1XEXA

Structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases.
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
PYIEKLELKGFKSYGNKKVVIPFSKGFTAIVGANGSGKSNIGDAILFVLGGLSAKAMRASRISDLIFAGSKNEPPAKYAEVAIYFNNEDRGFPIDEDEVVIRRRVYPDGRSSYWLNGRRATRSEILDILTAAMISPDGYNIVLQGDITKFIKMSPLERRLLIDDIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural biochemistry of ATP-driven dimerization and DNA-stimulated activation of SMC ATPases
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Cell cycle
molecule keywords SMC protein
total genus 45
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2004-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1xexA00
2EQBA 1LFDB 3CX7A 1YRAA 2IUUA 4LHYA 5SZKB 4DT1A 1H8ED 5FBRB 5FBLB 1A2BA 4M1SA 2VP6A 1N5LA 2OO7A 4PHTA 3T1VA 1G3IA 1SVKA 1VYUA 4ZDJA 2C99A 2KBFA 3AVPA 3TK1A 2C98A 3CW2A 4BFXA 4DSNA 5AUOB 1RE0A 3QKUA 1L2TA 3CRRA 1D6JA 2QP9X 4Q1AA 3WYFA 2XTMA 4JLJA 1TUEA 3VR2A 5K8LA 2D4HA 4PFSA 1YZTA 1RW4A 6Q21A 2DPXA 4KAXA 1HQCA 1R0YA 2RHDA 5JFGA 2IC5A 4HAUA 5JECA 1XTJA 4PHHA 2Z4RA 2W00A 4X8LA 1E94E 1HE1C 4JLOA 1XCPA 2J7KA 2EU8A 3LDAA 2ZJ2A 4Q47A 2GDJA 2C95A 3KUCA 2OHFA 4FW9A 5CLQA 4QM7A 2ZPTX 2D06A 5AWFC 3FMPB 1AKEA 1VCMA 2B8TA 4RZXA 4AG6A 4A15A 3THWA 4KYIB 3TBKA 3C7KA 4NDZA 2FSHA 3QG1A 5GADl 1W2HA 3SU8A 1KMHB 4IKEA 3ZVRA 3F5FA 3I5XA 1AZTA 2VA8A 4Q4AB 4C4PA 4AYXA 5HKKA 3KX2A 3AH8A 1YR7A 4ZDWA 4BEJA 3DOEA 3B1XA 2QY9A 4V0LA 3HYTA 1MRSA 1NMZA 1N6KA 1UJ2A 3IDQA 3KFVA 4Q9JA 2ZROA 2AK3A 3M6AA 3PV0A 3DOFA 4JLAA 2GBLC 5GJWC 1KY2A 1E0AA 3SEAA 1W4RA 4ACBA 2GILA 1KAOA 4Q5IA 3RNLA 4NONA 3ZJYA 3RC8A 2IHYA 2ZR0A 3K0AA 2HF8A 3K0CC 4R9UC 3U4QA 2GXSA 3A4NA 1XX6A 4YLGA 3BJIC 2FF7A 4CW7A 4TYPA 5F9FA 1VG8A 5DO9A 3EARA 4OKSA 3ASYA 2RGNC 3WHLA 2PL3A 1OH6A 2IYRA 2VYFA 3WBJA 2CDNA 1TPZA 2DY1A 4JLVA 3W5JA 1VCOA 1UBGA 2BBWA 4XTRA 3I4LA 2E1RA 1R5BA 2J3EA 2QAGB 1KSGA 3C14C 1NSFA 1WMSA 5FL7D 1PUJA 4PPQA 2GAAA 2IYWA 1U9IA 2HCJB 2PMDA 2YJTD 3K0CA 4IVQA 4HAWA 4DCNA 2JCSA 1VTKA 2QGNA 5FPSA 2XNSA 3GLIA 1OW3B 4C2TA 3QBTA 3VKHA 2PMKA 2GCPA 3JZMA 2G6BA 3HJNA 5C4MA 1DAIA 1XCGB 4QKQA 2VSOA 2D62A 3QENA 3GJ0A 4EPTA 1Z6YA 2CLDX 3B85A 4TMKA 4ZCMA 3FDIA 3SJZA 3KXIA 5JS8A 1Z0DA 3NC1C 1JALA 1SHZA 3SYKA 4EPYA 1W4CA 2QPAA 1T0JB 3U3OA 1G19A 5AUNB 3QXXA 2V3CC 2O8BB 3SI7A 1EK0A 2QMHA 3RS2A 1Z0FA 2H16A 2CCKA 1NP6A 2IYQA 1GL7A 4AKHA 4LYJA 3L8ZA 2V4ZA 3LNCA 3QXSA 1FMLA 1N0WA 1HEIA 3OEHD 3QNUA 3IO5A 4P0TA 4W5JA 1Q1ZA 5KSZA 3J81k 1GVNB 4B35A 3RDPA 4U00A 2PZEA 3ZYCA 1Z47A 3TAUA 1NN0A 4G5OA 2FH5B 2F3TA 5LDDC 5C4GB 2NZJA 3CX6A 4HI0E 4JLMA 3AP2A 1TUIA 5FOWA 4HZIA 3Q9LA 1E3MA 4X8MA 3ADCA 2HF9A 1E98A 3RS0A 1RYHA 1AGRA 1SQ5A 2W6JD 4GI7A 4P32A 2DFNA 3EPKA 4TL9A 2R65A 3I1FA 1RKBA 1Z2AA 4Q66C 1C9KA 2MMGA 3L0SA 2XSZA 2C9OA 2ZI9A 3K0FB 1JXMA 4GPTA 4HLQB 1SXJA 1UKEA 3C5CA 3CWQA 4Q7MB 2B7CA 5E7MA 2A2ZA 2HV8A 4B6FA 2F43B 2QMOA 4FCWA 1AS2A 2ONKA 3LBIA 4DJTA 3TAHA 1M34E 1KJWA 4W7SA 1W36C 3B8HA 2ZRBA 4KLZA 4IVRA 1OFTA 1ZD1A 1BIFA 2CLSA 4TQUS 4OI1A 3SFZA 4MRSA 2OBLA 2FFAA 3TVDA 4TYWA 1ZNXA 5BN5A 3EZ2A 5FBVB 2GK7A 4WZ6A 2OM2A 5FOVA 5L3RA 1FW6A 4ZO4A 1KI1A 1W0KA 3LY5A 4E03A 1Q3HA 4OI0A 4A36A 1J8YF 2QPOA 3CR7A 3NBYC 4BECA 2GJSA 2J9RA 4DLSA 3GLGB 1XPRA 4Q9LA 1OB5A 1YE8A 5FPKA 4MYHA 4JMPA 2G3YA 1IN5A 1JQJC 1U81A 3T5DA 4C30A 4V0KA 1JR3D 4Q4AA 2V55B 4BLSA 2IS6A 4Z8XA 1PLLA 3IGFA 4B3CA 4XJXA 3IEUA 3AKEA 4M1YA 3B6EA 4OBEA 1ZBDA 4KCGA 3B60A 4F92B 2KJQA 5FUXA 2YHSA 2C78A 3MLEA 4FXPA 3X1DA 4D0NA 5K8TA 4IOLA 2CXXA 5TARA 5ELXA 4JT4A 1G8HA 2OBMA 4M1MA 2ZRKA 4C0BA 4HB4A 1FQJA 1YR9A 2WPDD 2MSEB 1KI3A 5KSOA 3GLFB 1S4QA 2WJHA 4QM6A 4DDVA 3PUXA 3NBZC 2O8CA 1E2EA 3TH5A 4KYUA 1Z0KA 4EUNA 1QDEA 2N1BA 3C16C 2FFQA 3WRXC 1E1QD 1N6IA 5JS7A 1UDWA 2NIPA 1G8GA 2FA9A 3OHMA 1LS6A 5FFMA 1P60A 2BKUA 2QG6A 4Q4HA 4XVQA 1LF5A 3B1VA 4CT5A 4UNRA 1RVDA 4TYQA 4RVCA 4KITB 2O52A 1IJFA 2MMCA 4CVNA 5F3WB 4V0ME 3THXA 1FP6A 2W58A 4XIGS 3EA5A 4EJSA 4TTPA 3BFKA 3TSWA 1QHGA 3ZQJA 4B44A 1RRPA 3HPRA 4Q1DA 1GRNA 2QBYA 1V43A 2ZQ5A 1OH5A 5EP2A 2FOLA 1ZD8A 2RCNA 3SHWA 3VNUA 4C0KA 2WJIA 5C1BA 4OI2A 4CEHB 3TUZC 1XEWX 2CL6X 3LVQE 2V9PA 1TADA 2QI9C 4C0JA 1CBUA 1T3SA 5DHAA 5BQ5A 4BZXA 4M22A 5L3QA 3H84A 4Q7JB 1Z28A 1G20E 3C5HA 4ZI2A 5FOSA 1IN4A 4HAVA 2PEYA 1DELA 4DRZA 1U2RA 3T12A 221PA 5JLJA 1LW7A 2ONJA 4TYYA 1XDBA 5BN4A 5LD2C 5H68A 2ZI3A 3KXLA 4MGYR 4URYR 2ZM5A 2OZEA 3ZH9B 5P21A 3VAAA 3EZ7A 1U9IC 1G21E 1E1RA 2IF2A 1E32A 2OXCA 1O3YA 2IYUA 3PFIA 3IO3A 3HYRA 621PA 1R2QA 3LLUA 4W5WA 1KDOA 1RRGA 3FFAA 1KY3A 1ZUHA 3RRZA 3P1JA 3ADDA 2IYYA 1YZUA 1XTQA 5TMPA 1KSHA 2ZRMA 5KSYA 4HUQA 4M9QA 4DC9A 4LHZA 5JJIA 1Q1EA 3LXXA 3K53A 1N25A 3TSZA 1Z2CA 1P9NA 4YDSA 1F5NA 1ZU4A 4NL4H 5J47A 1L8QA 1MO5A 1YZQA 1Z22A 3M4YA 4IOMA 4ILEA 4IDOA 4KVAA 1VHLA 1KI4A 3UIEA 1EX7A 3RSLA 3CNLA 1YKSA 1WQ1R 2EVWX 2ERYA 2AK2A 1IN7A 2QT0A 4B3FX 2Z43A 4LPSA 4LWZA 1FNMA 1K5GA 4CEHA 1R8SA 1CR4A 2W0MA 1XWIA 5CM8B 3ADBA 3U7EB 1RYFA 3NBFA 1N3BA 4LY6A 3EC2A 4MITA 3NC0C 3SOPA 2R6GA 2WTUA 4BLQA 4ZKDA 2OCBA 5JCZA 3CF0A 4FMDB 2G9NA 2YWGA 4Q7KA 3T61A 2EW1A 3JVVA 4V0MA 2GEDA 2ZI4A 1TQDA 2ZI5A 1E9CA 2QE7D 1Q20A 5B64A 1EX6A 1KZGB 3P4XA 3I3SR 3QVUA 5EE5B 1WBDA 2P3SA 1ZM7A 4XOIA 3UMSA 1UBFA 3QF7A 2GJ9A 3RRYA 3GJXC 1I4LD 1G291 4PPNA 1KHTA 3I8XA 1WF3A 3C15C 2FGKA 5G3YA 4BFSA 2QEQA 2GRJA 4B3BA 4CIDA 3WNDA 2NZ8A 3KJIA 3R8CA 1KO1A 1II8A 3SJAA 1XJCA 5H8WA 4Q1EA 1XTRA 2J7PA 1PV4A 2PJZA 3CNOA 4B33A 4OYHA 2OCYC 4A6XA 3GLFE 4IXMA 3CZQA 1XD8A 3AGPA 3AF1A 2A5JA 4QFMA 3WY9A 1DAKA 1FZQA 2CE7A 1YU9A 4JKIA 4MRVA 4OQLA 2JJ2D 5BW8A 5IDVA 4B3GA 1AQYA 3QI2A 3EPJA 3IPYA 4Q1CA 1TU3A 1KJYA 1TQ2A 1CJKC 2V6IA 2RKOA 3A1UA 5KYKA 5CYOA 3QUSA 2QRZA 2YOGA 2B6HA 1DBSA 2ODWA 4RZ2A 5AJZA 4QBIA 4HUQB 4POAA 1KSFX 4RD1A 4DSUA 2O0KA 2FX3A 3FWYA 4A2PA 4DCSA 1UKZA 1NIPA 2H5EA 3KKMA 4HLCA 1P6XA 2F9LA 3B5JA 1GUAA 3T34A 4QHYA 4FN5A 5CB8A 4QOSA 5KDOA 4N1AA 2O8DA 2OV2A 4IXNA 1NSTA 3B1ZA 1OXVA 4I4LA 4TQ9A 4C7OA 4PQRA 2KB0A 2GAOA 5TXGA 1SXJE 4AK9A 5LB2A 1SVOA 4DEYA 3MJHA 4PR0A 1ZC3A 2O8FA 2WSMA 3TR5A 1XEWY 4MDFA 1IJEA 2YVUA 3O8CA 4LJ6A 2WJYA 3AP3A 1K8RA 1R10A 4TQAA 2OAQ1 2GWHA 1IN8A 4C0QC 5IHPA 5J4LA 2DWPA 1ZIPA 2J59A 2XITA 3NDPA 4WXPA 5JMTA 4L9SA 1DVRA 2BMDA 4DLUA 4NYJQ 1XP8A 2YOHA 5AR1A 2BM1A 2ZUBA 2WIBA 2NPIA 4FWTA 4A0GA 2DFTA 5AJXA 1NVVQ 2H8KA 1KO8A 3QY0A 5DLQC 1DARA 1KO5A 5GVRA 4R71A 2PZGA 3DMDA 1SKQA 3NG1A 3N70A 4DKXA 1XXHB 1ZNWA 1KI7A 2G83A 1EG7A 4II7A 4ZI3A 3KKNA 1NKTA 5J4KA 2QZ4A 3Q3JB 1BOFA 1X1RA 3P4YA 4JBWA 1VKJA 1KK2A 5BWMA 4LYAA 4HEJA 4QHSA 4RD4A 1ZNZA 3U3RA 1NN5A 5J4HA 4O2RA 1W0JD 2FG5A 1F6BA 3QXJA 3VTKA 2QN6A 2V54A 5EXSA 4A0HA 4ASUD 3MWYW 1BO6A 2HJGA 1AQUA 1US8B 3S1AB 1W49A 5EE0A 1FUKA 4O0MA 4D2IA 2H1LA 1FOEB 1KKMA 3CKLA 3CM0A 3LFUA 3ADKA 3Q72A 3KQHA 3CPJB 4QNMA 5JEDA 1I4TD 4XD7A 1R5OA 4LDJA 1GOTA 2YV5A 4E09A 3CLVA 4OHVA 2Q3FA 4D4KA 4HB3A 3IILA 2J0SA 2XOKD 4B48A 1GFIA 3NXSA 5KNBA 3IHWA 2KSQA 4I1VA 2Q21A 2TMKA 4YONB 2ZJYA 4F4IA 4QJ5A 1M6NA 2H7VA 1QRAA 1NI3A 1YZNA 1IXZA 1TU4A 1ELOA 3H86A 3LX8A 4DDTA 2HJVA 4TZ0A 1E2HA 1Q21A 1F3OA 5HCIA 1XFAA 2IXGA 2QAGA 2ZTSA 5IK2D 4F4JA 3DKVA 1MO6A 2G77B 4B71A 2RGEA 1NVUQ 4KFSA 1L4YA 2BOVA 2WOOA 1UBEA 2OEPA 1FTSA 2GXQA 5FUVA 1JECA 3FYHA 1EWRA 2BC9A 5AUPB 2CK3A 4LJ5A 3AVTA 1CLUA 1IY0A 4NCKA 1KIMA 4Q03A 2ODNA 2IYZA 4KFRA 5KDDA 4EQ6B 1GZSA 4EPWA 4JVNA 1KKLA 2F43A 3PJRA 3NDBB 2HUPA 5HCNA 4YDHB 2ZRJA 4K46A 1YRBA 1NNEA 1CR0A 1YR8A 2C96A 2VLIA 2FV8A 4C0AC 1GG2A 4Q00A 2D7DA 4A8JC 5KNCA 1YZLA 2JGNA 4NP6A 4PTLA 2WIAA 1QHHA 4NCNA 1UAAA 2FGJA 1U0JA 4UXJA 5L3SB 4HLUA 4LJ8A 3EG5A 3KZ1E 2GCNA 4HUTA 2WICA 2ZRHA 3DKPA 1G9XA 1T9HA 2DWQA 2Q9AA 3QQ5A 1EXMA 2ZIAA 2QP4A 3R9IA 5FOXA 1E69A 3U61B 1E9EA 2DCUA 2HLDA 4YMVA 4G5SA 2H92A 5GVSA 3OAAA 3UKDA 4BPBA 2NMVA 4JKYA 1JEEA 2FZ4A 1Q57A 2G0TA 4GMXA 5B57C 4URXR 3NKVA 1IONA 1Z0AA 2ORIA 1DAHA 2NO0A 3UG6A 1G4AE 2VIIA 1E4VA 4UNPA 1U90A 2IYSA 1N6RA 3P20A 1NVWQ 1KDRA 4KI0A 4OQNA 1KSJA 1MO3A 1EESA 5JJLA 2B8WA 1E9RA 2BV3A 3SYLA 1VYTA 1T6NA 4LBYA 3U7GA 2IYTA 3SYNA 3THYA 1JAHA 4JYCA 5KUTA 3AVXA 4OHWA 4TLAA 5IF9A 3FHOA 3QPVA 4Q4JA 1IY1A 1Z29A 1ZM3A 2BMFA 5G40A 5KPJA 4JT2A 3RSOA 3IQXA 3WXMA 2IK8A 4E5UA 1OB2A 4LJYA 3KTAA 3EASA 2IYXA 4AYTA 4CDGA 3UMFA 4ZIRB 2WSSA 5HPYB 2ORWA 5FBQB 4BUJA 3BOSA 4BFWA 1ODFA 1HV8A 3SQXA 1H8EA 1XXHE 3CBQA 3A1VA 1AIPA 1GKYA 3B2EA 3SN6A 3AP1A 2XZLA 4NYJR 3IIMA 1T4GA 2BM0A 1UEIA 3NHBA 2QM7A 3Q5EA 4HB0A 1SVLA 3GJ4A 2BIFA 4Z8YA 1N6HA 5IK2A 3DVLA 2ZRCA 1T8UA 4GZLA 1VCIA 3QXCA 1E1RD 4XVRA 4TYNA 1FTNA 1W44A 5TB5A 2F6RA 4M4SA 3LW7A 3E70C 1MH1A 1U98A 2ZANA 4UNSA 2ATXA 1CJVC 1FX0A 1OJLA 4D4JA 1DG1G 3PUZA 3PCRB 4DB4A 2O8FB 4MKIA 4ERNA 2F55A 4OQFA 1G3RA 4HSEA 1IOZA 2BHRA 2BCJQ 2CVHA 1Z3IX 4NMMA 4AY2A 4U5XA 5A4JA 1Q44A 3ZGXA 1S96A 4TLCA 3LXRA 1UKYA 5AJYA 5C2JB 5C18A 3R7WB 3EPLA 2FEMA 2HT1A 4F38A 3MG9A 1FUUA 4X8HA 1BYIA 3B9PA 4LUCA 4KXFB 4GRAA 3VU9A 3FMOB 1I4DD 4FD2A 3PUWA 4G5RA 4F4CA 1ETUA 4DLRA 2G1KA 1X3SA 4YC7A 3E1SA 2GK6A 1FFHA 3D8BA 2RGAA 3PIRA 3K09A 2ZXUA 1M7HA 4JSTA 1PLJA 3BD9A 2FSFA 4KBFA 2KI5A 4XVUA 1CJMA 3B1YA 3U7FB 1UADA 3GJ8A 5ANRB 2ZETA 2JLYA 3RC3A 3ND9A 4JIMA 1ZIOA 4IVPA 4QC2A 1KMQA 1DO0A 5FI0B 1G8FA 1D9ZA 3A6PC 1OV4A 2FSGA 2YOFA 3PENA 3HDTA 3IIJA 2FZLA 2IHBA 4MYUA 1XU4A 2ODBA 2J5XA 5EE3A 3BIFA 2JDID 1P9RA 4A9AA 4BEBA 3U5ZB 1UM8A 2JLWA 1NVXQ 2NOAA 2GF0A 2PBRA 3KQKA 1JJ7A 4OK6A 4ESHA 2PX0A 2AX4A 4LV6A 2JLRA 1HUQA 2A5YB 5G41A 2PCLA 3BWDD 1NG9A 1TF7A 1OKKA 1LVGA 5FR1A 2HXYA 5KO2A 3BORA 4C0HA 1S8FA 2R8RA 4PQFA 4AURA 2ZYUX 3QBVA 1D8TA 5TY0A 1P5ZB 2C8VA 4FI3C 3K9LA 2HLDD 4LJAA 1S3SA 3I5YA 3R8FA 3K0AB 3T15A 3MSXA 1SGWA 2GNOA 4B32A 3SBEA 5SZJA 4DDUA 3FMIA 3I8SA 3PG5A 3K9NA 3BFVA 4MDEA 1X8LA 4CEJB 3K70D 2V8OA 1FNNA 4DLXA 2GXAA 3D31A 4IDNA 2OFWA 3A1TA 2ZITA 1Q1BA 1QHYA 4BQSA 1JEDA 1NIJA 3VQTA 3N2EA 4DVGA 3OZXA 4JJZA 1ZMXA 3AQ4A 4DDWA 2NQ2C 1VHTA 4AKEA 4EAQA 4JLBA 2QQEA 2ZVQX 2F1IA 4TTRA 1WDTA 3K0FA 1NG1A 3F8TA 1E79A 3PEWA 1G41A 1II0A 4ACAA 3B13B 4UXHA 2QTFA 5EE9A 1L4UA 2OSBA 3LAWA 3GPLA 3V4RA 4HDQB 2XJ9A 2GETA 2R9VA 1OF1A 4J0QA 3AM1A 1J2JA 4WAUA 1TQ4A 2ZE5A 1GL9B 3HU3A 4M8NE 5KNDA 2VH5R 5FL3A 1ZM2A 1IBRA 4KU4A 2P5TB 1N5JA 4P4SA 4PHFA 2FPLA 3L43A 3CPEA 5LB4A 2J46A 1D2NA 1MO4A 4I1SA 4HDOB 1QG2A 4PAMA 2O0JA 3KB1A 2KBEA 5EXXA 3RAPR 2NO7A 3K9HA 3B9QA 1T5IA 1UBCA 2FEOA 3LV8A 4EDHA 2C2HA 3U6BA 1R0WA 2XTNA 2GJAA 2FJUA 5EE1A 4DT1B 1RJ9A 4WZBE 1OH8A 1TF5A 2WMOB 4G0NA 5JHHB 1E9FA 4IJMA 4MRNA 2BKEA 1G5PA 3G0HA 3Q7PA 2QE7A 2RB4A 121PA 4QJ4A 2IX3A 1E9BA 5BN3A 3CF2A 2J7PD 4GNKA 4PC6A 3CUEF 2IYLD 1F2UB 1ZCBA 3PITA 2GVZC 1WRBA 2EFDB 3HR7A 3WMFA 3ZQ6A 1GDDA 1N5KA 4L9WA 1F2TB 3QE0A 2CK3D 1CR1A 2PH1A 2V7QD 1W36B 2JDIA 4CT4B 4EFMA 3TIFA 2FE4A 3SR0A 4NCIA 1JNYA 1D5CA 3L2OB 5DI3B 1N6NA 4B74A 3UWKA 3W9YA 3THYB 2DHRA 4LJ7A 3SQWA 2GCOA 2JLQA 3MD0A 1DOAA 2A3RA 3KTAB 3ZVNA 1BMFA 1P2VA 2AD5A 4MQBA 4EJSB 4KSCA 1MRNA 2R6DA 1XTKA 1HY3A 1KO7A 2N42A 5FH9A 3KUDA 4RKEA 1Q12A 3MCAA 3T35A 2YNMA 3W5IA 1G7TA 5L8VA 2C9YA 1ZD9A 4MGKR 1E79D 1YHNA 2PCJA 3CZPA 2LWIA 1RRCA 3AEZA 1S2MA 2RGDA 4AKGA 2FNAA 4NH0A 1IXSB 1W47A 1YVDA 3LBNA 5M04A 3VHXA 3VR4A 1CP2A 2KWIA 2P0EA 4CEIB 4M0LA 2Z6VA 2IA5A 1NBMA 3BXZA 1W0KD 3DPUA 2GTPA 4H1VA 2VRWA 4ZKEA 1GITA 4QNRA 3OIUA 2PJRA 1XJ0A 1OIWA 1W0JA 5JCPA 3THWB 3X1ZA 1ZVQA 3REGA 1GKUB 1P3JA 4MYTA 4UNNA 3SBDA 3BBPA 3BH7A 4HZUB 4QG7A 2JLUA 2G88A 1RRFA 2VO1A 2ZYTX 4QL3A 4DCVA 5DHFA 3ZD7A 2WV9A 2ZU6A 4LJ9A 1OXXK 3JZAA 4DWJA 2ZJAA 4GL2A 4P3YA 4IEEA 2WKRA 4BFZA 3RHFA 2NO9A 1F48A 2QSYA 2ZR9A 4DZZA 5GJVC 4B43A 2ZSEA 1SXJD 5LD2B 1U8ZA 3Q8XB 1FPMA 3AB3A 2JLZA 4L4UA 2EYUA 4G1UC 4BWYA 5FPYA 4PAQA 3U3KA 2CHQA 2JEOA 1P61B 4A92A 3TUJC 1DEKA 3LX5A 3OFNA 4KLNA 5DE3A 4RSGA 4P31A 4TT3D 4URWR 2JIZD 1NMXA 3RS4A 1Y63A 1N6OA 2F1HA 4URVR 2DB3A 1XZQA 4EQ6A 3CONA 4MRRA 4D25A 2GVDC 2P67A 2QU8A 2ZJZA 3KKOA 4Q1FA 2D7CA 3O8BA 1E4YA 1BH2A 3V00A 1TAGA 3B82A 3T06B 3EA0A 2PZFA 2IXEA 3G5UA 3WYAA 4ZCLA 1EGAA 3DMNA 3NVAA 2K5UA 4TLEA 4Q9KA 5KOYA 1G18A 2IF0A 1IM2A 3QVVA 1OFHA 4UXIA 2W0SA 1CIPA 2IWHA 1EFHA 1LB1B 1YQTA 4FCTA 3CRW1 3ZZ0A 2IS1A 1GILA 3H0KA 1KMHA 3EZ9A 1WB9A 3KQNA 4GP6A 1XF9A 1UPTA 3LA6A 4WA7A 3PEVA 3IUYA 1J70A 4EJSC 3AVWA 3FTQA 5FTKA 1S9HA 1VPLA 2VHJA 3W3AA 4Z54A 4LYFA 1VDZA 4L5BA 3RWMB 4US2R 2Z4SA 2J87A 1BMFD 3K09C 2ZJBA 5JHGB 4NHOA 2AL7A 2A78A 3GQBA 1JB1A 3GLHE 5EUMA 3VNVA 1KNXA 2JJ8A 2R2AA 2VQSA 2OT3B 2VF7A 3CNNA 4FWIB 3N2IA 3UATA 1YR6A 1NLFA 2VHCA 1JR6A 2V7QA 5HZKA 5KU1A 2EFEB 1CF4A 1ZUNB 3ZVMA 4NYMR 2VTKA 1ZP6A 4BZPA 1P9WA 2VP9A 5H70A 5KTYA 3CF6R 1LV7A 3T1OA 3TQCA 4R2IA 4D4MA 4MUAA 4I81A 5JWHA 3AV0B 3NH6A 3M1IA 5CIQA 2J41A 2QENA 2F1JA 3L0IB 5HR5A 3AUXA 1HE8B 1Z6XA 3DO6A 1Z8FA 5CDFE 1SXJC 4XTCS 2ZSDA 1XTIA 2ASEA 3EWSA 4IHQA 4CGZA 2XX3A 4BGDA 2X2FA 2XEXA 2CVFA 2XSZD 2IS4A 2C04A 4OJKA 1B0UA 3GLHA 4XWOA 4D0GA 3ICQB 4LYHA 2NPFA 2DYKA 1KK0A 1B23P 721PA 2WWIA 1ZYUA 1EFUA 3QKSA 3ZZTA 1G17A 1NY5A 3GLHB 3NEYA 4PHGA 1QVRA 4KJZA 4MKGA 2WJGA 2ECKA 1RJ9B 1IQPA 2WM9B 4V03A 3RVBA 3MUFA 4ON9A 4G5QA 4JL5A 5JRJA 1Q1QA 1ANKA 2HYIC 1GAJA 2R6FA 1SVIA 4OJQA 5AJVB 5FUWA 2P6UA 3LH5A 3U44A 3ZIAD 1D9XA 1TX4B 1WXQA 2ZJ8A 4A82A 2QRNA 3AVUA 2ZRDA 4AD8A 2GZDA 1WP9A 1A4RA 4BLRA 4DLZA 1A5TA 2QM8A 2WKQA 3MWJA 1S1CA 2I4IA 1IAQA 1NRJB 1OXSC 2PEZA 5EP1A 3M0EA 2VF8A 3K1JA 1OH7A 3CO5A 1JPJA 2DR3A 4NCHA 3U60B 4Z1MD 4PSAA 1N5IA 5EZ6B 3RRNA 2YZ2A 1L7VC 1RZ3A 3CWZA 5B30A 4I1UA 1G8PA 2IEYA 4XWAA 4AG5A 3FFBA 3K9GA 2I1QA 4IRUB 5FTNA 1KI6A 4NCJA 4KFUA 4LC1A 3IPXA 5D3MA 1KZ7B 3AUYA 4D4LA 2ZJOA 3R20A 4YMUA 3KJEA 1WA5A 1G64A 4DSTA 2YWEA 3AF2A 1HYQA 3C8UA 3RRMA 3V9PA 2EWVA 2FU5C 1KJZA 4C2UA 3PQCA 3LW8A 3TMKA 1FMJA 1GKIA 1BYUA 2P2LA 2YC2C 4KO8A 3HPQA 4DLTA 2JATA 3GEIA 3FGNA 1ZM9A 2R62A 4ITRC 4IDPA 1OIVA 4ZV4A 2H18A 1XJQA 3Q5DA 1R4AA 1CU1A 2X19A 3WHKA 1RPZA 4TMWA 4F93B 4XWKA 4JBYA 2XXAA 1H65A 2AN9A 4IDHA 3NIBA 1OYYA 1X86B 4Q19A 3ZD6A 2NGRA 3AKCA 2WKPA 3PUVA 4N0DA 2AWNA 1UKVY 1T0HB 2O8EB 1WE2A 5CJ2A 3LLMA 4Z1MA 2Z83A 3W34A 5DH9A 3CRMA 1QHXA 2X1VA 3GLGE 3OEHA 1KO4A 4QGGA 1E2JA 4CYMA 3AGQA 4JVLA 3I62A 1G5RA 3NH9A 1XEXB 1Z0IA 421PA 3FKSD 5G3ZA 1YJ5A 3LVRE 3WRYC 2ZRAA 4Q4LA 3BAFA 5FTJA 2V6JA 2WWHA 1JJVA 2WWWA 2VP0A 5KHOC 1E1QA 1OXUA 2BDTA 4NU0A 1HT2E 3EIEA 3HWSA 3WNBA 1KI6B 3AVOA 1XD2B 3B7GA 4QRHA 3GFOA 4TMZA 1NLZA 4Q7LA 3I72A 1HTWA 2CCJA 4DIDA 3AVYA 2FMXA 4ZCIA 2AXPA 1X6VA 4TSFA 1Z5ZA 1HT1E 4V0OA 4LI0A 2DWOA 1G5TA 2OUKA 4WVFA 1TTTA 2AKYA 4AWXA 1XCMA 4PZLA 1TEVA 2WBLC 3N5CA 3NTUA 4YXWD 2P6RA 4QHTA 3TNFA 2AFIE 3SJCA 1PVOA 2VL7A 4ZPXA 3VMFA 3UG7A 4LC0A 1X8KA 1FP7A 2XTZA 1HURA 4KHZA 1QBKC 2J1LA 1EFCA 4ZDIA 2QP3A 4GP7A 4PC1A 2GJ8A 1NJGA 2GEUA 3DZDA 4Q21A 2XZPA 3TVTA 4FMCB 2ZRLA 1QHIA 2DFLA 1T3HA 2KE5A 4MA4A 2ZS7A 2D74A 3IBYA 3NWJA 4Q02A 1QG4A 3WMGA 3EZFA 2R6CA 1VCNA 4EFLA 2GBLA 3EIQA 2MSCB 4B3DA 5L3QB 1SVMA 4LBVA 3O8DA 1JR3A 1XMJA 2QMEA 4B6EA 3U2QA 2B7BA 3KJGA 4G3XA 2JLXA 1NLYA 1OLOA 3KKQA 4RZ3A 4YXWA 4WW0A 2BEJA 2ZVPX 2GHIA 2IS2A 4TMVA 1II8B 1F2UA 2ZSBA 2RMKA 1NF3A 2CBZA 1G3MA 1ZU5A 2XB4A 1G6OA 2A9KA 2RGCA 1GM5A 2XOKA 1R5NA 3NEJA 4RKFA 2ATVA 2GF9A 2VP4A 4MYCA 5G53C 2PX3A 1GL6A 1VG0B 1W7AA 2QAGC 2IWRA 5FUYA 4PC7A 1E2DA 4PO8A 1LS1A 1G8YA 1W5TA 1W4AA 1ZJ6A 4LCBA 521PA 4FINA 2O8CB 3EX7C 1R7RA 5JWRA 4IOKA 2FDCA 1U8AA 4IFBA 2IT1A 1E2PA 5LBIA 3T1TA 1PZNA 4EIWA 3MFYA 4BFYA 1M2OB 1HQYE 1COWD 3QG5A 4TL8A 4Q18A 5EP3A 2WWYA 4Y0AA 1KDTA 3UANA 3I61A 2WWFA 1X1SA 4QBGB 3MAAC 1KOFA 4O25A 3AKYA 3VX3A 5TDHA 3SZRA 1JXOA 2BEKA 4BRUA 3KB2A 5EUQB 2OLKA 1GIAA 1LNZA 4JLKA 4R98A 5K8IA 4A8JA 1U0HC 4IDQA 3RLFA 3W3ZB 4BFTA 3HU2A 2F3RA 3BB4A 3EWAA 3D6TB 3FPAA 2SHKA 1US8A 1E0JA 1DPFA 1M7BA 5EXPA 4HZUA 4M1TA 3H2YA 1DADA 4LSGA 4F91B 4PX9A 5LPNA 3TW4A 1XMVA 1CTQA 1P2TA 4PSKA 4YMWA 3GEHA 3AF0A 4A2QA 3GJ6A 3FOZA 2ZAMA 2IUTA 4BRWA 1DAEA 2RGBA 4LPKA 3OF5A 4US1R 1EFTA 4LZZA 1R0XA 4X8OA 1SKYB 1Y3AA 3REFA 4PSVA 5EZ5A 2WAXA 1MR3F 3E2IA 5CLLA 4D6PA 1T91A 4JJKA 4E22A 1E96A 1W5SA 3GFPA 3UWOA 5B58C 2ERXA 4S35A 1COWA 2QAJA 4R7ZA 3UK6A 3QKTA 3IKJA 3CPHA 3ECCA 4DLYA 1TF2A 1HH4A 1OFUX 2BMEA 3RS5A 1IXRC 3UXMA 3W6NA 4P33A 1DAFA 2JIZA 4TMXA 4RFVA 1S9DA 3SFVA 1H8HD 4MRPA 4AIIA 1NBMD 5CYPA 4D80A 2ZSFA 2NO6A 2W6ID 5A5GA 1ZRHA 3H1TA 4WZAE 2UKDA 1J99A 2QMUA 4EFNA 2I1VB 2CLCX 5CJPA 3BH6A 3EIHA 3TSOA 5HKKD 2V1UA 2VHUA 2BJWA 5FBWB 1R0ZA 3VR5A 1W36D 2G1JA 2LCFA 1Z6GA 5DISB 4D26A 3L0OA 4N0EA 1XRJA 4TLBA 4G01B 4LV5B 4RD3A 3JVUA 5FPHA 2WOJA 1M8PA 3KQUA 1D2MA 2ZRNA 4K8OA 1KK1A 1MABB 2Q3HA 4PPFA 2PLRA 4TL6A 1G7CA 4CF7A 5JWOA 1A1VA 2DFKB 4DLWA 1XZPA 4D81A 1XPUA 3VFDA 1II9A 4MUBA 2ZE7A 1TNDA 2LKDA 2RH5A 4OL0A 1MABA 1ZW6A 3DL0A 1GSIA 3A8TA 3AF4A 3I92A 1VG9B 2QSZA 1XNJA 3ETLA 2ZR7A 1S1MA 3R9XA 1AS3A 1WBBA 5TV2A 5FOTA 4TN1A 3X1WA 3KDSE 1SHKA 3Q7QA 1OIXA 2ZU0C 3VKWA 1NKSA 2Q6TA 3KQLA 1E0KA 1VECA 1SULA 4WIAA 3GJ3A 4PAOA 3ZIAA 1U99A 3Q85A 1U94A 4PC3A 4OQMA 1OFIA 3IEVA 4NKRA 4CRWB 4YMSA 2REXB 2IXFA 1JBKA 2QPTA 2ZI6A 4DHEA 4XH9B 1BKDR 2W83A 4LRWA 4UQOA 5CB6A 1AN0A 2GKSA 2VPPA 5DIFA 3THXB 4DCUA 4Q4JB 2GA8A 3RWOA 3L0PA 1JR3E 2OESA 2QBYB 2QTVB 3LQRA 1Z63A 1PUIA 3LD9A 1O87A 2JAQA 3LRPA 2ORVA 4GBMA 5B2ZA 3EZ6A 4RFSB 4C7OB 3BE4A 1DE0A 4BLTA 1OPXA 2UVQA 4HYYA 5DSZA 5FPTA 1H8HA 1N6PA 1E9AA 2CE2X 2UZ3A 4ESVA 2VBCA 2F7SA 4OHYA 4OHXA 1T3LA 2X77A 2CJWB 4HAZA 3MRSA 2IW3A 2JLSA 1ZCAA 2A5DA 2HXSA 2AFHE 2LKCA 2OLJA 3GCGA 1XEFA 4ASUA 1E2GA 3CR8A 3I73A 4JL6A 3C41J 3GLFA 1R6BX 1CKEA 2BJVA 2W6IA 1G7SA 4KBGA 4QGFA 2CEAA 1AM4D 4C0LA 4F7WA 4A2WA 3QF4A 1J8MF 1DAGA 2CNWA 3U3MA 3CH5A 5JJKA 5HE8A 3GD7A 4Q48A 4GFDA 4WBSA 1SKYE 3QPUA 2YC4C 4NPHA 4GMDA 4P4UA 4W5HA 1OHHD 4RY2A 3TLXA 2AWOA 5GJBA 3L82B 1U8YA 2J0VA 5FTMA 2BCGY 4M2LA 2Q9CA 5SZIA 1J90A 4DUGD 1TEXA 3FKSA 2XNDD 3V4FA 4A6PA 3OEED 2O5VA 2BWJA 3GLGA 2V1XA 2D3WA 4JS0A 1KYIA 4O2LA 1SZPA 1I2MA 4TL7A 3AKDA 1QHNA 4ARZB 2W6JA 1S3GA 4MH0R 4H9GA 5DNYB 2DBYA 3O8RA 2GJKA 2IEZA 4U02A 2ZYWX 1DS6A 1LF0A 2ZRGA 3OIVA 2WJJA 3K8YA 4URZR 1E2KA 1CEEA 4N3NA 2R44A 4XD7D 3LO5A 3MGCA 2IYVA 2OXRA 2Q3MA 3MJRA 2PLFA 4EPRA 5HE9A 3VKGA 1C4OA 1ESMA 1ZUIA 2OE2A 4RD2A 3K70B 1AJEA 3KXKA 4TT3A 3FB4A 5JI2E 1P7CA 2RGNA 1NY6A 4LBWA 4M1WA 1DTSA 4QGHA 1S0UA 3LQQA 1T5LA 2G0NA 1M74A 3IBGA 4M1KA 2XB2A 2RAPA 4RD6A 3QEOA 5C46F 2OCPA 4RCZA 5CK5A 4M9SA 3E5HA 2QTHA 4GOXA 3VX4A 2H17A 4U7DA 3OE7A 3TUIC 2WSSD 1UEJA 3WYGA 4FMCF 3U4QB 4HDCA 4NYIQ 4DLVA 3OEEA 1KGDA 1QZXA 5E7IA 3DHWC 3RYTC 1MT0A 1NMYA 4XSHA 2WHXA 1NJFA 3PEYA 3ZZUA 4DXAA 5BYJA 4OK3A 2N46A 4HATA 2OFXA 2WJVA 4M9ZA 4GDFA 1GRRA 3ND8A 3FHCB 3OIYA 3R9WA 1SVWA 1W46A 2J0UB 1E99A 4UNQA 2ZE8A 4C9BA 2JASA 2YKGA 2QL6A 4CZ2A 4B75A 2WWXA 2CHVA 2A7QA 3P26A 3U44B 1DO2A 4RFSA 4YQFA 3OESA 2QUZA 2HEIA 5L3VA 1JI0A 3BK7A 3WP1B 2CL7X 1FX0B 1KI9A 4KODA 1G3UA 2C9CA 3ICEA 2B21A 3D3QA 4LHXA 4A0FA 2ZS9A 1ESNA 3BB3A 1UDXA 2C5LA 3DM5A 3I32A 2ZE6A 821PA 4TLDA 3MWKA 4LBZA 1F2TA 1NL3A 2XAUA 3FE2A 3SNHA 1JQLB 4ZDKA 1CRQA 1ZAKA 2QA5A 4TWZA 4UKDA 1ZM4A 1E9SA 1A82A 2FSIA 3K0EA 5CDFA 1NN1A 1AKYA 1GP2A 2FWRA 4OI4A 1OYWA 2JLVA 1XEXA 4GZMA 2QNRA 4M9XA 2OBNA 2VHTA 3B1WA 3IHLA 2GZHA 1KTVA 2XJ4A 1VIAA 1TMKA 2Z5FA 3FHTA 1Z06A 2HYDA 1KI8A 3EC1A 1W1WA 3MMPA 4BFUA 4E07A 1DAMA 2AXNA 1JAIA 2IBMA 4WXRA 1W48A 4V02A 4M53A 4RZUA 2OG2A 2EYQA 5CK4A 2A5GA 3A36A 4W9MC 5GJCA 5IRCD 1LTQA 3LWNA 2AHOA 5F2EA 1W4BA 4QJ3A 5JRZA 5A0FA 2Q9BA 1VG1A 3A1SA 3PXGA 5DYIA 3FMFA 5JZVA 1E2FA 1RC8A 3W8NA 2ZSAA 3BERA 3WBKA 3ZS8A 3UMRA 4A1FA 2QORA 3AVVA 3EXAA 3HP1A 1Z08A 3CRVA 4KV9A 4P4TA 5EJEA 5L3SA 2X2EA 1EFRD 2FN4A 5AUQA 3SE0A 1G6HA 2QT1A 4NTZA 2VHQA 3OE7D 1GWNA 1N6LA 1Q0UA 2MSDB 1E2NA 1UF9A 2NTYC 3CX8A 2WZQA 1VMAA 3T5GA 3A58B 2Z0MA 3S1AA 3EPHA 1MV5A 3FVQA 4NYMQ 4DIEA 4C3ZA 4MKFA 2Q0HA 1QHHB 1XBTA 3GJ5A 1CJUC 2ZUCA 2H57A 3LBHA 2F1RA 1GRQA 1AA9A 2F9MA 4OQXA 5EP4A 1NN3A 2R6AA 3PEUA 4URUR 1OXTA 2FPKA 2QQ0A 3O47A 1V5WA 1GNRA 1OKKD 2CJWA 3TJZA 4QXAA 1M1YE 3TE6A 4PANA 3QJYA 5H1YA 1KAGA 3WP0A 8OHMA 4BE7B 3THOA 4D82A 3H4MA 3K70C 2ZUDA 3D7MA 2AR7A 2GESA 3PR1A 4UJ3A 3AF3A 4V0NA 5CIWA 5DI3A 3W8RA 4HLUC 3A37A 2ODEA 2WAYA 1VIYA 2XNDA 1SXJB 5FI1B 2CL0X 2NG1A 1RIFA 4TMTA 3A1WA 3GFTA 5K8UA 3B78A 2GCOB 3F3YA 2PT7A 4PZZA 4GSYA 2D2EA 1XPOA 2EWWA 1R8QA 2P5SA 4QGAA 1E6CA 5E7JA 5JSZA 5E3HA 2JJ1D 2ZS8A 3EAQA 2BVNA 2P6NA 3BS4A 3HR8A 1CJTC 2JA1A 3QKSB 5DI9A 3K0SA 1ZNYA 1U0LA 2CNWD 1ONBA 4FIDA 4FCVA 1G7RA 1Z0JA 2Y8EA 1JPNA 5HTKA 1OE0A 3A4LA 4IW3B 4C0SA 4JBXA 4NBSA 2RGGA 1GTVA 4IOJA 3EW9A 5BYKA 1E0SA 1E2QA 4GOKA 2ZREA 4AI6A 2J0UA 4KSBA 4Q01A 3WNCA 4YMTA 1J7KA 4O3MA 1WCV1 1HA3A 2YINC 2IUSA 1Z6TA 3VHLB 2AKAB 4B76A 3X1XA 1P2SA 1EWQA 1EFRA 3RS7A 2ZRPA 4Q1BA 5KSPA 5KPDA 1FL9A 2OILA 4KFTA 2ZYVX 2XZOA 3BGWA 2NO1A 3FKQA 2O8BA 1Z83A 3U6KA 3R7WA 3TRFA 2O8DB 3X2SA 4MKHA 2A30A 4FMDF 4LHWA 1OT3A 1KDPA 3HU1A 3TGPA 2HDNB 5E95A 4JSYA 1XD2A 2YYZA 1ZINA 1CXZA 2WPDA 4TTQA 3VR6A 4B47A 4L8GA 3G82C 4DBLC 2E9SA 5EXTA 1ZC4A 3GLIB 1Z07A 4HAXA 4LHVA 2FFBA 2YWHA 5JSZB 4Q9IA 2REBA 4B2LA 1YZKA 5JEEA 2VSXA 4ZIRA 2FFHA 4JVSB 4DB2A 4BZQA 2E87A 1YZGA 5IT5A 3SC3A 1T8TA 3OIWA 3RABA 3DEFA 2FPMA 2PT5A 4XSGA 2L0XA 4JZKA 2GXUA 1F60A 1XD9A 2EFGA 3DDCA 3P32A 4LV8B 4Q4HB 3ZDQA 2WMNB 4QBHA 3W6PA 2ANCA 5J5CA 4BFVA 5DN6A 5JBQA 2XXAB 4JL8A 4HB2A 1XMIA 1N0VC 3OAAD 4AYWA 1AZSC 2O8EA 1AGPA 4ARZA 1CULC 2OFOA 4M1OA 2HT6A 2XGJA 3TKLA 3BB1A 5FOUA 2W2TA 5JI3E 4AKIA 5CITA 3ONWA 4NZYA 4EKDA 4LGMA 1QVAA 1A7JA 2VEDA 3SHFA 3DZ8A 4MGZR 5KDLA 5TVKA 4PZYA 4A8JB 2BBSA 4GOJA 3QPWA 1E2MA 2VSFA 5F98A 5F9HA 1PJRA 2ZAOA 4IEIA 1E9DA 1MOZA 1N2CE 3CIOA 1KK3A 4A0RA 1GNQA 5DYGA 3CB4A 4TZ6A 1D2EA 2YWFA 1P72A 1XB2A 3QF4B 3ZS9A 1PLKA 4PO9A 1P4SA 4HLDA 4I99A 2C03A 4QBFA 4A4DA 1BS1A 2O0HA 3QEJA 4RD0A 5D3MB 4H1UA 3VU9B 4B2PA 4DCTA 3IQWA 4NYIR 4GT1A 2VP2A 4G5GA 1K5DA 2I3BA 3AVQA 3NBXX 3W6OA 2D2FA 3UPUA 2X8AA 4NE2A 2OCAA 4UJ5A 3T1QA 2ZI7A 3PUYA 4B34A 4HAYA 4KVGA 4CEIA 3BH0A 1AS0A 1VYVA 4LX0A 1MKYA 3GJ7A 4LOAA 4L16A 1P73A 3L8YA 3SJBA 2WWGA 1IN6A 1DG3A 1NBME 1Q22A 2CMKA 2EFHB 3U7HB 3KKPA 2ZJ5A 2VP5A 2REOA 3QXHA 5AJWA 2A5FA 4US0R 1Q3TA 3A4MA 5HZHA 2J0QA 4FMBB 3TW8B 1K6MA 1KNQA 4EPVA 3QKRA 4BLPA 3QSYA 1IY2A 3C4JA 3X1YA 1E2LA 1XMSA 5SZHB 4Y0VA 2RGXA 1A2KC 5FL7A 3ZLJA 4OHZA 4LK2A 4R2HA 2JJ1A 4M21A 3QIAA 1X8JA 4PPGA 5FTLA 1UFQA 1M7GA 2J45A 4PXAA 3RS3A 1CS4C 2BBOA 3BRWD 1NVVR 4L15A 1AK2A 5J4YA 3GLIE 1N0UA 5FR2A 4TSFD 1P75A 1I2DA 1W2GA 4Q9HA 3GEEA 1FQKA 2ZEJA 4BLOA 2WVJA 4PC2A 4Z51A 1TQ6A 1CR2A 3OFND 2GZAA 4DSOA 2W2XA 3MWLA 3PVSA 4K81B 3SDZA 1KI2A 1QHSA 2ZRIA 4DUGA 1G4UR 3GP8A 1C1YA 5UKDA 1GNPA 4JVMA 2RHMA 5CM9C 5J40A 3P27A 1OHHA 2GEVA 1P2UA 4IFEA 4P4SB 4BASA 1P62B 4I1OA 1SVSA 5E4FA 1RFLA 4B73A 2JJ2A 5D3QA 3IIKA 1G1MA 3KJHA 1XTSA 3VR1A 1G3QA 4OK5A 1QF9A 1G16A 1TL7C 3W90A 1Z6AA 4WOPA 3ASZA 4JLPA 3TR0A 4LJ4A 1OSNA 1XXHA 3CRQA 2HCBA 2W2VA 2EFCB 2CCGA 5BXQC 3KL4A 3CH4B 5DN6D 3F0TA 1IHUA 2CHGA 2C77A 5DGXA 5J4VA 4S2EA 3NHAA 4MGIR 3SS8A 4PQYA 2BMJA 4JLNA 2ANBA 5AK0A 2BBTA 3U3JA 2OAP1 3QKRB 3TQFA 2P65A 4EPXA 4JLDA 3QOFA 3WMEA 2IL1A 4DEXA 4JYBA 1LY1A 2AD1A 3KFXA 1E2IA 2QGZA 2B92A 4ABYA 4RJLA 3VR3A 4B2IA 4CEJA 3BFXA 3BC1A 2QROA 4D0LB 5EQTA 3DM9B 2UZIR 3RANA 4B3XA 1CRPA 2ZRFA 4AC9A 3GMTA 4PO1A 4RCYA 3ZVLA
chains in the Genus database with same CATH superfamily
4LSMA 2FJ0A 1N9ZA 1LFDB 2C97A 4OX9B 1P29A 1RAEA 4Q3KA 2NT4A 5DYTA 4QD3A 4DT1A 3H2ZA 5AVRA 4OA8A 3KC2A 3PNMA 3WIDA 2O57A 1A2BA 1YB6A 4XUGB 4GLFA 5ALRA 2NUTA 4HCJA 3PJFA 5JJCA 1CK4A 3T1VA 4ZYWA 5IKPA 4BNFA 1I3LA 4B7CA 4J76A 2DUUA 1HEUA 1LPBB 3DS8A 1GUDA 2C98A 2QGFA 4HTFB 2QIOA 1RE0A 3ID6C 5GM1A 1PKEA 1PUXA 4C1NA 1BGXT 1M1NA 2AUMA 1SBIA 2WMDA 3OFSA 3WTBA 5BRNA 5TR9A 1K9VF 5K8LA 2D4HA 3QLVA 3BJMA 1YZTA 1BVYF 1K8YB 6Q21A 5K05A 2DPXA 4KAXA 1HQCA 4E3ZA 1R0YA 5JFGA 1EGQA 3KSZO 1DG9A 2XMRA 2XVYA 4MS1A 4Q6BA 5JNRA 5A9TA 1PEDA 3I58A 4MCJA 4EYGA 4FC7A 1SUAA 1CRZA 5FV7A 1JIQA 2NLOA 3NV9A 4JLOA 2CL5A 4H35A 4TKMA 1YQDA 2EU8A 4WNCA 5HFAA 1XLTC 3SQLA 1A27A 2GDJA 4L28A 2C95A 3WSTA 1KERA 4FW9A 1E2UA 3HADA 2VVTA 4G36A 3HLTA 3FMPB 2LVBA 4I1PA 4CMEA 1EFKA 1XR3A 3THWA 1RNLA 1MHPA 1P2FA 4KYIB 4E5KA 1P7ZA 1TCAA 3FB1A 5IAKA 1N57A 1YOVB 5B4VA 3ZVRA 3L18A 4DM4A 3F5FA 1RDFA 1AZTA 3MWDB 4Q4AB 1JDZA 4FFOA 4MDHA 1XAIA 5G0SA 4BEJA 3AH8A 1YR7A 5HKKA 2W2LA 3IUJA 4IX9A 2PL9A 3IDQA 3K1TA 4XFDA 3BL8A 3ECSA 3I01M 4LJLA 4Q9JA 2XUOA 2AK3A 3EDYA 3M6AA 3PV0A 4YAUA 3BZWA 1KY2A 2XHEA 2AOTB 4JYPA 4ONEA 3S6JA 4MQFA 3OP4A 1PJ3A 1QWSA 4JP2A 2R68A 4Q5IA 5FEMA 3ZJYA 3TQQA 5AI9A 5EHNA 4YB8A 1SIBE 1Y6ZA 2JGLA 3RAEC 4R9UC 3VSBA 4BV9A 4D9BA 2WYVA 5AM3A 4RS3A 3EZNA 4KO1S 3P97A 4YLGA 1ZGBA 3AOGA 6CHYA 1QIKA 1TO1E 5F9FA 4KSYA 3K7EA 5G4KB 2ZIFA 5HGJA 1P7YA 1W73A 3AFIA 2OOKA 3WHLA 2R97A 2IYRA 2MHCA 4A0QA 3KYDB 3QYFA 2P2NA 3KE8A 1F14A 2BBWA 2WFLA 4XTRA 2E1RA 1R5BA 2QAGB 4CM9D 4MMZB 2DXIA 2QJFA 1HG0A 2GD1O 3AQIA 4DQLA 3GLQA 1ADBA 2UVPB 1RLOA 1U6KA 4AZTA 1KARA 1CS0A 5ECDA 3RJMA 4CMKA 4EHBA 4JNKA 5FWNA 1U9IA 2HCJB 2COEA 2YJTD 3E48A 3EMBA 3K0CA 1CS0B 4DCNA 4E32A 3KXPA 1P1BA 1L6RA 1VTKA 2QGNA 4X94A 4EATA 4P34A 1U7WA 2PWPA 3QBTA 5I4KA 5J63A 1E7MA 2XZDA 2PX6A 1Y3DE 4OM8A 1FDWA 2P0YA 2J0EA 3GC6A 3T1NA 4FKZA 2Q1YA 3T7TA 4F97A 4HYTA 2PVCA 2D62A 4LAFA 1KORA 4AJJA 1IIRA 4C7VA 3HLKA 1VA5A 3OC6A 1RJFA 3KXIA 2E4WA 3IQDB 1ESZA 3H2BA 3KHTA 5D85A 3U1TA 4EGQA 2ASVA 2ZTMA 1FYXA 2FI1A 4RIHA 2O5CA 5AUNB 1MVOA 1ND6A 3AUUA 3HB4X 2V3CC 2O8BB 2DPGA 1Z62A 3GEDA 4V2IA 2QMHA 3RS2A 1Z0FA 2RC5A 3B5EA 3L46A 4GI3A 1YJXA 4CG0A 5B2FA 4BN5A 1U3TA 1IYZA 1NGSA 3OT1A 1DRWA 4MV7A 3I1YA 4ZAXA 3T3IA 2PKQP 4HD8A 1JEAA 1HT3A 1C4WA 3IO5A 5E38A 5TPZD 3V1LA 4BBJA 5KSZA 1LKZA 4X9XA 1Z47A 4UEOA 3LHIA 3L0CA 5LL6P 2ZXEA 4XJTA 5LDDC 3UUEA 4TTJA 4QJBA 2VJDA 4N6GA 2F48A 4L7QA 4HZIA 5FOWA 3NHZA 3COZA 3UOGA 4EL5A 2IZ5A 4X8MA 4RQTA 3PTZA 3V34A 3TMAA 3OG9A 1SQ5A 2ZWOA 1ODIA 1FFXA 2BHSA 3KZXA 4U7WA 1MX5A 4PRLA 1RXWA 1HQKA 4RJIA 2MMGA 3MS4A 4GPTA 4KVFA 4ZQFA 4O4IA 4EMUA 1LZKA 1ECGA 1O6CA 3C5CA 1Y6RA 4Q7MB 1R50A 1XMQB 3OFJA 5ESXA 3EIOA 4QU9A 5I9NA 2A2ZA 2HV8A 3O8OB 5CW2A 1KZ4A 2QMOA 4INJA 4B6FA 4LF8B 1NW5A 3UUFA 4TSRA 1AS2A 3OF3A 4M83A 3V7NA 1I5RA 1PN3A 2NAFA 5BSMA 3F6CA 4BL5A 1MD9A 4A03A 2XBUA 4XYGA 2R84A 4M49A 4TLMB 2C3PA 4F1WA 1OC4A 4MUAA 3MJ4A 4TQUS 2YV3A 3HJTA 5A4IS 1DDOA 1FF9A 1T34A 3O1JC 1GA4A 3AFOA 2D4AA 2E5FA 5BN5A 5FBVB 3B12A 3JV7A 4KRYA 2FW1A 2E6KA 3N8GA 4LE2A 1HDYA 3IE1A 3CSDA 1AF4A 5TS3A 5DKFA 1IZYA 1CUGA 3ZV3A 1CDOA 2ZSHA 1Q3HA 4GBJA 4YPFA 1D0SA 1WZEA 4RE5A 4AJOA 4E03A 1J8YF 3E03A 4Z1OA 1OVGA 4K2HA 3UFBA 2J9RA 3PIDA 4BECA 1XPRA 1AHPA 1PNTA 3QE3A 1JHQA 4Q37A 1E5QA 4IIDA 1BRTA 1YE8A 1A2QA 5A02A 1CFZA 1FP1D 4X54A 2D59A 4JMPA 2G3YA 1IN5A 1HZZC 1U81A 3QVSA 4J03A 1MB2A 3LGAA 2D5BA 3GA7A 1SCUB 5CR9A 4JROA 1EVIA 3UJNA 1KP9A 5A5EA 4UCXA 5LLDA 3U1BA 4B3CA 4B3HA 3R3WA 5KTPA 2I55A 3B3AA 2HH9A 2O3SA 4M1YA 2YMQA 1GCUA 4G2TA 1TTQB 3BA6A 4GPIB 1ZBDA 5FPPA 3HHPA 4F92B 1VC2A 2KJQA 2Q6OA 4M0FA 2H1VA 4O1IA 2WFMA 2GEBA 3MLEA 3D3WA 4G97A 4DG9A 3AF6A 2X5JO 4X3PA 3FPKA 1MQ9A 4JT4A 4QPZA 1P45A 1LFAA 4B40A 4TWBA 5HUQA 3HYLA 1T3TA 4NZ9A 1ULBA 4HTFA 4O08A 5C7LO 1MTOA 4FFPA 1KI3A 1IB6A 2PL1A 2XB8A 4FZ5A 2K7FA 4MHTA 3R0QA 4K9DA 2WJHA 3RV4A 4QM6A 2IEAA 5K3AA 4LF7B 2PWBA 4J0DA 2PUJA 1LSJA 1FP4B 1E2EA 1Z0ZA 3QNMA 3R77A 4O4IF 4EUNA 1KMCA 1SBNE 1YQQA 1Z36A 3ABOB 1AG9A 3P0IA 4PGFA 5EKTA 3RVJA 2M6SA 1N6IA 2FHPA 1ZH6A 3FFTA 5CA0B 6GPBA 5JS7A 1J5XA 1UDWA 2NIPA 1G8GA 1NTOA 2FA9A 3SJ7A 3ZI7A 4AB1A 1G2PA 1JEQB 1DBVO 2QG6A 1AX9A 2R47A 4NK4A 4OQYA 2BMAA 1M6EX 4Q4HA 2WNIA 1FFEA 4XVQA 4DA8A 3HA7A 3F90A 2ST1A 4KITB 5P8WA 5F3WB 4CVNA 2XV1A 1IY8A 1NJSA 2R1VB 3TFWA 4XIGS 3G02A 3EA5A 1V4NA 3HCPA 4NJMA 4EJSA 3SYRA 3U4IA 3RFCA 3TSWA 1TYDE 4RVNA 1POXA 1RRPA 3AT1A 3JTEA 4BVAA 1GRNA 1K4YA 1P80A 1RXVA 2E82A 1V43A 4KHPB 2A14A 3D2BA 3GARA 5AVKA 5AW0A 2IH5A 2EQ5A 4GXNA 3SHWA 3U7RA 4FFSA 1PQPA 3OQ1A 3D6MA 3ZHZA 5C1BA 5CD1A 2QN7A 1XEWX 3NUZA 1JDBC 4FFLA 5KC8A 2QI9C 5FI5A 1XAGA 1T3SA 2Y0PA 4OB6A 3FZNA 5DHAA 3JQ7A 5BQ5A 1QP4A 1XN1A 4QOIA 1Z28A 2JBWA 3C5HA 3T5TA 4ZI2A 4V3CA 1IN4A 1XROA 5HTOA 1KH2A 2IGTA 1DELA 4K87A 1ADJA 5C8ZA 5ALMA 2ONJA 1C9YA 4TYYA 1XDBA 2DJ5A 2Z30A 2Q2VA 1H9BA 2H2IA 2WK1A 2ZI3A 2EX0A 2IPXA 4FBGA 5JDCC 5FIUA 4FZ3A 3SLRA 4YCMA 1NVMB 4Q3DA 3PFNA 2OZEA 1WL8A 4IQ0A 3PKIA 4RVUA 1XEAA 3BE5A 3GAZA 1LLDA 4IHJF 5FLYA 4BKOA 3Q2IA 5BR1A 3SKVA 2JZNA 4LCJA 3WWPA 3DD1A 2XYHA 5IUKC 1O3YA 5DWVA 2IYUA 7MDHA 2EJBA 3CF4A 3C6BA 1UPUA 5CMLA 2XE4A 1JW9B 3M6VA 1KY3A 1FMCA 1D07A 1LC3A 1Z25A 4MULA 2QWXA 2YWRA 1GA1A 4WD3A 1AGYA 3EFOA 4IF4A 3B3FA 2C2WA 1OD6A 2GN4A 4M9QA 2VNAA 1Q1EA 1MC8A 3AJ9A 4C08A 1ORTA 4MKRA 1ND5A 1N25A 2V65A 3FYUB 1GYRA 5LVAA 1Z2CA 4YUAA 1SOUA 4BP9A 3QU9A 4YP9A 1ZU4A 3OZDA 3M4YA 4IOMA 1WCXA 1ZONA 4WESB 4KVAA 4PX5A 4RIGA 1VHLA 2VDVE 4X7RA 3RSLA 5LKAA 3CNLA 5HZGA 1YKSA 2EVWX 2E48A 3LA8A 2QT0A 1U9JA 1XSEA 2YV2A 4P38A 4CMBA 2Z43A 1UXIA 3K35A 2PWAA 1LPPA 1EVLA 2WA2A 3F3MA 4EFKA 3OTQA 5E2AA 1T1SA 4K9PA 2NP6A 3BKXA 3PRHA 4IG4A 4LY6A 2XDQA 2VPWA 3NC0C 3SOPA 2Q7XA 1DZ3A 1U2ZA 1ZVJA 4BLQA 4NDNE 5HZMA 5JCZA 4KUHA 5L51A 1J25A 4PTYA 4DRXA 1FBTA 5ARDA 4G1BA 2EW1A 2GZ1A 4M88A 3QBDA 4ZOCA 4HVLA 1ZGAA 2DVMA 1LLQA 1EUCB 1S7GA 2Y2UA 3I76A 3C98A 3RYFB 3TN7A 4EEXA 5JS1A 2BGLA 1Q20A 3NM6B 1H2HA 1H0SA 1C9JA 1W19A 1KKUA 4CR8A 4YP7A 3Q12A 4XOIA 3UMSA 4D5EA 1UBFA 3QF7A 3WKBA 3DUWA 4QBKA 3GJXC 1I4LD 1G291 2BHTA 4R7TA 3TQSA 3VRHA 4IYJA 1OI2A 1UJ5A 4BO2A 2PD6A 3DQPA 2QRVB 3GP5A 5GONF 4B3BA 1K8XB 1XPJA 2HLPA 3WNDA 2WIJA 3FW1A 2NADA 3KJIA 1KO1A 5BWLA 2RB5A 3SJAA 4C2AA 1X7WB 1PJSA 2G9VA 3A4VA 3LDFA 2J3MA 4HC4A 3P9NA 3QLTA 4EUKA 3Q4GA 3CNOA 4BNXA 2H5IA 4FGZA 4OYHA 2HL6A 1QM5A 2O2EA 3RADC 4P0PB 5GIOE 3MILA 1JVSA 3NIGB 3A9UA 1J20A 4IVNA 1VCHA 3WB0A 3WY9A 1XVVA 1FZQA 2CE7A 1I4WA 2ZSKA 4MRVA 5LA6A 1T2NA 3CXUA 5INTA 1SKMA 1VL5A 1VPDA 1R6DA 4D3XA 1DX4A 2WQ6A 4Q1CA 1TU3A 1EHIA 3FRJA 1YS6A 1S8AA 3DEKA 3ZJVA 1XVLA 2C84A 2B1GA 2QD1A 4UVHA 5KYKA 1SHLA 2ZW9A 4RH3A 5CYOA 1G5HA 2I71A 2YHIB 3QUSA 3R5KA 3JALB 4IXWA 3DE7X 1N2IA 1YOBA 4HUQB 1NZJA 2ZB2A 3MW8A 3U17A 2R6JA 4A2CA 4DAOA 2FX3A 4L5JA 4A2PA 3FNBA 4NY1A 1NIPA 3NGXA 4DCSA 1QLWA 2Q5CA 1YZHA 1A7KA 3D3KA 4QHYA 1NYLA 4PQEA 5KDOA 1SEPA 4JP3A 4AP6A 1RI3A 2G5GX 2OCIA 2O8DA 1UZAA 2OV2A 3M3HA 4BC1A 3B1ZA 5IARA 4TQ9A 3TGPA 4G1CA 2IP4A 2GK4A 3PCXA 4HQ6A 5LMNB 2WDPA 1C7RA 4CLEA 2O59A 3IPCA 1NOJA 3HKEB 1SVOA 2H06A 4O0LA 2CZGA 2VDMB 4N8DA 1MW9X 2AN3A 4EABA 3MS2A 4EVRA 4C14A 5A5DA 2WJYA 4HDNB 4C3VA 4DNQA 1PTJC 1R10A 2NYVA 3IXMA 4KYTA 3W06A 4O5OA 4TZKA 1IN8A 3EG9B 4XYLA 3BD6A 4ZP1A 4H3KB 2FHSA 1ZIPA 1DKUA 1CC1S 5JMTA 1BWRA 1K3UB 2H1FA 4DJEC 1K6IA 2UVPA 4WASA 3CZMA 3WRXA 1NYQA 4EHKA 5M7EA 1XP8A 2YOHA 4H15A 2FPGA 2ZUBA 2X1MA 3I2YX 4HN4B 1J07A 2NPIA 3ASUA 3T7EA 5LYJA 3T6KA 1B1AA 4A26A 5AJXA 3QY0A 4YRFA 5F9MA 3EXIB 4F2HA 4NNOA 2QYOA 3IV6A 1KO5A 1MIOA 2VPYA 1KJ9A 2PR7A 5AVOA 3FCSB 4KMSA 2QW8A 2YYAA 5KYWB 4FK8A 2Y0EA 1XXHB 5DGIA 4F3CA 2WYHA 2SKCA 1EG7A 5LMZA 4UM9B 3DL2A 4RVGA 4CTKA 3KKNA 1IWOA 3S55A 3ZIUA 3UF0A 2AOUA 3ESQA 2P6MA 3Q2OA 1R6XA 2H4WA 2AI1A 1T0UA 5C51B 3Q0TA 4L78A 2JJMA 1Q0TA 1KK2A 4LYAA 4HEJA 2XGSA 4ZC1A 1ZNZA 1GARA 1M0WA 4CLRB 1NBAA 2G9UA 5HMMA 1NN5A 1NW7A 2G9ZA 2VUUA 1W0JD 1HMPA 3OEWA 4JJFA 1QFJA 3LKDA 3QXJA 2PFGA 3AI1A 4QATA 3VTKA 4A0HA 1X13A 4B4WA 1YOVA 1AXEA 3ZV7A 2VDQB 3G8YA 3S1AB 1LPSA 1FUKA 1J0BA 4OP3A 5HW0A 1J8DA 1NAHA 1FOEB 3NORA 1KKMA 2GZSA 2XQJA 3Q72A 5DNCA 3KQHA 3CPJB 5JEDA 4XD7A 1UR5A 3CVUA 1J22A 3AETA 4HFMA 1WNFA 4OHVA 4RADA 3RO7A 3VVMA 1SPBS 3HSYA 4N8SA 3VGJA 2FPPB 5JAQA 3KU4A 1TUBA 4K6FA 2TMKA 4YONB 5TSDA 2ZJYA 1Z74A 3QKIA 1M6NA 4WX2B 1QRAA 4I9HA 5EUCA 5I7RA 4P92A 4Y6OA 2EW2A 3PYLA 3O2NA 1Q21A 3TW6A 1F3OA 3F78A 4N5LA 5IZCC 1XFAA 2DPYA 2Q99A 2ZTSA 3CKKA 1MO6A 3WI7A 4B71A 1NVUQ 3N0XA 4BKQA 1UBEA 4LNHA 2RGYA 2Q29A 3CVVA 1FTSA 1UJBA 1J0EA 3RJZA 3ZGVA 3FYHA 3AEKA 2BC9A 4L27A 1TOAA 3UHOA 5H9WA 4NCKA 5EIAA 3P96A 2J9YB 2Q0XA 1WUTA 2ZTVA 2IYZA 3N7AA 4I1IA 4KFRA 2ZT6A 3AM5A 1J42A 4PG5A 2H59A 1O4VA 3EEOA 4K46A 1QX4A 4GS5A 2XVXA 3QEMB 3H6GA 3ENWA 3OLQA 1ZA1A 4BVKA 2AX3A 2FV8A 3KQWA 4XM1A 4ER0A 1HORA 4L4RA 4GKJB 3VHRA 4A8JC 3LY9A 3M8KA 3CLRD 1JDSA 3F6EX 3ASVA 1DRVA 4GYJA 1VKHA 4NP6A 5KMGB 2WIAA 1QHHA 4NCNA 1XMOB 4BMYA 5JZSA 1DWPA 1E7YA 1X39A 2A1TS 3KZ1E 1UBJS 3DKPA 4UASA 3HBJA 2XNCA 1R00A 1DMSA 2Q1SA 2Z3VA 2IKSA 2G7ZA 4L85A 4WBNA 5I45A 2Q9AA 3VU3A 1F8GA 1CSEE 5EI5A 2XYPA 3R9IA 1L8LA 4RHUA 1Q0HA 1E9EA 1NPTO 3H9GA 2KQUA 1L4BA 3BIXA 3D1LA 3Q2KA 2KPOA 2BGRA 2JS7A 3A4TA 4YMVA 2H92A 4N5HX 5H83A 3D4LA 1AUPA 4F4HA 4BPBA 4OHMA 5EYPA 1KJ8A 2V3VA 2HOQA 3C8MA 4NCAA 5IABA 5B57C 7REQB 3G2PA 3NKVA 3O8LA 2HBZA 2ORIA 3ISJA 2NO0A 5ED0A 1P8AA 2NU8B 3KFLA 2YMPA 4F2WA 2L17A 2VIIA 1U90A 2GFHA 3KUXA 3VNUA 3C43A 4RM3A 1N6RA 3U4GA 5DSXA 4CN8A 3L4KA 3VPCA 1KSJA 1YNSA 1DCFA 3WLSA 3AJDA 5HJEA 1F8FA 4TTTS 2J9GA 2BFWA 2WHQA 2BV3A 1B8OA 1VYTA 3ANNA 2TRSB 4U7FA 4B5LA 4DMUB 2IYTA 5DOZA 3NWBA 4OHWA 3M6IA 3G9XA 3NYIA 5E0OA 5I7UA 4O4LA 1ORDA 5A7HA 5JDIA 4JT2A 3O8QB 2NTVA 2RG1A 4YCLA 2IK8A 1ISGA 3ZWXA 4DA0A 2AEJA 4E5UA 3T95A 2X5KO 4AYTA 1OB2A 1NWHA 4CDGA 1JHPA 4ZIRB 3KQMA 3ZUGA 4EYOA 2QTVA 3ZCSA 3UJ7A 4MWTA 3KQPA 4XGRA 5BSHA 4PYKA 3CBQA 1AVTA 3EYWA 4U6SA 4C0WA 4ESOA 1I1HA 2ZBPA 3SN6A 4U2KA 4N5IX 1MU0A 1P6QA 5BSTA 3RARA 2BM0A 3NHBA 3UMGA 1ZGGA 3GJ4A 2M2IA 3V97A 2BIFA 4KE7A 1N6HA 3NPAA 1T8UA 4NX2A 3ED1A 4Q3BA 1YS1X 2VQFB 3D1JA 2ECQA 3RIYA 4TYNA 1W44A 4C4RA 1F1JA 4MK4A 4Z4IA 3MOGA 4LRTB 4UNSA 4B2YA 2IPNA 3LC7O 1B0AA 4D4JA 2GM9A 3PUZA 2X6QA 1T9ZA 2HDOA 3PNQA 1YBVA 4EX7A 5ICCA 3TW0A 4J4BA 2CY0A 4ERNA 1V8FA 3FNQA 1JA1A 2F55A 4AZ0A 1G3RA 1CEQA 3OX4A 3FPFA 1WVIA 4ZV9A 1CY6A 3L4EA 1DXHA 1FDOA 2BCJQ 3OVMA 1Z3IX 4NMMA 2P9TA 3AZOA 4GX0A 3R0VA 4G09A 1BC5A 2FMHA 3UB4A 3LT5A 1H2XA 3ZGXA 3H1AA 4D8WA 3C8ZA 4TLCA 4G0UA 5BXYA 1UKYA 4XA8A 3U4AA 3DB1A 1M2JA 3AIIA 1EK6A 4OQQA 3VPDA 4GOND 3QX9A 3R0ZA 4G5XA 4RM2A 4Y6GB 4YA6A 1F7VA 2NU8A 3DUFA 2HT1A 3FX2A 4EY7A 3AIOA 4X8HA 3B9PA 1XWWA 3FA2A 4LUCA 3H2SA 4KXFB 1ZN8A 3DXFA 3B53X 1CEXA 2L82A 1A8HA 1U7TA 1ETUA 4D42A 2Y1XA 4LYGA 1X3SA 4AZ3A 3E1SA 3MCUA 1FFHA 3DA8A 2F62A 1WNTA 2RGAA 1ESCA 2ZT5A 3K09A 4IIYA 4BYGA 1P31A 4MROA 3G88A 4RBNA 2J3HA 3BD9A 2ZJFA 1CJMA 2BKLA 4CV0A 3BUSA 2VCEA 1HOTA 3B1YA 3CBGA 3IR7A 4RS4A 5E2IA 5JLAA 3GJ8A 3ES9A 5ANRB 2RBEA 2ETVA 5EJIA 5JC1A 2JFVA 3EY4A 3P0FA 2Q41A 3GJZA 2WB4A 4QC2A 1KMQA 5AW3A 2NU6B 3HGMA 4PYJA 4N5MA 1HE5A 1PAUA 3REQA 4C06A 3HDYA 3O31A 3IIJA 1VP9A 1VKRA 2IHBA 1XU4A 2ODBA 2J5XA 4M60A 5EE3A 2PWYA 3D6HA 4JA0A 4NWIA 1DJPA 5F64A 3IOMA 4A9AA 5KOHB 2JLWA 1XYYA 2GF0A 1V6SA 1ZITA 2CNOA 2NOAA 3A1EA 4NOJA 3P2JA 4OK6A 2P2YA 5EKSA 2VDJA 1R0LA 3OJWA 1HUQA 2A5YB 2IE0A 3DCIA 4IR7A 4RYDA 4CG3A 4CQLB 3ZJTA 4YJHB 2HSZA 4JHLA 4BDSA 1LVGA 5FR1A 1Y9DA 2JVKA 1YVEI 2X8JA 3LXUX 2R8RA 4PQFA 4AURA 1D8TA 5TY0A 3DBIA 4OY3A 2C8VA 3K9LA 1KEUA 3R8FA 3I2HA 5HRAA 3MSXA 2JK0A 3IOBA 4J3FA 3FNRA 3VPFA 1EFAA 5SZJA 2XI4A 1EXVA 3I8SA 3ZXUB 5F73A 2I3DA 4MDEA 5B7GA 1N2CA 5FKJA 2X9NA 3N86A 5BT8A 2V8OA 2GXAA 3K1AA 1IZ0A 2PQ0A 2OFWA 3GVXA 3KZKA 4IDNA 4I6GA 4BQSA 1NIJA 1WV0A 4GL4A 1E3IA 2JHCA 3ONVA 3ROEA 3VQTA 2B2XA 4DVGA 4EUEA 1JYSA 3MWFA 4RENA 3AQ4A 1W94A 4XPIB 3UUGA 4BYMA 1UZMA 4EAQA 4TTRA 2F1IA 2XF2A 5K0NA 2O2JA 1QTRA 1CY4A 3RUDA 3F8TA 3SQMA 1NXVA 1E79A 1TE2A 1G41A 3VYVA 1A8UA 3LLVA 2PUVA 4ACAA 4OFXA 4YAWA 2QTFA 3K6JA 5T6BA 1L4UA 4FNMA 1M1XB 5HKLA 1M2OA 2XJ9A 3ITKA 1OI3A 2AI2A 5G2OA 1UL1X 4F9GA 5BUZA 1YD7A 1JTFA 4X41A 3VO2A 1V71A 3QFTA 4BE4A 2ZE5A 1CVIA 1GL9B 3HU3A 3B52X 3MN1A 3DE0X 2PMCA 1URPA 5BVGB 4P4SA 2QRLA 3VYWA 4CCSA 5HFJA 3EFOB 2WTNA 3LUCA 3WA7A 4TN5A 1QUEA 5LB4A 4M37A 1F06A 4L4ZA 2ZQYA 1VGVA 4N0MA 5ALNA 1D2NA 1MO4A 3FTCA 2HCTA 2E37A 2XWJI 4HDOB 4I1SA 1QG2A 4CV2A 4YRBA 3KB1A 3EVNA 3CUYA 3FVRA 2DT5A 1F51E 1M8KA 3K9HA 3KVNA 5J59A 1T9AA 1X7ZA 2OD9A 4DJDC 3JD0A 3NBMA 4WPGA 5ES4B 4UE6A 4CKWB 2PS9A 4FSDA 2HU2A 1PTKA 2A35A 2EOAA 3ON5A 4NBUA 4I4TA 2GJAA 2FJUA 2QKYA 2XA9A 1M2GA 4PG7A 5EHGA 4P4GA 1IOVA 3RS9A 4ZOLF 5EE1A 5B1DA 3GVIA 4DT1B 2HHJA 5G1NA 1A9PA 3EXG2 4DQ0A 1BJRE 2A8YA 1A8PA 4MRNA 4NENB 4TUYB 3TL2A 3G0HA 3JQ7B 4CGYA 4RZSA 1OTXA 2V7XA 121PA 4ZO8A 3HY3A 4AKTA 5EWLB 5BN3A 4H27A 3JZFA 4XEUA 4Y2QA 2J7PD 2P9ZA 4JUAA 4C5CA 3CB2A 3CUEF 5JO0A 1F2UB 2VDUE 2HEGA 3PITA 4ZFNA 3ZDAA 2GVZC 1WRBA 2VN8A 3IH5A 1GDDA 1N5KA 2XVAA 3RBVA 3T4UA 4PCVA 3MZ0A 4DMRA 3FVTA 3FOFC 3G0DA 4WN9A 2HQRA 4CT4B 1CY8A 1C41A 1UC9A 4F8YA 1DWUA 1JHAA 2EG5A 2DAPA 4NCIA 1T13A 1M2VB 1CQIB 3ET5A 4QO8A 4ZO9A 5DI3B 5CB4A 3BF8A 5B6JA 4G4GA 3RRJA 1N5DA 1F8XA 3VDRA 3THYB 2DHRA 2F8LA 4BN0A 2GCOA 3E9CA 5L9AA 1C3OB 1DJOA 3N28A 1P2VA 2AD5A 2DLCX 2EARA 2OK7A 4HDKB 1X8XA 3CN9A 2H0RA 2N42A 2Q6IA 3NTVA 5EN4A 2FZCA 1N2EA 4LI3X 4JUBA 3WWEA 3WBBA 4CMEC 1QF7A 5EIHA 4YVFA 1DCMA 1OBVA 1IL0A 4B8WA 1YHNA 3HO6A 3B3QA 3ICOA 4FE4A 3W5BA 3VR4A 3F3SA 1O5OA 3BCHA 3HXOA 2Z6VA 3O0DA 2IZZA 2IA5A 3R3YA 4R81A 3BXZA 1M76A 3DEIA 4H1VA 3UW3A 2OP0A 1CIJA 2Z98A 3J80A 1TJ3A 3DL4A 4RX1A 5BUCA 1FTYA 2HU5A 1V9SA 4F85A 4RSHA 3HUTA 3X1ZA 3QBJA 2G8NA 4MYTA 4UNNA 1KEZA 2F3SA 4B7AA 4ZOLA 3ZTTA 5KSWB 3BBPA 5D01A 5I4CA 5LP6B 3ZD7A 4DCVA 3HRKA 4X61A 2RJ3A 1N9KA 3O3MB 3NHFA 3TCNA 2HR1A 4LFBB 4L4SA 3JYQA 3RSGA 5KQPA 4MPTA 3ZLVA 5WRFA 2GYYA 4DWJA 2ZJAA 4KUGA 3PEFA 1EVZA 3E9QA 4AX4A 4GX1A 4JJ4A 1MJGA 4BFZA 1GZVA 1F48A 1IY9A 2W2LD 4ECAA 3Q6IA 3ZWCA 5A4FS 5LD2B 2WD9A 1M1YA 4FHDA 4LW8A 2JLZA 3DR5A 4PAQA 3U3KA 4ZQHA 2FX5A 3WLIA 3ZHBA 3WAJA 1U1CA 3PNOA 1C29B 2ZBRA 4NG4A 1E62A 4X90A 2FYTA 4KLNA 4RSGA 3Q5GA 1OZFA 3AEQB 3GCWA 3OH8A 1LDGA 4ZWNA 5A1JA 1THTA 2ZTHA 3AFGA 3RS4A 2WUEA 5BSFA 1ECLA 1JFLA 1EH5A 1IVNA 1E7QA 1N6OA 1V5GA 1B43A 3RBZA 5K6AC 5KC9A 2UXCB 5B1YA 3H87A 2C3UA 2ZJZA 5LMUB 3HDVA 4H4CA 1TXGA 2Y1CA 3PUKA 2Y0CA 2X0RA 3T06B 1RHRA 4AFNA 2AR9A 2P11A 5K03A 4FDVA 4AECA 4KPFC 1LDMA 3IP9A 5JSYA 4YCCA 2PAFA 2Y67A 4Q9KA 4JXZA 4WZBB 2O6HA 5T67A 1O8BA 1WDMA 3VC1A 1IOLA 2B30A 3NCHA 2MYPA 4PWZA 5EQJB 2W0SA 2CLFB 4ZQIA 1CIPA 1EVKA 4IIJB 1OU0A 1XDSA 3JAWA 5IVIA 3VVBA 3CRW1 1QB7A 1KMHA 2PO5A 3DMYA 3MK31 4YUXA 1XG5A 2BM8A 4LZJA 3T9DA 1YHZA 3G17A 2PRYA 3TVYA 1UJNA 2O5EA 1J70A 3C6QA 4DLLA 4NI5A 4P36A 1S9HA 3W3AA 1UBHS 1TAUA 2YFKA 4LCEA 3UAXA 1Z73A 1IWPB 2O3JA 4LYFA 4L5BA 3RWMB 2VCYA 1Q3KA 5BWOA 4US2R 5LP6A 2Z4SA 2ZPAA 3GMIA 4Z9FA 1AURA 5JHGB 3PQ4A 5I4IA 3GQBA 3I4CA 4QXOA 4RULA 3BRCA 3H2HA 1E4EA 2VZ8A 4BBAA 2ZRQA 4G1FA 1T2EA 2JJ8A 2R2AA 3EIXA 3II6X 4KQKA 2PXAA 1EFPB 1C4KA 3I0NA 3M89A 5IJXA 2DHCA 3RVMA 2VF7A 4ATNA 4UFPA 2Z6AA 4ZU6X 4H6VA 1X2EA 2VHCA 4KOEC 4MVJP 5ELLA 2V7QA 4BB6A 4FDUA 5HZKA 1CF4A 4MTLA 1EEXB 2VTKA 3I9V6 4G9BA 5MGBA 1E7RA 3U7QA 3CUSA 2ZZNA 1A95A 3T1OA 4X7MA 3B70A 3M1IA 1GAEO 2HBQA 2IFTA 4RIIA 2QENA 1BMQA 3AUXA 1HE8B 2J3QA 4GP9A 2PYIA 4JBNA 4JGIA 5EL0A 1B41A 1Q92A 2RAFA 3CT4A 2ZSDA 1QKKA 3E7FA 3D3EA 2OQRA 4B4VA 2PT6A 1AH2A 2HRCA 3JVDA 1LVHA 3WK9A 4CGZA 2GRAA 5ERGB 5TMDA 2XEXA 5CBPA 2CVFA 1A9ZA 5EIBC 4EY4A 4XWOA 3PFWO 4LYHA 3PPIA 1F4PA 2DYKA 4H3VA 1B23P 4JLWA 4PGAA 4TXLA 4RLHA 4YRKA 1LBQA 3OY2A 1ACJA 1EFDN 1J33A 1XL1A 2VHXA 1U5BB 1EA7A 4MWCA 4RY0A 3ZZTA 4PHGA 4KJZA 2BSAA 2WJGA 4CM8A 3RSHA 5J2UF 1SUFA 1Y1QA 3QEMA 5JSFA 2JCBA 4UUPA 4S3MA 3MUFA 4ON9A 2H1SA 4X20A 3DZIA 1FK8A 1EQAA 4G4JA 3A7DA 4ENVA 2HYIC 2WU4A 1FLNA 1SVIA 1K63A 2AFIB 1Z56C 4JB8A 4OJQA 4NENA 5DHUA 2PMEA 3ZIAD 1GGMA 2ZJ8A 2ZM6B 2F2TA 2Q2NA 4Q7QA 1MJ5A 4YV0A 4BNJA 3DDWA 1H05A 4H77A 3PQ2A 3H7IA 1AT1A 1EFPA 1ZLYA 2JD2A 3L8HA 4RK0A 1WZIA 2VNSA 1S1CA 3RC1A 1SU6A 3D6NB 2CYCA 2B0JA 1NW6A 1IAQA 2PBZA 1BDBA 3JQQA 4KAAA 5EP1A 4NR0A 4NU6A 4DSZA 5BNZA 2QDXA 1WSWA 1GTMA 4HVAA 4YI3A 1JPJA 4AP9A 5ITZB 4GE0A 3WAGA 1VMKA 3OP1A 1N5IA 5EZ6B 5ELMA 4DVJA 1RZ3A 3A2LA 1TCBA 4ZEOA 1T1JA 4UTOA 3FFBA 5LZ8A 3TSCA 1QU3A 2IDZA 2A67A 2WP8J 3OMLA 2PK3A 1L3CA 2K2QB 4LC1A 4KIJA 3DMRA 2AQHA 4G0OA 5D3MA 1PP4A 2ZZMA 4M86A 3AUYA 4PICA 1CY2A 3AR2A 1V7PC 4DY6A 3R20A 1QUFA 1T1GA 2WJPA 3NM5A 2YXBA 4DSTA 1HYQA 1E3SA 4HJXA 1JI3A 2VNHA 2CMFA 3RRMA 1VI5A 2EWVA 3S28A 3WIOA 3PC8A 1CVLA 4EG6A 5KTOA 4ENQA 3BVPA 3DLTA 3NFYA 3OLXA 3I30X 4QFCA 2X0EA 1VJ5A 1FMJA 2GT1A 1SD1A 1L9XA 4DADA 3JTMA 3DEHA 1DKNA 3IBFA 3OY7A 2GNPA 3QPDA 4KO8A 5DTIA 4BAGA 2ECFA 4DCPA 1R64A 3DHVA 2C2GA 3HUEA 1SG6A 2XPCA 3MPOA 1B6SA 5EC8A 3RTAA 5C5IA 3MTJA 3C6MA 1KZ9A 4Z9BA 1R4AA 1J1IA 3H4TA 3FPEA 4J2HA 4F3KA 1ADFA 3WLNA 4TMWA 1RPZA 5HP4A 3AJ8A 1UBNA 1CB0A 1RM4A 2VPQA 4U8HA 5NULA 2RGUA 4KGVA 3PUVA 2AWNA 3ZXIA 1T43A 2B2CA 4Q4DA 1T2CA 3QUBA 4MB2A 1I36A 2CDBA 4PV7A 3GCXA 1JIXA 1NX9A 4IIFA 4M9CA 1YB7A 1QDLB 3GLGE 1NI5A 3BFPA 2P1ZA 4GOLD 3IDZA 4QGGA 3C97A 5HIIA 3MF4A 3I62A 1BFDA 421PA 3WNVA 4ENRA 4G5FA 2FE1A 1BU5A 1JU4A 2ZT8A 3PJEA 4Y6QA 3W2IA 3W5DA 1M5RA 2ZRAA 4Q4LA 3BM5A 3BAFA 2QRJA 4PGHA 4QEZA 2WWWA 3G0BA 3ANXA 4RTPA 3GFFA 4NU0A 4CUKA 2BKXA 2HIHA 4PZ0A 2Q3CA 1KI6B 3B7GA 4Y6RA 2REQB 1KYWA 1FUIA 1NT2A 2HMUA 3TOZA 3PGMA 4K28A 3E23A 1FLVA 4Q7LA 2OTCA 1XZDA 3DO5A 3BKWA 5ICEA 1HT1E 1UP4A 2BFOA 3BE8A 1H9AA 3OT4A 4UDOA 4FYXA 2OPBA 1L5MA 3V4LA 4CCAA 3FTPA 2AKYA 1UKBA 2B9VA 2B78A 4JASB 3OD5A 3N5CA 4TLLB 4QHTA 1UXHA 3VPXA 3TNFA 2FW0A 3CEMA 1DC5A 4YUWA 4FN4A 1N0IA 2H51A 5COQA 4ZPXA 2I54A 2JGDA 2P2DA 2D8AA 4FHEA 2OV6A 4RHTA 4MVJA 3ITDA 4RGVA 5K3OA 1OFVA 2BFAA 5IAJA