2JRCA

Solution structure of peptidyl-trna hydrolase from mycobacterium tuberculosis h37rv.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
191
Chain Sequence
MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVHAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Solution structure and dynamics of peptidyl-tRNA hydrolase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 43
structure length 191
sequence length 191
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2jrcA00
2Z2KA 4QAJA 3TD6A 3VJRA 4JC4A 4DHWA 3TCNA 4Z86A 4FOPA 2MJLA 4FNOA 2Z2JA 4P7BA 4ERXA 3OFVA 1RYBA 4IKOA 4QD3A 4JX9A 1RYNA 4QBKA 3TD2A 5IKEA 4DJJA 4OLJA 3NEAA 4QT4A 4JY7A 4JWKA 5IMBA 2JRCA 5IVPA 4LWQA 3KJZA 3P2JA 1RYMA 2LGJA 2NAFA 4HOYA 4YLYA 4ZXPA 3KK0A 5B6JA 3V2IA 2Z2IA 4FYJA 5EKTA 3TCKA 2PTHA 4FOTA
chains in the Genus database with same CATH superfamily
4JJ7A 1BNCA 1QTIA 3EC7A 4JL8A 4XQEA 1IEXA 3MG9A 1SKBA 1T91A 2NXNA 3IMGA 5CFLA 1CVIA 1SCBA 2XMCA 2CCGA 4MIEA 3X1MA 4B81A 3GLGE 1T8YA 4PG5A 4B4OA 4PTLA 3P9SA 4B17A 3LW8A 1LTHR 3DULA 2OBBA 3FNHA 3NNDA 4BLPA 1Z4MA 3TO5A 3A0RB 3WGZA 4KREA 4YP1A 3YASA 1V11B 5DBFA 4KVFA 1N77A 4INJA 3B6MA 3T5DA 2NW6A 2LGJA 4A0SA 3TMYA 1EQAA 3OE4A 1P3Y1 1SH7A 2J0EA 5JVDA 1HYGA 2BCJQ 2UVPA 1JWLA 1Z16A 4FYKA 4KYIB 2FUCA 5JXJA 1EXWA 4CNBA 3QMPA 3VPAA 3HM9A 3H1GA 4G5HA 3SFTA 4C5AA 1A2KC 1NVVR 3DDUA 4ZCQA 1QQ7A 2PHZA 2RH9B 4RCYA 1GXSB 1QMGA 4F97A 3BH7A 4FFPA 1D2MA 4IXDA 1VL8A 1XN4A 1Z5OA 3NBZC 4JT8A 1CG6A 2JJMA 3G88A 1HTTA 1UIRA 2NUPA 2PRYA 4FZ5A 4MV9A 1RC8A 4BLUA 3WXMA 2P2CA 1FUKA 4KO4S 5FNVF 2QIPA 3C1AA 2ZR9A 2JS7A 4EW1A 3K70D 3HL4A 4UATA 2AOUA 4PN3A 5BUQA 3T9BA 4BOYA 1N2CA 3PRHA 1L7OA 1U8TA 1X7ZA 3ZS9A 3QE2A 4NFHA 2YYAA 1GUDA 4XQGA 5E9AA 4DA6A 4YUAA 8OHMA 4TV9F 3PJGA 3I6MA 5FORA 2C8KA 2QM8A 2Z57A 4KFCA 1TJYA 4BJHB 5AHKA 1D2HA 3BKXA 1GTG1 3FR7A 5BV7A 3WAGA 4GHWA 2J6IA 1BWSA 3SHQA 4CV0A 1VP3A 1JXMA 2IF2A 1X15A 3GJ5A 4Q9LA 2QN1A 5JBQA 2HF9A 2Y1DA 4YUYA 1XJ5A 2HJWA 3TKAA 2Q3JA 2QKYA 1SCAA 5EWMB 2NZUG 4LUCA 1J8MF 3SZOA 4EPYA 1R16A 1I5OA 1F4LA 3OOWA 4K0RA 1NF2A 2IDZA 1XZHA 1UK7A 3OA2A 1O9HA 4UULA 2CLLB 1M5TA 4DW8A 1UC4B 3HLYA 5C1PA 4GF5A 2PGDA 1UK9A 3HJUA 2IXTA 2XZTA 3VBCA 3ZDQA 2E0IA 3GA7A 3IIMA 2H1CA 3G2PA 3PDJA 1IWBB 1TRHA 5LYJA 3ZLUA 2O14A 1TAUA 2JGMA 1U9IC 1GUFA 1H2AS 1JDNA 3DFZA 2HK7A 1SCJA 4M1EA 5BNFA 1DAMA 2Z9CA 4HDNA 5JNWA 3TGLA 3AF3A 3AVXA 4OK3A 2E4ZA 4RS3A 1JHXA 3TTTA 2FPIB 3DE2X 2BGMA 1K3TA 2H17A 3D7MA 4PCVA 5JYBA 3GB9A 2WT9A 1LX7A 5C8XA 1J21A 3I12A 4HN2A 1R4ZA 2C20A 4GMFA 4MGIR 1QB7A 3DOEA 1JMKC 1ITZA 5FR1A 1S5PA 1YXMA 5FYDA 1Y9AA 4EBFA 4X8MA 3HUFA 4F1KA 1KYYA 4UNIA 1RHMA 3GT7A 3N2ZB 3KE9A 4LX8A 5LZ8A 2CXPA 2QD2A 2UZ4A 4UPEA 2HA6A 3SKXA 2BKAA 2C7GA 2BFOA 2UVQA 3GQBA 4OHCA 3N39C 2PQ6A 1W85A 4FFOA 1A7AA 2WHPA 4FWIB 4WA8A 3RT1A 1K7EB 3I9OA 4MICA 4UBOA 5TF0A 2CFRA 2JVJA 4ESOA 3QLUA 3PPXA 1KETA 4WZ6A 1AF7A 5CYPA 1F2UB 1HNZB 2IT1A 3GNSA 3SBDA 3D6VA 3OBIA 5C8YF 4YDSA 4GKAA 1XHEA 1R74A 5DYWA 2GEJA 4X1YA 3BF8A 3NTQA 5KNBA 1CY7A 2H16A 2CY0A 2EEPA 3TKYA 4LC9A 3CH4B 3OESA 1ZAKA 4E88A 1XCJA 1GAWA 3AJ8A 4BEVA 1Z4QA 4I46A 5E7JA 2HU5A 3EZ9A 1ODCA 2GM3A 3NT2A 4NFYA 4M1YA 4AJHA 2B83A 1BO6A 5TB5A 2P75A 4BO8A 5JPIA 1JEAA 1WA5A 1OHHD 2FEXA 3AHDA 5ARDA 3ZHYA 4G0PA 3DCYA 1PTJA 4J43A 4UHFA 5COBA 4YJ2A 4JYZA 1P7PA 2HBZA 2DTXA 1QK5A 1DOAA 1VG8A 2H4HA 1JEDA 2I2WA 4N8EA 5J2UB 3S2YA 2I4LA 5EXDA 2XOEA 3CRVA 4K0KB 3DQQA 3LQFA 5AKGA 4UXJA 4BRSA 3TLZA 2RHJA 2REQB 2YJTD 2OPHA 4DLPA 2QVZX 2HRDA 2ZJZA 1ULTA 1AQJA 4H08A 1V4VA 4J7XA 4JC4A 5DISB 4CCWA 3FDZB 3AVUA 3IQXA 5DHQA 1NI3A 1QNFA 3PE6A 4BMZA 1U1DA 2PYIA 3RUFA 2FN9A 3VI3B 2CB0A 2VSQA 3K9QO 4E2WA 5BSRA 5CA1B 3RYCA 4B44A 4H4CA 1N5KA 5KOHA 5C18A 1ZIXA 3P9PA 3H3XA 1H42A 1UMBB 1VRCA 4GOJA 1FLNA 3D6JA 3KQQA 4TWIA 5FLYA 1KPGA 2XOKD 3NDPA 3ZZUA 2AYZA 2JLBA 3QQPA 2XB9A 3K0EA 4MVJA 3TL2A 3X2SA 4EGJA 4AY6A 5FTMA 4O5OA 2VJAA 2CNLA 4JJKA 2ROQA 4OBBA 4NNJA 2WHRA 1G6HA 1RRFA 1XA0A 3E03A 3ODGA 3WYCA 5A6SB 3D3JA 4TWBA 3TXXA 5BY2A 5KDDA 3IILA 4KWEA 3T3PB 2VJBA 3AKEA 4OIFA 4AQDA 1ZD2P 1J5EB 2AFHB 2IZOA 3V1YA 1X8JA 3GARA 1SVOA 2F1OA 2GF9A 2IEBA 1HFWA 3G68A 3NOOA 4TL8A 4EFMA 1SXPA 2FJUA 2XUFA 1ZN7A 2ZI9A 1DP4A 3M83A 1WB9A 1GCUA 3DS8A 5MN6A 2W83A 2RG7A 1A5AB 1SU4A 3X1KA 4FNAA 5AJUA 3PVSA 1CUXA 2C2WA 1OBFO 1RM3A 3QM1A 1GHTA 4GI2A 3CUUA 1KI1A 2GN0A 2WM2A 4RVFA 2DQZA 3B3JA 2EX4A 3EK2A 4PO8A 1ACLA 4CM3A 1UBNA 2N1BA 1XBTA 4ZV4A 1C9YA 4B2LA 3DBHB 1NPTO 4Q1DA 4A27A 2RIPA 2HUNA 3HO1A 4ZYYA 4UQOA 1Y37A 4I6EA 4QOEA 4FZJA 2BFPA 2XDAA 1B15A 3CEAA 4BO5A 4C2AA 1ESZA 2ZR7A 2J3IA 2QW1A 4PPGA 4CKBA 1C3EA 4UEQA 3ER8A 1HXHA 4F2GA 3OTOB 3ZK9A 2OMEA 4S2UA 4U5XA 4PGHA 3HBNA 3ETEA 3P0FA 4R2XA 3EIEA 2XUOA 4N3CA 5HIIA 3SJZA 1Y7LA 4DQVA 3OQOA 2IS2A 2F43A 4HFRA 1YBAA 4U7DA 4EYKA 5JSZB 5KYKA 1QFSA 4O2BA 4YR7A 4RV9A 1F0KA 1IBCA 1PJ8A 5TGDA 4NL4H 3T0GA 1E4OA 2HPHA 3WMGA 3W3ZB 4PM4A 2VYQA 1UJCA 4UREA 2CT8A 2ZJ0A 3HS3A 3LPMA 1JDZA 1ZU5A 2WINI 4X9XA 2YW2A 1QYRA 4FWTA 2ZIEA 1XRMA 3OHPA 5DOVA 3DL4A 3KSUA 2E4WA 3G0DA 1VLJA 5HPYB 2YCBA 2VOEA 1KDOA 2H0AA 4YJ3F 3TEMA 4G5YA 3M3HA 4AT1A 5A9SB 1B2RA 1MO6A 4IO1A 1A97A 4DJ5X 3H42B 5ELMA 4DQDA 3O3OB 2RKOA 1KEEA 3UXHA 3HV2A 1L1QA 3GJQA 2B7LA 4G5XA 5TMDA 5IPFA 2C2YA 4TZ6A 1YZFA 3OUTA 1NONA 5FJIA 1T0IA 3T9EA 2WFZA 3W5JA 4LISA 2ZJAA 1US8B 2Q0XA 1X92A 4WK0B 5FPKA 2E5LB 1HM5A 5FJJA 3MT8A 2YWRA 3FMOB 1FY2A 2B1IA 4XIIA 5G3ZA 4XD2A 3DF9A 4DCJA 3BMNB 1JYEA 4BX2A 4FUQA 3K31A 4L4ZA 4NH0A 3CUWA 1JQDA 3AQIA 4ECEA 2E6KA 3C5CA 1LKZA 3DO5A 4Y9UA 2E4UA 1TO1E 1USUA 3EG5A 3WGYA 2X3UA 2WUFA 2CLHB 1XTVA 1DV1A 5F9FA 1P2VA 4CDRA 4LDPA 3RM3A 5JAUA 1WKVA 4MB0A 3VYTB 5KNCH 4ONEA 2FSHA 2VVTA 4Q3KA 3VH4A 3S81A 3QNMA 5ISMA 1X9IA 3VHXB 1ENYA 1SIBE 1ZEMA 3UGTA 1Q1AA 4UAGA 4IUDS 5JYDA 4DKJA 4RJKA 4S24A 5GY7A 5LZ5A 1QZXA 3AUYA 4BNKA 3IE1A 4JXKA 3II6X 4UVEA 1ZUIA 2H2DA 1N9ZA 1MPTA 3B89A 4ARVA 1ZC4A 5M7EA 5AJVB 2C9OA 1T0BA 4W5NA 1C1XA 5LC1A 1CUIA 4HH4A 5HE8A 1PRYA 3N2IA 5ERGB 1XEXB 4BC0A 1FDIA 1IHUA 3W5DA 5TPZA 2F62A 2REXB 4L2IB 1SXJD 3V9PA 4EI7A 1GT91 1V5EA 4FQ8A 2ZVQX 3GVHA 5JPCA 2R6FA 3LO8A 4I55F 2V1XA 3EXHB 4J0HA 3CLSC 4IJUA 1DUSA 2NNWB 2V55B 3F90A 3HL0A 3RNLA 4HAUA 2IXBA 2ZP1A 3VVMA 2R1ZA 4JB0A 2KSQA 5IS2A 1OZGA 4WMLA 3TLKA 1DIBA 3ND9A 1NP3A 3T1OA 1FX0B 4G0XA 5L95A 3MMSA 4KR2A 4V02A 2Q62A 3DBLA 3JALB 1DQRA 1H2YA 4Q4AB 4U2BA 1QR2A 4YCAA 1NG1A 1ZICA 4CL8A 2IV2X 5H4GA 3IBYA 4TKVA 1Z0ZA 1BC5A 1YV9A 4FLEA 2F4VB 4BAZA 1BMQA 3E0QA 3DMFA 4TSKA 4AMZA 1AO0A 4M37A 2Y1GA 5HOQA 3HXPA 1VSBA 2ZB8A 1JN0A 1YUNA 4HN4B 4LDNA 5FPYA 5IDWA 4AMGA 3G2JA 4MPDA 2H29A 5DLDA 1ESMA 2JLAA 3GZNB 4YQZA 1ORWA 4I4TA 1EX7A 1GU0A 5BOVA 3HPQA 3TTSA 4GX0A 1T4GA 1XEWY 3VYWA 4C0LA 2XQIA 2BMAA 5BRAA 2FEWB 2IYNA 2XDWA 3VR4H 3UUWA 4CG2A 1I6KA 3K1AA 4IHJB 4MVYA 5REQA 5AUQA 2PGNA 3M9WA 2HFKA 3AW8A 3LCUA 2FX3A 1OB2A 3I42A 3A14A 3NWJA 1XLUA 4HNUA 1C7IA 1C4XA 1R0XA 1ABBA 4CQLB 1XP5A 2CVPA 3B12A 3BHJA 4D6XA 2JEYA 2ZRIA 4PC3A 2JLUA 5IJWA 1NV9A 3QU9A 2AJDA 4U2CA 4CV3A 3ZWYA 3IQGX 4HDMA 3T7IA 3A4TA 1A8SA 4PPYA 5A1JA 4FGZA 2P9HA 5FL7D 3A6PC 1KE1A 1CEEA 2JGKA 2C83A 3FVQA 3RSZA 1PZFA 2QX4A 2RHCA 3PE3A 3JD3A 3RTCA 4C7JA 4HNVA 2JA2A 1XTKA 1AKWA 2M6SA 3IVXA 4C14A 4CF7A 4QL3A 5JROA 3JSXA 5B6JA 2CJWB 4YJFA 3I04M 3EMBA 1U2PA 5CM8B 5E1BA 1XRRA 2FLWA 3LVQE 4E30A 1WTAA 3SYLA 2G70A 3GFGA 3PX3A 1IQRA 4URYR 4UMVA 4DLBA 4X65B 5F5LA 2CBGA 4ZU3A 1J39A 4NF2A 1NXOA 3KLBA 3E9EA 5F3DA 1ZP6A 2IA5A 3M5DA 3OI7A 3CNQS 3C3JA 4OYRA 3C3KA 4EHHA 4AM8A 2VP9A 3WJ1A 4WCFC 1JB9A 4O4JA 3LPAA 5KYWA 1KMQA 1GTRA 4PTYA 4BN0A 1VMEA 2QROA 2C78A 2YFQA 4RKRA 1J9EA 2CHUA 3DOHA 4FBMA 3VU8A 3W6NA 4HVLA 2CYBA 1Z5PA 3G82C 1FP1D 3FLBA 2OT3B 3ZU3A 2ET6A 4GOKA 4IF4A 4OLHA 4Q3CA 3WHPA 1C8VB 4KGXA 5K1ZA 2ZUDA 4B3SB 5HIJA 2RAUA 3KHUA 4FI3C 4GBJA 1UIMA 4AF7A 1NX6A 3SIPA 3I1FA 4XYEA 2QYTA 1BGVA 3LFTA 3FNRA 2B1RA 4CMCA 2WJYA 1VI2A 5FXMA 1X80B 1EESA 1C80A 3Q2KA 5JARA 1EP2B 2KJQA 2ZSBA 3MK31 2ETVA 3NHBA 4W4TA 4M87A 5DJ5A 3RI3A 4B3CA 1GVNB 4X6YA 2O5RA 3QA9A 3IV6A 1FLAA 4FBGA 5JDCC 3PR2B 4Y9SA 3LTEA 4NDZA 4EG1A 1E1NA 1NR7A 5DM60 3ILXA 5JCJD 1GP2A 5AOAA 2NO4A 4RTJA 1JG4A 2I3DA 1VBNA 2HSWA 3OQIB 3GRPA 5IH7A 3GPDG 5D7NA 3QF7A 2Y99A 1L4NA 1O89A 4PLPA 1N2JA 4A15A 1IZ0A 3KKQA 3S44A 1BDHA 2WE8A 3G17A 4ZVUA 4GI5A 2CMHA 3T6KA 5BVGA 2HJRA 2HU2A 1DBVO 2NYAA 2JLCA 2VNJA 2Z3VA 2XMRA 1M73E 2GHIA 4YJHA 4IX1A 3UJHA 4LHVA 3KVYA 3ZZMA 2WKSA 4V0ME 2HC9A 2HBYA 3FWYA 3HVUA 1QQBA 1N2IA 4MWGA 4IIHA 2XT6A 1NBAA 1BROA 4OUDA 5FUQA 2R8OA 4BN4A 4XYLA 4C9BA 4G2NA 4W5JA 1HK7A 3MQ4A 2WSSD 3BIFA 2DEUA 1SURA 3V8EA 4RCZA 4Q03A 3U4DA 3BFKA 4MVJG 2QN2A 3QKRA 2REOA 3I2YX 3KKEA 1HDRA 3PBKA 3MCZA 1J23A 2HCRA 4HWSA 4IBOA 4OFBA 2VSFA 4OYYA 4QTYA 2C99A 2FN7A 3FHCB 5H59A 1VIMA 3O3MB 1AGXA 1JG2A 3Q2IA 2RJ3A 4CYMA 2LD4A 3AUSA 4FIDA 1EWVA 1JFFA 4YAKA 1L4FA 4YAWA 2RHOA 2QG6A 1S9HA 3SC3A 1PS9A 1EG7A 1K2WA 3ELWA 1PGQA 5FV7A 4JASB 1FYVA 4DMFA 3Q10A 5AD1A 2BCGY 3GJSA 4JD5A 3WYEA 1GITA 5TMBA 1OA1A 1J8FA 3VPFA 1E3MA 4QODA 3DKVA 4CRWB 2R5NA 4ZOLA 5K0JA 2CVQA 5F12A 3RB8A 2YWJA 2X13A 3JAKB 1BD4A 3DAOA 1Z18A 4HQ0A 1PG5A 4LMAA 2IEZA 2IODA 3WMFA 4F9FA 2QUZA 3P1JA 3EGWA 5JNLA 3GLGB 4HLNA 2C1XA 1B6SA 1UBOS 1MJHA 3MZ0A 2GM4A 2X9NA 4RIEA 1S8OA 1NI5A 4LC1A 2NTYC 3Q3IA 1H2WA 4ER3A 3KSZO 3TD2A 2ZJOA 4HQOA 3V2UA 2YDXA 2VO1A 3GX1A 4YQYA 1EWTA 1RWPA 3N0XA 4EB0A 4FDTA 2PWBA 5GINE 2C9BA 3H0KA 3RKSA 2MSDB 2A5JA 1NN0A 3OOJA 1M2GA 3JQAA 4PSAA 1VMKA 2PSEA 3TW0A 1V5WA 1G17A 1DEKA 3H2HA 1K7CA 1PI3A 1YB5A 3AERB 1F51E 1IN5A 4KIWA 1VYVA 4WFQA 1KFJB 4XGRA 2BMEA 4JYPA 2YHUA 4HGQA 2RGAA 1P9LA 4EIWA 1YD7A 2UZ1A 5F7ZA 4XD7D 1QG0A 3L0BA 3OPYA 1W0CA 4KDCA 5D3KA 3D3WA 2UYHA 4JEIA 4F60A 4ZI7B 1RYBA 4XYBA 4PZDA 2F3SA 4D45A 2ZU6A 2VK2A 4DSTA 1ABFA 3BD6A 1Y8ZA 3VR2A 4L08A 5J2TF 2I3ZA 3WA6A 4F04A 3PC8C 1TYAE 3PT9A 2FW6A 3KSBC 4OL9A 1PUIA 2CMKA 5I9IA 3WGIA 2ORYA 4RABA 2G40A 2BWJA 3CT6A 4DT1B 2WIFA 4LEIA 3T7RA 3AR4A 3AVPA 4Q4HA 3EFBA 4R3WA 4F6CA 4Z1MD 4A0GA 3RJ5A 4HATA 1N2SA 4NICA 4QPDA 3C16C 4TL9A 2H18A 4MYDA 2WI8A 4KNWA 1EFLA 3HWWA 2ZIAA 1GRVA 3BL5A 4G9GA 4DQLA 3Q88A 2EQBA 4CXMA 1I1QB 3UH1A 4CNQA 2CYCA 4R0VA 1FSSA 2YHIA 2H63A 4FFLA 4R84A 3PGLA 1ECLA 2C42A 3E5RA 4J6EA 2A9PA 2XGSA 3WQSB 4HG2A 1EJ0A 2IYRA 5CVEA 5J1SB 5FAXA 5BSWA 5JYEA 4AJEA 4AX8A 4JUBA 4CG1A 2WZCA 2JFOA 1GTMA 2GD6A 1JV2B 2BEUB 1I14A 4P81A 2GT1A 3SNKA 1R8QA 2I7DA 3W90A 1XTRA 1PZNA 2GBGA 4ND7A 3OTHA 5FLKA 4XB1A 5D3ZA 3KD3A 3MSXA 3ZD7A 3L4BA 3D5TA 3EEIA 1EB9A 4IUCS 2FQYA 2JAOA 3DONA 4N7RA 5CHEA 3PGMA 4YFVA 2BDEA 2I9PA 4GFDA 5EERA 2CNKA 3E3OA 1VG9B 1LDBA 1E1LA 2A5LA 2VDJA 2XYVA 2JI9A 3L7AA 1M0EA 1SBIA 1N5LA 4OU4A 3B3GA 2QPLA 2QLMA 4U02A 1KAHA 3QENA 4FYPA 4MR8B 3S2EA 2JLZA 3GRAA 4RVDA 2RHWA 1X3LA 3CWCA 1TB4A 2N46A 2XUZA 2QMHA 4O33A 1LQ2A 4TYNA 2C3PA 2KM1A 2X40A 1MQAA 1P75A 2PH7A 4LTMA 6LDHA 5IM4F 3IAUA 3AEUA 1V1MB 1GZ4A 1PL0A 1RW4A 3EAGA 4MULA 5ALRA 2D3WA 4P84A 1QO0D 2ASEA 1CQZA 1EM8B 1B0PA 3EARA 2W2LA 3F8WA 3NDJA 3O8NA 4MS3B 1RC1A 4JQYA 4DRYA 4E46A 2OYCA 4W6QA 2UAGA 3CMCO 5T8KC 4Y2VA 4I81A 4QYWA 3HKBB 4IEEA 1E60A 3ZE0B 4BGDA 5MN5A 3RFCA 2GHQA 4RL6A 4BVBA 5DKFA 1Y89A 4F2DA 4G0OA 2I4OA 2GR9A 3ZWCA 3HFSA 5BR4A 4HRXA 3ZH2A 2A86A 1UZUA 4ZKDA 2HMVA 1SBZA 3P94A 3PIDA 4FM9A 2OBYA 4K9MA 2DMRA 3IPLA 3A4IA 5B3KA 2OV4A 1JU4A 4DG8A 4PC6A 3A1DA 5EHIA 1YDWA 5BYKA 1NBEA 2WHQA 1IE3A 4JLWA 1CTQA 5P8WA 3EFHA 2BGNA 4IIEA 3WV4A 2ST1A 1KWKA 5CNIA 1R50A 4IS3A 3BDAA 4JR0A 3TQRA 4EEKA 7REQA 1MAWA 2WDPA 2GRJA 2E9SA 1NRJB 2AMYA 3DLIA 1FDWA 2H51A 3ZWXA 3OM9A 1R2QA 4NESA 2IPLA 1AK1A 1MT0A 3FUWA 2Q21A 1RZRA 5CU7A 3UAVA 2JH8A 3D7NA 1T4MA 5I48A 1AQLA 2WPDD 2ZKLA 1EXVA 2PUAA 4MQBA 3FIUA 3GR6A 1UT5A 4EABA 1E79A 1NYQA 1ZA1A 2VSNA 1AXGA 3VOTA 3IKMB 4LVCA 1SCUB 4QLBA 4WN9A 5C52B 3OEHA 3EF0A 1PD1A 2ZWAA 3GO4A 4C6TB 1CUUA 1CUGA 1E2UA 1L4KA 1C7JA 1I7NA 1OZ0A 1VHJA 1YTLA 3D54D 2IZ1A 4HGYA 3GFSA 4C7XA 2QZPA 1DT3A 3E27A 3K0FA 4FCVA 4REOA 2AHRA 3H99A 1JG7A 3UXYA 3TQSA 5SY4A 5JLJA 4BV2A 5L6MB 4URUR 3DTYA 1ORVA 3I5AA 3IA7A 1O7JA 2ZBDA 3VR3D 1I1HA 4QDOA 5ELXA 1SVWA 4DANA 4G0WA 1OILA 2XMSA 5CYGA 3RU7A 1D2CA 2F4NA 5LJLA 3VDXA 3ZGXA 3R3VA 4HRAA 1YRYE 1II0A 5IAOA 1VBFA 4HR7A 4AYXA 2QX7A 3ZVNA 5F23A 1T0JB 1M74A 3CNLA 4WEOA 4MRPA 2NLOA 5KQPA 4JR1A 5E6RA 3DBRA 3KJGA 1DQSA 3A1FA 4MS4B 5FNVA 4GM0A 3FOBA 1E3QA 3VVLA 1BN7A 1DFHA 4GGOA 3UGJA 1HORA 2YH2A 4PICA 4YHHB 4BE9A 1RRVA 4NAVA 5FHRA 2G07A 3PLRA 2BMFA 3NNNA 4QBTA 4XH9B 3UKOA 2YCLA 1EAYA 1XMSA 4C07A 2ACEA 3AO0B 1RADA 2GAIA 3PDIB 1QS0A 1AVTA 3EIFA 4TV9A 3UT0A 5IUKC 3DVRX 2LRHA 3HJGA 3U4GA 3DVQX 4N82A 3R5TA 4ZAGA 5L40A 2GARA 4B87A 4C7BA 1R0SA 4J1TC 1JHMA 5BWNA 3Q3EA 1NATA 1MQ9A 1MENA 4RPLA 4PLHA 1ULBA 1DARA 2PXAA 3N28A 1G18A 2HN9A 1SC6A 1OA0A 4ESHA 2W90A 9MHTA 4ZCRA 4JC5A 3B1WA 2EU8A 2VPQA 4DG9A 1N5RA 4B5LA 2NZYA 1D2GA 1QYVA 2C2KA 4QAQA 4A5OA 3ABRB 5MGBA 5JI3E 4CMJA 3RSLA 1XCGB 4ZFNA 2QD3A 1XG5A 3MLBA 4AVYA 3TECE 3A6GA 1A71A 1P2DA 4TTSA 1K6MA 3I34X 2CE2X 3DUFB 3RC9A 3O5AA 2ZTSA 3FWKA 2JANA 1QK3A 1M67A 1QH1A 1PGJA 4KWCA 5DIFA 5KNCA 2EG9A 1HETA 2WJWA 3EBOA 1RC0A 2ZEJA 3GDHA 3IUMA 3I5MA 5FR2A 1DAFA 3GLTA 4F92B 3A1TA 4DIDA 3N8DA 4DIMA 3D1JA 5C1DA 4L72A 2XEDA 2ZUFA 1TJ4A 2PU7A 5IT4A 5BSMA 5TJ9A 3QVLA 4LF6B 1T1IA 2HNAA 3TMAA 1QYCA 2CHEA 4JOBA 2WD7A 4QDUA 4CT4B 2CL5A 1J7JA 2EJCA 1FFBA 3RFVA 2XA1A 2XB8A 3KVRA 1QFJA 4KO1S 4KU4A 4EKDA 3RAFC 5AVXA 1XAJA 3LC2O 2D5IA 3GGOA 4RE5A 3SS8A 2QLLA 3A37A 1W52X 4TTQA 4D9KA 1XKTA 4DYDA 3Q85A 4DMCA 4FB5A 4OGFA 5A3SA 2AFIA 4QNRA 2V6GA 1HEUA 2ASVA 2LE0A 3DMRA 1R10A 4FNOA 4DXHA 2OORA 1ZH0A 3I2FA 2PJUA 1CDEA 2DX7A 2I6GA 3ZXIA 1IHYA 1VM6A 1X74A 1YCDA 2UZIR 1JPNA 2MSNA 4NK5A 4RIGA 5F1YA 3ZBQA 2FNAA 4LYFA 4DCMA 1B0ZA 1XWWA 1XZJA 1X77A 2YNMA 4NENB 4EKYA 5JCOA 3LY5A 1AG9A 2HPZA 1R6DA 2ZRFA 1Z2NX 5B3JC 2Q3MA 3G59A 4BTLA 2BGWA 1FW6A 2XCLA 3V4VB 4NSNA 3JYNA 4EGAA 5K20A 5C8YA 1N3IA 1IOZA 3BJZA 4YRLA 2VCEA 4L22A 3ROZA 1Y42X 1G19A 3W2GA 3HR8A 3ZWNA 5BSFA 1HZZC 1XC7A 1CYEA 1U28A 2X3FA 1JA0A 1N9GA 1GG9A 1TJPB 2OXFA 3M5CA 4FP9A 3AIKA 2MWMA 4PIMA 1MIHA 1PAUA 2Z5GA 1YU9A 3KOYA 1DG1G 1JA9A 3F71A 3TNFA 4Q12A 3ZIDA 5EIBD 1NL3A 4NZMA 4KFUA 4A6DA 1ZONA 1KJZA 1QANA 1HMYA 4LJ6A 4NBKA 4PLCA 3VYRB 3WFJA 5IBCA 1R0RE 2WM8A 1HFJA 1YQTA 4P3NA 2QGFA 1O6BA 2Z4RA 1JHDA 3PNYA 3RVMA 1R18A 2HO5A 3VSCA 2SHKA 3ONWA 1IIBA 3U56A 4P4TA 4RDXA 3A4YA 3GRUA 5LD2C 1ORHA 4ESEA 2NV0A 4G41A 1C7ZA 1ZFNA 2R7NA 1HSOA 2AG5A 1I80A 1J33A 3NOXA 3OIFA 2Z2KA 5CA0B 5T5QA 1I10A 4DV7B 3ZDDA 2LCIA 3U16A 3AFOA 4KAAA 5EVCA 4DC1A 2FZGA 2GUGA 1T43A 2HI0A 3BE6A 3DDHA 4Z99A 1P45A 4Z51A 4GMGA 2GCEA 1M8PA 3HVKA 4GZLA 3QU4A 3ZH9B 4Y0AA 3EIXA 1WXEA 5ED4A 3NC1C 1XU7A 2ZUTA 1TUBA 4HS4A 4EY4A 3HGQA 5IEJA 1RI5A 1RMQA 4C30A 4JVNA 2DC1A 1Y5NA 1M2HA 4MYTA 1QAMA 5IN5A 1M75A 1G8AA 1RVDA 2ZANA 3V1MA 4EBBA 2IEGA 4X62B 3PZBA 5HSGA 2CFTA 2EVWX 1XZNA 1H2HA 3PEEA 1V7CA 2W4IA 1YR8A 2PX6A 5BW8A 5CK4A 1LLFA 1UL1X 4OU5A 5YASA 4XM0A 1G5PA 3PXCX 4D4JA 3LZCA 1KI4A 4RM2A 4YV0A 1G41A 3JX9A 4LE2A 4EB6B 1UP6A 2GJ9A 2RI1A 1JX6A 1P9NA 3LH5A 3NIDB 5CBPA 1VG0B 4ZO7A 4BYMA 3PX7A 4HFMA 2OKGA 1BDJA 2DHCA 1Y3FE 2W6NA 4WWHA 3T61A 2BAGA 4I0WB 5DGCA 1UP4A 1WTCA 4BKPA 4KKVA 4DBLC 4F56A 4BYGA 5MHTA 4UEJA 4GT1A 4NG5A 4ZTBA 4FI3F 2R1VA 1OX6A 3VO1A 1P1HA 2ADFA 3AGPA 5DMXA 1R5NA 2BFWA 1COWD 3JQ8B 3OBBA 1GGKA 2ZAIA 5C31A 4L0DA 4MGEA 2ZAMA 5AJZA 1OLSA 4FFVA 2HHJA 3EW7A 4X41A 1J70A 1TM3E 3HN2A 3SF0A 4D8XA 2J0SA 1HLDA 2X8AA 2BM9A 3CH6A 4YJGA 3B7PA 3U6KA 1U2DC 3S99A 1PDOA 3I73A 2QLJA 1XELA 4JLUA 4LYAA 1HEIA 5JJIA 2JB9A 1E3JA 3A1WA 2GQ0A 3CVVA 2AR9A 1GDHA 3H4MA 3H2YA 2BM1A 1UBEA 2J5XA 4XVUA 1JH9A 1E3TA 2G1AA 3RH0A 4YMVA 1IHXA 1Y5LA 2OM2A 1QOQB 1MVOA 2GD1O 5EIOA 4NOKA 1E94E 3WRXC 2CF6A 3EWIA 3V33A 3UXEA 4NJMA 4LX0A 1OXMA 2M2IA 2N1MA 5ECYA 4B40A 1YHYA 4HB2A 2C00A 4Z1OA 3DEAA 2LCQA 2BH2A 2ZI6A 3ES9A 4XX0A 1HYBA 5AKHA 4F3NA 2EKQA 4G07A 1SC3A 3MS7A 4RK7A 5BW4A 4MKHA 1K9SA 3WL5A 2WV7A 2C4HA 3SSAA 4ISCA 3DFIA 3HYLA 4NEQA 4PQFA 1TCUA 4YJ3A 1KZ7B 2GSWA 1EZ1A 4ES6A 5CAEA 1VMIA 3K0AA 2EKLA 4ASUD 1E66A 5I3ZA 4Q6BA 4N3AA 3G2OA 5BWBA 3K9CA 3Q12A 4HLCA 1QNLA 4V38A 1E2JA 3M81A 2IF0A 2Z2YA 3EA5A 4V3CA 3T7CA 3R6GA 1WDMA 2G7ZA 3VNVA 1AO3A 5D5PA 1H4VB 1NBMD 5LDHA 3VVBA 1QU2A 2R3SA 1BE1A 2R8ZA 3GGCA 1QIHA 4WKBA 3S2GA 5AVTA 3E7DA 3ICQB 4D25A 1T34A 4PONA 3U0VA 4E15A 3ROPA 1F6BA 2PGJA 2XJ4A 3K09A 3LC1O 1U2TA 5EKUA 4ZJYA 2XXAA 5GIPE 4OI0A 4AZ0A 3HM2A 3IOBA 4LJ8A 2VEDA 1Z0JA 2VUHB 4QARA 5EIWA 1T2FA 3EZFA 1E9FA 3LRTA 2J48A 4LOAA 5F7JA 2JFFA 2OGTA 2NU6A 2HA4A 4Y6SA 3ZHSA 1ZESA 3PWTA 1DI0A 2Q29A 1XU9A 4BC1A 1ZM7A 2ZWVA 3RBAA 1JQAA 5FO0A 3OECA 2IEIA 1JJIA 3O2QB 3I0ZA 1QFMA 2DBQA 1D03A 1HT3A 2J7PA 3AV0B 3B8HA 3FTQA 3JARB 3OQJA 5ALOA 3ZHQA 1IY8A 5HNKA 1XLTC 2C2GA 3RADC 3IQHX 2MTBA 1ANKA 3HUTA 2QORA 4AO8A 1PJQA 2NWQA 3QKIA 1GGEA 3ROGA 1UXGA 3UAWA 5BWMA 2CUKA 1KF0A 4QPPA 4UMFA 3W7BA 3EWNA 4KXQA 5DE3A 3RC3A 3KBBA 4KC0A 5A71A 1DCMA 2JFBA 3QITA 1A5BB 2R6CA 3NASA 4L4UA 5ADUS 4I55A 1UK6A 4HAVA 2XUDA 1GWNA 1UWLA 2Q4OA 3BILA 4DRZA 2FPOA 2X1LA 1V3VA 2P3SA 1KR2A 4D9GA 4MNTA 4TVKA 2R84A 3Q15C 4YI5A 5FADA 5JV5A 2IPOA 2CFSA 1RT9A 1UFRA 4AJLA 1Q3HA 5H81A 4MYCA 4M0LA 2ID4A 4N54A 3N2GA 5I7HA 1Y7PA 4KFTA 2WWXA 4I8IA 1Z4NA 2Z1MA 5BV8A 3PNPA 1JWBB 1DMRA 3LA8A 1FUIA 2DHEA 1DFIA 1W5FA 3HHEA 4FEGA 5AIBA 4AY2A 2K4MA 3ZCUA 3N53A 2I8LA 1XQ9A 2HIHA 2IDKA 3H4VA 1HYEA 3IAS6 4ND8B 5A2QA 1X1RA 5T64A 4CU5A 5E6SB 1TYCA 4NOLA 1HF3A 3EGDA 3IEIA 1TRKA 3O92A 4IVQA 3RRJA 3URMA 4OUKX 4EY8A 3TAUA 4EG3A 4YRKA 4E5VA 1RQXA 3KR1A 4OI2A 4FZ3A 4GL2A 4B3GA 3BRQA 5DXAA 2GN2A 5I3CA 4UVGA 4M6WA 4EUEA 3IODA 1UANA 2Y9MB 1KAQA 3ONDA 4KE7A 3QFSA 5K3FB 3RUIA 3D4LA 3WBFA 821PA 2RHMA 2NYVA 1CUCA 2POCA 4RZUA 3IPCA 4N5DA 1ZVKA 3R8FA 3GLFE 2RGWA 4HHEA 5CHYA 1ENZA 3AP2A 4I1RA 3HNPA 2FKAA 1U7WA 4EHKA 5KWIA 2NZJA 2BT4A 1SU6A 5FFFA 5T4FA 4JIMA 3NVAA 4EJSB 5C4MA 4W7IA 3GFQA 1CS4C 2XWQA 3M34A 1Z6GA 4LJ7A 3RABA 4D9IA 2V0NA 2Z9DA 1RXCA 4K40A 4YT4A 5G0TA 2PYDA 5C5DA 4QSMA 4R2KA 3IO5A 5CFNA 3L8HA 5JJBA 2EJWA 1PX2A 1W19A 4YY3B 1P7VA 2B8TA 2DHQA 5DW0A 4MOWA 3ZXUB 3ANYB 4HL6A 3SI7A 5B1EA 4LQ4A 3LYLA 4RSRA 1H5UA 4EYSA 3ZI7A 3HCOA 3HNOA 3PXAA 5GJWC 1Q21A 4RGVA 4RTKA 2GDJA 1J0EA 1P61B 3IP3A 5E6UA 3D6HA 2AZMA 4JBXA 4L02A 4EGFA 2QUHA 5EE5B 2AI3A 1C9DB 1EZ4A 4RY9A 4Y2HA 3S1LA 4BJ3A 2DJIA 2UDPA 4U7HA 2ACVA 2PK3A 4ED9A 4Z3DA 2XWSA 4P98A 2Y1XA 2JFUA 4R81A 5FO1A 3WB2A 3H6KA 4GZ5A 3UG6A 4EK9A 4PW0A 1BHJA 4FEYA 4LBVA 1G6Q1 4B4WA 1HL7A 1H5NA 1NFFA 2C03A 5GGYA 2FPGB 1R0BA 1CNMA 4MW4A 4A8JC 4EUFA 1NVGA 3PT5A 3CZRA 2OHFA 1BOFA 1X8LA 4GPD1 3RS3A 4CG0A 2BYTA 1ZMTA 2LXNA 2G5TA 4P2GA 5EWLB 2C57A 1UP7A 2HUPA 1E7RA 4JODA 1EK1A 3L46A 3LYHA 3QYFA 4F3RA 2O19A 3QXJA 1ZOSA 2JHFA 4BPBA 4MJLA 1E8MA 1RWQA 2DLCX 3LXUX 3QA3E 1DTWA 1RPJA 5C1IA 2CDAA 5J59A 2P7HA 1FFGA 3PC3A 2C2HA 3FA2A 5ECGC 2XNDA 3CVYA 2IYYA 1KFKB 1T0PA 2A9OA 2X5OA 2J46A 4GECA 4URFA 4BO0A 1DLJA 3BOSA 1JKXA 1OV4A 1JDSA 1Z12A 3D5EA 2JAHA 2P8JA 3BRCA 4PZZA 3VPCA 5GOZA 1VJ0A 5IKOA 4R1SA 1KK0A 1PS8A 1A9PA 1RRGA 1BHO1 3QBVA 3ROMA 4FINA 3PFWO 2C7OA 2PZLA 1YUBA 3ESBA 2GEFA 4DDVA 2AF4C 1EQ2A 1Q83A 2DCMA 2W8BB 3DXFA 1MRSA 5EG5A 1FS5A 2RB4A 2HO4A 1FMTA 1RLTA 5I5GA 3THSA 3CT4A 1OB5A 1ETHA 1DXYA 4FOLA 1WDWB 3MJHA 5P21A 2WDZA 2NUAB 1DC5A 3OOSA 4DA4A 3AZOA 5L6LB 4BZZA 4WUVA 2B20A 2ZE7A 3C7DB 5JCXA 3LX4A 3RG2A 2H1VA 4Q01A 2CEAA 4JVSB 4LFCB 3EN0A 3H97A 1EFTA 2HK9A 4E7OA 4LI3X 1T5SA 3INGA 4WNYA 2R1TB 2D5CA 4GKVA 4OOFA 4EW3A 1KA9H 4YT8A 2JD1A 4ZICA 1MJNA 4C78A 3FOWA 3O1JC 4V0KA 1QTNA 3ZBTA 4CEHB 3U13A 2G0TA 2HH9A 4N7JA 1AA6A 2ID7A 1L7RA 4N5HX 4EHAA 3INNA 2XUKA 1PJ2A 4G2TA 4PPNA 1U8YA 4RA9B 2BRUA 1UDAA 3IXQA 3LIPA 4GGPA 4B4UA 5E2BA 3B7WA 3KQWA 4KN8A 3WK4A 1U7HA 2YN2A 4IVNA 1R5OA 2NUBA 1TO6A 3CJRA 3UWDA 3W5AA 5I4BA 4CVNA 1K7YA 1KERA 1HR0B 4YXWD 1KMNA 3JAWA 2OR3A 4PO1A 1SAYA 3U61B 3W2FA 1WY5A 3K6JA 1L5OA 1O6FA 3WP1B 5AVZA 2DFLA 1WU7A 3CLUD 3PV0A 2XT0A 3SXUB 4D8TA 1U5BB 1I3OA 1A4RA 1DCFA 5CJ2A 3TE6A 1YQUA 4XUDA 2V3VA 2SKEA 2JIRA 2WRZA 2AOVA 3BDIA 3ASZA 3A1UA 3WIBA 2HIAA 3RVDA 1W5TA 4QSHA 2I3AA 3ZDYB 3WAJA 1Y98A 1Z0KA 4B4DA 4LXUA 3NDRA 3LP8A 1Y1RA 1C29B 3NJ4A 3WLOA 4DILA 4GE3A 3IB3A 5K3OA 5KYGA 5KTKA 1Y4AE 3BWYA 2V54A 5ALKA 4BMSA 1QHFA 3COZA 1YE3A 1B16A 4DJEC 2P79A 3L0IB 4TX1A 3JW8A 3UB2A 4CKYA 2OV2A 1BX0A 4M1TA 3ER9A 4Q3OA 4BNJA 1E2MA 2PRKA 3RYIA 1FMCA 3X1DA 3VKVA 2YWXA 3JYHA 5CLIA 5L4SA 4YT2A 3P9NA 1QAQA 1ST2A 4LKRA 5AR1A 4E07A 4BY9E 1PL6A 4ZOBA 4YDQA 4FHGA 1XQVA 5JBIA 1TVMA 1QYXA 5FHQA 1N0UA 1JR2A 1U9IA 3U7QB 4B82A 2LP4Y 1RCFA 1C81A 1IJKA 4LVNA 1I2CA 1VMDA 3O03A 1O54A 4Q37A 1DTSA 4BX0A 2YN4A 1P0IA 2BMJA 1MFPA 3F1KA 3EODA 3KDPA 4HDKB 3KAJA 5CGZA 3RIXA 1U7TA 2O8BB 4MR7A 2BFMA 1IN7A 4FW8A 3T94A 3KPVA 3ZK8A 3KYDA 4NBNA 1ZD3A 5J2TA 1XRNA 1E3DA 1JKFA 4EKNB 1FL9A 1AHNA 3L01A 5KDOA 3D3KA 3JR3A 2CWWA 1U0JA 4M1QA 1E77A 1MO3A 3KT0A 2B98A 1QKJA 5DXJA 1XR3A 5IMSA 4EPTA 1J4AA 1E3SA 4KVZA 2C88A 3C70A 3GEPA 1EX6A 4RLFA 4Y18A 4OLAA 3PUXA 3D7KA 1V16A 5HDBB 2XAAA 5C46F 2IP1A 3DMPA 1AGYA 3BSFA 2QTVB 5IHXA 4IEFB 3TB4A 3UK7A 5ITSA 1T9DA 2C7QA 3EF1A 4PYLA 4WCVA 1Q77A 1XIVA 4B2YA 4RJ2A 5TPWB 2ZLBA 4Z8XA 2HMSA 1IBSA 4ZIRB 2BLNA 4EO4A 3SFVA 4BCDA 4Q1BA 1QYIA 5JH7B 1QO7A 2OD9A 3HXKA 4E4RA 5CPBA 4CPDA 1CR2A 2Y8EA 3BIOA 1DQNA 1PIWA 3D0OA 3GMIA 1OXKB 2YHBA 5SZJA 1LTQA 3FGOA 5DHFA 3SMVA 5KMGA 4HEA1 3NCTA 2I6XA 4HS9A 1YS6A 4JVOA 5CW1A 3L0YA 4DLUA 3V7WA 4DMHA 5IZ4A 1TXGA 3EULA 4HAOA 1CP2A 3GXOA 2L19A 3O94A 1TCCA 4MW5A 1U0OC 2N42A 3HEMA 3O4JA 1IYZA 1PJCA 2YUTA 3WJ2A 1QV9A 4CGZA 4GMKA 4LYHA 3OZEA 3T7AA 2CUTA 4WDRA 3H1FA 4HDQB 2Q5LA 4YUVA 4NOMA 3GNQA 3VI4B 2X8JA 2I99A 4NYIR 3ZW7A 5BR1A 3JQFA 5E4YA 3WVNA 4AZWA 1ZRMA 3LUJA 5AK0A 4D4HA 1C3OA 1NHGA 1U2QA 2OHGA 5CURA 3VGJA 4JLVA 4PCUA 3FGNA 3R5KA 3WNBA 4C08A 2AJLI 3VYUB 1OWPA 5IM4A 5AXCA 2OBNA 1YJCA 3LUKA 1GPKA 1IWPB 2DFVA 2YHSA 1BKDR 3QKSA 4J4TA 2I3GA 2VXOA 4F21A 4V1CA 2HW8A 1NJ5A 1CRLA 4JNCA 1ZLYA 1J8DA 1V3QE 2ZXFA 1Y8QB 5FBLB 1IBKB 2DJ5A 3I1YA 1AB5A 4KQFA 3Q6MA 3ZCQA 4DAOA 1NJGA 2RFLA 1PHPA 1XDUA 4MUMA 3NGMA 4KGVA 4Q1FA 1E3IA 2Q1TA 5KKCA 2CD7A 2KYRA 3H2ZA 5T6MA 2CW5A 1QMPA 3IYLW 3VU9B 2ZQZA 5CDYA 2J30A 4F96A 4NZ9A 2BFEA 2QJTA 5TNXA 1REQA 4DBVO 4DXDA 3MUNA 1BFDA 2H1HA 3RRFA 4Q3LA 5KTYA 2WWYA 4Z4EA 2PWYA 5M29A 1W94A 4WBNF 4HX9A 1M33A 1RI4A 2DVMA 4MWTA 1UEIA 4MQEA 3STHA 1GGFA 3STVA 3WWZA 4DB2A 4PHCA 2KPOA 2QNBA 3FZNA 4NXNB 1FRNA 3K8YA 4AZ3B 3JQBA 4ZVKA 4FGLA 1E32A 5KHLB 4WVLA 1N57A 2GNPA 4LF7B 5JFGA 1X3SA 1JEJA 1SXJA 3GLIA 4MUHA 4C20A 1VCIA 3QEMB 4C4RA 1I7QB 1HFKA 3SE0A 2VCHA 4LXHA 1T6YA 1P5JA 3WGMA 4RF4A 4H1WA 3H1TA 1TA9A 3P4YA 1VCMA 4X84A 4FCCA 3W34A 3W4KA 2J3QA 3VMFA 4DUYB 4PG8A 2KX7A 1PJSA 5CK5A 5DO9A 3Q40A 2BM8A 3MMNA 4YRNA 4WKCA 1NRIA 1TQ2A 2O9JA 3TSOA 2PKQO 1P80A 1YZUA 3C8UA 4ZC1A 1M1XB 3V2GA 1PLLA 2BF7A 5CT5A 3PXEA 1LNSA 2VATA 4G1VA 4DC9A 3UAOA 4LYDA 1JQ5A 3E58A 4JB8A 3K20A 5IJ0B 2B7CA 3BH6A 3LDFA 4H59A 4NYJR 4R1PA 3SHOA 1YMUA 3DZHA 2JAXA 4HD8A 2DPYA 1YVRA 5EC8A 5TJHA 5BYJA 4M21A 2YZMA 5KQMA 1WDLA 1MIOA 1IL0A 4ZZ3A 2FH5B 3VHLB 5G1PA 1NBOA 3IFSA 3Q3JB 2G3YA 1ZSYA 4KRYA 3K8ZA 2PNFA 4CT0A 4CMIA 2ZRHA 3RSCA 3W9BA 4P34A 2JI7A 4OQDA 1UFQA 1JHUA 1FUEA 3FPHA 4J2OA 4HQLA 2R97A 3ESDA 3WBJA 3CR7A 3QF4B 2DTDA 1P77A 4QQFA 5L3VA 3EMKA 4NIMA 5AVQA 4J4BA 2W6CX 2BTEA 1M6WA 1RBQA 4RJTA 5ITVA 4G63A 1DKRA 4HZIA 2W6IA 4E3ZA 1P8JA 4PXSA 1LVGA 1II8A 2QUAA 5K0SA 3TLJA 4LFBB 3C8HA 3H11A 2QU7A 3NANA 3P9YA 4QD3A 2WICA 3A9CA 3TTVA 1ZR4A 2VHCA 3WLSA 4F85A 1W34A 1O8CA 3I6QA 4KXUA 1I0LA 2XE4A 3ZNOA 4O4HB 3BCRA 5JZBA 3ET5A 2WSBA 1C1YA 3KWMA 2PYZA 4GXRA 2QG4A 4WI1A 2E87A 1L5NA 3HBLA 1ADFA 4B1FA 2CMFA 6REQA 5E0KB 4UNQA 1FNBA 1Z0SA 4MITA 2UVDA 2WW8A 5A3RA 2WB2A 6ADHA 1JILA 3AIIA 1DAHA 1FCJA 1U3CA 3IIKA 1WUJS 4FFSA 3LCCA 1G3UA 4H6VA 4INAA 4XRRA 1CX9B 1AUOA 2D0OB 2GPJA 1NMYA 3HKCA 1G63A 1UKZA 1MVLA 1FRFS 4H60A 2GFHA 8GPBA 5LP6C 1OBCA 4M7RA 3AKDA 1DOZA 1KMMA 3E2PA 4FGUA 1H6DA 2YMMA 4L8LA 3G0BA 2XF2A 5L7TA 1EU1A 1YB7A 2MINA 4U8HA 4NBLA 4AS2A 2JK0A 4LGYA 1XYYA 5KTRA 3REQB 4IDEA 2PBZA 3H5TA 3IMFA 4GSLA 4YYEA 1P2FA 1L4GA 3F6SA 4RYDA 1XTIA 3ESXA 3QIAA 4PYJA 1T3TA 3MLEA 5LIPA 2JF0A 1SHLA 1RR6A 1TC1A 1Y8CA 3RC7A 3VPXA 3TLCA 5BT9A 4JLKA 3AJ9A 2QAIA 2CL0X 4MEAA 4WTOA 2BKUA 2FSGA 2M32A 2Y0CA 5AT1A 121PA 4U00A 4YPFA 5H80A 1KDZA 3WK7A 4AICA 3B20A 2F2TA 3QE3A 5E9WA 3ZV5A 2GPNA 2OKCA 1VRVA 3LQQA 2JBWA 1W6RA 2GYVA 2G1JA 2GTIA 2Z0MA 3ND8A 1NJSA 3TR5A 4DPMA 2FSPA 1XFDA 4KR7A 1X9HA 3U09A 3MCWA 1FYFA 2PMKA 1EWQA 1RAEA 2JDIA 4D3ZA 3Q7RA 1GYPA 1L7XA 2JGAA 4JC8A 4MWBA 5IBRA 3FFBA 3GOQA 5KVQA 1WW3A 3BA1A 5DCLA 3ZHOA 3V9AA 2ZOSA 1ZVJA 2R8EA 4PFQA 4BQIA 1ULAA 5HRCA 1XDGA 2FEMA 3IE0A 2OHIA 3N05A 4FSDA 4PLWA 5F64A 4BECA 4DBZA 2G82A 3KWJA 3F5DA 3CZQA 1JI0A 4RW0A 3QP9A 1QHHA 4YDHB 2XW6A 1K97A 2C5FA 3FXAA 4WZAE 3FSJX 1DIOB 2ZJ1A 1NUPA 1EFVB 1FFAA 1PWXA 4D8WA 2GJKA 3JV7A 5L3SB 1BXRB 2C4VA 1HBJA 3U9LA 2ILTA 3OZRA 2C2OA 3ZE8A 2NSLA 2E5WA 1QH0A 2ZRAA 3O90A 4GMHA 4NZZA 4NYJQ 4XW2A 1KWGA 2BP7A 2F1IA 1K27A 4KRXA 1CVLA 1SCDA 5HKKA 3ZWVA 5A7HA 2RGDA 2BZGA 3WE7A 4EG6A 4ZGBA 2JNWA 4DV2B 3BGOS 5D5HA 1UPXA 1PW7A 3GJYA 2WVHA 5E4FA 4GLJA 2WF5A 3E53A 5G0VA 3A27A 1QGAA 2XRMA 2YXDA 3FKJA 3ISJA 4JUDX 1FYEA 5B57C 5C3MA 2QX8A 4KOEC 1LEHA 1V96A 1XV5A 2WWTA 4Y1FA 3DNMA 2QR3A 4IMIB 1UC8A 4K2AA 3G1UA 1OZAA 3RU2A 2DFNA 4DSNA 1XXHA 5KJ6A 1YOVA 3PR3A 1OLXA 1V37A 3WK8A 3L7OA 1KIAA 2AKAB 5AVWA 3ZJUA 1U8ZA 1OWMA 2JI4A 1AKVA 1CUAA 3IBSA 5LB2A 4F6LA 2PIDA 4BWFB 3OZGA 1NQAO 4QFDA 3PITA 3PRYA 2QUIA 3GYGA 3IDAA 5BR8B 3UJDA 2GO7A 4BX3A 1MV5A 1BEUB 1FU4A 4Q1CA 1IQUA 4R3NA 3DW3X 1T0UA 4IOJA 3E1KA 1EP1B 3T5GA 5IXYA 5IVKA 3SC2B 1OX5A 4N0PA 1SD2A 4TTVA 1AKUA 2HXYA 2JARA 3A9VA 3QHAA 3V42A 4KPUA 1S2GA 4ZDJA 3A70A 1HKHA 1CVRA 2Q0HA 2AZXA 1NVWQ 3LYUA 4QYSA 4N39A 4J94A 4AKTA 2DU8A 1I1OA 1AZSC 1NJ2A 2P9EA 2BF4A 5FQOA 3SPXA 2JFYA 1GPH1 3ROEA 4MXDA 1QHYA 4D82A 2V7WA 1OXXK 1Y0BA 3MEQA 2X41A 1T8WA 3QPBA 1A9XA 4QYIA 1J2RA 1W2HA 3NBYC 2ZBFA 2CLKB 5FQNA 3HBJA 4RAOA 1OY1A 3E5HA 5BMVB 4NARA 3GLFB 2NT4A 4M8KA 4GM1A 3SHTA 3L9XA 4KBYA 2E37A 5GJCA 2BGIA 1G7RA 4JLBA 5EL0A 1FXSA 4O0MA 1MO4A 5IDQA 4JI8B 1BQ3A 3KIPA 5EMNA 4GRIA 2R86A 1L6RA 2PFGA 1P1IA 4BVFA 3OFND 1DU4A 4XD7A 4AN0A 4CR7A 5KUTA 1OC2A 4RSHA 4U2KA 3GL9A 1LD3A 2ZYVX 3LRPA 3RK4A 1GZ6A 4NS1A 3RT9A 3W2TA 1VHTA 1GSOA 1SVIA 3MTDA 3WX0A 2P1DA 2C9ZA 4N48A 1KC1A 1CUBA 1ZK4A 2VDRB 2IYWA 2PGAA 4TXNA 3ODPA 4PAQA 4NC9A 2VJCA 3TVYA 1MOPA 1WO8A 3ZW9A 1GV1A 1HG0A 1PSWA 2QWXA 3B82A 1JPVA 4NMXB 4RY2A 3PLAE 4ZYTA 1T9GR 4BNHA 4J7AA 4RELA 4BNWA 1KVUA 3AXSA 4Z1MA 4R2LA 4ARZB 5AUOB 1E2DA 3WLKX 4AP9A 4F2HA 5C7LO 4MUJA 1ZCFA 2CLEB 3HP1A 1WVGA 3HJAA 4GX1A 4DE5A 5I47A 1WJGA 1GPBA 1KP2A 5ER6A 3T99A 2FCRA 1RKUA 2B8EA 2AW3A 1B7GO 5E8JA 1PWHA 4WLUA 3PNMA 4D26A 2NO1A 2IYPA 2JGDA 1P2GA 2WJPA 5LUAA 1HOTA 4Z3OA 2I2CA 2VPZA 3N3BC 2YJ6A 2O7RA 2RGYA 4DIEA 1WUTA 3DNFA 5U4XA 2W58A 1J97A 2XNHA 3D4NA 1GU1A 1N2CE 4E1AA 2C84A 2GN8A 5EP3A 1E9AA 2VAPA 1OFUA 4PYMA 2H08A 2DUWA 2MSLA 3MWEA 4CEJA 1V2GA 2VTDA 2PM8A 1CEYA 2CLSA 1IIRA 1YK1A 2PO5A 2UUPA 3I83A 3WGTA 4YUXA 2IXEA 4EHFA 4BIIA 1WHTA 3RVJA 2DG2A 2F1RA 1PZXA 3N07A 3X43A 4ZTUB 1JPJA 1K8XB 1Q0TA 3ZVRA 4IIUA 3BUSA 4QJ4A 5E38A 5L4LA 2RE8A 4NE2A 4JBHA 4H77A 3VC1A 3GT0A 2OHVA 3ZHVA 1T26A 4Z9XA 1T2NA 3Q7QA 3A05A 2ATEA 3WRYC 1VLZA 1ZRHA 4WXMA 2ZWIA 1D6SA 3NHSA 2J0VA 4UUBA 1HFEL 1QIMA 3IEPA 4QO7A 3DZGA 4CM9A 4LGCA 4JJ8A 4MVJI 2G88A 4QTZA 1G1MA 3S4YA 2M9MA 3H2BA 1QO0A 2C4MA 3NXKA 3UKJA 1E61A 1NVMB 2ZITA 1H69A 2VCYA 3JQPA 3ETNA 5GM2A 4WESA 4A16A 1YR6A 1C0PA 3AH8A 2QAGA 3DLCA 3HJCA 4PV7A 3V8VA 5BSHA 3DMTA 3I2JA 3QXHA 1ZJYA 4C7VA 1FRVA 1MD9A 3CNOA 2JI6A 3BJIC 4EUSA 1DC6A 4XDGA 4DREA 4GVLA 4S12A 3NALA 9GPBA 1EZZA 1NR5A 1ZJ6A 2B8JA 2BGKA 1Y6RA 4GG1A 4EYGA 3IKTA 3GP5A 4MKXA 1NF3A 4TRMA 4CMBA 3A32A 1R4NA 1Z3CA 2Q45A 3L6DA 1NOIA 1H9BA 4RHFA 3D8HA 2VQ3A 2YZGA 4Z7JA 1ONBA 1E1DA 3E8MA 5L7WA 2IS4A 4IFTA 3AVYA 3P2OA 2EP8A 1W9HA 1U7DA 3H5AA 2PKEA 3FHTA 4L4XA 3OX1A 1AZTA 3EXG1 5FFNA 2AC7A 2B25A 3DNPA 3LOPA 4KFRA 2I87A 5D2CA 5A5GA 2XZDA 2IPAB 4IDDA 1NVAA 4H27A 1ZOLA 5JAHA 4N4AA 1W5SA 4C04A 3J81k 3PHJA 3SR4A 3N8KA 1RZ3A 1WUKS 1KVQA 2FVXA 3G2LA 2WP8J 3U3OA 3VKWA 3EYAA 1G66A 4MVXA 3D7SA 4F3KA 5C4GB 2J6CA 5EPEA 3TNJA 1KFBB 3LVFO 3NWOA 1QPZA 5KQGA 1MJFA 3OIGA 3ZGVA 2I91A 1G2OA 3BXGA 3PUVA 5CFQA 1XAHA 6NULA 3L0PA 3O8BA 4IV8A 1F9AA 1M3SA 5AXAA 1GPDG 3H3FA 1B93A 4QUHA 1NC1A 1MVNA 2FX2A 1D3AA 3VR3A 4AROA 3KS9A 1YZNA 3I9FA 1ZM4A 4YMHA 3OA0A 4FXOA 5HVNA 4Q7EA 4MQ6A 1Z4IA 1Z75A 1BEZA 3A1SA 4LDRA 5DYTA 2QJWA 4BUZA 3ENZA 4LK2A 5IVHA 3I8OA 1ESEA 4YLGA 1IK4A 2C4NA 4P83A 2VT3A 3KE8A 5ALLA 1EFHA 5F4ZA 3S27A 4A3SA 3CVWA 1VC2A 3DR3A 5KSZA 1P29A 3DZBA 2FEPA 2GYYA 3EA0A 4FYHA 3H9QA 2WJ4A 3X1ZA 3KLOA 2WUDA 2H31A 4UBLA 5CVDA 4BQSA 3BWVA 4I99A 3NTUA 3AKYA 5ALMA 1BMDA 1GOTA 1WQ1R 2ZUCA 2OXCA 4JP1A 4Z7NB 1KI3A 4YRBA 3FOFC 1D5WA 2JH3A 3FNGA 3R7WA 4AUMA 1I30A 3B7GA 3I6IA 5J2UF 4RIFA 2VI5A 4DAEA 5FNZA 4IYRA 5IYZF 4ZRMA 1Z6TA 3P9QA 2W2NA 4JVMA 4UVHA 3EQ7A 3ETGA 4CW7A 3EPPA 3PQ4A 3KB8A 4RXMA 3IDQA 2WJZB 3VNBA 2CMGA 4HPXB 4IFIA 2RKBA 4XIJA 1Z47A 2BH9A 4AMVA 4OSEA 4JBGA 4B32A 1TF5A 1NP6A 1NW5A 2ZT8A 4Q82A 1P4RA 1R0LA 5L3QB 3X1XA 4IR7A 1SA0B 5HJ7A 1T5BA 2W9XA 1UFKA 3HCNA 4MVJE 1QGED 2EW8A 4M49A 2C07A 2XSZA 4UBJA 4AQYB 3SSNA 4AKEA 1VA4A 3UFXA 2VRCD 2HMUA 3FYUB 1JPUA 1WB5A 3BWXA 2CNWD 4BUCA 3LWDA 4YRDA 3MTAA 1QLJA 1OVMA 1D1TA 3TW8A 2LPMA 2ZRJA 3G02A 1TUEA 1QP8A 1C3VA 1NYLA 2OB1A 3QLJA 3QUTA 3H18A 2IZZA 5BN5A 1M8GA 4J9VA 4D3SA 4BWVA 2C5BA 3FTEA 3EVZA 1KYXA 2HJSA 5D3MA 2F59A 3EJWA 2PU5A 2X1VA 4HNHA 1SUWA 2JHPA 3QGMA 4MRMA 3C3AA 4WACA 13PKA 4AO7A 2YMQA 4U7FA 4CR8A 4E11A 5BNTA 2QX6A 2PX5A 3EQ2A 5JWOA 4X6UA 4YK7A 4HZUA 3HKDA 4MUIA 1EJ2A 4ROTA 3M1LA 3EXIB 3HACA 1HEYA 3NM5A 2PMBA 1TECE 1UM9A 2ONYA 1T9CA 2PTGA 3ESAA 3MW8A 2D54A 3MWDA 4XB6B 5ESRA 3V1LA 5B1SA 2NZVG 4OMUA 4P7JA 3ZVKA 1WETA 1RHQA 2YX1A 3IE2A 4QJBA 1Z6AA 5ETJA 2NO7A 3FIJA 3HUDA 4EQ6A 5G0WA 5JC1A 2D2IA 3M33A 8MHTA 3PVZA 3R7LA 3BHMA 1MNAA 2XD9A 4HFNA 2CYAA 1EX9A 2JIZD 3AONB 4IHAA 4U9IS 2WTNA 1E9BA 1QHIA 3MFQA 2AS0A 1W93A 5C2JB 5JNRA 2NTVA 2R5WA 3FYDA 3NTXA 3PKJA 4NATA 1RWBA 3AUXA 2YJNA 4B47A 1XZLA 4E2XA 5JIBA 2Z8YA 1QGUA 1OKKD 1ORDA 3FOCA 1S2IA 2QP3A 4YECA 1SZCA 4EF4A 3KZCA 3KZKA 3QBDA 3EPHA 3GFPA 4KN6A 2YYZA 4R8KA 2HMWA 5AM1A 1FQKA 2GM5A 1GAJA 5AJYA 4D3YA 1SKYE 1ZN8A 5CH3A 1ZGAA 5IARA 1CQXA 1KR5A 1PCXA 3CZ4A 3QEKA 4Z9FA 3STWA 2I7VA 4CM5A 2B21A 1MTZA 4MYSA 4YRPA 3M3DA 3WRWA 4ABYA 4DRXB 4EO7A 2JAQA 4MTLA 3RROA 4IW3B 2ZYUX 2MYTA 4EKIA 1O6GA 3DE1X 1RYYA 4AURA 3QPVA 3E1GA 1ND6A 1KYWA 1P3DA 3O26A 1C8LA 2EBFX 1PFQA 2WMDA 3R6LA 1QZ3A 4HGNA 4CN9A 1X1TA 2Q07A 3L92A 1Y3AA 4HBGA 1Y82A 1KI8A 4G8BA 1LBIA 1X7XA 4DCCA 2HY7A 1SVSA 3N5CA 3ZXXA 5JALA 3TSWA 3DO8A 3FJ1A 3LSTA 3UG7A 4FE3A 1ZA2A 1PNTA 1OFUX 4FYIA 4L8VA 4TMWA 4JYMA 3L5KA 4W5RA 2UUCB 1QH9A 5KOJA 3R8XA 3A6HA 1EFUA 2OCPA 3ASVA 1GTVA 5J1TB 1DAGA 4G89A 2HRRA 4BKUA 2BZSA 1WXGA 3ADDA 1Z7BA 3TR0A 4DNOA 2B36A 3MT9A 3IUNA 1UPTA 2FE4A 2Y66A 4JEUA 4N41A 2J4DA 5AJWA 2ZTUA 3O95A 3T9CA 2K87A 4HXGA 3BWCA 1GQOA 5LU9A 1EQUA 1V8FA 3KEQA 3THYB 2RONA 3NBUA 5H0IA 4AS3A 1H05A 1PLKA 3ESYA 5I7AA 3JD2A 2Y2UA 2BCEA 2GCOA 2ZCVA 3ROFA 1JEYA 2ZSJA 4EYEA 4LXYA 3FWNA 2HWYA 3QTLA 1J6UA 3UV6A 1FFHA 1FZQA 3W8NA 3L8FA 4PZYA 1E0DA 1O5OA 2ZUWA 5TDHA 1VIVA 1P7CA 1WPGA 2EV9A 4POAA 3RV4A 4ARUA 4UNRA 5K9ZA 1R1DA 1XPRA 4IKEA 2AJ8A 3DGFC 1U2ZA 4LHZA 2B9EA 1D4FA 3STUA 4BNGA 2BKVA 5HK8A 1OXTA 2UYQA 1LUAA 4OX9Y 4Z4IA 5B4VA 1H1LB 2B4QA 3NO4A 1S1MA 1AQIA 1L7QA 2VNKA 1SHZA 4EHNA 3UJPA 1SQGA 4A92A 1L5ZA 2QD5A 3AF6A 1ZLXA 1YI0A 2HDNB 5A06A 4JOSA 2CSXA 3OOEA 1Y63A 3LUHA 1ZINA 4UCXA 4BJ5A 2V6IA 3UJCA 2VSOA 1JDPA 2PUJA 4W5WA 4OBEA 2EDCA 2H2AA 5DLQC 4RMGA 3WGJA 2JIOA 4B6EA 4DGSA 5KPJA 4TV8B 1Y81A 2WNSA 1CHDA 3DFMA 2LV8A 3QW4B 1KJJA 4J0FA 1G3QA 3VDMA 3DF7A 1CRZA 5C51B 3PSAA 4UZFA 3TZCA 1DB3A 4LDAA 1L4MA 4R0NA 1GRNA 4ZALA 4FQ5A 2OK7A 1IC6A 2W2VA 3DKIA 1E2LA 3PFHA 1N6KA 4IIXA 3Q3HA 4JK3A 4GQIA 4OHKA 2IYTA 3DPUA 2YC2C 4C4AA 2CLCX 3L1HA 3LPDA 3UA4A 4HNRA 5IJXA 4F4UA 5HCUA 1QXSA 4AX4A 1FFXA 1S3FA 4F11A 3CSSA 3WTBA 5KJCA 4P9NA 3R6TA 2HJVA 1QORA 2OCAA 2VLIA 4ZEOA 1J25A 2D74A 2QSZA 1P4GA 5IHPA 5KIAA 3O9ZA 3MTIA 3HBMA 5K8VA 3ZUPA 4M7PA 1LZLA 4G8JA 1PQUA 2OG2A 1I2DA 3B48A 5B3JA 4DLWA 1CY2A 1FPMA 2P2ZA 4ZYWA 3GG2A 4P4UA 4XJXA 3P0HA 1XTUA 3PHGA 3QK7A 5COQA 2F1HA 2QBYA 1XMXA 1TLLA 2GPWA 3DEJA 5KNBH 4UFNA 2KHZA 1FVOA 3OLCX 3A0UA 3SF8B 3L3BA 1G16A 3AOEC 2QMOA 3G8DA 3U9TA 1YA8A 1RAIA 2ZSIA 4XGKA 4IHJF 3HBFA 2V98A 4OF4A 4DL9A 3HEBA 1CR6A 1ZUD1 4R6WA 4JITA 3WGGA 2OHHA 3K5WA 2IC5A 4D4LA 5JSQA 2PJZA 5K05A 2WTMA 3BSWA 2IUFA 4XZ3A 1PZMA 2D59A 1CS0A 4ITVA 3V3KA 1DEOA 5C0OE 1PV1A 1Q7EA 3QVGA 4ASUA 4MRNA 3GD5A 4PG4A 2ZSDA 3GD7A 1QP7A 2JLXA 4YMSA 3EXEB 1FQOA 5K8TA 2PN1A 3BZUA 1II9A 4LRSB 3PXBA 2ZCUA 1LPMA 2F00A 3SDZA 3FUTA 4L5IA 4PSKA 3O8OA 1KDPA 1EWYA 2IX9A 3FUXA 1T4CB 3FPEA 3LHKA 3N70A 4P3OA 2X5NA 2CK3D 4XA8A 2D62A 4C0HA 5CJPA 4R7GA 3N3AC 1ES9A 1F2TA 2WF8A 1L1FA 4LHSA 4F7DA 1O95D 4JA2A 4DTCA 1TPYA 3PI7A 2VJPA 3J7AC 2F3QA 1ORTA 1U7ZA 5H4HA 5FP0A 4TYQA 2QB5A 4BEJA 2WY2D 4B7ZA 1M2VB 1P0CA 1VE3A 1XRSB 3I39X 4WKPA 4ZK2A 3O0DA 4PN7A 5EXPA 3AL2A 4NP6A 2OXEA 1T3SA 2C97A 5KWEA 1OXVA 2ZBRA 2ZBGA 2XUAA 3KQYA 3KP1A 4U7TB 3C6MA 4I50B 1EGMB 1QLWA 3S6JA 5KNDA 3OIWA 1Q11A 3IUSA 3INRA 4WBNA 3AUFA 3FRIA 3MXTA 3HRHA 3HQ4O 4O4IF 3Q1LA 4WZAB 2X15A 4D9MA 5B2FA 4DQXA 1Y5IA 4B3IA 1JTFA 1GD1O 3PFCA 1AZWA 1CE8B 2H59A 5JNVA 2H7CA 2Q5OA 4Z8YA 2YDYA 1V95A 3PPVA 4DPKA 5EJ4A 1C41A 3JWIA 3GFBA 1QRAA 4KLRA 4RANA 4EYQA 2XDQB 1AC5A 5BSEA 3GWZA 3TFQA 2FFJA 3K5IA 4ICIA 3DTVA 4HB3A 3GA5A 3QUBA 2IYEA 3W77A 1M8KA 5FT9A 5NULA 4DDKA 2BMWA 1EX1A 1OT3A 4DIUA 5A3QA 3FVWA 3P0JA 5HX7A 5IAGA 1M10A 3E9DA 1Y8RB 1YGYA 2BFBA 2DT5A 4HH0A 3PXGA 5HR5A 2B1JA 2XUIA 4ALIA 3NRJA 4F84A 1E0KA 4K9DA 1S6YA 2PJDA 2Z2ZA 3VDNB 3VPHA 1RJ9B 1A27A 1WAMA 4KDEA 1BU5A 1TCBA 1RSZA 2K7ZA 1U2DA 2QLBA 1MO2A 2ZI3A 3LA6A 5FKJA 5HQJA 4BO3A 2L17A 2RG1A 3F6PA 4YRFA 2D1TA 4U0JA 2Y71A 3LDAA 3SNHA 1HUQA 2VUIB 2XWPA 4LRTB 4WV3A 3TYXA 2UZ3A 5IU6A 5LMNB 4GEKA 3SLKA 1FP4A 4DC0A 1BAPA 3GJ7A 1H8ED 3SYMA 1GSIA 3GAAA 1PVVA 3L8ZA 2ZSEA 3WRXA 2CNOA 2XWJI 3G49A 3CM0A 3MGGA 1XRPA 2GZSA 2HA0A 2W6JD 2VYCA 4MPRA 2BBTA 4ZT5A 1DMSA 3ITEA 4GU5A 2R9VA 3KZXA 4DMMA 5HS6A 2ZAOA 2C0PA 1SVNA 1CNEA 1LXCA 2CNDA 4ZT7A 1PR5A 3R6DA 1QUFA 2Q6TA 1B41A 1E98A 1KFCB 2C5LA 3MYYA 3TKLA 3W1VA 3QELA 2FMKA 3ELYA 1I4WA 1I24A 1JQ3A 1T4BA 4GM4A 2WVJA 4X3PA 4XWTA 2P9FA 5E8RA 1H4QA 3X44A 2BFFB 1USKA 2FQQA 1MZVA 3LGAA 3V7NA 3UTCA 1SB9A 4CKEB 1IHPA 2D8AA 5D84A 4ZRDA 5KYNA 1GLVA 1XEAA 3ORQA 4MV6A 1EK6A 1JZSA 1YR3A 3MD0A 4NMHA 4N7BA 1GGVA 421PA 2DY1A 4A0RA 2XI4A 4Q9NA 1VJGA 2YRXA 1KEUA 2Q28A 2JD0A 3M6VA 4Z0HO 2PMFA 4CUJA 4IXTA 1U7OA 3A3OA 2WMYA 3CISA 4HSGA 5KEIA 1KAGA 4HCJA 5AVUA 3CLHA 4OHBA 3O31A 1J2UA 5E3JA 5J5VA 4C4TA 1LK0A 2YWBA 1EYZA 3UT5A 1E5QA 1T2EA 3DZDA 4R51A 4B7XA 1FXWF 2PUHA 3JY6A 3RSFA 2GZDA 1GCAA 1WV1A 2G04A 4Q0MA 3S7ZA 1QRSA 1PZHA 1OJ7A 5DYNA 2Q6LA 2HYIC 1T6ZA 2BM0A 2Q3LA 2H4XA 5GGXA 2RC6A 2DAPA 5EINA 3HN7A 4GOXA 4JT2A 1KBOA 4MWEA 4DLLA 2YRWA 5DU2A 3HR7A 3QLUC 4AO6A 4PGFA 2OV6A 5JVDB 4X93A 3VR6D 1ZIYA 4YO8A 1VSTA 2Z5FA 1OAAA 4F8EA 1JSXA 2CXXA 4Q4CA 1FFSA 1UXIA 1E58A 1N6OA 1TGVA 3G23A 3T5AA 3MFYA 5EP4A 2PRIA 5I7RA 2BY4A 5HW0A 2W6MA 5TIIA 2ZYGA 1S3IA 2ERCA 2X42A 3N6XA 3JD1A 4QTXA 1YR2A 3GVCA 2YXPX 3PKIA 3M4JA 3THWB 4G0MA 3ZHBA 2IUEA 1L8XA 1K9VF 2E5FA 1P91A 1Y9ZA 2NUPB 1YTUA 5LSAA 4QUJA 1R6XA 4N47A 2I22A 1JSZA 4U8GA 5BNWA 1R4MA 2A9KA 3G9QA 4JJEA 4P1ZA 1G8JA 4PX3A 1ZQ9A 4JAVC 3WQRA 1N2CB 3PQDA 1Q22A 4UUPA 1EDEA 7MDHA 3F7MA 5KU1A 1X7ZB 4YYZA 2X9LA 4ZI7F 2DY0A 2I54A 1GILA 4NCXA 1M6EX 3UAXA 4K9QA 3F98A 1U65A 3ZJTA 2GJAA 3AEXA 3VQTA 1NSFA 5A1TA 4H7KA 1J2YA 3UENA 3DEYX 3F6BX 3ZCXA 1ARZA 2SKCA 2XTMA 5E3IA 2YVUA 3TLAA 2LUOA 2GSDA 4FCTA 3FUUA 1PG0A 2Z43A 4K9KA 5FBHA 3SDSA 4AUEA 5BORA 3HHPA 4R2JA 2B2XA 1SBYA 1QB8A 2ODTX 2X0RA 3O73A 4AY3A 1PZGA 2X0JA 4EJ2A 1G59A 4BXOA 3D4BA 2I4NA 5IAJA 1JQJC 5EJ7A 3BB4A 3H5VA 1ZUHA 1MFZA 3C7TA 3IA2A 5E1MA 3UW1A 4EJSC 6PFKA 4YR9A 4Z4CA 3HJRA 3QXSA 3VYVA 3S2FA 3TTXA 4ZAZA 5GADl 5DNWA 1T3ZA 2E89A 3QY0A 2WT4A 1FYXA 4IVRA 1AUVA 5KU7A 1TAQA 2QQGA 4Y8VA 5BQOA 3RRZA 5EKTA 4CIYA 2GCPA 2PS3A 3DWIA 4H3HB 3JZIA 2I66A 1M8JA 3FCOA 4Y2PA 4ETIA 4HDNB 2IEDA 5HIMA 1ESDA 3HJHA 4KIGA 4LOJA 5EKXA 5FI3A 3KQHA 3FKSA 3H7AA 1P1JA 2C61A 4MUXA 4KXFB 1RYFA 2EFJA 1U9JA 2YV5A 2ZRLA 3E5MA 4HXYA 3R7FA 5JJ5A 1P33A 4Y0VA 4HPJB 5B12A 2KS6A 3OCVA 1DV2A 3RSSA 2X5KO 1OH6A 3MUFA 4LGVA 5I4KA 2A6PA 3S1AB 1W96A 4E5MA 5DMHA 2P5SA 3L6EA 1ZKMA 1ZXBA 3NHRA 2ZBPA 1NLMA 3R3WA 1SMKA 3DBOB 5DNVA 1S8NA 3T7JA 4ZHSA 1KAOA 1I7LA 2AJBA 3GJZA 4MVJM 5CNJA 4AFNA 4TROA 1UBRS 1WUIS 5CG1A 1MQ8B 5GPBA 2FSSA 3D1LA 1QLHA 4M98A 5FTNA 4BS9A 3UMBA 3IEXA 3TAXA 3GQBB 1NMSA 1QK4A 2ZRPA 2ZJ5A 4G23A 3ZD6A 1W85B 2BEVB 4BNTA 1OWOA 2A0UA 1UXJA 3BGIA 1ZXLA 1X7YB 1T5LA 2ONCA 3INTA 4GI1A 2X77A 1ODFA 4ZO4A 5EPOA 1QH8A 3EIQA 3GCWA 1FUUA 3MLAA 5DHAA 4GKBA 5AW8A 1AX9A 3H9EO 4NVRA 3A3YA 4A8JA 3JPYA 3NEAA 3W5IA 4XCXA 2P4SA 1SQFA 1A8PA 4F1JA 2OCLA 2ZVDA 1NSYA 3D8BA 3DLPX 4TLCA 2INGX 4US0R 4WNCA 4Y2SA 3UATA 5LFAA 1B6GA 1N2GA 1GTL1 1L8LA 4L15A 1IH8A 5AK5A 2VF4X 2QM3A 3DTNA 3E9MA 3ZE6A 1ZK1A 2PAAA 1GZVA 2RKWA 3NHLA 4B75A 5FRDA 3FW1A 2ZIFA 1FU7A 2O8DB 3IULA 2YIVX 3T3IA 3I45A 4KYUA 3SJUA 4E5YA 2J3DA 5B3AA 2HF7A 1TC2A 3AZQA 3PK0A 3C85A 3X1WA 4QT0A 4RK0A 4AJ1A 3OC0A 3ZWAA 1XVAA 3ZG6A 2BKEA 4JSYA 2OCGA 4QDZA 2BL4A 4D7AA 4L5YA 5HDQA 3VKHA 1CC1S 1CLEA 4G5FA 1PR0A 2TS1A 4LY6A 4V1CB 1OXUA 3PFFA 1ZG3A 2PCJA 3PSHA 1KC3A 1WKCA 2DBRA 3U39A 4LF5B 3AFMA 2ZRGA 1ZK0A 3OLQA 1SOVA 1Z26A 2Y1KA 1Z62A 2W2KA 2B6NA 3HCPA 3KELA 2A0FA 1JSRA 1EVIA 4ZO6A 3WADA 2QHXA 3MF4A 3P2KA 4OD0A 4N9QA 3LXMA 1CP3A 1JHOA 3LY8A 4D9NA 4FFMA 5ES3A 2WZQA 1I3LA 4JFRA 2FHPA 3L07A 4QFCA 1U3WA 4D92A 4LF8B 1XVUA 2EX1A 4BP9A 3FROA 1I6WA 1QQ5A 2JCVA 2W2TA 4U2EA 2FEOA 2PGXA 5KVCA 3TL3A 4PWYA 1I6MA 2K5UA 2Q3DA 4PIVA 4LZNA 5C7IO 5I8PA 5J3JA 1EEXB 2L69A 4NU6A 1RFGE 1MEEA 1BW9B 1GXSA 1ZJJA 2PX3A 5B55A 4RHEA 4RPGA 3K9FC 3QRWA 4R69A 1EHIA 3TH5A 5HWSA 3PJFA 5CB8A 4QQKA 4DQ0A 4OP3A 3IT2A 1Z15A 1YL5A 2J67A 3WYNA 1CEXA 1GKIA 1LF0A 2FPXA 3HY6A 5AW5A 5A4MS 5CD9A 4PNEA 4CL2A 1QO9A 4HK4A 1J2JA 2Q2NA 4KDRA 5HF5A 4BWYA 4F5YA 2J09A 4C0BA 3NAQA 4WLFA 4PX9A 5C4IA 4BVLA 3BE8A 1BZYA 4MQFB 1C3JA 1UQRA 3LLSA 1C9NA 3K94A 1R12A 2O8FB 1DAEA 1NU6A 1PNRA 3R0QA 1DKLA 4NBWA 5EQTA 3TX6A 3EH2A 3KZVA 1V71A 2NPIA 2JVIA 3KT8A 5IASA 1P7WA 4ER7A 1XALA 1QIJA 1YAJA 2QRVA 2AR7A 1HLFA 3HY3A 1CFZA 4K9OA 1ZJZA 1FYDA 3CN9A 5HTKA 1N78A 1UINA 4IQFA 4TPKA 3RJMA 4CGYA 1Z6PA 2ISCA 1M2WA 2XYQA 3Q8LA 3N59A 3DXYA 3P32A 5ALWA 4KTVE 3W6OA 4CKBB 1EM6A 4N40A 4OBWA 4PNHA 4B6FA 3U4QB 1PR3A 2PUCA 4A36A 2CCKA 3W5UA 5BV0A 4PZPA 1G55A 4RF3A 2Y6VA 2F43B 5FWAA 1BYUA 2ANBA 2FN3A 4WFIA 3RQIA 1Y48E 2FB9A 1P2SA 5T4HA 3TNDA 1WMFA 2EGUA 4G86A 3PF8A 4GX5A 3WNQA 5AW6A 1LRJA 1PKEA 4QUIA 2VK4A 3RVNA 3W78A 2JFXA 1F2DA 4K1XA 2P2SA 3D8RA 4J7UA 4RD4A 3DR5A 5CJJA 3WZ2A 1F1BA 3VAYA 3KJIA 5SYAA 1E18A 3WDMA 4ZI2A 1X6VA 3R9IA 3N2KA 1QDLB 4CM8B 3SQXA 2V7UA 5C32A 3GFOA 3VMMA 5CTJA 2XLBA 1DL5A 3FCSB 1KEZA 1ID1A 2C4KA 3V80A 3MJVA 2X6QA 2AFIE 2AH5A 4AZTA 1G7CA 3OP1A 1G8YA 3ZZTA 3SK0A 3E5NA 3AYXB 3ZV6A 4C4PA 1NNEA 1JLRA 3SDBA 4YAUA 2YFKA 5DGDA 2YVKA 6Q21A 2ZT5A 2WYWA 1LA2A 2JCBA 4EI8A 3QU2A 1AMUA 4ZI3A 1MW9X 3KV1A 4INPA 4OIMA 3HDHA 2H48A 3JSAA 3ON5A 5TQ0B 3AM4A 2IBSA 2CFCA 3M6IA 3P20A 4I9FA 4JBYA 4CMAA 2XF8A 5DRYA 1WV0A 1WEKA 1P9OA 4K7JA 3ANNA 4TLEA 1P2TA 1OLOA 2ATCA 2IE0A 1NP7A 4KODA 1SR8A 4FB4A 5LP1A 4AULA 2BDTA 4BP3A 4M46A 1A95A 1F2UA 2FQ1A 3EZLA 3CPSA 3G5TA 4HEHA 4JMPA 4XJVA 3PRJA 1EA7A 4EATA 1VOTA 2AZ4A 3R4VA 4MVWA 4MWDA 2AI1A 4B3TB 4O8CA 4H7PA 1NNLA 1UBUS 2DT8A 3VZRA 4DR6B 2ZR8A 4DEYA 1D04A 1FJHA 1VP9A 4RVGA 4MRAA 5H16A 4Q7JB 2D5BA 2XY4A 4JT9A 1NXWA 1PDWA 3MA0A 2H5IA 2B1GA 3I23A 3OCYA 4LTDA 2G9NA 5F2OA 1NW4A 1SBTA 2B8WA 3S55A 2YMPA 3TK1A 3ZLTA 4ECAA 4H4DA 4JXJA 4WLVA 1C14A 3HCWA 3N86A 4KPEC 4KWIA 5BUCA 2W6QA 3PGJA 4LHWA 3U1VA 2PBLA 4ZDWA 3SEZA 4V39A 4CIAA 1ZGHA 1IWOA 2E1PA 1NIJA 2IWHA 4CDMA 5DCWA 1SN7A 2W2PA 5EJ8A 1AXRA 3ZKAA 4B6OA 4B7AA 3B6EA 3R3ZA 5IYZA 2REQA 5KTNA 5CA0F 3G2MA 3LC0A 4Q7MB 4BNVA 3FPSA 4KXVA 5TQ2A 1FSPA 4J03A 4Y2RA 3FDZA 5K8LA 4K9PA 4EMUA 5B64A 5FPPA 1Y6GA 4KXLA 4I5FA 4QGHA 4FFNA 3DBLB 2VYND 5B1HA 4CKXA 4X1IB 1QRTA 1JIUA 4TKVB 3SLRA 3ZU4A 1GGNA 1UMBA 2QW8A 1QOZA 2CLIB 4UM8B 4JKIA 2I2BA 3DMGA 4RPCA 5F4BA 1W88A 3QX7A 1D09A 5K0FA 3WLPA 4C0QC 2QTTA 4JLJA 2HJHA 3IMKA 1A50B 3B9BA 5EXTA 4C6HA 4UEKA 5FWXB 5FI1B 4A8TA 2I2AA 4LJAA 4PTZA 5KYUB 1GPJA 1TA0A 3TQQA 4M1WA 1EE9A 4UDOA 1E62A 2ADMA 3DVAA 3UN1A 1TM5E 4I4TB 4TSRA 1NMZA 3IDFA 3M6LA 1WBBA 4X6XA 3JZAA 1SQ6A 4XUCA 2JKYA 4NNPA 3QVVA 5EE0A 4K6CA