3ICPA

Crystal structure of udp-galactose 4-epimerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
295
Chain Sequence
b'MRIVVTGGAGFIGSHLVDKLVELGYEVVVVDNLSSGRREFVNPSAELHVRDLKDYSWGAGIKGDVVFHFAANPEVRLSTTEPIVHFNENVVATFNVLEWARQTGVRTVVFASSSTVYGDADVIPTPEEEPYKPISVYGAAKAAGEVMCATYARLFGVRCLAVRYANVVGPRLRHGVIYDFIMKLRRNPNVLEQRKSYLYVRDAVEATLAAWKKFEEMDAPFLALNVGNVDAVRVLDIAQIVAEVLGLRPEIRLVGDVKYMTLAVTKLMKLTGWRPTMTSAEAVKKTAEDLAKELW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal Structure of UDP-galactose 4-epimerase
rcsb
source organism Pyrobaculum calidifontis
molecule tags Isomerase
total genus 106
structure length 295
sequence length 311
ec nomenclature
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3icpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3icpA02
1VL8A 4X54A 4N5LA 1NVTA 3LT4A 4IDEA 1NQAO 1HEUA 4PIVA 4ZRMA 4BKUA 4CL3A 3C85A 3ZWXA 1LDGA 2Z1MA 2Q45A 2FPGA 4PG5A 4E5YA 2IODA 2PGLA 3PEFA 4I5FA 4UEJA 4CM8B 5BNIA 3RUCA 1GQQA 4BKRA 1HXHA 1OFGA 4FJ1A 4CLHA 4CM7A 4ALJA 4CR7A 4PG8A 5A5EA 4MVJH 2GSDA 4YVFA 4D0RA 3FBGA 4PZDA 2RBEA 3PIDA 3KOUA 3HJAA 3UAGA 4R51A 1SO8A 1Q0HA 1TB4A 3OJ0A 3QWFA 5A05A 5JDIA 4CLOA 1DJQA 4Z9YA 4H3VA 1KVRA 4QFDA 3ZWBA 4QT0A 1U3WA 1IUKA 1FJHA 4CM6A 1PS0A 3OHSX 1E77A 4DC0A 2BF7A 4GWKA 3WYBA 1Z45A 1HT0A 5FYDA 1Y5MA 3Q0EA 3IIEA 5DZSA 2AEJA 4L4XA 1JLLA 4FFNA 3RJ5A 3LF2A 4LCEA 3VPSA 4YPOA 5JY6A 1VI2A 4E13A 3O26A 3QLJA 1WDMA 4ALLA 4C7KA 2XPCA 3N58A 3KVOA 4QQRA 5HS4A 1VL0A 2PZKA 3L0DA 4MDHA 2X4GA 1NXQA 3PHIA 4EYEA 1ORRA 5BR7A 1ENPA 1V6AA 2ZTUA 1TT5B 3GZ4A 4PVDA 3WGGA 1D4FA 3F5SA 3SC4A 1KVUA 3UGKA 1JKFA 1GADO 4QFCA 3DBRB 4RZHA 1N92A 3FWNA 4YT2A 2X58A 2HQ1A 3WB9A 1ISIA 1NR7A 1YB4A 2E48A 3MWEB 4HFJA 1HDOA 5K6AC 1CWUA 1FDVA 3W6UA 1QG6A 4PGFA 4BMNA 2JD2A 2YHUA 4ZVVA 4W7IA 5C7LO 3ZU2A 1DAPA 5LC1A 2GCGA 3C7DB 4BO9A 4PLFA 1GCOA 1C1XA 3B1FA 4MP3A 3ZW8A 5L3ZA 4XRGA 2AQHA 3L4SO 4I08A 1ZK2A 1BXGB 4E2XA 4BNXA 4AJ4A 1R0SA 2EG9A 4K1LA 1EUDA 3MZ0A 7MDHA 5IDWA 1P1KA 1PZGA 1AGNA 5JAZA 1C0PA 2Y0EA 2VZ9A 4RF5A 5JCXA 5JAIA 1EZ4A 4NHEA 1BVRA 1CDOA 1Y6JA 1N9GB 4M89A 4KUGA 3GY0A 3TRIA 5L7WA 1ZMOA 3E9MA 3H5AA 4YT8A 3DBHA 5KVSA 1K89A 1YWGO 3TOZA 4ND5A 4WASA 3U4CA 3CUKA 5EESA 3VZSA 3D4NA 3GDOA 3LDHA 3PZRA 4YAEA 3ZZNA 4BNIA 5L45A 4YT4A 4J6FA 3TDKA 1KC3A 3KXDA 5KVCA 2RH8A 2SCUA 3NT2A 2QHXA 3ONDA 2EKPA 3QWHA 1ISJA 4FFOA 3EVTA 2V6GA 1NQTA 1OC4A 4YXFA 4W6ZA 4J7UA 2W2LD 3JQGA 3I9KA 1V3TA 4ALMA 2BFOA 2RAFA 5JCJD 1Z7EA 1DFIA 1DJNA 2OBYA 3OFSA 4YJDA 3B70A 3V1TC 5DNAA 1OBFO 3CH6A 5JPIA 4TRNA 4F6CA 4ALIA 5JO9A 5TJ9A 2AE1A 4GPD1 3OM9A 4D0SA 4RO0A 4OKNA 3A1NA 3PQDA 2HU2A 2I67A 4IJKA 3MJ4A 1JAXA 3EGOA 2X9VA 4R9SA 5ITWA 3V5NA 1SZJG 4IQ8A 1HLPA 5AYVA 2Q49A 1ZJYA 2QRJA 1HYHA 3WGIA 2E37A 4LMRA 3PWZA 4JCOA 2J8ZA 4IM7A 4Q3CA 1YB5A 1PJ2A 2EERA 5F3RA 1XR3A 3QP9A 1A72A 1DOHA 2QRKA 1VSVA 1Y1PA 2W2LA 1PJ4A 2WYVA 4TWRA 5JCJA 1AHIA 1PWZA 1H2HA 3RI3A 2HRZA 1U28A 4D7AA 1VPDA 4Q3DA 3VH3A 2HMWA 1R4MA 3SX2A 1J6UA 1KY4A 3TNLA 2NACA 4FJ0A 3U0BA 3I83A 3DZBA 1NHWA 1ZW1A 3ZV3A 4CMCA 4DL9A 1R16A 3DONA 5A9TA 3EUWA 4I1IA 3QVTA 2G5CA 4C4OA 4IIVA 3HG7A 4DIOA 2J3JA 4EBFA 1QYXA 5A4DA 1QV6A 4IZIA 1E6UA 3WJ7A 4EI2A 4NBVA 4CMHA 1DRUA 4BGEA 1K6IA 4J1TA 3OF2A 4ZQHA 3GN2A 4IDBA 2BI7A 3ETGA 4WE3A 1E7YA 5A02A 3DZKA 5I9MA 1W73A 4E12A 1P1IA 1PL6A 2ZJ1A 3ITDA 4GX1A 4OJNA 1NX6A 1GZ4A 1VM6A 3RAJA 5ENDA 4DLBA 4GL4A 4BV9A 2O7QA 2RHCA 1IHXA 3F46A 2B0JA 1ZSVA 1EE2A 1XDWA 4ND1A 5MGBA 3GGOA 5DOVA 2GD1O 1E1MA 5IFLA 3I1JA 2AXQA 4BNWA 2PD4A 1PZHA 2WEKA 2HRBA 3JQ9C 5CDTA 4WJZA 4CQLB 3PYMA 2Y99A 1EK5A 1GEGA 4A73A 3MJSA 2FY8A 1YL7A 4U5QA 4XB2A 1YBAA 3WTBA 2Q1SA 1EE9A 1ZZEA 1I3KA 1ZH8A 4LGVA 3PHHA 3PXXA 3PK0A 3LT0A 2CVQA 2EW2A 1PGJA 1AE1A 2B4QA 1E6WA 2YQ5A 2P68A 3QRWA 4QO7A 4TSKA 4GKVA 1U9JA 2FPPA 3PYLA 3VH2A 4CMIB 3VDRA 3PQFA 4YB8A 4Z9XA 3LLSA 2HJSA 1BHSA 4EGFA 2PKQO 2E49A 1X14A 3Q3CA 4J1NA 4LSMA 3FBTA 3ST7A 3QQPA 4NH4A 4I9NA 5AOVA 2Z5LA 1GQYA 3Q1LA 1PS9A 3KB6A 4WCFB 1N1GA 3RUDA 3G17A 1XQ6A 3LYLA 1HDCA 3WWZA 3ADOA 1BW9A 3ROMA 2EW8A 3WXBA 4BNZA 2Y0CA 1MC4A 1V0JA 4XYEA 4B3IA 4DRYA 2CZCA 3VDQA 4BQRA 4J9UE 1NWCA 3I23A 5DBIA 4QECA 4WECA 2Q4EA 4BNTA 4OXYA 3FR7A 4L76A 3MTJA 4P4NA 4WPGA 4HFNA 3L6OO 3CEAA 3RKRA 3RBZA 3SXPA 3I6IA 9LDBA 4RVDA 1GZ6A 2DFVA 1ZK1A 1XSEA 3WICA 4Z0PA 3EAGA 1I2BA 4PN3A 4NJMA 4XIYA 3WMXA 1XYGA 1GV0A 3TZ6A 1MXHA 2NTJA 3LC2O 5GZ6A 4BKQA 4C7JA 5H81A 2C7VA 4WCDA 4XCVA 2ZCVA 1HTBA 2JFFA 3RU9A 2A92A 2ZKLA 3DOOA 3WWYA 3ICCA 3ASVA 3CMCO 4I9HA 4TVOA 2EP7A 3X2FA 4MVJP 2POQX 4G81A 3S2EA 5HM8A 1PJ3A 3U4DA 4Y6SA 1KEUA 1NAHA 4XGIA 3GA0A 4DIBA 5CEJA 3KLMX 4DTIA 3GNTA 1ID1A 1ZJZA 1T25A 3DMTA 3PWKA 1YQXA 4R3WA 3WG9A 1XKQA 3I9JA 2FN7A 3E03A 1RPNA 3F1KA 4E6PA 2DLDA 3P2YA 1B8UA 1CERA 3AJRA 1OI7A 3I9OA 4IZHA 5CEEA 4OOEA 4PFJA 3BMOB 1P31A 4QX6A 2OORA 4HXYA 2E82A 4GVLA 3CIFA 1U8XX 4OO3A 4BO0A 2YFQA 3DBVO 1E6EA 1RKXA 3K2EA 3OH8A 2O3QA 3NTQA 4GLLA 3PQEA 4M55A 2ZYDA 4BGIA 3AM5A 4WNCA 4PLPA 1XIVA 3HQ4O 2AA3A 2O23A 5HBRA 4DBZA 2WMDA 2GN8A 3TF5A 5U9CA 1RYDA 4IDFA 3IS3A 3TZKA 4CM9D 3GAZA 2RH4A 4UUMA 2D5CA 4MP8A 2GNAA 4OXNA 1QSGA 3M6IA 4IQGA 5TRTA 1U3UA 3E5MA 1XLTA 3VPHA 4RCVA 1UXJA 2HMVA 3ZHYA 2DTXA 5IN4A 1LLDA 3ICPA 4R5MA 3L77A 2R6JA 2AHRA 2Q4BA 4UAGA 1UZLA 3H6KA 2DPHA 3AU9A 1G1AA 5U1PA 1T1SA 4EW6A 4OSOA 2PY6A 4AJLA 1B7GO 1UUFA 3S2FA 3GH3A 1GDHA 2YV2A 2LDBA 4Q3NA 4J2HA 4DMLA 4U0KA 5CPBA 4HX5A 3EHEA 5G0UA 2PGDA 5A9SA 3HWRA 5DCYA 1AHHA 1GEEA 1ZCJA 3ZV6A 2VZ8A 4CM9A 3GFBA 2YHIB 4WNIA 3DXFA 1XWFA 3NT5A 2VWPA 2TMDA 3PJEA 1NVGA 3N7UA 2ZYGA 4R5HA 1PR9A 4MO2A 1Y8RA 1U4SA 2I9PA 5U4QA 3KHUA 3TJRA 3DDNA 1HYGA 1QYDA 4RPJA 5IF3A 2X5JO 1Q2XA 5TS3A 2GLXA 4R16A 4KQXA 3INGA 2HMUA 4BO1A 1M75A 1Y9AA 2D59A 1WNTA 2G76A 4PLWA 3GRPA 4J4HA 1KIFA 4J91A 5T5QA 5GZ1A 1DPGA 1U3TA 2Z95A 4XWYA 3IC5A 1ARZA 1JW9B 2O50A 5CHEA 3UOGA 4GH5A 2C54A 4XA8A 3G0OA 4GGPA 3A06A 4DXHA 4BUCA 2ET6A 3E48A 2O3SA 1JA9A 1IZ0A 1V3UA 2P5UA 4CMEC 4BNKA 1U7HA 2UUPA 1U8FO 2YDXA 1LA2A 3WX0A 2PD3A 3W8EA 2CVOA 1C0KA 2RHRA 4MKZA 5KCZA 2C7GA 3OIDA 4BNMA 3WGQA 4YRBA 1DXYA 3W4KA 4XQ9A 2P4QA 2BFPA 2DC1A 2NU7A 4Q3BA 5JC1A 1HLDA 1C1XB 6ADHA 1PJLA 1SEVA 3AI1A 5L4LA 4CMKA 4HKTA 2JHFA 3MOGA 3W8DA 4UEKA 4MJLA 5JO0A 1MV8A 4M1QA 4RF4A 5DBGA 4CM4B 2ZB7A 4GQAA 5KVQA 4DYVA 4BOYA 1B14A 2OFPA 2P9CA 1NNUA 1QKIA 2J6IA 3GNQA 4BNGA 2X0NA 2VZ0A 2WSBA 2J3IA 4O6VA 3PDJA 4D43A 4K28A 3D3WA 4ONEA 1X7DA 5B4UA 3AOEC 1HDRA 3HNPA 2CD9A 2XAAA 1YRLA 4R1TA 3R3SA 4OOFA 4W99A 3PVZA 1EQUA 2YV1A 2DFDA 3FF4A 1YJQA 4LK3A 1NYTA 1N2SA 4WCFC 4MVJF 2E6UX 3VVCA 1X1EA 1WDLA 1H6BA 3GUYA 5F5LA 8LDHA 3JQBA 3JQFA 3I6QA 3DMYA 3U9LA 3M1LA 3PHLA 3AM3A 3WNVA 2UVDA 2BGMA 1P1FA 1Y8QA 4AICA 2BLLA 3MTGA 1PSDA 2Q2WA 2BH9A 4FPXA 3UHAA 5LDHA 5DDIP 3BTSA 4R9RA 1ZSNA 3MOIA 1M67A 1GCUA 2FSSA 4W4TA 4LRTB 3GF4A 1T2DA 2HLPA 3DZIA 1PWXA 3O38A 4CUJA 2Y68A 3CZRA 4KWHA 2FP4A 5COQA 2NNLD 1I3LA 2D0IA 2Y0DA 2JJYA 3O9ZA 4B7UA 5G0TA 4LW8A 3KYDB 4DVJA 3DHEA 3RBXA 4A27A 2IYPA 4L73A 5KOIA 5G0SA 3UCFA 5JYEA 2Q3EA 3MWDB 3BAZA 2W98A 5JDCC 2RIRA 1LSOA 2ZTMA 1N7GA 3IAHA 2PKQP 1LU9A 4YJFB 3WGOA 3H9UA 3TQHA 4O63O 4FR5A 1RM5A 3CPSA 2PZJA 5TJHA 1H2BA 1O5IA 2PR2A 4KTTE 2J5QA 3GVCA 3GEDA 4ALNA 1I8TA 3U4IA 1FF9A 2QIOA 2P4HX 4FFLA 1NPTO 3I4CA 4CQMD 1I01A 3VKUA 3WGHA 1H6CA 2JAPA 4FGWA 5L4SA 2ZATA 3E1KA 1NAIA 3SLGA 1GV1A 2Y1DA 3A4VA 5FI5A 3H8VA 3EMKA 4GWGA 4WUVA 3PYXA 1ZFNA 2X86A 3W4IA 4OQZA 5I8WA 1IZ9A 4AJHA 2CF5A 2GYYA 4IDDA 3GFGA 1HE2A 4II3A 1B8VA 1HDZA 4ZHSA 2QYTA 4XJSA 5ER6A 4MIYA 3KO8A 4JX8A 1EFKA 1Z73A 3D4OA 3K96A 4TQGA 3B1JA 4PG4A 1UDBA 5JLAA 3NX4A 3WSVA 4XDYA 2Q2VA 4IS3A 4WOJA 1P0CA 2X23A 2B4RO 3ZHZA 4IXTA 1SMKA 3ULKA 1LBEA 4S3MA 3GMSA 5HWSA 2B5VA 3DEYX 4KUEA 2GZ1A 4AJ2A 3WTCA 3ZU5A 4CQMA 1EUZA 2NLOA 3F4BA 4NIMA 4Z3DA 2NVBA 4EZBA 1KYQA 2GUGA 4ESOA 5C7IO 1I0ZA 2C5AA 3H9QA 4U8GA 2XXJA 3S1LA 4OXKA 5IN5A 4OYRA 1BDMA 4INAA 1LRLA 3GEGA 5CDYA 4UVIA 5KWEA 5JAMA 1WXDA 3H2ZA 2PLAA 5ILGA 1QYVA 4E33A 3ETEA 4RVFA 3BIOA 1T2EA 1TXGA 1FMCA 2X0JA 3KV3O 2VWHA 4XQEA 4BGUA 1V8BA 3W6ZA 5A06A 2YYYA 1QYWA 1D1TA 1F0YA 1DIBA 3PGJA 4Y67A 2PGJA 1P1HA 4HFMA 4RF2A 2VNAA 2NTVA 2W2KA 4LVCA 1E92A 4BKPA 5T57A 1BW9B 1MC5A 3FPCA 3ANLA 5B12A 1DDOA 4DUPA 1CF2O 2A4KA 4FC7A 1B16A 2OBNA 5CP8A 1UDCA 1FDWA 2BHLA 4R69A 2DT5A 1N8KA 1WAMA 4L0QA 2D8AA 4NBTA 4PLTA 5LDGA 1ZK4A 3TWOA 2VWGA 2DVMA 4KOAA 3T4EA 2O4CA 4B3HA 5K6AA 5A03A 5IZ4A 1I10A 2BKAA 1Z82A 3JQ7A 1FDUA 1PJBA 4K6CA 1ADCA 4NFSA 3IDSA 3AY7A 2JD1A 1TI7A 3ZWAA 1WP4A 1QYCA 4XYMA 1E3WB 2PD6A 1HF3A 3C8MA 3TOXA 2IEDA 3QWBA 3TZHA 1I24A 3HZZA 3HADA 1BXZA 3KUXA 4L9RA 4XR9A 4AJEA 2OZPA 2EKQA 3L9WA 3LSYA 3ORFA 4GX0A 4J1SA 3ASUA 2Z1NA 1B3RA 3JYNA 3OBBA 2CUKA 3D4PA 1I30A 1F12A 3GMDA 4B7XA 3KYBA 4K6FA 4PLGA 1K6JA 4CUZA 3KM0A 3FSRA 3RUFA 4NG5A 3BYZA 1FXSA 2ZYAA 2OO5A 2PFGA 3FCOA 2H5LA 1LDBA 4HNHA 3ABIA 3ZN2A 2NSDA 1JAYA 4CLRA 1UXHA 2X9NA 1GY8A 1T2FA 1C1DB 3GAFA 3M2PA 4CMGA 1H94A 2G0TA 3L4BC 1HDXA 2HMSA 4MVJI 3U5TA 4DBVO 4YQZA 1EQ2A 1ML3A 2IZ1A 3GZNA 4AJNA 4FB5A 2GO1A 2V6MA 3BHMA 3V2GA 3OQ1A 1N7HA 1JKIA 1ONNA 2V6BA 2HK8A 2NU9A 2EHDA 3AW9A 1X7GA 3BMCA 1HRDA 2Q50A 1LQTA 2GERA 3ZDFA 5ES3A 2O2SA 5G2OA 4AFNA 1PR3A 5IDYA 4XZ3A 1DIGA 2O2YA 4NK4A 2BELA 1E7RA 5G4KA 4EEZA 2EGGA 2I66A 3EK2A 2W4QA 3H9EO 4PLCA 3TL3A 3UFXA 3GDFA 3JD0A 1SOVA 2PWZA 2EGHA 4HADA 1E1NA 4TRMA 3WNQA 3JQAB 3ZH2A 1GYRA 4FGSA 4CMBA 1DEHA 2ZB8A 3ZHXA 4DLAA 3AK4A 2PKRA 1IE3A 4Y6PA 3JQ8B 3KLPX 4UVEA 2B69A 1I2CA 1XELA 3D64A 2VHWA 2JFHA 1T1RA 4YTEA 1NQOA 2WD7B 1ZBQA 4NBRA 2FHSA 1MFZA 1VRWA 1Q0QA 4YJGA 4CV0A 1E3JA 3OA0A 4NR0A 4E2YA 3CE6A 1YDWA 1DBVO 5EN4A 3ENKA 4BS9A 2CDCA 4R01A 4ZQBA 4CR8A 3GVIA 5AXCA 1XQ1A 2BD0A 4FOOA 1IULA 1DFGA 4J43A 3ETDA 1ZMTA 3L07A 1DIHA 3QA9A 4MP6A 4D46A 1HETA 3ZNNA 3MCVA 4JLWA 4N54A 5EQDA 1IHYA 1E7MA 2NTNA 3JYOA 4J0FA 1YGYA 3K73O 4RORA 5KTKA 5KJ1A 4BMSA 4CPDA 4NJOA 5JAQA 1OAAA 3F9IA 2Q1WA 1YQGA 4IDCA 3VPFA 1N1EA 3O8QB 2PH5A 3JYQA 4HP8A 3CXRA 4IY1A 2C07A 1NBOA 2O3UA 1ULUA 2JHGA 5EIOA 4Q9NA 2R00C 1MG0A 4W7HA 4BMVA 4NMHA 3VKVA 4GBJA 4L74A 2WJPA 1I36A 3VTZA 4Z9FA 1XU9A 1I32A 1UH5A 2GPTA 2VT3A 4YJHB 4UVDA 1QXSA 3PWSA 3GG2A 4F46A 4WLNA 1BVUA 5C5IA 4GKBA 3BA1A 3Q11A 3COSA 3NDRA 1GPDG 1A4IA 1LSSA 4AJPA 2PV7A 4HNGA 2BMAA 3BMQA 1BSVA 2G17A 2HDHA 1PL8A 2W90A 3DZHA 5HA5A 4D79A 1SEPA 3D3EA 2QX7A 4BNUA 4IBOA 1EBFA 3ZI0A 2IXBA 4IGFA 1UXGA 1E3IA 2DBQA 4M87A 4FDAA 1P3DA 3ROPA 5ICSA 4DMMA 3GR6A 4GGOA 4LN1A 3Q2KA 2D3TA 3UCEA 5F1KA 3C7CB 2IYOA 1CETA 5IDXA 4CM8A 2VRCD 3AI2A 2Q99A 3I9NA 2JKVA 3DFUA 1HKUA 4J49A 4M54A 1LLCA 4J4TA 1CQIA 3LT1A 5TT0A 1CIVA 2UDPA 4DPKA 3SJ7A 4XGKA 3L9XA 1Y7TA 4DWVA 3HFSA 1SBYA 1H5QA 4A0SA 4EJ6A 1M2WA 5H82A 1KVSA 2IDZA 4DPMA 2C29D 1T26A 4BB5A 4D45A 3GGPA 2DBZA 4AL4A 1V3VA 2OUIA 4GLOA 3GVPA 3UH1A 5C7OO 1ZUD1 5F1OA 2ZK7A 1EVJA 2D1YA 3KSUA 1SAYA 1U5AA 1AXEA 5ENVA 3P5SA 4A7PA 1GL3A 4A2CA 3RWBA 2C2YA 5G0VA 1I3MA 3DOCA 1OMOA 2VRCA 1UXIA 4I5DA 2NVUA 1HE3A 4ILKA 4FFPA 3B1KA 1RM0A 1DIRA 4XQCA 3OJOA 5BNFA 4R68A 1R4NB 2C5EA 1TT5A 3AUSA 2VHVA 4GAEA 3STHA 2IZZA 4RDIA 1YL5A 5T67A 2JD0A 3Q9UA 1DFHA 3ZGYA 2EJWA 3DBRA 5COAA 4F45A 3AY6A 3RCBA 1WDKA 3DB2A 3WDSA 3GGGA 5LCXA 3MJEA 3I9LA 4Z0HO 1TLTA 5KKCA 5IDQA 4D3FA 5TNXA 5IXYA 2VOJA 1SC6A 2GASA 4PRLA 4PLYA 3RASA 4E30A 5TQVA 4MOWA 4PLVA 2VT2A 2A94A 4Q3EA 3S2GA 1MGOA 3ROKA 3ZU3A 1UAYA 2P2SA 2GR9A 3OP4A 1KC1A 2EEZA 1TA4A 5TC4A 3IMFA 3H2SA 3JD4A 3H3JA 1NR1A 1U7TA 2B37A 2XOXA 4FBGA 3OMLA 1BXGA 3VZRA 4FCCA 4KDFA 3GHHA 1H93A 3DBLB 2VRBA 5EMHA 1X15A 3ZWYA 3QVXA 4IDGA 4BNVA 4EJMA 5EPOA 3SLKA 5IJZA 3ZHBA 1YDEA 2FZWA 4E5PA 1FK8A 2UUOA 5EINA 1VLLA 1IYZA 1EVZA 4YRAA 1D7OA 1N9GA 3FTNA 4YYZA 4D44A 2Y1CA 4LMPA 3A28A 5TIIA 4UULA 3VHRA 3OICA 4RLHA 3ADPA 4W9NC 2JAHA 3K8ZA 3QVWA 4Y6RA 1SCUA 3UVEA 1E3EA 4RQTA 2OL4A 4CR6A 1WMBA 1YQDA 4BHTA 1ZXLA 1W0CA 1MB4A 5FWNA 3DOJA 1KVQA 4HY3A 3TZCA 3H5NA 4PZCA 2OOSA 1J49A 1PGQA 2O3JA 5T8KC 1YOVA 4YR9A 4RLSA 2EJVA 2VYVD 3HE3A 4DA9A 5IG2A 4HBGA 4NFYA 2ZTVA 5J23A 2WWRA 3MEQA 4Y9DA 3S2IA 2HKIA 3KYCB 1R0LA 2EIHA 4UUOA 3GC6A 1BGVA 1QRRA 1E7WA 3IJPA 4PLZA 4FC6A 5ICMA 5B37A 1Q0LA 3U4HA 4N18A 4ZJUA 3C24A 2EV9A 1CQJA 1GAEO 5A3JA 1UAGA 3JTMA 1QP8A 1ZEMA 4RQUA 1T2AA 2V6FA 2IEBA 1UDAA 5L7YA 1QORA 2O48X 3OJLA 4LCJA 4GI2A 4A26A 4PG6A 2F00A 2BFMA 4GSKA 1EDOA 2FZEA 5EERA 4XEHA 4E32A 3JSAA 3WS7A 3EC7A 1S7CA 3EY4A 4CLOB 2NWQA 1JVSA 3WIDA 3AI3A 1I5RA 9LDTA 1NP3A 1UJMA 4ZU3A 2JCXA 2HO5A 3P19A 3ZWNA 1NTOA 1ADFA 1Z75A 1P1RA 1T4DA 2BGLA 2Q1UA 2ZB4A 2FOIA 3EW7A 3F1LA 5DT9A 1QV7A 3W4JA 3M2TA 2EF1A 4BO6A 1IPFA 3D5QA 1TVEA 2NVWA 1Q7GA 1PQWA 1CRWG 3NYWA 4XGNA 4E4YA 1CEQA 3ZWWA 5HRUA 4HUJA 4IQ0A 4KDEA 1JU9A 4U6QA 4BO5A 2FMUA 4E21A 3RUEA 3GLQA 1J4AA 3WGZA 2I65A 3AUTA 5L9AA 3DO5A 2OXIA 4R1NA 5BT9A 1A9ZA 2AEMA 3DWFA 3F4LA 5TGDA 5GZ3A 1MXFA 1D3AA 1WZIA 5AXDA 4O0LA 5IZCA 1IPEA 2HCTA 3WBBA 1T4BA 4CMEA 4Z3KA 3WFJA 2QG4A 2DTDA 2OHXA 3RFXA 3W1VA 3DTTA 3V1UA 5THKA 1MG5A 4HV4A 2FSVA 4TMFA 3NGLA 4DYDA 4L75A 2X5KO 2QQ5A 2FR8A 3LU1A 1LDYA 3FNFA 1WW8A 2C82A 4MIOA 3GPIA 3CSDA 4J3FA 3KZVA 3P2OA 1WWKA 1ZO8A 2DBVO 1O6ZA 5KKAA 4CM1A 3WGTA 3AUAA 4E2ZA 5A3VA 3D5TA 3FWZA 4CMJA 3LZ6A 2UV8A 4XIJA 2JFGA 4RGBA 3C1OA 2G82A 4K9DA 1J0XO 4MKXA 1VE9A 1BDBA 4D3SA 3H9JA 4DLLA 5EL0A 3RC9A 3JQCA 4GX5A 3RC2A 3NDIA 4CMIA 4WKGA 2Y67A 3TPCA 4PZEA 3AOEA 3EZLA 3FR8A 3KRTA 4IJWA 1P74A 3I5MA 3WQQA 3C7AA 2EP5A 4TVBA 2J5KA 4Q3AA 4G65A 3BMNA 4YAIA 3RJ9A 3DBHB 2WYUA 4JN6B 4WCFA 3V1YA 2PH3A 3MJVA 3PJGA 5GY7A 4BNJA 1X7HA 3HSKA 4OSPA 2Y66A 3VZPA 1OC2A 1LRKA 3GG9A 5TLSA 1GZ3A 1LRJA 1NPDA 2I3AA 4JNKA 5HTOA 4KQWA 1EK6A 5JSFA 3VVBA 4D3DA 1HDGO 5ER9A 2X1HA 1PX0A 3RUAA 4UVGA 4CV3A 3DZJA 1BG6A 1IL0A 4ID9A 5FEUA 4O1MA 5F21A 3JQGB 5FF9A 4J4BA 3OA2A 4D42A 3HUDA 3PDUA 4NPCA 4J7CA 4IS2A 3L6EA 5I7SA 1ISHA 1PGOA 3W8FA 4WEOA 2VUSA 1GYQA 3SEFA 2C59A 2PZMA 5DP2A 3OQ6A 3JQBC 2I6TA 1N5DA 3DL2A 3JQFC 5COBA 1JDJA 3DAGA 3QVOA 4AJKA 2BRUA 5A5FA 2VTEA 1P0FA 1B3BA 4JBGA 3I4FA 3PP8A 3QSGA 1JKJA 4QEDA 5KVVA 1DO8A 1B0AA 1VJ0A 2AE2A 3WBFA 4OKIA 4IPTA 4OM8A 2YDYA 4KTVE 5BQFA 1DIAA 4IJUA 1BMDA 1DC6A 4FFMA 2B35A 4GMGA 1JWAB 3RSHA 1EEHA 3IUSA 1LEHA 4LVUA 3M1AA 2XF8A 5EJ2A 4LRSB 3PIIA 1MP0A 2AMFA 1MFPA 2DBRA 1R4MB 2OP1A 3QJ5A 3HDYA 4BO8A 2DUUA 4BO2A 3UCXA 3KSDO 2GN9A 1Y9EA 1O95A 4I5GA 3AU8A 1EVIA 3BMOA 4QO8A 5JNLA 1X0VA 3OIFA 5TSDA 4CV1A 3RBVA 5DP1A 2YQ4A 1Z7BA 4OGWA 3VPGA 2I5PO 3S8MA 3QHAA 4MVJD 2H1SA 1AUPA 4HWKA 3OJEA 3G3EA 1R15A 4MPDA 2HMTA 3DTYA 4XYGA 3OSUA 3BHJA 2FPIA 3ZV5A 1M6HA 1WVGA 1JN0A 4N5NA 2DKNA 4XQGA 4BL5A 2GZ3A 4I9UA 2VUUA 3D1LA 3GQVA 1Z74A 2O7SA 1P44A 3E9NA 6LDHA 2Y1OA 3WGYA 5CG2A 3BTUA 4YDRA 3RC7A 3E82A 3B20A 5KJCA 4HFRA 3BXXA 3TFQA 2CY0A 2X5OA 2VUTA 3ZNQA 3ZWOA 1KY5A 2VHZA 3E8XA 3R6DA 3RU7A 1DC5A 1P45A 5F5NA 3ITKA 4OHUA 1YKFA 1HE4A 3U62A 4CM3A 2DM6A 2HSDA 3KSZO 1KETA 4E5KA 3V2UA 3FNGA 4MVJA 1H9BA 4B7CA 3ONEA 3ANNA 1AN9A 1LLUA 4JJIA 5BSGA 2FR1A 1GD1O 4DGSA 3K2BA 3LQFA 4IXWA 2VWQA 2NV6A 1EFLA 3R1IA 2GZ2A 4YWJA 4CV2A 3A9WA 3TSCA 4JGBA 1C14A 2YHIA 3GK3A 4BGVA 4II2A 1ZSYA 5KIAA 3BTOA 5BNTA 1I2ZA 5JDIC 3IUPA 7ADHA 4JIGA 1UP7A 2P9GA 2QRLA 4WLEA 3GPDG 5KNLA 3QE3A 3JYPA 4F6LA 3F3SA 2WE8A 1P33A 2UAGA 2VHYA 4E5MA 1BWSA 3BZUA 1M66A 1CJCA 1U2DA 4ND4A 3RUIA 1ADGA 2D5AA 2VQ3A 1XCBA 1ZK0A 3CKYA 3I3OA 4FN4A 2QYSA 4WK6A 4WLVA 3HN2A 4XR4A 5C3MA 4ZQFA 1F14A 3K30A 5H83A 1PQUA 3JQDA 3Q9NA 1RYEA 3PRJA 4NDNE 2B4TO 2J3HA 3DZFA 2VOEA 2NVUB 4XDZA 4U6SA 1YS4A 4OH1A 3NAQA 1QR6A 3HB5X 1QLJA 4L8VA 4M86A 2GF2A 3HHPA 4NJMB 5CDUA 4YQYA 4O5OA 1GPJA 1ENOA 4WLFA 4PRKA 3AFNA 4JJFA 3ROQA 1NVMB 3E6AA 4MKRA 3VOSA 1XA0A 3NV9A 4AVYA 4OMUA 1D1SA 4RPHA 1DLIA 1F8GA 4RZIA 2I3GA 2CMDA 3HDQA 5ADHA 3ZWMA 4BO3A 2ZQZA 4PLHA 5K9ZA 3MJTA 1K2WA 4RVSA 1R6DA 1LC0A 2VTDA 2WTBA 3PZBA 4JP2A 1NHGA 4JP3A 1K3TA 3UW3A 4AG3A 2JCVA 5ITVA 1JVBA 2IZ0A 3L4BA 3O03A 5CAEA 1IOLA 4DQXA 2O3TA 2YZ7A 4TRJA 3EZYA 1PGNA 1RJWA 4ZQGA 2TMGA 3IJRA 3MJCA 4CODB 3DHNA 3KEOA 4R41A 2B36A 4QUKA 4CM4A 1L1FA 3WQRA 3K6JA 2VYND 2X8LA 1PQPA 3T4XA 4FJ2A 4L4SA 4M49A 2Y05A 3EYWA 4M8SA 4PVCA 1DC4A 3DC2A 4XB1A 3L6DA 1XGKA 1T2CA 3NGXA 4QSMA 2HK9A 4OAQA 1JTVA 4YT5A 1F06A 4YAGA 2CDBA 3AWDA 3PGXA 3QWAA 4UEOA 1E1KA 3WFIA 5BSFA 3GUCA 5JY1A 5I9LA 1E5QA 1Q7BA 4IINA 1EBUA 3FN4A 1ZNQO 4J16A 1NM5A 3ZU4A 2GN4A 4ZN6A 3NJ8A 1GFSA 1PZEA 2Q2QA 3EDMA 3V8BA 4J2OA 4CUKA 3VPXA 1O94A 4RV9A 1U5CA 4CLDA 3QWIA 4NBWA 4AJOA 3FNEA 4JROA 5I7FA 2CFCA 4NNJA 3INTA 4DQVA 3NDJA 1U2GA 1YOVB 5JE8A 2VYNA 2WDZA 3ZWCA 2BFAA 5BSHA 5JXWA 4B79A 4U0JA 4EITA 3RVDA 3CINA 1DRVA 2PTGA 3AUUA 1H6AA 1HYEA 3RROA 2Y1EA 1LI4A 3AFMA 5L95A 1NQ5A 5CDGA 3RUHA 4DPLA 2DU8A 1NFQA 1WLYA 4MIEA 1UZNA 5FI3A 3ZV4A 1YH3A 4Q39A 2H6EA 3JCZA 4XKJA 1V35A 3GVXA 4N5MA 5G4LA 4BKOA 3H3FA 4RDHA 4ZA2A 2JCYA 3LF1A 5DCUA 4TKMA 1MLDA 4CMAA 3PTZA 5EQFA 2FWMX 2VHXA 4H16A 4XJTA 5A9SB 3E18A 3KYDA 1WPQA 3I9MA 4E3ZA 2PA3A 3RIHA 5A1TA 5B4VA 1E3SA 1XEAA 3PHGA 4WLOA 3F6YA 3F5QA 8ADHA 1ULSA 4B4OA 2QW8A 1YL6A 3TFOA 1PJQA 5L53A 2CNBA 4LSWA 4YJFA 1JWBB 4BVAA 4RL6A 4URFA 1NWHA 4TROA 5JFOA 1Y8RB 2R00A 2OMEA 2LDXA 5CEFA 5K0ZA 2W8ZA 1ZXBA 1NFRA 3OEWA 2Y1GA 3UF0A 1KS9A 2F1KA 5JMWA 1O89A 3ZWVA 1K0UA 2XXBA 1A27A 1R37A 5FFFA 3JD3A 2Y1FA 3PFFA 1ISFA 5MDHA 2CVZA 2GDZA 2VN8A 3WR5A 1I3NA 3QV1A 1HDYA 1IB6A 3IOYA 4DIFA 1C0IA 4UVHA 2WM3A 4CM5A 1OZAA 3JQ9A 4GSLA 1H6DA 1Y5RA 2J5RA 3C1TA 4B3JA 4KP7A 1SOWA 1BTOA 4IMPA 3Q6IA 1L7EA 4R3NA 4ND2A 2X7HA 4G2NA 4I8XA 1VSUA 2HUNA 1G6KA 2P9EA 2HAEA 2HK7A 1EMDA 3VH1A 4XYLA 4XYBA 5CPFA 1HZJA 5TX7A 5TF4A 3ZW9A 1GUYA 3WMWA 1D8AA 1E5LA 1HE5A 1PIWA 3H7AA 5I8ZA 1YXMA 3FHLA 4NI5A 2UYYA 4WOKA 3GEMA 2C20A 1U1IA 3RFTA 5I7VA 3V2HA 4QTZA 1Y81A 4YAKA 3H9GA 3RC1A 3VAZA 4ZQEA 1WMAA 2ILTA 1EUCA 1PJTA 3QIVA 4EJ0A 1E7SA 4TKLA 2D2IA 2YW9A 1W4ZA 4PCVA 2VCYA 3D3WB 1P77A 4Y8VA 2AQKA 3FTPA 3NEPX 2IE0A 3LLVA 5GMOA 3BMNB 3NRCA 5THQA 4FSHA 4NFHA 1KOLA 2D4AA 4JBHA 4NU5A 3WQSB 4NU6A 5DN9A 3PHJA 2AG8A 1WZEA 3G1UA 4LISA 2QZ9A 3K92A 5B4TA 3CMMA 2OP0A 2AQ8A 4BO7A 1PGPA 1Y8QB 1B8PA 1VKNA 3WYCA 3WIEA 2JL1A 1LJ8A 1F8FA 4GMFA 4B4WA 2YJZA 3NT4A 1PU2A 2BI8A 3JYLA 1XHLA 4XRRA 3OETA 3GHYA 3JD2A 2NU6A 1SB9A 4FIZA 4B4VA 5ILOA 3SBOA 1E3WA 4GVXA 3PFWO 1GR0A 3K9QO 3IL2A 2CF6A 2P91A 2A9FA 4MVJG 2X22A 5KJFA 5L7TA 1B15A 2O4UX 1GU7A 4ZGWA 3ONFA 1PS8A 1O9BA 2ZTLA 2HJRA 4BNHA 3T7CA 1LSUA 4BIIA 3ZNOA 5BSEA 4QXMA 3WOHA 3KBOA 3TZQA 3G79A 1VJTA 4RPLA 3VTFA 3HDHA 2CSUA 1A7AA 4BO4A 2YY7A 1F17A 1UZMA 5T6BA 1Z6ZA 3WSWA 1LTHR 2C2XA 3IQDB 1L7DA 3PJFA 3D7LA 3K31A 2NADA 4ZICA 1C1DA 1X1TA 3GRKA 3JQAD 3DMTC 4W9NA 4NZ9A 4EUEA 5AVOA 3DZGA 1MUUA 1YJ8A 5L51A 4UUPA 4YBZA 2OGUA 1HSOA 4WLUA 1IY8A 2I99A 5JYDA 2B5WA 2PNFA 4YAJA 3ON5A 2ZB3A 3LC1O 2YV3A 3LVFO 2GRAA 2AEFA 4EDFA 5JS6A 2PK3A 3A14A 5T8KA 4P4GA 2A35A 1I33A 1E0DA 3PJDA 4BNFA 2Y93A 4JJGA 4CL8A 3OJFA 4IJVA 2DTEA 4IIUA 2ZCUA 4KZPA 4CJXA 2DAPA 4R4JA 4ROSA 1XU7A 3GNSA 1X0XA 1E7QA 2WE7A 4KMSA 3ZCXA 4O59O 3UN1A 1XG5A 3ZNPA 1KVTA 3QVSA 5JC8A 1G0OA 1HSZA 1H0KA 1LSJA 1P9LA 1ENZA 2C0CA 3JQAA 4G5HA 4J0EA 1VC2A 1VJ1A 2CDAA 3UICA 4MINA 1DRWA 2NM0A 1LC3A 3JQ8A 4BQPA 1HZZA 4ITUA 1ZK3A 3HFGA 1RM4A 3C3XA 1S6YA 3FPLA 2NQ8A 4CQMB 2WD7A 2VNSA 4K26A 1UR5A 3DHYA 3E5RA 3HN7A 4TRRA 3H65A 1HWYA 5F1PA 5A04A 1DLJA 4OIMA 4L4RA 4RVGA 3WLFA 1A9YA 4D41A 1KEWA 4DC1A 4NQZA 2AW5A 3G1TA 4H7PA 2VYVA 3D0OA 1J5PA 2NUAA 4TZKA 3WYEA 1YBMA 1U4OA 4EUHA 3NKLA 3GOHA 1LXCA 5KJEA 2WD8A 3IP3A 4BV8A 1GTMA 3OIGA 1UP4A 4YACA 4TZTA 1ONOA 3AOGA 3FD8A 5G0WA 4RVUA 4KUHA 3CTMA 1QMGA 3H5RA 3KTDA 3RFVA 1GUFA 1O0SA 1JQBA 4BNYA 3ENNA 4IMRA 1H9AA 3O8QA 4E0BA 5KJ6A 2W2KB 1T24A 4YA6A 5DF1A 3GN1A 4B4UA 4P22A 4YRDA 1TEHA 4Z6KA 1M6WA 3JV7A 1YO6A 4B8WA 4J1QA 4R54A 1Q1NA 1YB1A 2G1UA 5IAAA 4JK3A 3QW2A 3RKUA 2R2GA 2WYWA 1LQUA 4ZD6A 3TN7A 1K5HA 3R0IA 4YJHA 1A4UA 4P8RA 1V9LA 4ALKA 1QLHA 3OEYA 1DHRA 5DCWA 3I52A 4E2WA 3LC7O 1P1JA 2Q1TA 1BXKA 4XD2A 1MA0A 4FOSA 3JQ7B 1LDNA 3PLRA 2PZLA 2DUWA 4FQ8A 3WJAA 5C37A 2AG5A 1PEDA 4RVHA 2NQTA 3DFZA 5AXAA 4FS3A 3TL2A 4BB6A 2ZQYA 2DQ4A 4BNLA 2B83A 4CQLA 4E5NA 3BTVA 1SNYA 3JQ6A 4R1SA 4A03A 1M76A 5IZCC 4N7RA 3OQBA 4DREA 4JQCA 4JXKA 4Y98A 3NTOA 5I7EA 3N74A 3NJ4A 5DBFA 1NPYA 4DQUA 1SB8A 3P7MA 4PG7A 4EEXA 1PL7A 3CZMA 4J9VA 4NK5A 4A5OA 1X13A 4FFRA 4MVJE 1MX3A 1U3VA 3VZQA 3IKVA 5CG1A 1VL6A 3T7EA 4IGEA 4CLRB 4CLEA 1KBZA 3GDGA 1LLQA 4WEQA 5AXBA 1ENYA 4ND3A 3UXYA 4OL9A 4AJIA 3DQPA 4S1VA 1NFFA 1A5ZA 1ONPA 1ZKMA 3S55A 3GZNB 5JMPA 5AQ1A 4AJ1A 1SPXA 1B2LA 2BGKA 1LDEA 3IKTA 1R0KA 3RQSA 1LX6A 1R66A 2EWMA 3Q2IA 5T64A 4A10A 3ANMA 3EVNA 3LT2A 1W8DA 3BMCB 5TT1A 2P5YA 5B1YA 2ZJ0A 3JD1A 3PPIA 1A7KA 1ADBA 4RPKA 5G4KB 2V65A 2X6TA 1UXKA 4AJJA 2AQIA 1GQ2A 4OQYA 2NU8A 5I9NA 1YVEI 2IRWA 2YUTA 4U7WA 4BNNA 2YFHA 3F47A 1KERA 3DR3A 5L40A 1PTJA 4E31A 1HL3A 1K6XA 5CFZA 4P4LA 1UP6A 1R4NA 3NUGA 3GVHA 1O8CA 1FDTA 3G49A 4XX0A 1VKOA 1LDMA 2EKLA 4P38A 3IP1A 4WGGA 4J7XA 5DOZA 3X2EA 1DAOA 2RCYA 3VH4A 4RPGA 3FI9A 1ZIDA 1AXGA 5L4NA 1E1LA 2ZIZA 1DHTA 2X0IA 2H63A 1PZFA 4H15A 3B6ZA 4YJGB 2GN6A 5JDCA 5HS6A 1Q7CA 2EXXA 3OECA 4IDAA 2O3RA 1DB3A 4MVJM 1NASA 4R1UA 1KEVA 1RWBA 3C1AA 3K5PA 1KEPA 2H9IA 1LNQA 1PJSA 1YBVA 3HDJA 3SVTA 1ISGA 4UREA 1DC3A 1DSSG 2Q46A 2X9GA 5DULA 3U09A 3DAPA 4Z0TA 3LK7A 2E4AA 4EUFA 3E9QA 3HB4X 4F3YA 2I76A 3SJUA 4GX2A 1A71A 2QZZA 4W82A 3DBLA 3GT0A 3KEQA 3UUWA 1YONA 1FDSA 1GYPA 1GUZA 1EDZA 1EVYA 3RD5A 1TT7A 2V7PA 3PLNA 3FRJA 3BHIA 1B26A 3PI7A 5JW6A 1ZVMA 3WLEA 1ZEJA 4J90A 1C0LA 3VC7A 3QY9A 4IUYA 1LUAA 2J3KA 3DAFA 4KWIA 2FR0A 3U3XA 3U49A 5CDSA 1RM3A 4UUNA 3ZWPA 4B8ZA 4NBUA 2FRDA 3SC6A 3R3JA 3INRA 3UKOA 1G0NA 4ZRNA 4YEDA 4YCAA 4JBIA 2GGSA 2IXAA 1BRMA 2DPGA 1W6UA 1R12A 3H4VA 5JBIA 4RJTA 3NTRA 3BMQB 3O4RA 3KETA 1PJCA 4FW8A 4I5EA 4FD3A 5A9RA 1YE3A 2X0RA 3FNHA 3AM4A 1OOEA 3AY3A 3KYCA 4RF3A 1E3LA 1CYDA 3JQEA 5IXSA 1C3VA 4CLXA 1ISMA
chains in the Genus database with same CATH superfamily
1EFUA 1JAZA 1YE5A 2ZJZA 4X54A 1HI9A 1X8XA 4PIVA 2WHEA 2QVZX 1DQZA 4FI3F 4CL3A 3OPYI 1RAGA 1WRBA 4JP8A 4FLMA 3MAAC 3QOFA 4FOTA 2W2OA 2Z1MA 4H08A 4RK1A 2MOKA 5GGYA 3OCYA 5JISA 2R5NA 1E94E 1TM7E 2PGLA 1YC5A 4U9HS 5G1PA 1BS9A 2PEYA 4QQKA 3RUCA 2B1JA 4HYQA 4BKRA 4PG8A 4CM7A 4ALJA 2MSNA 3AFOA 2D54A 1SELA 1GUBA 3V34A 1Z7YA 3IR5A 4GPEA 4PAWA 4WN9B 5BN4A 3BEDA 3D02A 3HJAA 4ZO4A 4R51A 1IQ0A 3SFTA 3U40A 1SO8A 3USCS 4OB8A 2GZMA 3OJ0A 3HDTA 2QGNA 1LCIA 1KEEB 2DG2A 4HH1A 2VSQA 3WIOA 2CUZA 1KE1A 2QVBA 4EPTA 1E9FA 4LOJA 3DZCA 3EG9A 1QC5B 3E7DA 4QT0A 3ZWBA 1FJHA 4CM6A 2PJUA 4B3SB 3AILA 3KKQA 3OHSX 3V1NA 5JI2E 2ZXUA 2XOKD 4NTZA 5CB0A 2HW8A 4PWZA 3GIWA 4GWKA 3CN7A 3WYBA 1VPTA 4CYMA 1Z45A 1HT0A 2QLTA 1S9HA 4Q0MA 5FYDA 3TFOA 2C7QA 4LY3A 3D0KA 4HTAA 4M9XA 4CGYA 2WHPB 1AD2A 5JY6A 3KE8A 4TLCA 1WDMA 5BNZA 2RHBA 4Q4CA 2PZKA 4Z1MD 4F06A 3BREA 4KXVA 2R25B 1Z4OA 2FQQA 3PNMA 5HE8A 2BKLA 3OCZA 3Q6NA 4Y2SA 1ENPA 3HEBA 3OTOB 1DO0A 4UEWA 5DT2A 1E2EA 1J0EA 4KPUA 3B7WA 4I9GA 1F6DA 3SC4A 3UGKA 2OWEA 4HBZA 4AMYA 5BWOA 2KPOA 3X43A 4MGHA 4MV5A 4FHCA 1WZNA 2CLFB 4TN1A 3WB9A 3WQHA 5IHXA 1ISIA 3BULA 3NHLA 4GICA 3T5TA 1MA3A 4B3DA 2L82A 1J24A 1Z0KA 4HFJA 1BWQA 3DKKA 1A95A 4M2LA 3MRSA 3N3AC 4CTMA 3PSAA 8AT1A 3IQGX 5K6AC 3FFTA 3T0IA 1PG2A 2JD2A 3D7SA 3P9SA 2UXCB 4UATA 3BDAA 2D5BA 3B9BA 4IEEA 6AT1A 5LC1A 3IA7A 2PXHA 4YRZA 4JUAA 5EC8A 1GCOA 2Q29A 1C1XA 5DXJA 5BSWA 2Q9BA 3NBZC 4DZTA 4PONA 4ETWA 5BWLA 2WAOA 1ZK2A 5HM6A 1BXGB 3DDZX 4E2XA 4AJ4A 5FWYB 1H8EA 4YI3A 3KJGA 3OZCA 7MDHA 1LPMA 3A1CA 3QUBA 2XUZA 1LPAB 2WA1A 4AKTA 1KHHA 1AGNA 4GMDA 1YZNA 2WFZA 1C0PA 2PH1A 5JAZA 4CZ2A 3LUJA 1G2OA 3TQOA 5JCXA 5JAIA 3GJRA 4B35A 4EKNB 2V59A 1S2GA 4IEIA 4M89A 4TXMA 3TRIA 2FEXA 2RKBA 5L7WA 1UK7A 1U1DA 3O21A 4GHWA 2ZYRA 4I1PA 1YBHA 2OCKA 3DBHA 3V8VA 3VYVA 4YV1A 4ND5A 2BKVA 3ESZA 3QBTA 2B2XA 3PE4A 5IVDA 3PZRA 3VZSA 3ZZNA 4BNIA 5K0SA 5L45A 3N8DA 2WJVA 4Q5IA 7REQB 3FUTA 4HQKA 4FGZA 1RZRA 4B3GA 5FWXA 3HA5A 2ORIA 3FB1A 2CBGA 3F67A 3KXDA 4KXUA 5KVCA 3ONDA 1W581 2EKPA 3M5CA 1ISJA 4IFTA 5JTUA 2V6GA 2C3OA 4EGQA 1OC4A 1PD0A 3NP7A 4JJ4A 4WERA 3LJKA 4BDSA 1HMPA 1ES9A 5EVJA 3WRXC 3WDLA 1I4WA 3PDWA 4J3NA 3RVNA 3SF8A 3E2IA 3CX6A 1V3TA 3BA6A 1KSFX 2BFOA 3SSMA 1Z7EA 3DZ8A 4ALMA 4I14A 5HGJA 3ZTYA 4ENSA 2JGDB 4YHBA 5DNAA 1JIVA 4UUAA 1XE3A 1AT1A 2NGRA 4DDHA 5TJ9A 1CUWA 2GK4A 2AE1A 3BM5A 3PR2B 2J31A 2HLDD 3W3AA 4GPD1 1KRHA 4RO0A 2Q6IA 4AY5A 3L1KA 3UAVA 3V8RA 2ANCA 3EMBA 3KUUA 1IEQA 2FSPA 4K9PA 3DMRA 3KPYA 4IJKA 2HDNB 4R98A 2FE1A 5DTJA 1JAXA 3PPWA 1EK1A 2X9VA 4R9SA 5DBEX 2DHEA 5EKXA 1SCJA 3LUGA 4OBBA 1D2NA 4D6PA 3LPMA 2CB0A 3OZAA 4IQ8A 5AYVA 1HE1C 1P7WA 4ROTA 5J40A 4GKJB 1HYHA 2E37A 2G1AA 1N25A 1THGA 1A2KC 2ZBDA 4JCOA 2J8ZA 5AI6A 2DFTA 4ZYUA 5B7NA 1K3UB 1SVSA 2HD4A 1OI3A 2DQYA 2QTCA 4IL5A 4YWHA 4ETMA 3UAYA 1XR3A 3QP9A 3AG6A 4V0KA 1UIRA 1PR4A 1VSVA 2ZAMA 1XD8A 1XCGB 2C5GA 4F8JA 4FKZA 4DT1B 4EQZA 1UOOA 5CXXA 4KMRA 5LA6B 3ZLUA 1JQDA 2WNSA 1SU8A 5IAKA 3N2IA 4JENA 5B58C 2CL6X 3VR2A 2HMWA 2ETXA 3IB6A 3N07A 4U2KA 5JSKA 3WX0A 3U0BA 3KWFA 5D87A 1CRPA 1F3LA 2DR3A 2TSYB 3K1ZA 3LTEA 5A9TA 3EUWA 3JSXA 1GG5A 4I1IA 2GQ0A 5IBPA 1AG9A 1RXEA 2QGFA 4IIVA 2UU9B 4E15A 1X77A 4IZIA 4CT4B 1E6UA 3ZS8A 2HJGA 4MRNA 5KPJA 4EKYA 3NBYC 4TWIA 5K0NA 2I1LA 2B3DA 2REQB 3DVRX 3OF2A 4ZQHA 3ICOA 2YHBA 4IDBA 4RM2A 4LF4B 5CJJA 1E7YA 3ICQB 2J41A 4E12A 5JXJA 3O73A 3SHWA 1DKLA 1PL6A 1DADA 5E9WA 1NX6A 1BCRA 3SBEA 3SKYA 5ENDA 1EG2A 2QY9A 4OQXA 4BV9A 3W5CA 4LZAA 3JAMA 2XUDA 1KJYA 1IHXA 3F46A 3IBTA 1UKBA 3JALA 1NJ5A 1WQ3A 3UIEA 3EEFA 2C2HA 4ND1A 5KOHB 5MGBA 3GGOA 3QKSB 4NV1A 3I1JA 1OBHA 2X4DA 2PD4A 3AVXA 3HKEB 1JXMA 4QDKA 3JQ9C 2YZKA 4LXTA 4QTYA 2DLCX 1EK5A 3S2ZA 4AX4A 2FY8A 2CZQA 2RHTA 1JR3E 1YZQA 1ZICA 5HMMA 5E4FA 2BHSA 1AUQA 4TMKA 4B17A 1P6UA 5BQOA 3M6MD 5IUJC 1TYAE 4IDQA 1W47A 5KHAA 2VYCA 4GI5A 2EWVA 3A1UA 3IJEB 2QD3A 3GZTB 1IXYA 1PGJA 1AE1A 1QZ3A 4BCBA 4LJKA 2QM0A 3QRWA 4I3HA 2GWHA 1X2EA 2FPPA 3IO5A 4ZAWA 3DB1A 3UOAB 1X1QA 3RF7A 3EGVA 5D3QA 2R0QC 3A1TA 4Z9XA 3CO5A 4C4SA 2PKYX 1N2BA 1F51E 2DKOA 4F1JA 5BPHA 4KGZA 3VKFA 4LSMA 1Q19A 5EXPA 2QN6A 5EHIA 1RS0A 1AGYA 2DCUA 1DJLA 2XE7A 1DKPA 4I9NA 4NH4A 5AOVA 3RS8A 4D8XA 2ACKA 3Q1LA 3DKIA 3PX2A 3BF8A 3K8YA 3BFJA 4LE0A 3G17A 3HWWA 2BPOA 2QT1A 1XQ6A 3IUQA 3CEJA 3RPEA 1OH7A 1Z7WA 4GFDA 4P5PA 1HDCA 3WWZA 3BILA 4XUCA 5ALJA 1GLNA 4BVEA 2PSJA 5CFLA 1M34A 4BNZA 4BEJA 2XF2A 4G24A 3IVCA 4HGNA 4O8CA 2BBSA 4XYEA 4B3IA 3OTGA 2LWIA 3I09A 3KS9A 3P0FA 4QWMA 4HAZA 2RK4A 3VDQA 3FPJA 4TTQA 3I04M 4ND8B 4EHIA 1GIAA 3LX4A 4MVXA 4P08A 4DNFA 2FEAA 2XDQA 4P4NA 4MGYR 5ALOA 4RUKA 4HFNA 4F96A 2OCPA 1E2MA 3SXPA 4U7GA 5LU8A 2EG5A 2JFWA 9LDBA 5EJ4A 5JOQA 3ZXSA 1O6BA 4EFNA 1UMBA 3E70C 4WJLA 3IO3A 4DR4B 3BAFA 1MO5A 2WSLA 3BC1A 1Y7PA 1RABA 3PNSA 1L7NA 1RWXA 2HA4A 1Z07A 2C8LA 4NJMA 4P5DA 1Z62A 2GAFA 4I1RA 4D4MA 2F8TA 3DWEX 4LDRA 1UDWA 4D98A 2QRGA 3TZ6A 1IM8A 5AVZA 4AN4A 4MQ5A 4BKQA 4B7ZA 1FXWA 2XMDA 3BGIA 1CVLA 2C7VA 1BN7A 1GKYA 2EFDB 4N0DA 1FLAA 2ZCVA 4L4ZA 1ZGAA 2JFFA 3LTNC 3DH0A 3DOOA 3DNMA 3N39C 3WWYA 1GRCA 1XTSA 1F0PA 1KQPA 1EX6A 2JHCA 2OHHA 4IIJB 4JC0A 2IF2A 4G81A 5HM8A 4ACAA 3F6PA 4XGIA 4NWIA 1L9XA 3AEUB 3KLMX 5HBGA 1BEEA 1IVNA 3OLZA 4Y2TA 4D4JA 5KREA 3M3HA 1ID1A 3KLNA 1ZJZA 3O90A 4L95C 2VTVA 3HGTA 3ZHUA 2FUKA 3DLAA 3MW8A 1Y6RA 4AMGA 4B6RA 1EQAA 3FUVA 4PGHA 1CXZA 3WI7A 1PRYA 4EKGA 3MTDA 1WG8A 3KQHA 2O8DA 4O4HA 4AKEA 5HOQA 5KTYA 1SXGA 3ANYB 3AP3A 2AR0A 1U9CA 4ZCMA 3I92A 4KX5A 1U0JA 4KQ9A 4UNPA 4HN2A 2OORA 4O4JA 1ATZA 1C1HA 1OYWA 3DVQX 2E82A 2FQWA 3OKAA 3CIFA 3OPQA 4GVLA 4I50B 4OO3A 4R2HA 4KR2A 1C7ZA 3DBVO 2P4SA 3J7TA 5CGQB 5F7OA 4NU0A 3K2EA 3OCCA 1JQ5A 3QVKA 1JZSA 4NG4A 5E2IA 1KDYA 2AF4C 4PF1A 1NLYA 3AM5A 3PRYA 3O83A 3U4GA 1CHNA 1RWWA 1UKYA 4TV9F 4C7BA 2PG3A 2WIJA 4Y9TA 3ERCA 4DBZA 3B60A 3BH0A 5CLFA 4Q21A 2GN8A 2V7GA 2RI6A 4D6YA 1YU9A 3KWMA 1P75A 3HB1A 2QM7A 3INYA 4QOEA 2RH4A 4LSZA 4UUMA 2D5CA 2QE6A 4M0LA 4MP8A 2AT1A 2G71A 3DO6A 4OXNA 3A26A 5DPMA 2I62A 1XLTA 3SAJA 2J59A 3ZH9B 3ZD7A 3ZHYA 1JR3A 1BMFD 3JATA 5ALMA 3SVZA 1JUDA 5A5GA 2ZOSA 4UTPA 1H0HA 1KDRA 2DZDA 3EY9A 3IBCA 3IIJA 1W36C 2ZVDA 2Q4BA 5A3QA 4RV4A 2WAYA 2ZRNA 3H6KA 2AXPA 2DPHA 2CDRA 3AU9A 2G88A 5IKOA 2Y9PB 4UHJA 1QIFA 2XNHA 5EGNA 3HU1A 4AJLA 4AT1A 4ARSA 2OT3B 4JLVA 4Z1OA 5JDIA 3ZBPA 3R76A 2LDBA 1V5IA 2NO5A 1ZA1A 4TYNA 1F60A 4QNMA 4EYSA 2XMPA 1USVA 1ZJ5A 3VNSA 2OLJA 1HZZC 2H7XA 5G0UA 3RRNA 5LIRA 4BBPA 4H6WA 5A9SA 4ZYYA 5DCYA 1W5BA 2CLIB 1GEEA 1WO8A 4HLDA 1ZCJA 3V42A 2YWCA 5CLQA 5L3VA 4ERNA 4EHHA 3NQ41 2OCIA 2YHIB 3DL7A 4WNIA 4O3MA 1TADA 2EZUA 2V54A 2QM3A 4K9MA 4X92A 2TMDA 1DZIA 3RU3A 3N7UA 4NDZA 1M72A 3W3AD 4R5HA 2AJ8A 1E4EA 1NBMD 2I4RA 3COZA 4RZSA 2VAPA 2A4MA 2J08A 3NC1C 2HXGA 5GONF 9GPBA 1U4SA 4OLHA 3WGVA 4OJMX 3TJRA 1Y1TA 2XKBA 3VDMA 5J47A 4RPJA 5IF3A 3HLKA 3ZIUA 3Q7SA 4OIFA 1L7AA 3EGXB 1NF8A 1YVUA 4ZYLA 2ONJA 2Q28A 1M75A 3RS5A 4UMVA 2ZIGA 3SYNA 3V4VB 4RYLA 1XZGA 4PLWA 2BFEB 5T5QA 3STVA 3OTWA 4YMIA 5TQ0A 1QGED 5GZ1A 3FFWA 3GLUA 4W8HA 2M98A 3DWIA 4AF8A 3CIOA 1CLUA 3SZRA 1KI3A 1ARZA 1Q6YA 3P2MA 3PQCA 5AUQA 2PUFA 1EA7A 1VCIA 1HORA 2XHEA 2JIZA 3IEKA 4QEZA 4GH5A 3U3OA 3CVYA 2XB6A 2C54A 4GGPA 1YHYA 4KRYA 3A06A 3TBKA 4H4EA 3QHQA 2NZVG 5HF8A 4AIRA 3H2GA 2WVJA 1WJGA 2B2NA 3E7WA 2P3OA 3ROFA 1UFKA 5C53B 2C2WA 2XMZA 1Q2UA 2P5UA 1MENA 1NJ6A 2GILA 4JGIA 3CKKA 4BNKA 4DZRA 2GAAA 1V8FA 3IIKA 1DTWA 2QX6A 2EW1A 4YCLA 2OK8A 3VX4A 5LPNA 2CV1A 4RIGA 1HTWA 3LC0A 4MKZA 2H08A 3A1SA 4N4AA 3OIDA 3TTSA 1ZRMA 2HHJA 5H68A 3WGQA 4QASA 4C20A 4YMLA 1IBMB 2J3DA 1AO0A 2IC5A 2XV1A 1UBHS 2R68A 3EFOA 2P4QA 5HTKA 2CEKA 2FR8C 3OM0A 5K2MA 2HC9A 2OQVA 8GPBA 1L8OA 2JI9A 2DC1A 3HWSA 4MMXB 5JC1A 4G1EB 2BEWB 1SEVA 3AI1A 2D5IA 2GCEA 2WWHA 3H0EA 4GBMA 4MRRA 4RMJA 5KOJB 5A0FA 3OQMA 3KR0A 3MOGA 3NM5A 3T54A 3TEMA 4XUEA 4M1QA 1NF3A 1OFVA 2HDOA 3PNKA 4TQUS 1ZL2A 4AP9A 1NVXQ 3NEAA 2FDCA 3IE1A 2FHPA 3CSUA 5BOSA 2YFYA 1PJRA 1B14A 1OASA 1QKIA 4IJ6A 1BJRE 3BFKA 4RMGA 4I3GA 5EP2A 4K40A 4PAGA 1WETA 1BHJA 2X0NA 3G0HA 3EUAA 2B7CA 5A6SA 2J3EA 2RI1A 5EP1A 4S1TA 3IP7A 1SUIA 2GD2A 4M9RA 1OAKA 3G0IA 4OKSA 3QMMA 3QZUA 3KTAA 3WKEA 5FX2A 4X7RA 1YRLA 2A7XA 4R1TA 4PXYA 3VHLB 4X1YA 2XMBA 3CT4A 4Q01A 1ZD3A 4X00A 1CW2B 2YV1A 2DFDA 4WZZA 1XJWA 2D8MA 3QF4B 1NYTA 2AN5A 3F78A 4UTZA 2X76A 5FCDA 3ZQ6A 4DA6A 1FUEA 4W8OA 4GOND 1IM2A 3ICVA 4HOYA 4RSGA 1IATA 8LDHA 3JQBA 5YASA 3NATA 3SM9A 4BASA 2J7PA 2E89A 5FTNA 3PF8A 3DMYA 3U9LA 3M1LA 4GBED 1Y8CA 1HR0B 1X80B 1EJ6A 3I5XA 1XMVA 1P1FA 3OPYA 4J7AA 2BLLA 3MTGA 2WJ3A 5D5QA 2CKMA 1PSDA 1N6HA 4FPXA 4EGSA 4G86A 2Y3IA 3ZLTA 1ZG3A 5LDHA 4UOZA 3TUJC 1MAUA 3AG5A 1U2RA 4ZOLF 2LIPA 2QYHA 5TS2A 1XZMA 3QOYA 4EW2A 2HXYA 2YWXA 4DCNA 1JB9A 2WMNB 3LLMA 4X3OA 2DWCA 3E8SA 1LI5A 1Z13A 2JW5A 4GMHA 1M9NA 3CRNA 5AKKA 1QIDA 4D9CA 4AZWA 1PWXA 3NHMA 3N2KB 1E2DA 4CUJA 1GAXA 1I9CA 3CZRA 2V7UA 4LBVA 2Z3ZA 2R4TA 4D56A 2FP4A 2Y0DA 1TECE 1F5SA 1ZL0A 4TMTA 3MLEA 4B7UA 3PEYA 3FZQA 4H77A 4LW8A 1TD9A 5ECYA 3DEAA 4MWDA 4A27A 3AB3A 3Q3IA 5EJAA 1P2UA 3GZJA 4HGQA 1G3UA 1LFAA 2IYPA 4RADA 5KOIA 1ZHFA 4PNZA 2GWRA 1RYBA 3BAZA 2RIRA 1LSOA 1W35A 4LYDA 3IAHA 4YJ3B 3TM5A 2IUFA 2PKQP 1LU9A 4MPRA 5DHSA 4XCQA 3H9UA 4PYKA 4O63O 1G2IA 4Y2XA 1G64A 1H2BA 3QE4A 1V3QE 2WVHA 2AOUB 3QU5A 1M1YB 1I8TA 2XY4A 2Y1LA 3U4IA 1LWOA 2AD1A 2EOAA 2GXUA 5ADUS 3ANSA 1W5FA 1EJ2A 3OZBA 3I4CA 3V97A 3K9WA 3VKUA 1SZDA 2JAPA 2RK3A 5L4SA 1E0AA 3OZUA 4WT7A 3ROZA 4IKOA 4P4SA 4JVOA 1GV1A 5GADl 2Y1DA 3A4VA 3H8VA 5GWXA 4WUVA 1OU4A 2ZE7A 1ZIOA 3WGJA 1MQSA 2VHQA 3TDMA 5I8WA 2W4MA 3HV2A 4XD7A 2XCRB 4QM6A 3F7NA 5AW1A 5JYBA 1W94A 2W42A 4IDDA 3HBNA 3R0JA 5E95A 4BMYA 4OGKA 3CVUA 3ZDDA 1B8VA 1ZBDA 2IZ5A 3IV9A 4MV8A 4PQGA 4ZHSA 1GPKA 4NESA 5ER6A 5J1TB 1PWHA 1RBQA 1K86A 4JX8A 3R6LA 1N5MA 2PBZA 3B1JA 4HEQA 5A5VA 4TVSA 3WSVA 4URVR 4NMLA 1RPJA 4XDYA 1S2OA 1N75A 2Q2VA 2H48A 4WOJA 3R9KA 3EZGA 3IYLW 4GYKA 1ECLA 4JLMA 4HH0A 1HT1E 3AO0B 2FQ1A 2M32A 4GUAA 1AN0A 3FFXA 4HS4A 4NPAA 5J43A 1UBMS 5IJ0A 4BMCA 4HZUA 4UZSA 1R0CA 2ETVA 4P84A 3WTCA 2I22A 3ZU5A 3ZQJA 1EUZA 2NLOA 3BFPA 3WVNA 1IN7A 4OHCA 1Y82A 2FLVA 4EZBA 4CKCB 1T8TA 4DDMA 4JQSA 5TMDA 2GUGA 1M1UA 1FTQA 2J9FB 5MFPA 2IEZA 3ZJVA 2XXJA 3OIWA 3LQYA 1TMKA 2P9FA 1ZM3A 1BDMA 4INAA 2BR4A 1LRLA 3GEGA 4FBMA 1JHVA 2BEUA 2VF8A 1FRZA 1WQ1R 3D4LA 2PLAA 1GPUA 4QNNA 2WU3A 2X5NA 4E33A 5JZ9A 2VK8A 3R3YA 4EHNA 3CLUD 2WICA 1BEUB 3PD1A 1EUCB 3WWOA 4EZEA 4RVFA 1XOIA 4I19A 1T2EA 3DMNA 1RQGA 1QTIA 2JAWA 4LQLA 1FP4B 4BGUA 2ZS9A 4H7EA 4JEIA 3MUNA 5CB4A 5H4HA 1CZHA 1YT5A 2IP4A 2QVGA 3KJEA 5EY5B 4N82A 1DIBA 5KWVA 3B8HA 2PGJA 1RPTA 4AD8A 4YGYA 4OQ4A 3TJZA 5HK9A 5EKUA 3GCWA 4NZMA 5EMKA 1CZKA 2VNAA 3HJHA 4UXIA 3LO8A 4OHRA 1DTEA 4HDMA 1E92A 2LBPA 5HCNA 1FFXA 4BKPA 4CKWB 3B82A 1G20B 1LPBB 1MC5A 3HVHA 3I61A 1DDOA 1Z6PA 3I62A 4DUPA 2OGSA 1CF2O 3QFRA 3ORSA 4WV3A 4BFSA 5HF9A 1T34A 5EJ8A 2NPOA 2PANA 2V9PA 1Z22A 3AETB 4INPA 5D7NA 2EU8A 1E1RD 2OILA 5CYFA 3HP1A 3MRVA 3OUTA 3N5CA 1EE1A 1E5VA 3ISTA 1X9HA 1Y5NA 1G8JA 4KOAA 1EHIA 1D2GA 1SHKA 2B8EA 3CV3A 3GFPA 5CCXA 5A03A 1I10A 2PSEA 4K6KA 2CK3D 1Z82A 3JQ7A 3TLGA 5JJLA 3VQTA 4K6CA 3LBNA 1OPRA 5C8DA 3ZWAA 1X6VA 2BFWA 2Y4NA 2VTBA 1E3WB 1Z26A 1NDHA 4MI3A 3B3FA 2BR3A 3C8MA 1P4GA 3QWBA 1QHEA 1UKVY 5D5HA 3TZHA 3K7EA 1KI6B 3HZZA 2FXVA 1BXZA 4N3BA 4RK5A 4YJ2B 3UWMA 2NYVA 4Z1MA 1NMQA 4OMCA 3X1DA 3HXOA 1Z7GA 3P0JA 1HURA 2CN1A 2EKQA 4FGKA 5E9QA 4TKUB 3W8RA 5JRJA 1G19A 2PV0A 1MNQA 1U0RA 3E9CA 3OZDA 3R4VA 4P31A 5EIAA 3TL6A 3D4PA 1I30A 1II8A 2PT9A 2QM8A 3KLOA 1QE0A 3MAGA 3LWBA 3OUUA 3SZGA 3IEVA 2IGTA 2FVXA 1DV2A 1I7LA 1K6JA 2GEUA 1NJGA 1P18A 4CUZA 3KM0A 1ZU5A 3FSRA 3RUFA 1NBHA 4B3BA 4UUQA 1M8KA 1E3QA 2DHQA 4PYQA 3ILXA 4M1OA 3BXFA 1FTGA 4KZKA 2AK3A 1ESCA 2H1LA 3Q8WA 4KHZA 2G0TA 3L4BC 2ZR8A 3CFYA 1HDXA 1JYFA 1QGDA 2AXEA 4YQZA 1TAQA 2QN9A 3NGMA 4ITRC 3JVIA 5AI8A 2YS7A 3GZNA 4MWBA 5HFNA 3UMGA 3WLKX 4AJNA 1BGWA 4D57A 4KQ2A 5J4KA 1UPFA 2AJTA 1XN4A 3M70A 4LF7B 2CVPA 3B2NA 1N7HA 4FU0A 1ONNA 5LMZA 4NLLA 1VBNA 5FXMA 4CIVA 2QBYB 3KXKA 5CM8B 4DLTA 1BVHA 5I7HA 4MAMA 1X1AA 3ZDFA 5ES3A 2JIPA 4YO8A 3Q3EA 4HAWA 4E5UA 1DIGA 3ER9A 2ZRPA 4B87A 3PGA1 2ZYSA 2XXAB 2EGGA 2YFKA 4IP0A 5CVUA 5JQWA 1FU4A 3H9EO 1XHEA 5JJ5A 2DUJA 4GRIA 3BWCA 3PU6A 3UFXA 1AKQA 1XEXB 4G41A 3P94A 4JWKA 4ZOBA 4DMRA 4MS4A 4LS3A 3ZH2A 3K72B 1GYRA 4BP1A 3A3NA 4TMWA 1LQ2A 3LCVB 3LHFA 1HA3A 1P9NA 5JHGB 4WZAE 4OFWA 3AK4A 2R84A 3JQ8B 1OAOA 4UVEA 2B69A 3GAAA 2EZ8A 3T5CA 3OU2A 1VTKA 4BN4A 5HKAA 5LNK1 1NQOA 2BZ0A 3HLYA 4NBRA 2RGUA 1NW7A 5DYYA 3MNFA 4KE9A 3L92A 4HMPA 4UMEA 4YJKA 4L72A 3F7TA 1J5XA 5I3ZA 1SBTA 4JYZA 5C5CA 5DGIA 1Y9ZA 1E3JA 4CV0A 3HVIA 1AKNA 4OX9Y 4BTEA 2VJMA 1XKXA 2P65A 2GBCA 5KYVA 3EIWA 4BFTA 3PWTA 1CQPA 3JYHA 5LZ2A 2J3MA 4F9FA 3F90A 4R01A 4CR8A 2BJHA 1JP7A 1PJ8A 1F2UB 1WB6A 4L3WA 2YMLA 1L4EA 3TIVA 1JXQA 3ODGA 5LUAA 1XQ1A 4FYYA 4FOOA 1TYBE 1N2CE 4FLFA 4UBKA 3ETDA 1W8IA 1TZMA 3L07A 4C0BA 3BXZA 1M7HA 1HETA 1ZRHA 3ZNNA 3NHZA 2HA7A 3BN3A 1FYEA 1NGSA 3C3AA 3GIDA 3LY5A 4N54A 5F64A 1UBEA 2HU5A 4D0GA 4MLZA 1QPGA 4F4JA 1YS2X 2OAEA 4GLJA 4LXGA 3HJGA 1L5MA 1YE8A 4NJOA 3DCIA 2PGAA 5DU2A 1YQGA 1N1EA 3CJRA 4KAJA 4HP8A 4LGMA 3ZOZA 4KMMA 4G67A 1RWPA 4IY1A 2C07A 2O6HA 2JHGA 3NOOA 1GUDA 3K6KA 5EIBD 1GA4A 3ESAA 2VATA 1V5WA 2R00C 3UYLA 3HU3A 1X8JA 2MYUA 2FWRA 2JLBA 2C5BA 3EODA 4NMHA 4D9NA 3MXTA 1T6BY 2CXXA 4NS1A 1DQYA 1I36A 1GXSB 2P2LA 2IXGA 3AKYA 1XU9A 1I32A 2GPTA 2JHAA 2ZRAA 4RGQA 3RG2A 4DNXA 3PWSA 4F46A 5AM2A 4KRFA 4RD0A 1FFYA 3M33A 3EXHB 3UTDA 2KWIA 3CONA 3K4HA 3NDRA 1GPDG 1A4IA 1LSSA 1XTUA 5FBZA 3TLEA 4TLLB 4AJPA 4R8RA 4A92A 4HNGA 1WA5A 3TPZA 3ZCTA 5HJEA 1JHOA 5IJWA 2HDHA 3F4KA 4MW4A 5DISB 3FLAA 5BV2P 4EUKA 1B2RA 2LNDA 3KPJA 3D3EA 5KTOA 3H83A 2I78A 3IOCA 2C3MA 4QOIA 2X14A 2IXBA 2NZUG 3H9CA 2Q5OA 3LW7A 4IGFA 1R18A 4QYXA 5ELXA 3COJA 1SBZA 2YJGA 1U6KA 1GGEA 2DBQA 4OJTA 2J33A 3OLYA 4GC5A 2E85A 3IULA 1P3DA 2QW0X 3ROPA 2GJ8A 4DMMA 4JGGA 2B7LA 3LBAA 4GGOA 4A15A 1UBCA 4BUJA 2A0FA 3JVVA 3U9TA 2D3TA 2ATCA 1W4LA 2ZT6A 2IYAA 2OGTA 2WG1A 3DYIA 4BUZA 3HCEA 3A9VA 4ADSG 2V4UA 2KLBA 3D1JA 3T15A 1GT6A 3I9NA 4EG4A 2E4WA 4HEA1 1YZFA 2IOFK 3X0DA 4LRUA 4F5DA 2ERYA 4HX9A 4WN9A 4J4TA 3HU2A 4UW9A 4UAVA 2Z6UA 2QRPA 3ZQUA 4EOGA 1A8PA 4DPKA 1ZNZA 3SJ7A 3SKVA 1EM8B 2PSHA 1KEEA 1Y7TA 1MF7A 2VCEA 1SBYA 1H5QA 1R5NA 1AQYA 3CCCA 1UFQA 3L0SA 2V6IA 3LGXA 3ORRA 4G9GA 3UWPA 1QC5A 4GOOD 2JA1A 1DWPA 1JDBB 3LI2A 2HB6A 2FJUA 3GGPA 2DBZA 4N47A 2PPLA 1QG0A 3AUXA 4MO9A 4Y9SA 5C7OO 4IDHA 2P5SA 4AJ9A 3GD5A 5J5VA 1EVJA 3EDOA 1U5AA 4A4DA 1AXEA 2C9MA 5ENVA 3M9WA 2WJJA 4JI3B 2WQ6A 3EIXA 3HGMA 4MLPA 4JOCA 2WHPA 3X1XA 5CFOA 1C29B 2RKOA 3H2IA 2C2YA 5EG5A 1I3MA 4MARA 3C15C 3WHPA 2W6IA 4O4LB 2NU8B 1UXIA 3FAZA 1XPUA 3M9XA 5BP7A 3G0GA 4ILKA 1DXQA 1DIRA 1HPLA 1RM0A 3ZYZA 5E8RA 1JG3A 5BNFA 4K0KB 4K8OA 3WJ1A 1JKXA 2ST1A 2PYDA 3STHA 3C5EA 4EQ6B 3TMKA 4EKDA 1P4SA 5EZSA 3UA3A 4ISBA 2EFCB 2I6SA 1L7MA 4NMWA 2JD0A 3IDQA 1T5DX 5HZMA 3RADC 7MHTA 2EJWA 2CGEA 2EKZA 5COAA 1U9IC 3AY6A 1RW4A 3GUZA 4WZ6A 3FDJA 5DNDA 3UQYS 3V8MA 1VA4A 1AV6A 3WDSA 2BAGA 4ZI7F 3I9LA 2GNPA 3REGA 1L4BA 4QJ5A 2WYHA 4P32A 1IY2A 4NNPA 3CNLA 4EX7A 2VOJA 1SC6A 2VFAA 3ENZA 3QNMA 2XKAA 5BURA 2VLIA 3S6JA 5FHQA 2I4NA 3QU9A 4PLYA 3RASA 4D80A 5TQVA 4DNOA 4UDYX 3RVBA 2Y1XA 2VT2A 2HSJA 2RK6A 2QVLA 3ROKA 1UAYA 3HXMA 5CH3A 2X6QA 2C7BA 4MUXA 2Q4RA 4ENVA 5HR5A 3OE5A 5FNVF 3BSFA 3ROTA 3TGWA 1M6EX 2ZYVX 1PR2A 3ROEA 2PWAA 5TC4A 2R86A 3HHEA 4D9BA 1U7TA 3B9QA 3H18A 3OMLA 1BXGA 4ENTA 4C4TA 3ENWA 2G7MC 4H1HA 2H4JA 1CJKC 2ODQA 5FWYA 1WY7A 2JGIA 4FFWA 1OF1A 1X15A 2N46A 5EMHA 5KNBH 4O4IB 3T7SA 5CXUA 5KTPA 4TSFA 3K70C 3ZD9A 1V25A 4Y2HA 1CUZA 4Q7KA 3ZHBA 1RJDA 1Z0SA 2FZWA 3AX6A 3EQ9A 1AC5A 4CFZA 4Q00A 3D6VA 2CE7A 3R24A 3UG6A 4YYZA 4DA7A 1H85A 4BNDB 1ABBA 3Q1KA 2WJ4A 3ORYA 3B6JA 5TIIA 4RH0A 4JDUA 4IX9A 1PFGA 4MA4A 4UULA 4U9UA 5ED0A 2IOFA 4PSKA 2YJ4A 5EXDA 3T7TA 4C5BA 1SXJB 3PQ2A 4M76B 4LJYA 4CEHB 3BIJA 4MPJA 3CLHA 2IEAA 3DVSX 7REQA 1Z6XA 2R6DA 1NW6A 1WMBA 2YJ5A 3UAWA 4AN1A 1YQDA 4Y6LA 4BHTA 4UTRA 5LMCA 5AQEA 1MB4A 4HVTA 1H9CA 1VIVA 2R1ZA 2Z4RA 3DOJA 1MRSA 3DV0B 1KVQA 4PSVA 3KQSA 2RD2A 1I6LA 2GZRA 1Z4NA 2OOSA 3H5NA 1ODIA 1PGQA 4L8FA 4OY3A 4PZCA 5CNJA 5D1NA 3QEAZ 2OORC 2OHFA 4C0HA 4JI2B 3LDAA 1OWNA 1UDXA 1REQB 2VYVD 4R0NA 1ULZA 3GJ8A 4LX0A 5FI0B 4HBGA 3FM9A 5F1YA 2JGDA 3CPHA 1KQ3A 3QI7A 5DN6D 1JEOA 3L7IA 4MSUA 1NVAA 2VA9A 3WB2A 5C4IA 2A0YA 5J23A 4DW8A 4FIDA 4F4CA 1R0LA 1N1MA 1NJ1A 2DPXA 3PC7A 1TUBB 1ICEA 2EIHA 3PUXA 5BN3B 4KR3A 4UE3S 5LZ7A 1TZ2A 1W5EA 1BGVA 2HBRA 1EXDA 1QRRA 1RMQA 4PLZA 2CJPA 4FC6A 2JIBA 5B37A 4I3FA 2ZKIA 3FHOA 3HL4A 1K68A 4YAFA 2IKQA 1PT9A 2QEQA 2EX4A 3B1ZA 3JTMA 1WCYA 2CL0X 4L50A 1SKQA 4C4YA 2V6FA 3SHVA 4K88A 1NW5A 3FCEA 1G21B 1P9OA 1NE2A 1QORA 5L7YA 2MIIA 1XLTC 5JD3A 1X1RA 5IS2A 1RCTE 1T3ZA 1EDOA 5EERA 2ZJ4A 2QG9A 4AM8A 4MQ6A 2PFSA 4IUCS 4B43A 4MDYA 1U7ZA 2F2TA 2NXCA 4X8HA 1CRZA 2GX6A 2REXB 4EK9A 4QLBA 3MGGA 3TXAA 1OWLA 4DT1A 3IX7A 5LA6A 5AKHA 2JCXA 2XTMA 2HO5A 3P19A 1Q3HA 4B44A 5BXYA 1ADFA 1D2RA 5AUNB 5B6JA 4OREX 3FPBA 3GRRA 4Q4AB 3SVLA 2Q1UA 4Z3OA 3H17A 5DT9A 3L8GA 1BO6A 4CCYA 2F9MA 4BO6A 4OB6A 3LXRA 4RTMA 2GD0A 1TVEA 4HHEA 2VP0A 1Q7GA 4HQFA 1O96B 1PQWA 1ZNXA 2FZLA 1XRPA 3VR4A 2W2PA 3WIBA 4UU8A 4DDTA 5JSQA 1CEQA 3ZWWA 4LJ5A 5HGXA 4HUJA 1ST2A 4IQ0A 4KDEA 1JU9A 2V0NA 4E21A 1J4AA 3WGZA 5T4EA 2HWUA 5KPDA 1HT2E 3G82C 3DO5A 1V16A 1S96A 2OXIA 4R1NA 4UAJA 2AEMA 4HAXA 2REQA 2OCDA 1W96A 2P9TA 1KZYC 4EJSC 3FVTA 3CNEA 4O0LA 4AWXA 2XTAA 5CVTA 4O08A 3IGFA 3OCUA 4CMEA 1QIKA 1F2VA 1Y4SA 2PGNA 2X15A 2X8WA 2R1TB 3HC7A 5ARCA 3RFXA 3W1VA 4DUGA 4C3VA 3G9XA 1B6SA 1M54A 3DDOA 1IZZA 2FSVA 3GU3A 3BRQA 1ZH0A 3Q3GE 4DYDA 1CJTC 4MUNA 4E6EA 5KOHA 2QQ5A 4DMHA 3QKSA 3LU1A 3HUEA 1J07A 2C82A 1SUFA 2PAFA 3AEYA 1I3OA 3HKEA 3QYAA 2ID7A 1H0RA 1TU4A 4G4IA 2AVDA 1T2VA 4J3FA 3K71B 3KZVA 1XMOB 1WWKA 4HDOB 1XA3A 1ZO8A 1MOQA 2H17A 2YXNA 3ER6A 5AIAA 5KKAA 3R8XA 4CM1A 4UOQA 3FWPA 4F72A 2C2ZA 1JEYB 2CVFA 2C4MA 3FWZA 1MO3A 3L8CA 1WPXA 1ZZGA 4BVLA 4QATA 2XITA 4RGBA 1E9EA 5LKRA 1VE9A 2E55A 3TUZC 4M60A 3CLKA 4D3SA 4PPQA 1EUDB 3EVGA 3V4OA 5KWSA 4C5AA 4H4CA 3FYHA 4TLDA 2IPAB 4TLEA 2WIDA 2FJ0A 1QQ5A 3CLTD 4ABTA 4TWBA 4MUJA 3AOEA 3ENVA 3CN9A 4EHDA 1Q74A 1P74A 1Z56C 2QWXA 3C7AA 4ME6A 2JC3A 3SDZA 4K9KA 3H4TA 3F0TA 4YAIA 3BMNA 3LL7A 2CL5A 3PBKA 5LDDC 1QGUB 3Q6MA 4EKIA 3V1YA 5AVJA 3SBDA 4QSHA 3BQ9A 3OFVA 1M6VB 4BNJA 2PCLA 4OSPA 4YDQA 5KNDD 1WDWB 1DRJA 3QE9Y 2YL2A 3LQKA 4ANFA 4JNKA 3HZOA 2I3AA 2XCUA 4LFAB 3G7SA 4KQWA 2BP7B 4BZZA 3FRIA 3AHIA 5MFZA 2C96A 4GLBA 1E2BA 1SCIA 5AVXA 4GXQA 4C3UA 2AR9A 1PX0A 1NUTA 1PT6A 2G8NA 3EFBA 4ND8A 3IERA 3DE6X 4UVGA 3FLBA 1DAIA 3JQGB 4J4BA 1EG7A 1EX9A 3OA2A 4D74A 3THWB 4K03A 1OX4B 2V7BA 7ABPA 4HNTA 1GNQA 2VP4A 2RGEA 2FPMA 3D5EA 4GLFA 3UXHA 4MI9A 2ZWVA 2PXCA 2ID4A 1CBUA 2DHDA 2FJPA 3CW9A 2OTCA 4H1TA 4QYMA 3VU9B 3W05A 2XEXA 1GYQA 1OT3A 3SEFA 3EVAA 5JNLA 5DP2A 2PGXA 4LMAA 1Z33A 2AOVA 2ZYIA 3JQBC 1N5DA 3KEMA 4EL5A 2GPBA 4QBIA 5L3SB 3Q3JB 2BRUA 1R8QA 4IV5A 2XVMA 3BSYA 4K46A 3NTVA 1B3BA 1UWKA 1O87A 2A0WA 2JAOA 1DO8A 1B0AA 2UVQA 3NHYA 4JB2A 1MC1A 5AHWA 1L7QA 1M73E 1B41A 1X3SA 4IPTA 3WFZA 2YDYA 4IIJA 2LZ0A 5BQFA 1Z0ZA 1IFXA 2RG1A 3SKXA 1DIAA 2RAUA 3GGCA 1E2FA 1SXJD 3RSHA 3AEUA 5IMBA 1GNRA 2EIXA 2F90A 4PIPA 4LE2A 5AVTA 1DQSA 2RGXA 4LRSB 3PUJA 3WDKA 1CUBA 3PIIA 5ALVA 1MT0A 2Z3VA 3DMGA 5KTNA 2DBRA 3G7NA 2OP1A 2IY7A 5JJCA 3S68A 3DE7X 1XTQA 4DLWA 3DV2A 4TWZA