3X1YA

Ras-related protein rap1b(l9v) with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
b'MREYKLVVVGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1yA00
1G5RA 3H4MA 1OKKD 3BE4A 1NKTA 4XWKA 1XB2A 1W0JD 1I4TD 1P7CA 3TMKA 1JNYA 3QXCA 2R62A 1QHYA 1XD8A 4WIAA 1IM2A 2F1IA 1FUUA 1M34E 3C14C 1XZQA 4D0GA 3GJ4A 3BOSA 3OIVA 1EG7A 5CB8A 4C7OA 2KSQA 3QIAA 4YMTA 4IVQA 2UVQA 1RIFA 2UZ3A 4ZKDA 2FFHA 2CLSA 2ZSDA 5JECA 2Q0HA 1DAIA 2QE7A 3V9PA 3VAAA 3QVUA 4DSNA 2NQ2C 5F98A 4EQ6A 1NLZA 3DZDA 1Z07A 3K0CA 3LW7A 4KU4A 2REBA 2W58A 4QGGA 3QSYA 4YONB 1II9A 3K53A 4JLNA 3WRXC 1ZD1A 3L82B 4WOPA 3SQWA 3LBHA 1Z0JA 4CEJB 4NCJA 2CLCX 4C0BA 4DLWA 4RFVA 4HZUA 5L3SB 4UKDA 3S1AA 3FTQA 4TT3A 4RZ3A 3KJEA 4Q47A 4H9GA 3THYA 2BEJA 2P0EA 4B33A 1OV4A 3AVYA 5FTKA 4A2QA 3KJGA 5HZKA 5IDVA 1CXZA 1G17A 1P9RA 4BASA 2O8EB 5EE0A 1TX4B 1GRQA 2GHIA 4NCHA 3ZZ0A 3GLIB 2IA5A 5KPJA 4LSGA 2PCLA 2WIBA 4Q1AA 1G3RA 3B9QA 1PLJA 5BN3A 1TL7C 2VHQA 3PITA 3UG6A 2FPLA 2NMVA 1SVSA 2ZE6A 4HB2A 3KJHA 1IXRC 3FDIA 3GP8A 1ZNYA 4BFWA 2ZRBA 4P32A 1G8FA 2GXAA 1LW7A 1E94E 2GJ8A 1NY6A 1IXZA 2BMDA 2VYFA 1NBMD 2ZI6A 1UAAA 1LVGA 4FWIB 3A8TA 4Q7JB 2PX3A 2O8CB 4JSTA 1OLOA 2OFXA 1XMJA 4M22A 5JWHA 1G3MA 3ETLA 5GJBA 3D8BA 2KE5A 3EPJA 4EFNA 2FSIA 1S1CA 4EPTA 5FPSA 4PAQA 4BPBA 4I81A 1BIFA 2OCYC 3GJ0A 4LDJA 3CZPA 1QHNA 1R8SA 1CIPA 4XD7D 4PPFA 1KMQA 2OM2A 3CNNA 1US8B 2XGJA 4LYHA 1IY0A 5DLQC 4FWTA 1R8QA 3TSOA 3RWOA 4DLVA 4C9BA 3PIRA 4E5UA 2YVUA 2AK2A 1VDZA 4DUGA 3Q7QA 1SHZA 2F1HA 4HATA 5CITA 4OHWA 4I99A 1PUIA 3ZIAD 1DG1G 3PFIA 3VHXA 4C0KA 5JI3E 5M04A 5EZ5A 1D9ZA 1SXJB 1XZPA 3AKEA 4B3GA 4W5JA 3EPKA 4WBSA 4HAYA 3O8DA 3AVPA 3QENA 2IEZA 3ICEA 2FWRA 2WMNB 4UNNA 2GZAA 5F9FA 4US0R 5CLLA 5FOTA 3RSOA 5FL7A 3TUJC 1ELOA 4V03A 2AXNA 2IUTA 1X8LA 5KUTA 1G5TA 3ASYA 3QPVA 3CX7A 1NG1A 3B5JA 2Q3FA 2G83A 3VU9B 3E70C 4BFXA 2ZREA 2ZJOA 5DI3B 1U8ZA 2CNWA 1OIXA 1S3GA 1KDTA 4D26A 1OXUA 4MKHA 4LC0A 4P0TA 3WP1B 5JWRA 2OCPA 1NL3A 2WWXA 3CB4A 2GXUA 1F2UA 5AJYA 1BS1A 3FE2A 4CW7A 5G3YA 4I1VA 1O3YA 1KI4A 1WDTA 1ZUHA 4BFZA 4NTZA 1X86B 3VR2A 4DIDA 3I5XA 5K8IA 3NXSA 1VTKA 4EFLA 3H86A 1EX7A 3AP1A 3LXXA 1OB5A 1HURA 4KJZA 2ZRKA 1LS6A 4LJ5A 3SOPA 4JLJA 4PHTA 4FCWA 1YKSA 4QBGB 2WSSA 1OHHD 4L5BA 4TLDA 2FA9A 4E09A 4M1YA 4Q4HA 3QOFA 2A5YB 2R6DA 1LF5A 4JYBA 5FTMA 2QGZA 4LI0A 3EIHA 1DG3A 2EU8A 2WPDA 5JRJA 2BV3A 1VECA 2JEOA 3GQBA 1D5CA 2B21A 4PX9A 3O8CA 5DH9A 4PC3A 3FKSD 2J41A 5JI2E 1UDXA 3OIWA 1CTQA 3RRNA 3CM0A 5JS7A 3K0EA 1CJVC 3QXHA 4NCIA 2VPPA 4W9MC 4US2R 3GLIE 2B6HA 1NI3A 1E4YA 1QHHB 3B9PA 4JVMA 4TLCA 1Z3IX 1F60A 4GSYA 2PJRA 1B23P 3GJ3A 2G6BA 5CIQA 3NVAA 4N0EA 3WYFA 1I2DA 1KAOA 1WP9A 2QTVB 4MRPA 1ESMA 2ZR0A 2XZOA 5TB5A 4V02A 3K70B 1N0WA 3NH9A 3TAHA 2OHFA 4JL6A 1UKVY 3NKVA 5H1YA 4EPXA 3SFVA 4NYMR 2O8FB 4CT5A 5AUPB 5BN4A 1W1WA 5HE8A 3RS5A 4L8GA 3T1QA 2ZSEA 3QPWA 3CRMA 4D4MA 5J4YA 1RFLA 1R6BX 2H1LA 5D3MA 4M1SA 2CBZA 1VMAA 2RGCA 1DO0A 3C7KA 1CR4A 1HYQA 5JCZA 2VHCA 4TL7A 4GOJA 4NYJQ 4YMWA 4CZ2A 1FMLA 3KKPA 2ZANA 3FVQA 2DBYA 1E99A 4NCNA 4OQFA 4H1VA 4F93B 2PZEA 3Q5EA 2ZYUX 2WZQA 3EWAA 1KOFA 2FGJA 1KI2A 4M2LA 4IXMA 1KDOA 4AYTA 4OHYA 3VR3A 1XF9A 2IW3A 2FZ4A 1N6KA 3R9IA 4LBWA 1DADA 1YZGA 2ZUDA 4IOMA 2IBMA 2QL6A 2PMDA 2VF8A 4JLVA 1GRRA 2HJVA 1YVDA 5FH9A 2C98A 1SXJE 4YC7A 2MMGA 2VHTA 2W6IA 4N3NA 4KXFB 1G1MA 2J0UA 3HWSA 1RJ9A 1TUEA 1ZCAA 2O5VA 2XX3A 3HPRA 1IONA 5IRCD 3HR8A 1S1MA 3DMNA 1OXXK 2QT1A 4LJYA 3P1JA 1V5WA 1XFAA 4BLPA 1JBKA 4Q4AA 4M1WA 4BLOA 2ZRPA 3KXKA 4R98A 1X1SA 4PQFA 3D7MA 4RD4A 4MKGA 3QF4A 3SDZA 1ZCBA 3H84A 1GKIA 2ODEA 4QGFA 2GF9A 4PSAA 2R65A 2X8AA 4TTRA 1XJCA 1Z6YA 2GAOA 4HZIA 4KBFA 1UPTA 3I8SA 1E9EA 1CLUA 2JJ1D 2CHVA 1KO4A 1S96A 3NHBA 3PEVA 1E1QD 4PANA 5TXGA 1XX6A 1QVAA 3C5CA 4YMVA 4NKRA 3V4FA 3G5UA 1QZXA 2YHSA 4RZ2A 4D6PA 1KKLA 4D4KA 5L3RA 1VIAA 3GJ7A 1D2NA 3KZ1E 2OUKA 1G7TA 4TLAA 4TMKA 3I72A 3RLFA 1JEDA 2CDNA 1RRCA 121PA 5JSZA 4B71A 4P33A 2ANBA 5L3QA 1XMVA 4MRSA 2DFNA 5SZIA 1KY2A 1C1YA 4MQBA 3JZAA 1OH7A 5JCPA 3OZXA 4HLUA 4IFBA 1BYIA 3AGPA 1E2NA 1T3HA 2C8VA 2QA5A 1N5LA 2ZE8A 3T1TA 5J4LA 3KQUA 2IYSA 2VIIA 1VCOA 5LDDC 4W5HA 3AKDA 4S35A 2I4IA 2IHYA 4AYWA 2Q3HA 2TMKA 3PUYA 2Z6VA 3T5GA 3L8ZA 5E4FA 1E9BA 1NG9A 2NPFA 5BXQC 3FMIA 2O8DA 1ODFA 4B2IA 2ZVPX 4HB4A 4XSHA 1N6PA 2GZHA 4ZKEA 2IS2A 2VA8A 2FPMA 3E5HA 4KHZA 2V9PA 3L0OA 3GEEA 3BFVA 1E3MA 3MLEA 1CULC 4D25A 3DVLA 5HE9A 1CJMA 3KB1A 3OE7D 4ASUA 4IVPA 3KB2A 2GWHA 3QXJA 1ZUIA 1NP6A 1KO7A 2H8KA 1R0ZA 1G18A 1N5IA 1HE8B 1OF1A 4X8OA 5KDDA 1ZC4A 4QL3A 4RZUA 5FUWA 3CWZA 1F3OA 1FX0A 3A1UA 3LY5A 4EKDA 1XP8A 1GVNB 1KYIA 2D4HA 4BRUA 5AUOB 1PV4A 1OH5A 3TW8B 1FOEB 1T9HA 1XXHB 1C4OA 1E9FA 3EZFA 2VSFA 2F43B 4LBYA 3BORA 1AZSC 2WKPA 4GZMA 3R7WB 1GM5A 4I1SA 2PLRA 3B1ZA 1FW6A 1YQTA 2J0VA 3UPUA 1JI0A 1N2CE 1P4SA 3A36A 3CR8A 2J0QA 2W6JA 4CVNA 2PJZA 3GFOA 3C41J 2QE7D 1DAMA 1DBSA 1F48A 1WCV1 2D06A 1S2MA 2GJSA 4NH0A 2C9CA 2JLQA 3QKRB 5DHAA 3U3MA 1RRFA 4XSGA 1KNXA 4IFEA 4JMPA 3BK7A 4PAOA 5KU1A 1G41A 1V43A 5FL3A 4PZLA 2YINC 3SJAA 4V0ME 1YR8A 4DJTA 1G3IA 4QHYA 5CB6A 4TT3D 3K09C 1E2FA 3EWSA 3U4QB 1E1RD 2BHRA 4PTLA 3TQCA 4LJ7A 4N1AA 1RYHA 3OEHD 2B92A 3ND8A 4HLQB 1FMJA 3G82C 3HU2A 5GADl 2GCNA 2GDJA 3VTKA 5LD2B 1YR9A 2RMKA 4KFUA 1KI1A 5EJEA 3IEVA 3EA5A 3AKYA 1N6IA 1NMYA 4NBSA 4UXJA 2WAXA 3T5DA 5CDFE 4Q00A 4XOIA 3P4XA 4B2LA 2J0SA 2DY1A 3IPYA 1CR1A 4QBIA 2GF0A 4L9SA 1A7JA 2W2XA 1GDDA 4F4CA 4NPHA 2VLIA 1Z29A 2ZJ5A 3IUYA 2ZS7A 3KX2A 5CK4A 2IYUA 1TF5A 1OIVA 5FUYA 1HUQA 3AQ4A 2ZRDA 4YDHB 4DT1B 3I62A 2OT3B 4BLSA 4Q48A 4HAWA 2BMJA 1S9HA 3N2IA 4FMDF 4G5RA 3MJHA 4URXR 4EPYA 1KK1A 2BM1A 1HQCA 2J5XA 1DEKA 1OFIA 1FL9A 2ZAMA 2XB2A 2P5TB 3UMSA 4M9SA 3IBYA 1JXMA 2MMCA 3T1VA 1JR3A 1XTJA 4JJKA 4C0HA 3RAPR 3U61B 1JB1A 1XMIA 1AKYA 3DKPA 2QQEA 3KFXA 1YU9A 4QRHA 2GXQA 2IYLD 5KDLA 2P67A 4DVGA 3U6KA 1E2LA 4JLAA 4DUGD 1T8UA 1IY1A 3NH6A 1FNNA 4C0QC 1AS2A 5ANRB 1VG8A 1ZYUA 1W4BA 4A82A 2QORA 3PQCA 2QPOA 2REXB 3IPXA 4M9ZA 1XD9A 4B76A 3PCRB 4O2RA 2VP6A 2JATA 3BFXA 3DM5A 4Q19A 4Q4JA 5A4JA 1R7RA 1ZM4A 2YWFA 1KSFX 5FR1A 1E2PA 1N6NA 4Q5IA 2CCJA 2Q9CA 3BIFA 3SBDA 4TYWA 5FL7D 4Z51A 1NVVQ 1OFUX 3SYLA 2VO1A 1E9AA 5FBQB 2O8BB 3U2QA 3IQWA 4Q9HA 3QKSB 4MYHA 2VQSA 3OFND 5C46F 3AUXA 4RD6A 3IGFA 1CJUC 4DDVA 1XXHE 2KI5A 1MT0A 2NO6A 2QI9C 2V4ZA 3LH5A 4U00A 3RYTC 2JLYA 2ZXUA 2RKOA 521PA 1JQLB 1CR0A 4TZ6A 2PEYA 3KTAB 3ZVMA 4TMWA 4KLNA 2WJGA 3FPAA 4C30A 4IXNA 2QTFA 2ZJYA 3LX5A 2W2VA 3EPLA 1U81A 1KZ7B 2ZI9A 2GJ9A 2GEDA 4TQUS 1G291 2HCBA 4WXRA 1T91A 1DAFA 2EQBA 2N1BA 3K9NA 3K09A 4HB3A 3PUVA 2IL1A 3BS4A 2GCOA 4WAUA 2QM8A 1LS1A 2WSSD 5SZKB 4M21A 3QEOA 1FPMA 5AUQA 4OI4A 5FFMA 4B44A 4IDNA 2RAPA 1E6CA 1KZGB 2IYWA 2V8OA 2WPDD 5EE5B 1OXVA 1F2TA 1VCIA 4TQ9A 1KSGA 3SJCA 3QE0A 3N5CA 4PQYA 1HE1C 2YNMA 1AZTA 2JJ1A 2Q6TA 2OBLA 1SVKA 3DMDA 1I2MA 4LBVA 2CJWB 2Z0MA 1TEXA 2Q9AA 4Z8YA 2QBYB 4G0NA 2CJWA 1Z83A 4H1UA 4CEHA 1XD2A 1AA9A 1VHTA 4PO8A 2DYKA 1AS3A 5JWOA 1UDWA 2GXSA 2VTKA 1WXQA 3MAAC 4AC9A 1KKMA 5EP3A 2FOLA 5KNDA 2FN4A 1QRAA 4FMCB 3UIEA 2VSOA 3AF3A 3IIMA 2IYXA 2B8TA 4ACBA 1Z22A 3KJIA 2AFIE 2W2TA 3QI2A 3THXA 1DAGA 1ZM9A 3VHLB 3VKGA 1ZIPA 1I4LD 4ITRC 4OQNA 5TV2A 4RSGA 2GVZC 4PPNA 1YR6A 5CM9C 2RGBA 3CO5A 4ARZB 3QNUA 4PHHA 1MABA 4HUTA 5DIFA 4DLZA 1W2GA 1LV7A 5AWFC 1N5KA 2C9OA 4RCYA 5JRZA 1E32A 1NSTA 3C4JA 4EDHA 5JHGB 3QBVA 4Q21A 2BOVA 2KWIA 2QU8A 1A1VA 1UBEA 4MUBA 1EFUA 4Q1BA 1Z0DA 2E1RA 1VYTA 4HLDA 2R6CA 4G1UC 1R5BA 5KTYA 1P60A 2ZI4A 2D74A 2ORVA 1ZUNB 4BE7B 1RRPA 5FUVA 2GESA 4CF7A 3J81k 3K0SA 1XTRA 2QN6A 2WTUA 3V4RA 1RYFA 1MOZA 2V1XA 2N46A 1VPLA 3I61A 3BB3A 2WWHA 3Q9LA 1XWIA 2MSEB 4Q9LA 4HLCA 4A1FA 3U7GA 4OJKA 2AWNA 4MDEA 4DB2A 2W6ID 3LFUA 1J2JA 1BH2A 1SXJC 4QG7A 2HYDA 3LVRE 4HB0A 2Z4SA 3GJXC 1P73A 1UF9A 1W49A 2IX3A 2J46A 4Z1MA 4KFTA 2ODBA 2FJUA 2Z4RA 4IOJA 3SI7A 4DDUA 2YZ2A 1JPJA 4DWJA 4PZYA 4FXPA 4TLBA 2OO7A 4NCKA 5C4MA 1CJTC 1K8RA 2DR3A 2D2EA 5FTLA 2FSGA 3VR1A 4RFSB 3CF2A 4D82A 3E1SA 1ZU4A 1ZNXA 1ZM2A 3F8TA 4KFRA 5JLJA 1ZMXA 5G40A 3MMPA 3T06B 1QG2A 4JKYA 1E0JA 3QXXA 3CNOA 1L8QA 4B3BA 3RS0A 1QBKC 2EYUA 2PLFA 2AKAB 4OJQA 1OYYA 1CF4A 2JCSA 4TSFA 3QUSA 1NNEA 2J59A 2XTNA 5FOSA 4Q1DA 4CEJA 2H5EA 2C9YA 3OIYA 2RGDA 2XOKD 1AQUA 2QGNA 3H2YA 3CF0A 4GZLA 4O0MA 5L3SA 2W0SA 2FX3A 3AB3A 4PQRA 3KXLA 1VCMA 2OCBA 4TTPA 4M1OA 3ZD6A 3KFVA 1E1RA 3L43A 2RH5A 1DPFA 2EFCB 1XTKA 5J4KA 3OEHA 3W3AA 4MGIR 2VL7A 4NZYA 4A92A 2O8EA 1E0SA 2VP4A 2QP3A 4TL9A 4B3DA 3GLIA 4I1OA 1P2SA 1G4UR 1W5SA 5EXXA 4Q1FA 2IS4A 2DFTA 3Q72A 4PZZA 4JT2A 2WWIA 4QC2A 2MSCB 2NO0A 1ZBDA 3GLGB 5EZ6B 5BYJA 4QNRA 3AGQA 1M1YE 3AVQA 4M1MA 4F4IA 2HT1A 3U60B 4XJXA 5C4GB 2ZRAA 4ASUD 1E98A 1FTSA 3RRYA 1II8B 4AWXA 3B8HA 4MRVA 2ODWA 3K70C 2J3EA 1G7RA 2QUZA 5B2ZA 2X1VA 1G16A 3ZVRA 1JQJC 2O8CA 1DOAA 4LBZA 4IW3B 3UWOA 3BB4A 1IN5A 1NVXQ 4PSKA 2C96A 2ZIAA 2E9SA 2XITA 1XJQA 1D9XA 4M53A 4TQAA 1LY1A 4Q7LA 421PA 3CR7A 3PEWA 3WXMA 2X19A 3FKQA 4D81A 3SYKA 1US8A 1Z47A 3DOEA 4E07A 1K5GA 2OXCA 4V0NA 1NVVR 2AFHE 4EUNA 3LX8A 3HDTA 3W8NA 1J7KA 1S9DA 2CL6X 4AY2A 4NE2A 1QHXA 4KCGA 1O87A 1WF3A 3BJIC 5DISB 4EJSC 1NMXA 1OT3A 2C77A 2W6JD 4OHVA 1LTQA 1MRNA 2QP4A 4BFSA 1Z0AA 2Q21A 3AVUA 1IN6A 1EFHA 1SXJA 2R6FA 5TY0A 2AD5A 4P3YA 4BUJA 3ONWA 3ADCA 2BJVA 4LPSA 1PLKA 3C5HA 3NC1C 1L4YA 2ZYWX 4MGKR 1Z6AA 2CLDX 4A6XA 2JLWA 3SS8A 1TEVA 1Z6XA 4KYUA 5AJVB 2BWJA 5CK5A 1SHKA 2HV8A 3OFNA 3SU8A 3BERA 5H68A 2ECKA 2BC9A 4Q7KA 3VU9A 2P5SA 2ZETA 4UNQA 3B6EA 2G0NA 5DI3A 2G1JA 3L2OB 4DRZA 4O25A 3LLUA 4JLPA 1ZIOA 3PUZA 4IHQA 4IDQA 4QOSA 5HCIA 4URWR 5B57C 2QY9A 2GJAA 4HUQB 5FBWB 3K8YA 3DL0A 1GTVA 5BN5A 4KBGA 1OXTA 2F9MA 4GP6A 2WJJA 1QHSA 4ZDIA 1BMFA 3RS2A 1K6MA 3NDPA 1NN1A 4X8LA 3UK6A 1E2QA 1FP7A 3WMFA 2V1UA 2OEPA 1JJVA 4B43A 3KKOA 4LHXA 2JGNA 4X8MA 2A78A 4A8JB 1TF2A 1H8HA 4LJAA 1KO5A 1SVIA 2WOOA 2F7SA 4JLOA 1QVRA 1FP6A 3OEEA 4PHGA 5H70A 4WXPA 3B2EA 1HT2E 4PSVA 4V0LA 2WJIA 4URYR 1B0UA 4PPGA 4GL2A 1U0HC 1GFIA 4BECA 3VKHA 1E9DA 2GETA 3U3OA 1ZC3A 1GITA 1JR3D 1QHHA 4MYCA 5IF9A 4DLYA 1MR3F 4A6PA 1KK3A 3NBZC 3PUWA 1IOZA 2FE4A 2A30A 1XBTA 5KSZA 1XPOA 3GLGE 3T15A 4LYFA 4XH9B 5BW8A 4FD2A 2FDCA 3W6PA 1YZTA 3W3ZB 1HQYE 5FOUA 2VBCA 2O8FA 3M6AA 4RD1A 4FCVA 2CHQA 4B74A 4BZQA 1G3QA 4C2TA 5TDHA 4B48A 4TLEA 1U0JA 4KV9A 2CXXA 4R2IA 2VP5A 2ZRMA 4NP6A 1XMSA 2NPIA 3ZD7A 1PVOA 3U3RA 3ZQ6A 4BEJA 1TQ6A 4B34A 1KJZA 1XPUA 1E2IA 2CCGA 3ZVNA 1MH1A 4B32A 3FWYA 3TNFA 3CRRA 2WICA 1U94A 3QKUA 4GPTA 4EJSB 5FUXA 2NG1A 1XCMA 5GJVC 4BRWA 5J47A 1M6NA 3RVBA 4CIDA 3W6NA 1E9CA 4ZDJA 3ICQB 2AKYA 1KO1A 2AHOA 3EC2A 4B75A 3F5FA 1W46A 3I32A 4Q1CA 2C5LA 4JJZA 2BBWA 4TYQA 1W36C 2IHBA 3PEYA 3BRWD 5CIWA 5DI9A 1G20E 3NG1A 2FV8A 2QRNA 5EE1A 2FFQA 3DKVA 4DCTA 3P26A 4G5SA 3WYGA 2KBFA 4P4SB 1W2HA 1WA5A 4DCSA 2VF7A 4JSYA 4UXIA 3LWNA 1G3UA 1KI9A 4PHFA 4V0MA 1NY5A 2BBTA 3FMFA 1LNZA 1TQ2A 4JBYA 4TMXA 3SHFA 3IIJA 4ILEA 4QGAA 4LJ9A 1XEFA 2D7CA 1KDPA 1U98A 3U7FB 1GG2A 2GVDC 5KSPA 2NO7A 1E4VA 5DN6A 4DB4A 3TK1A 3N70A 1FNMA 1ETUA 1H8EA 3GMTA 2IXGA 1HEIA 1R2QA 1P5ZB 3QKTA 3ZS9A 3WNDA 2QPTA 3CH4B 4QNMA 2ZEJA 2ZJ8A 4K8OA 4PPQA 4RY2A 2Y8EA 4QGHA 2CVHA 1N5JA 2Q9BA 5CDFA 3SC3A 2EYQA 5FI0B 1GNPA 1ZP6A 2EVWX 3EZ9A 3LD9A 1ZM3A 2OAP1 2IT1A 2HUPA 5LD2C 1KIMA 4D80A 5GVSA 3DM9B 4P31A 2XOKA 4IEEA 1XJ0A 2QRZA 2QSYA 3BWDD 2WSMA 1EGAA 1IN7A 4G5QA 2GKSA 3WHLA 3IO5A 3Q85A 1A82A 3IO3A 3NHAA 1VCNA 5FTJA 4JL5A 1IN4A 4NONA 4L9WA 3AVOA 1R4AA 1M74A 1E79A 1F6BA 1YHNA 4GOKA 4B3XA 2ZQ5A 3AV0B 2NGRA 2YYZA 4DSTA 1MV5A 4XIGS 2G3YA 5DHFA 2PMKA 1FFHA 2CE7A 3M4YA 2AWOA 1KDRA 4MKIA 3P20A 2HF8A 1OPXA 3GLHE 4FMCF 4OK3A 4XVQA 3A1SA 3KUDA 1SVLA 4YXWD 1R5NA 4G3XA 1TQDA 2WWWA 3QF7A 1G8GA 1K5DA 4Q4LA 2VSXA 2PBRA 1WQ1R 3ADDA 1GOTA 1G8HA 3GJ6A 3K0AB 1Q1EA 3FGNA 3KQHA 4RKFA 4IVRA 4YMUA 4EPRA 2QG6A 2ORIA 3TQFA 5KYKA 1W4AA 2RHDA 4B73A 3IQXA 3P27A 4JYCA 3HP1A 4TYPA 2A5DA 5AJWA 1OH6A 2H92A 1T0JB 4Z1MD 1E69A 1XXHA 4LV6A 2C78A 2F43A 2N42A 1QDEA 1W36B 3B1VA 4ZV4A 4TN1A 3THWB 2A5JA 1XDBA 2EFHB 4DXAA 3BB1A 3R7WA 3ZLJA 1NN0A 3LV8A 5CLQA 3UXMA 3TAUA 2G1KA 4J0QA 4JS0A 4ZDKA 2FNAA 1TADA 1YZNA 3CWQA 1OYWA 2FGKA 2YWHA 2HXYA 5SZJA 4RD2A 5KOYA 3R9WA 2VP0A 3SQXA 3T1OA 1OJLA 4BEBA 4M9QA 4TSFD 4DC9A 1N0UA 2BIFA 3B13B 3SEAA 1P72A 1E2DA 5KO2A 5FR2A 2H7VA 3QKRA 5AJZA 3W90A 3W5JA 3LRPA 1KI3A 2QMUA 1W4CA 2ASEA 3EAQA 1NN3A 3WMEA 3SJZA 3KL4A 5CM8B 5EXPA 1DELA 5GJWC 4DEXA 3L0IB 5HTKA 3FHOA 1UJ2A 1PUJA 2J87A 4UJ5A 3F0TA 2QENA 3AEZA 3D31A 1E96A 2DB3A 3U4QA 3LBNA 4CGZA 3CNLA 1AKEA 4A0HA 3FFBA 1XU4A 1VYUA 5C1BA 1ZRHA 4NDZA 2EFGA 1X6VA 2ZI3A 2AR7A 1ZD8A 4HAUA 4II7A 2GCPA 1XEXB 2R6AA 3LAWA 4UJ3A 3AH8A 2P6RA 3CRW1 2BCJQ 3GJ5A 4D4JA 5DSZA 1T0HB 1AS0A 2YC2C 3A58B 5G41A 4PXAA 4KI0A 1A4RA 4C0AC 3IBGA 4DHEA 2LCFA 1GSIA 3UKDA 3TIFA 4TTQA 5E3HA 1NVUQ 4WZAE 3GLFB 4LX0A 1RE0A 1NF3A 3AVVA 2OBMA 1Y3AA 3U44B 4C0JA 1EK0A 1E2EA 1L4UA 3SJBA 2I1VB 3RS4A 3U5ZB 2JA1A 1FQJA 4DT1A 4KSCA 1JPNA 2R6GA 3HU3A 1KI6B 1GILA 2X77A 4LCBA 2HEIA 1S0UA 1VG0B 4HEJA 2REOA 1Z0KA 5HPYB 1T5LA 2R9VA 1SZPA 3MCAA 1G7SA 2YV5A 3MSXA 4OHXA 3VFDA 4A9AA 1TF7A 2EW1A 3QY0A 5H8WA 4Q1EA 3CPJB 3PV0A 2D7DA 5JZVA 4LOAA 3EW9A 1Q57A 5K8TA 4NYJR 4LJ8A 4POAA 2PL3A 4DZZA 1Q12A 5CYPA 1PJRA 3T34A 3SNHA 3QXSA 1N0VC 3TGPA 1RRGA 1W7AA 4CEIB 3FB4A 5L3VA 1E0KA 2AXPA 4IDPA 1X8JA 1Z8FA 5EXSA 1R5OA 1SXJD 4TYYA 3K0FB 3MG9A 4S2EA 2DWQA 5KPDA 3PEUA 1HH4A 2IYRA 2ZVQX 5G53C 4Z54A 2OILA 3DPUA 3UMFA 1IN8A 4F4JA 2V55B 2F55A 2KJQA 1OSNA 1N3BA 4L16A 5JEEA 2O8BA 2R8RA 2QPAA 2OESA 3TE6A 3QKSA 1X8KA 4MKFA 5EE9A 4JIMA 5C2JB 1DTSA 4BWYA 5F9HA 2D3WA 2P3SA 3M1IA 1NBME 3CRQA 1XEWY 4JLBA 1QF9A 5FI1B 5DO9A 5JEDA 4A36A 4I4LA 4F91B 1D2MA 1JALA 2ZE5A 3KTAA 1II0A 4DSUA 2ZR7A 1QG4A 3CX6A 2WKQA 5BWMA 1T8TA 4QJ4A 2QAGC 4HYYA 2NO1A 3A1VA 1UKYA 5FBLB 1BMFD 2ZROA 3SBEA 1W47A 3ZZUA 1Z28A 5E7JA 2AL7A 5J4VA 5FOXA 2PEZA 4C2UA 2JJ2A 5SZHB 2GNOA 3TJZA 5F2EA 3TBKA 3TKLA 4FI3C 3LVQE 4URVR 3PENA 2XXAB 4KYIB 4TL6A 1H8HD 3CRVA 4AKEA 1VIYA 5FBRB 3GPLA 1U9IC 2RGGA 1SQ5A 2ERXA 1KGDA 621PA 2ZYTX 3AF1A 1HT1E 3OEED 5AJXA 2YKGA 5DYGA 1OE0A 4DLRA 2V7QD 2ZS9A 1IBRA 2QAJA 4PFSA 3G0HA 1N6HA 2ZJZA 4NMMA 2GILA 4OQLA 3EPHA 1N25A 1DAHA 3EASA 3K0CC 4LYJA 1JAHA 2QTHA 1GIAA 1UKEA 4ZI3A 1VKJA 1NIJA 4BFTA 5EP1A 2WOJA 4QJ3A 4Q03A 2QBYA 3Q5DA 4XVRA 1IQPA 3SYNA 1JXOA 2WVJA 3A6PC 5B30A 5LB2A 3SR0A 2IXEA 6Q21A 1JAIA 2V3CC 5E95A 3K70D 1OW3B 4MITA 1U99A 1YRBA 3DZ8A 721PA 2QMHA 3EZ6A 4Y0AA 3GLFE 1NJFA 3P32A 2IYYA 1BYUA 1GKUB 2D2FA 3C8UA 4EFMA 4PAMA 5JBQA 3KXIA 1KMHB 3DO6A 4YMSA 3VR4A 3DOFA 3B60A 3BGWA 3GJ8A 4BGDA 3LW8A 2JDID 5EUQB 4JLKA 2A3RA 2VP9A 1NRJB 4ARZA 1NLFA 3U3JA 2ZTSA 4V0OA 3IDQA 1COWA 3N2EA 3NBFA 3U7EB 2V54A 2WWGA 3MUFA 4DSOA 3KUCA 4BFVA 3O8RA 4HI0E 3Q3JB 3NEYA 1TTTA 2IUSA 3DDCA 4XVUA 2HLDD 4YXWA 2HXSA 2DHRA 1ZAKA 3FMPB 1EWRA 3OESA 2QP9X 3PVSA 1P2VA 3QVVA 5UKDA 3TW4A 3B1XA 2J7PD 3MWJA 1XRJA 1RVDA 4UNSA 4XWAA 4NYMQ 1GNQA 1EWQA 1Z2CA 4CRWB 1LFDB 1J70A 3CPHA 1W48A 4F38A 3RRMA 3TUIC 2BKEA 3QPUA 3FHCB 4TYNA 4CYMA 1BOFA 3OF5A 1CU1A 5AK0A 3U3KA 1RW4A 3R9XA 2OV2A 4QKQA 4M4SA 2XSZA 2BDTA 4N0DA 5DN6D 1TUIA 2OE2A 2QAGB 3AUYA 4AIIA 3ADKA 1YRAA 2PT5A 4RFSA 1H8ED 3VNVA 1MO4A 8OHMA 1OFHA 1X3SA 4OK6A 4ZCMA 1GKYA 1P61B 1P9WA 3BBPA 2IUUA 4BQSA 5JFGA 1KSHA 1Z6GA 2OFWA 1GWNA 3CX8A 1AK2A 2L0XA 1YZKA 4IDOA 4WZ6A 4C7OB 1AGRA 2P6UA 1U9IA 1EX6A 3ZVLA 3MJRA 3EA0A 4ZO4A 3AF2A 2FZLA 5HZHA 3KKMA 3EZ2A 3ND9A 1UBGA 2G77B 2ZM5A 1JECA 4X8HA 3H0KA 2ATVA 1KJWA 2CHGA 3R20A 4I1UA 2OLJA 1S3SA 4EQ6B 4A8JC 2A2ZA 4M8NE 3FOZA 1CJKC 4PC2A 2JLUA 4XTCS 3Q7PA 4B3CA 3UG7A 4PC7A 3CH5A 3WP0A 1WRBA 2XNDA 5IK2D 1E79D 2VRWA 1XCGB 4MH0R 4U02A 3SE0A 2WIAA 4HZUB 1JEEA 4LHVA 3S1AB 3E2IA 1VHLA 3BXZA 3WNCA 3MWKA 1W0KA 3TVTA 1G64A 2GTPA 2W00A 3BC1A 4WZBE 3THYB 4D4LA 4R7ZA 3SZRA 2CCKA 3REFA 4ZCLA 1AN0A 1Q1ZA 1LB1B 3GLGA 2EWVA 2JAQA 4FMDB 2NZJA 3ZYCA 2QROA 3AVTA 3R8CA 3AF4A 2LKDA 4R71A 1II8A 4G5GA 3REGA 1N6OA 2GEUA 4A0FA 3OHMA 1CR2A 1KI8A 3FMOB 1DAEA 4DIEA 3KQNA 2FFBA 5E7IA 2WBLC 3X1WA 5B58C 3LDAA 4B6FA 2ZSFA 3KKNA 1ZJ6A 4EIWA 5HR5A 1RKBA 3K9GA 2JLRA 3NBXX 5J40A 1AJEA 4QBHA 1U8AA 1EFTA 3WBKA 1CP2A 3X1ZA 1W36D 1CBUA 4NHOA 2F3TA 4IJMA 2BMEA 2IWRA 1DVRA 3RC3A 2OSBA 3NWJA 4GRAA 3BAFA 4BFUA 2WJYA 4LV5B 3K9HA 2ZS8A 3IKJA 4IEIA 4Q7MB 3I1FA 3UWKA 1E2KA 1Z6TA 3WMGA 1E9SA 2WM9B 3B82A 3ECCA 5KSOA 1ANKA 5DNYB 5TARA 3X1DA 1D2EA 1KAGA 1NSFA 5AUNB 3AM1A 2CK3A 2P65A 2Z83A 1G6HA 1XPRA 2FSFA 4DLSA 4QHTA 3TVDA 4AKGA 4RD3A 4CEHB 1KO8A 5FBVB 4JVLA 1L7VC 5EP2A 4ZDWA 1GRNA 2ZI7A 3C16C 3RDPA 2QNRA 2OAQ1 3A4MA 3L0PA 1ZM7A 1GP2A 2G88A 4BZXA 1ZNWA 2F3RA 4QHSA 5GJCA 4YLGA 1GNRA 1OFTA 5HKKA 2FEOA 2FMXA 1FUKA 4HUQA 2JIZD 4A0GA 2WMOB 1HV8A 2NOAA 1SKQA 3GD7A 3CF6R 5JJLA 3MRSA 1A2KC 3NEJA 5BQ5A 2ODNA 4LWZA 5FPHA 1EFRA 2HF9A 1WBDA 2UZIR 4RJLA 3IHLA 1N6LA 4ERNA 1E0AA 3V00A 4KLZA 4RCZA 1A5TA 1Y63A 2AX4A 2I1QA 4A8JA 1DARA 3QJYA 4F92B 1F2UB 5GVRA 1Q3HA 2DWOA 1UBFA 1P2UA 4HDQB 1U8YA 2DWPA 2ZJBA 2FFAA 2HCJB 4URUR 4P4TA 1Z06A 1GAJA 2V7QA 2CL7X 4HDCA 2NIPA 3JVVA 2P6NA 5FOWA 4XTRA 4L4UA 1W44A 4Q9IA 3QBTA 1ONBA 2RB4A 1ZNZA 1Z0IA 3DEFA 1UKZA 4Q4HB 4AK9A 1WBBA 3HJNA 3B1YA 3GLHB 2YWGA 4OBEA 4DBLC 3CONA 3GLHA 1KK2A 1M2OB 2JLSA 4W5WA 3KKQA 1SGWA 4A2PA 2GBLC 3SN6A 4O3MA 2K5UA 2GAAA 2IS1A 2ZAOA 4US1R 1G5PA 2CL0X 2IYTA 5EXTA 2NTYC 4JBXA 4HLUC 5EP4A 5FOVA 1BO6A 3UANA 2R2AA 2XJ9A 2JDIA 3I92A 5CYOA 1Z5ZA 1M8PA 2RGAA 3EIQA 4LV8B 5FPTA 3SHWA 2VHJA 1G19A 4LUCA 4Q9JA 5JMTA 2XZLA 2O0HA 5EUMA 4DEYA 3PXGA 1H65A 2CMKA 2IC5A 1TU4A 4YDSA 5TVKA 2PCJA 2AK3A 4OI1A 2QEQA 3BH0A 2ZU0C 4FN5A 4KVAA 2OCAA 4EJSA 4JBWA 4B35A 2XNSA 3MWYW 3AP3A 5J5CA 2D62A 4IOKA 1S8FA 2HLDA 1P75A 2X2FA 2YJTD 2ZRCA 5D3MB 4AYXA 2ZI5A 3L0SA 4G01B 1DAKA 1ZU5A 2ZUBA 4PC6A 2DPXA 3HU1A 4QM7A 221PA 2F9LA 4LRWA 1R10A 3D3QA 2IEYA 4K81B 4ZCIA 3NDBB 1JR6A 4AKIA 2J45A 2IYVA 2J7PA 3PJRA 1ZW6A 1YE8A 2NZ8A 5LPNA 4D0NA 1E9RA 2XEXA 3W5IA 2EFDB 1DE0A 3W34A 1IHUA 2JJ2D 4P4SA 2FH5B 3MGCA 4FINA 3UATA 3R8FA 3ZQJA 2OFOA 1S4QA 1AIPA 4D0LB 4G5OA 1YZUA 2WKRA 2F1JA 1UFQA 5EQTA 3CKLA 5G3ZA 3GFTA 2CEAA 2OBNA 2BJWA 2C95A 3EZ7A 4GNKA 4KSBA 2WJHA 3QQ5A 1BKDR 4IDHA 1A2BA 2FSHA 2WAYA 1OKKA 2J0UB 1NIPA 4HAVA 1RJ9B 2H17A 5LBIA 1IXSB 2ZR9A 4ACAA 1W0JA 3VNUA 2DFKB 3OIUA 3RS3A 3NIBA 4GP7A 2ZRFA 3H1TA 3LXRA 1AGPA 1FQKA 2GA8A 4MGYR 4Q4AB 5HCNA 3VMFA 2LWIA 4XWOA 1EESA 1PLLA 2YOFA 3QF4B 3K1JA 4KODA 5JJIA 1GZSA 3LLMA 5BYKA 4JL8A 4JVSB 3WHKA 2VHUA 2R44A 4BFYA 4GFDA 4M1KA 2ZE7A 5P21A 2PT7A 1FZQA 3X1YA 4NYIQ 4ESVA 2RCNA 1W5TA 1XTIA 821PA 2JLZA 4K46A 1XNJA 3VQTA 1RPZA 2RGNC 1ZD9A 2H18A 1Z08A 5IK2A 3QG5A 2OG2A 2IF2A 2CE2X 1VYVA 1GL9B 4ZPXA 4LJ6A 4AD8A 2C04A 3LBIA 2ONJA 1XCPA 1COWD 2XTMA 3T61A 4AKHA 5FPKA 5JSZB 4CT4B 2Q3MA 1WE2A 3LNCA 4OI2A 2B8WA 4TMZA 5L3QB 4DLXA 2GBLA 3NTUA 1Q0UA 2QQ0A 2WV9A 4JKIA 3LO5A 2F6RA 3HYTA 4L15A 3TUZC 3ADBA 2HJGA 1Q3TA 1UBCA 3VKWA 4DLTA 2OLKA 2V6JA 1UADA 1Q1QA 3M0EA 4Q01A 1MO5A 2ZJ2A 2O0JA 2XB4A 4DKXA 3ASZA 3WBJA 3K0AA 2BKUA 2IF0A 4KITB 4B3FX 2W83A 2ZRNA 1OXSC 3NBYC 3I3SR 4DCUA 4KO8A 2O8DB 2ZITA 1KJYA 2ATXA 3TH5A 2P2LA 2XJ4A 1GUAA 3JVUA 1G8PA 5E7MA 2JLXA 1NMZA 1GL7A 2VP2A 1T5IA 3KQLA 4BLRA 4C3ZA 2PX0A 3U7HB 1X1RA 1KY3A 1W4RA 3OAAD 4ESHA 4M0LA 2O52A 2GJKA 3U6BA 1NBMA 1OB2A 2A9KA 1KK0A 1Q44A 2LKCA 2XSZD 4MYUA 2C99A 3THWA 4B6EA 3D6TB 4PC1A 5J4HA 2QT0A 5JHHB 4A0RA 3CW2A 1FX0B 1DO2A 3GFPA 1TPZA 3X2SA 4UNRA 1JJ7A 1NKSA 3C15C 2A5FA 3CPEA 1Z63A 1MO6A 4D2IA 4A2WA 2X2EA 4XD7A 4UNPA 3IIKA 2VEDA 1NJGA 1J99A 4Z8XA 5K8LA 2C2HA 5TMPA 1OIWA 1P6XA 1VG9B 2B7CA 2JJ8A 3RHFA 1T3LA 3A1TA 5KNCA 1HA3A 3AP2A 2ZSBA 2ERYA 4TMVA 3Q8XB 4U7DA 2BMFA 1M7BA 3B1WA 3ZIAA 3EX7C 4ZI2A 1WMSA 4NL4H 4F7WA 4WW0A 1WB9A 2ANCA 3ZDQA 3F3YA 3IHWA 3QEJA 1M7HA 1YZLA 4OYHA 3LQQA 2QZ4A 2XNDD 2HYIC 2FPKA 4TZ0A 3A4LA 1J8YF 1NVWQ 3TR0A 5KSYA 2JIZA 3WYAA 2GZDA 2QMEA 3X1XA 1I4DD 5A5GA 4R2HA 4LJ4A 1XEXA 1W0KD 2O0KA 4WA7A 4A4DA 2FF7A 3NC0C 4UQOA 3W8RA 2ZUCA 1TNDA 1G4AE 4HSEA 4JZKA 4KVGA 3VX4A 1SKYB 2ZRJA 5EE3A 2RHMA 2Z5FA 3EC1A 3AVWA 4LK2A 2KBEA 5ELXA 2ZRLA 1Q22A 4IOLA 3GLFA 3EIEA 3RSLA 3PUXA 4IRUB 1QHIA 1T4GA 3GEIA 5C18A 2RGNA 3U44A 4GBMA 2XTZA 1GL6A 3WRYC 5DYIA 4OL0A 5IT5A 4JLMA 1AM4D 4UXHA 4CDGA 5K8UA 3BH7A 1G9XA 1KI6A 2ZYVX 2B7BA 4RD0A 1TMKA 4AURA 3VX3A 3ZH9B 3CIOA 4MGZR 4BZPA 1U2RA 2EFEB 4DLUA 4C0SA 4QJ5A 1E2JA 2QMOA 3AF0A 3RS7A 3TR5A 4LY6A 5F3WB 4U5XA 2WJVA 1F5NA 3CUEF 3CZQA 1OHHA 2GK6A 1TQ4A 3FYHA 4AI6A 1AQYA 4MRNA 3LQRA 2IS6A 3K9LA 1VG1A 2OXRA 2GK7A 4RKEA 3FKSA 3T12A 5IHPA 3W9YA 3HPQA 5FTNA 3JZMA 2J1LA 2PZFA 3MWLA 1U0LA 4GT1A 1IJFA 4CEIA 3QG1A 2WWYA 2H16A 2IYZA 4OKSA 4PR0A 1KTVA 1ZINA 3K0FA 1ESNA 3LA6A 2VH5R 2ORWA 3MD0A 4LYAA 4C0LA 3B85A 2A5GA 1G6OA 1QHGA 3SFZA 2CK3D 2J7KA 2AD1A 2NO9A 3RNLA 1CS4C 1E2MA 3RRZA 1XTQA 4TMTA 4AG5A 4B47A 3A1WA 3W6OA 3PR1A 4Q4JB 4B2PA 4FCTA 1L2TA 1P2TA 3FFAA 4LGMA 2PH1A 4FW9A 2OZEA 4EAQA 1TU3A 2YWEA 3L8YA 2ONKA 5HKKD 3DHWC 3B78A 4LC1A 3AVXA 3ZGXA 1RZ3A 3ZJYA 3A37A 4TWZA 4LHYA 4URZR 4YQFA 4ON9A 4GMXA 4AG6A 1RC8A 4HAZA 1EFRD 1HTWA 1SVWA 2G0TA 2FG5A 4RVCA 1KHTA 2CVFA 4FIDA 4ZIRB 5A0FA 2CNWD 4V0KA 1CEEA 4ZIRA 2WHXA 2IWHA 3I4LA 3P4YA 1LF0A 2SHKA 2UKDA 2J9RA 2XXAA 1J8MF 2MSDB 3EARA 2I3BA 2E87A 4DDTA 1FTNA 1NLYA 1EXMA 5KHOC 4KAXA 4OK5A 4E03A 1MKYA 2RGXA 4KFSA 4ABYA 3MFYA 3VR5A 5CJPA 1Z2AA 1UEIA 1NN5A 3CLVA 3ZZTA 4GOXA 4RZXA 1KSJA 4QBFA 3I5YA 5JJKA 2HDNB 2BCGY 1J90A 2GCOB 3UMRA 4DCNA 1M7GA 1P3JA 2EWWA 4NYIR 5CJ2A 2ZRGA 4FMBB 1YR7A 1G8YA 4W7SA 4LHWA 5FPYA 3TSWA 1YZQA 4Q9KA 2ZSAA 2IK8A 4O2LA 1UM8A 1N6RA 2W0MA 4LHZA 4A15A 1IJEA 1P9NA 1T3SA 3TSZA 4P4UA 4DCVA 3PG5A 1MRSA 4DDWA 3GCGA 4IKEA 4Q66C 4MYTA 1CRPA 1E2GA 4R9UC 3RANA 1F2TB 1Z0FA 2C03A 2DCUA 2BVNA 4JVNA 4M9XA 4BLTA 2GEVA 3TLXA 1D8TA 1Q21A 1ZVQA 1SKYE 2A7QA 1UEJA 5KNBA 3FHTA 2YC4C 4QM6A 5L8VA 3BFKA 4BLQA 1P62B 2BEKA 3THOA 3ZS8A 1E1QA 1SVMA 1XTSA 1T6NA 2WWFA 2H57A 1D6JA 1XD2B 4OQMA 1CRQA 3EXAA 1KMHA 3BD9A 4E22A 2Z43A 4EPVA 4JLDA 2JLVA 2BBOA 4HDOB 5LB4A 3RWMB 3O47A 1EFCA 1TAGA 3IEUA 1KI7A 1Q20A 1Q1BA 2GRJA 1R0XA 4GMDA 4MA4A 4MRRA 4WVFA 2IYQA 2XZPA 5DE3A 2BM0A 3THXB 2V6IA 2ZPTX 5AR1A 2FEMA 5D3QA 3RABA 2JASA 4HAXA 2QM7A 2RGEA 3I8XA 4Q18A 4OI0A 2BBSA 1SULA 5B64A 3O8BA 3EG5A 2IXFA 2ZRHA 3IILA 4PO9A 3WY9A 1MABB 1E2HA 1PZNA 4EPWA 4MDFA 1OH8A 3TRFA 1YJ5A 4LPKA 1R0YA 2QSZA 4LZZA 2AN9A 3GEHA 4PO1A 1KNQA 2ZJAA 5DGXA 1CKEA 3RC8A 3CBQA 3A4NA 4OHZA 3AKCA 4GI7A 2G9NA 3B7GA 4M1TA 5JS8A 2FU5C 1JR3E 4JT4A 3VR6A 1MO3A 3KDSE 2PZGA 3KQKA 3BH6A 1R0WA 4NU0A 1SVOA 4Q02A 4GDFA 2DFLA 1C9KA 4QXAA 2HT6A 5KDOA 2YOHA 3OE7A 3OAAA 3HYRA 4OQXA 4C4PA 3I73A 2ZU6A 2ZRIA 1IY2A 1HY3A 4TL8A 2XAUA 4QFMA 3HR7A 1DS6A 1XEWX 3T35A 2F1RA 4MUAA 2YOGA 3WNBA 2KB0A 1G21E 1IAQA 1U90A 2QAGA 1G7CA 4Y0VA
chains in the Genus database with same CATH superfamily
4NBNA 4EEZA 4RELA 4WECA 4XWKA 1OAOA 3ACCA 4HYQA 4QU8A 1DNPA 1W0JD 2W98A 3IOEA 1EMDA 4MZDA 3WJAA 4CKXA 5J23A 3QXCA 3AJ9A 2IZ6A 2FR8C 3V6LA 5IARA 3CY6A 1QHYA 4JC5A 3HDYA 1O0CA 5CVDA 1EZZA 5EJ2A 4U39A 1IM2A 2WU0A 2YS6A 4KR6A 4QDTA 2QJOA 3OM1A 1EG7A 3RGGA 4CI9A 2IVFA 4D0RA 3ILYA 1MENA 4YMTA 3DLPX 4IVQA 1CHNA 3Q15C 4PO3X 4RPKA 2XKKA 3KV1A 1N3LA 4ZKDA 5T4EA 2ZSDA 4FYIA 1PDWA 2NSLA 4OUDB 5I7SA 4R54A 2NQ2C 4P5EA 1SUSA 4QYIA 4EQ6A 1WZEA 4IGEA 1UR5A 1NLZA 4HMPA 3V97A 3WLMA 4IX9A 5DIZA 1ENYA 1EUDA 2REBA 4O1HA 1N2XA 1II9A 3BJMA 4MVYA 3K53A 4JLNA 4DV7B 3WRXC 4YT4A 3L82B 4WOPA 1L4GA 4CEJB 4JXKA 4C6TA 3KSZO 5ALSA 2CLCX 3PWSA 1EBBA 4NAVA 1JG4A 4JUCA 1EBFA 1F8YA 1FJXA 2Q3BA 4DLWA 1DC8A 1VB3A 4HFNA 3U3ZA 3LKBA 2PL1A 3H8SA 1R6VA 5CYGA 2JL1A 2PVSA 1Y1PA 3FTQA 4TXJA 4BYMA 3R5TA 3IA2A 3FY4A 3L0DA 1OV4A 2QYTA 5FTKA 1B0PA 3KJGA 2F2TA 1R88A 3TRKA 5HZKA 1B1AA 3B1FA 2OORC 1I5RA 3C6ZA 4YP7A 4EVQA 1A4UA 5EE0A 1OQAA 4YCSA 1CYEA 1B93A 1ZO8A 1JE0A 5KPJA 3HZHA 4XLZA 3RYFA 3O4FA 3MTJA 1FQOA 3JQ6A 5LYYA 2YRFA 4ZEXA 2JGRA 3DB2A 1XJ5A 1G3RA 1GUYA 3OQIA 3OFSA 3RARA 4UTNA 2X7JA 3H2BA 5BN3A 1WB5A 1B7GO 4JJAA 4GM0A 1JKFA 3KJHA 5BSHA 5CA1F 2QS9A 2YN4A 4JB0A 1YQWA 4RK5A 2ZRBA 2X0EA 1WCXA 4MP3A 2H65A 4CM8A 1LW7A 1CG6A 3YASA 3DJYA 3WWZA 4X92A 4CM4B 4DTCA 1WF6A 3G13A 2VYFA 3ZD8A 1NBMD 1TTQB 1F2DA 2ZI6A 5D51S 1N9ZA 1KP2A 2IEIA 4FWIB 1IWOA 1OAKA 4L73A 4W99A 2O8CB 4MVJH 1JFFB 2I2BA 5JWHA 5CJJA 1YVUA 3A9TA 3EA4A 1AUQA 4DRYA 5I51A 1Y4UA 3EPJA 4AJ1A 2C92A 3C1OA 4HDRA 1SXQA 1U1IA 2NU9B 1BIFA 2W6CX 3GJ0A 4LDJA 4XDHA 3VAZA 2A9JA 2PD6A 1QHNA 3CZPA 3I2HA 3OJLA 2NXJA 2PGLA 4D82A 1RKXA 5LQDA 1UZAA 2V7BA 4IWXA 4AO7A 2MT9A 3C6QA 1F12A 1W9MA 4DV5B 3MPUA 3RWOA 1QP4A 4C9BA 1J21A 1NUSA 5HF9A 5TF4A 5LP6A 5KNCD 5KYUB 1XF1A 5AVUA 2F1HA 3TI9A 4JQYA 3VVCA 1Y48E 4WH0A 1CS0A 4YJFB 1PUIA 3VU8A 3QY9A 1N5MA 4GX5A 3VHXA 2FSPA 4C0KA 4BNLA 3KVRA 3NQ41 5BSEA 1D9ZA 4YUYA 1KJ8A 3M6FA 3EPKA 4WBSA 2X2PA 2ZDHA 3O8DA 3L0YA 3F9RA 3BTUA 4I2VA 3I2YX 2WMNB 3KD2A 3ICEA 4PZ9A 9LDTA 1JSLA 2GZAA 4US0R 3CH6A 5HG0A 3WLNA 3ZU2A 1X8LA 5T5QA 2IBTA 3QV2A 1G5TA 1EQUA 1TJPB 3QPVA 5JSHA 1RWOA 3E53A 2Q3FA 3GLVA 4AP5A 4DCOA 1DFGA 4UCXA 4XJSA 2ZBGA 1SY7A 2FRDC 2MYPA 3HVRA 4W9RA 1Q7TA 1U8ZA 2HRBA 4NARA 5FEUA 3IT0A 5ALWA 3OM0A 1FLAA 1KDTA 2RHBA 4MKHA 5KOIA 4P0TA 1YAHA 3A6KA 2OCPA 3DCYA 1DINA 1FFDA 3Q7EA 4UBOA 5BN5B 2ODTX 4EY4A 1TCUA 2WP0A 3MQFA 2NVUA 5U1PA 1WDTA 4NEGA 4BFZA 3WLSA 1T2AA 1Y5NA 3DAOA 2AA3A 2D00A 5LQMA 5KYWA 1E7QA 3T7DA 1L5OA 3LXXA 4DRXB 3I53A 1K2WA 1VI2A 1LJLA 4KQIA 2ZRKA 3TO5A 1EXDA 3PGLA 1YKSA 3QLTA 2PM8A 1R18A 2GYYA 3RUCA 3K5HA 2FA9A 1OGYA 3R4CA 4Q4HA 3QBJA 2H4YA 1K7CA 2XE6A 1LF5A 4RDIA 3M1YA 3M83A 2JC3A 3JD3A 5FTMA 3EXEA 3GDWA 3WOVA 1S2GA 3EIHA 4V1CI 2EU8A 5JRJA 5CFOA 5L40A 2VSYA 1WAMA 2BFFB 4PX9A 1BWPA 1JHVA 1NYRA 4P7FA 3O8CA 1UBMS 5CHYA 4N0MA 5CBPB 2J41A 4Q6WA 3OIWA 5JH7B 3GCXA 4MJ7A 3CM0A 5JS7A 2WFLB 1CJVC 3QXHA 1BG6A 5JANA 2VPPA 4AS1A 4CIYA 1H9BA 4QUIA 2C07A 3UWMA 3DAFA 3VYUB 3OLCX 4G0UA 4P83A 1QHHB 2MJLA 2K7ZA 3B9PA 4JVMA 4TLCA 2PJRA 2CHFA 1NJ5A 2G6BA 3L0CA 1LVHA 3JQRA 2F4NA 4MNTA 5BSUA 4YRTA 4MRPA 1WP9A 2BP7A 3L6OO 4LVOA 2ZR0A 1UOPA 3RTBA 4BWVA 5AI9A 2XZOA 1Y8ZA 4O6VA 2Q50A 3NYQA 4M83A 4JB2A 5DXFA 3E8SA 1N0WA 2OHFA 3EXIA 2UYYA 2QE6A 3HL0A 1TE2A 3KEQA 3H7IA 1UKVY 4IDDA 5D84A 5KQPA 4EPXA 3R6LA 2J67A 4E33A 4X94A 2HL6A 2VPXA 1UJMA 1QYDA 4AKTA 4BXOB 3OFJA 2IV3A 3WISA 1R6BX 5BSWA 4IEFB 1I94B 3CT4A 3ZK9A 3ZN2A 3CVYA 3D8HA 4DYVA 2HWYA 2RI1A 4D3SA 1PO7A 4ZANA 1Q92A 3UQYS 3MT9A 4L8VA 4K9LA 1O0SA 1VMAA 1DFHA 2H51A 4UFOA 1NBIA 2O3UA 4AZVA 1HYQA 4EG7A 4TL7A 2GLXA 4YO7A 2W4MA 1ZSYA 3C1UA 4O5AA 3FVQA 1E99A 2XNKA 1QZ3A 4H1TA 3BCHA 3QX9A 4H1VA 3TOSA 2PR2A 3UJ6A 5FLYA 2PZEA 4X7RA 4X9XA 2E0IA 4TT8A 4OATA 2ZYUX 2WTBA 4HPJB 3EWAA 5CT5A 3KTFA 4DUPA 4IXMA 1E8DA 1L7MA 3VR3A 4OOEA 2IW3A 2FZ4A 1SQSA 4NSNA 1N6KA 4GUDA 3GEMA 3MLBA 4IOMA 2IBMA 1QYXA 2I4MA 2VJBA 1KEPA 2J4DA 2MDTA 1M6WA 5BRNA 3GZ4A 1RLJA 4MQUA 2Z2IA 1YVDA 4HWOA 3L7NA 4LXQA 3IOMA 3W5CA 3FTEA 4DC0A 2I67A 1H2AS 3IDOA 3MWEA 4CMBA 4BO6A 2RG1A 4C1NA 5L7WA 3AIMA 4MQ4A 1KU6A 3HPRA 5IKPA 1XZHA 3JRWA 3LDUA 1T1JA 3BUSA 3P9ZA 1NMQA 3VSAA 2GT1A 1JHPA 3SDSA 4NEQA 4LZAA 2O1SA 2DPLA 2PSFA 4BLOA 1YVRA 2ZRPA 1WPQA 1X1SA 3C4QA 3MS2A 3PEEA 3QF4A 1Z4IA 4UFNA 4X7MA 2JI4A 1QNLA 3GAMA 3QPBA 5DM60 1FYXA 1GKIA 4FZJA 2Y1GA 3RUFA 3TPFA 4Q24A 3UAYA 4PSAA 3I42A 3RRXA 3PX3A 1FVXA 1Z6YA 3EXHB 5AHRA 1Q6YA 5A9TA 1ENPA 1Y9ZA 3OUZA 2KM1A 1T3GA 2VPZA 3OTWA 3WL6A 1H4TA 3AOGA 4P53A 2IY7A 1E1QD 1JHUA 5DYYA 4ZGGA 3KWMA 5AK5A 1HLPA 1YS7A 3DLIA 1NYLA 4NVRA 2PQMA 3NFRA 1GGHA 4ZVTA 3SZ3A 1C81A 1LNQA 3V7WA 3LL4A 3V4FA 2A0WA 1QZXA 1YIAA 2JVKA 4JEMA 4U7HA 1HDOA 1HZZC 1PFVA 2BPOA 5AOCA 3TQOA 1RBMA 5E4YA 4C3OB 1KKLA 1OLUA 1UP6A 2C4MA 1CT9A 4D6PA 2G76A 1D07A 3GJ7A 1SBCA 4QXQA 2OUKA 2ILVA 2IOYA 2W37A 4X64B 5CA1A 2J3DA 3I72A 2F1KA 2G82A 4S04A 1E6EA 5JSZA 4L4ZA 1XDWA 1XRPA 3DFZA 3WGZA 4B71A 5ARBA 3TGLA 3QMVA 3RAJA 3GOQA 1LDBA 1RAIA 4D9CA 5ADHA 4MR7B 2IHZA 1RRMA 2WAAA 4YQYA 4EATA 2R47A 4U3JA 3CLSD 1VP3A 1B2LA 1BYIA 3AGPA 3D5EA 3GH3A 4LVUA 1L5QA 1VMIA 4MW4A 3OBBA 3GGJA 4W4TA 4CMKA 5ESXA 1YXMA 2VIIA 1ZIYA 3HYCA 3QUTA 1VCOA 3EG9A 1OWLA 4LKRA 1T2UA 4OB7A 3EY9A 2IHYA 2FP3A 2R8XA 2Q3HA 1XEAA 2TMKA 3B1KA 3PUYA 4J4BA 1NG9A 3BT7A 4WOKA 4POOA 2BF4A 1P8JA 2Q4BA 3TSCA 3FMIA 5BXQC 1V16A 1ODFA 4TZKA 3R7SA 3SG0A 3SZMA 1N6PA 2GZHA 4ZKEA 1S8NA 5LUBA 3U4GA 2VA8A 3VR6D 3ZQKA 3E5HA 1KVTA 4RMHA 3TNYA 1IDOA 2P41A 3MLEA 1CULC 1VKNA 4BS9A 5ALFA 3DVLA 4RE5A 4WLFA 4O8ZA 4OB8A 4ASUA 4IVPA 3QXJA 2WF6A 2YV4A 1NP6A 1PTKA 3I5UA 4W1RA 3TTYA 3VSDA 4ARSA 1RXWA 2H8KA 3E3MA 1ODJA 1HG0A 2YZMA 1OF1A 2B36A 1HE8B 3L7BA 4KIWA 2CZQA 4M38A 1GADO 4REQB 5KDDA 3SK0A 3PXAA 1JH9A 2KMLA 3H0CA 1E7RA 1W30A 3PI7A 4GPAA 4JFRA 4X6YA 1F14A 2V74B 2V7PA 3FVVA 4XDGA 3RREA 4NBRA 1GVNB 4ZODA 3WMXA 2A9FA 2HCTA 2R84A 1OH5A 4XPIB 3TW8B 4X97A 3B7PA 4N3GA 1NBWB 1T9HA 2W2KB 3EZFA 4JP8A 4QATA 4Q1VA 1CFJA 4Y7DA 2DRIA 3OTIA 3N05A 2M6LA 4AS2A 3QVGB 3UUFA 1X15A 3P94A 2G1PA 2BFOA 3WJ7A 2WE8A 5A3VA 3ZCRA 1FW6A 3CUUA 1YQTA 2J0VA 2ETVA 1LTKA 2QRUA 1P4SA 3MLAA 3QOWA 3UICA 2EG5A 2W6JA 1KPHA 3FOBA 3MHPA 4LMRA 2PJZA 5DHPA 3L7KA 2G04A 2AT1A 4LXYA 4NAUA 3D6MA 1JBQA 1DBSA 1F48A 3VSBA 4B4UA 3G2KA 1X0VA 1RMYA 3K73O 2P77A 4PYJA 2ZSUA 4DSAA 1GFWA 3ORFA 1WCV1 3PCTA 2Q29A 2P9TA 1PEDA 1YQDA 2JLQA 1MJHA 3GT7A 1HPLA 4XSGA 3L1HA 2MHCA 5ARDA 3GLKA 3UF0A 4PAOA 1OWOA 1YB2A 1U80A 3FSGA 3EK2A 4Y3UA 3CEMA 4PZLA 3SJAA 3LIIA 4V0ME 1KVSA 2PYZA 5CB6A 3K09C 3WGMA 3RBVA 3EWSA 2Q45A 3HB0A 1W5EA 4MS3A 2FZEA 1I14A 3EN0A 1R12A 2EL9A 3E7PA 1E1RD 2PUEA 1SVUA 2PWAA 3MMZA 1J5EB 4LJ7A 1HDCA 2QRLA 2Q5EA 3AIOA 3OEHD 3ND8A 4KE8A 1DWUA 1FMJA 1ULUA 3MGKA 4L0QA 3HU2A 4MUKA 4Y98A 3UAXA 3IPAA 4PBSA 3AWIA 1YR9A 4GPZA 4KFUA 4D46A 1OVGA 2GNAA 3HCRA 3ZJVA 3AKYA 1UPXA 5M7EA 4KH1A 3FAKA 5CDFE 2ZWOA 3KQOA 4S12A 2J0SA 1ZCFA 3VPHA 2DY1A 1GUZA 4BGEA 1CR1A 1RADA 1VJ0A 4QBIA 4L9SA 1L6IA 1K4YA 2W2XA 1GDDA 1ML4A 4F4CA 2JFUA 3KQWA 1QMPA 3KX2A 4UASA 4JWKA 4A0SA 1VOTA 4ALIA 1TF5A 3K71B 2HHCA 2GPTA 5FI5A 2WUDA 5FUYA 3TTWA 4E2YA 4YDHB 1VBKA 3KYCB 1Z9BA 3H5NA 4QVGA 2G7ZA 1OA1A 2HMSA 3N2IA 4CQMA 3ISTA 2FP4A 3HB1A 5CH5A 2BM1A 1QB8A 1SKMA 1HQCA 1OFIA 1QONA 1J00A 3L1KA 4CL3A 3I01M 3LCJA 3TJMA 3DDUA 2HHHB 1GARA 1ZKDA 3QZUA 3RBAA 3ZLBA 4CM3A 1U28A 2WFZA 5C35A 1X7XA 4KGZA 1U7ZA 1JR3A 1FSZA 4MQ6A 4C0HA 3U61B 3FGZA 4XUCA 3KFXA 4QRHA 3VUFA 1JEAA 1I3MA 1ORHA 3WLPA 3L7OA 1W76A 2OHVA 5KDLA 2P67A 3OJWA 5TC4A 3JRXA 1YI0A 3ZE7A 5IVIA 5A4KA 1EK1A 5L95A 3VH1A 1DKLA 5KCMA 2AMFA 1VG8A 2F9FA 3ICVA 1XV5A 2G4CA 1KQOA 4MEJA 2VQFB 5KHAA 2QORA 5EIEA 3FA2A 3IPXA 2XOEA 4O2RA 3Q8LA 2JATA 1FLNA 1TRKA 2A3NA 3IAAA 4RV4A 3A3KA 1M8GA 1AZLA 2EAUA 5DGCA 4CJXA 3ET5A 2PPLA 3BWMA 1HKUA 1N6NA 3LOPA 4ZAYA 3GQVA 1QU2A 2FRVA 5FL7D 2I8CA 3IJRA 2CHUA 5KKAA 4UD2A 4HADA 4WV3A 1SEVA 3HQ4O 5FBQB 5AOBA 2IKSA 2Z9BA 5ELLA 1M34A 1XQXA 4IV0A 4Q9HA 8ADHA 4MYHA 2RBGA 2VQSA 5J9FA 3OFND 2GHQA 3IGFA 1CJUC 1KETA 2PQ0A 4DDVA 3X2FA 1XXHE 4CQLB 2P4EA 4HNTA 2GN6A 2XF8A 2OQ2A 3KYJB 4XAQA 4DLLA 2EIXA 2NO6A 2QN1A 1WKBA 3L6EA 4O2BA 2ZXUA 4MW9A 1PR0A 521PA 4D98A 3E9YA 4IDEA 5HOQA 4TZ6A 3RTDA 2DKNA 2PEYA 2PGOA 1QR6A 4RDXA 4ZI5A 3PTAA 1NVMB 3ZVMA 5IM4F 2EKZA 1PI3A 4C05A 1ONOA 1FFXB 4IXNA 5DKFA 3VR2D 1A8PA 2JF0A 2ZI9A 1KZ7B 2NYRA 2GEDA 3IBSA 2GWRA 1USGA 2HCBA 3EZLA 3IQEA 1BJTA 3F6BX 4IG9A 4IXTA 3VO9A 4WXRA 1T91A 2J6BA 2X9GA 3K9NA 5K0EA 1O6CA 3PUVA 3KUUA 3MTIA 4QELA 3ZE6A 4FC6A 4YJKA 1PWYE 1SOVA 1C3OB 3QEOA 4H6VA 2O3RA 1P17A 4XFJA 2VAXA 1M2VB 4OOFA 1WCYA 4BN0A 2RAPA 2MIIA 4PSCA 2PKQP 2WPDD 2IYNA 3D7LA 4TKZA 1OXVA 1F2TA 3OUUA 4TQ9A 3UB2A 2LPMA 1JIVA 4IHJB 2GD6A 2YNMA 2JJ1A 3BTOA 9ABPA 4I5IA 4EG5A 1SVKA 3C4VA 2R5NA 3PPVA 2Q9AA 4N3CA 1X9IA 4G0NA 4K6OA 4NOJA 3EH2A 2Q5JA 3EY4A 1AA9A 3FFTA 2DYKA 1AS3A 1ABEA 1NQWA 4MLCA 5J5AA 3RV4A 3DEYX 1ACJA 1KKMA 3EH1A 3RADC 4R1LA 4FMCB 5KQMA 4LZPA 2R00C 4BQIA 2FLKA 2ZKIA 2AV6A 3PNKA 4FKMA 4PCVA 2AFIE 2YWCA 2VF2A 1DAGA 1ZM9A 5JZ9A 4ZAWA 4IDGA 1CUFA 4C0XA 4AJOA 4N7JA 3BIJA 3FYCA 4MX8A 3SYRA 1GTL1 3DEIA 3O93A 2IEDA 3JX9A 4F60A 1VP9A 3OA2A 2RGBA 3IERA 2CF6A 2G8NA 4PHHA 4YWJA 1A9XA 4DQXA 1W2GA 3H2SA 3IB6A 3NT2A 3R0XA 1XVUA 4FZ5A 5FXMA 3PT5A 4EDHA 1ABFA 2AUMA 2EV9A 3QBVA 3QBEA 4G25A 5EI5A 1ZESA 3FDXA 3I52A 2BOVA 3V4PB 1RTTA 1WIWA 3MJCA 4CV0A 2HV9A 3AHEA 3AMVA 4PGFA 1YA8A 4Q1BA 4LOHA 2ZATA 4D41A 5JARA 1H4SA 3GARA 2QWXA 3DEAA 1F3LA 2CFTA 2R6CA 4W9NC 4YP6A 3JQCA 4COKA 5JAPA 1P60A 3RU3A 1YE5A 3PC7A 2RBKA 2ORVA 3KPJA 4DJJA 3BL5A 4B80A 3UPTA 1XTRA 2M32A 3K0SA 4D43A 4XX0A 2XUHA 4LWPA 5JZMA 3V4RA 3A2KA 4IIGA 2GEKA 2XDAA 2V1XA 3GCZA 5AMXA 1OGJA 1KDVA 4EFMA 3Q9LA 2WWHA 3AU8A 5T6BA 2Q5LA 3C6XA 1TD1A 2EX0A 1MJFA 4L50A 4Q9LA 3U7GA 4ITUA 4MWOA 4BO4A 3DTTA 3GEBA 3OT1A 1KQ3A 2AWNA 4OJKA 1LPMA 5AK6A 2W6ID 4R41A 1J2JA 3OLVA 1A77A 4FJ1A 3WADA 3WOHA 1U2DC 2HYDA 3DAGA 4HB0A 3GJXC 3WQSB 1UF9A 2J46A 3HCPA 5DTEA 2VZLA 3UMBA 3PNYA 5JNLA 2FJUA 1C7EA 1KIFA 1VB5A 1ZXXA 2Z4RA 4QBTA 2PRSA 1PQ4A 1O89A 1JPJA 2XYQA 2YZ2A 1A3CA 1R9MA 2B4QA 3EEBA 4FXPA 4TLBA 4DWJA 5EIFA 5C4MA 4QPPA 4CFZA 2EXXA 3GDOA 2NACA 4JOQA 2YX1A 3DMGA 3JR7A 4Y1EA 5FTLA 3UN1A 3CF2A 3IEXA 1MG5A 1ZNXA 2OA0A 1PBNA 3FNRA 3T7EA 1OFVA 1PZHA 5G40A 3U3XA 4BNNA 3GEGA 1QG2A 3O7MA 4JKYA 1PS0A 4DR6B 4DDKA 1E0JA 1Y81A 2JJQA 3NEAA 4OUDA 3JYNA 2C9MA 3AKZA 2NVBA 2FUCA 1GV0A 1QDUA 1NV8A 1DRKA 2B99A 2AKAB 1GCIA 1YASA 2HQ1A 3FCEA 4Q82A 4R2MA 1EP9A 5DSTA 2OYRA 6GPBA 1THTA 4EW2A 1C8VB 5BQ3A 1EU1A 5BQXA 1AKWA 1GYRA 1NNEA 2J59A 4GKBA 3HH8A 1IVNA 1H42A 3STUA 3ZCQA 4Q1DA 4OVKA 4JQCA 3RSQA 5J63A 4A23A 4CEJA 1OTYA 2XA9A 2MU1A 3OIYA 1P7VA 4X85A 1IRXA 2ROQA 4TVSA 2XOKD 3H2YA 2QGNA 3O3MB 1A9XB 1RR6A 4WDQA 3NOXA 1YAJA 2BZ1A 2RHWA 2W0SA 1GU1A 3PLNA 3QPCA 4TS1A 4X84A 3ZPXA 1JIKA 5I45A 1U4SA 1LLDA 2C0QA 3NDRA 4R1QA 4PQRA 4Z7JA 3NBMA 3AONB 4M1OA 4RS3A 4TVKA 2RH5A 1O8CA 4CU5A 1WD7A 1XTKA 4R68A 3MWFA 4NZYA 2VL7A 5J43A 4KRXA 2BCEA 2FMKA 4ZP1A 1RXYA 5FCDA 3V1TC 1NSYA 2IZ0A 4MP6A 5ILQA 4BZZA 1P2SA 1Y6RA 3MC1A 1RWXA 4OG2A 5EXXA 1O6BA 4LYYA 1VM6A 1JSXA 4PZZA 4QC2A 3LGAA 1U0SY 2GLTA 2NO0A 3OHPA 5KQGA 4TUYB 3DEHA 4N49A 4V2UA 4AICA 3GLGB 5D2CA 4N5MA 2WI8A 4TXHA 4G0OA 4B8YA 1E3DA 1JYEA 1M1YE 3AGQA 5B37A 5TJ9A 2HT1A 3NMUF 2V58A 1YGYA 2LP4Y 3G2QA 5DLYA 2R4TA 4HRYA 2ZRAA 4Y9DA 5C4GB 4KGDA 3ROPA 3RRYA 4CM4A 4AWXA 5ICGA 1T1RA 4WWHA 1XN4A 2Q5OA 3K70C 5FLEX 4G5YA 2D7JA 2QJWA 4RXTA 1EVYA 3TOXA 2X1VA 4BC0A 1XDUA 1EUCB 1JQJC 4K9MA 2O8CA 2WA1A 1JFFA 4M46A 2IXTA 4IW3B 1C30B 3BB4A 4AXBA 3UJDA 1NVXQ 2FFJA 4PSKA 4NV3A 4UHBA 4F12A 2XITA 2M1ZA 1RABA 1SPBS 1CVLA 1Y42X 1J0EA 2NU9A 3G0GA 3KFLA 4QEZA 4YALA 1XOIA 2R1TB 2V97A 4XWGA 3FKQA 4UAVA 4KPGA 4ZMSA 4D81A 1U2GC 1Q2XA 4AAYA 5JAIA 4M86A 4MV0A 2C4NA 3JQPA 3ZBQA 1J4AA 1I6WA 4BN5A 4CUZA 3IP9A 4Z9FA 1YV9A 2AFHE 3VPBA 2A0YA 3ZJ5A 1LNSA 2FUKA 2HJRA 3HDTA 3OY7A 4IAOA 3W8NA 3EUWA 4F5DA 3VTAA 5KYUA 5DISB 3HBMA 2YN0A 3NIGB 2II6A 3NTQA 4EJSC 1OT3A 3B1JA 2GBIA 1BWQA 1LTQA 4R81A 4BMPB 1MRNA 5K03A 5LQKA 2IH2A 2JH8A 5IM4A 1T9BA 1Z16A 4NS4A 3AVUA 3PXCX 3AY7A 2PS0A 3NT4A 4ZVSA 4MA5A 4QU5A 5CXSA 5E2IA 3JS5A 3ZDZB 4BEVA 4YCAA 2FZGA 1PLKA 3C5HA 3NU1A 4BNIA 2WYIA 3UV6A 4MIYA 3AO0B 4TV9B 2CLDX 4EX7A 3GNLA 4KZPA 3GP3A 2JVIA 3IV7A 2F00A 4ALJA 4G8CA 2WRZA 3WKDA 4CMHA 2HV8A 4RF2A 4HGOA 3RYHB 5FA6A 2ZBQA 1U3CA 2ECKA 2FMUA 2ZETA 1QVVA 1OTXA 4DRZA 4BU1A 1C5KA 1XN1A 2KW5A 4IHQA 4QOSA 4E2WA 4URWR 1XVIA 1H2RS 1Y6JA 4EJ2A 1S8AA 4AJ2A 3JYLA 4LGCA 5BN5A 3P9SA 4EF5A 1CFZA 2RD2A 5KOHB 4XB2A 4LSWA 3QLVC 1DWPA 5J5VA 2HRCA 4E0BA 1NN1A 1VI5A 3HM2A 1PEKE 1DHTA 3VYSB 3H19A 4DRXA 3HB7A 3OETA 5BOSB 1FRFS 2AQ8A 3JQAB 2PXCA 1NW3A 4R0NA 2HBQA 3FUWA 4FYKA 2A78A 4U0KA 1TF2A 1RHJA 1PG2A 1NYTA 4LJAA 3L8CA 2X0IA 3TTSA 4U7GA 2WB2A 1ZOIA 4FFBA 5HNKA 4CTJA 1TA9A 2F48A 3VTFA 5AYVA 4UQLA 4GVPA 4JLOA 4IQ0A 4R9VA 3M3HA 1RPNA 1TDJA 1EHYA 3JAWB 3QWAA 2BFFA 4HN9A 3C5EA 3EGIA 4TGLA 4H7HA 4V0LA 1NE2A 3VNSA 5CBPA 3QSYA 1LLFA 1V8FA 2P79A 4K9DA 3GEPA 4FHFA 4R4JA 4GL2A 1U0HC 2WFLA 4UUAA 1GFIA 1NJ1A 2HBZA 1RP7A 2VRNA 4PLTA 4BECA 2ZYRA 1JWBB 1E9DA 4JI2B 3VKHA 1ZC3A 1QHHA 3WGGA 3ZV6A 4EY8A 4I6GA 3HY6A 5IF9A 4MWEA 1J2RA 4L72A 3DO8A 1O94C 2Q5HA 1QANA 3N7TA 3NBZC 3VU0A 3ZJUA 1AGYA 1SPXA 3PUWA 2FE4A 4FOLA 1U7OA 5EWLB 3QUBA 4RJTA 4N03A 2OBYA 1KYYA 1T4DA 3JQ8B 4QFBA 2R68A 3BREA 2PDAA 1F9AA 1D0VA 4ZWNA 5BW8A 4K8RB 2FDCA 3W6PA 5CDUA 1YZTA 2IY9A 5FOUA 2W6ZA 4LOLA 4B74A 4BZQA 1G3QA 5C1OA 4BXOA 1N3YA 5TDHA 3T5PA 1KAMA 1ECPA 4R1NA 4R2IA 2VP5A 5BR8B 4CLDA 1XAJA 4DM7A 1XMSA 3R3HA 4CWAA 4M9RA 1JDNA 1E61A 3O83A 2F59A 3WB0A 3ZQ6A 4BEJA 2Z8YM 4HRVA 5AW1A 2JA2A 1KJZA 3H3XA 1K92A 1QKJA 2HQSA 5JMWA 1MH1A 3SHOA 1P1RA 3FWYA 1MAUA 4ISCA 2V45A 3QKUA 1PJ2A 4JDUA 4R7TA 4F72A 5C53B 2NG1A 1UJ5A 1NW5A 2EHJA 2P35A 3O7WA 3STTA 4AP6A 3A4TA 3RVBA 5HX7A 4IF6A 3W6NA 1E9CA 3FHJA 1X7GA 4B75A 2AHOA 2ZZMA 1OWNA 2ZYAA 3F5FA 1TCVA 2VK8A 3I32A 5KJCA 2BBWA 3OTQA 2C5FA 4YP0A 2RHGB 3C3KA 1J2TA 2A67A 4HLNA 3CUTA 4Z2AA 4C7XA 4D6XA 2FQWA 2WG0A 5C81A 9GPBA 2FV8A 4MTCA 5EE1A 1J23A 2IYPA 2K87A 3L1JA 2D13A 1XLVA 4DCTA 3P26A 4FEGA 2PUAA 1L7DA 1UWKA 2KBFA 1GAQA 1Q0HA 4MQFB 2CVQA 2WIGA 3B6MA 4JH0A 4M99A 1R3UA 3T7AA 3V8VA 2BKAA 2Y9MB 4RJIA 5K4GA 4JSYA 4RENA 3VO8A 3LWNA 1GGFA 1G3UA 3FCSB 5DBIA 1VA5A 5MGBA 4M8IA 5AI5A 1QIHA 4LF6B 1KZ4A 5EC8A 4JBYA 4A2CA 1FIUA 1YCGA 3ESXA 4K05A 1U2SA 5A5EA 3EF1A 5CBKA 2B4AA 2HIAA 2PKWA 1XEFA 5HF5A 4XGNA 5DB4A 2WVHA 2M6RA 1E4VA 4YPVA 2BGLA 4WD3A 3N70A 2X1MA 5LLSA 4YP5A 4YJ2B 1KYTA 1ETUA 1MT3A 4LTDA 4M49A 1VKZA 4MWTA 1P5ZB 3QKTA 4QQKA 1XCOA 3CH4B 3CE6A 3EXHA 1Z5OA 4RY2A 3F3SA 2V6FA 1NV9A 1OX6A 2H5JA 1E6KA 1TYCA 1TKCA 2GCEA 4AJLA 2EX4A 2B25A 2CVOA 2I6SA 4Y6OA 3RSZA 5MFZA 5EMMA 3T1NA 1KIMA 5GVSA 2HJSA 3GLRA 3JSXA 5JTUA 3FNHA 5I9LA 2P9BA 3BWDD 2UV8A 3IEIA 3LCUA 4LRQA 4V3CA 1T6BY 2CYAA 2AN3A 1U3DA 2ADMA 3ZV5A 1SG9A 2GKSA 3WHLA 3Q85A 1N1GA 2YW2A 3IO3A 1JNXX 1IG3A 3GHYA 2VG8A 3ILHA 3CS3A 3PNOA 5FTJA 1B6GA 4ZI7B 7YASA 3DR3A 4CDMA 5C8DA 1YA6A 2NYUA 3DULA 4MR7A 4JL5A 1RFGE 2XYRA 3OE1A 3U0VA 4NONA 2WZCA 3AVOA 1R4AA 1G2OA 1E79A 1RMTA 4ZVQA 4IHJF 3NBUA 3VZPA 4JQZA 4OIMA 3I3OA 2CBGA 1G5FA 2GPWA 4L4RA 1BC5A 1C4WA 2YQ4A 4E5KA 3EPPA 5AM4A 2ZCVA 3VM6A 4HG2A 4RTRA 4J9UE 1P4GA 2PMKA 4MR8B 2WU3A 3LY8A 1R66A 4HUJA 3GP5A 1KDRA 2X9NA 2LV8A 3H3JA 4NG4A 5DK4A 1ZI8A 2ILTA 4FMCF 4RSRA 1GN9A 5I7VA 4MRAA 1X1EA 4MPPA 1D7AA 4RO0A 2LBPA 4S0XA 1O0BA 2E4UA 1SURA 3KNZA 3O95A 3QF7A 4Q4LA 3TBHA 1M9NA 3LC1O 5D5QA 1J5PA 1WQ1R 2PBRA 1G8HA 2OV1A 5EVJA 4YO8A 4D9FA 4LAFA 5T4HA 4Z7NB 1E0DA 2XQIA 3FGNA 1Y4AE 1BHO1 1ZMRA 5DNDA 3T5CA 1Z4KA 1AKUA 4REQA 4IVRA 4B5KA 2NUBA 4QU0A 4E94A 1E3JA 5KYKA 3VR4H 1W4AA 5TPZD 4CKBB 4P80A 3IQXA 4JYCA 2G1UA 3OOEA 1V8ZA 3ZG6A 5AJWA 3OLQA 2B7LA 3OC6A 4FT4A 3F74A 1PFUA 2OLEA 3EFEA 4XPIA 3TRJA 4GLJA 3TW8A 4Z1MD 1E69A 2W2KA 2GOYA 4LV6A 2H7CA 2G9QA 1QDEA 2K2QB 3TLCA 1W36B 2PV0A 1XQ9A 1ZZGA 2JVJA 3B1VA 4K6KA 4R2WA 1FFGA 1HKHA 5K99A 1FRZA 2A5JA 2EFHB 3QVGA 3VJKA 3S1LA 3UM9A 4NQZA 5CLQA 3HNRA 1R0RE 1KAQA 3TAUA 3DTVD 4ZDKA 4NXNB 1V71A 2FNAA 5AW0A 1AD2A 1YZNA 3CWQA 3OOSA 1EM6A 4A10A 1T9GS 1OYWA 4EUEA 5JXWA 3PA6A 2ONCA 3PL5A 4RD2A 5FBHA 3NOQA 3DC2A 4P5DA 2VP0A 4U2DA 5AW5A 2G5TA 3T1OA 1TK3A 1VSQA 2XKBA 3SMVA 1MW9X 4MCHA 1QQ7A 4TSFD 2FEXA 3LCMA 4OM8A 1V7QA 1FDIA 2Z2XA 2UVDA 5KO2A 5FR2A 3W90A 3UTDA 2M9MA 3W5JA 2BI4A 1KI3A 4NCAA 1REQB 3KG2A 2WR8A 3PD7A 4NOLA 2KYRA 2Q99A 3KL4A 4TXLA 3N75A 4O0LA 4ESEA 1KAHA 1SOUA 1WKCA 3ROGA 5FT9A 1PW5A 4QOFA 3DE5X 3GGDA 3H5AA 3E84A 5D85A 5TX7A 4FD3A 2QVZX 1VLJA 3ODGA 3AETB 1E96A 3FPHA 1UC4B 3VVMA 1XMOB 3GCDA 3G0BA 4JAVC 5KMGB 3PQ8A 1YR3A 2XRFA 4S0ZA 4AMGA 3FFBA 1KYQA 3WWYA 5C1BA 4NDZA 1RAHA 1X6VA 2EWMA 3N2YA 3R3XA 2OGZA 1BE1A 1KWGA 1OA0A 4HAUA 1VPEA 5E9WA 1XEXB 1I9GA 3GROA 4UJ3A 3AH8A 3U17A 3OF2A 1TRHA 1E5QA 3F2VA 4GIBA 1KA9H 2WWVD 5DVZA 2CW5A 4G2NA 5HF8A 2YC2C 3A58B 5A3QA 1GDHA 4DWVA 1A4RA 1RWMA 1DEHA 1XTTA 3S2ZA 1TTPB 4FSDA 3TIFA 1QR2A 3EMBA 3PA8A 4AJNA 3KAKA 1C7ZA 2DBVO 5E3HA 4CTNA 3UHFA 2R96A 4EBFA 1MJGM 3OG9A 4LX0A 3Q1LA 2H07A 4A8HA 3OKAA 2WQ6A 4OQ4A 1J97A 4FSXA 2C7RA 3T3MB 1TKBA 1QGED 3AJAA 1L4UA 2AEJA 2I1VB 2JA1A 2PGXA 4DAEA 1E1KA 1EVZA 4TKVB 1W73A 4NJOA 1GILA 1SWWA 1CP3A 1CEQA 2X77A 3EVCA 3VHRA 4HS4A 2HEIA 4C06A 1VG0B 1QGOA 2VUTA 3VKVA 5K0CA 5I7WA 3Q4GA 4R2XA 3W3AH 4CM6A 1O95A 4OHMA 3UOAB 3KHUA 1WSAA 2YY5A 3OZ7A 3ZY6A 4ZVVA 3AF5A 3TNJA 2WPNA 1TF7A 2EW1A 3EJ6A 5AQ1A 3CPJB 3PV0A 4TUYF 1Z26A 2REQB 1JR2A 3HUEA 3OZIA 4LJ8A 4YJGB 1X19A 2CUKA 3N8HA 2YCLA 4LZNA 2F17A 3U7QB 4DPLA 4Z7OB 1CUDA 1BRMA 1JHZA 2C5AA 3TGPA 3OCVA 4ZZ2A 2ZXFA 5F7XA 4JI1B 4BX2A 4DA0A 4G4GA 1CY8A 1E0KA 1ICEA 1WM1A 2QRGA 2YVKA 4LXGA 4QTZA 1IAVA 1K3FA 1XWWA 1Z8FA 2CN1A 4W7IA 3GN1A 1SXJD 3F4BA 5D00A 5H82A 4JLSA 4DCJA 2FWNA 5KJFA 2C2WA 2XY4A 5DW0A 2UXDB 5DX0A 4RNDB 4J0HA 2I2XB 1AHIA 3L77A 1OCEA 5DK6A 1UBNA 1HH4A 5G53C 2ET6A 2PG3A