1XEXA

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
PYIEKLELKGFKSYGNKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
molecule keywords SMC protein
total genus 45
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexA00
1OHHD 4M1OA 2GNOA 3LXRA 4A6XA 4D4LA 4JLJA 1DO2A 3PG5A 1GL6A 5GJVC 2FGJA 1CLUA 5E95A 2WWWA 4KFUA 4MQBA 4KO8A 4Q21A 4M9XA 1KY2A 1RE0A 5EZ5A 1SHKA 4WXRA 3AKYA 3DKVA 3THXA 1TAGA 1E2PA 2HDNB 1IY0A 1MO3A 3J81k 2PT5A 1IN7A 3AGQA 2PX0A 1IBRA 4DC9A 1ZM2A 1JALA 2ERYA 1WBBA 3AVYA 2FE4A 3CRVA 4AY2A 4IDOA 3SBEA 5EXSA 2GCPA 1PLJA 4P0TA 4XVRA 2QTVB 4F91B 2D3WA 4IFEA 5C4MA 1RW4A 4WAUA 4CEIA 421PA 1PUJA 3T1OA 3D8BA 4HAXA 4TLEA 1G41A 1NLFA 2AR7A 2ZPTX 2KE5A 5E7IA 3FMOB 4GMDA 1X8JA 3TR0A 3CPHA 4X8OA 3TR5A 4YMTA 2Q9AA 5A4JA 4XSGA 3CW2A 4LC0A 4Z51A 2ZR0A 1ZM4A 2IUTA 1UEIA 2DBYA 1EFHA 1DVRA 1GRNA 1M7BA 1Z6TA 5FFMA 3LW7A 1ZJ6A 4MYCA 4TSFD 2IYQA 1QBKC 4M0LA 1Z2AA 2XXAB 1OXTA 4TQUS 3PQCA 3RANA 4BWYA 4MUAA 3U2QA 1JAHA 3LO5A 2K5UA 4EKDA 2AL7A 4M1WA 4M9ZA 2JLRA 2NO9A 3AVOA 1L4UA 3MFYA 4OHWA 4WXPA 4Q1CA 1NJGA 2HLDD 2F9LA 2N46A 2EFEB 2V8OA 2ZI6A 3KJHA 1UAAA 3WHLA 2CCKA 2QE7D 3MMPA 2P65A 3H2YA 4F92B 1VIAA 3KXLA 1JR3E 2J87A 4ZDJA 4BQSA 4JLPA 4HZUB 1GNQA 3QOFA 1XPRA 4ON9A 1EFCA 1JJVA 3CKLA 4JKYA 5BN4A 2GDJA 3SQXA 3X1YA 2Q6TA 4NHOA 3GLGA 2QMHA 1H8HA 1ZUIA 4ZO4A 2FMXA 1UPTA 3E1SA 1N3BA 3VKGA 2FZ4A 1HA3A 2ZRHA 4LYAA 3KQHA 1KI9A 5G40A 2RGCA 2OM2A 2JJ8A 2XJ4A 4JVNA 1UDXA 2IHYA 2WMOB 3QPWA 2G3YA 3DVLA 5JCZA 1EWQA 1E3MA 3RS7A 1W44A 5G3ZA 3PUWA 1YR6A 2AXNA 1E2EA 2NQ2C 3DM9B 3I4LA 4HB4A 4BZXA 2OXCA 2ZUCA 1G1MA 2XNDA 3D3QA 1UKVY 4M22A 4PAQA 1P7CA 2YYZA 3VX3A 1BH2A 2JLZA 1WMSA 4KFSA 4A0GA 2IS4A 2A3RA 3SYKA 3CRW1 4HB3A 3FDIA 3A37A 5DSZA 4I1VA 4NH0A 1TEXA 5FI0B 4DJTA 2RB4A 2J41A 2X19A 4NYMR 1W46A 2O0HA 4I4LA 5LD2C 4CEHA 4D82A 2GXQA 3I61A 3BJIC 4TWZA 3C8UA 2UKDA 5TXGA 4B44A 1BS1A 5A0FA 3KKQA 4IDQA 4CEJA 5JWOA 2W00A 1BO6A 3GLIB 1W36B 3AF4A 3K9LA 2PZFA 3HYRA 3KKPA 4GZMA 3CWQA 1E2KA 3DOFA 2ZJOA 3B1YA 3TSZA 1NIJA 1AQUA 2NPIA 2OFWA 2XB4A 5AJZA 3GJ7A 3Q3JB 2GZDA 2IXFA 3Q8XB 4GP6A 2ZRMA 2D7CA 1M8PA 1Q0UA 3QKSA 3EX7C 3GJ6A 2IW3A 2JA1A 2RGNC 3U3KA 4C4PA 1A4RA 5BW8A 2CMKA 3U7GA 1G3UA 1PLLA 3QIAA 3B9QA 5FBWB 4QNMA 1HE8B 4M9SA 5IK2A 4V0MA 2XTNA 1NP6A 2WVJA 1FX0B 4DDVA 3MG9A 2JDID 5JHGB 2PEZA 1MR3F 4PC6A 4IVQA 2C9CA 3RRYA 1CIPA 1WCV1 3RLFA 4TYYA 1IXSB 3K0AB 5AJYA 4BRUA 2OE2A 3I72A 2CEAA 1GP2A 2P3SA 1E2NA 2P6NA 1IN8A 1Z8FA 3B85A 4PHHA 4EPVA 4RD3A 2J0SA 1CEEA 1EFTA 4FCVA 4PC2A 4MDEA 2YNMA 4FCWA 2HJVA 4Q7KA 4B43A 2C96A 1ZNZA 3CF0A 3CLVA 3VR3A 1ZYUA 3HU3A 3H86A 1W0JD 3KKNA 3WYGA 1FTSA 4M53A 1MRNA 3JVUA 1U8ZA 5E4FA 5KPDA 1UF9A 1M74A 3FYHA 4LHZA 3TBKA 3K0CC 2QM8A 2EW1A 1SXJC 1X86B 1BOFA 1GRQA 1OLOA 4JJKA 2C95A 5DN6D 4KBGA 1XP8A 1B23P 1II9A 4B6FA 5JI2E 2ZU6A 1KO7A 5JBQA 2Z0MA 1DE0A 4Q4AA 5AWFC 5DHFA 2IYRA 1FFHA 2QGNA 3LA6A 1N6RA 2ONKA 1G291 4D26A 4Q9KA 1KO4A 1Z06A 3QKUA 1YZNA 1NKSA 3A1VA 1ZD9A 3B13B 4EUNA 2QU8A 4BFZA 1SKQA 5KSOA 2O52A 1SVWA 3OZXA 3QKRA 3DMDA 1KDPA 4Q03A 2CE7A 2VHTA 4LBZA 3NVAA 2JJ2D 1R10A 4KVGA 4B34A 2EWVA 2QP9X 5AJXA 2IF2A 2IYZA 1LB1B 5CITA 3UKDA 1CJVC 2J0VA 4DT1B 2FN4A 2RHDA 1SZPA 3WNDA 1JI0A 2Z6VA 3KFVA 1DAGA 4NYJQ 4PPNA 4XVUA 3EPLA 4TZ6A 5AJWA 5FOWA 4OKSA 5F98A 3THXB 3I92A 2F7SA 1O3YA 5C46F 3C41J 3QENA 1FPMA 4KXFB 1Q44A 4XWOA 3P32A 3THWB 1ZNWA 1D2EA 2PLFA 2QN6A 4TSFA 4NPHA 4H1VA 2VP6A 4DUGA 4D4KA 4UNNA 4DB4A 1XEXA 3BBPA 1U2RA 1H8EA 1QHHA 3PEVA 2R6GA 5KTYA 1XTSA 4JLBA 3ZS9A 4Z8YA 1W36D 4V0NA 5EUQB 2BOVA 2F1HA 3S1AA 2QUZA 3SN6A 2ZS8A 2HLDA 2JAQA 3FB4A 5DH9A 5C1BA 2AK3A 3UMFA 2QBYA 2WV9A 3NHAA 4KJZA 4HDCA 1VDZA 2ODEA 2A9KA 4GNKA 1E2LA 1M1YE 1CJMA 1TNDA 1XJ0A 1ZUNB 2WM9B 5TY0A 4KI0A 4RZ2A 5EE0A 1D9XA 3VX4A 1XXHE 4PZZA 3I73A 1Z08A 1EFRD 3MWLA 1FUKA 3KJIA 4OQLA 3FMPB 1F3OA 1IN4A 2AWOA 3MWJA 3PR1A 1R0ZA 4MITA 1FP6A 2AFHE 3W6NA 3CUEF 1CR4A 3EAQA 3NXSA 1IJFA 2ZI9A 1YQTA 2ZM5A 2KSQA 3C15C 5HZKA 2JATA 1RKBA 4UNPA 1H8HD 3T35A 1KK0A 3REGA 2ZRBA 4RCZA 4DSTA 4DLYA 1KSJA 2IT1A 5EUMA 1EK0A 2Q9BA 4PTLA 4AK9A 4NMMA 5IT5A 4MA4A 3BC1A 1IM2A 3P4YA 3FFAA 4OJQA 4D0LB 3QQ5A 3C14C 3NC0C 4ZPXA 1U0HC 1U94A 1W4BA 1WDTA 1LF0A 2L0XA 4DEYA 1GNPA 4Q4HB 2ZSDA 3FWYA 2X8AA 4OL0A 1YU9A 4AKEA 1T0HB 3LBHA 1E9AA 3Q5DA 1G3RA 1SVSA 2OAQ1 4A8JB 4XH9B 4O25A 4P4UA 3T12A 2A5JA 5G53C 4CT4B 1WRBA 1YVDA 2OCBA 3OIVA 1KSGA 2XSZD 3REFA 4A6PA 2QORA 2PT7A 1W2GA 4NCHA 3PEYA 3Q72A 2JJ1D 1NSFA 1UBCA 1Z3IX 2JEOA 5B30A 4XD7A 5JEDA 4YONB 2ZJYA 5J4HA 1NN3A 1P6XA 2QEQA 2XOKA 3A4MA 3OEHD 3IUYA 5JEEA 4TYPA 2NTYC 1GITA 3AF3A 2AHOA 2J9RA 3KZ1E 3PXGA 2H18A 4MH0R 3C5CA 4W9MC 4CW7A 4DLRA 4IXMA 4G3XA 5A5GA 3VAAA 1FZQA 1KTVA 5SZHB 4E07A 4EJSB 1TUEA 2JDIA 3RS3A 3SJBA 1PUIA 2YC2C 3VHLB 1ZIPA 2PJZA 4PPFA 2DR3A 1XTJA 3FMIA 4LBWA 6Q21A 3HR7A 3TLXA 1BIFA 2J3EA 5D3MB 4GOKA 4W5WA 4B3XA 5JRZA 1E2IA 1FQKA 1N0VC 1OJLA 2GBLC 2GHIA 2QSYA 4AWXA 2DHRA 4GZLA 1AIPA 2WJVA 3B1VA 3CH5A 1JJ7A 1N6KA 2RAPA 1E99A 2A30A 2ZE8A 4ZDIA 5JWRA 3CX6A 1PV4A 3U5ZB 2ERXA 5D3MA 3GJ8A 4HUQA 1W4CA 2F1RA 2X2EA 4QBHA 1U99A 1S8FA 2OCYC 1T9HA 4B47A 1A5TA 5DGXA 4LPSA 3VR1A 3GP8A 2FPLA 2O0KA 1GIAA 1E79A 4JLKA 3F5FA 3L0SA 1Q3HA 3U3MA 2ECKA 3ZLJA 3EZFA 1MABB 3QKTA 2VLIA 2FF7A 1P61B 1WA5A 1Z07A 5LD2B 3VR4A 3HPRA 3PFIA 3KJEA 3ZD6A 3EIQA 3GLFA 1P62B 4NL4H 2W2XA 1FMLA 3FE2A 1O87A 2P5SA 1XRJA 3K0EA 4WA7A 4B6EA 3ZD7A 3R9XA 2AXPA 1TTTA 2CXXA 2YOGA 3B1XA 3MSXA 1Z29A 4ZIRA 1T91A 3WMEA 1ZD1A 4UXIA 2PCLA 5L3RA 3TJZA 5J4LA 2JLUA 2IWRA 1E0SA 5DI3A 1U0LA 1OSNA 1KI1A 2H7VA 4QBFA 3VNVA 2QMUA 1Z6GA 1RYHA 3TSWA 3SFZA 3LWNA 4I1UA 2V4ZA 4HYYA 5LDDC 1JQLB 1W0KA 4LCBA 4LY6A 3ZH9B 5IHPA 2V9PA 4HAUA 4O3MA 2O8CB 4LOAA 4XWKA 1D2MA 5KHOC 2C77A 2JLWA 1HH4A 2UZ3A 2O8DA 4M21A 2FSFA 4RJLA 3HDTA 2GZHA 3K0FB 3BRWD 4FINA 3IPXA 2GA8A 2ZRPA 3GJ0A 1NG9A 5JECA 1S96A 3KKOA 2E87A 3O8RA 2PJRA 2G0NA 1DAHA 3W3AA 4HZUA 5CYPA 5EP4A 2OG2A 4B3GA 2O8BB 2O8EA 1G64A 1G7CA 3QF4A 3CZQA 4A92A 2ZJAA 3T34A 3BH7A 5J40A 4B71A 621PA 3VU9B 4RKEA 1G8GA 2QTHA 2YINC 3KKMA 1KDRA 2J5XA 1GILA 5H1YA 4EPYA 1U81A 2C9OA 4XJXA 5HR5A 4D80A 3AF0A 3D7MA 1X8KA 4C0KA 4UNSA 1FUUA 4FD2A 1J70A 2FGKA 3UATA 4BEBA 5GADl 2FG5A 5EP3A 4TMZA 2ZS7A 4IHQA 3SBDA 2MSEB 3KB1A 1Q1EA 4JYBA 4N0DA 4EQ6B 1JQJC 1I4LD 4EPRA 5KO2A 3UWOA 1XX6A 1NNEA 1CR0A 2ZRLA 2QPOA 3H1TA 2ZYWX 1SVIA 2O8EB 2G88A 1W0KD 5EZ6B 2ZUBA 4KVAA 1OE0A 4Q1FA 4NCJA 4RCYA 821PA 5C18A 1ZD8A 4OK3A 5EQTA 5BN3A 2ZRCA 4OI4A 3JZAA 1XF9A 2C78A 3W6PA 4GP7A 3PITA 4KSBA 1S0UA 2BEKA 2W0SA 4TMWA 5SZJA 2IXGA 4J0QA 1T6NA 4X8HA 4C0HA 3UWKA 4RFVA 3UK6A 2BMEA 3U3JA 5CIQA 5KSZA 4LC1A 1CXZA 4Q5IA 3KQNA 1KI8A 1RJ9A 3D6TB 1GZSA 3WRXC 5KOYA 3T1TA 3PIRA 3PV0A 3I62A 2RCNA 1W5SA 1D9ZA 3C16C 3LFUA 1R2QA 4JLMA 3FVQA 4FMDF 3RVBA 3CH4B 5AUPB 2D4HA 3QBVA 2OUKA 1TUIA 4QOSA 2MSCB 5DYIA 1UKYA 3TVTA 1JNYA 2ZRFA 1VIYA 2KBFA 2FEOA 4TL7A 1UDWA 3C7KA 1ZNYA 2QMOA 5KNBA 3ADCA 1DAIA 1OFUX 2GRJA 2JJ1A 1JXOA 3MJHA 3NBZC 1XTRA 1CULC 5DI3B 3CF6R 3V4RA 2VA8A 1N6OA 1J99A 2C03A 3OAAA 1M6NA 3IQXA 1NMYA 2H8KA 4BFUA 3CRRA 5ELXA 4JSTA 4DDWA 4DIDA 4W5HA 2RGXA 2ZRJA 2JLXA 1OXSC 2GEUA 4BFVA 1RRGA 3K8YA 4AYWA 3FKSD 3K09A 2OLKA 3PVSA 1IAQA 2G83A 4U5XA 4ZDWA 4YLGA 5DO9A 4EFMA 4DHEA 3PJRA 3JVVA 1AKYA 3W8RA 4CIDA 3NIBA 1NLZA 1IY2A 2WIAA 1U98A 3K0AA 3IKJA 1GM5A 4HDQB 1J2JA 2WJHA 1LFDB 1QVRA 1KZ7B 3ONWA 3OHMA 4B73A 3HPQA 4LYFA 1U9IC 2ZSFA 5FBRB 5HKKA 4BEJA 2W83A 3THOA 2AX4A 3O8BA 1GL7A 3QPUA 4L4UA 3ADBA 3H4MA 1NBMD 2JCSA 2CJWA 3K0SA 3K70C 4OBEA 4UXHA 3QG1A 1ZNXA 4L9SA 4TYQA 3UG6A 1AN0A 4TYNA 2E1RA 1XEWY 4OK6A 1XD9A 2CJWB 4CDGA 2PH1A 3ZIAA 1A7JA 1A1VA 1JPNA 1KI7A 1D2NA 4PZLA 3DZDA 5F2EA 4P32A 5CK4A 4BZQA 4LHYA 2P6RA 4RD1A 1R5NA 3ZDQA 4AURA 4PSAA 2A2ZA 4YMWA 1V43A 2BKUA 2OCAA 2ZVPX 3IDQA 5FI1B 1XWIA 1N25A 2CL6X 1P3JA 3KB2A 4ITRC 4QKQA 1CJTC 2V7QA 5KPJA 4GL2A 2D74A 2ZJBA 2FJUA 4MRRA 4MKGA 1QHXA 4WBSA 1OH7A 2O5VA 4P31A 4BFTA 2FOLA 4EDHA 2Q0HA 2N42A 4A2QA 2ASEA 4LK2A 4G0NA 3OFNA 3AP2A 4U02A 3NKVA 3TRFA 4DLXA 2MMCA 5GJBA 1NMZA 2BWJA 5BYKA 3QSYA 3SC3A 2WAYA 3OESA 1OB2A 3R20A 4Q4JA 4F4CA 1VG8A 4OHVA 3DDCA 1G7TA 3AP3A 1COWD 4QJ3A 3AKDA 5B58C 2J0UA 2ONJA 3TUIC 3NG1A 1YZUA 4HB2A 2DWPA 5CM8B 2VP0A 1SKYB 2IC5A 2VHJA 4CYMA 2OBLA 2ATVA 2GJKA 3N70A 2PX3A 4EFNA 2P2LA 1Q57A 4NONA 2YZ2A 1XPUA 3Q85A 2KJQA 3AH8A 1G4AE 1K6MA 1Y63A 4R9UC 3T06B 2GWHA 2BEJA 1NVVQ 1XDBA 2HV8A 3VHXA 1YHNA 2B7CA 3BK7A 1OKKA 1SGWA 1DO0A 3BFXA 4MUBA 3V4FA 1GNRA 4QXAA 4AYXA 1P4SA 4M1KA 4QFMA 2EWWA 1NVVR 4B2IA 1GKYA 2ZU0C 1MO5A 4LHXA 1X8LA 2VHCA 2YHSA 4LI0A 2IL1A 1M7HA 4DDUA 1AQYA 1AK2A 4Q4LA 1E9CA 1G3MA 721PA 1WXQA 2W2VA 2NO7A 4ACAA 1D8TA 3HU1A 2YKGA 4NCKA 4PXAA 2R6DA 3R7WB 4F38A 2Z5FA 1TU4A 4DZZA 3GJXC 2J7PA 5L3QA 1SXJD 1G19A 5B64A 1FTNA 5DN6A 5AUQA 4S35A 2HCBA 2WOJA 2VEDA 5K8TA 4O2LA 5DIFA 2N1BA 1VCOA 3PENA 4CVNA 4MRSA 2GKSA 2WJYA 1VCNA 3W3ZB 1QHIA 3TIFA 3OEHA 1XJQA 5SZKB 3T5DA 4XWAA 2V3CC 4HAWA 1FP7A 3DZ8A 2QT1A 1FNMA 3S1AB 5GJWC 1E4VA 4RD4A 1FNNA 4KFTA 5FOTA 5JCPA 3EWAA 3UPUA 1J8YF 1WF3A 4DIEA 3NEJA 1QHHB 3WMGA 1ESMA 1G21E 4RD2A 3SEAA 4WZBE 5DE3A 1N5JA 1TX4B 1ONBA 2NO6A 3LXXA 3PUVA 3TE6A 2ZRAA 2JJ2A 4MYHA 1R0XA 2CDNA 2DFLA 2IA5A 2PZEA 3W90A 3KDSE 3GLGE 1W49A 2DFTA 4YDHB 4D81A 2BBTA 4AG5A 1CTQA 1BMFA 1ZC3A 1ZC4A 3W34A 4ASUA 4UXJA 1WQ1R 4DLTA 3P20A 1GG2A 1YZLA 4QHSA 4JT2A 2EFGA 5CLQA 3L8ZA 3SJAA 4TLDA 2ZSEA 1LS6A 4G5QA 4JBYA 1MO6A 2XZLA 4FMCB 1UBGA 3G5UA 3CONA 1VG9B 2KBEA 3BH0A 3RRMA 1UFQA 3TW8B 4DLVA 4Q66C 4PHFA 1JBKA 1PVOA 2QRZA 4ZI2A 5J4VA 1NSTA 4JJZA 3QY0A 5KDOA 1YZTA 3U3OA 3W6OA 2R8RA 1EXMA 1E1QA 1IONA 3T61A 4BECA 4KLZA 2WTUA 1F48A 1VTKA 1E2MA 1NI3A 3A1TA 2BCJQ 3KUCA 2D06A 3JZMA 4Q4AB 3CBQA 4NYMQ 4ARZA 5J4YA 3GQBA 4OYHA 1Z2CA 3VR6A 2WSSD 1E2GA 3X1WA 3BFKA 1DG3A 2QRNA 1TF7A 2OFOA 2ZI4A 2ZRDA 4Q7LA 3T1VA 3RC8A 4TMVA 2ATXA 5JS7A 2GF0A 3SHWA 2LKDA 1MABA 2UZIR 1IJEA 3KXKA 1KMHA 4K46A 1G5RA 4OJKA 3BOSA 3SJCA 4MGYR 4BRWA 4DSOA 4LV5B 3B7GA 4Q1BA 2Z4RA 3A8TA 1W47A 4C0JA 1OPXA 2O8BA 1X1SA 1T8TA 1KYIA 1CP2A 4TT3D 3K53A 3T15A 4D0NA 1G8HA 1GTVA 2A5FA 3IHWA 4QBGB 2V1UA 3ZIAD 1G8YA 2ZS9A 3UG7A 1G20E 1G7SA 4LJ4A 4D4MA 5EE5B 5GJCA 5JJKA 4UKDA 1HQCA 3RYTC 4MDFA 5CM9C 3AVPA 1F60A 3ZJYA 1EX7A 1OYWA 3AVVA 1NN0A 2O8CA 4ZCLA 4KHZA 1XD2A 4HAZA 3NH9A 4JBWA 4TMKA 3TAUA 1SKYE 3QNUA 2QQ0A 4DSNA 4IRUB 3K09C 4LYHA 3EC1A 3AVUA 4HEJA 2CHGA 1RC8A 1U90A 1A2BA 4B33A 3L8YA 1DOAA 2YWFA 3IIKA 4D25A 1V5WA 1KJWA 5LB4A 3WNCA 4H9GA 3I5XA 1AM4D 4OK5A 1EESA 3GJ4A 4PC7A 3U6KA 3FOZA 3L0OA 4QGAA 2J0UB 1E9RA 4ESVA 4LYJA 2ZAMA 5GVRA 2ZE6A 1N6HA 4P4TA 2BM0A 3K70D 1E2HA 4DLUA 1MT0A 5DYGA 2IYLD 3DEFA 1NVUQ 3NDBB 3LH5A 2VH5R 1JEEA 1N6PA 2CNWD 1P60A 1DS6A 4G1UC 3P4XA 5C4GB 2IYTA 2GEDA 1WP9A 4BE7B 3VKWA 4B3DA 2H5EA 1F2UA 3NDPA 4M2LA 2QAJA 3B82A 5TDHA 4K8OA 3SZRA 3I3SR 4PPGA 2IYXA 1L8QA 4DCVA 3I5YA 1XPOA 2W6IA 1KNQA 4OHZA 1XTIA 4KITB 2EYUA 1FMJA 3PEWA 1CBUA 1S3GA 1ZM3A 2BMFA 2ZRGA 1T3SA 2CHQA 2WWXA 1X3SA 3MUFA 1Z47A 1DPFA 1OV4A 3DM5A 1Z6AA 1ZUHA 2REOA 2F3RA 3RC3A 2VL7A 3QE0A 4FN5A 2Z83A 3GJ5A 2FEMA 2OO7A 1T0JB 2IX3A 1P72A 3AEZA 1Z0FA 1FQJA 1UM8A 4BGDA 1H65A 3L43A 1KMQA 1Z0AA 5FTMA 5KU1A 2X1VA 1L4YA 4XSHA 3M0EA 4JYCA 4NCNA 4AKGA 1BKDR 1OXVA 1GFIA 2XNSA 1FOEB 3M1IA 2BJVA 1TQ4A 2JLQA 4YMVA 1XB2A 3LBIA 5JJIA 3IPYA 3FKQA 5KSPA 3MJRA 2VPPA 4WVFA 1WB9A 4GT1A 4QJ4A 4KYUA 3OF5A 2Q3HA 3ZVLA 4I99A 1G9XA 4DBLC 3NBYC 4CRWB 4GI7A 4UNRA 4TL6A 3KQLA 2GAAA 4DDTA 1SVLA 3A58B 4RZXA 5K8UA 3CF2A 3CNOA 8OHMA 2WWGA 3UXMA 3ZVNA 2WKRA 1I4TD 1N0UA 1E9FA 4MYTA 5CJPA 1IN5A 5FOVA 4CGZA 4A8JC 2SHKA 1TU3A 2JLYA 4U7DA 2XB2A 3ADDA 3L0IB 1YRAA 4JSYA 1ZCBA 3O47A 2IUUA 1YKSA 4OI0A 3N2IA 4BLOA 4BFXA 5TB5A 5FOSA 4NCIA 2FPKA 2W58A 1W7AA 4PC3A 2B92A 3BD9A 3U44B 2GJ9A 1G17A 2BKEA 1A82A 3N2EA 4JZKA 4Q19A 3KFXA 5B57C 1F2TB 1TF5A 4L16A 3WBJA 1A2KC 3ZGXA 2RGGA 3IIJA 2NPFA 1J8MF 2WKQA 4YDSA 4BFWA 3WY9A 2V1XA 3NTUA 3KJGA 2FSHA 1P75A 3X1XA 2YOFA 2QP3A 4RY2A 2VF7A 3PEUA 4GOJA 1KI6B 5JS8A 2RGDA 5HE8A 2GJ8A 1XCPA 2XEXA 1R5OA 1P2VA 2ZSBA 3LBNA 4TLCA 1IY1A 1K5GA 5FOUA 4BLRA 5F9FA 5H68A 1EWRA 4JMPA 4M1SA 5D3QA 2ZRNA 3CPJB 3LLMA 4QC2A 2HF9A 2GXUA 2WHXA 1XEXB 4XOIA 4QNRA 3TAHA 4EPWA 4IFBA 2KB0A 4LJAA 2ANBA 1DAEA 4C0AC 4AIIA 4FCTA 1ZRHA 2CLCX 4TTRA 2AN9A 4B2LA 3DKPA 5BYJA 4PHGA 1GL9B 2DFNA 4JLOA 1VECA 1VPLA 3QG5A 5L3SB 1GDDA 2BM1A 3VNUA 4US2R 5CJ2A 2R44A 1IXZA 2QPTA 3HJNA 1HY3A 4LJ5A 2J46A 1OXUA 4B75A 2V6IA 2X2FA 3B9PA 4IOLA 2VQSA 1NN1A 2PL3A 1Z6YA 3CM0A 3M6AA 4JVSB 1FW6A 3Q7PA 3SI7A 2IYWA 4TQ9A 4W5JA 4DLSA 1GSIA 1VG1A 4V0ME 4BLPA 1VYVA 2CVFA 2VRWA 3TH5A 2G6BA 1CU1A 1G8FA 3L2OB 3LW8A 1F2UB 5CYOA 2FWRA 1UKZA 3KL4A 2CL7X 1XMJA 2OAP1 3K9HA 3MWKA 3F0TA 4HZIA 2QAGA 4RZUA 2F9MA 2C2HA 3RWOA 3UANA 1JR6A 3WYFA 3Q7QA 4B3BA 3I1FA 1OIXA 1NY5A 4QGFA 3K0FA 4URYR 4I1OA 4MKFA 1B0UA 1Q12A 4NBSA 5AK0A 4B3FX 3GMTA 4URVR 1CF4A 1S4QA 5DHAA 1Z0DA 4O0MA 3SHFA 1OFHA 3OAAD 1NJFA 2I4IA 1MV5A 3CIOA 4Y0VA 4AKHA 1E32A 3ND9A 3I32A 4LBVA 1ZU4A 3TVDA 1P2SA 4HLDA 4YQFA 2XGJA 3VFDA 1KDTA 3FKSA 4GBMA 4II7A 1E1RA 4IXNA 5LPNA 4URWR 5AJVB 4Q02A 4DUGD 2ZJ8A 4Q01A 1Z0KA 4NZYA 1OIVA 4LGMA 2BIFA 1D5CA 4IOJA 1D6JA 4XIGS 3TK1A 3DPUA 4ZCIA 4ZIRB 5JSZB 2D2EA 2A5DA 4DKXA 3SQWA 3GJ3A 2ZJZA 2GXSA 1U8YA 4G5RA 4D0GA 4M1MA 4HATA 2NIPA 2WMNB 3A4NA 5IDVA 1XXHA 1XZPA 1GKIA 1NBMA 4URZR 2DYKA 3L0PA 4LJ8A 4V03A 2GEVA 2XJ9A 2RGNA 1RPZA 1KDOA 4Q9JA 3V9PA 4QHTA 4PC1A 1M34E 1JEDA 5M04A 2GILA 3GCGA 5JHHB 2HEIA 4QBIA 1AGPA 1F5NA 1ZMXA 1J90A 3GFPA 2Q9CA 3A6PC 4TQAA 2NGRA 1K5DA 2ORIA 4M1YA 3RDPA 5HCNA 1E94E 2H92A 4HLUC 5E7MA 2BDTA 2HYDA 1T5LA 4LX0A 1YJ5A 2BJWA 3DHWC 1KK3A 2PMKA 4RFSA 3CNNA 3U7FB 4MRVA 1JECA 4A4DA 2JLVA 2NZ8A 4KBFA 3AP1A 3U61B 1E1QD 4Z8XA 3QEJA 2NO0A 1G5PA 2J45A 1GRRA 1JXMA 2V7QD 5JWHA 2GJAA 2IYYA 3T1QA 3DMNA 1T5IA 1E0KA 2GAOA 3NC1C 1VCIA 4V02A 5CB6A 5F3WB 2LCFA 2ZTSA 1Z83A 2OZEA 2ZIAA 4CEJB 2F43B 4FMDB 1E1RD 2CK3D 4N3NA 2ODNA 3U3RA 5FPYA 3TQFA 4EFLA 3AKCA 3CO5A 3KUDA 2JGNA 1XMSA 2QE7A 2IF0A 2XZPA 1T8UA 2H1LA 5K8LA 3LY5A 3BB3A 4C0SA 1COWA 3P27A 1NMXA 4F4JA 4A36A 4Q4HA 1XNJA 4Y0AA 2J7KA 3ZQ6A 3AVTA 4JBXA 2JASA 4ARZB 3AUYA 1ZAKA 2D62A 1Q1BA 2P6UA 2XTMA 3TSOA 1JR3A 3LD9A 3ETLA 2CE2X 4Q1DA 5L8VA 2OESA 4TZ0A 4L15A 4GDFA 5C2JB 4LDJA 2QT0A 2XOKD 3E5HA 1VYUA 4C7OB 1RRPA 1K8RA 1E4YA 2Z43A 2VBCA 3WYAA 3IEUA 4Z1MD 2B7BA 4NP6A 4HUTA 1P73A 2QZ4A 4PO9A 1G6HA 3K0CA 4UJ5A 4US1R 3RHFA 3U44A 5JI3E 4KAXA 3KXIA 5KDLA 5CDFA 1GOTA 1W36C 3MRSA 1VG0B 2FDCA 4QM6A 1N6NA 1HV8A 3QVUA 3FPAA 4ZCMA 2I1VB 1OF1A 1KJZA 3PCRB 1RJ9B 3LQRA 1FL9A 3OIUA 3D31A 2QNRA 4UJ3A 4LZZA 3ZYCA 5J47A 3BERA 4YXWA 1SULA 3BB4A 3WNBA 2DB3A 1U8AA 4KU4A 4X8MA 3VTKA 3KQUA 4A2PA 1UJ2A 4AKIA 1SXJA 4LPKA 1KO5A 1Q20A 4NYIQ 3WMFA 3IQWA 2QBYB 3TQCA 3PUYA 4ZV4A 5EE3A 5J4KA 3IEVA 3RS0A 2I1QA 2QL6A 4KYIB 2J1LA 1M2OB 2CK3A 1S2MA 1KY3A 2ZRKA 1Q3TA 1TMKA 1ZBDA 1G4UR 2QI9C 2Q21A 1DADA 1IHUA 1YR7A 1LF5A 3R7WA 2ZJ2A 4LJ7A 3E70C 3GLHA 2ANCA 2BBWA 2RMKA 2R6FA 4X8LA 2AK2A 2NOAA 4GPTA 2C9YA 1G8PA 1XD8A 2CNWA 4TYWA 2BVNA 3O8DA 1Q1ZA 1E2JA 3QXJA 5FL3A 1SQ5A 1HQYE 2TMKA 5FBVB 4AI6A 2DCUA 3RSOA 4BUJA 5L3QB 3R8FA 2IUSA 4LV8B 5IRCD 1SVMA 3X1DA 1BMFD 3EPKA 4LHWA 1US8B 221PA 2HXSA 3RS5A 3K1JA 2B8WA 3BAFA 1RIFA 3IBYA 4TMXA 2HYIC 1NVXQ 4HLQB 2ZJ5A 1R8QA 1L2TA 5KNCA 3B2EA 1OH5A 2OBMA 4P4SB 1IN6A 3EA5A 2GF9A 3VU9A 1KSHA 4B2PA 2WICA 1S3SA 1AZSC 3A1WA 3DO6A 1PJRA 3QF4B 4PSVA 2VSFA 2IYUA 4URUR 1C4OA 3LAWA 3QXCA 2H57A 4C7OA 5EP2A 4BPBA 4F4IA 5IK2D 4C2UA 3T5GA 1E9DA 1GWNA 1NLYA 4DCSA 3B60A 1VHLA 2GZAA 1XEFA 2EQBA 4QG7A 3BFVA 3EA0A 4PFSA 2WJIA 4TTPA 4GSYA 2OSBA 4PQYA 4CF7A 2W6JD 5J5CA 1CJKC 2O8DB 2GVDC 4OQFA 4EIWA 4H1UA 3QJYA 4POAA 2QTFA 1F6BA 3MGCA 3GPLA 5G3YA 2REBA 2REXB 1AZTA 4RD6A 1KIMA 4RVCA 2F55A 2ZE7A 1E0AA 4LJYA 5L3VA 2VIIA 5FUXA 4A0RA 3AV0B 2ZETA 4KFRA 1HUQA 2WWIA 1J7KA 3AVQA 1JAIA 2P67A 2GCOA 3FHCB 1HE1C 4GMXA 1DBSA 1II8B 4DLWA 4QHYA 1ANKA 5BQ5A 4G01B 4PANA 1ELOA 3BE4A 3GLFB 1E2QA 5EXPA 4MGIR 1Q21A 2QQEA 2XITA 4LBYA 2BV3A 3HU2A 1NRJB 2DWQA 1E6CA 4FI3C 4IW3B 2EYQA 5FPSA 3AM1A 3CZPA 2HUPA 4Z54A 4AG6A 1MRSA 2RGEA 1QG2A 1ZINA 4IJMA 121PA 3IO3A 4C3ZA 3EZ6A 3P26A 1II0A 4JLVA 1YZQA 4IEEA 3ZVMA 4C9BA 4HUQB 4M8NE 1S9HA 5CK5A 4BASA 2FNAA 5KYKA 5F9HA 2GK6A 1OKKD 4NYJR 2LWIA 2WPDA 4NDZA 5EXTA 4FIDA 4TTQA 2W2TA 4C0BA 1QRAA 1G5TA 1QHNA 1E2FA 3LX8A 3LVQE 2QM7A 2AD1A 4L8GA 3RWMB 1YRBA 4R7ZA 5E3HA 3X1ZA 4OQMA 2OEPA 2YJTD 1VHTA 2ZYUX 3OE7A 3LV8A 4TN1A 1CKEA 1DAFA 4OI2A 1Q22A 3EZ2A 3FHOA 3EPJA 4ZI3A 2VP9A 3KTAB 1E9EA 5DLQC 4L5BA 5FUWA 1S1CA 1NG1A 2ZQ5A 4R98A 3W8NA 3CNLA 2IHBA 5FTLA 3EIEA 1CR1A 2QG6A 3GLFE 3Q5EA 4R2HA 3EPHA 4MRNA 5FUVA 1ODFA 1EX6A 2CL0X 3U4QB 4BFSA 1JR3D 3U7EB 4PX9A 5CB8A 4ZKEA 1XCGB 2NZJA 2Y8EA 1ZCAA 4PSKA 2A5GA 1P9NA 1LTQA 4UNQA 4M9QA 4CEHB 1KI4A 4M1TA 5KUTA 1M7GA 4Q1EA 3TNFA 1N6LA 2ODWA 1YR9A 2O8FB 1BYUA 4AC9A 2ZAOA 3AVWA 2LKCA 3BORA 4P4SA 1U9IA 2G1KA 4U00A 4BLTA 5HCIA 3RSLA 5FPTA 5K8IA 2BMDA 1QDEA 4XTCS 1KAOA 3ZS8A 1NKTA 4YXWD 1MH1A 4BLSA 2ZE5A 3WRYC 2WKPA 3HYTA 2HXYA 2PCJA 2QAGB 3A4LA 3EZ7A 2ORWA 3B6EA 3CRQA 4B76A 3FHTA 1UBEA 1C9KA 4V0LA 1LY1A 1XZQA 3QF7A 2AKYA 4HLUA 1W4RA 2IS1A 4GRAA 4URXR 5E7JA 2G9NA 2XSZA 1XEWX 2GBLA 1WBDA 1XBTA 4XTRA 3NHBA 1HTWA 1R5BA 2IYSA 4M4SA 4W7SA 3H0KA 4JL8A 3RRZA 2XX3A 4XD7D 3KQKA 4DEXA 2H16A 3U60B 2XXAA 2VTKA 1YE8A 4IOKA 4P3YA 1S9DA 5L3SA 2J0QA 1W0JA 4HB0A 2BHRA 1KKMA 4KSCA 3WXMA 1DEKA 1SHZA 2FH5B 1W4AA 1NL3A 1W5TA 3K9GA 3N5CA 3QPVA 4DSUA 1ZIOA 3RS4A 2R62A 4EQ6A 1KI6A 2QSZA 1KSFX 1SXJB 2OILA 1AKEA 2YWGA 3OIYA 1RFLA 4Q7JB 1KHTA 3AF1A 4LV6A 2F1JA 4JS0A 3ASYA 4Q9LA 5JZVA 1MOZA 3PUZA 2ZXUA 4A15A 1KNXA 5FR2A 1E9SA 1KK2A 4US0R 2GESA 2PZGA 2J59A 2GETA 1QZXA 4QL3A 2QPAA 1AS2A 1E69A 3ND8A 1N6IA 4TLBA 3TMKA 1R8SA 3ZZUA 1KKLA 2QMEA 1N2CE 3ICEA 2WJJA 4HI0E 3EARA 4PHTA 4E22A 1X6VA 2D7DA 1CR2A 4IDHA 3SJZA 1HYQA 2F6RA 3IILA 2PBRA 4Q48A 2FSGA 3BGWA 2DY1A 5TMPA 2YVUA 4DT1A 4F93B 2IEZA 1IQPA 3VR2A 2W6JA 1EFUA 4B3CA 2ZSAA 2C99A 1OH6A 2EFHB 3QBTA 5UKDA 3CB4A 3B78A 4A9AA 5FTJA 3RS2A 4DWJA 4JL6A 3QXHA 2O8FA 1ETUA 3GEIA 5AUOB 4LHVA 2HF8A 1XU4A 2XNDD 2F1IA 1Z28A 3M4YA 2KWIA 3R8CA 3I8SA 5JJLA 4ZDKA 1EGAA 5BWMA 1VCMA 3TUJC 1NY6A 5IF9A 3BH6A 2WSMA 4OHYA 3IHLA 4KV9A 3UMSA 3NH6A 3CRMA 1E79D 3GLHE 3U4QA 1OYYA 2CLDX 3Q9LA 5KDDA 3MWYW 2GJSA 1LW7A 2FV8A 2AFIE 4PO1A 1Z63A 1T3LA 2YWEA 4MGKR 1XTQA 2QY9A 1GAJA 2ZI7A 1ZVQA 4WZ6A 2OBNA 2OV2A 2WWHA 2GXAA 3BWDD 2DWOA 1HURA 4Q9IA 4RFSB 3L82B 3ZQJA 1MO4A 3EW9A 3KTAA 1DG1G 4L9WA 2C8VA 4YMSA 4FWTA 3IBGA 4GOXA 4DRZA 4NTZA 1S1MA 4ASUD 4K81B 2IXEA 1JPJA 4A0FA 4Z1MA 3LQQA 2DPXA 1N5KA 3OIWA 1TF2A 3AB3A 2ZROA 1L7VC 1FX0A 3LVRE 2VP5A 4DVGA 4JKIA 1EG7A 5FTNA 1QF9A 1XMVA 1ZW6A 3CPEA 4R71A 1DAKA 4RKFA 5FUYA 5H8WA 2GVZC 4F7WA 5FL7A 4EJSA 5FR1A 1LNZA 1UEJA 3LX5A 3NBFA 1E0JA 4V0KA 3EWSA 3QKSB 1R0YA 2WPDD 3MD0A 4DLZA 4B32A 5FTKA 2I3BA 3HWSA 3GFOA 1Q1QA 2RKOA 1NN5A 4JT4A 521PA 2GCOB 1QHYA 1ZM7A 2XZOA 2X77A 2BMJA 2EFDB 4D4JA 2IBMA 1JB1A 3B1WA 3NWJA 1NF3A 3DL0A 3O8CA 1NIPA 2P0EA 4KCGA 5FPKA 2B21A 2V54A 1LS1A 1G6OA 4B35A 3A1UA 5EXXA 4QGGA 1OFIA 2Q3MA 3UIEA 3WHKA 4A8JA 4D2IA 4PPQA 1HT1E 1RZ3A 3GEHA 4KLNA 2HCJB 2QROA 4NYIR 1VKJA 2OCPA 2Z4SA 1OFTA 1TQ6A 2FA9A 4ILEA 2IWHA 1W2HA 3AVXA 3RNLA 3U6BA 3I8XA 4MGZR 4O2RA 2BBSA 2ZR7A 2CCGA 2ORVA 2YWHA 4ABYA 5EP1A 4DB2A 3HR8A 4A0HA 2VO1A 4DXAA 4TT3A 2JIZA 2G1JA 1XD2B 2V55B 2OT3B 5FBLB 2ZR9A 3X2SA 4I81A 1DELA 1R4AA 3WBKA 4HDOB 1P2UA 2MSDB 2YC4C 4LJ9A 3SNHA 5AR1A 3WP1B 4QGHA 1W1WA 2UVQA 3LNCA 4WOPA 5JRJA 4Q18A 3B1ZA 1US8A 5CIWA 1KJYA 2BC9A 1E2DA 3THYA 4WW0A 4A2WA 1AS3A 3ICQB 4B48A 1AJEA 4HSEA 4MYUA 3ZZTA 3OEED 4D6PA 1G3IA 1U0JA 2DFKB 4PAOA 2AKAB 2QP4A 4PR0A 3WP0A 4KODA 4ACBA 2MMGA 3BB1A 2VP2A 1IOZA 1QG4A 2HJGA 3ECCA 1P9RA 3EG5A 1UADA 4G5OA 4N0EA 5KSYA 4HAVA 3IGFA 2A7QA 4EPTA 2JLSA 3FTQA 2H17A 4IVPA 3ADKA 3AGPA 2YV5A 2FPMA 3GFTA 4LSGA 4HAYA 5DI9A 4XVQA 3GLIE 2WOOA 1KMHB 2O0JA 1KGDA 2B6HA 3CX7A 1MKYA 1N5LA 4LJ6A 5FPHA 2RH5A 3THWA 1KI2A 3SE0A 5LB2A 4E03A 1LV7A 2IK8A 4C30A 1AA9A 1P9WA 1ZM9A 4JVMA 4LWZA 4RSGA 2WWFA 4TL9A 2VHQA 1AGRA 4ZKDA 2XTZA 3AQ4A 1AS0A 5EJEA 3SS8A 1UBFA 4QRHA 1XFAA 1KK1A 1QHGA 1YR8A 1OHHA 4IDPA 4Q1AA 2FZLA 3G0HA 2WZQA 2CLSA 4P33A 5P21A 2IYVA 5HTKA 2QENA 1YZGA 4E09A 5FOXA 5HE9A 1SVKA 1NBME 3EC2A 2R2AA 4Q9HA 2YOHA 4JVLA 3A36A 4HLCA 3VKHA 3QI2A 1CS4C 1R7RA 2EFCB 4JL5A 1ZP6A 2R6AA 1F2TA 2FSIA 2AWNA 2HT6A 1W48A 1KI3A 2CCJA 1OXXK 2WIBA 4E5UA 1RRCA 2W6ID 4CEIB 2EU8A 2VHUA 2GK7A 2VF8A 4NE2A 3GD7A 3RABA 1ZU5A 1TQ2A 2GCNA 3AKEA 3B8HA 1N5IA 3QKRB 3OE7D 2ZANA 3QUSA 4FMCF 1X1RA 1TL7C 3SYNA 2ZUDA 2ZITA 3KX2A 1HEIA 2ZI3A 3SDZA 2ZVQX 4A1FA 3B5JA 4IEIA 3W9YA 2W0MA 3IO5A 1HT2E 5GVSA 4PQFA 4ERNA 1OW3B 1WE2A 3K9NA 4MKHA 4B74A 5AUNB 4G5GA 2EVWX 4IVRA 1IXRC 1N0WA 1QHSA 1TADA 5TARA 2VSOA 1R0WA 4I1SA 4LUCA 2C04A 2A78A 3E2IA 2CVHA 2P5TB 1RVDA 3FFBA 5JMTA 4DCTA 2NO1A 2VYFA 1DAMA 2QA5A 3PUXA 3SR0A 2FFQA 4AYTA 5DNYB 1OH8A 2IS6A 2ZREA 1RRFA 3EZ9A 2F43A 3C5HA 4PQRA 3VQTA 3CR8A 1SVOA 2KI5A 5H70A 3OFND 4C0LA 3MCAA 4R2IA 2C5LA 2WJGA 3ZVRA 3VR5A 5FL7D 4EJSC 3THYB 2VSXA 1I2DA 2PMDA 1YZKA 4Q00A 2FFHA 3BXZA 2OHFA 1KAGA 2R6CA 2WAXA 4MKIA 4CT5A 1T3HA 2WWYA 2ZYTX 3IIMA 2C98A 2PLRA 5B2ZA 1DTSA 5JFGA 3TUZC 1NVWQ 1P2TA 3QXXA 4UQOA 3EXAA 4V0OA 3ZZ0A 4AD8A 1ESNA 5CDFE 1BYIA 2RHMA 1CRPA 4CZ2A 4IKEA 4BZPA 2E9SA 2QGZA 3AUXA 3NEYA 5JSZA 2BCGY 1VMAA 3TW4A 2AD5A 2XAUA 5JLJA 4RD0A 2FU5C 3H84A 1I2MA 3CX8A 3HP1A 4S2EA 3FMFA 1G18A 2WBLC 5EE9A 2NMVA 3BIFA 3DOEA 3K70B 2NG1A 5BXQC 2OLJA 1E98A 1XXHB 3EASA 4TMTA 3TGPA 3R9WA 2OXRA 4OQNA 2IS2A 3GEEA 5BN5A 3MAAC 5FBQB 1Z22A 4GFDA 1XCMA 1R6BX 3QVVA 4YMUA 4TL8A 2PEYA 3A1SA 2IEYA 1QVAA 1H8ED 1RYFA 2V6JA 4IDNA 2B8TA 3V00A 4Q4JB 3GLIA 4OQXA 4G5SA 1GVNB 2Q3FA 4PAMA 1C1YA 4QJ5A 2J7PD 1UKEA 4EPXA 2RGBA 1P5ZB 1CJUC 2JIZD 3BS4A 4EAQA 1Z5ZA 2R9VA 3TKLA 1TPZA 2F3TA 3G82C 5TV2A 1Z0JA 4DCNA 1DARA 2G0TA 3ASZA 1GKUB 4NU0A 2ZI5A 1OT3A 1KZGB 1KO1A 1E96A 1KO8A 3SYLA 1Z6XA 3RAPR 4NKRA 1E9BA 5EE1A 1OIWA 1GUAA 2R65A 3UMRA 5KNDA 2QAGC 2HT1A 4C0QC 3LRPA 3F8TA 1EFRA 3U7HB 4OI1A 1G7RA 3LDAA 3SU8A 4DCUA 5HKKD 3P1JA 4YC7A 4ESHA 5DISB 1T4GA 3LLUA 5FH9A 3OEEA 4JLDA 3SOPA 4BLQA 2G77B 3CR7A 4QM7A 3CWZA 1PLKA 2ZYVX 3F3YA 3W5JA 1CRQA 4PO8A 4JLNA 1PZNA 2CBZA 5CLLA 1OB5A 1TQDA 1XTKA 4A82A 1Z0IA 2ODBA 3C4JA 3EIHA 3SFVA 3GLGB 4WZAE 3RRNA 5HZHA 2RGAA 4N1AA 4FMBB 1SXJE 4FWIB 2ZRIA 3NBXX 1XMIA 1KOFA 5LBIA 5SZIA 4MRPA 4Q7MB 3VMFA 3R9IA 2WSSA 2ZEJA 1I4DD 3QEOA 4IOMA 5G41A 2GTPA 2FX3A 3QXSA 1II8A 4FW9A 4OHXA 4WIAA 1G3QA 5ANRB 3W5IA 3AF2A 1TEVA 4JIMA 3MLEA 4C2TA 4PZYA 1XJCA 1Y3AA 4JLAA 2D2FA 4RZ3A 2FFAA 4TLAA 2BBOA 4BFYA 1VYTA 5TVKA 3FGNA 5HPYB 4Q47A 2A5YB 2FFBA 1G16A 2VP4A 4LRWA 2CHVA 2OFXA 3GLHB 1LVGA 4FXPA
chains in the Genus database with same CATH superfamily
3F9CA 2OORC 4XD2A 3WJ7A 3NDJA 5KTSA 1MAAA 1QQ5A 2W2QA 4JLJA 5C9ZA 1BD3A 4MWDA 3PG5A 4I08A 4PNZA 4W82A 5GONB 1FLVA 4C0XA 5J43A 1D1TA 2I8LA 3OURA 3LZDA 3S2EA 2ZJ6A 1ZQ1A 3FTPA 2HZBA 2GFIA 3AOGA 4WDRA 3WBBA 4DADA 4M9XA 2JFNA 1RNLA 1GFWA 5HFNA 4DIFA 5E3JA 3SF8B 3HE3A 4DR2B 8ABPA 1RE0A 3QV2A 5EZ5A 2H2FA 3I04M 4Z86A 2UU9B 4O4JA 4RGVA 4AECA 1RP1A 3KR9A 1M66A 1UODA 1MO3A 2HDNB 4V24A 4V0QA 2QZSA 2UVPA 2PX0A 4WUTA 1M6EX 2WTMA 2I6FA 1ZM2A 5LM3A 3NBMA 4OLBA 3AVYA 4WOCA 3PT9A 4IDOA 2GARA 2FQWA 2WG0A 5DX1A 1NUUA 4P0TA 4XVRA 2QTVB 4L72A 5ALSA 4F91B 3PNKA 1NW5A 1SBHA 3NHKA 1NFRA 4NJEA 1C7ZA 1P1HA 2Q3LA 1FLDA 1W87A 4I55F 4K6FA 1SD5A 4RNCA 1SEPA 3GEDA 3N39C 4HPJB 4DR3B 2BZ1A 4TLEA 5K0SA 1MIHA 1NLFA 2ZJ0A 1YFZA 3E7WA 2FOXA 4PYKA 3TR0A 4BMDA 3CPHA 4CG3A 4X8OA 3U4AA 5DV9A 4HVCA 3TR6A 4YMTA 1IL0A 2XBUA 1B0ZA 2DWUA 4XSGA 4QTXA 4ERXA 2LUOA 3IR7A 2W98A 2ZR0A 3RJTA 1OUMA 3UAWA 4BBJA 4L02A 3MS4A 2DBYA 2I2BA 1DVRA 3R6WA 4G6ZA 3GXBA 2MDTA 3ANLA 4YRGA 3PIIA 2NLOA 4O5AA 3HXOA 2YZMA 3DWEX 3RK4A 3K1AA 1Y98A 3NBKA 3NX4A 4HQLA 4TSFD 2VNSA 5KQGA 2Q1TA 1ACMA 3IOEA 3RGWS 8ATCA 2XXAB 1OXTA 1EHYA 1VRCA 2V3VA 3ESCA 5B7NA 1YBMA 3L05A 5JZOA 1X7WA 3I2GA 3U2QA 2GEKA 4S1VA 1NVGA 1JAHA 1U7XA 2OL4A 5JD6A 4LF7B 1C80A 4GQAA 3LTNC 3TNDA 1XNRB 1L4UA 3KZXA 1M75A 2AW3A 4WXPA 3RYIA 2F9LA 3L8EA 2EFEB 3FGOA 1B6SA 4MJXA 1ML4A 4QUGA 5JYEA 1CUGA 3TLMA 3PL5A 4ETIA 3MMPA 1P2FA 1V96A 3VU8A 3ZE8A 5C52B 3RKRA 3GCWA 2CNBA 1GGNA 2OBFA 2CLLB 2RB5A 4QJIA 1YCDA 2IYFA 2GKOA 4GI1A 2ZJ7A 4HZUB 1RHQA 5H9WA 4FC6A 4KIUA 1XPRA 1PG0A 4NXMB 5B3JC 1JF8A 3CKLA 4RK6A 5BN1A 4EFKA 3SQXA 3KHKA 3ZCQA 4NHOA 1SO8A 3GLGA 1H8HA 4ZO4A 1N3BA 1X0XA 1YR3A 3OOYA 5LMCA 2R87A 3K20A 1HA3A 4D42A 3HFRA 2BN4A 2RGCA 2VQDA 2JKYA 2OM2A 2JJ8A 3NWPA 3A28A 3M5DA 2O6HA 1EWQA 5C7OO 2YYYA 4TM8A 3RS7A 3PX3A 3F6EX 1RZRA 1V1MA 2FUNB 4E2WA 3EEOA 5BSHA 4GX2A 3IP9A 1T9BA 5EWJA 1UQTA 2HA2A 1P80A 1GGKA 1UKVY 4AW9A 1ZG3A 3FPKA 5D7NA 1WMSA 4BVKA 2IEGA 2BM8A 4KFSA 4A0GA 1TKRA 2IS4A 2A3RA 1U8CB 1MQAA 1Y4UA 2JW5A 3FDIA 1D1PA 5DVZA 2O3TA 3Q3GE 2H9IA 4NBRA 2WAAA 4AB1A 1CX9B 4Y6PA 1K75A 5IEBA 3FVRA 3M4XA 3IYLW 2E6KA 1HDOA 1Y33E 4PNHA 1J23A 3N2GA 2GXQA 4QUBA 3ZC3A 5ESDA 4BN4A 2JIBA 1A5BB 3C8UA 1LC3A 1SB8A 1IUOA 3K6JA 4UM9B 5IANA 4YJFB 1U0RA 1OV6A 3C24A 4LQCA 3NTXA 1H6BA 3F74A 5AKJA 2XQFA 4NBVA 3AESB 1EJ6A 3AF4A 3PNQA 1RKVA 1QCDA 3CWQA 1CUJA 3LUCA 3DOFA 1QZZA 5IS2A 2VJPA 3B1YA 1NIJA 1LZLA 1L5WA 5AJZA 3GJ7A 3Q3JB 3UC9A 4BP1A 4L08A 2GZDA 3Q8XB 2VDWA 4I1RA 1PS9A 2AA3A 3Q7EA 2D7CA 3LXUX 3QKSA 4Q9DA 3GJ6A 2IW3A 2VTDA 3K72B 4LJRA 5B4TA 1ZJWA 1NUPA 1UWVA 3O8OB 4C4PA 4X3OA 2NYUA 3CZ4A 1XQ6A 3U7GA 1DLJA 2VF5X 2FZWA 3QIAA 1DQNA 1EK6A 5FBWB 3V4LA 5IZCC 4N3CA 2OGWA 2XTNA 4CDNA 2XBMA 1DHTA 2WVJA 2JDID 2HNBA 1FYVA 4YPFA 4EG8A 4B3TB 1ZITA 2AMYA 1FB5A 3HWX1 1Q2UA 1QO0A 3V48A 5EIXA 1QIJA 3O2JA 2GHQA 4TYYA 3NNSA 4PYLA 5C8YF 2O7SA 3P9CA 3A6GA 3ZOZA 3I72A 3CT6A 3MEQA 1HZZC 2QTCA 2JKZA 1E2NA 1BOOA 2GNPA 2HH9A 1U8EA 1H93A 1Z8FA 2ETXA 4RVSA 5JVDB 3ZHZA 1M5RA 5K03A 2V6GA 1U0BB 4KV7A 3TWOA 3GPCA 4MDEA 3L6EA 1W75A 3MRVA 4RXTA 1R0BA 4B43A 4Z6KA 3KEOA 4Y8VA 2NXJA 4RMIA 3CF0A 4O2AF 2J31A 1MVLA 2GPJA 4Q3LA 1E8NA 3VR3A 4YIHA 1ZYUA 5I4CA 1FP4A 1RWQA 1KFCB 1JFLA 1NYRA 2CMFA 1ORTA 1W0JD 3QV1A 3KKNA 4CF6A 4UTVA 3FPLA 1FTSA 3UJAA 4GC9A 1ZRMA 1MRNA 3LBFA 1S01A 1VKNA 2EP7A 4GYJA 3UH0A 3ZD9A 5I01A 1JWAB 4WY2A 4GM0A 2HMAA 5E4FA 3I9LA 2VUSA 3BTUA 3TXAA 5KPDA 5JYDA 2YMLA 3CBGA 4LHZA 4H3VA 4YMIA 4A2CA 4BAUA 2QM8A 3PNSA 4K0RA 2ZBDA 2VTVA 3LUGA 3NASA 5AKZA 4ALNA 2EBHX 3GLSA 1GRQA 1OLOA 4GMFA 4ER6A 4OQ4A 2JZOA 1IHPA 1YTLA 4C4ZA 5HUHA 1FW8A 4D9BA 1V3TA 1II9A 3DBLB 4PV7A 2FPPA 2ZPAA 5CP8A 4KPGA 3RREA 1F4PA 4OGLA 4DEVA 1DE0A 4Q4AA 5AWFC 1RI5A 1QTRA 5E6UA 1EEXB 2QGNA 3LA6A 3D6VA 4FB5A 4FKZA 1P45A 4R81A 4Q9KA 5F1OA 4K9MA 4JLSA 3A1VA 3N74A 4NX2A 2NUAB 1O8BA 2NO5A 2RAFA 4LXYA 3IUBA 1KQNA 1UJ4A 3ABQB 5D51S 1ODTC 4X91A 5KSOA 3IAAA 1SVWA 4RH0A 4WLUA 1SKMA 3FNHA 4TXLA 2CE7A 2QB5A 1Q6ZA 5M7EA 1SHUX 2EC5A 3DBRA 4DWOA 2OCIA 4RY0A 5F4BA 4PXYA 4EYKA 1VJ1A 1S3IA 2PQ0A 4R9SA 3JD2A 3W8FA 4ZK2A 3HACA 4Y2JA 2EWVA 1JQBA 5FA8A 2R48A 4PTZA 2FOIA 3OOJA 2ZB3A 1RYZA 4XUEA 2VDUE 2CBGA 4XIIA 1IEQA 1ZSYA 2O1EA 1JI0A 2Z6VA 3EPLA 1DAGA 4R6WA 4XVUA 4DYVA 5C51B 4XPZA 4UEJA 4OKSA 3THXB 2PWZA 4PAGA 4KK4A 2QXUA 1G20B 1U6KA 2XHEA 3N1UA 1RPTA 3AI1A 2WIGA 1NW6A 3H1FA 1XA4A 3O83A 3T54A 3P32A 3UJ7A 5GV7A 3A14A 1C7JA 2FP4A 1DBRA 2XUOA 3ZJTA 2PLFA 4B6PA 2FW6A 3QEKA 3HVKA 4BPRA 1CJCA 5GPBA 4F1JA 4DUGA 2XVZA 3PFWO 4DB4A 3LDGA 1IC6A 3RHSA 1XMQB 2H9AA 5KTYA 1Y5LA 3JD4A 3ZS9A 5EI5A 3IAS1 4Z8YA 4A5SA 5JYBA 1W36D 5EUQB 2BOVA 1NUTA 4J2TA 4DNFA 1SUEA 3S1AA 4OO3A 3SBOA 4ZEXA 5EWLA 3SN6A 4C05A 1VMKA 4DAOA 1XNGA 5JISA 3EFBA 2HLDA 1Z4MA 5KYXB 3FB4A 3H0EA 3GJZA 1VBNA 1BMDA 3NHAA 4LKRA 3T9DA 5HOEA 1OBFO 1EH5A 3UMJA 2R11A 4M60A 2E4UA 2AUTA 3B1KA 2A58A 2M6KA 1TNDA 5FTWA 5DYNA 1GAQA 4MMZB 5EE0A 2VJLA 3VX4A 1U0NA 2IHUA 1XXHE 2JZNA 4GQBA 4E14A 1C2TA 1H2HA 2IPAB 1IOWA 4OBXA 4A1OA 3I73A 2YRXA 3PE4A 1EFRD 3SVZA 5T7BA 1FUKA 3KJIA 3FMPB 1NQVA 1M2OA 3MWJA 3PR1A 1R0ZA 2GR9A 3DL4A 2P30A 2AFHE 4YV1A 1VHJA 3EAQA 2XZDA 2AEJA 2ZI9A 4WK0B 2O8NA 3C15C 1ATZA 3I9MA 5ILGA 2EF0A 2HRDA 1H8HD 3E53A 5DHUA 5IW8A 4DSTA 2A0FA 4ZVUA 3VZQA 3VXKA 1L1RA 4IIUA 1HFJA 1TVKB 4ETMA 4GP9A 2Y92A 4DNOA 1BDMA 3KZNA 3ZHTA 4XARA 2QL7A 1MMFB 3I4FA 4M1ZA 3VR4H 5LVAA 4Z3KA 3OE1A 1IM2A 3N3BC 1ISFA 1Z7EA 4OJQA 3S28A 3QQ5A 1DBVO 1WSWA 1U2EA 1WKCA 4LVCA 1FJXA 4DGSA 3D5QA 3BGSA 1CDEA 3FNBA 4RZHA 2OFFA 4RV9A 4XKJA 3S2ZA 4F4DA 1CNMA 1GYQA 7REQA 2IE8A 2ZSDA 3Q2KA 4YCBA 3VZSA 1PD0A 1YL6A 1KEZA 4OL0A 2Z57A 3ENZA 2W70A 1K92A 3QSGA 1LPNA 4BQEA 1PF7E 1SPXA 1IHXA 2C9ZA 3FCSB 3C5WP 3L6BA 1SVSA 2H4ZA 4XB6B 5AVJA 4ZEOA 4XH9B 1JDTA 4O25A 5CT5A 1FU4A 4XYEA 4DV2B 1ODSA 1YVDA 3EVEA 4H18A 4A6PA 3OIVA 4TV8F 2H1WA 1E20A 1W2GA 2AT1A 2JJ1D 3M4ZA 1NSFA 1Q92A 1UBCA 2D5BA 3FROA 2JEOA 5DRYA 3WGYA 4EZBA 2NUPB 3BWCA 1LRKA 2C8LA 4NV1A 4D3FA 5JEDA 3HCRA 1OI3A 4WXYB 3QVTA 2WLTA 3DOCA 3JQ8B 3WGUA 3IUYA 2J4DA 4C22A 4CV1A 3R6GA 2FRXA 2WNHA 1O4VA 3FWPA 3HNRA 4TYPA 1GITA 2G06A 2XYRA 3AF3A 2AHOA 5CVVA 4MH0R 3SY8A 2VZEA 5IU6A 2O2EA 1I5OA 2PJUA 2PRYA 3EQ7A 4DLRA 4MV0A 3P2EA 3PCXA 4IXMA 3E9QA 1K8ZB 4L4ZA 4PZ9A 1F7VA 1QUFA 2VH2A 3R77A 3ANMA 1XN4A 4GKAA 4IMRA 1IAVA 4ZZIA 3KSBC 4GM1A 1ISPA 3RS3A 4BIMA 1PUIA 2FSUA 3Q6IA 1J22A 1ZIPA 1A9SA 2PJZA 4OQZA 1SC9A 2CUKA 1FSFA 3T0IA 3ZI7A 1Y6GA 3MBOA 4DQUA 7YASA 3Q2IA 5IF3A 6Q21A 5BV0A 3LVFO 2DPGA 2XKAA 4X1IB 2JIPA 4W5WA 2DETA 1KY5A 5JRZA 5ALHA 2KYRA 2GBLC 4NR0A 1RDFA 2DHRA 2F1OA 3LPCA 5CMLA 1OX4A 2JRLA 2VT3A 2VJNA 3CH5A 3VPDA 1N6KA 1YQEA 1E99A 3UOGA 3I5UA 4ZDIA 5B55A 2HADA 4IX1A 5D3MA 3GELA 4Y7DA 4I14A 3RS9A 1W4CA 2F1RA 3DMFA 5DRTA 4OGWA 1VLZA 5AXCA 4DLPA 1WWKA 2TSYB 5BUCA 1S8FA 1T9HA 4B47A 1W85A 2QN8A 5CNKA 1I10A 3HI6A 1G8KA 1UC9A 2FPLA 3GRFA 4HUJA 3ELWA 4LRSB 4NFYA 4MGHA 2YY7A 2VPIA 3WO0A 4KIJA 5JMOA 2EEZA 1Y8QB 3MJCA 4JLKA 3F5FA 1D03A 1Q3HA 4RSMA 3U3MA 3JYQA 5IMSA 4D6YA 2JB9A 2I2FA 2V6MA 3ZLVA 1CY2A 3EY4A 1H3EA 2PT6A 2VLIA 1UOQA 2AG6A 1NAHA 2RHLA 4FFPA 3RROA 3WB0A 3QITA 1P62B 1VXRA 2C4UA 2JHCA 3K0EA 4WA7A 1XRJA 4FGSA 3ZD7A 3ICCA 3OC0A 3MRTA 2O1WA 1SVUA 3MSXA 4G0QA 4EFDA 3WMEA 1XU7A 4UXIA 4IKPA 4RMJA 3QFSA 1CZNA 1RJWA 4RV4A 2WYHA 2JLUA 4OQQA 2IXTA 2VQ3A 2YYAA 4N82A 3RU9A 4CNQA 1OSNA 1J8FA 4MCIA 3G0IA 5E4YA 4B0OA 2AN1A 4R7TA 4BKUA 3CYFA 1RRVA 1VL2A 2ORYA 4IZ6A 1F4VA 1W0KA 4XX0A 4JQCA 4LCBA 3LPDA 3L79A 3TNJA 2PSHA 2O8CB 3KR0A 1D2MA 2KHZA 2NADA 5JNUA 1SEVA 4MQEB 5CT4A 1E62A 3NAZA 4HVLA 2DEUA 4JI1B 2FSFA 3KKKA 3LHKA 1EGHA 2JD1A 4K9NA 2FJ0A 3EVAA 4UAJA 3T7DA 4BJ1A 3B6KA 1Y3HA 2GZHA 3CHYA 2Z09A 3DVSX 4UUOA 2C4KA 2PGAA 4PFQA 3LF2A 3KAKA 1GA4A 3E23A 4WSOA 2ZRPA 5DLDA 1DP4A 1Q1NA 4ZTUB 2ENWA 3UHOA 2X58A 4HFJA 4HPXB 2BFCA 3QA3E 3KKOA 5DGDA 4CTKA 4OREX 5JECA 2G0NA 1DAHA 1OILA 3NKLA 3DOHA 2VAVA 3FDZA 5EP4A 2WTBA 1ORWA 1BCSA 2Z1MA 3CZQA 3OIDA 3T34A 5J40A 5DYWA 2OCDA 2G82A 4FFBA 4RKEA 3H6GA 4F2HA 4Q7QA 2QTHA 5JAUA 4ZC8A 5FP0A 1JAXA 2QPLA 5T5QA 4YRJA 2J5XA 3RJ5A 1PVVA 3GFBA 1Z13A 1L4HA 4KYVA 2OGUA 1QPGA 1U81A 2C9OA 1JEYA 4G37A 4MVJG 4UZSA 2JGFA 1QTQA 4UNSA 1MXFA 1ZESA 2PV7A 1Q7BA 1DEOA 1FUUA 1Y7PA 4H0NA 4WACA 2PMWB 5JBNA 2YXEA 2FGKA 2PK3A 4EG0A 4IHJB 5IBPA 2PX6A 2IZZA 4P3PA 4PIMA 4TMZA 2ZS7A 3C6MA 1I7SB 3C3DA 4E12A 2MSEB 1O96A 4KXVA 5BWCA 3EQ9A 5IT4A 1I4LD 2YZ7A 4G0OA 5BWNA 4DPMA 1LLUA 3AETB 4M9UA 1DKRA 2BLLA 1YU6A 3M4NA 2C4MA 1NNEA 3W2TA 4EK9A 4M8LA 1CR0A 5CAEA 3DP9A 4D57A 1XO1A 5ALUA 4O4LB 5ENZA 1Z38A 3EIUA 3KXDA 4OHMA 3LFHA 4DUPA 2A8YA 3TPCA 3ZY2A 3GT7A 2FPXA 2W4MA 2P77A 5EC8A 5CA0F 5TMDA 5EQTA 5MN4A 3DULA 4DV5B 3AFNA 3JZAA 2W6NA 3H18A 2FN3A 3GMDA 2RH9B 2BEKA 2ZZKA 2GZMA 2QU7A 3UB2A 5CEJA 1T6NA 2DQ4A 5I9SA 4HNSA 2O3JA 3FD8A 2BMEA 4GPZA 1CUCA 4CM9D 4K3UA 1RJ9A 3D6TB 4JBIA 3WRXC 5H9VA 1QLWA 2B5VA 3DE7X 2OXEA 2RCNA 1W5SA 5HIMA 4KPUB 3C16C 4JXXA 1I0ZA 3LFUA 2X3FA 2A9RA 3WA6A 1C1XA 3LK7A 1TUIA 3G8YA 1T8YA 2NTNA 4PBSA 4V2UA 1AMUA 2IY8A 1ABEA 3EXG1 1Y3DE 1EQAA 2UYHA 1HFKA 1UFOA 1VIYA 1NATA 1UDWA 3QE9Y 4TOIA 4U5QA 1Y1LA 1DAIA 3HJAA 2GRJA 1Z15A 3QVSA 4QSHA 2HQSA 1WZCA 3DE0X 3MJHA 3OSZA 1XTRA 4W8GA 3V1LA 5DI3B 2QRVB 4YUYA 4P5DA 2D4AA 1JSZA 4IS3A 5JIBA 3OAAA 2B1RA 3BG5A 1SXIA 4ZGGA 2H8KA 4BFUA 3FJYA 4JCCA 1U80A 3CRRA 5D85A 1Q5PA 1Q14A 3BSWA 4JSTA 4RVHA 2LXNA 1FLNA 4JJ4A 4W5HA 2RGXA 4TM7A 3D54D 1YBHA 2DBRA 2FUG6 4NBLA 3UMMA 2QM3A 1QZ3A 2GEUA 3NBQA 3ZU2A 3K9BA 1C50A 1X80B 3FKSD 4XOUA 1FYWA 1SMKA 1IAQA 2R84A 3V8MA 2E89A 3H1EA 4DHEA 4YR7A 2VJKA 3F6CA 3JVVA 4AMBA 1T6BY 3UJ9A 1KQOA 1NLZA 1IY2A 4ZGBA 3KB8A 4BXOB 2FRVA 4H4EA 1U98A 3K0AA 4C01A 2X1MA 1SQFA 2VT7A 2NV6A 1GTL1 1J2JA 5HBGA 1LFDB 2BZGA 1QVRA 3GFFA 3ZI0A 5C8DA 5DTIA 1KZ7B 2WYUA 5HKKA 3HPQA 1I7QB 5DYTA 1JVBA 3THOA 4B7UA 4L4UA 4C6SA 4JBNA 2I3AA 2LW7A 3M9WA 3K0SA 1K89A 4F84A 4YJGB 1ZS9A 3K70C 1P7WA 1HNWB 4L9SA 4TYQA 1NVDA 4AUKA 1XEWY 3GP3A 2MSWA 3BEOA 1XQXA 3W4JA 4CE6A 3C43A 4M88A 1A7JA 2B99A 1XDGA 1FYFA 3OMWA 2Z9DA 4DLNA 2VYND 4M7OA 5F2EA 1Z7GA 4AU1A 2V97A 4XWTA 2EKZA 3MFQA 3MXTA 4BZQA 4LHYA 2P6RA 4RD1A 3UBMA 2AXQA 1N5MA 5BMOA 2EIXA 3RSFA 1OBCA 1WPXA 3DHEA 4AURA 5CA0A 4AMVA 2A2ZA 2YFKA 3OZDA 2R4QA 1BGXT 4UHEA 4Z9AA 3UB3A 5LWHA 3A0RB 1A8IA 4RLHA 4J29A 4MIYA 1HO3A 5DOZA 1TFUA 1W6RA 3FDFA 3N07A 3QMVA 4YAEA 5K20A 2V7QA 1PV2A 4NZ9A 5KPJA 2RIRA 2ZJBA 1CVLA 1B6RA 3JQFA 2X4IA 2VHYA 3IMGA 4G0MA 2RH8A 3IULA 3D7KA 2Q8QA 4L6IA 4O4HB 2Z5LA 4XRRA 2N42A 4UPEA 5AHOA 3ELBA 3I42A 4G0NA 2L18A 5I7EA 1S6YA 3TZEA 3LG2A 3LUBA 2L69A 3HZOA 2J4FA 4DLXA 2A1TS 3DVQX 3NMUF 3PLNA 5BYKA 2DRIA 4EYSA 2ACVA 3QPCA 4CKCB 2D5IA 3KZMA 4MPDA 4Q4JA 4HTAA 4F4CA 3PJGA 3UHPA 5BSFA 3F67A 4LMBA 3N76A 1COWD 2R7KA 1E9VA 4QJ3A 3TUIC 4PSCA 2O48X 4MR9A 4FDAA 3H5AA 4RLQA 4O8ZA 2VP0A 3R5JA 4WV3A 3MRXA 2F8SA 2IC5A 4KQFA 2VHJA 3V8BA 4CYMA 3T7IA 2B4TO 2OBLA 4M7WA 3WSWA 5JOQA 1ZR2A 2GJKA 3GJRA 2PX3A 4BOYA 1XTTA 3GHYA 4WFJA 3SR3A 4ZD6A 4QHTA 2YZ2A 1M8FA 5DDIP 3DHNA 1XPUA 1WOYA 1A77A 3AH8A 4Y2RA 1T9ZA 1K6MA 2ZWMA 3BMQB 3KZOA 1DCFA 4R9UC 1YE3A 1Q7CA 2GOYA 1I9GA 3ET4A 1B76A 4Q9AA 1OXKB 1O6ZA 1SGWA 4OX9B 4MUBA 1VP9A 3V4FA 3P9ZA 3VYSB 1P4SA 2IOQA 2YIDA 4ENWA 1NVVR 2DWCA 2ZU0C 3SQOA 1TKCA 1X8LA 3L4KA 1M7HA 5KBYA 1AQYA 4Z1OA 3OFSA 5ICCA 1OCEA 3UJCA 3WB2A 4E5YA 2R97A 4MW9A 3ROEA 3ZDEA 1ZEJA 4ACAA 1X7WB 2YJNA 3LPLA 4W63A 4FWTA 4PXAA 4Z2YA 3R7WB 1A1SA 1X80A 1N7IA 1TA0A 3T5MA 3V7YA 2O23A 4I4TA 3JVEA 1A27A 2IU3A 3TTWA 3WOHA 1YMUA 4OHUA 4MUGA 2P62A 3GVXA 3U31A 1R0SA 1FTNA 3WLPA 4E13A 2UUAB 2HCBA 1CZOA 4LJLA 1TGVA 5KVQA 2CLMB 1VCOA 2QY6A 3OKCA 1C9DB 2FP4B 2GKSA 3FNEA 2WJYA 1VCNA 3CEMA 4U7HA 1NXWA 1QHIA 1UXGA 3I52A 5DP2A 3TIFA 3HXKA 3NHMA 5EFZA 4XWAA 1WNFA 4HAWA 1PQWA 4XWYA 1ULHA 3TXYA 1C30B 1VRVA 3S1AB 5GJWC 1UXIA 2WIFA 1H2RS 4RD4A 3D02A 1Q7EA 4KFTA 4D44A 5LJIA 5JCPA 4MRAA 1J8YF 3V8QA 4DIEA 4IMPA 5TS2A 2A1UA 5AKXA 3WMGA 1AC5A 1G21E 1O08A 4RD2A 1K0UA 2NU8A 5B4VA 4LVUA 5LQDA 2DBZA 4G1MB 3K5HA 5DFAA 1XJ5A 1YSCA 2VI5A 4F6LA 4HN2A 1WCIA 1L8OA 3ROTA 3ITNA 3PUVA 4DDHA 2H54A 1QXSA 1EA7A 4G0XA 2VAMA 1E7QA 3R5TA 2DJIA 1R0XA 3I2FA 3KT3A 1Z6QA 3PHHA 3KDSE 3OCVA 3QK7A 4WLNA 2FZKA 3CGWA 3UZUA 3GLGE 2BBTA 2QV0A 5GONF 2FQ1A 3N8HA 1WQ1R 5J59A 1IMJA 4DLKA 3R7FA 1GPUA 2EFGA 3O1HB 3S8MA 2EBUA 1X9HA 2IDJA 3SJAA 3WWEA 3ZBUA 5B12A 1B74A 3MXOA 3DVAB 4JBYA 3W2HA 1B6TA 3PWTA 3COSA 1IMOA 2JGRA 5AO9A 5TX7A 3G9TA 4FMCB 3C5VA 3PC8A 3U5TA 3PHGA 3DLAA 3GVCA 4NDAA 3K2IA 5DNAA 5KS2A 1VG9B 2KBEA 2XUIA 1HYBA 2EX4A 2WI8A 4R83A 3FKJA 5DK4A 3RBVA 3WYEA 4K87A 3KCNA 3GARA 3IVAA 4YJ2F 3BF8A 4GOND 3QY0A 1VKZA 4P6VF 4EENA 1NLMA 1UKBA 1EXMA 1E1QA 3T61A 3O74A 4BAGA 4LWOA 5ELXA 4FEGA 4I55B 2WTUA 1VTKA 1UIRA 3A1TA 3B9BA 5IDXA 2P2YA 1NNLA 3JZMA 4MRMA 2FWIA 4BV8A 4G4SO 4NYMQ 4RVGA 2TS1A 1QYDA 3RTAA 3PXDA 3WG9A 1GR0A 5EQJB 5A4FS 4Q16A 3OPMA 5AM0A 1E2GA 1O5TA 2QRNA 2P90A 2RK4A 2M98A 1IBLB 1KBQA 1GL3A 3RC8A 4IJQA 4J0JA 1N8TA 3E58A 2LZ0A 3QNWA 5JS7A 1ZZGA 3K3PA 2GF0A 4RAOA 3SHWA 2LKDA 2RHHA 3NI2A 3EJWA 3NOVA 3JQRA 3GMSA 1QOZA 3BDIA 1DAPA 2NQ8A 2I99A 1QH9A 2YR0A 3EEIA 4G5FA 2HXGA 1TTQB 2Y1WA 2ZGVA 4CQLA 3NV9A 2BKLA 4K46A 2NP6A 2YXPX 3BOSA 1QIIA 2JHFA 2ZBQA 1PX2A 3QVLA 2Z4RA 4GVPA 4ZVLA 2B0CA 1QB7A 3CKKA 3ZQKA 3DT6A 4MIEA 1V4VA 2E5LB 1V4NA 2O8BA 2BI4A 1HDXA 2CLEB 1PJZA 3JAWA 1T8TA 1KYIA 3K5WA 2AMVA 3T15A 4D0NA 1IRIA 1G8HA 2WUGA 2AHRA 2NAFA 2N3ZA 4QBGB 2GBCA 1T43A 1KJ9A 1WPRA 2WU0A 4NS4A 3IV7A 1M2JA 4Z99A 1OX6A 2UUOA 2V1UA 5SY4A 1RJFA 4G5YA 3WDKA 4FQ5A 1NQWA 1ZMTA 4D4MA 2OQRA 3ONEA 3W3AD 4F21A 5EE5B 3T5BA 1HQCA 4CPDA 5FEUA 4W8OA 3QHAA 3T8YA 5BWBA 1F60A 1OYWA 2QN7A 1NN0A 4QJBA 4XCXA 3TM5A 4KKXB 3RF7A 1XD2A 5DM2A 4OQYA 4TMKA 3FJ1A 3WKAA 5EEHA 1SKYE 4BGIA 5LA6F 2A94A 4JUAA 4R8SA 4DSNA 3MK31 1NASA 2EFYA 1FDWA 3DMTA 3JALA 1LK7A 3VR0A 4F8YA 3VGJA 3UAYA 3DXZA 2XY4A 4EL0A 1V5WA 2WP0A 4GAEA 3Q41A 4OPMA 4UUPA 3I5XA 4W5QA 4PC7A 5F5XA 1M2HA 1USUA 5A3VA 4MR7B 1XLVA 3L0OA 3OPYB 2J0UB 5FFFA 3NBAA 2O5EA 4D3YA 3MIZA 2ZAMA 1K7EB 1OASA 4LVNA 5GVRA 2HJRA 3IH5A 1N6HA 4P4TA 2BM0A 5A06A 2Q29A 3K70D 5JH7F 3DAHA 4LXHA 3SXUB 1M76A 2WG2A 5DYGA 5THXA 1WEKA 3UJ8A 4QPDA 2YCBA 4ZYTA 1XHFA 4ZT6A 4I66A 5IJ9A 3LH5A 3DH0A 1O2DA 2F62A 3DKKA 4IF6A 1K86A 5K99A 3EG9B 1WU7A 1P60A 2VZ8A 3JQBC 1FVHA 2WIKA 1R1DA 2W2MA 4MWZA 4DW8A 3O9MA 4D0SA 4ABTA 4BE7B 2W6PA 4MV4A 2H5EA 3NDPA 5GMOA 4M2LA 2QAJA 2XDQB 3B82A 4HEHA 4K8OA 3UXYA 5I5EA 4PPGA 4UMVA 1TW3A 1V4BA 3T9EA 3RQIA 3MOIA 2VRCD 1ZOOA 1N2CA 2CXSA 5K3AA 1XPOA 4PAWA 3WIUA 3GN1A 3UAZA 2FQXA 1Z25A 3VI4B 3JALB 1HRDA 4NK5A 3T3EA 2OV3A 3LC0A 3NM6B 2BMFA 5F51A 1AUQA 2XKBA 4BDSA 2CHQA 4Q3DA 2I9KA 1I0LA 1N2SA 1X3SA 1YAJA 1Z47A 4MB2A 1OV4A 2XV1A 5K0CA 4JB0A 2CJXA 3MJEA 4WKOA 3P96A 2IH2A 4BNDA 3MCVA 1U6IA 1YGYA 2Z83A 1YDWA 4BNZA 3FVWA 4MCAA 4JBLA 3I2HA 2IX3A 2EQ5A 4ZEMA 5A4AA 4ND6A 1FQJA 4NMWA 2A9PA 4BGDA 4P58A 1AKRA 2GYYA 1KMQA 3DR5A 2G8NA 4GXTA 1XAHA 5HM6A 4L9AA 4ZZ3A 5KU1A 3EXG2 1QAMA 4RJIA 4XSHA 1A4UA 1XV5A 3FXAA 5IKXA 4I5EA 1Z16A 3RYFB 1OBVA 4NCNA 3FTEA 4PYMA 5ESRA 1ENZA 3OJOA 2DQYA 1GFIA 4Z0TA 3ZCRA 5KTOA 3KLNA 2AI1A 5SV2A 2WM2A 1JT9A 3HEMA 2PXXA 3GQBB 3LSYA 1GJRA 4YMVA 1DWOA 1VLVA 2Y4OA 3N5KA 4NABA 2ZYDA 4DNXA 1XRLA 1LLQA 1ZXXA 3MPUA 4WHMA 5KHLB 4Z5XA 3MLBA 1ICEA 3B3JA 3QYPA 2R66A 3ORFA 1WB9A 3TQHA 2E21A 2AFIB 5KZMB 3MQ4A 2IHZA 2Q3HA 2HY7A 2JFOA 4ZZ0A 3PGXA 1XZCA 3RARA 3EZXA 3W1EA 4EW3A 3GA7A 1HE2A 3NPAA 4TL6A 3ASVA 4ARCA 2NNWB 2OAEA 1M6HA 2GBGA 3FOAA 4RSRA 4HNTA 4NJEB 1PWHA 4ED9A 3A58B 3L1KA 3AZQA 4F97A 4P9NA 4MWGA 5CLIA 2B94A 2WWGA 1C7EA 2BGIA 1L7DA 4L9RA 1I4TD 1P0PA 1ZXBA 2H4HA 2YQZA 1IN5A 3PS9A 4MYTA 4R3UC 4A8JC 2RG7A 4K5QA 3HDGA 3PQ7A 4N5HX 4CM5A 2XB2A 1Q0RA 4XYBA 3L0IB 3UT6A 3IJEB 3FWHA 4YVFA 5KKCA 4J7XA 3VI3B 2G9ZA 4N8DA 1Z2OX 1YKSA 2C1XA 1H6AA 4OI0A 1FFYA 1SUAA 4BFXA 5CA1F 2ZM6B 4KPYA 4RWZA 3O8QB 5E6SB 4OF4A 3C8MA 2X6QA 1E3TA 4RO0A 3SC2B 2ROQA 3O2SB 4AZ0A 2GCEA 4TLMB 1B2LA 5TT1A 1P18A 1Z0UA 2AGVA 4EH1A 2GJ9A 3EA4A 2BKEA 5AM1A 2VEOA 2NU8B 3ZQUA 2A0UA 3G7NA 3D2LA 5L7WA 5AHKA 5LP6F 3KFXA 1WUKS 3LL7A 5M2QA 3U56A 3WBJA 3ZGXA 2F3UA 4TLLB 3CY6A 2ID4A 3JWJA 3NPMA 1SA0A 1J8MF 4FD3A 2APJA 4G84A 3ZH2A 4GEGA 4CCYA 4M0CA 1Q77A 1UC4B 1BRTA 2EW8A 3KJGA 4B82A 3BXPA 2A14A 4F04A 1DMSA 1TLLA 1KI6B 1RZVA 3U7QB 2CGEA 1EAYA 2RGDA 4HMPA 1USKA 4WLOA 1XCPA 2XEXA 3JVIA 4K9PA 4FKMA 5BNWA 3G6KA 5I9LA 2EG5A 1DDGA 1TKBA 1WU8A 2HMWA 4F2PA 5TPZD 3GLTA 4DR5B 2ZZMA 5F9FA 2HHJA 1VP3A 2H0AA 4FFDA 5LKRA 4R1QA 1GGEA 1AUXA 3RG2A 5KX5B 3KOXA 4O4LA 1HE4A 3QU4A 5D3QA 1INLA 2ZRNA 3CPJB 2PGXA 3LLMA 4N9QA 5EJ5A 3LCVB 1XIVA 1UJ5A 2J85A 3BF7A 1XEXB 2GPYA 4IIDA 1R6AA 1EUYA 2JCVA 3TAHA 4EMUA 4IFBA 1B15A 1DAEA 2GBIA 3K2BA 5KYYB 2H59A 2Z6QA 3WGKA 1QVVA 2CLCX 4TTRA 4WLEA 4WADA 4BQQA 4I2VA 4EA7A 5F52A 3DKPA 3DYIA 5BYJA 1NFFA 2DSNA 3DEJA 4BN5A 4MWEA 4JLOA 2F59A 4N4AA 3ZWWA 3X1KA 5IYZA 1AN9A 2VNJA 4FTWA 4US2R 3X1WA 4KQ2A 4G8CA 4KMSA 1AKVA 4PZUA 5EINA 5H5JA 4IMJB 5KOJB 2X2FA 1KFBB 1WDLA 1Z88A 1Z6YA 3RVPA 3DHVA 5AVXA 1GN8A 4ZAGA 2D54A 4W5JA 4BHTA 2JPDA 1VG1A 5HS6A 2XCIA 4BZWA 1A0OA 2RHJA 1UXJA 2VRWA 5IXYA 1JEJA 2G6BA 1PE0A 1QLHA 5BYBA 3VU1A 2R1VB 3ECSA 1UKZA 3UV7A 2YYSA 5CB4B 1QVWA 1Y82A 2I2AA 2OAP1 3F0TA 3K9HA 3MWKA 4HGOA 1G8SA 1QYXA 2VWHA 2YL2A 4HQ0A 4RZUA 4WNAA 3UANA 1JR6A 4K2HA 3WYFA 5JNLA 3SQNA 5B1YA 2VNHA 1V11B 3VMMA 4QGFA 3PRHA 5JSHA 1K3UB 4MKFA 4XDYA 2HTFA 4B3FX 4C4TA 4URVR 3H4VA 4HBGA 1F0PA 5K09A 3R6TA 4GKJB 5I7AA 4BRSA 5FBZA 3CIOA 2ZG6A 3N2KA 4XM1A 4Y0VA 3ET5A 1G63A 1LLCA 2VPTA 1MEEA 3ABZA 3H8SA 3JATB 4YPVA 3D3EA 4XWGA 1SKBA 1FRQA 3U1BA 1T9GR 4YQFA 1CQXA 4RVUA 5TJHA 1QH0A 3FKSA 3DFIA 4LC9A 1FBTA 3BWEA 4URWR 1HL7A 4P80A 3IJRA 5AJVB 1RZUA 3T5CA 4JENA 3WQSB 2BFPA 2D0OB 3BXXA 1HI9A 3HU5A 1Z0KA 4NZYA 4ZYLA 1OIVA 2YVQA 3FIUA 2XMZA 3CFYA 4LGMA 2QTLA 1IEXA 3QYFA 4N6NA 3V4ZA 3VR5H 1MG5A 2V9ZA 3ZU3A 1NQUA 4DKXA 1H4VB 1G5QA 4FFOA 4N3AA 2GM4A 4PSUA 3GJ3A 4IV8A 1PVDA 5KC9A 4KR3A 3ZXYA 3A4NA