1XEXA

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
PYIEKLELKGFKSYGNKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords SMC protein
publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 45
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexA00
2CL7X 1BYUA 2XOKA 5CB6A 4BECA 3GLGE 2D62A 3P1JA 2DFKB 5CIQA 5EE9A 1M6NA 2ORVA 2ATVA 1HH4A 4N0DA 1DADA 3QF7A 1QRAA 2IW3A 1XPOA 2IBMA 3RC8A 4NHOA 4Q02A 4PC2A 4B3FX 1DAHA 2DWOA 3BB4A 4QBGB 3F8TA 1VCIA 2GWHA 2BIFA 1DE0A 1G4UR 4JSYA 4U7DA 4TZ6A 2ODBA 2Q9CA 1JJ7A 2GJKA 3OE7A 4Q1CA 4RD4A 5BWMA 5KPJA 2BMEA 2J0QA 1RW4A 3KQKA 1RC8A 1OB2A 1IHUA 1W0KD 3DEFA 4DKXA 1SVKA 4JT2A 1XF9A 1E0KA 1COWA 1UAAA 1G20E 1KAOA 1T0JB 2YJTD 5A4JA 4Q4AB 3GLIA 1J90A 4DVGA 3OFND 4Q4LA 5AUPB 3B1XA 2WJVA 2RGGA 3QKSA 2KB0A 2Z5FA 2ZUCA 3QIAA 4D6PA 1XPUA 3A37A 1MOZA 2FZLA 2BEKA 1Z29A 2DWQA 2XZLA 1IXZA 1UBEA 4JYCA 3BWDD 1KI4A 4AYWA 2HLDD 4DEYA 3KQHA 4HDOB 3PJRA 2XTMA 4M1YA 1Z0FA 1V43A 3OIYA 3M6AA 1EWQA 3T1OA 1E0JA 1FQKA 2J87A 1O3YA 1OXSC 2ZJYA 1PLJA 2QU8A 4B2PA 3LX8A 4NP6A 4CVNA 1DO2A 4BE7B 2YOHA 1GP2A 1S1CA 4U5XA 3GLHE 4PSAA 4GZLA 4OQFA 2IYUA 5AJWA 2GESA 2BKEA 3ZS9A 4QJ4A 1VHTA 3VR2A 4EPTA 2IWRA 1GIAA 2GDJA 2PLFA 3KB2A 4WZ6A 2HJVA 3NBZC 2FEMA 4D0LB 1J70A 2JCSA 4TQ9A 5K8LA 4UXIA 2J59A 1QHIA 2FA9A 4R2IA 2H17A 5DLQC 2O0JA 4FCTA 3ICEA 1UKZA 4Z8YA 4QNMA 2PH1A 1XEWY 5EP1A 2CL0X 1RRGA 2NO9A 2YWHA 4I81A 4LHVA 3T06B 4KI0A 4W5HA 1E2MA 3ADBA 3DZ8A 3WBKA 4EIWA 2RHDA 3BERA 3H2YA 4II7A 4KV9A 1PUIA 1N3BA 4FMDB 4FMDF 1OV4A 1OFHA 3SEAA 1E2JA 3R8CA 1HE1C 1G6OA 1NBMA 2YHSA 5EE3A 1JJVA 3EZ2A 4C0LA 4PO1A 5IRCD 2FU5C 3U44B 2ZETA 5DE3A 1GFIA 1F2UA 2CK3D 4ACAA 4M0LA 4XWOA 2VP4A 1VYTA 2VHTA 4TYPA 2HYIC 2NPIA 1XD9A 2P5TB 5B57C 1XTQA 4PC3A 4R71A 2IUSA 2C77A 3DKVA 4HZIA 1XRJA 4LJ6A 1Q22A 3K09A 1CJVC 3MLEA 4KHZA 4RKFA 1ZW6A 4HAYA 1UDXA 1GRNA 2JLYA 1GDDA 2OESA 4HYYA 5JJLA 1YR6A 4DLWA 2J9RA 1XTKA 2V1UA 4GZMA 2ORIA 2KBEA 3U60B 3HPQA 3WP1B 3FOZA 3AEZA 4K81B 1G19A 1HQYE 4MGIR 1G8HA 3EZ7A 5B30A 4IXNA 2CJWA 3NH9A 3C16C 1E96A 5JHGB 1G5TA 1LF5A 1MKYA 2VP5A 3THXB 2OLKA 1CEEA 1GNPA 3LY5A 2ZRCA 3SHWA 1L8QA 3TUJC 5FTJA 1A7JA 4CEHA 1ZD1A 2DPXA 3CX6A 4F4CA 5L8VA 3VNVA 2QI9C 1M7HA 4LY6A 5TY0A 3PITA 4BFUA 2B8WA 4V0NA 3K9HA 4PHGA 2L0XA 3PR1A 1KMHA 3QVUA 4NTZA 5EE1A 2W58A 2CLCX 1KI1A 2B7BA 1VG0B 5HTKA 3UATA 1TTTA 2SHKA 1N6KA 4OI1A 3D3QA 4KBGA 1P4SA 2GEDA 4X8LA 3KKMA 3BB1A 3GLIB 4IKEA 5BN3A 1ZIPA 3NHAA 4U02A 1TF2A 4LK2A 2WSMA 3ZJYA 3BXZA 1UJ2A 2NQ2C 3QKSB 3AM1A 4LHWA 3RLFA 1NVXQ 1JQJC 1Q12A 1XTIA 4FCVA 4L9SA 3NDPA 5HE8A 3K0FA 3THWB 1P61B 1KGDA 2YWGA 3WBJA 4O2RA 2GF0A 2XTZA 1ZM3A 1U9IC 4OHVA 1GRQA 3LRPA 3E70C 5KNBA 4B3CA 1G4AE 3NKVA 3QOFA 5JWOA 3TJZA 2GETA 3KXLA 3KTAA 2DYKA 4RD2A 2IA5A 1KO1A 1S3GA 4TYWA 1PLKA 4KITB 4V0LA 4TL8A 1W48A 4FMCB 2BJWA 4UJ5A 5F9HA 5FOTA 4Z1MD 1XJ0A 1RRCA 1NMXA 2ZVQX 5JS8A 1IJEA 2IK8A 1EX6A 2NGRA 1F3OA 2JDID 2P3SA 2R6FA 3CBQA 3NVAA 2R6CA 4YMTA 1Q1QA 3CWZA 3THYA 4WXRA 2DWPA 1P60A 1P9NA 2JATA 2PCJA 4YDHB 1TF5A 4YMUA 4LI0A 3TSOA 2IS4A 2IYXA 3LBNA 4X8MA 4Q03A 3FMFA 5DHAA 5EQTA 3B8HA 2BDTA 1PV4A 3ND8A 3GEIA 3UWKA 4IVRA 3NHBA 3CIOA 3A1VA 4D82A 2VHUA 1TQ6A 3IHWA 4B33A 3NG1A 3PFIA 2AHOA 2D7DA 4Q1EA 1OXXK 2PCLA 1XMSA 4Q9IA 2CLDX 4QOSA 2GHIA 2IHBA 4IVQA 4GDFA 2QTVB 2JLWA 4CEIA 4LYFA 3PUZA 4PZLA 4A4DA 4M9ZA 1N5IA 3SNHA 4C0SA 2GNOA 1F2UB 1U8YA 1T3LA 1QZXA 1WF3A 3IQWA 4L4UA 3EC2A 4C7OA 2Z43A 4JLKA 3ZZTA 4W9MC 3QPWA 2QL6A 2NTYC 4Q1AA 5DISB 3U3RA 2F1JA 2OAQ1 4PQRA 2GBLA 2I4IA 2MSEB 5KDOA 3ZLJA 1NY5A 1Q57A 1VHLA 4FD2A 2O8DB 4F38A 3HDTA 2GTPA 4LV8B 2WJIA 4DDVA 1QHHA 2REOA 2PL3A 4MYTA 3EIHA 3LO5A 2ZXUA 1CR4A 1FL9A 1R0ZA 1FZQA 3OEEA 1MO6A 1Y3AA 2R9VA 2ZQ5A 2EFGA 2H5EA 3PG5A 1MRNA 1Z28A 2AKYA 2V1XA 1IONA 1Y63A 3Q7PA 4PC1A 5SZKB 4HAVA 3DL0A 2ZITA 3F3YA 1DBSA 1CF4A 4CYMA 4CEHB 2A3RA 1VDZA 1DO0A 4OK6A 2QM7A 2XB4A 2FG5A 1R7RA 1ZD8A 2WTUA 4QHTA 1CLUA 3AKEA 4MRPA 3LVQE 4HI0E 3IBGA 4PZZA 2XB2A 1XMIA 1YRAA 1N0WA 3T61A 2BVNA 2FX3A 2ZUBA 3T35A 3TUZC 4NU0A 4C0BA 2VF8A 2VEDA 3I3SR 5KUTA 1F5NA 1GITA 2QE7A 3AB3A 1KDRA 4GOXA 1TQ4A 3UK6A 3R7WA 5UKDA 1JXOA 3ZGXA 2WJJA 2PT7A 2G83A 4KODA 1KDOA 4QGAA 3KFVA 2ZRJA 1KK2A 2GAAA 3CKLA 1OXVA 4ESVA 1Z07A 3E2IA 3RS0A 3RRMA 4WXPA 1R5BA 1E9DA 4LOAA 4HLUC 3B1WA 3CNOA 1P9WA 3P26A 1FX0A 2WSSA 4EQ6A 3ND9A 1L4UA 2IS1A 1JBKA 5J4YA 2VSFA 5DSZA 2VSXA 2FSHA 1S9DA 1NKSA 2QMOA 3DVLA 2GZDA 3EZ9A 3U6KA 1ONBA 4H1VA 3D8BA 3W5IA 3MGCA 1Q3TA 1U0HC 3AH8A 2AK2A 4KVAA 5K8TA 1ZU4A 5P21A 4O25A 5FOVA 2WAYA 2XXAB 2ZR9A 4NKRA 4EFLA 4BLTA 4Q66C 4RD1A 4LJ9A 3D31A 4Q1DA 4YMWA 1UKEA 4B76A 4KLNA 5AUNB 2ZRFA 1G7SA 1KNQA 3M1IA 1X86B 2QN6A 2QPOA 4HB3A 1U90A 3AVVA 1YHNA 3X1WA 1KI7A 4V0MA 3WNBA 4ACBA 2JJ8A 3BGWA 3DDCA 3I5XA 1E2DA 5KSZA 1BKDR 4UNNA 1NLFA 1NSFA 4I1UA 4TYNA 1Q1BA 4LWZA 1II9A 2WJGA 1XZQA 4RD6A 4ZV4A 2IYVA 1DOAA 1OYWA 2F3RA 1U81A 4DCVA 2QGNA 1XWIA 1CULC 1OHHD 1TMKA 2ZYUX 5AUQA 1I4TD 1SZPA 2F3TA 4B35A 4P32A 2ZE8A 1EG7A 1KOFA 4A6XA 4MQBA 3THOA 4ZKEA 5KHOC 4DB4A 2OBLA 1QG2A 1LFDB 2RGCA 2AN9A 4C7OB 1CBUA 2GXSA 3LLUA 3K9GA 1D9ZA 1CRQA 1I2MA 2GAOA 1FP6A 4IOJA 1XTSA 1Z2AA 3J81k 2R6GA 3TAUA 1SKYE 1Z22A 3IILA 2C9OA 4IOMA 2OAP1 4JLPA 4XD7A 4BZPA 2GJ9A 5ELXA 3EA5A 5CM8B 4JLNA 4GMXA 4RZ3A 2CE7A 3EPJA 2C9YA 4EJSB 2X1VA 2FGKA 5KSPA 4M1TA 4YXWA 5C4GB 1QHHB 4IEIA 2WICA 3AKCA 1DARA 2G1KA 5DN6A 1AZTA 2OXRA 1ESMA 2G77B 1P6XA 1YZKA 1GILA 1R0WA 2VO1A 5D3MA 1QF9A 3MCAA 1VIAA 1T9HA 4B48A 3E1SA 3IEVA 2ONKA 1L7VC 4I99A 4LJ7A 4DB2A 1SVIA 4GP6A 4GPTA 4OJKA 1S4QA 1XU4A 1JEDA 3LA6A 3GLFA 2GCOB 2RGDA 4OBEA 1HA3A 3OIUA 4BPBA 1Q1ZA 2NOAA 1W47A 1XXHE 3KFXA 2QMEA 4PAMA 1K5DA 5GADl 5FI1B 5FR1A 5A5GA 4RFVA 3TLXA 3PUYA 1GOTA 2P65A 4OL0A 4RZ2A 3L0SA 3Q5DA 4RFSA 1YZLA 1P72A 1XTJA 1MABA 1U98A 1N6LA 3I5YA 2A30A 5FUYA 3R7WB 5GVSA 5AJVB 3T5DA 3AV0B 1W36C 4PZYA 1ZIOA 2N1BA 3FHTA 3GLFE 3ZDQA 1QHNA 4R7ZA 1JR3E 2QQEA 2VF7A 2FPMA 4Q00A 2FFAA 2JLXA 2C9CA 5LDDC 1M7GA 5CLLA 1PJRA 1W49A 3U3JA 1FX0B 1FP7A 4NONA 1E4VA 1WXQA 2D7CA 2ERXA 2OZEA 2IYQA 3GP8A 1OFIA 3U3OA 2ZR7A 4MKGA 5EXTA 1EFTA 2OFOA 3CO5A 3DOFA 3LLMA 1N6OA 3T12A 2BWJA 1A2BA 1SXJE 1E9AA 4DLTA 4QJ3A 3BJIC 1XFAA 3K70D 2AD1A 4DDTA 2BCJQ 5M04A 1E32A 4P31A 4TMKA 1Z8FA 3DKPA 1ANKA 5FL3A 3NEYA 5C2JB 2AWNA 2XX3A 4O0MA 3ZYCA 3A4LA 1YE8A 1S9HA 2QROA 1T3HA 5G3ZA 5CJ2A 2CCJA 3LV8A 4NYJQ 2O8CA 1WB9A 1SVSA 4C0HA 1ZRHA 2GEVA 3FKSD 4BRWA 3C15C 2IL1A 3TW8B 1J7KA 3GJ6A 3QXCA 2RGNC 2Q9AA 4CZ2A 1II8B 2ZI7A 2CL6X 5E95A 3G82C 3Q9LA 5DI3A 3EWSA 1HYQA 3U2QA 3SN6A 4D26A 1W5SA 1XJQA 1UDWA 4X8HA 1E3MA 5J4KA 4MGZR 2ZYTX 3I72A 4WZAE 4JZKA 4FMBB 5KNDA 1CR2A 4QG7A 1XCGB 3BFKA 4GOJA 1UPTA 1OKKA 3VKGA 4BFVA 2O8FB 2BBSA 2GKSA 1IN4A 5FUVA 2FH5B 2ZJ2A 3NXSA 2F1RA 2NO0A 5EZ5A 4XVQA 3PXGA 2YKGA 3B13B 3NIBA 4B74A 1P2TA 2WKRA 4LPSA 1MV5A 1GZSA 4GP7A 1KSHA 4KFTA 2IXGA 5FOUA 1ZUIA 1J8MF 2QORA 1CP2A 3O8RA 2J7PD 2O5VA 1OH6A 4DLXA 1P75A 2D2FA 4M1MA 3QENA 1CXZA 2IT1A 1OIXA 3SHFA 2NZ8A 4ZDIA 1G7TA 4HZUA 4URWR 1NP6A 2Q3HA 2YOGA 4MKFA 1X3SA 2ZSFA 4TMTA 5CYOA 2B8TA 4A8JB 2FEOA 4HEJA 1E9EA 2V54A 3MRSA 3MJHA 5EE5B 2F43A 3UWOA 4DLZA 1OFTA 3MWJA 1PVOA 2ZJBA 3CF6R 3CWQA 2GJ8A 3MWYW 3SZRA 3M0EA 2QE7D 1W44A 1NN0A 2PLRA 4ON9A 1QDEA 4G1UC 3I4LA 2JDIA 1Z0KA 4A6PA 4TZ0A 5BXQC 4XOIA 1CRPA 4CF7A 3VX4A 4E03A 1IY1A 3EC1A 1GL7A 1P5ZB 2P6NA 4TYYA 3V00A 2WSSD 2ZE7A 2R62A 2BMJA 1Z6AA 1UKVY 4RFSB 4ARZB 3CZPA 4RSGA 1X8KA 1CJMA 1H8HA 2WIAA 2KE5A 2JGNA 4IDOA 4JBYA 4BEJA 5B64A 3QG5A 1C9KA 3BBPA 3A1UA 4MYHA 3AVXA 4TL7A 4D0NA 2IYTA 3P32A 3C8UA 1N0VC 3C14C 2A5GA 1VYUA 1RPZA 4P4UA 1E9BA 1U99A 4ZDWA 1DAEA 3DHWC 2FOLA 1G7RA 4NPHA 3U7EB 4JBXA 1T4GA 3LBIA 1GKYA 4L15A 2ZI5A 4BRUA 4BLOA 4DIEA 3I1FA 1UBCA 1Q0UA 1Z0DA 2C2HA 1VMAA 4Z8XA 3VR3A 2ZS9A 4G0NA 1ZNZA 1AS3A 3WMGA 3DOEA 3FYHA 3HU2A 4R9UC 1UADA 1NN5A 1W4RA 1WRBA 2RKOA 1A82A 4AY2A 3Q7QA 3A4MA 2C03A 5EXPA 2ZRBA 4WOPA 1E2HA 3H1TA 2O8CB 3LW8A 4HUQA 3DM5A 4XVUA 3EZ6A 1KSJA 1XD8A 1FQJA 1T6NA 2FF7A 4MITA 2FGJA 1RFLA 4V0OA 1G6HA 3GLHA 5GJWC 3RABA 4B2IA 2V7QA 3AVWA 4V0KA 1YJ5A 1XD2A 3SYKA 3HR8A 2FJUA 4BLSA 2J3EA 3SJZA 2VP9A 2W6JD 1KKMA 4XD7D 5AWFC 3UG7A 3WP0A 5L3VA 4JL5A 1KKLA 3OAAA 1E9FA 3B1VA 1CTQA 3RANA 4Q9LA 3LQQA 4YXWD 2BV3A 3CRVA 2ZS7A 3K8YA 4LJYA 1F2TB 2FSIA 4OI4A 4UNRA 1ZM7A 3WYFA 3QSYA 1FPMA 5DN6D 1UBGA 3FVQA 5J5CA 2A78A 4JJZA 2DBYA 2WPDD 4ZI3A 4GNKA 2XTNA 1KI6A 1RRPA 2ZEJA 2OBNA 1G3MA 1NVWQ 4JJKA 1HE8B 3K0AA 2EWVA 1TAGA 2ONJA 2A7QA 3C5HA 2RHMA 4DCTA 1M1YE 4I1VA 3KL4A 4TMWA 2A5DA 4FINA 4XWAA 3CF2A 3B2EA 3ZVMA 3AVUA 3OEHD 3FMIA 2UZIR 1LTQA 2YV5A 2QAGC 2WWGA 3FPAA 1OE0A 1ZMXA 4Z51A 5BW8A 1NG9A 3L8ZA 4OHXA 1Z6YA 1ETUA 2J1LA 2VP6A 1S1MA 1R5NA 1SVLA 4D80A 2IHYA 1ZNWA 2JAQA 2XITA 2I1QA 2GJAA 3EX7C 2A5JA 4YMSA 3WYAA 4JKYA 1SXJD 1H65A 2WOJA 3TAHA 5H8WA 1KO4A 1LNZA 2GVDC 4L9WA 5G53C 1SHZA 1E9RA 2G3YA 2WWXA 1E0AA 3N5CA 1M74A 2QTHA 5LD2B 1NN3A 1IJFA 3GLGB 4M1SA 1U2RA 4DT1A 4F92B 1EFHA 4QHSA 3OIVA 3VNUA 5TARA 1E2EA 2C78A 2KI5A 3QPVA 2DCUA 2WAXA 3VX3A 4QBHA 3VU9A 3K53A 4AKGA 1XMVA 3G0HA 1YR9A 1RJ9B 1OHHA 2WWHA 2VHJA 4GFDA 2RGEA 2VIIA 4OHZA 5GJBA 1RYHA 1XJCA 3GJ7A 4ZCLA 1IBRA 2KBFA 2A5FA 1KY3A 3LWNA 1W4AA 2R44A 4F4IA 2ZJOA 3HU1A 3PEYA 2JJ2D 2QMUA 1US8A 2AFHE 1FTNA 3KUDA 4LCBA 4QXAA 4M22A 2J0UA 1E2LA 2NO1A 4IFBA 4D4JA 3U7HB 1U94A 4AG5A 5FTKA 1FMLA 3FFBA 1XNJA 2AWOA 4XJXA 1ZD9A 4LYHA 1PZNA 2BMFA 4DLVA 2JLRA 2OT3B 5FL7A 1YZQA 5GJVC 4Q01A 4QM7A 2W2VA 4Y0AA 1SXJC 1KNXA 2IYRA 4ILEA 821PA 5KU1A 1E6CA 2ZTSA 1LF0A 2CHQA 1AJEA 3B9PA 2EQBA 1W4BA 2W6ID 4FI3C 5CDFE 2QG6A 2CBZA 4UQOA 4LC0A 1W5TA 3LDAA 4WZBE 3QBTA 4EAQA 4TTQA 3O8CA 4HUQB 4DLSA 1R2QA 2VP2A 1OKKD 2X2EA 2EFCB 4B6FA 1JALA 1GNRA 1BIFA 3VHXA 5JJKA 1OIVA 1PUJA 1RVDA 4M8NE 4WVFA 3GLHB 2RAPA 1E2GA 3MFYA 4I4LA 2WMOB 4RJLA 5JLJA 1OB5A 1AZSC 1CKEA 1XD2B 4R98A 3VR6A 1T0HB 4M9XA 2N46A 4AC9A 2EYUA 4URVR 1GM5A 3SYLA 4TLDA 1CU1A 2VRWA 4DIDA 3BH7A 5E4FA 2LKDA 2DY1A 1WE2A 1IN5A 1ZVQA 1SHKA 4URUR 5SZJA 3SC3A 4DSUA 4KLZA 621PA 4WAUA 2HUPA 2WKPA 3PCRB 2RGNA 2OG2A 1V5WA 4EDHA 5KTYA 2ZE5A 3N70A 1OLOA 3EIEA 5KNCA 1Q44A 3HR7A 1QHYA 2OFWA 1ODFA 1HUQA 5DIFA 2O8EA 2OFXA 3EG5A 4M4SA 4NBSA 3K0AB 5ANRB 4Q48A 5J47A 3L0PA 5HZKA 1QHGA 1PLLA 3JVUA 4B73A 4YQFA 4W5WA 3U7FB 1X1RA 2D06A 1KO8A 1E1QA 1E79D 1QVAA 4TSFA 4A9AA 4KSBA 2PZFA 2ZIAA 1QVRA 1G3RA 2VSOA 3CW2A 3VMFA 3KJEA 2HT1A 3KJIA 4LC1A 4PHHA 2V6JA 4P33A 4DSTA 3BIFA 3TR0A 4AWXA 1JR6A 4LJ4A 3SI7A 2AXPA 3KX2A 1H8HD 3L2OB 1KI9A 4AURA 1SULA 1K8RA 4MRRA 1Z6XA 2GVZC 4MYUA 3UPUA 1G8YA 4XWKA 1KAGA 4QBIA 2WHXA 1LV7A 221PA 1Z0IA 3QEJA 5JSZA 1NVUQ 2ZYWX 4B3DA 4G5RA 2JLSA 3FKSA 3F0TA 5JCPA 3UMSA 4FWIB 5CK4A 3P20A 4PAOA 4G5GA 4MKIA 5LBIA 3AVTA 3HYTA 4AIIA 3KJGA 4QM6A 3BE4A 1QHXA 3IO5A 4NL4H 1FTSA 3CH5A 2EU8A 3IPYA 2D2EA 5AJXA 4W5JA 4MA4A 1G9XA 2HT6A 2YWFA 3A1WA 1TNDA 4ZDJA 1T5LA 2OV2A 4C9BA 3BOSA 2F9MA 4X8OA 5CB8A 3AQ4A 1YKSA 3OESA 4YC7A 2F9LA 1SVOA 3W9YA 1E1RD 2O0KA 2CJWB 1Z2CA 3T15A 4C0JA 4RY2A 1G3IA 4Q5IA 3K1JA 1U8ZA 1ZBDA 3EASA 3LVRE 1FUKA 4HLCA 5FPHA 4DC9A 2J7PA 1NLZA 4CIDA 4ZI2A 2Q9BA 1M34E 1VECA 2C5LA 1FOEB 2V7QD 1L2TA 1JB1A 5FBWB 3SQWA 2NPFA 3AKYA 3PEUA 2QT1A 1KMHB 1NIJA 3GJ0A 2Z83A 4EKDA 2ZRGA 4KJZA 1R0YA 4Q9HA 4C4PA 2ZRHA 3OAAD 1G18A 2XZPA 4PR0A 3FGNA 2J0VA 1ZM9A 2CVHA 2B21A 2F1HA 2FSFA 2FMXA 2ATXA 3CNLA 3S1AA 2XNDD 3N2IA 4DCUA 4KFUA 4QKQA 3SJBA 5JFGA 4L5BA 4NMMA 3W6OA 2ZSAA 2AL7A 1CR0A 4TLEA 5AK0A 5J4VA 2XNSA 4FXPA 1GNQA 3U7GA 3K0FB 2MSDB 2D4HA 2W83A 1I2DA 5LPNA 1HTWA 4S2EA 3ECCA 4QBFA 1IY2A 4LDJA 2VP0A 3TSWA 2H92A 4DJTA 3KTAB 1VCMA 2BKUA 1AIPA 3O8DA 3IUYA 1M7BA 1N5KA 3MWKA 4MUBA 1T91A 1P2SA 2G6BA 4KSCA 2F1IA 4HB0A 2JJ1A 5FPTA 2R65A 3TH5A 4Q7LA 4WBSA 4DUGA 4TL6A 4RKEA 3WXMA 2WBLC 3W5JA 1GKIA 4TQUS 4MGYR 1W0JD 3THYB 3TK1A 3BFVA 4CGZA 3IEUA 1Z0JA 2KWIA 4PSVA 3UANA 3LXRA 1II0A 2Q3FA 2PT5A 1R10A 3NH6A 1VG1A 4Q19A 4B32A 4FIDA 2ZRIA 1IM2A 2VHQA 4F7WA 3BB3A 1KDPA 1YR7A 5L3SA 1G21E 4EPYA 3PV0A 4UXHA 3K70B 3K9LA 5AJZA 5GJCA 2QSYA 2XJ4A 3AUYA 4JIMA 2Q0HA 4LHYA 2QSZA 5LB2A 3WMFA 5JJIA 2HF9A 2O52A 1BH2A 4B75A 1JAIA 4DXAA 4AD8A 5B58C 3DO6A 3AVQA 5SZHB 4B44A 4HDCA 4O2LA 4TWZA 1ZC3A 5EJEA 1XDBA 5FOWA 5FR2A 2CCGA 1WA5A 2R6AA 4QGGA 1UBFA 4CEIB 3CRMA 2UKDA 5TVKA 4BFXA 4UNQA 2Y8EA 3UIEA 3AVOA 4D4LA 3W3AA 1FFHA 1QG4A 3WRYC 1Z06A 1AKEA 1Q21A 3AKDA 5JBQA 3I73A 4JVLA 3SFZA 4WIAA 3DMNA 1DS6A 1Q3HA 2W0SA 1AS0A 2WIBA 1W36D 4DCNA 5JMTA 2ZS8A 3U5ZB 1LW7A 2GXUA 2W6JA 5CIWA 4AI6A 5FL7D 5DNYB 1NJGA 1ZUHA 2OHFA 3RS7A 2GILA 4IOKA 4US0R 4PTLA 4ZO4A 4OQMA 1XXHA 1P7CA 1XEXA 1JI0A 2IX3A 1XCMA 3X1XA 4DZZA 5FUWA 3RNLA 2LCFA 4PPQA 1W46A 1WBBA 2WPDA 4E22A 1NG1A 3PUWA 3T34A 2GK6A 4AKEA 2QENA 1T3SA 2GZHA 4BFYA 4F4JA 4POAA 3R9WA 2HXYA 2C96A 1NMYA 4M9SA 1MT0A 4C0KA 1MO4A 4M9QA 2RGBA 1G64A 1KIMA 1JR3A 3VR4A 3OEHA 1ELOA 3QPUA 1BMFD 3A58B 2Q3MA 1KSGA 4Q7KA 3PEWA 3G5UA 4QJ5A 2ZVPX 5DO9A 3W6PA 4KFRA 1OT3A 4MYCA 2BEJA 3R9IA 2FFQA 3AP1A 1I4DD 5CJPA 1EFRD 4LRWA 3FE2A 3QKTA 5AR1A 2PZGA 1KI2A 1KJWA 1S8FA 3KB1A 1G16A 3S1AB 1E2IA 3TR5A 4PC6A 1SXJA 1SKQA 5D3QA 4GBMA 2QP9X 1MH1A 3H0KA 4TTRA 1FNNA 1N25A 1IOZA 4TT3D 5G40A 3RS4A 1Z0AA 2WMNB 1BO6A 3EA0A 4PQFA 4EPXA 3DZDA 4A92A 2QRZA 2OO7A 3R8FA 3QXSA 2PMDA 3VR1A 1NN1A 1WP9A 4EQ6B 3PEVA 3MMPA 4NZYA 2ZRPA 3FHCB 4J0QA 5HCIA 1E1QD 4TSFD 3NBXX 3RS3A 2FN4A 4A1FA 3AP3A 4D25A 2D74A 3BORA 2F7SA 3QKRA 1QHSA 3WNCA 3C7KA 4PPGA 1F60A 1U9IA 2RGXA 4L8GA 4DSNA 2ODWA 2JJ2A 2WWIA 2IYYA 4WA7A 1YU9A 3CPJB 4HSEA 3R9XA 2IS6A 1E99A 3KKPA 2ANBA 1XEWX 2CMKA 4PSKA 2WM9B 4PXAA 2ZYVX 1TEVA 2NO6A 2PEZA 3FTQA 4BLQA 3ZD7A 2ECKA 3L0OA 3QE0A 5CITA 1EGAA 3AUXA 2JIZA 2W00A 4XH9B 3UMRA 3REFA 2GXAA 2A9KA 2Z4RA 1CJTC 3E5HA 3QXXA 4V02A 1YR8A 1KI8A 3HWSA 4B34A 4PHFA 2HCBA 1N2CE 2JLZA 1M2OB 2BBTA 2W6IA 3UMFA 3VFDA 3EPLA 2P67A 3NBYC 1Z5ZA 3Q5EA 3FFAA 5EXSA 4AYXA 1NMZA 1G7CA 3HU3A 3CRW1 3KUCA 4M53A 4BEBA 1N5LA 4Q4AA 1IN6A 2PZEA 4TLAA 4PQYA 1QBKC 1NSTA 4EPRA 5IK2A 2BHRA 3D6TB 2CNWD 1VG9B 2YYZA 4TLBA 4AKHA 2XEXA 5EP4A 1WBDA 2EFDB 3FMPB 1G5RA 3EW9A 2ZAMA 4B2LA 2VL7A 2YVUA 1ZINA 5FTLA 3ZQ6A 2HJGA 5JZVA 2FV8A 2PX3A 3QXJA 1TQ2A 3SBDA 1RYFA 5FBQB 4HAZA 3ADCA 1E4YA 4KBFA 1KK3A 3CRQA 2VLIA 5F3WB 1D8TA 2HCJB 2OCPA 3BAFA 2OCAA 2ZI6A 3B1ZA 2AX4A 1TU3A 5F2EA 4B47A 2O8BA 1XXHB 1GSIA 1RZ3A 1XEXB 1YQTA 5E7IA 4A0GA 3L8YA 1G17A 4KCGA 4PC7A 3SS8A 2RCNA 3EARA 1NVVR 3GEHA 1JPJA 1NF3A 2LKCA 5D3MB 3H86A 1G8PA 3EXAA 3LBHA 2V3CC 2DR3A 4NCIA 3GJ4A 3L82B 3T1QA 4Q9JA 3EPKA 4LSGA 4ZDKA 3HJNA 3LFUA 2JASA 3U4QA 1DAGA 2YWEA 3LW7A 3U3KA 3ADDA 2FFBA 3NBFA 4M1OA 3GLFB 5GVRA 4BFSA 2QRNA 2OSBA 1E79A 2GZAA 3IKJA 3BRWD 3U6BA 1A5TA 3B85A 1G8GA 3LX5A 5FBVB 1S96A 4JL8A 1UFQA 2GA8A 1DTSA 1KO5A 2V8OA 2ZRMA 3ZVLA 3KDSE 5J4LA 4I1OA 5EE0A 1Z6TA 4W7SA 2QY9A 2W2TA 1E2QA 1MABB 3F5FA 2B7CA 4Q47A 1ZM2A 2H16A 4LHZA 5G3YA 1LS6A 3T1TA 2W0MA 3QUSA 4TL9A 8OHMA 5TDHA 4NYMR 1OSNA 4UXJA 2GBLC 2QUZA 3LXXA 1B23P 2JJ1D 2ZUDA 2GCPA 4XTRA 2C04A 2EFEB 1VPLA 3TRFA 3OHMA 4DUGD 1G3QA 1U0JA 2WWFA 3CF0A 3CZQA 4EJSC 1UF9A 3U44A 2ANCA 2OE2A 3B6EA 4DRZA 4DDUA 2GJSA 3OF5A 3UXMA 3KQUA 1CIPA 2AXNA 2AFIE 3GFPA 4HB2A 2FPLA 4LX0A 5FTNA 3HP1A 2GRJA 3X2SA 3CNNA 2GK7A 4A0FA 4TLCA 1G41A 5KSOA 2YNMA 1TADA 3NC0C 1N0UA 3ZZUA 1E0SA 2BM0A 4A15A 4B3GA 3CONA 3B78A 3L0IB 1VG8A 4EFNA 1C4OA 2YC2C 1W2HA 4F93B 4HLUA 1XCPA 4JT4A 4C0AC 1AA9A 1P73A 1GL6A 1P9RA 3DPUA 1J2JA 4LJ5A 4IJMA 1EWRA 1GAJA 5FTMA 4DLRA 3WY9A 3V4FA 1OJLA 3H4MA 2OEPA 2QP3A 3WHKA 1E1RA 3P4YA 4JLJA 2P2LA 3SR0A 2F6RA 3THXA 3CX7A 1VCNA 2FWRA 3FKQA 2QBYA 3IIJA 4ERNA 1OW3B 3RDPA 4GSYA 3Q85A 4AG6A 1XPRA 3AF2A 1P62B 1YZTA 1GUAA 3DMDA 4LPKA 1E69A 4DCSA 4EPWA 2FNAA 1XMJA 4PX9A 4JLVA 4YONB 2XSZD 2GF9A 3RS2A 5DI3B 1HT2E 1T5IA 2NO7A 2ZI3A 5H70A 2P6RA 3ZD6A 4Q1FA 1N6IA 3FB4A 3PQCA 4BFZA 2EW1A 1ZU5A 1UM8A 4Q4JA 4K8OA 2IWHA 1NY6A 2I1VB 1DAFA 1TX4B 1SGWA 2OBMA 3LD9A 5BN5A 1D2EA 2XNDA 1R5OA 1G5PA 4LV6A 3X1DA 4UKDA 1G8FA 2J46A 4UJ3A 4MDFA 4NDZA 2IXEA 3QVVA 5FOXA 3NWJA 3R20A 2OCYC 1KDTA 2P0EA 1P3JA 4TQAA 2N42A 2JA1A 3I32A 3A1TA 4YLGA 3KQLA 3THWA 3RAPR 5K8UA 2H18A 3K0EA 1D9XA 2AD5A 1LS1A 2BCGY 1JAHA 4GOKA 3ZS8A 4MRNA 3C5CA 1JR3D 3RRZA 2ZAOA 2X8AA 1HY3A 4HZUB 4E5UA 4MRSA 4LBVA 1E2PA 2O8BB 3MWLA 1YZUA 4TYQA 3RSLA 5C46F 2EVWX 3KZ1E 4HAWA 5KDLA 5CYPA 1S2MA 5TV2A 3GLIE 2B92A 3BC1A 3TSZA 4RD3A 2QGZA 2F43B 3RS5A 1T8UA 2AK3A 3CR8A 3O8BA 1E98A 4EUNA 2J41A 3AF3A 4DLUA 1KY2A 4ZIRA 4OQLA 3W6NA 4Q1BA 1AQYA 2BC9A 4A0RA 3IO3A 4IHQA 2J5XA 3TVDA 2H8KA 1UEJA 4A2PA 3U4QB 4Q9KA 5KDDA 3MAAC 3NEJA 3ONWA 1R8QA 1W0JA 1G1MA 1A1VA 1N6RA 1HQCA 3W34A 4CDGA 1R4AA 3PVSA 4MDEA 3EPHA 5EZ6B 2REXB 3CPHA 5EUQB 3ASZA 2QPAA 3ZVRA 1AGPA 2QPTA 4Y0VA 2V9PA 1JECA 1R0XA 1D5CA 1WMSA 4K46A 1EXMA 2W2XA 2FSGA 2HYDA 1ESNA 2MMCA 1KMQA 4KO8A 1ZP6A 2XJ9A 2IYZA 3T1VA 5CM9C 2ODNA 3FWYA 4ESHA 1NL3A 4RZXA 3OIWA 1OYYA 1KK1A 3CLVA 4BWYA 2RB4A 1WQ1R 2V55B 3IIKA 1U8AA 1MRSA 3BS4A 3AGPA 4GT1A 4A2QA 4ZCIA 2VHCA 1EESA 5L3RA 3W8RA 1ZAKA 2ZI9A 1KTVA 1ZCAA 1Z47A 1Q20A 3K9NA 4NCHA 3RWOA 4H1UA 4M2LA 5CDFA 3KXIA 2MSCB 3NDBB 4BLPA 3GJ3A 1HURA 1S0UA 3AF0A 3B60A 1CJKC 3OZXA 1VTKA 4G5OA 2X19A 4GI7A 4LUCA 5JWHA 2PJZA 4A8JC 5F98A 3JZAA 2ZM5A 2IXFA 2QQ0A 4IVPA 2YC4C 2OCBA 5K8IA 3QNUA 2C99A 5HPYB 2ZANA 2JIZD 2V4ZA 1MR3F 3B9QA 3W90A 5IT5A 2JLQA 4P4SA 5BN4A 1DG1G 5G41A 2CDNA 2BM1A 2XAUA 2O8DA 2IYWA 1BYIA 1YZGA 2HF8A 1ZJ6A 1FMJA 1DAKA 2YOFA 3TGPA 4QL3A 4PO9A 2ODEA 5B2ZA 3TE6A 1NBME 5J40A 4JVMA 1H8ED 4PPNA 2IEYA 1J99A 1RE0A 4OKSA 1ZNXA 2QM8A 3RYTC 1Z63A 4D2IA 4Q21A 1NKTA 3VTKA 1E94E 3ADKA 2WKQA 2QNRA 2O0HA 3TBKA 4BQSA 3PUVA 3Q8XB 2QBYB 3PIRA 5IK2D 4RCZA 1TF7A 2WJYA 4HB4A 3CRRA 1N6NA 5FI0B 2C95A 4P4TA 2ZRLA 5FBRB 3IHLA 5H68A 2RMKA 3LQRA 2DFLA 1BMFA 1Q1EA 1N5JA 1NVVQ 3GFOA 4G3XA 4M21A 5HCNA 3TQCA 1MO3A 1X6VA 2FFHA 4QNRA 3W3ZB 4Q4JB 4NE2A 4ZKDA 1NIPA 3VKHA 5HKKD 1EFRA 1IXRC 2HDNB 3BK7A 2CHGA 1KZGB 4LYJA 4URYR 5DH9A 1D6JA 3C4JA 5JECA 3ZVNA 3MJRA 4PFSA 3GCGA 3IGFA 4HLQB 4OHYA 2HXSA 4BASA 2ERYA 4TT3A 1KI6B 1BOFA 2R6DA 3A36A 2VTKA 3SYNA 2KJQA 4OI2A 1XX6A 1OPXA 5IHPA 1NRJB 3KXKA 5FOSA 4JLBA 2FDCA 1ZNYA 1A2KC 4JS0A 1KK0A 3SDZA 2Z0MA 2VBCA 3GJXC 1P2VA 4RVCA 3B1YA 4NYMQ 2RH5A 4M1KA 2G9NA 4UNPA 2AR7A 4B43A 1IQPA 4KYUA 4FWTA 2QAJA 3VHLB 4FMCF 4ASUA 3GPLA 1S3SA 4A82A 4ZIRB 3K0SA 4KYIB 4CW7A 5TB5A 2JEOA 2ZI4A 2XXAA 1SVMA 4BZQA 1GG2A 4DDWA 2X77A 1P2UA 5IF9A 3Q3JB 1TQDA 2VA8A 1EFUA 5KYKA 4B6EA 3VR5A 2D3WA 2QZ4A 3CM0A 3RRNA 2VYFA 4MKHA 4KXFB 1AM4D 4DT1B 2ZROA 1OXTA 3LAWA 1E9SA 4LV5B 5EXXA 2IYSA 3KQNA 3SOPA 3HPRA 2NZJA 5JCZA 3AF1A 1G291 3M4YA 4TTPA 3VU9B 4US2R 1GL9B 3QBVA 1X1SA 1DG3A 2R2AA 4LZZA 3B7GA 2QTFA 1WDTA 1HEIA 1GVNB 2YZ2A 4Z54A 3K0CC 3LH5A 2HV8A 2XOKD 1Z08A 5JS7A 2ZE6A 2MMGA 5HZHA 5JEDA 1US8B 2CNWA 2K5UA 4JKIA 4BUJA 2G0TA 3MG9A 4IDPA 1KJZA 2J0UB 4BFTA 3JVVA 4AKIA 2PBRA 3A4NA 2OM2A 3EZFA 1W36B 2ZRKA 4NYJR 2IF2A 5HE9A 1D2NA 3CUEF 4P4SB 2JLUA 4XTCS 2ZJZA 4NCNA 3LNCA 3UG6A 1YZNA 4WW0A 2BBOA 4EJSA 5DYGA 1XB2A 5JRZA 2DHRA 4YMVA 1IN8A 3HYRA 2Z6VA 3OE7D 4JMPA 4FW9A 2R8RA 3TUIC 721PA 4G5QA 4QC2A 121PA 5LD2C 3BD9A 2KSQA 1Z3IX 4N0EA 1AGRA 2UZ3A 5JI2E 1COWD 4O3MA 4QRHA 3RVBA 4ZCMA 4CT4B 4C3ZA 4C0QC 1E2NA 4F91B 2WJHA 2XZOA 2GCOA 4PHTA 3T5GA 2ZRDA 2AKAB 3QG1A 5KOYA 5F9FA 2WWWA 3O47A 4LGMA 4C2TA 4RZUA 4LJAA 1GTVA 2QMHA 4JYBA 4NYIR 4DHEA 5EP3A 4TMXA 1HV8A 2EYQA 2OILA 4OHWA 4OK5A 4DLYA 1OXUA 1TL7C 1X8LA 4Q7MB 4LJ8A 5E3HA 1XZPA 4DEXA 4JBWA 4QHYA 5TXGA 1HT1E 4MRVA 2ZJ5A 2NG1A 1IY0A 1IAQA 1KI3A 2REBA 2ZRNA 3TIFA 4TMVA 3QI2A 4M1WA 3TW4A 3ZIAA 2O8EB 2J7KA 4HATA 1O87A 3IIMA 2ZREA 1XTRA 3PUXA 1E2FA 3I8XA 4JSTA 4FN5A 2C8VA 4OJQA 3B82A 4KU4A 2E1RA 3P4XA 2NIPA 4Q4HA 5FPYA 4BFWA 3JZMA 1DEKA 3X1YA 4IFEA 3SU8A 2LWIA 2Q21A 4FCWA 4XVRA 3RSOA 2IF0A 3PENA 4CEJA 1BS1A 4NCKA 1G3UA 2PEYA 3CB4A 5LB4A 3BFXA 4URXR 5DGXA 4HAXA 4KAXA 5DHFA 4H9GA 1TEXA 5C18A 2DB3A 4R2HA 2C98A 1EFCA 3ETLA 4OQNA 1AQUA 1TUEA 4E09A 4GRAA 1SQ5A 3GEEA 3RRYA 4PAQA 3QJYA 1RKBA 2TMKA 5A0FA 3GJ8A 1W2GA 2QAGA 2E87A 4JLDA 421PA 2OUKA 2VH5R 1DAMA 1XEFA 1JPNA 5E7JA 5KPDA 1NBMD 5H1YA 4LHXA 4LYAA 4QGHA 5JSZB 2ASEA 5JRJA 2G88A 3QF4A 3I61A 2H1LA 1CS4C 2WVJA 1OF1A 4DWJA 2JLVA 1CJUC 4CT5A 2IUUA 3QKUA 4IXMA 4JLMA 1II8A 3EWAA 4OK3A 2XSZA 2CLSA 2G1JA 1IN7A 4D81A 2HEIA 5TMPA 2CHVA 2OLJA 1YVDA 2BOVA 1DELA 3AVPA 3V4RA 1W0KA 1UEIA 4URZR 2CXXA 2P6UA 4S35A 1TPZA 4N1AA 3SFVA 4I1SA 3GMTA 3GD7A 2CE2X 1NLYA 3OFNA 4LBYA 2O8FA 2PJRA 1VYVA 3WYGA 2CVFA 1LVGA 1CR1A 4D4MA 4N3NA 4V0ME 2H7VA 4D0GA 4A36A 3GQBA 2QP4A 4JL6A 4JVSB 1W7AA 5HR5A 3TVTA 2F55A 3AGQA 5L3QA 2BJVA 2IEZA 5DI9A 2YINC 3MUFA 5JWRA 1EX7A 2HLDA 3A6PC 1GKUB 1XBTA 2DFNA 2FZ4A 1K6MA 3TNFA 2B6HA 2ZJAA 4BZXA 3NC1C 4BGDA 4A8JA 3AF4A 4TN1A 3ZH9B 1TU4A 1M8PA 4B3XA 5AJYA 1AS2A 2A2ZA 3KKQA 3KJHA 4XSGA 3TMKA 3WMEA 3VAAA 2E9SA 5EP2A 4GL2A 4JVNA 3QQ5A 4Q18A 3IDQA 3FMOB 4UNSA 2Q6TA 1J8YF 4QFMA 1AN0A 3RHFA 3RWMB 1TUIA 5CLQA 1AK2A 2VPPA 3K09C 1LY1A 4G01B 2ZU0C 4IDHA 2CEAA 1JXMA 1N6PA 4MGKR 2ZU6A 1JNYA 3W8NA 1DAIA 2IUTA 4ARZA 4CRWB 1WCV1 1ZCBA 1ZUNB 2FPKA 4HUTA 3P27A 1UKYA 4US1R 1Z83A 4AYTA 3IPXA 3WNDA 4G5SA 4DSOA 2VQSA 3TKLA 5JHHB 4ASUD 2RGAA 3ZQJA 4PO8A 3IBYA 1ZYUA 3AVYA 3N2EA 1W1WA 1OH7A 3A1SA 1GRRA 4XIGS 4NCJA 5J4HA 2CK3A 1ZC4A 3GJ5A 3CX8A 4PPFA 5JEEA 4JLAA 4P0TA 1NJFA 4JLOA 1X8JA 4Q4HB 2V6IA 5JI3E 2WZQA 1KYIA 4MUAA 1F6BA 2EFHB 4P3YA 1EK0A 4OQXA 4OYHA 2ZR0A 1F48A 3DM9B 3ASYA 1L4YA 3U61B 4CEJB 1LB1B 2J45A 5KO2A 4PANA 3REGA 5L3SB 3WRXC 1E9CA 4A0HA 1FNMA 1Z6GA 4C2UA 5SZIA 2EWWA 3FDIA 1SKYB 3Q72A 4IDNA 1DPFA 1H8EA 2QEQA 3UKDA 2QT0A 1FW6A 3QEOA 4E07A 2ZRAA 2ZSBA 1OFUX 4GMDA 4EPVA 1KSFX 2QAGB 5BYJA 2ZJ8A 3D7MA 4IW3B 5FUXA 2H57A 3I92A 2WWYA 1B0UA 1OIWA 3IQXA 1DVRA 4KVGA 2PX0A 4HLDA 5FPKA 5EUMA 3QF4B 2IS2A 1VCOA 1MO5A 5IDVA 3I8SA 1JEEA 6Q21A 3CR7A 4RD0A 4Q7JB 1NI3A 4U00A 1XP8A 4ITRC 1N6HA 3VKWA 2WOOA 4HAUA 3CPEA 5HKKA 1RRFA 2ZSDA 2CCKA 4KFSA 1W4CA 2IYLD 4NH0A 4IDQA 5C4MA 4HDQB 1F2TA 3CH4B 2A5YB 1C1YA 3OEED 3SBEA 4L16A 3GFTA 1R6BX 4IRUB 4ZPXA 3U3MA 2PMKA 3AP2A 2X2FA 4B71A 4NYIQ 5L3QB 4BLRA 3ICQB 3H84A 4MH0R 4RCYA 3K70C 1NNEA 5C1BA 3FHOA 4A2WA 3K0CA 4C30A 4LBZA 3KKNA 3NTUA 1T8TA 3A8TA 2I3BA 4DBLC 2J0SA 5CK5A 2GEUA 2FE4A 2GXQA 5E7MA 4IEEA 4LBWA 2P5SA 1SVWA 2BBWA 1A4RA 3VQTA 1I4LD 5FPSA 2UVQA 5DYIA 3WHLA 2IC5A 4ABYA 3EAQA 2NMVA 4Z1MA 1VKJA 2G0NA 1AKYA 4QGFA 3QXHA 2ZPTX 1SXJB 1ZM4A 3X1ZA 1VIYA 2QA5A 1FUUA 3MSXA 3I62A 3SQXA 2ORWA 3KKOA 4OI0A 4AK9A 5BQ5A 4YDSA 3SE0A 4TMZA 3ZIAD 2ZSEA 3GLGA 1KO7A 5FBLB 3BH0A 3L43A 5FH9A 2GCNA 3BH6A 1D2MA 3B5JA 1KHTA 4B3BA 3TQFA 5BYKA 4EFMA 1KZ7B 1GWNA 3C41J 4V03A 3V9PA 3ZZ0A 1K5GA 2DFTA 4D4KA 1R8SA 2XGJA 2OXCA 3EIQA 1JQLB 1OH8A 1OH5A 3MD0A 1YRBA 3SJAA 1KJYA 1U0LA 5FFMA 3QY0A 1IXSB 1E2KA 2WV9A 2Z4SA 1RJ9A 3QKRB 3RC3A 5AUOB 4IOLA 4XSHA 1RIFA 2BMDA 5KSYA 521PA 3SJCA
chains in the Genus database with same CATH superfamily
2X5XA 2QRKA 3T7KA 4CCYB 4BECA 3DDNA 2AZXA 5EE9A 1Z4KA 4EKGA 3G8YA 3RC8A 4BCBA 2C82A 3I58A 4GRDA 4NHOA 2Z2IA 5KJ6A 1DAHA 2DWOA 3BB4A 4J94A 3F8TA 2BIFA 3BIXA 2B20A 2QF7A 1BN6A 4KR6A 4OEHA 2UUOA 1K88A 2Z30A 4B45A 1SQGA 1Y8CA 1HDEA 2GJKA 3HXPA 3WG9A 3OE7A 4XIFA 1Q0PA 5CA1A 3P2OA 4Q1CA 4AJ9A 3UJ9A 4DNQA 1RW4A 2J48A 3KQKA 2Z5LA 2XKKA 1A8HA 3M8KA 2C92A 1L8AA 2C0PA 3DEFA 4UEOA 1KL7A 4BX3A 2G1AA 1COWA 2FW7A 1LKZA 3JQBA 3GVCA 1C80A 4XPZA 4MNTA 2YJTD 3GLIA 4UMVA 1J90A 4EK9A 3WK7A 2V3WA 1EVZA 4DVGA 4Q4LA 2H4ZA 3OZGA 3B1XA 3OPNA 4KO3S 2J9ZB 3QEMA 4XARA 4YCAA 1QGAA 4GWLA 4U3JB 1H4QA 2Z5FA 2GZMA 4D6PA 3K6SA 4DR1B 5IEJA 3AFHA 3O82A 4NG4A 4KPEC 3QFHA 1YQGA 2FZLA 5JS1A 2IEDA 3KPYA 5I9IA 1ZMBA 4FSXA 2Z2XA 3ZHSA 2OR3A 5AIBA 4N03A 2HCTA 2R8PA 4K7JA 1X7HA 3K1ZA 4Y1EA 1P7YA 3G0BA 5BOSB 4M1YA 3C6BA 4MIKA 1U28C 1NRXA 1V43A 1BOOA 2OC4A 3VR4H 2FLVA 2Q0QA 5FWDA 3G0IA 1RYDA 1VL1A 1UM9A 4WPGA 3SNKA 2QU8A 4B2PA 4NP6A 1ISIA 1ZNQO 3H5VA 1C1XB 4D9FA 4UUNA 4DABA 5TNXA 4PSAA 1JHZA 4EJ0A 2IYUA 2Z56A 1GCAA 2IIBA 1CNEA 5LDGA 2EC5A 2GESA 2UDPA 1JS1X 2W8BB 4PLYA 2GM9A 4TXMA 4QJ4A 1VHTA 5FADA 4EPTA 1CSEE 2WE8A 2IWRA 3KB2A 2GDJA 2PD3A 4FM9A 2ZVJA 2YWXA 4WZ6A 1J70A 1RR6A 3G8AA 2ODPA 5K8LA 3KJXA 4RH1A 3ZHTA 1TZCA 2H17A 4JELA 1IY9A 5DLQC 3RU9A 3VJMA 3F47A 1NPTO 2F67A 4FCTA 1UKZA 4X90A 3STTA 2VCEA 3WIBA 4YP0A 2PH1A 4F2PA 2CL0X 3KKKA 1F38A 5EIBD 1UK9A 4FHDA 1U7UA 4H1TA 3HUUA 8GPBA 1SEPA 1U8UA 3IEKA 4L7QA 3D1VA 3F9CA 2CXPA 3TFQA 3WBKA 3BGOS 2VPXA 4BVHA 5LYJF 5LYJB 3AR7A 3EK2A 2RHDA 1NZFA 2G07A 4CCSA 1N3BA 1KVTA 4FMDB 4FMDF 1V8DA 3ZGNA 1OJ7A 3NUQA 4JOQA 4UASA 4FT2A 1Y1LA 1X7DA 1WKVA 3DMTC 5B4VA 2H48A 3JAWB 5DE3A 1GFIA 5IRCD 4FDMA 3NB0A 4U2FA 4HDRA 1FYDA 1JXAA 1QPGA 2CLOB 2HYIC 2Q6OA 1EWVA 1GSHA 2WF6A 2NPIA 3D8RA 3K1YA 5ALWA 2O1XA 3ZPXA 4PC3A 1D7OA 2V0NA 4AMUA 3OA2A 4WADA 2IUSA 2FXIA 4K6HA 1NM5A 1U0RA 2W6QA 2C77A 4O08A 1DCFA 3TE7A 4OHUA 2ZPUA 4LJ6A 1H0RA 3GIWA 3LYLA 3MLEA 4A16A 2HLNA 1UK7A 3PXXA 4HAYA 4KHZA 1UDXA 4RKFA 3CBGA 1GDDA 4W8OA 3W5DA 1KFEB 1YR6A 1XTKA 2V1UA 3PRHA 4G09A 5F7XA 2PS3A 4E2WA 3ENKA 4MI1A 3FOZA 4E5YA 2WHQA 1Z7EA 4K81B 1PSWA 3QNWA 3K5IA 1G19A 2BONA 3UAYA 3R3JA 5JJBA 3CCBA 3EZ7A 1NMQA 4IXNA 2CJWA 2QVBA 4BUCA 2NM0A 3L7JA 1TK3A 1E96A 4U2KA 2OLKA 3A10A 1F8XA 1GNPA 1GPMA 2JPDA 3LY5A 5SY9A 4WEOA 3I0NA 5AW4A 1L8QA 4DKJA 3QVGA 1C3OA 4F4CA 3I2IA 2RH9B 3JASB 3AFNA 2QZ9A 1TC1A 1M7HA 1WCWA 3OT5A 1C7FA 1WEHA 4IIJF 4V0NA 1AXEA 1HT3A 3PDHA 3BCUA 4XM1A 4FHGA 2RIRA 3PR1A 1A9ZA 3QVUA 1J2RA 1M1YB 4D9KA 3IULA 4IS2A 2G17A 4BQOA 4HEA1 2GLXA 1D1SA 1KI1A 1P4RA 3I34X 5HTKA 5L4NA 3E5MA 5DNVA 2B1GA 3IVXA 4OI1A 5CU7A 5LQSA 3CN9A 1MEEA 3KKMA 4IH9A 3PZBA 1YK0A 5IAGA 2AJCA 1TGYA 4GS5A 3REQA 3BB1A 3T6KA 5KIAA 4IKEA 2HW8A 1B0AA 3NHAA 4D1YA 2IFTA 5DM2A 3EGVA 3MF4A 4IRXA 4LK2A 2EL7A 4YACA 5JHGB 3CT6A 3JYHA 1GKKA 3HE3A 3L4SO 3Q6IA 3UA3A 4NARA 3ZHBA 1YHYA 3AM1A 2BFBA 3LKZA 1XZKA 4R84A 1Q12A 2TECE 3LF2A 3K0FA 2HA5A 5AIAA 5K4AA 4KAAA 3WBJA 4EUEA 2GF0A 3PHHA 4N5IX 2XE6A 1ZM3A 2WD9A 4OHVA 3M7IA 3UJAA 1R15A 2EQAA 2O3JA 1PAUA 8ATCA 4B3CA 2NXJA 3UCEA 4KOAA 3GGGA 1QCZA 2DFDA 1Z36A 1GPDG 3PDUA 5JWOA 3TJZA 3CXUA 3NUZA 1DKNA 1COZA 1KO1A 4YAKA 3AI1A 5H4HA 3U4AA 2JB9A 1PLKA 3RVPA 2Q4EA 1A88A 3NXKA 4V0LA 4FMCB 3HB5X 4DNXA 2WW8A 2BJWA 1HDXA 4NAHA 3OZCA 1LWNA 1LWOA 1YDWA 4XB6B 5FOTA 4Z1MD 5F9HA 1UXOA 2JZCA 3FPCA 3IVAA 1P33A 1V8FA 1L5HA 3UOAB 1OLXB 3H8JA 2G36A 1IJEA 1EX6A 2HQBA 2V6FA 1F3OA 1WTCA 2CYCA 4HRAA 2VF5X 2PUJA 2R6CA 2HMYB 2VZLA 1Q1QA 3NVAA 2O3QA 2DH6A 4WXRA 1YBAA 1YDEA 1U7PA 1P60A 3JR7A 1U4NA 4FW8A 1F4LA 2OL4A 1SR8A 1ACLA 3H75A 1TFUA 3MLAA 3FCSB 3MWDA 4X8MA 3OZTA 2PUWA 3PA6A 4ETWA 1RZVA 5EQTA 4F8EA 2BR3A 5CVVA 3B8HA 3GGSA 4J29A 1PGNA 5EPUA 4YRLA 2OHGA 5JCOC 1PV4A 3RVKA 3GEIA 2ZG6A 4B4KA 2F4VB 3UWKA 7GPBA 1AHIA 4IVRA 2AEJA 1EJ6A 2B37A 1ZN8A 3CIOA 3NX4A 3SZLA 2EP7A 3BPSA 3K0BA 4D82A 3IHWA 1MX5A 3PFIA 3OQIB 3AESA 2D7DA 4DIKA 4DV5B 4EB0A 1DCMA 2P75A 4K1XA 3L79A 2IZOA 2XD4A 2CLDX 1FP2A 4Q9IA 3WIUA 3ZG6A 2A9RA 1AC5A 4IVQA 2QTVB 3UFBA 1AO0A 1IB6A 4CEIA 4ZZ0A 1IK4A 5CGQB 4M9RA 1F14A 1OZFA 2NTJA 4M9ZA 4FDUA 1L1QA 1ZH6A 2GNOA 2WT4A 1GAWA 1S8AA 1BFUA 2B5VA 3COVA 3IQWA 1WF3A 1CY7A 1MIOA 3DCYA 3NBQA 3NT2A 3OOJA 5FORA 3RU2A 1VHJA 4W9MC 3C70A 2QL6A 1XLVA 4I14A 4ISCA 4DJJA 1PVDA 2J4CA 5JSYA 1MAWA 3C5WP 3WTCA 2GBLA 4C4XA 4F4HA 4ZJYA 1LRLA 3LCMA 2SBTA 4W5TA 3PQ8A 1RAEA 5DN9A 5KDOA 2WHYA 1IQUA 1JDPA 3I12A 3ZLJA 3ONEA 1VHLA 2XCQA 4NVRA 1CUSA 1VSUA 2FMHA 2ZXEA 4QOJA 4ZVSA 3VZDA 4F38A 1SG0A 1TDJA 1W4ZA 4DDVA 1K9VF 1QHHA 1YMVA 1IXYA 3NBMA 2ASVA 2KW5A 3EIHA 1B1CA 2M9MA 4LDNA 1FS6A 2ZXUA 1NQAO 2JLCA 4TWIA 4D9CA 4PR3A 5EKDA 1SPBS 4Q3EA 4BJ6A 4JEHA 3H11A 3IV9A 3LT5A 2ZQ5A 1KFJB 2GOYA 2H5EA 2B8EA 2HA4A 3EVEA 2AKYA 1ZHHA 3N2KB 2V1XA 1IONA 3Q7PA 4AZ3A 1T9KA 4J49A 4B4OA 4OG2A 4HAVA 5KTSA 1EDEA 4R2MA 1DBSA 1LLCA 5LQKA 1CF4A 1XRSB 4LXIA 5E3JA 4CYMA 1ZHOA 3OMLA 1IRXA 1UCFA 3HNPA 2A3RA 3OPVA 3L0CA 2FUNB 4EITA 4EJMA 1QYVA 2QM7A 2A1TS 3RSHA 1WVGA 2E4XA 2C3YA 5JV5A 3IAEA 3SC2B 3W2GA 1GV1A 3AKEA 1PBTA 4HI0E 5A7GA 5JYBA 1XJ5A 3WLKX 4QGSA 1WZNA 4MVJG 1QWSA 3DTNA 4K9PA 1N0WA 3X43A 3O8OA 1W29A 4C0BA 1AUXA 1T2EA 4IBOA 1EUYA 3LPLA 5KUTA 3AMVA 2QE7A 2ZWMA 3OJLA 1KDRA 4GOXA 1TQ4A 5BN3B 3UK6A 5IN4A 4DMMA 4NH4A 1RI3A 5BSMA 4AL4A 3DWEX 1AKQA 1KR5A 2PJDA 3HXLA 1Z45A 3BMOA 4XB2A 3GARA 4NCXA 5IKPA 1IVSA 4TVOA 1M75A 1H2YA 3A6HA 5KTPA 3AEUA 2POCA 1RTKA 4IGEA 2GEBA 1GG9A 1R5BA 4YMUA 4YUWA 4ND6A 4LOAA 4HLUC 3VTFA 1PQUA 3RB8A 2PBLA 1TO6A 2RHWA 3F5SA 2AQ8A 4FGWA 4EQ6A 3ND9A 4QQFA 5U9CA 5BR1A 2GFIA 4YB8A 1BH6A 1ACMA 2O57A 2VSFA 3EFOB 4P35A 4QUHA 4L78A 3TL6A 3THRA 4DM7A 1E60A 3OJFA 4AMVA 1P0IA 1XAIA 3IS3A 3LY7A 5F52A 3IR6A 4QTZA 5CW2A 2UZ4A 3F5QA 4R41A 3QTBA 2XDYA 4UUPA 1RI1A 3D8BA 4QBKA 2VYND 4AJLA 5ALZA 3BT7A 3MS4A 5CD9A 4ZOBA 1NBAA 5KC9A 4RGQA 3VKFA 4F2WA 5HQ3B 1I5RA 4O25A 3C8ZA 3N2ZB 3PRJA 3ROGA 1EBBA 1SZCA 3N8KA 4GKBA 3ZEAA 3UICA 3R5HA 4Q66C 4EF5A 1D3AA 4IIUA 4MVJH 2QYHA 4CG3A 1VLMA 3LWDA 2MSNA 4YMWA 2WFZA 5F51A 4ZO6A 4B40A 4K87A 4OBBA 1H1LA 4MR7A 4BAGA 4HB3A 2C2OA 2QPOA 4IMPA 4O0LA 3RG8A 1JU4A 3V33A 2OO3A 3X1WA 1KI7A 5BR7A 3T5AA 1QTQA 3DDCA 1DAPA 4QBTA 4J9UE 3N2NA 1NLFA 1NSFA 1V71A 3PXAA 4QQ8A 4TYNA 4K9OA 4IEFB 2GERA 1GCOA 5KQLA 2WJGA 4YH1A 3SVTA 4E15A 4S05A 1M2OA 1EK5A 3WGOA 2VH1A 3RI3A 4KZPA 2WU4A 1PUXA 1SWVA 5F76A 3FLBA 1QF7A 1OHHD 1Z7BA 2NYRA 2YY7A 1NC1A 1LJUA 1TO2E 5AUQA 4BMCA 2J9YB 4YLYA 2C4NA 3C6XA 2HF7A 4DPLA 5GMOA 2OXIA 1JBQA 4MQBA 4YV2A 6REQB 1GAXA 1R5JA 5TF4A 4BO2A 2AG8A 1RLOA 2ZRQA 2UYYA 2VUTA 1LFDB 6AT1A 2ZUFA 2CY0A 2I55A 4FNAA 3ZY3A 3QY9A 1KU6A 5EWMA 2PLAA 3FN4A 1YV9A 3K9GA 4F9GA 2HMVA 2OCLA 5DNCA 2GAOA 4IH1A 4R1QA 1JIQA 2I62A 3A9VA 1FDRA 1XAGA 1XTSA 1SIOA 3J81k 2R6GA 4MV9A 1R4NB 2PRKA 2DKNA 3TAUA 5AESA 2J6HA 1JW9B 2OAP1 3PRYA 4XD7A 5C4IA 5ELXA 1MTZA 1UMBA 1PYDA 1DKMA 1IOVA 4JLNA 5CM8B 3WGQA 1ZRSA 1SBHA 2C9YA 3PNVA 1L1FA 3TD9A 2FGKA 5EXDA 2WICA 3FNBA 1DARA 1Z37A 1DOZA 5CVTA 3VPCA 5IS2A 4CU5A 2G1KA 1HXHA 3GFQA 4QECA 1KYVA 1G5FA 2G77B 3EXIA 1P6XA 4ZEWA 2MINB 2VO1A 2Z6UA 1QF9A 1KPHA 4TXHA 3VDQA 1T1SA 1T9HA 5CX1A 4DY4A 1DXYA 1H9CA 1RP7A 4P58A 3SX0A 3O9ZA 3F5DA 3HYLA 4D0RA 5BT8A 1SVIA 4GP6A 1NT2A 1PW7A 3U81A 3H6GA 3DAFA 3LA6A 1YJAA 3N8IA 2GCOB 3I4CA 2RGDA 4OBEA 5IJ0B 1QP4A 3AJEA 4KQHA 2IPAB 2X3YA 1Q1ZA 3P2IA 4QDTA 1A9XA 3MJDA 2NOAA 2QTTA 1B15A 2WVGA 3G89A 3OZEA 2RC5A 3UHJA 5FKJA 5T4EA 4FQ8A 3OQJA 2XB6A 3TLXA 3R1IA 2P65A 3L8CA 1JVBA 1L3CA 4OL0A 3L0SA 4PIVA 4RZ2A 4EO4A 1YZLA 4GW3A 5F7OA 1P72A 4Q9NA 1XTJA 5JZBA 4C4RA 3HM9A 3HEMA 4NRDA 1LBEA 5FUYA 1K6EA 1UMDB 3O4GA 3OTGA 5D2CA 5ENDA 3IC5A 2XUFA 5AJVB 4DJ5X 3E15A 1VSTA 2Y1FA 3HBFA 5HKLA 4XCXA 2UU9B 4PBTA 1WHTB 3COZA 3IQHX 3VTAA 4BX0A 4NPAA 3R7FA 4ZJZA 1T36A 2QQEA 1DQPA 4BIMA 3GLFE 4Q00A 2XIJA 1K4YA 2C9CA 3F8SA 4H31A 5LDDC 1DBWA 1PJRA 1W49A 4UCQA 3RFVA 3RVRA 1ODSA 1FP7A 4NONA 1SXIA 1MAUA 3R5KA 1WXQA 2HHJA 5LQMA 2ZR7A 4EA6A 1JDSA 5I7WA 2NNWB 4K9DA 3LLMA 2AOUA 3DOFA 3VI3B 5KYYB 4W8GA 3NPAA 4DLTA 3CKMA 2PX5A 1JLKA 3V4OA 4Z2YA 3JU3A 1HNXB 3CINA 3GEDA 1J1ZA 3I2KA 3WL3A 2Q3EA 4C7VA 5M04A 1NLMA 1E32A 3MCVA 3DC2A 3NOOA 4TMKA 4YQYA 3VOTA 3NEYA 1QHFA 2PR2A 2AWNA 2XX3A 3FIJA 2J6BA 3B20A 4O0MA 3ZYCA 1KE2A 1F0KA 1J00A 1UC5B 1X7YA 1W87A 3DE4X 4CL8A 3FOFC 2OORC 3ITKA 3ROMA 3VSBA 4FOSA 1KYZA 2DUJA 3LV8A 4C21A 4DDKA 1Z35A 2R6ZA 4OH1A 1JIXA 4ZK2A 1HNNA 2ZSUA 1SVSA 4AWBA 4P83A 1E18A 5EZYB 1RHRA 2GEFA 5EZYF 2DR0A 4DARA 1F7UA 5FFNA 1T2DA 1J7KA 4ZVNA 4LKOA 3R8CA 2Z8ZA 1LDNA 3QXCA 2VJAA 2P7HA 5KB3A 4Q3DA 1II8B 3H9GA 2XA2A 3D4IA 4ND4A 3O8QB 4O4HA 3OTQA 2P77A 5KX5B 1XK7A 1SUCA 2OD9A 1XLUA 3SLRA 3BYZA 4X1IB 3GUHA 5AVTA 3VGJA 3K7EA 2H51A 4E2XA 3VHRA 1JMYA 4YP7A 3AOGA 4PSCA 4EVQA 4MQFB 1QFJA 2ZIUB 1M2GA 4BO9A 5LYYA 2BFPA 1DCTA 3R8XA 3TB4A 2C54A 2BDUA 4ZT2A 4RQBA 2CXOA 3R6WA 4KQ1A 1RWOA 1SC3A 4CUZA 3TZCA 4D3YA 5ALXA 1M8KA 1GLNA 3AI7A 2NO0A 2QLJA 2FPIA 4XVQA 2XVXA 3W5CA 4RTKA 3HY3A 1VB5A 1UP6A 1MV5A 3GPCA 4GP7A 2IXGA 2HRDA 5FOUA 2P4SA 4KX5A 2BFOA 1ZESA 2C57A 3ECAA 1J8MF 2QRPA 2YQ4A 3SKVA 3OVMA 4FBLA 1KEEA 1OH6A 4XI9A 1PWZA 4YI5A 2OENG 2D2FA 4IDCA 1R0CA 5BN1A 4HS9A 4WKCA 1VPEA 3QENA 4WESB 1MX9A 4L22A 1HFKA 2NZ8A 3ROXA 2MJLA 3D7NA 4GP9A 2JH8A 5JIBA 4NK4A 5KBYA 1IZYA 1I14A 2YOGA 4ND5A 4TMTA 4A8JB 2JJMA 3P5BA 4XCVA 5KQPA 4HFMA 1KH2A 5EE5B 4V2UA 3WAGA 3GRYA 3WO1A 2QD4A 3WYDA 4DLZA 5A1TA 1LRJA 2A14A 3MWJA 1B42A 1R6AA 5CH5A 5H5JA 1BKYA 2JIBA 3NOVA 1WPXA 1W44A 3VDNB 2PLRA 1RVV1 1JHVA 1JBEA 1QDEA 2JFUA 3C3CA 3EYAA 4G1UC 5EOVA 4LXQA 5J63A 2J3LA 3IXQA 1Z0KA 4TLMB 2D13A 3GNLA 4MAAA 4R1PA 3T3OA 2QJFA 3RQIA 1Z0SA 3RHSA 1H0HA 5CTJA 5LBTA 3RSQA 4D3SA 3L92A 4G23A 4ZV9A 4FXOA 4RK7A 4HUJA 3ROEA 5LIPA 3ISVA 2VNJA 4NPCA 2Z9BA 1GL7A 1Y9JA 4TYYA 2M1ZA 3LWZA 2WSSD 2ZE7A 3O0TA 4ZD6A 2BMJA 2L19A 4ARZB 4RFSB 2H4WA 1SVNA 5FWAA 1CUXA 4I8IA 3QW4B 3QM1A 1X8KA 1XQVA 4IVNA 1CJMA 3EVFA 4GF5A 3VNSA 3A1DA 2I2CA 2IHVA 2NV2B 3IMCA 3UQZA 1KEWA 4BEJA 1J0AA 3QG5A 4NBKA 2V7TA 4BLUA 4PNZA 3UFXA 1C9KA 3BBPA 2CXNA 2EJWA 3EUEA 5DNEA 1UBRS 2IYTA 3RT1A 4JJFA 3UJ7A 4LCEA 3F6SA 3ZLUA 3L1HA 3S68A 4OVKA 4BVKA 4E08A 1DKRA 4Q34A 1TE2A 3ZUPA 2NZUG 4P4UA 1U99A 4RENA 2HU7A 1WW2A 2BFEA 1OX6A 4NPHA 2A1IA 3Q3GE 1LNQA 1T4GA 3E7XA 3WBBA 1XDZA 2GBCA 1GKYA 2OYSA 4FHFA 3W2TA 5AOBA 5IABA 4DIEA 3IUSA 4CQMB 1BE0A 5BORA 3LSTA 1Z0DA 2GN1A 1N8KA 3C85A 4PN7A 3HC7A 1XLTA 1ZR2A 4G0NA 3PSHA 4KXYA 2WF5A 3GF4A 4TM7A 4RNDB 5JG7A 3CVVA 2OKGA 3A3NA 4EHFA 3HU2A 5DGCA 2YN0A 5FBZA 3L6OO 2XYGA 1NN5A 2GQ0A 3BMXA 4C43A 4QASA 4M76B 3Q7QA 4R1LA 4JR1A 2OUIA 2QN1A 4HUQA 1HR0B 4QDKA 5JT1A 1KSJA 3ESRA 4JP2A 4ID9A 4MIOA 1GXSA 4LE2A 3BQMB 4BNVA 2YXBA 5G4KA 1RMTA 3VVCA 1NI4A 1VA5A 2IDZA 5DB4A 1NBOA 2V7QA 1MIHA 1ESDA 3E6AA 2VJKA 3GFFA 3MYRA 3SYKA 1JYEA 4JITA 4KR0A 3CG0A 1FRVA 4IV8A 3N0WA 4GWGA 5IP5A 1SU4A 1DTWB 1ZSNA 2JGAA 3SJZA 4BNXA 5I7OA 2ACKA 5AWFC 3UG7A 4P7GA 1RQXA 4GKKB 2Y1CA 1USVA 5DHSA 2G70A 3SBXA 2ZCJA 1YVEI 5KWIA 3B1VA 4TZTA 2Q7DA 4YXWD 2YUIA 1D6SA 2RSLA 2AOXA 2I76A 3OM0A 3PKZA 4OI4A 3K9WA 5C5CA 3RD5A 1DUVG 5EKSA 4KHPB 3QSYA 1RXIA 1QS0A 2GZSA 3TNYA 1SXQA 1I2BA 3LGSA 4WA8A 3S1LA 2WPDD 5FLEX 2XYPA 4G0YA 3EXHC 2UXDB 1KI6A 1VIMA 5ALDA 2ZEJA 5JROA 1EUCB 4H60A 4I9FA 3JD2A 1RXWA 1HE8B 1Y48E 2BFWA 2REQA 4ETNA 2VDUE 3BKXA 4XEUA 1ENOA 2ONJA 4O8ZA 3NHUA 1M1YE 1N1DA 1T5TA 5H0IA 4E3WA 1DG9A 3NATA 1Z5GA 1P77A 1O6BA 2A5DA 2W2QA 3CF2A 4N5DA 4AO7A 4AVYA 3ZVMA 2BE7A 3WQSB 3AVUA 3E48A 1UJ5A 3O7MA 3OEHD 3IUNA 3CEJA 1I2AA 3GDOA 1JLLB 4WE3A 1JFFB 3G9TA 3L7CA 1ZMXA 5HM6A 5BW8A 1NG9A 1Z6YA 2IEIA 1PWXA 5EJGA 4RYLA 4BO3A 2VP6A 3R3YA 2A9FA 4RF5A 1C0LA 2VDLB 1S2LA 1ZNWA 2R1VB 3CVJA 4IX1A 2I1QA 1O9GA 4NFSA 4RJJA 2C4TA 3A70A 2A5JA 2YXDA 2EEPA 4G5HA 4JKYA 4YMSA 3DVAB 3LUDA 3WYAA 1NMSA 1SAYA 1CEXA 1H65A 1OU4A 1I1NA 2C5HA 2WOJA 1T25A 3OPQA 5HMLA 2P2DA 3TAHA 5H8WA 2GVDC 1GPBA 4JP8A 4L9WA 1NV8A 4YBZA 1V1MB 3N5CA 4H7JA 1SVUA 2QTHA 4B9EA 4EJ2A 5HNKA 3FPEA 1NN3A 1IJFA 5GOZA 3WWCA 4RJIA 5C3MA 2HMSA 4MPTA 1U2RA 1OBCA 3CNHA 1CZKA 4NJMB 3BAZA 2BTEA 5BR4A 1MFZA 2DUNA 3TM4A 1BEEA 3G68A 3H2KA 4BBAA 4ZHQA 1NR5A 3E05A 2D00A 4IM7A 2C78A 3WIDA 1C8VB 4J0JA 1RACA 2G04A 3U48A 1RRMA 3DXFA 1HRDA 4G5FA 3K53A 2WNHA 3MLBA 1I8TA 2HQSA 1YR9A 3KQVA 4ZAZA 1Q1GA 1OHHA 1L7PA 1TOAA 2VHJA 2WWHA 1FU4A 2VIIA 2O6LA 3I2HA 4OHZA 3LF1A 3USES 1FFCA 2XCOA 4YJGB 2W2KA 3GRPA 5D00A 3HNRA 3LWNA 4F4IA 3V6MA 4LDAA 1R9MA 2JFGA 3ZE7A 5HG0A 4RCVA 1N7IA 1PKXA 1L5NA 1NBHA 5IJZA 2BFDA 4QXAA 1WSWA 1L4KA 2NO1A 2Y0BA 1TCCA 2CLMB 2WU1A 4X3CA 3U7HB 1R4ZA 2H2FA 5T7BA 1FMLA 1XNJA 2QXTA 5KTNA 4XJXA 3LHSA 1ZD9A 4FZ3A 4LYHA 3S29A 5E2IA 5JNUA 3LFHA 2P1RA 3O9VA 1ECBA 5CEEA 2HSGA 3KUKA 1OGYA 4Q01A 5GJVC 2W2VA 1H1DA 1SXJC 2IYRA 3CHYA 4ILEA 5T64A 2YASA 4MW5A 1BZYA 1PG5A 2I33A 2D1SA 2GN4A 1LF0A 3KSDO 3NJRA 5TSDA 3WIOA 4DG5A 2OHHA 4Z5XA 3B9PA 1W4BA 1H3NA 5IM4F 1RLMA 2AB0A 4GLOA 2NUPB 4NZPA 4FFDA 3ZCXA 1GUDA 4C87A 4CKEA 4EG8A 3JPWA 4P4GA 4RHCA 4UQOA 4LC0A 1NNUA 2GAFA 5JISA 5MFPA 1MVOA 2N75A 5KAMA 3O8CA 1OWNA 4DLSA 4DA9A 1LI4A 3II6X 4M36A 4L4ZA 1E59A 2EFCB 1A9SA 4B6FA 4Q39A 5ER6A 5K0NA 3WGYA 4W1RA 1CQPA 1W5FA 1P18A 1HE2A 3TINA 1OIVA 5CXXA 1LPSA 3GLHB 2G28A 1MLDA 3ELWA 3MFYA 4I4LA 3IB6A 2A4KA 2WMOB 4RJLA 1YBHA 3VH4A 1XD2B 1CKEA 4E4RA 4WY8A 4ZZ1A 5JLJA 1OB5A 2MOKA 5SY4A 3E2PA 4DRYA 4ZMSA 3I64A 2ATIA 1E6EA 4NBUA 1NUTA 3N86A 3AOEA 4QJIA 1TO1E 1WPGA 4AC9A 2DG2A 2NXNA 4TLDA 1CU1A 3PEFA 5EIFA 4ZC8A 3SYLA 4YAOA 1J49A 2XOEA 3BH7A 3MM4A 5ILGA 4E5KA 4CODB 3UVEA 3SC3A 3P5SA 3N6XA 4D43A 4I46A 5A3VA 3PCRB 1N34B 1V5WA 1SY7A 3GGJA 4JA0A 2ZE5A 2EW8A 3EIEA 1B00A 4HWRA 1QHYA 2XW6A 1X1AA 4X92A 5DIFA 3QNMA 4M4SA 2CNBA 4NBSA 3TRDA 3HFRA 3K0AB 1Z4MA 4KG7A 2HZ7A 3PWKA 1S2IA 2IY7A 3AXSA 5DNWA 5FNZA 5HZKA 1QHGA 4YQFA 4G0VA 2C7PA 4OXKA 4EB6A 2HIAA 1O2DA 1U3CA 3PB3A 1A4XA 1KO8A 4EHAA 2W4IA 4FBMA 4TSFA 1PJTA 3GOHA 1QOPB 4FEGA 4J0IA 5KTRA 1FCJA 1G3RA 3B7PA 3TI9A 4IV0A 3VMFA 2AC2A 2G9UA 2RG1A 2HT1A 1N9GA 2YRFA 1NV9A 4O1HA 5BURA 1QIIA 1UOPA 5BR8B 4FZ5A 4DNOA 3OEYA 4FX5A 1SD1A 1UFKA 4LJ4A 5DEIA 3SI7A 1J0BA 5T4BA 1R4MB 3ET5A 4DTCA 4ZOLA 5LD2B 1E1CA 4E7OA 1H8HD 1FRFS 4L2IB 4MQEB 1XVTA 4D9JA 1KI9A 4V2IA 4HXEB 4L73A 4DMUB 1ZJYA 2FEAA 3GK3A 5KQMA 4PO3X 1Z6XA 2GVZC 1XXLA 2D5AA 1QH8B 1G8YA 1DRJA 2ONYA 2ZUWA 3R75A 2ECQA 2H52A 4FGKA 2WHXA 3DULA 4HH4A 4LGVA 1REQB 4QBIA 1LV7A 2PVSA 221PA 3AK4A 5JATA 3BX1A 4ALJA 4M0FA 2HGSA 3LU1A 4GOND 2IIVA 2Z95A 2PUFA 1SCJA 2DJIA 3UMSA 4J0FA 4BO1A 2XGOA 3P20A 3KYCB 4JYPA 4F3CA 3HYTA 2WDPA 4FLMA 4NEHB 3HYSA 2YY6A 3T4EA 4BCDA 4BV2A 4E51A 4Z9BA 1PGQA 4NFLA 1V7PC 3IO5A 5BV8A 4MP8A 4QT0A 2V97A 4ECEA 1BGXT 3JS5A 4MV1A 5AJXA 5JTUA 1UKCA 1QAMA 4MA4A 4C4YA 2JFXA 1W59A 2X40A 3A1WA 3A28A 5C0OE 4JASB 3RK1A 4X84A 5KHAA 4X8OA 4C9BA 3B6KA 3V6LA 2HTFA 2KLBA 3HJAA 3L4BC 1KPIA 4V0SA 5D7BA 4IIGA 3R6TA 4HGOA 4LZPA 3VO8A 1SVOA 2O3UA 3QMVA 3W9YA 1OZAA 2A57A 4B87A 1FNSA 4X85A 1J2EA 3K1JA 4Q5IA 3QHPA 3LVRE 3Q3CA 2YS7A 2VC2B 2HUNA 1FUKA 1A9YA 4HLCA 4AJNA 2RK3A 1OR8A 2QLBA 2C94A 5IVDA 1WCXA 4ZI2A 3GBSA 3A3YA 5HS4A 3ORRA 3WNQA 3P0IA 3QELA 4WNIA 2C5LA 4XJSA 2MTBA 5THQA 4H7FA 4LY9A 5D5PA 3IOCA 4YCLA 2IYFA 5AW2A 1ZJZA 2QT1A 2JHPA 1ZKDA 4RO0A 1CWUA 1D0IA 1NIJA 1QV7A 3EWIA 2JKYA 2P5YA 4MR9B 4Q9HA 2EJCA 2ZRHA 4L1KA 4N01A 5EQFA 4C7XA 4X65B 3KV1A 5J1TB 4LF6B 4QOFA 2CVHA 5HIMA 2HI0A 3T9AA 2FSFA 2FMXA 4Z4CA 3VVLA 4DCUA 1JSZA 2YFYA 2HMWA 4KFUA 1SBNE 2EZ9A 4OJNA 4RIIA 1VI5A 4XWTA 3MB8A 3SJBA 1ZK2A 2ZT5A 4Q24A 4B9AA 4ZEMA 4AAYA 1O4VA 2PT9A 4CI0B 2AL7A 3IKVA 3I6YA 1H4SA 2YNMC 1FU8A 1QK4A 4AY3A 2DPGA 4FXPA 4RHEA 2I4LA 2ISQA 3I53A 3VYRB 4F86A 4P98A 1BVHA 1E8NA 3DDHA 4N12A 4QEKA 4I8XA 4IIEA 1UBOS 1BE6A 2MSDB 1EUZA 2Q62A 3L6CA 4R2WA 2D4HA 3FUWA 2FTKE 4JH0A 4F2DA 1FUIA 3UPDA 2B2CA 4RSHA 2V96A 4KQ6A 3CSUA 4CL0A 3P96A 1IY2A 1EFPB 3C24A 2DBVO 1VPTA 1W4LA 4LDJA 3TQTA 3RYHB 4M8LA 2BKUA 1YCHA 4E6PA 2ZIXB 3IERA 2OV1A 2ECFA 3MJTA 3UJPA 4CPDA 2YJ6A 3UN1A 1QRTA 1NVKA 5KS2A 4ZYVA 1T91A 1Z38A 2F1IA 5FPTA 5C35A 2EL9A 3DLIA 1YB6A 3RAJA 3ZJ5A 1I36A 1DKOA 4WBSA 4I9UA 4DUGA 4B6PA 3WXMA 2YXLA 3W5JA 1U5BB 1S01A 2P2GA 4HH1A 5JSHA 1HZJA 2FW8A 1GKIA 3DP7A 1DC6A 1NXVA 4J0GA 4X7RA 3ZBUA 2HIGA 4MGYR 5EVJA 2VSYA 1T9GS 3OQHA 4YT2A 4JXXA 4YR9A 1Z0JA 4PSVA 4MMYB 2QQ5A 2ZYSA 4RETA 3FR8A 1P1IA 4FR2A 3NH6A 1NW8A 3WK8A 5AVXA 3UGQA 4DAOA 5HW0A 4B32A 1FSPA 1IM2A 1PNVA 2EOAA 4ZI5A 4FFSA 5LJLA 2G67A 3PFNA 4O4IA 3SSMA 3K70B 5AJZA 2GCGA 5GJCA 4RHTA 4BMXA 4ED9A 1C7IA 4BHTA 2QSZA 2BM8A 3RIYA 3JQFC 1NDQA 2ZBUA 3RS9A 2A1UB 3RBAA 3JR3A 3M2PA 1TCBA 3QUTA 4JOCA 4M9UA 1ORTA 1Y1RA 2JGMA 1YU6A 3ESDA 3MS2A 4Y6LA 3DO6A 1THGA 1W75A 4HDCA 3LCCA 4O2LA 4YRKA 3TTTA 4EATA 5EMJA 3PC3A 1HYGA 5LWHA 5FR2A 1RXSA 2CCGA 4PYMA 2QAIA 5K20A 1Q16A 2R6AA 3MELA 5FBKA 2Q3CA 3ZY4A 1BQEA 4KGDA 4KQMA 4BFXA 3RAEC 1Y42X 1ZQ9A 2DOKA 3DAYA 1ZA2A 4ARSA 4J1TA 1KOLA 3EF0A 1MB4A 3TDNA 3ZE6A 1KERA 1PEYA 1QG4A 2C3OA 1Z06A 2NZWA 1H2BA 2CLHB 4Y8VA 1L7QA 3U0BA 1GU1A 3IB3A 4WIAA 1W36D 3V8EA 2M6SA 4E5MA 1EG2A 1J25A 1XQ9A 2VNSA 2VWQA 1TJPB 3OX4A 4DCNA 4OMUA 1BS2A 2GXUA 2JLAA 2NADA 2GVNA 3H8SA 4UATA 1NJGA 5FL7D 1G8JA 2FR0A 4KLAA 1GQOA 2W11A 1FJHA 4TTTS 3WGTA 1WW3A 2PGIA 2IXAA 3NHLA 1OX4A 1Y8QB 2ZYGA 1P7CA 3L7LA 4QPCA 4CKBB 1Z4OA 1C50A 1JI0A 1CV2A 1YJCA 2W71A 2X0FA 3X1XA 4BXOB 1E3EA 2BGJA 2H7CA 2NSDA 2J9GA 3D2BA 4R05A 1W46A 4XWGA 1Z74A 3L7YA 2WPDA 2XMZA 5H80A 3VPHA 1IHXA 4Q3BA 3BK2A 2GK6A 4QQRA 1EK2A 3V3TA 2QENA 1T3SA 3ZY5A 4Q6WA 5LSAA 1FSZA 2GZHA 5AVVA 1TT5A 4QUEA 2HXYA 1WZUA 2VJOA 1G8KA 4M9SA 3X1MA 4C0KA 2E55A 1DHTA 3MRVA 3T7TA 4BKUA 3G79A 4W5QA 1BTOA 1KIMA 2FWNA 1EGHA 4LC9A 3V46A 5CEJA 5TPWB 5BV7A 1J21A 2EX0A 4BLWA 3OEHA 2IYPA 4WWHA 5C7OO 1G42A 4Q7KA 2VXCA 4Q7EA 2O4UX 3NIGB 5FJIA 2ZVPX 1D5WA 2JARA 1ZK4A 4J2TA 2BEJA 3UXEA 1YZ3A 2CFRA 2FFQA 1I4DD 5CJPA 3UWSA 3QKTA 5AR1A 2IODA 3T3DA 4CCWA 2BEWA 5BQOA 3TM5A 1G16A 3S1AB 3SF8B 3WHIA 3ZKWA 1SKQA 2PL9A 5D3QA 4FZRA 2QP9X 5EHIA 1KC3A 2XCRB 5KNCD 1NJSA 4K9KA