZA 1ZUD1 2OP0A 3VH3A 5DCWA 3C1AA 3DZHA 3DZFA 5A03A 5CEFA 2HK8A 1IHYA 1ISJA 2VHZA 1PJ2A 2DBZA 2EGHA 2Y1CA 4U8GA 1C0IA 5JAQA 3JQFC 1RM0A 5COBA 3MTJA 4AJJA 3S1LA 4IINA 1KBZA 1R4NB 2GR9A 2FR8A 4YJDA 2FZWA 2I65A 3IJPA 1E6UA 1SPXA 4I9UA 1YBAA 5JMWA 2Y66A 3LT0A 3DEYX 3GVXA 3CPSA 1NTOA 3BZUA 1FDUA 3H5NA 4QSMA 3H9EO 4WECA 2VOEA 4XEHA 3GMDA 3NRCA 4J2HA 2A35A 3KYCA 4R16A 4Y98A 2R00C 4RGBA 4OOEA 4CR6A 1UP4A 5C3MA 1I32A 4WEQA 1GCUA 3GEGA 2AQHA 1EQUA 5G0SA 1GAEO 3I9KA 4R9SA 1JKJA 2O2SA 4IDBA 1J4AA 1E6WA 1C3VA 4MIEA 2TMGA 2VRCD 3ZWPA 2XAAA 1GV1A 2V6GA 4S3MA 2D1YA 4FFRA 3WFIA 2FR0A 5LDGA 3ZWMA 1PJTA 4OHUA 4R01A 2AQKA 2I5PO 2OORA 3D3EA 5G0VA 1E3WB 2RH4A 3DOJA 1T4BA 2DT5A 1SAYA 3E9QA 4JJIA 2R2GA 3O38A 4CUKA 4RPHA 5B4TA 5IN5A 4YJGA 3VPFA 3SC4A 1U2GA 5ICMA 3DZBA 2D59A 5BQFA 4R9RA 3KETA 4GX2A 1FXSA 5J23A 4BMSA 3TZHA 4F45A 3P2OA 3DBLB 1BHSA 1P77A 3F4BA 4IDDA 4U0KA 4AJNA 3ZW9A 3DZIA 3GZ4A 1HEUA 3WB9A 4G65A 2Y0CA 3E18A 2J3JA 4I9HA 4KZPA 2B69A 4P4GA 1ZK0A 4JQCA 3RUIA 3W4IA 3WQRA 5CDSA 5K6AA 2VYNA 1ULUA 2HK9A 1F8GA 1S7CA 3VZSA 1E1NA 3GEDA 1NPYA 3DMYA 3ZWBA 5HA5A 3AFMA 2PZKA 5DF1A 4CQLA 3WGYA 3QV1A 3I4FA 2VHXA 3RWBA 4D0SA 1GPDG 4FJ2A 1HDOA 4BNYA 5AXAA 3JTMA 4WPGA 1DC4A 1FDSA 2CF5A 4I5FA 1IPEA 2CDAA 3OETA 4IJWA 3E5MA 3GGOA 4CLHA 2FP4A 4E5KA 5KJFA 3VTZA 1DFHA 4FOOA 5I8ZA 3PHJA 4LCEA 4PLYA 3AY3A 4FSHA 2CDBA 3BMNB 3G79A 5MDHA 3MOIA 4BQPA 4D42A 3ZWWA 3VH1A 2I6TA 5A9TA 1WP4A 1EBFA 1NHGA 4GMGA 3R3SA 4R4JA 1I30A 3C1TA 3TL2A 5A5EA 1HZJA 1I24A 4WE3A 3RUCA 4ALMA 4BIIA 5TIIA 1M76A 4AJ1A 1XWFA 5KKCA 1YVEI 4HWKA 4DA9A 1K3TA 3K31A 2WEKA 1KYQA 1PGOA 1GUZA 1HYEA 3PZRA 1TB4A 2YV1A 2YV2A 2GPTA 2X0IA 1Z74A 1A72A 2EHDA 2FSVA 3RUHA 1Y7TA 4YQZA 2O3SA 5BNFA 4BUCA 5TF4A 4W6ZA 1SMKA 5B4UA 3CINA 2Q50A 3HN7A 4W82A 4OO3A 1ZJZA 3ANLA 2BF7A 1NVTA 5EN4A 1XHLA 3ETGA 4CMJA 2FMUA 2Y93A 4YTEA 2IZ1A 3ASVA 3B20A 3O8QB 4CODB 4PN3A 4BL5A 1DFIA 1DXYA 2NM0A 2OL4A 5TNXA 3OP4A 3K6JA 1Z7BA 4ZQEA 5KTKA 4GVXA 2I3AA 5L4LA 5KJ6A 3DBHB 3PWSA 1QSGA 2W2KA 1YKFA 3I52A 4OXYA 4U6QA 1X14A 2DUWA 4AJ2A 3W6UA 4CMKA 4DC0A 2B4TO 4FQ8A 2VWQA 1T2AA 2ET6A 3BA1A 3ADPA 1YB5A 4HFMA 1VL8A 1J6UA 1U3TA 4WUVA 2V6MA 3JQAB 4ESOA 2DVMA 3PHIA 4ID9A 3JD0A 2C20A 3BIOA 5AVOA 4UVGA 3KM0A 3OIDA 4LN1A 4Q3DA 2FRDA 4IMRA 1HDGO 5GZ1A 2DBVO 4R51A 3INRA 1MUUA 5T8KC 4D45A 2EGGA 3JQ8B 2PZLA 2JHFA 1Y8RB 3NTOA 4XB1A 4BNJA 3HDHA 1IUKA 2B36A 4RQUA 4D0RA 2X0RA 5CPBA 1CIVA 5TQVA 4OQZA 4BO1A 5T64A 4CPDA 2X9NA 1R0KA 1T25A 4XZ3A 1E3IA 1YBMA 1UXJA 4AJEA 2Q2VA 2Y68A 2TMDA 3A06A 3GN1A 1N5DA 1GL3A 1N1GA 3OBBA 4E12A 3BHIA 3H3FA 5KJ1A 3CZMA 4HY3A 1YOVB 4M1QA 4GQAA 1A9YA 2NQ8A 3JQ9C 4ZQGA 3RFVA 1NASA 4EW6A 2VUTA 2Q46A 2Z5LA 3FNEA 1VKNA 4L4XA 3L0DA 3K5PA 3OMLA 2YHUA 1Q7BA 5DULA 2PGJA 1BXGB 1Y1PA 5JY1A 2JD0A 3IP1A 5CDGA 2W8ZA 3BTSA 1Q0QA 1TI7A 1HE2A 3QIVA 4YJFB 1PL8A 3TN7A 1GFSA 4E31A 7ADHA 3DDNA 2P9CA 4EUEA 2PTGA 1XA0A 1V3VA 3GH3A 4RDHA 1ZH8A 3VTFA 2PKQO 4AJPA 5G4KB 3F1KA 3RKUA 1N9GB 4FJ1A 4CL8A 1IY8A 3G49A 4FGSA 4AJHA 4EJMA 1LEHA 4DPLA 4BS9A 5GZ6A 3RBVA 4UVEA 2NVUB 2GZ3A 2AEFA 3KYCB 1U3WA 1DHTA 1HDYA 2X86A 3WICA 1G1AA 3EVNA 2PLAA 1A4IA 3NV9A 4O63O 4MVJM 3OF2A 1U3VA 3WMXA 3PI7A 4WLFA 1YRLA 2B37A 2H5LA 2QHXA 5A9SA 3JCZA 4E2XA 1DIHA 5DNAA 2JFHA 4OIMA 5TJ9A 3F5QA 4XRGA 1D1SA 2B35A 3ON5A 1OMOA 1VM6A 1GDHA 4ZQBA 2BH9A 1PJSA 2NU6A 4D3SA 3DBLA 4YVFA 3W1VA 2OFPA 1SEPA 3GK3A 4A0SA 1ZO8A 4GBJA 1UDCA 2HDHA 3DBHA 2Y1DA 3V1YA 2QG4A 4DIFA 1PZEA 4M86A 3QVWA 1LSSA 4JP2A 2AQ8A 4DLLA 2Z1NA 1PL6A 2VHWA 1BTOA 3ONEA 1H6BA 3UICA 4J7CA 1Z45A 1IL0A 4A03A 3WQSB 2PD4A 3KSZO 1PGNA 2HMVA 4EUFA 4RVFA 5CDYA 4P8RA 3RUAA 4BNFA 1RWBA 1F06A 4WKGA 5C7IO 2PZJA 4J90A 1WVGA 4BNHA 3DAGA 3OECA 4BGVA 3VKVA 1OC2A 2Q1TA 1UZMA 1D7OA 1HLPA 1SCUA 2VHVA 4J0EA 3JQ9A 4DYDA 1LDNA 1MG5A 3IC5A 3TRIA 4DIOA 1E3EA 2Q3EA 1N8KA 4ALJA 1NAIA 1A9ZA 1QP8A 4JCOA 4JN6B 4Q3EA 1EE9A 4BNXA 1H6CA 3ITKA 3AUSA 1RKXA 5CHEA 2AE2A 5JDIA 3NKLA 3GGGA 3ST7A 4AJLA 1CWUA 2FR1A 4ZQHA 3ORFA 2HU2A 4UVIA 1VLLA 5G4LA 4K1LA 2I3GA 3WGHA 3F6YA 3QHAA 4LMPA 2GDZA 4XJTA 4B3HA 1E5QA 5TC4A 2FHSA 1Y8QB 1UR5A 1M75A 5AQ1A 4J4HA 2UAGA 5JY6A 3AI3A 1HE4A 3OH8A 5BT9A 1UJMA 4NH4A 1AE1A 2Y1GA 3GDFA 4RLSA 3KYBA 2CFCA 4IDAA 2NU8A 1J49A 1VSUA 4NU6A 3GHHA 1EFLA 2OBYA 1G6KA 2NADA 3DHNA 3D3WB 3KOUA 3NT4A 2ZCUA 1RYDA 3X2FA 4KQXA 3DMTA 3PGXA 6LDHA 4BVAA 3GDGA 2LDBA 2UUOA 1HWYA 1YS4A 3FR7A 3K2BA 2QZ9A 3GPDG 1L7DA 4XR4A 4BV9A 2HJSA 2BI8A 3TZCA 2IEBA 3FD8A 5K6AC 1SB9A 1E92A 4AJIA 2J6IA 5JYEA 3WIEA 6ADHA 9LDBA 2EF1A 4GX1A 1WDLA 3VDRA 5JC8A 3PRJA 4DLBA 3RSHA 1EUCA 3EUWA 2RCYA 2UVDA 4R1TA 3LC1O 4NK4A 2RAFA 2FSSA 5A3VA 3U09A 4MP6A 3AU9A 5KJEA 4IQGA 4LVUA 2EJVA 1B14A 2YY7A 4PLHA 3GGPA 1LU9A 2XPCA 3R1IA 2VHYA 1ISGA 2HJRA 2GF2A 2O50A 3T4XA 3V1TC 4FFNA 2QRKA 5I9NA 3KBOA 3ZHZA 1PIWA 2VQ3A 3NAQA 1Q0HA 1GEGA 5DCYA 4BGUA 3CXRA 2YQ4A 1DHRA 4LSMA 1WWKA 4D3DA 5EERA 4BNTA 3LYLA 5CPFA 1NHWA 1B8PA 2POQX 1YJQA 3A4VA 5TRTA 2IDZA 1K89A 4B4OA 1QYDA 3L77A 1UAGA 1NFFA 3U4HA 3KEOA 4IDFA 3FNHA 3K92A 4F6LA 4PGFA 4W99A 3BMCA 3B6ZA 1E1LA 1XDWA 3ICPA 5I8WA 4LSWA 4B7UA 1PGJA 3K73O 1YQDA 3FWNA 2PKRA 1VC2A 3HFSA 2YHIA 4JXKA 1HKUA 4WCFB 5CP8A 4RPJA 1ZEJA 3BMNA 1CEQA 5DOVA 1PZGA 1IZ9A 3MJTA 3PXXA 5H83A 1ZSVA 2V6FA 2YYYA 1QYXA 3KYDB 1P1FA 1NPDA 3AK4A 4GH5A 2Y0EA 5IXYA 2DKNA 1N92A 2Q4EA 3GF4A 4Z0HO 1WDKA 2JCYA 5EPOA 5L51A 1R4MB 1X0XA 3RUEA 1AUPA 2P68A 1HSZA 2A94A 1KIFA 4R41A 1PJBA 3HHPA 4IJVA 2E6UX 3GNSA 4HV4A 1NQTA 2WJPA 3JQEA 1EZ4A 2HK7A 1TA4A 1GPJA 3QSGA 4INAA 3TOZA 1HF3A 1M6HA 3B1FA 1Z73A 3QQPA 1TT5A 5L95A 3V2UA 3I9JA 4AL4A 1DPGA 4MVJP 3KSDO 4EJ0A 5TLSA 3FBTA 3S2FA 3FSRA 3SX2A 3CZRA 3QVTA 1YBVA 4GWGA 2QRJA 1UXKA 4ITUA 2YUTA 1E1KA 4RORA 4RLHA 3JQAD 2ZATA 4MVJH 4II3A 1KEWA 3CE6A 2WD7B 5CG1A 2J8ZA 3DOOA 4I5GA 3EK2A 3PYMA 1DJNA 3WLEA 3IJRA 3PHLA 1P9LA 3MJSA 4YPOA 4NU5A 4ND4A 4YACA 3HQ4O 4QX6A 3G17A 2E49A 4CMEC 1K6XA 3DZKA 4CV1A 5KVVA 3B70A 1F14A 2X7HA 3OA0A 1GYPA 2EP7A 3CUKA 1QORA 4TKLA 4CMIB 3TFOA 1C0LA 3IUSA 4FFLA 2DFVA 4CLOB 4A73A 4S1VA 2J5QA 5EQFA 5AXCA 4CMCA 3V8BA 1QYVA 3D1LA 5A9SB 3ZCXA 4YT5A 3ZWAA 3PJEA 4E2ZA 3W8EA 4E5YA 4TRRA 2BMAA 4LISA 3ZV6A 1PZFA 1EFKA 2HUNA 2NLOA 4ZA2A 3L4BA 4TZTA 4TQGA 1PEDA 1Y8RA 3QLJA 1MFPA 1XU9A 3D5QA 4FCCA 4PG5A 1VI2A 3GNQA 5IN4A 1ENOA 4CL3A 1PJQA 2NVUA 2ILTA 1GU7A 3VH4A 4EUHA 3UUWA 3ZW8A 4FS3A 4JBHA 1Y8QA 1ADBA 5KOIA 2C07A 2GYYA 1H0KA 3PWZA 3GEMA 2VZ9A 4BNMA 3QVXA 4DXHA 5I7VA 3LF2A 1N1EA 4YR9A 4BNZA 1LRKA 1T26A 2VWPA 2ZTMA 4Q39A 2Q1WA 1GUFA 1U1IA 3QVSA 2G0TA 1B8UA 1LTHR 4CM4A 4LCJA 4CM1A 4E4YA 1A7KA 4BO4A 3SJ7A 3L4BC 2YQ5A 1QV6A 4ZJUA 3WR5A 4BO8A 1EQ2A 1B8VA 1ISMA 1LSOA 1PS9A 3ZNPA 4NZ9A 5A3JA 3ULKA 1NR7A 3VC7A 4D3FA 4YAKA 2VT3A 2ZIZA 2Y0DA 4BNUA 3N7UA 3C7AA 2Y05A 1BW9B 4B4UA 4BNWA 3U9LA 3WQQA 5COQA 3S2IA 2AEMA 5JDCA 1LI4A 4XR9A 3AM5A 4WLNA 1KERA 2HKIA 3ZWOA 2W2LA 4XIYA 1RYEA 1I0ZA 1E77A 1JQBA 4IXTA 1Y81A 1EK6A 3STHA 4IDGA 4GKBA 5L45A 1N9GA 5FF9A 3VZPA 3GNTA 2HAEA 3JQ7B 1QV7A 4HBGA 3WYCA 1R0LA 2VNSA 3H8VA 4DYVA 3UN1A 4CUJA 1ZSYA 4E32A 4YB8A 2B83A 3W8DA 4PLVA 1D1TA 1J0XO 5DDIP 2VCYA 5I7SA 5H81A 5T57A 4KOAA 3C8MA 1R0SA 3QWAA 1S6YA 1SNYA 1YQXA 1HL3A 3CKYA 2GN6A 2A4KA 4PIVA 4H15A 4J1TA 5ENDA 1A27A 3OIFA 4KWIA 4L4SA 3VVCA 1PQPA 4HFJA 1PJLA 4IIVA 1PZHA 1TXGA 1M2WA 4RVUA 3UCFA 1OZAA 1O0SA 2XOXA 4TWRA 1JVBA 4UREA 1HTBA 3DR3A 3NJ8A 3E48A 3EAGA 5IDXA 5L7WA 3M2PA 2Q4BA 5JW6A 1PWZA 3G3EA 1PWXA 4C7JA 1RM3A 5CFZA 1XLTA 4CM5A 1NFRA 4GL4A 2CSUA 5JCJA 2VRCA 1B2LA 1HYGA 3PVZA 3ZWVA 4YXFA 1BMDA 5KWEA 1SOVA 3H2ZA 4MVJD 3ZV4A 2EWMA 3OJLA 2GASA 1EUDA 5GZ3A 1ISIA 1HDCA 3UW3A 1UDBA 4NR0A 2C2YA 5JAMA 2BGMA 2VTDA 1YL7A 4K6CA 4IS2A 1B15A 1DEHA 1U5CA 4E0BA 1B26A 4IS3A 2YDYA 1MFZA 5U1PA 2UUPA 2ZB7A 1LX6A 4KP7A 5BNIA 4TMFA 4J4BA 3UKOA 2GN8A 3AW9A 2ZYDA 3JD3A 4JP3A 1L7EA 3L6EA 4ZVVA 5TT1A 2DC1A 4XQ9A 2GD1O 4HXYA 4PLTA 4BO7A 5BSHA 4AJKA 4MDHA 4JJFA 4YAIA 3OJEA 2FY8A 3UCXA 1ZNQO 3RD5A 3KXDA 3OICA 3I9LA 3BMOA 1MG0A 3IP3A 3T7EA 3TSCA 2DUUA 1BDMA 1V6AA 4RO0A 3SJUA 4IJUA 4DTIA 4YEDA 4O59O 1NPTO 2AQIA 4BB5A 1U7HA 4YQYA 1LDYA 3U4DA 4E2WA 2CUKA 2OXIA 1KS9A 1YWGO 2ZYAA 1KY4A 1E7YA 2X4GA 3GLQA 1P1HA 4W9NA 3DOCA 1NYTA 1GQYA 4EEXA 4GMFA 3IAHA 5U9CA 2HRZA 3L07A 4RVDA 4YAJA 1FMCA 1QLHA 4E33A 3ZGYA 4FN4A 5A04A 1LC3A 3NDJA 1HE3A 4CM6A 4PRLA 4QT0A 5JE8A 2W90A 3M2TA 3KHUA 1YONA 3VPGA 2VYVD 1YJ8A 4IUYA 3RQSA 1I33A 4Z9FA 2CD9A 4R68A 3HADA 3AUUA 1IB6A 4LMRA 3FNGA 2BRUA 2PV7A 3C7DB 4ROSA 2A92A 4RQTA 4HUJA 2JFFA 1U8XX 1ML3A 2O3QA 1DLJA 3GVHA 4R5MA 4UULA 1GD1O 4WCFA 2D2IA 3GRKA 3N74A 1VKOA 5L4NA 3F5SA 2QZZA 4AJOA 4IDEA 5B4VA 1P74A 4ZQFA 3ZU3A 2YV3A 3H2SA 1UDAA 2CZCA 1C0KA 3FHLA 3CEAA 3TF5A 4B3JA 1T1SA 3FPCA 1ZVMA 2OP1A 5IJZA 5T67A 2JCVA 4CMHA 3ZWNA 4QFDA 5JCXA 3PQDA 1LBEA 4R3NA 1H94A 4BGIA 4BMNA 4FC6A 4A10A 3H5RA 3E6AA 1U5AA 3E82A 1HZZA 3KUXA 2O7QA 3PFFA 5KJCA 5DT9A 2DM6A 2UV8A 2F1KA 4PLPA 4QUKA 4CM9D 4R3WA 5H82A 3R3JA 3MJVA 5F1PA 1K6IA 1X1TA 4K26A 4WNCA 1PJ4A 2P9EA 3RC7A 3SC6A 3JQ6A 1U2DA 1ONOA 1AXEA 2XXBA 3E1KA 3Q2IA 4NBWA 2NTNA 1ENPA 1GTMA 3JQBA 2GERA 3ZV3A 5K0ZA 2UYYA 1WMAA 2G17A 5JDIC 1EEHA 3TQHA 4BV8A 2YZ7A 4RZHA 3H9QA 3IKVA 2IXBA 3AOGA 3QRWA 3R6DA 4RF3A 1BXGA 5FWNA 2DTDA 3B1JA 2HQ1A 1JWAB 5DOZA 3LQFA 3GC6A 4FD3A 2O23A 2O3UA 1ID1A 5KKAA 4BKUA 3AWDA 4ALKA 2NACA 3P2YA 5THQA 2RHRA 1WNTA 2DQ4A 3ONFA 4LK3A 4MVJF 2AG8A 1XQ1A 3LF1A 3WTCA 1H6AA 1U8FO 3HUDA 1C1DA 3VVBA 2QRLA 2GUGA 3RFTA 1Z7EA 4R69A 2GLXA 1P45A 1JDJA 1LQUA 4TZKA 3SVTA 1DAOA 1VJ1A 5IZCA 5EJ2A 4NDNE 3OJFA 2O4CA 3H7AA 1WZEA 5U4QA 3U4IA 3F9IA 5HWSA 3VPHA 1F8FA 1NWCA 2ZCVA 2AG5A 4B79A 1GR0A 2GNAA 2BGLA 1GZ4A 4DPMA 1V35A 4KTTE 4WNIA 3VH2A 4XB2A 3NDIA 3ZHBA 5DN9A 4CM4B 4XQEA 5A4DA 3JV7A 5IG2A 4Y6RA 4ZRMA 4J1SA 4P22A 3WGTA 4J16A 3GA0A 1DIRA 1O89A 4PFJA 5CG2A 5C5IA 2E82A 4A2CA 2EW2A 2D4AA 3EZLA 1ONNA 2JHGA 3ZDFA 1VL6A 5BSGA 1YQGA 1DDOA 5DP2A 3O9ZA 4OAQA 1A71A 4HNGA 4XYMA 4BMVA 4DRYA 1ADFA 1JLLA 5A06A 2NVWA 2VZ8A 3OFSA 4ZHSA 3H3JA 4WLEA 1JTVA 3MJ4A 3E9NA 5FI5A 2NUAA 1IYZA 1LQTA 1P31A 2VYND 1U4OA 2Y99A 4Z9YA 4OXNA 3MTGA 3FPLA 2YFQA 4L4RA 1NP3A 3OQBA 4AG3A 3S2GA 3DBVO 1ONPA 3WGOA 4GLOA 4JNKA 3KB6A 3WTBA 3JQFA 1QRRA 1NM5A 4M55A 5BR7A 4GWKA 1KEVA 5G0TA 2WTBA 3E8XA 4NNJA 1T2EA 1T2DA 2BLLA 3FF4A 2ZQZA 4DIBA 3DBRA 3O26A 2EIHA 4FBGA 1FK8A 3CIFA 1EVZA 3ZU5A 2DPGA 1ZEMA 2X5JO 4PZDA 3M1AA 4IZHA 3ZI0A 3DQPA 4MOWA 1CJCA 3AUTA 3R0IA 3PFWO 4TROA 3WMWA 4FPXA 5L40A 4B4VA 5IXSA 3AI1A 1YH3A 3QWIA 1KVSA 1MB4A 1UP7A 2BFMA 2PD3A 4G5HA 1XQ6A 2RBEA 1H9AA 2DTEA 3KSUA 1HETA 2X1HA 4GLLA 5LCXA 4ZU3A 2FPIA 4GX0A 3GG9A 3BMQB 2P9GA 3DC2A 3RASA 1CERA 4I8XA 3GUYA 3PDUA 4D79A 3I9OA 2OO5A 3HDYA 3NX4A 4B3IA 4IMPA 3HDQA 5BSFA 4A7PA 1GQ2A 3IOYA 2JD1A 3GR6A 3DMTC 3ROQA 3VDQA 3ZWXA 4NPCA 4E5NA 1ZSNA 5CDUA 5JLAA 1ISFA 4KTVE 2VWHA 3RAJA 4BNIA 4ILKA 4II2A 9LDTA 5ITVA 3JD1A 5TT0A 3D0OA 3ZWCA 4LVCA 4PLGA 3DBRB 3RI3A 2W2LD 4NFSA 4CQLB 4IIUA 2HO5A 1V0JA 4J0FA 3JYPA 1DIGA 3GUCA 1LUAA 4YYZA 3E9MA 4U0JA 4CLOA 4PLWA 4BO2A 4A27A 4PG8A 1UZLA 2FOIA 2VUSA 4HFRA 5G4KA 3RJ5A 4ND1A 4EDFA 2XF8A 1TEHA 4GGOA 4B7XA 2IEDA 1R4MA 4QXMA 2PGDA 2GN4A 1WLYA 3RBZA 1K6JA 3BTOA 4H7PA 2JL1A 2RH8A 1SEVA 1T4DA 2PKQP 2JFGA 4PCVA 1EVYA 3PZBA 3F46A 3Q11A 4YAGA 1EDZA 4R1SA 4PLZA 1UXIA 5HRUA 4BKPA 3OQ1A 4D44A 3DHYA 1R12A 4NBUA 5F1KA 4DL9A 3I1JA 4KUGA 4QQRA 1LDGA 3AFNA 2Y1OA 4QTZA 3BMQA 1GCOA 5DCUA 3QP9A 5JDCC 4EYEA 1J5PA 2IE0A 5HS4A 2H9IA 4N54A 1ZK2A 3OEWA 1KC1A 4E21A 3BHMA 4MVJG 1YDEA 3ZNQA 4Y9DA 2VTEA 1TT7A 1F12A 4HX5A 5JBIA 1PL7A 2ZB8A 3GRPA 3ADOA 5CEEA 3JYNA 5L7TA 4J1NA 3IDSA 5KIAA 2YJZA 1B0AA 3HE3A 1DRUA 1JAXA 3ZNNA 1IULA 3L4SO 1E7WA 1ARZA 4OSPA 4UUNA 4JBGA 1VL0A 2H63A 3LZ6A 3MWEB 4RPGA 4EGFA 1IZ0A 4XYGA 4O0LA 1QKIA 4AVYA 2VWGA 4KUEA 1KEUA 3PIDA 4HADA 1VJ0A 3HSKA 3S55A 1P33A 3FBGA 3UAGA 3WBFA 1O8CA 1NXQA 4E13A 3DB2A 2BD0A 2PR2A 3O4RA 1ZJYA 3QE3A 3PHGA 3WDSA 3UXYA 1EUZA 5JYDA 4ND5A 3WSWA 4RF5A 3FTNA 3AM3A 3NT5A 4K6FA 4PRKA 1AN9A 3WGZA 4IM7A 4EITA 4MKXA 4RPLA 2E48A 3IUPA 1NQAO 1N7HA 1PJ3A 5CDTA 4CMBA 1O95A 2YW9A 5ILOA 1E0DA 3G1TA 5A5FA 1GYQA 1DBVO 1DIBA 2X22A 3QA9A 3C1OA 2B4QA 3JQ8A 3RU9A 5DBGA 2Q1UA 4KUHA 1I3LA 5JSFA 4YT4A 1C1DB 1LLQA 2EW8A 4UVDA 1IHXA 4CV0A 1E7SA 3JQDA 4FGWA 4A5OA 2BKAA 4E30A 2O48X 4E5MA 4ONEA 2GSDA 3D4OA 4K28A 4I08A 2NU9A 5C7OO 4J9VA 1FDVA 2DPHA 3F3SA 3G0OA 3WGIA 2BFOA 4IQ8A 1B16A 3ICCA 2WMDA 1KOLA 2Y1FA 3GT0A 5IZCC 2NSDA 4BKQA 3DFZA 3C24A 4YDRA 4YRDA 4OKNA 4K9DA 1K5HA 3GZNA 3UGKA 4PLCA 4QO8A 1KVRA 1E1MA 4OJNA 4G81A 1LLCA 2W4QA 3H5AA 4PVCA 3TOXA 4DLAA 5HBRA 3WFJA 4BNLA 4H3VA 1DB3A 1M6WA 3GQVA 1X1EA 3AOEA 1BXKA 1I8TA 3GHYA 3H4VA 5KVCA 3GVCA 4KDFA 1OC4A 2NTVA 2O2YA 2X8LA 4IXWA 2RHCA 5A05A 1GEEA 3WGGA 1MC4A 3ENNA 1IOLA 4J91A 3HB4X 1ZFNA 4NHEA 4OH1A 4UAGA 3L6OO 3RFXA 1YGYA 1NVMB 5EIOA 3OJ0A 3UVEA 2SCUA 1FJHA 1NBOA 1LRLA 3FRJA 3D7LA 3K96A 3S2EA 4XDYA 1U28A 2CVZA 1PGQA 4N5NA 5EL0A 3MEQA 1PQWA 1LNQA 2BHLA 2F00A 3H6KA 1I36A 4EEZA 1UZNA 1SZJG 4WK6A 4Z3KA 1Q1NA 3HJAA 1CDOA 4YBZA 1ZZEA 3WJ7A 1Q7CA 5TJHA 4XQGA 3QWBA 4MVJI 1CRWG 1R66A 2CVOA 1Y9EA 4DC1A 2Q2QA 4Z9XA 1QLJA 4BQRA 4NJOA 2NTJA 1BG6A 1HE5A 1C0PA 1DJQA 2IZ0A 1GY8A 2OZPA 2JD2A 2O3RA 3HNPA 3TWOA 3I23A 3WX0A 5I7FA 1ORRA 3FWZA 3K8ZA 4NJMB 4I5EA 1PGPA 1N7GA 3ZWYA 4O5OA 4XKJA 5IZ4A 3GZNB 4PVDA 5JO9A 2PD6A 1I3KA 3LT2A 4MVJE 4NBTA 4XYLA 4RPKA 1KC3A 2CY0A 1C1XB 3DTTA 4JX8A 1SOWA 1EK5A 1EVIA 3MJCA 5ILGA 4G2NA 4OGWA 2FN7A 2Z1MA 1AGNA 1P1IA 4DQXA 2J3IA 1LXCA 2O4UX 3JQ7A 3SLKA 1TVEA 4XJSA 3ZN2A 1PS8A 1DRVA 1MX3A 4Y6SA 3CMMA 4WGGA 4DMLA 1H6DA 2QYSA 3GVPA 3H9UA 1KY5A 3PP8A 1W0CA 2W98A 2DBQA 5HTOA 4YJHB 1Y5RA 3BXXA 3L9WA 4J4TA 4M8SA 2V6BA 4WOJA 3V5NA 2X0JA 2WYUA 4BKRA 1QXSA 4RVSA 4C7KA 4M49A 4N5LA 1MXFA 2PGLA 3C3XA 3DTYA 3SEFA 3DHEA 4LGVA 3HDJA 1E3SA 3E5RA 4I5DA 1GADO 1V3TA 3WG9A 1EDOA 1H5QA 3KO8A 3PTZA 1YOVA 1OFGA 4NIMA 1GYRA 1X7HA 3M6IA 3I6QA 4WCDA 1HSOA 2GZ1A 4XX0A 4PG7A 1UAYA 3QW2A 3PJDA 1NFQA 2W2KB 4IQ0A 3RVDA 3JYOA 4DUPA 4RJTA 2C5EA 2C5AA 1RPNA 3OSUA 4YCAA 1G0OA 4XQCA 4YAEA 3OA2A 1M67A 2B0JA 2I99A 4NFYA 4Z6KA 3T7CA 1PQUA 3F47A 4OYRA 2X23A 1T24A 2V7PA 4IGEA 1PR9A 4DPKA 1VE9A 1PR3A 1UP6A 4W9NC 5AYVA 5CEJA 3I6IA 2Q1SA 4XYEA 3RCBA 3DAFA 2BFPA 2PNFA 2LDXA 5JPIA 1WXDA 1H2BA 4UEOA 3OEYA 2WDZA 3KV3O 2QW8A 3VPSA 1PU2A 1Z75A 1E6EA 1ZMOA 5F3RA 2HCTA 4U6SA 4CMGA 5DBFA 1Q0LA 4NG5A 3U4CA 2EV9A 3PLNA 2C2XA 1Z6ZA 3U3XA 2X0NA 2Y67A 3PYXA 3PJFA 1SB8A 4CM8A 1A4UA 1AHHA 1RM4A 1YL5A 4J7XA 3NGLA 4FJ0A 3KYDA 3V1UA 3DXFA 3ZV5A 5A02A 2JKVA 4GGPA 4IZIA 1BSVA 1O6ZA 1O94A 3RC1A 1YO6A 4ZD6A 2D5CA 2QYTA 4BNVA 4PG6A 4WCFC 3JQCA 4L76A 4XYBA 3C7CB 3ZU4A 1DLIA 4Z0PA 4UEJA 3RUDA 4D46A 2O3TA 1Q7GA 1OOEA 4KMSA 3PQFA 4XGKA 1WAMA 4MKZA 4YWJA 5T8KA 1N2SA 1OAAA 1QMGA 3GAZA 4GKVA 3S8MA 5JCJD 1LLDA 1T1RA 3PHHA 4NFHA 3D3WA 5IDQA 4MVJA 3SXPA 1XG5A 1F0YA 1VPDA 4P4LA 2EERA 4GX5A 5F1OA 3LT4A 4DGSA 4ND2A 2YFHA 3RBXA 5ITWA 2C7VA 4GPD1 4XCVA 3UOGA 3Q9UA 4Y67A 1ZK3A 3ZHXA 3KTDA 1CYDA 2RIRA 2WD8A 3RU7A 3NGXA 3ROPA 4FFMA 2Q49A 1FDTA 1GV0A 1K2WA 1SC6A 5GMOA 3GOHA 4C4OA 3HN2A 2JCXA 2C59A 3TDKA 2WD7A 5IF3A 3EC7A 1ZXLA 4YJGB 2BFAA 1E3JA 1ZXBA 5IAAA 2XXJA 3SBOA 2ZKLA 5B12A 4MINA 4HP8A 3CMCO 3PPIA 3Q6IA 2JJYA 3W4KA 3RROA 2DLDA 4UUPA 4EBFA 2EEZA 4WLVA 4ND3A 4F6CA 4JROA 5ENVA 4TVBA 5L7YA 3NEPX 1ZMTA 2FPPA 4NMHA 1AHIA 1KVUA 2C7GA 4DBVO 4L75A 1X13A 3A28A 4PG4A 1I5RA 1X7GA 2AMFA 4L0QA 4GI2A 3Q1LA 1O9BA 2QIOA 3D4PA 4AJ4A 4J2OA 1MV8A 3JYQA 4IJKA 5L9AA 1UXGA 4QECA 3FNFA 3W4JA 1YXMA 2HSDA 4CQMB 4YT8A 2NQTA 1E7QA 1MC5A 4YT2A 3KVOA 2HLPA 3AY6A 2R00A 5KNLA 5AXDA 2PH3A 1GQQA 3TL3A 4TRNA 3IS3A 3VZRA 1HDXA 1Y9AA 1CQIA 2IZZA 2X5OA 4HNHA 5IFLA 4BNNA 4AICA 3NJ4A 3DO5A 4DBZA 2I9PA 4OQYA 2DBRA 5HS6A 5JO0A 5TSDA 3KEQA 3RKRA 3OQ6A 4BB6A 2H1SA 4UVHA 4N7RA 3MZ0A 1UH5A 1DC3A 3WNVA 3BYZA 5G2OA 1LSJA 1EVJA 4JK3A 3ANMA 3KRTA 3GPIA 3X2EA 4E2YA 2CF6A 4WLOA 3VOSA 3TZKA 3JYLA 3I9NA 5F5NA 2DTXA 1QYWA 1I3MA 3QY9A 8LDHA 4J49A 5KCZA 2NU7A 2OUIA 2PZMA 3ROMA 2GGSA 1JKFA 1LA2A 4UUOA 1HRDA 1D3AA 3ENKA 1HXHA 4YA6A 1V3UA 2C54A 3MWDB 1JVSA 2VRBA 4WOKA 4TVOA 1XKQA 1NQ5A 3JD2A 4UEKA 1C14A 4BHTA 3PQEA 4URFA 4CLRA 2VT2A 4KDEA 4OL9A 1W73A 3WIDA 2D8AA 3K2EA 2E37A 4AFNA 3HZZA 3LLSA 3WLFA 5FEUA 2I76A 1I2CA 1XGKA 3AY7A 3DAPA 2C29D 3IMFA 3C85A 5LDHA 3GY0A 1R4NA 3PJGA 5C37A 3PIIA 4Q3CA 2EKPA 1ISHA 1GZ6A 3WS7A 3ABIA 3QWFA 2WWRA 5G0WA 2OBNA 1EBUA 3P7MA 2BGKA 3PYLA 4FW8A 1MLDA 5T6BA 1DAPA 3DONA 4RVGA 1BGVA 4E6PA 4MJLA 2J5KA 1HYHA 4N5MA 5DZSA 5FYDA 3ETDA 1FDWA 1SBYA 4XDZA 3UFXA 2J3HA 1DSSG 4JLWA 1FF9A 4MIYA 4MKRA 2PH5A 5AOVA 5I9MA 3WYEA 1LJ8A 1TLTA 4GSLA 4J7UA 3FN4A 1LDBA 1SO8A 3SLGA 4Q3NA 3EY4A 4B8WA 3FI9A 1BWSA 4NI5A 1XU7A 2GO1A 4WASA 2FPGA 3JSAA 3KZVA 2NV6A 2ZQYA 2G82A 2GN9A 1PTJA 3BMCB 3EVTA 1RJWA 4U5QA 4XD2A 1R15A 2P91A 2D3TA 1OBFO 3PGJA 3BMOB 3EGOA 2Q99A 1LDEA 2ZK7A 3UHAA 1W4ZA 2ZTVA 1U7TA 4GAEA 2JAPA 3RIHA 2HMUA 3TJRA 2AW5A 3I9MA 1NAHA 3WSVA 3I3OA 4ZGWA 3PDJA 1LRJA 5ICSA 4W7HA 2Q2WA 3GDOA 2EJWA 3Q3CA 3VZQA 2V65A 2PFGA 4BO0A 4J6FA 4X54A 4CMEA 4CQMA 4CLEA 5JC1A 3BHJA 1E3LA 1KEPA 2BI7A 3Q0EA 5T5QA 4Z0TA 1MA0A 3DWFA 2VNAA 3AM4A 2I67A 4Q9NA 1YL6A 3DZGA 4R54A 3ETEA 1NQOA 3K9QO 3OM9A 2GZ2A 2GRAA 3GAFA 4BGEA 4LW8A 4ZICA 3D4NA 2EKLA 4FC7A 3E03A 3VKUA 2A9FA 2P4HX 3CSDA 4MIOA 3WBBA 3EHEA 3WXBA 4B8ZA 2FZEA 3NTRA 4ALNA 3UF0A 1JAYA 4L8VA 5F5LA 4BNKA 2X6TA 4DREA 3LK7A 2YDXA 3I5MA 4CLXA 2ZB3A 1P1KA 2C0CA 3WOHA 1EE2A 3D5TA 1P3DA 4JJGA 3LT1A 3EW7A 4JBIA 4JGBA 5EMHA 4J3FA 1LDMA 5CAEA 3K30A 2ZTUA 4ZRNA 3BAZA 1BXZA 3MOGA 2CDCA 3AUAA 2OGUA 3ZH2A 5A1TA 5JNLA 3TNLA 2UDPA 1ZKMA 1Q2XA 3N58A 5TS3A 2Q45A 5G0UA 1XIVA 1NWHA 3MCVA 1PX0A 4CUZA 3DFUA 4BO9A 4EI2A 5K9ZA 1DOHA 3F4LA 4RF4A 2BELA 5KVQA 4ALIA 4F46A 2ZTLA 1ZIDA 3WJAA 1NVGA 4B7CA 1B3RA 2AA3A 1DIAA 1V9LA 1BDBA 3WWYA 1JWBB
chains in the Genus database with same CATH superfamily
5F64A 1ETUA 1FUYB 3PNVA 2EFEB 4B43A 5K8UA 4NK5A 2EJCA 1XHFA 4A26A 4CT4B 1T6YA 3PEEA 2YL2A 3ICWA 4Y8VA 2IXAA 4KH1A 2PQ0A 3HEMA 4BCCA 5JXIA 3P19A 1AKRA 3OHMA 3MF4A 4GUAA 2Z6UA 2GXUA 1ADGA 4R1LA 1MNQA 3I28A 1ORVA 1B3BA 3JVVA 4LOHA 4RE5A 3SC3A 2ZRQA 5FWAA 1TTQB 3B36A 5D5PA 1TUGA 3FGZA 5FLEX 2WZBA 1E9SA 1JS1X 2HMYB 5K20A 3KP1A 2J31A 3I6MA 2CJPA 2R6ZA 1NRXA 4JLVA 1KI4A 2IEZA 2P4QA 1D04A 1EVLA 2XUOA 5HE8A 1YB1A 2A9OA 3OU2A 4DLVA 3VYRB 4QBTA 4PIMA 3FTPA 3I4CA 4LXGA 1QZUA 5E1BA 3R75A 1NRIA 4UHBA 1H9BA 4RZ3A 4YV0A 2CXPA 4BJ3A 4CTJA 3IIEA 4K9SA 3RW9A 3FR8A 3ET5A 3A9WA 4N3GA 1FIUA 3VJLA 4J9UE 3C48A 4R2HA 4PQYA 1T6XA 1YDWA 3ROZA 1A9TA 1SBCA 4OXKA 5JS6A 1FXWA 3MTQA 1UQRA 4BGPA 3D31A 4F4DA 3LIIA 4WOCA 5EINA 3QE4A 1TFRA 2OK8A 4QJ4A 3SZGA 1FU8A 2GN0A 4IVRA 1YC5A 3EE6A 1EIZA 2O0JA 2QTNA 1SVIA 4EHDA 2QX7A 1MB9A 2WYWA 2CL7X 1VG8A 4JX9A 4AP5A 3IRVA 3ZBUA 3O4JA 4YRFA 3LC2O 4LXUA 1JG7A 3SQDA 1DKPA 4MRVA 4U2DA 3K6KA 3AI2A 3WK6A 5B6PA 1J0CA 3R3ZA 5EHXA 1HDRA 3ZXXA 3V3KA 1JHQA 5JZOA 4ZI7B 1U31A 1BVRA 3K35A 4UNPA 1WMFA 3T3MB 3TRHA 3EVZA 2GEDA 2WFAA 5H59A 2AG6A 3GJ5A 4TTVA 3V00A 4ED9A 5KKNB 2P1ZA 1F2TA 3U3KA 5EJ9A 3C8UA 1QQTA 1GSOA 1E4OA 1LI7A 5G1OA 3LX6A 4FFBA 3SMQA 3DKVA 3LVFO 1MGOA 1E7MA 3ORQA 5FI3A 5TV2A 4CIYA 1QR6A 2D0DA 4R5HA 4DM4A 1NQWA 1DBRA 3CA8A 3H8JA 5DGHA 1JW9B 2QZ4A 3IHLA 3T38A 1HLFA 5EJFA 1PSDA 5JXWA 3I4LA 5DI3A 3CPHA 3EGEA 2ZZKA 2C2ZA 1SC1A 4PSDA 1DAKA 3NHZA 2AYYA 4RKFA 4ZO4A 5EP1A 3K6RA 2WJ4A 4HH0A 5B37A 2X9GA 2J0SA 3EPPA 4K05A 1Z8DA 2PMEA 2Q5EA 4S24A 3NTQA 1QYCA 5ER6A 1QQBA 2QRZA 3ABRB 3O3MB 1Z82A 1W8DA 1KVQA 4QDUA 1JJ7A 1VMDA 1JLHA 3VX4A 4ZN6A 4AUKA 4L73A 3ERCA 3W5IA 1LX7A 2WYOA 4M7OA 3U3RA 5A4AA 2X8JA 5BWMA 3IQZA 4QEDA 5EMLA 5KQSA 2OLEA 3ESQA 2OAQ1 3AXSA 2QQEA 3LC7O 2AHRA 1JLMA 2FGJA 4UBIA 3U37A 4QQ8A 1REQA 2CMDA 4YAOA 1CY7A 4N18A 4PLFA 1ANKA 2I3DA 2MYUA 2JGDA 3E9ZA 4JLUA 1XZJA 3KSMA 4K6MA 3VAZA 1MORA 3PE4A 4KQKA 4UUBA 1O0BA 5TGDA 1TM4E 4LXQA 1BGXT 3DQZA 2KPOA 3MJEA 3N86A 1FZTA 2AYZA 5IK2D 4D41A 2H1OA 3G0HA 2R48A 2XODA 4ZK2A 5EE5B 4QUGA 4B3GA 3OOHA 5CT9A 1D0IA 5C7LO 3BTUA 3I0NA 1G55A 1M7HA 2JLAA 4QUHA 3RG8A 4B82A 1P2UA 1XB2A 4FMPA 4IFTA 4MPDA 4OIFA 1L1FA 1P1JA 3V4VB 3BXOA 3DEIA 2BMJA 1G21B 3ER8A 4H3SA 4TRJA 4LC0A 1FMJA 3COSA 3HJBA 1GPWB 2PNJA 1YK1A 5FBQB 3T5GA 3QJGA 1JU9A 3DT6A 4M89A 3PDIB 2GSWA 3I1IA 4DCJA 4B6RA 4W1SA 2P2SA 3U7GA 1S2MA 2QJFA 1A7AA 1CEXA 3U0BA 3QU9A 1QHHB 2Y1KA 3HJHA 4HG2A 2E4UA 3OIGA 1CSEE 1NA5A 2MIIA 1RMYA 3HA3A 1ND6A 4O29A 4DSTA 2AC4A 2R6HA 1FDRA 1FFHA 1OROA 1HY3A 4WOPA 1L4BA 2FWRA 3VR5D 1FQOA 4YAKA 3GFBA 3VV2A 3F1LA 3Q7SA 1G8KA 3TTWA 5CB4A 4O4JF 3O1LA 2R62A 1C7EA 3KSBC 1WBBA 5JYBA 3ANTA 4O1MA 3ZHYA 3BDIA 3AESA 3GMTA 2HHCA 4FOSA 5JCOC 3DC7A 4OKSA 4XGNA 2IW3A 4Q9DA 3K1JA 2GHRA 4N1AA 3SOZA 1JKXA 3VNRA 1T4CB 4NJMA 5CVCA 2VEOA 1W19A 2IRWA 2G8NA 3P71T 4MUMA 2RKWA 4M6WA 3LMKA 2GKGA 5IHPA 3O8QA 2O8EA 5BSEA 1WMBA 4ZYTA 5K0FA 2MYNA 4H16A 4M0PA 3OIWA 3JD4A 3T1VA 4BO5A 3NOOA 5A62A 1YFLA 1QPZA 3N8DA 4EZIA 1P0CA 3OLCX 3THSA 4TLLB 2O7SA 1DKLA 1U3FA 3NHBA 4J1QA 3DMGA 4D43A 4AN0A 4UCWA 3O7MA 3IE2A 4BYMA 5K2OA 3HO1A 3LVQE 1UDXA 1UINA 4FMBB 3PEFA 2DAPA 5EPEA 4LRTB 2CYAA 1E5LA 1NR5A 4UTRA 2ZWIA 3JASA 3UBTA 3HLYA 3BEDA 1R0WA 4WXRA 4IWXA 4GSKA 4RD0A 1DC6A 3LSYA 5GY7A 3C3DA 3ENZA 3ND8A 4MMXB 4XA8A 4ZP1A 3EAFA 4DMMA 4W5JA 4H3KB 4HL6A 4TKVB 1BVYF 3INGA 1IBLB 2VN8A 3JQGA 3VPXA 3MBIA 3G0IA 4EK9A 5KDLA 3W8FA 1SXPA 5JJIA 4NESA 3FFAA 4I8IA 4I55A 1POXA 3OLXA 4WA7A 4JHXA 3C3KA 1H93A 4GLFA 1JHUA 1UJ2A 1Y5MA 1JR6A 1M83A 1CF2O 2VG8A 4GFDA 1GUYA 2PZEA 3CVJA 3FMPB 4ZT3A 2CVQA 3CPJB 5LOVF 4XARA 1QU3A 5AK6A 4XIJA 1QE0A 4U7DA 1HYBA 2W42A 1UFRA 1P4SA 2VTBA 1BRMA 1ZUHA 4Q9LA 3RVSA 4BHHB 4Q3AA 1CVRA 1GPUA 1XCBA 2J46A 2OCYC 3QENA 1XVLA 4UFOA 4XWYA 1NW5A 3VHRA 4B76A 2VYVA 2NWQA 4J1GA 4L1KA 4OM8A 2I8CA 3U7FB 1QE5A 1U0JA 2YMLA 5FFNA 5LPNA 1QHXA 3FA2A 5I7EA 2IW1A 1TJPB 2C9BA 1EWRA 2CLOB 5L53A 5IDYA 5EQDA 1BC5A 2QE7A 3NETA 5TMEA 3AFHA 4LNHA 3BDAA 5HF5A 3CVVA 2BGTA 4KQ2A 4EG6A 5JH7F 1XR3A 3Q1KA 4M7WA 2W6MA 3B1ZA 1M2OB 1T9ZA 3CLTD 1NC3A 1PYDA 4PZPA 4CLDA 3GN2A 4WXHA 4LOKA 1X19A 4WK0B 4B7ZA 2IYOA 2P79A 3WYBA 1B41A 4RD4A 2A9VA 1HT0A 1PWEA 4KMMA 4X65B 4CMIA 2AVNA 5D85A 3RAFC 2XQFA 1DFGA 3NPAA 2AN3A 2RJ3A 2XVYA 4IEFB 3UK6A 5F51A 4LRSB 2WJWA 5LZ4A 1S3FA 1KY3A 4KGVA 2QMUA 4Y1GA 5JFOA 1HLDA 1XSEA 3H2KA 2G9NA 5BNZA 4RTPA 5FLKA 4TM8A 1D8AA 4NBRA 2Z2IA 1E8NA 1WW8A 3U13A 3Q8LA 2GMWA 3A0UA 3UTCA 4CM9A 4MP8A 4ZI3A 3EZYA 3DVRX 5I7AA 3M5DA 1Z6YA 4G1MB 4MIKA 1JHMA 5D3MB 4RVNA 5IKOA 2AEJA 2HMSA 1D7AA 4MSUA 3AHEA 1W4AA 1ZIYA 2R6JA 3IERA 3GLHA 2VYFA 3N0VA 4UHJA 1ZUD1 4DV5B 1XD2A 3VH3A 1G7CA 1R0BA 5EJ6A 3D6MA 2V03A 3LPMA 4JL8A 3ZQUA 2EGHA 4IH9A 3VPAA 5JAQA 3AKCA 4PZLA 3T99A 4C0HA 1RM0A 4AWBA 3MTJA 4F96A 2JLXA 2D06A 2O2HA 5J1TB 3RWOA 3DE7X 4AUNA 3KAQA 2FR8A 4LBWA 2P78A 4GF5A 2FZWA 1Y3FE 2XMZA 3IJPA 4UXJA 4Z2YA 1J5EB 1ZY2A 4GM4A 2IHZA 2ZYRA 4NV0A 3N75A 3T9EA 5HOEA 3EXEA 3QI7A 3GVXA 2YIVX 4IIYA 1TK9A 4ND8B 4CCSA 4Z8XA 1NTOA 2BBOA 3IURA 1FDUA 3NEJA 1FP1D 1GKUB 3TLAA 5GINE 1CDEA 3SXUA 2XMQA 1RMQA 2CGEA 3F96A 4J2HA 4U9HS 3UMGA 1WB9A 2OZEA 2PGAA 3BKWA 4Y98A 4OOEA 1QGUA 1LBHA 2J41A 3TSAA 4CT5A 4RTNA 4WWHA 4QBHA 1EQUA 1KSGA 4P34A 1GAEO 1P1BA 5CHYA 2EGUA 4KFCA 5JSKA 1X1DA 4HOYA 4MYDA 4R9SA 1DU4A 2O2SA 4FI3C 4IDBA 5C8DA 1J4AA 2VTVA 4IXDA 3WLOA 2Q0QA 2ONCA 5CD9A 3BL6A 1ZM7A 4YAFA 1BD4A 1V5EA 2XMDA 2ISQA 1JZTA 1D0VA 1T9GS 1OZFA 2XSZA 3DTNA 3IQXA 3WFIA 1YNSA 2AQKA 4PXYA 1WEKA 1KMNA 2OORA 3D3EA 3M89A 4M7PA 2DHCA 4P3NA 1T13A 621PA 5KU1A 4UTVA 1T4BA 3FAZA 2DT5A 1F0KA 3K0FB 2P3SA 2R2GA 2Z2ZA 4JJIA 4DSAA 3R9WA 3WWEA 3H2GA 4FUQA 1BHJA 2YCBA 2FHPA 4K86A 1N2OA 2YHSA 3IEMA 5ICMA 5BQFA 3RADC 3WLPA 2K2QB 1VSTA 3KEMA 4M9UA 4R9RA 1YZQA 5ALDA 4BMSA 2XQIA 2JBAA 2PT9A 3KETA 4AQ7A 2VF8A 1NUTA 3WP0A 3N0XA 3DBLB 1UL1X 1HGXA 2NT3A 3F4BA 1YZFA 4U0KA 4AJNA 4ZCMA 1H2ZA 2WVGA 2XE6A 3GZ4A 1XC7A 1HT1E 4UFPA 4G56A 4ZOCA 1IAVA 4ZT2A 4QPPA 2J3JA 4P4GA 2CBZA 3WQRA 1NM5C 3RUIA 3ZOKA 3OQIA 4ER5A 1J8DA 1ULUA 5K6AA 3KZKA 4XVCA 1NPYA 1O9GA 2JKYA 4Q1DA 5HKKD 2I6FA 4CQLA 1E4VA 3WGYA 2Z8XA 5F33A 2VHXA 2JHAA 4H7JA 1SXJD 1PW5A 3RWBA 1G3RA 3FPGA 4L0CA 3H0CA 1N32B 5FL7D 2Q6OA 3BXPA 2PKEA 2FV8A 3JTMA 5AXAA 2W6JD 2WHYA 5IMBA 5JU6A 1FDSA 5GQSA 4GOKA 4V0SA 4YCDA 4PAQA 3GGOA 2FP4A 4G36A 3C98A 1N33B 4FOOA 3PHJA 3FDZB 3PFHA 4NCJA 5BQ5A 2CDBA 5MDHA 3H1PA 3A2LA 2GLUA 5ARBA 4D42A 2DRIA 3N2ZB 3U7HB 1FJ2A 1J90A 2GAJA 2I6TA 1XVAA 2I22A 2VCHA 3CT6A 5A9TA 5J47A 5C5CA 4GMGA 1NHGA 2E1RA 5LNK6 1T4GA 1ZBDA 1MPXA 2G25A 2XUDA 4L27A 4MLCA 4ZAZA 3IA2A 5FP0A 1XCPA 1NKVA 1VMIA 4I4LA 3RUCA 5IU6A 3PI6A 4KGZA 2QKYA 4JUAA 1V48A 2ILVA 4B75A 1M76A 1O2DA 4D8YA 1M8PA 1NP7A 4W8GA 3KPYA 5JMOA 3K31A 1JE0A 2WEKA 2ODTX 3PZRA 5DSTA 2X15A 1GA6A 1SD2A 3B7PA 4I1SA 4RNDB 4HS9A 1M1UA 3V8NA 4CXMA 2ZAGA 3HJFA 2GLTA 2FSVA 2WUVA 3OPVA 3RUHA 5CA1A 4YQZA 2O3SA 3QLEA 1C7FA 1W76A 3I53A 2QOEA 5TF0A 1SMKA 4OI2A 4QLBA 2P5TB 3CINA 3U4QB 3TEFA 1U0SY 3HN7A 1WU7A 5CJ2A 2D5IA 2GZMA 3S2ZA 2A1IA 2OCAA 3CONA 3A6HA 1HDIA 1WXXA 1ZS9A 2BF7A 3QI2A 5EN4A 1XHLA 3KB2A 2Y93A 3ZX4A 2QSJA 4GC9A 1BMTA 2C95A 2IZ1A 4I6GA 2QTHA 3IUNA 4PYIA 2OPHA 2IYSA 2OL4A 2HRDA 3GWGA 3LCVB 1S9HA 1K86A 4FYMA 3ADBA 2YXLA 3K6JA 5C80A 4DEXA 1Z7BA 4LBYA 4N9WA 4O1HA 5KEIA 1SC9A 3WIBA 1C8BA 4BV2A 1PG0A 1ITZA 1QSGA 3DXYA 2H18A 1E5VA 4JVNA 3R3XA 3T1QA 2DUWA 1F60A 2QN8A 2B4TO 2W6IA 3BB1A 4FQ8A 3T1YB 1PR5A 5AKHA 1T2AA 3LWDA 3CWQA 3UWDA 1QNFA 1VL8A 2J7PA 2JGIA 2PL9A 4U2KA 3C6YA 4EP1A 1U3TA 1JH8A 1IC6A 4GZ5A 2FR8C 3JQAB 3ELYA 3EWIA 4Z1MA 4ESOA 3IXQA 2GZAA 2DVMA 1PF7E 3FSGA 4WKCA 2IHJA 3PHIA 4ID9A 1APBA 2C20A 4C0WA 2HBQA 5IABA 2CSXA 1D2MA 5FWYB 1GTRA 4DB4A 1JNYA 5EZYB 2H9YA 3VOAA 3WO0A 2H08A 4LN1A 3UA3A 3MSCA 2V3VA 4BEBA 2OO7A 2QN2A 3INRA 3HCRA 4I55B 5T8KC 4D45A 2PZLA 2JHFA 1P2TA 3OUTA 3STWA 2PT7A 3E7XA 3STVA 4CTNA 5F98A 1D5WA 4MYRA 4BNJA 2BJHA 3GLHE 3HDHA 4UZSA 5B7NA 3SHWA 1X8XA 3K1AB 3QG5A 2B2NA 2G5TA 1NJFA 4ZYXA 1L4HA 2PRIA 1NBAA 4WN9B 3EOBI 4BO1A 1JH9A 3JZFA 4AUEA 3QFFA 5A4FS 5GJCA 1T25A 1ZINA 4AJEA 4G26A 2Q2VA 2WSSD 2TMDA 3A06A 3ITNA 1KYZA 4YGYA 3RVLA 2EKZA 2I2AA 3JQ9C 2BJVA 1WTCA 4ZQGA 1C80A 4Q0MA 3OOEA 2VUTA 5F7OA 4C2BA 4KLCA 3K5PA 4OP1A 2H2FA 4PTZA 2PGJA 3ROTA 3QEKA 5K0NA 1B43A 1C81A 5KNDH 3IMCA 4B3IA 3UXMA 3IP1A 5JY1A 4L7VA 4ZV4A 5CDGA 2A9RA 2CFRA 3BTSA 3KB1A 4ZO7A 3BZWA 1HE2A 4Y0AA 3BM5A 3QIVA 3OFKA 1W94A 1C7IA 3AB3A 3ZOZA 2Z5GA 3AESB 2ZWPA 3FW1A 3JVEA 1OFUA 3KKNA 4E31A 2H7YA 4I4NA 3QEAZ 1W9MA 2FW0A 5JD6A 1ABEA 1IQUA 1BQEA 1TCBA 2PTGA 1XA0A 3MRTA 1I3OA 2TS1A 1Q16A 3PQ2A 4H27A 4OFXA 2FU5C 1NMYA 3EIXA 3SJAA 1QVRA 1PT7A 1AA9A 3AP3A 3L0BA 2UXDB 4MHSA 4IFIA 2PKQO 4AJPA 1QJCA 4XOUA 3I5XA 3F1KA 3M81A 1NF9A 5HCUA 4G4JA 4TT3D 4KR9A 2XMGA 4ACAA 1JIJA 3S7TA 5JPDA 1CF4A 4G6ZA 4BQEA 5DKFA 1XE3A 2RGUA 4KQ9A 1V1MB 4I3GA 4TSRA 4UVEA 4UZEA 4ZT5A 1GCAA 2C58A 2O2GA 2NVUB 4ES6A 1N75A 4OD0A 1SR8A 1DX4A 2GPAA 3VO8A 1WJGA 1HDYA 4IYRA 4QYIA 1ECBA 2X86A 3HJNA 3WICA 1HV8A 4DNOA 1RFLA 3Q4GA 2I6QA 3TSYA 2PLAA 4BEJA 3M6AA 4S2UA 2IGTA 1YDFA 1N2EA 2X2EA 1SOMA 1U3VA 3WMXA 4BZWA 2ZT8A 3PI7A 1JWLA 1YRLA 4JU8A 1ZDMA 3UJAA 1II0A 1DWOA 1ACMA 1DIHA 3A3KA 2JFHA 3A2NA 1VHQA 2G7MC 3R3YA 4CN8A 3TJZA 1DQSA 2PPVA 1EI9A 2FOXA 2YJ3A 4UNIA 2XTZA 2HEIA 4I1OA 1PQ4A 1CZLA 2GILA 2CXNA 1PJSA 2ZSAA 3MINB 4ZQBA 2J5BA 5E38A 4BFCA 2MSWA 2X7JA 2J07A 3HKEA 3MQFA 3QVVA 2ERXA 1L5RA 1CIJA 4A0SA 3GK3A 3GJ4A 1ZO8A 4GBJA 5J63A 5IJZA 2HDHA 3JX9A 2D1QA 3G8DA 2AFHB 2I7XA 4WSOA 5TPZD 1LSSA 1QZZA 5DHFA 3REQB 2ONZA 1QWSA 3ONEA 4EY3A 2OBFA 3PX3A 1H6BA 3G8YA 4HCJA 4PYMA 1Z45A 2MMCA 5FOVA 5A7HA 3NTLA 3IVRA 3UAYA 1JGTA 5B1EA 1W581 2PD4A 2CFSA 2PTHA 3KSZO 4HGPA 4NRDA 4J0QA 4RVFA 2OMKA 4CFSA 4OEHA 4EUFA 4BNFA 3A6DA 1LF5A 5SZKB 1GNLA 1NN3A 2AXEA 2PZJA 2IHKA 1TVKB 1WVGA 3QKSA 4OMDA 4ZC8A 2HIGA 2JB9A 1FTGA 1Z0ZA 3DAGA 3GUHA 2OGWA 3KTAA 4BGVA 4DEYA 1GL9B 2Q1TA 1UC4B 1UZMA 2WPNA 5ALOA 4X94A 4V3BA 2J4FA 2V5UA 2V7UA 1HLPA 2JLQA 1SCUA 2GWRA 5JAPA 3EIOA 2IIQA 3JQ9A 3OEED 3BILA 5FNVA 4BRSA 3TRIA 2C2WA 1E3EA 1DP4A 1Y33E 2Q3EA 1QP8A 1FP2A 2FUEA 4QOIA 3UMYA 1EE9A 1JIVA 1H6CA 2YWRA 3ITKA 5FT9A 3AEUB 3AUSA 1NU6A 2VC2B 4HMQA 4B8WA 1RKXA 1VBMA 5KOHB 4OL0A 2OV2A 1E1DA 1KGSA 2GPJA 4KVFA 4K6HA 1DOAA 3GGGA 4FFSA 4DMGA 1B8NA 1OI4A 1CWUA 4EB6A 1KDOA 1JIQA 4Y0VA 4UVIA 4TVKA 2I2BA 4AZVA 5IM4F 1Y9JA 2WJAA 4QGHA 3FY4A 2R84A 1W5FA 2KMLA 2A84A 3T9AA 2GDZA 2A59A 1L7NA 3GFSA 3CLVA 5K8CA 5TC4A 3SF8B 1YCFA 3TO5A 3K70D 4F93B 1SZDA 2R11A 2CHUA 3QU5A 5D1NA 2ZR8A 5FRDA 5EXPA 4A6PA 1RI3A 2CHVA 1NQXA 2YWXA 4Q4AB 4YN3A 3EXG1 3COYA 4MR7A 1I51A 5BT9A 2A57A 4F7DA 1UJMA 3CF2A 4Q93A 3W05A 3OE1A 4X8MA 3ZJ5A 1I1QB 1IVNA 1A9OA 1RXVA 3SHQA 1Y8AA 2GX6A 5BP7A 4IDAA 1ECCA 4IMIB 1WA5A 4PZYA 1KP9A 1P4GA 2YMQA 3X43A 2WAOA 1V2HE 4RW0A 4YUWA 1G9SA 2NADA 2UKDA 2ZUFA 2REQB 1E0SA 5GJVC 3FNQA 1Q0UA 4GOXA 3X2FA 3DMTA 5HZKA 2NXEA 3EPJA 2IHYA 1GITA 1M6EX 1Q1GA 3HRKA 3LOPA 3GNLA 1EFDN 2C2KA 3GDGA 2LDBA 1IN5A 3MLEA 5H4HA 3KWMA 3UJCA 2DEUA 4GNKA 3K2BA 3FR7A 3TIVA 2QRHA 4LA4A 2JGMA 3EOAI 3TLGB 3E22B 4BV9A 2ZI9A 1XTPA 4FGLA 1PNOA 5F4BA 4G09A 3VKWA 3DYVA 1ZLYA 2IL1A 2KQUA 1KJNA 4QPZA 2QMQA 4C0QC 3A3YA 4KE9A 2OO5C 1E92A 3Q7RA 4URUR 4S1TA 3WHKA 4QNNA 5B1IA 5AT1A 4AJIA 1RI4A 2NAPA 4M36A 4EJSA 5K7SA 4TXLA 9LDBA 4NY1A 3NIDB 2EQBA 4C87A 5ALWA 2VPXA 4MWTA 1E9CA 5IANA 4RIEA 4UBJA 5JC8A 1GWNA 1ZOPA 4LE0A 3DEKA 2COUA 3SK0A 3U3JA 1NNSA 2UVDA 5CVVA 1EM8B 4IGAA 2C9YA 2IXFA 3MBKA 3Q7IA 4L8WB 4LY3A 1BE1A 4JEIA 4MUBA 5EKTA 1ZGBA 3LBNA 3KEGA 1SUEA 4ZGGA 4PLHA 2Q5IA 1A3CA 3DCNA 3GGPA 1CCWA 5CX4A 1Q6YA 5HKAA 4NEQA 3A36A 5GOTA 1EWVA 4C4RA 3G2OA 1Z2EA 2O50A 4YP0A 4HAUA 5FO1A 3HB9A 1G63A 1WUKS 4MPTA 1LLFA 4F5EA 1PIWA 2IHBA 1Q0HA 4YRCA 4WBNF 3L8ZA 1RQLA 4EPTA 2TMYA 4B2YA 3KU1A 4U2EA 3SQXA 2HMAA 2XJ9A 3QXCA 1G8AA 1WWKA 1X7YB 4LSMA 5SYMA 3TM5A 5M29A 2P3LA 1E5DA 3MLAA 1HKHA 3UV3A 3EPHA 3AINA 3LYLA 2RGRA 4PF1A 5CPFA 2H2HA 4YP9A 1M2NA 3WZLA 4PWZA 3V46A 5JZBA 2E6KA 3LA6A 2IDZA 4PS0A 2AN5A 1BA2A 4LVOA 1F51E 2H5JA 5AHWA 2XVXA 3KEOA 4IDFA 2DY1A 7MHTA 3HP1A 5H9VA 5JZ9A 4A8TA 3T9CA 1YZGA 3B6ZA 1E1LA 1SM4A 3IMKA 3EFOB 1KEEB 1LB1B 2JIZD 3N87A 4FMDF 3H2HA 4B7UA 5M5BA 2Q2NA 1FP6A 2DJ5A 4L08A 3FWNA 1YA4A 3OCJA 4FEYA 2PKRA 4NP6A 3AVOA 1K66A 1SRRA 1MOSA 5CP8A 2RMKA 2ADFA 4XFKA 4A0RA 3L8MA 3P97A 3PA8A 2BMEA 4MYSA 4P4SB 3ZI4A 2PRKA 3L40A 4MLDA 4PZUA 3KQTA 4DT1B 5BN4A 4OK6A 4URWR 3L93A 2PCLA 1KAEA 1ZSVA 2BSXA 2IQ5A 1JLSA 1VG9B 3F5FA 3KYDB 2YHBA 3FKJA 3JRXA 4NARA 4QXRA 5IFKA 2R8YA 2Y0EA 4HQKA 3CU5A 4YQFA 1XZQA 5LA6F 3BORA 1N92A 3GF4A 2H1HA 1U0RA 1WDKA 4FLEA 1XNJA 1C3OB 1S2GA 1POWA 1SIOA 3KJHA 4Z5XA 1RZRD 1VCOA 4CHTA 2NPOA 2D62A 1HSZA 2A94A 4F6RA 4TMKA 3X1YA 3MG9A 4EI7A 1X7WB 2X8BA 1EZ4A 1TA4A 3GROA 2BKLA 3EA5A 2RHHA 1HF3A 9ABPA 1TT5A 3SFZA 2H0AA 1SHLA 4JJ6A 1PO7A 3MWKA 1DPGA 1JFSA 4MVJP 3KSDO 4IQ4A 4EJ0A 2FUG1 3SIPA 3ZWDA 5FWXA 3FM9A 1GA4A 1SUPA 2QL7A 2ECKA 3EH2A 3A4TA 3FBTA 4IJ6A 2W6ZA 2XGGA 4MV0A 4OHPA 3VYSB 3UV7A 2H1LA 4GWGA 4AB1A 1USIA 2QR5A 4TM7A 2G5PA 4OHCA 3JQAD 1E2MA 2IJGX 4RLHA 4AG6A 3EIUA 4JI1B 2MDTA 2CJWA 4MVJH 1YVPA 3EJWA 2D7JA 3BGIA 2EFDB 5DLDA 4JI2B 3DOOA 3WLEA 2ZR9A 1VHWA 3B1XA 1N3BA 2VJOA 3MJSA 4BIMA 5BN3B 2AFIA 2QTVB 4NU5A 1Y4UA 3JALB 4WOBA 3BFXA 3G17A 1V7CA 2E49A 2DECA 4PHHA 4EHHA 3EZXA 1G2OA 4OYLA 4PR3A 3RU2A 3ICVA 3P0JA 2WF7A 2PGIA 3QKIA 4J16C 3Q3GE 2C96A 3WQHA 4AAYA 4EOGA 1KIAA 2C94A 3OSZA 4HR7A 2EP7A 2NUPB 2ZUTA 1YK0A 2HGZA 2HPVA 3F4KA 3F6RA 4PC2A 3DDHA 4TKLA 2V74B 4UUMA 2DFVA 3HBMA 3ND5A 4CLOB 1GU0A 4A73A 4C7BA 3GRCA 3V8BA 1FLDA 4HDRA 3O73A 2ZRMA 2EZTA 3C3MA 3H13A 3VJKA 3ZCXA 3W8EA 4DMCA 4TRRA 5ESRA 5B1SA 2FRXA 4IIFA 1K7YA 3WNCA 2D1SA 3PX2A 1MOZA 2ZJBA 2YYAA 3A4YA 4KBGA 1TGYA 5BOSB 1D9ZA 3MD9A 4TZTA 2VNJA 3EC2A 1XU9A 4FCCA 1FRQA 1H1TA 2FEOA 2G1KA 3OI7A 3GNQA 2PX4A 3IAXA 1AQLA 3RREA 2Q6VA 2A7XA 2BZ1A 5LQRA 4EHFA 3W5VA 2VF7A 2BGRA 2V5VA 4EUHA 1ESEA 5JT1A 1FNNA 4FS3A 1I2MA 3CEHA 2C07A 1DMSA 1H0KA 1X2BA 5ECWA 3ZBTA 4BWGA 2D74A 2CLIB 1T1GA 1XMIA 2J3MA 3GFOA 5T6MA 2M6LA 4CG1A 4ZZIA 2HHLA 1VJRA 1OWMA 1OWOA 1QHNA 3LF2A 1IVSA 1LRKA 5DJ5A 2VWPA 1RXSA 2ZTMA 2Q1WA 2Q4OA 4XB6B 4YDHB 2Z5FA 4HQRA 1U1IA 3GBVA 5BR8B 3RV3A 4GYWA 1QFSA 2AT1A 1AGPA 3UK0A 5NULA 1B6GA 3NCTA 3B53X 3W7BA 3K6SA 3SDZA 3BSWA 2HF2A 4K9KA 2OTCA 4H08A 4OU5A 3F78A 4BO4A 1XV5A 2OV4A 1JB9A 1LY1A 2BMVA 3SJ7A 3W06A 3EFEA 4D26A 4WVFA 3WR5A 1XRJA 2I3ZA 4B2IA 1SBQA 3RRJA 4M98A 2QAGA 4FX5A 3ULKA 4GI5A 1GKYA 3VC7A 3B3GA 4D3FA 4ERXA 4RESA 5LP6F 1HT3A 3F3YA 5ES4B 3A6PC 3UAOA 3OCWA 1E6CA 3WQQA 3H4IA 1VHLA 2R6GA 1W4RA 1ZI9A 1UM9B 1DZ3A 2SHKA 3FYUC 4DCCA 4ZYVA 5JDCA 2HKIA 1MU0A 4PO1A 5EKUA 1QZTA 1FLAA 3KJQA 4AX4A 3D4IA 4IXTA 1EK6A 2Z8YA 1Y4ZA 4B80A 2OBMA 4GKBA 1KOGA 1N9GA 2OAGA 2XT6A 2ACKA 1UKBA 3HVJA 3EVBA 4DR6B 1R0LA 2DF8A 2HCBA 1F2TB 1V96A 1JHZA 1G8MA 3R0XA 3UN1A 2O2IA 3DEJA 2OR3A 4U7HA 2V0GA 1H1LB 1N2CB 1SXIA 1ADJA 2PT5A 2XKJE 3Q12A 1ZSYA 5E4JA 4MRMB 5EMKA 1YZLA 4ZV9A 4E32A 5KHAA 2M1ZA 4LJKA 4PFKA 4DDVA 1R5NA 4PLVA 1CEEA 1J0XO 3T7KA 5DDIP 2NX2A 1NKTA 4QRIA 5GV8A 2WIGA 1QQAA 4M53A 1NJSA 2WT9A 3PTAA 3D1JA 4ARAA 3VPBA 3E84A 1SNYA 4ZYWA 1PR2A 2QNBA 2A4KA 3I2JA 4LGMA 2JGKA 2JK1A 4J1TA 1IY2A 1T8RA 2ZYWX 5CCEA 1KMIY 3AFOA 1GG9A 1QJ4A 3AQ4A 3KOOA 2ZIFA 4JIMA 4DLTA 3SYMA 2WPDA 3EZNA 1K7EB 4P3KA 1LS6A 1KR2A 5DTQA 3AETA 1N77A 3EDCA 1QC5A 3T5MA 1PJLA 1SA0B 4W9RA 1USVA 3LYAA 1PZHA 1TXGA 1RPJA 4L2IA 4RVUA 5EIBC 3UCFA 4B87A 2XOXA 1DGQA 3L8FA 5EIBD 2WWYA 4RBNA 1JVBA 2PQ6A 3C15C 3L4EA 1HTBA 5ALZA 4LJYA 3ESDA 1DEXA 1NMQA 3AWIA 3N2LA 3WE7A 2XYQA 3NJ8A 1IZYA 3TW8A 3M2PA 5L7WA 2Q4BA 1LJLA 3P9NA 1GQSA 1RRFA 1JR3E 4NENA 1PWZA 2YH2A 4Q1EA 4F9TA 1YI8A 3UGJA 1ZQ1A 2ZWAA 4MKIA 1AUVA 1XLTA 4AZWA 1NFRA 1YA6A 4YXFA 3ZWVA 4B7AA 2VRCA 1B2LA 1S4QA 3N8GA 3RSSA 5LLTA 3IQGX 4XLLA 3H2ZA 4BFZA 4MVJD 1DDGA 3OJLA 2BSAA 4PBRA 2VF2A 1TVKA 1UDBA 3UW3A 4OLAA 1ZGCA 4UCFA 3COPA 1M6NA 2EARA 4K9OA 4KQ6A 2BKEA 2ZRPA 1MNAA 3PNPA 4C6HA 4DRXA 1B15A 1DEHA 3FFXA 1NF8A 5K3EA 4UHEA 3MA0A 2BBSA 3LWZA 4IUDS 1NLFA 1BX0A 5KU7A 2QT0A 4P7KA 4TMFA 5SYNA 3UKOA 5BNIA 3W5AA 1NDQA 5GM2A 3SHFA 1IIBA 3JD3A 4WACA 1GG2A 5GTDA 1E4EA 3ZJUA 4ZVVA 5TT1A 1IUPA 4K9PA 4GSYA 3IALA 3OO0A 3MVEA 4AJKA 1N6OA 3PUIA 3WAJA 1SU6A 3U3OA 3UMSA 3G2IA 4JI8B 3OJEA 3UCXA 4RIIA 1A04A 1GR1A 4IEIA 5I48A 1P75A 5JNWA 4KQIA 4MQBA 1JG3A 1P9WA 3FUTA 4CQJA 1Z0AA 1TZ2A 1CFZA 3J81k 4Q21A 5HBGA 3TSCA 1J1IA 1OT5A 3PXCX 4I1RA 4IQFA 2O8CA 2P2CA 3KLBA 1FVXA 4Q9HA 3V2IA 3HPQA 1E8MA 4R05A 1U7HA 1ZW6A 2WWGA 1MQ8B 3DAHA 2ZYAA 3DXXA 1CR1A 3GLQA 3IBFA 1P1HA 1KFBB 2HREA 3KOXA 4W9NA 2ZYSA 3DOCA 3R8CA 5F23A 1XTJA 1D2NA 4Z7JA 3WJ2A 1BU8A 3NO4A 3RYCA 2DXIA 1EHYA 4IVPA 4E15A 2QD3A 1M1YE 4A16A 3FX2A 2K7ZA 1GZHB 2GHQA 5AK3A 5T4HA 3GCGA 1ABFA 6CHYA 3R0JA 5D84A 1NP6A 1HE3A 4F8JA 2ZIUB 1GGJA 2QZSA 3ZHRA 4HWTA 4RM2A 1IUNA 5EWMB 3FLEA 4V2IA 4DR1B 1C9EA 3VPGA 2PG3A 2VYVD 2VYQA 3ABSB 3CWZA 1V5IA 4AKGA 1CQPA 2DUMA 1I33A 3UPTA 1DEOA 4IILA 1JDVA 3HADA 1LQ2A 1PFQA 3AUUA 4LMRA 4HGZA 3FNGA 2BRUA 3QMVA 5AVXA 2A92A 3OF5A 4HUJA 1U8XX 3FVVA 4WCFA 5EIAA 2N47A 2D2IA 1WHTA 3P20A 3N74A 1QKKA 2IUEA 1D2GA 3AEXA 4N3AA 3SZRA 3F5SA 3OMWA 2CLKB 2BEVB 2FEKA 3B2NA 3CN7A 3F8WA 3FGOA 3ZU3A 3I1FA 2H11A 5KQPA 1HI9A 1VL2A 3H2SA 2AOUB 3P8ZA 4LC1A 4Y9TA 4Z4HA 1QX4A 5HR5A 1E0KA 2B4AA 3KOMA 4IWYA 4B3JA 4GXNA 3FPCA 3TMAA 4IDNA 4QEKA 2FTKE 1AS0A 3G85A 2FF5A 2JCVA 3C3AA 2I4NA 2ODWA 3K9HA 4NCIA 3RNOA 5BY2A 3DDOA 4CKCB 1D1QA 2JGNA 1CQWA 1MX5A 1IHOA 1OGYA 2WUDA 2ZWVA 3LH5A 1OB5A 5KSPA 2DUNA 4YRZA 4MLPA 1T9AA 1HZZA 5GPBA 2O7QA 5KJCA 4HAVA 2DM6A 3HKDB 4PLPA 4L5YA 4N7MA 4IP0A 2VP4A 4CM9D 2GM3A 2XXAA 4EZEA 4FHEA 1K6IA 2HDOA 2IP2A 3RC7A 1PJ4A 2HPHA 1G5HA 2P9EA 1S8OA 1U2DA 3OJWA 5MF6A 2IXDA 3E1KA 1YVRA 3Q2IA 1QAMA 1GTMA 1R8QA 5HJ5A 1Z6XA 3L4JA 3FIJA 4E2FA 3TQHA 4G67A 1WPGA 1Z8HA 3ORHA 3K70C 1RRMA 2YZ7A 2CNDA 5I5GA 3H9QA 5IAOA 2JK0A 4JQYA 4H7DA 2HTEA 4HAWA 1FUEA 5AW3A 2YXEA 3E5HA 4P0PB 5FWNA 2PUCA 2DTDA 5FJIA 5AOAA 2C7OA 2K7FA 4E4RA 1I6MA 4F2PA 1CUEA 4HNVA 3LQFA 5IBQA 1TUBB 2O3UA 2OHOA 3TD9A 5BUCA 3M9LA 2NACA 3P2YA 5AKXA 1URPA 1CJVC 2RHRA 3CUVA 2DQ4A 2GEVA 2J32A 2PBZA 3EQ9A 2V97A 3ONFA 4Y1FA 5ELXA 5B3JA 3PDCA 2CMKA 5LQNA 5BUQA 1C1DA 5JSZA 4RTLA 3BPSA 3GLGA 3HO6A 4FMCF 1Z08A 4AY2A 2XBLA 1P45A 3D81A 4L07A 4DQKA 1JDJA 1YHYA 1TF5A 3SVTA 1E60A 5DPMA 5IASA 3OZIA 1VCIA 2WIBA 3NEAA 3OJFA 4UEQA 2O4CA 3AF3A 2A5GA 3V1KA 4H2DA 2ZAYA 1F8FA 2P9JA 1T9KA 1KTIA 4P7BA 1F0PA 2IYYA 1GZ4A 4ZC1A 4WNIA 1ORTA 3JV7A 4P93A 2F3QA 4JT8A 2XSZD 1DT5A 4OA5A 4J1SA 4ZRMA 3ZHQA 2YWJA 5K0GA 1N0WA 2OYRA 1ABBA 1O89A 4PFJA 2QTRA 3UQYS 2RGYA 4A2CA 4CTKA 2JHGA 4EHIA 1ZJ4A 4GR5A 4QPJC 5AOCA 2YJTD 4JI7B 2W4IA 1DDOA 3TAUA 4QGFA 3SE7A 3AERA 3NPMA 5DP2A 4KYVA 5KOYA 5EXEA 2OILA 4H4CA 1PVVA 5CB4F 3DVLA 1GA1A 3HCOA 3ZGNA 3R5XA 1ZM3A 3L7JA 4ZJYA 3WL8A 4DRYA 7ABPA 4F11A 4XUEA 1QRSA 4LJAA 4YJ3A 2PM8A 2NVWA 1L4FA 3ELWA 3DGFC 3OFSA 4LDJA 3HPRA 3SCZA 2Z4SA 4IVQA 3E9NA 4ARUA 1A8UA 1R6TA 1FTWA 3HNOA 1FVFA 3K0HA 1EX1A 1OQAA 4FEGA 4HZUA 4K3VA 4NJEB 5GGXA 1RHQA 3SQMA 1QUEA 2DBYA 2Y99A 1C5KA 1QOQB 3AR5A 4NTZA 2H4JA 2YFQA 3MYRA 1L8LA 1GDDA 3BMXA 1UBEA 2XITA 3DBVO 3VVLA 3MFQA 3OURA 2H48A 1TVMA 4JNKA 5ALQA 1ECJA 4DABA 4KRFA 1QRRA 5ELLA 4LJRA 5C34B 4HNTA 2BCGY 1Y89A 1H0RA 2QJOA 2RC6A 1U8AA 4ZJZA 4S05A 2BLLA 1ZITA 4B2LA 3IE0A 2RI1A 1BEUB 1SCNE 1UOPA 3DBRA 5SZIA