3A10A

Crystal structure of response regulator protein trra (tm1360) from thermotoga maritima in complex with mg(2+)-bef (semet, l89m)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
116
structure length
116
Chain Sequence
MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKKDAKIILLTAYSHYRSDMSSWAADEYVVKSFNFDELKEKVKKLLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Response regulator
publication title Structure of PAS-linked histidine kinase and the response regulator complex
pubmed doi rcsb
source organism Thermotoga maritima
total genus 42
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3a10A00
3N6VA 5B3JC 2I6FA 1FFGA 4KFCA 3LOPA 4JP1A 4DADA 1ZHHA 2PKXA 3EULA 4LE0A 4O5AA 4B09A 1ISSA 2IYNA 3TB6A 3LUCA 2QV0A 5JNUA 3QX8A 1W25A 2NT3A 3KCNA 2JBAA 1SD5A 4JA2A 4MS3A 5FWXB 1Z2DA 2WRZA 3MQ4A 4MRMA 1T34A 3RVOA 2B4AA 3H5OA 4M88A 3O1JC 1E6LA 1JYFA 4KNYA 3CLKA 1D1QA 1A2OA 5CNMA 2JVJA 2WWVD 5KC9A 5JNVA 3H1FA 3I42A 4HYEA 2FLKA 3JPWA 4MR7A 5JNSA 1R8JA 1D5WA 4L85A 1OXBB 2N9UA 3CRNA 1DG9A 4H3HB 4LDAA 3H5WA 5TE9A 4KK3A 4G0OA 1ZGZA 3OLXA 2RGYA 4PZ0A 1Z17A 3F6PA 4O1IA 1DBQA 3T38A 1LJLA 3H5IA 5DGCA 4RK4A 4OLAA 3CFYA 4EY3A 4Z9AA 4OG2A 3NNNA 1E6KA 3EGCA 3CZ5A 5TQ2A 4ETIA 4FE4A 3BRQA 1GCGA 1GCAA 2NT4A 4KV7A 2FQYA 3OLZA 3SQNA 1AB6A 4RU1A 1NATA 1TM2A 3UUGA 1QP7A 1PEYA 4RWEA 5T3YA 4YO7A 3QELA 4G97A 5CNJA 1F4VA 5EWLA 4ZPJA 1I3CA 1DC7A 2JBAB 1SXHA 2B1JA 4WXMA 3GYBA 3OMWA 4Q6WA 1GUDA 1NXXA 2QR3A 5TQ0B 4Y9TA 2MYTA 3ROFA 4YV7A 2NZVG 1K68A 1MAVA 2CHFA 1M5UA 2VYCA 3O1HB 2MSLA 2R4QA 3R0JA 3FDFA 4ML3A 4E7OA 6ABPA 4W5QA 4RK5A 2WY2D 2E4XA 4EVSA 2WJAA 4GPAA 4CBVA 3JS5A 4G0MA 1EWTA 5IX8A 3CS3A 4N0PA 4JB2A 3Q15C 1GLGA 2PUFA 1ABEA 2QVGA 5ED4A 5IC5A 1HEYA 4MAAA 1WETA 3UKJA 3H5LA 3K4HA 2FTKE 5BRJA 1JFTA 1D1PA 3F7NA 1KMIY 4RXUA 4H60A 2OQRA 5HM6A 2WB4A 1NTRA 4KQ9A 3F73A 1FFSA 1PEAA 3H6HA 1RXEA 3L6UA 1LBHA 1LBIA 1Z16A 3HSYA 4JASB 2VK2A 2VUHB 7ABPA 3QELB 3MMNA 2FEPA 1NXVA 5EWLB 4YWHA 5KC8A 3IP9A 3NBMA 4EGSA 4OLBA 1DJMA 2GKGA 2A9QA 3HXMA 3CG0A 2E4UA 3H1GA 2L2QA 3CHYA 2HPHA 3ILYA 4N47A 1P2FA 1M5TA 2AYZA 5KI6A 1U04A 5DTEA 1NXTA 1EHCA 3OO0A 3QEKA 3HCWA 1ZVVA 3KHTA 3KLNA 2IOYA 4IMIB 4RDCA 3KG2A 2L17A 4PE5B 1Z26A 2O20A 1SRRA 3BRSA 3VNAA 1Z12A 2QVCA 2H0AA 2ZAYA 3QEMA 4F3TA 5HQJA 3O2JA 3GBVA 5FBKA 1C4WA 1QQBA 2F8TA 1TLFA 2JVIA 5HSGA 3EQZA 4MYRA 3IP6A 4Z99A 4OBBA 1M2EA 3RVPA 3HM9A 2MSWA 1USIA 2IPNA 1P6QA 2Q5CA 3C3WA 4TLLB 2FQWA 3HK2A 1APBA 3DGFC 3GV0A 4OATA 5FWYA 4F8JA 4UHJA 3EJWA 3BILA 1JFVA 3LUKA 2HQRA 3M9XA 3L49A 3LTEA 1D2AA 3CU5A 2IKSA 4NV3A 1S8NA 4WWHA 3LUJA 5TPZA 3OM0A 5TQJA 3EDCA 2FQXA 4IRXA 4MR9B 4P1ZA 3Q7TA 4EYOA 3A10A 2PAFA 3O1IC 4RXMA 4TN5A 4XLTA 4UHKA 5B3JA 3T6KA 8ABPA 3C97A 4PEVA 1ZITA 4KVFA 1MB3A 3CZCA 1ZDMA 3LUAA 5DLEA 3FGZA 3E3MA 2AYXA 4ZJPA 1VPWA 3QEMB 2X7XA 5IEBA 4KK4A 3ROTA 2E4VA 4F12A 3OQMA 3G1WA 3RVQA 6CHYA 3KJXA 4DQDA 4EUKA 1LJUA 5IULC 4D6XA 2E4YA 3KS9A 1A0OA 4P98A 3O21A 4EYGA 4G0XA 1TJYA 2WMYA 1Y1LA 3C6QA 3O2QB 2PUAA 2L19A 1YIOA 2IPMA 4F11A 4RKQA 3H5VA 2H3HA 4QPJC 3N53A 4LE1A 3MM4A 2E4ZA 1XHFA 5FWYB 5FBHA 3D8UA 1ZGGA 2RJNA 1DRJA 3EAFA 3HVRA 5KQLA 4QICA 1QO0A 2CD7A 4W5RA 2PL1A 3OLWA 4YCSA 2W42A 3F6CA 3T95A 4W5NA 3NHMA 1DBWA 2A9RA 2FMFA 4Q7EA 2PMCA 4YRZA 1PNRA 3HV2A 1QO0D 3NNSA 1JL3A 2GI4A 4MS3B 2FEWB 4IGAA 1BVHA 3LUFA 4HNSA 4MRMB 3DLHA 3O74A 1U8TA 3M6MD 2PUBA 3HUTA 1RZRA 4W5TA 1NY5A 2LIVA 3MIZA 1BA2A 1KRXA 1DZ3A 3CTPA 1QNLA 4LX8A 2A9PA 5PNTA 3GA5A 3RVJA 4MR7B 5KQMA 1LK0A 1RZRD 3RVSA 4Z4CA 2XDYA 4G0QA 5IBQA 3RVLA 5JNRA 4G0PA 4EVRA 4N03A 3Q9SA 3SY8A 3N0RA 1MB0A 1BDJA 3N0WA 1MVOA 4WT7A 2FN9A 1MIHA 4TMYA 4Z9BA 4EYKA 2HQBA 2TMYA 2KYRA 1CYEA 4RKRA 4Z4GA 1ZN2A 2GX6A 2RJOA 3RVKA 2BGGA 3H75A 5TQ2B 2PUEA 3D02A 4L4UA 5EWMA 4D6YA 4YR7A 2LBPA 3FFXA 4FB4A 4MS4A 1TVMA 2JRLA 3LMKA 3TMYA 3OO1A 3RVRA 3TX6A 3MA0A 1GUBA 3I09A 2HQOA 1U2PA 4W5OA 3JY6A 2HJ9A 4PICA 2QSJA 2DRIA 3FFTA 2JB9A 3FMVA 3MF4A 4LE2A 4QYMA 3N8IA 5BR1A 3KTOA 5KQPA 1E6MA 1ZY2A 1FFWA 3C3MA 1PUXA 4G86A 5EWJA 4OTZA 5KWSA 3FFWA 5JS2A 3RVNA 1IIBA 1P6UA 2CWDA 2FLWA 3QLTA 2PUCA 1JX6A 1L5ZA 4MQFA 2LUOA 2IPLA 3C3KA 3RVMA 1E2BA 2FW0A 4YGXB 1YS7A 4XAQA 2GWRA 4Z4HA 4Q6BA 2OENG 2YHAA 2R48A 4JOQA 1NXPA 5C5EA 2A9OA 1C0EA 3URMA 1FQWA 3BREA 3OQOA 4GNRA 1KRWA 3KKEA 1YS6A 3JVIA 1SXGA 4KMRA 2NZUG 1ZH2A 3CKMA 3DLBA 3HJFA 2YHBA 2FXIA 2P9HA 5GOTA 1CEYA 3A3KA 3KYJB 1K66A 5GQSA 4KPYA 4NCBA 2QU7A 2QW1A 4G0ZA 3HZHA 4IMJB 4Z4FA 4RY8A 5F64A 2CHEA 1JF8A 3DZDA 4WZZA 1QQAA 3HDGA 3O2SB 2FSPA 5TPZD 3OM1A 5CNIA 1BAPA 3LUGA 5EWJB 3EQ2A 3IP5A 5E3JA 4XASA 4IILA 1JWLA 1NXOA 4N76A 1DC8A 1UDRA 3Q7SA 4LRQA 1VKRA 4WUTA 4JAVC 2LP4Y 2HSGA 5CNKA 3JVDA 1YK1A 4MQFB 2PL9A 4RY0A 3E61A 5IUJC 4ETMA 1DCFA 5IEJA 1H9CA 2ID7A 2J48A 3N0XA 4MLDA 3W9SA 5BRAA 1YMVA 4RK0A 1QPZA 3GRCA 3CNBA 2MYNA 3QK7A 5T7BA 2LPMA 1P8AA 3A0RB 4DN6A 2MYPA 1ABFA 5DCLA 4S04A 5TQ0A 1SXIA 4PYRA 2E4WA 3IDOA 3JTEA 2WJWA 1VRVA 3I45A 2IPAB 3I5AA 4KRFA 4D74A 4LDZA 3MYYA 3OLYA 1D4ZA 1J56A 1Z25A 4Z0NA 5KQGA 4ZYLA 1A04A 3IPCA 1Z18A 4YLEA 5IUKC 2ID9A 4XARA 5IUNC 2PE5A 2M1ZA 4IF4A 5JNWA 3RQIA 1JHZA 1RNLA 1B00A 3IP7A 4JB0A 3S99A 2FKAA 2V0NA 2PUGA 5I4CA 3Q7RA 1URPA 3HO1A 4HNRA 1M2FA 4MS1A 1JFSA 9ABPA 3DGEC 4RXTA 5ABPA 3T8YA 3RH0A 3SM9A 1NXSA 4MPTA 1BDIA 1XHEA 1RPJA 3HEBA 1YMUA 3H5TA 3O75A 4RK6A 1DP4A 3DBIA 4RV5A 1KGSA 4Z4EA 2FVYA 3UK0A 4MLCA 1DCKA 1F51E 5D2CA 1U2QA 4RZSA 4XXHA 4XFKA 4FE7A 1AB5A 3HS3A 3NHZA 2JCGA 3LFTA 2R47A 4KREA 4MGEA 4NICA 1ZH4A 4YP9A 5BQ3A 1EAYA 2JK1A 3GBPA 3N75A 3SG0A 1USKA 2P4UA 4MR8A 2QXYA 4F06A 3TO5A 4HNQA 5C5CA 4RY9A 1BDHA 2JVKA 3NNDA 3OQNA 1ZESA 1JYEA 3H1EA 3Q41A 3CG4A 2F8SA 3B2NA 3QLVC 4QYWA 1W9HA 3OMXA 3ILHA 5CHYA 4Z4IA 1Z13A 1Z2EA 3LKBA 4NQRA 3OLVA 1EWVA 2FN8A 4RK1A 4MQEA 3SNKA 5TPWA 3LUDA 4RSMA 5JNTA 4YS6A 1YK0A 4ETNA 1QP4A 1CHNA 4EVQA 4MS1B 4TLMB 2VUIB 3BBLA 2QZJA 3A0UA 3GT7A 3EODA 2NUBA 3GWGA 1EFAA 3P9YA 3QLVA 4E7PA 3QLUC 4RS3A 5JS1A 3HDVA 1JBEA 1XWWA 3M9WA 3LUHA 1L5YA 1QKKA 3KSMA 4N41A 1RXIA 5FWXA 2IDMA 2FEKA 4MR9A 4KZKA 1ZAYA 3LKVA 2GBPA 4N0QA 1ISRA 3QLUA 2PUDA 5DKFA 1USGA 1TMYA 1DRKA 3G85A 1QMPA 4MR8B 5HKOA 1DCMA 2M98A 1PNTA 4LZLA 2PJUA 4WXEA 5EWMB 1QP0A 2MSKA 4S05A 2R25B 3JPYA 1OXKB 3KLOA 3IPAA 3SAJA 4MS4B 3TD9A 3K9CA 2FMKA 3GL9A 4ZMSA 3H6GA 2ZWMA 2FMHA 1JLKA 1JDPA 1YVUA 1DBPA 1JH9A 1U0SY 3KYIB 4NCAA 2L18A 4O1HA 1VLZA 2PLNA 4ZMRA 3VNBA 3HUUA 4EYQA 1NXWA 4MQEB 4RK7A 5TPWB 1EWKA 2FMIA 1JDNA 4G0YA 1FSPA 1Z15A 1YTUA 2MYUA 4KQCA 4H3KB 3QX9A 2RDMA 1PHRA
chains in the Genus database with same CATH superfamily
5LL6P 3N6VA 2ADOA 3CJQA 3F3YA 1Z38A 3QKRA 5FF9A 3V4VB 4KFCA 2HLDD 3HUFA 4ND5A 2VJOA 2I2AA 1SBZA 4OH7A 3UC5A 1QVRA 1KNXA 1N2IA 4Z8XA 3UQZA 1R5BA 2CB0A 1AUXA 3WLEA 5J5CA 2X1LA 1I1HA 3KFVA 4BU1A 4EPTA 1GDHA 1U3GA 3EDOA 1R16A 3O4FA 1QWOA 4MNTA 4TOIA 2EF1A 2H57A 3AC0A 4OQYA 1KFJB 4PFKA 1PJLA 4X65B 3OP1A 1Y7IA 4WKGA 3FBGA 5DGIA 3T9EA 4Y7CA 1XJWA 2VHJA 1ZUNA 1CUCA 3DDWA 1YQXA 3K2BA 4JBNA 4H7FA 4ENUA 1E7RA 2I3ZA 4IVQA 4GPD1 3FOCA 1YVPA 3WS7A 2XD9A 3DMPA 2ZIXB 1YUNA 3FFBA 1ZSYA 4G0WA 4LNAA 4UHCA 3PNBA 1C3VA 1ICEA 3Q1KA 5J5AA 1VSUA 3BMOA 4KK3A 4Y2PA 2O2SA 1U11A 5IKOA 3LL4A 4Q9AA 2IIQA 5EP2A 4GVPA 3PQ3A 2W4MA 3T38A 1VIDA 3LT5A 3ITDA 4AUNA 2PUHA 1OBFO 1KSFX 2OA0A 2VQ6A 1M9NA 1N78A 1B76A 3HRKA 4M53A 2XQKA 3VPSA 4G65A 4M1YA 4C7OB 1ZW1A 4M1KA 5I9SA 2ASVA 5ITZB 3ZK9A 1NATA 4QNRA 2D1QA 3DYIA 2WJHA 3QF4B 2DBQA 2IW1A 3FRIA 1A4UA 3QELA 1MXHA 2XNDD 1O6BA 1SKAA 2H5IA 1C1YA 3IUYA 1HNXB 2H4WA 5J5VA 2BGNA 1GGJA 1SCBA 2QLBA 3PFFA 1ZNYA 5KJCA 3BQMB 3FNEA 3B7PA 4PG4A 1EH5A 4TV8B 3SIXA 4NULA 1M76A 3NT4A 2QMEA 3WDKA 3MYRA 4Q6WA 4X3OA 4YVFA 5JO0A 4HSEA 3W5HA 1SXJE 3ED5A 2HU2A 2CHFA 2RG1A 3MB8A 3OQVA 3O1HB 1M6NA 1XAJA 5EERA 5BQ5A 1HLPA 4GMKA 4W5QA 2IPOA 4DC1A 4I1IA 5JZOA 3L8FA 5E4TA 4MCAA 1CU1A 3DTVB 3CS3A 1WS6A 3QVVA 3QVXA 4KIFA 4MDHA 3U1TA 4O4IB 4EM6A 1LVHA 4K05A 2J6HA 4US0R 1ZS9A 5CGQB 1AGYA 1SKYB 2W98A 3V4SA 1ZVQA 5DNUA 1GUYA 4XA8A 4OKIA 1SU6A 1E2KA 3QRWA 5L7WA 1P7CA 3ZTYA 1VJ5A 3G49A 2QZPA 4EARA 4HEA6 4HH3C 2X2OA 1A5SB 4HMQA 3VSBA 4BMPB 3L40A 1K5PA 3FR7A 3C4VA 4RXUA 1F0YA 3UENA 3KDAA 2WB4A 4JENA 5CFRA 3BEOA 4LF7B 4MVXA 2HRZA 4Y2HA 4FMCB 2V1XA 4AP9A 3DHVA 4I50F 4J07A 4UHEA 2X14A 1ZD4A 1RXCA 1YQEA 1VE6A 3K9WA 1PT7A 3SKXA 4ESEA 3EIQA 2GMWA 2PHZA 2RK4A 5CB8A 3DWGA 4Z51A 2OV8A 3DDUA 1QUFA 1W8DA 4JC8A 4OLBA 2EWWA 2YBEA 2P9TA 5KNDD 5LKAA 2QG9A 2ZCVA 5AVOA 4ZMBA 1S2DA 5JI3E 3PQDA 4I9FA 1OLXB 2B8NA 2WG0A 3D7RA 4IH1A 4KQKA 3SVTA 1D03A 4RF4A 3QI7A 1JHUA 2WDZA 2WWIA 2BRUC 3NB0A 2QAJA 3KHTA 2NYUA 1E5LA 1RJFA 1XXLA 2DF8A 2LCIA 4JT2A 5AR1A 1BH2A 2QG4A 1ODFA 1U1IA 3JWHA 1AMNA 5I9TA 4KXYA 3SSMA 1X86B 5IT4A 3QU7A 5JALA 1TF2A 1JDVA 1LSSA 2Q99A 2QZZA 3CIFA 3IJ5A 4DAOA 1GAXA 3U3RA 2B5OA 1SCNE 3N3BC 4BQEA 2HJVA 2Q6VA 1TQ6A 4OJQA 1NPYA 3KB8A 1K8QA 5IH7A 4BO6A 3ST7A 5DULA 2O52A 2PA0A 3IP6A 4MYRA 4NY1A 3ZK7A 3B3JA 3K6KA 4Z3KA 4ERNA 4Y2RA 2MSWA 2EWMA 4JU9A 1DIRA 3CO5A 4BLRA 1CFJA 2GESA 4YCJA 2PR2A 3OTOB 4DR3B 3GZNA 4TZ0A 4YPFA 2W2KA 5DEOA 3UW1A 1BKSB 2R6HA 2IYOA 2JIOA 2FUG1 4LBYA 5GONA 2RE8A 2GS9A 2RMKA 2HO4A 3NBAA 1KYWA 3MVEA 4O4JB 3RRZA 3MS2A 1KJ9A 1W1IA 3ZGLA 1NR5A 1T9DA 4KAFA 4UULA 2VWQA 4I3GA 1KH3A 3DONA 3KFLA 2FQXA 2YFQA 3GK3A 3L1JA 4FEEA 4OMDA 5DNVA 3VYSB 1JAIA 1EDEA 1GGVA 3H9CA 4KDRA 4BMZA 4DREA 3U40A 4L6AA 3RS2A 2QROA 3FKQA 4UHKA 1CY7A 3B6KA 5JRZA 2WJGA 4JJIA 4YMHA 1DAFA 2XNHA 3HB9A 2GZSA 4TSRA 3V1TC 3S1SA 1USUA 2Z3WA 3IJRA 1DBIA 3LBAA 3TLAA 4JFAA 4CM4A 3AJ8A 3IDAA 1V3TA 3OC0A 4KYVA 4F85A 4POOA 3ASYA 4J91A 3IIJA 4CU2A 3G1WA 5PNTA 3RVQA 5I9MA 1FUKA 3EGOA 3F97A 4A5OA 1XHLA 1R6TA 4EG0A 2XQVA 4RVOA 2A1TS 4EG4A 2BIFA 4N3BA 4F4JA 1A0OA 2RGUA 3PC6A 1BFDA 5JMWA 3S2EA 3F8SA 5K1ZA 1U94A 3G7SA 3H5VA 4NYMR 4C0WA 3IVRA 4GSLA 5K4AA 3C1TA 1XMVA 1MJHA 2AK2A 2P0AA 2B25A 2RJNA 3FRHA 3M6XA 3OZTA 3TAXA 4ZVQA 1ODSA 1UKBA 3EWSA 3ABOB 4X63A 3AJRA 1JQLB 3ZU3A 3EPJA 4DWOA 3I9NA 3M5PA 4W5RA 5DU2A 1WPQA 2X4IA 3EBLA 4Y2SA 5HTKA 5AXBA 1V6AA 1EFRD 2VZLA 1Y3DE 2NUTA 1Z75A 2WIKA 2FMFA 2X8JB 1PJBA 5DCWA 3VZSA 1C50A 3G9XA 4Z2YA 1NFFA 3WK7A 1TVKA 1NQOA 2I99A 5AKEA 3TE6A 1AGNA 1A8HA 3G89A 2VP4A 4KWTA 3O9VA 3DZJA 5L6MB 4YIHA 4EHAA 1WA5A 1LNZA 3D4NA 1Z6PA 4U2DA 3UFBA 1X7WA 5KX5A 4GP7A 2AG0A 4C7KA 2HF9A 4OL0A 3PR2B 1QE3A 4H1UA 2NMVA 2QNBA 4OQPA 3TECE 2Z2XA 3H16A 4KXQA 4H7PA 4E5NA 5IAGA 2UKDA 721PA 3NTVA 2BELA 2BT4A 2XDYA 1XWFA 1XEXA 1YI1A 1EESA 1JHXA 3SZRA 4NAUA 4WNAA 1GDTA 4O2BF 2W2NA 2Y9PB 3OJ0A 3E9MA 4HRYA 4M9QA 3WX0A 1QLWA 3K0BA 2YJ3A 1NVUQ 2XCIA 1FNMA 3O8DA 2NPIA 3K1AB 2UXBB 2G9VA 3DE3X 4LYEA 3V8BA 4GLLA 1SWVA 4MVJM 3PA6A 3VUEA 5BWBA 3LYUA 4JI2B 2CCJA 2XCOA 3P71T 3O93A 3CEPB 5EIBC 4OAPA 1HO3A 3JQPA 4OP3A 4U39A 1UBNA 3HCNA 3R3VA 4ZU6X 3WK8A 2ZU6A 4EHKA 5BQOA 2ODAA 1IFXA 2HQOA 3HJHA 2OKGA 5FNVA 3CUYA 1XNHA 5JECA 1ZYUA 3I2YX 4OKNA 2Y9MB 4UVDA 1ZAKA 2JJ2D 2DRIA 2WM3A 3EVEA 2ZIVB 1G21B 1CW2B 5DTRA 5T5QA 3PF8A 1AGRA 3KBOA 3I53A 1ZICA 4HS9A 2Y0CA 4PSKA 2AN1A 4WLFA 4X6LA 3PGA1 1BWSA 5EUQB 4ZVKA 4CKEB 4CCSA 3F9CA 1UQTA 1ORVA 5AVUA 1IHXA 4UCWA 1HM5A 1C3LA 3T4XA 3H17A 1HDEA 4EABA 2OAQ1 2X1HA 3CPEA 3K09A 4LQCA 3FSGA 5BQPA 2GT1A 5AUNB 2X0JA 1Y6FA 3VPBA 1WW3A 3RS8A 2YZNA 1YS7A 2WM9B 5CPBA 5E7MA 1TC1A 4WECA 4Z0TA 4DCUA 3BFKA 3R5KA 2R7AA 3NWJA 2I76A 5KSOA 1KZYC 3M4ZA 3UWSA 5G4KB 2W6CX 2QQ5A 3C0KA 2GJSA 3E0XA 1M67A 3BFVA 1ZD1A 4JLWA 4XVQA 4OI1A 1AKWA 4D8VA 2H29A 3IQIX 3P0RA 2X0KA 3L01A 3JVIA 4E4YA 2J67A 4OUDA 1O08A 2FYTA 1FRVA 2XGSA 3DZCA 5GM2A 2Z8YA 3INNA 4FMDB 1CJTC 3BCHA 1O54A 3K0KA 2IBTA 3GLIA 3GRKA 1L7EA 9MHTA 5KYWA 1MO5A 1I24A 4LI3X 4LYYA 4LTDA 3HYRA 2H7VA 1U8AA 1ID8A 4DB4A 4GAEA 2O0HA 2ZKIA 5EMKA 5HYVA 3OEYA 4MINA 4YCNA 3PKZA 5EYPB 2DCUA 4A6XA 4BPBA 3MGBA 1M72A 4R16A 3FYCA 1LUAA 3VPGA 2HMAA 2WU3A 1UADA 2J3IA 5GJBA 5K2OA 3RODA 1DINA 2ODBA 3HUEA 1Y34E 4ZV7A 1JXAA 3AR7A 3VU9B 2OOSA 5FOUA 3GPDG 1PUIA 4MITA 1E64A 1ZUHA 5CNKA 4KLZA 1GP2A 1RZ3A 2OCXA 4EHIA 3H5NA 2HEIA 4LX0A 1YSCA 5HP4A 1UUFA 5AJVB 1H9CA 3D6MA 3ZWCA 2VXYA 4V3CA 3LQ2A 4P0TA 1VHQA 4LXYA 4YQZA 2HZBA 3DBRB 2Y6VA 2PT6A 3T7SA 1JHAA 1E63A 1PT8A 4G81A 2XBMA 3LCJA 3WLLA 2G9QA 1DOZA 1OTHA 1P6XA 2I65A 1DB3A 1BHQ1 1CPYA 3A36A 3IDOA 2ZTMA 3OTHA 2H18A 2XLCA 2VNIA 1YGPA 3F96A 3L6BA 3W6UA 4KRFA 5E2BA 3RG8A 4G8CA 1UEXC 3BAFA 5U4XA 3SQDA 3TSCA 1A04A 4AX4A 3CJRA 3MAAC 5JZBA 3PWSA 2AX4A 2IODA 4XCQA 4NS4A 4BRUA 1G3QA 4L5BA 1JHZA 1B93A 4HWKA 5TARA 5EZYB 4NS1A 4TV9A 1LLUA 5JYEA 3KSRA 4G26A 2PUGA 1NPTO 1Z8HA 2FB9A 3U49A 1WB9A 2AN3A 5I8WA 1ZSNA 1QOPB 4M54A 3DGEC 4U0KA 4LECA 2WOOA 2XOEA 4ZAVA 2W6JD 3V2HA 3IOMA 2KSQA 3JRXA 3Q9LA 3PQ2A 3C74A 2GA8A 3QE9Y 2R3SA 2ID8A 4ZZ1A 4F21A 5J4YA 3L8YA 4RV5A 3X1YA 4A15A 4C88A 4YFVA 1SQFA 1ZG3A 4QRHA 4CG1A 1DCKA 2V55B 2PMWB 2WM8A 1R9NA 1IMOA 4M8KA 1G60A 3TR6A 2ZQYA 4GSYA 1T1IA 3T9CA 4DWVA 1H65A 2LZ0A 3LFTA 4GMHA 3AVTA 4FYIA 1SC1A 4FFOA 3A4NA 3AUAA 2P2LA 2XWBF 4CUZA 3G2NA 5EINA 4C4YA 3IE2A 4ZI2A 1DE0A 4PZUA 4AO6A 3KU4A 4QO8A 1QTIA 1RM4A 1C7EA 2GEDA 2HSDA 3H4MA 4HUQB 4KYIB 3KWLA 3DOEA 1E2GA 3HB5X 5AHWA 1ZR2A 4R01A 3WK9A 1IPFA 2EZTA 5JASA 3B2NA 3F0TA 4UBOA 2C5AA 3IAS1 3R1IA 1E92A 1VYHA 2CDCA 3LSTA 4G6ZA 1AZTA 3HCCA 3OEHA 4J0KA 4KN8A 3VMMA 1Z2EA 1S2MA 3E4CA 1JDSA 4G5RA 3T0GA 1YR6A 2FN8A 3G5MA 3K2EA 1KYYA 1SY7A 4N4AA 4RD3A 4ZC1A 1M2JA 1Y8ZA 1R8YA 4KLAA 3UHPA 3Q85A 2A0YA 3EMDA 4CGZA 3U9LA 2R8OA 3D8BA 4HG2A 1E4EB 3TSOA 3GWGA 4IDHA 3P9YA 3EN0A 4ZI5A 4D44A 1TO2E 3C3YA 4Q3KA 1NIJA 4Z49A 2VH5R 3HDVA 1JBEA 5ADVA 5TLSA 2J4CA 4OB6A 1E9SA 2D2IA 3S28A 1WXDA 2XI4A 2HEGA 1MG0A 1U0TA 3C3CA 3E48A 1RBZA 3I52A 3L7YA 4IO1A 1WB6A 2PD4A 4MGZR 4UVIA 4EDFA 4EPVA 4F04A 1ZX1A 5KTSA 1EXDA 1LDYA 1XZQA 1YRYE 3HA3A 1XKQA 3B70A 4W5WA 1OLUB 3L4KA 5HGJA 3D54D 4L7QA 2C96A 4DMUB 2GXQA 3TLMA 1OX6A 3BJZA 4FD3A 2GBLC 4Y9SA 3SFVA 3UNXA 1QMPA 2M98A 2C54A 2OXRA 4D46A 2Q2VA 3UK2A 3QKTA 1MHTA 1J9EA 1TKRA 4F4UA 1VJCA 5F98A 3RR2A 2O2XA 2AC4A 4KE9A 2HCRA 3JALB 2GBFA 3KB2A 1V5IA 3OESA 3U48A 4DNOA 4EO9A 1OBOA 2C5SA 2Z9DA 3RHZA 3GA7A 5AESA 1COWD 5I6DA 3E70C 5FUWA 2AZTA 3WLFA 4E13A 2H9AA 2BFCB 5TC4A 1KS9A 3DAOA 4M99A 3EC2A 1AXEA 2RH5A 3VM6A 1YTUA 4Q1EA 2B1IA 3SKVA 4UARA 2VHUA 2C84A 3WGIA 1J5EB 4CI9A 4C3UA 5KEIA 4KO3S 1ZQ1A 4LV8B 1EXWA 1KO8A 5BUZA 3EVTA 5J43A 1ZW6A 1HMPA 1QGED 1ZN9A 3KQYA 3QPCA 1T2VA 1KBQA 1XTBA 3SYMA 4JP5A 4DMLA 3ZQKA 4US1R 1B0ZA 1HOTA 2NT3A 3CA8A 4B6OA 3GJ6A 4F86A 1H4VB 1H4SA 1GXSB 2YDXA 4IG4A 1MQ9A 4MRMA 4XZ3A 1X1TA 3ZU2A 4N6NA 4M88A 3WWPA 3CLKA 4WOBA 1UANA 1FNSA 2C2BA 3H1FA 3QQ5A 1A5BB 2I6GA 3HEMA 4L0CA 5FL7A 1SBYA 5IYZF 1XZCA 1C7FA 2QZSA 1FVHA 4JR1A 1ZL0A 3DFMA 1IONA 1PL7A 3O03A 4BTVA 1Q0SA 2Z6VA 4ESOA 2J9FA 4GXRA 1T3SA 4PPGA 2XVZA 3CRNA 3NDIA 4V39A 1GR1A 4Y2TA 3TTVA 2GPJA 3LY5A 3OF2A 4KUGA 3WHPA 3GUUA 2WYHA 3OLXA 2RGYA 3B8EA 1VDZA 3ZGVA 4TVBA 1CUSA 1LJLA 3U5TA 5FL3A 2WILA 4C6HA 4RK4A 5DB4A 2VI5A 5HWSA 2CXXA 3GVIA 4KE7A 3J81k 4Y18A 4DMCA 5DLDA 3O90A 1RQPA 3WJ7A 5KNBD 2QENA 3INTA 4IICA 3W5AA 1P61B 2ZRBA 8ATCA 2ZE5A 3U9TA 1S8FA 3JR7A 3REOA 4KPFC 3MN1A 4RU1A 4HNAB 1TCCA 1L4UA 3W2GA 3DEJA 4YCDA 1E1LA 4BATA 4C89A 4I4TB 1IOZA 5CYGA 1P9LA 2DHDA 4P3OA 4YAFA 4PCLA 4FEGA 4DZZA 4E30A 3L18A 4EF4A 3VYWA 3DF9A 1P5HA 3UB4A 2A5FA 1I3CA 3EZXA 4ZEWA 4B9EA 5BV0A 1L3IA 2JLUA 2DECA 1NNLA 3I01A 3TNFA 5BR4A 2Z3VA 3N7AA 2PANA 3SIPA 3EGXA 4YMWA 2H59A 3DHWC 4XWWA 2NPOA 4MVJD 5JJKA 2YYAA 4ZPXA 1QHXA 2QLNA 3RWBA 2CVQA 4HH4A 2UUCB 4BQRA 4EVSA 3C3BA 4GPAA 1OFUA 3AH8A 4HTFA 4ALIA 2IHUA 5FQOA 2UYCA 1P9RA 2BCGY 2PJZA 2Q3BA 1BC5A 4AZ0A 3WAGA 3D5TA 1ABEA 1Z3IX 4B6QA 1FFDA 1PZXA 3AY0A 4UMDA 4JS0A 3AKEA 4AZVA 5I4BA 2QRLA 3RKUA 1A7AA 1ZJZA 5JMPA 3RFVA 3ZG6A 3A3YA 3F7NA 3G0OA 3WSWA 4R41A 4WGFA 4AKTA 4BTLA 4W6QA 1TCVA 2OQRA 4IXWA 4NP6A 4RA6B 3IAXA 5AVSA 4B4DA 3HKBB 2R60A 2H11A 3T7RA 3UMVA 2OZVA 4E2YA 3MGCA 4IQ0A 2J6CA 5A9TA 5MFPA 2LCFA 3HSYA 3L1IA 5KVSA 3ABZA 1EBFA 1U6KA 3Q4GA 5T67A 1A8UA 4MAMA 4ZQIA 4BV2A 4DEVA 2RHGB 1K4KA 2DU8A 7ABPA 3GLIE 1VB3A 1DAOA 1XOIA 2PM8A 3SNHA 4DLSA 1SMKA 3AWIA 3CG0A 1XA4A 4DJAA 1TQ8A 4G25A 5DM1A 4J16A 1NC3A 1O4WA 2BBOA 4ZGGA 3DE4X 3FWPA 2A9KA 1NXTA 1QIGA 2HK8A 5KINB 4XSGA 5BVGB 2PPLA 2XGMA 3L0IB 4XD2A 1PJAA 5C4MA 4QEKA 5DASA 3GROA 2JCXA 2VNHA 1JR2A 2QRKA 1U3TA 1EFHA 1TRKA 4JQOA 5JHGB 4FHCA 3GGCA 5H59A 3NASA 2FLVA 1SBTA 3FGPA 1E1QD 4I5DA 1MIOA 3VU0A 3HTXA 2ERCA 4CTNA 1WQ1R 2D62A 1TLFA 3NC1C 4KAAA 2AFIA 4ZKDA 3GJXC 1CQJA 4ZREA 3FDZB 4MLPA 3BD8A 1D2MA 4N7BA 4I9GA 1N7IA 2R96A 2V7XA 2C9OA 2W2OA 3H8JA 4ZAZA 5B1SA 5CR9A 1N2SA 1KGDA 4JP8A 2MIIA 2PKYX 3DEKA 3PGXA 4R9UC 3EFHA 4MP8A 3JZMA 5ALRA 3TR5A 2A1UB 1I6KA 3L0SA 3N76A 4YMLA 3TL2A 2PS3A 3AFNA 4WDQA 5EIXA 2WJIA 1XTSA 3H7AA 4HNTA 4NCKA 4M3NA 4Y8VA 2Y05A 3AIMA 1F5SA 1G5IA 2HB6A 1HDRA 4CFZA 1GG8A 5AW8A 1S8NA 2JG3A 2B4RO 1F9AA 1B6TA 3ROKA 3HNPA 3TPFA 3NAMA 2R5NA 5B3JA 3M7IA 3V8EA 5BV8A 1YA8A 2O1XA 4FW8A 1AM4D 1G1MA 1U3FA 3KK0A 4AKHA 221PA 1S8AA 4NAHA 3CT6A 1I32A 2OV6A 1YHNA 1P2GA 4WE3A 5IEBA 2BMWA 1KO4A 2I1LA 2FX5A 3MD9A 2W00A 3PQEA 3TZBA 1MOPA 3AVXA 1LJUA 1P2DA 1QGAA 1JZQA 1KVQA 2XQIA 2OORC 1I2ZA 3C7CB 3CMMA 3PHLA 4WOJA 3UJDA 4A6PA 4BWFB 3S8EA 2E1RA 4JFRA 1ZVKA 4K2HA 1ZK2A 1EFPB 3NIFB 3U4MA 3WIDA 3N8KA 1MB9A 1S2GA 3OKCA 1JPVA 4QPJC 4D8UA 1DUIA 2A0FA 2QLLA 3PITA 2PQ0A 1SD1A 4KE8A 2LD4A 4P34A 4B0OA 2M6RA 1DRJA 1CDZA 3AESB 4L08A 3CZMA 1Z6QA 3HHEA 4IJ5A 1E0AA 4IG9A 3TTWA 2ZSFA 1QCCA 1CVIA 2PO7A 1T35A 4MV5A 3E23A 4OQMA 4TVSA 4HWPA 1B73A 4TKLA 2RJ3A 5THKA 1KEEB 1G3RA 3OT4A 2JJ8A 4YRZA 1JL3A 4DR1B 1JVBA 1JAYA 1H1LB 4H7JA 3FETA 3EDMA 1V0JA 4GI3A 1KDZA 3I9MA 5JAIA 5K0FA 1RI3A 3MJRA 4FMPA 4CMBA 5JD3A 3A7EA 3R3HA 1E6EA 1EXVA 4WHMA 1US8A 3T9FA 5AUQA 5CYPA 5ALSA 2J0UB 1P1HA 1YU9A 1KF0A 2FZGA 1NP6A 2HFJA 2RH4A 3PXEA 1C80A 1KFCB 4M86A 4M0FA 1SIWA 4QX6A 4XB2A 3K94A 5KDOA 3NG1A 3LQRA 4JBWA 4U0JA 1RZRD 4BU0A 1N1MA 2WA2A 4ZAFA 2J6BA 4F4FA 2FXVA 1RHUA 1OLOA 1V96A 3F2VA 4XVHA 3SY8A 1EQUA 3MXOA 3N0RA 4AU1A 5K8CA 3N0WA 5JCOA 3ZV3A 3IAFA 4V0RA 4AMBA 1GU1A 4UTNA 1E3IA 3AVUA 4BB9A 2A9JA 3ZXUB 1XGKA 3BXHA 3RVKA 1E20A 1HDYA 4KOEC 3H75A 2RHTA 4N1AA 4UMVA 4H7EA 1GZ7A 1Q15A 3PL1A 5CA1F 4EVIA 1GTRA 4NXNB 1OPRA 5FBWB 5EWMA 1MQ8B 4G4SO 3ROZA 3VGJA 5IM5A 4EKIA 1L7VC 3ICCA 3IUBA 1N3IA 3PC7A 3FWHA 4D3ZA 1M2NA 5ALPA 5JQGA 1GRVA 3JY6A 1HE8B 2LGJA 4PC1A 2VYVD 1IN6A 4FOPA 3L0CA 4E1BA 4XWGA 4LDQA 1YQQA 3T7TA 2C3PA 2JKVA 1E7QA 4H4EA 2VH1A 1ID1A 1HQYE 3ZDFA 1X8XA 2JH9A 3T9BA 2WUGA 4INAA 5HF5A 3ZYZA 3QVUA 3PC2A 3CE6A 3FF4A 3IGFA 5FPKA 5IDQA 3KSZO 2VT6A 3C3MA 2AKAB 2HU5A 2N46A 3BC1A 4FOSA 4CLOB 3HM2A 4HLQB 4EJMA 4NECA 3FYUC 2CXQA 1WWKA 4NWIA 2DE0X 2ZSBA 1E2BA 3AV3A 4X0EA 2P9JA 2WT4A 2GWRA 3FWYA 3TQQA 1YZFA 1KMHA 1MX9A 1EG7A 2O4UX 5TF4A 3AR2A 1FP2A 5C1PA 1B6RA 1QLHA 1NXPA 1RWPA 2PS0A 4DDMA 3OHMA 4WK4B 3DMTC 2QVBA 2C4VA 2YOGA 1IUNA 3GN2A 5D1NA 3GJSA 1NQUA 3GJ3A 4DL9A 4HF7A 1CWUA 2P2ZA 2CNWA 3V7YA 4Q7QA 3AFMA 4TKMA 4HOYA 2C2OA 1HUQA 3L7DA 4YJFB 2X0FA 3WISA 2Q6OA 1HNZB 2YHBA 3B9RA 4NEHB 3T34A 3OVMA 1AKMA 1JYSA 1KDVA 4C0AC 1NYQA 4NBRA 4H15A 3ZR4B 5JSZA 3M81A 4D99A 4F1JA 2RB5A 4IIFA 1XN1A 7GPBA 1WBDA 4U7JA 4Q19A 3N3AC 3QPVA 2C3MA 1H5UA 1V5FA 2BE9A 2ZVPX 3L0OA 1QJCA 5C3MA 5F64A 3ML1A 1M74A 4JEMA 1KJWA 1OZHA 4CMAA 3V1MA 5CB4F 2NZJA 1FFAA 2H7CA 3I5MA 4J6FA 3U3ZA 1LF5A 1HTBA 2ECQA 2ZRKA 2Z04A 3WHLA 3FGNA 5DT9A 4FDAA 4ZI3A 1ML4A 1U2EA 3LYAA 4AYXA 5L53A 2VA9A 4Q3EA 4BAGA 5K6TA 4EZBA 1KBZA 3WYAA 3THYB 4AAYA 1NF9A 3IIEA 5L7YA 1TTHA 4UOZA 1N0UA 4JB3A 1MGPA 2NUPA 5IJ9B 5A9RA 1T4MA 1GTL1 5AW1A 4RAQA 5ELXA 1X6VA 3II6X 1XJ0A 3DO5A 3L5OA 4FSHA 1U99A 2YHIA 1VA4A 1UJ4A 4ZOEA 4IIGA 4FHZA 4GOLD 3ZV6A 2FPLA 1DV2A 1KC3A 3HNOA 4P3PA 1HTWA 3ROPA 3AJEA 821PA 4OHXA 4EJ6A 2AN4A 1F8YA 5JDIC 1WBBA 5EP1A 2IV7A 5KQGA 2ODWA 1K92A 1DXYA 1Z25A 2PX6A 5B1DA 4P0QB 1Z4LA 2XRFA 1NM5C 1CSEE 3H2JA 4UM8B 1OXSC 1X1RA 4CMJA 5AVYA 3NJRA 2LV8A 1PBNA 3HPRA 5LDDC 3U44A 2XB2A 3NTXA 4UATA 3SXUB 4GR4A 1Z7EA 1IWPB 1WO8A 4I46A 4IJUA 1NUPA 4O59O 3TSYA 5A9SB 2UU9B 3HP4A 4C43A 3JAKA 4YAUA 3BD9A 3OE5A 3GLGB 2NU6B 2OZLA 5BPFA 3KYCB 1F8UA 3R77A 2OHVA 5L4LA 1IQUA 1SK8A 3WLKX 3AUTA 2Q1XA 5C5IA 4CIBA 1NLMA 2A94A 1NVXQ 4UCQA 3FCYA 3UWKA 2B9EA 2IITA 5KYXB 3O75A 3IX7A 4TWZA 4AS3A 4DANA 3N0TA 1G8SA 3LD9A 1QQ7A 3BL5A 2X8AA 1JPNA 1GTVA 1OQAA 1U2QA 1CQZA 2CK3A 4NE2A 3DHNA 4OI4A 2X77A 4YQYA 5DNAA 1RLOA 4H1WA 1CXZA 3JYPA 4RSHA 4ZAGA 3UOWA 4JLUA 5K3OA 3K4QA 4CMEA 2HA6A 5SZHB 2VNAA 1ZM9A 1T5BA 1Y7PA 1OVGA 1QYCA 2BGRA 2KLHA 2OFOA 3QEJA 1ESMA 4HAVA 4UNPA 3KQQA 3T1HB 1U7UA 3E27A 3AJDA 4QAQA 5AJUA 4OYHA 4PN3A 3RU3A 1FDOA 5LQCA 1EWYA 3FUUA 5EJ4A 3OQNA 1E6CA 1ORHA 3QHPA 4I0WB 1JYEA 5C0OE 1QXSA 5REQB 4AJNA 5JV5A 5J4LA 2AGVA 3ENNA 4C7BA 5ECYA 4RS4A 2QTFA 2YWHA 5CHYA 1Y33E 2DQZA 3OQIA 4LFAB 1FFBA 1JJFA 5EJIA 4RK1A 2A3NA 5CDFE 1RPNA 4MQEA 5BWMA 4RZ3A 1E94E 1QIDA 3CBQA 4XWTA 3EDRA 2VQEB 1BGWA 1TYDE 3IQXA 1V1JA 3PJEA 4B3BA 1E5XA 3EZNA 1HG1A 1R4NB 1G17A 1UOPA 4RFVA 4YRFA 2NUAA 1VP9A 2XMZA 4J16C 4TLMB 3D8TA 3ZK8A 4KC0A 2DPXA 4LMPA 1KBOA 1PDVA 2REBA 2W4QA 4D8WA 5DRTA 2GZHA 1EWQA 4RVUA 5KWEA 3C5CA 4G5XA 4LKOA 5EXEA 4YRKA 4ZVNA 2B5VA 2BAGA 3KSMA 4XR9A 2NSJA 4R9NA 3VFDA 1RQXA 3E5MA 2WK1A 3PUVA 4R1QA 4BNNA 2F48A 4NSNA 1FJGB 3BMQB 1M3SA 3EA0A 4KXWA 3ONDA 5KB3A 2HMVA 1V5EA 4HGQA 3H2HA 4AJ1A 1P2TA 4UBMA 2PL5A 4MGHA 1NJ8A 1UBSB 2ZR9A 1OE0A 2I7TA 4XH9B 4HRVA 3R74A 3TRIA 1BFUA 3HWX1 4G0UA 2VLBA 4PLCA 1BE8A 3PIRA 3R6DA 3FOFC 4HEA1 4LVUA 1SVIA 5K3FB 4QLAA 3GWZA 4BO7A 4MQBA 5AH0A 2JCYA 1U0SY 1V1RA 4DT1A 3NORA 2XCRB 4FFNA 4BCBA 2ZSDA 3SHFA 1FLDA 2CXHA 2HMTA 4URVR 3KQHA 3CUVA 4TWBA 5FUQA 1FW8A 4EGJA 2FSGA 1G3IA 2HLDA 5CXSA 5IMSA 3PTAA 1IU9A 3V8PA 3K8YA 1FX0B 4K6CA 3TLXA 2O7RA 1BZYA 3JYLA 4WJKB 5B3JC 5B7NA 4IDNA 1FFGA 3CNLA 1A8QA 4CIAA 3ZD6A 1PLJA 3EF1A 1YULA 3KQTA 2JIMA 1MV5A 1O6FA 1QOQB 2KHZA 5DE3A 1ZBDA 1IDOA 3KYBA 4POAA 3OZDA 3AB7A 2Z1NA 3NOOA 3I34X 3A1TA 1ZHFA 3PXUA 4DCGA 5FI1B 3KXLA 4E5DA 2WZCA 5JNUA 4DKJA 3CX6A 1DQRA 1QM5A 2EQ5A 5DBHX 1H9BA 5GWXA 4TTTS 2FAXA 3ZV5A 1NBEA 1NMSA 1ONNA 2KWIA 2X3FA 1F2DA 5CNMA 2XITA 1JQEA 4BX0A 1E2QA 2I7VA 2PCJA 1C1XA 1NBHA 4RF3A 3GLFB 5HNKA 3ROXA 4IIJF 4P36A 3A1EA 3B2EA 1U0HC 1EFKA 1UXJA 2E0IA 2FPOA 3NBXX 3ZDXB 1JDTA 1PIWA 1ZJYA 2DX7A 3RYIB 1PZNA 3KKOA 4EA8A 5K8UA 4LC1A 4ZJYA 3AF3A 4QBFA 4OHZA 2IEYA 2X5XA 1F4LA 2D2XA 4MQUA 4WVLA 3VAAA 3VNUA 1XEFA 2I2CA 5U4QA 5IF9A 1DBQA 2YRWA 3IAM1 4GEKA 4OCZA 1YQDA 4ALMA 3FTEA 3E3OA 3JQRA 5IVPA 2I7XA 1N8NA 2O0MA 2OR3A 4DXDA 1VPTA 3L5KA 3ZCPA 3S3TA 4ZT6A 1QBGA 4OPMA 2FQYA 2LKCA 1KEUA 2R1VB 3ZKWA 3OLZA 1RAFA 1W85B 2ADFA 1T0UA 1Z08A 2Q2QA 3A9RA 3CB2A 4HZIA 3RO7A 2FH5B 4M8IA 1A1SA 3BOSA 4LIPD 5AVRA 1BGVA 4G97A 2IYSA 4TLBA 4F3KA 4ND3A 2A57A 3MS7A 5J3JA 4GZ3A 3V4LA 1FW6A 4DDVA 4KR2A 2BEVB 2C4MA 2P5UA 2XUQA 4OO3A 2JGKA 1ORRA 3F4BA 3H0KA 4YRSA 5E6RA 2CNNA 4XCVA 3UTDA 3E22A 3VZQA 4CKCB 2BP7A 3QVSA 2JA2A 4C0BA 1FXSA 3MWDA 4D3XA 2NZVG 3EG9A 3LWNA 3ZD9A 2I2BA 3FF1A 3HV0A 1WPGA 2XMBA 2EFGA 4IY1A 3IA2A 4TRRA 3W9BA 4ZDJA 2QTTA 1ZLYA 5SYAA 4HK4A 1MHPA 1UQUA 2CL7X 2I4TA 2PIDA 3H0CA 2GCIA 4PG5A 2PNJA 4AZWA 4IIBA 3S5JA 5C32A 3B3AA 1XA3A 4RTKA 1GLGA 1M1YA 4JX8A 3LHKA 5CMLA 1RJ9B 1Q0ZA 3F5MA 2E89A 3MEQA 4XWYA 4KQGA 4LJ9A 5K6AC 2Y1EA 1TF7A 4PAOA 1F7UA 1OROA 2B4KA 1GAEO 3VVBA 1SA0A 1DFGA 5IS2A 1T2FA 3R5TA 2FMTA 4HQLA 1T9HA 3LIIA 1JXQA 2AI1A 3ZH9B 3OU7A 1QTNA 2E3JA 4URUR 1EFVA 1XCLA 3E84A 4ROSA 2VUHB 5TXGA 4U2GA 7MHTA 2HF2A 4A8PA 3WL6A 2QLMA 4IGIA 2H08A 3SD7A 1AXRA 5LZ7A 2ZSAA 1KY5A 6GPBA 2X9LA 2HNKA 2J3JA 4W9NA 3ZHTA 5BQXA 1Y6QA 1M8KA 1C8LA 1W0JD 1IHYA 2BJWA 1XTQA 3O94A 1MABA 4FNAA 4TWRA 5KI6A 4YV2A 2EV9A 5C8VA 3RAJA 3KETA 4H16A 2HBQA 1R4MB 1T5HX 2H4YA 4XB1A 3JD3A 4ER3A 2L17A 4H1HA 2E7ZA 1QHYA 4R68A 3JYOA 4MJ3A 1VYUA 1OFUX 5GVRA 4RACA 2GD2A 5JVDB 3VNAA 3WA6A 5IVHA 3DAPA 1TC2A 4OA5A 3K1TA 3NHFA 2G77B 3O2JA 4YASA 3ISVA 5DHUA 1VLHA 4C78A 1L7RA 3KZNA 3ZE1B 4B71A 1VP3A 1MJGM 4ARCA 1UXHA 3BE8A 3V80A 2ZBFA 4ZZ3A 5JFOA 1O96B 4ND8A 1N5LA 1U0BB 2PZKA 1DEAA 2XUPA 4CLXA 2ZAOA 3H1PA 1WU7A 1YUMA 4HUTA 1WW8A 4YIKA 1JI3A 4LXIA 3UF0A 2VHTA 1QF9A 3CY6A 4KPUB 3AHJA 1DSSG 3OHSX 3C3WA 3B1KA 3AIKA 2BGUA 3LCCA 1JXMA 4MWBA 5C1BA 5CLHA 5D3ZA 2X86A 1C1DB 2YL2A 3TCKA 4BZWA 4GLJA 1MD9A 2GBIA 2ZSIA 2HXGA 3FWKA 1ARZA 1ONPA 3VR6H 4FI3F 2V8BA 4JITA 3GQBA 3JQEA 3TQRA 4B35A 6LDHA 3PEYA 1U9IA 2F3SA 4IDOA 5F1YA 3NGMA 2DLDA 1YB6A 3VJKA 3C6KA 3UV3A 4Z7QB 1NMEA 3E2MA 3E1KA 1K06A 2C5LA 2ECFA 5B6PA 3IB3A 1Z33A 4QWMA 5IDXA 3Q6MA 3KUUA 5LOVF 4QUDA 1XTZA 2H2HA 5LB2A 1WX1A 4ZRMA 1ZITA 2JLWA 2IHYA 4JXXA 2WTNA 3P0IA 2Y71A 4KVFA 2OBNA 1MAHA 1I0IA 2HAEA 4AN1A 1DEOA 2BKXA 1FS4A 2IT1A 2NQTA 4WSOA 1BYUA 2IOFK 4Y1RB 2WAXA 3FTQA 4OQFA 3H2IA 1GYQA 3AOEA 3QFHA 4JWTA 5IPFA 4NYJR 4DQDA 3U1BA 2VDWB 4BVHA 2FWMX 3SLKA 2IZ6A 1WIWA 1OY1A 1X1SA 2B2NA 2CFRA 3FGOA 5JQWA 2Z1DA 1FE8A 1ZGAA 3C3DA 4MCJA 5EHGA 1J09A 1Y1LA 1G8AA 2I78A 2PYZA 2WKWA 2CDRA 3O2QB 2L19A 4MI6A 4PAQA 2CMFA 5AIBA 3GVXA 2XMGA 2I9PA 2X2EA 3MM4A 4JL5A 2VZEA 3DBHA 3T41A 1SIUA 1XK7A 2AVNA 2GFQA 2C57A 5IJ0B 3HJGA 3OU6A 3X44A 2HJRA 2XXAA 4KG7A 5LXTF 3E3AA 2NWQA 2PMDA 1D9XA 3KAKA 3L0ZA 4YJ3F 3WIBA 4X1IB 4W5NA 2P2DA 5KNCD 2A9RA 1SKUA 1PNRA 1DKOA 3G5LA 3NNSA 3P9PA 4D9IA 1QGZA 5CBKA 2PKQP 4HNSA 1BN7A 3BHNA 3JASA 4B6JA 1JKIA 3D1VA 4PM4A 5IAJA 4GO1A 1WMAA 4DARA 1FFYA 1G3UA 1FF9A 2JHPA 1AKVA 1ZISA 3NONA 4AECA 5EHXA 4JX9A 5JE8A 5HW0A 2YQZA 4J0CA 1YT5A 2IYAA 2PSFA 3ZGYA 3EARA 1FXUA 1SU8A 1U1CA 3EISA 5A6VA 1ODJA 1Y4UA 2H1LA 2DBZA 3B5EA 2DZDA 2ZIEA 5KQMA 1IATA 3JQCA 2D1SA 1CY0A 2WFLB 3SU8A 1NX6A 3BXFA 2RGWA 4XYLA 3KCQA 4LHSA 2X8WA 3VR5D 1K8XB 1HXHA 2YC2C 3IHLA 4GQAA 3VRHA 1T4CB 4ILEA 3UT0A 2ENWA 2QTWB 3N7UA 3PXXA 2ROQA 5MGBA 1LXCA 1OTXA 1NBOA 1ZJ4A 1MPXA 2DERA 2YFYA 1I3LA 2GK7A 3L7NA 3VOTA 4CQMA 4HNHA 2MINA 2AOTB 2GYVA 1NLFA 4GKBA 3CH7A 3AZOA 3L7KA 3MJCA 4CU5A 1COZA 4RIIA 3SR3A 4DFDA 3OICA 5CBPA 1G9SA 3K0HA 4NIMA 1W5FA 4PHCA 4WBSA 3EXFA 3PT9A 4YALA 2M6LA 1XDUA 3QVGA 3RTAA 3TMYA 1YFJA 4LYDA 4YAJA 2Q2OA 2J5QA 1GUBA 1RXUA 1SC3A 2JJ2A 3QXCA 4LXHA 1XQYA 2VJPA 3SJUA 2X9VA 1C0IA 1YKFA 3AR9A 2QX9A 2FRVA 1X1AA 2HJSA 2XE8A 3K0EA 4BFVA 1U9YA 5DI3A 4EMTA 1PLLA 5K8LA 3GBSA 3OQ6A 4OB7A 5DI9A 3BTOA 3QZUA 4DWJA 3MPOA 4L4RA 4WNIA 1P3DA 2YICA 1NUUA 2P6PA 4JBLA 1I4TD 2V9CA 2NADA 4RIGA 1IG0A 4ESVA 1Z73A 1KQ3A 3I64A 1U2ZA 2OM6A 2B3TA 3VPCA 5GIOE 4YJ2F 2BHRA 2CHVA 2J5BA 1VCNA 3NW9A 4HFNA 4MQFA 3I04M 4OSEA 3TLBA 3UGTA 1DFHA 6REQB 3DVRX 4OK6A 4BGEA 1QG4A 1J0XO 2YV1A 4B7UA 3ZWKA 3W6PA 1QHHB 4MKXA 4F1WA 3TOZA 4Z1OA 3UAXA 1XXHB 4GYJA 2FPUA 1KR5A 1QIEA 4FIDA 3T61A 3FMIA 4UEJA 1JIJA 2GZMA 1M54A 3T5TA 2JAOA 3BREA 4D98A 3F6YA 4WOKA 1RKVA 1DDGA 2X76A 3MCTA 4XPIB 1CZHA 3SMQA 2ZIXA 5J59A 5A5DA 5EVCA 1CEYA 3KZMA 4WXRA 1U8UA 2X13A 3ZS8A 5HRUA 5ALIA 5B5SA 1KR2A 3SE7A 4D42A 4U2CA 5DHFA 1IIRA 1Y98A 2WSYB 5DP1A 2DUWA 5KZMB 2RONA 2ZZMA 4H18A 3SDBA 4K6FA 3D0QA 3NAQA 1DCTA 2WYUA 4IUDS 3DL2A 3W5VA 3WMRA 1QQAA 1P80A 1X9HA 2GHQA 1OX5A 2BY4A 3PXAA 4LI0A 4M9ZA 4C7OA 2Q4DA 3AVQA 3RVDA 3T1QA 1N5RA 2P65A 1NRXA 5DNCA 1FMCA 4UZEA 1MAUA 1NUTA 3ESXA 4YECA 3V48A 2HXYA 3QF4A 2XT6A 4QAJA 2RKOA 4AY4A 3E61A 1A8PA 2IHJA 3NM6B 4JI8B 4ZVMA 1X2BA 5T4BA 3ZWDA 4FWTA 1JDZA 1S89A 2HLNA 2BN4A 3JQFA 4IGEA 4OD0A 4RK0A 4TV8A 3WRXC 4JGBA 3N2YA 2MYNA 2VDNB 2JASA 5DW0A 3P5BA 3GFGA 1S7CA 1G7SA 4PANA 2FJPA 3UT5B 4BAZA 4C05A 3PX7A 3GR6A 1LTHR 1RCUA 3A25A 3DWEX 4RZ2A 3E7PA 4YXWD 3V6MA 4WXYB 1R9MA 2QN1A 2WTAA 3C5VA 2DWOA 3QWFA 4FQ5A 4LSWA 4XYEA 1XZMA 4MUIA 1ZGCA 1AKYA 3X2FA 1XAIA 3EFBA 1P75A 5DSXA 1IXRC 3HB0A 1NAIA 1U8EA 3IPCA 5IUKC 3LKZA 1G8PA 4O4IA 1YB2A 4AG6A 2JJ1D 2IHNA 1G5RA 1MV8A 1ZK1A 3KWJA 5SZIA 4A82A 1W93A 4D9BA 1OI2A 2PXCA 1RRFA 1NV8A 4F9TA 3W5BA 2VJQA 9LDTA 4GP6A 4KXMA 3IP7A 2WT9A 2OFWA 3JZAA 2VAMA 2OZKA 3B1YA 3NHBA 3P27A 3K0AB 1G9XA 4GXQA 2W6JA 2VFAA 5J58A 5K01A 3A9SA 3VTFA 1HMYA 1M2FA 3H9JA 1N2XA 4JQZA 3EEIA 4EJ2A 4ZO8A 3L1KA 2AMJA 2ZWPA 4Q1VA 1XHEA 3GUCA 3HEBA 3TW0A 2KMLA 4W99A 3X1ZA 2ATEA 4MKRA 4AS2A 3T1TA 1JR3D 3DYBA 1P2BA 2B7LA 2XPCA 4LQ4A 4ZGBA 1T8WA 3QBEA 5JAUA 4I8XA 3VUFA 4ND1A 3V46A 1ZRNA 5L6LB 1B0AA 3PC3A 1DV1A 1JB9A 1H0RA 3GP5A 4I19A 1XRPA 4IS3A 4W5JA 3S55A 2PJRA 1ISHA 2XNJA 2JH3A 1P72A 2JCGA 3L1UA 3LA6A 2ILVA 2R47A 4PLGA 1RC8A 3TMAA 2XKBA 4R9RA 5CJPA 2WZDA 5FTWA 1EAYA 1P4HA 4U6NA 4X94A 1W0CA 1P5JA 2G7MC 2MSDB 2PBRA 2QXYA 1SXJC 1VHWA 3VX3A 1EX7A 1H0KA 2DFKB 2PSEA 2VWGA 4NENA 5TT0A 3VSEA 2CV0A 1RWWA 1JEAA 2IY8A 2E6UX 3H1EA 2QJOA 1K9SA 1WL8A 3BHMA 5DV9A 4D41A 4YAKA 1EPUA 3ILHA 2IY9A 3LKBA 3X1XA 5F7XA 4MPDA 2I6UA 4CIXA 1FSZA 1L9XA 1ZEMA 1MTOA 1T0JB 5JMTA 4A1FA 2F3QA 1JMYA 1ZIPA 4W8OA 4XUCA 1Q1GA 3V97A 2W71A 5A71A 2Z8XA 1K7EB 2UVPB 4F6CA 4AD8A 1ZCAA 1X92A 4MAFA 2DUUA 3IUEA 4PC7A 5CHEA 2VZ0A 2J45A 3VO8A 1D1SA 3QNMA 5L95A 3UV6A 5A2GA 2ZYGA 3CGGA 1UAGA 2R8RA 3OKPA 4O4JA 3GU3A 4DA8A 3OJEA 1M6HA 4WEQA 4XGIA 3ZUGA 4KQ2A 4CUJA 4PYJA 3BE5A 2PCLA 4FILA 4PGAA 1NNUA 3OCZA 5EXSA 1JHYA 1V9LA 5EI5A 3NCTA 3WKAA 3N87A 5KTMA 4Z4QA 1JKFA 1XQ9A 3DEHA 5EJMA 3QUAA 3HR7A 1I6MA 5E2AA 3L06A 5IT9A 3HC7A 2FUNB 3DOJA 1RPTA 2ECKA 5KTPA 4H2DA 3FAKA 3H2SA 3CC8A 3GFQA 3PD1A 5CJ2A 4MA0A 1USGA 2OHIA 3NATA 3ZWOA 5IJAA 4FEAA 4MDYA 2XUIA 4Y6SA 4YP0A 3RSFA 3SGLA 4NTZA 5EIAA 3CUEF 4R7TA 2C8LA 5FTKA 2D74A 3A14A 2QHXA 1KK0A 2QOEA 3PX3A 3E9EA 4RH0A 1JIUA 1COWA 1Y5LA 3PZBA 3VX4A 3ANXA 3GLHB 1QFZA 3KPJA 4KR0A 5ERXA 3VYRB 4WKBA 1JDPA 4BVGA 4C5CA 1Z0UA 1G2IA 2DCMA 3M89A 1YDMA 3BERA 3HUUA 3C8DA 1Q7GA 4OLFA 3VDXA 1XRLA 2A5LA 4UHHA 3L8HA 1TLTA 1KYXA 1M2HA 2G1PA 4J1TA 4X1YB 4JVOA 5KWSA 1PYOA 2YJTD 3C8MA 5HE9A 1E2MA 2P9BA 2V5AA 2OBLA 2QTGA 3I12A 5TS2A 3V2GA 2Q1TA 1QIJA 4N5HX 4AX8A 1AUPA 3H2BA 3EVNA 2H1CA 2ZSEA 2X6TA 3AINA 2CLSA 1RSZA 4ZO7A 3T1NA 2JLZA 5FOWA 2X8JA 3G9TA 4DVGA 2ODEA 1V9SA 4R1TA 3GCWA 4B73A 4U2EA 2QN3A 3H5OA 4WOPA 3QVLA 4EUHA 4M1TA 1LS1A 1DTWB 1NVMB 5HE8A 3B48A 2RI1A 2XTJA 4AUKA 2Z8ZA 5AVXA 1PEDA 1ZP6A 2VJMB 1XLVA 3C3PA 3AHDA 4FE3A 4BVJA 1E8DA 4II2A 4YCMA 4GPIB 2N9UA 2ORVA 1UXGA 2Q4RA 1KYQA 3N8GA 5AXAA 4DF3A 3TTTA 2FUEA 4HXGA 2TRSB 3S1LA 2YRXA 3R23A 1Z17A 1O58A 2PLAA 1JJIA 2XUDA 4K9LA 3ADKA 4GOOD 2GOYA 5KNBA 2PUTA 5AWFC 3X1KA 4XX0B 1KMQA 2IF2A 2Y1CA 3K1AA 3QOYA 3THSA 5JPDA 2QUIA 2C98A 1Y1SA 1WSDA 2FPKA 3MINB 5F4BA 4CODB 3ZJTA 5T6BA 4ATNA 4OQQA 1QO7A 1Z4MA 5AW7A 4UBKA 4KIJA 4QELA 1YS1X 3MTIA 4OOFA 4LJKA 1QR2A 3BRWD 4N12A 4IHKA 1A71A 1VL8A 4LCEA 3C1UA 1I6LA 3IELA 4UAJA 2DPGA 1EJ6A 5FOTA 3T3HA 5FXMA 3QKSB 2Q4EA 1WY7A 4NPAA 5FOXA 5F76A 3LQ1A 5LZ4A 1E5QA 4GKAA 1DO2A 1UBOS 3PFWO 4ZVVA 4ZWNA 1WUJS 1UPCA 2M1XA 1C9KA 3PICA 4XQ0A 4MVJA 1G21A 4BBZA 3UJ6A 3T7IA 2DPMA 2X9GA 3VNVA 3DL4A 2YKGA 3ROFA 5IVKA 2AK3A 5CFNA 5C80A 2BR5A 1CR2A 3P4YA 4I55B 4EFLA 2WJAA 2GJ8A 4FBMA 1E58A 3A05A 2B94A 5FHRA 1T2EA 2DBYA 3OURA 1XRMA 3ZWNA 2H1IA 3Q15C 4BB5A 2CGEA 1DAPA 3ZDAA 4CCYB 3GCXA 2YASA 5CB0A 3G6KA 3PC8A 1KJIA 3N2EA 4PC2A 5BRJA 3GG9A 3SEQA 5B3LA 1V45E 2AQHA 1GHTA 1X77A 2PD6A 5L8VA 4MWEA 4NATA 2RAUA 4DNFA 3CEHA 2XVXA 2GAAA 4QSHA 1ZUD1 4IR7A 3GJ4A 4FS3A 4H0CA 3BL6A 1BXRA 1KKUA 4QXOA 5GINE 4S1TA 1XDSA 3BGDA 4V2UA 3HE3A 1XT6A 5HFNA 3KOXA 4IHJB 4DG5A 1N34B 1QYRA 2D5IA 1UPUA 3PXGA 3RRBA 4R0MA 3P5SA 2CV1A 2BFPA 1A2BA 2FCAA 2VIIA 4Q4HA 2L2QA 5EZQA 1CRPA 3ED1A 4PQEA 4R2IA 2AYZA 5EYPA 2H2DA 3WK5A 4AJIA 2PXAA 1CJMA 2WW8A 4ND4A 4EOGA 3ADOA 1TE2A 4Q9JA 1E1QA 3UJNA 1L5HB 1QTRA 3BRSA 3VU9A 2FZ4A 2WPNA 5TY0A 4D57A 1LU9A 3A26A 5KHLB 2VN8A 5B4VA 1A2QA 3IXLA 5AK5A 1W59A 1FTNA 4TS9A 3W2HA 2JI8A 3V3TA 3Q0TA 3UBTA 2O3SA 4IV0A 3VHXB 5KIAA 3DBRA 4IEEA 4M1SA 3COWA 3UEOA 3RVPA 4PLHA 3HM9A 5EGSA 4LYHA 4Q5IA 1M0SA 1YCHA 3FIUA 4HR7A 1P6QA 4KX3A 5DYWA 4BJ5A 4TLLB 1KRHA 2FWIA 1JNYA 3V1LA 1UOEA 5ARDA 5A3SA 2GVNA 4KQJA 1M34E 2JLBA 4KOAA 4B47A 1FS5A 3NHKA 5KTYA 2QTLA 2IY7A 4PN7A 1OHHD 1NOIA 1ORIA 1RQ2A 3GUZA 4B74A 3AUJB 3LPCA 1DRUA 1N2OA 3Q8WA 4WK2B 1H8EA 3Q3EA 1STOA 4ES6A 1OIWA 4QU8A 3JRWA 1F06A 2GFIA 5BN1A 3FDXA 1IY8A 1F6BA 3OOHA 3R5HA 1SKYE 4JLBA 4YACA 5EZYA 4OSOA 4D4LA 5HIKA 1H05A 4EYOA 4ZVRA 1ZKDA 1RMYA 2PAFA 3KUDA 1C7QA 1NVFA 1GZ5A 2AX3A 3ZCQA 3RYHB 4F3RA 4RJJA 1GRNA 2HNBA 3OJLA 5AVWA 2EZ4A 3FYDA 1ZDMA 4DAEA 2X4GA 2NZWA 1E2EA 4GNKA 3DTNA 5JD6A 4JXZA 1BXZA 1UJMA 2COUA 3IB6A 1WB5A 4TLCA 2EOAA 1XTVA 2VSOA 3CB4A 1K6JA 1X19A 3T94A 1BCRB 2IS4A 2QLFA 3K9HA 3DZ8A 3AF4A 2FWNA 1A4RA 3E9QA 2G5PA 5ICSA 4ZDWA 2GTPA 2I4MA 1O94C 2R6CA 1ZEJA 4ZOLF 1ULSA 4JMPA 5K99A 2FN7A 2IZ0A 5A4DA 1A9ZA 1YB7A 2XKAA 3EH1A 1KDPA 1R6VA 2O0KA 4A8JA 3WGUA 4GI2A 5CFZA 3AF1A 1TJNA 1ZXLA 5SICE 3BUSA 3EAFA 3QBTA 4TXJA 5EEGA 2HK9A 3DTYA 1VL5A 1Z62A 4CCWA 4FD2A 2CD7A 4FFDA 1CZKA 1PK9A 2FI1A 4HMOA 4OIFA 1YQUA 3HCAA 1PR2A 5DX8A 1FB5A 3WRYA 2AMVA 2E5LB 4Q7EA 1N36B 3JARB 3JQ8B 2Y93A 2W2MA 1X3LA 3I9JA 2WYOA 2Q3MA 1WQ4A 2D2EA 4A26A 3LC1O 4MPJA 1VYVA 4HXEB 3NC4A 4PBSA 3K1JA 3RUHA 1TCUA 1UM9B 1YC5A 3IPRA 3EH2A 2CNBA 3NHJA 2E6KA 4R8MA 1RZRA 5LB4A 1JQAA 1IHOA 4QRDA 3SHWA 3WLMA 1OW3B 1EE2A 4U2FA 2W8BB 2ZR0A 2ZRHA 2NXEA 4C04A 3M6LA 1OJLA 2A35A 3RVJA 1O97D 3RRYA 4L4XA 4YHHB 2FZKA 3L7JA 4G0PA 3T12A 1SQ6A 2X1MA 3IOEA 1Z37A 2JIDA 1BDJA 2V9ZA 4GF5A 2ZXEA 5C8YF 2FN9A 3L79A 1LRKA 3MLEA 3LX6A 1U0FA 2IYLD 1OLUA 4QOGA 3RTCA 1MW9X 2C7RA 2WTEA 4P33A 3DV0B 3N05A 4PRZA 2IEDA 3NZEA 4QUAA 1NW8A 2CLEB 4B6FA 3AZPA 2NACA 3CN7A 3OKFA 3P0JA 1RI2A 4ZT5A 3R7NA 1P81A 3FPBA 3SP1A 1KHHA 1U7ZA 3M6UA 3QTTA 3GGOA 3PRKE 2AJCA 2H4HA 2OV3A 3I8SA 2JI9A 5HS4A 1GA4A 1QMGA 1UJBA 1NQAO 4OQNA 4CQNA 3GX1A 3VISA 1JEJA 1EEXB 2VYVA 4U3JB 4YRAA 1RFLA 4IZ6A 2CMGA 3PV0A 3IMGA 3W4JA 1U8YA 4FJ1A 2GHIA 1W4AA 3M1LA 4CM6A 1H22A 3RK1A 4XEUA 3G79A 1GRRA 2VP6A 5FV7A 2BFCA 4LE2A 1YZLA 4A36A 1TPYA 3U7HB 2EKLA 4HGRA 4BZZA 5EAIA 3HH8A 5DOVA 2GNAA 3WFJA 1YRQA 4HH0A 1ZJJA 3KUCA 4HFRA 4MPRA 4N48A 2ZXUA 1DO8A 3CW8X 4J43A 2WJVA 4OHBA 2XXJA 5ALUA 4GOJA 5JFGA 1DIAA 4YJKA 3NFYA 4M9RA 4Z4HA 2A5JA 2YJGA 3SVLA 2JKYA 3FH0A 1Y4DE 4WLUA 1UK7A 1H6DA 1Y8QB 2AUNA 3A4MA 1I94B 4G1CA 2O2JA 2QYHA 2FEMA 3DE7X 4HDQB 4Z3OA 5HEKA 5EIOA 4R83A 2GM5A 1Y1PA 2QUBA 3CX7A 3DB2A 2ATCA 1WXGA 3FVWA 3PA8A 1NRWA 1W4BA 1ZH2A 3PFIA 4F92B 3W78A 3RYCA 3FLBA 4QDUA 5JFTA 5DYYA 2YFHA 3MRTA 4R8RA 4U7HA 1Z5WA 2BM0A 4Q1DA 1MU0A 2JFOA 1G5TA 3PQ5A 2BHNA 4A73A 2MTBA 2QGFA 2Z57A 3IURA 3QKUA 4FXOA 10MHA 5ICGA 4HLDA 2VF2A 4Z4FA 5FBVB 5EP4A 3A11A 1MNQA 4ER5A 3N5KA 4DV2B 4B3CA 5HRCA 4IRUB 1GTZA 2FF5A 2P2CA 3A28A 1WPXA 4NFYA 1BMQA 5ERGB 2Z2JA 5KYTA 4K6MA 4BO8A 1K88A 4HNAA 1P0QA 3IQFA 4N76A 1EVQA 3C41J 5EEHA 1VKRA 3HB1A 4CG0A 2HSGA 5ALLA 1YCDA 3A6EA 1PD1A 2HIMA 2BKEA 1X1EA 1E0SA 4QD3A 4JGIA 1CS0A 3EOBI 4LOHA 1QPZA 1JPJA 3OJXA 5EQFA 1A4IA 2GR9A 3DVAA 4BGUA 1KY2A 1RI4A 5JY6A 1IRXA 2ACKA 1G21E 1O6CA 4XGNA 3WTCA 3FHCB 2PFKA 1PJ4A 2C31A 3A6KA 5I7HA 2W6NA 1K6XA 4NXMB 1F12A 2XYPA 2RC6A 2VHYA 5LPNA 2GPYA 3HACA 4MHOA 4AZ3B 4LDRA 3K6RA 1GNVA 5EFOA 5ENDA 2N0SA 3LDGA 5ANRB 4PG8A 1OUMA 1J56A 1GKYA 1YASA 4MMZB 4JT9A 5HKBA 1O9BA 1H2ZA 3IBFA 1EFCA 2EZUA 3MJVA 4M0EA 2D8AA 4EK9A 1DHRA 2WF6A 3NVMB 3RC7A 4OA8A 4N5MA 1V3UA 1Z68A 4Z6KA 5LU9A 3UHAA 3RQIA 5JNWA 4KGVA 5KMGB 4BN0A 5GY7A 1BDBA 3H86A 5K0CA 4NFSA 2Y99A 1HFEL 2VQ3A 5K0GA 2XMPA 3KXPA 5ALVA 1P18A 1QOZA 4RO0A 1GNRA 2H4ZA 2IEBA 3K0FB 3CKKA 3VU3A 3T8YA 4AF6A 3PI7A 4BJHB 2OCKA 2FSHA 4J76A 4QJ5A 3ZLTA 2NZ8A 3I0MA 5EG5A 1YMUA 2Y3IA 1PJRA 5ES4B 5FLYA 1RKUA 1RWBA 2FVYA 1ZVMA 3PD0A 1UKVY 1D9ZA 4DRZA 2RI6A 3N2NA 4RL6A 4RZSA 5C8ZA 2AXQA 2GEBA 1QYWA 1UXIA 1WMDA 4FLFA 4FSXA 4LK3A 4FSDA 4QBTA 5G4LA 3TLJA 4M8LA 3X2SA 5HK9A 1RLJA 3PGVA 1OH8A 3JQGB 4KN9S 4AXBA 4AJLA 1SVNA 5D51S 3RFTA 4HAWA 2BKVA 5EJ9A 1GPJA 2G7ZA 3D8SA 3QGMA 1DIHA 4ZXFA 1LK7A 2Z08A 2PT5A 3WBFA 3O9ZA 1CK4A 4BMDA 3PQCA 3SZOA 1HZZA 5LD2C 3LFUA 2EJVA 2PZEA 3H2KA 3DUFA 3Q7QA 1JAZA 4HVLA 2V9PA 3QLVC 4IZHA 4MV6A 3I4LA 3NGXA 3EZ7A 2BD0A 4HEQA 4Q9LA 5AVZA 4I1YA 4V1CA 3FDZA 1ZI8A 4D8TA 2ACEA 1M2OB 1A96A 1L5FA 3P4XA 2R2AA 4GGMX 4WK6A 5J2UF 4Y2UA 5TPWA 3HSSA 3U4CA 5EA2A 3UJAA 2B6HA 3R7LA 3DL7A 3FNBA 2B30A 1SUSA 3EBPA 4CRWB 1AHNA 4OAOA 2QZJA 3F3KA 3GT7A 2BTQB 1NRJB 2A1UA 3GAMA 3GJYA 4RFSB 5K8IA 3QLUC 1GR0A 2JJMA 3E1GA 1S6YA 1RBQA 2QA5A 1XWWA 1WUYA 1SM4A 3IT2A 1ESNA 2XRYA 4HQFA 4OV6B 1VZ3A 2FMUA 3CUWA 3DT6A 3MRSA 4IX1A 1PE0A 4YJHB 4B87A 4B75A 1MW8X 4EP1A 5B53A 2JGJA 3R40A 1QHFA 1L3CA 3GC6A 1BE0A 2E4AA 4EMBA 1H9AA 4M1OA 1SB8A 1H42A 3JQDA 2G70A 1ZAYA 5E6SB 1E3SA 2DUNA 2BGJA 4QC2A 2YNMD 3EAQA 3EQ7A 3E81A 2QT1A 1IEXA 4O08A 4JP3A 1HK7A 3USES 3WNDA 3AV0B 1DAGA 1L5RA 1UWKA 3AM4A 4FEYA 6Q21A 3WQQA 2R25B 2EFEB 1KP3A 5KQRA 1KZ6A 4MS4B 2H54A 3VQTA 1V8FA 1M1NA 1PGOA 2NVWA 3DHEA 4XJTA 2JFBA 1IY9A 3ZIDA 2HMYB 2QUHA 4ASUD 4BQQA 1NU6A 4G4SP 3SPXA 4DV6B 1PQYA 2QRPA 5H80A 4ZARA 1EFPA 4F8EA 3DLIA 2RGBA 1U02A 2BGWA 2FOIA 1NJFA 3IJPA 5G0TA 3GJZA 3PQ8A 4OEHA 2ZUTA 1B8UA 4WV3A 4X71A 3ZGOA 1WZEA 1TFUA 3G2IA 5JADA 1QBKC 1PHRA 3QJ5A 5E3IA 1AMUA 1DEKA 4X00A 4AWAA 1SVKA 3KQWA 3EIEA 1V8ZA 2WUDA 3L6EA 1WUKS 3GEBA 3IIKA 4TL7A 3S27A 3AVWA 3UH0A 2FPMA 3B1WA 3L1HA 4DADA 1DDIA 3GCGA 3MLAA 3MWJA 4LE0A 4YUAA 2QT0A 3KXDA 2QV0A 4A5SA 1V47A 2ZB3A 4QOIA 4X7RA 3FSJX 1H1LA 3QTBA 5ALGA 1A7UA 3GRAA 3NYRA 3F1KA 3OPYA 2CUNA 3QH4A 4GGOA 3I37X 1T8TA 3FJYA 3IEIA 4KNYA 2HKIA 2P2YA 2WF9A 4GECA 3OX3A 3AVVA 1QP7A 1S02A 1VPEA 1HH4A 2VO1A 3TZLA 2G17A 3GT3A 1T1SA 2PS1A 3JPWA 4PGGA 4Q3DA 1QDEA 5DWQA 3UAOA 4A8JC 4JLNA 3OP4A 3IQEA 5AI4A 4R7GA 1XTTA 4EB3A 1J2YA 1CUWA 1QE0A 1EWRA 3AHHA 4PZ0A 2AG1A 5TGTA 1TUBB 4AK9A 4LJ8A 5DGXA 1YOBA 4HQKA 1N1DA 2OFPA 4JK3A 2JGNA 4GBMA 4RF2A 3WRYC 5LQSA 2J9YB 5D6NA 4OG2A 4F84A 4FDVA 2Q9UA 2CF5A 4WX2B 2BMAA 1DJQA 1GAWA 1KJYA 3QMVA 3NBFA 2GPTA 4X1KB 4RTOA 2IYPA 3OWHA 4N5LA 4R2XA 2F7SA 1G2QA 2JGMA 2A9FA 1YDEA 2DKOA 2G40A 2XWJI 2JL1A 3L0BA 1WR8A 2OHHA 3BIOA 3VH4A 3UMYA 3I30X 5TNXA 1VE1A 4AY6A 4WCDA 4DM3A 1LC0A 4L72A 1WBJB 2XNCA 5GJWC 3RC1A 5E9WA 2O6HA 5C37A 2BI8A 2QVYX 4ZZ0A 3L4JA 4CEIA 1TQ4A 1QAOA 5CVDA 1LPSA 2FW8A 1XWIA 5B1IA 1SXHA 2GN9A 2O0JA 1QJ4A 4FUQA 3U5ZB 3GYBA 2WIFA 3L4BC 5ITWA 3LY9A 2N75A 2B0CA 1NR1A 2WU8A 1E2JA 1AK9A 3JQAD 3PFBA 2WG2A 5K4HA 4TMFA 2TMDA 4YEDA 4YMIA 2Q6KA 4RA9B 4LJRA 1MAVA 3B36A 4L0DA 4NAVA 1GZHB 5P8WA 4CLOA 1IEVA 3RROA 1Y8RB 4E2FA 4EA9A 2F8MA 4OXNA 1II8A 4FONA 5LQDA 4TRMA 3PYXA 2DWUA 1VHDA 1OT3A 3N2IA 5GV7A 1PR3A 3KKKA 3UQYS 1BEUB 4LRUA 3BWVA 4MJXA 1Z8DA 2XE7A 5JIBA 1M5RA 5ED4A 3STVA 3H13A 4ROTA 4YDHB 2FPPB 5SZJA 1UWVA 2V3VA 4QVKA 5TMEA 1LQUA 4WOCA 2AXEA 4OHFA 1KMIY 1ULTA 2CZCA 2XNSA 1XUOA 3GLUA 1T24A 4O6VA 2P4QA 3CF4A 3ZD7A 5JU6A 1WQ3A 2GWHA 3MELA 5D85A 5DBOA 4BXOA 1I33A 1W0JA 2HUNA 4TGLA 3QELB 1V4NA 4EGSA 2J3HA 2Q5OA 4G3XA 3FLAA 5K09A 1M7GA 2A9QA 2BJVA 3DXYA 4PQGA 3HXMA 3OLCX 2KJQA 2O1EA 2XXBA 3KJQA 4ZALA 3QQPA 1KO7A 3G82C 1P2FA 3MUFA 4TUYF 5CVJA 3RC9A 4QUHA 1EHCA 4BEJA 1E1KA 1E3WA 1EUCB 3P0EA 3DDOA 4AB1A 3U9SA 3PEEA 3UYLA 1QAMA 2QMZA 1LQTA 5FA8A 5A6SB 3IKTA 4ND7A 1KTIA 3KTFA 1RAHA 1O9GA 1FBNA 2F00A 3UA4A 1E61A 1R4ZA 1WDLA 7AT1A 1SHZA 5DCYA 2RAPA 2EL7A 4LGCA 2ESRA 5KHAA 3CZRA 1GL9B 1LLCA 4JI7B 1BRTA 1PI3A 2I3AA 2VDJA 3THYA 1DX9A 1CDDA 3KQSA 1O8BA 4EECA 4J29A 3TZQA 4UFNA 5IJ9A 2QQGA 5HXAA 2HK6A 3S2ZA 2WSLA 2JAHA 1RYEA 2FPWA 4B85A 4LBZA 3C43A 2O2YA 5I9IA 2IPNA 2H8GA 3P2YA 3WYEA 4P3XA 3R7DA 1H5NA 1KMNA 2DG2A 3HK2A 2O5CA 3GZ4A 1L4BA 3BE6A 5KWJA 1XLTC 3ETEA 3KO8A 2ZIZA 4UQPA 2XF2A 2RH8A 2RHOA 3ZNOA 4BX8A 3INGA 1Y42X 3WLOA 1NTOA 4IGKA 4ARAA 3LS2A 4GX1A 4X7BA 3CU5A 2CKDA 4H1TA 3SBXA 4X8HA 3AUUA 3FDIA 4Y6OA 5L3SA 4JI5B 5TPZA 3SXUA 3FPEA 3EDCA 4AQ7A 1BCSB 4KWHA 1GSHA 3RLFA 5CXQA 4HLUC 3JQBC 5A9SA 4D96A 3H8SA 1QZTA 5JSKA 3RABA 4DVJA 3GLGA 2K87A 5H70A 3QWAA 1NWCA 3PU6A 2GM3A 3QIAA 4HC4A 2Q9CA 1FU8A 3Q1LA 1IEWA 2H1RA 1XZPA 2R87A 2QN9A 1HI9A 2CXOA 4F5EA 1KEZA 2FV8A 2NX2A 4PG7A 3M5WA 3PNMA 4QJ4A 1YQWA 3B7WA 3T3EA 1ETHA 1XVUA 1CJKC 2Q5LA 4B33A 4C4TA 5KYXA 3FMOB 1AVTA 1QLJA 1XX6A 4R8VA 4RSGA 2OMKA 1HT3A 4N5IX 4RTMA 3BMXA 2DWPA 5FPSA 1X1BA 3C8ZA 4P98A 1G16A 2IP4A 4BFCA 3OOEA 2O23A 1EYZA 4HFJA 4Z9FA 3TQFA 1A9YA 1QU3A 1BHO1 1JDJA 2QT9A 4EEXA 3N53A 1QH9A 5LYJF 3UPTA 1A98A 3GZNB 3O0DA 4WH0A 4LJ6A 3SSOA 1ZGGA 5IP5A 1I5OA 3AHIA 3DFIA 3GVHA 3VPFA 5KNCA 4PQRA 1VBKA 1ECGA 5REQA 1B14A 4O8ZA 1N6KA 2PMCA 1QSGA 3DBOB 4ESHA 1WM1A 4MS3B 3ZQJA 2V4ZA 1E1RA 2ANBA 3TGPA 4DCJA 1AOXA 3DT8A 4UZSA 1R4NA 3IQZA 3TRKA 3ZDQA 4DDTA 1MVNA 2DLNA 3NRCA 3O3NB 4I3FA 4QIHA 4D8YA 5L3VA 2MT9A 4QOFA 3BA1A 1KRXA 4C0JA 2NAFA 2A9PA 1B8OA 2DUJA 3HLYA 1ENZA 4QGFA 2WOJA 3K72B 1FFCA 3UKOA 3VR5A 3WK6A 1Z3CA 4NNPA 3VKUA 4R8LA 5BSEA 1PJSA 1NN5A 1MTZA 2PH7A 1VB5A 5CM2Z 4EVRA 2YMMA 3AF6A 4RULA 4G9EA 2P79A 3B9PA 3KT8A 1QP4A 3B82A 1MIHA 2RSLA 4YRPA 2G4CA 4RKRA 1VZ2A 2XR1A 3DEFA 2J3QA 3BMQA 3GW8A 3H1BA 1PS9A 3NHRA 4UTXA 2PNFA 3PSAA 5PGMA 4X8OA 4ARBA 5JAOA 1E3MA 1Z7YA 4PFJA 3T4PA 1AO0A 3CV3A 3L82B 4C21A 2DAPA 5HCIA 5DMXA 2X6QA 1I7PA 1KQOA 4FDLA 4G1BA 3UBMA 1B2LA 4Y1GA 3VYUB 3DBLA 1QRUA 2OC4A 4TKUB 1DO0A 3A3NA 3H04A 3OU2A 4TTAA 3K7EA 4QPCA 1AD2A 3A27A 3PWTA 2C2MA 4X64B 1WMEA 3CXUA 3NKFA 4GL4A 2Q29A 3ISJA 1BS2A 2D0DA 3MILA 3AR3A 4F2HA 3DM5A 5LMNB 4MGIR 5I5GA 1BE6A 4HDNB 2CYAA 1GFWA 5D3QA 3I6QA 3I58A 4ZQEA 2JB9A 1OILA 4I50A 1JEQB 1YRLA 3LNCA 3MF4A 1E9VA 3JATB 3LBYA 4GZMA