3K4PA

Aspergillus niger phytase
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
438
structure length
438
Chain Sequence
SCDTVDQGYQCFSETSHLWGQYAPFFSLANESVISPEVPAGCRVTFAQVLSRHGARYPTDSKGKKYSALIEEIQQNATTFDGKYAFLKTYNYSLGADDLTPFGEQELVNSGIKFYQRYESLTRNIVPFIRSSGSSRVIASGKKFIEGFQSTKLKDPRAQPGQSSPKIDVVISEASSSNNTLDPGTCTVFEDSELADTVEANFTATFVPSIRQRLENDLSGVTLTDTEVTYLMDMCSFDTISTSTVDTKLSPFCDLFTHDEWINYDYLQSLKKYYGHGAGNPLGPTQGVGYANELIARLTHSPVHDDTSSNHTLDSSPATFPLNSTLYADFSHDNGIISILFALGLYNGTKPLSTTTVENITQTDGFSSAWTVPFASRLYVEMMQCQAEQEPLVRVLVNDRVVPLHGCPVDALGRCTRDSFVRGLSFARSGGDWAECFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-phytase A
publication title The structure of Aspergillus niger phytase PhyA in complex with a phytate mimetic
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 151
structure length 438
sequence length 438
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3k4pA01
5AJYA 2HIAA 1DKMA 2P2ZA 1C7ZA 3IT3A 2EKZA 2P79A 2ENWA 4EO9A 1V37A 5CU7A 3ZHCA 2P77A 1FBTA 4GPZA 4IJ6A 4HBZA 1DKPA 4D4MA 1TIPA 1EBBA 3D4IA 1UJBA 2ENUA 5HR5A 3GW8A 2P6OA 3QPUA 2H0QA 3QPWA 5HTKA 2P9FA 3QPVA 3MBKA 4PZAA 2H4ZA 1ND6A 4IJ5A 2P2YA 3K4QA 5AJZA 4D4KA 2EOAA 2GFIA 3E9EA 1DKOA 2WNIA 3E9DA 3IT2A 3D6AA 2HHJA 3NFYA 1QHFA 5AK0A 2P78A 2RFLA 1BIFA 5AJXA 3IT0A 1DKNA 2BIFA 3EOZA 1CVIA 3NTLA 4D4JA 2YN2A 3MXOA 1E58A 3C7TA 2A9JA 2H4XA 3BIFA 1H2EA 2OWEA 1FZTA 3GP5A 2P30A 3K4PA 2H52A 3DB1A 3LG2A 5AJWA 1C81A 1H2FA 1SK9A 4TSRA 5CDHA 3FJYA 2WNHA 4D4LA 1ND5A 4JODA 3R7AA 3PGMA 1QFXA 1SKAA 1DKQA 4ARUA 2OWDA 3F2IA 1BQ3A 2A6PA 3LNTA 1C80A 1SKBA 1SK8A 4AROA 1RPAA 5PGMA 3FDZB 2DWPA 2HPAA 4PZ9A 2AXNA 3GP3A 3HJGA 4ARVA 4ARSA 1XQ9A 3D8HA 2EKBA 3OI7A 4MA4A 1IHPA 4PGMA 5AJVB 2IKQA 2WU0A 3DCYA 2P9YA 2P6MA 1UJCA 1BQ4A 2PA0A 4ODIA 3IT1A 1DKLA 2DWOA 3FDZA 4QIHA 4EMBA 2I1VB 3F3KA 2YN0A 2QNIA 3O0TA 5CX4A 1YFKA 1NT4A 3E9CA 4JOBA 1K6MA 3EZNA 2F90A 4FDTA 4FDUA 3KKKA 1RPTA 2P9ZA 1E59A 1T8PA 1QWOA 4E3WA 4GPIB 3LL4A 1YJXA 2P75A 1RIIA 1V7QA 4JOCA
chains in the Genus database with same CATH superfamily
1NE2A 3VA7A 1JBKA 1XDBA 2HIAA 2IHBA 3CPEA 2OO5A 3E7XA 4TWZA 3NHFA 4BCDA 3KKLA 2WT9A 4J3NA 1ZXBA 1QB8A 1Z8DA 2N42A 3FNFA 4KRYA 2IPOA 3R7WA 1GL6A 1KS2A 2H4HA 2QY9A 1JU9A 2BFFB 2PUBA 1NHWA 2XUDA 3COYA 2VCYA 3QPCA 2O48X 1CJBA 3HADA 4E1AA 4M46A 3UVEA 2BGNA 3HCEA 3LIIA 4CMGA 1FVHA 1LBEA 4I9UA 3DZJA 5B1YA 3CH5A 5A4JA 3GFQA 1V95A 4DR2B 1BAPA 4AKTA 1TNDA 2WE8A 3IOYA 4N5NA 3I09A 2AZXA 3BTUA 5D8DA 1YJQA 1J6UA 3O4GA 1KORA 5AXDA 3MBKA 1XDDA 2I3ZA 1FFCA 2F3SA 2XPCA 5JAZA 4UPDA 2J5BA 1E62A 5HQJA 3QIVA 4F93B 1CUUA 4WKOA 1QE3A 2OGUA 1Z26A 4IMPA 2Z09A 4KWEA 3NM6B 4CTJA 3M4JA 2HMUA 1SQ6A 2QYSA 5MN5A 2GJKA 1Q0HA 3FJOA 5DXFA 3HKBB 2ID9A 4CM4A 3V46A 1I1HA 4PPNA 1GCOA 4WH0A 3L46A 1E6LA 1EE2A 1FMLA 3ANYB 2ORWA 3QV2A 4PR0A 3CVJA 1NUQA 1T34A 4UHHA 3VKWA 1PLKA 1CB7A 4LJ5A 2BF7A 5A7HA 4CIYA 4DYVA 3VISA 2CVZA 2EP7A 2R8YA 1IB6A 3H3JA 3W4JA 4EHDA 4W1QA 5TQ2B 4GWKA 4ZCTA 2ATEA 2YWBA 3SY8A 4E2ZA 3HY4A 3GO4A 3ZDRA 2C2GA 5BMOA 2RI0A 2HH9A 1O94A 5FBQB 3RODA 1IC6A 2JC3A 4D3XA 5DTMA 2BEVB 1F4VA 3GA0A 1IATA 3T1HB 1XLTA 4TSRA 1X13A 2VP2A 2EJVA 3QKIA 3G0BA 1KI6B 1TM4E 4DDUA 1CE8A 1PG5A 2QG6A 3ACBA 1T2UA 2IF0A 4Q9LA 3W6PA 3WBFA 2XBMA 4INOA 2Y1LA 4OHMA 5I9LA 4RK1A 4ZYUA 1DWUA 3KVNA 4M0EA 1JS1X 3OVMA 4UEOA 5LUBA 4BKPA 1R4ZA 1OGIA 1Y8QA 3KJIA 3TD9A 3FDZB 4E5SA 3ESDA 1S4MA 3QMPA 4B09A 4C3UA 4BO5A 3H9CA 1TC2A 3WA7A 5BYBA 4XWTA 5A7GA 1H9CA 2VUSA 2ZYHA 1ZY2A 3R3HA 4EF4A 4EB0A 2BOVA 2QVXX 4LOIA 1TK9A 1FX1A 1E3EA 2O5VA 3LQ4A 2Q8PA 4KWTA 1ZH0A 3A9WA 3ONVA 3OPYA 2J4DA 3EFOA 3ND5A 2OCDA 4CQMD 4EYKA 5IN4A 3IYLW 3S7TA 2F1OA 4XDZA 4I4IA 3EE6A 1E1CB 2I1VB 4BGIA 3M5CA 3UMVA 2HDNB 1E7RA 3KCNA 2KWIA 2Y27A 3PRKE 4PSVA 3MF4A 2I80A 1PZFA 1R3UA 3H1AA 2V7PA 2V7QD 4FDTA 4NATA 1PNVA 3DFZA 4NNPA 2FN3A 4B71A 3PUJA 4MQLA 1TMKA 3IPRA 3WIBA 5AD1A 1YR8A 3F7TA 2O05A 3HZRA 2V7EA 2ECPA 1SCUA 4RA6A 3QWFA 5BN4A 4QEZA 3L4KA 1LVGA 1EHIA 2BEWA 3NCHA 1N5IA 1R0RE 4MWOA 3IVRA 2EKZA 2I2DA 1GAXA 2ENWA 1VYHA 3CUEF 3IGFA 4BX9A 1KGDA 1Q1ZA 4BKMA 3UAWA 3DFUA 1FUUA 2CVPA 3N86A 4HAOA 5DYYA 1A1VA 1R9GA 1LK7A 1W88A 2BKEA 1MOSA 4UE2A 2FR8C 3OFKA 2HQSA 3E6AA 4L2IB 2P4SA 3ZNOA 5HE9A 1NU6A 2YNMC 1DO0A 2VNSA 3BDIA 1J7KA 1D2AA 1TGYA 3QPUA 1CK4A 5EJAA 4CQMB 5CA1B 1Y8RB 2WABA 3TKAA 1ISPA 1PDOA 4IMIB 1WUTA 5AVJA 2Q1TA 5IAJA 3A28A 4IHJB 4RZQA 4PC3A 1SUSA 5EJ4A 4I9GA 4RVSA 4OPMA 4LQLA 3EVFA 1OZGA 4BX2A 1J9GA 1OOEA 2XUOA 1GTVA 2KMLA 2XX3A 3ASVA 3ET5A 3GLHB 4NENB 4E1VA 3CVUA 5T4FA 5JT1A 2ODPA 1AF4A 4IG4A 1Y7LA 4JXJA 4OH7A 5IUNC 2PJZA 1XWFA 2QXYA 3G88A 1RYYA 2JFHA 5IJWA 4YTEA 2ZI7A 4M22A 1JDBB 4HGRA 3V8PA 1PX0A 1HQCA 5IF3A 5DBFA 2HSDA 3IIEA 2TECE 3CWCA 4RTJA 4B87A 1N8KA 2QZPA 4R69A 1OXMA 2X2PA 4U4AA 2BHNA 5KJCA 2Q4EA 4PTYA 3DOEA 4ZVLA 5FI0B 3THRA 2ISQA 1J99A 1KQPA 2WKRA 2RGEA 2VP0A 4OFZA 2Z8ZA 1W5FA 3V3TA 1NUUA 1PJTA 2FW8A 4M7WA 4OFBA 3TTXA 4DAEA 2XQKA 3R3JA 1TEVA 3IP8A 4HRVA 2CJXA 4G4JA 1RRKA 4TQ9A 3TXXA 4CE6A 3DHVA 1EXDA 1P7CA 4D4LA 5KYXB 3OU6A 3DLAA 1NONA 3PJDA 4GMKA 4RKWA 2X2FA 4Y1EA 4BO0A 1SIBE 2AV6A 1OWPA 2PO7A 4FOSA 4TL7A 1VE3A 4OHRA 2ODTX 4BB9A 5BXQC 1ZVMA 3IXMA 2WYVA 5JWHA 2C9DA 4MQUA 4D9JA 4RVUA 1ZJYA 3GPBA 4CLOA 4OBXA 2QD3A 3OLVA 4NXNB 1XFAA 1ZCJA 4DIFA 4HLCA 4Q3EA 5FPTA 3U3KA 4EHKA 1QH8A 1ZM7A 3WMGA 1JAIA 4RVNA 4WDRA 4L15A 5IKPA 3ZZTA 2EKBA 4HGZA 2G88A 5EMLA 1RIFA 2QOEA 5REQB 2IEBA 4PIPA 1R4NB 4BO7A 1K7YA 1OWOA 5B30A 2A94A 4GPAA 1YA6A 1TZCA 1UUFA 3ZJTA 3PWSA 1L8LA 3ZIDA 2EYQA 3DTNA 2P65A 3ZDXB 1WVGA 2FN8A 2JGDA 2PV7A 1NYRA 2QGFA 1JPNA 3CRW1 3W78A 3UV3A 3KLOA 3D6HA 3OQ1A 4DSZA 4ZVQA 3BB4A 1S9DA 3FUCA 3HNRA 3WQQA 2JZOA 2GVDC 5D5QA 4Q4CA 4FNMA 2ATCA 1KDYA 3E8SA 3IAHA 4JAVC 3NRJA 3EXHB 1PSZA 4KG7A 1HYGA 5JNUA 1GNLA 1RLUA 1RWKA 3QSYA 4AG5A 2PQ0A 2IHVA 3LTEA 4J94A 2JFBA 1N5DA 5FOUA 1T1GA 2ZM5A 3DKPA 2WT4A 2Z4RA 1VL5A 1Y8CA 4EPTA 3MYRA 1T9DA 3P8ZA 1U65A 3AVOA 2JCSA 2ZRDA 3D6TB 3P2IA 3A9UA 5EIEA 3BRQA 3GVPA 1HZZC 4ZARA 4HMOA 3FDIA 3HB0A 3BH0A 2COUA 1YB1A 4XPIA 3I52A 4S0ZA 4XQ9A 1GNSA 1U28C 1WKCA 2XNJA 1EBBA 4OB6A 3A6LA 3LJKA 4P93A 1B4DA 2MYPA 1GN9A 4MPRA 1MCZA 3L05A 3M6LA 4I6JA 1EDBA 1VLZA 1RQNA 4KZPA 3T41A 5KO2A 3ZWYA 4G36A 3FRJA 1KEPA 3HV2A 1SH7A 1HDRA 3A4TA 1PTJA 3SC2B 3NBKA 3KFXA 3C5HA 3V00A 1RYFA 4BQFA 2UXBB 2HF2A 3JQQA 5K8UA 1EIWA 2JIRA 2O3TA 3PHGA 4X84A 3N6VA 3L49A 5EXSA 2P0EA 2Q6KA 4WKGA 3QXHA 5HIKA 3TTVA 4GP9A 3RO7A 1RKQA 1QTNA 1Z38A 1M6VB 3FNGA 4QQRA 3PJRA 3AVPA 3KHKA 5CX1B 2O2SA 1SIWA 3D4BA 2VHCA 3P0FA 3G13A 1Y3AA 2RC5A 4N82A 4Y9RA 5F5NA 1M2OB 3JTMA 2Z5FA 5AK4A 1QMPA 1LUAA 3W77A 1GXSB 2JFPA 3JPWA 2HCJB 2C9BA 3BEDA 5F1PA 4ZREA 2YN2A 5G1OA 5SYNA 4YBZA 1IMOA 1VKHA 2EJCA 4KHPB 1PT8A 4M89A 1L5GB 4ZU6X 2GAJA 2JANA 4ID9A 3A37A 3DZDA 4QG7A 5GGXA 3ZR4B 4DYDA 4ESEA 3MTBA 4G1VA 2JEYA 4B6RA 5SYAA 2Z1NA 4XXHA 4DG5A 2Q5HA 3GGCA 3TRFA 1HK7A 3PVCA 4RF2A 4LDZA 1FC0A 4GWGA 4TUYA 5HZGA 4YMVA 4TZKA 3DKIA 3FCEA 5EI5A 4BAUA 4N3NA 3AM4A 4TQAA 2RAPA 2K6GA 1KQNA 1QAOA 1EINA 3A6HA 2PUHA 4NCHA 1X9HA 2AFRA 3R5FA 2V55B 1PFGA 2GVZC 3EWAA 2WJHA 5JDIC 4JFRA 3FHLA 4L9RA 2F3PA 2AQKA 2DMRA 4RJIA 4DSAA 4KDEA 3V1MA 2CMHA 4ZJYA 1TVKB 1RABA 1PK8A 3B6MA 2V6JA 3JWPA 4G5GA 1N0VC 1PUJA 3AEXA 3KKOA 1Y42X 3VR2D 4EAQA 1D4OA 1N7JA 1FX0A 2R9VA 3CPHA 1G8SA 2XUQA 2W2PA 3OPYI 1EQ2A 2N1BA 4C7MA 4D9IA 2C98A 1BWPA 3PXUA 4PHGA 2P6MA 3ANLA 4FGJA 3THYB 4G24A 4UM5A 1KVTA 3E3OA 1SBTA 5EY5B 4GFDA 3CLTD 5GQSA 4QELA 4IXNA 3IB6A 4CKBA 2CV1A 2C77A 2R5FA 1IU9A 2B9VA 5LR6A 2BFAA 2D59A 2O1WA 4N47A 5B6PA 3AMVA 2QJTA 4WFKA 3JATB 1DMSA 3T52A 3T54A 4F3NA 1GNQA 1VRCA 1YFZA 3EXIB 4M38A 5B4VA 2E6UX 3CGGA 3D4NA 1ECBA 5JZOA 1V1MA 2AG0A 3N6XA 1TJ4A 5BQXA 2O7RA 4IF6A 5ALQA 3U26A 5HZMA 3COVA 1I2BA 1R0XA 1HORA 3S27A 4HNAB 1FYVA 1R5JA 1E2IA 2OZLB 2WK1A 2UUAB 1KZYC 3BHIA 4GVXA 2IVFA 2QQ0A 4IS3A 2ERXA 5FP0A 1OVGA 3UB4A 4QE3A 1VIDA 4AO6A 2NVUB 3EIQA 1PR3A 3N58A 4DV1B 1USKA 1Z0JA 5JVDA 3PE6A 5E4JA 2WHRA 3VDRA 1XEWX 3B2NA 5CHEA 3JYQA 4N3CA 2HJVA 1JQBA 3UXMA 3T3OA 3GOHA 4NWIA 3HY6A 2AN9A 3M6UA 3I2GA 2J67A 1G6OA 4OI1A 4RULA 2DKOA 1I30A 2IU4A 1GQFA 3UA4A 4A36A 1QDUA 3GZ4A 3I23A 3UG6A 3FOCA 4OBEA 2WA1A 5BXYA 1PZGA 1RKUA 2V5AA 4AN4A 3SZGA 3CB2A 1B16A 4W9RA 1P31A 4EPRA 4J0HA 3OECA 1C0KA 1UCFA 2XOKD 2XRZA 3TW0A 3WGJA 5DK4A 3VYWA 4JWTA 4KPFC 4G0XA 4ZQHA 1C7JA 3P9KA 2O5EA 3EGVA 2IE8A 2VJMB 3JVIA 2IPNA 1ILEA 2J7KA 4JI8B 1JZSA 2XVYA 2RJNA 1XRPA 3ZXYA 1Z7GA 1BG6A 1GRVA 2YMLA 3I5AA 2VH1A 1XTKA 2XF8A 2PNJA 2A9RA 4JJZA 1MPXA 3RSZA 4LOJA 4GZ3A 3G23A 1CS4C 3EGDA 4ZT4A 4DCOA 3P7MA 3DBHA 1EVQA 3I2JA 4ZOBA 1WO8A 2X0EA 3H5OA 4KFSA 1JDTA 3GJ5A 3OLZA 1V2GA 5CIYA 4J49A 1QVVA 2SKEA 4FFNA 3LG2A 2WUFA 4I4CA 3ZWDA 4C0WA 4OQXA 1JIKA 3RRBA 2Z9DA 3ZV7A 3KSZO 5K5EA 2YOHA 2CXTA 4EUEA 4QGHA 1NVAA 3LW7A 2PJDA 4OHWA 1JQKA 5AW5A 3FF1A 2ECOA 5TY0A 4B3XA 2HN9A 3WNVA 3ZHTA 5GM2A 4C4ZA 4DJAA 2V97A 5DRTA 3TS1A 1TPZA 3MCZA 5AKXA 1Q44A 2Q1YA 2Q8QA 4N0MA 3KZKA 2JLYA 1MO2A 4DPMA 4BXOB 2VWHA 1E2FA 4TWAA 1ZQ1A 3OQIB 5DM1A 5DO9A 5E1BA 5BN3A 5JDCA 3A6FA 4MP8A 1AGXA 1BA3A 3H4TA 2FJPA 4NSNA 5KAPA 5JUWA 1P1HA 1FDRA 2ZCVA 2J9ZB 1E0AA 1DUVG 2IIVA 4RZXA 3W5CA 1IMJA 1H65A 4S1WA 2R2AA 3NX4A 2VJCA 3FSJX 4AQYB 3GHYA 4DJTA 2JLRA 1K9VF 3IALA 2ZR9A 3EZ9A 3I73A 4Z6KA 2O8BA 5ADWA 2CMFA 2OP1A 3SP1A 4IQ8A 4OP1A 4YROA 2IPXA 2XMGA 2EF0A 3OTIA 3Q40A 5IAOA 3S5JA 1A1SA 3RJTA 1X70A 5KWVA 1WZUA 2AX4A 3SEAA 2QAGB 1CLEA 3RIYA 3S2EA 3WOVA 2BR3A 2C8LA 1NTOA 4RGQA 4R7GA 5L3ZA 2LV8A 5FUVA 1M9NA 4QASA 2VSQA 3D6FA 5BNTA 5K20A 1Q83A 2B20A 3CRZA 2I4LA 3MAGA 4YMSA 3ICVA 5LP1A 3R0IA 3L18A 3GXBA 4PQFA 4BZQA 3QE2A 2NTNA 3JU3A 5CVEA 1J0CA 3QELB 5AJUA 2MSWA 4IOMA 2E4YA 1KVRA 3OLYA 1IEWA 4JIMA 2I22A 4LI0A 2WHYA 3JQ6A 721PA 3HY3A 6CHYA 2CCKA 2CJWA 3KYCA 4TMZA 2H00A 3RC2A 5ARCA 1OT5A 3FPBA 1OB5A 3S29A 1TRHA 2XCLA 1YZUA 2WWWA 4B3BA 3CUKA 1QYCA 1E1MA 4EX7A 3GJRA 5TX7A 2OCGA 5LU9A 3I9FA 1HDZA 1TIPA 5HBGA 3WWYA 4DDKA 1Y1SA 1M34E 3F3MA 1PFKA 5T8KC 1OC4A 2Q5LA 2VAXA 4G41A 4KJZA 3R40A 3K9GA 4MYHA 2R86A 3IJPA 4NESA 1UBHS 3ZE0B 4WD3A 4D02A 4D3FA 2CVFA 3E9ZA 1JSLA 2EZUA 3JVUA 3LKZA 3ZYZA 4ARZB 3SYMA 1OKKD 1FRNA 3GRYA 1E7QA 1DE0A 1SHUX 3WDMA 1BCRA 3RYIB 1KDOA 1J0DA 1Z35A 1Q0PA 3Q0IA 2XB2A 1YBVA 1SCNE 2SBTA 2X0DA 3AV0B 3N2GB 5DM0A 5G0VA 3AVXA 2GK4A 5JQGB 3R9XA 3UWOA 1F9AA 1T25A 1H42A 1T2VA 1WCXA 1ST2A 2GEDA 2WPNA 1L4UA 2OPHA 4DMMA 1E7YA 1GWNA 3QE3A 1C4XA 4KNYA 3W5HA 2NVBA 3NYRA 5C3UA 4L0QA 4IKOA 5E38A 5IC4A 4BNKA 4M8IA 3L1HA 1FRQA 3C4JA 3AR9A 2V7TA 1HDXA 1OT3A 5IP5A 1S3SA 3CXUA 1J09A 1DT5A 3JRWA 3L5OA 4XUGB 2XMRA 4J9VA 4OLJA 4TWIA 5DNWA 4HAWA 1PU2A 3GDFA 2HWWA 4YT4A 2A9JA 3H2KA 3PQFA 5EYPA 4ER3A 5IZCC 5LYYA 2WFMA 4KGDA 3BGVA 3TPFA 1WMEA 3IH5A 4RY2A 1VJ1A 5GJCA 4BWFB 1PN3A 2JH3A 4PZYA 2GNAA 1EFVB 5DI3B 4IL5A 1H2FA 5A2QA 2NMVA 3D2LA 4X3CA 3GT0A 3SKVA 2EV9A 3G5TA 3RHFA 1U9JA 3IODA 4MUYA 4QGBA 1CUIA 3WB0A 3UK1A 5LMNB 2PSEA 1KMQA 3R6WA 3H7IA 4P5PA 2IBTA 2GHRA 1G291 2XIJA 4XFJA 2QLNA 4MKZA 1CW2B 1J8YF 3W3AD 1JEYB 1MEJA 5LYJF 2XDYA 1LSJA 5KKCA 2Y3IA 1TL7C 3H05A 3H11B 4QPPA 4N9QA 3COSA 5BORA 4B75A 5JEDA 1V71A 3ONEA 4N3AA 2A7XA 3L82B 2AF4C 2IZ5A 5FKJA 4RHCA 4JJIA 2ZRCA 2ZGVA 3AP2A 5C46F 3H2SA 2ETVA 1Z0AA 3LCCA 3RUAA 5KKNB 1TECE 4RFVA 1X3SA 4XJVA 1LA2A 2IZZA 1LKZA 3HGQA 3PFHA 1SVNA 4DLKA 3C74A 2R6JA 2NU8B 3LBYA 2A14A 2JLCA 3OWOA 2B98A 4NAHA 1CDZA 5CURA 4ZVTA 3RTGA 1NVDA 1FSFA 3OF5A 2JFFA 3G8DA 4LBVA 5A0TA 4I55F 1NASA 4QEDA 4ZAGA 1LQUA 4EFMA 1P0FA 3NDIA 3REFA 3P2OA 5J2TB 5F12A 4W82A 4Z53A 1DL5A 1PG2A 2X86A 1JKXA 1C7RA 4U1RA 4V0NA 5CT8A 4US1R 2JIPA 4MKFA 1AUXA 3ESBA 3Q5DA 3BIOA 3NWBA 1RWOA 2BELA 4MYDA 3WAKA 4GNKA 3R3UA 3RTBA 3CZMA 3I04A 4HGOA 1YF3A 1UDBA 3ENKA 3IO5A 5C32A 3QNMA 3T9EA 1SHJA 4AZ3B 5BMVF 4EO9A 1VPVA 1UC9A 3DFIA 5HFJA 4UCFA 1CUDA 1N5JA 1YRQA 1Z0ZA 2JRLA 1ZH8A 4M87A 2J8ZA 2IYAA 2QEQA 3OSUA 1ULUA 3I53A 5FPPA 2ID4A 4ZCIA 3AI7A 4MGHA 5CNKA 5TT0A 2WC1A 1VP9A 1U8EA 2YYYA 4HDQB 4J7AA 3TNYA 3AESA 2YW9A 1J00A 1GZ7A 3VR3D 3GLGB 1E7MA 2DQYA 3HJNA 4GP6A 2FPKA 4NHEA 1H6CA 1YZTA 2C04A 5HOEA 3PNQA 2PE5A 4FWBA 4MAAA 2GTHA 3E8XA 2ZUBA 3L8YA 3FYDA 4IZ6A 4DNQA 4XJXA 2WF8A 3NP9A 4UTNA 4M0DA 2DR0A 3D3WA 3K4QA 1KJWA 5J40A 1P72A 1LW6E 4DZTA 4GDFA 2OILA 3IOEA 4EHIA 3OZBA 2QMOA 2P4UA 1RTTA 1L5QA 3C3JA 1L4HA 2PLNA 3GN1A 3Q4GA 3WS7A 3VPAA 2HHJA 3HU5A 2FDRA 1EWVA 1YQ9A 4HDSA 4YA6A 1Z2NX 4XVHA 1Z6YA 1G2OA 3QOFA 4L72A 4NV1A 2YKGA 1PL0A 1RKBA 4ZJZA 1W7AA 3DWFA 1JV2B 4BKOA 1KOJA 1XRNA 4EPYA 4A73A 4JI4B 1ECCA 1BDMA 1OBHA 3KQHA 2DFTA 3FDFA 3K8YA 3F47A 1QO0A 1RI1A 3SQOA 5C81A 5C7YA 4RL6A 2ODWA 1JEQB 1P7YA 1KH1A 4BNJA 4JLNA 1G6Q1 7MDHA 2R66A 1W4LA 2XE7A 4J16A 2A5LA 3HJCA 5LLDA 1K92A 1Q7BA 1YK0A 2YBEA 4DV0B 2FEPA 3Q7RA 3OF3A 3VNBA 2JVJA 5JHHB 2X7XA 5P21A 4EITA 3EEBA 1S2DA 4GOLD 4M9RA 5JG7A 1ZMXA 3V33A 2XRFA 4B2IA 1C50A 3E27A 3FM9A 1O4WA 1P1BA 3KQKA 4D4GA 1ISFA 4OGWA 1PYOA 1ZI9A 4PYJA 5A3VA 2P1ZA 3CX4A 2YRXA 4X20A 3GELA 1PZHA 3K15A 1AC5A 1EDOA 3OC0A 4QPNA 3JD1A 3ZCSA 1QVWA 3EBPA 4TRMA 3AERA 4ZICA 3GP3A 2N9UA 3C41J 3GUCA 4GX1A 3IQEA 1CZLA 2QW1A 1GKUB 2P5SA 3C3BA 1SU4A 3NT2A 4HWTA 4MJ7A 4DA9A 2ZWAA 1KQFA 2P4EA 1LNQA 4Q9JA 1N33B 1CIPA 4ARIA 4BNXA 3MS2A 4H7IA 2R8EA 3FROA 2F55A 2HIHA 3TZHA 3RIEA 5CT9A 1V8PA 3SBXA 2PUWA 3C39A 3I04M 3FX2A 4BS9A 1DU4A 1UXIA 3DBRA 1K6IA 5CLHA 2QBYB 3DW1X 3FOZA 2HNBA 2QG4A 1H0KA 4XM0A 5LJIA 5JS6A 3QI7A 2IV2X 3T15A 1O5OA 1ORWA 1AV6A 1HLFA 4E3WA 3I4CA 2DFVA 1FXUA 1H4TA 3WC4A 1G1AA 2FLKA 3WAGA 4MRMA 2GF0A 2YWRA 2WILA 1JHRA 5JFTA 4ONEA 4PAOA 5HUJA 4X95A 2XTMA 1SQGA 2P9JA 1M33A 4JLKA 1IEVA 3IDZA 3PNYA 1XC7A 5LXTA 1HL3A 1IY9A 1P1IA 3TEMA 1VIYA 3IB3A 4KI0A 5EWLB 2Y68A 4P82A 3B2EA 4QTTB 1PJ2A 2DR2A 2O3QA 2VWQA 1NXVA 2HOQA 1OBFO 3DHNA 1TAGA 2GSDA 3CSUA 5GJWC 4NKRA 3UHPA 2D7CA 4YJFA 2QZZA 3E03A 4C4TA 3FE2A 3PIRA 2NO1A 3D8RA 2VT6A 4KYTA 2XDQA 3ZHVA 4BO4A 2VA8A 1ESMA 3GRKA 4WRRA 3PPWA 4WOPA 5IH7A 3T4PA 2XB8A 2Z57A 4DWWA 4F91B 1E9RA 2TRSB 4DGSA 3U61B 1YVEI 1X9IA 2H1FA 1C3JA 3UFXA 1YQEA 1VLVA 1D07A 3A4NA 3V34A 1G3MA 5CEFA 5LQNA 1VLLA 1TAHA 4F6RA 4RVDA 3LPMA 4B3FX 1O7JA 1OTYA 3MWDB 2NPFA 1LFAA 3NR2A 4WA7A 4DIEA 1GSOA 1YRBA 4D6YA 3K92A 2FMKA 5AK0A 4Z1MA 2YXLA 3H19A 4JBIA 1NYTA 1OAOC 2G07A 4OB7A 3QFSA 2CWWA 4MGEA 4V0RA 1TMOA 1NVBA 4ZOLB 1BDHA 2H07A 4EB3A 4DIOA 3Q72A 4G5QA 4NZOA 2J0SA 1U2TA 4M0KA 2ZOSA 4IXTA 4TV8F 3T1NA 2DTEA 3ZLVA 4O3MA 1GYPA 1UJMA 2BUBA 2GJAA 1FNBA 4FYXA 4M8KA 5ES4B 5A1TA 4RA9B 5A62A 1XZKA 4X1YB 1P45A 3EW7A 4R0NA 4N8SA 1FDVA 4QOSA 1AZSC 4R9VA 3ZZ0A 1PL8A 4EAAA 3BS4A 4HSGA 3DEIA 4IY1A 3NJ8A 3RS0A 2QTFA 2CY0A 2Q5OA 2QR5A 1YL7A 1J0EA 3C3MA 3OFND 4MV9A 3DQQA 1HDEA 4XOUA 2O9JA 2WMNB 2W8BB 5BPFA 5IVKA 3TFWA 3KXDA 2FMXA 1VYUA 4WINA 5AW8A 2QUIA 3N05A 2OKCA 4K05A 4P7GA 2O2CA 4P83A 4UARA 3BGIA 1I24A 2LNDA 2QP9X 1DELA 4D74A 1KEVA 1SMKA 3P96A 3EIEA 3PENA 3TJMA 3ZDCA 1UKZA 5CYFA 4HVAA 4IIBA 3QJ5A 3FMGA 1HLGA 2ZIVB 1P29A 2XQFA 3P9RA 4M4SA 2XMPA 4RFSA 5C4GB 1U8UA 1U98A 3T5DA 4EQZA 2WF7A 5LP6C 3FHJA 5E7MA 4DV3B 2IOFK 1NULA 4YWJA 4L74A 2ZRIA 3UIEA 3OUTA 1H2HA 2REBA 1RZUA 4M8NE 4NV3A 3OCXA 3SJUA 4AD8A 2N47A 1DRUA 4PRKA 1NW4A 3JAMA 1FJXA 2QI9F 2VHXA 2OGZA 1YZLA 2JLSA 2X7JA 3DBVO 3FRHA 1IUPA 1UFOA 3R7SA 3GZJA 1RC0A 5JASA 4PSAA 1F8UA 2WHQA 3NHRA 2YMMA 1IVNA 4AWBA 1T3ZA 3QG1A 4AYXA 4DMLA 4YXWD 2GXAA 5IC6A 1O96B 2PL1A 1GGKA 4ZK2A 3I5YA 4KEAA 1UAAA 1JAYA 2HV9A 1IZZA 1BGWA 5FBWB 1UOEA 1U0FA 5FQOA 3DP7A 1R2QA 3DLIA 1K89A 3WLSA 1GZSA 2ZSIA 2IV3A 3T4XA 2ZRLA 1QFSA 1CTQA 3STVA 4DV7B 4JEMA 3L41A 2AZDA 1BMDA 1I6MA 3AP1A 3EH2A 3SR3A 1V9SA 2PLFA 2Q6OA 3KB8A 4GOND 4QBGB 5E4FA 1SY7A 4D8YA 4FSDA 2ZT6A 4YJKA 1L1FA 1EJ6A 2QRPA 1KNXA 5JRDS 2IK8A 1AA6A 1XB2A 1FLDA 1XRJA 4CFSA 2IL1A 5E3HA 3ADBA 3HLKA 4RK5A 4B8WA 4DLAA 1PWHA 1A9PA 2VDLB 4Y2JA 2P2GA 3SHVA 3SSNA 1N2CE 2FG7C 4QL3A 5JYEA 2OQIA 4ERXA 5FBHA 3V48A 3STWA 2K7FA 1CUSA 4B4VA 4FGZA 3HK2A 3GEMA 3BC1A 1FLVA 3WL4A 1YR6A 2BZSA 2FWMX 1LWNA 1YQDA 2Y6VA 3S68A 4D8UA 3HEAA 1Q0LA 5HNKA 4UUPA 1HYQA 1N3IA 1K8RA 3OZFA 1H1TA 2E4ZA 1ESNA 2DQ4A 4L85A 4PXAA 1HE4A 3UJCA 1BXKA 4ENQA 2GBLA 5BN5A 4I81A 4C7OB 5I4KA 2NQ8A 4Y6QA 3RAPR 3LFHA 4JKYA 2CGEA 1FU7A 6Q21A 3NPMA 1XTVA 2DGDA 3NAZA 5IDYA 5U9CA 3AVYA 2NU7A 3LT2A 1Q1BA 1AQLA 1VLJA 3VHRA 1EZ1A 4G89A 3V2IA 2HREA 2PR2A 3AJRA 3E05A 1D2HA 4L16A 2EWWA 1R9MA 3VSDA 4EYOA 4C2UA 3IXLA 1L7AA 5EUMA 4ER5A 1AB5A 8ABPA 4D2IA 1MABA 1X7XA 2D0OB 3LXXA 5D84A 3ZHRA 3JD2A 2QRQA 3DQZA 5EIBD 4YC7A 4YALA 4FMCB 3FJYA 4WBNF 4PG4A 4XJTA 3EPPA 4WKPA 5LQRA 3ZWPA 2V7UA 3UMCA 1EVLA 1V7CA 2PZMA 2ACKA 1Z6QA 3QNUA 1C3LA 3PFBA 3B5JA 5DLYA 1H3FA 4EKDA 4AJ2A 1D8AA 2FFRA 4W9MC 4J75A 4EP1A 4H7HA 3ES9A 1NQUA 4KPUB 3WGIA 2BAGA 1RT9A 1CSEE 2A4KA 1T9HA 16PKA 1EQAA 5DTRA 1CCWA 2QRVA 2OMKA 2XF2A 1U1DA 1X8KA 2AB0A 4MPTA 1BA2A 4X94A 2J3LA 4WGFA 2RHHA 1LK5A 1XLWA 2YJ5A 3E2IA 1W94A 2W2LD 2BE7A 1UP6A 1Y7IA 1VCMA 2VXCA 3DVSX 4RD3A 3D8NA 3W8NA 3KPJA 3STTA 1PFQA 4LHWA 4UUOA 3HQ4O 3PIIA 4GGMX 7GPBA 1G8KA 3CT6A 3AKEA 1N0HA 3CG4A 2HBYA 1TQ4A 3H8JA 3QLVA 5K0FA 3OD1A 1M2NA 1PJQA 1OJ7A 1MBZA 1QK5A 1IN4A 2QUKA 4GXQA 2F43B 4JC8A 1NW6A 5FUMA 3AHJA 3MWYW 1SHKA 1YCGA 1O97D 4B2PA 5KQMA 3T5CA 1G8PA 4K6OA 2WV7A 2IHYA 3FR8A 2HSEA 4K03A 1SKQA 3BD8A 3ZV5A 5ALTA 3LPDA 4K81B 2O54A 1HX7A 2B1GA 3U17A 4UREA 4QT0A 3OQ6A 1II0A 3P19A 2AG5A 4DMKA 1UDRA 2YC2C 3AM3A 4W9NC 2JI9A 4KAXA 5LBUA 3CBGA 5FNVB 1K0UA 3TQOA 5GOTA 4UBOA 4BV9A 4EOGA 4TV9F 1WDKA 4WY5A 1QP4A 4U2FA 2X0JA 3NKVA 1M1NA 3E5NA 1CULC 1R8SA 3AEYA 3CIFA 4M1TA 3AU8A 2OLEA 4ZCQA 3B7GA 2JJ1A 3ETHA 3R5JA 4L95C 3M81A 3D7RA 1TIKA 1U6JA 3QWIA 4OHZA 3WL6A 2B1RA 1G7TA 5A5VA 4CIXA 3KSMA 5DCYA 3PHIA 4R8MA 3QVMA 2VWPA 4NEQA 3GFTA 3F97A 3T3DA 5G0TA 2I6QA 3N07A 4WNAA 4C7BA 2CYCA 2NVWA 1LZLA 3EMBA 3DMDA 1QIEA 2H18A 5H83A 3DDWA 5FULA 2ANBA 2WHPA 2IDZA 4GM1A 1GPMA 2BYTA 1AUPA 3OKCA 3G2NA 3OO1A 3IIJA 5DM4A 1JB1A 2BIFA 1IQRA 4DA7A 5FAKA 3UPUA 4MYTA 1NY5A 2YHUA 4GR5A 4OGLA 4U2BA 2Q4TA 4GVLA 1OX6A 3M89A 4M1SA 5ALJA 4FSXA 2XT9A 3WX0A 1ZZEA 1KZ9A 2OP0A 1QG0A 4QNNA 4DYHA 4OHBA 1M73E 5ALHA 2VPTA 2C31A 3MJTA 1NPTO 1OFGA 2X5XA 2VP6A 3ORFA 3P27A 4U7GA 4UVHA 1X74A 4DLVA 1HEYA 2ZYTX 1TKAA 2ZBGA 3DAHA 1A9OA 1IQ0A 2P68A 1ZOLA 2O8CA 1U2PA 1T4BA 1EVIA 2I1WA 5AKYA 3FMOB 5EHGA 1YIOA 3BIJA 4KLRA 4A0SA 5I45A 5LZ4A 1X80B 3LD9A 121PA 2P9TA 3M33A 1XZCA 2FWRA 3B20A 4RVFA 1ZJ6A 3OPYB 3CUYA 3VTZA 5JI3E 2OV2A 1J25A 1Y7PA 1RXWA 3EEQA 1JYSA 1SVOA 5HZHA 3B1YA 4PSUA 4FEAA 1Q3TA 1JVNA 1S02A 1QSGA 1PR9A 3EVCA 5HJ5A 4LZZA 1N77A 4Y2HA 2W8ZA 2G9ZA 4BVBA 1L5HB 5LQSA 5EKDA 5BQ5A 3C0KA 3NDRA 5EHZA 4TT8A 2HB6A 2ZJ0A 3FIJA 2FY8A 4J91A 4GGOA 4GOOD 5A3JA 3OCUA 1UJ5A 2Q3HA 2JK1A 3QXCA 2RGXA 3ENZA 4OK5A 3QVLA 3UW1A 4C0JA 5A1JA 3SHTA 5JXJA 4EHFA 1M2JA 1A4UA 2W6JD 4B6OA 4NCIA 1SCUB 1Y1LA 3FNBA 5BN4B 1UBGA 3L8HA 4XB1A 4DADA 1SXJE 5ABPA 2YV4A 3E9CA 4K40A 1BMTA 1TM2A 3ZCPA 2FH5B 3TVDA 1AN0A 2G72A 1GRRA 1KS9A 3ITEA 4G3XA 5JAIA 1URPA 1XQVA 1W88B 4AKIA 1IJKA 4RKQA 4QZVA 2RHLA 1L5LA 2EEPA 2FRVA 1VPDA 4XRRA 1GLGA 2P8JA 2J3HA 3IP9A 4LC1A 4QT4A 1QPZA 4UTPA 1RQGA 1G60A 2ZUDA 2C2ZA 4MUFA 4H3HB 4X6UA 3TLMA 2FRDA 1H9AA 1NAHA 2P79A 4ZVMA 2OCLA 4FYVA 3GGDA 3CF2A 1YOVB 2W6ZA 2IOFA 3P45A 1SELA 3IDSA 4L73A 4E46A 1ZOOA 2ZRJA 1P2DA 1LDGA 1V1RA 4FFBA 4KUGA 3ZLJA 2IZ6A 3W1VA 1TXGA 3EULA 1M2EA 2SNIE 3OIUA 3R4CA 4QJ4A 3MYYA 2PT7A 3Q6MA 4BV8A 4BGEA 3KUKA 2VRWA 1NVTA 2HWUA 2CEKA 4CN8A 4ZFNA 1D2NA 1TCAA 2NV2B 1A5BB 3X43A 3FRIA 1OXUA 2F8TA 1HLPA 2D0IA 4C88A 2NXWA 1J90A 1ZK1A 5D6OA 4JEIA 2OXIA 1LGYA 1DIAA 1QK4A 3TR5A 5F2NA 3TQSA 3E5HA 1I36A 3QKTA 4G85A 4ILKA 5D6NA 1EWYA 5DI9A 1DSSG 4JELA 1NDHA 1EFDN 3JALB 2ZJ5A 1R8YA 3JWJA 3SR4A 2XUHA 4R31A 5G0WA 4FE4A 3GDOA 3QWAA 2WJYA 4MQ6A 3MAJA 2BFOA 4QYIB 2HCBA 1JLHA 1MFPA 3RVRA 1JH8A 4MNTA 1GL7A 2MJLA 3FYSA 4GWLA 2O0HA 3VNQA 4TRRA 2ILVA 1Y6JA 1YB4A 3OZVA 1O5IA 1PT9A 4MINA 3WLIA 5A5EA 1SXPA 4TM8A 2RIRA 3D4OA 3PEFA 1EM6A 2NSHA 4MUJA 4PAWA 2JKVA 5TGDA 3OJFA 4CUJA 4E5DA 3WL8A 2O8EA 4XFKA 1KI3A 3SE0A 1WA5A 4AY5A 3RANA 1N57A 2O6HA 3LWBA 3RAJA 1XNJA 2C2YA 1Q7GA 3ZGNA 2ZKLA 4D98A 3ZD7A 1QU3A 2XDAA 3DJYA 3NIWA 3G7NA 5K0EA 2FSUA 4CLOB 2HCTA 4NZ9A 4FR5A 4EW3A 5C8YA 3SR0A 3PQCA 2VH2A 1QH8B 3BTSA 3PTAA 4O1IA 3QKSB 1I1QB 1ZW1A 2P2LA 1SXQA 1U7DA 1SHLA 4FYJA 3WP0A 4N49A 4XAQA 2Y1XA 3TL3A 3V42A 1J23A 3PGJA 4OQEA 1RJWA 1CJMA 3N76A 3BUSA 3NHUA 4OJQA 4UKDA 5FEUA 4ZA2A 3BA6A 5JISA 3KE9A 5C7LO 4D9KA 3FTEA 1CUAA 1R16A 1XA4A 2PZEA 4GKKB 1I7DA 3Q1KA 5EP1A 4ES6A 5IJ0A 1DNPA 4H31A 4CG0A 2XE8A 4BGVA 1SM4A 4FK8A 4JNCA 4D9CA 3DPSA 1K2WA 1VKJA 3O8RA 1G3RA 4XVCA 1II8A 4MKIA 3I76A 4PEVA 4N8EA 2ZT7A 3BFVA 5FJIA 2JGAA 5LVAA 3OUUA 1GQ2A 4LZOA 2QNIA 3FR7A 3D7KA 3TSYA 3AL2A 4GYKA 4HBGA 1M34B 4IVPA 3H99A 3Q3JB 1SPBS 4MO9A 2HY7A 1KI8A 3GCZA 3MWFA 4FDAA 4WQMA 3BQMB 1WF3A 4NCKA 5CLLA 3U4GA 1AO0A 3NH9A 1J4AA 1V8DA 2LBPA 3FFTA 4X1OA 3ZWAA 1NRJB 5A4MS 1MOQA 2KE5A 1KEKA 2BFEB 3LLUA 1XVUA 3BJMA 2UZ0A 3P0HA 1CUCA 3PDIA 4XPIB 3T7RA 1UWVA 4XD2A 3RVPA 4FP9A 1CF9A 1WHSA 3NHLA 2ZATA 1M0TA 2QV0A 1DMRA 5M2QA 5C52B 4YPVA 2IYSA 1PDVA 1T8UA 1AMOA 4Q3DA 5K2MA 2VYNA 2ZJ2A 3O8CA 4UU8A 3ZVLA 1SBZA 1TD1A 4L8LA 2II6A 4BWGA 1RSZA 5CMLA 1WPQA 3FHTA 4Z0PA 1T9KA 3WYNA 2Q1UA 2VJBA 1U3CA 1H1DA 4RTLA 2E7ZA 5BSVA 3ANXA 1OH6A 2OORA 3KEMA 1TF2A 4NMHA 2J45A 4FN5A 1P2FA 3K6KA 4MB6A 4X8OA 2PMFA 2VJKA 4ZVOA 4DDTA 4KRFA 3JXEA 1Y1KE 4DRZA 2E1PA 4FYMA 1L4LA 2HRRA 4IJWA 1XXHA 1W6RA 1M8KA 3GLFA 5HQ3B 2WB2A 3S40A 3LCVB 2HK8A 2KI5A 4GHWA 2PQ2A 4XA8A 3I34X 1TJNA 4RVCA 4IILA 4BQIA 2IP4A 4R8LA 2RFLA 3TN7A 1E94E 5IYZA 3K70C 1T3LA 4JYZA 4C89A 2VBFA 3D7SA 3JR7A 2MINA 4G0PA 2QSJA 5BPHA 2C5LA 4L0DA 1NVVQ 1VI2A 2FCRA 2IU3A 3DQPA 1JXOA 5EKTA 5I01A 2HBZA 3WIOA 4BO6A 1E2HA 3LPAA 3IVAA 4Y7CA 5DLPA 4M7OA 4E22A 5BWBA 3WQSB 4IGAA 1YHZA 4B6GA 1HSZA 1V6SA 2ZITA 5CXXA 3ZJVA 2ZRMA 1EUYA 2GO1A 3T9BA 4ESVA 2IODA 3DEYX 4XGKA 1P4JA 3GJ7A 1MA3A 5EESA 2C42A 4ALKA 1MTOA 2G09A 3BA1A 1HBJA 1NDQA 2PCLA 5ALZA 4RDXA 4KL8S 2GM3A 4C7VA 4F6CA 1FDTA 2WA2A 1D2MA 2EBUA 3ZY3A 1R00A 5K01A 4MQ4A 4DBLC 2Y1FA 4IJQA 4X44A 4EZEA 2DWQA 5AESA 1ZGZA 4LJ7A 3H42B 3BBLA 3P1JA 3E53A 3OTHA 5AP9A 5JJBA 4RPIA 2RB4A 3P5SA 5BYJA 3I8XA 3P0EA 1ZJ5A 1Q5PA 2A8YA 1YGPA 3AL3A 1FFXA 1D6SA 1PKEA 4MW6A 5BNWA 1NR7A 4ZALA 4CKBB 3THXB 3QW2A 2F2TA 2OB1A 3DOJA 5GTDA 4TKLA 5G0SA 1D0IA 1NZFA 2MIIA 3HDGA 1N6RA 4FM9A 4OL9A 3WBJA 1A5SB 4HQOA 4JP2A 5K8TA 1YUMA 2C00A 3BH7A 1SU8A 1P2VA 3VC1A 1KC1A 1IK6A 1H23A 4N4AA 3DZKA 2DEUA 5BQOA 4CUKA 3U44B 1DC5A 4DQXA 3SQWA 2P6PA 5JR3A 3UOGA 2JIMA 2HU2A 3LHSA 5DYTA 5ALOA 1XCOA 3O8NA 1KQOA 3SGLA 2IEGA 1Z25A 4LZJA 2GMWA 3UAZA 2PXAA 3N0RA 5LNK6 2ALJA 3VOSA 1TMYA 1OE0A 2R85A 5CIQA 5DCWA 3V7FA 4EWLA 1GP2A 5JVDB 3MIIA 1GPAA 1R0SA 1MQ8B 4E7PA 1W9MA 4AECA 4YEDA 2PS9A 5H16A 4H7DA 2QD4A 3TGLA 2VK4A 3LV8A 1EFUA 1NNUA 4XUDA 4QOJA 3AOEA 1VBKA 1QJCA 3HXLA 4OOFA 5E6RA 2PX5A 3I42A 3H2BA 4X1KA 4GR4A 1P60A 1XN1A 1HUQA 2LCFA 3GGPA 1PWEA 3MFQA 3TFOA 1X7YA 3IEIA 4O5OA 1EX7A 1MJNA 3HFSA 3U2QA 2VQDA 3HMKA 2HKIA 1GILA 1AS0A 2FSSA 1Z4MA 1K4MA 2D2EA 1JBEA 2R1TB 1MB2A 1Z5PA 1BSVA 1WXQA 4QQNA 1CDEA 1N0UA 1CKEA 3C5WP 4D5EA 1UM8A 2GM4A 1SBHA 3F8WA 3MWJA 3E58A 4IEFB 5F4ZA 3DDUA 4F92B 3CX7A 2GAAA 3K09C 1X2EA 2HSJA 4GG1A 3G2LA 4MPDA 5EINA 4TZ6A 3HHPA 2BTEA 1N6NA 2DPMA 1ZIOA 2XIQA 2IHTA 1JLMA 3ZE8A 2ADOA 3ZTYA 3HDTA 4TWRA 1PNOA 1FVOA 2C3OA 1EEXB 2QW0X 4KR9A 1WY5A 2Z58A 2JJYA 1YB2A 3NXKA 4RJJA 1G17A 1SBYA 3ZDQA 1C3OA 3KDSE 5THKA 2B6NA 2GSWA 4HYYA 1CR1A 5ALUA 4WXEA 1R9JA 3ZHXA 5K0NA 5DE3A 1PVOA 2AWOA 2L17A 3V97A 4UVDA 4Z49A 3W5DA 1F5NA 3H5TA 1EDDA 2GYUA 1WLSA 2XMCA 2Y0CA 3D6MA 3LCRA 1RAEA 1RNLA 1T5OA 2DQSA 5LQKA 4OXYA 3U3JA 2FEXA 5K6TA 1KEEA 3PCRB 2WKQA 4R81A 1SOVA 4G5OA 4KC0A 3A6GA 1N5RA 3RSGA 4BMCA 2R6FA 4ITUA 1UANA 3SG0A 1E2EA 3NDJA 2VAVA 2WG2A 3D6NB 1W47A 1N3BA 2JF0A 2VPQA 1QGED 1DTWA 3TF5A 2L0XA 5D86A 4WLOA 4BO2A 3NWEA 3FCSB 4YPFA 3W2HA 4IDCA 4KQCA 3BQ9A 2I33A 1CUZA 1CXZA 2UUOA 1RHRA 3CLHA 3DPIA 2O8BB 1P18A 2COKA 3MCWA 3NJRA 3I9V6 2FEKA 2CD7A 5I5GA 3K05A 4IDEA 4M9CA 2B5OA 5LL6P 1ODJA 1QONA 2Z4SA 1NPDA 2NXEA 4MVJI 5J23A 1NXTA 2QR3A 1H5QA 3H1EA 5EAIA 3ENWA 3B6ZA 1YRAA 7YASA 3D8HA 4MLPA 5T6BA 1LJ8A 1KU0A 3F6EX 3BL5A 1U7UA 3X1KA 3E7DA 4DR1B 1K6XA 3I9V1 4JJ7A 3QEBZ 1T4CA 2B3DA 5IARA 1YJ5A 2PSJA 3AY7A 5TQ0B 1G8FA 5E6SA 3G3EA 1E3MA 3B12A 4G2TA 1RYBA 1C1XB 3GNTA 2DPGA 2V65A 5T5QA 4MVJE 5AXCA 5FBKA 1RWXA 3AG6A 4GX0A 1GG5A 3TVYA 4QXQA 2CJWB 3DO6A 2WMDA 3Q7IA 1U2EA 1W76A 3C4QA 4FS3A 2ODNA 3G5UA 3NDPA 5FHQA 4B83A 4RMGA 1UT8A 1ZGJA 4JI3B 1XVIA 2C2KA 4DRXA 2AXEA 2IDMA 4UBMA 4YCAA 1NV9A 2GESA 3EQZA 1VJTA 3KZNA 2RONA 3B1XA 2OHHA 3ZDAA 1IPEA 2I6GA 4LV6A 5KDOA 1FDSA 1C4OA 2NT3A 4LZPA 4UUBA 1LPMA 1KYXA 1HSOA 4CI0B 1B6SA 1D1SA 3ZNPA 5B3AA 3V1UA 4CDNA 3U80A 4RTRA 1HTBA 1W9HA 2KW5A 5IUJC 4Q34A 3SYKA 5F2EA 3C87A 5KVVA 4HDCA 4MW0A 1VJRA 4ZVKA 1QWSA 3KELA 2AC2A 1ORRA 4B4KA 2OLJA 2R84A 5JCZA 4RTOA 1PJLA 2ACEA 5JXHA 1DXQA 1LDBA 2RDMA 1V5GA 4IXDA 1EK2A 4D4IA 5BW4A 2M6LA 1TKBA 4YAKA 1RMYA 2BFPA 2PYIA 4ENSA 4WWHA 3Q3VA 3A05A 3ZBUA 1LVUA 4P3YA 3EA0A 1LDEA 2F3RA 3CE9A 3EDOA 1P0IA 2BD0A 2O1XA 1R0CA 5T67A 4ZIRA 3RU9A 2H4WA 1A8PA 1EWKA 3QU7A 5KTMA 2ZU6A 4LCJA 1LZKA 2YWCA 4TMTA 4A8TA 1H85A 5EYPB 2ZEJA 1EFAA 2L19A 4FNAA 4JLMA 3DB2A 2WINI 3JQBA 1SC4A 5CNIA 4PAMA 4WNIA 3ILSA 3EGCA 1HE1C 2D1QA 4AJNA 1A2KC 3MTIA 1JNYA 2YS7A 4H17A 1UBRS 3THSA 4DIDA 2XD9A 5LYJA 3S2UA 1A9SA 4ISCA 3M1LA 3MHPA 3VKVA 1AO3A 3NIBA 2H1RA 3ZU6A 2BHTA 4F3KA 3AI2A 2DP4E 4QUJA 3FKJA 3T38A 5JD4A 4K3VA 3H13A 2R7LA 2GXSA 4EGAA 1U3DA 1YE5A 3PNLA 4ZO6A 3H5LA 2WPDD 4DLZA 1SEVA 1AK9A 1DFGA 4FWTA 2PU7A 3FTFA 3O8QA 4ND3A 4I8DA 4JL8A 1Z5UA 1G38A 1YZQA 3D5TA 3ZQKA 2GYWA 3AZOA 3N1UA 3ETNA 4FIZA 3EX7C 2EL9A 2B5WA 2ZBUA 3WGKA 1N34B 4DV6B 2GTIA 3I5UA 2NP7A 4RE6A 1KEUA 2R68A 5D1NA 3HLTA 4JP3A 2Y76A 2P67A 4I55A 1YR7A 5FFNA 1KJIA 4QGFA 4YDHB 1T2AA 4EI8A 1Z08A 3A14A 3LO5A 2GF9A 4R6XA 3ZJ4A 5EMMA 2XLBA 3QMVA 5KYVA 2I7DA 1LBSA 2A33A 3IULA 1XDSA 3BE6A 2DXIA 4D6XA 5DHSA 1O6GA 1XX6A 2IKQA 2LKCA 3LUHA 4GYYA 5B2ZA 4AO8A 5BMVA 2MYTA 1FNDA 1JEOA 3R3XA 2GLTA 2XNSA 1QGOA 2ZVDA 4JSRA 4DQ0A 1AK1A 2NZJA 1KP2A 2ZAGA 3QF4A 1KK0A 2ZB7A 5AK5A 2FUCA 1T9BA 4YJ2A 1H2ZA 3EAFA 1ZH2A 3HWX1 2VKQA 1USGA 2VDPB 1TQDA 1Z07A 3QENA 2HRDA 1QO0D 4MI9A 5FI1B 1CNFA 4ZCPA 1RC8A 1NXSA 1ZK3A 1WEHA 3SSAA 4E4RA 5TR9A 2ZXUA 4WXHA 3V1TC 1H8HD 5CHYA 4D4HA 1WEKA 1N2CB 4JB2A 1XZPA 5IT9A 1ESZA 4K6KA 2DOKA 3BSSA 3I61A 5K3SA 4DT1A 1Y3CE 1XZGA 3BMOA 1DKMA 3AESB 1CUWA 2P2ZA 2C4UA 3G7SA 4A82A 4GBJA 5JALA 1J07A 2GBFA 3DZGA 3QPDA 3LX5A 1U7PA 3PQ4A 5DIZA 4Y18A 1A98A 3PT9A 3DBIA 5A4IS 4FR0A 1GGFA 4XIGS 1XU4A 4UVIA 3KTDA 2VF8A 1GQQA 4JR0A 3D3WB 1RFLA 3X44A 2HXSA 2I5PO 4RO0A 1IAVA 2QG9A 4IDHA 4R9SA 4YRTA 4ZXPA 1COZA 1E9VA 1YJ8A 4L75A 3WWPA 4DQLA 4KODA 2QTVA 1BMQA 1L4MA 3S1AA 4ZOCA 1Q1EA 5DPMA 4LY0A 3AUSA 4MI1A 2I78A 2NACA 4QTXA 3WB2A 4DNOA 4AUNA 1VFNA 4DLNA 3KOOA 2IXGA 4QBKA 4EW2A 2AT1A 4OHPA 4CG3A 3PXDA 1F8YA 2PRKA 3FAZA 4W5QA 3R8FA 2VDOB 2D13A 2O0KA 2PG3A 4QC2A 1XEAA 3EGEA 1JDPA 2XNKA 1MJ5A 1Y8AA 2C95A 3OZTA 3NATA 4JS0A 5FEMA 5AM3A 2JZNA 2ROQA 4ABTA 4R6WA 3KDAA 1V35A 4FOTA 5EKSA 4F38A 5A02A 3EIWA 1QHXA 1Z15A 2H2FA 3EVEA 3GCWA 1IZ9A 1FS5A 3RRFA 4BJ3A 2H17A 2QGNA 5F64A 3I0ZA 1QF7A 3A1VA 2XGJA 4HXYA 1EFCA 3ITKA 3WJAA 4BRSA 4V0QA 1O0CA 2GFQA 5GZ3A 1I3NA 1B1AA 1WZ2A 3PQ3A 4AW9A 4Q9NA 1R37A 1WB4A 4FC6A 4CEHA 4Y6LA 2JCBA 3TR6A 5IJZA 2BM0A 3NBZC 1EA7A 3JZIA 3OO0A 4E33A 3TAXA 4QQKA 4DLSA 1LNZA 5LKRA 4BIIA 3K9LA 3ZHQA 3G79A 2EDAA 4H18A 4OU5A 5DJ5A 5LMZA 1NJFA 1Z4OA 1TUEA 3CKMA 4UE6A 2EIXA 4AB1A 4D9BA 1B0UA 1EK1A 1RMQA 2GN0A 3QTLA 3NBFA 4IBOA 1GLNA 2YWXA 3PI7A 5K99A 3RLFA 1WPXA 3DBRB 1WB6A 1NXWA 3L8CA 1T0JB 2HQRA 2X6QA 1W29A 1VL0A 1Y9AA 1JHQA 5KYGA 2P62A 1TOAA 3T5TA 3ASZA 3A31A 2C9MA 2GEVA 1EGQA 1Z29A 5LLSA 1F1BA 1SA0A 3OQHA 1L5SA 3F6CA 4LBZA 3T3HA 1V48A 4Z1MD 5KYWA 2MSCB 1Y63A 4XEHA 1G42A 4RHYA 1U2QA 1ICEA 5LXTB 5CP8A 3HUUA 3PXCX 4ADSG 4QUBA 4D3ZA 1G1MA 3GMTA 4GKVA 2VDWA 2JJMA 4B2LA 3UJ6A 4YR7A 3QLEA 1E9AA 1K7XB 2WQZA 2FPLA 2ZBVA 3HCPA 3NU1A 4IIEA 2OV1A 3RV3A 2XHEA 4BNMA 3I9MA 1IEXA 2FX5A 3W1WA 4YAFA 1FNCA 2I2WA 2PJUA 4YJFB 1ZCBA 4BNHA 2Z6QA 2CLEB 1JFFA 4BOYA 4ZYLA 5T64A 3R6TA 2XDQB 3R3YA 1BFDA 1W5SA 2WYOA 4JGGA 1KERA 4HDAA 1C8KA 3LUAA 2YYSA 2FSIA 4ITRC 4BVKA 1NW8A 4MUEA 3SHOA 3OZSA 3UT0A 3WE7A 1W0CA 2JDIA 5KSWB 1MV5A 4GPZA 5HOQA 4C4XA 2C20A 2AHOA 4H4DA 3UFXB 4G8BA 4TMWA 5IXYA 5DNDA 3OPQA 4BHTA 4RPCA 3ZGZA 1B74A 1QLHA 4O33A 4F6RB 4V1CA 1H66A 4GM0A 2PWYA 3B78A 1DJQA 2F1JA 5JNTA 1JFTA 1U5AA 3GCDA 3K4HA 3MCVA 1PVVA 1NR5A 3AB8A 4KV9A 4TV8A 5GY7A 3PGLA 5ELXA 2ZANA 4N3BA 5KTPA 4NAUA 3WK4A 4AY3A 4BYMA 4D25A 4MUIA 5DHTA 1J97A 1IH8A 2FFQA 2O23A 3JQGA 2W43A 4QOEA 2XMZA 3C3YA 3C4VA 5CGZA 2WWVD 3SQNA 4W5OA 1OH5A 1T4DA 3PJFA 1XZJA 2HIMA 5AJZA 4LJRA 1O8CA 4QXMA 3LVQE 4F2HA 2PRZA 2GOYA 2AVDA 1E9BA 2ECFA 4ZT3A 3IS3A 3RS5A 4DZZA 3KJFA 4GMXA 2XTJA 4I1YA 2RGYA 2PVPA 1HTTA 4DVGA 2TYSB 4IXWA 4LGMA 2JFUA 2EEZA 3W9YA 4EO7A 3M3PA 4FIDA 1QGUB 5FTLA 3U5TA 1RWMA 4Q3BA 3KLNA 5CTAA 1N1EA 1VFPA 4JH0A 1F0PA 1HA3A 5FRDA 4R5HA 2ZBDA 1YZ3A 1NATA 3V8VA 3S2SA 3PNPA 3T6KA 4B4UA 1PQPA 1QYVA 1FUYB 1ZL2A 2Q21A 4JJGA 3KSBC 3L0ZA 1GQOA 2JW5A 1C0LA 3BE4A 4WSOA 2ERCA 3EGIA 3A11A 3R77A 5TS3A 5J59A 1TYBE 4CDMA 4JI7B 1SZPA 2BM1A 2MTBA 5HKAA 2DETA 3EVNA 1R66A 4HDNA 5B58T 2VKTA 4R40A 2BN4A 5CDHA 2Q5QA 1RYMA 4F60A 2ZI5A 4Q03A 3A36A 3FCCA 5CCBA 3R7AA 4EM6A 4BNGA 1YK1A 3TFQA 5JCJA 4RFSB 4CT5A 4M37A 1OXTA 5I51A 4I7EA 4QO8A 3LNTA 4C1BA 5LP6F 4ZQFA 1GLVA 4GQBA 1T6XA 1U9CA 3EDYA 5AM4A 1XVTA 1QH1A 1YC5A 3O4RA 5ALWA 4G4SO 1N2BA 5H80A 1UOOA 3N70A 4PPGA 1UDXA 1GU0A 1I0LA 2ZBRA 1VMDA 5CFMA 4V0MA 3GRCA 4Z4IA 3ZBTA 1KXZA 1C41A 1A76A 2AFVA 3PJEA 4BP9A 4OX9Y 1P2SA 1C9KA 2ZJ3A 5TARA 4CHTA 6GPBA 2WAAA 2GK7A 1VE6A 4Q48A 2YJZA 2JIOA 3H2IA 4O4JF 2OYRA 1Y1PA 3RABA 3SJCA 3LDGA 1XQ1A 2YWJA 4MUBA 4EVQA 4RE5A 1Y4DE 4R84A 3WNZA 2C3YA 2XDWA 1JDZA 1JLLB 3DGEC 2VFAA 3MAAC 4KYVA 2CHQA 3BIWA 2O6LA 4HN2A 2H1CA 2HU5A 5AM2A 1E5VA 1RKVA 2CE7A 2B34A 5AVSA 3P9QA 3FTPA 5DV9A 3BK2A 2AMJA 3G1TA 1P5HA 4ENUA 3RG2A 3UHJA 2IYFA 4CTOA 4ZZ3A 4KJXA 1W1UA 4MYRA 3WGUA 1USUA 1UM9B 5AWFC 4B1FA 2A35A 2FVYA 3UF0A 1NIPA 4PVDA 1WULS 3S2IA 5FLXA 3IA7A 1HO3A 3HYNA 2AC4A 4DSOA 2VDKB 4BBAA 4NJEA 3C15C 4TWJA 4I4TF 3KTOA 4CM6A 1NVXQ 3GV0A 4YVFA 4BVJA 5AVWA 3GIWA 1BZYA 4MHOA 1CJSA 1YACA 3AJDA 5DWDA 3WYFA 3CLKA 1IHDA 5EGNA 1JDBC 1EK5A 3Q0TA 4JYMA 4YMTA 1W96A 1CY1A 2J5KA 4EATA 2LIVA 2TMGA 5BN5B 3TTWA 4CF7A 1R10A 2B8NA 2I3AA 2R1ZA 1GJRA 4P58A 2P2CA 3AKCA 1NOJA 3BJZA 2OV3A 3GGGA 1ATZA 1NMSA 4X7MA 3ORYA 5ICGA 4C2TA 1N5OX 1O0SA 3T7CA 2DG2A 5A0VA 1POXA 1TU4A 4N54A 4WBNA 1ZD5A 1EH5A 2VTKA 3OE7A 2W48A 4RIEA 4CKYA 5K4HA 1TB4A 4INAA 4HVCA 3OQNA 3JAWA 3DE6X 1MQ9A 3FBTA 3KQTA 1IHOA 4M49A 1X94A 3MZ0A 2AQ8A 3ZWVA 4BTVA 1X7XB 1JKJB 5THQA 4QYSA 5IDVA 3A26A 2AQIA 4Q47A 5AKKA 1ADFA 3KPUA 2B2NA 1PG0A 4O4HB 2I71A 3DE0X 1Q2XA 3B6IA 3FSGD 1Q6YA 4KMOA 3O3NB 1UZAA 4GKJB 1W581 3WB1A 2HZBA 1E32A 2H0RA 2ZBPA 5TPZA 3PF9A 1KBOA 1DIGA 1L8AA 2QF7A 4FMPA 5DNEA 4JJKA 3UAVA 3BSFA 3WNCA 3L0PA 5KVAA 2POCA 4D8TA 3TMAA 3TQHA 2XKJE 3ZX5A 5I7HA 3MN1A 4MJ3A 1BHQ1 3Q7PA 5KHOC 3W9UA 2C58A 3BXGA 1VPEA 3RUHA 1U9YA 1MC5A 1KO5A 5AVZA 1KJ9A 4OQDA 3H1PA 3KXKA 1E2QA 1JR4A 3PVZA 2R4QA 3QLUA 1NF8A 4TTTS 3V9AA 2YV5A 4NZMA 4UMFA 4HGQA 3UB2A 3ZK7A 1XWWA 5KU7A 1CQWA 1DC7A 1BHSA 4BUJA 3V8NA 4FFOA 3WRXC 1YTLA 1R0WA 4D6PA 3A3KA 3FGPA 2GM9A 1XTRA 3FCOA 3PZBA 3ZD6A 4MICA 4F71A 1HL7A 1T9AA 2VJPA 4L5AA 1ORIA 3ND6A 1ZM4A 3VRHA 4RNDB 5JNRA 2B61A 3AIKA 4PC6A 1SUAA 2PZLA 3K0AA 2GN8A 3E61A 3MRVA 1FOEB 4MH0R 4BU1A 2QRHA 4E14A 4RS4A 5CJPA 5ICCA 1WBBA 3M8KA 2FW1A 1KAQA 1AA9A 1NU8A 3IBCA 3KE8A 4PQEA 4TV9A 3QV1A 4EJFA 5B1EA 3FW1A 5DGCA 3IVMA 1I2DA 2H08A 2W6NA 4K8OA 3KZMA 2X58A 4Y2TA 4Z3DA 3F5FA 4RLQA 4XQEA 3TLCA 1W0JD 5BV8A 3AUJB 5L40A 5JBIA 2AKYA 4HNTA 4TLMB 1FW6A 3T0GA 1V3QE 1GTL1 1AKMA 3TRJA 1G8HA 5LSAA 4BRWA 3VBCA 1U90A 1JQ3A 4AYWA 2VLIA 1Z3IX 4UASA 1I9CA 1FVFA 2CL7X 2GN6A 2FX2A 2PR7A 4LY9A 3ELYA 1ZD1A 5I6DA 3DHEA 1J20A 1Q2UA 2CL6X 4BO1A 1GSHA 1E4EB 1A7KA 1N2EA 1ZS9A 3EXFB 1TUIA 3KQVA 2ZR8A 3ILVA 4LEIA 3WYCA 5H5JA 5IKMA 2O5CA 1N2OA 5K0JA 1R0BA 4Q7KA 2Q2VA 4K6GA 2VVTA 1A5AB 4HKTA 1JDUA 3QU4A 4M88A 1PLJA 3E7FA 3K94A 4LOLA 1ZUHA 2VAPA 2ZJ8A 4HAYA 4O4IF 1F7VA 1SOUA 2PEZA 4M55A 1L3IA 4GI2A 4JBWA 1G21E 4A2CA 9LDTA 4HLDA 3VH3A 5FB3A 1D2GA 1J24A 1JTFA 1U1CA 2IEIA 1SGWA 1X1CA 2IXBA 1V6CA 2PS1A 3S2ZA 4ZYWA 5HCIA 4HUQA 1S2MA 1AX9A 4MQBA 2J3KA 5FTWA 4B6SA 1N6PA 1SC1A 2XR1A 3V4SA 4LHZA 5IHXA 1G8AA 3WNQA 2JGRA 1IDOA 4HGNA 1XCBA 2B9EA 4MWGA 4Y3UA 1A8SA 1B93A 3LBNA 1AKNA 2OSVA 3BWBA 3LPCA 3SXUB 1Z18A 4A91A 4F96A 4X62B 1H2RS 1QZTA 2OCXA 4Z0TA 2BGMA 1AS2A 2XH8A 5LBIA 1XNQB 3ROXA 1Z36A 1VSBA 5CB6A 3NBMA 3S1SA 4DA0A 1BJTA 3I2KA 4X63A 2QPAA 4KREA 1A88A 1P77A 1GVNB 2O0JA 2XY4A 3EVBA 5SY4A 3IEMA 2P90A 4TRJA 3HWRA 2K7ZA 3II6X 3KX2A 3JQ7B 4MVYA 3TB6A 3B6KA 3O95A 4BVAA 2OG2A 1ZVKA 2XSZA 1QG2A 5ECYA 4A1OA 5EJ2A 5CDGA 1Q1AA 1XPJA 1P44A 2CT8A 5M04A 4RU1A 3A25A 1K8ZB 4DZRA 1E0KA 2ZBFA 5BOVA 4CL2A 1NRWA 2VNIA 4KQ2A 4GE0A 2WIFA 4DNXA 2QLTA 2HMVA 4WVLA 3W8DA 1MGOA 4PLYA 1DUSA 4MCIA 4EI9A 2DT5A 3OKAA 1ZD3A 3AUKA 1R27A 1QVRA 1U2ZA 2IUTA 1QXSA 3NUQA 3QGMA 2GD2A 3LLVA 4QJIA 5AW7A 4Q12A 5ITWA 2DPYA 1V2HE 2GN4A 2HEGA 3BREA 4KGVA 4BV3A 1FYXA 2JGIA 4K2HA 4CCSA 4XARA 1DBWA 4A26A 2EG9A 3GAZA 4RF4A 1RXIA 3ZWKA 4IX1A 1VPLA 3PEVA 3EDMA 4MCJA 4Y98A 3HM2A 1OV4A 3LQFA 3ORHA 4NBNA 5AW4A 1DX6A 4KAAA 1RMTA 5KX5F 3ZWMA 1W36B 4TMKA 4FWIB 3U3RA 4HF7A 3AILA 2G04A 2XNHA 3MINA 4WLNA 3TCXB 3SS9X 3T5GA 4A9AA 2BGTA 1E60A 2HMTA 4WCFA 1Q0TA 1B8NA 3L7CA 2R48A 3ROZA 3KUCA 4R2JA 3PD0A 3T8YA 5KB3A 4MX8A 1Q0ZA 2PGLA 3UOAB 1GFIA 3NWPA 1KJ8A 4H6WA 2VYVD 4IYJA 4OL0A 4Q1EA 5A6SA 1CPYA 1ZNZA 4EA6A 4ECEA 1XTQA 2I9PA 3JTEA 4OMUA 2O20A 2PH1A 4PYRA 2XT6A 4JLSA 1I7LA 3A0UA 5A0FA 4A8JA 3D02A 4FXPA 2GM5A 2GKSA 2X0IA 1QLJA 3VR1A 2DBZA 3K8OE 4EB8A 1RXVA 4QVKA 5GPBA 1CQIA 1ETHA 1DEHA 2YW2A 5FCDA 4RNCA 3E1SA 3HZZA 3NT4A 1OC2A 1EHYA 1XF1A 2X7HA 4FKZA 1FK8A 4UD2A 5AH0A 4QJ3A 5K8IA 3ZHCA 4A4DA 3GOQA 3E22A 3O91A 1ZOSA 3KHSA 2B4KA 5P8WA 2X5NA 2ZJ1A 4M76B 3WGVA 4DJFC 2J30A 3DOCA 3NG1A 4ZTBA 4DG8A 2VA9A 1JT2A 4ZDJA 3CX8A 4CIWA 3ANNA 4GE3A 4QKQA 5DTJA 4H1WA 1LLQA 4UPVA 5EFOA 3GLIE 3IPLA 4MSUA 1BEUB 9GPBA 1Y6FA 1Z0FA 1FJ2A 1AHNA 1CWUA 2BGLA 3DTVD 4LGCA 4PU0A 1OF1A 1WW2A 2WG0A 4G8JA 1USWA 3K9FC 2E21A 4NCAA 1FNSA 3L7JA 4MUNA 1ZH4A 2REQA 1JR2A 2XRYA 5E2BA 3UXYA 1P3DA 4D42A 4D7AA 2VJYA 1DRJA 2YYAA 4IIGA 1RU3A 1Z5GA 1BNCA 1TC1A 2QL7A 3ESCA 1SULA 3ND8A 2JFQA 2RHWA 4I19A 1SXIA 4GO1A 2WF9A 5F3RA 2R62A 1EXNA 2UUBB 2C84A 2FZVA 1XKLA 2MMCA 3AFGA 5CJ2A 1P4SA 1GPDG 2ZUEA 4CLHA 5DCUA 3FNRA 4Z2AA 4ZCRA 2D00A 2Q9AA 1NJSA 3BIFA 2MR6A 4A6DA 1K6JA 1KY4A 1Z16A 3E81A 4O2BB 5EJ7A 1HYHA 2I4IA 2J9FA 3I6YA 3KU4A 4BFVA 3L6BA 3N8HA 5JNWA 2QRKA 3H17A 5F33A 2QE7A 2HHCA 4UULA 1KVQA 5KYYA 1QUEA 5IK2A 4KO3S 4CM9D 3KUDA 2G9QA 5ERGB 1PFUA 3Q88A 4R8KA 4YJ3A 3UQZA 4U7TB 2VHYA 5L4SA 3PL5A 4QFCA 1FQKA 2Q3LA 3DTVB 4NMXB 2Q62A 4G81A 4GOMD 4Y6RA 4PC2A 4DMUB 3OIWA 2WE7A 1DLIA 1WPGA 2QAGC 3F49S 2QMZA 3N0WA 3SX0A 3F6SA 4AG3A 4ARSA 5K0SA 4KR6A 1II8B 4DJEC 5JIBA 3DBLA 1CZOA 5FXMA 4UTVA 3Q9UA 3I1IA 2Z3VA 4DN6A 5HWSA 5K8VA 5LC1A 1EESA 4D81A 4EYEA 1XYVA 4JXZA 1N9GA 3YASA 4YXFA 3U3DA 2RKWA 3B38A 1VE9A 4RBNA 3DUFB 1SVLA 5KTNA 2ZIZA 1NXOA 2DVMA 4QOFA 3THWA 2WYIA 2KB0A 4NDZA 4WJKB 1FMCA 3G1WA 2W83A 2JLWA 2UUCB 1VL6A 1ZSYA 1MC8A 3PFNA 3PDIB 4IJUA 3SC6A 1X7HA 5G1PA 3HVKA 2BY4A 2AYXA 1WHSB 3HUDA 1NT2A 2ONYA 4HRYA 4RCYA 1PWYE 2BFBA 1T0PA 2X2OA 1ZK0A 1IZ0A 4ZVNA 1RADA 5AYVA 2PRYA 2G1UA 2OBXA 1OI4A 2GPTA 3KR1A 3LP5A 1W46A 1J21A 1YJXA 4BO3A 1U5CA 3CRNA 3VR6H 5J2UF 4KO4S 1NQAO 4F7DA 1U3TA 2CUTA 2J7PD 5EVJA 4IDFA 2BEJA 2GGSA 3O4JA 4HUJA 4I4LA 3UKOA 1K2VN 4BQPA 4GSLA 4H16A 1GTMA 3N0TA 1KKMA 5SYMA 3CISA 1PR2A 4MVCA 1BX3A 5CDTA 4U9HS 2W22A 2V7WA 4OM8A 1U6IA 1XD2B 4M0FA 3R7NA 2UU9B 1SBIA 4NZNA 3VU9A 1XMVA 4WXMA 1IN1A 4Y67A 1ZAYA 1VMEA 1XXHB 3P26A 2X8JA 3RTDA 4DB4A 2IC5A 1B15A 2KS6A 4M1OA 4V3BA 1PR4A 4BKQA 1UPCA 1XKQA 1N8NA 1NJ6A 4MIYA 1KC3A 1MR3F 1G3QA 1OCEA 1UBUS 1X7WA 2NYRA 4RD2A 1AQNA 2VP9A 2B1JA 5KNCH 3TR0A 4A10A 4RESA 2XYPA 4QU8A 4UMEA 4UXIA 1VZ3A 3SZMA 1VHWA 2FSVA 5BQ3A 1NNEA 4ENPA 4BNYA 3GJZA 1ZEJA 2WJVA 4LYAA 4AAYA 2GX6A 3JRNA 3ESAA 4OY3A 5L95A 1F1JA 1QS0B 3U4QB 3EDQA 4UUQA 5FOSA 2I29A 5BRJA 1TYCA 4LJLA 1OX5A 3WWZA 4QEKA 1KDPA 3AL0C 3OTQA 4PFKA 3K1JA 4YCDA 1RM3A 5DSXA 1T36A 4U7JA 2VYCA 1L7EA 3E15A 1CJVC 2EWMA 2QTNA 3TXYA 2BRUC 4B81A 2M1ZA 4EPVA 1ADCA 4CM7A 2BLLA 2VXOA 4WXRA 1WBJB 4S1PA 3LHDA 5F1KA 2TMDA 5KSZA 4NJMA 4UPEA 3BAZA 2WF6A 3TEFA 1D7OA 2RHOA 4IV8A 3O93A 4IUBS 5GV8A 1SQ5A 3FWHA 1KH3A 1Y81A 2AOWA 1W34A 1V16B 3GYBA 2GAFA 1GCGA 1PD1A 2FSFA 3WKAA 2FX3A 1X1SA 3V8EA 2FWBA 2R8BA 4KVGA 3K0BA 3LUJA 3MCTA 4B48A 3CH6A 4BMOB 1XALA 2O8DA 5ERXA 2Y4NA 4WK0B 2FE4A 3AZQA 2HDHA 1D9ZA 5B12A 3PRJA 2PT9A 4J0GA 3NHZA 4X3PA 5E95A 2HXGA 2PUGA 1AZTA 1CIVA 4G9GA 3D81A 3MMPA 1JEJA 3BQNB 3G2QA 4UBKA 3RFTA 2G0TA 5HIJA 5E4YA 3EWSA 3U37A 3HB9A 3PFFA 4FZ5A 1CEYA 5GINE 4PPQA 1H93A 1Z6AA 3QU9A 3KD3A 2OAQ1 4PRYA 1AM4D 4U6QA 3DAOA 3OIYA 3RPEA 2WLTA 3TQRA 1QYRA 4F4HA 4QBFA 2IZOA 2O5RA 4FD3A 3AT1A 4AZSA 1MC1A 1DAGA 2PL5A 1KL7A 5DSZA 4C5BA 2DERA 1OREA 2OYSA 2GHTA 3IBSA 4OMFG 4UHJA 5DTIA 4MO2A 1Q92A 1R6XA 4ECAA 2HRZA 2IFTA 4KQEA 1YR9A 4LMBA 4C9BA 1NLMA 1M1ZA 5LWHA 1J49A 2FE1A 2P9GA 5CB4F 1T0UA 3DMTA 4KE9A 2I2XB 2R6DA 3CONA 3D3QA 3VUEA 1YRHA 4EJSA 4IUDS 4YLGA 3R7BA 4EKYA 1FTNA 2EFHB 1RRFA 4NBTA 4OH1A 4B0OA 2A3NA 3CLSD 4XVRA 5EZ5A 3H16A 5L3RA 4UEJA 1RQPA 1X7YB 4J2TA 1SZCA 2FZ5A 3BG5A 3ITNA 3WDLA 4JWKA 1E79A 1H2XA 3LQ2A 3N7UA 3D9QX 3AEQA 1GFZA 1T5TA 1EM8B 1Z82A 3OEHA 4KIWA 4L0CA 1K6EA 5GZ6A 2GHQA 4ZHSA 1YQUA 4PLGA 3LPLA 1M83A 3PYLA 3FG9A 1C2YA 3RUIA 3DMPA 4QPZA 1D9XA 4M83A 2V4UA 3CRRA 3AI3A 4P92A 3WV5A 1W44A 5IASA 1SVIA 2Y0DA 4BQOA 1XGKA 1JHYA 5AQ1A 4WAUA 2H11A 4NYJQ 5E3JA 3V4OA 1VSUA 3AIOA 3VX4A 3URKA 2PKCA 2FEOA 1KWKA 1KZHA 2YFHA 1K5GA 4FDVA 1XAIA 3I83A 4YUWA 1UODA 2VRCA 4TLDA 4B5KA 1CY8A 5HVNA 2L2QA 4EEZA 4XSHA 2I6UA 5FNVF 1CR6A 2DPHA 2C4HA 5JZMA 2OCAA 1XEFA 1Z7EA 1KJYA 3X3HA 4UM9B 1KEEB 1X77A 1R15A 5TQ2A 4L7VA 2IX3A 3WSWA 4JQSA 2LPMA 4PCLA 1IY1A 4URFA 4EHBA 1XSEA 5LJLA 4EA8A 2X6TA 3C6QA 2IE0A 3ZV3A 2NQ2C 4RMJA 4PRZA 4F9EA 3EUAA 2QVGA 1B1CA 1N6IA 4JOSA 3TZBA 4FN4A 3X2EA 3PGKA 3V55A 1W2HA 2W4IA 3JASA 1P4AA 2C82A 4DPLA 1IXYA 3KTAA 4XUEA 1E9SA 4RQTA 3WIVA 3DZ8A 3IR6A 4DJJA 2C92A 2GCPA 3CH4B 3DB1A 1JJFA 3JQPA 4GRAA 5ILQA 3HB7A 3ICWA 3PFKA 3SJAA 3E3LA 1EVJA 4PYIA 3DLCA 1SK9A 1L3CA 1LC0A 1UT5A 1BWSA 3LHIA 4PRLA 3HBJA 4R8SA 4AMVA 3AUAA 1F0NA 3DMNA 3RKRA 1C1DA 2A57A 2BE9A 4FFPA 3WI7A 4ETIA 1B6TA 4ZOAA 3EDRA 1ZMTA 1GTZA 3DOFA 3L40A 1T4CB 3IE1A 1V8OA 2RGNC 1JVSA 3G0GA 5E6SB 2NSDA 4RQAA 3O8LA 4BDTA 4RJTA 1L4BA 1PHRA 2Q27A 3E2MA 3DOUA 4HQNA 1GZ4A 2F1IA 3HB5X 2V6FA 5EGSA 2MU1A 5ER6A 2FUG6 4JR1A 1R6BX 1IHPA 2Y1KA 1M6NA 1IY8A 4W1PA 3ZW8A 3DEHA 4Q37A 7ABPA 4UBIA 1XHLA 2E37A 3VR4A 2IYLD 4LF7B 1OD6A 4ZTZB 3IRUA 3HRIA 5I7UA 1IIRA 3U09A 3U56A 4OF4A 4F84A 3QXJA 4Z8YA 3WGLA 4XCQA 2FUG1 3EYAA 3GT4A 8GPBA 3C48A 1CFZA 1M5TA 4G4GA 1QR6A 2FQWA 2ZYWX 2HD4A 3JYOA 2WMYA 3KKKA 2FEMA 3C6KA 1L7DA 1T0BA 3KOZA 4J0FA 3O21A 4HQ0A 4ICIA 1QHNA 4LV8B 4JB3A 4F4DA 2F4VB 1JQ5A 2VL7A 4OUDA 4CTNA 3NHYA 4L2IA 4JR2A 3KOUA 1S1MA 3U4IA 4G2NA 1L4EA 4HJRA 3DAGA 4KVFA 3IEUA 4NEGA 4IPTA 3EMKA 1D0SA 4CQMA 2PZKA 5CA1A 2DFNA 2UZAA 3I30X 3LZ6A 1SD2A 1JZQA 1BRTA 5IZCA 3FB1A 1I8TA 3KB1A 1NIJA 3QX9A 3VAZA 1MORA 4IHJA 1EJBA 5JRZA 2VF2A 2FPSA 3ILXA 2BMAA 1VG9B 4OXXA 5C51B 4B3GA 4RTQA 3I28A 2PU5A 2NXCA 3WKDA 4ZIRB 3V1YA 4CODB 3AWIA 4NENA 2P2NA 2ZBQA 4S2UA 3GLHA 4LECA 3C6MA 5CFPA 2HUPA 3DT8A 4PZ0A 4X1IB 1DIRA 2PD4A 3HXOA 1T5DX 4ALJA 2A1IA 2UV8A 3OCWA 4BBZA 4EDFA 2D1RA 5FUBA 2CCJA 2NTJA 5D85A 3PE3A 1JAXA 1MRSA 3HLYA 3ZUPA 4EELA 5CCXA 1K63A 1LPNA 2J07A 4C5CA 5JAPA 1JMVA 3G2IA 4HPJB 3IAUA 3ELDA 1E0SA 2WNIA 5LYJB 1ZU4A 5IBRA 3G9UA 2OCKA 2QLMA 1QQTA 1O87A 3N2IA 1O9GA 3SX2A 5HRAA 2QZ4A 4GNRA 4RZHA 3HVIA 4L3WA 2PX3A 1XZHA 3SSOA 4RVGA 4B2YA 1XDGA 1CF4A 3R5KA 3KS9A 4LE2A 2M2IA 5CH5A 1ZNWA 2SECE 4IGFA 4BNTA 5FLYA 5AUNB 3ZCQA 2XUJA 1WZIA 2W6CX 3ASUA 3NJ4A 3AEUB 5KYXA 4OO3A 2OWEA 3FNQA 2P9HA 5ECGC 2YICA 5TDHA 1WP9A 5JJKA 4QODA 4PZZA 3KV1A 1XDZA 3O3CA 3QX7A 3GEPA 3OQJA 4KXVA 3AF3A 4MW5A 3HWSA 4P3PA 2OBMA 1ULAA 2V96A 3EBOA 5CUQA 1KY3A 1HETA 2C2WA 1DDOA 4I55B 4XB6B 1B6RA 4D96A 4L76A 5GONF 2B30A 4F5DA 3QU2A 4CETA 4OXNA 3TE7A 1XCJA 4JU8A 5CVVA 3JD3A 4QFMA 5KHAA 4BL5A 2UVPA 4QDZA 1SC3A 5F7XA 3L7MA 1M66A 4LY3A 2AFHE 1YD7A 2JFXA 1RWVA 1YSCA 5AKLA 2ODEA 2OBFA 5A7FA 2RH8A 1R4NA 5BMVB 4GX2A 1OGJA 1KGSA 3U3XA 5TV2A 3OMXA 3BFKA 3OY2A 4C2AA 1YS6A 4LPSA 3HDVA 4N12A 5JH7F 2AS0A 2ZYUX 3WICA 3AFMA 3ZH9B 2ZT5A 3OLQA 4WW0A 1B0AA 1UMBA 4RELA 4E6PA 5HW0A 1XK7A 3EVAA 3BWDD 2LUOA 1J8VA 4S0XA 2EW1A 4KO8A 1NJ8A 1UKBA 3MM4A 3NC1C 3WLTA 2WU4A 3QZUA 1XUOA 2ZRGA 1F48A 3OC6A 2V8OA 5A05A 3S2GA 2YJ6A 3GVHA 4OG2A 3BMOB 5CGQB 4YRNA 2XVXA 1V4BA 4TL6A 4XLZA 4JMPA 1C5KA 3WKBA 1SUDA 3GAMA 4P0PB 3SWWA 4G65A 5EFZA 3OJLA 2YXPX 1M8JA 2G80A 3W6ZA 4F4JA 1GSAA 2FWAA 2XCRB 1IRXA 4LGVA 2GT1A 4EL0A 2F8LA 1EP3B 1O8BA 2QV7A 3HXKA 4B44A 4LDJA 1Z0SA 1AGPA 1N3YA 3QXXA 4GF5A 1YDFA 3JY6A 3CSSA 3P2YA 4ZI5A 2QTVB 3GJYA 1OLSB 2PFGA 1Q95A 5HPYB 3SC2A 2DY0A 2CZGA 2IHUA 3TQTA