2JRCA

Solution structure of peptidyl-trna hydrolase from mycobacterium tuberculosis h37rv.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
191
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVHAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Peptidyl-tRNA hydrolase
publication title Solution structure and dynamics of peptidyl-tRNA hydrolase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 43
structure length 191
sequence length 191
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2jrcA00
3NEAA 5B6JA 3KJZA 4OLJA 2Z2JA 4FOTA 1RYBA 3OFVA 3P2JA 4DJJA 5EKTA 4Z86A 4LWQA 4ZXPA 2NAFA 4YLYA 4FNOA 3TCNA 2Z2KA 4QBKA 2JRCA 1RYMA 4HOYA 4JWKA 4P7BA 4QD3A 4DHWA 3TD2A 4FYJA 4JY7A 1RYNA 3TCKA 2PTHA 4FOPA 4ERXA 4QAJA 5IVPA 3TD6A 2Z2IA 2MJLA 3KK0A 4QT4A 4JC4A 5IKEA 3VJRA 5IMBA 4JX9A 2LGJA 3V2IA 4IKOA
chains in the Genus database with same CATH superfamily
1M2EA 1SWWA 2P40A 3SGLA 1B41A 1GYPA 3DFIA 1TYEB 1EH5A 4TQAA 4W9NC 2CLMB 1CIJA 1FFWA 1LJ8A 1QG2A 2V9CA 5ALJA 3BEOA 4YBZA 4JJKA 5SYAA 4A0RA 2PAFA 3HXLA 4FT4A 3TQRA 3DXZA 1HDCA 2GTHA 5DI3A 3U44A 1W34A 3N8HA 3ZWWA 4NATA 1C8KA 3E5NA 5LD2C 4CGZA 1ZUD1 2CXSA 4OLAA 1X7XA 2J9GA 4P36A 4XX0B 3IBCA 2ZUFA 4GUDA 4MRAA 4MUEA 4RY0A 1SUAA 3BMXA 1Q0UA 2WPNA 5TMEA 3UGJA 3U61B 1Z63A 4IJ6A 2GPBA 3D43A 4FHFA 5EZYA 4BE7B 1GQ2A 3DD1A 2Z3VA 3HUTA 5E7MA 1BOFA 4ZA2A 5G41A 2QP9X 4OKNA 1QPZA 1SRQA 1ZO8A 2EAUA 3ETHA 1Y6FA 2HK6A 4BUCA 4IQ0A 3EVZA 3GAAA 1K7EB 3HEAA 5CAEA 3H11B 1O2DA 4Q4DA 1ZEJA 3SAJA 1O95C 3SKXA 1FP1D 4I9FA 3ZDZB 4Q1AA 3U6BA 2PTGA 4GC9A 4EENA 2CVQA 3IEMA 4DHWA 1I3KA 1K88A 1OWLA 1BMQA 2I2AA 4JJ6A 3WKBA 4HYEA 5K6RA 5TQ2A 3FSGA 1Y6RA 2PKQO 1SIBE 1H05A 4HY3A 3DO5A 5AKHA 5CP8A 5F5XA 5KNLA 3AVYA 1P2FA 2DTXA 3FH0A 3I8SA 2BRUC 3NIBA 3SM9A 1IHPA 1EB8A 3VISA 3ZJYA 4K6CA 2LDBA 4M76B 5ALQA 3E1SA 2AUNA 4YP5A 3UGQA 2ZQ5A 5IDVA 4A27A 3R3WA 1XNJA 4DLUA 5ECDA 4PSAA 3E48A 1PFVA 3KWFA 2ZYAA 4ZAZA 3T61A 1XMPA 1AB5A 2FN3A 3OMXA 4GHWA 3AKCA 1E63A 5AI6A 1AA9A 3WLRA 2L17A 3A58B 2EFGA 3OCUA 3ADBA 2NSLA 2ZANA 1BW9A 1NE7A 2A0YA 4MW4A 4BJ1A 1GPMA 4BJ6A 5ALTA 3IDZA 3KSUA 3Q3CA 1U7HA 4DIEA 2B34A 2GI4A 5AQEA 2XMSA 1O9GA 2IYQA 5LOVF 1KKUA 1RWOA 4YRCA 1CF2O 2NO1A 2DFVA 4BX9A 1E2HA 4PYIA 2DKFA 4FQ5A 4RSRA 3ILSA 1PVVA 1RRMA 4IIBA 1L4BA 3QVKA 5IARA 3UB2A 3VYSB 1D4AA 1ZLYA 2NT3A 4H35A 5KSZA 5F7OA 4I4NA 5C3MA 1WL8A 1BGWA 3PWSA 3OFND 4MDYA 3B1KA 4XJTA 5D7BA 4C5CA 4ZEVA 5A5GA 3IMGA 5FBWB 3NUZA 4EPYA 3UOAB 4DL9A 4LXQA 1YQQA 2BDEA 5EZSA 4ER7A 1IULA 2JZCA 4CF7A 4M4SA 2XHEA 5CTJA 2H9IA 3TIXB 3D7KA 1TTPB 2C00A 2X9VA 3NHZA 3M1AA 4IGAA 1N1DA 4KPYA 5DOVA 1W36B 1T9AA 3WV4A 1SUEA 3B38A 3P26A 1V7CA 1A2KC 4LKRA 4UARA 2QTCA 1WKBA 5AKXA 4GZ3A 1CZNA 2C8JA 3AM1A 5CM8B 3QHPA 4IDHA 5ITZA 5ALPA 4HDSA 2DYKA 1L8XA 3TIVA 1QE3A 2NU8A 3WE7A 1T4CB 4HNGA 4WCFA 2OCKA 3U5TA 2O8CB 1TU4A 3FNHA 3KKQA 5HF8A 3ZWNA 1UK9A 2O5RA 2HQ1A 2H06A 4DXDA 5C37A 2W4IA 2B9EA 3PGLA 4LW8A 4QIHA 3BXZA 3RFTA 1VJ5A 5TC4A 2CSXA 3AM4A 3EXEB 1XMVA 3VU8A 4N1AA 1DX9A 4K9PA 2BYTA 5LZ9A 4JUFA 1VIDA 1KH3A 1KQOA 3ILVA 2Q7DA 3VKFA 1JWAB 1R4MB 2Q8NA 3ZW9A 4UOEA 1SBQA 5F2OA 4ZEMA 2QXYA 5CA1B 2PUCA 4LV8B 3B7PA 4IP0A 3DKVA 3P19A 3AR9A 5CW2A 4YCLA 1Y6ZA 3PRJA 1XROA 5LUBA 2JFYA 1QX4A 1VE6A 3OLWA 3KQKA 4LF4B 4XM0A 5AKGA 1T0HB 3D5EA 3ONVA 1YZQA 1J0XO 5BP7A 1KDVA 2GN0A 2Y77A 3QLUA 4QXOA 4OHUA 4YUAA 1KAHA 4MZXA 5JFOA 2R6HA 4GE0A 2R7LA 3LQ4A 2BEVB 3VV2A 3KPYA 1KAQA 1LKZA 1KERA 3IILA 1YE8A 2VF2A 2WINI 3DOFA 5BV1A 5ITWA 4M0PA 3U09A 4NBTA 2JCBA 3CLVA 5E6UB 3AP2A 5CB6A 2H48A 1GU0A 2Z57A 4BGEA 2FRDA 2HT6A 4RLFA 1O9HA 3OFJA 5AD1A 1ILWA 1W52X 4P3PA 5ALHA 2Z8XA 1YOVB 4KO8A 3NBZC 4KQFA 1D4ZA 4N3NA 4Q4JB 4IMJB 4E07A 1Q11A 3I42A 5JO9A 4CMIA 3G88A 1JXAA 2AG8A 4KJZA 1VKRA 4Y0AA 2I9KA 1R4ZA 2CB9A 2XNSA 3HB7A 1D04A 1GKLA 1M3SA 4MS4A 2AR9A 5ALIA 4ZYVA 4JT4A 1IBMB 3HJFA 5BQPA 2AFHE 1E1KA 2IZZA 2SICE 4R1UA 3R3XA 1OZ0A 1RLIA 1T2FA 3DO6A 4QECA 2XNDD 3ROKA 2EFJA 1CNEA 4MWTA 3TRKA 3TZ6A 3A6DA 5FQOA 1K3UB 3T7IA 2YJTD 5CVTA 3EQ6A 2V6GA 3V7FA 1C1DB 5F73A 4DLAA 5AR1A 1P8JA 1CTQA 1V8ZA 1XN4A 5CURA 5EPEA 1LQ2A 2CF6A 2HJSA 1LEHA 2PRIA 3D4PA 2FPIA 4GYJA 2GM4A 2W2LA 4AJLA 2RIPA 3DEZA 2QYHA 3T8YA 1ID1A 2Z6QA 3TYXA 3I04A 1QKKA 2RAPA 5IC4A 3FZQA 4IX9A 1XTZA 4A0FA 3FSJX 3A32A 3B9BA 5CB4F 4HQKA 1ZI8A 5DMXA 4DQXA 2J6BA 4FFDA 3GQBA 4PLHA 2FE4A 5LZ7A 3RVOA 3K70B 4BN0A 2NQ2C 1TAHA 3IKVA 1ND6A 1TVKA 1AX9A 2XOKD 1JMYA 2VDVE 3DHEA 5JWOA 4D3DA 5CA0B 1ZIXA 3MMNA 2EARA 2SECE 4EO9A 4R9NA 1XV5A 2HL6A 3GLIB 3QA3E 3E7WA 3I9NA 4WK2B 1ST2A 2Y1DA 5HTOA 5B2EA 1T3SA 1YU6A 3UUFA 2VYFA 3DVLA 5F33A 2IUEA 3EFEA 4HQFA 3VO2A 5IVPA 5EYPA 1QHHB 1F8XA 2XF8A 2XUPA 4I3FA 3CRQA 4K26A 4TV8A 3BJRA 3AH8A 1DKLA 3G9XA 5BMOA 3CVXA 4OM7A 2JLSA 3JD3A 1RLOA 3KE8A 5DNDA 2NTEA 2PCLA 1LV7A 4HRXA 3FNGA 2X76A 5AJZA 3HKDA 4D9HA 1MG0A 2PL5A 1EWVA 1FPMA 2Q9CA 3EGCA 4KACA 4PBTA 3HCNA 2GH1A 1N5KA 4XI9A 3TLYA 1DPGA 1OBVA 4TVBA 1KAEA 2V45A 2HJ9A 3WGKA 2JGDA 3PXEA 1JLMA 1XMIA 2OB2A 3SF8B 3AUJB 3FAZA 1AZSC 1THTA 2GHRA 3HWWA 2PNJA 3WYAA 4D43A 4OIMA 4B7UA 4ENSA 3I1YA 2ETVA 2Q27A 4E88A 3BN3A 2O48X 2IX9A 5DM60 4YPOA 2C7QA 3FOBA 1OWOA 5KCMA 2D1QA 3VYVA 3C85A 1SC3A 1CY6A 4MVJP 5DH9A 4ZQFA 4OL9A 4ZO6A 5HDBB 5JZOA 1AQNA 1ZEMA 3AWDA 4DR7B 1I4WA 2IP1A 1OHHD 4O29A 1U2DC 1TB4A 4RD2A 4YJ2F 5ALKA 5TGDA 4BV2A 3PC8C 2O0JA 4RS4A 2ETXA 2WIGA 4D9IA 4E22A 4N6NA 4PYOA 3M2TA 1IOZA 2FI1A 2L18A 1QFJA 3ESQA 1SOWA 2HMSA 3GLSA 1X8LA 3V3TA 3U60B 4OLBA 1T9HA 1A88A 3EDRA 3F0TA 4M0FA 2VUUA 2Y0EA 2ZRBA 4ITUA 5GM2A 1WVGA 4IZ6A 1E4EB 5J9FA 1NP6A 1XL1A 2A5LA 2CBZA 4PQYA 2XXJA 3SS9X 3UMGA 2JNWA 1RHQA 2AJBA 4UZFA 1UOPA 4IJ5A 4TZKA 3RSLA 1V71A 4BO3A 3TAXA 3E9MA 1GUFA 3ID6C 3OVMA 4J7AA 3VZRA 4CMCA 2ZXEA 4FJ2A 4DMUB 5AM1A 3LY5A 4YAKA 2ZCJA 2RHWA 4BLRA 3MCAA 3AFMA 4LQCA 2GEKA 5COBA 1Q14A 1V11B 4ZREA 1BFKA 1QG6A 5J2TF 3LLUA 3MOGA 5G0WA 2J5RA 3K92A 3HNOA 4N0EA 4RNCA 5CDHA 3COPA 4ARAA 5L45A 3BMQB 4RETA 1SU7A 2EKLA 1KR2A 3LDGA 4HYYA 2IZOA 4ZP1A 5LCXA 4MARA 1ZUNA 3FYUC 2FPOA 3SZMA 3R3UA 4HZUB 3DXXA 4ACAA 1CRZA 4YY3B 3AY6A 1H2BA 3SF0A 3W5HA 5BMVF 3JD1A 3MOSA 4IR7A 2ZWOA 2G5PA 3DULA 1KY3A 2P9JA 1BZYA 3NB0A 1JLRA 3RRYA 4ALNA 2ZIXA 1JHPA 1UXJA 3EVCA 1S9DA 3MT9A 3R7FA 3V42A 4BQEA 4HLUA 2QN1A 1QFYA 1ADJA 1N4DA 5H8WA 2YNMD 3QFCA 2CVZA 2H2GA 1WCWA 1X87A 2X15A 3KU1A 4RSMA 3Q8WA 4DDKA 5CEJA 3QKWA 3C97A 2VHQA 4H7PA 3QM1A 4UE2A 4X62B 5KTMA 2FG7C 3WL6A 2BKUA 4JEUA 1RQGA 1PRYA 2RHCA 2HLDD 3Q88A 4MPRA 1N2SA 3TW8A 1WUYA 2VPIA 1RLMA 2F64A 4PEVA 4CQNA 3TOXA 1BFUA 1EJBA 2C9ZA 4FNMA 3SX2A 4RA9A 1ZL2A 1X3SA 1HYGA 1G3MA 4HRVA 4FMDF 5KJEA 3Q8XB 2ZOSA 1MB9A 4RFSB 4JZKA 2VZEA 5IUKC 1GZHB 1BVYF 2W6OA 2H57A 3A26A 3L4SO 3O82A 4O4IA 4BFWA 2TSYB 2XXAB 3C3EA 4PHHA 5B4VA 1H8EA 2CBXA 3AJEA 4INPA 3AESA 3S7ZA 2ZAMA 3ER8A 1RR6A 4CV3A 2W2VA 2PUEA 1CUZA 1YK0A 3ADPA 1YDFA 4IICA 2XMCA 5FORA 5K3DA 1MHPA 1U1EA 1N0WA 1QQAA 5J47A 1NVVR 2A9FA 3E3AA 4Q5IA 4D5EA 1YDGA 3M3HA 3K9BA 1GR1A 2XE7A 3RC1A 3RYFB 5IYZB 2V3CC 4DTCA 1OPXA 1SBIA 3DR3A 3EZ7A 2H7VA 4IIUA 3CONA 2JFOA 1ZMTA 2Z2YA 4KZPA 4V0ME 2XQJA 4FK8A 1SOVA 4BP3A 3HZOA 4D4HA 3HJCA 2QRQA 1T6YA 4Y2VA 3IERA 1YS4A 3K96A 2OHXA 3ADCA 3EBPA 5T4FA 4MVJA 2EGUA 1DHRA 5IT4A 4EW6A 1C4KA 2RBGA 2E1RA 3EZXA 3G8BA 4FKZA 4KDCA 3ZE6A 1UIRA 5LJLA 1X39A 4BV3A 1NQTA 1O54A 1UXIA 3KLNA 3O8OB 3KYJB 1OV6A 2LCQA 1M66A 3NIDB 1DNPA 1TM1E 3T9BA 5JZMA 5C1PA 2QMOA 1U0SY 2YWFA 1YR6A 2OV6A 1ESNA 1IHXA 4NJEB 1YA8A 1LB1B 1J22A 3PS9A 3C7KA 2YIMA 3VU1A 3OOSA 3I45A 2PX6A 2GKOA 3THYA 1GFZA 4ZU1X 4M54A 1FU4A 4MV6A 3HR4A 3A0UA 1C0IA 2CFRA 3CLHA 2ZCUA 4MVCA 4EHHA 1ACMA 2ODTX 4HMQA 1U5BB 3SQLA 1R3UA 1J42A 1SZDA 3R3SA 4UCXA 5D00A 5C8YA 1OYYA 1UKBA 2GF2A 1U04A 4BNHA 4WN3A 5FI5A 4C7OA 4MK4A 4Y2YA 3ZGNA 4LF8B 1AUQA 3U4GA 2YC4C 2XGGA 4QWMA 5A0VA 2O8EB 1NVAA 1ZD5A 4N3GA 1Y6GA 3X0DA 3ZDEA 5HCIA 4MCJA 4P3OA 3MPUA 5HIMA 4M86A 4BYMA 4EHLA 2HB6A 1JIQA 5GV7A 4HH3C 5D3QA 5DOZA 1KK1A 3LSYA 1JDJA 1L4YA 1R4NA 2NO9A 3A37A 5IT5A 1VM6A 3A6ZA 4EB3A 5F3RA 4ATNA 1UODA 4JASB 3G2IA 1WDWB 3GLVA 3L0SA 4PLTA 1I36A 5DYIA 2BZSA 4BGDA 4IW3B 4RVFA 1AE1A 2IY8A 3DM9B 2WM3A 3ERCA 4AAYA 4GEGA 4X45A 2A67A 3F1KA 3ZV5A 1M8PA 4W5JA 5JMPA 1Z35A 3WL8A 3A4LA 1KPHA 1V9LA 1UBJS 2JGIA 2ZSIA 3QSGA 4G4SP 4GX2A 4IJQA 4M99A 5F12A 4E4RA 1HQDA 4QU9A 2XYPA 5ICSA 3FMPB 1RTKA 2C42A 2XUDA 3THSA 4EJSC 4DS3A 3MUEA 2OOKA 1WQ3A 2A0KA 3OZCA 1AV6A 1YZ3A 1EVQA 4LZNA 4KG7A 3FNRA 4W1SA 5D1HA 1X86B 4DA6A 1H42A 2CMFA 2YHIB 1ZKDA 5TV2A 3CR8A 4KQ6A 1X1DA 3GT4A 2FN4A 3BMCA 2AVDA 2HPAA 2RI0A 2XHZA 5DHFA 4JI8B 3IR7A 3DLIA 1V4VA 4UNPA 3COJA 2J0EA 4B48A 2H4XA 1QIMA 2IK8A 3LT1A 4HF7A 3LFHA 1D1TA 4RPCA 2VZ0A 4C0AC 1KYIA 4D8WA 5J2TB 1DXOA 4EG7A 4M8KA 4ZIRA 1CNMA 2IXEA 3LT4A 1MT3A 2GHQA 4EMTA 1XU9A 2IYXA 2QNRA 3DWFA 4Y9RA 3IAEA 5DLYA 3PC7A 4GPAA 5CR9A 1UC9A 3GGCA 5JDIC 3O91A 2Z6AA 2CLOB 3RRFA 1X7GA 2H1RA 5FHRA 4ERNA 1C7IA 5HOEA 5KHLB 3B7WA 1UFQA 1EVYA 1IAQA 2ZYHA 5EN4A 3UCFA 3UT5A 5CCDA 3SOZA 1P1KA 4FMPA 1RXIA 2SKEA 2KQUA 1SG6A 2FEAA 2VT3A 1Z2DA 3BE5A 4O2BF 1KI7A 3TLGA 1AGYA 1ZN2A 2X9QA 3FCSB 3NCHA 4X54A 1EEXB 5EPOA 1K1EA 2XA9A 1T3ZA 3WYEA 1W96A 1AQ6A 3NHFA 4BQOA 1ZG3A 1NBME 1RADA 1EK6A 4LCEA 2J3JA 3IV6A 4DWJA 3KM0A 3ANSA 2WICA 2RGNA 3WGUA 3H2HA 3I2HA 5BSFA 3AW9A 1GYQA 4REMA 1EM8B 2X7XA 4DUGD 1MX9A 5I47A 1BJTA 4M0KA 4BX0A 5FBQB 1HMYA 2X9GA 2ZK7A 3LUHA 1MENA 1NY6A 4JLMA 2ACKA 4QXRA 2I80A 3UFBA 4HVTA 2ORIA 3EASA 4B17A 3OQMA 2G4CA 4FMDB 2MSDB 4FW8A 3LFTA 2BSAA 3C6XA 1JA9A 4GNKA 4PXAA 1J0CA 3EUAA 2WHXA 3I3OA 5LYYA 2E87A 1X7WA 2P5SA 3QXSA 4OIFA 4ZEOA 2WOJA 2IYTA 4Z9XA 4ENRA 1QOZA 4I6GA 2DKOA 3AUUA 1RYBA 1QB7A 2FY8A 4HNAA 4PANA 1RBZA 3BFKA 3AF5A 1A9RA 5ENDA 1LBQA 1Q7GA 4WUVA 1JG6A 1NHGA 2HTFA 3W3ZB 2P4HX 2WE8A 2VLBA 3EH1A 4LY9A 3EAGA 2I65A 2O20A 1NT4A 3D8UA 4NCIA 2DXIA 4C05A 1AXEA 1BD3A 3NLLA 1N9GA 1VP9A 1QHIA 3PA8A 4QHSA 3J81A 2I6XA 1WQ4A 1WX1A 5K0SA 3RM3A 1L7PA 1RQ7A 4AZ3A 1C50A 2C5BA 2CHQA 3DUFB 1CE8A 4ZYWA 1QP0A 1DAMA 2FQQA 4OJQA 3UJCA 4B2LA 1XNGA 1KMHB 1X92A 1QZXA 1KO1A 2R8YA 2PWBA 2WWWA 3VR5A 1QPGA 4K1XA 5EJMA 3CEHA 3PD0A 4GNRA 3KOZA 1O96A 3H2IA 4FX2A 3R9IA 3W2IA 4KCGA 3DSRA 4BMSA 1JIVA 5KQGA 5DNAA 2BGRA 2VQ6A 3CRMA 2UVPB 1PQPA 1TT5A 2HA4A 2H1FA 2V8OA 3DYVA 1G9TA 1V7QA 4ISBA 1VL1A 2GYWA 2VWHA 1T26A 3H05A 3JASB 2H9AA 4G0MA 4PNPA 1DO8A 4DNFA 1MFPA 1IMJA 2JFZA 2OC4A 3WNZA 5KHOC 4ETWA 3MGBA 4ZQEA 2AQ8A 1UZNA 3LF2A 2AZ4A 4J91A 5FOSA 2D5CA 3RI3A 4E5DA 2CLCX 2YJZA 1YD7A 4G0QA 4CMEA 1ZD3A 1SXJE 4HDMA 2OORA 1L5GB 4HGPA 1Q7BA 1O58A 4FGUA 2WKWA 3CVJA 4R84A 1XNRB 4V0RA 3ZW8A 4NPCA 1XRMA 1YZHA 1RCTE 1LBHA 1XTSA 2EFYA 1H9AA 1THZA 2WT8A 4RY9A 2AF3C 5JAQA 4EMUA 3OE7A 2O50A 2Z98A 4LJ4A 5AW1A 1UUFA 3HYTA 3M6XA 3RTCA 3TMYA 4DT1B 1HZZA 3N2YA 2GAFA 3U7QB 4BNNA 3CUTA 4WACA 3U39A 3AFIA 2FW6A 3HGTA 4B6EA 5KC9A 1KDTA 4YAIA 1FXWA 2P77A 2D00A 4E32A 4TZTA 3E6AA 1DKNA 1E0SA 3IV9A 2MIIA 1R3DA 1Z33A 3EMKA 4MHOA 5JD6A 1DV2A 3JYPA 2XCSB 3PIDA 1EVLA 2C9YA 3WNVA 5IABA 4LBZA 4A2QA 5ERGB 3WYCA 4J6EA 5AI8A 3HB4X 3M5DA 4G0XA 1HT0A 3QBDA 1KK0A 2R8XA 4D41A 2FSGA 2FZGA 2Y68A 4XGRA 3GA0A 4N3BA 5JXWA 1WY7A 3RJ5A 1WP4A 1GFSA 3PFHA 3ZZNA 1DGQA 3K20A 5FBZA 3R0VA 1OY1A 3IP1A 4P92A 1E1RD 5HJ7A 2OGTA 3A7DA 4JEHA 1NR7A 5CFQA 1NXXA 4FFSA 4RQUA 3W5CA 1AKQA 4AUMA 3CUVA 3BA6A 1EIZA 3L7BA 4LK3A 5EQFA 2AG0A 2L82A 1OB5A 3LS2A 2A5GA 2JFWA 4XUDA 1J0AA 1JJ7A 2NU6B 2X9LA 4GM1A 1F0NA 4JSTA 1XJWA 1E5TA 3REOA 5AW2A 2OUIA 3RF7A 3LH5A 3ROXA 3WLAA 8ADHA 1ADFA 5CG1A 1FS5A 4JBYA 2Q4BA 1COWA 1CZLA 2QTZA 3JALA 4M46A 4OH1A 2Q41A 4QU8A 4RE6A 3UWSA 3H83A 1KORA 4NCXA 2F43B 2JHCA 1XZFA 1F1BA 1YVEI 2H3HA 4PGGA 1WW3A 2R65A 3L49A 4WMLA 3VO8A 4BO5A 3HC7A 1BHO1 1CB7A 4II3A 1KMMA 1MC4A 2JKVA 1E2JA 3AP1A 3PD7A 4BWFB 4GPD1 1R8JA 3L01A 4QC2A 4HDAA 2P9HA 1GITA 2WYVA 3VNBA 1WG8A 1L9KA 1TKAA 3AV0B 3GJ5A 3UJDA 1NPDA 1MVOA 4U7TB 3WA6A 3VVCA 4HTAA 5DBGA 1DDGA 2HBYA 2K5UA 3FBGA 1MEEA 4OQMA 3PR2B 4MXDA 4OREX 4XIJA 4ER6A 4WZAB 5AVTA 1WCXA 4RU1A 3GCDA 2VAMA 2QUIA 4TYYA 3TL3A 5B55A 1E1LA 1D1QA 1JHYA 1O97D 3CLUD 2G82A 3SLKA 4CQJA 1Z73A 5HJEA 3MYRA 1B0UA 1Z88A 3A70A 1ZHFA 2QT1A 2WWRA 2O8NA 5DCLA 4EITA 1HE2A 5F7ZA 5H82A 3THRA 4RD6A 4DARA 2O05A 1CF9A 1NR5A 4UEQA 3TM5A 3RRMA 4DM4A 1BE6A 4PIMA 4BKUA 4K9KA 3MD9A 3EARA 3QFRA 3MS4A 2I87A 2E7ZA 3PEEA 1W1IA 1CQJA 2WBLC 5LQCA 3X2FA 1Q3TA 2IYNA 3RUAA 1USUA 1T1RA 1EJ2A 3ZY4A 4FEAA 3A2KA 2GN1A 2EHJA 3GRCA 3R7NA 3QF4A 3V8RA 4CNQA 1P0MA 4IV5A 3P9PA 2PZBA 5KYXB 4UC0A 2I8CA 2YY6A 3U3ZA 5K0FA 1Q74A 3WJ2A 5I9BA 2IYWA 3KZKA 4UNQA 1R0WA 3ENVA 1V37A 4WW0A 4GUAA 4IIVA 3HNPA 3X1KA 4KH1A 2I1QA 1SG9A 2FX3A 3RJ9A 5JUWA 1W5AA 4XAQA 2GD2A 4J4TA 1NBWB 4DA7A 1NULA 3ZR4B 4BCDA 1VYUA 3C5HA 3L7MA 3IOYA 4B09A 4DIUA 2GZRA 2NO7A 1LPAB 3OEEA 4TOIA 2PMFA 4BY9E 1E1QA 1P73A 2ZWIA 1H0RA 2NVBA 2HMTA 5EPUA 2E9SA 2VPTA 4LV5B 3N3BC 5BSUA 4DQ0A 3H5AA 4LBVA 5EFZA 2BMAA 1EK1A 4LOLA 1U2GA 1V8OA 5JADA 1MR3F 2ZUWA 4LA4A 1RDFA 3IHKA 4KLZA 5K7SA 1MB0A 2C20A 3PENA 4ZI5A 3O75A 4MV8A 3LL7A 3C6MA 3BXHA 4AJ1A 2RHTA 3C98A 4EHFA 4HUJA 2ZJAA 1LFDB 1W85A 2I4MA 2J7PA 3IUBA 5EIFA 4AB1A 2OV8A 3UGTA 1VHQA 1PJ4A 4NZ9A 1U31A 2YTZA 1SBCA 4ZI2A 5JU6A 3VA7A 2B92A 2ZM5A 4WZBA 1EHCA 1XIVA 3KWJA 4RK4A 4YMIA 1G20E 3PJRA 4NHEA 1MD9A 1LF0A 4E2YA 3OPYB 1IQRA 1K4KA 3ET4A 3JAWB 4LRWA 4RLQA 3REFA 4LZJA 3WI7A 2Q1TA 1IM8A 1XVIA 1FS6A 2VHTA 3E1KA 4NK5A 2ISQA 4XVUA 2PX2A 2QP3A 1PJLA 2QTNA 5TPZA 2I8LA 1A98A 2V7EA 1H9CA 1YASA 1ECBA 2G1JA 2HBRA 4H77A 1KAGA 3Q1LA 4BMCA 4QFCA 4YS6A 4H3SA 3OBIA 2CNNA 3MZ0A 1GU1A 4M49A 3ZJUA 1P2UA 1WCIB 1ZNWA 1ONNA 3QEOA 2LCFA 3G9QA 3T06B 1FLDA 1MAVA 4CEJA 3T0IA 3CVWA 2JCGA 3KJIA 3TIGA 1A77A 4CLHA 3PE4A 2I9PA 2VH5R 4U6QA 3S3TA 2FPRA 3IUMA 2YXNA 2AVNA 2QVCA 4BNDA 3RVRA 2WTUA 1E7QA 3HXQA 3HPQA 1CHNA 3OOJA 1DQPA 2Q5JA 2G9QA 3QHAA 3AHGA 3P2JA 3K5PA 3QFSA 1A5BB 4DANA 1VG0B 3CNLA 5FUXA 1QH1A 2O2JA 1UBLS 1A9YA 1JWBB 1JV2B 5CLQA 3ZBTA 1YF3A 2IODA 3GDFA 1UAYA 2H16A 3BWBA 3KSMA 1GCOA 3K53A 3LXRA 3ILHA 3STVA 2IS1A 1JEEA 1YK1A 4ZHQB 1T24A 3BMOB 2AE1A 3L84A 2WWVD 3INYA 5JSZA 4YREA 4JI6B 1WBDA 2G6BA 4LJKA 3IJ5A 3V4PB 4WESB 4WN9A 1IK4A 3PTAA 4KLCA 4AIIA 1KO5A 4CDNA 3TZKA 4KMSA 4HX9A 1GPJA 1JG7A 1U99A 3HP7A 1DQYA 2WSMA 2X9NA 3F6YA 2ATIA 3QK7A 4RV4A 3LVRE 4KFCA 3CTMA 4RTKA 1U8TA 3D9QX 3ZTWA 3RC9A 5JMOA 5K8CA 2FJPA 1M6VA 3IAXA 4BNZA 2HO5A 4EZIA 3RYHA 5JZSA 4PXYA 5KYYB 4PRKA 3ZLVA 5LP6A 3C8ZA 1X13A 2ONZA 3K31A 3PR3A 1Q7RA 4B3RB 2R1VA 4Y2HA 3HDVA 2P2SA 1PIWA 4AIRA 1AK2A 2I2CA 3FD8A 4E1VA 1XOIA 1GGFA 2XZDA 2OWEA 1PS9A 4WLEA 4MQFB 1I24A 1GPNA 5EE0A 3FOWA 1AZLA 2NV6A 3B85A 4KQGA 2XY4A 3S4YA 2D3TA 4ZK6A 3OWHA 2VKQA 3ZCSA 3G9ZA 1JLSA 1POXA 4S1VA 1T9KA 1XUOA 1XELA 2GA8A 1TZCA 4EPVA 2JC3A 3TZQA 4MAMA 3ZHVA 5LQUA 3U62A 2CE2X 1CEYA 3JQBC 5CNKA 5CB8A 2KJQA 3K0FB 2WF8A 4MWGA 1TIKA 4WOJA 3KQVA 4DFDA 3U31A 2R79A 4FBMA 4LJ6A 4OYHA 3WNDA 2WSIA 3BD8A 2WKPA 4D9KA 2VDJA 2H2AA 4W8GA 5D84A 1FUIA 1VJDA 3B1YA 1Y4DE 2NG1A 2Q28A 5ILQA 1FBNA 3BB4A 5BWOA 1WBBA 4Z2AA 2GARA 3CB4A 2W2MA 2GN8A 2VJCA 4GOLD 3ROPA 4WY8A 2ATEA 2P7IA 5KNDH 4ZO9A 1W93A 4AQ7A 1QK3A 3V6LA 4DOMA 3JQ7B 3QPBA 4NKRA 1Y9DA 5AM4A 2IW3A 2OILA 1A82A 1IHDA 1SXHA 2EU8A 2JFFA 2UDPA 2WEKA 4MR8A 1DTWA 4X92A 1OXKB 5GGXA 5L7YA 1R0RE 3HZZA 1MOQA 1QGUA 1KZHA 3BMNA 4MR7A 1UBSB 1EFAA 4KR3A 5A3SA 3DQZA 5DI9A 1X7ZA 3I6ZA 4YRKA 1VRCA 5IAAA 3EQ9A 1G8JA 4D7AA 2PFSA 1UMDB 5C4GB 1RC1A 1Q0QA 2C57A 3MJHA 3CZAA 4R1QA 4TL8A 3KBBA 3RC7A 5CD9A 3UB3A 1JSZA 5JLJA 5L4LA 2JLYA 4QSHA 1O6ZA 1OXTA 3KPVA 4Y0NA 3TQHA 1ANKA 4EGCB 1OREA 2A2ZA 2H2IA 1YQDA 3RLFA 2HQSA 2GLTA 1V16A 4KR0A 2D8MA 1FF9A 2X42A 1Z34A 1VKJA 2GAIA 2GBLA 5DYNA 3MWLA 5CBPA 3RAGA 2FPLA 4XDHA 1SMKA 1U8YA 2JIQA 3PQ4A 4QX6A 4PICA 5ERXA 4RIFA 4O2AF 4Q4HA 1G2QA 4NMWA 3M1YA 1GNPA 1PT6A 2ID7A 3WFZA 2BTOA 4G4SO 4JX8A 4CMHA 1JFTA 2I91A 2IZ5A 2FLKA 3GLIE 1NATA 1GAXA 4X71A 1ECPA 1SCBA 3OEHD 3OA0A 4E5YA 5L3SA 2DT5A 4RGYA 1P1HA 2H2HA 2JLVA 4FXPA 3PGXA 1PJBA 2VJAA 1U0EA 1RJWA 2ODQA 2A78A 2DFLA 1L1RA 1XA0A 4G65A 4D02A 2ABWA 1FSFA 5DM2A 4P4LA 5J5CA 2OGWA 1ZOLA 2C0QA 2C5HA 2R4TA 4HXFB 3SEZA 4QRIA 1P19A 3CKMA 2PLAA 2A14A 4KQEA 2HA0A 1I5OA 1MJHA 2NAPA 3HN7A 1EXVA 4LE1A 3IXLA 3AB3A 3G2NA 3K0EA 3QVLA 2OG2A 1CQXA 4G8BA 1LC0A 2JLZA 2VPXA 4GM0A 4F2DA 1AKYA 1BDMA 3L46A 2WC1A 3GLGA 2A84A 1QU2A 4DWOA 1J2RA 2Q2OA 3NBQA 5IUJC 3WKEA 4BFCA 5EWLB 1U8FO 3CJTA 2WAAA 2W2KA 4UZSA 4ZVSA 2G1UA 1W76A 3ZHTA 1KEUA 3L8HA 3BULA 2ZS7A 5GQSA 3H5LA 2R5WA 4ECEA 3H5WA 1I2MA 5JD5A 2FSVC 2YFHA 1F4LA 2AFIA 3EOBI 2EX0A 1AC5A 1T35A 2FMXA 4H9GA 4KWTA 3BJZA 3IIMA 1MHTA 2GZ2A 5BNFA 3RIXA 2GA9A 2PSJA 1PSWA 2M6SA 3VVBA 2XTNA 5BOSA 1O03A 5MGNA 2BDTA 4FGWA 2F4VB 1KJYA 2JGMA 2OHFA 3IPRA 1B7GO 1R0SA 3TNJA 2ZIVB 4Y2JA 5KX5A 4OHOA 1EP9A 2G70A 2ZSDA 4R0NA 4MH0R 1E6KA 3IEKA 3ASZA 4BP9A 5A5FA 2C07A 2BFBB 2C7OA 1SPXA 2NTYC 4X7RA 1JNXX 3E5MA 3R8CA 2OFWA 2XVZA 3HPRA 5TPWA 2ZT5A 2B7CA 4RQBA 1Q50A 1B6GA 1NC3A 1RHRA 2QGFA 3EGDB 5BSRA 4H0FA 4QYIA 1NA5A 4ZDJA 2J3IA 2PFKA 1IN7A 4E4YA 2F9MA 3H3XA 3LX5A 4WTOA 4EUNA 2WWXA 1NXSA 3BWXA 3AIKA 2Q7OE 5ARCA 3FMGA 2R6AA 4J0QA 4N5LA 2JI8A 1ZWLA 3CF6R 3SZRA 5AW8A 5IKMA 4AY6A 5DNVA 3DHYA 3M89A 2LCIA 4OO3A 4UE3S 4W5RA 1OKKA 3BIWA 3IT1A 4MV3A 1DOZA 1PQYA 3ZIAA 1MORA 1XCJA 2ZRCA 2D2FA 3QYAA 5DN6A 1ODKA 1Y9JA 2R4UA 4RMNA 1JMVA 5DYWA 3SU8A 2HSWA 1DBWA 1M2KA 3GWGA 1P9OA 2O23A 4IXMA 1S1MA 2CVOA 3QI2A 3RUCA 3CVUA 4F0JA 1LDBA 2I4RA 2CJWB 2O57A 2P27A 2WJHA 3NORA 2J5BA 1R64A 1WLSA 2G3YA 5ALZA 4DGQA 1AJEA 1K68A 4R7TA 3HYLA 5JATA 2OHIA 4R1LA 4NP6A 3DZBA 4BWYA 1HT3A 2BBWA 4PM4A 1GXSA 1JQAA 1PZMA 5THQA 1J4AA 1DC8A 2ZUCA 4P4UA 1GPYA 3GUUA 5JCJA 5KTRA 3OQ1A 4L6CA 2W43A 3HUFA 3OUTA 3OFSA 3Q72A 4HDRA 4FFPA 1FK8A 1QBKC 3FCAA 1VLVA 3NT2A 2JD0A 4TWZA 2QKYA 4OU4A 4R05A 3PDUA 4FCWA 4MJLA 2QRJA 1JJFA 1U98A 1FTWA 3WBKA 3UC5A 1LWNA 4LY0A 2IEBA 4V0SA 4UTRA 4QG3A 5JXHA 4LXTA 3L43A 4IHJA 1P1BA 3K0CA 3UAYA 4IILA 2COUA 4ISCA 4ZMBA 5BYJA 5B1HA 4BMYA 5FEUA 1KOJA 4CETA 1GTRA 3MS2A 4NULA 4M0LA 2REXB 4OBBA 1UBCA 1G1MA 4WVLA 1ECLA 4HGZA 1OVGA 2AZMA 1Z2NX 3E84A 3FFXA 3L7OA 4KYUA 3E53A 3UK2A 2ZITA 1XRJA 3ETNA 1HL3A 4B76A 4IKPA 4LYJA 1XJ0A 1MLDA 1S4QA 2ERCA 2IZ0A 1UDRA 2F00A 5L40A 1QRAA 4EELA 4IFIA 2I71A 2HSDA 3B3FA 4XGQA 2Z8YM 3SVLA 1FX0A 3DBLB 3BQ9A 4KPGA 2GJ9A 2WTBA 4NVRA 1GG9A 2QRVA 1KBOA 1N2ZA 1LK5A 3QTTA 1MZVA 2Q6KA 3PHJA 2ID4A 3IBFA 4LJ7A 2D74A 3NTOA 2XF2A 4TMFA 1U9ZA 2VWQA 5DXAA 2FFBA 2JIZD 4QYMA 2YYSA 1SM4A 1FSSA 1P18A 4IHQA 2JATA 5DP2A 4RL4A 5DXFA 4O2AB 5HRAA 2NUTA 4P4SB 3K1JA 1N6RA 2BL4A 4JKOA 4F6CA 2FLVA 3KOUA 4CF6A 1TW2A 1WXIA 5KPDA 1SD1A 3OLCX 4KEAA 5BUZA 1DIOB 3PGKA 3PJEA 3EA5A 5EZYF 5CDYA 4F9GA 4M6WB 3B20A 4ETNA 1TGYA 3HDQA 1C8LA 1NFFA 4YVFA 3WQRA 1PK9A 3PLNA 1NI4A 1A7AA 4RCVA 3LK7A 4EPTA 3Q9SA 4IUDS 2RJOA 3M3DA 4JB0A 2Q29A 2G4LA 2R8ZA 1QRDA 3G5TA 1T5HX 2RONA 1P45A 2JGNA 3K3PA 4KN6A 3L5OA 1SKYE 2HDHA 2PWYA 1G5RA 2QK4A 4MJ3A 4NOLA 3V7YA 5DIZA 3W5JA 2PJRA 2YZ7A 2X2FA 4AJPA 3CF2A 5CDTA 5CFNA 4NEQA 1ABBA 4DR1B 1CJUC 1ORDA 4KQ2A 1GY8A 4DBZA 3CJQA 3C5CA 3GRPA 2OQVA 1DADA 1JT9A 4QUDA 2WZBA 3EGVA 1U0RA 3HYSA 2OBMA 5HZMA 1ZZEA 2IE8A 2YWXA 3H2SA 5HE8A 4IGKA 1YS2X 4L0QA 3FWZA 1SHKA 1CULC 1R18A 1JR4A 2VUIB 2VDUE 3GAFA 3BIJA 1JQ3A 1Y9EA 4MGYR 1SUWA 5MFZA 1QHSA 4CKWB 1XGKA 4X0EA 1VXOA 4UULA 4J6FA 2UYHA 1UC5B 2DUMA 3L06A 4HPWA 3FF4A 2Q5FA 4YUXA 3MCZA 3I64A 4P22A 1G8YA 2V7XA 2C3MA 3E9EA 4HO1X 3IQFA 4LNUA 1YCDA 9LDTA 2FPMA 1PYOA 1K63A 1ESDA 2XLBA 1Y8QA 2I7DA 3WRYA 3X1XA 5EJEA 1Y5IA 1XZGA 4WCDA 5IBPA 4ZD6A 4J16C 1ZU5A 4GXTA 2C2BA 1SU8A 3QPUA 3ETJA 3D8BA 1WPGA 1W5FA 1RI2A 3T7RA 2VH2A 4EKEA 2W6IA 5BSHA 4QD3A 3LUBA 4IEFB 2XDQB 4NPAA 3DJFA 2HRBA 5LBTA 3SNKA 1ZS9A 4GYYA 5DTRA 4QQKA 3SQNA 3M34A 4YTEA 4L15A 1RJ9A 1BA3A 4IDEA 5A7HA 4OFZA 3G9TA 1U6JA 3VSBA 1XHLA 2EQ5A 3GLKA 2IYUA 5H81A 3F8WA 3RIMA 1CS4C 2ZATA 3SCZA 1J8MF 4U7JA 4J9VA 3SZOA 3E9QA 3B1FA 2HDWA 3T3HA 1SIOA 3DEKA 1T3LA 4RXUA 3GGGA 4GWGA 3OTWA 1Q2XA 2CMDA 4H3KB 1CLEA 2E37A 4IQ4A 3IMEA 3OICA 3GEEA 2ZTLA 4RF2A 1FDVA 4RWEA 3WQSB 5EY5B 4MYUA 3FOAA 4GI7A 3B7GA 4BP1A 3GRAA 1UZUA 3K32A 1X6VA 3LZCA 5EHGA 5TMDA 1L5VA 1UP7A 4JQZA 4DLWA 3RH0A 1ZN9A 3YASA 4YR7A 5IZCA 4ZRDA 4CRWB 1US8A 2WY2D 1CZKA 1GCIA 1P9NA 1RZ3A 1GTG1 2ZVQX 1ZM4A 4MWZA 4OLHA 4PNHA 3U3JA 5CDSA 1U9IA 1W35A 2KLHA 5A62A 1PF7E 1IBKB 1CDDA 2QVGA 3C41J 1C3EA 3DP7A 5CYFA 2B5WA 4KI0A 2B36A 2HRQA 3LX4A 2ADOA 1TI7A 5ED0A 5HM6A 1S8FA 3DEAA 4NRDA 4PO3X 2IZ6A 1M1NB 3I8XA 3QVJA 3WGZA 3AVXA 2DBRA 3OOEA 3KUUA 3OOWA 4Y6LA 2OK7A 1T8RA 3EBLA 1V3VA 4I5IA 5ECWA 2ZJ6A 4GZMA 2PUDA 2FEXA 2WHPA 5CYPA 2OOSA 5CITA 2I2XB 3GEPA 1Y48E 4HXGA 4OFXA 5K0GA 4C6HA 3MEQA 4OMCA 5A71A 1PJSA 1FNBA 1VHTA 3A6LA 1A8HA 2XR1A 3BBPA 4M9QA 1UZMA 2BBOA 5FA8A 1NVMB 1ZK3A 2A88A 4JX9A 4HDKB 3AU9A 3SD7A 5DWVA 3U5ZB 2D0PB 1UBRS 3IEIA 3EGXB 3QVSA 1VDMA 2JIBA 1S9HA 4GPZA 4OLJA 5E4TA 1T2DA 4OAOA 2B2NA 4X6UA 4NMHA 4C2UA 1QYRA 2YVLA 4F3YA 2P3SA 1FP6A 1CEEA 5EHZA 2REQB 4AU1A 5GZ6A 3WYGA 3ZNNA 4NZPA 1VJ0A 2XD4A 5I48A 1P0CA 4AJOA 4RF5A 4P7FA 1QE0A 1UEJA 4QBTA 1YB7A 4QU0A 4WNYA 4A91A 3BRSA 2WUWE 2GM3A 3B6KA 1LH0A 1UFVA 2PKRA 3PXUA 1FP4A 2WFMA 5BN1A 1RPTA 1K8ZB 3EMBA 5FA5A 4FMBB 4MULA 4IJUA 3U81A 3VDNB 2JHFA 2P30A 1X7XB 1G8HA 4OHBA 5T3UA 2AMFA 1QRSA 3COZA 4FGSA 1XXHE 1E0KA 3ND5A 1XKLA 4FWTA 3QTBA 2RDMA 1NBOA 4NFLA 4G0VA 3ED5A 3V8NA 2IX3A 5EZYB 3NHBA 2BI8A 1G19A 2ENUA 2HR1A 5JS6A 3FA2A 2W98A 2KS6A 3AIOA 3R76A 4Z4CA 3R7DA 3LLCA 2IELA 5DM1A 3LUKA 1ENZA 1FUEA 1IB6A 2W11A 4HNVA 2DECA 1VCOA 4Y2PA 1NTOA 2HCBA 2IQ5A 1UC4B 3WFJA 4V1CB 1H3FA 3TJZA 5LVAA 1Q1EA 4Q47A 3DE5X 2HX1A 2FJUA 4JKYA 4WERA 3JQAD 3ZE1B 4B80A 3LE8A 4BLPA 1DDOA 1YR9A 2HK7A 2XB8A 4CIVA 4R2MA 1P77A 1E1YA 2YWEA 2ZUUA 4ZCPA 2LWIA 3I0MA 1DZIA 4NH0A 4MRMA 1TUGA 4K46A 2OZVA 3QHQA 5E7IA 5J59A 4TXHA 1JU3A 4TV8F 3U49A 5IJXA 3D7RA 4RTQA 2VSYA 5SZIA 1C0PA 4F96A 1XDGA 2LTAA 1DAOA 4JLJA 4B6FA 4F6LA 1W4LA 2WW8A 3SZUA 1A9XB 3H5VA 4KNVA 3NEPX 3QV2A 1Q21A 3UEOA 3WOVA 1HNWB 2JJYA 1Z5ZA 2Q7XA 4MEAA 2UZIR 4IQ8A 2DFDA 3BWYA 4KJXA 4NOMA 4OMFG 1F3OA 3QPCA 3P9XA 3Q5DA 1XZ8A 2EHDA 2G80A 4YJDA 4YMTA 2JAQA 3HCWA 4PAWA 3U7GA 2G9RA 5EIEA 4TKUA 2HCTA 3ZH2A 3DDNA 3C24A 2VYND 5CLIA 3Q6NA 4JU8A 7MDHA 5FPPA 4C4XA 1N2XA 2VJBA 3FTQA 1ZVMA 3CWCA 2GCOA 2OAP1 1DOHA 1Y98A 5DM0A 2Y4OA 5I9SA 5IBCA 2IS4A 1UFOA 1RTTA 2KHZA 2P9QA 1NV8A 2ZTVA 1CERA 1F2UA 1QFMA 3FIJA 3VM6A 3TZHA 2P5TB 1ZK1A 3T54A 1XSEA 3G59A 4QDKA 1JEAA 1SVWA 2GXSA 3EY4A 4UUPA 3ZWPA 3KFVA 4MS3B 1N1EA 1U4SA 2HM7A 1M2VA 2FWRA 3U16A 2Z5VA 5JR3A 1ISPA 3OZFA 2P9YA 5KO2A 4OEHA 5G0TA 3T0GA 1G6OA 3DXYA 1YRBA 5LDHA 4EG3A 1Z15A 1PR0A 2CK3D 3LBNA 5KWIA 2PE5A 2PS0A 3UK1A 1WEHA 4WCVA 3TFOA 3PWZA 4E1BA 2P6UA 1PLLA 1DJLA 1EEHA 1NXQA 2FW8A 2A5YB 4HDSB 1M1ZA 1XVVA 2E4YA 3DOEA 3KB8A 5DTIA 5EE3A 2G9VA 3NZEA 1QRRA 2VHYA 4MUAA 5BOVA 1XTQA 3RT7A 1R37A 5ADWA 3ADOA 1G16A 3KXKA 1A69A 1Z0IA 4YRDA 3TW4A 2P9FA 3HEBA 4XTRA 5AUOB 2VOEA 3P1JA 4F4FA 1U1GA 1P80A 2DCMA 1E3IA 1X8JA 2Z5FA 4PNZA 4QOJA 2AQHA 3B3QA 4IIFA 5K20A 5JO0A 1JJIA 1DV1A 1G5PA 1C2YA 1TC1A 2ZBPA 1QHNA 1B26A 2QNBA 5HHTA 1JWLA 4RDIA 4NE7A 4LOIA 2FZ5A 4MUJA 3HY4A 521PA 2BGJA 4MKFA 3LC2O 3PVSA 4TRRA 2GN6A 4TL7A 2ZRNA 3IR5A 4JJ8A 5ITSA 4BMVA 2DETA 1D7AA 2PUGA 2AFHA 1W44A 4BB6A 6Q21A 4RKYA 3NM6B 4QTYA 3IELA 1I1NA 3V34A 4GR5A 4DV2B 3ORHA 1DB3A 1ZVQA 1KVTA 3BWEA 3EPLA 1ZA1A 3NVAA 4PR0A 4UBOA 3RW9A 3HVJA 1VIVA 2Z04A 2OBXA 4HG2A 5FFNA 3G2LA 3TCXB 5BNIA 3LRTA 2BMEA 4MIKA 1Q19A 4YRQA 1SUIA 3MHPA 4BO6A 4AJJA 1YQTA 5C32A 2EYUA 1Z6AA 4H6PA 3PVZA 5AKEA 5LWQA 1Q16A 1GQOA 1ZMBA 1Z2AA 3DP9A 2G04A 1LVHA 3V7NA 1NDHA 1PNTA 2YY5A 3UUGA 3EIWA 1BVHA 1RBQA 1U2TA 3HDGA 1NQAO 3QELB 4D4KA 4YWJA 5JV5A 1KO4A 1XAJA 4BJHB 4HAXA 4RZSA 2EJCA 5K9ZA 2VPQA 1NQ5A 2WSSA 1D3AA 4FU0A 1EK0A 1FW8A 4O4IF 2DMRA 1P61B 3ND9A 4O4LA 5BQ5A 3A05A 5AIAA 2QVXX 3T3MB 3AUYA 1Z36A 2QT0A 3WMWA 1MJGM 2BELA 3ONWA 4HLNA 1Z25A 3M6UA 4Q15A 2XDYA 2W8BB 3PQ6A 4MIOA 3R7AA 3TEMA 5TIIA 2HGZA 3LOPA 4NJOA 3NWBA 2J31A 1VIMA 1X9GA 3G2KA 4M36A 3RPEA 3SBEA 5LJIA 3CF0A 2YXDA 3PDWA 3PEVA 3OHMA 5DISB 1FNDA 1DJMA 1B1CA 3HEMA 3NYQA 3GY0A 4UM7A 3RVBA 4AS3A 4F2GA 3ZQKA 1TQ6A 3OTQA 4HAZA 1F2TA 4O2RA 4DIKA 4TRMA 2OBYA 1VLZA 2GCGA 1IZ0A 1FFDA 2QUZA 4JODA 3L0YA 3S28A 4B71A 3AVTA 4W9NA 3VC2A 2FWNA 4RTPA 3L6EA 4ND4A 1FFCA 3CY6A 4D45A 3NJRA 4DE5A 2XMDA 2D06A 3IQEA 3UHPA 4DDUA 4CG1A 1T13A 1G41A 1R0XA 3HE3A 4RXMA 4WAUA 4YJKA 1A76A 1KJ8A 1T8SA 1YJ5A 2ZRDA 3A14A 3DEYX 3GI1A 3IJRA 4MS1A 4BVKA 3OQBA 2P6PA 3RTEA 3ZHCA 1Z0DA 1GA6A 1MXFA 1RKQA 4XM1A 2PLNA 2AJCA 5I9TA 2UUOA 2B4KA 4ER0A 3CUYA 4BRSA 3GGPA 4Z1OA 1A4RA 2PUJA 3NNSA 4I66A 4NE9A 5EYPB 5SZHB 4EW3A 2E49A 2NTVA 4OOEA 4NCKA 2D6FA 4TT3A 1J8QA 3BSYA 3N05A 1C81A 3K73O 5ALLA 4J2TA 5HCNA 3DBHA 2D1FA 2I33A 3I0ZA 3AHHA 4GOJA 3P0FA 4OA8A 4ZAVA 5FOVA 5G0UA 1O95A 2FNAA 1TA4A 2VK1A 1NYQA 3IT3A 4QPCA 5CH5A 2B7BA 5HFNA 5L4NA 1YJXA 3A6GA 1FIUA 1F60A 1Y1SA 3EG9A 3LLVA 5I7SA 5JCPA 1EZ1A 2JGDB 2BKEA 3H9JA 3TNDA 4C0JA 5K09A 3FMIA 3GUYA 1U3UA 1IH8A 2H1LA 3SYMA 1KF0A 1NX9A 2AYZA 2BRUA 4K2HA 5HWSA 1YZVA 3BRWD 2WJIA 3UH0A 3TR6A 3ZK9A 1A8IA 3CN9A 3WRVA 2B0CA 2MJLA 1KMIY 3AR6A 2XUZA 3D4OA 3MWDB 4X3CA 2EF0A 2NACA 3SYKA 1P91A 5BSWA 1U0NA 1L8AA 1TEVA 2R48A 1TF5A 1U8AA 3GUZA 3GO4A 2RGYA 3ST7A 3U37A 1PQWA 2AV6A 1BXZA 2OENG 5K01A 1FDUA 5FWYB 2H7CA 1DKQA 2G4VA 3ONDA 1EG7A 2P2ZA 1XLTC 3QYPA 4HAVA 3WOHA 3MXTA 4TUYA 1AGXA 4CV2A 1TOAA 2RD2A 1NXVA 2JK0A 3N2LA 4Y1FA 5CVEA 5KINB 2JIDA 1W2GA 3QVXA 3TGLA 4WH0A 1GG2A 1I94B 1NR1A 2ZUTA 2Z58A 3O2QB 4DABA 5JS7A 1I9CA 3I8OA 4Q9LA 4LECA 4N47A 3VAAA 1N33B 4LXYA 3WRWA 4RHUA 1OBCA 1DJOA 3GJ6A 1XRRA 4E2WA 3U9SA 4KSCA 4ZK2A 2Q8PA 4JYMA 2OBLA 5D3KA 1FNSA 4G36A 2BM1A 4C4SA 2XTJA 3KO8A 2ODNA 1M6EX 4XVRA 1OIXA 1QH8A 2HJHA 4R2LA 5DHUA 1MQ8B 5EUMA 1WUHS 2VP6A 2AEEA 1OROA 2YN4A 3HDTA 5AXDA 1PNVA 4C43A 1C8VB 4B3IA 4S2UA 3A04A 4GR4A 4GX1A 5B37A 1Z6GA 3O73A 4PZYA 1HY3A 4DJTA 1IWOA 5K2MA 3HGMA 3Q3EA 1S4MA 4WBNA 5A4KA 1V4NA 5CIQA 5IS2A 4MP3A 2G36A 1E0AA 3FOFC 3L0BA 4MJXA 3BTVA 3IX7A 2QTLA 3PNOA 1H4SA 3IUPA 5HFJA 5BV2P 4BYGA 3AILA 3OPYI 1J6UA 1RMYA 3GAMA 4I1RA 1OH7A 9ABPA 1UBEA 2DBYA 4YP7A 4UTNA 4BO2A 2ECOA 4CKXA 1A8SA 3BD7A 3MJRA 4LJ8A 2NUAB 3AUKA 4MUHA 2A8YA 5AYVA 3GJSA 1BVRA 4K6HA 1NOKA 4PR3A 2XKKA 4A8HA 3L0IB 4CR7A 1RXWA 3PQ3A 4X1KA 5EHQA 1J5XA 3E2PA 4QPDA 3SR3A 1QDUA 3SSAA 1Y3DE 2EIHA 1P7CA 4W5WA 4YXWD 2HJWA 4KWCA 3ETLA 4ZYUA 4ZTUB 2PZLA 2RGRA 2ZROA 4PAMA 4PZPA 1W0KD 3LECA 3S1LA 3T99A 3N6XA 1AMNA 5EUCA 3KZXA 3QI7A 5TF0A 1VYTA 3IVRA 2W0MA 3B5EA 4K88A 4QLOA 5EKSA 3TW8B 5ICGA 4V0MA 2WMOB 3O3CA 1W8DA 1NKVA 4MWSA 3ZI0A 1Z0KA 1YAJA 3HN2A 3C3YA 4RA9B 1E2LA 1R0YA 1RJDA 2Q3FA 3D0OA 2G25A 3EVDA 5AFSA 4Y1RA 3LVFO 1V1RA 3UMFA 2IHNA 2E4WA 5EGNA 2DHCA 4BZWA 2R8RA 4JUAA 2R62A 4D9NA 1B73A 4Z54A 1MU0A 4ZJYA 2P2YA 2ZIUB 2ZBFA 4AWBA 4EZEA 3X43A 3BAFA 5A7FA 3TZBA 5JRJA 2Y0BA 3CLTD 5JW6A 2ZB3A 1H2HA 3JQAB 1ODTC 3LUDA 2LBPA 3O8CA 4PSKA 1SOUA 4KO2S 2P2CA 4G41A 4I5GA 1KYZA 2ZRHA 3RSGA 2B25A 2JBWA 3KV3O 4AZWA 4RA6A 5HGJA 4F2WA 1L8QA 1EUZA 5IEJA 4I55B 1HSZA 3ZGXA 4DG5A 3LDHA 3TJRA 3DKPA 1W5EA 2Z2IA 4IFTA 4WKOA 2QQEA 3QPDA 5C52B 2C9CA 2RFLA 4NBUA 2Y1KA 2OMKA 5FO1A 4OGWA 1AQIA 3SDSA 4X1YB 1KSFX 3JWGA 3V2IA 3OU6A 4BNFA 5F3WB 1A1SA 1NKSA 1X2EA 3KS9A 1KKMA 1Z0AA 5C7YA 5C35A 2HIHA 2OV1A 4RPIA 2FK7A 3VMFA 4OI1A 3AVOA 1EGMB 1JAYA 2CXHA 1N7GA 3INTA 1JTVA 3PEUA 3MTIA 4I1VA 4K6MA 6GPBA 5IXYA 2VSNA 4FE3A 4RHFA 5WRFA 4A9AA 3IULA 4V1CI 1H4QA 2VDMB 4QKQA 1DC5A 1TZ2A 1UP6A 4YALA 3ROEA 5A9RA 3WQBA 3HSYA 1J56A 5B58T 4C1NA 1YR2A 4RVCA 1PWYE 4FWIB 1E99A 2DWPA 3AETA 3IAS1 2Q3DA 2EIXA 3OPVA 4CV0A 4F8EA 2JJ1D 2VDWB 1HYEA 1N1GA 3DOUA 4Q18A 4WV3A 3F6BX 3ZWXA 3IXMA 1XE3A 5ITVA 4W9RA 1MAWA 2HYDA 1P74A 1WSWA 3F6RA 4OP1A 1GUBA 2P5UA 3HO8A 2GVNA 3BWMA 3EBOA 4JXKA 1AGPA 5JSUA 1CR6A 3V8PA 3PQFA 1KZ4A 3URKA 2F2TA 1VCIA 2J0VA 1PHRA 1JP7A 5KAMA 2IUUA 2OXIA 4GPBA 2GCEA 1K8YB 2XRYA 1XDUA 5IH3A 1UQUA 3HMKA 2B3TA 2XVXA 3MT7A 1GZSA 2PH1A 4R2JA 1X8XA 3ON5A 3WK8A 1JR2A 2WNIA 2ZFUA 3B1XA 1T9ZA 3HWRA 1LZKA 2HN9A 2V0NA 4BN5A 3M6VA 3SE0A 5C80A 2OFPA 2D13A 4JZYA 5DHPA 4JGBA 4PTLA 3W6UA 1FXWF 3AL3A 3RDPA 3CNNA 5EMMA 4HDQB 1QV6A 2I8AA 3I0NA 5FWXB 4E3WA 5DGIA 2F3QA 2IDMA 4Z1MA 2PUBA 2DQYA 3BE8A 2R1ZA 4AROA 1IMOA 4ZO8A 3RLIA 4DILA 3QX3A 1IPHA 2V7GA 2C3PA 2VP3A 2Y66A 5LN1A 2JLAA 4U5QA 1QKJA 1QIGA 1Q0ZA 2GPAA 4Q9DA 3VPCA 5TR9A 4C04A 2YFYA 3BCSA 2EP5A 3IRUA 3NIWA 4Q93A 4CLDA 4DDMA 4HD8A 4G4JA 5IKXA 1N5OX 4F92B 3GT3A 4LF9B 4E3ZA 1E3EA 3PGVA 4DLPA 5AUPB 2QD5A 3D3NA 3W6OA 2ZZMA 4KN9S 2XCQA 3QKTA 4EG4A 3ICPA 5HKKA 4PX9A 1QYDA 3BMCB 2A94A 1TYAE 3G2JA 3CZRA 5E38A 2W6JD 3KTOA 5A9SB 1Q1GA 3UOWA 3DC2A 4EI9A 1U2DA 3KPUA 3PC8A 1N2GA 1XMJA 3IBYA 1HE3A 1D5WA 1QVZA 4R51A 2QGZA 4WY5A 5LC1A 4RTNA 1AZTA 1W4ZA 3K0AA 3GELA 4I1PA 4DLVA 4ZIRB 1CS0A 2Z56A 5E9WA 1M7HA 2VBGA 3HM2A 4TSKA 4Y8VA 3UUWA 4NYIQ 4ZOLB 3PX3A 2X8WA 3R5JA 1MA0A 1U2ZA 2CL6X 3CSSA 1AS3A 3HM9A 4EMSA 1WZEA 2QLFA 3WZLA 2WMYA 4RKQA 1K7YA 2QW1A 3QU9A 5AXCA 5DPMA 4CBVA 3DAGA 4HVAA 4ERXA 2IYFA 3UT5B 4CEHA 4UXJA 1VMKA 2CLSA 1J8YF 2M32A 4XSGA 4PAOA 4PBSA 4BB0A 3F3KA 1QIIA 1GJRA 1ML3A 1YR7A 4I08A 4RKRA 5K3CA 4DCMA 1R1DA 4TYQA 2ZYSA 3H4VA 4B3SB 3M83A 3OAAD 4FCVA 5FPQA 3ANYB 1KO8A 4OA5A 1C3JA 5FD8A 2QE7A 5IM4F 2ZBGA 3O6VA 2CDCA 1EB9A 3B9PA 1FRFS 1MX1A 3N8IA 1GGEA 3FYUA 3L1JA 1HE1C 1IQ0A 2ECFA 3SEQA 3VHRA 4NTZA 5JHGB 3SXUB 4YPFA 3ZV3A 4EYKA 2ORED 3JWHA 1GG8A 1ZBQA 2QA5A 4JB8A 4PCLA 4E7OA 1DC4A 4UUMA 1JHUA 4CUKA 4BWGA 2ONKA 4E14A 2H7YA 4V39A 5FLKA 2GAAA 2X19A 4J76A 5BW5A 4OQPA 4DV1B 2IE0A 2H2WA 4ZQHA 2DTEA 3VR6D 2PSHA 3UC9A 2LE0A 1IVSA 2GZAA 4JJAA 3PYLA 1NVWQ 4OPMA 3B48A 2NVUA 4NF2A 2H59A 4NENB 4QJIA 3MINA 5DB4A 4YQFA 1JFVA 1GT6A 2C1ZA 1B8PA 5CRIA 4ZOCA 3UMSA 4ZOBA 2ATVA 2L69A 5A4FS 4P0PB 4IF6A 2NSHA 1D0VA 2BP7A 4OFWA 4OHFA 4WOCA 3W06A 1ZW1A 5EXDA 5L7WA 1W25A 2I4LA 1QIFA 3KP1A 3VPGA 3RRBA 3DE3X 3VNVA 3N2EA 3EQ2A 4N3CA 2PPLA 2J33A 4RK0A 1KI6A 3L5KA 5I51A 1XTRA 3U3RA 4UAUA 4YV1A 1X1TA 4ECAA 5CFOA 3NHYA 4J49A 3OQPA 3THXA 1X1CA 4YCAA 3ZDCA 4C3OB 1JJVA 1G8MA 3RAJA 1JECA 3OFKA 1CR4A 1CE8B 2NZ8A 1DKUA 1WXQA 3RO7A 3PF8A 2OGSA 2UUAB 4BQPA 4DSAA 3ESXA 1GZ4A 3STXA 4ZV7A 3KYDA 2PCJA 2P1RA 3MN1A 1DIGA 1N0VC 1DJNA 3KBOA 3C3PA 3Q8KA 1O96B 1SBYA 2EJVA 3LC7O 5HUHA 2B83A 1SA0A 4KAFA 1GPBA 4AMYA 5J40A 1WXDA 1T2VA 5KBYA 1W36C 4WKGA 4L28A 3F7NA 3GJXC 3KXPA 4GVPA 5IBRA 1NNSA 2O7NA 1FQWA 5EIHA 5U4XA 2X0IA 2JBAA 4ZI7B 5H4GA 1TYDE 1UT5A 3FIUA 2I34A 4H1HA 3BTOA 1MDBA 1ECGA 1WOMA 1J39A 3MGGA 5DM4A 5FPSA 2RKWA 3RVNA 4BFTA 1RRCA 1QORA 1TM2A 4ND7A 4CQMD 5C1OA 2P9TA 3C2QA 3R3VA 4R6XA 1XBTA 5TGTA 3ER6A 2E85A 2XRFA 3L0DA 4C89A 3E9ZA 3RS2A 4HFNA 1V25A 1AIPA 4KYTA 1QWOA 3NP9A 4CKCB 3GDWA 1SUFA 4UHBA 1BN7A 1E3JA 1W0CA 1ZCFA 4DUYB 2WM2A 2JJ2D 3X3HA 3VR3A 2VP2A 5B30A 4YRFA 3AVWA 2WIFA 2QJWA 3RSQA 3BORA 3ACDA 3NOVA 4OOFA 3STUA 4RVSA 2IIQA 3FYCA 5DVZA 3OSZA 3O1JC 4TWBA 1OFUX 3PNMA 2JPDA 2A1UA 1Z38A 4J7UA 1KZYC 2XA2A 3K1ZA 2ANCA 4B40A 2HGSA 2JKZA 1UEXC 3DO8A 4YAFA 5I7VA 4F4UA 1II8B 2ZI6A 1BH6A 2N9UA 1W48A 2CFOA 4RUKA 5BSMA 1K8XB 4ZCSA 2HMUA 3OJLA 2VJKA 3VHXB 4XA8A 3SC2B 3KQQA 4NU6A 4WGFA 3S70A 3H6GA 4ZHSA 1B3BA 1GPAA 5JH7A 4O25A 4YRIA 4UVDA 5FPHA 3A6PC 1JR3A 3TZCA 1R16A 1K7XB 3AU8A 4HWGA 4PBRA 5LMNB 4MQ4A 2Y93A 1ODFA 1A9ZA 2ET6A 2HRZA 3LKDA 4ROTA 1DWPA 4C76A 2VHZA 1E92A 4CODB 1IN5A 2GZSA 2P1DA 4UBKA 1VL5A 2PDAA 2QG9A 2W70A 1MJGA 3ZPXA 2FFJA 2JJQA 1PNRA 1M1XB 2KM1A 2NX2A 5JZBA 4PC1A 2I6FA 1EESA 1NURA 1DFHA 2O8BB 3HH8A 4FUQA 4IIHA 4RQTA 3R7BA 3QEBZ 1Y8CA 2IZ7A 3H2BA 3EVTA 2X23A 3OIDA 3ZQJA 2Q0XA 5C18A 1SB8A 5HGXA 2DLNA 2G83A 1P7WA 1O7JA 4RY8A 5FL7A 3GFQA 3HWX1 4HAOA 1V8FA 2XE4A 3O4VA 2E4AA 2BZ0A 2IYEA 3IGFA 3DF7A 3JALB 5GIPE 1EFVA 1MW9X 5HIAA 4AD8A 5G2OA 4EQ6A 1M7BA 1MA3A 1P33A 4KIJA 1IUPA 2IS2A 1K2VN 3EFOB 3ZTYA 1Z06A 3ES9A 3HBFA 1UF9A 4REQB 2RGUA 5LP6F 3VUEA 5FLXA 2V4UA 2JLUA 3H18A 4P3XA 1J70A 4GQIA 2AN5A 2E48A 3Q11A 4NAHA 1LW7A 4ZVNA 1Y8AA 2WYUA 2WP8J 4H31A 2DVMA 2GEJA 2HNKA 2GNAA 5DX1A 4XIYA 4NR0A 3FCYA 3JQGA 3SWWA 1QTRA 1A4IA 1S89A 4BIIA 3VNAA 3PEYA 5B7PA 3ER9A 3LJKA 2QPOA 5BN3B 1XCOA 4BE4A 5JDIA 3NMUF 2GEFA 4QFDA 4BO4A 1YJCA 2QG4A 4YQZA 5FF9A 2O8FB 3D6FA 3GLFA 2A1IA 1FUUA 2OCXA 2XZTA 1Y63A 1RWNA 4K9OA 1MX3A 3DLTA 2OV4A 4B2IA 2ZVPX 4W4TA 2I5PO 3A11A 4JI7B 2A5DA 3L3BA 3L8ZA 4FDUA 4JAVC 4A8JB 3OQHA 1QS0A 5U9CA 2ZJ3A 4P31A 2J3DA 4MICA 4ZODA 1AKTA 2VP4A 5F51A 4PIVA 1ADYA 1Z5OA 1UPXA 3RUHA 1M75A 1GPUA 2XCRB 2ZU0C 3LK6A 2J9ZB 2QQFA 1J1ZA 4XXHA 4NCJA 1GZ5A 2B4RO 3QF4B 1CY0A 1UJBA 2UKDA 3UNXA 4FGKA 4KBFA 4A1FA 2JFGA 5DNCA 1AUPA 3WQHA 2OAGA 1EZZA 3WWEA 1A4UA 3FR8A 4CN8A 3I73A 1CJCA 1M72A 2BMWA 2PY6A 2VAWA 3IJPA 1SVMA 5EXXA 4A2WA 3BS4A 4XD7D 4R1PA 5HKOA 2VQFB 3W2TA 5KQMA 2IHZA 2IP2A 1A0OA 1SXPA 2XWJI 5CT9A 5HDQA 1G3UA 4KXUA 4XIIA 4BBJA 3NEAA 3WKAA 4CXMA 1FCJA 4L74A 2C7VA 4CIAA 2F3SA 5A5VA 1DIBA 1XU7A 5FP0A 4RMHA 3EUFA 1RW4A 4KTVE 4EI7A 1L8LA 1C7ZA 2P3QA 3VNRA 2HZ7A 2R86A 3A9UA 4XPZA 4R7GA 4CM3A 4WGGA 1JPVA 1CU1A 3L7LA 4QRHA 4N5DA 1P6UA 2CSUA 3U4IA 1PDOA 1XXLA 4R1NA 2P9BA 1U2SA 4CHTA 5JZVA 3H0KA 4YPVA 1PJ8A 1EXMA 1KO7A 2BFFA 4TTQA 4AJHA 3VAZA 1JDNA 4KC0A 4DCNA 5L95A 1V6SA 1Q5PA 2IDZA 2NXNA 3V6MA 1Q0TA 2OCDA 2OG1A 4HWSA 4JH0A 3IV7A 2MHCA 4YGYA 3RANA 2PYIA 4P6VF 5JY1A 4Z49A 1HDOA 3G0BA 1H4TA 3NHJA 1WEKA 3ZWDA 3KR1A 4A0GA 3QUBA 4B8WA 4B4KA 1AXGA 1Q0LA 4W82A 4KZKA 2FN7A 5LA6F 5AW3A 4O3MA 3VKGA 5KYUA 4TXNA 1M67A 4P3NA 4LMRA 4ZCRA 4QQFA 3V4VB 1GTL1 4RK7A 2PSFA 1QFXA 3EY9A 3WYDA 2CFSA 1V43A 4LHVA 4RKEA 2OYSA 4CFYA 3U1VA 1TPYA 2FMFA 1THMA 2LRHA 2OK8A 1YI1A 3L40A 1M8KA 3OY7A 2O3TA 2F62A 1B43A 3O5AA 4YCDA 4BASA 5JAUA 1A97A 4CEJB 2ZETA 3OIYA 5GADl 2X0RA 3N2IA 3MBOA 4GMXA 3UFXB 3PPVA 1KPGA 2H63A 2C3YA 4WINA 1YI8A 1HYBA 2XD9A 2XECA 3EAQA 1W5TA 3I6BA 2WD9A 1LD3A 1J20A 4MWDA 5CTAA 4EVRA 2E4VA 1PT8A 3A27A 3RBZA 5HRCA 3K0HA 2BF4A 5ESWA 3O4FA 1YJAA 2HIGA 2C61A 2C2YA 5KX5F 4YECA 2FFRA 3KTDA 2P9CA 3FI9A 4UHKA 2RAVA 1I51A 5DHTA 5KNCA 3ZHSA 2JGEA 5FCDA 2XE6A 3ENNA 2Z83A 2H2FA 1U7OA 4ON9A 3DVQX 3EC1A 2C9MA 1QO0D 1IK6A 3KVYA 2WWHA 3GG9A 4K7JA 3VKHA 4U2DA 1D2NA 3T9EA 2H4ZA 3KHKA 4FSHA 4U00A 5IKEA 3ZBPA 4BNXA 2WK1A 5JSZB 1L0BA 3NGMA 1OI3A 3AM3A 3E0XA 4YRNA 1J33A 4TWIA 5HK9A 2GF0A 3RWOA 4QODA 5EKDA 4WN9B 1GYRA 4BAUA 3IDAA 3P4XA 1DP4A 1TLTA 3H9EO 1F0PA 4FQ8A 5ILGA 1LBSA 1GLNA 4QTXA 3KCQA 4L76A 4ALJA 2IW1A 3ZS8A 3VNSA 2B9VA 3GU3A 4BN4A 3RYCA 4L4UA 1DBRA 1MP0A 3AW8A 4GL2A 4AWXA 1Z8NA 1QE5A 3K4QA 3FPAA 1GL6A 1NZFA 1XVLA 3EQZA 3PQEA 1P4GA 4FCCA 4MLCA 4QE3A 4BTEA 3HABA 2Z2XA 3D31A 4I8DA 3CWZA 5SY4A 1C30A 2R1VB 3MJEA 1ULAA 4URZR 3H2KA 1K9VF 1OF1A 1OLSB 4OKIA 2LXNA 3AK4A 4YT5A 1YHNA 3KV1A 1K98A 3P9YA 3I2FA 3TXYA 1KVUA 2NO0A 4FYPA 5E0OA 3LQYA 5FLYA 4EFKA 3KE9A 3OI7A 3T9DA 2IXGA 3BFJA 2OYCA 3A9VA 1C1HA 5L3QA 1RVV1 1YZFA 3L7JA 1QZ3A 3HR7A 3VR2D 5JASA 1G4AE 3GZNB 4YA6A 4D3ZA 4MYRA 1U90A 3ZNOA 4C08A 2D7JA 5FRDA 2WUVA 2GKSA 3TE7A 2RK4A 1R0KA 1Z3CA 3PQ2A 3WL7A 4Q7QA 4AUNA 1XEWY 1X77A 3G2QA 2H18A 1B8NA 4KQIA 3RS4A 3QZUA 4EI8A 1J07A 3JR7A 3R5KA 4NCHA 3BT7A 1ULZA 5TQ0A 4QGFA 3H99A 4PYNA 1KDOA 1Y4ZA 3IOCA 4IHJF 4X95A 4QSMA 1VCMA 1RNLA 1JAIA 3KKPA 3ZD6A 1M8JA 4QDTA 3L77A 3TLAA 3PGJA 4C0LA 5B4UA 4KRGA 1XB2A 1XMQB 4MR8B 1FYDA 2WT4A 3AKZA 2HXSA 5TJHA 4WJLA 4TV9B 1QGUB 2C3UA 2O2ZA 2YJGA 1PKEA 3EUEA 2QTVB 2O3RA 3NM4A 3ITKA 1NPTO 5FADA 4RZ2A 4HL6A 2PBLA 3ZNQA 4F2HA 4EATA 3C7DB 2W93A 4LC0A 3NHSA 4GLLA 1NW8A 1YONA 2IXBA 3RVPA 3VDMA 1EU1A 1JBKA 3K6RA 3GLHA 4CQMB 4MUXA 4UTOA 3DLHA 1MQ9A 1SC4A 3CRW1 3HKEA 3AJRA 2FX2A 2AK3A 1B93A 4MA5A 1FYVA 3FGPA 3OIVA 3O9MA 4DYDA 5LNK1 3KG2A 2ZQYA 2QTTA 4JBIA 2D62A 3BL5A 1CZHA 2IUYA 4F38A 1VA4A 2C99A 5GVRA 5TE9A 2IH2A 4A26A 5I01A 1BC5A 4Q4HB 3D3JA 3NOOA 4OCZA 5C7LO 4GSKA 4U7FA 4A3SA 1P44A 2YWGA 1EUDB 2FGKA 2QYOA 3TVYA 4MYSA 1SFRA 4ASUD 2ZVJA 5IU6A 1CG6A 2GEUA 1BXGA 3NAZA 1W49A 4URHA 2AEMA 4X1OA 1K5GA 1QGED 4RD3A 3RS7A 1LVUA 3A9TA 3IHTA 1ZDMA 1LX6A 3MTBA 3ANLA 3PLRA 1BX1A 2JCVA 1Q0PA 1XALA 1ZICA 3A1CA 3DE6X 4MYDA 4W7IA 2F59A 5E2BA 4GQAA 3VNQA 1PUXA 4WECA 1DBPA 1XZBA 1B14A 3ENZA 3PSAA 4Y3UA 4JVOA 5F1OA 3DG9A 1U5CA 2X8BA 4KVFA 2COKA 1NXTA 1Z45A 3LOQA 4GVLA 4PQEA 5LA6B 1LNQA 2WPDD 1CQPA 4M9SA 4ZOEA 4C0HA 4RTRA 3KX2A 3P9CA 3W3AA 3U40A 4G5SA 1JMKC 4UUQA 1RI5A 2IY9A 3AF4A 3GMTA 2W22A 4WX2B 4MZDA 4R1SA 2QRNA 4NV0A 4QPPA 4U8HA 2W2KB 5MDHA 2JDID 3A4NA 3MD0A 5CLGA 4FR5A 4K9LA 1KE2A 3KNZA 5CBKA 4MAFA 1OVMA 1HQKA 2AFIB 4RCZA 3RBXA 1T5LA 2EL9A 4N4AA 1BCRA 3TQFA 5KYVA 3OZXA 1U8CB 1SUDA 4CIBA 1EJ6A 4L0CA 1L4KA 3ABSB 3CNBA 1G8FA 3IAM1 3VR4A 4MKXA 4Z7JA 5KEIA 2PUAA 2M6KA 1YTLA 4LRSB 3D6AA 3A2MA 1LBIA 3MLBA 1LPBB 5EZQA 2H1SA 3QFFA 3R5TA 3FHJA 3GJZA 4ZICA 3NXKA 3IPXA 4JDUA 3HXKA 2X6QA 1UJ6A 4JUCA 3HJHA 5EWMA 3FI0A 3G5MA 1CVRA 1ONPA 3L8GA 4FYVA 1MG5A 4L9RA 4X00A 4F04A 2FLWA 2WWIA 4FYWA 2FMKA 1ZGAA 2O7VA 3U3OA 1A7UA 2ZSKA 1NJ2A 1HFJA 2CHFA 2CNLA 2QGNA 3OZAA 4Y6OA 5TPWB 4MLDA 2XBLA 4UDNA 4C2AA 3EPKA 3EDYA 2ADMA 2V7WA 3ANMA 3N7UA 1HURA 3NAGA 4H1TA 1L7DA 5CMLA 4EUHA 4YT2A 1RXYA 1LPSA 3LBIA 5JCOC 2DKNA 2YXBA 2AXPA 4RKFA 1JIKA 1C3OB 2D0IA 3LWDA 4FKBA 4PFKA 5GY7A 3RU3A 2ZDQA 5ED4A 1G17A 2AMYA 3TQSA 2V7TA 3BJMA 4RJ2A 4CM8A 1U9YA 3KEGA 2G07A 3TUJC 3CZ5A 1X1AA 3Q5EA 2B98A 5BV7A 3EX7C 2EW8A 2OE2A 3KZVA 5JAOA 1U3WA 1R0ZA 4F5ZA 1N78A 5MN5A 2QTAA 3H1FA 8ABPA 1HRKA 3BB3A 3DS8A 3MUNA 4QEKA 4YCNA 3LBHA 4RHYA 1E5XA 4C06A 5FX2A 4GRAA 5B64A 1DUSA 4TKZA 3SS8A 1Z56C 4ENPA 1BWQA 5MF6A 2GBIA 2LKCA 3GPLA 1YQEA 4S05A 2YL2A 3NFYA 1PEAA 1KJIA 4UNSA 1VKHA 2YMLA 4B31A 2WLSA 4C1BA 1YZGA 4YCMA 4MP8A 4C0WA 1J1UA 1Q6ZA 3LKVA 3OJEA 4N03A 1S2GA 4TMZA 3CSDA 2HRRA 4L2IA 2C84A 3A1NA 3R20A 2VJMB 3DYIA 2Y0PA 3FBTA 4HDRB 1HH4A 3WGMA 2AOUB 1SBHA 1H2RS 2D59A 4NJMB 4MYCA 3OKAA 2XT0A 3GLQA 4OI4A 5AQ1A 4F5DA 1RAFA 3U4AA 4BXOA 1FEZA 1MZPA 2V6FA 2DX7A 1VIYA 1FFYA 2UVDA 1BEZA 5IJ9A 4HAWA 2UXDB 4JN6B 1AKRA 1H0KA 4ZYZA 5E7QA 1LUAA 2WD7B 1H94A 3E58A 4NS1A 3S8MA 3T5DA 3TKLA 4KQWA 2REBA 3CZCA 3CIFA 2IOFK 3I9KA 2PEZA 3ME5A 1TCUA 1ZD8A 1VPVA 3JQBA 1W4AA 3T4UA 4DPKA 1HR0B 4FI3F 1NJFA 1BMFD 4B5LA 3LYAA 3CV3A 4G0OA 3WLEA 5AXBA 2FRXA 2AZDA 1O94D 4W7SA 4XUCA 3W78A 2P6MA 5L9AA 2H1CA 2Q2WA 2WV7A 3DVAA 3AXSA 2X8JB 4CQLB 4KXVA 5AVVA 5MGBA 2ZBQA 2GN4A 1M2GA 3LA8A 3GMDA 3K16A 5IFLA 2J4CA 2BGLA 3NKVA 2NT4A 1IIBA 4IJKA 2FZKA 4MVJE 4OHWA 3RFXA 3DLPX 3TPCA 1Q12A 1XD2A 1RU3A 2DWQA 2EC5A 2XDWA 5AOVA 5KDDA 2MINB 3GJ4A 1P62B 3I05A 3LY9A 4U3JA 3WIEA 4N0PA 3EMVA 3QXJA 4MOWA 4OQEA 3F73A 3II6X 1E3DA 2HA3A 3RC2A 1WXHA 3EXHB 4LAFA 4Q03A 5JG7A 3DEFA 1IWPB 2PUTA 2BJHA 3D0KA 1VJTA 3JVIA 2Q5OA 2CNKA 4HX5A 4K6KA 1XI2A 3MTEA 1T0BA 2YNMC 2ZIGA 3R8XA 4F3KA 5KSOA 2H1IA 3E3LA 3H9UA 2X2PA 3DDOA 4BZXA 2E5LB 4PYMA 3U3DA 3RV3A 4PU0A 1LPPA 1P2SA 3GD5A 1I3LA 3M4NA 5EMHA 5E7JA 4I1YA 3UUEA 4BEWA 3RVSA 2C9BA 3GPDG 5KNDD 3KSBC 4ZRMA 3SKVA 1DRVA 2RAUA 2Z95A 4BVLA 3IODA 4FOLA 3E22B 4OBWA 4HUTA 3V1KA 3HGQA 3GLRA 4Z9AA 5EKTA 3HFJA 4I4IA 4IVRA 5IT9A 1DXQA 3C43A 2IEAA 2EGGA 3HA3A 5EHXA 1GOTA 1SU4A 4BFXA 3HCFA 1CRWG 3W2FA 5AWFC 4OUDA 3U9LA 5KVVA 1A8QA 1SQGA 5B53A 3TD2A 3ND6A 4F3TA 1WY5A 2OBFA 3ASUA 2RHHA 2E6UX 1H2ZA 3B60A 2ZE5A 1TADA 2ZRJA 2AZTA 3HL0A 4D0GA 4XZ3A 2CXPA 1TUBA 4EX7A 1KMQA 1F51E 4QGSA 4KR7A 2VNAA 4Q0MA 1EE1A 1QHEA 2II6A 2IUFA 3IAS6 4XYBA 3T7EA 4AJNA 2JAUA 4D9GA 3ABQB 4NMMA 1RAIA 2VHEA 3D8HA 2PK3A 1CFJA 2VL7A 1DAFA 2R97A 1OI2A 4Z8XA 4DMMA 3C3MA 1G21B 1RLJA 2QTWB 3A25A 1TJPB 4MW1A 1DWUA 3IE2A 1YVRA 3NBUA 1DSSG 2O06A 4IS3A 3N0VA 4JSYA 4OHRA 4ZQCB 1Y8QB 5IAOA 1Y3CE 3W1WA 1JSLA 1YFJA 1C9EA 4F06A 1H1LB 3D8TA 5IN5A 4LMPA 3SJUA 4ZJUA 3PFBA 2J9YB 3FRIA 4LGCA 2FSVA 4Y2QA 3MBIA 5EQTA 1KIMA 3U13A 1KSGA 2PZ8A 3V8BA 1AHNA 1SCUA 2QRLA 4G5GA 4Q24A 4RIEA 5EVCA 1ILEA 2IITA 2EP8A 2H6EA 5JIBA 4PO8A 4AW9A 5LB2A 4ILKA 1NVFA 4DQUA 3FKQA 3TX6A 3MMPA 4J29A 1RLTA 2J3KA 4MWCA 1OX5A 3L9WA 1JR6A 4HAUA 4RENA 2ZJ4A 4QXPA 3V1UA 1UKCA 3PUYA 4MKRA 5J2UA 1HTWA 3X1MA 5EZ5A 4YCSA 4BECA 1G5TA 3R7WA 3SOPA 1I4EB 3Q0EA 1UDXA 4MEJA 4EHKA 1DEKA 1G291 4NZOA 4M1MA 2OVFA 2XXBA 2DHEA 1TRKA 3ABIA 3VJMA 5DSTA 1GV1A 2VNHA 3ND8A 5KZMB 1EZ4A 1R0LA 4XJXA 1KJQA 2IU6A 4ZZ0A 5ECGC 4LWZA 1QGDA 2YDYA 4ZTZB 1G55A 4K81B 1MKYA 2QW8A 1B6SA 4BFLA 3EVNA 2ES4A 1WAMA 2PMKA 1RYYA 3KJNA 4OHVA 5DLQC 3V32A 4HGQA 3PDIA 1HG0A 3MFYA 1J0EA 5LYJA 2ZWMA 4ZVLA 4KTTE 4R98A 1I7SB 3BXEA 4LV6A 2ZJ0A 5B7QA 1P9WA 4BZZA 3KLBA 1UMBA 3L1HA 3BF8A 3CPJB 2ZYRA 3FPEA 3WGHA 3OX3A 5IH7A 3MJSA 1Y3IA 3T5GA 4LN1A 1Z7EA 1OD6A 4Q7MB 1JDTA 3BIFA 1BG6A 3EIUA 3NDPA 3I9JA 4Z4HA 4HV4A 5K0EA 1WUJS 2WHPB 3CYFA 4RK5A 4MW6A 1EFKA 1Z4LA 4JL8A 2A33A 4JQYA 3NBMA 1KETA 1N5IA 5EJ7A 1AN0A 2XCTB 2QVBA 5CFZA 5A6VA 3ZVKA 1FDOA 3D7LA 4X1IA 2I0FA 2WJYA 3AR4A 3QBVA 4ZPJA 2YVUA 2JI7A 2GK7A 4XWTA 5AJXA 3ZK7A 1FMCA 3K9LA 3MIIA 4RD0A 4UDOA 3GB9A 4N3AA 3BH6A 4LSGA 3SDBA 4EHNA 4P38A 1D2AA 1FVOA 5ARDA 5IVHA 4L6AA 5G0VA 3G0DA 3I6IA 3WL3A 5JS1A 2E6KA 1J1IA 5G1PA 5TJ9A 2XMQA 3ZXYA 1RZRD 1Z6ZA 4LXIA 2C78A 2FSUA 4RVDA 3T15A 4B3MB 4OSEA 3I23A 3WKDA 4WZ6A 1DC7A 4KB5A