1XEXA

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
b'PYIEKLELKGFKSYGNKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMC protein
publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
total genus 45
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexA00
2NO7A 4EFLA 3HJNA 4LYAA 3BB3A 3GLFB 121PA 2REBA 3EIQA 1Z22A 2A9KA 2QT0A 3NDBB 2FPKA 5G53C 1WQ1R 2O0HA 1D6JA 5G41A 4BZQA 4JBXA 4YXWA 4JLOA 2WJYA 1RZ3A 3FPAA 5FTMA 1U98A 1DPFA 1P9RA 3Q8XB 3W8NA 2DHRA 4YMVA 1SXJB 3OIUA 1DADA 1TUIA 4AK9A 4XVUA 4JT4A 2NPFA 3WP1B 1YHNA 2KSQA 3T5GA 4KVAA 1E0JA 1UKVY 1D2MA 1RE0A 5AJZA 1JEEA 1HQCA 4PQFA 1KJYA 3QNUA 1QHIA 4G5RA 3FMPB 4BFUA 4TYNA 5TDHA 3G0HA 1N6IA 2OFOA 4AI6A 3ZS9A 2DWOA 4MYUA 2WJJA 1OW3B 2YJTD 1E2HA 3KQHA 1SKYB 2DY1A 4CZ2A 4P31A 1UKYA 3MJHA 5JHHB 1IBRA 1YU9A 1LF0A 1Q12A 2BV3A 4MKIA 5EE5B 1F2UA 3SJZA 2IS2A 1KO5A 4KODA 3GFTA 2X1VA 1H8ED 1NKTA 1Y63A 4M9XA 4URZR 3TQFA 4RSGA 2CXXA 2ZRAA 3I4LA 1G7RA 1E9DA 4WXRA 3FFBA 3UK6A 3HR7A 3KKPA 5JRZA 3DOEA 1CR2A 2SHKA 5IT5A 2I4IA 2R6AA 4EKDA 2OBLA 2OM2A 2CLDX 4JVNA 4IDOA 1JBKA 5KHOC 1L4UA 1U8ZA 1SHKA 1G1MA 4A6XA 4TL7A 5FPKA 3P4YA 2O8EA 1FMJA 2ZRFA 3CW2A 2ANBA 1QHYA 2L0XA 1P9WA 3OFNA 4IFEA 4Q47A 4OHWA 5HCNA 2NIPA 2W83A 2HUPA 2ODEA 5A5GA 2AFIE 3QF7A 5FL7A 1MV5A 2ECKA 2ZI7A 3PEYA 3L0IB 4V0LA 2AHOA 1NMYA 1T8UA 4IXNA 4TMWA 1VKJA 3TVDA 2PEZA 3L8ZA 3O8RA 2J59A 2WKPA 4LDJA 3TR5A 2QE7D 1LVGA 2G88A 4C0JA 4FCTA 5CK4A 4I4LA 1IHUA 4KFRA 1CR4A 1FUKA 2F1HA 5FFMA 2J46A 3FKSD 2JLQA 3IIMA 5DHAA 2XOKD 4DSTA 2ZVPX 1AJEA 3CZPA 5E7MA 2AWOA 1MO4A 1VYUA 1XD9A 5TY0A 1U0LA 2ZS8A 3IILA 4MYCA 3L0SA 5BN4A 3QKSA 1UKZA 3VR2A 4Z54A 2WPDA 1YZKA 2BIFA 2J9RA 3A58B 3CF6R 4URVR 5KSOA 3D8BA 1NMXA 1M7HA 2QQEA 2VHCA 3CPEA 1EFHA 3B1WA 3LBHA 3KX2A 4C0QC 3QJYA 1S1CA 1CLUA 1S8FA 2FG5A 5FPHA 3RDPA 5DE3A 2CK3D 3LLMA 5AUPB 821PA 4LBWA 2BM0A 3FFAA 1GZSA 3EA5A 4OHVA 2XTMA 3Q7PA 2IUSA 5GJCA 5LD2C 3DHWC 1PVOA 3IEVA 4BLOA 5B64A 2QNRA 1ONBA 1R8QA 1IONA 1G3IA 3VMFA 2AX4A 4D82A 3FWYA 4NL4H 3GEIA 3HU3A 4I81A 4C30A 3AH8A 1X86B 2DR3A 2EQBA 5EXPA 1G8YA 4I1UA 1Z29A 1F2UB 1OB2A 2IXEA 1W5SA 721PA 1FMLA 3FMOB 3KKQA 1I2DA 1XMVA 1W4AA 1E9SA 2XNSA 3OIWA 3PEVA 4MRVA 2QPOA 4TQUS 4KSCA 4V0ME 4LHYA 1AQYA 2G1KA 3NWJA 1GAJA 1NJGA 1LB1B 4RD1A 5FI0B 1HE1C 1Z83A 1KSFX 3L8YA 3EPJA 1KKLA 3U3JA 4IDHA 4WZ6A 4BFXA 3PJRA 2OZEA 2EFHB 4Z8YA 2JJ2A 2ZSAA 1BMFD 2PZFA 2D3WA 1J70A 3AM1A 4TYWA 2EYQA 1DAGA 2QSZA 4XOIA 3K9HA 4OQFA 2JDIA 2WBLC 2ZRGA 1G8FA 4XSGA 4NP6A 1B23P 5AUQA 1KK3A 1JR3D 2WWYA 1ZJ6A 2ZQ5A 3UMFA 1ESMA 1CKEA 2XZLA 3TSOA 3AGQA 3TRFA 4OQLA 3NH9A 5HR5A 4O0MA 3QKSB 3OESA 2UKDA 4CIDA 3EZ2A 3P1JA 3VR6A 421PA 3EW9A 4YMUA 1Z28A 4PHFA 1FTNA 1J8MF 1DELA 1JALA 1E1RA 3AF2A 2ODBA 3U6BA 2QTFA 2CBZA 2GVZC 1M1YE 2D2FA 4Q7KA 1NP6A 3HYTA 2IEZA 4TMTA 4D0LB 2KB0A 1GWNA 2ASEA 5LB2A 4B47A 3ZVMA 3CR8A 4FI3C 3CKLA 1NBME 1S9HA 2V7QD 4DEYA 3F0TA 3G5UA 3QXSA 4B48A 1R2QA 2A5JA 1KO4A 2OAQ1 4BFYA 4NCKA 4BFSA 1GM5A 1VPLA 2J3EA 2WMOB 3CX7A 4NYMR 3K9GA 3TUIC 2RHDA 4D0NA 3NHAA 4OK6A 1W4CA 3IHLA 3MWLA 1Z47A 2O8CA 3WRYC 4HAZA 1XU4A 4V0KA 4B6EA 3IGFA 1X3SA 2B21A 2BBSA 3H2YA 4DHEA 1NJFA 2NPIA 1QHNA 3QBVA 2GZAA 2RKOA 3WMGA 1IN5A 4LJ7A 2CE7A 3LD9A 1N0VC 5CM8B 5CITA 3EASA 4RD4A 2IUUA 2I1VB 1KJZA 1RVDA 1W36C 5AJWA 3SYKA 2JJ1D 1LF5A 1WMSA 4IJMA 4DUGD 2OFWA 1ZU5A 4QBFA 3I61A 4XWOA 1S0UA 1OIVA 2A3RA 5J4YA 3CX8A 1DTSA 1E2NA 1B0UA 3AF4A 3W5JA 4F91B 2BMEA 2H92A 2ZS7A 5DYGA 1DOAA 3EC1A 2WIAA 1DAFA 1YZLA 3DOFA 3U7EB 1FX0A 2ZI4A 4DDVA 4D26A 3BORA 1Q1QA 1EESA 3K70C 1F60A 2ZYVX 3HP1A 4MGIR 2HLDD 4JBWA 3QKRA 5KO2A 2GCNA 1JB1A 1XD2A 4FN5A 5EUQB 3VFDA 1VCMA 3BB1A 3T61A 3W8RA 3BFVA 3T5DA 2OCBA 2ZJ2A 1SGWA 1N6PA 1DAKA 4IDQA 1DVRA 3BK7A 2G0NA 2WKQA 2BVNA 3B1YA 1XCGB 5FBVB 3H0KA 2W00A 4BASA 2RGBA 3B1VA 1EK0A 2GJAA 2ZVQX 4NYJQ 5KDOA 3B82A 5KTYA 4A9AA 5EZ6B 4D4LA 5K8UA 2QROA 2OXCA 4JS0A 4M22A 4DWJA 1OH7A 3VU9A 5C18A 3K0CA 3FE2A 1UBCA 3BAFA 5LD2B 4JVLA 1EFCA 1MO6A 1EG7A 4ZKDA 4GFDA 5FOSA 3K0FA 1NNEA 2C95A 2HEIA 2PT5A 3TSWA 4BZXA 1X1SA 2DWQA 4A36A 1R10A 4IFBA 2QQ0A 2FGJA 2FE4A 4PZZA 4Q1BA 1OHHD 2WIBA 4QBHA 3DVLA 3ZH9B 4Q4LA 2IYRA 2C9OA 4LYJA 2HXYA 1MH1A 1P2VA 1IXZA 3RRMA 4Q9LA 2F9LA 1FL9A 2ZJAA 3CR7A 1UPTA 4KFUA 5FR2A 2H57A 4M53A 4R2HA 5P21A 5JEEA 2REXB 4W5WA 1DG1G 2IYWA 3VR1A 2XEXA 2O8CB 5B57C 2ZYWX 2IYUA 4HAWA 4IOJA 3CB4A 4JBYA 1QVAA 4TMZA 5DO9A 5DYIA 3U2QA 1IJEA 1NIJA 1YZGA 4P4SA 4K81B 1LFDB 2BMJA 2YZ2A 2IWHA 1ZVQA 2ZRBA 5TVKA 1UEJA 5G3YA 4BWYA 2VQSA 2QMEA 1NN0A 4LYHA 2F1RA 2BMFA 2F9MA 3GLFE 2XXAA 1KZGB 1QHGA 1XCMA 4QGGA 4ITRC 1YZTA 3LQRA 2KI5A 1ZNZA 2WSSA 3QKTA 4JMPA 5AJXA 3TKLA 1OV4A 2GEDA 1NN1A 1CR1A 1FX0B 4JLPA 1ETUA 1KTVA 4K46A 1XEFA 2B8TA 4LJ5A 3IHWA 5DI9A 3SFZA 3QKRB 5HCIA 5AWFC 3HWSA 1XD2B 3KDSE 4TTQA 2OCYC 4QFMA 1YRAA 3RHFA 4A0RA 4RJLA 1AN0A 1HQYE 5HZHA 5GVSA 2N1BA 2GZDA 2R9VA 1E3MA 1WDTA 3SS8A 4EFMA 1GKIA 5JMTA 4MYTA 1ZM7A 4Q7MB 1E98A 5AR1A 2ZRPA 4D4KA 2Q3HA 5FPTA 2B7CA 3MCAA 5LBIA 1T5IA 3BJIC 2C8VA 1VHTA 4PO8A 3DO6A 1CIPA 2ATVA 1OIWA 1HYQA 4LJ6A 3B2EA 4IOLA 5H68A 2MMGA 5C2JB 4F92B 2BOVA 2HV8A 2UZIR 3K0FB 4B33A 3C15C 2P65A 1VG0B 3PUYA 3B9PA 4MH0R 3B8HA 2YNMA 2IL1A 1KGDA 1KAOA 3WYFA 4DSNA 2JLRA 2EW1A 2FN4A 1V5WA 4JT2A 1HH4A 2OLKA 1C9KA 2DCUA 2CNWD 2QM7A 2RMKA 3DKPA 3LNCA 3JZMA 3KB1A 4BLPA 1US8A 1W36B 1OB5A 1AGRA 5GJBA 2A5GA 2WWFA 3P27A 2VP4A 4DCSA 3IDQA 1P6XA 2D74A 4GZLA 5DISB 3UIEA 4B32A 1GP2A 3QVUA 3TAHA 2QN6A 1XMJA 2OV2A 1O87A 2ZJOA 2BJWA 3NC1C 4GL2A 2VRWA 1XJQA 2VO1A 3K0EA 3LDAA 1VMAA 2FPLA 2GCOA 2V1XA 4P33A 4WAUA 4EPTA 4FW9A 3B5JA 5G40A 3K70B 1XTIA 5JFGA 1E94E 1JQLB 1L2TA 3VNUA 5C46F 2R2AA 2IW3A 4AKGA 4DLWA 1E2DA 3I5YA 1EFRD 3NIBA 3FMFA 1YR9A 4KCGA 4QC2A 3GJ0A 4P4SB 3V4FA 3KXKA 1A5TA 4MQBA 1KI9A 4UXHA 1E4VA 1VCIA 3EXAA 3B1XA 4Q00A 1G4AE 4DLZA 1NVVQ 2H18A 2HXSA 3VHLB 4AY2A 4NMMA 3VX4A 3W3ZB 4X8LA 5FOWA 1H8EA 3CIOA 3LO5A 3PUVA 4AYTA 1KDPA 1UBFA 2GJSA 2XXAB 4P0TA 4M1MA 4G01B 3BIFA 4JSYA 3QG1A 5JEDA 3MUFA 3W34A 2IX3A 3CONA 1KSJA 3SYNA 1ZCAA 2VHJA 5JRJA 4HAVA 4TTPA 2JATA 1Z0DA 5JI2E 1D9XA 1Q22A 3PXGA 2Q6TA 1TX4B 3B9QA 4MUAA 3JVVA 2NO0A 1UF9A 2GESA 1CBUA 3A1WA 1M74A 4QXAA 3GLGA 3NDPA 4NYIQ 1FNMA 2DBYA 1N5IA 2GXSA 2YC4C 3MWYW 3BGWA 1E4YA 1ZW6A 4MA4A 1TF5A 1ZIPA 2Q21A 4AKHA 1A4RA 1MR3F 2ZETA 3GFOA 4JLAA 5J4LA 4B3GA 4HEJA 3VNVA 3ASYA 3B85A 2GAOA 5C4GB 4KO8A 4IDNA 4PQRA 1YRBA 5EQTA 1CULC 1U9IA 3L0OA 1OJLA 4ZKEA 3RNLA 1VHLA 2FV8A 5B30A 3N70A 1N5KA 1A2BA 1LW7A 4NU0A 2XOKA 1IXSB 4FIDA 4PSAA 3RSOA 2P67A 1SVMA 2DPXA 3LW7A 3UATA 2QORA 3O8DA 1Z3IX 4M1WA 2P3SA 3NC0C 5BWMA 1RRPA 1P75A 1PLKA 2Z4RA 3ETLA 2B8WA 2QAJA 3DPUA 2J7PD 4TT3D 1TEVA 1HE8B 3LFUA 4B43A 2P0EA 2ZR0A 4DLVA 1US8B 1P2SA 2RGNC 1Q3TA 3GFPA 2JASA 4DT1A 1ZUNB 4PQYA 3U3MA 1LNZA 5DH9A 621PA 4B34A 2ZREA 1KY2A 2WAYA 1U0HC 5L3RA 1RRGA 3QXJA 3CF2A 2GCOB 2IBMA 4UJ3A 5CJ2A 1ZD1A 3HU2A 4JJZA 4NKRA 4BECA 2B92A 1OKKA 3V00A 1OSNA 2KWIA 4UQOA 5CM9C 4OK5A 5CB8A 3KJEA 2CL7X 1RYHA 1OXXK 1JPNA 3VAAA 1Z08A 2RB4A 3IEUA 3UXMA 2O8FA 5KSYA 2CCKA 4G1UC 4ZDIA 4JLNA 4TLDA 1COWA 2CJWA 1EGAA 2JLVA 2DWPA 3N2IA 1SVSA 5IK2D 1NBMD 4BFVA 1JNYA 1A1VA 2ZI6A 2FMXA 1E99A 2Z0MA 2C78A 2Q3FA 2RGXA 1JI0A 1UAAA 1N5JA 1VIYA 1XWIA 3AVWA 4Q5IA 4MITA 1G291 3RLFA 4CEIA 4HAXA 2R65A 1XEWX 4A0GA 2PBRA 1AS0A 4XH9B 3Q85A 5CDFE 4GT1A 4IOMA 3AVPA 4NONA 5AJYA 4LBZA 5FPSA 5BN3A 4HLDA 2XSZD 3J81k 4MDEA 2Q9CA 1DAMA 1Z0JA 3GLGB 4JVMA 2RAPA 2QPAA 1ZCBA 2WOJA 1P2TA 3VHXA 3ZVRA 4MKFA 4RZ3A 1G3UA 4D2IA 5J5CA 4B2IA 2GJKA 4GNKA 3U3RA 1BMFA 4ZV4A 1Z07A 3BERA 1XJCA 2H7VA 4HAYA 3PUZA 2RGNA 3BE4A 1EX6A 3R8CA 1M7BA 1XJ0A 3C5HA 2ZRCA 1XEXA 1KK0A 2QBYA 4LK2A 1G7SA 1JR3A 1W1WA 4F4IA 1RJ9B 4BEJA 3GLIE 2F1JA 2J5XA 3QXHA 4AC9A 5SZHB 3GCGA 1QG2A 5CK5A 3AVYA 2QT1A 3CZQA 3R20A 3RC8A 3EX7C 4HB4A 2LKDA 3GEEA 2GF9A 3KFXA 5J40A 1Z0AA 4GP6A 4PPFA 1JAHA 2NQ2C 3FMIA 3GJ5A 2GKSA 1U8AA 2CL6X 2AN9A 3EARA 1FFHA 1DAIA 4HAUA 3EPKA 4LBVA 4TLEA 4KAXA 1IN6A 4B3CA 4RZXA 5CB6A 1S4QA 2NO1A 3KZ1E 2DFKB 4UKDA 4TYPA 3W9YA 1PLLA 4V02A 3I73A 3QG5A 4QJ4A 6Q21A 4DT1B 4B3XA 3GJ8A 3QI2A 3LAWA 5HTKA 5K8TA 3A4MA 2AWNA 5LB4A 3X1ZA 3PFIA 4Q1CA 2KBFA 1SKQA 1M34E 2YWGA 3LWNA 4BFTA 2V7QA 3AVUA 4KJZA 3U7GA 1W2HA 4FCWA 2WV9A 1U8YA 3BS4A 2WWIA 2DYKA 3H84A 4Z1MA 3EIHA 3THYA 4DEXA 5FBRB 5F98A 3AF1A 4HSEA 2IK8A 2GK7A 3U7HB 3IBGA 4TMVA 4PHGA 1E2QA 1IM2A 3CBQA 3PUWA 1HA3A 2R44A 4MDFA 4LUCA 2F1IA 3FTQA 1CJMA 2O8FB 1U94A 2P6NA 3LW8A 5FOXA 5L3VA 1W0KD 2IYTA 2CJWB 3ADBA 3O8CA 1T0HB 4CGZA 2GTPA 1T4GA 4ESHA 3THWA 3EZ6A 1DAEA 4MUBA 4LY6A 1UBGA 3D31A 2GETA 1KI8A 2ZRJA 4M9ZA 2O52A 4TSFD 1G64A 2PX3A 4Q9IA 1QHXA 2JJ1A 3QVVA 2FZ4A 4DUGA 1MABA 3K0SA 2ZYTX 4CEIB 2ANCA 4G5QA 2JJ8A 3AV0B 5CYPA 4U5XA 3MRSA 1G7CA 3DM5A 4B35A 1I4DD 1OFHA 2A30A 4KFSA 4E22A 3QF4A 2C9CA 1L4YA 4LWZA 2ZUDA 3HDTA 3PG5A 5H70A 1NSTA 2HLDA 1WBBA 5HKKD 3TMKA 2GZHA 2J1LA 5JJKA 3Q3JB 3T15A 1G6OA 2UZ3A 3FHCB 3IBYA 4TWZA 4EDHA 1T91A 4DZZA 2O8BA 3WBJA 2QGNA 1N2CE 1E2FA 1T6NA 2GWHA 2H16A 2QP3A 4YC7A 2FWRA 3BB4A 1XEXB 3UWKA 2QBYB 2PEYA 2GJ8A 2IYZA 3KQLA 5B58C 4Q18A 4AIIA 1QVRA 2G83A 2VP5A 4ZI2A 1J7KA 1VYVA 2ZUCA 1LTQA 4MKGA 1Z0KA 1OF1A 4DKXA 1G6HA 1OPXA 1NLYA 2ERXA 2YVUA 3C8UA 3X1YA 1OYWA 5EE9A 4ARZA 4G5OA 1KO8A 1KSHA 2A5DA 4QGHA 3NH6A 4FCVA 4U02A 4HUQA 4QOSA 5DN6A 2YV5A 3A4NA 2ZI3A 3TNFA 5FUYA 4XWKA 4NYMQ 1YZQA 4YDSA 2ZUBA 1HV8A 3GLHA 1KI2A 4W5HA 2ODNA 2VBCA 5GJWC 5BN5A 2XTZA 1YKSA 5TB5A 4CEHA 3BRWD 2IS4A 4RY2A 3THYB 1LY1A 1QRAA 1W4BA 3I1FA 1HURA 3QENA 4JKIA 4C4PA 1G8PA 2H8KA 3KKMA 4GRAA 3FYHA 3RAPR 3T06B 4KU4A 4LPSA 1N6KA 4IEIA 4WZAE 4QKQA 3K1JA 2O8EB 2XJ9A 3MMPA 5L3SA 5E4FA 1NRJB 2W6ID 1FUUA 2QENA 3ICEA 1X1RA 4IHQA 3N2EA 3THWB 5KNCA 3P4XA 1E9FA 2ZJBA 3QXXA 1A82A 3LBIA 4B6FA 2VHQA 4LX0A 1OH6A 5HPYB 3AQ4A 2ORIA 3ZD6A 3T35A 1E2LA 1IJFA 1X8JA 1U90A 1MABB 3WY9A 2BEJA 4GOJA 4ESVA 5FUXA 1XZPA 2CEAA 3QIAA 2YHSA 4FWTA 3K0AA 4PAMA 2XX3A 2D4HA 2XJ4A 5EP1A 3M6AA 2AK2A 4OHYA 1SVWA 1N5LA 2WWHA 2PZGA 4NHOA 2VSOA 2BJVA 4F4JA 1ZU4A 3QF4B 1E0KA 3OE7D 4UNPA 1W5TA 2CCGA 2QY9A 3RANA 1N0WA 3ICQB 1P73A 2Z83A 3GJ4A 1HTWA 2ZR7A 1R4AA 1YVDA 4IOKA 2VPPA 3MFYA 3NVAA 5E3HA 2R62A 1G5TA 4RKFA 2GA8A 2FFBA 4M1KA 1R5OA 4KV9A 1QZXA 3SHWA 1BH2A 5FR1A 2O8BB 4Q03A 4OYHA 2IYLD 4A92A 5AJVB 1TADA 4FMDB 4LZZA 2W2XA 1EX7A 1N6NA 2X19A 3MWJA 4LOAA 1TQ6A 4LBYA 1EWRA 2VP6A 4XIGS 5JCZA 4W9MC 1VG1A 2WOOA 3Q7QA 1G3QA 4KITB 3THXA 4GMXA 3PQCA 4UNSA 2BHRA 1UBEA 2VYFA 1JR6A 3DKVA 3CNNA 3AKEA 4A2QA 4JZKA 3A37A 3IKJA 4P4TA 1GL6A 3K0CC 3MLEA 2PCLA 4B2LA 5JS8A 4ARZB 4G3XA 1NF3A 2DFTA 5FTKA 2ZRLA 4HUQB 2IYYA 4C0LA 3R8FA 1FQJA 4UJ5A 2NO9A 1IY0A 1WXQA 1ZM3A 2ZRDA 4HUTA 1P4SA 4DIEA 2CNWA 4BZPA 5JBQA 3GLHB 3TR0A 1Z6XA 1OXUA 4B75A 3EWSA 3OIVA 1VTKA 4G5GA 3RRYA 4CEHB 2ZE5A 2ZU6A 1J99A 3T1OA 2OBNA 4F38A 3T1TA 3HR8A 1TNDA 1KI3A 2PLRA 1CEEA 2FEOA 5E7IA 2ONKA 3ZVNA 4DDTA 3R9XA 2ZTSA 3ZZUA 4KLZA 1N0UA 3A1TA 5L3SB 3TK1A 1XXHE 1VG9B 3OFND 1H8HD 2NZ8A 4M1OA 1Q1BA 3MJRA 4LV8B 4A8JC 1DEKA 2FFAA 5DHFA 3U60B 1D9ZA 1ODFA 4CT5A 5SZJA 4TLAA 5A4JA 3QUSA 2XTNA 3K0AB 3MSXA 2VL7A 4OJKA 1UKEA 3BH0A 2G9NA 3B78A 2Y8EA 4OJQA 3WHLA 2IT1A 1Z5ZA 3KXIA 1I2MA 2P5TB 3RABA 2JIZD 1A7JA 2XAUA 4A0HA 3LVRE 2LWIA 4N1AA 2EYUA 1AS2A 1IQPA 4US0R 2D7DA 1UFQA 4QHTA 1GVNB 1HT2E 1K8RA 3KKOA 2JEOA 4D4JA 4OI4A 4MKHA 3M4YA 4PXAA 2OBMA 4OQNA 3K09A 2XITA 2C5LA 2WPDD 4M9QA 2PMKA 4DIDA 2R8RA 2RGCA 4NCIA 2BCJQ 1WRBA 2NGRA 4QHSA 3FOZA 2AR7A 3B7GA 1VYTA 4WIAA 5D3QA 5JECA 2V1UA 1Q0UA 2E9SA 2G0TA 3THXB 1T9HA 3SJAA 1NSFA 2IEYA 4Q02A 2ZR9A 4Q48A 5EUMA 5KSPA 4DLYA 3DZDA 3SDZA 4UNQA 5FOUA 1ZINA 2MMCA 2IA5A 1R0ZA 4IRUB 3CNLA 3M1IA 3IUYA 2BKEA 5LDDC 3WYAA 2GILA 5KNDA 1FNNA 2YWHA 2P6RA 5EJEA 1NLZA 3SJBA 4LCBA 4PC2A 1OXTA 1MO5A 3PEWA 1GRQA 3AF3A 4KI0A 3K53A 1YJ5A 4HI0E 1SHZA 3U5ZB 3TW4A 2W58A 2J7PA 4TT3A 2CCJA 4WOPA 4A8JA 3L43A 4XVRA 2BCGY 1I4LD 1NN5A 3CO5A 1S3GA 1MRSA 4BRWA 1ZMXA 4W5JA 2V9PA 1ZM2A 4DDWA 1GNQA 3QSYA 1RFLA 1CS4C 1IN7A 1TEXA 4FD2A 2EWWA 4M1YA 3W6NA 1AK2A 1QBKC 1YR6A 3JVUA 4XD7D 5TXGA 2YINC 3KJIA 5H8WA 3LLUA 4AURA 3CH4B 4IVPA 1SVIA 2WWWA 3QEJA 1CRPA 3RS0A 4HLCA 4ZI3A 1UADA 3QQ5A 2IXGA 2W2VA 3LVQE 4ACBA 2FDCA 4XTRA 1HUQA 4RZ2A 3MG9A 1SXJE 3NXSA 4DLTA 2IF0A 4LJ8A 4PC3A 4Q19A 2JJ2D 1JXOA 4LV5B 5IK2A 1NBMA 2YYZA 4EIWA 1W2GA 3X1DA 1E69A 1KI1A 4GPTA 2Z4SA 1NY5A 3D3QA 2BM1A 1XB2A 1ZAKA 3IIJA 2JGNA 5K8LA 1RC8A 2J45A 5B2ZA 4F4CA 1SKYE 1ZD8A 4LHVA 1CJVC 2VHUA 2W0MA 3X2SA 3I62A 2OILA 4PR0A 1TU4A 2F7SA 5EZ5A 4LHWA 4NH0A 2XSZA 1U81A 3VU9B 1JAIA 2AXPA 2ZITA 1XTKA 3CRRA 3WYGA 2C2HA 2G77B 2VH5R 2EFEB 2QAGC 3ZQJA 3ZD7A 1K5DA 4RCZA 2FH5B 2W0SA 2ZSFA 2BEKA 1G19A 1ZNWA 2RCNA 3SYLA 1G8HA 1XFAA 2ZYUX 3Q5DA 4XJXA 3QKUA 4R9UC 2WJGA 2W6JD 1KAGA 2H1LA 4RZUA 1J8YF 2HJGA 2ZS9A 1SQ5A 2WHXA 4AD8A 1PZNA 4GDFA 2IUTA 1OYYA 2NG1A 3G82C 5F9HA 4KHZA 4JKYA 1E9EA 1R7RA 1Z06A 4Y0AA 1VG8A 3RS2A 1U9IC 2QL6A 2GXAA 2JCSA 3BC1A 4FINA 1GL9B 4Q1DA 1U2RA 1W44A 2VF7A 2ZRMA 3SQXA 1ZBDA 3EZ7A 4W7SA 4L15A 3WRXC 3Q5EA 4Q9HA 2QM8A 2J41A 4LI0A 2Q9BA 3TJZA 1YZNA 2PX0A 4MYHA 1E9RA 4HZUA 3C7KA 1ZIOA 3OHMA 4IXMA 4TQ9A 3TAUA 4M21A 4A8JB 2GXQA 1E2JA 5AUNB 3U6KA 1AZSC 2IHBA 1XX6A 3DZ8A 1R0XA 2TMKA 2ORWA 4DSUA 1E2MA 1NN3A 2A5FA 2QUZA 2VP0A 4Q4JA 4QJ5A 2O0JA 4NTZA 1S2MA 4WBSA 4ZO4A 3SU8A 3UG7A 3ZZTA 2HCJB 4DCVA 4KXFB 3L82B 4I1SA 3NG1A 2OO7A 3SC3A 1KDTA 5JSZA 3NBFA 2GCPA 2ZAOA 2VSFA 3SI7A 2R6CA 1KOFA 1JR3E 3QBTA 2C9YA 4S2EA 5JS7A 4US2R 2QAGA 2WZQA 1OT3A 2QG6A 3BOSA 1PUJA 1W0KA 2IWRA 2FA9A 3BH7A 2FZLA 4OHXA 1VCOA 1QG4A 1R0YA 1DG3A 4WXPA 3TW8B 4E5UA 5CLLA 1T3LA 1ZP6A 1NG1A 3UANA 4M8NE 4TSFA 3SEAA 1JXMA 3TUJC 3EAQA 4AYWA 2NMVA 4UNRA 3TE6A 1VCNA 1LS6A 1YQTA 4AYXA 2QE7A 3ZIAD 4A6PA 4PSVA 3NBZC 1A2KC 1D2EA 2C77A 2RGAA 2IYVA 3SN6A 4BRUA 4DCTA 4PC7A 3AGPA 3FKSA 5UKDA 2NO6A 3W6PA 2JLUA 3P26A 2GF0A 3M0EA 4CF7A 1AS3A 4GMDA 3QE0A 5HKKA 1QF9A 4OI1A 3WNCA 4ZDKA 2FJUA 1CJTC 3IO5A 1NY6A 1K5GA 5KNBA 5SZIA 2C98A 4CW7A 2A5YB 2EFDB 1E79D 1MRNA 2WWXA 1RW4A 2ZE6A 3HPQA 3TH5A 1FW6A 4QBIA 3AVXA 3AUXA 5J4VA 1AQUA 4E03A 4Q1EA 1AM4D 2ZU0C 4G0NA 4MRPA 2C99A 2ZJZA 1N6OA 2CK3A 2N42A 3QPUA 3X1XA 3NEJA 3O47A 3PIRA 4OKSA 2OUKA 1XP8A 3C16C 3CNOA 1CU1A 4GZMA 5CLQA 4BFZA 1E2EA 3CRVA 4P32A 4URUR 3GQBA 4IVRA 1XZQA 4IEEA 4HZUB 4QGFA 3IQXA 3EWAA 3WMEA 1JPJA 5E95A 2PL3A 4HDCA 1MT0A 4KVGA 5C4MA 4KBGA 4ZPXA 4UXJA 3BFXA 2OSBA 4Q4JB 5HE9A 1E9CA 4NZYA 1G3MA 1GOTA 3EZFA 3CF0A 4GOXA 4HB0A 4PZLA 3GJ6A 2MSEB 4DLRA 4Z8XA 5IDVA 2KJQA 3SFVA 4YMWA 3SJCA 4C0AC 3PCRB 2NTYC 1GL7A 4R98A 4KYIB 4FMCB 4M2LA 1ZNYA 2QP9X 4CT4B 3E70C 4KBFA 2IC5A 2OEPA 5JSZB 2VEDA 3GEHA 3CUEF 5L3QA 5FTJA 4OL0A 4M0LA 3AKCA 3REFA 4F93B 2QAGB 1T5LA 1XPRA 4DDUA 5TMPA 3H1TA 1NL3A 3CRW1 3DMDA 3FVQA 4EJSC 1E6CA 5D3MA 1N6RA 3LBNA 1CRQA 4D4MA 3LXRA 1IY1A 4AKIA 2FU5C 1TQDA 3T12A 3UMRA 5FBQB 3FDIA 2VP9A 3OIYA 4FXPA 4ZIRA 3AVQA 5J47A 1E1QD 1OH8A 2AXNA 4JLDA 4ASUD 1G4UR 3IIKA 1CF4A 1DE0A 1E2KA 2GAAA 2FSIA 2XZPA 3NKVA 3SHFA 2QEQA 4BUJA 4KFTA 8OHMA 3CLVA 1TPZA 2OFXA 2PH1A 3PUXA 1XTSA 3OE7A 2CVHA 2X2EA 4O2LA 3E5HA 1KYIA 3TIFA 1NVUQ 3BWDD 1CJKC 521PA 1VIAA 2ZROA 2Z5FA 2C04A 4AG5A 5FBWB 1P3JA 3ZYCA 1ANKA 4NCJA 4A82A 3AP1A 4BLTA 3D6TB 1Q20A 5FTNA 5BQ5A 1XD8A 3VR5A 2EWVA 4EPYA 4BPBA 5EP3A 1FTSA 3PEUA 4Q4AA 3AVVA 4TLBA 1KI6A 4LV6A 5J4KA 2X8AA 1GILA 3ECCA 1KY3A 3TGPA 2HF8A 4N0DA 3UG6A 3V9PA 2WAXA 1PJRA 2J7KA 1IN4A 2RGEA 1IAQA 2QMUA 3CRQA 1GIAA 2QA5A 3B6EA 2V54A 3F5FA 2GEUA 3RRZA 5JWHA 2WICA 4AWXA 1GSIA 4DVGA 5ELXA 4JSTA 4QG7A 5JLJA 1Z6AA 2ZAMA 3MAAC 3QEOA 1NKSA 1T8TA 1XBTA 4EJSA 2WVJA 5KDLA 5FTLA 3EZ9A 1XTQA 1SULA 3TVTA 3W6OA 2G1JA 4PC6A 1G9XA 4IKEA 2YKGA 3NTUA 4WW0A 3TSZA 4DB2A 4LHXA 1W47A 4PHTA 4JLMA 2ZXUA 2IYSA 3L0PA 4V0NA 1PV4A 4B74A 2IXFA 1GKUB 2VIIA 2J0UA 1L7VC 3RS5A 4NPHA 4QNMA 2C96A 3S1AA 2CVFA 5CYOA 4A1FA 1RRCA 2VLIA 4JVSB 3RS4A 1KSGA 5L3QB 4Q66C 5FPYA 2CE2X 1NG9A 3ZQ6A 4M9SA 4MGKR 3MWKA 4RD3A 2OCAA 3AUYA 3KQNA 1H8HA 5GADl 5D3MB 4HB3A 1LS1A 1E0SA 4HB2A 3N5CA 4P3YA 1AIPA 2FSFA 1JEDA 2GXUA 3DM9B 4XTCS 4YDHB 1Q44A 2FPMA 2XB2A 1BYIA 4UXIA 4NCHA 4OBEA 5KU1A 4ZIRB 2ZI5A 2EU8A 3K8YA 3KTAA 4TL8A 5JJIA 4O25A 3OEHD 1ZM4A 3AF0A 1AKYA 2I3BA 2V8OA 2JIZA 3ZZ0A 4QNRA 4BE7B 3CPHA 1SXJD 2R6DA 1WP9A 2ZEJA 3RS7A 4QRHA 3FHOA 1P5ZB 4HATA 1T3SA 3FB4A 4DCNA 1R6BX 1OFTA 3RSLA 2VA8A 1GRRA 4B3BA 2BC9A 4J0QA 3WXMA 4ON9A 5CJPA 3KQKA 1DAHA 2VF8A 4TZ0A 2VTKA 5EXXA 4A0FA 2O5VA 4A2WA 2JLXA 3U61B 1UJ2A 3I72A 1E9BA 4YLGA 4Q4AB 4PANA 1AZTA 1W4RA 1KI6B 3GJ3A 2REOA 1G7TA 2WM9B 2HT6A 4C0SA 5CDFA 4ZDJA 2IF2A 4LJYA 2CHVA 2QPTA 2LKCA 1OHHA 1GUAA 2PT7A 4KYUA 1IN8A 1L8QA 2PJRA 4TTRA 1FOEB 5LPNA 1OXVA 2MSCB 3P32A 4PPNA 1XCPA 4HYYA 4OHZA 3OAAD 2N46A 3BXZA 4B2PA 2WSMA 2GEVA 1OKKD 4QM6A 4OK3A 1P61B 1XTJA 4EJSB 4LJ9A 4Q1FA 1S9DA 1Z0FA 2H17A 3Q9LA 4FMBB 2Q3MA 3ZGXA 1KIMA 2ATXA 5KUTA 3AKYA 5IHPA 1XPUA 1EWQA 3OEED 1COWD 4L5BA 1WB9A 1KDOA 1KI4A 1CP2A 2ZE8A 3A4LA 4PO9A 4D25A 2ZJ8A 4Q7LA 4EPRA 4G5SA 3GLIA 5FBLB 3WNDA 4RVCA 2WJHA 4QHYA 4EPXA 2J0UB 2GHIA 1NLFA 4JYBA 4MRRA 5SZKB 4A15A 2HYDA 3S1AB 2V4ZA 4XD7A 1KO1A 2QMOA 3NBYC 4DXAA 3EC2A 4TLCA 2QRZA 2O8DA 4GSYA 1TQ2A 5J4HA 4M4SA 1P9NA 2HT1A 2F55A 4HLUC 1KNQA 3ONWA 4E07A 3TQCA 2F3TA 4FMDF 1ZC4A 4I99A 3KUDA 5CIWA 1OH5A 4LJAA 1W0JD 3AKDA 3AEZA 2J0VA 3SBDA 2XNDD 2AKYA 2GVDC 5JWRA 3CPJB 4DBLC 4H1VA 3MGCA 1VDZA 4GP7A 1KKMA 1E2IA 1LV7A 2GNOA 5FOVA 4Q1AA 1XF9A 4X8OA 3REGA 1BOFA 1CTQA 3PV0A 4R71A 3R7WA 4BFWA 3ZLJA 1G5RA 3DL0A 4QL3A 1QDEA 4LHZA 4BGDA 3KTAB 5K8IA 2V6IA 2LCFA 2WKRA 1F6BA 3PITA 1Q57A 3QXCA 3RWOA 1S1MA 1FPMA 4YXWD 3VKHA 4RKEA 4QJ3A 3C41J 3E2IA 1TQ4A 3A1VA 5KPJA 2JLSA 1ZUIA 5BXQC 1PUIA 3Q72A 1E96A 5KOYA 4U7DA 1KNXA 1EFTA 1Z2AA 3QY0A 4XVQA 1W49A 1FP7A 3P20A 2D7CA 4GBMA 2CHGA 1Z6GA 3B1ZA 3THOA 3HYRA 4C9BA 4TYYA 5BYJA 3RVBA 4TL9A 4E09A 3K09C 1T3HA 2WTUA 2ZI9A 1P2UA 3LA6A 1WE2A 2OCPA 3W90A 3GP8A 3ADKA 5KSZA 2W6JA 2W2TA 4TYQA 4URYR 4ZCMA 1I4TD 1Z63A 2E1RA 3AP3A 5F3WB 3UKDA 1MKYA 3NEYA 1ZYUA 3BBPA 2I1QA 1M7GA 5FUVA 4Z1MD 4N0EA 3I3SR 4O3MA 1II8A 1G5PA 3HU1A 1F2TA 1TL7C 1ZD9A 2Q9AA 4HLUA 2ZM5A 3X1WA 3CH5A 5FOTA 1BO6A 1DO0A 5KPDA 3VQTA 4FWIB 1E32A 2HF9A 4ACAA 3U3KA 4PPGA 4US1R 2QRNA 5L8VA 2PCJA 1X6VA 3WBKA 3CX6A 4TN1A 4EUNA 1EFRA 2P2LA 4EAQA 1YZUA 1D5CA 1ZC3A 2P5SA 3GLIB 2X2FA 3ZJYA 1G41A 4CEJA 3PVSA 2ODWA 5FL7D 1IY2A 4DB4A 3C14C 4XWAA 2CLCX 1Z6YA 4MRNA 5IF9A 2D2EA 2ONJA 2BBTA 5EP4A 3RYTC 3L2OB 2FSGA 2ZJ5A 3VKWA 2O8DB 2Z6VA 2CMKA 4MGYR 1OE0A 1Z6TA 3IQWA 1HY3A 2AKAB 3K9LA 3CM0A 3DDCA 2WJVA 3T1VA 4F7WA 4K8OA 3KXLA 3A1SA 5JI3E 4Q01A 1E9AA 4PHHA 3O8BA 1XTRA 3A6PC 4Q9KA 4EQ6A 4JLKA 2ZRKA 5AK0A 2PZEA 4RD6A 3WMFA 1N3BA 4CRWB 3GJ7A 4C3ZA 4PZYA 5EP2A 4TL6A 1KMHA 2YOHA 2DB3A 3U44A 4ILEA 4HLQB 1GITA 1M2OB 4R2IA 4RD0A 3R7WB 2CHQA 2WJIA 1UEIA 2EFGA 1N6HA 3LY5A 1WCV1 1N25A 2VHTA 3ND9A 3VR4A 2D62A 3WHKA 4V0MA 4WVFA 4DLUA 3ZIAA 1II0A 3UMSA 1RPZA 3T34A 2UVQA 4B76A 2V3CC 3SZRA 3WP0A 1JECA 4CYMA 1NIPA 2AD5A 1TMKA 3KJGA 4ZCLA 1AGPA 1R8SA 1VECA 2BMDA 5TARA 2F3RA 5JHGB 2JLYA 1TU3A 5KDDA 3HPRA 3C5CA 3QPWA 3ADCA 4ABYA 3I8XA 3W5IA 5M04A 1JJVA 2J0SA 4C7OA 1CR0A 5DN6D 1M8PA 5F2EA 1TF7A 1NVXQ 1E79A 3EA0A 2J0QA 4Q21A 3KL4A 3GLGE 2ZJYA 3NBXX 4POAA 1II9A 3OZXA 1KMQA 3A1UA 3CWZA 1R0WA 1GG2A 2QTHA 1C1YA 2OHFA 5HZKA 2BWJA 2JLWA 1N6LA 1J90A 2OXRA 3RWMB 2FNAA 1II8B 2VP2A 1F2TB 5IRCD 1TTTA 1KDRA 2IYXA 2ORVA 2B6HA 3U3OA 2GJ9A 1FQKA 3LXXA 3AVOA 4A2PA 3EPHA 1F5NA 1W7AA 4V0OA 4JLBA 1UM8A 3EIEA 1KK2A 4U00A 4H9GA 2QU8A 4LJ4A 4RFSA 4JYCA 1XRJA 4CEJB 3H86A 1GFIA 3DEFA 1GNRA 4PAQA 1XEWY 1DS6A 1TF2A 4CVNA 3K9NA 2ZRHA 1XMIA 4L9WA 1G21E 1GTVA 3LH5A 4UNNA 3TBKA 1U0JA 1W46A 1JJ7A 1HT1E 2JDID 3KKNA 3MD0A 5FH9A 1IOZA 5CIQA 4IDPA 1YR7A 5KYKA 2JLZA 1E0AA 2IHYA 3LQQA 4EPWA 5AUOB 4AKEA 4RFVA 5DIFA 5EXSA 4C0HA 3B60A 4EPVA 4C2UA 4EQ6B 1P60A 1ZRHA 4LC0A 1Q1EA 2XB4A 3PENA 4LC1A 2J87A 4GOKA 2BKUA 1KMHB 3R9IA 1J2JA 1OFIA 3U44B 4B73A 1E2GA 1C4OA 3AVTA 3I92A 4NYJR 4JL5A 2RH5A 4II7A 1E1RD 4WZBE 1WF3A 1RYFA 1HEIA 2YWFA 1X8KA 3UPUA 4B3FX 4ZCIA 1Z2CA 2R6GA 4DC9A 1CJUC 5DGXA 1XDBA 4YMSA 1E1QA 2FGKA 2MSDB 4ASUA 2HYIC 1UDWA 2XGJA 4HZIA 2G3YA 1H65A 2NZJA 3RC3A 4TMKA 2FSHA 1KK1A 1P72A 3IPYA 4GI7A 1SVKA 1XXHA 2YOGA 3E1SA 2OAP1 3OF5A 4DCUA 4Y0VA 4ZDWA 5TV2A 1GKYA 1KI7A 4MRSA 1OFUX 2HJVA 1KHTA 4LGMA 2HCBA 1WBDA 2ZRIA 3LX8A 2D06A 5E7JA 4BLSA 2AFHE 1TUEA 2FEMA 3KFVA 4JLJA 4Q4HA 4AG6A 4C7OB 2AD1A 2ZIAA 1IXRC 1E2PA 1OXSC 3FKQA 4Z51A 1XNJA 3JZAA 1R5NA 1GRNA 4EFNA 3U4QA 2A7QA 4Q7JB 3T1QA 4P4UA 4WA7A 2XZOA 2OT3B 1NI3A 3SBEA 2CDNA 2QI9C 3GMTA 3QPVA 4QBGB 1M6NA 1EXMA 2JA1A 1ZNXA 2GDJA 2JAQA 2RHMA 4L9SA 4URXR 4PTLA 4YQFA 4M1TA 3RRNA 2OE2A 1SXJC 4LYFA 1PLJA 1RKBA 2YOFA 5A0FA 221PA 5EXTA 4A4DA 1RRFA 1G8GA 2P6UA 5C1BA 1BS1A 1X8LA 2ZRNA 5EE0A 5FL3A 2AK3A 2K5UA 4HDOB 5EE3A 4LRWA 2HDNB 2CL0X 4H1UA 3B13B 2IS6A 4RFSB 1G18A 5BYKA 4PAOA 3KQUA 2IYQA 2WMNB 2NOAA 4D6PA 2H5EA 1R5BA 2F43A 4OQMA 4DLXA 4DJTA 5DI3A 2QP4A 1CXZA 1SVLA 4B44A 1RIFA 1S96A 1OLOA 5GVRA 4C0KA 4DLSA 1NVWQ 2WWGA 3CRMA 2GK6A 1U99A 1QHHA 4CDGA 4ERNA 1DBSA 1G17A 2GRJA 4D81A 3H4MA 4NDZA 4C2TA 1BKDR 3WNBA 2YWEA 1Z0IA 2QSYA 4L16A 4I1OA 2FX3A 4I1VA 3KJHA 1G20E 3VX3A 1BYUA 4KSBA 1GDDA 3VTKA 1YE8A 3VR3A 3F3YA 3V4RA 1YR8A 3AP2A 3IPXA 4N3NA 2FFQA 4PFSA 2OESA 2GBLC 1G16A 4X8MA 5G3ZA 3BH6A 4JIMA 3IO3A 2KE5A 3LX5A 5JWOA 4BLRA 3UWOA 4OI0A 4QM7A 4X8HA 1BIFA 2VSXA 3DMNA 3KUCA 1MO3A 2FF7A 3GLFA 1SVOA 1UDXA 2PMDA 1Y3AA 5FUWA 3BFKA 3SR0A 1Q1ZA 2EVWX 2ZANA 2A78A 4DSOA 1F48A 2ERYA 3VKGA 4BLQA 3OEHA 1W36D 1ELOA 2X77A 1RJ9A 1XXHB 3ZDQA 2C03A 1SXJA 3LRPA 4JLVA 1O3YA 2ZE7A 2OG2A 3SOPA 4JL8A 3GD7A 1ESNA 2FFHA 4TMXA 4IVQA 2G6BA 2O0KA 2QGZA 3F8TA 3LV8A 4Q4HB 1GNPA 3EG5A 4FMCF 3QOFA 4R7ZA 5FI1B 3SE0A 4RCYA 3ND8A 3K70D 4NCNA 3I5XA 2ZPTX 1P62B 2CLSA 2EFCB 1MOZA 4DRZA 2FOLA 3I32A 2ZSDA 3W3AA 5H1YA 3TLXA 4BQSA 3U4QB 3ASZA 1S3SA 3NHBA 4TZ6A 3ZS8A 4LSGA 1KJWA 4PC1A 2V55B 3KB2A 3PR1A 3TUZC 5DNYB 4D80A 1G3RA 1AKEA 4PPQA 4PX9A 2QTVB 4L4UA 2QZ4A 1XPOA 1KZ7B 4O2RA 1W48A 1AA9A 2PJZA 1TAGA 4PSKA 4Q9JA 3R9WA 2PLFA 3FHTA 1FZQA 4LPKA 2BBWA 2OLJA 2Z43A 4NBSA 5F9FA 3C4JA 4MGZR 4KLNA 2ZSEA 4TQAA 3OAAA 2WSSD 1Q21A 4OI2A 1SZPA 1XMSA 2YC2C 4RD2A 4C0BA 3SQWA 5ANRB 4S35A 3FGNA 2A2ZA 4BEBA 1NVVR 3D7MA 4D0GA 4URWR 3A36A 4V03A 1Q3HA 4QGAA 2GBLA 5HE8A 2E87A 4PO1A 1FP6A 3EPLA 3SNHA 1ZM9A 3OEEA 3ZVLA 2F43B 2DFNA 2DFLA 2RGDA 2W6IA 4JJKA 2KBEA 5DI3B 4IW3B 4YMTA 3CWQA 1D8TA 1WA5A 1ZUHA 1V43A 2BBOA 3RS3A 1D2NA 1T0JB 4B71A 5JCPA 1QHHB 5DSZA 1K6MA 5BW8A 3A8TA 2Q0HA 3I8SA 1DARA 5JJLA 1QHSA 2IS1A 2AL7A 1KO7A 3U7FB 5JZVA 4NYIR 1OIXA 4OQXA 3ADDA 2RGGA 4NE2A 1F3OA 1EFUA 3GJXC 1JQJC 1P7CA 2QMHA 4XSHA 2F6RA 3BD9A 2R6FA 4L8GA 4YONB 3GPLA 4B3DA 3GLHE 5GJVC 2V6JA 2B7BA 3AB3A 1W0JA 2ZSBA 2BDTA 1DO2A 2XNDA 4M1SA 5DLQC 4JL6A 1Z8FA 1NMZA 5EE1A 4HDQB
chains in the Genus database with same CATH superfamily
2NO7A 4XR4A 2FYTA 3L84A 3HJNA 3MA0A 5KJ6A 2HA2A 2NXJA 4QUHA 4DCPA 3JALA 4EKIA 1P44A 2QZSA 5F4BA 2A9KA 4RKYA 2QLLA 4MWZA 3UQZA 3OCYA 3REQB 2H59A 5KYYB 1MXFA 3MYRA 3ZCQA 1NWHA 1WQ1R 2CMHA 1SUEA 2OGTA 4ENUA 3QRWA 1JTVA 4YXWA 3HCAA 4YP0A 2VN8A 2ATCA 2OR3A 3KE9A 3OIUA 1U7ZA 3G7SA 1FB5A 4LQDA 3VRHA 3T5GA 4XVUA 4KVAA 5CYGA 2XVXA 1D2MA 4BLWA 1BS9A 3RGGA 2Y1XA 4M7RA 3ZCTA 4UCQA 3TZBA 5AJZA 1JQDA 3FPHA 2BLLA 2VJCA 4AMZA 5I9SA 4ER7A 2XRZA 1C1DA 1QHIA 2HH9A 5ALHA 1K27A 1UBSB 1MAUA 3DOHA 3DNMA 4G5RA 1JJFA 3VZPA 4AL4A 1F38A 1X77A 5TDHA 3V3KA 1N6IA 3G0HA 1PEDA 2R1UA 2X8JB 2KYRA 4MYUA 2WJJA 4Z7NB 3QOYA 1N1DA 3OQJA 2C8JA 3OJXA 2DY1A 2Z2JA 1U5CA 1SG9A 5JHHB 4CR8A 2LW7A 1N7GA 1LF0A 4MKIA 4YWHA 4AWAA 1K8QA 3WFZA 4CIYA 3CVYA 1LLQA 2IS2A 4P35A 3VO2A 3C3WA 3ONNA 4UDOA 4QU8A 1DBPA 4I4NA 4URZR 4GM1A 2XNCA 4PLFA 3UMGA 4FN4A 4CDMA 4G0PA 3VUFA 3I4LA 4WK2B 4BO4A 4YV2A 3FFBA 4IIDA 3KKPA 1JN0A 1HDZA 5AKKA 3PNVA 3TCXB 2LUOA 1PJBA 2H06A 5AKGA 2IUYA 3FDXA 1JBQA 4MLDA 4IDOA 1JBKA 1U3VA 4I3GA 3HCNA 5EKDA 1L4UA 1KFKB 4DGSA 2FZGA 1JLLB 1J4AA 2O8EA 2O1SA 2ZRFA 3L7DA 1XJWA 4QYXA 1TCBA 2LTAA 2ANBA 5FUXA 4L73A 4JBNA 2O48X 4NJMB 5BV0A 2AZXA 1B76A 1P9WA 4LAFA 4Q47A 1X0VA 1P0FA 4OHWA 2CF5A 1JFRA 1VFPA 5EMNA 3COVA 2QLJA 4JUCA 4BQIA 5A5GA 5FL7A 3JYHA 3Q12A 5DW0A 2AHOA 3P9CA 4WBNB 4IXNA 4C03A 3DVSX 3DTVD 3QHAA 4TMWA 1RAAA 2PEZA 4DNFA 3V4SA 1QNFA 2DMRA 3TR5A 3ZHCA 1TC1A 4ZTUB 4KQFA 4J4BA 3UK2A 1SXPA 2ES4A 4C0JA 1EGHA 4M36A 5I4BA 1J1ZA 1Z0SA 2PO5A 4RPKA 1FUKA 3TNDA 1G6KA 4BB5A 4F1WA 1ICIA 2F62A 1M2EA 3B3GA 2BI4A 1VCHA 2OC9A 1B6TA 2Y1WA 2Z5GA 2XDQA 3HACA 2R6ZA 4CWAA 1U0BB 1J2TA 4TGLA 2R1TA 2YMMA 3ZQKA 3P9SA 3FNBA 1MO4A 3AR2A 1XD9A 3EXG1 3BULA 3ND6A 3EVGA 2K2WA 3BA1A 3MT8A 1IEVA 1VHWA 4MIKA 4E5SA 4L5YA 1W6RA 3RVOA 4UUOA 3CCBA 3KZCA 1UIRA 3VR2A 2R00A 3JYLA 3ZGLA 1IU9A 1NMXA 1OROA 1VRCA 4YJDA 3ICPA 4YPVA 1TCCA 1BRTA 1QOQB 2E4WA 1R9GA 1Z7GA 2CMFA 1QZZA 2AF3C 1SOAA 2CY0A 1EFHA 2HA7A 2RSLA 3B1WA 3IHTA 1G6Q1 3KX2A 4HHEA 3UA3A 1E1MA 4ZEVA 1TCAA 3GRAA 3LPLA 5FPHA 3RDPA 5JS6A 4F60A 4L72A 5DE3A 2CK3D 3U49A 1NYRA 1DUIA 5JJBA 1WETA 2PDAA 4D9IA 5AUPB 2J5RA 5E4TA 4ND7A 3O3MB 3WJ2A 1MW9X 1Z7EA 3DLAA 3FFAA 1EJBA 2X0FA 3VHQA 4JWKA 4MKXA 2G4LA 1HM5A 3GMDA 3V8MA 4JJ7A 3ZDEA 3AR6A 1VPDA 1KE2A 5LD2C 2LCIA 4RHEA 2C4NA 4OX9B 5KWIA 1PVOA 5IEBA 1F5SA 4GLOA 3IEVA 3RIYA 3KJQA 4JR2A 5HOEA 3ZE2B 4KK3A 1NLMA 1TKAA 4FDAA 4QUEA 4PRKA 2FUG1 3GEIA 2G5CA 3HU3A 3ROZA 3W5DA 4MAMA 4AICA 5BUQA 1PIWA 4NVRA 4BPRA 4I1UA 5JD5A 1P7PA 1Y3IA 3SF0A 3E9QA 2WUDA 2QN8A 3N58A 5CT8A 4YJ3A 3G1UA 5IFLA 3ROFA 2FZEA 721PA 1GTG1 3FY4A 2B0CA 1X1DA 4AS1A 1DWPA 3L1UA 3NIDB 1XMVA 2CW5A 1B8UA 3AW9A 3K35A 2BEWA 2EHJA 3C70A 2ZXEA 1ISMA 2OCGA 2GPAA 2JIQA 3LQKA 3QJ5A 2FCRA 1E64A 4MPJA 4V0ME 4B6RA 4PYIA 3KWFA 2G1KA 1LTHR 1JKFA 3CYFA 1NJGA 1LB1B 2BTQB 3EEIA 3EJ6A 3ER6A 3JRWA 4N5HX 4RXTA 3JS5A 3X2FA 4YRNA 3EPJA 3L4BA 2E49A 3HUDA 2X9NA 4MOWA 2XD9A 4GPZA 4IDHA 4HXFB 2DETA 3JV7A 3MZ0A 5CAEA 2EFHB 2YRXA 4HMQA 5DYTA 4WESB 1BMFD 2PZFA 4RCVA 4YRPA 1MENA 2A58A 2D3WA 3FDZA 2HN9A 2WD7B 1IZ9A 2KPOA 3G0IA 1DAGA 4UBMA 2B4KA 4DYHA 5IKXA 4GUAA 1GNVA 5DU2A 3QKIA 4KR7A 3GNTA 4NI5A 5F78A 5CT6A 3C3MA 4WN3A 3IVCA 1B23P 4R8VA 5AUQA 4CDRA 2OV6A 4FHDA 3JWGA 4KN5A 1ZJ6A 1VL5A 1MAWA 2O3RA 2ZQ5A 1ESMA 1CKEA 3DLTA 5BSEA 4HDRA 5IULC 2HGSA 5BN4B 4QE3A 3KZOA 2O6LA 5LLDA 4OQLA 3NH9A 3GP8A 4E30A 1CVIA 5E6SB 3X1KA 1U4NA 1Z28A 4PHFA 1T1IA 5DCLA 1O08A 1WD7A 5GZ1A 1K7XB 3I6YA 3NETA 4F1JA 1DELA 1Y89A 3TG2A 1CY0A 1BFDA 1E1RA 1MC4A 1TYEB 4JC0A 3F71A 2ODBA 4AN1A 3U6BA 4MW7A 2QTFA 3UV7A 1CUUA 1FFWA 2PVCA 1DKMA 2Q0SA 1QGED 2AX3A 3PJGA 1FLAA 1N75A 2NP6A 2EP7A 1EAMA 2HTEA 3UWPA 1QYDA 1Z26A 1GWNA 5LB2A 2W90A 5KZMB 1PR4A 3E35A 4IGFA 4CLXA 1ECBA 4RQBA 4WA8A 4M0MA 2OP0A 2OBFA 1NMSA 2AF4C 3CCCA 2DBRA 4TTTS 3I04A 1YJAA 3NGXA 1QWSA 1M3SA 3P9XA 4TUYA 4JENA 4URFA 1OMOA 3ZPXA 2NPOA 3QBEA 1YJQA 3QXSA 1H1DA 4PFJA 4HWOA 3VO9A 4B48A 4CMGA 3OE4A 5DNCA 1KO4A 4EZIA 2QQFA 4JEHA 4UM7A 5JJ5A 1KU6A 4FFWA 4L28A 1M2FA 4CQJA 1U4SA 1VPLA 2EW2A 4KMRA 3IOCA 4ZHQA 6ABPA 1TUGA 3QELB 4KNVA 4NYMR 3EXEB 4Z0TA 1C9NA 2QRKA 4D0NA 5K05A 3N3AC 3G2PA 2G6TA 1RWWA 1Z17A 2VNHA 3DVQX 2JIDA 3D6UA 2WAOA 2VJMB 3IGFA 1NXOA 1X3SA 2BBSA 3H2YA 4OXXA 4PE5B 4WGGA 5DNDA 1NJFA 4PG4A 3VV3A 4DHEA 1X80B 3QBVA 2GZAA 2X1HA 4LWPA 4LJ7A 4C29A 3D2CA 5EHNA 2IUUA 3A2LA 1KJZA 1QG0A 1FMCA 2B5OA 2EERA 2GUWA 1Y1SA 4I50F 2XT0A 3TIIA 2ZUVA 4DUGD 5K09A 3TXXA 4QBFA 3GJQA 1S0UA 3B48A 1OIVA 3M6UA 4GX0A 3D8NA 4JU8A 1V2HE 4GSLA 2Z6UA 4WY5A 4XB1A 3W5JA 4Y9RA 4F91B 2QG9A 3NHSA 1NMEA 2VFAA 2VPYA 1DOAA 1ZD2P 3DWEX 5ALFA 1BQEA 2WIAA 3NUQA 5ERYA 4E0BA 3VJRA 4CYMA 1P4AA 3DOFA 4LDAA 2ZI4A 1CY1A 3FBWA 1GL3A 1B2LA 1Q1QA 3BORA 3O9ZA 2QD3A 3QE2A 4F2HA 3K70C 1F60A 3QVOA 4XXHA 2Q2QA 1L4MA 4MGIR 2P8SA 1E6KA 2ZIGA 1RAHA 4PYQA 4OM8A 5HUHA 3QKRA 3CX3A 2QBYA 2C4TA 2GCNA 3EIWA 4Z53A 1IHPA 2V0NA 3DBRB 1XD2A 4FN5A 4KX5A 2VP3A 3ESCA 5DM2A 1ZZEA 5THKA 2J3MA 3BFVA 3T5DA 5LOVB 1INLA 4E14A 2OKGA 4IDQA 5F2OA 3TTTA 3QE3A 2CEKA 3S0JA 4KDFA 1DVRA 4ZV7A 2PT9A 1K3UB 1YT5A 2VLBA 3V5NA 1XCGB 3DCYA 4YGYA 3QUAA 2W00A 1SH7A 2J5BA 3PK0A 3T7IA 1RYNA 3E2MA 3N8IA 5BV7A 1P0IA 4PU0A 1GYPA 5JDCC 3L4KA 1AT1A 4E1BA 4D4LA 5K8UA 2QROA 3RS8A 3ZEIA 1WPXA 3PT5A 1OH7A 4Z9FA 4XUGB 5C18A 1YBAA 3FE2A 4G8BA 5DWVA 4EHFA 3AHCA 4NWIA 1EFCA 5DBOA 2VK1A 4IS3A 1GXSA 1XE3A 4OHPA 5IJ9A 3GOQA 3RI3A 4GFDA 1AUVA 4KXYA 4EZEA 3CVOA 2HX1A 5FOSA 1QK3A 5JVDF 3NRCA 3PE4A 4DZRA 1AX9A 2HEIA 1NNEA 4LFBB 4GD3Q 2Q9UA 1FVOA 5M29A 1RWVA 4G1CA 1N3LA 4UAVA 1KWKA 3TSWA 2PKQP 1W75A 1X1SA 4N39A 1DWOA 1R10A 4GQIA 4IFBA 1CY8A 1OY1A 2FGJA 2QQ0A 4A1OA 3STYA 4YMIA 4Q1BA 3L9WA 4HGOA 4LRYA 1KYQA 3VOTA 5EIEA 5LQDA 2QM0A 1X94A 3ZH9B 4CU5A 1LC0A 2C9OA 1BA2A 3T9BA 5HK8A 1HDEA 4Q3LA 3G2KA 1I1OA 3QVWA 1MH1A 4FVTA 4XGNA 3PC6A 2FVYA 3PA6A 4TQGA 4PHCA 3NWEA 4KFUA 3DF7A 1UPTA 3QLEA 5P21A 2NNLD 4M53A 3GCDA 1C80A 4W8OA 1ECLA 1CPYA 2QTCA 3U0BA 2GTIA 1DG1G 5KTOA 4HVLA 1G42A 1VMIA 3TINA 1IM5A 1HNWB 1QSGA 1EVLA 4KQ9A 3M6LA 1N2CB 2LDXA 4CMIA 5B57C 4OLAA 3KLBA 4QVKA 1X9IA 5DO9A 2G04A 1KL7A 3DA8A 4X64B 1RU3A 4TTSA 1NIJA 1NVAA 3P0RA 4WX2B 1OFVA 4UHFA 1GT6A 3QLJA 4KIUA 5KOHA 2IWHA 1SXIA 5D87A 3SZGA 3AEKA 2ZSJA 3HJRA 2NP7A 4PBSA 2BZ1A 2F1RA 3UFXB 3RUFA 5SV2A 4JEIA 1QP0A 1JHAA 2RE8A 3NHYA 4NK4A 1D6NA 4CV1A 4ITRC 1YZTA 2C8KA 2QYHA 3D5EA 3LQRA 1BFKA 4HRVA 4PGMA 3EGDA 4QPPA 1ITZA 1I1NA 1KHHA 2DLDA 1NN1A 4ESOA 3B6IA 1CFZA 2CBGA 3NUGA 3KAJA 1KTVA 3OKPA 1EK1A 1XEFA 2SICE 2EFJA 2MOKA 4QO7A 4RSRA 3K5HA 3OU7A 3TX6A 3ZV5A 2NM0A 3PPVA 1NUHA 2VDRB 4KXNA 4PS1A 4EMUA 5CBPB 3R0ZA 4B31A 1ORVA 4TTQA 3UC5A 3VPGA 2QZJA 4QFMA 1YRAA 2DHDA 1Y3BE 4X20A 4A0RA 4RJLA 4B4KA 3LRXA 4QOGA 5GVSA 4DQDA 1E3MA 3JD1A 3SS8A 1QPBA 6GPBA 1H4VB 4G0YA 2Y67A 3L7MA 4CLRB 4OQYA 3ZWCA 1YK0A 5F4ZA 3DBHB 4DJFC 4UM8B 4AS2A 3QITA 4MS1B 2W93A 2Q3JA 2HBZA 2AJBA 4D4KA 3DBLA 3HWWA 1GGKA 3MCAA 4IAOA 1T5IA 1T9CA 1Q6YA 3G5AA 4L02A 3WLIA 2JHPA 4EATA 2G25A 2IEAA 2YYYA 4IH4A 3R75A 1L7XA 4OGKA 2JANA 4PZCA 3FWZA 3MAGA 4LJ6A 3B2EA 4IOLA 4F0JA 7ADHA 4OBXA 4Z4FA 3RUEA 3VA7A 1SWWA 1VG0B 3PUYA 4MH0R 4MV1A 3B8HA 4CHGA 1ZQ9A 3IMKA 4E5DA 2WQ6A 5ICFA 9LDTA 4GPEA 4C5BA 1J0XO 3RRFA 1YNSA 4UM9D 1ONOA 1V5WA 5TQ2A 1YZYA 3QNMA 3SM3A 3I52A 4CM5A 5KHLB 2CT8A 3UT0A 2OLKA 3E4CA 2DCUA 5CW2A 4DDMA 4G0XA 1U2GA 5D00A 2XMZA 1US8A 1M9NA 1UFKA 4YVFA 2WWFA 1TCUA 1GRCA 3IVAA 4IMPA 2VP4A 2WU1A 3IDQA 2ECPA 3K5PA 2ID9A 4W5RA 1C8BA 3UIEA 3BQNB 2BFAA 3FVTA 2PYZA 3C8MA 3BVPA 3EZNA 3QVUA 4MWOA 2QN6A 1OTHA 2ZJOA 2BJWA 2VO1A 3EBPA 4P33A 1VMAA 1XDDA 4P08A 4F3YA 3IMFA 1NXVA 4DQLA 4FW9A 2JAWA 5G40A 2H9YA 1WM1A 4P3KA 1E8DA 5JFGA 3ZDAA 2WFLB 3COWA 2QUKA 1H2WA 5C46F 1FX1A 2R2AA 4KXWA 4DLWA 4I19A 3QLVC 1EFRD 3NIBA 4LCEA 3JCZA 4KCGA 1HTTA 4O4LA 4P4SB 3QLUC 1IWBB 1A5TA 4MQBA 4UXHA 4XGRA 1JRLA 2DVMA 3EVCA 4RIIA 1QRTA 3VX4A 2QX8A 4M49A 2F3QA 5C53B 2QZ9A 3HBFA 4MUEA 1KDPA 2GJSA 3T3EA 4B0OA 4AYTA 4P0TA 4M1MA 2YFQA 3O8NA 4GH5A 3AZQA 4IMRA 4JSYA 3SD7A 2R84A 4RK1A 1BA3A 3CONA 2GZRA 4JFAA 4N82A 1V95A 3FPCA 4UM5A 4XYMA 4CG0A 4B3JA 4DQVA 4G89A 3FUWA 2B4TO 4MI6A 3V48A 3JZIA 2AUMA 2BFDA 4K1XA 4L50A 4K9RA 3NOVA 4BKQA 3QV1A 1Q22A 2REQB 2Q6TA 2ZSIA 4ZJUA 3A05A 3JVVA 5LYYA 1PNVA 3LZDA 4C7VA 2KHZA 2R8BA 3A4VA 1UF9A 1DGQA 3A1WA 3NHZA 2EP5A 3GLGA 4EEXA 2QRMA 2JD2A 5IU6A 2AVDA 2YC4C 2V7TA 4ILKA 1Q91A 1ST3A 1EUDB 4LVOA 5CVJA 5JCJD 1J33A 3EVEA 5FBKA 3KT8A 3OLVA 3WB2A 1TF5A 1Y3FE 1ZIPA 2Q21A 4N9WA 3EBOA 2ZETA 1R6AA 3E8SA 3DTVA 3CX4A 1NONA 3GFOA 1UMBB 3L6CA 3NANA 4ZEXA 2P5UA 5JMPA 5J4LA 2Q4DA 1JTFA 1RXIA 2YJ6A 2Y92A 3HJGA 4GC9A 3VOSA 5FORA 4PQRA 3BXEA 1CULC 2HSEA 3L0OA 1OJLA 5JY1A 4OHBA 1SU8A 4JSRA 4KQ2A 1VJCA 3BZUA 1BDJA 1A2BA 2O8NA 2PZLA 2W11A 3JAKB 1UKAA 4FIDA 4LYDA 4HX2A 1JZQA 1KZ6A 2CUTA 2P67A 4HOYA 3K5WA 5CNKA 3GEBA 4QDJA 3TZLA 4M60A 2RONA 4Z4HA 1E3LA 1JHUA 2DPXA 2XBMA 2JI4A 3LW7A 2PSEA 1E2BA 3RJZA 4UVEA 1N9GB 1J9GA 4AB1A 1L7OA 3RYCA 1XTUA 1XN1A 5IKMA 5A4FS 3S2GA 4M1WA 2P3SA 3N05A 2O8VA 5L4SA 3I9MA 1MG0A 3DR3A 4KQHA 1VE9A 4OGGA 5DKFA 1MT3A 4DR3B 2EL7A 5ILQA 2I54A 1UH5A 5AW2A 1YH3A 4DMFA 2E2WA 2H4WA 4FM9A 1Z3CA 2RGNC 3BXFA 1NBOA 4L4XA 5EJ9A 4JBIA 1L3BA 4G56A 3FF4A 3AO0B 3KO8A 2DRIA 1ZN9A 2FPGA 621PA 4Z2AA 3DPIA 1JQBA 2ZREA 1KY2A 1PEYA 1K9SA 3TQSA 1RKQA 2CZQA 3Q8KA 1U0HC 2F9FA 5L3RA 3QXJA 3ZOKA 4B6PA 1QIHA 3PX3A 1YOVB 1YC2A 2YRFA 4PCLA 3DLPX 1ZD1A 1D07A 5C80A 4NKRA 3TSCA 4X00A 4BNDB 2B92A 2PWZA 2QDXA 1J8FA 3D3WB 4G67A 5DFAA 4HX5A 2KWIA 1J25A 4F3RA 3TMAA 5C5DA 2QD1A 3PZBA 1OXXK 2H8GA 3H6GA 2RB4A 3KU4A 1COZA 3L5KA 4C78A 5FV4A 1BSVA 2O8FA 3UV6A 3E9ZA 4G1UC 2HADA 4HY3A 2ZFUA 1WY7A 4JLNA 3ZUPA 2CJWA 1EGAA 1GZ5A 2P3LA 2PPVA 3FFXA 3L6UA 3N2IA 4MVJM 5LC1A 2HSJA 3W1VA 5IK2D 3F9CA 2FMXA 3I9LA 2YQ4A 2PL1A 3W04A 3ACBA 4GI2A 4FFPA 3YASA 1SU6A 1JI0A 2L82A 1DJPA 4IXTA 4Z2YA 1WUIS 1RQXA 3RU3A 1AO3A 2Z8ZA 2DBQA 4I5EA 5FI5A 4DEVA 2V6FA 2R65A 2YDYA 5FPQA 2CXUA 3HJBA 4LGVA 4J90A 4MICA 4YAJA 5IM4F 3HXKA 1R9MA 3AVPA 5AJYA 3WHPA 1SUSA 1OOEA 1RTTA 4H7DA 4KPFC 2B1IA 1LKZA 4ZVRA 1L8AA 4GLFA 5BNTA 1WSBA 3NYQA 5JATA 2WOJA 1RD4A 1YGPA 2BEUA 1P2TA 3NRJA 3KD2A 1ZCFA 3W2TA 5ITZB 4M37A 2W2LD 5KQPA 3NNSA 5K3EA 4F93B 1FYEA 5WRFA 1BMFA 3HNRA 3PXUA 3KTDA 3U3RA 4NJOA 3UCFA 2O8CA 4ZAXA 3JQAD 4OOEA 4R3UC 2G80A 4BN5A 1XMQB 3TWOA 1JFTA 2XODA 1PT6A 1PZGA 2PU5A 4ZMRA 1UBOS 3WQSB 3LU1A 4HNHA 1JG2A 1VJGA 3RVNA 3MMNA 4P4GA 1Y4UA 5A3QA 4PYLA 2ZRCA 4JJIA 1GUBA 4LK2A 3FPGA 3U48A 3DV0A 3EB9A 2I5PO 3IELA 2YJZA 2F1JA 3FLMA 3GLIE 1I3KA 2B8JA 3GCGA 1QG2A 1Q7BA 2QT1A 3R20A 4TRNA 3ZI0A 5LVAA 3RC8A 2JFHA 3KFXA 3DW1X 3EVTA 1BCSB 2WAAA 5J40A 5EZYA 1Z0AA 1XOIA 3Q9UA 4MUHA 1E5DA 1GGVA 4UREA 1RWOA 2QAIA 3GJ5A 4B8WA 2GKSA 4QUBA 1EHIA 2BMWA 3TNJA 1N2BA 1L4FA 4HAUA 2H48A 1NF8A 1T6ZA 4WKPA 5H5JA 3RD5A 1M75A 1L5MA 3TRHA 4A0QA 4RTOA 4OCZA 4QXRA 3CR3C 4X1KA 5L3ZA 1GGEA 3M6MD 5AKJA 2JJYA 3V8RA 2B30A 4EFDA 5AKEA 1O8BA 3OETA 2HGZA 1D5WA 3UGKA 2BKXA 3UW1A 3WNVA 4B3XA 3QVGA 4BQOA 5T7BA 3CZ9A 3A4MA 3BQ9A 3X1ZA 2AOVA 2YWGA 1SKQA 2Z95A 2PD6A 3OTHA 5E6RB 2OCIA 4MMYB 3H84A 3JQRA 5F98A 1QX3A 2HAEA 4KGVA 2W5UA 3OD1A 4DVJA 4DV2B 4B3SB 4CG1A 5LZ2A 3AF1A 4WBNF 5IVKA 1Q6ZA 1ODCA 3V46A 2O54A 4BMCA 1ODSA 4ZZ3A 2WIGA 4H7HA 5I7AA 2VQ3A 1J1UA 3E8MA 2R44A 1IOLA 3DMTC 4H0FA 1GNTA 3WKEA 1TJPB 5HF8A 1IDOA 3RTAA 5KC9A 4K28A 4H1HA 5KOJB 1J39A 1DB3A 1SD1A 3PGLA 2VDLB 3EVDA 2C1ZA 5L3VA 2GTPA 4XPZA 2R7AA 1FRNA 4UD2A 1O77A 5CYFA 5KVQA 1RJGA 3WZMA 4LY6A 1UBGA 3OJ0A 5ALDA 3C6YA 2C0QA 2O52A 1ZEJA 1FPQA 1J0DA 1G64A 3AHFA 3JQFA 1O4WA 1YGYA 5TJHA 2X4DA 4PF1A 4WY8A 3QVVA 2XVAA 3GO4A 4FBMA 1GU0A 4WCDA 4BN4A 2ZTMA 4DUGA 2ZYTX 3G6WA 3K0SA 1QPZA 3PXCX 1LUAA 5AO9A 3ORFA 1UK7A 3R6LA 5H0IA 3TEFA 4BNGA 1FQWA 4ML3A 1G7CA 1ZIYA 2OHHA 1TD9A 3WGQA 4YUXA 3WQBA 3DZIA 4B35A 5BN3B 3ENNA 1I4DD 1M2VA 3C39A 3ND7A 3Q3HA 4BNNA 2FQXA 4RMNA 4E22A 3CCFA 2C9CA 3QVKA 3GU3A 2VAXA 4NE7A 2FXVA 4ZANA 3PG5A 2HIHA 1QU2A 3BILA 2VZ8A 5ALXA 2NYRA 3N9IA 4KEAA 3UBMA 5HKKD 1AKQA 2J1LA 2WA2A 1HDRA 2PSFA 1ZRSA 4OHMA 2UZ3A 1NJ6A 3M3HA 3TDMA 2P2CA 2K7ZA 4L76A 2O8BA 1H93A 3GGGA 1N2CE 2O2EA 3G8BA 2GT1A 2H16A 3UWKA 2QP3A 3BSYA 3PHHA 1JDVA 4DBLE 3QH4A 4B8ZA 2QBYB 4WKOA 1MW8X 1M2JA 4MZXA 1LPNA 3AI1A 3KR1A 4CL8A 5B58C 2Y6UA 4FR5A 3GFRA 3WIUA 3ENKA 5DM70 1ZNQO 2P2YA 3F6RA 1B4DA 1NXSA 1YAJA 2VOJA 4KGXA 3HCCA 2EF1A 2HWXA 3BD6A 4LDRA 3FNEA 2LBPA 1OPXA 3I3OA 2ERXA 2I7VA 3C8UA 1PJ3A 1V47A 2ONCA 2Z4TA 4HV4A 2DKNA 3NZEA 4KBYA 1OYWA 1Z45A 4HWPA 3FGOA 2WVHA 1VE5A 3PNMA 1KSHA 2A5DA 1R37A 4U02A 4ZV9A 3T9DA 3GROA 4EZBA 1FCJA 1H42A 3V1KA 1GFWA 1ODLA 4XA8A 3HBMA 1MA3A 2GB4A 3ANXA 2Z3WA 2EG5A 2VHYA 4FDVA 4TWAA 4B3RB 4INZA 1WZNA 2C1EA 1YO6A 2W2MA 2FZCA 3WV5A 2ACWA 1HORA 4HQRA 1M73E 4N0QA 2XTZA 1YKSA 4CEHA 3BRWD 4RORA 5EXEA 3PP8A 2WJ3A 4RY2A 5C1DA 1U28C 3THYB 1QRAA 1B8NA 5HS6A 1LPMA 2RFLA 3QENA 4C4PA 2E4YA 4QWWA 4RIGA 3WRVA 2PSHA 1YL5A 3O74A 1FS6A 2GUGA 4GRAA 1SEPA 3T06B 4LPSA 1H2ZA 1W9MA 3O1HB 2WFZA 4Y2SA 1C30B 2VYVD 3K1JA 1HPLA 4OUKX 4BAUA 1CUGA 3CIFA 5L3SA 1BE1A 1YB6A 5E4FA 4DOMA 4P7JA 1SXGA 4PN7A 5JBIA 1G60A 3N2EA 1LRJA 1Z39A 4BGVA 5I5EA 3L7IA 3KCNA 2VHQA 5A9TA 1KZ1A 1SUFA 1PQ4A 5HPYB 2J67A 1OI2A 2IHVA 4PLZA 3ZD6A 2DERA 5HM8A 2AZDA 1E2LA 4JAVC 1X8JA 5BVHA 1U90A 3EXIA 4GOJA 2O7SA 2Z1MA 3PKJA 4P22A 5EXDA 2VJAA 2WB4A 1QORA 2YHSA 2HA5A 4QDKA 1E1CB 3ORRA 4EELA 1ISIA 4BWFB 1TM3E 4J3JA 1N5LA 2WWHA 3L0YA 4JI3B 2J3JA 2PZGA 4Z7OB 1R64A 4KIJA 2ZG6A 2BJVA 3QF4B 1LNQA 4Y7CA 4Q05A 4CMEC 4R9SA 2CCGA 4YRQA 2QT9A 5DP1A 3RANA 1UZAA 3VNQA 3D3NA 1YUMA 4ZVVA 3TFOA 5AW8A 3LZCA 4J1TA 5C8XA 3MTAA 1EM6A 1LFAA 1QZUA 1YVDA 1IK6A 4IDAA 2GA8A 3K71B 3AUSA 4B4DA 2IXBA 4LXQA 1Q17A 5M3BA 2QW0X 3ST7A 5FR1A 3ER9A 5EQJB 5JTTA 1SBCA 1Z9BA 2APJA 4LZZA 5AJVB 2DZDA 4C1NA 3ROQA 1UXIA 4LOAA 5HKOA 1EWRA 2VP6A 2X6QA 4WLOA 5JCZA 3CGGA 3MILA 1ES9A 4YJFA 3ZK9A 1AZLA 3WLTA 2BFBA 3M4ZA 5DYYA 2P75A 3V7WA 5C5IA 4KITB 1YBHA 4L75A 3CISA 1Y80A 3TE7A 2BHRA 1UBEA 4HD8A 2VA9A 4R69A 2IY9A 3W4KA 4R7GA 4DR6B 4MPTA 3AKEA 1JR6A 5A3SA 4DMKA 1Z2OX 4JZKA 1FP4B 3SY8A 3TLCA 1REQA 3MLEA 4W82A 2PCLA 4B2LA 5JS8A 4RF3A 4QXQA 4OSOA 2GPSA 3N0WA 4ARZB 1ZDMA 3PC8A 4G3XA 4O6VA 5FFFA 1NF3A 3RB8A 4DDKA 2RBKA 1I14A 4OFZA 4YV1A 2ZRLA 4UEWA 1R0SA 4HUQB 1LWOA 4EW3A 1BDBA 1JU4A 4Z3OA 3R8FA 4UJ5A 3QUCA 1THZA 2N75A 3IJEB 1IY0A 5DULA 5JR3A 2FEPA 3JVIA 4DIEA 5JC8A 2NUBA 2QDKA 2J6IA 3UN1A 5BN5B 4B75A 3EWSA 3LIIA 4G5GA 2G7MC 3RRYA 3FVWA 5CDYA 4IQ0A 5JVDA 2EKZA 1J99A 3M83A 5DXAA 3T1OA 1V8FA 2UYOA 4NBTA 1NDQA 4N8SA 2XT6A 3BWYA 4UU0A 5LOVF 3GXBA 3SWWA 2Z9BA 5E7IA 5FT9A 3TOCA 3ZVNA 3R9XA 4YN3A 3QTLA 1B8VA 2ZTSA 3B3FA 3ZZUA 4DIUA 1H3NA 1W93A 4JEUA 1BXRA 1LPSA 3CVJA 2A94A 2O1WA 1VG9B 2R7NA 3OFND 3NASA 1H8HD 3I58A 1H66A 4QYIB 4BLVA 2C2GA 5CD1A 4MCAA 1OGIA 1IBLB 3AXTA 1DEKA 2FFAA 4ABTA 4R9RA 3RKRA 5F5NA 2WM8A 1YVUA 2YHAA 1FMFA 1T6YA 1ODFA 4CT5A 3L0BA 1OLSB 4TLAA 2IV2X 4YLYA 3PNBA 5TPWA 3CBGA 3IEPA 2NT4A 4ZT5A 1QO9A 3BH0A 2FB9A 3MWDA 2X3UA 4U2CA 4WBXC 4LTDA 5CXXA 1N8TA 1OZHA 2ABWA 5FFNA 5EIXA 3MPUA 1H6BA 1QGUA 2IRWA 4C87A 1ZMRA 4B3TB 1Y1PA 2QXUA 1Y9ZA 2WTAA 3RABA 2EGGA 4A0HA 1A7JA 4ZFNA 2IDKA 4MRAA 4YBRA 1ZZGA 2LWIA 4N1AA 3VC7A 2VTBA 1RQNA 3AYZB 1IQPA 4RABA 3T9CA 4QHTA 1GVNB 3QYPA 3G9QA 1KMCA 3KKOA 2QN3A 2JEOA 5K0SA 2MSLA 3EPRA 4MKHA 5JAMA 3V34A 4PXAA 3W7AA 4BNYA 2XITA 1C9JA 1H5NA 3L77A 3I34X 3A11A 4DIDA 5HDBB 2R8RA 2RGCA 2PWYA 1FNSA 2XI4A 4YRMA 2B99A 4WN9B 3H1EA 4YUYA 4AIRA 1VJRA 3FA2A 2FDXA 3B7GA 4E5YA 1TLTA 5BWNA 2WIDA 3TI7A 2ZIZA 1YS7A 1Q0UA 3AFHA 3O0TA 3I45A 1HRKA 4NCXA 3UAWA 5JSUA 4TRRA 4NOLA 2I4NA 5F21A 3UFBA 5B55A 2YCLA 3FYUA 1NSFA 2IEYA 3GMSA 3SJAA 5B2EA 4HAIA 4JGGA 4EKGA 4GYWA 5KSPA 3EDRA 4MYSA 3TMYA 1FFBA 1V3UA 3PE6A 1BW9A 4WXEA 5JXJA 4Q12A 3PX7A 2W7TA 2WZCA 3IUYA 3WYAA 4KQMA 1EFDN 2GILA 2H2DA 1FNNA 5EJAA 1JLHA 4ZT6A 5EJEA 4MW4A 4MLPA 2UZ1B 2MYTA 3ZTYA 1JHQA 1TPYA 2ZQYA 2J3LA 3NNDA 3AF3A 1YJ5A 2KM1A 2DKOA 1Y4SA 1S6YA 1EUYA 5TQJA 1MEEA 4WOPA 3GUZA 4A8JA 1WY5A 3L43A 2G9UA 1I4LD 1NN5A 2C82A 1M6VA 4JA2A 1ZMXA 3HL0A 4ICIA 3UICA 4IQ4A 1Y5RA 5H59A 3C3PA 1IN7A 1ADJA 5IC5A 1U2GC 3RNOA 4KXVA 3U3XA 1AK2A 1G0NA 3PDHA 3VDNB 2OGUA 3JVUA 2V7UA 2YINC 5K4AA 5H8WA 1IATA 5F76A 3CH4B 5ALIA 5AYVA 4YYZA 4BMXA 5IYZB 1IWOA 1XVIA 4Y3UA 3ZXYA 2FPWA 2WWWA 3QEJA 5CFRA 5CH8A 4IUDS 3QQPA 3F90A 5HOQA 1W4LA 1QVVA 1XCJA 5HQTA 4ACBA 1FDUA 3F4BA 4MHTA 3EK2A 3CEMA 1EK2A 1UPBA 2FRDC 5EQDA 1YRHA 3VGJA 5K3FB 4ZZ1A 4PC3A 2TRSB 2IELA 2IDZA 2IE8A 2JJ2D 3GLKA 4XQGA 1HXHA 4QECA 5IK2A 5ES4B 2JLBA 4Z9XA 3TW8A 4BGIA 1XV5A 5M7EA 4DV5B 4Z4EA 3GN1A 1EHYA 2O2YA 3R2JA 3CLUC 2B1QA 4ARAA 2J9FA 2E3JA 2Q5FA 3S2ZA 5LZ4A 4ISCA 1ZAKA 2QWXA 1L1RA 1TYDE 4Z9AA 3VAZA 4G41A 1CQPA 3C3DA 4WCFA 2J45A 4CTJA 3H3XA 4UUPA 4WNYA 4LHVA 2FFRA 4JCOA 3GJYA 2OILA 1DDIA 1TO6A 2R11A 4MUIA 1TU4A 4NMLA 5B2FA 3QVJA 4NU8X 3TRJA 5BN1A 4G9BA 1P1JA 5T6BA 3VU9B 3PNOA 3MB5A 2PMFA 1SKUA 2C2HA 3I9FA 3WDMA 5AVVA 4O1IA 3ZQJA 3BXXA 4IY1A 3OZCA 1FSZA 1K5DA 4AKTA 2W0SA 1J1IA 2W2LA 1XFDA 5AJHA 4NH4A 5LP6B 1E5TA 5B4VA 3ANYB 3A3NA 4IS2A 3EDQA 3OQHA 4QUAA 3SYLA 1AHHA 3ZCPA 1V96A 3KSRA 2RJ3A 2ZYUX 4JV5B 4DMRA 3Q5DA 4Y1EA 4R9UC 2DX7A 5EPUA 2ZZKA 3NT4A 3THXB 2FCAA 2FMFA 1KAGA 2H1LA 3KQVA 4AZVA 1J8YF 4BVJA 2BZGA 1LA2A 4J1NA 4DAEA 2JCGA 4UHHA 1UKCA 1OYYA 2NG1A 3G82C 4UVHA 5F9HA 3K6SA 1IVSA 4JKYA 2J9XB 3L6EA 4Y0AA 3P9KA 4ZALA 5TF4A 2XWSA 4ZVUA 2PKWA 3DE2X 1W44A 2C9ZA 3NX4A 4W7SA 3QVLA 4MI3A 1Y1RA 1X7GA 2OV4A 3LUAA 1RJEA 3Q5EA 4RMIA 4Q9HA 1TIKA 2NV2B 1OFUA 2PFSA 3VDMA 1IZ7A 1ENZA 1X87A 3WWPA 2XWPA 4TMFA 3C7KA 4BBZA 1ZIOA 1PT8A 4LJKA 5CEEA 1RADA 3CS3A 4K8RB 3U6KA 4HFMA 1UOPA 2YUIA 1AZSC 3KLMX 3F46A 4HDSA 4EF6A 4EEKA 4JP1A 1GTSA 2PG3A 3G89A 2ORWA 5G4KB 2ZWOA 2C7GA 5IW8A 1L0BA 1NN3A 2IP1A 4ALJA 4F2DA 5KTNA 3OZEA 3RBAA 1KMNA 4FFMA 4P93A 1G66A 2C97A 1XCLA 1YV9A 4WBSA 3SHOA 4BE9A 2R1VB 3SU8A 2Y1EA 3UG7A 1C7IA 2XCSB 4G8JA 2ZTVA 4KXFB 5TPZD 1KZ9A 3F7MA 7REQA 4RWZA 4UUBA 5GONB 5KU7A 1SRRA 2FFJA 5JSZA