1XEXA

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
PYIEKLELKGFKSYGNKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMC protein
publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 45
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexA00
3GD7A 2H92A 4LRWA 2WJYA 2NTYC 2OESA 4ZI3A 1OH8A 1W47A 4D26A 5LD2C 3ZLJA 1Q21A 1VTKA 5HKKD 4HUQB 3HDTA 4B2PA 1OIXA 3RC8A 4KU4A 2ZEJA 3NG1A 3CONA 1IY0A 2C9OA 2VP9A 3KFXA 4P33A 3JZMA 1TUEA 4RZUA 4GT1A 3HU1A 2XX3A 1AZSC 4P4UA 4Q4AA 4EQ6B 4W9MC 2Z43A 1KDRA 4YLGA 3EWAA 4I1VA 4LHVA 5KSPA 3T5GA 4CIDA 4P31A 2O8FA 3L8YA 3TUZC 3KKNA 2HJVA 4PO8A 3CX7A 1E9RA 4AK9A 2CL7X 4LJ5A 5IK2A 4AURA 2F1RA 5F2EA 1SKYB 4QGGA 3ZS8A 3AP1A 4QM7A 1E9DA 3MG9A 4YMSA 3TW4A 4TZ6A 1T5LA 2ORIA 2LCFA 4F38A 2GBLA 2ZR7A 2QT1A 4TMZA 4ZIRB 5FPKA 4JVNA 2FSIA 2PJZA 3ASYA 1SVKA 2HV8A 2UVQA 5FPHA 1WA5A 4HZIA 5DLQC 4OI1A 4BLTA 2EFHB 1CJMA 3VR6A 3UANA 4DCTA 2FSHA 4LC1A 2X8AA 1YZLA 2OLJA 4WZ6A 4DCSA 5K8LA 2WAYA 1R10A 4PQRA 4FMDB 1AIPA 4JLPA 3WHKA 5LPNA 3EPKA 3KFVA 3CO5A 2Z83A 4E03A 1CLUA 2VEDA 2XAUA 3DZDA 1A82A 1G8FA 2I1QA 4IOLA 4MYTA 1ZNWA 3B2EA 4HDCA 2OILA 5HCIA 3I5XA 3VR4A 2WIBA 1DAIA 1NMZA 4BASA 5JRJA 1SXJC 2KB0A 3OFND 1DAKA 3O8RA 1GZSA 2CHGA 5SZHB 1X1RA 3CRW1 1E2KA 2QPTA 3M1IA 1PV4A 1N5JA 4LYAA 5CLLA 1A4RA 3REFA 1KO7A 1NN0A 2ZANA 4PC7A 4XTRA 1PUIA 3SQWA 4NYMQ 4MUAA 1IXZA 4QBHA 4IHQA 3QIAA 1XXHE 4BWYA 4EPTA 4KYIB 5EP2A 2DWQA 3O8CA 1KNQA 1TF5A 1OV4A 1Q1BA 2NGRA 5TV2A 4BLOA 5B30A 1NF3A 1W49A 1KSHA 1HV8A 3PR1A 2B21A 2XZLA 4FW9A 3FMFA 5E4FA 1SVMA 4D0LB 4X8OA 1N6PA 1MO3A 1A1VA 2R44A 2DB3A 1C9KA 3Q7PA 5BWMA 1YRBA 1Q12A 2QM8A 3BAFA 4EJSC 1N0WA 1Z3IX 4RD3A 5DI3A 1NVXQ 1S9HA 4QJ5A 1XDBA 1W46A 1U0LA 5A0FA 2VO1A 1TTTA 3RVBA 4PAMA 1P2TA 2R62A 2ZSFA 4N3NA 2OFWA 2ANCA 3QOFA 2BEJA 4TLCA 3ADDA 4LV6A 2IK8A 2OBMA 2ZS7A 4H1VA 1G8YA 1K5DA 4DSNA 3ICQB 1YZTA 3Q5EA 4KSBA 2VP6A 2ZSBA 3UMRA 4WAUA 1JQJC 1NMXA 4BQSA 1OB5A 1M7GA 3ZDQA 2ZIAA 3NBFA 2IYUA 1OFHA 2REXB 3GLHB 2RGCA 1NJGA 2YWHA 1VIYA 2QZ4A 3O8BA 2J0UA 1H65A 3PXGA 2CCGA 4JLNA 4XTCS 2ZUBA 3WBJA 1UKEA 3QSYA 2QNRA 2ZYVX 1T6NA 3DO6A 2ZE7A 3ASZA 4C0QC 1OXVA 4I81A 1JEDA 2BCJQ 2DHRA 4BFZA 2PZFA 1II9A 3AUXA 4LBZA 1IN6A 3ZGXA 2J7PA 1NMYA 3P32A 1JB1A 1E2NA 2ZTSA 5CK4A 3AVXA 4Q48A 2WWFA 5EP4A 2J0UB 4PHFA 3QF4B 4D2IA 2PX3A 2HYIC 1G6HA 4BFXA 1IXRC 2ZAOA 1X8JA 3QBTA 4MKGA 4QXAA 5GVRA 3RAPR 1US8A 5IHPA 4B76A 1U9IC 2GZAA 2OBNA 1E98A 4RZXA 1NIJA 2XSZD 2ZSAA 1Z07A 1EFUA 4GI7A 3L82B 4Q7KA 3L43A 4FN5A 3QY0A 4XVRA 4DB2A 3W6NA 4MUBA 3CR7A 1ZD1A 5K8UA 1ELOA 4WXRA 1YZQA 5G41A 4E09A 3GLGE 5IDVA 1US8B 4PQYA 5FL7A 4PX9A 1L4UA 2CCKA 1WF3A 2ZR0A 4DT1A 3CR8A 2JLZA 5CM9C 5P21A 2QAGA 3ZD6A 1W36D 4RFVA 2WJHA 3FB4A 4HB3A 2AFIE 3RRZA 1G3RA 2VP4A 3OZXA 3ADCA 1NSTA 1OIWA 3VX3A 2FSGA 2EFGA 3QQ5A 2NO7A 2GXAA 5C18A 1R0WA 1G3IA 1KK3A 2ANBA 2ONKA 4AKGA 1OLOA 4LK2A 4O0MA 4ON9A 4Q21A 4BLQA 3QKRB 1JNYA 1W4AA 2XTMA 3WRXC 2GILA 1G7CA 3MLEA 4MGYR 3SFVA 2BVNA 4ZI2A 1W4RA 1M34E 5TDHA 1QVRA 4MDEA 5JZVA 1OXXK 4B44A 4DT1B 1FL9A 4FCVA 4OQXA 1T8TA 3BBPA 1PLKA 4IRUB 5LD2B 1FW6A 4GMDA 3DZ8A 2OCPA 3PEVA 1HUQA 1E0AA 3ZS9A 4M1TA 1U94A 4UNPA 4BFTA 2X2EA 2OAP1 4V0NA 3DKPA 3ZH9B 3THYA 2X77A 4M2LA 4CEJB 1MH1A 4MA4A 4B6FA 5KNBA 1N5LA 3B1YA 3MD0A 3EAQA 4WW0A 4AG5A 5EP3A 1OW3B 3AF1A 1A2KC 1U98A 3N2EA 1Q1QA 3KB1A 4CYMA 2UZIR 4EKDA 2QMHA 4W7SA 3MCAA 1E2FA 4V0LA 5EUQB 4A2WA 1KKLA 4MKHA 1S96A 2PLFA 4GFDA 2D7DA 3A36A 3TBKA 3HU2A 4G01B 4QRHA 5C2JB 5JEEA 2E87A 4JVSB 5KNDA 3U5ZB 1CRQA 1A2BA 1YR7A 5M04A 4E22A 5AUNB 2A9KA 4PC6A 4CF7A 1IJFA 2HDNB 3CRVA 1F60A 3I61A 2ZRMA 5J40A 3WBKA 1UAAA 2IC5A 1CULC 1YR8A 1AKYA 4DSTA 3TQFA 3CZPA 4EUNA 1XPOA 3E1SA 3V00A 1P73A 3Q85A 3TSOA 3GPLA 3IEVA 1ZIPA 1CTQA 1U81A 4KCGA 2WJVA 1QHGA 2DFNA 3P26A 5GJWC 1G9XA 1HE8B 4A8JA 3ZVMA 2ZYTX 3K0AA 3B1ZA 2CL6X 2QROA 4CT5A 1U8AA 1SXJE 5L3SB 2O8DB 2GETA 1IY2A 3ZQ6A 2ZM5A 1JAHA 4WZAE 3FMPB 1MO4A 2ZSEA 2ERXA 4KYUA 1JJVA 5FPTA 1KDOA 2IEYA 1IJEA 3BGWA 1KO4A 4M1WA 2FH5B 1S9DA 5GJVC 5H68A 3RS2A 1ZNXA 1P5ZB 2EYUA 4RKEA 4QGFA 5SZJA 1PJRA 1BYUA 3LRPA 4GNKA 1S0UA 1Z0AA 4B3FX 1GSIA 1KY3A 3V4FA 4DDWA 5KSZA 4II7A 3CRQA 3JZAA 3AVPA 1YKSA 5AJYA 1R0XA 3D6TB 2MSEB 1Z8FA 2G88A 2J7PD 4C0SA 1FQJA 1XEWX 2KBFA 1WCV1 2GJKA 4DLWA 3KQKA 3T1QA 3X1YA 2RGNA 2ZRIA 3KJIA 1N0UA 3TH5A 4EJSB 1TQDA 5FOSA 4W5HA 4BFWA 1JBKA 1PUJA 3EG5A 4C0AC 3THWB 3R9WA 1J7KA 4V0OA 5ELXA 1E32A 1U0HC 5D3QA 2WOOA 2F6RA 4A15A 4RZ2A 2H5EA 3CX8A 3RNLA 2V4ZA 4BFUA 1I4TD 4QHTA 4V03A 1V5WA 2CVFA 2W83A 4KSCA 3KUCA 3RS7A 2B6HA 5DYIA 2V3CC 2RHMA 4Q47A 3EPHA 4TL8A 3KKOA 4WOPA 2O5VA 3VQTA 1W5TA 3FE2A 1Z6TA 2OCBA 4FWIB 1QG4A 4DIDA 3FHOA 4M1OA 1DADA 2C5LA 1M6NA 2R6DA 2ZVPX 5FBQB 1J2JA 1NVUQ 2VRWA 4Q7MB 3QE0A 2JJ2A 4B47A 3ETLA 1KKMA 2ZE5A 2ZYUX 2JA1A 4UXJA 3NEYA 4EPRA 4X8MA 4RD0A 2B7CA 2IX3A 3FPAA 3MJRA 1TF7A 2HYDA 2FPLA 2ODEA 3MWLA 4LC0A 2GCPA 4PPFA 3OESA 1VG9B 4P3YA 5JSZA 5KHOC 3GJ4A 3W6OA 5KUTA 5FR2A 1BS1A 2QPOA 4JLVA 1EFCA 3SBDA 1CJUC 2PEYA 3HR7A 4TYNA 1LS1A 2NZJA 3Q72A 5EXTA 2IXEA 2HLDA 5AJZA 2C9CA 4TLBA 3DPUA 2G77B 3F0TA 1FFHA 4M9XA 3BC1A 4DLRA 4I1SA 3U6BA 4G5OA 1DVRA 3FHTA 1Q1ZA 3QVUA 1R0YA 5J47A 3KL4A 2PT7A 4AKEA 5H8WA 4EPVA 2UKDA 1G3MA 3T1OA 3RANA 5BYJA 2OG2A 1F2TB 2ODNA 2QPAA 2GDJA 1ZYUA 1JR6A 4B3CA 1VCMA 4GP7A 1CF4A 2EWVA 2CE2X 2J9RA 1E3MA 1TEVA 2IT1A 1I2DA 2YV5A 3GMTA 1E9AA 3KJHA 5JECA 4CEHA 3AGQA 4D0NA 2W2VA 4UXIA 2BBTA 2MSDB 4C0KA 5L3VA 2WMOB 4CEIA 3LY5A 1VCOA 3ECCA 3KQUA 1OYYA 1N6HA 2C96A 5FR1A 4BFVA 3TVDA 3RS0A 5B64A 4B6EA 3CRMA 4HLUC 2BJVA 1X86B 2ZITA 2XNSA 4V02A 3W5IA 4JIMA 4FCWA 1MO5A 2QT0A 3K70C 4GDFA 1RPZA 2QE7A 1HT2E 1OIVA 3T06B 1VYTA 5FUWA 2VA8A 1E2HA 5HZKA 1I4LD 1NN3A 1S8FA 1G8PA 1L2TA 2IUUA 1BMFA 2A3RA 4LJ9A 4RD6A 5E95A 2FG5A 3Q7QA 4HDOB 2GXUA 3DVLA 1ZUIA 1DBSA 3SJCA 2F9MA 2ZAMA 4MGKR 1XNJA 1E2PA 1J8MF 4ZCMA 1L8QA 1W0KA 5GVSA 2WKRA 4TWZA 2GTPA 5FOTA 1OXTA 4CRWB 2JLQA 1E9BA 1N3BA 4DLYA 1ZNZA 2F3TA 1ZM3A 4D6PA 4Q19A 5EE5B 1W4BA 3VKHA 2FNAA 3CZQA 3U44B 5JJKA 2BBSA 3BH0A 3VHLB 1N0VC 3LDAA 1TMKA 2JDIA 2GJSA 2A5YB 2QP9X 1UFQA 2PZEA 5G53C 2P3SA 5F98A 4PHGA 2FFHA 2AKAB 3X2SA 3RC3A 3Q8XB 1SVSA 2IXFA 3LBIA 1U2RA 4ILEA 4S35A 1WMSA 5JEDA 2B8WA 3GFTA 3N2IA 5FI1B 1G6OA 2G0TA 3BH6A 5FBWB 2JCSA 4ZCIA 4FMDF 1AA9A 4OQLA 121PA 4A0HA 4PZZA 2GVDC 2B92A 5CM8B 5JHHB 1Z63A 1RRCA 4IW3B 2O52A 4JLAA 2FFBA 2V55B 3CF0A 4UNRA 5FOWA 3AVTA 1GOTA 4N1AA 1ZM4A 4M22A 4G3XA 3SQXA 3IGFA 2RGGA 3QXXA 1QHSA 1XCGB 4BEBA 3K0FB 3A1UA 1E2LA 5EUMA 1SVLA 2IYLD 2R6FA 3WNDA 4JVMA 1KI8A 2QP3A 3DM5A 4P4TA 1NP6A 1GFIA 3K53A 4FD2A 1R5NA 1GITA 2W0SA 2YVUA 3FGNA 2BMEA 3LD9A 2PJRA 3UMSA 1HURA 2A5DA 1HTWA 4NYJR 4M1MA 2WWHA 3AUYA 1R6BX 3PQCA 1GAJA 4AC9A 3T34A 4PANA 1EX7A 4JLJA 1JALA 4PZLA 3RRYA 4AWXA 2V1UA 1V43A 1TADA 5H1YA 2P2LA 4CZ2A 4XWOA 3VTKA 3I73A 2F3RA 5KNCA 2J0VA 1W48A 2YWFA 3AKEA 4LJ7A 2LWIA 4NE2A 1I4DD 2PL3A 3K9GA 5AJVB 5GJBA 3U3OA 4LYJA 4LJAA 4ACAA 5EE1A 1E9FA 3H2YA 5KU1A 3B5JA 2V54A 1MKYA 2ZSDA 4DXAA 1XWIA 3ADKA 5JS7A 2PMKA 3EZ7A 3L2OB 3PITA 3U7GA 4QBGB 2HT1A 3FFAA 2H7VA 2ZS8A 3MGCA 4BZQA 1XB2A 1JXOA 4HB2A 621PA 4CGZA 2ZU6A 5AK0A 4E07A 2HLDD 2GXQA 3IEUA 3MRSA 2WKPA 4KV9A 2JLYA 1N6OA 3UKDA 4TZ0A 3AP2A 3BORA 3SU8A 1VG1A 2G1JA 2RGBA 2XOKA 1ZM7A 4EPXA 2XGJA 1N5IA 4TYPA 2DFTA 4LOAA 3SN6A 3CM0A 1G3UA 1KAGA 5DN6A 1R5OA 3O8DA 4CDGA 4Q01A 3OE7A 2A5JA 1NLZA 1B0UA 1QHIA 1MO6A 1XFAA 2OAQ1 2IYXA 4EQ6A 4K8OA 3L0SA 4H9GA 4YONB 4KITB 2ZRGA 2ZI6A 5SZKB 2QA5A 4F4IA 4QNMA 4FI3C 3RHFA 1A5TA 4PPNA 3U6KA 1FMLA 2ZI9A 3ZVNA 1R4AA 5CYOA 2FFQA 2VQSA 4LCBA 1KI6B 2J59A 4JYBA 4C0HA 5FTLA 1XD8A 2CHVA 1M74A 4HAZA 3SEAA 4MKFA 5FPYA 2R6CA 3A1SA 4ZIRA 2DR3A 2XSZA 1FMJA 1OPXA 2R8RA 4MQBA 4Q18A 4Y0AA 2QE7D 4AYTA 4UNSA 2Z4SA 3QVVA 1N25A 2ORVA 3UIEA 3FVQA 1KI2A 4LYHA 1ESNA 1KO5A 1JEEA 3OAAA 1WB9A 1NG9A 1XTIA 4GOJA 4OK3A 5TY0A 4DLSA 5J4VA 2QI9C 2OM2A 1RC8A 1T91A 5JS8A 5DISB 3CPEA 1BMFD 2ZRNA 4M4SA 2BWJA 1XCPA 2CDNA 4PXAA 4KFUA 4I99A 1P60A 5BW8A 3OEEA 3U3MA 4MKIA 2JASA 5FUXA 5AUQA 1FP6A 3QXHA 2WOJA 1NSFA 5KDLA 2CNWD 2KSQA 3GJ5A 4JL6A 1U8YA 1W0KD 1G7SA 1ZP6A 4TT3A 3R9XA 3BFXA 2IYSA 1E2DA 2BC9A 3DMNA 4B48A 2I4IA 5A5GA 1ETUA 2IUSA 1WQ1R 3IIKA 1D2MA 2F43B 3IQXA 2CBZA 1DTSA 1Z6YA 1SZPA 2P6NA 4G1UC 3ZYCA 4Q4HA 2V7QA 1YJ5A 4US2R 4JLOA 2JDID 4LBVA 4URUR 4D4LA 4GP6A 2D2EA 1AGPA 1E79D 4URZR 4U7DA 3BOSA 1XZQA 4A82A 3HWSA 1TEXA 2KE5A 2OO7A 3L0IB 4V0MA 4LBYA 3X1XA 1S3GA 3BXZA 3K70B 4C7OA 1MRNA 5FPSA 2EW1A 3DDCA 4WZBE 2BV3A 2CLCX 4OK6A 1RZ3A 1YZGA 3TSZA 3X1DA 4A0RA 1E99A 2EYQA 1E2QA 2V6IA 2VPPA 1TUIA 1F2UB 4JLBA 4Q4HB 1NVVR 1QHYA 3QKSB 2YINC 3AKCA 3PUWA 4RY2A 1XXHB 1IAQA 2PCJA 2XJ4A 3SE0A 1OH7A 4MRNA 3AF0A 5LB2A 3NDPA 1DELA 1E94E 5CITA 4D4KA 3R20A 2LKDA 3TVTA 1T0JB 3K09C 5AUOB 3FFBA 3RSOA 2C78A 2IS1A 4PTLA 4C7OB 3N70A 4G5SA 1HA3A 2IUTA 4R2HA 4FIDA 1G7RA 3U7HB 4IKEA 2KBEA 2ATVA 2GAOA 1S2MA 2R6GA 821PA 3GLHA 2CEAA 1AZTA 3B1XA 2F1HA 4KBGA 2QGZA 4TL6A 3AV0B 1QHHB 3CH5A 2ZI3A 4QBFA 5EE0A 1OYWA 2QL6A 1PLJA 2ZJZA 3L0OA 1FQKA 3WYAA 1RJ9A 3LLMA 3D8BA 1P4SA 4ARZB 1XJCA 3FDIA 2Z4RA 1L7VC 4DCNA 2H16A 4LX0A 2ZETA 2ZI5A 1DG1G 2FGJA 1ZVQA 2BCGY 3IQWA 1XEXB 1NBME 1DG3A 4ZCLA 3DHWC 4LDJA 2VP0A 4NPHA 5JRZA 2REOA 2WWWA 1XTJA 2WM9B 2AFHE 2CJWB 2ZE6A 3GFOA 4RVCA 5CLQA 1Z0JA 2NPFA 2JLVA 4PQFA 3IUYA 1AQUA 3QEOA 4BFSA 3W8RA 3VNUA 4HB4A 4B3DA 3LVQE 1IHUA 4IDQA 3QF4A 1RJ9B 1HEIA 1U90A 5DNYB 2VBCA 1E69A 4ZPXA 5JMTA 2A2ZA 2XOKD 4FXPA 4LHZA 3QPUA 4B43A 5A4JA 2WWXA 1W2HA 3F3YA 1GP2A 2IYWA 3C16C 4PC1A 2ONJA 2ZRAA 2HEIA 1KYIA 2GEDA 4NDZA 5DN6D 5KDDA 2XZPA 1Q3TA 1G21E 2KWIA 3OE7D 3ZJYA 1M7HA 2C2HA 4I4LA 4OHZA 3NKVA 4QL3A 3EXAA 1PZNA 3PJRA 3FKQA 4HLDA 3X1WA 1DE0A 2HUPA 3VKGA 3I8SA 3QXJA 3KXIA 5IT5A 1XJ0A 3EWSA 2CL0X 3TUIC 4NMMA 3LAWA 2OSBA 3QBVA 4KODA 3UPUA 4KFTA 3ND8A 4ERNA 4DUGA 2IXGA 4TTPA 3TSWA 3U3KA 3EC2A 4O2LA 1UDXA 1EGAA 4JLKA 5BN5A 1VDZA 1J70A 4RFSB 4DLVA 1JPNA 2YYZA 2OZEA 2VHTA 3DEFA 4XJXA 3PEUA 2YKGA 4F4CA 3KXKA 4L5BA 4PR0A 2GRJA 2YOGA 1Q0UA 1IY1A 4LV5B 5EP1A 4L15A 3MJHA 4TMXA 4R71A 4HATA 3OAAD 1VECA 2QQ0A 2H17A 1DO2A 2YHSA 3M0EA 2WICA 3BRWD 3C8UA 3GLGB 3QKRA 1E0KA 1N6RA 1YHNA 4R9UC 3G5UA 4NCKA 3OEED 2WPDA 3WXMA 5B58C 2BOVA 2VHJA 1Z22A 1GIAA 4PPGA 3K0SA 1R8QA 4TT3D 1BH2A 2AR7A 1G20E 3VX4A 2O8BA 3QJYA 4B3BA 2D7CA 3QKUA 1VCIA 3NHAA 2GF9A 3U3RA 2GNOA 4CEJA 1YR9A 2ZJOA 4P4SB 1GKUB 3IBGA 3KTAB 2JLSA 5BN3A 4A1FA 4YDHB 1JJ7A 2IS6A 2V7QD 1Z2AA 2JLWA 3TW8B 4L9WA 1J99A 3CLVA 2H8KA 4RJLA 3VKWA 4GBMA 4JBWA 2OCAA 4ACBA 4YQFA 2BHRA 1XF9A 3GJ7A 4C30A 4NYIR 3P20A 3AKYA 2NQ2C 4JKIA 2BMDA 1W0JA 4EFLA 2O8BB 1ZC3A 4QHYA 3K9LA 1GNQA 2VP5A 4PSKA 3R7WB 2ZJ2A 5CDFE 4WA7A 4QBIA 1OH6A 3NVAA 2P5TB 2ODWA 3ZZ0A 4C9BA 3KQHA 3MAAC 3CWQA 2AXPA 2Q3HA 1CR1A 1Q3HA 4GPTA 1AJEA 1NN1A 1ONBA 4NTZA 3T61A 2WV9A 4DIEA 4JL8A 1IN4A 2PH1A 4DZZA 5BXQC 1G18A 4M1YA 1S3SA 4P32A 4B35A 3BWDD 4D0GA 4TLAA 1OHHD 3EZ6A 3LW8A 1HT1E 3K9HA 1P72A 4PZYA 2ZJAA 4ZV4A 3LXRA 3REGA 2ZQ5A 3PUXA 4ZDKA 1LNZA 1SXJA 4Q1CA 1AK2A 1SULA 2OEPA 3I1FA 3IO5A 4E5UA 3LA6A 5L3SA 1XPRA 2O8DA 1VIAA 1T3HA 1H8EA 1SGWA 3PCRB 2FOLA 4EPYA 3B7GA 4D4JA 1OXUA 1E1QA 1Z83A 1JR3E 2PT5A 1R2QA 2ZJBA 1E9EA 4DKXA 1OXSC 3WNCA 5JWOA 1FPMA 5DHAA 4UJ3A 3TIFA 1CR2A 1DARA 1XX6A 4PSVA 1OSNA 3RS3A 1NKSA 1RIFA 3SC3A 1K5GA 1W44A 1EFTA 5CB6A 1ZCAA 2G1KA 3K1JA 3ZQJA 1DOAA 1RVDA 1P7CA 3SS8A 1SXJB 2IA5A 2DY1A 1TU4A 1FTNA 3TR0A 2NO9A 3KKQA 5E7JA 2FN4A 4LPSA 3RRNA 2AHOA 1P9RA 1EX6A 2L0XA 1KMQA 5EXSA 2HF8A 2NPIA 4JVLA 2KJQA 3AM1A 2IYRA 4QJ3A 4EJSA 2GCOB 2D3WA 3B1VA 3AVUA 2X2FA 4ZKEA 3THWA 4QG7A 2C04A 4Q1FA 3ZVRA 3SR0A 2XTNA 2Q3FA 3GLIB 2D2FA 2QG6A 1P9NA 2ZRBA 3SI7A 3GLIE 2TMKA 1RYFA 3GJ0A 5JHGB 4NCIA 3IIJA 4WXPA 4F91B 3B85A 2P6UA 4IEEA 4KHZA 2QBYA 1AGRA 1VMAA 1KMHB 3A37A 2WWGA 3KZ1E 4JBYA 2NOAA 3GJ6A 3I72A 4C4PA 1S1CA 2QMEA 2IYYA 2VH5R 1G4AE 3G82C 3S1AB 3T15A 4DRZA 5D3MB 4DUGD 2NO1A 2ZRDA 4XWAA 2W2TA 2ZRKA 4NYMR 1P62B 1QVAA 2XJ9A 2DYKA 1OJLA 3AP3A 3C41J 2VLIA 3NBYC 1XMJA 4HAYA 3UMFA 2WWYA 3A4NA 5IF9A 2QBYB 2FEOA 3IKJA 3R9IA 3ZZTA 2F1IA 3I4LA 1Z0FA 2GEVA 2YC2C 2GWHA 3DOFA 1XZPA 3NBZC 3ICEA 1CJKC 3F8TA 3JVUA 4TMWA 5EXPA 2AK3A 3GLFE 1GUAA 2AN9A 3N5CA 4XSGA 3MWYW 3SHFA 5JI2E 1C1YA 1OFUX 2BM1A 4RD2A 5TVKA 2BBOA 5TXGA 4OI4A 1M2OB 2CHQA 2A30A 2WPDD 4OBEA 5J5CA 4Q1DA 721PA 2IS2A 3W5JA 2JGNA 2HT6A 3NH6A 1LV7A 4YMVA 1JECA 1U9IA 1J90A 1F2TA 5LBIA 3TNFA 2IF0A 2VHCA 4HAXA 3CIOA 3UWKA 3V9PA 3PUZA 1T0HB 2QSZA 2RGAA 2Z0MA 1Z5ZA 2XEXA 4DLXA 1KNXA 4OQMA 2OHFA 3CB4A 3AVWA 2FMXA 4KLNA 1IM2A 1MR3F 3RDPA 4KVGA 4DWJA 4F4JA 3A58B 2QMUA 4OHVA 2BEKA 1EFRA 4WBSA 1U0JA 2YZ2A 1E2EA 2HXYA 1IBRA 1NKTA 2Q9CA 4DDUA 4UJ5A 2PLRA 1CP2A 3EARA 4U5XA 1FX0B 4Q9IA 3B8HA 3AQ4A 4Q9HA 2MMCA 3EIQA 1YE8A 5H70A 1MOZA 1W0JD 5AJWA 3LX8A 1IOZA 3R8FA 1BYIA 1YZUA 1WBBA 1ESMA 3TAUA 5AR1A 2JJ1A 4AKHA 3AF3A 2YNMA 3EASA 1IXSB 2PX0A 5E3HA 5KPJA 2OCYC 1VYUA 4L8GA 4LYFA 1CS4C 3IBYA 2O8EB 4QHSA 4BLPA 2DWOA 1ZCBA 1QRAA 2J0QA 3OIYA 2ZYWX 1F5NA 3NBXX 2IEZA 2Q6TA 2RGEA 1KY2A 3OIWA 2RMKA 2HJGA 2CLDX 3LV8A 4IDHA 4HAUA 1Z06A 4IDOA 4M9SA 5IRCD 1GKIA 5JBQA 3A8TA 2OT3B 1E2MA 2OE2A 3IPXA 3QXSA 2H18A 3PENA 3ZIAA 1P3JA 2ERYA 2RH5A 5AJXA 1VHTA 2ZJ8A 1LFDB 1SVOA 3FHCB 3LVRE 4NHOA 3VU9B 4D81A 1SXJD 1FNNA 2G83A 2REBA 2EFEB 4AI6A 3C4JA 3A1TA 5DYGA 4AG6A 4HSEA 1H8ED 2GBLC 2Q9BA 1TQ6A 4AIIA 2J0SA 1LW7A 1Q1EA 4US0R 1W36C 4A4DA 3U44A 4Q9LA 5JJIA 3QUSA 1E1QD 3OF5A 1T4GA 4PO1A 5LB4A 4OHYA 4XOIA 4PAOA 1KI3A 1Q57A 3NH9A 4LJYA 3W6PA 1D6JA 2QORA 2XZOA 1AN0A 4XH9B 4Z1MA 2WSSA 2CNWA 4LPKA 3H1TA 2W2XA 2JEOA 5EXXA 1GDDA 4MRPA 1Z29A 4KFSA 2GKSA 2W00A 4YMWA 4HEJA 1O87A 1KK0A 1G4UR 1TX4B 4QC2A 1GL7A 2NIPA 1JI0A 2IHYA 4LJ8A 5EE3A 3NXSA 1RRGA 1E79A 1KO1A 4HZUB 3K0FA 3X1ZA 3WMFA 2DPXA 4A0GA 5FTKA 1DAFA 1XU4A 2JIZA 3EPLA 2W6JA 5HE8A 1W5SA 1D9ZA 4POAA 1WBDA 4Z8YA 4LJ4A 2F7SA 1G64A 1XBTA 3K8YA 1XEWY 4JMPA 2WVJA 3QG1A 2ZRFA 1KI9A 1NN5A 4F93B 3PFIA 1GNRA 1XEFA 4I1UA 2VL7A 5GADl 1SKQA 5ANRB 2CVHA 1BO6A 3A4MA 2Q9AA 3D3QA 3SYNA 3RS5A 1CU1A 1VPLA 4EIWA 4OL0A 1G5TA 1HYQA 3LO5A 4UNQA 4C0JA 4RD1A 3RYTC 5DIFA 1VHLA 2MSCB 2DBYA 1SHKA 3SFZA 1HQYE 4Q5IA 4EFMA 4ESVA 1N6KA 1TF2A 4IDNA 1UEIA 3VR2A 2EQBA 2IYZA 1GRRA 521PA 1ZU4A 2E9SA 5KPDA 2I3BA 4G5QA 5JJLA 1NRJB 2QM7A 1PVOA 2QTHA 3WNBA 1MABB 1ZAKA 3PVSA 4LZZA 1FOEB 5BN4A 4Q4JB 2VSXA 4M0LA 5E7MA 4IVQA 2JLRA 2W6IA 1NL3A 4HAVA 2R9VA 3KQNA 3EZ9A 4A6PA 3CBQA 2PMDA 4P0TA 1LTQA 3KXLA 4XWKA 3AGPA 1Z28A 1KSGA 3O47A 2K5UA 5KYKA 3E5HA 1XTQA 1WE2A 2VIIA 3LNCA 4LHWA 2ZUCA 1D5CA 1EK0A 4B73A 2AD1A 2N42A 4NCJA 1CR0A 3P27A 1X8LA 1E6CA 2CE7A 2J1LA 4LY6A 3U60B 5TB5A 3EZFA 2ZPTX 5L3QB 1OB2A 4IXNA 1P61B 5KDOA 2IHBA 2P65A 2WJJA 2G3YA 3AVYA 1BKDR 3CNLA 3DOEA 3UG7A 2RGDA 4XIGS 2YWGA 2LKCA 3VR1A 4Z51A 4O2RA 2QGNA 1E2JA 3T12A 3CRRA 4LWZA 1EFRD 1OFIA 1CIPA 1KI6A 1A7JA 2AWOA 2FPMA 3JVVA 4B3GA 1FZQA 3SYLA 4BFYA 221PA 1LY1A 2GAAA 1EFHA 3FOZA 1UBFA 4M53A 4R2IA 2YOHA 4YMTA 5C46F 1B23P 1KSFX 4JZKA 2WKQA 2EFDB 3NC1C 3E70C 2FGKA 4G5GA 1YU9A 3HJNA 1GILA 5FI0B 1YQTA 4UKDA 5BYKA 2JJ1D 3CNOA 3HU3A 2C99A 4IJMA 1ZNYA 4BE7B 4Q1AA 1M1YE 2O8CB 2ASEA 2OFXA 1ZJ6A 2IW3A 1J8YF 4OKSA 3CKLA 2HF9A 4TMTA 4HLCA 2KI5A 5DO9A 1II8A 4K81B 5FTNA 4MGIR 2GHIA 4MYUA 3A1VA 1R5BA 1EXMA 1OF1A 4MGZR 2B8TA 2IBMA 5DSZA 4BRWA 2O0JA 4TQ9A 3ZIAD 1G3QA 3B82A 1KJWA 3D31A 5EZ5A 4D82A 2BMJA 1CKEA 4BECA 3EIEA 1UDWA 4ZDWA 2F43A 2Q0HA 3C5CA 4M9QA 2QAGC 3AVOA 4NL4H 3SOPA 4WVFA 4IOMA 2IF2A 1II8B 1Y3AA 3H4MA 1TPZA 2YOFA 1NG1A 1CJTC 4DHEA 2A7QA 1XD9A 4EAQA 2EVWX 1CXZA 3BS4A 4Q9KA 3H0KA 3LWNA 5G3ZA 4HLUA 4AYWA 2WSSD 4US1R 1Z0IA 2BJWA 4Z1MD 5EQTA 2NG1A 3QKTA 1Z0DA 4NZYA 1TQ2A 1HE1C 2ZREA 3TUJC 1CJVC 4MH0R 3TKLA 3AVVA 2CK3A 3C14C 4Q00A 1UBCA 1E2IA 2C98A 3VMFA 2JLXA 1AQYA 1XCMA 5J4KA 3NEJA 1SKYE 2VYFA 5JLJA 2QUZA 1F2UA 4IOJA 3GJXC 2QU8A 3QKSA 1TNDA 4PAQA 4NH0A 1XXHA 2DFKB 4URVR 2IS4A 3RWOA 1E4VA 3SBEA 1R7RA 4AD8A 4DSUA 3CX6A 2JIZD 4Q4AB 1E4YA 2FPKA 2W6JD 4URXR 2VF8A 4Q9JA 4QKQA 3SJBA 2I1VB 3RLFA 1XJQA 1G8GA 1UKYA 1GTVA 1E0JA 1ZW6A 2RAPA 3TLXA 2O8FB 1YRAA 3KDSE 4NBSA 4TYQA 1OKKA 3MWJA 1JXMA 2IYVA 4PFSA 4D4MA 1EWQA 2VHUA 2ZXUA 3SJAA 3MFYA 4M1SA 2ZJ5A 3RWMB 5UKDA 4F7WA 3NC0C 4N0DA 4RD4A 4A36A 4JT2A 4TQUS 3VR5A 4IDPA 4KVAA 1QHHA 3SDZA 1NLYA 4GMXA 3LLUA 1NIPA 1W36B 2RKOA 3AF2A 1LF5A 4Z54A 2Z6VA 4V0KA 4D25A 4TN1A 2RGXA 4ARZA 4TLEA 2GJ9A 1UKZA 2ZS9A 3WYFA 2AKYA 2DWPA 4UQOA 3EPJA 1OHHA 2UZ3A 4IEIA 3LX5A 4L4UA 3SNHA 1NBMA 4QNRA 1XEXA 1ZIOA 2J87A 2QN6A 4PHTA 4MRRA 4G5RA 2EFCB 4ZKDA 2J46A 3B78A 3U7FB 1HH4A 2CJWA 4B75A 1C4OA 4CVNA 3GEEA 2AWNA 1SQ5A 2OXCA 4DLUA 2FU5C 2ZRLA 1M8PA 2W6ID 2BKUA 2VTKA 4TSFA 1T5IA 1EG7A 3IHLA 3WHLA 3HPQA 5G40A 5F3WB 2J7KA 2DFLA 5DE3A 3B60A 3T1VA 1KGDA 2J41A 2OXRA 3W3AA 1OE0A 4A8JC 4KXFB 4V0ME 1WRBA 3U2QA 2WAXA 3EA5A 4XSHA 1N6LA 3BFKA 2RCNA 1QHXA 1LB1B 2WJIA 1VYVA 2NZ8A 2WHXA 3MSXA 4PHHA 2FFAA 4RSGA 4LSGA 3MMPA 3GEHA 4HYYA 3EW9A 3KX2A 4BZXA 1DAEA 1AM4D 3KUDA 2Y8EA 1K8RA 2IYQA 4Q1EA 4TTQA 3W34A 1ZMXA 4KFRA 4QGAA 1GM5A 2C9YA 4Q7JB 4OHXA 2FZLA 3D7MA 2W58A 5JI3E 1SVWA 1XD2A 2F55A 3PG5A 4TQAA 5F9FA 4RFSA 3R8CA 3PIRA 2EWWA 1XTSA 2RGNC 1XTKA 3U3JA 3T1TA 3UATA 1VG8A 2QP4A 5J4LA 2OBLA 3GLHE 3LW7A 4OQNA 5DI3B 4BZPA 1RYHA 4HDQB 5FOXA 3T35A 1XMSA 5KTYA 2OUKA 5FL3A 3A6PC 1KDTA 2J5XA 1DAHA 4DEXA 3RS4A 4CW7A 2QMOA 4EDHA 3GLGA 3UXMA 1KAOA 4NU0A 1UEJA 2AX4A 4B2IA 2GCNA 2IYTA 1XD2B 3B6EA 3FYHA 4F92B 4DJTA 2P5SA 2ZROA 2H1LA 2X19A 4C0BA 2GJ8A 2FF7A 4DCUA 1G17A 1P2UA 2N1BA 3ONWA 1G5RA 1KK2A 3WRYC 3TJZA 1UADA 1N6IA 3IIMA 4KI0A 2CMKA 4DCVA 4DEYA 1OH5A 1XP8A 5AWFC 3NWJA 1DEKA 2Z5FA 1RRPA 4JSTA 1KO8A 2D4HA 3M4YA 2HXSA 5FTMA 1F48A 4P4SA 1ZM2A 4RZ3A 3KTAA 4Q02A 2F9LA 1G19A 4JSYA 2WSMA 3FMOB 2WZQA 3IPYA 4A2QA 4MYCA 1KJZA 2QRNA 1W1WA 5FBLB 1KDPA 2BKEA 3FKSA 1ZC4A 2C95A 3OEHA 1X6VA 4B32A 2CCJA 4DVGA 4DC9A 1N6NA 2BBWA 2YJTD 4DLTA 1UKVY 3TRFA 3KQLA 3EZ2A 4HLQB 3UG6A 1FNMA 5FUYA 4MDFA 2WBLC 3K70D 1D2NA 1XPUA 4DLZA 3C5HA 4NP6A 1BOFA 3R7WA 5DGXA 4PC3A 6Q21A 3F5FA 2CK3D 5CDFA 2VP2A 1MRSA 1ZD9A 4ASUA 5IK2D 4BRUA 4L16A 1IQPA 2ZRHA 1G41A 2GA8A 3IILA 3QG5A 3GQBA 4QGHA 5DH9A 1NY5A 4JKYA 5JWRA 4HAWA 4BLRA 4JJZA 1EESA 1QDEA 5C1BA 4Q66C 1QBKC 1ANKA 4O3MA 1D9XA 2AK2A 2HCBA 5HCNA 1OKKD 3CF2A 2FDCA 2V9PA 4M8NE 1Z0KA 4NONA 2E1RA 2AXNA 4U00A 4TMKA 2Q3MA 3K0EA 1KSJA 2R2AA 4UNNA 3EC1A 2QAGB 1JR3A 1VG0B 3VFDA 2DCUA 3BB1A 5KSOA 3OIVA 3AB3A 3UK6A 5J4YA 4TMVA 1KOFA 3BD9A 5FOUA 1LS6A 1U99A 2D62A 1P75A 1CBUA 1U8ZA 3AF4A 1NBMD 2P6RA 4PSAA 3J81k 3TAHA 1DAGA 4YXWA 1LF0A 4HUTA 1R0ZA 4YMUA 1ZINA 3H84A 3EA0A 4B33A 1YZKA 3LFUA 3CW2A 4LBWA 3QPVA 1YZNA 5JWHA 1E96A 4TSFD 3DMDA 1G291 2B7BA 2GCOA 3ND9A 1UPTA 2NO6A 2FE4A 2V1XA 3QI2A 5CIQA 4GZMA 2P0EA 3H86A 4NYJQ 5BQ5A 4BEJA 4ITRC 3GLIA 2QQEA 3THYB 2AD5A 2FZ4A 3P1JA 3IHWA 5FFMA 3I32A 1Z47A 5TARA 3K09A 3ZVLA 4IVPA 5B2ZA 4MRSA 1KMHA 1FUKA 4PO9A 2GVZC 2QTFA 2XB2A 5C4MA 5HTKA 1G1MA 1NVWQ 4M9ZA 8OHMA 3PEWA 3TGPA 1H8HA 2NMVA 3S1AA 4Q03A 3U4QA 1Z6GA 4PC2A 2XITA 5D3MA 1ZD8A 1FP7A 5FTJA 2ODBA 4I1OA 3BB3A 5JFGA 3VHXA 1GL6A 1COWA 2SHKA 2GJAA 4G0NA 4KLZA 1FTSA 3WY9A 1Z6XA 2HCJB 4C2TA 4OI0A 3RSLA 3HPRA 4JLMA 4IFBA 4EFNA 1QF9A 4GSYA 3GJ8A 4URYR 4A9AA 1WXQA 3ZD7A 4FCTA 3GLFA 2ZI4A 1RE0A 4NKRA 1UJ2A 3G0HA 3VR3A 3U4QB 2EU8A 2ATXA 5G3YA 1ZU5A 4LUCA 1Z2CA 1X8KA 2OFOA 3SHWA 4LV8B 4OI2A 3I62A 1KIMA 3L8ZA 1N5KA 1FUUA 1TL7C 2R65A 2FX3A 1LVGA 2RB4A 2ZE8A 5HE9A 2FA9A 5J4HA 3W90A 1IONA 4RCZA 4A92A 4A8JB 3K0AB 1OFTA 1E0SA 4FMCF 4QFMA 1Q22A 5CIWA 1N2CE 4HI0E 3WP1B 3CUEF 1ZRHA 4QM6A 5DI9A 4DDVA 1KI4A 1QZXA 4EPWA 3GCGA 1KZGB 3GLFB 1NNEA 1O3YA 5FOVA 3HR8A 2ORWA 3CNNA 1E1RA 2GZDA 3KJEA 3ADBA 1YR6A 1Q20A 4OK5A 5L8VA 4XD7A 3CWZA 5K8TA 3K0CC 5DHFA 3NTUA 4Q7LA 2PEZA 1T8UA 2QEQA 2VSFA 4B74A 3FKSD 2D74A 5CK5A 1FX0A 3OEHD 3K9NA 2WTUA 4JYCA 3BIFA 2GXSA 1ODFA 2CXXA 4OQFA 1W2GA 5FUVA 3TE6A 3U61B 4A2PA 3KB2A 3B9QA 1X3SA 1QHNA 2GEUA 4C0LA 1G16A 4JL5A 1KI7A 1T3SA 4ASUD 4ESHA 1CRPA 3BH7A 4B34A 1P2SA 4UXHA 5FL7D 3LBNA 2O8EA 2BMFA 4JJKA 3LQQA 2GESA 3IO3A 3TR5A 1F3OA 1UBEA 1IN7A 2QY9A 1TQ4A 4LJ6A 5CYPA 4XVUA 1JQLB 5CJPA 1XMIA 1Z08A 3TMKA 1ZBDA 3TK1A 3GP8A 1DPFA 3OIUA 2G6BA 4IOKA 4DB4A 4M1KA 2OV2A 2W0MA 2XB4A 2F1JA 5CJ2A 2BIFA 4XVQA 2ZRJA 1ZUNB 3BE4A 3VU9A 4OYHA 4DBLC 3KKPA 3CH4B 1VKJA 4JS0A 3FWYA 4LHYA 4GZLA 1NY6A 3BFVA 5KSYA 3FTQA 1F6BA 4GOKA 4N0EA 3RABA 1GWNA 2C77A 2CLSA 1K6MA 3AKDA 3QNUA 3L0PA 1T3LA 3NDBB 4W5JA 4IVRA 4X8HA 5KO2A 1JR3D 3C7KA 2X1VA 4QOSA 5L3RA 2A78A 1W7AA 2BM0A 3LQRA 3OHMA 5JSZB 3QF7A 3Q3JB 2XNDA 4B3XA 1P6XA 3VNVA 1NVVQ 2JJ8A 2WWIA 1JPJA 1E9SA 4KO8A 3BJIC 1XRJA 2MMGA 1RW4A 2Q21A 1GRQA 2BDTA 2ZVQX 3A1WA 2P67A 2WIAA 4TL7A 4YXWD 4TYYA 1JAIA 4TTRA 1HQCA 2WJGA 2V6JA 4JT4A 1D8TA 4LGMA 4Y0VA 1NLFA 3I3SR 4OJKA 4KJZA 4L9SA 5HKKA 4S2EA 4Z8XA 4O25A 4ZO4A 1SVIA 3UWOA 3PV0A 4KBFA 4HZUA 1OT3A 2N46A 1T9HA 1XMVA 1MT0A 4IFEA 4AYXA 4X8LA 4FMBB 4JBXA 3B1WA 2PZGA 4CEHB 3IDQA 3DM9B 2FV8A 1EWRA 5EZ6B 3AVQA 1UBGA 4BGDA 1P9WA 4YC7A 3P4YA 4CEIB 2GF0A 5KOYA 3Q9LA 4TL9A 5E7IA 3PEYA 3KJGA 2ZI7A 3DL0A 2ZR9A 3LBHA 1H8HD 3M6AA 1TAGA 3LH5A 4C2UA 5HZHA 1W4CA 3KKMA 5FH9A 4C3ZA 4B71A 4BUJA 3B13B 4B2LA 4MYHA 1COWD 3QENA 3I8XA 3V4RA 1G5PA 2A5GA 4W5WA 4AKIA 1DS6A 3HYTA 2G9NA 1L4YA 1UF9A 2QTVB 2ZRPA 4OJQA 1KTVA 4FMCB 3WYGA 3WP0A 2ZUDA 3P4XA 2O0HA 4RCYA 4K46A 3AH8A 1WDTA 1MABA 3B9PA 1KK1A 1P2VA 5JCPA 3VAAA 4Q4JA 3I92A 2ZU0C 1KI1A 3FMIA 4LHXA 2J45A 4DSOA 4LI0A 1QG2A 2G0NA 5SZIA 1GRNA 2H57A 5AUPB 3T5DA 2J3EA 3DKVA 4R7ZA 4D80A 1YVDA 1IN5A 2PBRA 4KAXA 2C03A 5LDDC 4H1UA 5F9HA 4IXMA 5FBRB 3SYKA 3Q5DA 1BIFA 3W3ZB 2XXAA 3OFNA 3A4LA 3QPWA 2IL1A 1GG2A 421PA 4BPBA 2IWRA 5L3QA 1PLLA 3MUFA 3PUVA 4YDSA 2FWRA 2C8VA 2IWHA 2JATA 1ZM9A 5EE9A 1E2GA 2FJUA 4PPQA 4J0QA 3GFPA 4MRVA 2XTZA 1NJFA 5EJEA 1E1RD 1WP9A 4MITA 1KJYA 1XTRA 2VF7A 5C4GB 3PUYA 4DDTA 3C15C 1SHZA 3CPHA 2OLKA 1D2EA 2PCLA 2D06A 2YC4C 2GK6A 4XD7D 1DO0A 2V8OA 1X1SA 2QSYA 2RHDA 3BERA 4A6XA 3BK7A 2XXAB 3AEZA 1E9CA 1AS2A 3GJ3A 2QENA 3QEJA 2AL7A 2QAJA 4URWR 4CT4B 5B57C 1MV5A 1GVNB 4R98A 3BB4A 2GK7A 1G8HA 1KHTA 2JAQA 3CF6R 3HP1A 3WMEA 5K8IA 2R6AA 3W9YA 4ZDIA 1UM8A 3I5YA 5HR5A 2VHQA 4Q4LA 4ABYA 1I2MA 2JLUA 2JJ2D 5JCZA 5GJCA 4NCNA 5FBVB 2O8CA 4TLDA 3LXXA 1S1MA 3SJZA 2FEMA 3WMGA 1M7BA 2NO0A 4TYWA 2QRZA 3K0CA 3EIHA 3HYRA 1G7TA 1GL9B 4WIAA 3NHBA 5CB8A 4BLSA 1Y63A 1HY3A 1II0A 4M21A 2FSFA 4QJ4A 3NIBA 3EX7C 2ZRCA 1RKBA 1GKYA 1TU3A 3RRMA 2A5FA 4FWTA 3THOA 4GOXA 1NI3A 3MWKA 1IN8A 3QXCA 3THXA 2YWEA 4NYIQ 2VSOA 1RRFA 2GZHA 1ZUHA 4HB0A 5TMPA 1R8SA 1DAMA 4GL2A 3W8NA 1AS0A 4HUQA 2ECKA 3CPJB 4U02A 1AKEA 1AS3A 2O0KA 5HPYB 3U7EB 1RFLA 2XNDD 3ZZUA 3SZRA 2WMNB 4ZDJA 3E2IA 4NCHA 4RKFA 4Q1BA 4A0FA 4FINA 1Q44A 4OHWA 1S4QA 1CR4A 4JLDA 1GNPA 3GEIA 2ZJYA 3THXB 4AY2A 1Z6AA 3TQCA 1CEEA 1KZ7B 1VCNA 4GRAA
chains in the Genus database with same CATH superfamily
1VI5A 1T0PA 3WZMA 1UJ5A 1NU6A 1QXSA 2NTYC 1MAAA 2DVMA 1W19A 2OESA 2VJCA 3DDSA 3PJGA 5JSFA 1EAMA 2NXNA 3W8FA 3T7IA 2AZ4A 3EYAA 3PLAE 1VFNA 3BTSA 3H2BA 2SECE 3H9JA 3JATA 1QO7A 2F2TA 1RLMA 3C24A 2BM9A 1WXDA 3CPSA 2SBTA 3DGFC 3HDTA 3JWEA 4IDDA 2IU0A 3T3DA 1IY0A 2C9OA 2NYAA 2VP9A 5C5IA 3JZMA 4W5QA 3L4BC 4EQZA 1AZSC 4Q4AA 4EHNA 1TEZA 1KDRA 2YV3A 2C4NA 2PY6A 4YLGA 3N58A 2PUFA 4I1VA 1WHTB 4KQMA 3BPSA 5FV7A 2A0YA 3E27A 4B71A 3KKNA 5AH0A 4L4RA 1E9RA 2CFCA 4AK9A 2EARA 3IBTA 5H81A 4DF3A 5IK2A 4U3JB 4BXOA 2A7XA 1LNQA 4QUEA 5FEMA 3I9OA 5DYYA 4EKGA 3NJ4A 4FNMA 1SHTX 2VJDA 3MG9A 4JSRA 3ON5A 4KVFA 2BD0A 2JB9A 3E9YA 3HEBA 4PLFA 4RH3A 4RQTA 3TW4A 4EG4A 2ORIA 4P5EA 2R84A 5FDFA 3CLSD 2X2PA 1KOJA 3ABIA 3HJGA 3OKCA 4LMRA 4TMZA 4UAUA 4X3OA 1HF3A 3WMRA 1H5NA 2PQMA 5FPKA 3OQIB 3E2PA 5A05A 1SVKA 3A28A 3HCFA 5FPHA 2HPHA 3V1LA 1GUYA 4HZIA 1GRCA 5AQ1A 5D86A 3K0KA 1N2IA 3VR6A 3HN7A 1QPGA 2FSHA 1UJBA 2YYSA 3HNPA 3NHRA 2EKDA 2WZDA 1TYBE 4DCSA 5JBNA 4CLOB 4BVGA 5EMKA 2QZPA 1N1EA 2YZ7A 1JG6A 2QJTA 5B4VA 5LPNA 4JNKA 1DIOB 3HXKA 5C80A 3HN6A 3SFTA 4LK3A 4AULA 4C4ZA 1EM6A 1GKKA 2XAUA 2HREA 1A82A 1G8FA 2I1QA 5DM2A 2R8BA 2BFNA 3A4IA 1KDVA 2CBGA 3V2HA 3OZBA 4HDCA 4LEIA 4IICA 1OAAA 3I5XA 5L4LA 1QZUA 2V9ZA 3WQSB 3CUUA 3MC1A 3S8YA 3QEMA 3FNQA 3IP7A 2KB0A 3L7BA 5LP1A 5KTRA 1PJBA 4U1RA 2CHGA 1GT91 1X1RA 3V7WA 1E2KA 4PG5A 2AQIA 1UXGA 5D51S 1PV4A 2DETA 4OXQA 4AKTA 1RZRD 3INGA 1PFUA 1A4RA 1L9XA 1ZITA 1AB5A 2ZANA 2J6IA 2WJ4A 4X1IA 4DR5B 2Q5JA 3NMUF 3SQWA 1BDMA 4NYMQ 4ZN6A 2RJOA 1TOAA 2V3VA 3QIAA 4MV6A 1DRVA 1X8XA 1CDDA 1KEZA 1XRPA 1BW9B 3UYLA 1TFRA 4KJXA 4LYYA 2ASVA 3N2KB 5TV2A 3IUBA 2QRGA 1KEEA 1KSHA 3P97A 2B83A 4OO3A 4RADA 2XZLA 4O2AB 1PT7A 2B2CA 1GTJ1 3FCUB 3KHKA 3HCCA 2A0UA 4RORA 4IHJF 4UAGA 1MO3A 1P5FA 1PZFA 1RVV1 5EIAA 4B17A 4BKMA 1YA6A 4DMCA 5REQA 4UOEA 2R44A 4LWOA 1QC5B 1KYTA 3TCNA 5JD3A 2PUDA 3Q7PA 3KCQA 3QELB 3D0QA 1Q12A 4OYRA 5IM4A 1N0WA 1X2EA 4GO1A 4JUIA 5EXEA 4RPIA 1GAEO 1XDBA 1W46A 3F46A 5KYGA 2VO1A 2JI9A 4PAMA 3F1KA 1P2TA 2OV3A 3RJTA 3J80A 2ANCA 1ZRMA 2DHDA 3PFKA 3EFOB 3RUHA 3NHFA 4CMEA 1EGHA 4H1VA 2RC5A 3SVLA 1K86A 4WMLA 3RTDA 3WQRA 1P9LA 2VP6A 1ADFA 2HZBA 2R7NA 2ZSBA 4GMGA 5EYPB 1FDSA 3A31A 4QTYA 3TOSA 1OB5A 2VBGA 2WINI 3BIWA 3BSYA 3H2HA 1U3TA 2VXYA 4UAVA 4RLHA 1G8JA 2YHIB 1M7GA 3UK1A 4DWVA 2ZIAA 4OFZA 5CH3A 1JZSA 2IYUA 1IHYA 2E7ZA 3GLHB 1YASA 3L9WA 4P08A 1V7CA 2WYVA 3QA9A 4A7PA 3RVMA 1VIYA 2PKRA 3H9UA 3O8BA 3VC7A 2J0UA 4C4AA 3BXGA 4B82A 1JIVA 2VK2A 3A9VA 4MVJI 4CQLB 1HRKA 1RHMA 1PT6A 3WBJA 2Y93A 3GJRA 3MUOA 1N9ZA 2RDMA 3QSYA 4CN8A 3ID6C 1KYQA 1T6NA 4BWGA 1WW2A 2IPXA 3ASZA 4C0QC 1EP3B 2EEPA 2Q6IA 5DRTA 4B3IA 3HJRA 4Y2JA 5J63A 1NC3A 5F76A 1JEDA 2DHRA 3IPRA 4G81A 2PZFA 1P0FA 5ESXA 1C9MA 3UJDA 4BFZA 1UL1X 3H05A 1SMKA 2PMCA 4WLFA 5JMWA 1ZK1A 2F00A 2P6OA 3AL0C 2YH2A 4EJ6A 3ZGXA 5DHRA 2QYTA 2JG3A 1O94C 3G0OA 3DUFA 3GXOA 3AM4A 3LX4A 3AMVA 3C7CB 2WWFA 3KQMA 5EP4A 4PHFA 4PRLA 3DYVA 1M1NA 1NOJA 3QF4B 4D2IA 3GJQA 3L1IA 2Y68A 4BFXA 1IXRC 2ZAOA 1X8JA 1V9LA 4F9GA 1Z2OX 4IYRA 2Z8YA 3NAZA 1U9IC 2VDQB 1M0SA 4R69A 3IT3A 5I8PA 4A8TA 3JQ9A 1E98A 2PSEA 4RNCA 5FWYB 5F5LA 3L82B 4Q7KA 1CE8B 3L43A 1P45A 4PCLA 3QUQA 2EJVA 2R6ZA 4HN2A 1Y9ZA 1NWCA 1SEPA 3I2KA 4RVDA 3PWTA 2EATA 1YTUA 1RQGA 3QWHA 5BSRA 3LRXA 5CP8A 5AIBA 5IG2A 1ELOA 4TUYF 3CZ5A 2Q41A 3RYFA 1HLFA 2JFUA 4G4GA 4M36A 4BYMA 3EXEB 3EY9A 4LE1A 4WNCA 3RYIB 3I76A 4WCFC 5A9RA 3WQBA 1OREA 1I33A 1YQ9A 1ZH6A 4Q12A 2RHRA 2VBFA 1WDKA 2FZKA 5FL7A 5JDIA 1PNQA 1TK9A 3D0KA 4R5HA 1MGOA 1JHRA 1WF3A 1YDFA 2CCKA 3VOTA 4EK9A 1HE2A 3KEMA 1CUAA 1Z5OA 4AMUA 3FB4A 4HB3A 5HTOA 3HZZA 5EAIA 5TF0A 4B7ZA 2P3LA 3HA7A 2R47A 4N82A 3WL8A 1AHNA 3QE3A 4WWHA 5AVUA 1RZVA 4B46A 2NUAA 3L4BA 5T64A 4J0CA 2EFGA 2D5BA 1IZ9A 2GXAA 1A9QA 1R0WA 1KK3A 4G4JA 2ANBA 5IFKA 1JDVA 2OGSA 2ONKA 2W6OA 4DE5A 3ZHCA 3EGXB 5IW8A 4MYRA 4R1NA 1ETHA 4OBWA 3BTUA 3QKRB 1W4AA 4TS3A 1MD9A 1HOTA 2GILA 3ILHA 1LPBB 4MGYR 3SFVA 3SSNA 1W4RA 2FQWA 3UJCA 1GA6A 4D99A 3MWEB 5TDHA 1QVRA 1SU8A 5JZVA 1OXXK 3FROA 4DT1B 4OQXA 1W4ZA 1QCYA 1SOAA 1JQEA 1CS0A 1MDFA 4J9VA 1ECGA 4NH4A 3WLEA 2I6FA 2VPTA 4M1TA 1MPTA 1P2FA 1U94A 2FPSA 1YB1A 2H51A 1E63A 2X2EA 4OUKX 3OM1A 1VL8A 4OYYA 4BFTA 1VCHA 1DINA 4V0NA 3ZH9B 3THYA 2AG8A 4U2FA 2YYAA 3M6MD 2GLXA 1EVYA 3GDWA 2OBBA 2BRUC 4RL6A 3DLIA 5JNSA 4C5AA 5ER9A 1PR5A 3I2JA 1ZXLA 4K3UA 3GA5A 3EAQA 4NU5A 5AKGA 3FF1A 1U3CA 3IUSA 1U98A 1H2ZA 4CYMA 4FFDA 1PKEA 3OFVA 4JEMA 3GY0A 3Q9SA 3J7TA 3TX2A 2CV0A 3DCJA 1E2FA 4Q6WA 4A2WA 2L82A 2PSSA 1WAMA 3AEUA 3IQHX 3EVDA 3OECA 4LNHA 4W1RA 3VC2A 1ZR4A 4N0PA 3PHGA 2C3OA 5F1KA 2VJYA 1LPMA 3BWVA 3I5MA 3A36A 3Q6IA 1WBJB 4IFIA 4KWIA 3EMBA 5C2JB 3TZHA 3R7SA 2E87A 3L93A 1LRKA 3U5ZB 2JAWA 2OYCA 4E22A 5AUNB 1EINA 3FR8A 2KLHA 2NSJA 2CMDA 1KEPA 2PSJA 5T4BA 3ZX5A 2AOUA 4AO6A 1Q7TA 3NO4A 3IVXA 1AK9A 4HDMA 4M0DA 1OAOA 5HEKA 4AS2A 1JRLA 3D7LA 2ZRMA 3LHSA 2LR0A 4MMYB 5J40A 3WBKA 1UAAA 3CLKA 4OMFG 4YACA 2VEOA 4HL6A 1NV8A 1AKYA 1UQRA 3ZCVA 5CX1A 2P5UA 3TQFA 1ZESA 1OZGA 3QH4A 2Q29A 4HMPA 4YJHA 1MJNA 4F6CA 4BS9A 4WCFB 2D5CA 1ISHA 1X74A 4P84A 1NNLA 5J23A 3JSAA 4L9AA 5H82A 1NW3A 2GASA 1POXA 2I2WA 2WI8A 1CF2O 4GQAA 2PSHA 3K0AA 4C14A 1AKNA 1NXXA 2UUPA 2ZSUA 4KXWA 4P86A 5D5HA 5JAPA 4HYTA 4Y0NA 3VDMA 4PS1A 5L3SB 5LL6P 2O8DB 2GN2A 2B78A 1JAHA 1O77A 4WZAE 3W9UA 5HZGA 1MO4A 1WVIA 2EL9A 2ZSEA 2WV7A 1Y7TA 3HJAA 2QKYA 2ERXA 4LI3X 3RIYA 4WH0A 5FPTA 3T9EA 4B6JA 2I6TA 2IEYA 2QD4A 4JD5A 2HU8A 3ZQKA 4LOHA 2JIRA 1K8QA 3DC7A 5GJVC 2OXTA 1S9DA 4JA0A 3TCKA 5K20A 2HQ1A 4IVNA 2UVDA 3L8HA 2D1SA 5I5GA 2EYUA 5SZJA 2MYPA 1SCNE 2EJBA 2JIBA 3LHKA 4JC4A 4V2UA 1EP9A 4WCVA 2PUCA 3GLTA 1C3EA 4OIFA 3BL8A 1F38A 5DNVA 3C5VA 2HLHA 3JVIA 1T10A 3FFTA 3PXDA 4N76A 1PX2A 1DBRA 5CJJA 3Q3GE 4II7A 1G8SA 4JIGA 4EB6B 3CEPB 4DSZA 1R0XA 1N2CB 2WAAA 1LDMA 2G88A 4C0SA 1FQJA 1VI2A 3KYDB 2GEKA 3NASA 4QASA 2GJKA 1H9BA 5EPEA 4DLWA 3C2QA 5DGHA 3X1YA 2NSDA 4AAYA 4DBVO 4ZVVA 1N0UA 1BQ4A 1YDWA 1H2XA 2PBFA 1TAUA 1DQSA 4MDYA 2PZKA 1PUJA 3THWB 2HMWA 4A91A 3FOEC 2PVCA 2XD4A 5CU7A 4X20A 1E32A 4BO5A 1OBVA 1E61A 2PRIA 5D3QA 3T7AA 2WOOA 3WDLA 2GOYA 1S3IA 1QG0A 5PGMA 4C88A 4A15A 1FYFA 2H5EA 3DXZA 3CX8A 4G86A 4JOQA 4QHTA 4V03A 1QVZA 3PCXA 2W83A 1OI7A 1UUFA 1DX4A 1TDJA 1IEWA 4EY6A 1FRQA 1U65A 1Y6RA 2RHMA 2XXBA 5YASA 1RAGA 2BR5A 3KKOA 3FUTA 2O5VA 3LY9A 3SIRA 2C4MA 3AXTA 3OF2A 1WU8A 5K6TA 1M2EA 5B6IA 4ID9A 4XAQA 1O94A 1EB9A 4BRSA 2YQ4A 2DWCA 4DIDA 1DADA 2DLDA 2QD3A 4BGIA 1OLSB 2R6DA 3O2SB 1DRKA 1CW2B 3RUAA 2FXIA 2Q5QA 2ZE5A 1PZXA 3FPBA 3PPXA 3DDWA 4EPRA 1NQAO 2IIBA 2FRXA 4HDRA 4BV2A 4CM4A 5IPFA 3DKRA 4RD0A 2JKZA 5DHSA 3IB3A 2IX3A 4UW9A 1PFYA 4TV8F 1TF7A 5K3SA 3OU6A 3JQPA 3I52A 2W70A 1KP3A 3EVEA 3MWLA 2O7SA 1VJ0A 1QKJA 2FW1A 1ONSA 2ZIUB 1VG9B 1X7GA 5IT9A 2I7VA 2PWAA 2V7EA 4P3YA 5I4BA 4LZWA 3N87A 3ZWBA 3GJ4A 4KO3S 3G9TA 3NVDA 3LT4A 4UE3S 2FR0A 1BS1A 4Y2GA 1MGPA 1SRRA 2E3JA 2Z09A 3DR5A 1EFCA 3PFWO 4H3HB 4QAJA 4CU2A 4E08A 5CDTA 3K16A 3OJFA 5FA6A 1R8XA 2O19A 1PGNA 2CXPA 1I5RA 2D00A 2AOWA 2XH8A 4HBZA 5EXTA 5BN1A 2HLDA 3ESYA 2XWPA 1Z74A 1PWYE 1U3DA 3QNMA 3HEAA 4LQCA 1L8LA 4WKNA 1FFHA 2AW3A 3BC1A 4L28A 1T5SA 1TJNA 1WMEA 1UMCB 4HWPA 5TPZA 4E7OA 1HLPA 3FHTA 1YR2A 2GN4A 2HD4A 4MI1A 2TSYB 4UBLA 5H8WA 4EPVA 3ANLA 1MENA 2OG2A 3E9EA 3MMZA 4LXTA 2ODNA 4GVPA 2HOQA 1Z34A 2HWUA 3TINA 2FYTA 2GDJA 1Y6ZA 1ZYUA 2AOXA 4L75A 4GP7A 1JR6A 5KB3A 3HZOA 3RAEC 3HV2A 2DLCX 1L7BA 2PL5A 4ZCPA 2IX9A 1UM9B 3JQDA 1I2DA 2AOTA 2OCIA 3GMTA 4DWOA 1N36B 5DCWA 1E9AA 3KJHA 4CM9A 5JECA 4CEHA 5M2QA 4UUBA 1K27A 4YMGA 5ALYA 2E5WA 1N9KA 1V1RB 3VC3A 3OQMA 2HWKA 4MPJA 3Q98A 1B1AA 1Y7LA 3CRMA 4GXNA 3HGQA 5E4YA 4I8DA 4O4JF 5A2GA 4CMAA 5G0SA 1X86B 2NADA 1YRLA 1C0KA 1QANA 3PC7A 3LDFA 2J5KA 4JIMA 4Y2VA 3W5IA 4C1BA 3QW4B 1MO5A 1RWXA 2GUWA 1SUEA 3EXFA 2AJ8A 5EGNA 2NSLA 1VYTA 3UKOA 2YDYA 3VNBA 5DMXA 1OILA 1LNSA 1NN3A 3BT7A 3JD4A 3C3XA 5LLSA 3GN2A 3CEAA 2BRUA 1P6UA 5JPCA 1QV6A 4I0WB 2AF4C 2WF6A 1PFQA 1L1FA 4N41A 4QA9A 3DLCA 1RWQA 2FG5A 3EUFA 4CR6A 2XCSB 2OZPA 2GXUA 3TL6A 3DD5A 1KZ4A 3STHA 2G1UA 6LDHA 2OTCA 1UBMS 2YJ6A 4D5GA 3GZTB 4YUVA 3NWOA 1IDN1 1YH3A 3FHLA 4PV7A 2NVOA 3SAJA 1FY2A 4WLNA 2F9MA 3G7SA 3IDOA 1RDFA 2VK4A 4G1CA 4BMNA 4ZCMA 3BVPA 1W25A 1NVDA 1L8QA 1W0KA 2WKRA 3O4IA 5IKPA 1TQ8A 2PL9A 3P2OA 3ZU5A 2DQKA 4M0KA 2OOSA 3VPSA 2B34A 3PPVA 4K9MA 4KNWA 4DLYA 4TPKA 5A4KA 2ZK7A 4EYGA 3R23A 5C8DA 1G60A 3K05A 4RF4A 4RTRA 2R97A 2ZYHA 2Y71A 3BMNA 4C7VA 2W42A 1JHPA 1Y48E 4B9AA 2BBSA 4EG6A 2A9QA 3LDAA 4MV4A 4QDZA 1GDHA 2GJSA 2JDIA 2QP9X 4DJAA 3ENZA 4IUCS 2PZEA 5LMNB 2RK6A 3AETA 5F98A 4RIFA 3UOGA 4PHGA 4A26A 2B99A 2AKAB 2FFHA 4EI2A 2H1FA 4MW1A 3Q8XB 1P5JA 1U3WA 4UARA 4RPCA 2QY6A 3F67A 1B14A 3HXMA 1X1BA 3RIEA 5ETJA 4BYGA 1X15A 1X7ZA 4ZA2A 3WNQA 4CI0B 4AJHA 1NR1A 1R9NA 1M6EX 1C1DB 1DHRA 4HG2A 3DO5A 1TUGA 3ZYZA 4FMDF 1AA9A 2UYOA 3N7AA 2ADOA 2O7VA 4OQLA 4A0HA 4PZZA 4EZEA 2AZTA 1OTHA 1ID1A 1XU7A 2CFRA 3R24A 1W52X 2J8ZA 5CVDA 3KQVA 4BKQA 2YRXA 2W93A 1EE2A 1RCTE 2GB4A 3ZDRA 4I66A 2EJUA 4UDXX 4UNRA 3F7MA 1Y8QA 3FVRA 1QHSA 2O4UX 4IIJA 4BEBA 2FTKE 1MG5A 3A1UA 1HEUA 1RKUA 4IF4A 1RAHA 1MPXA 1ACLA 3O84A 4G0OA 1ZK0A 1E2LA 4OHBA 5LYJA 3V7NA 5AVQA 3P5BA 3AEQA 4P4TA 5ALFA 1A8UA 1GFIA 3EQZA 3ML1A 1Z4PX 4GQBA 3LD9A 3QHQA 1C8BA 1XKXA 2X3YA 4NYJR 4I3FA 3PQCA 3UH1A 3NR2A 2QUHA 1EX7A 1LBQA 3OFKA 1YJ8A 1BD3A 1JALA 2H1RA 2M6SA 4HXEB 4KIGA 3QK7A 4PZLA 4RW0A 4KQFA 5DTJA 3MTAA 1JHYA 3FPHA 3OJLA 1VRWA 4MUXA 5AKYA 1YULA 1Y9DA 2QGFA 3K31A 3VTKA 4F5ZA 2OV8A 4TLLB 3SEQA 1GPBA 2IZZA 2YWFA 4UASA 3AKEA 4LNUA 1LPOA 4UM5A 5I4CA 1VXOA 5AJVB 3U3OA 4HDSB 3LCVB 4DV7B 5KU1A 2WSBA 4DUPA 5BSTA 1CEXA 2BTQA 5IKMA 5JADA 1MKYA 4N65A 1XWIA 4BVAA 5KEIA 4Y2XA 5LXTF 4JWTA 1UJMA 1WZUA 2MHCA 1RJDA 1WO8A 2PMKA 3EZ7A 3L2OB 1XMXA 3GPIA 4FDTA 1QWOA 4A6EA 5JVDA 5KYNA 1E1LA 1DBWA 3AHEA 2OFFA 5BN4B 1Z5VA 2YZGA 5CD9A 1NUAA 1XB2A 1P1JA 3CE6A 4GSKA 4HB2A 2ZU6A 4MWTA 2BTOA 1YTLA 2X8JA 4HH1A 4E07A 4KWCA 5LNK6 1RQLA 1SIUA 1A69A 3NZEA 4JDUA 5J2UA 2H2GA 5TQJA 2CHUA 2JLYA 1Y3IA 1PQUA 4EUKA 1N6OA 4H4DA 4WECA 3ZK8A 1VG1A 2H1WA 1V39A 5EWMB 4AZ0B 1XF1A 3D7SA 2JIMA 4JI7B 3CM0A 3ZIDA 3ZKWA 4EGQA 4JQZA 2FRVA 2MYNA 4ZGBA 3KKEA 1K2WA 4RKYA 2RBKA 4D4HA 2PO7A 1HFEL 5ALDA 3DMFA 4FMPA 1CNMA 2ZG6A 4LZJA 4QX6A 4K8OA 3LKZA 3UO8B 1WOYA 3CN9A 1WHTA 3PZRA 3ZBQA 1PK7A 2RJNA 5A5EA 2ZUVA 1SQ6A 4J7AA 2QA5A 4OGLA 1L5ZA 4ZPJA 5SZKB 5EMHA 3ROQA 2E0IA 3FZYA 4ZO8A 4UM7A 1R4AA 4MHOA 2FFQA 3MERA 4U3JA 1XJ5A 1XRSB 4C0HA 4FKMA 1B4DA 1D04A 4HAZA 4YJGA 4DR6B 1UBUS 2NV0A 2XBMA 2WFAA 3ZY3A 5F4ZA 2PKXA 1AO0A 2R6CA 1H9AA 1GJRA 4HNAB 4G67A 2Q0QA 4RJIA 4BNMA 4ZHQF 5LR6A 1ACMA 1OPXA 2R8RA 2GZSA 3BRQA 4MQBA 1K7SN 5THXA 1QFXA 1AQJA 3E9RA 1JW9B 4IF6A 4PSDA 4UNSA 1PVVA 3Q6NA 3QVVA 3TLGA 1OZAA 3FVQA 3Q3HA 3A2LA 3FFXA 1DPGA 3PT5A 4C7XA 1GZ3A 3L6BA 2YIMA 4L07A 1QF7A 2O2SA 2X76A 5TY0A 2TMDA 1CERA 4OHRA 1RC8A 4X3CA 3BRWA 4F06A 1BMFD 4M4SA 1XCPA 1NMEA 2CDNA 2D54A 1I5OA 2P77A 3TRJA 3OEEA 1INLA 2PMBA 3U3MA 3T5MA 2RI6A 3WLOA 1R6UA 2WB2A 1L7EA 1FP6A 1A0OA 4MX8A 3G2OA 8LDHA 2JL1A 2YY5A 1ZD2P 4PNZA 3VSBA 3H99A 4CDNA 2KSQA 3RFFA 3S44A 4E12A 1U8YA 1ZP6A 4GI2A 5BVGB 5KTOA 3ECSA 3BFXA 2IYSA 1E2DA 3IEKA 1GSHA 1ORRA 4RYDA 4JBHA 2PPLA 2I4IA 5A04A 3CIFA 4S2UA 1SBYA 3HN2A 4YNBA 3OJ0A 1A72A 1SZPA 4PINA 4G1UC 4ZGWA 4K1LA 3ZYCA 3GAMA 3GP5A 5IVKA 1N34B 1CP3A 3O4GA 3AILA 2RC6A 1J4AA 4D4LA 2K7FA 4NEHB 1AGPA 4UNIA 3W2IA 3BHNA 1BW9A 2IYOA 2O3UA 2COUA 3TZCA 3E1KA 1XZQA 3WMWA 4A82A 1E7RA 1MEOA 1NPDA 1TEXA 4GF5A 5JAUA 3L7KA 4LBYA 1LDEA 2I4TA 4O2AA 2PU7A 9GPBA 1BKSB 1P31A 1MRNA 1B0ZA 4ZZ3A 2P2CA 3E53A 3R3JA 1KRXA 4OLHA 1RZ3A 1AY0A 2AUMA 4Y9SA 3TSZA 1QC5A 4CUKA 4N49A 2EYQA 5KC9A 3QELA 1F2UB 4JLBA 5F51A 3T9DA 3PPWA 2WVGA 3E8XA 1OXMA 2PCJA 1ZIDA 2XJ4A 1N1DA 2P5YA 3W1WA 2QRVB 3OI7A 1EJ6A 4X1KB 5AHWA 5ICEA 3NDPA 1LK5A 1DELA 1LTKA 2HF2A 4OB8A 5CITA 2P7IA 1JJAA 3DD1A 1WLYA 1L5LA 3RC2A 3EFOA 8GPBA 5LQMA 1VL2A 1BWRA 1ZMOA 2FMHA 2YY6A 2QYSA 3DE6X 3K09C 5KWEA 1E1MA 5IMBA 5AOBA 3FFBA 2C78A 3D4NA 3DOOA 3E82A 5EYPA 2VSQA 2I8LA 3S8MA 3VPGA 2IS1A 5AM0A 1CUEA 3INRA 2A58A 3WLRA 1Q7CA 4FHGA 1DKNA 4RLSA 1XHLA 2K2QB 2GO1A 3KS9A 2YHIA 4MB0A 4RMNA 1PHRA 1G7RA 1ULAA 5DP1A 4IKEA 3HUEA 3RFCA 2KBEA 2ATVA 3SG0A 2UXBB 3PNBA 1PD0A 3GLHA 3DLHA 3FWPA 2F1HA 1BAPA 1EWTA 1KBQA 3ACBA 4QBFA 5LWHA 1OYWA 2GH1A 2QL6A 3L0OA 2VDVE 1RXSA 3WYAA 1CQPA 3KYBA 1RJ9A 3LLMA 1F2DA 4G8DA 10MHA 3D8BA 2X9NA 3DBRB 3ORFA 5KJEA 5B58T 4FEGA 3U26A 2HHJA 4PAWA 3C6QA 3T99A 4U7JA 1QIMA 2PZBA 2XVYA 3ANSA 3M2TA 1FLAA 2QW1A 3W1VA 1ZVQA 2BCGY 1GU1A 1XEXB 3ED5A 4MIOA 1D2GA 4A8PA 4CLDA 4G36A 4DMRA 4KIJA 4YS6A 3ZTTA 2VP0A 4NPHA 2Y1OA 1FLNA 5JAMA 1U3FA 1PFGA 4K9RA 3AM3A 2D1YA 2XY4A 1UZMA 2GD2A 3GFOA 2ZE6A 4MVJG 4RVCA 5AW9A 4O2BF 3MTGA 4PQFA 4ZQHA 5KVVA 1P7YA 1U8XX 1VKRA 2HWYA 3LGXA 3W8RA 1HZZA 3GZNB 3QF4A 1HEIA 1DFIA 1ZISA 5DNYB 2M6KA 1U6IA 3QOYA 2VBCA 3KQOA 4MUFA 5HKBA 4GIBA 5EI5A 2XOKD 3ZHRA 1AXGA 3QPUA 3OJWA 2H48A 2HGZA 3NONA 3T3IA 1VE7A 3WSVA 1WR8A 4BMPB 3MGKA 3OQ6A 4N54A 2RHLA 3M6FA 4NDZA 5HNKA 3M3HA 2JGMA 4OA5A 1O96B 3VHQA 5T7BA 2KWIA 4YUWA 5FWYA 1JVSA 5MGNA 1CE8A 4I4LA 4OHZA 1PCXA 4QG3A 1PZNA 2G71A 3FKQA 3GO4A 3H13A 3ZY5A 3IMKA 3I8SA 3QXJA 5DGCA 2WWVD 4AO8A 5IT5A 5DBFA 3EWSA 4ZYVA 2IH4A 4EMSA 1RWNA 3LAWA 4KODA 2H0QA 3R5SA 4KFTA 3SX0A 4ERNA 3EXEA 2C1XA 5T67A 3RYIA 3U3KA 5A9TA 3NT5A 1EGAA 5CTJA 3LZ6A 2RAVA 4JLKA 2JRLA 3FCYA 4OGFA 3AONB 4QYIA 5DB4A 5F1OA 5MGBA 4CIVA 1T8RA 1JA1A 2WJ6A 3GRFA 5ITWA 2O0MA 2YYZA 3A06A 2Q8QA 2MJLA 3DEFA 4GOMD 3AY0A 1PV1A 1Y9EA 2GN9A 4XJXA 1K75A 4YPFA 2N1MA 4EX7A 4F4CA 2YKGA 3VUEA 3HM2A 1SELA 1UK8A 1YA4A 4B7XA 4EFKA 5A3JA 3K4PA 3NHYA 3C6XA 4R71A 1N2EA 3NT2A 4QOIA 5EZSA 4UTOA 3M0EA 4WNAB 1U3VA 3EGXA 1XZ8A 1W6RA 4FTWA 1FYEA 1RQNA 2BH2A 1VJDA 3QKRA 2X1LA 1N6RA 3ZE0B 4MUGA 1H2WA 1G4HA 3ESZA 3G5UA 3PKIA 4NCKA 3MWEA 4OQDA 4YCLA 2WPDA 4JT8A 2XWSA 3IQFA 5B58C 1IUOA 1HEYA 1VKHA 1Z22A 4HFJA 4ZOAA 4EEXA 1TD9A 5JCXA 4BBPA 5BO5A 1HE5A 3CA8A 1YJXA 2AFIB 3IOYA 4PPGA 4E2FA 4U2CA 5IJAA 1K98A 2R5NA 4UOZA 3VX4A 2YS7A 2O8BA 4LQDA 3QJYA 3DE2X 5DHPA 4B3BA 5B7QA 1VCIA 2KW5A 4IWYA 3F4KA 4TS1A 2YVAA 4FNOA 4O1HA 3WIBA 2V7VA 2NLOA 1GKUB 2MYUA 4GE0A 3PDJA 2YBEA 4UU7A 4XCQA 4DMHA 4TZTA 2ZWVA 5BN3A 3PRJA 5JXHA 4I50B 1T3TA 2IS6A 1Z2AA 4YP7A 4JT9A 4QRIA 1STOA 2ARKA 2YQZA 4X6LA 5LZ7A 4XB6B 3JTEA 1FLVA 4L9WA 4F2GA 4F3CA 1T5OA 1J99A 3FWKA 4RJLA 1XCBA 4JBWA 2OCAA 1TMYA 5JCOA 2AW5A 2PVSA 1K63A 2J32A 4KH0A 3D8NA 3EBLA 1BHQ1 1U4SA 1V3VA 1GGNA 2A86A 4JKIA 5FWDA 2I67A 1XZMA 4W63A 3ZWQA 2FN7A 4TSRA 1UOEA 2P9BA 2Q0XA 2X4IA 1ZC3A 1LDGA 3FWNA 2HPAA 4P3PA 5LSAA 5ICSA 1M5TA 4JXJA 3W5HA 3U0VA 5CDFE 3KSAC 5HG0A 1VE3A 1AHHA 1IEXA 4XX0B 3MTIA 3EVGA 4L73A 1T6YA 3NVAA 2NWQA 1HZJA 5KHLB 4C9BA 1QHFA 3IMGA 1A97A 3MAAC 2B4KA 1GTL1 1Z8DA 4GPTA 4MDHA 4HMQA 5DMHA 1NN1A 2EQ5A 3HHEA 3T61A 5AVZA 2WV9A 4G1VA 5BXQC 2PH1A 2BFAA 3GF4A 5AJHA 1JTFA 3WJAA 4M1YA 4B35A 3HYSA 4DG5A 4ZC1A 3D8SA 2C5SA 3LW8A 1DAOA 2ECOA 3BJMA 1ZH8A 1SCQA 3E5MA 4N8SA 1O4WA 2IZ1A 2QG4A 1T2CA 4PZYA 1RM5A 2HHCA 2ZJAA 2GK3A 3T0IA 3SKXA 5EJ9A 5KVSA 1JVNA 3FRJA 1TRHA 1TZKA 2WB4A 2ZQ5A 4G8JA 3I05A 5U1PA 3UCEA 3MOSA 3ND7A 4Q1CA 5L3SA 3IIIA 4MOWA 5BR4A 3AB7A 2AEFA 1U8EA 2EKPA 2GPYA 4NMHA 1T3HA 1H8EA 1V5GA 4OJNA 2FOLA 4GKAA 5EPOA 3VH1A 4EPYA 1A2QA 2W22A 2DFVA 3IE0A 4O4LB 2C7GA 4RPGA 5B1DA 2BFEB 2X5XA 3STXA 2CDRA 2PT5A 1VPWA 1R2QA 3CLUD 2C2ZA 4W99A 1U8CB 3K9CA 3D3WB 1K3FA 4J0DA 4UEKA 1QB7A 5DHAA 4E1VA 4FE4A 1DARA 4KP7A 5SY9A 1LD3A 3COSA 3SHWA 3UJHA 4DQUA 2BM8A 4XGKA 1YR1A 1ZCAA 1SY7A 2VJKA 4J75A 2XV1A 3K1JA 1FP1D 3PJFA 1HNWB 2Z98A 1DOAA 2VZ8A 3GJSA 3V48A 3IMFA 2DY1A 1TU4A 1N2CA 3DWGA 3KYDA 4UHEA 1L4LA 2AHOA 4F6LA 1SK8A 5EXSA 1C9DB 2HF8A 2IUEA 4YDRA 4EH1A 1BJRE 4E5MA 5AW6A 1CNFA 2I1LA 5JSUA 4QODA 2D3WA 3AVUA 1SD2A 1D0IA 2X2FA 3HJCA 4ZKEA 5BWLA 3THWA 2C04A 4Q1FA 3A9TA 3ACDA 3DGEC 3N0WA 4EGSA 3CH6A 3DDOA 4J0HA 3GLIB 1N9GB 2QG6A 1P9NA 2ZRBA 1KR2A 2XVMA 4ZU6X 1F0KA 1HDGO 2EZUA 3GJ0A 2I1WA 3GARA 4NCIA 4RIEA 2IZ5A 3UMCA 3LHDA 4B5LA 4BEVA 4F91B 3B85A 3DTTA 3ET4A 5GGYA 4KHZA 4R1QA 1FMTA 1M0EA 1L7RA 2JD2A 3KETA 4DCJA 5BP7A 1TA9A 4CJXA 3HYNA 1S1CA 1WUKS 3C1TA 1PSZA 4MARA 3A10A 3NTOA 1Y1QA 1J6UA 2XZTA 3DP9A 2TS1A 5IEBA 5HRAA 3S1AB 1OLSA 1VLHA 3O3MB 5JC1A 1CDEA 4AZVA 1L4FA 2I99A 1ICIA 1KTIA 1ZH4A 5I3CA 1P62B 1QVAA 3A4YA 4HTFB 4FOSA 5DIZA 4R8LA 3C41J 2VLIA 1J0BA 3L8EA 1E6UA 4RTKA 4TYMA 4C2AA 5A3QA 4X94A 4QDOA 2O3TA 2QBYB 2FEOA 2YJGA 2HJ9A 3IKJA 3KR0A 1CRLA 4R8KA 3URMA 1PGJA 2YS6A 3D2AA 5KNDH 1NAIA 3DFZA 3KOWA 1WZCA 2C2OA 3IDZA 1AUOA 1OY1A 3SQOA 4EG3A 2GWHA 2OC9A 3DOFA 2O2IA 3SF8A 3TXYA 4YUZA 1CJKC 5LOVF 3NJRA 4E2YA 3F8TA 3ROEA 4CN9A 3EQ7A 4XSGA 1M6VB 1XSEA 3VGJA 3SHFA 4BMVA 3NOQA 1OFUX 7MDHA 4XPIB 3U49A 2V4UA 2B25A 1UP4A 3DZHA 1ST2A 4I5GA 3CFYA 3T3EA 1UCFA 1UIMA 3W7AA 721PA 3MOGA 1DIBA 1R3DA 1BVRA 1JV2B 4TQGA 1JECA 3E18A 3PICA 4G0QA 3TLZA 3TNFA 4CETA 4JWKA 4HAXA 5TS2A 3VPFA 5JNRA 1C3JA 1OTYA 4I19A 2OGWA 3CG4A 4H6XA 1UM9A 3J81A 3LOUA 3U7RA 3FJ1A 4PZPA 2QVXX 3CB4A 5K0NA 1Y7HA 4CKEB 4D1YA 1X1CA 3DFMA 4BV9A 3PF8A 2FLKA 1PNVA 4F4JA 2O1WA 4L85A 3F6CA 3E7WA 4FBMA 2W2KA 2R6HA 2D2XA 1KBZA 1U0JA 5KINB 4GYJA 3E2MA 3R4CA 2HIGA 4G8BA 1JEJA 3E9DA 2HQSA 3R0XA 4Q9IA 3B8HA 1AZLA 2Z8YM 3HXTA 2XMRA 3PNSA 3HVUA 2DPMA 1MOZA 3S8EA 3EZXA 3JRXA 1Z38A 4GPEA 5AJWA 4C2BA 2UV8A 3G2JA 3LUCA 2XDAA 3W2FA 5DHTA 3DF7A 1ESMA 2E48A 1G5QA 2HFKA 3IXLA 5KPJA 3OX4A 1VYUA 1X0VA 3LY7A 4FR2A 1F8UA 3NOOA 3TB6A 5C1DA 4XGQA 4MV5A 3GUYA 4QHSA 3COJA 1ZCBA 4YV1A 1XZNA 3OIYA 5KTMA 2J0QA 2ZYWX 3DKIA 2Q6TA 1EKXA 3HCAA 1FK8A 3OIWA 4Q3CA 3FDJA 1EVZA 5EKXA 3TZKA 4E0BA 1OVMA 1OA1A 3LV8A 4JLSA 5FF9A 2QWXA 4M9SA 1Z06A 2C07A 3CJRA 3KTOA 3U7JA 5LMZA 2OT3B 2OE2A 2X6TA 3BMQA 4GPIB 2H18A 2WF9A 2RH5A 5IEJA 4RO0A 4TTPA 4ZJZA 4LSWA 4DV6B 5FLEX 1HSZA 3FHCB 1SVOA 2PGLA 4HMOA 3DZFA 1Y8RB 4R4JA 4TSKA 3ZE9A 3CW8X 3SKVA 4JJFA 3A1TA 4TZKA 3VU3A 1RHJA 4HSEA 4AG6A 1KJ8A 3NWPA 3UC9A 2GBLC 4M7OA 3SLGA 5JXWA 3D3KA