2JRCA

Solution structure of peptidyl-trna hydrolase from mycobacterium tuberculosis h37rv.
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
191
structure length
191
Chain Sequence
b'MAEPLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVHAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Solution structure and dynamics of peptidyl-tRNA hydrolase from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 43
structure length 191
sequence length 191
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2007-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 2jrcA00
1RYNA 4ZXPA 4ERXA 4JWKA 5IVPA 3KJZA 4FOPA 2Z2JA 5IMBA 2JRCA 5B6JA 3VJRA 4QD3A 4JY7A 4HOYA 3NEAA 2NAFA 3P2JA 4JC4A 3TD2A 4FOTA 3OFVA 2LGJA 4QBKA 2MJLA 4QT4A 4OLJA 4Z86A 4DHWA 2Z2IA 4P7BA 2PTHA 3V2IA 3TCNA 3TD6A 4QAJA 4JX9A 5IKEA 3TCKA 4YLYA 3KK0A 1RYBA 4IKOA 4LWQA 5EKTA 2Z2KA 1RYMA 4FNOA 4FYJA 4DJJA
chains in the Genus database with same CATH superfamily
1OVMA 4UDXX 1LDGA 1DOAA 3LUDA 4I46A 1XAJA 1HDCA 2ZULA 3ZWAA 4Q3CA 4P0PB 4WA8A 3HU5A 3HUEA 3BQNB 2JRLA 1SC6A 2Z1MA 3IDQA 3CR7A 3KR0A 4PAGA 5DFAA 3SAJA 3U48A 2BN4A 2G1KA 1RLUA 1BRMA 1PJCA 2EJBA 3KIPA 4IJMA 1VLJA 3P4XA 4IJ6A 5KHAA 4D80A 1YR3A 4FFSA 1L5SA 4LQ4A 2HQBA 2VJMA 3E70C 4URFA 3QFSA 4PQEA 5L53A 1SXJA 2PL9A 2VKQA 3PHHA 1WD5A 4OXNA 3CRVA 2C5HA 1ZN8A 5C53B 2H9AA 4LZNA 5KX5B 1QS0A 1HX7A 1OZGA 4X84A 4EYQA 1KPGA 4M1EA 2HEGA 3AR6A 4QICA 2BZSA 3MELA 3AXSA 4ZJPA 3U17A 1SN7A 1Z36A 2DQ4A 3KQWA 4PYRA 3ZE9A 1UC8A 2VPIA 1OTHA 1CNMA 3ECSA 3EXHA 3JYQA 4A91A 4R31A 4B7ZA 5JEEA 1LPNA 1XJQA 5SZJA 3FUWA 5COQA 4LW8A 4UBLA 1QONA 1XEWX 5NULA 2WNSA 3TSAA 2GPYA 3ROEA 4MV1A 1JECA 2QBYB 3Q0IA 1BROA 4KAXA 5GOTA 3GYGA 4O8CA 4YECA 1OLOA 1R4MA 5B2ZA 3OFSA 1R15A 2GI4A 2I2CA 3OPXA 2OM2A 4H7FA 1JU3A 2WSYB 4PG7A 1E6KA 2JFOA 4IIJA 3V7UA 3V1KA 1N2IA 2YQZA 1M2WA 1TUEA 4FFVA 3S3TA 4BFSA 4LNUB 1N6OA 1NSFA 4ESOA 1QIGA 4D26A 1LF0A 2A33A 1JHRA 3M3HA 5DK6A 1UQRA 3SDSA 3GL9A 1ADBA 3MINB 1M8GA 1YUNA 2CE2X 1FB5A 3GBSA 2IFTA 4PZPA 3EAGA 1NTOA 2CHFA 3AEUB 4IRXA 4UZEA 3CYFA 3KELA 2I6GA 4HDNA 3WLEA 4JUAA 2Q4TA 5DE3A 2L82A 2RAUA 3M1YA 3V34A 3B53X 4F5EA 2GS9A 3L6RA 2EZ9A 1JA9A 4ID3A 4CKCB 1OJLA 4J8PA 4EW2A 2Q2QA 3CSUA 4QBTA 2IVFA 1JFFA 1XTPA 3AM4A 1ECJA 4EB6B 3NT4A 3SBDA 5K0GA 3L0ZA 1GPMA 4JP5A 5FADA 1KSGA 1WZNA 2X6TA 4G89A 1HOXA 2H0AA 4R1LA 1ODCA 3V9AA 2HRZA 1LDNA 2FW8A 3SR3A 1P0IA 3W8DA 4L8FA 1Q44A 1MLDA 3LZ6A 4DV0B 1TA9A 4BNMA 1JEYB 3M0EA 4CL0A 1I4LD 1W8IA 4XQ9A 2BFWA 3W6ZA 4AKHA 4MRPA 4X1YA 2MSNA 4CCWA 3GVCA 2JKYA 3TOZA 2OHXA 1U31A 2PAFA 3AEYA 5DLYA 4A4DA 1QU3A 1Q77A 3IIJA 3U7JA 1XROA 1XBTA 1E7RA 2FPSA 2UXCB 4WNCA 5LDHA 1E9RA 3F7OA 4M7OA 2CNBA 2CK3D 3ZUGA 4AURA 1POXA 4PX5A 1N75A 2GNOA 4C4AA 2GBIA 2Z5GA 1NYQA 5G1OA 5PNTA 5G3YA 3M6WA 3L6BA 4YI3A 3A06A 1HI9A 1WQ4A 4GPBA 3RWOA 5D01A 2FPKA 2Q0SA 5F5XA 3G17A 2H7YA 4ZU6X 3IAM1 1GGMA 4K6MA 3PHJA 1VHDA 1ZJJA 2O52A 4R1UA 3FAZA 1HORA 1GU7A 1EHYA 1TB4A 2IYYA 2FZLA 3GT0A 2IE0A 5DYYA 4IDDA 4QBFA 3RF7A 4DIOA 4FX5A 3DCIA 3IPCA 1MGPA 2R25B 1O9HA 2CVHA 5K0TA 3WQBA 3VXKA 1JHQA 3IIKA 5TEWA 4WW0A 3OEHA 1R5BA 4IFTA 3TW6A 1PTKA 5AR1A 4JOQA 1RYNA 3L05A 4JA0A 3V9PA 3LC2O 1T9AA 3NT2A 1Q20A 3AEKA 4P93A 5JHGB 1FSSA 1ORWA 1E99A 1NSYA 1WG8A 1YK0A 3NLLA 4UVHA 5DU2A 5LMCA 1E4OA 1XKXA 2JZOA 1YDEA 1WP4A 4YAJA 2HNBA 2AHOA 3ICOA 2JFZA 1QMGA 3AF3A 5I9IA 1NBOA 4TMWA 1E2DA 1SVKA 2PL1A 1VXRA 4HJRA 5TB5A 4B2YA 1ZVQA 3P20A 4YR9A 2MINA 1FUUA 5B53A 5A3RA 3NAQA 3DE3X 1GNLA 4MO2A 5DM70 2GLUA 2COEA 4P4LA 5KOJB 4X5OA 3BB3A 4BN0A 1MO5A 5BT8A 2D3TA 2PGAA 1TYEB 4LDJA 5BXQC 1GZ3A 1GPNA 5CLQA 4L78A 3GGPA 5F1KA 2A88A 3HY6A 1RC1A 3C43A 4JCOA 2C59A 1J5XA 1DDGA 2EWVA 1E2PA 1FS4A 4AZVA 3S81A 1Q83A 1Z6ZA 5I3ZA 1EWTA 3LSTA 4HB2A 4MUIA 2EKZA 3AL2A 2IY9A 5KSPA 4OK6A 1N1DA 1IJEA 3PD0A 2PSDA 1II0A 1E7SA 1M34E 2AF4C 1N3BA 4MCAA 1G4UR 3KZMA 5HG0A 3FFAA 3Q3EA 3KKOA 4N4AA 2BPOA 2Q4EA 4XIIA 4IXTA 4BZPA 1BEUB 2LR0A 7REQA 3HUTA 4S04A 1HURA 4UBIA 4WNAB 2TYSB 3UA4A 2XVXA 3LQ1A 1MXFA 1KXJA 5FTJA 4JWKA 1BE0A 1ONBA 3RIXA 5AVRA 1W36B 2IYQA 2R48A 4JNCA 4GYYA 5K99A 1JEEA 5TVKA 2C5LA 4JQCA 2FEWB 2NVWA 3A4NA 3EWSA 1U7WA 5GVRA 4PSKA 3EUEA 2CSXA 2C82A 3L7KA 2Q5QA 2GR9A 3VGJA 5DM2A 5KYGA 4CXMA 4MWEA 1Q0QA 4HEA6 2PIDA 3F1LA 4LDAA 5SZIA 1Y82A 3IUSA 1E9AA 1T5DX 2DPGA 4JFRA 1Y63A 4ALLA 1QIMA 3DDOA 4U6SA 5B1HA 5KYVA 1OD6A 4OMDA 5EINA 1V5WA 4TQ9A 5HIKA 3VDNB 2MMGA 5DM1A 4LWQA 1JZQA 2Z1DA 2B9VA 5HS6A 4MW4A 4N5HX 3ZXXA 2BGGA 4DTCA 5I47A 4QUHA 5EYPA 5FWDA 4TTIA 1NNLA 3D8TA 1QSGA 2CXHA 3HKDA 5DK4A 4C04A 3P0IA 2JGKA 4INOA 4RANA 2R60A 2BFBB 3RHFA 2RGRA 1SCJA 4I1IA 4MQLA 4UD6A 2H2WA 4E33A 5AESA 1D2EA 1RAAA 2NYAA 4FC7A 4JODA 4JJZA 1UXJA 4NZYA 5JAOA 3LT0A 1ZH4A 1LTKA 5KTYA 1RE1A 5JT1A 1PNTA 2PUJA 3I3SR 3LC0A 1URPA 4XX0B 3LDHA 4N9QA 1OVGA 1Y8AA 4QFCA 1GTRA 2VTVA 4E5NA 2Q3DA 3ABRB 5CM8B 4A16A 4Z4HA 2NO6A 4WK6A 2R4QA 3NEJA 2NO9A 1Q2XA 3CTPA 3W7VA 4UAVA 3U09A 1YRLA 1QHEA 2BMVA 2OAGA 3OEYA 3TAXA 1WE2A 1F7UA 2I4IA 1X8KA 3MUNA 4PV7A 3D31A 2V7BA 1UDWA 3T7AA 3TTUA 4ZGGA 2DSNA 5CT4A 2VTDA 3H2IA 1HDZA 5CTJA 4WERA 3FVWA 1EFHA 2WZCA 2YFHA 2HV9A 1M8KA 1YHNA 1A7UA 3IOCA 4NK5A 1LPSA 5HR5A 1D2NA 1FQKA 1S8OA 1TU4A 5JJ5A 2ZYHA 3PK0A 2GM4A 1T9GR 2FN7A 3U4GA 4ZQCB 1RYZA 2Q3EA 1ZSVA 3IAHA 1PIWA 4H7EA 3WL4A 5TMPA 2UKDA 4AMBA 4CYMA 2YY5A 3KKLA 1P5ZB 1T1RA 1I36A 1YB2A 1IN8A 4G4SO 2JLSA 4HAZA 2WTUA 5AXCA 721PA 2J3IA 2VL7A 3GLRA 4YRIA 5CCBA 2EEZA 4IV8A 5COAA 5CR9A 4CDNA 1PJSA 1YRAA 2H4ZA 3EMKA 4LXTA 3UFXB 1JIJA 4IIGA 2QTFA 2ZJFA 3DJYA 2DM6A 2I65A 1RD4A 2JZCA 5IH3A 4IFEA 3SZMA 5DM60 3R7LA 1TVEA 3KZNA 4Q6WA 1JDTA 3VZQA 1DQSA 1VKNA 3W3ZB 1VIDA 5CEEA 3N58A 3HGMA 3Q8KA 3TMYA 4KNWA 1CUCA 1T9HA 4QM6A 1SCQA 3KQNA 2BUAA 4LWPA 2B8EA 2P6MA 1HTBA 3T3HA 4D6YA 3AU8A 1E4VA 1Z62A 4MW0A 1MO6A 4HX2A 2EKBA 4MULA 3T3IA 1JPVA 1X3SA 2YXEA 5L3SB 2R97A 1BXRA 3CFYA 4J0IA 1Q91A 5EWMB 4HF7A 4WJZA 2Q4OA 1GPAA 3AF1A 1W36C 1O54A 4ITUA 2CLEB 1Q5PA 4JBGA 3W05A 3W7BA 2WM8A 1S1MA 4O2RA 5A7FA 2EKDA 2R5NA 2EX1A 3PX3A 1XQ9A 4N5NA 3TEMA 2E18A 4LF8B 1CYDA 1NRXA 2VTBB 4KWCA 3KSMA 1P1IA 4ML3A 3TBFA 1BE8A 1FFSA 3IMGA 3D3NA 3IQWA 1U3DA 1JBQA 5IC6A 3G0GA 4GKVA 4RFSA 1SXHA 1NI4B 2XUQA 2F1JA 4CUZA 1QKKA 1CG6A 2KX7A 1DBPA 5EXTA 4YCNA 2BZ1A 1I24A 1JXAA 2Q4BA 1TQ8A 2O2YA 2X77A 3PXBA 4GR4A 4MTCA 2H5LA 4WASA 3W4IA 3WK5A 4BX0A 2CLIB 1J5PA 3SQXA 3TZCA 4P7GA 2QLJA 3RAJA 2BMWA 5AW6A 1W2GA 3R7WA 4AL4A 3VV2A 3GMIA 3MGBA 1BDBA 3D3EA 3TLKA 4EF6A 3DQQA 2XX3A 4ZCLA 1C3OA 4PSUA 2BFMA 1QMPA 4V3BA 3SJUA 1NAIA 2WIKA 2JCXA 2JJ2D 4R83A 4F4JA 3RJTA 3DBRA 5J59A 5GVSA 5KNDA 1VDMA 3ZJUA 2QAJA 2QMEA 3SF8A 5KKNB 5SYAA 1G20A 1WB5A 3AETA 1R0LA 4NAVA 4IHJF 1DIRA 5IUNC 3X1DA 1VIMA 3FHOA 4F1WA 4IUCS 4YRBA 5K8IA 3INGA 3F73A 2F67A 3H16A 1EWQA 3DMGA 3B13B 4UTPA 4JB2A 4FFNA 3TXAA 3GMDA 2F3TA 1DFGA 2H1VA 2WE7A 3BICA 1DT3A 1M2GA 3CEHA 3R0QA 3BCUA 3O4GA 5HF8A 5A4DA 2VP2A 4Y6OA 5T41A 1OE0A 1J97A 4GE0A 2H29A 2W6OA 1T2EA 4HQOA 3CG0A 3M2TA 5FA6A 3H4IA 4MV4A 4US2R 3P26A 3I2IA 4PO1A 4OB7A 5CFLA 1I5OA 4KR2A 1XDZA 1C50A 3GA5A 2C99A 1T2NA 1Z8HA 3KOMA 4CR8A 4Y0NA 4R9UC 4FR5A 5EIEA 3DLIA 4C0HA 4X7PA 4I6EA 5DYIA 1NW5A 5C37A 3D6AA 2V4MA 4HWGA 1BW9B 1NYTA 2IPXA 4H27A 3LXUX 4Y1RB 4BFLA 1E5VA 2GN9A 1W8DA 8ADHA 4GR5A 2PEZA 4C1BA 4K9SA 4IF4A 2F59A 1OA1A 2EARA 2GEJA 2JGMA 4ACAA 1G38A 1W9HA 2YIDA 2INGX 1OYOA 3SMQA 2RGEA 3CO0S 1PZNA 1P3Y1 2EIHA 4JP2A 4URYR 1Q1QA 2O05A 1QDEA 3MRXA 3P45A 2FR8C 2D5LA 2XPCA 3N0RA 3KVYA 4G01B 2XUIA 2VP4A 4YXWD 2YRFA 1V7QA 3V6LA 1AUXA 1RRGA 2BFFB 2DTXA 2JCYA 1AGRA 3QGMA 3MLEA 1FFHA 5GJCA 2C9BA 3JYPA 1ZNZA 4X3CA 2WLTA 2C31A 4D8VA 2YYSA 3BKWA 3HO6A 2H18A 1FY2A 1SVSA 3QEJA 4MJXA 4LBVA 4RPCA 1DKQA 1TLTA 2EZ8A 2DR0A 2W71A 4JSRA 4CLEA 3C24A 1CP3A 1KVRA 4BUCA 3IB6A 5BSRA 2XGOA 1GOTA 2G6TA 3WLTA 1HPLA 3TIFA 5KWIA 3AR5A 2RHCA 1RBYA 2QG9A 2G1PA 2C4KA 1RJDA 1DEKA 4M0MA 1DBVO 2QUZA 3T5TA 3IFSA 1A4XA 1LD3A 1XQXA 3DWFA 2WPNA 3BVPA 3I9OA 1WMEA 2G5PA 2VJKA 1JDJA 2G4LA 1VKOA 1UIMA 3ND9A 2XTNA 4IR7A 4Q3LA 1ZR2A 3N3BC 3GFVA 1PR1A 3P9RA 2P9TA 2I7TA 5JFGA 1U0SY 1OH6A 1QGDA 1AGNA 1V48A 2IDMA 5CXXA 3EF1A 2FN9A 4KOAA 1VHQA 1L9KA 3GWZA 3K16A 3G13A 2HLNA 4PNPA 4W1PA 5EPEA 1OTYA 2VDJA 4E1BA 3CBGA 4C76A 3ZQUA 1UBHS 2GVZC 4BO5A 5BWMA 3RRNA 2ZJ5A 4KTVE 3QW2A 3R41A 4EB6A 1YE3A 4CMIA 3FI0A 2HYIC 2YHIB 4BBPA 3OQVA 1G2QA 1UFQA 2G1UA 2JKVA 1ZL0A 3R23A 1JLRA 2XCIA 2PQ0A 4YRSA 1WF6A 4J49A 2FOIA 3R6GA 4CWAA 1V11B 1OXVA 2XV1A 3MAGA 3HKEB 5CIYA 1O9GA 3DDHA 3ZQ4A 3X1WA 1BVRA 2KBEA 1V96A 3T12A 1UPTA 4JB8A 1XB2A 3EC7A 5D3QA 3SYTA 4Q1CA 1DG1G 5I6DA 1U5CA 4QNNA 4RACA 5JAQA 3N2YA 5K05A 1QYRA 2Q1SA 4TZTA 3TSOA 1VPDA 3BGDA 4BCDA 3CLKA 3C48A 5FWNA 2HA4A 3UXEA 1VMDA 3GC6A 4X1KA 4BVLA 5I4CA 5KTRA 4K46A 1AD2A 2QTVB 3WWOA 5L7YA 4PNEA 4J90A 2OY0A 2HCFA 1Q15A 3DFZA 3F6BX 5KYYA 4KMRA 1E0SA 2HM7A 3K9GA 3PV0A 4ZIRB 2I4OA 5FI3A 1I3CA 4M1TA 5AM1A 2ZUDA 4LJ7A 3SQWA 3R5FA 3X3HA 4DQKA 5A4MS 5IKMA 4HWKA 1LJUA 2H57A 5EJAA 2FH5B 3CV3A 3HN6A 3OPYB 3DGEC 5EIXA 4HRXA 1E3WA 3UBTA 1JQAA 4Z4GA 1H2YA 1KEKA 4RHUA 4MJ7A 4ND3A 4EEXA 1VFPA 5CNMA 1G18A 3I2YX 1NXOA 1E64A 1QFSA 4Q4AB 3K70D 1T9KA 2C8KA 2XMCA 3NGXA 1ZJ5A 4D8UA 5K45A 2XXBA 1DAFA 3GO4A 1AKUA 1HT1E 3FOBA 1FIUA 3I8SA 1WPXA 3PEVA 4Q9DA 1YJ8A 2DKOA 4YMLA 5K0BA 1KRWA 1E8NA 1Z29A 3NFRA 4NYJQ 1MOZA 1VSBA 2I99A 2QYSA 3RS4A 1H0KA 4LJ5A 4N01A 5BOVA 3QXGA 4DDKA 1S2NA 2V5AA 3VHXB 1W5FA 3N0VA 2FJ0A 2H59A 2ZRQA 2JH3A 3OT4A 4L15A 1W4BA 1DC8A 1LI4A 4IHJB 1ECLA 4LV5B 4P32A 1A76A 3NIDB 3C7CB 1Z0JA 4XGKA 4ZVTA 5IVKA 1YB5A 1T0JB 4FFBB 3I01M 4RZQA 3SXUB 1QGYA 1Z0SA 4MLCA 4RK7A 3AV3A 4F9TA 5A1JA 3DDSA 1E6CA 3ZGNA 4QPJC 2NPFA 1M33A 3FNIA 4E2XA 1P31A 4KLRA 1HK7A 4IOKA 2V5VA 1KNQA 3URMA 1AURA 4WXRA 3S1AB 2C07A 3VO9A 1AX9A 1ESZA 4NCJA 4JBWA 3AUFA 2R1ZA 1G7SA 4LYAA 1HTWA 2ADOA 1ZGZA 4RDXA 4EY4A 3RYHA 2KBFA 2JGEA 5KOJA 1H2RS 1SIUA 4QOJA 2PWAA 3L7AA 4JEUA 4YT2A 3HR7A 1MRSA 3L02A 4LRSB 1QDLB 4NU5A 1R18A 2OA0A 3IYLW 3IUJA 5ABPA 3RLFA 4B82A 1QOPB 3OP1A 2WKSA 1J1UA 2GESA 1EVLA 2PXHA 3K31A 4KXQA 4TLMB 5HIJA 3UVEA 3PPWA 4MEBA 3P19A 3JRWA 3VAZA 4WOCA 3IODA 4P80A 1XOIA 1GEEA 1UEJA 3KQLA 2ZS7A 1YULA 4JBYA 3PSAA 2RC5A 1M6VA 2IJGX 1DAMA 4TM7A 4KN5A 2Y76A 2PEYA 5FOQA 3U81A 5LQUA 3WK7A 1UKAA 2YX1A 1UP6A 2WJGA 3JQAB 4C4SA 1QHHA 3D1LA 3OBBA 3CNQS 4NEHB 1J0AA 2I1WA 4FNAA 4XYEA 4CG3A 4JJ8A 4I6JA 1TQ2A 3A2KA 1IUOA 3KSAC 4QYSA 3FWZA 4GZ6A 3JVUA 1H1DA 2VBCA 1E63A 1P9RA 2TSYB 1Q17A 3GEMA 3PUYA 4RJLA 4YQYA 1E18A 5DTIA 3ZIAD 4CM1A 4NI5A 5JSHA 3RTDA 4L72A 5AK6A 3UOGA 1I8TA 1LBTA 1IVNA 1KVQA 4NV3A 3QLVC 1QHIA 1UMDB 1FPMA 4N7RA 1YQUA 4Q3OA 2HZBA 1XWWA 3OLYA 5K03A 1D04A 3BA6A 4FJ0A 3U9SA 4CRWB 3D6HA 2JH8A 3HCPA 4RDIA 5LUAA 1GGNA 3ELDA 1JR4A 1Y9DA 2V7TA 3A70A 4QUIA 4BJ3A 4MPDA 2ZJ1A 2DT5A 3GLGA 4DDMA 2CLSA 1J70A 3PNPA 4ZRMA 4GWLA 1TZCA 2V7WA 2C61A 4POOA 2WJHA 1Y3FE 4B48A 2FQYA 2C5GA 2GF2A 3A6PC 2PRKA 3L0PA 1ZNXA 2DQSA 4I9FA 5CLHA 5H4HA 4DXAA 1YQTA 2B3TA 1QQBA 4HYTA 2O20A 3IUYA 1T8WA 2FFHA 1EB9A 3B82A 9LDTA 4P3OA 1QDUA 2GCEA 2QRVA 2JNWA 2H92A 3A28A 5H9WA 1ITZA 5FV7A 4J94A 2R84A 1SQ6A 1UT6A 3KWJA 4I8XA 5KOIA 3TNYA 3ZCTA 4KMOA 1GNRA 4YLEA 3EA5A 1N0IA 4E94A 4MWCA 1CW2B 2MSLA 3KVNA 4KR3A 2VSFA 1K5PA 2Y05A 2BFEB 3UT0A 4GMDA 4P98A 1CFJA 1RRFA 1W5SA 5IJ9A 2COKA 1T15A 4AXBA 3L9XA 1JG3A 1QK4A 3DTYA 2Z9DA 1P0CA 3LDGA 1EYZA 5DNEA 1UBRS 2HDOA 1N1MA 3G5AA 2FW1A 4WK0B 1NR7A 3UFXA 4JR1A 2FR0A 2OBLA 1ZCAA 2WT4A 3MGCA 3GR6A 2X23A 2IKSA 2O8NA 3PQ8A 2QNIA 4JEIA 5ALYA 2QGFA 5GIOE 5JISA 2J32A 3B5EA 3TNLA 2QR3A 5HRUA 1LLCA 3A0RB 1GUDA 4B34A 4BFXA 2H8KA 2XD9A 2IHNA 1HE5A 4AJNA 1HFJA 1FK8A 4QOEA 3JATB 1XELA 3K6RA 4RKWA 5FB3A 3I2FA 1VRCA 4NBSA 4EYGA 4RGBA 3NDBB 1EJ6A 1SOWA 1E9CA 3UMBA 3OZXA 1BOOA 1MA0A 2ZI4A 3PWSA 3BMCB 4X00A 1UKZA 2ZDGA 2PFSA 3QKIA 1FF9A 4PC6A 5EWJB 2VA8A 4P33A 1I4EB 2YNMC 1ZUIA 3S68A 1SVOA 1X74A 3I4FA 2VTBA 1EIZA 2NU7B 2HKIA 2F9LA 1M1ZA 4D74A 1PV1A 4CCYB 4EAQA 1S9DA 4XXHA 4OXRA 3X1ZA 4MPRA 4G25A 3PJRA 2CEKA 4AT1A 4KACA 3PC8C 2OV2A 2HRRA 4Z6KA 4CZ2A 1M5UA 2QV0A 3L5OA 1L5LA 1XN4A 3YASA 4Z86A 2ZOSA 4C78A 3BMXA 5LQDA 3U49A 2QW0X 1JKIA 3AI1A 1TTPB 3GNSA 3PQCA 1HZJA 3VJKA 4AS3A 4F46A 1G3IA 1JQ3A 4BHTA 1G5HA 3HWSA 1EFDN 3W5UA 4RIGA 1FYWA 5JZBA 3RVMA 1Z74A 2JJ1A 4FGKA 4UDNA 2AD1A 4FR2A 2G7ZA 4Q7JB 3RUEA 4BEWA 4ZCQA 5LYJF 5I9SA 1ZIDA 1SPXA 2F9MA 4KODA 1U0FA 1COWD 1KF0A 4MV6A 4AKGA 4HQKA 5D6NA 2EW1A 5ILGA 3H1FA 3SHFA 3NHZA 4EKDA 1RAIA 5ICFA 2ZZKA 2GN0A 4DYVA 3O8BA 1XZBA 1ISHA 4QJBA 2PUAA 3OSUA 3QKTA 1EJBA 2I8AA 2K7ZA 5KI6A 3U4HA 5B1YA 5FOSA 2PTHA 4UBNA 3X1XA 3D3WB 4G1UC 1KYQA 4RULA 3Q11A 2WTNA 4MMZB 5MN6A 3S5JA 3WL7A 3GFQA 4BBJA 2DPMA 3JQFC 5E8RA 3SJBA 5LQKA 3ADPA 4Q7KA 4X1OA 4X90A 2VQEB 2YFKA 4A82A 1C9NA 3RS9A 2QRZA 1ODJA 4BEBA 5FWXB 3SIXA 4CIXA 1T36A 3A9VA 1PWZA 3AFGA 3UT5B 4DHEA 1KK0A 3T3DA 4DPLA 1D6MA 1M1YB 2DG2A 2G9ZA 3L6CA 4Y1RA 5EE1A 4Q48A 3K6JA 1G5FA 4G63A 4HS4A 1IE3A 4PGAA 1EFRD 4G84A 1VG0B 3GJRA 1ZU5A 1VE7A 2PKQO 1T26A 1GAJA 2JI6A 3EFOA 3T1HB 1SZJG 2OXRA 1BXZA 3LUJA 2Q1YA 1NOIA 4KQ9A 2JAHA 4QGHA 4URUR 3U0BA 1BU8A 3INRA 2CVOA 5BWLA 5IULC 1CUVA 3L46A 4ZDKA 1FJXA 3EZ2A 5ES3A 1MAHA 3NP7A 3N7TA 3HCDA 1FTQA 3CUYA 2RKOA 3AK4A 2ABWA 4JLMA 4QXMA 4BE9A 3Q9SA 4ZXPA 4AG3A 5IUJC 1MX9A 2I7VA 1YL7A 4G0OA 3UUGA 2D1RA 3VPBA 5JH7F 1ZITA 4X7MA 1CB0A 1L7VC 3VHQA 4YAWA 5CIWA 4BFUA 1ZMOA 2OHFA 5F1OA 4XM0A 1EX9A 1XD8A 2CBZA 3GUZA 3PFBA 5D87A 4RSRA 2WPDD 2RAFA 4J1NA 4LGCA 1N5OX 3IE0A 2LVBA 3HSSA 2FDRA 2IUYA 3O82A 1PWHA 3QBDA 1F2UA 4QXRA 1NNUA 4WEOA 3T1VA 3TX6A 5TR9A 4F3CA 4FYKA 5HXAA 2VPPA 1PZFA 1V6CA 3AWIA 4WK2B 1GSIA 4YAGA 2W6ZA 1EM8A 1SVNA 4ZO7A 1JHDA 4ZU3A 2RHOA 3LP6A 3L41A 4Z1OA 3R8CA 1WPGA 2IY8A 5TF0A 1KL7A 4EI8A 3NYWA 4YRNA 1MABB 3HCOA 3N6VA 4PPNA 4OI1A 4DGQA 2W2TA 4HYEA 1O97C 1SCNE 1KFBB 4KHPB 3QYAA 2RCYA 1BVUA 1XTIA 3WOVA 2IV2X 1H2AS 5A3SA 1V8ZA 3ZWXA 1T5OA 3FTCA 3P9QA 3ROXA 1KI9A 5BSFA 4HQRA 4DYHA 5L40A 2D7DA 1YT5A 2ERXA 1QGZA 4UTRA 3P9YA 2OO3A 3FGOA 4F8JA 5A7GA 4RS4A 4QAJA 4M7RA 2A67A 1CXZA 1Z18A 4EQ6B 1W36D 1REQA 1YBVA 1GZVA 2O2SA 4MWGA 2H2FA 3P0HA 1X70A 3OFNA 1MVLA 4NPCA 1EGVB 3I6IA 2FQWA 2YHIA 3A1NA 5IXJA 3QWHA 4CTKA 1V39A 3N2KA 3TMKA 4F6RA 4RCYA 2O50A 1ACLA 4ZVQA 1V8BA 1L7OA 3SZ3A 3DHVA 4PYKA 3DAFA 3HKEA 3KSDO 2Q5CA 3OD5A 4FOLA 4FFWA 4LHZA 2D5IA 2V3WA 1SBQA 3PE3A 1QGED 5EESA 2E4XA 3HMQA 3TFQA 4CMAA 4IQ8A 2HFJA 4S2UA 2N42A 3HEBA 1C9MA 1UADA 5LLTA 1RM0A 1TPZA 4J7XA 5LBIA 3NJRA 1C4OA 3EHEA 1OBHA 4C6HA 4UHJA 3WRYC 2JFUA 5J23A 3ADDA 5ALIA 2FKAA 4KVGA 3RWMB 3SJAA 4DRXA 1ADGA 1KZ7B 1KZ4A 3C7KA 4HFRA 2C5EA 1NW9B 1QVWA 2X0RA 5LWHA 3I04M 3LC7O 4BP8A 4ZIRA 1U0EA 4F60A 3EFBA 1U6KA 1J8YF 4BL5A 3DLBA 3PLNA 5K3AA 4J3JA 2HRDA 2BGLA 3QLVA 3EOZA 1CB7A 3ZHXA 3V32A 3ZCVA 3P2OA 1JFSA 1KFEB 1CZNA 5AXDA 1PJTA 3IELA 1RI1A 4ESVA 3SDZA 1G8SA 2DHRA 4BVEA 4IEEA 4X62B 2RH5A 1RSZA 1VCOA 2G08A 2Y1XA 4PHCA 1EKXA 1RI3A 4Q4AA 3AILA 4ALMA 4AJ1A 3HHPA 4MMXB 2ZSBA 4GBED 2RMKA 4QATA 1EVKA 1HSZA 1Q0LA 1RYHA 3HU2A 4YBZA 1HE1C 4LPKA 3AVYA 2H0QA 4EKNB 2GYVA 4BV8A 5FTLA 2IHJA 4PF1A 5CK4A 5E3IA 3IDAA 3JU3A 3BTVA 3ZJYA 1L5RA 1E79A 5FBRB 1JAYA 1QFMA 4FFOA 2F1KA 1A8SA 4WVLA 2YOGA 3SIWA 1V37A 3VHXA 3I58A 5C3MA 3HKCB 1W1WA 4NBRA 5DBHX 2V7XA 2Q0HA 5HTKA 1C4XA 5LYJB 1DLJA 2WUGA 1M6NA 4GFDA 1OIXA 3DVSX 3KTDA 4KQKA 4ZQEA 3QTLA 2C5FA 3EZGA 4Z49A 4O25A 4E4YA 4CFZA 2OWEA 3PEEA 1AZLA 4P84A 1TYCA 2A7QA 1FU4A 2RC6A 4JASB 2OSBA 1EJ2A 3WG9A 5FPYA 5B4UA 3E3MA 3ZCQA 2F4VB 4IDQA 1JTVA 1ZUWA 1FFXA 4TRNA 5FYDA 4XGQA 5IVIA 2Y0EA 4ZZIA 3S1AA 1EWYA 4IO0A 3M1AA 1DKLA 5GGYA 1EEXB 1X8LA 1I2ZA 4G3XA 3ZIDA 2BYTA 1CRWG 4M1WA 3OMLA 4NG4A 4X97A 1BSVA 1OYYA 1VQ1A 5FF9A 3U60B 1FFCA 2EHJA 2X5OA 3OLWA 5FQOA 2JLVA 2I87A 4XWGA 1HYQA 2ZI9A 3W4JA 1FA9A 2Q28A 4KO4S 4OPMA 1Z2OX 3OH8A 4GRAA 4TT8A 4E11A 5JYEA 3FPAA 3SZOA 1QG2A 2YVLA 1M10A 4GM0A 4HDRB 1Z7BA 3QPBA 4AP9A 1KE2A 3W8EA 3LT5A 1SK8A 1QTNA 4V2IA 2FWMX 2QQEA 1V5IA 1YAJA 1M2VB 2QN9A 3HVKA 2EL9A 3IA7A 4IIXA 4JEMA 1JLSA 1CJUC 1M2JA 2QRUA 3ORHA 4JUCA 3JSXA 3UJAA 2WHRA 2C3PA 1FFWA 2OKGA 4JBNA 3LJKA 5H70A 5DYWA 3JQAA 1XR3A 3NBZC 3NB0A 1HLGA 1ZFNA 1L1FA 3BC1A 3MWLA 4MXDA 3SSNA 4B73A 5ED4A 2QIOA 3EA4A 4HGRA 4TV9F 2CXXA 4ARUA 4BRUA 3S4YA 4FW8A 2FU5C 5JH7B 2YNMA 3OLCX 3RAGA 4A1FA 3OOWA 3ZVLA 2WU3A 2FRVA 3EVAA 1KSHA 5KIAA 4CTJA 2VQ6A 3P71T 3RK0A 2AFHE 4INZA 1E7YA 2NT4A 1TO6A 5F98A 1RW4A 1UMDA 3CM0A 1U63A 2G07A 2XYPA 1SUPA 4C0JA 4IQGA 3TE7A 2JFHA 3WY9A 4YAFA 4RTLA 4QQNA 2BKUA 2WHXA 2Q9BA 3P9KA 4GSKA 3PCXA 5EJMA 1NXVA 3PC8A 4OH7A 2B0JA 3PA6A 2HMYB 2QQ0A 4OGFA 4XWTA 1IM5A 5ALZA 2CUTA 4Q93A 1FDRA 2QXUA 1WJGA 1MT3A 3BE4A 2BJWA 3G2QA 3NS7A 3I34X 3RTBA 2BGJA 1ZY2A 5LM3A 3ZNOA 1U0HC 4KL8S 1ZM9A 5BN5B 3DBHA 4OB6A 3PD1A 3WLSA 1FRNA 4EHFA 2AN1A 3L7OA 1OLUB 1EA7A 3SJCA 4CIVA 4X6YA 2WHYA 4IZIA 4D0NA 3NBFA 4A15A 5BQ5A 1YO6A 1MRNA 3WZMA 3ZOKA 1KI8A 3G02A 2ZBUA 3VOAA 2NUTA 2C0CA 3ON5A 3MF4A 2VSXA 3CXRA 1L5YA 4AXXA 4RD3A 5LLSA 4GUDA 1PR2A 4L0DA 1A50B 3B1JA 4JJFA 1UJ5A 4RPJA 1LFDB 3QXSA 4X61A 3BGWA 2ZLBA 1HDEA 5EXDA 4XKJA 4D9JA 3Q3CA 3RUHA 4BX8A 4E51A 2RGNC 3SLGA 5I9LA 2ZYGA 3NNNA 3GG9A 3RUPA 4P3PA 1H6AA 5IKXA 2XY4A 3O83A 5DZSA 1TCVA 1TUBA 5FBKA 2W48A 4AO7A 5AW5A 4TKZA 1Z7GA 1TJ3A 1POWA 2HK8A 3VNRA 3OY2A 3AVWA 1EXNA 2ZUTA 2C92A 2K6GA 2YYYA 1GDDA 3UYLA 2WAYA 1GPBA 3JQFA 4HBZA 4DQVA 5DNDA 3NP9A 3H3FA 4J1TC 3SJZA 2ZB7A 2WWRA 3GT7A 3BXXA 3ROTA 2XSZA 4PQRA 4JYAB 4ASUD 2FF5A 3B3QA 2PUDA 1FDOA 2J3QA 2V6MA 2XE4A 3FUUA 3KZOA 2DTEA 4LJ4A 4E30A 5KVSA 4Q3DA 1SZCA 3B6IA 3DKPA 3FZYA 1OI3A 3F3KA 5EFZA 1RLIA 2OG2A 1GSHA 3TXXA 4MGZR 4K0KB 1AQ6A 2W6PA 2CL0X 4F3RA 3PUHA 2RI1A 5BV1A 3G6KA 2YR0A 1TTTA 4JLSA 4LI3X 3DZHA 4RV9A 2J1LA 3RTEA 4ZOLB 4QTZA 3OU6A 4O4LA 4V03A 1N1GA 3TKAA 2QU7A 3W8NA 1E2KA 4BO7A 3QSGA 4DNPA 1UBUS 3NBMA 4QWMA 3LF2A 2ZZMA 1C7FA 2IHBA 2Y2UA 2P9HA 3ER6A 5JLJA 2QUKA 1Q7TA 4RVHA 1S2DA 3UQYS 1KY5A 3QBVA 1B6SA 2CXQA 2BHLA 1K68A 1S2MA 3JVIA 3SEAA 3LPAA 2FW9A 3MT8A 5IBCA 3ZCPA 4HTFB 3HY3A 1CRZA 1GG5A 2CKDA 4HXYA 1G6KA 2B36A 2WV7A 4I1OA 1VA4A 3TS1A 5FBHA 5DNCA 2QD1A 1V5EA 2WWWA 1XCBA 2OC4A 2XT0A 1PVVA 4OI2A 2KMLA 2VYVA 1W4AA 4KGDA 1GXSB 1SOVA 3W5SA 4ZEMA 2HMTA 2V6GA 4G37A 1T8UA 4KO1S 4LECA 4CCYA 1RHRA 1VPTA 2E37A 3UAZA 2P8SA 5BQXA 1QIHA 2V65A 1CE8B 2WUDA 3T5CA 2UUOA 5JU6A 1XZFA 1O0CA 3CF4G 1BWQA 1NXXA 5K3SA 5EHQA 5E7JA 2K4MA 2DQKA 3IDOA 3ONNA 2OHOA 1MV8A 3KEGA 4MKXA 1LPMA 1KDZA 3BPSA 4KSYA 4X6XA 1SU6A 2PKQP 1N36B 3PC2A 4JGGA 1PBNA 2NACA 3MOGA 3OZTA 4L3VA 1VGVA 4OJTA 3G9UA 3E8MA 1YZYA 1YR7A 3L7JA 4H4DA 1DX9A 1PJZA 2NTYC 5B3LA 3L84A 2YV3A 4OHKA 4QWWA 3EPJA 1NIPA 3WWDA 2GB4A 5HJEA 1OC2A 1GQ2A 5H0IA 2IP2A 4MR9B 4KW7A 4O5OA 5FUMA 2JGAA 5M2QA 2RHMA 4PZCA 2W98A 2BW0A 4EFNA 3ZZ1A 2BCEA 2JEZA 3LSYA 1RXSA 4N0MA 2DFNA 2PXXA 4O4IF 1J2TA 1CQIA 3GDOA 2EKLA 5EPOA 3JQBC 3LPMA 5EAIA 3MT0A 3CIFA 4YMTA 1YRQA 5ENZA 3OVMA 1XVUA 3EH1A 5BSGA 2C03A 4ND5A 2HU5A 4TS9A 3QF4B 4WFQA 5AOCA 1K9VF 3RHTA 1AMOA 2RE8A 2C7QA 4C14A 1QYIA 3FVQA 4DDWA 1KSJA 1KWGA 4DMFA 4MW9A 1R0BA 3REFA 2UUBB 5FWXA 2P65A 3ZZ0A 4F5YA 3V4PB 1EX7A 1MPTA 3A4TA 3B6KA 3GT4A 2PNFA 4RFLA 2RK3A 1FTYA 4ZHQF 4R8SA 3UT5A 4IMJB 3MWKA 5FPSA 3U6BA 1BJTA 3KKPA 5KO2A 4TV9B 1I3NA 4Z0TA 5B1SA 5CH8A 2D7JA 5I5GA 3TL2A 1LUAA 5JRJA 4UE3S 4DR4B 1P2TA 1IULA 1U94A 2FUG1 3TGWA 4LVCA 4Q7LA 4D97A 1A9QA 3CX6A 2OHGA 3O31A 3AB3A 4GVXA 4MIOA 3F3MA 4REQA 5JAHA 3CF0A 2BHRA 2JHCA 3H17A 1II9A 2EU8A 1U80A 3JZDA 3T9CA 3AF0A 3H9QA 3WBJA 1ZKDA 2I22A 1LDYA 1B0UA 2XVMA 3DG9A 3IOMA 4TROA 3UKJA 4CI0B 1Y98A 2O54A 3DQZA 3K4QA 4PYNA 2A0KA 5HCUA 4TKVA 2VTEA 2YZ7A 2DBVO 4Y2GA 5E0KB 4HATA 1X7DA 4O8ZA 4MCHA 1E0KA 3ASYA 4I08A 4JBHA 4EPWA 4CLRA 3DB1A 1L4EA 1GPDG 3NGLA 3ANMA 3SC4A 3FHTA 4CMHA 2M6SA 3IHTA 2P6NA 1DAKA 1I2MA 1NG1A 1PK7A 4O4HF 3OPYI 5CEJA 2VP6A 1LVGA 2WIAA 3W79A 1PYGA 1G5TA 1N7JA 3WGNA 4BE4A 1VYHA 4KUHA 1CUWA 4US1R 4W9NC 3LYHA 3R20A 4ID9A 3CLUC 3O4VA 2ZGVA 2ATVA 3ISJA 4GXRA 3UMMA 1E2GA 1WMFA 4LC0A 1ISJA 5IF9A 1GKLA 5DNYB 1KDYA 2VXYA 2FPOA 1CUXA 4J0CA 3H2ZA 1XN1A 1A7AA 3E2MA 3KV3O 4PAQA 4V24A 3RC1A 4CTMA 5C80A 2VDWA 4R40A 2VJPA 4OXXA 3RV3A 3LCMA 3SLKA 4XDZA 3ZXIA 3SHWA 3KUDA 1VG8A 1QZXA 4D8YA 2YY7A 4RIIA 1N57A 2EQBA 4CN9A 4NONA 1HGXA 3K7EA 1V3TA 5E2IA 3ZCUA 2UUAB 2J0VA 2HPHA 2MR5A 4IH9A 5GZ6A 1NOJA 1W44A 3LP8A 4F3YA 3ZE2B 3F6PA 3EGXB 3TQFA 3S7ZA 4ETNA 3C3EA 3F8SA 4HLDA 1WCXA 4MA4A 4MUMA 5BYBA 1N77A 1WU7A 2GMWA 2HTFA 4F4DA 3T1OA 1Y5IA 4WQMA 2BH9A 4HAXA 5EZYF 2C1EA 4XFKA 1GU1A 4DC0A 1S2IA 1B0AA 1ZUNA 4JGBA 2EVWX 4EQ6A 1JLKA 4OM7A 1P4RA 3ZWDA 4BMXA 1AKVA 4KNYA 3EXFB 4W7IA 5ADVA 5INTA 4NKRA 1N6KA 2V98A 2YNMD 4BZZA 1KQGA 5AICA 1NJ6A 3ZW9A 1CLUA 2J48A 3PR2B 1S5PA 2OT3B 2YOHA 1MHPA 1QFXA 4RU1A 3D3JA 4HEQA 3N6XA 4N7MA 2QXTA 4Q9KA 1NFFA 2PX4A 4YGYA 1K27A 3H1PA 2JB9A 4DWOA 3T3OA 2V7GA 4HX5A 2AN9A 1QUEA 4RJ2A 2V5UA 2RONA 5G4LA 4JLPA 1CJVC 1UJBA 2ZXEA 3Q7TA 4QD3A 5D84A 3V1YA 2CFSA 4KNVA 1ATIA 3OLXA 5EQDA 2DBZA 2RGAA 2C94A 3WGVA 1H5NA 1B73A 1W85B 1Z37A 5JYDA 3A1UA 4XQGA 2QTBA 4YFYA 4UCQA 4R8LA 1P2FA 4DREA 5IAGA 1ZVKA 4XCVA 2IPNA 4BWGA 4CL2A 2YWRA 4QSHA 1AHHA 3L8YA 4KP7A 4OLFA 4MQ5A 4WKGA 3GJTA 1ZVJA 4CR6A 3ICQB 3IP6A 1D4OA 4Y7CA 4F2GA 5AM3A 2F17A 3IVCA 3LF1A 3D6NB 2H51A 3I9NA 4PTZA 3ZWMA 2EJVA 1DG3A 4ACBA 4EHBA 4KXXA 3IXLA 4MQ4A 5BW6B 3MD0A 2AEEA 4FT2A 4GH5A 1I0LA 1MENA 2Y1OA 4G23A 4X1IB 2PUCA 7ABPA 3PUZA 1XMIA 3LL7A 4WL0A 2A4KA 3IB3A 3MIIA 5CLLA 5FTMA 3EGCA 4RK1A 1GUZA 1MDBA 2OV8A 4WXYB 4XUEA 5DHSA 4P4UA 1Z68A 2YMQA 3MMNA 3JAWA 1IN7A 1SCKA 1MC1A 4MUYA 1AMUA 4NXMB 1I4WA 2IITA 4Q1EA 1KE1A 1W0JA 2IUUA 4JGIA 1GGJA 3V1TC 3WISA 4B6JA 5E6RB 2ATEA 4ZANA 2OE2A 2EEPA 4J43A 3ILXA 1QRRA 4CEHA 1UKCA 5K2MA 2P11A 2H4XA 4MYRA 5K2OA 4E15A 3DEFA 3ZR4B 4C5AA 2C3MA 3NHMA 1NX9A 3N5KA 2V55B 1SHLA 2QJRA 3F6EX 3T1TA 5B57C 3EJWA 1FDVA 2XSZD 5LYJA 2DH6A 5KWJA 1DU4A 5K4AA 1V25A 1WXIA 3B9QA 1U8YA 4IYRA 1J24A 1G8YA 5E4JA 2QT0A 1AK9A 2AEMA 2FUCA 2X8LA 5LQCA 2L2QA 2WTMA 4O4IB 3P9IA 2PGDA 5LNK6 4JI2B 3OQPA 2VK1A 3QIVA 3GVIA 1FLAA 1THZA 2VWPA 1FUKA 2JC3A 4FOSA 3MTGA 4FFRA 1O0BA 1LTHR 1XTSA 4MUGA 5JFTA 1FVXA 4GLFA 5JPCA 1G8AA 1EFTA 1JMVA 4EOGA 3GLIB 1U8CB 2N46A 5KNLA 3A6HA 4FJ1A 4UNQA 5THXA 3FLBA 2H1HA 4NFSA 2ISQA 1CY2A 2Y0DA 1U8FO 1YS6A 2XMDA 2DWUA 4DR2B 1AQNA 2BFAA 3ZE0B 5B6JA 2PSJA 4QEDA 4HDRA 4JNKA 4N0QA 4M88A 3WKEA 4ZHQB 1YZLA 1GUBA 2WNIA 4IJUA 5DISB 1GAWA 2FRDC 3KPWA 4YP6A 1YRYE 1VSQA 4L9RA 4DLKA 1C2TA 2VYVD 1MVNA 3H2SA 3JYLA 4QEKA 1B23P 2XW6A 1U1GA 1M2VA 1TO1E 3E1SA 3LUFA 4ZVKA 1UBLS 2I3GA 3B6JA 2OGTA 4LMAA 3WDKA 1G3MA 3LV8A 1YZHA 3OIVA 2YQ5A 4M7PA 3C6KA 4DCUA 3UOWA 1RPTA 4HL6A 1Z82A 1PE0A 4MQEB 5JW6A 2YINC 4ARSA 2H07A 2DFTA 1TFRA 4MROA 3PL1A 5EMHA 1BU5A 1U2RA 3JSAA 4LGVA 3B36A 4YQEA 3IJPA 3ELWA 2ESRA 2VHJA 5ALQA 3VR5H 3KZXA 2P4UA 3FLEA 4NQZA 4RZXA 3U37A 1EH5A 3OY7A 4BLUA 4B3TB 5JH7A 4O4HB 5AW7A 1A5TA 2FFBA 2IYLD 3E81A 3O1LA 3Q5DA 4ECEA 3EGIA 4GGPA 5B58T 3SC3A 3OO0A 1XK6A 1PDVA 1F60A 4N7BA 2A14A 1NTRA 4QYMA 2V9ZA 3CVVA 1J06A 2J9GA 3UAYA 3G8BA 4C4OA 4FGJA 4H08A 1L2TA 2CCKA 3A1WA 3JZFA 3N7AA 2HAEA 3DZBA 2GLXA 3JQ7A 2VT3A 3NHAA 3DR3A 3OLZA 3VO8A 1R66A 4F5ZA 4A73A 2XMBA 3I52A 2R2AA 3QOYA 4JUFA 4B71A 1D2CA 3RYFB 4E46A 5CCXA 3V1MA 4BPBA 3B70A 2HMSA 4D4KA 4C6TB 4LE1A 2EIXA 3IIEA 3QLUA 4GKBA 4R05A 4WINA 5BN5A 1BCSB 4M98A 3CINA 1PEKE 5K3CA 4Z3DA 1E9SA 3W7AA 2DU8A 3SICE 2G36A 3FYCA 1GFZA 2CKMA 3ANXA 1O96A 3HI6A 4C0XA 2EZUA 2QM7A 2IH5A 2L19A 4Y9UA 5EZYB 3DXXA 2O8EB 1FQOA 3TZHA 2OCBA 4TYYA 4WEQA 3EZNA 5AVWA 5I7SA 3GEHA 1U3UA 2YXDA 1BJKA 4R1PA 3DP7A 3ZHQA 4DLZA 1UUFA 1N4DA 1C0PA 2XGGA 1OX4A 3JQBA 1E1QA 4B6FA 4KSCA 2M6RA 3WGQA 4Y2UA 3U7IA 4M55A 1U5AA 4YN3A 4JXXA 4LQCA 5CVEA 3ZHYA 1K4MA 4B4OA 2CHVA 5K6RA 4FSDA 5CBKA 3N86A 2AJCA 3I30X 3EIWA 3LTEA 1LRJA 4OA8A 2JFNA 3OHPA 2DPLA 2VUUA 4GAEA 4PQYA 3GZ4A 4KWTA 5EUQB 1EDZA 5FRDA 2I6UA 3R4CA 4G4IA 4WZAB 5KTSA 4TYNA 4K9PA 4O6VA 5DOVA 1E60A 3TOXA 4BNYA 5KJCA 5HF5A 3LY5A 2Q1TA 4GVPA 1IY8A 4AJHA 4K9DA 1NDHA 1GQQA 3D5EA 3Q0TA 4UM8B 5IBQA 1T1IA 3MBIA 4PRZA 4Y1GA 3HB0A 2QYTA 3OQ1A 5C7IO 2WWGA 5B2EA 3FZNA 5AYVA 4XH9B 1A2QA 4I3FA 4DSNA 1Y89A 3KQSA 1DTWA 1E2EA 3TLCA 4ZQIA 3Q5EA 1KI7A 2JGDB 4PO8A 1SOAA 3A2NA 1KZYC 2OFFA 3P1JA 1EXVA 1JKXA 5J4LA 1X7YA 2J3DA 2TMDA 2LIVA 2W4IA 4HR7A 3COWA 1Y1KE 4NOJA 5CUQA 1N6RA 2XUPA 3B12A 3ML1A 4JHXA 3RR2A 1BQEA 1ODTC 4UPEA 4G9GA 2PVSA 3JY6A 2PZEA 3L07A 5BYKA 1PNVA 2OCGA 4JB0A 1K63A 4MX8A 1HFKA 1K6IA 3GLKA 3NTRA 3BA1A 4M83A 3OC0A 4YCMA 2PFGA 3V7YA 1QRSA 4BRZA 1IZ0A 4OV6B 1Z5ZA 1Y6RA 2JFWA 1WNFA 2JFXA 2EF0A 2OGUA 2W2MA 3DEAA 3FB4A 4IO1A 3GGGA 1X7ZB 4JYBA 4NFYA 4S0ZA 4EVRA 3T34A 2VNAA 1CTQA 3MN1A 4LBYA 4CN8A 1NU8A 2RDMA 3DFIA 1NHWA 1DUIA 5EA2A 3VV3A 2IELA 5B7GA 1CE8A 1NF2A 1PD0A 1Y9ZA 3QFHA 4YA6A 3I6MA 4D4HA 1D4FA 4NOLA 1UKBA 5JZMA 1TKBA 2NAFA 2BFOA 5HMLA 1NDQA 5AVJA 4BGIA 2CSUA 4PN7A 1IVSA 1SIWA 1MZVA 3UAWA 1A88A 1Z2EA 3EQ2A 5CA1F 1MJGM 1JBKA 3KQMA 3P32A 3BE6A 4UATA 1QHXA 3RIMA 1H0SA 4OHOA 2I8LA 1KKLA 3K0HA 4DSOA 4DAEA 1ZIOA 5EKTA 2G7MC 2W4MA 3EQ9A 1V1RB 1HDRA 2DY0A 3RW9A 3A1CA 4ZEWA 2J0SA 2GJ9A 2AMVA 3LPNA 1E8MA 2HF2A 2JASA 1LS6A 2L0XA 4QGAA 3KZ1E 4ZV7A 2YS6A 2D4AA 3UK1A 3W8RA 5JAUA 3ZDDA 2NXCA 2ZR7A 5D2CA 1RJWA 3C6XA 1DO0A 4NENA 3U4CA 3LHFA 4I5EA 3HR8A 4REMA 3QENA 3N1UA 1KGDA 3EG5A 2QAGA 4WTOA 1TVMA 4BMPB 9LDBA 5DN6A 7MHTA 4MEJA 3OFVA 4URXR 1GNSA 2PE5A 1ISGA 1WOYA 2SCUB 1GEGA 1F3OA 4EMUA 4BNNA 4AMUA 1VCMA 5LCXA 3CZMA 3IV9A 3THRA 4ZRDA 3GELA 3JRXA 4ZQHA 1LV7A 4MB0A 2ODWA 1CULC 2GHQA 4U02A 2ASVA 3TCNA 4C0BA 4DMKA 3EGOA 5AK4A 4EGJA 1Y81A 2GFHA 1KKUA 4JI3B 5EG5A 1P39A 1H0HA 3LG2A 1WTCA 3T4XA 2AQKA 1KBZA 1VJ0A 2XF8A 2RGYA 1ECBA 1IFXA 2VYNA 4OU4A 4B32A 3HGTA 1H93A 1XDUA 4W82A 5D00A 4IJQA 1ZZEA 4BVGA 2QJOA 2R6FA 3E6AA 1KDPA 3EF3A 3K4HA 2DTDA 3LCCA 2EQ5A 4X71A 1L5GB 3W9BA 1HDOA 1Z6QA 4TV9A 1X3LA 1A82A 1W0JD 3NDRA 3B1KA 3JRNA 4FCTA 2ORYA 3FSJX 1X0VA 1STOA 2VLIA 1HZZC 3QVUA 4HNAA 1PJRA 1MEEA 4YJ2F 5HHTA 3ZI7A 5ADUS 2BMEA 4LRYA 2QX4A 3JZAA 2RHRA 3G2MA 3A6LA 1PN3A 3V8VA 4EA6A 1R5NA 3JV7A 3G0CA 2IF0A 2JATA 3OICA 3A4IA 2QW8A 1YB4A 1T6XA 3MRVA 1B42A 4HO1X 4YROA 4IKEA 3SHVA 3KFLA 3UK7A 2QPLA 3K73O 3CNEA 1PQYA 4NMLA 3FF4A 1WVIA 4OO3A 4QHTA 5DCLA 5IVDA 3FW1A 2ZUEA 2GN8A 1H8ED 2BJHA 4OBXA 3GQVA 2WINI 1XZ8A 2CUNA 2PU7A 2ODNA 1J56A 3LWNA 4J4BA 4PXSA 4E08A 1UK8A 1UMCA 2EJUA 3LT2A 4H0CA 1LY1A 1Z5NA 2LKDA 1T9BA 2YC2C 2QS9A 3I6YA 2I33A 4DN6A 3DVQX 2ZETA 5KQLA 3GLVA 4EA7A 2H48A 2AQIA 1YCHA 1WHTB 1A2BA 3F5MA 4BMSA 1MX5A 5A04A 5A5FA 4BKQA 2CLOB 4D02A 4WESB 4E32A 5FDFA 1N6IA 2IZZA 3IE2A 2UZAA 3IEPA 5F1YA 5KBYA 4IWNA 4LFCB 4GPIB 3GAAA 3FMFA 1EAMA 3OIYA 1CUZA 4JXJA 3PF8A 4K1XA 2BC9A 2HA3A 4F45A 4DY6A 1XAHA 4KXUA 3VNBA 1KBQA 3GLFE 2FPPB 1RKUA 1LCIA 2XE8A 4OFXA 4A3SA 4ZCMA 1TZJA 1X7XB 5DTEA 4AO6A 4M38A 4PCVA 5GM2A 5IBRA 3SS7X 2CFCA 5F2NA 1PDOA 3QWFA 4F4HA 1IXZA 5IU6A 3C8DA 4PSDA 3NCTA 5KUTA 5GIPE 5HS4A 3ROFA 3GUYA 1UOOA 2IC5A 3K0AB 4NMMA 3D6VA 3A7EA 3AOEC 3GLHE 4GMXA 3E84A 4M9SA 4DEYA 1DWOA 2NN3C 1EA5A 2WWFA 4GOLD 2FWBA 2M6LA 1VE5A 2OAEA 1VG9B 3CXUA 4KPUA 2FRDA 1NJ1A 4TWAA 4BGEA 4LHWA 3SFVA 1MQ8B 4FYJA 4WN9B 3H99A 2NW6A 3GHHA 4EEKA 4QQFA 3JVDA 2OQVA 4EITA 3E4DA 4ND4A 3H5VA 1BRTA 1RS0A 4KRYA 4AQYB 2AG6A 4ECAA 2ONCA 3BH6A 2X58A 4L02A 2BEUB 2ZIFA 3ZPXA 2I6TA 1VECA 3EY4A 4OMCA 4GKKB 1MOPA 5AM0A 1W85A 2QN2A 2GD6A 1QR6A 4PC2A 1EP3B 4KQXA 4FWBA 1N6HA 3NHWA 4EKEA 4PBSA 3QJYA 4PSCA 2GM9A 3N8HA 2VJCA 2Z1NA 5P8WA 3MD9A 5HKOA 2EP5A 2LP4Y 5F7ZA 5IP5A 3ZLUA 3ANTA 1I7QB 2I6FA 2A5DA 2VPQA 2UVPB 2Z09A 5DKFA 1LQ2A 4MUHA 3BDIA 3ASZA 1OLXB 3QZUA 1CJCA 3QE9Y 1ZM4A 3OP4A 4JDPA 4L2IB 5AJVB 4ZALA 4QXAA 5BSUA 4K6OA 5BYAA 1EUQA 4PN3A 2OHVA 2BEVA 4U2DA 5JD5A 3C6YA 3ZGYA 2XIJA 2FFJA 3H83A 1E1YA 2Q9CA 1HBJA 5TGZA 3H0EA 4ER3A 2X0NA 4IGAA 4NV1A 2C9YA 2C9OA 1PQWA 2RB5A 1X19A 2ZJ0A 4JJ7A 1RAEA 4N49A 3JPWA 4U39A 2D0DA 3F9CA 3GFRA 4Z54A 1DO8A 4B31A 2V9PA 3R2JA 4KYVA 4H3VA 3GY0A 1W9MA 4DZZA 5ETJA 5CA1B 5SY4A 1CP2A 4MITA 3M6XA 2HWUA 1IIRA 1SVMA 1E7QA 2GEDA 2ZRPA 4OKSA 4ZYWA 4PX9A 4NU6A 5LIRA 4QL3A 4E07A 2PUBA 3STXA 2WP8J 2Q4RA 3T3NA 1G3QA 1I2BA 1NP3A 1OFVA 3O8OB 4J03A 2XZPA 4TS1A 3TIIA 2AK3A 3HXTA 2PYIA 3Q5GA 4RNDB 5G0WA 2LGJA 4EA9A 5E8JA 3DJFA 4NBTA 5EJ8A 5KC8A 4K8OA 1WXDA 4TXHA 4BO0A 3HWRA 3BEDA 5IX8A 4YRTA 1JPJA 4L08A 2IW1A 2HJSA 1IHUA 1CY0A 3H1BA 2ZAGA 4PZDA 5EMKA 1FRVA 1XLUA 1L5WA 4XRRA 4AZ0B 1AY0A 2FUNB 1E4EA 1H4VB 2AV6A 1OFUA 1AGPA 2H17A 1TEXA 2GPJA 3AR7A 1LGYA 3DTTA 1D07A 1II8A 1MO2A 2J9FA 4M2LA 5G02A 2HA6A 1RYEA 4PPFA 5KJ1A 1J0BA 3WB9A 4EUKA 3TSZA 1LQTA 1MDFA 3ZJ5A 4EKIA 5IVHA 1PU2A 1R0ZA 2HL6A 2Y0PA 2E48A 1X1AA 1IXSB 4NBNA 3BXPA 4QPZA 1Y4UA 1GZSA 2JIBA 2WEKA 4BV9A 1KJYA 2IEDA 1K7XB 1ZK3A 2OZEA 1PGJA 2IZ6A 1T35A 5FA8A 2AJDA 1MB9A 3ENZA 2XJ9A 3U31A 3UICA 5HUQA 3QPVA 3MT9A 3E9MA 4HAWA 4Z0PA 2OYSA 3U4AA 2NO0A 3ILHA 4DNOA 3S8MA 3CLUD 1UDXA 1XCOA 2W2LD 3O5AA 3C3KA 3V8QA 2R11A 2PX0A 3E22A 4E6EA 2ODQA 3NWOA 4MQEA 3UXYA 3GRYA 4N6GA 5KYNA 3LNTA 5K8LA 1L4KA 3CSSA 4IX9A 4MS4B 1CQPA 4Q16A 2QRQA 1CIPA 1NDUA 2EBHX 4I4TF 1JHMA 1FLNA 1L4FA 2WKRA 1KEUA 3QI2A 5F5LA 2VFAA 3ST7A 1EG7A 3D1VA 2ZBDA 3BIXA 5LA6B 2WD7A 4DG8A 3QHAA 4KLCA 4E0BA 1QRTA 1V95A 2I2FA 1U3GA 3BZBA 2CFRA 1KARA 4CLHA 2YVAA 1BD4A 2TS1A 3VTFA 1ULAA 5H9VA 1NBMA 3IPAA 1F51E 3K0FB 2I6XA 1L4NA 4OHPA 1Q2UA 2C3UA 4ZREA 1XD2B 3TCXB 5IAAA 2J7KA 1AOXA 3LKDA 1B6RA 4RF2A 2C8VA 2RKBA 1ADCA 2VCYA 5CT5A 2QMZA 5EJ4A 5GINE 1X6VA 2VT7A 3DBLA 4D0GA 1FNCA 1JLHA 1O6FA 1P0PA 3D8RA 3F49S 3ICVA 1SQFA 4PIPA 2ZREA 4C6TA 5IK2D 3I61A 3VSBA 3EIOA 2GDJA 4ZO9A 2QAIA 4Q4HB 1DKRA 3L0IB 4FMCF 4AJ4A 1J0DA 2PH3A 4ILEA 3U3JA 5TC4A 1UBNA 3S1SA 1KZ9A 4Z7QB 3C4VA 2EFHB 3EAQA 3OJCA 4GQAA 4H9GA 4QNMA 3AIMA 5CXUA 2GN6A 3JD1A 2Q62A 1VI5A 3O4RA 3IVAA 1E5QA 1U2PA 4JUDX 3GFSA 4OL9A 3UJ8A 2O8EA 1NVMB 1P5JA 2VSQA 4M9XA 3QA9A 3G0HA 1JB9A 4Z1MA 2NXWA 4IQ4A 4AAYA 2NU9A 3DE5X 1VL2A 3H19A 4MRMB 1EI9A 3E1GA 4QOSA 4DE5A 2IEGA 2B3DA 3C97A 1UWLA 1P73A 4XOIA 3AEXA 4OX9B 1DJLA 5TIIA 2NZVG 2OD9A 2QRMA 1RNLA 1SU7A 1DBWA 2W6JD 4XVCA 1Z47A 3EQ7A 3QVSA 1T34A 3PDIA 2R65A 3UH0A 1EUZA 1XZCA 2UZIR 1I0ZA 2LRHA 4WXMA 4HNVA 4K9QA 3ZD7A 1C8VB 3SGLA 2DR2A 3F5FA 3DD5A 1RBMA 3CVUA 5A9TA 2RHGB 2C1ZA 3RG2A 1OYWA 2ZAIA 4DCTA 3OJEA 2QW1A 3GCWA 5JXGA 1SKQA 5EY5B 3C3PA 4ILKA 1JW9B 1NBWB 2HN9A 4NYMR 2G88A 4YQFA 2A0XA 1N8SA 2IU6A 4TKMA 3NOQA 5FFNA 5CIQA 1XUOA 3NONA 4W5WA 2B20A 3ZXSA 2WV9A 2M2IA 2VRWA 3DWEX 5DLQC 4JITA 1ZXXA 2QP3A 3IX7A 4DT1B 1IXYA 3STVA 1HZZA 3TQQA 1WZIA 3QITA 1PSDA 2PVPA 4O3MA 4BVJA 5LBUA 3FPHA 5A62A 1IZZA 1WM1A 2YMLA 3CF6R 2DC1A 1SXGA 2R00C 4L50A 4D9GA 2D54A 1W0KD 2JGDA 4I55F 4P22A 2X5XA 3WGGA 4QLAA 2PX2A 3CNOA 3B7GA 4NBLA 1DMSA 4WXEA 2C2OA 5HSGA 3QA3E 2CNLA 4GECA 2CEAA 4XTCS 1CS4C 4PQFA 1EFLA 2FMFA 4KDRA 1G3RA 5HF9A 5MFPA 1OIVA 1YTUA 3SBXA 3L7IA 3Q98A 1H8HD 2ZUVA 2IEZA 5ALLA 1TL7C 3C41J 1IZ8A 1O5OA 4TT3D 1WWKA 1TCUA 2OFPA 3D8UA 3UXHA 3WFJA 3PQDA 2A0YA 1K8RA 1VMAA 1X7ZA 1NVBA 3DTVA 1MRZA 1WXFA 3K0EA 1LBQA 4XFDA 3JQ6A 4NULA 4ICIA 4L51A 5CJ2A 1X1RA 4LXYA 2JBAB 6ABPA 4BFVA 1ZGBA 2O1SA 1XNJA 4S1NA 2ET6A 3KYCB 1PLKA 3NBXX 3BULA 3QJGA 1BS2A 4GZMA 4NICA 4J0FA 3ZV5A 3ZU2A 1X0XA 3AJ9A 1RMQA 5BSEA 4BNUA 1SUSA 1LBHA 4YMGA 2BBSA 2XKJE 3F5SA 3DEJA 4G85A 2VTKA 4H1HA 1IBCA 2XI4A 4HGNA 4BNZA 1OX6A 2PZ8A 1XQWA 3EHDA 4KPGA 6LDHA 2BELA 2YDYA 3ONWA 3FZQA 4XX1A 4KXFB 4XARA 2ANCA 5ER9A 3BH7A 1NR5A 5HA5A 5KOYA 1DAOA 1ILWA 1RBZA 1V1RA 2GKOA 3RS8A 4A2QA 2LIPA 4ZVOA 3ZGZA 5T4HA 4B09A 1ZD8A 4Q4CA 2HFKA 2PGXA 4M1OA 1PR5A 4W6ZA 4BC1A 4WLEA 4F85A 3EODA 3AOEA 1ODFA 4MQBA 3WGUA 3LX4A 4CV3A 4FDMA 4MUBA 1FNMA 2Z2YA 1TAQA 5HDBB 4P92A 3VNSA 1E0JA 1CHNA 4X44A 2EG9A 3U3OA 1YQGA 4OHVA 2SCUA 3IBYA 4RIHA 5FTNA 2OVFA 4AN4A 2ZIWB 2ZRFA 3L1JA 1NM5A 4M1KA 5CXSA 4D81A 3Q7EA 3S8YA 3MQFA 2GD1O 5JY6A 4BIIA 1T43A 1NXPA 2P4EA 3RARA 2Z6VA 4G9BA 4N48A 5U4XA 3OJ0A 1ZM2A 5JYCA 1FP4A 2PGJA 3P0FA 1JSXA 1A9PA 3TH5A 4OHMA 3FTFA 3KM0A 3SIRA 3RV4A 1WX1A 2WIJA 3OM1A 3AKZA 1J99A 1KQNA 4BAGA 5LBTA 1YDMA 3DLCA 5KNDH 4I4TB 1U7XA 3FCAA 2XUGA 1GV1A 2I2XB 2EATA 3ZU4A 3VTAA 4CVNA 4Q00A 1AQJA 2P9EA 3EE6A 1EVZA 3Q3HA 4FHZA 4X3OA 1P1RA 1Z8DA 3ROMA 2NTEA 3X1KA 1WD7A 3S6JA 3R1IA 2XUHA 2PHZA 2VRCD 4IF6A 2H63A 1OKKD 1VLVA 2XWSA 3RBVA 3LCUA 4TVBA 3NAZA 3G5TA 5L4NA 1NLUA 5LIPA 3FUVA 1F2TB 1T25A 1KETA 2Z8YM 1IWBB 2XXJA 2VATA 2QPTA 4IG4A 4DSTA 2XNHA 4NTZA 4ZICA 3EEFA 3R9XA 1S3IA 5DWQA 4AY3A 4C0LA 4IUDS 4U2FA 4YIKA 4U0KA 1AV7A 5DNVA 4HQFA 4LJAA 3KJHA 1T0HB 3O8DA 4MHOA 4MPTA 4H3KB 5LOVF 5SZKB 1Y34E 3GJZA 2BFDB 4RPHA 2F9FA 1ZXLA 2QZPA 1ZA1A 4FMCB 1R8JA 3QKRB 5CAEB 1PUXA 4C9BA 2GBPA 3CVJA 1SJ9A 3M33A 5TPWB 3FYUB 3H1GA 5K3FB 2XRFA 2WSIA 3KETA 3JAKA 2VPZA 1QO9A 1SGWA 1M7BA 1OH7A 3N70A 1PHRA 3C0KA 1QQTA 2G8NA 2HPVA 1GCOA 3B1XA 3CUEF 3A1FA 5A06A 3DZJA 1HNZB 1OZAA 3T95A 2AC4A 5AW3A 2ZM5A 2BZGA 4GSLA 2HHHB 2BUCA 2ZIEA 5I9BA 3G2PA 1P8JA 3LW7A 3ZZMA 2BGMA 1NMQA 3CNNA 5EE0A 1E3QA 1VMEA 1X7XA 2A0WA 3BD9A 5DXJA 2X0EA 4J0KA 5KAPA 3R7BA 2FZCA 3EC1A 3BRSA 3RQSA 1PR9A 3OWOA 3RT1A 3LL4A 3T35A 5K09A 3K9LA 3TUZC 1SVLA 3OE7D 1P7PA 2C83A 1NF8A 5MF6A 3RSFA 4N03A 3LUBA 3VC3A 3TR5A 1QZUA 1QF9A 4RTJA 3AY0A 1OT3A 1CQXA 2ZYVX 2ZBFA 1SUWA 1UBOS 1YVUA 2BGUA 2FZKA 3FCYA 3T41A 5I8WA 5M34A 4O1MA 3LY9A 5MFZA 3Q2OA 3W04A 3RYCB 1RWMA 2XT9A 3TOCA 4CM4B 4ZQGA 2MSDB 5DYTA 4PC3A 5CFOA 1KGSA 1ZN9A 2GWRA 3L7DA 3PZBA 4BJ6A 3EIUA 5JOQA 1I2DA 4G2NA 3ZD6A 1X38A 2R6ZA 1IN4A 4OL0A 5CLJA 5T3YA 4ND8A 4C3OB 3L1KA 4J0EA 2I7DA 2GBCA 1ULSA 2P1ZA 4Y18A 5FCDA 3WAJA 3LPDA 4GI7A 1DCFA 3GEDA 1L4BA 4I55B 5CXQA 1RLMA 4P3XA 1XDBA 1VMKA 4EPXA 1AO3A 2HMAA 4OJMX 3W2HA 5G0SA 1PVOA 3ZW8A 2VP3A 3TL3A 1OFHA 1CUUA 2G06A 2XUDA 4I7EA 5ER6A 2VHEA 4AROA 4P7KA 3IURA 4LF9B 3RIEA 2QRGA 1I13A 4KMMA 3VR0A 5K0ZA 4BRSA 3I1IA 2WBLC 3I0NA 1Z12A 5CU7A 1BX0A 4IRUB 3QKUA 5AT1A 4BBAA 4U5QA 3WLKX 4AY2A 1OW3B 121PA 1RQPA 1T8TA 3A6DA 4CLOA 4L2IA 1U3WA 2AMFA 4I9UA 4J76A 4F1JA 4P58A 1GL6A 1XEAA 1EFVB 2AFIB 3CX3A 3Q8XB 4PCLA 4GZ5A 2PV0A 2WW8A 1OI7A 4K03A 4DV6B 3RKRA 4HYYA 2J46A 2EX0A 1R50A 3FPGA 5EJ5A 4TTPA 3EZ7A 1XAIA 3GXBA 1E1KA 1GLVA 2RGDA 1XP5A 2B0CA 2PRJA 3N87A 1KIAA 1D0IA 3GLQA 4Q05A 4ENVA 1HLPA 1ICEA 4CKZA 1CQWA 2X9LA 5H83A 2V7UA 2C54A 1YDHA 3GRRA 2P0YA 4IV5A 3W5AA 4WLOA 1R00A 2WA1A 3FYUC 1I4OA 1QV7A 1P1KA 1UCFA 2JH9A 3UHJA 1KAGA 2Q3BA 2XECA 1USWA 5DP1A 4YRRA 4Z7OB 5JQWA 4Y2QA 1DG9A 4FLFA 5AHOA 2D0IA 4IDEA 2Y1LA 4X92A 1O58A 1WDTA 2AQ8A 2PO5A 3BGOS 4JYCA 3BMNB 1PHPA 4NCHA 1SBZA 3MAAC 1O9BA 3JX9A 3G7SA 4PRKA 1CS0A 4A6XA 4EI2A 3Q7SA 3IUNA 1PJBA 1H2FA 2KM1A 1Q21A 2O0HA 3W9YA 3NORA 4ITRC 1ZD5A 4DW8A 1LW6E 1Y7IA 3FWKA 2PS1A 3LRTA 1E0AA 3GJ8A 4MAFA 2D1FA 1G7TA 4RADA 2W37A 2J7PD 4NYIR 1Q7CA 4E1AA 1IEXA 2R6AA 3HCEA 1P44A 1XMVA 3ODGA 4C05A 2J45A 3NV7A 3ONVA 3HYRA 1Z6YA 3RRFA 3A3PA 1BXKA 2WIFA 4I8IA 4HGYA 4LV6A 3A6JA 3EOBI 4YMIA 1P0QA 3DEHA 3FDXA 4M76B 4RGVA 1I7SB 4RHEA 1TNDA 2AOVA 2F3RA 1OILA 1YI1A 1VKZA 1OFIA 3PE4A 1TUGA 4ZVNA 3HBAA 3RH0A 4YJ2A 4RDHA 1KZGB 4OGLA 4R2WA 1F38A 1C1XA 5LQJA 2O9JA 4X85A 1UK9A 4CKBB 2B5WA 4JR2A 5H3CA 2R00A 3GX1A 3EFEA 1V0JA 3VDRA 4MS3A 3BB1A 2IYEA 1GTVA 4HD8A 3RCBA 4Y6RA 4EG3A 3LFUA 3PHBE 4MS4A 3L0BA 3SXJA 2XQVA 3W6OA 1IVYA 2ID8A 4B1FA 4JQZA 3WWEA 3ORYA 4B8YA 4CV0A 4WLUA 3M6AA 4ETMA 4DCVA 1GARA 2OQIA 2IQIA 3QV1A 3R75A 3WAGA 5NLLA 5LOVB 3HA3A 2G09A 3NYRA 3R5TA 5JAIA 1H2EA 2WJ6A 1EFUA 3E1KA 1GPH1 3C1OA 2JHFA 4B33A 2X0JA 4H60A 4QYTA 2BF4A 5DHUA 4YPFA 3VSDA 2XTAA 1GILA 3MJTA 1O5IA 1XD2A 1HLFA 2B7LA 5AXAA 4AX8A 3GJ5A 4ZT4A 2PMEA 2QZZA 3H86A 3HEMA 3PRYA 1NR1A 2O6LA 1CUBA 5CNIA 4U7WA 5FLYA 2BP7B 3INTA 4D7AA 4FGZA 5GZ1A 5IPFA 1LBIA 2OO5A 3CO5A 1E2QA 2O1XA 2WD9A 3O0TA 1DTSA 1ZDMA 1G60A 4ENQA 3CH6A 3L77A 3FVVA 4Q1DA 1DFHA 2DYKA 2QMOA 4YRKA 1Q0PA 2FMKA 2ODAA 3JWPA 4H6PA 4FMPA 3B38A 3WNZA 1ORVA 4XYMA 2O3UA 4P4TA 3UWKA 1JDBB 3F98A 1DWUA 5B4TA 5JJBA 3E3OA 2IBSA 3M89A 4IUYA 1ZM7A 2ZE5A 4ZC1A 1GCAA 5GP1A 3SKYA 4ALNA 4ZVVA 4F8EA 5C81A 1D4AA 1L6RA 2XUJA 3FOWA 5CD9A 1U1IA 1LVUA 2DUWA 5EKSA 1AHPA 2B2XA 3DPSA 2HC9A 1XFAA 2D3WA 4JC0A 5HDQA 1EUCB 3LH5A 1DHTA 3LHIA 4UQLA 2OL4A 3QU2A 1IBKB 4MIYA 3ZWQA 3D2BA 2YJTD 3R3HA 2WZDA 4EI7A 5HQ3B 1EZZA 2C42A 1PNRA 1ZIXA 2OGZA 2W6MA 4PHTA 1BMDA 4XGNA 4RK4A 4ZJZA 3HY4A 3HYSA 3WICA 1FX0B 5CDFA 5K6AA 3O3MB 4KIJA 2HZ7A 1D2GA 2JEOA 1NE2A 1M72A 3FYTA 4PRLA 1FYVA 2IHTA 4AS2A 5EIBC 5JROA 1OXUA 3CLRC 3EQZA 3ISTA 5AW1A 4BJ1A 4YRGA 1UOQA 2R86A 4TTSA 4EHLA 1EPUA 3V1LA 4FB5A 2WVHA 5ENVA 1PDWA 2OLJA 3EQ8A 1RXVA 1PX2A 3N75A 1KVUA 4KE9A 5B1IA 2AQHA 1B8PA 1P75A 3DKVA 4MP3A 5E6UA 3ZS8A 5ICCA 4M9QA 4CL8A 1GDHA 3IV7A 5EKUA 1O6CA 4L4SA 4R1SA 3K20A 4R2JA 3EEOA 1OV6A 2W70A 1SCUB 2X7JA 1FZQA 3FTEA 2G8LA 2VZLA 4OUDA 3P2JA 3LQQA 3O9MA 2F3PA 2HADA 3GCDA 4J7UA 2ZSFA 2Q2WA 4YRCA 4O63O 4ENTA 1PT9A 3H65A 3IEVA 3LRPA 1AF4A 4M0LA 3X2SA 1MAUA 5A3VA 1XXHB 3VTKA 1J22A 3R4VA 4CUKA 3W90A 2Q3FA 1ZA2A 5HZMA 3EGDA 2ZWVA 3GVXA 4LCEA 2E7ZA 5KCMA 4I5DA 4DFDA 3VR3D 2ACKA 1XYGA 4HNSA 1K3UB 4B7CA 4JS0A 2PUHA 5FIUA 3HB9A 3L4SO 2NUPA 2A9VA 1NJSA 1QLWA 1HA3A 1Z6TA 1FE8A 2P9YA 3CLTC 2PJRA 3KYCA 4QJIA 3DHWC 3UJ7A 1AKQA 2NAPA 5J4HA 2B2CA 1BTOA 2A9RA 1HYGA 1VBMA 2PGLA 3WRVA 4BKUA 3T7JA 3TECE 1HL3A 1FSZA 2ZTHA 3LO5A 3H1TA 3HXMA 2WHPB 2A86A 1Y5NA 2XOEA 2Y6VA 3D8BA 2ZIVB 3AUSA 3EAFA 4RVGA 4DLWA 4PC1A 2JLCA 4TXLA 2O3QA 2IIBA 2OECA 5I8PA 3FMGA 5FUBA 1WETA 3HDGA 4YCBA 4LZOA 2GYYA 2HSDA 3GJYA 2OBMA 2LWIA 3K35A 4FNMA 3TQIA 2ZU0C 2GZHA 3ZWCA 4BNIA 1VLLA 1JDBC 4W5NA 1VJ5A 2AN3A 4H7JA 4GLJA 5TQ0B 4QZVA 2BRUC 5JATA 1J07A 1VHTA 2OD7A 3ESYA 3L0YA 4MB6A 4R2KA 5WRFA 3VR5A 4CQLB 4E2FA 1OASA 3R7AA 3AVUA 3EPPA 1R6XA 1W5TA 2P3OA 3NWBA 3DP9A 4RWEA 2ZE8A 2OBXA 3H5RA 2YWCA 1EDOA 3PT5A 4GGMX 3PPVA 3AUXA 5HRAA 1P4SA 1WW2A 2D5AA 4IRMA 1NMXA 2PAAA 3ZEAA 4KSBA 5AD1A 2GHRA 3TD9A 2V4ZA 3KDAA 4U9IS 1T91A 4J3NA 4NWIA 1P7CA 1GG2A 3KDSE 3U3XA 4EK9A 3CLVA 2QUIA 3PXEA 5BW5A 1BCRA 1JFVA 2NUBA 2IYSA 5P21A 3VDMA 3NZEA 2RBGA 4FFDA 4MKFA 2JIZD 1AQLA 3H8VA 5FA5A 2EWMA 4AECA 3RC9A 2NZWA 3VI4B 3IQFA 1LLUA 4I4TA 5K3DA 1KOLA 3D7NA 1G21B 4HQ0A 1KH1A 3BHJA 4GI5A 1ECGA 4RVSA 4B3MB 3INYA 3ZLBA 4ZJYA 4EG8A 4FDLA 4MPPA 5IM5A 2R85A 3FCXA 2I6QA 3M6VA 1YS2X 2VUSA 4AKEA 4EUEA 3NIWA 4P7BA 2DQYA 3CH4B 3O2JA 1QWOA 3LM8A 1L7QA 3OUUA 3K1AA 1X77A 1NLFA 4F3NA 3D5QA 2C57A 4PGMA 4ER6A 3FJYA 2I2BA 1UODA 5BSVA 2H3HA 4HFJA 3QMVA 4E22A 2CVZA 3E5HA 2SKCA 2NQTA 4KQEA 3QMWA 3DHNA 1SUAA 1FJ2A 2W2KA 1N8TA 1IOZA 4U2KA 5EXPA 1DQZA 2Q8PA 4JP3A 1UAYA 2ILTA 3KQTA 4WV3A 1R27A 4EJMA 2QN8A 1MU0A 5BQ3A 1QO7A 3M83A 1TW2A 3KE9A 3DUFA 1Q16A 4QA9A 3LCJA 3QKRA 3ZLVA 5DPMA 1K6MA 2FEAA 2IXGA 3R5HA 4LF7B 1NONA 5KNCD 1FMLA 1MV5A 1QUFA 2YHUA 4MQ6A 4UD2A 5TPWA 5GZ3A 4NCXA 5K3FA 1EJ0A 3I5AA 4PRYA 2VF2A 4TYMA 3D02A 4BMNA 1CZHA 4D6PA 1ADYA 1BD3A 2YC4C 2XGMA 1M74A 1CUFA 4LYFA 1QTRA 3C98A 4ZT2A 1QG4A 4I36A 1MW8X 1N2OA 1RBQA 3D6FA 3AERA 5IEJA 1IUNA 1ZUD1 2O2DA 1ZSNA 4UTZA 4K1LA 5EJ9A 2C9DA 2GA8A 4L7VA 1W34A 2GN1A 3KDPA 3LK6A 3NHFA 5EP1A 5LQRA 1WEHA 4BQFA 1GCGA 4KXYA 3AESA 1FQWA 5CB6A 4IMIB 2ZCVA 4CM8A 3QV2A 4IPTA 5CG2A 3G9XA 3L1HA 5FLXA 1ZGJA 2GETA 2P6UA 1RC0A 1M2KA 2R6CA 1TAHA 3NDIA 1TT5B 4S1TA 5TQ2B 3R09A 4IWYA 3ET5A 4HPWA 4DSZA 1WCIB 4BO3A 4PFQA 4QPPA 2D0OB 4MR7A 3L4BC 2X8JA 4J75A 4HDAA 1FXSA 4BDSA 3NMUF 1AXEA 2B1JA 2HXYA 4KQCA 2GKSA 4Y1EA 3EXEB 2OV4A 5HRCA 3RYCA 3U44A 3THWB 3KEQA 1D9XA 4CM4A 1CLEA 1LH0A 2HLDA 2XB2A 5ALGA 3Q87B 4MVJM 4CT0A 4GPD1 3VAAA 3DOJA 5A9SB 1CUEA 4JN6B 2P9QA 3KQQA 3O03A 3OKAA 1CEQA 4OJQA 1RRKA 3AIOA 3D3QA 2MSKA 3N2ZB 4IH4A 3LVRE 2QMYA 3MTBA 2R8XA 2V8BA 1JAZA 2CYAA 5FKJA 3OQMA 4KDFA 2ZJ8A 3HVHA 1NLYA 2WWXA 4J9UE 4CCSA 4I55A 5ALFA 1KY3A 2JHPA 4WBNA 3ZE8A 3VKUA 4UU7A 3FD8A 4C6RA 2YJ6A 2WJWA 3HJGA 1LSJA 1OBFO 2WOJA 3WZ2A 4MIKA 3DE2X 3ED1A 4A6PA 1M7GA 2AR0A 3SOZA 1MX3A 2WM2A 3EBPA 4GX0A 1OWNA 3ZZUA 1PG5A 1GZ5A 4A8JA 3UH1A 1A9TA 1HR0B 1UBTS 4F2HA 5CA0F 1M1XB 1OFGA 3WRWA 4FE3A 1BKYA 5E7QA 1F8FA 3F6YA 4TUYF 1L8LA 2AUTA 1N2BA 1EFVA 2BL4A 3T4PA 3C6BA 3OSZA 2NWQA 2DETA 3AVVA 5DNWA 1M6EX 3QFFA 3CN7A 3SEFA 3TRIA 1J0EA 4OQZA 5JLAA 1QE5A 4C43A 2QV7A 1DQPA 3K2QA 1JBEA 1TMGE 1Y3BE 2CXOA 4E13A 2F7SA 5JCJD 2XVYA 4XYGA 4DG9A 3UWOA 4BKRA 2QZJA 3IT0A 3GFOA 2D0PB 1EK0A 4LJYA 5KDOA 3I0MA 4BFYA 2QQ5A 2Q6IA 2XUKA 3R0IA 4XLLA 3H5WA 4IL5A 1O1YA 5IAEA 5FOVA 3U3KA 3HFGA 1WXHA 3A1EA 5BSHA 2N9UA 1GVHA 4R6WA 2PQ2A 1HETA 1W46A 4TTTS 4MUFA 3BL8A 4PY2A 1SB8A 5FJJA 3LWBA 2M1ZA 3EMDA 2NPIA 2OHJA 5DHAA 2J8ZA 4S05A 3LLCA 2LCQA 2ERCA 5AK5A 3BMNA 3G23A 3GT3A 4MUXA 3JQQA 3UK0A 4JIMA 4WACA 5FTKA 4AY5A 4GOKA 1TJNA 2JA1A 2QROA 2ZR0A 1JI0A 3ORRA 3IPYA 4P5DA 1Z0UA 3NX4A 4B2LA 2PYZA 1E1RD 4AUEA 2HSZA 1ZC4A 1GR1A 4QIHA 1WU8A 4MIEA 1Y7TA 1B93A 1K8ZB 2D1TA 2WQZA 4ETWA 2OVBA 2XA2A 3T0IA 2I2DA 2REQA 1CVLA 1G20E 3A9TA 3W5IA 3FPCA 1Z56C 2R6DA 1FS6A 4GR9A 4TQUS 4MJ3A 4RMNA 3DO5A 3PQEA 4N39A 5HX7A 1XO1A 2G5CA 5CNJA 1DJPA 1VRWA 2I1VB 2WG0A 2QB5A 2YVUA 1RZRA 1Y6JA 3PXCX 1THMA 1NQAO 2XQGA 3IILA 5J40A 5SV2A 2RB4A 3T9FA 4NH0A 3I42A 3HXLA 2R7MA 3X1MA 3RTGA 6NULA 2AWOA 1O5TA 5ICGA 1AZSC 4RD0A 3MGAA 2PX8A 1IQ0A 4UHKA 4Z0NA 1Z4MA 2HIMA 2QN6A 1NFRA 2R47A