3ICPA

Crystal structure of udp-galactose 4-epimerase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
311
structure length
295
Chain Sequence
MRIVVTGGAGFIGSHLVDKLVELGYEVVVVDNLSSGRREFVNPSAELHVRDLKDYSWGAGIKGDVVFHFAANPEVRLSTTEPIVHFNENVVATFNVLEWARQTGVRTVVFASSSTVYGDADVIPTPEEEPYKPISVYGAAKAAGEVMCATYARLFGVRCLAVRYANVVGPRLRHGVIYDFIMKLRRNPNVLEQRKSYLYVRDAVEATLAAWKKFEEMDAPFLALNVGNVDAVRVLDIAQIVAEVLGLRPEIRLVGDVKYMTLAVTKLMKLTGWRPTMTSAEAVKKTAEDLAKELW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords NAD-dependent epimerase/dehydratase
publication title Crystal Structure of UDP-galactose 4-epimerase
rcsb
source organism Pyrobaculum calidifontis
total genus 106
structure length 295
sequence length 311
ec nomenclature
pdb deposition date 2009-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3icpA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3icpA02
3JQBA 1Q7BA 2OP1A 1W6UA 1GEGA 3GVXA 3LYLA 1EE2A 4S1VA 2OHXA 5F21A 1TLTA 5IAAA 3I6QA 4CUZA 3KUXA 4RO0A 5K6AA 3HADA 4U0JA 5T64A 2I67A 2YZ7A 1PGQA 3RASA 3UFXA 3WBBA 1UJMA 4J7CA 1EDOA 1GL3A 2R00A 3U4CA 4UVEA 2SCUA 4W99A 4HV4A 2X1HA 3U5TA 3MTGA 3DZIA 4YTEA 2V6MA 4YJHA 4AJOA 5A5EA 3OH8A 3VKUA 4CQMD 2D2IA 4DMLA 4F6LA 3PGJA 1MLDA 3FWZA 4XB2A 2BGLA 2QYSA 3WX0A 3H8VA 3L6OO 1L1FA 2YHIB 2NTJA 1MP0A 3CUKA 1DFHA 4J49A 2EKPA 3F47A 2VHVA 1JWBB 2JCYA 4PLWA 4CMJA 1EDZA 4PG5A 4YJDA 1KVTA 4PLVA 4BUCA 3TZKA 3V5NA 5K0ZA 3VVBA 3ZWNA 1LLCA 3OA2A 1YOVB 3M2TA 5BT9A 5JMWA 4YACA 4E2XA 1PQPA 1KVUA 1RYEA 3GEDA 2RHRA 4CL8A 1HDGO 3SJUA 5JSFA 3QRWA 5L7YA 3RU9A 4H15A 5AOVA 1M6HA 3FHLA 4M86A 3ZN2A 4CMBA 2FR8A 3TJRA 4DBZA 1VE9A 1GYRA 4CLDA 2YY7A 1X7DA 2ZJ0A 3DZKA 3DBLB 3WGIA 5JBIA 4N54A 3HDJA 3VPHA 3OJEA 4BKPA 3QY9A 4HNHA 3L0DA 1T25A 1QR6A 4FC7A 3DMTC 4J6FA 1CWUA 3U62A 1LA2A 4IQ8A 2DBQA 4JIGA 1QLHA 4WJZA 4J2HA 2OGUA 1BSVA 3ZV4A 3ANLA 5L3ZA 2BI7A 4DC0A 3HDQA 3HSKA 3GF4A 3ONEA 2YW9A 2GZ3A 1IPFA 4JROA 1FDVA 2EG9A 1ZEMA 4CMKA 1UH5A 1LDEA 2Z95A 3H9JA 1SOVA 2QHXA 3OJOA 2W2LA 3ENNA 2D5CA 3KO8A 1ID1A 4BVAA 4ALLA 4B7XA 1X7HA 3SLGA 1NAHA 3QSGA 2C2YA 4CM7A 3LC7O 4DLAA 1PSDA 3K2EA 4GSKA 4PLHA 5ITWA 1PEDA 4AG3A 1H6BA 4XYGA 3I4CA 1E6EA 1PGPA 2VYND 5DN9A 3GN1A 1C0PA 4OOFA 1WLYA 1H0KA 4PRLA 1ZMOA 3BIOA 3OF2A 1B26A 1GADO 1MXHA 3LF1A 1N9GA 3ENKA 4PLTA 1M67A 3BMOB 3HB5X 2DUWA 3NRCA 3VC7A 4OXKA 3NJ4A 1VSUA 2CD9A 4CM8B 4M89A 1DRWA 1LLDA 1M6WA 3AJRA 4ZRMA 3SC6A 1JVBA 1HE2A 3DBHA 4BQPA 1ISHA 1D4FA 4R1UA 3WSWA 1PJ3A 1XIVA 1IHXA 4L75A 3RUEA 3U09A 4DL9A 2WMDA 2PZLA 3R3JA 1SPXA 4L9RA 4BO4A 4KDFA 4NK5A 1UP6A 3EZLA 4N5NA 2YV2A 1KY5A 3BTOA 3DTYA 1IULA 4NZ9A 3FD8A 2VWHA 2VRCA 2Q2VA 3U9LA 2GGSA 3JQFA 4E4YA 5DBIA 3RSHA 4CMHA 3C1AA 5JDCA 4LW8A 2OMEA 1ONOA 3GOHA 1JKFA 1PZHA 1ENPA 1LDNA 2GSDA 3ROKA 1Z45A 3B6ZA 2GDZA 2X6TA 2EERA 5B4TA 1DEHA 1TB4A 1IHYA 3B20A 4IBOA 1FDSA 2C0CA 1NPTO 2OL4A 4UEOA 3VDRA 2RIRA 3CEAA 4LISA 2JKVA 4E13A 1IYZA 4MVJP 4ZQHA 1ML3A 1KY4A 1ONNA 4UVGA 4GMGA 3U3XA 1WZEA 2NU9A 3AOEC 2O7QA 1I2ZA 4R1NA 2D59A 5F3RA 3ZWBA 1DFGA 1YRLA 3KOUA 4ZICA 1UDAA 4TROA 3A4VA 2YFQA 1V3TA 1VPDA 4IQ0A 1PZFA 2AQHA 2Y93A 3RC7A 3Q2KA 3AU8A 1HDZA 1JTVA 5T6BA 1EBUA 3WGZA 2PKQP 4RPKA 4R5MA 4Z9YA 3JQ7A 3RBVA 4WLEA 2P9EA 3H6KA 2VT2A 3INTA 3Q0EA 4PLYA 1U1IA 1QV7A 4CM5A 3IAHA 1I2BA 3KZVA 3TFQA 5JW6A 2PLAA 4HWKA 3T7CA 4XRGA 3GUCA 1UXGA 1J4AA 1I0ZA 3BHIA 4Z9XA 5G0VA 4R41A 2HLPA 3IP3A 4G81A 3QA9A 2FWMX 2NQ8A 1R4NB 3WYCA 3OSUA 4B4WA 5GZ3A 1T4DA 2QW8A 2LDXA 4KTTE 3GHHA 3I9NA 4B3IA 3I52A 1YB1A 4JCOA 3RI3A 4BNMA 1Z6ZA 2O3JA 4CLEA 5DP1A 4U7WA 4EUHA 1U8XX 3AUUA 3D3WA 4AJLA 3Q1LA 1AHHA 2JFHA 4W82A 2I5PO 4XQGA 1P1HA 3B1JA 1NR7A 4BNKA 3V2GA 2I76A 5CG1A 3BAZA 1V9LA 3WQQA 4GGPA 1NR1A 4Z3KA 1YL5A 1LSJA 1MG0A 4B8WA 4OO3A 4RVFA 3E9NA 3WGHA 1KIFA 4BB5A 5G4KA 3IKTA 4INAA 2E4AA 3MJSA 3OEYA 3PWKA 5BNTA 3OJLA 2F1KA 3T4XA 2JL1A 2Q1TA 3JQ9C 4QFCA 3VZPA 1P3DA 1U9JA 1E3SA 1G1AA 2Q1UA 3NDIA 1I2CA 1XQ6A 2B83A 5FFFA 5J23A 3DHYA 1IPEA 5A03A 5GZ1A 5EERA 5T8KA 4ALJA 5A4DA 2JHFA 1XEAA 2POQX 3JYOA 4IJVA 3ON5A 1N2SA 1LJ8A 1S6YA 4XYBA 4RZHA 4IDGA 4IXTA 4WEOA 3I4FA 5TC4A 3S2GA 3ZU3A 3FF4A 1E3EA 1I24A 1ENOA 4K6FA 4UEJA 1C0LA 2HU2A 3ICCA 2P91A 4E32A 2J3KA 4EZBA 1PS8A 1DBVO 1LU9A 4LMRA 3DQPA 5CPFA 2J5QA 1WDMA 3D5TA 1EFKA 3ITDA 2VTEA 3DBRA 4DVJA 1GZ6A 4D42A 4PRKA 3OICA 4Y9DA 4NJMB 3NDJA 3ORFA 4AJEA 1VM6A 3ONFA 2DPHA 3I9OA 2VWGA 1I01A 4ALIA 1KC1A 2X0JA 3PYXA 5L45A 5CP8A 2NNLD 1T2DA 1KVRA 2C2XA 4DQUA 3PZBA 2VQ3A 2JD1A 3UCEA 4YPOA 5KKCA 2DUUA 1WPQA 3MTJA 3WS7A 5I8ZA 3WWYA 6LDHA 2Y0EA 1E1NA 2BFMA 5EESA 5TGDA 1HYGA 2ZCVA 5FI3A 1B8VA 3K92A 4P38A 5EJ2A 4BNHA 1KEVA 2DTEA 4ILKA 1RKXA 4Q3NA 3EHEA 1T1SA 3A9WA 1DHRA 3WJ7A 2NSDA 4HFJA 1C3VA 5L4NA 1YL7A 3DZBA 5G2OA 4ZQEA 1V0JA 4RDHA 1EK5A 3JQGA 2QZ9A 1E7QA 3D4NA 1AE1A 3BZUA 2W90A 2PK3A 4CM9D 1QXSA 2WEKA 3MWEB 1Q0QA 4IXWA 1NQTA 1GZ4A 2FP4A 1W0CA 3GHYA 1KEUA 3BMNB 4NNJA 4QSMA 1P44A 3DAGA 4NBVA 2YDXA 5FWNA 3C85A 4AJ4A 2HJSA 5KJFA 2Q50A 3ZHYA 2VZ9A 2WDZA 2DFDA 1ZZEA 2WE8A 2OXIA 3KLPX 3ZWYA 3UCXA 3NV9A 4J1SA 2QYTA 3WR5A 3B70A 2VWPA 4O5OA 1D1TA 4R54A 4FJ0A 4CMAA 5BNIA 1PWZA 1N1EA 1PQUA 5ICMA 2QZZA 3W8FA 1EFLA 1ZKMA 3GG9A 3PJEA 4MVJF 1N1GA 3ZWAA 2IZ1A 4IIVA 3AW9A 2VRBA 4CMEC 3VKVA 3PDUA 5THQA 4ND3A 3ZWVA 3GDGA 2DPGA 3F5SA 4D41A 1UP4A 1W4ZA 2H9IA 4AJ2A 5B12A 4Y6RA 3LF2A 2X9GA 4IUYA 1LDMA 5B4VA 4NBUA 3L4BA 2PKQO 2IE0A 4D43A 3ADOA 2B36A 1CQJA 4IM7A 3L07A 5AXBA 3KEQA 4JJFA 3IJPA 4GAEA 5EQDA 3TZQA 3JQ8B 3BTVA 1DIGA 1HZZA 1H93A 3IQDB 5I7SA 2ILTA 1AHIA 4DPLA 4JJIA 4II2A 1EUDA 2B37A 3MJVA 5C5IA 5TLSA 2C07A 3VAZA 3AFMA 2BHLA 5T67A 3JQAA 1SC6A 2WD8A 4DUPA 4I5GA 1SO8A 4W6ZA 4YXFA 4XIYA 4L74A 2BFOA 5EL0A 1HDCA 1K6XA 1AUPA 3E9QA 5AQ1A 4XR4A 3UHAA 4PZCA 1T2AA 4EW6A 2BD0A 4RL6A 3HNPA 3WSVA 1ZIDA 1VL6A 4OKNA 1YS4A 3PQDA 1DAOA 1NXQA 1VSVA 2P5UA 3MJ4A 4FOOA 1MFPA 3WLEA 2EP7A 4TZTA 7ADHA 4DLLA 4MKZA 2WM3A 4AL4A 1UXIA 4IMPA 3K8ZA 4PG4A 2NVWA 3MCVA 2EW8A 1LLUA 4NMHA 2IDZA 4EGFA 4JP3A 2D0IA 3EK2A 5A5FA 3PVZA 3GC6A 4HUJA 4W4TA 4NJOA 4QXMA 4AJ1A 1NX6A 3AY7A 4Z0HO 3INRA 5HS4A 4IDCA 2IXBA 3RBZA 1E7WA 4MP6A 3LQFA 4MP8A 4A2CA 4KOAA 2GO1A 3ROPA 3ADPA 2CUKA 4ZD6A 1DC6A 1H9AA 4R5HA 1MC5A 3GR6A 4GH5A 3KYDA 4E33A 2O3RA 2NACA 2Y1OA 1NM5A 1S7CA 4U6SA 4DQXA 1NQ5A 3O03A 5TX7A 4BO5A 1NHWA 2EV9A 2Q1WA 3JCZA 1E3WB 3GVCA 1WMAA 4Z0PA 7MDHA 3EMKA 1UZMA 5IDXA 1ARZA 4N7RA 3EVTA 1FDWA 3NTOA 2VUUA 3DFUA 1ZBQA 4EBFA 4I5FA 1DFIA 4C7KA 2VYVD 1FXSA 4UUMA 2C20A 5A9RA 2DAPA 2H63A 3GVPA 1X1EA 1IE3A 4YT8A 1NNUA 1Y7TA 4RF5A 2O2SA 5JO0A 4GX2A 3OJ0A 5JLAA 3UICA 1ZXLA 2EEZA 2FOIA 4M87A 3AK4A 4LCEA 3DBHB 3GGGA 3RC9A 1C0IA 3MOGA 4WKGA 1GYQA 1ONPA 3KHUA 4TSKA 3ZZNA 1LSOA 5A9SA 4QT0A 3INGA 4BO9A 3JQBC 4FFOA 4IMRA 4RF3A 4TQGA 4UVHA 4NFYA 4P8RA 4BNZA 4J16A 4Z9FA 3RUCA 3ZI0A 1RYDA 2WWRA 2P2SA 5JCJD 1J0XO 4IDBA 3ZU5A 2LDBA 3ZHXA 2Z1NA 3GVIA 2OBNA 3VH2A 2HMTA 1GD1O 2I99A 5K6AC 2AQ8A 4AJKA 3EY4A 1BTOA 3H3JA 4OQYA 1LUAA 1XDWA 3ZWMA 2AEJA 4P4NA 3ZWOA 2X4GA 1XCBA 4GPD1 3V1YA 2CNBA 2R00C 1V3VA 4FPXA 3WGOA 1ADGA 1ISMA 1E3LA 2VOJA 1EBFA 1CERA 2Y0CA 4MP3A 4CQLA 2Q1SA 3KETA 3ZNNA 3AI3A 4CLXA 3UF0A 4OKIA 2X0NA 4HX5A 4RZIA 1GUYA 1HDXA 1YXMA 4L8VA 4CLOB 3PWSA 2YQ4A 1DDOA 3OIFA 1YBAA 4ALMA 1QYCA 2ZK7A 3HE3A 1ULSA 3S8MA 3E03A 4YB8A 3GFBA 2Y68A 1D1SA 3PRJA 3CMMA 2EKQA 4CM6A 2CDCA 1ZSNA 4R68A 1VJTA 2VNSA 1R66A 3A28A 1JW9B 1UXJA 5TJHA 1IY8A 2ZIZA 3H9EO 3GEGA 3JQ7B 1OBFO 4GGOA 3WJAA 1ISFA 1DC5A 3N74A 3CTMA 5KNLA 2HMSA 4GMFA 4BGIA 5DZSA 3LLSA 5L53A 1U7HA 3GT0A 1AXGA 2UV8A 3CZRA 2B4RO 5ADHA 3SBOA 3M1AA 3WGTA 2IZ0A 2WTBA 3RU7A 4M8SA 5IZCA 3S2IA 4M1QA 4FN4A 3RFXA 4WOKA 3DONA 3PGXA 4GLOA 1TA4A 3G3EA 3PK0A 1NVGA 1PJ2A 4IZIA 4ID9A 2DLDA 4QX6A 1HE4A 1OFGA 4UVDA 4DC1A 2C29D 5G0SA 3W8EA 4DIBA 4OXNA 3W4JA 1MFZA 2AW5A 4BV8A 2NADA 4OHUA 3A1NA 4XJSA 4LRTB 2VOEA 3AM5A 3GN2A 3BA1A 4DXHA 3DL2A 3EYWA 4D3SA 4IJUA 3WDSA 3EC7A 4D0SA 5JC8A 3ZU4A 3GAZA 1JLLA 1FDTA 2R2GA 1NQAO 3F1KA 3MEQA 5CDTA 5I9MA 5DDIP 1U3VA 1XELA 5DULA 3AUTA 1WMBA 4WLOA 5F1OA 5G4KB 3UW3A 1CQIA 1LC0A 3VPXA 4BGVA 1O89A 5DCUA 3KYCA 1DIAA 3N58A 3NDRA 1VJ0A 4CUJA 1QLJA 2X0RA 3FWNA 4RPHA 1Z74A 4GBJA 5CEJA 4H3VA 1BG6A 1QRRA 2BI8A 1U4OA 1GTMA 1ZK1A 4E2WA 1PJQA 4II3A 5DBFA 1EE9A 1EVJA 1T2CA 2OZPA 1Q0LA 4IIUA 3TOZA 4KQWA 3GUYA 4RORA 5JAIA 1J5PA 4RF4A 2FPPA 2XXJA 1ZK2A 3QW2A 1B0AA 1QSGA 5JDIA 3C1OA 4JBGA 4FFMA 2CFCA 1GDHA 3SC4A 1R37A 3FPLA 3H3FA 4I5EA 2DFVA 2DM6A 4J9VA 5ER9A 2X58A 4FS3A 1PS9A 2AG8A 4IGFA 2A9FA 2RHCA 4CMCA 4DIOA 5I9NA 4AFNA 3W6ZA 3ZWWA 1G0NA 1P1FA 5A04A 1HWYA 3H65A 1LQTA 2B69A 1YGYA 3QLJA 5I7EA 2A92A 4BNGA 3JQFC 3QJ5A 4OMUA 5JDCC 5DBGA 5I9LA 3RJ5A 3F5QA 1EVIA 1F06A 2TMDA 1DAPA 3VTZA 5H82A 1V35A 3PWZA 3IMFA 1YVEI 1O6ZA 4OJNA 3AOGA 4EUFA 4I9HA 5KVQA 4BO8A 4YYZA 4HNGA 4DPKA 3KSUA 3DMYA 4RPJA 2EXXA 2RH4A 4BO1A 4CMGA 4DREA 3DXFA 2Q4EA 1LSUA 2VRCD 5ES3A 2BGKA 1H2HA 2HK9A 3OEWA 1ENYA 3DOCA 1OI7A 4EUEA 5AVOA 2VHXA 5COAA 4NHEA 3GGOA 1JAXA 4R4JA 5CEFA 3WYBA 5FEUA 4KQXA 2UYYA 3ETGA 1NHGA 2PNFA 4W9NA 6ADHA 4BO0A 4HP8A 4UVIA 2PZJA 2E48A 2ET6A 3TN7A 2CVOA 4J9UE 2ZTLA 3E48A 3UCFA 3NTRA 1I3MA 3IJRA 4MKXA 4KUGA 3JQGB 2IEBA 3PHGA 4D79A 3DTTA 1HRDA 1QYVA 4R1SA 4AJHA 2O4CA 1SOWA 4CR8A 1C14A 1VJ1A 1Y8QB 3FTPA 4OSPA 3JYNA 1F8GA 3GQVA 4MOWA 2GCGA 4RCVA 2NV6A 2X5JO 4CMIA 1EUZA 2VZ0A 2Y1GA 4XCVA 3QHAA 5JO9A 3PHLA 3T4EA 3T7EA 2V6BA 2BFAA 3I23A 2QRLA 2D1YA 3IKVA 1XG5A 3JD1A 2VN8A 4PN3A 1QYWA 4I1IA 3CIFA 1UXHA 4LCJA 3KEOA 1BVUA 3DBVO 4NK4A 1UXKA 3DZHA 1AXEA 3PEFA 3HFGA 4N5LA 4YDRA 1ZK4A 4DLBA 1JWAB 5TRTA 3O26A 3STHA 1X15A 2VYNA 4DTIA 1GCOA 3ETDA 3H7AA 3VPGA 4XWYA 4GI2A 3FBGA 1U5AA 4XYMA 2CVZA 2DC1A 3H9UA 3V1TC 3H9GA 1GCUA 3MJTA 4FFNA 5DCYA 1I3KA 3LK7A 4PG6A 4B8ZA 1E7SA 5ICSA 3BMQB 2BRUA 1GR0A 3DWFA 3E82A 3V1UA 5L51A 2J6IA 1NPYA 1PJSA 2B0JA 3DOJA 1KYQA 1RM5A 4F6CA 2CZCA 4WCFA 3NT4A 3QP9A 3OQ6A 5IZ4A 3TL2A 1GPJA 4JBIA 2FZEA 2EP5A 2A4KA 1E6WA 1V8BA 2D5AA 3PDJA 4DRYA 4QTZA 5A05A 1CEQA 4J1QA 2NVUB 5T8KC 3RCBA 1KBZA 3JQEA 3RUIA 1LRKA 4XDZA 2Q3EA 1Y8RB 1YKFA 1A4UA 4CR6A 3ONDA 4JJGA 1V6AA 4Y67A 1P1KA 4YT4A 4NFSA 4BNNA 4AJPA 3MJCA 1B16A 1D7OA 3FTNA 1KOLA 5MDHA 2HAEA 2P5YA 1MX3A 2Z5LA 4LRSB 4P4GA 1DXYA 4MVJA 4YJFB 1LBEA 5ENDA 3ZW9A 4XJTA 1H5QA 3Q9NA 4A26A 3D64A 2GN9A 4TRRA 5JAZA 4YWJA 3ANNA 4O1MA 1YJ8A 3GPIA 2VUTA 2GZ1A 2PZKA 4HXYA 1BHSA 1JQBA 1EQUA 3ETEA 4O63O 1B7GO 3C7CB 3C24A 1XQ1A 2CF5A 3UAGA 3EVNA 1NP3A 3OIDA 3O8QA 3DB2A 3F1LA 1XLTA 1Z7EA 8ADHA 1C1XB 2XAAA 1A9ZA 1LX6A 4OQZA 3DFZA 4XIJA 1X7GA 1DO8A 4XGNA 3JV7A 1ZUD1 2PH3A 1F8FA 1A4IA 1H6DA 4YT5A 1JVSA 2J5RA 4E2ZA 1SB9A 1ISJA 3KXDA 1A72A 3RQSA 2ZB7A 1XR3A 3K9QO 4D3FA 2IEDA 4F45A 1Z75A 3V2HA 2VUSA 3RUAA 3HN2A 2DT5A 2EGGA 4YQZA 3VHRA 3D4OA 3OA0A 3WGQA 2I9PA 4M55A 1DIHA 1DOHA 4L4RA 4NU5A 4QUKA 2CSUA 3AUAA 1JKJA 1E7YA 5T57A 1FF9A 4MVJM 1D3AA 1MXFA 4R69A 5F1PA 3IUPA 1ZMTA 2Y0DA 4D45A 5B4UA 1YOVA 2ZYGA 2PY6A 2PD4A 4EEZA 4WE3A 1CDOA 2W98A 1W73A 1DHTA 2HMWA 4YVFA 2CDAA 1EUCA 3PQFA 1EZ4A 4O0LA 1KEPA 4E12A 2C7VA 3L4SO 4PZEA 4QO8A 2C5EA 5CPBA 1TT5A 1BDMA 1P74A 1HDRA 4ZQGA 4Z6KA 4LSMA 1VRWA 4MKRA 1A71A 1BW9A 2E37A 2PH5A 4HFMA 5A9TA 4WLFA 3G0OA 3ITKA 2I6TA 3DBLA 5I8WA 2VZ8A 1DRUA 2HSDA 1P0CA 4KP7A 4BOYA 5L7WA 3C7AA 2QRKA 1HZJA 1GYPA 2ZTUA 3EUWA 2OOSA 1BGVA 5A3JA 1E6UA 3AU9A 2B4TO 4CLHA 4A5OA 1SCUA 3GK3A 3K73O 2HJRA 4KZPA 3GFGA 3OM9A 4J7UA 5BSEA 1IOLA 4YJGA 2VT3A 4CLRB 1XU7A 3I6IA 1ZFNA 4AJNA 4XA8A 1P9LA 1DLIA 4HFNA 2CDBA 3EDMA 4JQCA 2PGJA 3RUDA 5TNXA 1UAYA 1I30A 4RQUA 1KC3A 1R4MB 1BXGB 3L4BC 4J7XA 5K9ZA 4DGSA 3GA0A 1HSZA 4MINA 3KRTA 2TMGA 3L6DA 2FHSA 3QIVA 4NBRA 5L95A 3PI7A 1K5HA 5KJ6A 5CDYA 3IP1A 3TF5A 3WWZA 1IB6A 1P45A 4BL5A 1WAMA 1LEHA 2Q46A 1QP8A 3JQ6A 4Y98A 3TQHA 1TI7A 4XR9A 5BSGA 5CFZA 3S1LA 3GMDA 4PLCA 4UULA 3E5MA 1MB4A 2ZB3A 1PWXA 2JFFA 1ZCJA 3EZYA 1LDYA 4FW8A 2ZYAA 4WLUA 1E3IA 3CE6A 1QKIA 3BMOA 1RM3A 2AE2A 3IUSA 4CODB 1HYHA 4CM8A 4E0BA 4I08A 4BNLA 4Q3DA 4LSWA 1EVZA 1FJHA 4PLZA 1SEVA 4FSHA 3FNGA 4LK3A 4EDFA 1CYDA 1PGOA 2OFPA 2BF7A 3A14A 3HDHA 1ADBA 4XB1A 3L77A 1T26A 3JQAD 2WE7A 4FDAA 3WTCA 4CV1A 4Z3DA 4JXKA 5HBRA 2E82A 5IN5A 4FIZA 5LC1A 2NTNA 2FN7A 3ULKA 5GZ6A 1E1MA 2QIOA 1R15A 4OH1A 3AY6A 4WASA 1GPDG 2HRZA 3GNTA 4ESOA 4KMSA 3DZJA 4WUVA 2G17A 2PWZA 4BO7A 4YJHB 4BIIA 2G0TA 3H5NA 2D8AA 3TZHA 1UDCA 1SNYA 4ROSA 4OL9A 4TKMA 1P1IA 1ORRA 3AM3A 3LU1A 3OQBA 4XGKA 5A06A 4OOEA 4A73A 2BELA 2V6GA 4CR7A 2NLOA 4ZA2A 1PU2A 2ZYDA 3PLRA 4K6CA 4UUPA 2FR0A 3AY3A 3IC5A 3OMLA 3VTFA 2UUOA 3UKOA 3KYCB 1HTBA 4CM1A 2CF6A 3E18A 4IS3A 2Q2WA 1Y5RA 3SX2A 5BSHA 3K96A 1PL7A 1DPGA 1GQYA 4RVHA 2PV7A 2VTDA 3DHEA 3F3SA 3PIDA 2F00A 5EIOA 4E30A 3WYEA 4D7AA 3QVOA 3BTUA 4LMPA 3P2OA 4J43A 4L0QA 5JC1A 1FDUA 2HO5A 1K3TA 1YB5A 2YJZA 4U6QA 5IDQA 2O23A 3FI9A 4MIYA 3PP8A 2CY0A 2C54A 1QYDA 3TDKA 5JE8A 1J6UA 1TEHA 1HETA 2JJYA 1DJNA 4OXYA 4MIOA 5C7IO 2B35A 2AQKA 2X9NA 1R0LA 3WIEA 2WD7A 1YB4A 1B3BA 2FZWA 5CG2A 1WNTA 5ENVA 1R4NA 5AYVA 1SMKA 1CIVA 3BXXA 4K1LA 2CMDA 2I3AA 4YAGA 4GVXA 3CXRA 1MA0A 5CDGA 5EN4A 1UDBA 2WYUA 3ZNPA 3QVSA 5CDUA 2ZB4A 4CV0A 4RLHA 1WDKA 3DO5A 2J5KA 4ZHSA 3HHPA 1RPNA 2EF1A 5U9CA 2Z1MA 3UUWA 2QQ5A 3R0IA 1F12A 3JSAA 1ULUA 4NG5A 4EJ0A 5JYDA 5G4LA 1GUZA 3LZ6A 5A02A 2AE1A 3VOSA 5KOIA 2C82A 1YO6A 3ST7A 2DBZA 3KLMX 3G1UA 3TZ6A 3ANMA 3CINA 4XD2A 5LCXA 3PPIA 4P4LA 3K30A 1NAIA 1BWSA 4BGUA 3AI2A 4R9SA 2Y99A 1ZH8A 2EWMA 3D3EA 3U4DA 2GRAA 4CM3A 3ASUA 3ZV6A 3NTQA 3FSRA 3QVTA 1H6CA 1PS0A 2EGHA 4ZQBA 1DRVA 1N9GB 5LDHA 3GZNA 3QWBA 4J2OA 4R3WA 5I7FA 5CHEA 3F4BA 4JBHA 2EKLA 1PTJA 2Y05A 1T2EA 4CM4A 3TSCA 4KUEA 1ZEJA 4LGVA 4TKLA 1RM0A 1LDBA 4ND2A 4TRMA 4FGWA 3KM0A 3JQCA 3RC2A 2A35A 1GUFA 1PGNA 4WCDA 3Q9UA 1SBYA 4ND4A 2AQIA 3GVHA 3Q3CA 1LDGA 3GY0A 4JP2A 4FBGA 1P1JA 4CMIB 3QV1A 3NKLA 1K89A 1BRMA 1ADCA 2BKAA 4GWKA 5IZCC 2YQ5A 4W7IA 5C7OO 1W8DA 3NYWA 1HDOA 3OECA 1ZSYA 1I8TA 2VWQA 3FR8A 1Q0HA 1ZJYA 4J1NA 1X14A 4NBTA 2UDPA 4WNIA 3M1LA 1OAAA 4B3JA 1R16A 1SEPA 5IN4A 4UREA 1VKOA 3D5QA 1E5LA 3V2UA 2NQTA 4IZHA 4EYEA 1FK8A 3QWAA 5EINA 1H94A 3AWDA 4KDEA 1TVEA 1ZXBA 4GKBA 1DIRA 2E6UX 5LDGA 4ZN6A 1P1RA 4MVJH 1XYGA 2DTDA 4NJMA 1KETA 4WEQA 4E5NA 5L9AA 3MWDB 4BKUA 4HY3A 1O8CA 3GRKA 3SEFA 3GGPA 5JMPA 3QWIA 5IXSA 1ZSVA 2O50A 3C7DB 1X0XA 3GDFA 1GU7A 3UN1A 3L9WA 1WP4A 2XOXA 2VYVA 1IZ9A 2HKIA 3WBFA 3VH3A 2RH8A 4O59O 1JAYA 1NFFA 2WYVA 1ISIA 3GAFA 3PTZA 1YQDA 2JCVA 3LC1O 2FSVA 4YCAA 3W6UA 4CJXA 3VDQA 2UVDA 4AVYA 4L73A 1B8PA 1LLQA 3FBTA 3HN7A 3G79A 2GR9A 1C1DA 4RGBA 3Q2IA 2IXAA 5DNAA 4TRNA 5IF3A 1MGOA 4MJLA 1PZEA 1ZO8A 3KTDA 4WCFB 3TFOA 2Q99A 4XQ9A 3WTBA 2R6JA 3D4PA 3G49A 3ZWPA 3JD3A 5G0WA 4E5YA 3S2EA 3I9KA 2NM0A 2GASA 5JDIC 2EJVA 3LT1A 3RROA 3ROQA 4GKVA 5JAQA 3L6EA 4ZJUA 5TIIA 1EEHA 1FMCA 3UH1A 3W4IA 1X1TA 3C3XA 2DQ4A 3VZSA 2X5OA 4RLSA 4FJ1A 4BNXA 5T5QA 1KVSA 1X0VA 2G82A 4XQEA 3I5MA 4TVOA 2JAHA 4DA9A 5IG2A 1VL8A 1ZW1A 1PJ4A 3D3WB 3TL3A 4XYLA 3H9QA 4WNCA 1I3LA 5HA5A 4AJIA 3RJ9A 2IYOA 4ALNA 2Y1FA 3ZCXA 2PR2A 3K31A 3K2BA 1GY8A 2JD2A 4JX8A 1XGKA 2AHRA 1XA0A 4ND5A 4XEHA 2ZATA 4ZU3A 3O8QB 2W2KA 1NFRA 2GN8A 3K5PA 3RVDA 1LSSA 3P2YA 1IZ0A 2YYYA 4CV3A 4N5MA 1F14A 4MVJG 4Z0TA 3RWBA 3RBXA 3LT0A 4PLPA 2GPTA 4OGWA 1U3WA 2D3TA 4GWGA 4J91A 5FF9A 1I3NA 3LT4A 5FI5A 1YE3A 4YR9A 4YRAA 4IINA 2AA3A 2PFGA 2IRWA 3CSDA 3JYPA 1VL0A 4PLFA 5B1YA 2YFHA 2W2LD 5HM8A 4J0EA 5G0TA 4IY1A 4YAKA 4W9NC 2E49A 3DC2A 3O4RA 3JQ8A 3U4IA 1ENZA 1M2WA 2Y66A 3WFIA 4TMFA 5DP2A 1N7HA 3FNHA 4NDNE 4BKRA 4JGBA 2I3GA 3PLNA 2Q2QA 3RC1A 3X2EA 1I36A 1UZLA 5A3VA 4BO2A 4EJMA 3WGYA 1G6KA 4ITUA 1JKIA 3KBOA 2PGDA 3QQPA 3LSYA 3M6IA 5JY1A 4B3HA 2P9GA 3BMCA 3QVXA 3R1IA 1KS9A 1DJQA 1TT5B 1OMOA 1RM4A 3SVTA 2C5AA 2B4QA 3OIGA 3ZW8A 3NEPX 4GLLA 4RPGA 4HBGA 1BW9B 1E92A 4IPTA 1WZIA 2YV1A 3VH1A 4CQMA 4WLVA 2NWQA 3DBRB 3G1TA 4K26A 1AN9A 3OP4A 5HRUA 1IL0A 5TQVA 1O0SA 2UUPA 3P19A 4BKOA 2FPGA 2PD3A 4URFA 4E2YA 4Q3EA 1E5QA 2I65A 2X22A 3NGXA 4PG7A 4S3MA 5ILGA 2X8LA 1KEWA 4NIMA 4YJGB 4BNIA 2I66A 4DYDA 1YDEA 5AXAA 3W4KA 1SZJG 2PZMA 1VLLA 2DBVO 4WK6A 1UP7A 3GDOA 3PHHA 3WOHA 1HSOA 4BGEA 4BO3A 2Y1EA 4QO7A 4TWRA 4FOSA 5KVSA 4BNWA 3TWOA 3DR3A 1B15A 2X7HA 4O6VA 4QECA 1E0DA 1O9BA 2ZQZA 4Q3AA 4EI2A 2FSSA 2G5CA 4MPDA 3E9MA 1E3WA 4DBVO 1E3JA 2PA3A 1MG5A 4WCFC 4RPLA 4JLWA 3AFNA 3W1VA 4WLNA 5BNFA 1NQOA 2YV3A 3Q6IA 4HFRA 3UXYA 5CAEA 1PJLA 3IS3A 5JFOA 5JNLA 2VCYA 4L76A 5L40A 4HADA 2V65A 5G0UA 3PHIA 2HQ1A 2WJPA 1E7RA 1QORA 1R6DA 1P0FA 1B2LA 3DZFA 3S2FA 1X13A 2OORA 2XF8A 3F6YA 2X5KO 4ALKA 4KWHA 4G5HA 4CV2A 2GNAA 5HS6A 4XDYA 4Y6PA 4FC6A 1U4SA 3C8MA 3IOYA 3LDHA 4JNKA 1NVMB 4U8GA 1Q7GA 3DMTA 3CZMA 3KSZO 2G76A 5H83A 1H9BA 1JA9A 4PVDA 4PGFA 4F3YA 2VHZA 1QMGA 3IDSA 5IFLA 5EMHA 2BGMA 4YAJA 3QE3A 4TZKA 3ZHBA 5DOZA 1PR9A 1Y1PA 4WGGA 1LRLA 1VKNA 4K9DA 4DMMA 4TVBA 2AEFA 4BB6A 2O3TA 2NUAA 2BMAA 1O5IA 4NQZA 4E3ZA 3S55A 3I3OA 1PX0A 1H2BA 2Q45A 3KVOA 4MVJD 5A1TA 2Y1CA 4M54A 3H5AA 4RF2A 3ASVA 1PJTA 3DZGA 3IIEA 3Q11A 5U1PA 1Z73A 4CLOA 2YDYA 5KJ1A 4F46A 4J1TA 2NU8A 1HL3A 3I9LA 3B1FA 3H5RA 5KKAA 2UAGA 4QFDA 3E1KA 3C1TA 5TS3A 1HLDA 1N8KA 4GL4A 4NH4A 1T1RA 1E1KA 3DAFA 3JQAB 2P68A 2Y1DA 3ZNQA 1N92A 3HZZA 3WXBA 3E5RA 4QQRA 5EQFA 3RUFA 4Y8VA 4UUOA 3D1LA 2ZTVA 1YWGO 2FPIA 2WSBA 3OFSA 4GQAA 4IDEA 3QVWA 1N7GA 1KVQA 4BMSA 4E31A 5KWEA 5L4LA 1B8UA 5AXDA 3WLFA 4YEDA 2HMUA 4C4OA 1K2WA 4E5PA 2HRBA 2FY8A 3HB4X 4PFJA 3LVFO 2QX7A 2HK7A 3EAGA 1MV8A 1D8AA 3UVEA 4FB5A 1E1LA 2O3UA 2WD7B 3OJFA 5JPIA 5TSDA 4XKJA 1QV6A 2P9CA 4E5KA 1A27A 1NWHA 4MO2A 2H1SA 3PFFA 2IODA 1U3TA 4FR5A 4B79A 4N18A 4AJJA 3WNVA 3E6AA 2H5LA 4A03A 1V3UA 3COSA 3WICA 4UUNA 4I5DA 3WG9A 1T24A 2GYYA 3X2FA 5COBA 3ZV5A 4IDFA 2JCXA 1PZGA 5HTOA 1BDBA 1NWCA 3GNSA 1GZ3A 3RD5A 3ZHZA 3HUDA 4OSOA 4I9NA 3KYDB 4E6PA 4YBZA 4H16A 2AEMA 4G65A 1F17A 3ROMA 3SLKA 5IXYA 1ZVMA 1WXDA 2GZ2A 3WQRA 4WPGA 4PZDA 2YUTA 1LQUA 2YHIA 2AG5A 1K6JA 3D7LA 3AOEA 1PL8A 1B3RA 3WGGA 4M49A 3FNFA 4A27A 3WMWA 1GEEA 3PJFA 4R9RA 3P5SA 4BHTA 1Q7CA 3GG2A 2WYWA 3PZRA 2P4HX 5TF4A 4Y6SA 2DKNA 5F1KA 4PCVA 5BSFA 1U2GA 3PFWO 4UAGA 3GZNB 5DOVA 2NU6A 2IYPA 5TT0A 1HF3A 1ZK0A 3IL2A 2JAPA 4CM4B 1BXZA 1CETA 1JU9A 3BHMA 4PG8A 3R6DA 4YAIA 2J8ZA 1U3UA 2QG4A 5KJEA 5KTKA 5F5LA 1U5CA 1GV0A 5H81A 4LVCA 2HUNA 4EEXA 3FCOA 1QYXA 2DTXA 4CPDA 1ZNQO 3AI1A 5A9SB 1UUFA 1A9YA 1Y6JA 4FGSA 1O94A 4YT2A 3DDNA 1DSSG 4B4VA 2RCYA 3GNQA 2DVMA 3SJ7A 1HYEA 3NX4A 4JN6B 3P7MA 5CEEA 1NVTA 1I10A 4AICA 5B37A 1GFSA 3NT2A 3GH3A 3OETA 2XXBA 4D46A 4XX0A 3RAJA 1PL6A 3PJDA 1GAEO 4EJ6A 1T2FA 2GN6A 4J4TA 4RVSA 4BV9A 1LC3A 3LLVA 4CQLB 9LDBA 2FMUA 4NPCA 3WB9A 3F46A 1NTOA 3HWRA 4DYVA 1A7KA 4EITA 2HMVA 1CF2O 2O2YA 4ND1A 3CKYA 4XYEA 4A7PA 3GLQA 1O95A 3NT5A 3TRIA 4YA6A 3ZWXA 4KTVE 5C3MA 4G2NA 1DLJA 2W4QA 4A10A 5L4SA 1HEUA 3DOOA 2Q49A 2PTGA 4KUHA 4WECA 1Y9EA 3KSDO 3EGOA 4GX0A 5I7VA 2XPCA 2PD6A 3G17A 4E5MA 1CRWG 3AM4A 3GEMA 2CVQA 3PYLA 2YHUA 2NU7A 4RJTA 3JQ9A 3FRJA 4MVJE 2X23A 3I9JA 4ZRNA 3L9XA 2OUIA 1YBMA 1C1DB 1PIWA 3ZDFA 3RFTA 1IUKA 2GLXA 2NTVA 1DC4A 4L4XA 4K28A 3ZH2A 3HG7A 4Q9NA 5TJ9A 1M66A 4GX1A 4ONEA 4GX5A 3QWHA 4R01A 2V6FA 5GY7A 5KVCA 4RVDA 5MGBA 1OZAA 4LVUA 3FN4A 1GQ2A 1E7MA 1I5RA 1YL6A 4B7CA 2O3SA 1N5DA 1R0SA 2GF2A 4OIMA 4R3NA 1A5ZA 1Y8QA 4NFHA 4HKTA 1Q2XA 1VI2A 4PIVA 4XQCA 4ZQFA 3U4HA 2QRJA 3PJGA 4E21A 2BFPA 4KWIA 3JD4A 4NU6A 4BNJA 3N7UA 1ZK3A 1C0KA 1I33A 4IGEA 4XRRA 4CL3A 1JDJA 4IS2A 1A7AA 2ZQYA 1K6IA 1L7DA 4FD3A 2FRDA 1UZNA 1SB8A 3GMSA 4FFPA 4J0FA 1YH3A 4J3FA 5GMOA 3ZWCA 5BQFA 4BKQA 4W7HA 5ITVA 1PJCA 3U0BA 2Q4BA 1M75A 3FR7A 1PQWA 3VH4A 1Q1NA 1YDWA 1HE5A 3DHNA 4D44A 2HK8A 1HDYA 3JD2A 3RFVA 2GD1O 4DIFA 2D4AA 2FR1A 1PJBA 3H2SA 2O48X 4ZVVA 2RAFA 3H4VA 3UOGA 2W2KB 2J3HA 4YQYA 3H2ZA 2J3IA 3I9MA 3VZQA 5HWSA 5BR7A 1NASA 4MIEA 4NI5A 4XGIA 1LXCA 3PHJA 4FFRA 1R0KA 2VHYA 4BO6A 2BLLA 4BNVA 2NVBA 4CM9A 4R16A 4C7JA 4IDAA 4BNTA 3TPCA 1EMDA 3V8BA 4FFLA 1MC4A 5F5NA 1GQQA 5COQA 3FPCA 4BMNA 1F0YA 2VNAA 4Q39A 2AXQA 1EQ2A 8LDHA 5DT9A 1M76A 3BMQA 3LT2A 1U8FO 2X86A 2ZTMA 1BXKA 1EVYA 3HJAA 1BVRA 2JFGA 4X54A 3DEYX 1YONA 3NGLA 1LTHR 4Q3BA 4LN1A 4B4UA 2B5WA 3HDYA 2HCTA 4DWVA 2ZJ1A 2NVUA 2EW2A 3BMCB 1Y8RA 1ZJZA 5CDSA 2EHDA 4D3DA 1U2DA 2X9VA 2X0IA 3ZNOA 5JXWA 4YAEA 2DBRA 3O9ZA 1UAGA 4FJ2A 1PGJA 3JYLA 5DCWA 4OAQA 5ER6A 4OYRA 3D0OA 1VC2A 1DC3A 4GVLA 4CQMB 3U49A 5FYDA 1CJCA 1P31A 4YJFA 4BNUA 5C7LO 1HE3A 5AXCA 1LNQA 4A0SA 4DPMA 3JD0A 1LI4A 4UEKA 1TXGA 4RVGA 3M2PA 2JD0A 5U4QA 2OBYA 2C59A 3HFSA 2B5VA 3OBBA 4RQTA 4CMEA 4MVJI 3GRPA 1Z7BA 3AUSA 1AGNA 4IQGA 2JHGA 3JTMA 3RIHA 3RKUA 5KJCA 5IJZA 2GN4A 3ZGYA 3VPFA 1SAYA 4OM8A 1C1XA 5ILOA 4GSLA 3HQ4O 3MZ0A 3E8XA 4IDDA 1DIBA 3F9IA 3NAQA 4CUKA 1ADFA 1YBVA 4RVUA 1RWBA 2A94A 2ZB8A 1HKUA 3NUGA 1HXHA 3KV3O 3MJEA 1DB3A 3PIIA 4ZGWA 2GUGA 1YJQA 3VVCA 1OC4A 3PYMA 1RJWA 1HT0A 3VZRA 1UR5A 1Y9AA 4R1TA 4JK3A 4BNFA 4D0RA 2H6EA 1XU9A 2IZZA 1NPDA 1Y81A 1E77A 5IDWA 4PVCA 1Y5MA 4YRDA 5KIAA 5JY6A 2ZKLA 3GZ4A 3PXXA 3WFJA 3TNLA 2C7GA 4RV9A 5KCZA 1JN0A 3WIDA 3ABIA 5IDYA 4FCCA 3CH6A 2W8ZA 3WQSB 1Z82A 4U0KA 1NFQA 4DQVA 4XZ3A 1NBOA 2OO5A 1TT7A 1QG6A 4RDIA 3JQDA 4I8XA 3VPSA 1BMDA 2P4QA 5EPOA 3BYZA 3QWFA 3OHSX 5THKA 1PR3A 1WWKA 4Q3CA 4J4BA 4L4SA 4QEDA 9LDTA 3DAPA 4IJWA 2O7SA 3OQ1A 2EJWA 1K0UA 4MDHA 4BQRA 2PGLA 4NBWA 3RUHA 1J49A 2BH9A 4B4OA 1YQXA 1ISGA 1GV1A 1OC2A 3A06A 2HDHA 4R51A 3W8DA 3TZCA 3WNQA 4BS9A 2O3QA 2RBEA 5JAMA 3NJ8A 3SXPA 1MUUA 4BNYA 5DF1A 1B14A 1U7TA 3EW7A 1P33A 4J90A 3RKRA 1XHLA 4CLRA 4IJKA 3CPSA 2O4UX 5JCXA 2G1UA 1XWFA 1XKQA 3TOXA 2OP0A 3B1KA 2EIHA 1XSEA 4B7UA 3KYBA 1T4BA 3PQEA 4I9UA 1R12A 1R4MA 1BXGA 5JYEA 3BHJA 2V7PA 3UGKA 4H7PA 4P22A 4TRJA 3LC2O 1WW8A 5JS6A 5KVVA 1WDLA 2PKRA 2J3JA 5TT1A 3WMXA 2GERA 3ICPA 5C37A 3I1JA 4PLGA 4U5QA 3KB6A 4WOJA 5JCJA 3CMCO 1LRJA 5L7TA 4BMVA 1WVGA 2ZCUA 3JYQA 4J4HA 3ZV3A 4FQ8A 1I32A 1NYTA 3F4LA 3O38A 1L7EA 1H6AA 1P77A 2AMFA 3BTSA 1YQGA 1OOEA 2DU8A 2Y67A 3BMNA 3I83A 1G0OA 3GPDG 3ZU2A 4YRBA 1KERA 1U28A 1HLPA 3MOIA 4NR0A 1EK6A 3R3SA 2VHWA 3K6JA 3FNEA
chains in the Genus database with same CATH superfamily
4GR4A 1ZBDA 1MW9X 1Q7BA 1P0MA 1NBME 1SD1A 3LY8A 4RZ2A 1CD5A 3EVCA 5D5QA 1D2EA 5E2AA 4D82A 1DWPA 5FXMA 4GR9A 2CLMB 4TN1A 3EQ2A 5F21A 3UAZA 2QAJA 4WJKB 1ZN9A 3MD0A 1FFDA 2Q6TA 3MERA 1XJCA 2VPQA 4X1KA 3PDHA 3KAJA 1KIMA 2FPXA 2RGDA 1QS0B 3KKPA 2I67A 1NN3A 2VBFA 2YZ7A 4IDHA 2FEXA 4R6WA 3UFXA 3BQ9A 5DHPA 3WBBA 4QKQA 1UJMA 3NETA 2DLCX 2WU0A 2O1WA 2R00A 3U4CA 5JT1A 2CVFA 4UBNA 5I4CA 3U5TA 4FFDA 4YTEA 4YCLA 1Z35A 3KV1A 4QXPA 3AVWA 1V5FA 1Y33E 2WSLA 4CQMD 3W1WA 4UBIA 1C81A 3WX0A 4NFLA 3L6OO 1L1FA 2YHIB 2NTJA 3G88A 3GCDA 1DXQA 4O4LB 4URZR 2FHPA 2NUTA 1MJFA 1XCMA 4X3PA 3NHSA 4NZYA 2VHVA 3K16A 2JCYA 4KQEA 2O0KA 5ALLA 4AULA 3MJHA 1V26A 3KEGA 2O5EA 7ABPA 4RV4A 3QE2A 4Z3OA 4PLVA 1R88A 3TZKA 5K0ZA 3TG2A 1HEIA 3OA2A 3CVXA 2LW7A 4PC7A 5JMWA 5I5EA 4M8NE 2DPLA 3GFOA 1KVUA 3HJCA 1EUCB 4Q4DA 1DINA 4MWGA 2WG1A 1HDGO 4LQ4A 4NBLA 5JSFA 2IHNA 2OAQ1 2RFLA 2Y1WA 2ZRFA 1JB1A 1M6HA 2HIAA 1UMCB 3FHLA 4H15A 4M86A 3WV5A 3ZN2A 1CP3A 2FR8A 1U7WA 2FOLA 4L5JA 2EJBA 3WWCA 5F7OA 2FTKE 2VUHB 3IDQA 5BQPA 3HYNA 4OHCA 2WM2A 1CFJA 3KXIA 1MTOA 2OORC 4KO8A 4BPBA 2H1IA 2J9ZB 3ORHA 1S4MA 2I6QA 3DZKA 3RRZA 3SQWA 1F38A 3WGIA 3H4IA 4DXAA 5CBPA 3I6MA 1NSFA 1RNLA 2IUSA 3P9PA 3R7BA 4L2IB 5BPHA 4ZOEA 1Z5ZA 3E5HA 4FC7A 3DMTC 2A84A 1CWUA 4J6FA 1LA2A 5E6UA 5CH3A 5JJIA 2Z4RA 4IQ8A 4F2WA 4HDMB 1OVGA 2H9YA 4XUCA 2QN9A 3VNQA 4WJZA 1TJ5A 3I8SA 1JLHA 5TVGA 4E94A 2F1OA 4HMOA 5L3ZA 5CXQA 4JSRA 4DC0A 1NY6A 3ONEA 3IURA 2YW9A 2GZ3A 4RJIA 5SZHB 3PF9A 1JSXA 2A57A 1IPFA 2RH9B 4O2AA 5FBKA 1U63A 1C4KA 2EG9A 4CMKA 2R9VA 1JIQA 1OXSC 5A4AA 1FFYA 1VG8A 2YC4C 2PBRA 4LRXA 2QHXA 4QVIA 4AK9A 4QPPA 2W2LA 1LBHA 5CW2A 1XBTA 2ZPTX 2ZBGA 3DFKA 4LXXA 2WWFA 4B7XA 4KQIA 4XQ0A 1NAHA 2FWBA 3CGWA 3MWGA 2C2YA 1XFDA 3YASA 3EVAA 1O87A 2ADOA 2ZSBA 3LC7O 4B6EA 4DLAA 1SC1A 3K2EA 4HX2A 4EG5A 1J8QA 5K4AA 2FVXA 4YUWA 4G4SP 5ITWA 1MX5A 2WYIA 2XCQA 3I39X 3FTCA 2ILVA 4XYGA 3WK7A 3O5AA 3SEQA 2G1JA 2P4UA 5DN9A 5CT8A 1PWHA 4HAUA 3M82A 4BZZA 2XDYA 1ZMOA 3OOEA 1IOWA 1DWQA 4PLTA 4V24A 2E21A 5IWCA 1M67A 3BMOB 1A82A 3VC7A 1T36A 2BHTA 4OXKA 1GTRA 2CD9A 2B3DA 2AJLI 2X2EA 2PX0A 2VI5A 3JZFA 9MHTA 1E0SA 2I3BA 5EHGA 3IAM1 1JVBA 2VDQB 3BF7A 3H2IA 4QXAA 3TPFA 1J5EB 4LF7B 1CF4A 3LCRA 2IH5A 1H1LB 1SHLA 2BFEB 1WB4A 3UK6A 1GR1A 2OO3A 4H7IA 4KKVA 5B6PA 5IVKA 1ZINA 3DT6A 4L75A 2AOTB 3KELA 3BH6A 4IIFA 2O2IA 4KIJA 4YAOA 2PZLA 4L9RA 2J0VA 2WJYA 2NOAA 1TUBB 3BC1A 3K9GA 4P3OA 3VDNB 1SKQA 4L3OA 2VWHA 4UATA 1QIKA 2VRCA 3AKDA 3G0GA 1QO0D 2P5SA 2ZJ7A 3ANTA 4TTTS 1XXLA 5DBIA 5GWXA 1QHNA 4IKEA 4B0PA 5JDCA 1KP2A 3F6BX 4JBLA 1JKFA 2GSDA 1ENPA 4C1BA 1G20B 5BV0A 3B6ZA 3CSSA 1H8HA 3QFTA 4LRQA 4MW0A 4HMQA 1NG9A 4O2BB 2AOWA 4QGAA 3B82A 1DAKA 4C1NA 2XUIA 4C89A 4AX8A 3O21A 3B20A 4IBOA 3KQUA 4UM5A 1NPTO 4DRXB 2OL4A 3NLLA 3W7BA 5H3HA 1UBEA 1AKRA 2GCIA 3F2VA 4N49A 1OJ7A 1JU4A 4NKRA 3IBGA 2DZDA 4L07A 3KDSE 4LYHA 1QDEA 4S1NA 3G7SA 1V1MA 3MWDA 4OF4A 3TJMA 4OQFA 5B7GA 2BE7A 2WJHA 5FBVB 4DMUB 3PC3A 3B6JA 3DPIA 4M37A 3UC5A 1CT9A 2J48A 4O1IA 3AVTA 1COWD 2JHCA 3LKVA 3UT6A 1G7SA 5I7AA 2GI4A 3IT1A 1ZC4A 3GYGA 3LH5A 5IAKA 3FPHA 4P82A 4HOYA 3Q3GE 3K4QA 4J07A 2DG2A 3M5CA 1AK1A 1UZUA 3QXGA 2WAAA 2FSGA 3C6ZA 3RC7A 3AU8A 3QA3E 1HDZA 1LPPA 2DECA 4RVOA 2EZ4A 3H6HA 2GB4A 2AKYA 1K7CA 1EBUA 4I2NA 5ED0A 2PKQP 2ZEJA 2ODBA 3JQ7A 2CHEA 3FBWA 3SU8A 3Q0EA 1HTWA 1JA0A 3HB0A 1GLGA 5ALFA 1T4CB 3KR1A 3NJRA 4TYMA 3HXOA 4M1SA 6REQB 4HWKA 1P5ZB 1WMSA 3RHTA 3THSA 4ZI7F 3B5IA 3CX6A 1CR1A 2O52A 4CEHB 2XNHA 1FYDA 3T3NA 3ZCSA 4DR3B 1F7UA 4TZ0A 1JIIA 3OLCX 2ZI9A 4KXQA 3PC2A 2IVZA 1FXWF 4YQFA 3OX3A 3OSUA 4B4WA 5GZ3A 1Z18A 2QW8A 3I9NA 4H3SA 4F3KA 4LX0A 1YB1A 4IH1A 1RWKA 4D6PA 1JIUA 1XCPA 2IYXA 5EJ4A 3VVMA 4Z4EA 1ZGZA 2EFEB 2KJQA 4M9RA 3DEFA 4EABA 5DP1A 4OI2A 3TLJA 3QX3A 4LMAA 3A3YA 4GKAA 4EUHA 2JFVA 1YKSA 3AUUA 2OVFA 3A70A 3G85A 2VTBB 8OHMA 4XQGA 1J8YF 5KTNA 1P1HA 3B1JA 4BNKA 3E2IA 1QAQA 4DHEA 5BV7A 5IM4A 2P9ZA 2R751 2AR0A 3ITEA 3QU9A 4GFDA 3HJHA 3I01M 3Q7TA 5KU1A 2ZYVX 1KO1A 1XQXA 2ATIA 1PUIA 3D2LA 3PUHA 4MR8A 4YASA 1RWQA 4OI0A 2OQIA 2QDKA 2FI1A 3VSDA 4XTRA 3IXMA 4OO3A 1ZRMA 2O54A 1SUSA 2HA0A 3LUKA 3ZS9A 3IKTA 1A1VA 3PWKA 2HRRA 3OLXA 1ZVJA 4FHFA 2RK4A 3EZ9A 3OJLA 4JLDA 1LVUA 4NCXA 4OFXA 2XT9A 4FYHA 3JARB 2F3RA 2QE7D 2G28A 3FZYA 5IYZA 1OX4B 4COKA 1T5HX 1E4EB 3REGA 2SECE 3L0IB 4LOIA 4PYRA 3ZBQA 1K2VN 2HBRA 1JQAA 1ZVVA 3WYFA 1JEQB 3NDIA 2B82A 2PZBA 1I2CA 1XQ6A 2B83A 4FNGA 3CG0A 4TXMA 1MAWA 4YP9A 3WAKA 1J42A 4MVYA 5J23A 1Q17A 2R25B 1IOVA 5CLJA 5T8KA 4ALJA 2VAXA 4Z9AA 1ZCZA 2JHFA 3SNKA 3AETB 1TAHA 2BP7B 4JP8A 1XEAA 3JYOA 4BTLA 4CKYA 3L1VA 1N9ZA 3ESAA 2C9CA 1LJ8A 2BJWA 2P6NA 1NOIA 3N2IA 3PX3A 4JYBA 5A5DA 3E23A 5HJ5A 5K45A 2NYUA 3LZCA 3OPYA 4N3BA 1XNHA 1YAJA 2PZEA 4IDGA 5TC4A 3S2GA 3V3KA 3ZU3A 4YRQA 3N2GA 4LE2A 5CTJA 1NI3A 4HI0E 5KDOA 5AT1A 2GXUA 1C0LA 2J0UA 5EWMA 4FMCF 1SBTA 2P91A 1K08A 4E03A 1B43A 1PS8A 2AC4A 2QR2A 1JKXA 3OUZA 4H1TA 4YRJA 1DBVO 2FRDC 2CLHB 3QZUA 4LMRA 4EZEA 4FYVA 4RTLA 1ZD2P 2Y4OA 4L28A 3O1LA 2X3FA 1L7OA 3ITDA 3DBRA 5FNVB 4DVJA 3QM1A 4D0NA 2XRMA 2GFHA 4AYTA 5EZYF 4M0DA 2CKMA 4KQ2A 2GRUA 3R5XA 4MUGA 3D7KA 5FCDA 5DSXA 4NJMB 4LY9A 1QH8B 3ONFA 5MN6A 1CZRA 4UC0A 5KTTA 1QCDA 1I01A 1SUPA 1JR2A 1ZQ9A 4ALIA 2O8CB 1KC1A 3FYHA 1E2FA 4XDGA 2J3QA 2NNLD 1T2DA 2XUZA 2QROA 5HKOA 1UKVY 2HHHB 2O9JA 2VQ3A 4GYJA 4F84A 1JEYA 5TPZD 4GEKA 4Q34A 3ZJVA 2DETA 1MH9A 2ODNA 3VU8A 4B73A 1M1UA 1FA9A 2Y0EA 2IUYA 3GT3A 4O4HA 2PR7A 4Z2YA 5TGDA 1OROA 4LDNA 2ZCVA 4C6HA 1YCHA 5FI3A 2VUIB 4P38A 2BFDB 2XWPA 4BNHA 5F4ZA 3CF4G 1WPXA 4CKXA 4DVGA 3W5CA 1FLDA 2COUA 3BWVA 5H02A 3I6YA 2D1FA 4KXVA 1DHRA 1P73A 2Z2IA 4WY8A 5CXXA 4HFJA 1E69A 4I1RA 2A9KA 4IJSA 3F74A 3EVFA 3QFCA 4Y6GB 1CULC 2HWKA 5IASA 4NZNA 2YZ2A 1XNRB 1P72A 1E7QA 3BK1A 1AE1A 3BZUA 2VJYA 1QONA 3QPUA 3IA7A 2BE9A 2IZ7A 4B82A 1OH6A 4UAUA 1Q0QA 1KZ9A 1YVPA 4HEQA 3BFPA 4M1EA 1FFXA 2ZVQX 1NQTA 1GZ4A 1KOGA 4K3VA 1C3LA 1T2UA 3GHYA 2GF0A 3NANA 3QYJA 2ZR8A 3IT3A 5BOVA 1ORTA 2JFPA 3DAGA 4NBVA 2YDXA 3FYDA 4CDGA 1I0IA 4UBKA 2HN9A 2AHOA 2Q50A 3ZHYA 2ZYRA 5D01A 2R62A 2DFDA 4TMKA 5KNDD 2Q28A 3IJEB 1E79D 3ZWYA 3KSMA 3E3AA 4AWBA 3TLGA 4DF3A 3U9SA 2VWPA 4HZGA 4JT8A 2CVPA 3N07A 2OYCA 4RFSA 5BNIA 1I1NA 2F9MA 3REFA 3WLOA 5BN3A 3FPSA 2XQKA 2FKAA 1ZKMA 3PJEA 1TM5E 4MVJF 3GT4A 1N1GA 4MWOA 3ZWAA 3F3KA 1ODCA 3VHLB 1KGSA 2R6FA 3BWBA 4R8MA 3OOWA 3T3MB 4QFBA 1Q44A 3E22A 1JQEA 2QSUA 4TV8F 5KEIA 1KZ4A 1UP4A 1DBIA 2H9IA 5LZ7A 3TNYA 3KLBA 2GVDC 1CIJA 4FZJA 3FLBA 4AJ2A 4IWNA 1PR5A 2ZSHA 5BRNA 4WINA 1QK5A 3ZJ5A 1E2NA 1XQ9A 2X9GA 4FKMA 4IGKA 1LDMA 4IUYA 4NENA 4NBUA 3FHTA 4FLEA 4D43A 1JDNA 3BMXA 2CV1A 2FWPA 3ADOA 1YDMA 1CQJA 4E4RA 1E0JA 1LVGA 2W71A 4GAEA 1XUOA 2H8KA 5ECGC 2PEYA 1WPGA 2Z08A 3ABZA 3CSUA 4EF4A 5I7SA 4U7DA 2CNDA 1KOJA 1AHIA 3ZPXA 1A5TA 3HU3A 4II2A 2B37A 2XKAA 3MJVA 5C5IA 4EKGA 1JT9A 2RBGA 3HJNA 1M8FA 2ZUBA 1QVAA 4M7PA 3H9BA 2W11A 4Y30A 1TM3E 5FB3A 5FJJA 3FMOB 3U37A 3FGOA 5ALIA 2HPVA 1JQDA 1E18A 2YVKA 1SC6A 3MHTA 2IYLD 3VR3D 3ZY3A 4QAJA 4MA0A 1IPHA 1O0BA 3DVLA 1Y6FA 5TXGA 4L74A 4YCSA 1L7AA 5JALA 2M6SA 3KT6A 2R7NA 1UBGA 1TADA 3UHAA 1T2AA 4BIMA 1O4WA 2IYQA 4RL6A 3UHPA 3BE6A 4YO7A 1UCFA 4JI0B 4FHEA 4OKNA 4N03A 8MHTA 1J00A 3Q1KA 1YS4A 3PQDA 2OBBA 4HWSA 3BXPA 3EGEA 2OO5C 2VL7A 1V96A 4D4LA 5K0EA 2QD2A 5CBPB 2PYIA 3AEXA 5DYYA 1LLFA 1U6IA 3AP3A 2WG0A 3EWIA 3TQQA 1MIHA 1IXZA 1UXIA 3K8ZA 4HGNA 2NVWA 4JR2A 4PGAA 4BJ3A 5E3HA 4D9EA 4YMGA 5K4GA 3OI7A 3AXSA 2ZUTA 1ZD4A 4D56A 3PC7A 3X1ZA 3MIZA 4F5WA 2D0IA 1U1DA 3U3OA 4HUJA 3KD2A 2AXNA 4YJ2A 3K0AA 4P6VF 4P2BA 3D0KA 3KTFA 1OXKB 4HATA 2XBMA 2WB2A 3AY7A 1W19A 4RCYA 2EX1A 2W2OA 2XCSB 2IV2X 4EQ6A 5HS4A 4L7VA 2KW5A 3FUXA 2FSUA 3G6KA 3RBZA 3UWOA 1E7WA 3W3ZB 1NW3A 4O2AB 4TYYA 4M8LA 3B12A 1CCWA 1V5EA 3ADPA 2CUKA 4S1OA 4PO8A 5E4FA 2V9ZA 3PUWA 3VPCA 3FZEA 4NY1A 5CM2Z 2IPXA 2VATA 3VFDA 1XRPA 1BCRA 5J40A 2ZUCA 4C29A 4Z7OB 2Z9DA 1LWOA 3BL6A 1SCQA 4KJZA 4MUYA 4MYSA 5FOWA 4U6SA 2XRYA 4J03A 2PMWB 4PNHA 1RBQA 3ZK9A 5TX7A 2BPOA 5E7IA 4Z0PA 1YASA 2V4ZA 2FF5A 1JIKA 1UEIA 3EMKA 1KKLA 4N7RA 4FSDA 3BDAA 4LOKA 4OPMA 2ZW9A 1IK4A 4MKGA 4PO3X 4BQQA 2IHBA 1P5FA 3MWFA 4LOLA 4EBFA 1YDFA 1OGYA 1EINA 1RPAA 1TO2E 1FXSA 3JWPA 4UUMA 4ARVA 4GZ6A 2QIPA 1G20E 2D1SA 3IESA 4M2LA 2DAPA 3SYNA 3C3YA 3GVPA 1T36B 1NNUA 2QU7A 5EFZA 1GTVA 1TEXA 4G07A 4OP1A 4GX2A 1UT5A 1E2HA 4OXIA 5JO0A 2JHPA 3G02A 4UW9A 2A0UA 1R0BA 1Y7PA 4PSCA 4LV8B 3C43A 3V2IA 3TECE 2FOIA 1YR6A 2SHKA 1GT6A 3OZTA 3VUFA 1R9JA 2HUPA 1U7ZA 4G5SA 2GXAA 1RS0A 4DLXA 1U1GA 2EFGA 5IC6A 1EK2A 4NTZA 1N0UA 2PS3A 3FXAA 4FFVA 4QT0A 5GJBA 2Q4RA 1KZHA 2AN5A 1GPLA 4G0YA 5EGSA 1WCIA 5TQ0A 3VR5H 4TQGA 4U8HA 4NFYA 3DDHA 4EJFA 1XVLA 2BEWA 4J16A 3RUCA 2WWRA 2I8LA 1J0XO 4HWRA 2KMLA 3PTAA 1YRWA 3ZHXA 4PSVA 5AK5A 5FO1A 4JUBA 2W6IA 5HCUA 3IXQA 2I99A 5IZCA 4KFTA 4NS4A 1UC4B 2UU9B 4N76A 3D4IA 3W5JA 5LIRA 2NUAB 2X4GA 2PGNA 5B55A 1J9EA 2CNBA 3PQ3A 4JJAA 4UHDA 4PV7A 2Q1SA 1TVKA 4I6EA 2DQYA 1L5NA 1ZLXA 1BQ3A 2QP9X 1UFRA 2QVGA 4X64B 3GLFE 3L92A 2YOGA 1DDOA 4PAOA 3QKRA 2VSXA 5AJWA 4E2FA 4JU8A 4ALMA 5FD8A 1QYCA 4LWOA 1ZHHA 4X1YA 2CE2X 1ULSA 3CCFA 3K35A 3S8MA 3EIOA 4GOXA 4NPAA 4QOFA 2I2CA 3TAXA 4FFBA 3KJXA 5DRTA 1ZGHA 2JJ2D 2VDVE 1D1SA 5LQNA 4DOMA 1SCNE 2BBSA 1QX4A 2CDCA 2X6QA 5K3SA 3SMQA 2PG3A 3V4SA 1VJTA 2QLTA 3QYAA 1FSFA 1R66A 2Y3IA 5JNTA 3G8YA 1JW9B 3N5KA 1W4RA 3V33A 4ZEVA 1UMBA 1N5JA 4MS3B 1HT1E 1KHHA 4NAHA 5CFMA 4UM9D 3KKQA 4QNNA 1TRHA 1DAGA 3JQ7B 1KAMA 2LTAA 1BYIA 4KQ6A 2RHWA 3AUXA 3IMCA 2F90A 1JFTA 3WJAA 2PPLA 3U80A 4CIBA 3S2YA 1DC5A 1W48A 3N74A 1L7XA 3L8MA 4F72A 4NE7A 3OE7A 5L6MB 5DZSA 2W6JD 2Z2ZA 2OKGA 1ORDA 4TSFA 1Y34E 3EY9A 4MMYB 5ADHA 3BDIA 2O1EA 3SBOA 1YZ3A 2J6CA 2Q6LA 2IZ0A 3WGTA 1CY1A 1QDUA 4C0BA 2WTBA 4FYXA 4RWZA 1IB0A 3EDQA 3RU7A 3VHXA 3HS3A 4HAVA 1U7OA 1ORWA 3L82B 1S2MA 3PNQA 3D4BA 4IF4A 4NYIQ 4WT7A 1VLJA 2RJOA 4TTAA 5CTAA 4JI3B 4MNTA 3A32A 5IANA 3ADCA 4WOKA 5LMUB 3DONA 3D0QA 3D31A 3PUZA 4DA8A 4UTRA 3X1XA 2L69A 5BSTA 2FYTA 3CLTC 2PMFA 1XF1A 3D8HA 4REQA 5FUWA 2IYTA 5IVIA 2HEIA 4DNQA 1FSPA 1TD9A 3ZDYB 1PJ2A 1AQLA 1Q3HA 2H54A 4IZIA 4ZC1A 3KFLA 4UVDA 4Q19A 1Z6QA 4OXNA 5CNMA 2NADA 2FMIA 3A1NA 1EFRD 1KFKB 3AM5A 3LQYA 5LMCA 1PR4A 1EIWA 4BJ6A 4CNQA 4HNVA 3STTA 4IJUA 4D3SA 3SAJA 3S1AA 3EC7A 2WHEA 1EDEA 1RRFA 3W2HA 3LUHA 1JLLA 2BF4A 4G84A 5LLDA 1E2QA 1IN6A 2X40A 1KZ7B 5CGZA 5AKZA 3SIRA 2UXCB 1W94A 1WV1A 2JLYA 4UJ3A 1EWVA 1N2OA 4I4CA 3GX1A 4H6VA 1C9KA 3HC7A 1GA1A 1QDLB 5DULA 4WLOA 5F1OA 1E1CB 5F7JA 3OZFA 1P7PA 1CQIA 1LC0A 2KPOA 5AW8A 4S2EA 1W47A 3CFYA 3KYCA 5C52B 1DIAA 2JLUA 4OXRA 4D9IA 5IYZB 1SUCA 1NP6A 5CLLA 3UJ9A 3G0BA 3DLAA 3LY9A 5E0OA 4EFDA 2XTJA 1W36C 5HDQA 1W88A 1N0HA 3FDXA 5EYPB 3UIEA 4E2WA 3CB4A 1ZK1A 5BMVF 3MTDA 4II3A 1UWKA 5DBFA 3UV7A 5BYKA 3CO5A 3N7TA 4G25A 4LGCA 5K3AA 5JYCA 1UT6A 4IIUA 1JL3A 1XP8A 4KQWA 5FOVA 3TK1A 3GUYA 5JQGB 3L7BA 1TMGE 1D8TA 4TSRA 2Q5HA 2VJCA 4JOCA 4FFMA 2H08A 1GDHA 3SC4A 1R37A 4I5EA 4WK2B 4YJ3F 2C94A 5DSTA 5ER9A 3TNDA 1PS9A 4G97A 2AG8A 4LYJA 4WKOA 1ZS9A 2R66A 4TXJA 3GXOA 4OUDA 4ZEWA 2CBXA 2VJKA 4HDSA 2BMDA 3N2GB 3CF2A 1QLWA 1QK4A 4AFNA 1B00A 2GETA 2NAPA 3AHEA 2EYUA 4GUDA 3W6ZA 3ZWWA 2OLEA 2PJUA 1H22A 2AX4A 4Y9RA 3AXTA 2JLBA 5AJXA 4C3UA 2CVHA 3IAM6 4OMUA 2XMSA 1PLLA 1ZUWA 2DR0A 3N53A 1QANA 3S1SA 4BRSA 3DXZA 1WSDA 1F06A 2F3PA 1FDIA 2XH8A 4K86A 2TMDA 1DAPA 4A3SA 4AXXA 1T1JA 5JBNA 4LRYA 2QX9A 1FPMA 3C3AA 2X0DA 3O0TA 1TDJA 4OJNA 2Q7DA 2ATCA 3N8IA 1D07A 4UPDA 2CWWA 3DKRA 4EUFA 3DLBA 3OLZA 4PHTA 1NUSA 4KPYA 4TL6A 4D0GA 1MKYA 3W5VA 2HYIC 2ZWOA 3OFVA 2EBUA 2ZUFA 4CMGA 5JXGA 5JD4A 4GMHA 4LHVA 1OBVA 3IP5A 3SC3A 1H2HA 5JJCA 3G2IA 1WL8A 2GEKA 2CBGA 2OSBA 4NARA 3O2QB 4RSHA 1JEYB 3DOCA 1OI7A 2PBZA 4JUDX 1I5OA 4QPCA 4KG7A 4EUEA 2FGJA 3PNVA 4C6SA 3FA2A 3H87A 3DF7A 1A8SA 1L5FA 1YJXA 1FUKA 2VHXA 4O4HB 4QDXA 1ZZGA 4R1PA 2NVOA 1MRZA 4NHEA 5COAA 3RF6A 4UQOA 4HS9A 4R4JA 3T1NA 5A2GA 5CEFA 4A0FA 5LQAA 4DSZA 2W48A 4KFCA 5IBQA 3ETGA 3ZQ6A 3MRVA 1GKIA 3H0KA 1IEWA 1FFAA 4BO0A 1FNBA 4C0AC 3Q5EA 1Y7HA 1VLHA 4UU7A 1UWCA 2CVOA 5YASA 2QLMA 4ETMA 1L1QA 2I3ZA 3E48A 3Q2OA 3HA5A 2MSLA 1I3MA 1KI7A 3B3AA 1NVEA 3CUTA 5JSHA 2CFRA 4KUGA 4CDNA 4KQMA 5K09A 2WD9A 5JATA 3PHGA 5ECWA 3DTTA 1HRDA 1M3SA 4MJ7A 5CFRA 4INOA 4CR8A 3B8HA 1Y8QB 3A27A 3DJYA 3RFFA 1QG2A 4MS4A 3JYNA 3GQVA 3W7VA 3KZNA 1FFXB 4NULA 4RCVA 3MT7A 1SXJD 3SICE 4CMIA 3GMIA 5JXHA 4HDCA 4ABTA 3VU1A 3LXXA 4IIXA 3QKTA 4ABYA 5HQ3A 2Q3MA 2G06A 2YIVX 4OP2A 1YJBA 4Q1BA 5JROA 4K9MA 1J0BA 2IYAA 3GLTA 5ICFA 3HUUA 4TQ9A 4OI1A 3VR5D 5J4YA 3HR7A 3ISTA 3KJHA 2FW1A 1W0JD 2V9PA 4UTXA 1A2OA 3HI4A 5EPUA 1GGNA 3TLGB 1CEXA 3C45A 1XG5A 2CW5A 3F8TA 3HKCA 4QBFA 2GPSA 5DNCA 4B83A 5H4GA 2JGIA 1AO3A 4RFSB 1S2IA 3C5EA 3WLLA 4JNGA 2XRFA 5BN3B 5CNKA 3CIFA 2W6NA 2OHGA 2P3SA 2P62A 3WKBA 1DKLA 1EVLA 4NV0A 1CLUA 3DWGA 4GE3A 1AOXA 4MEJA 1RHRA 2E6KA 3DZHA 3H2BA 1K7XB 1XQVA 3HFGA 1U81A 4QBIA 5TRTA 4MUFA 4B4DA 4KIUA 3HJFA 4B2IA 2PS1A 3S27A 2QTCA 3QTBA 3ETDA 3I2JA 1RI5A 1KWKA 4XWYA 4JA0A 2OHOA 4BMYA 5AK0A 1PD1A 1U5AA 4NENB 5KPDA 3DT9A 4ZO7A 1WZUA 2GUWA 2H2GA 3AFHA 2PRJA 1ECFA 4K9OA 1YJ5A 1QGAA 1L3BA 4EI9A 4FFNA 1CQJB 3RO7A 1I3KA 4PG6A 5ICSA 3BMQB 2YVUA 5K8TA 1GR0A 3E82A 4UFNA 3ZTYA 4J7AA 4C87A 1NPYA 3GCGA 1WXIA 1PJSA 2B0JA 3KHTA 1KYQA 4TTVA 1GOTA 4F0JA 4O4JA 2CE7A 3NT4A 3USES 1DKQA 4EMSA 3QX7A 1BN7A 2R8PA 4JLVA 5FL7A 1L5HA 5IVHA 3IQGX 4I1OA 2A4MA 2VSNA 5F73A 1IIBA 1CEQA 4WNAB 2NVUB 1KBZA 4X0EA 1LRKA 2XNDD 3T15A 3UA4A 4LJ4A 2DHQA 1RVV1 1YKFA 5JS1A 1W30A 3V00A 4J1JA 1QO0A 4JJGA 5I9IA 1U0LA 1V6AA 2IWRA 4GGMX 3VI3B 4W5TA 1AURA 4QULA 3W2GA 4ZTZB 5KYKA 3C5HA 5TF0A 4CL2A 4RELA 2HAEA 2H92A 1Q91A 2O1XA 3UAXA 1AV6A 3B9RA 3NNNA 4RWEA 1YDHA 2GTHA 1DXYA 2JHAA 3EVEA 3MA0A 4MVJA 4P4GA 2VNIA 5D6OA 3Q9NA 3VDMA 2PUWA 3DHWC 1U90A 4Q15A 1QRTA 4O1MA 4NU8X 4KYIB 3GLRA 2ZJ3A 4F4DA 2B4KA 2WIBA 4H60A 3VNUA 2PWAA 2VP2A 1JAIA 4YJ2B 3G9UA 3C7CB 2XJ4A 1GCGA 1A9TA 2OM2A 3I2GA 4KVAA 1KIAA 4EQ6B 4OB6A 3NNDA 1GFIA 1UFKA 2WKQA 3FLAA 4OHOA 1HT3A 2G1PA 3F0TA 4JU9A 1QAOA 3DFZA 2OBFA 5BYJA 1QUEA 2P2NA 3HA2A 1X7GA 1M0SA 3KU1A 4MV8A 4Q1CA 4Q4HA 4XGNA 2WWYA 1HDEA 1SUAA 3IOMA 4I46A 4US1R 1UJ4A 4UNRA 1GCIA 3GGCA 3SOZA 1H6DA 2EF0A 3C3CA 5IM5A 3R3HA 1RYMA 4DLYA 1MQ8B 2D2EA 2J5RA 3T5BA 1GQSA 4LE1A 1UPXA 2JFYA 1A72A 3RQSA 2V1XA 3G59A 4ON9A 4IV0A 4L9SA 3BBLA 1B0UA 3Q6NA 3V2HA 3RUAA 3LOUA 4EPYA 5IUNC 3K70D 2DT5A 4RABA 4MWDA 1B0PA 1IN4A 2H2HA 4LJ6A 1G8GA 2WM8A 3VGJA 4V2UA 1DOHA 1UK9A 4QUKA 5F33A 3RGGA 2HGZA 2CSUA 1INLA 4D4KA 1H3EA 1E7YA 1VP9A 3QEMA 4NJEA 5B7QA 5JZ9A 2AOVA 3NOOA 4S0ZA 5F1PA 5B4UA 3ILXA 1YOVA 2Y1KA 2ZYGA 3LCCA 4CF3A 3GRFA 9GPBA 1PR6A 2HMWA 5HVNA 2BUAA 1NQVA 2CDAA 2FEAA 1VPEA 2ISSD 3PQFA 4Q00A 3I9V6 4ZVOA 1Y37A 4O0LA 4E12A 4YV1A 3CJQA 3LLUA 3L4SO 1EESA 4PZEA 1M0TA 4RIGA 1CEEA 1SIWA 3HA7A 4JJ6A 4BRWA 4TWZA 2YWCA 5JAUA 5K3EA 3WIBA 1DJOA 3OPXA 1JJVA 1BDMA 3LXMA 4GR5A 5LP6F 1O6CA 1YSCA 3CO0S 1AKUA 4ZJZA 3LRTA 4UHFA 1VIVA 1ZOOA 1VRWA 4MKRA 2OCXA 3V4ZA 4D4HA 4DUGA 2WAMA 4TWAA 621PA 1N33B 4FOLA 3B1VA 3PNKA 4XTCS 4DJ5X 1OLOA 4UD2A 3ITKA 4WK4B 5I8WA 1WCIB 2VZ8A 4TMZA 2HSDA 3FYUA 5TQ0B 4BOYA 1UPCA 1RJGA 3GRCA 3MVEA 2BEWB 3OZXA 3M4JA 3OLQA 1E62A 3IDFA 4JVNA 3DLHA 4B2YA 2XOKD 2ZTUA 3HVUA 1E6UA 3AU9A 2B4TO 4JLBA 5KS2A 3DD5A 5DGTA 4A5OA 2R0QC 1D0VA 2GAJA 5JFGA 1G63A 1HQCA 5I5GA 2EZUA 2WSIA 1EJ0A 2AX3A 3M3DA 3CZQA 3GFGA 4MCAA 5GONA 4CTMA 1IOLA 3T7DA 4F04A 3HLKA 1XU7A 3I6IA 2N46A 4I50F 3WMGA 3ABOB 4XA8A 2P3LA 2N75A 5B58C 5FNZA 1RQGA 2ASEA 3CUWA 1UBSB 3TRDA 2FX5A 4HNRA 3WO1A 2QN8A 2PXHA 3RUDA 3FTDA 5KYYA 2ZSFA 1UAYA 4OQPA 1I30A 3BK7A 3AR9A 1L5MA 3L4BC 3QKRB 2YMLA 4PXYA 1MO5A 1A5AB 1TIBA 2HH9A 3ZIAD 3K6SA 4BAGA 4X1YB 4RGVA 2MMCA 2IX3A 4E88A 3DMDA 4DEYA 3L6DA 2FHSA 3AYZB 1B42A 2ORIA 3EQ6A 2PJRA 1K5HA 4HLCA 2YMPA 4HWOA 1EGQA 1H2AS 3ZHOA 1PFVA 5C7YA 3IP6A 5CDYA 2IF2A 2IELA 1P45A 3T1YB 2PL5A 1DAMA 3S1LA 3GMDA 2QQGA 1T5DX 3BWCA 3E5MA 1VMEA 3CX3A 2R8XA 1UMBB 3I1IA 4QHSA 4ZALA 1Z0DA 2QJTA 3RTCA 3SQMA 1XEXB 4PTZA 4OYLA 3NVDA 2JFFA 4RX1A 3QPVA 2OV3A 3N7AA 3SDSA 1EP2B 1JI3A 1KMIY 3CE6A 4W5OA 4D9FA 1VDMA 1N5OX 4CM8A 4HVAA 3GJ4A 2JVIA 4MQLA 3AKEA 3R6LA 5D7NA 3U3MA 2WLSA 5GIOE 3HJRA 3LNTA 3OQIA 4OHFA 2H8GA 3IDZA 3OIYA 2O8DB 1WF6A 4NLLA 5JWHA 4DB2A 5HX7A 4OX9B 3TW0A 3A14A 1OA0A 4EB3A 2NO9A 4G5XA 3L77A 3SP1A 1L7BA 4ATNA 3T12A 1X2EA 3VHXB 3ZHRA 1CJSA 1S1MA 1XZMA 3JQAD 2O0MA 2L42A 2WDPA 2ZAYA 3K9LA 3P5BA 2QTMA 1HTTA 3ICEA 1A7UA 1JGTA 1QQ5A 1RVDA 3OZWA 2R60A 4DGQA 3V97A 3G13A 1E1MA 1W5SA 2EG5A 3LV8A 1R15A 4IX1A 2BGUA 2H0QA 4MRPA 4REQB 2XYRA 2YR0A 3CONA 1VHWA 3X1KA 4DA4A 2PQ0A 4WUVA 3HI6A 1RWPA 3OZCA 4EF6A 1L5SA 2IYWA 1ZI9A 3RS5A 2EBFX 2HLHA 4JSTA 4OHZA 5LMZA 2V7QD 4WKBA 2N1MA 5EHZA 3I5XA 4B3TB 2MJLA 3LDGA 1UDCA 4RJKA 2ZR7A 1SNYA 4A0HA 5AVJA 3Q88A 4G0VA 1VG0B 3KAQA 3OZBA 3S1AB 3GP8A 1DKRA 1NONA 2HJVA 2AZTA 3OKFA 4MIKA 4Q9AA 2ZWAA 1FNMA 1JLLB 2YVLA 3CEPB 4OOEA 2WBLC 4QBTA 4BMCA 1J1IA 4Q02A 2FVYA 1EM6A 2RGCA 3KXKA 1GRNA 1WY7A 4LXHA 2QGZA 3QEOA 1N2GA 4UUPA 3RS0A 5IPFA 4EHJA 1DKNA 1TKCA 1RR6A 1ZA2A 2AMYA 2NYVA 2XA2A 1H1TA 3ND8A 4IDQA 1I6MA 4F71A 3PE3A 3KYCB 4UASA 4LY3A 4L50A 5EXPA 4OHMA 2Y1LA 2Q2WA 3H2KA 5F2KA 3TLZA 3EBOA 3GU3A 4EM6A 5BSHA 3BZBA 3K96A 5K8CA 4ZI7B 4ZCIA 3ROXA 1DPGA 1GQYA 2XCRB 4BZXA 2PV7A 4FNOA 4BE7B 3U4GA 2AZDA 1W4LA 4A9AA 5EIOA 2JIPA 2QPTA 2RH5A 3A26A 5DSZA 1KI3A 4Y1RB 1ADJA 2Q4OA 3QVOA 3BTUA 4MRAA 1Z16A 4J8PA 5DI3B 3RTBA 4XE5A 3WDKA 3ZIUA 3LPDA 4NCAA 1U3FA 5F2NA 2JS7A 3LE8A 2HO5A 1NRWA 2XNKA 1BHQ1 3DB1A 1Q1BA 3OAAA 5K3OA 4H6XA 5IDQA 3I6BA 5KNDA 3ZBTA 1FW8A 2RGYA 2G40A 3DDWA 1YR2A 3ESYA 3K1AA 4MIYA 5BOSA 2HDWA 5KYGA 5A3RA 1OUMA 1QG4A 1Z33A 1VMIA 2ZBUA 4FZ3A 4LJLA 2X9NA 2AQKA 4AXBA 2RGNA 3BG5A 3WGVA 4OUDB 2OE2A 1YB4A 2Y0BA 2C3YA 5CVVA 4HDSB 3BCSA 3TNJA 4EUSA 5CG2A 1TK9A 5CX4A 2CSXA 2RHGB 3AMVA 2R5FA 3G2HA 1R4NA 2NO0A 4WN9A 3WXMA 1SMKA 2J6BA 3KQPA 4BQEA 2FH5B 1WHTA 1IWBB 4K1LA 2OFXA 3HXTA 4GVXA 3CXRA 5DHTA 5CDGA 5CLIA 2IPOA 3ZEIA 3ZC3A 1G5FA 3PUYA 3W2TA 1T6ZA 4PZZA 1VBFA 2A3RA 1WDKA 2SBTA 1YIDA 1G2QA 3DO5A 4OGGA 4YGXB 4GM4A 3W78A 2FEKA 2XMCA 2PUFA 1RPNA 1RLUA 3E58A 3UUWA 4G85A 3TLXA 3E9EA 4G09A 1CKEA 4WN3A 3LECA 3MTEA 4OSEA 2MSDB 1WXQA 3DG9A 4NG5A 4XUEA 2XKJE 4LZWA 3LZ6A 2X9QA 4FI3F 1OIVA 1E2JA 3VOSA 4RGYA 1T8TA 4AMBA 5BUZA 1UK6A 3BDVA 4RIHA 5KOIA 5MFZA 2DBZA 2VHEA 3KLMX 4MB0A 2J7PA 2VJOA 5DLEA 4DY6A 3CX7A 3LP5A 3AJ9A 4L8YA 1U1FA 1P2VA 5J4HA 2X3UA 4QRDA 4XD2A 5LCXA 3PPIA 5EXXA 3VR3A 3IBFA 5CB6A 3K30A 3EFOA 5AKHA 4UTOA 1TYAE 2C58A 3AI2A 3O4IA 2Q5FA 4NQRA 4BGUA 3D3EA 2EWMA 2XGMA 3Q3IA 2R1TA 4JB8A 3KPJA 4XX1A 3G0CA 2WIFA 5AWFC 5ICGA 3ASUA 3EZFA 1F8UA 5IKXA 1XE3A 4KQ9A 2X1LA 4G5YA 1PS0A 4IILA 4UQPA 1N9GB 3O1HB 1N8NA 3QWBA 3D9QX 4R3WA 4ENTA 5CHEA 3AX6A 1BYUA 4QDKA 3VHQA 5KNCA 4JBHA 2EKLA 1PTJA 1P6QA 4JB3A 3PXDA 4MV7A 3TQCA 3AERA 4CU2A 2Q3HA 2VK4A 4DADA 1AY0A 3HY3A 1FCJA 4ND2A 4UNNA 1D4OA 2QNIA 3DMGA 4TRMA 1WCXA 4C7VA 3KM0A 2R84A 2BH2A 3E5NA 1KHTA 3R6TA 2IVFA 4TPKA 4CETA 1EH5A 5CFOA 4GQBA 3K5HA 3QLUA 4QNMA 3NMUF 3A0RB 2AQIA 1RXIA 3A8TA 3OZDA 4MS4B 3U4AA 2KLHA 3GXBA 3JAWB 2HSEA 4JP2A 3QOXA 4FBGA 1SQFA 1T2NA 2ODPA 3OZEA 1HURA 2MSWA 1FS5A 2YFYA 4XFKA 4CMIB 3S44A 3AKYA 2WA1A 3NKLA 3OHMA 2BKAA 5EMMA 4M9XA 1DBWA 5C7OO 3AILA 3ND9A 1W8DA 2XQIA 3NYWA 2D13A 4MR9B 1II0A 1HDOA 3D4LA 3M81A 5EZYB 3PDCA 2VWQA 3FR8A 4S05A 4DV6B 4J1NA 1QTQA 1T91A 1RXSA 3EEBA 5LP1A 4NBTA 5LR6A 3DE3X 4WNIA 2GARA 2O6LA 3T3DA 4AO7A 3KQHA 1R16A 2YZGA