3X1YA

Ras-related protein rap1b(l9v) with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MREYKLVVVGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1yA00
1TU4A 1EG7A 1DAHA 4XH9B 5G53C 3W5IA 2JLUA 4DCSA 1N2CE 2B21A 5JHGB 5H8WA 3TW4A 2GZDA 1NBMA 4O25A 4LI0A 4M9ZA 2PX0A 1JEEA 2O0KA 3SC3A 1QHHA 2G1KA 3GLIE 3ZD7A 3TVTA 2AKAB 2IBMA 1R6BX 4S2EA 3LRPA 3TMKA 5HE8A 3EXAA 2JLYA 4MKGA 2WJJA 4DSTA 3VKGA 1KI2A 2CL0X 1JR3E 2GKSA 5FBLB 2JJ2D 4ZDJA 4FI3C 1YVDA 3LBHA 3LXXA 3U3RA 3UIEA 2C5LA 4G5RA 2QI9C 4KLZA 4URZR 5CK4A 2YVUA 2H92A 3GLGA 1F2UB 4W9MC 2Z83A 5JSZA 2W6JD 2ZRMA 3U3MA 1OB5A 1WXQA 1FMLA 2QT1A 1G7TA 1KSJA 5CYPA 5FL7A 3QEOA 4Q4HB 4DC9A 2GXSA 4TMXA 3L82B 4BLRA 1L4UA 2DCUA 4HLQB 3H4MA 3RS5A 3ZIAA 2QGZA 1TEVA 2V4ZA 3GLHA 3TBKA 3CX8A 4Q9KA 2ZTSA 2OG2A 2YOGA 1MH1A 2GEVA 1GRNA 1Z07A 3VR6A 1FP7A 1WB9A 2XSZD 2D74A 1HQYE 1V43A 3IDQA 5CIQA 4WXRA 1KDOA 1QHSA 2IT1A 2MSCB 2QTHA 4IVQA 4URVR 4M1SA 3F8TA 4DRZA 3P4YA 2HT1A 1TF7A 2O8EA 4D2IA 4D6PA 3T12A 3H0KA 4WZAE 1AKYA 4C0KA 3BB4A 1KNQA 5F2EA 2QROA 2ERYA 5DLQC 3AF1A 2OESA 1GITA 1EX7A 1QHNA 4BZQA 1RRCA 1X3SA 3QKRA 3ONWA 1XMSA 3MD0A 1W46A 4KXFB 1M6NA 5IHPA 1VKJA 4B73A 2QRNA 2GCOB 2PZFA 2IS1A 3B6EA 1E6CA 4PPNA 1EFHA 5DH9A 3SYNA 1G5RA 3SJCA 4JBXA 2BKEA 4UNQA 2VF8A 3LAWA 1NP6A 4ZV4A 2X1VA 4B74A 2A5GA 3SBDA 4LHXA 3P4XA 5FBQB 4A15A 1K6MA 1ZAKA 1KZ7B 3W6NA 4MYTA 4PHTA 4DLSA 1U98A 2BBTA 2PJZA 3DVLA 1OV4A 1GL7A 2QPAA 5CLQA 3K70B 4PC1A 5KSYA 1O87A 5EJEA 4D81A 3GPLA 4QGAA 3Q3JB 3QI2A 1G7SA 1N0UA 2J87A 4JL6A 3R7WA 5EZ5A 4EPYA 3IHWA 4YDHB 1XCGB 5FBVB 2NMVA 1FUKA 2VP5A 4NCKA 4QJ4A 2DR3A 5A4JA 4UNPA 1J7KA 1SKYB 2CCKA 4HUQB 3KXKA 4QXAA 3VR2A 1PUIA 2PMDA 1S4QA 2CMKA 3SYKA 3DM9B 4M4SA 4NYJR 3NDBB 1E69A 4TT3A 4JSYA 5SZHB 1E0AA 3T1OA 3LW8A 1E9AA 1E2KA 1AZSC 2C77A 1OFTA 1T9HA 4LHZA 5JI3E 4LV5B 2R6DA 3T61A 1IOZA 4ZI2A 5KO2A 2BJWA 2ANBA 4JBWA 2ZANA 4CEHA 4DVGA 1IXSB 5DI3B 4CGZA 4FCWA 3MSXA 2YWFA 4EAQA 1NJFA 1W47A 4LCBA 2IEZA 4IEIA 4M1KA 2J41A 2BMDA 4KYUA 3K0AB 1YJ5A 4DDWA 2VSXA 1JAIA 4AWXA 2XX3A 1WBDA 4AKIA 1KHTA 2VA8A 1G5TA 3ZZTA 2ZI4A 4NYIR 4QNMA 3GLIA 1IN6A 3QG5A 2ORVA 2FDCA 5EE5B 3FKSA 1YR9A 4IEEA 4JLOA 1Z2AA 4A9AA 2C2HA 1QDEA 2KI5A 3KJHA 5FR2A 3UMSA 2WTUA 1CLUA 2ODWA 1UKZA 1Y63A 1XEFA 1U8AA 1YU9A 2QEQA 3ECCA 3HWSA 4US1R 3WP0A 5C4GB 1NLYA 2J7PA 4Q9IA 3WP1B 4EFNA 1U2RA 3CONA 3X1YA 2D3WA 5TDHA 3RS0A 3EPJA 1MO3A 4JT2A 4LBZA 3KKNA 3MWKA 2CJWA 4LYFA 1XEXB 4DCVA 1SZPA 1US8B 2ZRHA 4F4JA 2RGCA 2AWOA 5L8VA 1G8PA 4D0NA 2XOKA 1OH8A 4LOAA 4MGIR 3I62A 2BDTA 5SZJA 1DG1G 3W8NA 1Z0IA 4QHTA 2W6IA 4DLRA 4GI7A 4TL7A 4Q4JA 2F9LA 2JEOA 3CRMA 2IA5A 4UNSA 5JECA 4ASUA 3SU8A 2R6FA 1X6VA 3EA5A 1G4UR 4QNRA 1QVAA 4ARZA 3TSWA 3ZQJA 1WQ1R 1CF4A 3QY0A 1AS0A 3W6PA 4EJSC 2V1UA 1CJTC 5TB5A 3CBQA 1Q21A 1Z6XA 3B1WA 2NO1A 2ZI5A 4OQXA 2ZJZA 1TQDA 5EXXA 2ZS8A 1M34E 5C4MA 1G6HA 2WJHA 3BH7A 3FHCB 4NYJQ 4DSNA 2FA9A 2LWIA 1K5DA 1RC8A 1Z83A 1ZW6A 3AKDA 1E0SA 2ZUCA 3AF4A 3BIFA 3H2YA 2GA8A 1ZCAA 4NPHA 5F9FA 5JCPA 1I4DD 5F9HA 3WY9A 1YR8A 1ZUIA 3M1IA 2XJ9A 3MAAC 4D25A 1D8TA 2JJ2A 4QGGA 2JA1A 3F5FA 1ANKA 3A36A 3FMIA 5FOTA 1RRPA 3TRFA 4E03A 2W6JA 1DTSA 4UNRA 1XJ0A 1KJZA 3THXB 4M2LA 3KUCA 3I5YA 2ZSAA 4O2RA 2ODEA 4OI1A 5IK2D 2YWEA 4NYIQ 4CZ2A 1MO5A 2P0EA 3PV0A 4XSHA 4V0OA 2O8FA 4JVNA 4M9QA 1GRQA 3FMPB 3P20A 5KSPA 421PA 1JAHA 3CRW1 4HB4A 3FTQA 3WYFA 3Q5EA 5EZ6B 4Z1MD 3EW9A 3QF4A 1KI9A 2VQSA 3IKJA 4B6EA 1IY2A 2QRZA 1XPRA 2YNMA 3C14C 2ZYWX 4LHVA 1RFLA 1QRAA 4Y0VA 5D3QA 4Q7KA 2EFHB 3QIAA 4Q1BA 4BLPA 2XGJA 1FZQA 1TU3A 4M53A 2ZR9A 1EFRA 3D3QA 4NONA 1Q3HA 1VYUA 5J4LA 4TLCA 3WNDA 2EFDB 2XEXA 3I8XA 3OIYA 4HDCA 2DHRA 3OHMA 4QBIA 1YZTA 2PH1A 3IILA 3AVXA 4ZIRA 4RKFA 4E09A 1D2MA 2OCPA 4Q4AB 4Q1EA 4EQ6B 4RFSB 2ONJA 1XWIA 4ACAA 4HI0E 5FOXA 4OI2A 1ZD9A 1E2FA 2R6GA 4KODA 1RYHA 1E2EA 1KK0A 3KL4A 2BHRA 4KI0A 1Z0AA 4XTRA 3TAHA 4JKIA 4LPSA 2GWHA 3D31A 5BXQC 4HUTA 1N6PA 2ZYTX 3BJIC 3R9IA 1T91A 1MR3F 1U0JA 3PEWA 5DO9A 4IJMA 5KU1A 5SZKB 2G0NA 2QN6A 2ZITA 5GJWC 3TQFA 2AHOA 2B6HA 1AM4D 1I2DA 2J9RA 2NG1A 3ASYA 3FWYA 2A5FA 4JLVA 4XVRA 3A37A 1BKDR 4JLAA 1T6NA 2ZRJA 3H1TA 5E95A 1TX4B 4BQSA 2DFTA 1Q57A 1N6HA 5D3MB 1GTVA 1S8FA 1T5LA 2EWWA 4F4CA 5GADl 1RJ9A 3AVWA 1VCMA 1OIWA 2IWHA 3RWMB 4D4LA 3ZVLA 1MO4A 3BB3A 1Z6GA 4A8JA 1UKYA 3T5GA 4U7DA 3L0SA 1VG0B 5DYIA 1II8A 1W2HA 1XTIA 4G0NA 3Q5DA 1NJGA 2JIZD 1YZUA 3A4NA 4QBFA 1W36C 2FE4A 2CCJA 4Q9HA 3O8CA 4RD3A 3MCAA 5FH9A 2NZ8A 5FBRB 3QJYA 1MO6A 2OT3B 3CX7A 3K8YA 3QSYA 3NBYC 2QA5A 4R71A 1NVUQ 2VH5R 5BW8A 4TWZA 1KY3A 3L0IB 1OH6A 4L9WA 2J0UA 1ZVQA 1OF1A 2DBYA 3QXXA 2ERXA 3NVAA 4A4DA 1G3RA 1DPFA 1S1CA 1JECA 2PLRA 2ZRBA 3SHFA 2KSQA 4GOKA 3I4LA 3SJZA 4KBGA 1MRSA 1SQ5A 2D2EA 3HU3A 1DVRA 3PEVA 3DKVA 2C03A 1PV4A 2ZRIA 4AK9A 1OXTA 4Q1DA 2RKOA 4TTPA 2R8RA 3OAAD 4MRNA 3AB3A 3QPWA 5HPYB 3QXCA 5AJXA 1WE2A 2H16A 2QORA 4GZMA 3U2QA 2QE7A 2JLSA 4WOPA 5AK0A 3L2OB 4MGYR 1G5PA 5K8LA 1G1MA 1EWQA 3I92A 3FKQA 2NGRA 4HDQB 2LKDA 4LJ8A 1Z5ZA 1OYWA 5LDDC 1E1RD 2VSOA 3IO5A 4KAXA 4WVFA 5BN4A 3G0HA 1W5SA 4AKGA 4G5OA 2VIIA 5AUNB 3K70D 2QG6A 4L4UA 4Q00A 3LVRE 3GMTA 4BLQA 4PSKA 2VHTA 2IXEA 4KVGA 2XB2A 1GVNB 1SXJB 1TPZA 2O5VA 2WAXA 4C3ZA 1LS1A 2QP3A 3NBZC 1L7VC 2O8DB 1PUJA 4JVLA 3M4YA 3A1UA 2ASEA 3ICEA 5A0FA 5H70A 1XRJA 3AUXA 3I72A 1UDXA 3B5JA 2A9KA 4M9XA 3F0TA 4B35A 4EKDA 5HE9A 3AVUA 1NN5A 3Q72A 1NBME 2DWOA 4D26A 4G5QA 1KTVA 3LD9A 5FL3A 3O8RA 5EP4A 4PTLA 2WHXA 3EZ6A 2OFOA 4V0LA 1Z6YA 2ZRNA 5L3RA 2ZJ2A 2PCJA 4ZCLA 4CT4B 3W90A 3EZFA 1IY1A 1T4GA 2QUZA 2GESA 1OKKD 3RSLA 4A0HA 3QE0A 4AI6A 2YYZA 1TEXA 3S1AB 1P3JA 1N5JA 2IYUA 4FN5A 1FFHA 1XTJA 3FOZA 5IK2A 3LLUA 3GLGE 1Z8FA 3AVVA 1Z63A 3CX6A 1T3SA 4MQBA 5JZVA 2O8BB 2ZJBA 3GFTA 1BO6A 1VDZA 4Q03A 1SVIA 1M7HA 1M7BA 4LJYA 4C7OA 3W6OA 1F2TA 2N42A 2ORWA 4GRAA 3T1VA 4Z51A 1LF5A 1R0XA 1GUAA 2JAQA 2QAGA 4M22A 4OI0A 5FTLA 4OJQA 3VX4A 5FOSA 2ZVPX 1XCPA 2IW3A 3GLHE 5EXSA 2Q0HA 3RWOA 3VR3A 5L3QB 1J8MF 4OBEA 4NE2A 4EPTA 3CH5A 1LB1B 4LJ9A 1N0WA 3U44A 1W4RA 2ZRPA 4I1VA 3U3JA 5AJWA 4OK5A 3ZQ6A 1XF9A 2MMCA 3PENA 4UJ5A 4IOLA 1U9IC 2O8CA 1HURA 4UNNA 3VQTA 3TUIC 5AJZA 2X8AA 3ADBA 3ADCA 3AEZA 1ZM2A 3KB2A 3LX5A 3TKLA 2ONKA 2GJSA 2Q9CA 2W2XA 4TZ0A 3B60A 1U99A 1XEWX 2ZAMA 4YDSA 3RNLA 1KI3A 1F6BA 2ZVQX 4BEBA 3LQRA 4A2QA 3ND9A 4LWZA 2CNWD 1JBKA 3PG5A 2C95A 4XWOA 2IC5A 4YONB 2R6CA 3NWJA 4OL0A 1RKBA 5G3YA 1KAGA 4QHYA 1JPJA 3VKWA 5BYKA 4XSGA 4G01B 4IFBA 1WRBA 3THWB 1S2MA 3CNOA 2EYUA 1XCMA 1KMHA 5CIWA 2GNOA 4CF7A 3RANA 5J47A 3FDIA 2IUTA 2QBYB 1J90A 1J8YF 3BB1A 1ZUHA 2QTFA 4ILEA 2BCJQ 1FNMA 2NO6A 1QHXA 2VHQA 221PA 1N5KA 4LJ5A 2DYKA 3A1TA 1EFTA 2ZM5A 2PLFA 1UKEA 3CO5A 5L3VA 1TQ2A 3UXMA 3A8TA 2FH5B 1G21E 3LNCA 3C41J 3X1DA 4F92B 4II7A 4WAUA 4QFMA 3RHFA 4ABYA 1NKSA 2F1JA 4Q47A 5CM8B 4CYMA 4JJZA 4PXAA 4ITRC 4YMWA 3LO5A 1N6RA 4KSCA 4EPVA 4V02A 1FQKA 1G18A 2JJ8A 1Z3IX 3C5CA 4H9GA 5DHFA 1W7AA 4GT1A 3WYAA 1DARA 4YMSA 3AVQA 2YKGA 1ONBA 2A5DA 3RS7A 4TMVA 3CWZA 2ORIA 3B9PA 3ADKA 5LD2C 3FB4A 3OIUA 1PLKA 1LTQA 1TF5A 4TMTA 1FW6A 3MWYW 2RGDA 4BPBA 2FMXA 1CU1A 1KGDA 1E99A 2OCAA 3KB1A 2C8VA 4JZKA 4Q9LA 2OBMA 1NIJA 3QUSA 5DISB 1HYQA 5DYGA 2RCNA 3GLFA 1B0UA 2RGXA 1GZSA 3BRWD 3E1SA 4DEXA 2A30A 5LB2A 4GDFA 1RRGA 2F3TA 2NO7A 4C0AC 1ZNWA 4F4IA 2HCJB 4D4KA 3DO6A 4XOIA 4A0GA 1ZIPA 1EWRA 4IOMA 2NPFA 1M1YE 3ND8A 1XBTA 1CBUA 1V5WA 4C0QC 3DM5A 3CPHA 4JVSB 4R7ZA 2H18A 3LLMA 4HATA 2FSFA 5C18A 2GXAA 4CDGA 3BK7A 2V7QD 3KXLA 2DWPA 4PFSA 4Q1AA 1XD8A 4URYR 4B44A 4WXPA 4JKYA 4CW7A 3HDTA 4PHFA 5DIFA 1W4CA 2H5EA 2PT7A 4DHEA 5IRCD 4C0HA 4P4TA 4RD2A 4H1VA 4LSGA 4MRSA 3SEAA 4TSFD 2FGJA 3NIBA 3QG1A 4R2HA 2ZE8A 5JEEA 2R2AA 1E1QD 3WMGA 3K09C 4PX9A 1ELOA 1Q1ZA 4PSVA 4RVCA 4CRWB 5F3WB 3IQWA 3QNUA 4A2PA 4B75A 4IW3B 4NH0A 4TTRA 2RGBA 5E7IA 4AKEA 1E2JA 1R5BA 2GK7A 2UVQA 1Q0UA 3F3YA 4C0JA 3TNFA 4B3DA 3LXRA 1Q20A 2FFHA 1BYUA 3ZD6A 2F1RA 4WIAA 3R8FA 2Q3MA 4N0DA 3AVTA 5BN5A 1YQTA 4DT1A 3TIFA 4FCVA 4TMKA 2ZS7A 2QMEA 5K8IA 3MJRA 1Z0DA 2A5JA 3BC1A 1KKLA 1OXVA 2Q21A 4JMPA 1Z06A 4M1OA 1E2DA 1G3QA 2ZYVX 4Q1CA 4NZYA 4A0RA 3RABA 3MJHA 4TYPA 5J4YA 1QHGA 1DADA 4W5JA 1HV8A 3OE7D 4IVRA 4K46A 1XD2B 5AUQA 4B3BA 5JHHB 5B30A 5J4VA 3BAFA 4IKEA 4LX0A 4WZBE 5FUXA 1DO2A 2XZOA 1JJ7A 3DDCA 1G19A 3MWLA 2FFQA 2WBLC 3AVPA 2Z4SA 2QMHA 1FTSA 2JCSA 3B7GA 1JALA 3A1SA 1P75A 3LVQE 2BC9A 2ZE7A 2CCGA 2QPOA 2OCYC 1UJ2A 4MGKR 4BLSA 2I4IA 3NDPA 4NCIA 5BWMA 2CLSA 3QXHA 4PQRA 4M1YA 1QZXA 2QM7A 3BH6A 4DIEA 5F98A 1W0KD 1XJQA 4BECA 3K70C 1W36D 1DE0A 2QSZA 5KUTA 2ZREA 1P2VA 4B2IA 2JATA 2FSHA 1NN0A 2XTNA 3DOFA 1N0VC 4MRPA 1GRRA 2WZQA 5FOVA 1QHHB 2GAAA 4ON9A 2D7DA 2NZJA 4KV9A 2P6NA 3QQ5A 1P6XA 1N6NA 2CE2X 4B43A 2IUUA 2GRJA 1DAIA 1XEWY 1HH4A 2PEYA 4PSAA 3IIMA 1E2PA 2WPDD 4BFSA 3K0CC 1KYIA 1TTTA 4F38A 1EXMA 2BJVA 4OI4A 4GZLA 1ZM3A 2AD5A 2RMKA 3EA0A 4TLDA 4XWAA 3GLGB 5JSZB 3CPEA 3AF2A 2C04A 2CXXA 2IXFA 1VIYA 3PUXA 4V03A 4XTCS 3KJIA 1CR0A 2IL1A 4LHYA 2XXAA 1X8JA 3CKLA 1E2IA 3NXSA 1H8ED 3AV0B 721PA 3FVQA 1CRPA 1XXHE 1CEEA 2R65A 4XIGS 3GLHB 2QM8A 4LDJA 1OE0A 4C0BA 3UG7A 2ZU6A 5KPJA 2FX3A 2LKCA 1AGPA 4XD7D 1SXJD 1UBFA 4AD8A 2IXGA 5GVRA 4C2TA 4QL3A 4TLEA 3T34A 4KFTA 5CYOA 2C99A 1ZIOA 1GIAA 4GMDA 1FL9A 5CLLA 1E0KA 3T1TA 4Q19A 3P26A 1ZNYA 1IN5A 1XU4A 2REBA 5HKKD 3PUVA 3FHOA 2O8EB 3EG5A 3NC1C 4JIMA 1E2MA 3BXZA 1G16A 2ZAOA 3GJ4A 1KOFA 2G83A 2ZJ5A 3ZDQA 1RVDA 2VF7A 1GDDA 4EJSA 1DAKA 1SVOA 2CK3D 3PEUA 4QJ3A 1AS2A 1R8QA 1BMFD 4R2IA 4TYYA 3QKRB 4HLCA 1KI6A 2IF2A 1LVGA 2WOJA 4IXMA 2VP4A 3T1QA 1N6LA 4B3FX 5HZHA 4TYWA 3V9PA 5KSZA 3HR8A 2YWHA 1E0JA 5AR1A 4V0NA 2JLRA 3X1ZA 3BGWA 5J40A 3UK6A 4AYWA 4HB2A 5JCZA 3QPUA 4A6XA 2A5YB 2GJ8A 2CHQA 1P60A 4X8LA 1W4AA 121PA 3RS3A 2D62A 3Q8XB 2YINC 2H57A 4OHVA 1DBSA 1NG1A 2N1BA 5EQTA 4Q7LA 5TV2A 1Q3TA 4KFUA 3R7WB 1LFDB 2W58A 2CL7X 2PZGA 3I5XA 4DB2A 2MMGA 1LS6A 3AVYA 4GOJA 4YLGA 2GXQA 3EAQA 3GJ7A 5B57C 5C46F 4E07A 4LV8B 4L8GA 2P2LA 3U4QA 1CP2A 2VPPA 3V00A 3DOEA 1UEIA 3BH0A 1P62B 2ZYUX 1T0JB 1H8HD 4KCGA 4W5WA 2ZSFA 3U3KA 2W2TA 1LF0A 4LY6A 4XJXA 2R44A 5DSZA 3SDZA 3A1WA 1X1RA 2V7QA 5DHAA 2I1QA 3VX3A 1QG4A 3K53A 4TZ6A 1OFUX 1FPMA 3PVSA 4J0QA 4QGFA 2OXCA 3TSOA 2WIAA 3G5UA 4CEHB 1D2EA 2AR7A 4CEJA 4TSFA 1UBEA 2C9OA 5JRJA 2UZ3A 3SS8A 1XB2A 1FNNA 2AD1A 4HAVA 1E1QA 5BN3A 3LQQA 1OYYA 3CRRA 4I1SA 4RZUA 4RZXA 3CZPA 4B48A 1OIVA 2C96A 4JT4A 2IYTA 4PO1A 4YXWD 2BV3A 2ZUDA 3ZLJA 4QM6A 3GLIB 4BFWA 1PZNA 1T5IA 1YR6A 3IEUA 1KK3A 2PBRA 3QVVA 3DZDA 2QP9X 3FPAA 4B76A 1K8RA 4DCTA 1UAAA 2NQ2C 4YC7A 1P9RA 2Z0MA 2ZJAA 1KI1A 4M1TA 3O8BA 5AUOB 4PQYA 1UADA 5E7MA 1R0WA 4Y0AA 4Q9JA 1KIMA 4KVAA 4OQMA 2JLXA 1OHHD 1J99A 1S3SA 2GVZC 3T06B 2GXUA 2YWGA 2CJWB 3KXIA 2V9PA 2VRWA 2XSZA 4X8OA 4UQOA 2Q3HA 2Q3FA 4R9UC 4YMTA 2V3CC 1WBBA 2IUSA 4PO8A 1HE1C 3W3ZB 3LH5A 1YZNA 3GEHA 2A78A 2O52A 4U00A 1JB1A 4Q5IA 1PLLA 3K0FA 1OXUA 5CK5A 2ZUBA 1CJKC 4BLOA 3KFVA 2B7CA 2FF7A 1XXHA 3NEJA 4Q4JB 4OHYA 3VHLB 2GEDA 5JFGA 3RLFA 3THYA 4L15A 3BD9A 2IYQA 3D7MA 3L43A 1OXSC 1VTKA 4ARZB 4M1MA 3ZJYA 4F7WA 2Q9BA 3J81k 4B2PA 5FFMA 3PFIA 1YZQA 2CE7A 4TQUS 4DJTA 1UFQA 1HA3A 1Q1QA 1W0KA 3GJ3A 1A7JA 4AURA 4JYBA 2TMKA 2Z43A 2Z4RA 1E9DA 1G64A 4A2WA 4G5GA 2FJUA 3DKPA 1S1MA 2C9CA 3JZAA 4B2LA 4M0LA 1E79D 2BM1A 3EARA 1AQUA 5E7JA 1TADA 1W49A 4KYIB 4K8OA 4UXHA 2NTYC 2WWWA 2DFKB 1I4TD 4OJKA 3JVUA 4KFSA 1W0JD 4IFEA 5FR1A 1A2BA 1DG3A 3OF5A 2EW1A 3RRYA 2VEDA 3I8SA 1TQ6A 2WKPA 3QEJA 5EE1A 4L5BA 3KTAA 2B8WA 1NMXA 2GAOA 5CM9C 2G9NA 4DIDA 1IAQA 1IJEA 1W2GA 4BASA 3CR8A 1KJWA 2JLQA 2CBZA 2VHJA 1SKQA 4LYAA 2CHVA 3BFXA 3LA6A 1ZYUA 2H8KA 2WWXA 3OEHD 2O8FB 2OAQ1 2IX3A 2CHGA 2D2FA 3KKPA 1ESNA 4ZI3A 2WWGA 3E2IA 3VU9A 2J1LA 4LC1A 3MRSA 1WMSA 1ZMXA 4HSEA 4CEIA 2OZEA 2ZRFA 5DI9A 4D0LB 3SFZA 5FPTA 2AFHE 3QF4B 2W00A 4XD7A 4OHXA 2WIBA 1DEKA 4AYTA 3BBPA 4FD2A 2NOAA 4IDHA 1R2QA 1KSGA 1EX6A 2BOVA 4P4SA 2WSSD 1GKIA 2IYXA 1NMZA 3WBKA 5B64A 5HKKA 2FPMA 2RAPA 1E9RA 4MGZR 3U5ZB 1G3UA 2FGKA 2XNSA 4KLNA 1TQ4A 4HEJA 4FCTA 4IDNA 3BS4A 4TYQA 4D82A 4MYCA 4PZYA 1O3YA 1OT3A 5G3ZA 2CK3A 4HZUA 4TN1A 3AM1A 4IXNA 5K8UA 1BMFA 2ZRKA 1AZTA 1KZGB 3VAAA 3ZH9B 2ATVA 2JJ1D 2EYQA 1NLZA 4MUBA 4ZIRB 8OHMA 1KSFX 2MSDB 3VNUA 4F93B 1GAJA 5KNBA 1NG9A 2WJVA 2P6RA 1E2LA 2KWIA 2E9SA 4RCYA 1GP2A 2OFXA 4RZ2A 2HF9A 3KUDA 1UPTA 2AKYA 1WF3A 3FYHA 3QENA 1OJLA 4OK6A 5CB8A 1TF2A 3LW7A 1MABA 5FBWB 4D4MA 2JASA 3W9YA 4JLKA 1FX0A 4TL9A 3C16C 1VIAA 6Q21A 1DS6A 1SXJC 4A6PA 4UXIA 5JEDA 4HB0A 4LPKA 1CJVC 1NY5A 1E9FA 3UATA 3RAPR 4ESHA 1K5GA 3U61B 1GOTA 1X86B 1P73A 2RGEA 3CW2A 3RRMA 2VP9A 2F43A 1ZM4A 2OLKA 5UKDA 5C2JB 3IEVA 1C4OA 2X77A 3SR0A 2GJAA 4IRUB 4HAYA 4WBSA 1L8QA 4FMDF 3DMNA 4LBVA 3GLFE 4KBFA 4O2LA 4MRVA 4AKHA 3M0EA 4ERNA 3I3SR 1L4YA 1RJ9B 2WWIA 4XVQA 4Q7MB 1AK2A 2SHKA 1Q1BA 4FMBB 3WNCA 2WSMA 4Q18A 4A8JB 3TR0A 4PQFA 4LJ6A 3EIEA 2K5UA 1H8HA 3LFUA 3PJRA 2IHYA 4LV6A 4NU0A 1II8B 2GZHA 4LYHA 1XD9A 5HZKA 3SHWA 1AIPA 3U7HB 4A82A 5KSOA 4E5UA 1IJFA 2D06A 2J45A 3D6TB 3X1WA 3EX7C 5H68A 5E3HA 1OH5A 2BWJA 1ZP6A 5HR5A 3GFOA 4BLTA 1IQPA 4M1WA 4QRHA 3O47A 3PIRA 3BWDD 3G82C 4DLVA 1CIPA 1F48A 1YHNA 1ZU4A 2YC2C 3BERA 1N5IA 3KKQA 4P32A 5JLJA 3GCGA 4NCJA 1RIFA 1YE8A 4IDOA 4OHWA 2UKDA 1U9IA 4A92A 4JVMA 4JLNA 2QQ0A 3B8HA 2J0UB 2JLWA 4O3MA 3QKSA 4RD6A 1QG2A 2G77B 2I3BA 4DWJA 4DXAA 4YXWA 1OFHA 1N6OA 4C0LA 5BQ5A 2J46A 3LBNA 1L2TA 5CB6A 3B1XA 4QC2A 2EFEB 1XTKA 3RC3A 1PJRA 4GOXA 5TVKA 3WBJA 4EPRA 1UDWA 4Z1MA 2EU8A 2OAP1 4PANA 4BFZA 3K9NA 5LBIA 1I2MA 1G8YA 2GDJA 2ZROA 5FTJA 1KO4A 1TUEA 2XTMA 1NL3A 4LBWA 2VHUA 2ZJOA 3UMFA 5L3SA 3A1VA 4PPFA 3KDSE 4Z8YA 2HLDD 1IXZA 4XVUA 2BKUA 1VYVA 3CF6R 4BFUA 1WP9A 2QMUA 3CNLA 5JI2E 1EGAA 4A1FA 4B3GA 2G0TA 2NO9A 3ZZ0A 5C1BA 3EPKA 2JLZA 1NNEA 1ZCBA 1HT2E 4FMCF 4LJ4A 3CNNA 5JBQA 3P32A 5TXGA 4RKEA 4LBYA 4TYNA 3E5HA 2FSIA 2BMJA 4BRWA 4HDOB 2ECKA 1ZINA 2FWRA 1AN0A 4PAOA 3CPJB 4OK3A 1OB2A 2D7CA 3DMDA 2C78A 1KDRA 2HDNB 2WICA 2EWVA 2ZRAA 1EK0A 4NTZA 2RGAA 1XZPA 3CR7A 1BH2A 4C9BA 3EC1A 4C2UA 3C8UA 1HE8B 2WJIA 4QBHA 2IHBA 1G20E 1P5ZB 3CH4B 4BFTA 4GL2A 1E79A 4FXPA 4M9SA 4NDZA 5EUMA 3EIQA 4EFMA 2ZETA 1SULA 1ZU5A 3B85A 4OYHA 4S35A 1UKVY 2IF0A 2BEJA 1W0JA 4FW9A 4WW0A 4PC3A 4L9SA 1VPLA 1YKSA 3MLEA 4B3XA 1PVOA 4Z54A 3Q85A 2ZR0A 2IS2A 1H65A 2CEAA 2FFBA 2PT5A 4ZDWA 4BGDA 3TLXA 4P0TA 3OZXA 1D2NA 4HYYA 5GJVC 521PA 2OBLA 2Q9AA 3U6KA 4DZZA 5KTYA 1F2UA 4BEJA 2HXYA 3NH6A 3ZYCA 5JJLA 2R9VA 4U5XA 3B1ZA 2DWQA 4YQFA 3HU2A 3SI7A 4LHWA 3NKVA 3OEHA 1G17A 4Q4HA 2RGNC 3CIOA 4JLPA 3K09A 3IBYA 1CR4A 3IGFA 2JIZA 5EE3A 4C7OB 1JR3D 1F2TB 2B8TA 2BBWA 2F1IA 2CDNA 1U8ZA 2QAGB 2J7PD 4HLUC 1G9XA 1G8HA 4JLJA 1KI8A 1AS3A 2OE2A 3THOA 1FTNA 1YRAA 3N5CA 3K0SA 4V0MA 3KQKA 2J7KA 2QP4A 1CJUC 2AL7A 1G8GA 3FFBA 1MV5A 2NO0A 4K81B 4M21A 3L0OA 1W4BA 2V8OA 4JYCA 3U44B 4BFVA 1G6OA 1NVWQ 2ZRGA 5ANRB 3KQHA 1BS1A 3WNBA 4QHSA 1XPUA 2QY9A 3AF0A 2O8CB 3QXSA 4B47A 4JSTA 4LJ7A 1U90A 5EP1A 4AIIA 2CLDX 4RD0A 3HPQA 4IOKA 3UWOA 4GBMA 1IN8A 5FPHA 4ZCMA 1E4YA 1YZLA 2RHDA 4JL8A 5DE3A 1VHTA 2VBCA 2JJ1A 1SVKA 3A58B 2VLIA 4URWR 3OAAA 4RFVA 1GKUB 2E1RA 3B1YA 3AGPA 4URXR 4DDTA 3CLVA 1NN1A 3NHAA 2GCOA 3PITA 1YZGA 4PPGA 1IXRC 1II0A 1Z2CA 3RYTC 1Z29A 3GJ0A 1ZD1A 2HYIC 3TUZC 2WVJA 2KE5A 3REFA 2IK8A 4FIDA 2RHMA 1KMHB 2C9YA 2DFLA 1VYTA 2ZSEA 5CDFA 2IS4A 1M8PA 1GILA 2XTZA 3OEED 4QOSA 3T15A 1E1RA 1VECA 3I61A 4CIDA 4YMVA 4LK2A 2BM0A 2QL6A 2FPLA 2JDID 3REGA 1JXMA 3GJ6A 4TQ9A 2PL3A 1Z22A 2XJ4A 4QBGB 3QBTA 3I73A 5J5CA 1P2SA 2VYFA 2OLJA 2KB0A 3C15C 4PAQA 4QGHA 1GL6A 4MKHA 3AVOA 4Q02A 3T35A 3CF2A 2I1VB 4LC0A 3JZMA 2QGNA 1NKTA 1ZNXA 4QKQA 4RCZA 1E2GA 4HUQA 3A6PC 4KHZA 5JJIA 3M6AA 2BMFA 2QPTA 1SGWA 1QHIA 3NG1A 4RD4A 4UXJA 3EC2A 2G6BA 3MFYA 2V6IA 3K0CA 3KKOA 3L8ZA 4JL5A 1VG9B 5KNCA 3R9XA 2AX4A 3TE6A 1F60A 2A3RA 4C4PA 1YZKA 4BUJA 1P2UA 2QTVB 2OM2A 2WWHA 4NHOA 2OBNA 5FOWA 4KFRA 3GLFB 3N70A 3RDPA 2REOA 4EFLA 2ZI3A 2PEZA 5AJVB 1HQCA 1LY1A 1VCIA 1WCV1 2BEKA 1CULC 2BCGY 2PCLA 2WJGA 3CUEF 5DI3A 2AK2A 1T8TA 3FGNA 4RSGA 3OFND 1GNPA 3K0AA 1FOEB 5JMTA 2XB4A 2C98A 1OKKA 2WMNB 3KJEA 5KDLA 3SBEA 2G1JA 4PZZA 3K0EA 4ZDIA 1KJYA 4PR0A 1S3GA 1EFRD 1XP8A 1IN4A 3I32A 4B32A 4UJ3A 3U3OA 1NVVR 2XAUA 1OW3B 3SJBA 3PXGA 1P2TA 1PLJA 1RYFA 3IBGA 4X8HA 1CS4C 3PUYA 4TL8A 5KDDA 2N46A 5BYJA 3W8RA 1M7GA 4DLTA 4DLWA 1E2NA 1VHLA 1OSNA 2ZPTX 4TTQA 2JGNA 2AFIE 4RZ3A 5CJ2A 1NSTA 4KU4A 1KAOA 3FMFA 3K1JA 5HTKA 1JPNA 1XEXA 2HLDA 3U7FB 2CVHA 1US8A 5KOYA 2ZI9A 1UF9A 3PR1A 4HAWA 2GCNA 3TVDA 4AYXA 5FI1B 1E94E 2WWFA 3GJ5A 1QBKC 2V1XA 5ELXA 1Q1EA 1MOZA 3NTUA 4DT1B 3IPYA 1N3BA 2J0SA 2GVDC 2XZPA 2F3RA 2XZLA 1IONA 1Y3AA 3I1FA 1QVRA 3U60B 2YOHA 4KITB 1JQLB 1Q22A 4PO9A 3DHWC 3UWKA 4A0FA 2HJVA 2KBFA 1N5LA 4B3CA 2CNWA 2EQBA 1R4AA 2GZAA 3HYTA 3WHKA 1J70A 2HUPA 5IF9A 1P4SA 1ZJ6A 2FEMA 4DKXA 3FHTA 2QZ4A 4GP7A 3IUYA 2L0XA 1TUIA 3CM0A 1DAMA 1AGRA 3HYRA 3GEEA 5HCIA 4BRUA 1F3OA 2VSFA 3HR7A 5TMPA 3ZS9A 2A7QA 3AUYA 3P27A 4TQAA 2F55A 4IDQA 1MKYA 3MMPA 2A2ZA 4JLDA 1Q44A 4MH0R 2YC4C 1GNRA 3TJZA 1CR1A 3NHBA 4D4JA 5EE0A 1RE0A 2GK6A 1JXOA 2GILA 2ZXUA 2IYYA 3P1JA 1NN3A 2ZS9A 1FP6A 4FWIB 4HAXA 4URUR 3GJXC 4P31A 5CITA 2V6JA 1S0UA 4KO8A 2Z5FA 3WRYC 1R5NA 1MRNA 3THXA 2QQEA 4DLXA 2WAYA 3TQCA 3UG6A 4D0GA 5JWHA 1JNYA 2R6AA 5EXTA 3O8DA 4XWKA 3ZVRA 1NVVQ 3N2IA 2W0SA 1JR3A 1Z47A 2GF9A 2VL7A 2W0MA 3GD7A 4CT5A 1VCNA 2FSGA 3U6BA 2ZJ8A 1KMQA 2FOLA 2VP2A 3A4LA 3AKEA 3VR1A 1E96A 2ATXA 3WXMA 4EUNA 4ZKDA 1JI0A 1NRJB 4I1OA 3ADDA 4QM7A 2QE7D 1OPXA 1KDTA 4OKSA 1W5TA 1UEJA 1R5OA 3PUZA 4D80A 2ZRDA 2GHIA 2ZSDA 4LZZA 2GETA 5KPDA 1SXJE 3KJGA 3ZZUA 3V4FA 1EFUA 3B78A 3Q9LA 3QF7A 3TSZA 4Z8XA 1D9ZA 1G291 2RGGA 3KZ1E 5FTNA 4EDHA 2XXAB 1LV7A 4AC9A 2ZR7A 1P9WA 2FEOA 3NBFA 5FUYA 3TGPA 4I4LA 1CR2A 1TL7C 4MRRA 4DB4A 4ESVA 4OQNA 4EPXA 4DCNA 1U81A 3SYLA 3K9HA 4Q01A 1W48A 3KFXA 1R10A 4B34A 4BE7B 1QF9A 2V55B 4R98A 1IM2A 2FV8A 5EP2A 3SZRA 1SHZA 1GWNA 4Q4AA 3EWAA 1NMYA 2ZI7A 3AKYA 4EQ6A 4RFSA 1Z0KA 3VTKA 1IY0A 2P3SA 4MKIA 1Z0FA 4W7SA 1XPOA 5J4KA 3B1VA 3FMOB 3HPRA 1W1WA 5M04A 3W5JA 5FTMA 1XJCA 1ESMA 1E3MA 1AJEA 4Q21A 2G3YA 2J5XA 3CRVA 2OXRA 3OEEA 2GTPA 3NC0C 1RPZA 1DOAA 1N6IA 2VO1A 3MWJA 1CKEA 3H86A 4P33A 1E9BA 1XTQA 2JDIA 4EJSB 1VG1A 4Q66C 1G4AE 1OIXA 2YJTD 4LYJA 4BWYA 4X8MA 1KI6B 1NI3A 3CB4A 5EP3A 2VP0A 3KQLA 3DZ8A 2RH5A 3MUFA 3QVUA 2FN4A 4DUGD 5D3MA 4A36A 2H7VA 3BORA 1XZQA 3UMRA 1X8LA 2B92A 2QT0A 1OFIA 2PZEA 4E22A 1SHKA 1VG8A 3AGQA 3BOSA 2LCFA 2VP6A 1VMAA 4LRWA 3OE7A 5AJYA 4RD1A 3KX2A 2UZIR 1GG2A 2CLCX 2E87A 3MG9A 5DNYB 3HU1A 4IVPA 3W3AA 4RY2A 3TK1A 4P3YA 1NLFA 2J3EA 1II9A 1DAGA 3QOFA 4C0SA 4NCHA 1RZ3A 4JJKA 4QJ5A 5KNDA 2QAJA 4HLDA 5EUQB 2IYZA 3QBVA 2P65A 5CJPA 1XTRA 2AXPA 1D9XA 1T8UA 3CZQA 3VMFA 2GCPA 3OFNA 1ZC4A 2ZRCA 3WMEA 3U4QB 2OSBA 3SNHA 2B7BA 3OIVA 2W83A 4PHGA 1E9CA 3NH9A 2R62A 4ZO4A 3RS4A 4NL4H 2EFCB 1E9EA 1DELA 1HEIA 2HEIA 3L8YA 4MKFA 3LDAA 3RRZA 2IYSA 4HAUA 3QXJA 4IHQA 2F7SA 3D8BA 2GBLA 4O0MA 5FUVA 3UKDA 4DBLC 1BOFA 5IDVA 3PCRB 2HCBA 2ZRLA 4ZPXA 3TW8B 4CEJB 5FPYA 1XNJA 2HF8A 4Q48A 3EPHA 4FWTA 1I4LD 1KKMA 2WPDA 3U7EB 3SN6A 2D4HA 2ZE6A 1R0YA 1KO5A 2FZLA 2J59A 4TLBA 3DEFA 2PX3A 4DLZA 4MYHA 3VR4A 1Z28A 4OHZA 1UM8A 3LY5A 5B2ZA 1DAEA 2ZEJA 1S96A 1S9DA 2O0HA 1S9HA 3U7GA 4MDEA 1G41A 2OHFA 4EIWA 4FINA 3IHLA 1ZM7A 5LPNA 3SQXA 1U94A 1NY6A 5FOUA 3WYGA 4DLUA 2PJRA 5A5GA 1H8EA 2P6UA 1G3MA 1QHYA 1R8SA 4PC6A 5B58C 3L0PA 2XNDD 2YHSA 5DN6D 4IOJA 1FUUA 2OFWA 2WV9A 1ZUNB 3BFVA 1SXJA 2WM9B 2HXSA 1WA5A 1KO1A 4NMMA 3RS2A 4GFDA 2GBLC 2YOFA 1ZNZA 2O8DA 3KQNA 3C5HA 3WHLA 2HV8A 5E4FA 4HB3A 3T5DA 2FFAA 1GNQA 5GVSA 3B82A 3K0FB 1RRFA 1CRQA 3VFDA 4JS0A 1HUQA 2F6RA 2FG5A 4PZLA 2KJQA 3GJ8A 1XXHB 2XITA 4MUAA 2VTKA 2ODNA 4AG6A 2IEYA 4F91B 5JJKA 2FU5C 3MGCA 1E9SA 3V4RA 3THYB 4JLBA 4W5HA 3IIJA 3RVBA 1JR6A 2QU8A 1F5NA 1COWD 2P67A 4RJLA 4M8NE 3EZ2A 4GPTA 4HZIA 2AK3A 3JVVA 3ZVMA 4AG5A 1MT0A 2BVNA 2OUKA 1W36B 2X19A 4LJAA 2DB3A 1OLOA 2DFNA 4DSOA 3S1AA 2BBSA 3GQBA 2ZJYA 2ZIAA 3ASZA 3GP8A 3R9WA 1KI4A 3IIKA 2BMEA 2OO7A 3ZGXA 1NBMD 2NPIA 1KK1A 4BFXA 1SVMA 5AUPB 4NP6A 2O8BA 4TMWA 2GJKA 1E32A 4H1UA 821PA 4P4UA 4A8JC 1XFAA 2X2FA 3SQWA 3LV8A 3RSOA 1ZRHA 1GM5A 1TNDA 1ZD8A 1RW4A 2ANCA 3KTAB 4NKRA 4PPQA 1HTWA 4DDUA 5J4HA 2NIPA 1R0ZA 1D5CA 3HJNA 5HCNA 4HAZA 1X1SA 2IYLD 4YMUA 1T0HB 2FNAA 5L3QA 2F9MA 4V0ME 1U8YA 3Q7QA 5GJBA 4DLYA 1WDTA 3IPXA 2YZ2A 1XMJA 5KDOA 3ZVNA 3AF3A 1Q12A 5H1YA 1GL9B 5KYKA 5FL7D 2HT6A 4NCNA 4JLMA 4ZCIA 3RRNA 1SVWA 5TY0A 3VU9B 1HY3A 3EPLA 4MDFA 3PEYA 2PMKA 1DO0A 3ZIAD 4CEIB 3OIWA 2OCBA 1G3IA 2FPKA 2DY1A 2ZSBA 4MITA 4N3NA 1JJVA 1ODFA 2GF0A 4PAMA 5G40A 4UKDA 5FPSA 5IT5A 2P5TB 1A2KC 3N2EA 4OQLA 1KY2A 3BE4A 2YV5A 3WMFA 5FI0B 4P4SB 3FE2A 3K9GA 3CWQA 2CL6X 1LW7A 3WRXC 2ZU0C 2WKRA 5JS7A 2BIFA 5FTKA 5JS8A 2W2VA 3KQUA 2ODBA 3THWA 1E2HA 5AWFC 1U0LA 5EE9A 3IO3A 3VKHA 4WA7A 1TAGA 2QNRA 4KSBA 1OXXK 2QBYA 5CDFE 1GKYA 1M74A 3C4JA 4HZUB 1XDBA 3AKCA 4BFYA 3QPVA 3NEYA 4DSUA 3AP3A 3AP1A 4GSYA 2EFGA 1KK2A 3SOPA 2P5SA 3PQCA 1D6JA 4LGMA 1P61B 4GP6A 4TMZA 2J0VA 3GFPA 3DL0A 4DUGA 2JLVA 4V0KA 1YR7A 1T3LA 3RC8A 5LB4A 1OHHA 2ZE5A 1ZC3A 3R8CA 4MA4A 1DAFA 4KJZA 1Z08A 1P7CA 2WWYA 3QKTA 1MABB 1GSIA 1NF3A 1SKYE 3W34A 1FX0B 2CVFA 1U0HC 5TARA 1AA9A 4US0R 3HP1A 2QSYA 3B2EA 3EWSA 4BZPA 1KO7A 4FMDB 5P21A 4NBSA 2RB4A 4DDVA 1AKEA 3KKMA 4Q7JB 2F43B 4B6FA 1Z6TA 3EZ9A 4B71A 4B33A 1FMJA 4I99A 4BZXA 2G88A 2REXB 2QMOA 4PC2A 4MYUA 4AY2A 1JQJC 2IYWA 1E98A 2AXNA 1KSHA 2GEUA 2OV2A 4NYMR 3VNVA 1IHUA 1ZM9A 3H84A 2O0JA 2RGNA 3Q7PA 1IBRA 3ICQB 2X2EA 5KHOC 4PC7A 4US2R 2ZQ5A 3QKUA 1XMVA 1P9NA 3IQXA 1HT1E 1BIFA 5FUWA 5K8TA 2IYVA 2Y8EA 3UANA 1T3HA 1ZBDA 4ZDKA 4TT3D 1VCOA 2FZ4A 3PUWA 4HLUA 1LNZA 3LBIA 2KBEA 4I81A 3EIHA 2H1LA 3ZS8A 4LUCA 4Q1FA 3R20A 4TL6A 4GNKA 1J2JA 2WOOA 1XMIA 5G41A 2V54A 1CTQA 3AQ4A 3K9LA 4EPWA 4L16A 2AN9A 4GMXA 1GFIA 4I1UA 3EZ7A 2HYDA 4POAA 3X2SA 1X8KA 2DPXA 3VHXA 1FQJA 3OESA 4U02A 1TMKA 2MSEB 1CJMA 2Z6VA 3X1XA 1NSFA 1A1VA 1OH7A 2Q6TA 4WZ6A 3AH8A 4PHHA 2QAGC 1KO8A 3QKSB 1E4VA 2GJ9A 4DCUA 5JWRA 1R7RA 2ZI6A 1B23P 621PA 1N25A 1JEDA 3TH5A 3TR5A 1W44A 3EASA 2WJYA 3AP2A 1UBGA 3TAUA 4G1UC 3TUJC 2EVWX 1KI7A 1M2OB 3B9QA 2WKQA 1SVSA 3CF0A 4DEYA 4IDPA 2QENA 4QG7A 1CXZA 3DPUA 3FKSD 4Q4LA 2J0QA 3LX8A 3CRQA 1C9KA 5GJCA 2OILA 2VHCA 5SZIA 1IN7A 2XNDA 3VR5A 5DN6A 3B13B 4ZKEA 4C30A 1XTSA 2IWRA 1G7CA 1NIPA 3SFVA 4TLAA 3BFKA 4JBYA 1G8FA 1N6KA 2H17A 2OEPA 1A5TA 5L3SB 3E70C 1Z6AA 3UPUA 1E2QA 1BYIA 1G7RA 4FMCB 3SE0A 2WSSA 5JWOA 3ETLA 1UBCA 1KNXA 1Z0JA 1XD2A 4N1AA 1C1YA 3GEIA 2AWNA 2XOKD 2HJGA 3A4MA 5JRZA 5FPKA 3FFAA 3C7KA 3SJAA 4ACBA 4N0EA 2W6ID 1EESA 2IYRA 1NVXQ 2F1HA 1KDPA 5DGXA 4ASUD 3LWNA 4G5SA 1A4RA 1P72A 1EFCA 1ETUA 1A82A 1AQYA 1SVLA 4G3XA 2WMOB 1XX6A 1COWA 4OQFA 3NBXX 2BBOA 4CVNA 4NYMQ 5LD2B 2IS6A 1YRBA 5EXPA
chains in the Genus database with same CATH superfamily
3G8DA 1MAAA 3GAZA 1TJ5A 3OY2A 1N33B 4BNWA 4MAMA 5M29A 1PO7A 4XH9B 4M49A 4RPJA 5ALNA 2JLUA 2PAFA 1N2CE 3T0FA 3U31A 3G9XA 1CDEA 1GV1A 2CUKA 2QW0X 3KLPX 2GZDA 3HV0A 2YV4A 3SG0A 3BFPA 1JEEA 3SC3A 4K3UA 1QHHA 2O3RA 2G1KA 3H65A 3PNOA 5C34B 3TVTA 3ZD7A 5ALWA 1E1YA 1OXMA 4S2EA 1ZVMA 3BXOA 3DMTC 3EXAA 5KC9A 4AB1A 1VFNA 2WIKA 2I3GA 4MKGA 2WJJA 1D2AA 3T3DA 3RK0A 3WWEA 2VAVA 2CL0X 1CRWG 5JRDS 2O59A 2GKSA 5FBLB 2JJ2D 4I4CA 4ZDJA 3U3RA 4KXQA 2LUOA 2Z08A 2AJCA 4A2CA 1M1XB 2GAFA 4RC9A 1NI4A 3OEWA 3P0FA 4YJ3A 3H13A 4I66A 1TIBA 5JCXA 2J5KA 1PJLA 3TW6A 2H92A 3EGDB 1F2UB 4BP8A 4YJFA 4EYSA 2A59A 5F52A 5BUCA 4HTFA 1WZEA 2F00A 2UUOA 1PFVA 2X4LA 4H4CA 1ACJA 1XZHA 5LXTA 2NP6A 1R9MA 4WJKB 2V9ZA 1KSJA 3QX9A 5CYPA 5AKHA 4E5YA 1Y8CA 2WFLA 3LPMA 3DULA 3I34X 4NBRA 4S1TA 4IKOA 4TMXA 4EWLA 4YDQA 2YXEA 3MMSA 1X38A 3L4EA 1M5TA 2DCUA 4HLQB 2BFPA 3ZH2A 1XYGA 1CY0A 2V4ZA 4L7QA 4UDOA 2Z5VA 3H5AA 4PONA 4Q9KA 5J40A 1E7MA 2Z3WA 3HDGA 2BL4A 2EKPA 3R3JA 4FFNA 4XGKA 2YOGA 1NJSA 3I1JA 2B4KA 4MS4B 4C5CA 1GRNA 3I01M 4UOEA 1FP7A 2GM9A 1U2QA 4WXYB 3H3JA 1QOQB 1W5AA 4HWSA 1V43A 1ZJZA 2YNMD 1FFDA 3OWHA 5C31A 5CFQA 4Z9FA 4L5JA 3RJTA 3HFSA 2Y2UA 2FZEA 4M1SA 1AN9A 2LIVA 4DRZA 3ETEA 2E6KA 1BA2A 3QFRA 3HCPA 4UREA 5T64A 4C4YA 4D2IA 4DNQA 4D6PA 3H0KA 1Y37A 4C0KA 1UZMA 2AE2A 3G0BA 3HVIA 3QBDA 4JU8A 4YK7A 2WIFA 2QROA 3UN1A 1IG0A 1KHHA 1P44A 1QIJA 1U6JA 2ERYA 4FNOA 3VPFA 2QN2A 3W8DA 3VVBA 4J0CA 2OESA 1GITA 1EX7A 1SCIA 2JFGA 3ORYA 4AZ0A 4BZQA 1AQJA 4TS3A 4X3OA 1RPTA 1NDUA 3O4JA 4HPWA 4DMKA 1HBJA 1BDHA 4CDRA 5IHPA 2HSJA 4PGFA 4ZCTA 1SVNA 1U3GA 4J0KA 4LSWA 1WVIA 3MLBA 3PNVA 2EEZA 2IS1A 4R51A 1EFLA 1EFHA 1QYRA 4PZAA 3NW9A 4FP9A 4TX1A 3WLQA 4EMSA 1G59A 2OK8A 3AYZB 3DKRA 4RVOA 4C08A 3KSMA 3EQZA 2X1VA 3C39A 2PGJA 4RIGA 5D84A 4B74A 1T9DA 5DOVA 1Q92A 2XBLA 2QSUA 3DQZA 3W6NA 3V8EA 1X94A 2XMBA 3HGMA 3HKCA 4H7IA 4PHTA 1RYZA 4UEOA 2GPNA 2BBTA 4YCAA 3R5TA 3DVLA 1FRZA 1OV4A 1OAOC 2JNWA 5CLQA 1KA9H 2J3KA 3K70B 1J1ZA 5EJEA 2WG2A 1L1EA 4D81A 3OE4A 3PD0A 4FHGA 5BORA 3R2JA 3UOWA 1N0UA 2VJCA 3WRYA 5J63A 1UDAA 4EPYA 1UUFA 1KFBB 4B79A 3CS3A 4M9UA 2OOKA 1ZIXA 2X7HA 1FUKA 3G0CA 4UZFA 4YDHB 1WZNA 1HM5A 3RTAA 2DR3A 1J7KA 1L0BA 1SKYB 4PZDA 3B20A 4HUQB 4ND8B 3W7BA 4TXNA 3BILA 4FDLA 3JQ6A 1S4QA 2JEZA 3DM9B 4NYJR 3NDBB 2YJ5A 2FVYA 1NP7A 2ATIA 1E69A 4H7EA 4KIFA 5DTMA 4C43A 2QV7A 4FT4A 3FPEA 1AJEA 1LQ2A 3GDGA 5TLSA 3R77A 3LW8A 1E9AA 1OFTA 1T9HA 4OAOA 4XFDA 1FMTA 2PR7A 2J4FA 2R6DA 2Y0EA 4DIKA 1IOZA 5BW5A 5GINE 4P7GA 5IHXA 1XK6A 3WMWA 4I36A 2D2VA 3QVGA 5KO2A 3PFNA 3VJKA 1VPWA 3KCNA 4TWAA 3DWFA 5THKA 1DRKA 4CEHA 3U7RA 1MC1A 1PCXA 5TQ0B 4CGZA 4D3DA 2EBFX 4FCWA 3MSXA 2AF3C 2AHRA 2JBAA 2YWFA 2DE0X 3MGKA 3I9V1 5DTRA 5AHOA 4EYKA 4UHHA 2HU8A 4LCBA 4M1KA 2J41A 5JDCC 4KYUA 1PW5A 2BISA 3TINA 4DDWA 2XX3A 1G5TA 1XQ1A 2R47A 1TU0A 3T6KA 3CTPA 1YB2A 2IDMA 3TLGA 3MIIA 3UKJA 1VL6A 3GGSA 3AHGA 4W8HA 4G25A 3MOGA 3WRVA 3HXOA 2ZKIA 5DK4A 3DD5A 3QG5A 3WBFA 1TUBA 1U6IA 2ORVA 2IP1A 5ICCA 1EQ2A 3FKSA 3PRYA 3U3ZA 5KC8A 4IEEA 4UCWA 4A9AA 1O54A 1O6GA 2X8JA 4I3GA 1WHTA 4CR8A 5EFOA 3D1VA 4INZA 2KI5A 2PTHA 1NKVA 3UMSA 5KWVA 2WTUA 1Y63A 1XEFA 2GQ0A 1UJCA 4US1R 4EFNA 2SECE 1P1JA 4Q9IA 3FUXA 5DNAA 5BWNA 3WJ1A 2FWMX 3PGA1 5JSYA 1UMKA 1WHSA 2Z1NA 4B4WA 3TQRA 4B0PA 5BSKA 4M1QA 1MO3A 1AK9A 4JT2A 1KQPA 1OY1A 2ZYSA 3KKNA 3MWKA 2CJWA 1YCGA 5CD1A 1AQLA 3VHRA 1TJYA 4MLCA 2JJMA 4N6NA 4JC0A 4OM8A 1ADFA 4X84A 2GPSA 5I4BA 1SB8A 1WUHS 2AWOA 4OLHA 1G8PA 5L8VA 3IH5A 1L5KA 4EFDA 1BQ3A 3FCEA 3T95A 2FMIA 2OCLA 3I62A 2BDTA 2W2PA 3AL3A 2Z1DA 3N0XA 2XZTA 4AY6A 1NR7A 3IXMA 2F9LA 1GTSA 1JR2A 2IA5A 4Q39A 1I2CA 1PS8A 4UUQA 1G38A 1DFGA 3TGWA 4CT0A 1H9CA 2CYAA 2VAXA 3TSWA 4GQIA 1GAEO 1O96B 3QY0A 3W6PA 5LZ2A 3BGVA 1YA4A 2H4FA 3CVOA 4EJSC 3QU9A 4P3OA 1CZLA 1E8DA 4HMQA 2B1JA 1Q21A 2XVAA 3B1WA 3L8DA 2ZI5A 4U4AA 3TW0A 1CZRA 2ZJZA 1TQDA 1U8TA 1G6HA 1A9XA 3ANTA 1P7WA 3AKDA 1WKVA 1WJGA 3UHFA 4EMUA 4X64B 5EUCA 2PWBA 4BVBA 3GZJA 1XELA 5FA5A 1BDMA 1PFYA 5LOVA 1E59A 1Z62A 3A1DA 4Q7QA 3WY9A 2H4WA 2WLSA 1ZUIA 2WDPA 3GU3A 3VAZA 4ETIA 1D8TA 2W2NA 3D3WA 4IZOA 2PGOA 5D3KA 4DA4A 3LHIA 3Q40A 4C4RA 3KHSA 4F6CA 2PBLA 3O84A 4M6WB 1AT1A 1AK1A 1AV7A 1P5RA 4NMXB 5FOTA 3M6VA 1RABA 4CIYA 1T2AA 4N4AA 4ESEA 1VLLA 2I4OA 1NJ1A 2VUTA 4D98A 1XJ0A 5HRCA 2I4MA 3UK2A 3N2KA 1XZAA 3SBOA 2APJA 1YK0A 1ZH8A 2YWEA 2ADMA 1H66A 3C3AA 4DJDC 4KB5A 2P0EA 3T0GA 1YQXA 4V0OA 2PT9A 4JVNA 1U2ZA 4ISCA 4KO4S 1GRQA 2YTZA 3GY0A 3P20A 2XMDA 2WHYA 3RYHB 5CG2A 3MMNA 1JAHA 4LWQA 3FF1A 4HB4A 3Q5EA 2ID4A 4Z1MD 4IDCA 1SK8A 2HMWA 2BTQA 3CZ4A 4AX4A 1FYFA 1XQVA 2VQSA 3BCRA 3N9IA 4YO8A 2C2WA 5ENZA 2HRCA 2QRZA 5AW5A 2G8NA 4B6EA 3FWPA 4CKYA 4Q3NA 3TNJA 4TKZA 3SS7X 2XXAA 1E7RA 4F9EA 3E0XA 1N2GA 1RFLA 3N59A 5D3QA 1E5DA 4Y0VA 5JY1A 4K8RB 1TVKA 3T4EA 1PJ8A 1RNLA 4D8XA 1AXEA 4PZPA 1XU7A 1FZQA 5ADUS 1TU3A 5FULA 2F90A 4WFKA 3LCRA 4E13A 3JQ7A 3LRXA 3E8MA 1ODTC 3P9IA 5EWLB 3VDQA 5ALGA 1P33A 3I9OA 4IS2A 4TLCA 3PT9A 3T9BA 1DJNA 2FPPB 2W8BA 3SLKA 3OHMA 1VBFA 4QBIA 5C4IA 4B3MB 1O2DA 3SY8A 3RFFA 5ALKA 1JQAA 3WSVA 4ZIRA 2ZUWA 2L82A 3R3SA 1BX3A 1S2OA 1V45E 1W88B 1T5SA 1SPXA 5GONA 3NCTA 3TPCA 3JWHA 4B3TB 3EXIB 2YWBA 3EWNA 1WD7A 2XZDA 3K6JA 3Q3HA 5ERGB 2R6GA 4LDQA 1C30B 1RYHA 5GIOE 1EGHA 1U11A 3KL4A 1ULAA 1QZUA 4XTRA 2P9GA 4JQYA 1ZEJA 4DN6A 2MSNA 3ZZNA 2ZYTX 4W5RA 1T91A 3I12A 2RE8A 5DO9A 1H1LA 4ALMA 3A4YA 4BN5A 5ITZA 4F4DA 2XT0A 3HB0A 2J9RA 2NG1A 4HNHA 4P5EA 3BREA 2C2XA 4RO0A 5DNUA 1VZ3A 2EEPA 2DR2A 3LWDA 1QOZA 4JR0A 1F14A 2WHQA 1VSVA 1J0DA 1E62A 1VSQA 3HACA 4MVJD 4YLEA 4FONA 2EWWA 4M88A 1OTXA 4FLEA 2Y1OA 2QMYA 2G5GX 2VRCA 3ICOA 1MGOA 5BNWA 2V7TA 5JCOC 4S05A 4ZU3A 4KJXA 4D4LA 3ZVLA 2Z2ZA 3BB3A 3DMHA 1Z6GA 4ZAWA 2B25A 4U7DA 4WE3A 2GD2A 3TEJA 4M7OA 4XQCA 3RVNA 3TD6A 5T5QA 1J25A 4AKSA 5IKOA 1W2HA 4OIFA 2ZSIA 1CC1S 2I7CA 3OQ6A 5CB4A 4GICA 3Q5DA 1NJGA 1IDN1 1I7PA 3OQHA 1RI3A 3U7QA 4G4SO 1G2IA 1W8IA 1RWBA 1D6NA 5JPDA 2CCJA 1AQIA 4RD3A 3TTUA 1BN7A 5DWDA 5EVJA 3URMA 4D9BA 1RAGA 2A9OA 5KOHB 2WTMA 3QJYA 2NYAA 1P0FA 3W4KA 4HCJA 4UD6A 4BE4A 2J09A 1EX9A 4IXWA 5DWQA 5LQAA 5BW8A 3GEGA 1OH6A 3H05A 1G1AA 2ZAGA 1V7PC 3EA4A 4BMYA 2N75A 2ODPA 1S8OA 4BGEA 2DT8A 4A4DA 2BGRA 1DPFA 2GZ2A 4BFLA 3L6EA 4S3MA 4Y30A 1FZTA 1YSCA 2JD2A 4NJMA 4I8IA 4UTVA 2V7XA 2B1RA 3DXXA 3H9QA 3HRKA 3MTIA 1DVRA 1ZK0A 2C03A 4RHYA 3EMBA 4B81A 4HGZA 1PGQA 5TVGA 3WRXA 4TVOA 1JT2A 2R8RA 3H11A 4F3NA 1E7WA 1V5IA 3MJTA 3AB3A 3QXCA 4UAGA 5DTQA 2TSYB 4KAAA 5D3ZA 2V9CA 2LV8A 2I4TA 5YASA 2EJWA 1WE2A 3IALA 3OA0A 1JDZA 4N7RA 1WVMA 4P36A 5CT9A 3IUBA 4N12A 1BXGA 3SC6A 2PGIA 5AK0A 3CEHA 3WGYA 4I1RA 2PXXA 8GPBA 4IIVA 3X2FA 4ZJYA 3AUUA 3NU1A 4QYIA 4WPGA 2LKDA 5G1PA 5I9BA 3FBGA 4BQFA 4DCMA 1UZUA 1Z5ZA 3NKFA 4RQTA 2VPQA 1Y3HA 2IRWA 4HFRA 2VSOA 3UHAA 2HA7A 1QIIA 4WVFA 4H6VA 3A25A 3WISA 4MS3B 4ZICA 1W5SA 3WMRA 4UBJA 5TC4A 5KOJA 1TLLA 1KJ8A 2VIIA 5AUNB 4I3FA 3DQPA 4PYIA 2ZXEA 3FCOA 3K1AA 2DKFA 3NALA 3VZBA 1JW9B 1L8LA 4Q00A 1KARA 3RT9A 3LVRE 4EEZA 3V48A 1OQAA 2YJ6A 1QFMA 3OZ7A 1Z35A 3RD5A 2VHTA 3TLAA 4DUPA 1E5VA 3H5LA 1UJBA 4ZOBA 3GUVA 3K3PA 3VNSA 1L4FA 2XI4A 2F8TA 4C3ZA 1KVRA 1PK9A 1XJ5A 1PUJA 2D3TA 1XDDA 1BQEA 3GW8A 1YJAA 2P4HX 4MUHA 1P3Y1 3M4YA 5EIFA 3BDAA 4BLWA 3ICEA 1RZUA 2VKQA 5A0FA 1B00A 1T3ZA 5F1YA 2WW8A 3FPCA 1AA6A 3SVZA 1E58A 3I72A 1QFXA 3ADCA 1QRRA 1PE0A 5DTJA 2A9KA 4KR2A 5LC1A 4UEJA 3QFFA 5HE9A 4UQLA 1LGYA 3EGOA 3WYCA 3RU2A 1FYVA 1NN5A 3H5NA 3O7WA 4XDGA 3H99A 1NBME 2DWOA 4PX2A 2HZBA 1JDTA 1IWOA 3LE8A 1KTVA 3LD9A 3VNBA 4D26A 2FW8A 5CCBA 3A6KA 4J2OA 4BV2A 5E6SA 4PTLA 1CUIA 2WHXA 1PDWA 5BT8A 3SQLA 2JFOA 3F46A 5CURA 1Z6YA 1W35A 1GZVA 1Z12A 2BZSA 4MP3A 3D64A 4X44A 4CQNA 5CX1A 5K6TA 2IVFA 1Y7IA 4D96A 1D7AA 3W90A 1N75A 3N8KA 1JHYA 1M34B 1ZDMA 4UAJA 1ECLA 3QE0A 2Q2NA 3SSNA 1HNZB 4TV8F 1TEXA 1M72A 3PFGA 1P3JA 1N5JA 2VQDA 5JPIA 2PX5A 1FFHA 2HRDA 4KE9A 3D02A 3LLUA 3WLMA 4BKUA 5J23A 3GLGE 2E4ZA 4CMBA 1T3SA 1NYLA 4G56A 4AG3A 1ZFNA 3GOHA 4KWTA 4WT7A 5LVAA 3GFTA 4HQRA 1VDZA 4Q03A 4HYEA 3G2LA 4M0UA 2Q5JA 4B3IA 4JYAB 4N3CA 1F2TA 3T1VA 2VT2A 1R0XA 4G1CA 4LHSA 2CT8A 3K73O 4DNXA 4YPVA 1WUTA 1K92A 1U0BB 1T2VA 3VX4A 2FZVA 4Q3BA 1NW3A 3IQIX 3LS2A 5IF3A 2Z5LA 1L7AA 5H0IA 4CMEA 1WXFA 4MJ7A 5TMEA 5COQA 3UUFA 3EDRA 4XSVA 5LUAA 4P6VF 1J8MF 4OBEA 2Z6AA 4EPTA 3OOHA 3X1ZA 3DFZA 2V03A 2WJZB 3CH5A 5FX2A 3L1KA 1LB1B 2P6MA 3BD8A 2ZTLA 2D0DA 3ZGYA 4NBTA 3F5MA 4I1VA 2AQIA 2Q0QA 3ZWBA 1Z2NX 1KAEA 2QTZA 3PENA 4UTOA 1PRYA 2AR9A 2O8CA 4IGKA 2O1XA 3M4ZA 3RVPA 4C5AA 4EHAA 1DHRA 2RGWA 3IERA 4PN3A 4UMFA 2JG3A 1FLNA 5AJZA 5IBPA 1GAXA 1UK7A 1ZM2A 3KB2A 4FM9A 3LX5A 2JHCA 1F6WA 3ZY5A 1XA0A 2OGUA 3IQHX 1X2EA 3OUUA 4HV4A 1T4CA 3B60A 5CA1A 1R6DA 4YDSA 5J1TB 8LDHA 1KI3A 1SG0A 2ZVQX 4Q9AA 5CAEB 1JTFA 4PBTA 1L5LA 3UJBA 4IF6A 4LE0A 3TDKA 2C5GA 5J5VA 3OLWA 4LWZA 1JBKA 1RZVA 3PG5A 3QLUA 1V6CA 2DG2A 3N86A 4MAAA 4YAFA 4XWOA 2X7XA 4YONB 5BYKA 3NWJA 1RKBA 2VDNB 3S2IA 3R5JA 3TG2A 4BCCA 4EYOA 1O97C 4GXNA 2COUA 4GKVA 1LRLA 5ETJA 3ZDEA 5J47A 4KXVA 5K3AA 2VHVA 1Q1GA 4KIWA 1ZSVA 5CD9A 1JG4A 2BCJQ 3ED5A 1NPYA 1Z2OX 4CI9A 4CM9A 2VHQA 1WETA 3T3IA 3HXKA 4BXOB 5K20A 1T1RA 2PUCA 1S2NA 1OREA 3DBLB 4BVHA 4F6RA 1BCSA 3FWKA 4U2DA 4YP6A 1LBEA 4L72A 2A9VA 5JSFA 3INTA 1OASA 2O9JA 4GOMD 4WNIA 4X61A 5B55A 2XGSA 3FD8A 3OQJA 1MG0A 2OGTA 2UYOA 2EZ9A 4KMMA 4KSCA 5IX8A 3DMTA 1G18A 2EQAA 4PINA 3BX1A 3KQSA 4V02A 1W7AA 2UXBB 1GZHB 1L5MA 4MVJF 2YFHA 1DARA 2HHCA 5TGDA 1ONBA 2A5DA 2E37A 2FPSA 3MB8A 2H4JA 4ZXFA 1RYYA 4JSRA 5LKAA 4KGVA 4QFDA 5LD2C 2QLJA 3GB9A 1Q17A 1L5RA 2IHZA 3MGGA 1GYQA 3JQGB 1SG9A 1V7ZA 4J3NA 1FW6A 4BU0A 4BPBA 5T67A 1U0OC 4ZAZA 1RC1A 1Y7PA 2PZMA 3BM5A 5KKNB 1HYQA 2EW2A 1B0UA 1GZSA 3E1SA 2Q8NA 4W1SA 1ONNA 2QR5A 1A5BB 5K6AC 3A26A 1KP9A 5DHTA 2M6KA 1PJZA 4V24A 4ALKA 1MHTA 1M0TA 1C9YA 1RWNA 1ZNWA 2I76A 2W11A 4KK3A 5IJ0A 3M9WA 2X5NA 1BKSB 1R3UA 1EWRA 4IEFB 5H82A 4DPMA 5ES3A 2OHXA 1DIBA 4CIWA 9MHTA 1M1YE 5AM4A 4C0QC 1V5WA 2VPWA 1MTZA 4I4IA 2YBDA 3CPHA 3ILYA 5IYZB 1A9OA 3MVEA 2H18A 3LLMA 2FSFA 2GPJA 1KOJA 3DG9A 3KELA 4UMDA 2XWQA 3IIIA 1GSOA 3M1YA 4JKYA 4PHFA 1YK1A 1H05A 3KALA 1U9JA 3ANMA 5THXA 2I7DA 4DHEA 3TL6A 3QELB 5AVKA 4C0HA 5HSGA 4EI7A 4P4TA 4TZTA 2WYOA 5J1SB 4LSGA 4C3UA 4UUNA 2RHHA 4TSFD 2FGJA 4BO1A 4R2HA 3BE6A 2ZE8A 1EVEA 1C3OB 2J6BA 3WMGA 2XUJA 5AKGA 5A5EA 3L1VA 1UC4B 3ZG6A 5KX5B 1OJ7A 2XD4A 4JV5B 4L02A 2R5NA 3O1JC 4LE2A 1PR0A 4B75A 2WYHA 3BXFA 4NH0A 4TTRA 2YBEA 4O2BF 2CUTA 3GA5A 2Q29A 5D2CA 3G8CA 5ECWA 1B74A 1VGQA 1GPWB 3IURA 1KWKA 4Z4GA 5CEJA 3BSFA 2JLCA 3EGXA 1YZYA 1B2LA 4H0FA 4JJ4A 4CUJA 7MDHA 4WIAA 5D00A 3R8FA 3VJRA 4RS3A 3O9VA 4WRRA 3DE3X 2V58A 1YQTA 2VJBA 4DT1A 2J07A 2MSKA 5ICFA 3MMZA 3SQOA 5HIAA 1Q19A 2GTHA 2H31A 5IT4A 3ZDDA 4TMKA 1UWVA 4GQAA 3M6FA 1Y9AA 2XE7A 3S44A 1CWUA 1U7WA 1XDGA 2FY8A 5EZYA 4WV3A 3ETCA 2P0YA 3W2FA 3O21A 4BO7A 3H87A 4Q1CA 4A0RA 2CF6A 1FP2A 1GQRA 5IT0A 1QHGA 4RE5A 2BKAA 4V1CA 1OAOA 3HJAA 3CKMA 1YGYA 3KPWA 4IVRA 4UHEA 1B6GA 1YFKA 4CKZA 3KYDB 4Y18A 3MCVA 4KQXA 3ZD9A 5JHHB 1MJ5A 2DR0A 3EEQA 4G24A 3WVNA 1NP3A 4WZBE 5J5AA 1N2EA 4NHEA 5FUXA 1WR8A 2A0XA 2G09A 3FTDA 5A04A 3F4LA 3DDCA 1G19A 1YE3A 2FN8A 3DT8A 4N76A 2WBLC 3SSAA 4BKOA 4PRLA 2FEXA 2JI4A 3B7GA 3LVQE 1JFFA 1RWQA 1NW5A 4DGQA 2WD8A 1UJ2A 4K0RA 2G36A 4XB2A 1KOLA 1PD0A 3DR3A 4QX6A 2IU0A 2D8AA 3Q88A 4NCIA 1JX6A 3RV3A 4MEBA 2HAEA 3PQ4A 3NHRA 3FTFA 3HN2A 1W0KD 4UTXA 1EJ0A 2ZDHA 4H31A 2E85A 4LCJA 4BP1A 1DE0A 2UZ1B 2HDWA 4JEMA 4UEWA 4JI7B 4I6GA 1KVQA 3USCS 3WSTA 1RXVA 1FFGA 2ZREA 3G2NA 3N8IA 1HSOA 2KPOA 4DMHA 3DAHA 1NN0A 4QXPA 3A04A 1N0VC 5FOVA 3VOTA 4F6LA 3QE9Y 2GAAA 4OMDA 1KP3A 1GPH1 4KV9A 3DZIA 5U4XA 1EU1A 3QQ5A 1C8BA 1P6XA 4F7DA 3DFIA 3A70A 3IEKA 2IUUA 2GRJA 3R7LA 4PSAA 1QNLA 3AJ9A 4YFVA 2BELA 4BFSA 4WN9B 3K0CC 3NAZA 3K9BA 1TTTA 4IMPA 2LR0A 1B8NA 2Y1FA 4EVIA 3D5EA 1QFZA 4BQEA 3HA2A 3NFRA 1TVCA 4YP9A 1YMQA 4OBWA 4XWAA 3DXZA 4EJ0A 2QZJA 5JSZB 1U8FO 4KX3A 3RAFC 2CXXA 2IXFA 1IMJA 3SJUA 3WWYA 3HJCA 3DHNA 3PUXA 1DBPA 3H9EO 5EMLA 3WHIA 4H7KA 4RTRA 3CURA 3KJIA 1CUGA 3AR6A 3FSGD 2QRGA 3VI3B 4LHYA 3HJHA 1PWHA 1H5NA 2YMPA 3PD7A 3OJ0A 1F4VA 1NDHA 4MA0A 2C0QA 1GPDG 3WKAA 5JQGA 1PBTA 2FTKE 2GPTA 2ZVJA 3FVQA 4V0QA 2PSJA 1IYZA 3CMMA 1CRPA 2IZ0A 2R65A 5HZGA 3GLHB 2ORYA 2Y99A 1A76A 2VT6A 4I2VA 5BSTA 2FX3A 4LQCA 2LKCA 2R8PA 2FEAA 1DKNA 4IIJB 2UDPA 4OMFG 1C7IA 1NJ2A 3DV0B 1G6KA 4IFIA 3AY0A 1I2AA 5JCJA 1A95A 1FL9A 5CLLA 3R5XA 2FP3A 3F6RA 3T1TA 4K88A 4Q19A 1GRCA 1N9ZA 2CL5A 4LDRA 1XU4A 2REBA 1JFTA 1JBEA 3PUVA 1SHLA 4KOEC 4JIMA 1SFRA 3GJ4A 4L08A 4KQ2A 3SSMA 4BN0A 4EYQA 3C4VA 5I51A 2VF7A 1LLFA 3RUPA 2JGEA 3SWWA 3IBSA 4B84A 4EJSA 1F8UA 5K0CA 3EYAA 3WYAA 2CK3D 4N3BA 4MQMA 1YL7A 2E4XA 4RXMA 1BMFD 1XTPA 4MI9A 2Y67A 4PZCA 2LVBA 4CF3A 4J94A 1J2EA 2FB9A 3C1TA 2IF2A 4H7HA 2K7FA 1QH9A 4IXMA 2FFJA 3GFRA 3KBOA 5CEEA 3E5MA 4H3KB 4GLOA 4U2FA 4B3FX 2BGUA 1XRLA 2JIRA 3NYIA 3LKVA 3P0JA 2NQ8A 5D87A 2X6RA 2M6RA 6ABPA 3BGWA 3H16A 2O4CA 2C82A 4MQ5A 5CP8A 3ZV4A 5A06A 5AESA 3BPSA 3FPLA 4X00A 3RASA 3HLKA 4U9HS 2P6PA 5EINA 3RK4A 3SZUA 3G6WA 3EQ7A 2W6OA 3W5SA 5F51A 121PA 1VXOA 1H5QA 3RS3A 3OM0A 4BQOA 1U5AA 2JFFA 2JLBA 2XYHA 1GT6A 1O08A 3ROTA 3WTBA 2BSQA 1H2WA 3L8FA 1NX9A 1Y6ZA 2GYYA 1X7DA 5KTOA 3R7WB 1LFDB 3OQMA 1WOMA 2YN2A 1QC5B 3I5XA 2ZB8A 3KB6A 1JVSA 2VPTA 2E5LB 1FVOA 4XI9A 1UP4A 2I29A 1V3QE 1QGUA 4J49A 3EAQA 4YT8A 4Q4DA 2NSHA 2JVIA 4LV8B 3QNMA 4L8GA 3ZZ1A 5D7NA 4EHIA 4W99A 1UEIA 1ZISA 2DWUA 3ZU2A 5B7PA 3DV9A 2PSDA 1XLVA 1H8HD 3PPXA 4HGOA 1VBMA 4KCGA 3WK9A 2NVOA 3WLTA 1NOIA 5EWLA 3SDZA 2RDMA 4NULA 3ME5A 5ALMA 4CKBA 1T4MA 2V7QA 2I1QA 4QBTA 3K53A 3VX3A 4ER5A 5TPZD 4RAOA 1N7IA 3DTYA 4GMFA 2PDAA 4ZEMA 4UPVA 4QNNA 4PM4A 1QB8A 2REQA 3G5UA 1DEOA 5JNVA 2WG1A 1D2EA 2IDZA 5KKAA 1N5RA 4DWOA 1DAOA 2UZ3A 1X7ZA 1XB2A 3UMJA 1E1QA 1T29A 3LUPA 3RFVA 3UAZA 3PBKA 2E89A 1UBTS 3VKVA 1FW8A 1SC4A 5A2QA 1ZKDA 2C88A 4RZUA 5HF8A 4BX2A 4RZXA 3CZPA 2I54A 1T9CA 3EFHA 4KVZA 3GGCA 2X0FA 1GNVA 3OCJA 4R8MA 2L17A 2Q2QA 3T0IA 3UCFA 5CVTA 5B1EA 1BTOA 2V4UA 3ZU3A 1EWTA 3SHVA 1Y0BA 3BWBA 3IEUA 3IB3A 4MA5A 2PBRA 3E23A 5KWJA 1PWEA 4RTJA 3FPAA 3IJPA 4J90A 2YJZA 1K8RA 4DCTA 3PNPA 1UAAA 2NQ2C 1QYIA 4WLFA 4LDZA 3KJZA 5FLEX 4ADSG 3PXXA 1RXWA 5JSQA 1SURA 4PQYA 2YHIB 2BZGA 3IKVA 3VC7A 3WAJA 1ZUNA 1YC5A 2VXBA 4OUDB 4V2IA 3T06B 1Y9ZA 3WGZA 6YASA 3HO1A 1QLWA 3MRXA 3NPMA 2YWGA 5H3LA 2V9PA 3RVKA 1WV0A 4X8OA 4UQOA 2Q3HA 4YMTA 5I7FA 2ZZNA 5JO0A 3ZCUA 1V37A 3ZLTA 2HU2A 1XL0A 1UIRA 3L0YA 2WE8A 4DV0B 1HFJA 3KWLA 3W1VA 3W3ZB 3WYDA 2A4KA 3KAKA 4FJ1A 3RFTA 4I14A 3OX3A 1MV8A 1OXUA 5CK5A 4HGQA 4WLVA 5KYVA 1C8KA 1FU7A 3STWA 3S2EA 2ZW9A 3DEAA 4PGHA 5K0LA 4Q4JB 3FYUC 4Z0TA 1SELA 5JCOA 2GEDA 2X22A 4WLNA 2QRKA 1AKWA 3TDNA 5KVVA 2C3PA 5JFGA 3RLFA 5A6VA 3BD9A 3MK31 2QPLA 3ACBA 3D7MA 3QSGA 1MH9A 3OJWA 3ZJYA 3LF2A 1PNVA 3EK2A 2Q9BA 3ISJA 1CB7A 1ECGA 1WTCA 2ISSD 2Y1XA 4LVNA 2EARA 1KJQA 2IY7A 2L18A 4Y1EA 3V7FA 1UFQA 1VE5A 3NTXA 1Y3BE 3GJ3A 4PLVA 3ZDFA 4JYBA 4L75A 4LE1A 4IUBS 1IWBB 3PIDA 4LNAA 5BR7A 2Z4RA 3NHLA 2NU9A 4QUGA 3QLTA 3EVEA 4G5GA 2FJUA 3HHEA 2CJXA 1Y6JA 5KWEA 4B2LA 2VYQA 1K6EA 5BOVA 2H2FA 2OY0A 1YJXA 1CS0A 1AQUA 1W49A 4KYIB 4Y1GA 4DLAA 4K8OA 3V7WA 1OROA 1QQTA 2DFKB 5C9ZA 1MAHA 3JVUA 3ZPXA 2HA5A 2G5TA 3A9WA 1A2BA 3PLRA 1XZLA 2YJ3A 1XNGA 4MP6A 4J0FA 2VEDA 4I5IA 1LTHR 5T3UA 4KN8A 4A73A 5IUNC 3NR2A 4UCXA 3TSCA 3OJOA 4ARVA 2IHTA 5A71A 4L5BA 2B8WA 3F1LA 2PYIA 4KXUA 5CM9C 2G9NA 2RARA 2CXNA 1IJEA 2P11A 3FLEA 4KR9A 1GZ3A 1GTZA 4O2AA 2W2KB 5CLHA 3I0NA 1PIWA 1UZLA 4WVLA 3HCNA 3C4QA 2VCEA 3ZW7A 4HQKA 3BFXA 1UM9A 5E1BA 4DG5A 2JK0A 1Y1LA 2Y9PB 3LA6A 1ZYUA 1ACMA 2EBWA 2H8KA 2WWXA 3OEHD 4X3CA 5HKOA 1IQ0A 4IIHA 3OT1B 4ZI3A 2WWGA 1QTNA 3L1IA 3DCIA 4CQMA 4OEHA 4BMSA 3CISA 1QIFA 1FMCA 1WMSA 3MRSA 2PKQP 4QUBA 1MAUA 1ZMXA 4KQFA 4QYTA 3QX3A 3ENWA 2ZRFA 5J58A 4UVGA 1QP8A 2OZLB 2XE8A 3DOOA 3QF4B 5JBNA 3Q87B 4XD7A 1KERA 1TZ2A 4CM1A 1OU0A 1LC0A 1R88A 2GKOA 2IOHA 2WIBA 4FFRA 1E64A 4OHXA 4IDHA 1HG0A 4IIGA 1OA0A 2A86A 2W71A 1KSGA 3NOOA 2PTGA 1MF7A 2O54A 1UWCA 2BN4A 1GKIA 1VSTA 2IYXA 1NMZA 3WBKA 3JV7A 1GPUA 5B64A 4DABA 4RCVA 2FPMA 4XLZA 2RAPA 1E9RA 3PQ6A 4MGZR 4D6YA 1MFZA 3BZBA 1G3UA 3B70A 4N9WA 5T6BA 2Z5GA 3WKCA 1W87A 4KLNA 1TQ4A 4WN3A 1UXOA 5EMNA 4FCTA 2NUBA 3EVFA 4D82A 4U7GA 5I9IA 4WHMA 3G3EA 3HP4A 5IUKC 3AM1A 4HZUA 5CLGA 5K8UA 4ISBA 1OLSA 4EKYA 4ZI7F 1L1QA 5ED4A 4OHOA 4BTEA 1NDQA 3GPDG 3KIPA 4UM9B 2CFCA 3CGGA 3UGJA 2MSDB 2NV0A 4H7PA 1SBCA 2WJVA 1TKCA 3BMCA 3KHKA 4WECA 2QTBA 3WXBA 4FC6A 4AXBA 2C2GA 4RCYA 3DMGA 2OFXA 2RAVA 3O8RA 1UPTA 2AKYA 1I3CA 3DCNA 4UNIA 1GPLA 9LDBA 1T15A 1MABA 4ND2A 3TOCA 5H9WA 4TL9A 1GG9A 3C16C 1PW7A 6Q21A 4JEIA 1VBKA 2HK9A 3OTQA 4RKWA 1Z25A 1SXJC 1F51E 2V3WA 1PTJC 4WTOA 4HB0A 4LPKA 1GPKA 3WDSA 4CUKA 1RMQA 1E9FA 4PYQA 3JARB 5FWAA 1K5GA 4ESHA 4CL3A 2GMWA 3UCXA 3CW2A 3WAGA 2VP9A 1Z3CA 1A7UA 1HEUA 3SBXA 3L0DA 3I5AA 3O31A 3HZRA 1RFGE 1U3VA 3VH3A 4WK2B 3P9ZA 4ZOLA 4KV7A 2W22A 2NYUA 2WUDA 1H94A 5C2JB 1TDJA 5F77A 3SR0A 4U7TB 1J39A 2DC1A 1L8QA 3PVCA 5CT8A 4F0JA 1E7YA 4JJ7A 3DMNA 3M83A 2Y0DA 3VSEA 1YB6A 4FD3A 1KWGA 4AKHA 3QWFA 2BFDA 2WWIA 4GGPA 3UAXA 1UPUA 3IEIA 2OV4A 3R7SA 2YDYA 3HVRA 4ENVA 1OGIA 3DAYA 5GOZA 3L01A 5ELLA 4H7FA 1ODIA 4XWGA 3WNCA 3FCAA 3QPCA 4LJ6A 3EIEA 1FYWA 5FQNA 3PJRA 2LP4Y 2IHYA 3DGEC 1WQ3A 2HHAA 1ARZA 1H6BA 1MQ8B 2GZHA 1RTKA 2J3MA 2IY8A 3DBIA 1XD9A 4J0IA 5HZKA 5JARA 5KSOA 3X1WA 2VOJA 3QVKA 4B83A 3EX7C 5CTJA 2J9FA 3IAM6 4L74A 4O4JF 2BWJA 4GKAA 1ZP6A 4XDZA 4LOIA 4RENA 3HXMA 4CLOA 2VDWB 4M1WA 3PIRA 4BGIA 3HDJA 1GZ5A 3BERA 2YC2C 7YASA 1N5IA 2AEMA 5JLJA 5JU6A 1F8XA 4WKGA 1TGYA 1LW6E 4G86A 3H9GA 2BGKA 4YAEA 5LLTA 2P3OA 4ZQGA 2O05A 3GUHA 4ALJA 3STVA 2FN9A 2NUPB 1FSPA 3OQIA 4ONEA 5H3CA 2FKAA 2WAMA 4DWJA 4YXWA 3UJHA 4C0LA 3K1YA 4FS8A 2I2XB 1L5NA 1JYEA 2PPLA 3I6YA 3U39A 3MYRA 1FFBA 4J75A 5EZQA 3TCKA 4G0ZA 1AHPA 5ADWA 4UFPA 1EVYA 4E46A 3KETA 4I1PA 2J6IA 2VT7A 3CZ9A 3AEUA 4EPRA 1KEEA 2AI2A 4S1PA 4IY1A 3T9DA 4PANA 1WZUA 4EUHA 1RJEA 3FA2A 4IR7A 1ZGZA 1U3FA