3X1YA

Ras-related protein rap1b(l9v) with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MREYKLVVVGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Ras-related protein Rap-1b
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1yA00
2FFBA 4D4MA 2CMKA 3QOFA 1QG4A 2CK3A 1KK2A 1XMSA 3TBKA 4CRWB 4BASA 4Q9JA 2QBYA 2VLIA 3ND8A 3QJYA 2QMOA 2XZPA 2ZE7A 2OESA 1ZYUA 5F9FA 5G53C 1YZQA 4NKRA 4C9BA 4IEIA 1DAHA 3VHXA 3I62A 3PEWA 2REXB 5JZVA 1E2PA 4KLNA 3E2IA 4P33A 3B9PA 1UBCA 1CXZA 1M1YE 4M1WA 4A82A 4C30A 1MV5A 5C1BA 2C03A 3OIVA 4IKEA 5DHAA 1R4AA 2RGGA 4LJYA 5CDFA 2NQ2C 3UMRA 1NLYA 5SZJA 1GKIA 1DOAA 1NIJA 1NMZA 1S8FA 4FWTA 3DVLA 1R0WA 3NBZC 1D5CA 2JCSA 2ZE8A 1GFIA 1N6KA 1G41A 1XTSA 4KI0A 4M1YA 3CO5A 1S3SA 4FINA 4B3BA 1P61B 4OHYA 1JJ7A 1QHXA 3ETLA 4RD3A 5HTKA 1W49A 4EFMA 2GXSA 2ZUDA 5JEDA 5AJZA 1FNNA 2ZS7A 4RZUA 2O8DB 4LJAA 2G0TA 1X1SA 4MQBA 3ZS9A 3K1JA 1MKYA 3BS4A 2ZSBA 2HV8A 2HYIC 4B6FA 2AK3A 2QAJA 1OHHA 4V0NA 1ZC3A 1FX0B 3R20A 4GNKA 5TMPA 2LKCA 1DPFA 1KSJA 4DT1A 1SHKA 4NH0A 4XVUA 1GDDA 1E94E 4ZCIA 2HCBA 3K8YA 3K0FA 4BZQA 2CJWB 3FB4A 3GFTA 2IYLD 1E2NA 5CIQA 3P4XA 1TQ2A 1NG1A 1ELOA 1KDPA 2HXSA 3D31A 4GP6A 4KYIB 3UMFA 1R5BA 2XXAB 1OIWA 3RRZA 5DISB 4PSAA 2CLSA 3WMEA 2Z5FA 5F2EA 1Z0JA 3FHOA 1YZLA 3RRYA 4ARZB 3CUEF 4UXHA 1NMXA 1UEJA 4HB3A 2OFXA 4O0MA 4W7SA 1E2JA 5LB2A 1KYIA 1T3SA 4PC3A 5DI3B 4A6PA 3SYKA 1CF4A 5TARA 3GLGB 4QBFA 1Z2CA 4M53A 1UKZA 4LY6A 3UANA 1GNQA 3TUZC 4KVAA 1T6NA 1KJZA 1N6LA 5IK2A 5AUNB 2ZJYA 5KDLA 4RZ2A 2AK2A 1YZKA 5K8IA 1SXJE 3GLFB 2FU5C 4F7WA 2CCJA 2ZVPX 1GZSA 3VU9B 3WP1B 1FP7A 1E2IA 3SQWA 1YZNA 1A1VA 3TRFA 3REFA 1G3QA 2OCAA 1HQYE 5JS7A 2D2EA 4ZCMA 4QJ4A 2XXAA 3UPUA 3LW8A 4PAOA 4YONB 1G7TA 2HF8A 3C5HA 4OI0A 4TQ9A 3WXMA 4GL2A 3SDZA 2V3CC 1IN6A 3QXCA 2FG5A 4LC1A 3A1SA 5TVKA 5BQ5A 2YWGA 4X8MA 4BECA 721PA 1P6XA 2A9KA 1X8KA 3H0KA 3Q8XB 4XH9B 1GKYA 1HT1E 2IF2A 1GL7A 3OEEA 2CBZA 4GZMA 4G1UC 4Q9IA 4TMWA 3UWOA 4BPBA 4JT2A 1Z6TA 1X1RA 3VR5A 2ZAMA 1W0KA 4C0HA 1G291 3AF4A 1XTRA 4EFNA 4RVCA 5J4YA 5KNDA 1Q1EA 3EC1A 3KX2A 2JJ1A 1A5TA 4V0KA 2QORA 3BH6A 4DLSA 3EAQA 2X2EA 3KUCA 4TT3D 2YC4C 4LK2A 1ANKA 5B30A 3B8HA 4KCGA 3SN6A 1QBKC 3T1QA 1U0JA 1J70A 3HPQA 1YZUA 2ZRNA 5FL7D 3R7WA 1MO3A 3QY0A 4JKYA 1JEDA 3PEYA 5JMTA 5AJWA 5CIWA 3L0OA 2IEZA 3SNHA 1SULA 1BO6A 2ZSAA 4NPHA 1DVRA 1QZXA 3EXAA 2ZRAA 5CJPA 1AA9A 4DCVA 1OLOA 2CL0X 4ESVA 1OH8A 2EWWA 4F91B 3AVOA 3OHMA 3AH8A 1DS6A 5TV2A 4A1FA 2ZJ5A 2ZIAA 4LYHA 1DAIA 4CF7A 5DO9A 2BJWA 3DDCA 3K0AA 1XNJA 4P31A 2QAGA 5FI1B 2CCGA 3L0PA 3SJAA 3B78A 1J90A 2O8FB 5DH9A 4MGZR 3IUYA 4ZI2A 3FOZA 2BWJA 3RVBA 5L3SA 4W9MC 2OLKA 2ZRJA 4E5UA 2W2XA 1E32A 4PTLA 4RD2A 1VECA 4OBEA 1FPMA 2HEIA 3W6NA 4XSHA 2P0EA 4IDHA 3AUYA 1P5ZB 1TAGA 2KSQA 2J0QA 2F6RA 4WW0A 2GBLC 1NBME 2FSFA 2J5XA 3KTAA 1GOTA 1VHTA 3BORA 1KKMA 4NCIA 3LVQE 3ZZUA 221PA 2ANCA 1R7RA 3MWLA 1Z47A 2GJSA 1GUAA 1W0KD 2JLQA 2RHDA 5DLQC 3TR5A 5BXQC 3AVYA 3NKVA 1TX4B 1HUQA 1XEXB 1M7GA 1VIYA 2JJ1D 3U4QB 2ZRFA 1U98A 2QA5A 3BFXA 1TADA 1BS1A 4TTRA 1VIAA 2O0HA 5CB8A 3RNLA 1G8FA 3QBVA 1X8JA 5K8UA 1XD2A 2W6IA 2VHUA 2R6GA 1VCMA 1XEWY 5GVRA 1D2NA 1E9EA 4B2LA 4DIDA 1KJWA 1QG2A 1E3MA 2GTPA 2QAGC 1SVLA 5E3HA 2QTVB 2FA9A 3WYFA 4XVQA 4KFRA 1FW6A 4M22A 2VF7A 4WOPA 1XP8A 4YXWA 1NSTA 2HYDA 2JJ8A 3V00A 3EA0A 3PIRA 4Q4HA 1IN8A 3T5DA 3QPUA 5A5GA 3CRVA 1CR4A 2ZSEA 2B7BA 1E1RA 2F43B 1W5TA 2X77A 4KU4A 4DEYA 1FUUA 4DLWA 5M04A 1G3UA 1AIPA 4M2LA 2IS4A 1XCPA 4UKDA 4A36A 4BZXA 1XEFA 4X8HA 1RRCA 1UEIA 3QVVA 4BQSA 3IGFA 1W48A 1PLLA 2A5DA 3GP8A 4HI0E 1NF3A 3TVDA 2FDCA 3CPEA 4OQMA 2VTKA 3PCRB 1XTQA 4QXAA 2DYKA 2ZR9A 4HAYA 4M21A 4Q4LA 3DOFA 3ZIAD 2O0JA 3B1WA 4EQ6B 3PFIA 1K8RA 1VYVA 4DXAA 4LCBA 5HZKA 1GITA 1N5KA 3H84A 2JLUA 1GL9B 3PEVA 3TW4A 4H9GA 4BLSA 5EP1A 3PR1A 4QC2A 1S1CA 4JLJA 3NC0C 4FD2A 5AK0A 2D7CA 3AVXA 5BYJA 1BMFD 1KDOA 2B7CA 3U2QA 3I73A 3TAUA 4BE7B 4N1AA 3QVUA 2J41A 2HDNB 4BFXA 4RD6A 5SZHB 2WWFA 1E4YA 5L3SB 1U81A 3EZ2A 3EX7C 4S2EA 1E2GA 2I3BA 3U3MA 5CITA 1LW7A 3K70D 4ZDJA 1J8MF 1WF3A 1XMVA 4P3YA 4RJLA 1OE0A 3A1TA 1GIAA 1G19A 4LPKA 3I61A 3RDPA 1P9NA 1DAKA 2IS6A 1Q1BA 2VSXA 4Q1AA 1H8ED 1Q3HA 1VG8A 1N0WA 1OKKA 4M8NE 1SVIA 3KDSE 4DCTA 1G4AE 5B64A 4M9SA 2ZE6A 3THYA 1JXOA 3RS4A 2FSIA 2NZ8A 1E6CA 3EZ6A 1ZIOA 2MSDB 1FMJA 2FZLA 2ZYWX 2D4HA 2FX3A 4Y0VA 3TVTA 2IHYA 3GEHA 3L82B 1QRAA 5HKKA 3Q9LA 3GJ4A 4QOSA 2PZFA 1NJGA 1VG0B 1NN5A 1OFHA 2J1LA 5CK5A 1T9HA 3QPWA 4LV5B 4DLRA 3OFNA 4DSNA 1AKYA 3LQRA 2IYQA 1EG7A 2GK7A 5JSZA 3U7FB 4NL4H 3K09A 3BGWA 4JLVA 3L8YA 1J8YF 1JR3D 3CRQA 1GWNA 2CJWA 3CM0A 4FCTA 1A2BA 1KZ7B 1D6JA 3AVUA 2REOA 4P0TA 1SVKA 5FL7A 1Z22A 2ORVA 4A0HA 4AYWA 1DAMA 1P9WA 2TMKA 1JPJA 3DO6A 1LVGA 1S0UA 4KHZA 4MKFA 2ATVA 2JDID 3VTKA 1Q12A 1A4RA 3T1TA 4GZLA 2EFDB 1ZIPA 1VMAA 2ZJOA 3HWSA 3QUSA 2OM2A 2IF0A 3U60B 2OO7A 3EIEA 3AUXA 4EPYA 1UFQA 3I5XA 2PBRA 3K09C 4FMCB 1CJUC 4UQOA 3TQCA 1VPLA 1XTJA 1W2GA 3ZYCA 4AYXA 2IT1A 3RANA 3SYNA 2QUZA 1DTSA 2IYZA 1B0UA 2ZUBA 3AB3A 3ADKA 3KTAB 4DZZA 1UKEA 1FNMA 4TYNA 1OXTA 1VYUA 1DAFA 421PA 5JJKA 4C3ZA 1KAOA 5FPSA 3RABA 4UJ5A 4OQFA 4JVSB 1Q21A 2XX3A 1E2DA 3MWKA 4BRWA 4QGFA 3SFZA 4CT5A 4WXRA 3X1ZA 4LI0A 2ZAOA 3GJ3A 2AFIE 5AUQA 1ESNA 1XBTA 2R44A 1CTQA 2BMDA 3CPJB 4IDNA 4LZZA 3FVQA 2H17A 4C2TA 4D81A 1P2TA 3S1AA 2ODBA 3KL4A 2EFGA 2C96A 4HAZA 3KKNA 1ZU4A 1M6NA 3SC3A 4LHZA 3T61A 1LS1A 3FPAA 3L2OB 2FPKA 4YQFA 2X2FA 1EWQA 5KHOC 2JLVA 5JRZA 1DG1G 4L15A 4PSKA 3SEAA 4TYQA 4Q48A 1QVRA 2IUSA 5HZHA 4HLDA 3QBTA 1V43A 1VCOA 2IWHA 4E07A 5DNYB 4M9ZA 4BWYA 3HU3A 2JLYA 3FWYA 4JLAA 2CL7X 4I1SA 3EWAA 3AF2A 4TWZA 3W90A 4B75A 1DEKA 4DLXA 1H8HA 3A37A 3PUVA 3BFKA 3F5FA 2QN6A 1WE2A 2MMGA 4MYHA 4Q1EA 1NVVQ 3ZVLA 2B8WA 3KUDA 4NCNA 1JQJC 1U9IC 3B1ZA 1LV7A 3C7KA 4OJQA 1JR3A 1RRFA 1KI6A 2GZDA 3UWKA 5DI9A 1F5NA 1L7VC 2XJ9A 4JLMA 5AJXA 1ZM3A 2BBOA 2BOVA 2WM9B 3RRMA 3K9GA 1R2QA 1II0A 2QP4A 2GXQA 2PL3A 3DMDA 4IDPA 5DIFA 4A8JB 1G8HA 5P21A 4JVMA 3Q7QA 2JDIA 2RAPA 4ACBA 1BH2A 2P3SA 2REBA 4D4JA 2WIAA 4DDVA 2DBYA 4OHWA 3A4LA 1HE8B 4HZIA 1IJEA 4GT1A 4W5JA 4YXWD 5EE5B 4OQNA 3LBNA 3IIMA 2Q21A 3LH5A 3PVSA 4GRAA 4NU0A 1X6VA 4Q1CA 4Z8YA 2YVUA 4PZYA 2ZR0A 4ITRC 1FZQA 3FTQA 1IBRA 1XD8A 1IHUA 4HUQB 3VNVA 4LC0A 5J40A 1N6PA 2WVJA 2F9MA 1QHYA 5CK4A 2AKAB 5C4GB 4ZI3A 2XB2A 3JZAA 3U6BA 1CRPA 5KSYA 2GKSA 3A1WA 3WYAA 3T35A 2FWRA 3BAFA 3JVUA 5GJVC 1ZMXA 4DRZA 1G6OA 2BBSA 1E0KA 2JATA 5CDFE 2W83A 1YE8A 2QGNA 2Z4RA 1RW4A 5G3ZA 2ZUCA 3MD0A 5KO2A 4XWKA 1XD2B 1UKYA 3IKJA 4N3NA 2PJZA 4CDGA 2KB0A 1NL3A 1NY6A 1OIVA 1YR9A 1G17A 2C9OA 521PA 3REGA 5LDDC 4NTZA 2E9SA 3ICEA 3FHTA 2KBEA 3LX8A 3T15A 3PENA 3ICQB 1HT2E 2GEVA 1MO6A 3O47A 3FMIA 4B3DA 4W5HA 3NHAA 5FTNA 4A8JA 1KI1A 2YWEA 1U2RA 2WSMA 1Z0FA 3SJBA 3AVTA 1RVDA 5E7JA 5HCNA 1S2MA 1J7KA 1KSFX 2QE7D 1YRAA 3GJXC 1LFDB 2XOKA 4AKHA 4OHXA 3SBDA 1TQDA 4URYR 3CPHA 2CVFA 2HCJB 1F60A 2ZRCA 1PV4A 2ZRKA 4UNNA 1E9RA 5EJEA 2QI9C 1W0JA 2RGNA 4LHVA 5TDHA 4URXR 1XPOA 1ZD9A 5F98A 1P60A 1AS3A 3W3AA 5E7MA 3EIHA 2GXAA 1QHGA 4YMWA 2AR7A 2PX3A 1HA3A 2W6ID 5FTLA 3HJNA 1E98A 1F2TA 4WBSA 2Z4SA 1KMQA 2ZSFA 5CLQA 2VP6A 4JVNA 1EFTA 2FOLA 2OG2A 3QKUA 4EPTA 1TEXA 2DPXA 4ESHA 4BFVA 2CCKA 2A5YB 4Q21A 4H1VA 821PA 4EIWA 4Z51A 4KJZA 1NLZA 2HLDA 4TLDA 4B73A 4LYJA 3GJ8A 3ZJYA 5FOSA 2ONJA 1E9AA 1C1YA 3U44B 1XU4A 1TPZA 2ZRBA 2ZRGA 3IPXA 3T1OA 2WJIA 2VHJA 3LAWA 4FMBB 2J45A 2B21A 1FUKA 4JZKA 1FX0A 4Q02A 4AYTA 4E22A 4Q01A 2FSHA 2O0KA 2V55B 4L8GA 4PC7A 3WP0A 4TSFD 2ZJBA 1DO2A 4RFSA 4O2RA 4XTCS 3K9HA 1XZPA 2AHOA 1II8A 5DGXA 2ZRLA 3VFDA 3DL0A 3IPYA 3Q5DA 3IEUA 4FMDB 2GVZC 3CONA 4NP6A 3V9PA 3H4MA 1Z63A 1CLUA 3MGCA 3SFVA 3OAAD 2YOFA 3QENA 3LDAA 1QHHA 4Q03A 3SU8A 2C04A 4AKEA 5IT5A 2GAOA 4D0LB 4Q00A 4DKXA 5EXPA 2OFWA 3IILA 4U7DA 2V1XA 4LJ9A 2E87A 2FV8A 5AWFC 3THWB 1W4CA 2H5EA 3IQWA 1ZUIA 3QF4A 3R8CA 2DHRA 3A4NA 1WB9A 2F9LA 4P4UA 4HEJA 1QHIA 4A9AA 5AJYA 4NYMQ 1KK3A 2CXXA 4UNPA 2ZJ2A 1CR1A 4CEIB 3VKWA 3EZ9A 4KAXA 4CIDA 1WRBA 1OH5A 3FMOB 3O8CA 4R2IA 1D9XA 4G5GA 5D3QA 1OB2A 4DDUA 1G7CA 4BUJA 1ZNWA 3IQXA 2D2FA 3GD7A 2ZREA 3THYB 2ZE5A 4NBSA 1T8UA 2IW3A 4MYCA 1JB1A 3TKLA 2C9YA 5KDOA 1ZNZA 2LWIA 2YC2C 2O8BB 1NN0A 4K81B 1E2MA 3UMSA 2H57A 3BD9A 3MWYW 4XOIA 2D62A 2OXRA 5JS8A 4M0LA 2MSEB 4PO1A 1ZM4A 1H8EA 1LNZA 2V1UA 1HYQA 4Q66C 5CB6A 4ARZA 2Q0HA 3NC1C 4TLEA 1S4QA 3OFND 3OESA 2IYTA 4S35A 1N0UA 3ZLJA 2V6IA 1OW3B 2Q9CA 4JYBA 4WZBE 3AKDA 3AEZA 4ZO4A 5GADl 3R9IA 1G7RA 3Q7PA 5B57C 1MO4A 5BN3A 1E99A 2W58A 3VHLB 4G5RA 2P5SA 2LCFA 3TQFA 5J47A 2O8CA 1EFRA 3PV0A 5CLLA 4C7OA 2NIPA 2OHFA 2YOHA 2ZU6A 2AN9A 1XJ0A 1DAGA 3C16C 1WP9A 1R10A 4PSVA 4B2PA 3AM1A 1ZM9A 1PZNA 2H18A 1R8QA 3D6TB 3X1XA 4D4LA 1U0LA 1Z08A 2BVNA 4M9QA 4KLZA 3H2YA 2BEJA 2JLSA 1TF2A 2D06A 1DARA 3K0EA 2WKPA 4Q7LA 3ZGXA 1OYYA 3QKRA 4Q1BA 3O8RA 4DB4A 3TH5A 4RZ3A 1E4VA 1FQKA 1OJLA 4UJ3A 3VKGA 3PUZA 1K6MA 2ZETA 3NG1A 2D3WA 4KITB 5GVSA 1JJVA 2ZANA 3GLHB 4BLRA 2JIZD 3QQ5A 1EFHA 1MRSA 2HT6A 1SXJB 3C4JA 4C0BA 3WNDA 1RE0A 2GZHA 4M4SA 1L2TA 2ECKA 2FGKA 4LOAA 3E1SA 3JVVA 1NN3A 3DM9B 4JLKA 2F3TA 2XAUA 3VR1A 3A8TA 3SJZA 4JIMA 5H70A 2EYQA 1XB2A 3K70C 3TAHA 3EPLA 1VKJA 2VSFA 5HCIA 2GZAA 5EXXA 3SBEA 3UK6A 5L8VA 3SYLA 2IL1A 2WBLC 4V0OA 2HF9A 3K70B 1KI9A 2R6DA 3HU2A 2EFEB 3B9QA 4JJKA 1L4UA 2QQEA 1NRJB 4NYJR 2G88A 1E2EA 1KHTA 1XRJA 3GFOA 4OI4A 3B2EA 4ZIRA 2XJ4A 1KO1A 1Z29A 2J87A 4CVNA 4MRSA 1T3HA 4JLPA 4WXPA 2EU8A 2QM8A 4XWAA 4B44A 3GLHA 5DN6A 1C9KA 2GCPA 2WMNB 3LX5A 4LDJA 1D2MA 4NHOA 2WPDA 1JNYA 4MRRA 1X86B 3KB2A 3V4RA 1G8GA 1KJYA 3L43A 1G1MA 3R9XA 1ETUA 2VYFA 3BB3A 2NO0A 1KAGA 1YU9A 3E70C 4TL6A 3RRNA 5HPYB 4JSTA 2WJYA 3Q72A 2OT3B 4A2PA 1HURA 3QXSA 2AL7A 4V02A 3I4LA 3LA6A 2WAXA 4I1OA 2Q6TA 2WOJA 1P2VA 2GBLA 2OILA 4PPGA 5IHPA 4TZ0A 3NEJA 2O8BA 2OCPA 1NKTA 4PC6A 1Z8FA 2WJVA 2Z83A 3VNUA 3QE0A 1EFRD 2WWIA 1GRRA 2OCYC 3WBJA 5KYKA 1GKUB 1ONBA 2J0UB 2P65A 3AKYA 1Z28A 1TUIA 4C7OB 1JXMA 4BFTA 1FMLA 4EJSA 2XSZA 2V7QA 4URUR 3LXRA 2QMUA 2EYUA 1E9DA 4BFYA 1DADA 1XD9A 4MKGA 1M7HA 2FEMA 2FPMA 1CJKC 3CW2A 1JI0A 2FGJA 4M9XA 3WHLA 3GPLA 4MH0R 2PX0A 1SKYB 1FFHA 4C4PA 2PZEA 3C14C 4TMKA 2QTFA 2QPTA 4GI7A 3NXSA 2DFTA 4A4DA 3AP1A 1Y3AA 4K46A 3CKLA 1E1QA 1EX7A 5CYPA 5G3YA 2CVHA 4WAUA 2OBLA 2DCUA 2ERXA 3DHWC 1SKYE 3SHFA 3CR7A 4MRVA 2FJUA 3AVVA 4JSYA 3EPHA 3ZS8A 4ZDKA 1UBFA 4IHQA 3CR8A 2GF9A 4ERNA 1DO0A 1G7SA 4CEHA 1FTSA 1ZINA 4Z1MD 3CWZA 3DKPA 3MG9A 4KODA 1U8AA 1E0AA 2J3EA 4IFBA 3ZVMA 1G3MA 2XSZD 1I2MA 1DG3A 2X8AA 4KV9A 4OHVA 4TLCA 4FCVA 3MJRA 1AS2A 1MABA 2CNWD 3W8NA 2IYRA 1GM5A 4L4UA 1YVDA 2B6HA 3F3YA 1E9SA 2PT7A 1NVWQ 4QHTA 4B32A 4URWR 4XJXA 3U5ZB 1NVVR 1Z5ZA 3X1YA 4D26A 2HT1A 4JVLA 1Y63A 4CT4B 1WBBA 1XCMA 2PLFA 1W4RA 4LYFA 1SVSA 5FBWB 2YKGA 1IXSB 2ONKA 3EW9A 4DT1B 3NEYA 1F3OA 2WSSD 3AGPA 4FXPA 2JGNA 4BFWA 4TMXA 2PCLA 2QSYA 4HZUA 4XD7D 2QPOA 4JJZA 2KI5A 5HE9A 3KFVA 1ZVQA 4MDEA 3RS5A 2AXPA 3THOA 2RH5A 1AZSC 2QSZA 3ADBA 1KMHB 4TYYA 4L9WA 2LKDA 3PEUA 2ZI6A 3QKRB 1AM4D 5AUOB 1UJ2A 4PO8A 2IYWA 4YC7A 2VHQA 4UXJA 2HLDD 4ZCLA 2IA5A 2CK3D 3TMKA 4I81A 4C0KA 2C77A 1Z6YA 1CKEA 3X1DA 4R7ZA 1GVNB 1L4YA 1OV4A 3CB4A 4QJ3A 2EQBA 1EFCA 3EG5A 5JECA 2ORIA 3RS3A 2PEZA 3G82C 4US1R 3BJIC 4PFSA 1OB5A 4DSUA 1HH4A 1N25A 2FE4A 4UNQA 2PMKA 2ZRHA 2ZYVX 5HR5A 4F4JA 1XMJA 5LB4A 4QRHA 1D9ZA 2WJGA 4QGAA 2ZJZA 4F38A 4B33A 4AI6A 1ZNYA 3N70A 2PLRA 2ODNA 1VG1A 4DCUA 1KY2A 3V4FA 3U44A 3AVQA 4AWXA 1P72A 2IK8A 1CRQA 3EZ7A 1MO5A 1E79A 3PUYA 4EKDA 5FR2A 1G4UR 3GMTA 3K9NA 3RSLA 2ODWA 1JPNA 4GFDA 4V0ME 5BN5A 5F3WB 4V0MA 2I4IA 3EWSA 2WJJA 1G3RA 2R2AA 3P26A 2O52A 2AX4A 2GJKA 1I2DA 2PEYA 1X8LA 4G5QA 4XIGS 2GEUA 2VPPA 2Q3FA 3NH9A 4FI3C 1HTWA 2V4ZA 2NG1A 2PT5A 2QU8A 2IC5A 1MH1A 2FFAA 2NZJA 2GCOA 5EP4A 1G6HA 2R62A 4NYJQ 4CEJA 1IY0A 5JRJA 5K8LA 3K0CC 4HUTA 5KDDA 1AQUA 4QGGA 2QEQA 4FW9A 3WY9A 4A6XA 2RGNC 1KI8A 1CIPA 1IJFA 1UBGA 3RS2A 5SZIA 1ESMA 2J7KA 4IOMA 1DBSA 2VL7A 1R0ZA 2QT0A 1XX6A 2GCNA 3UKDA 1SKQA 2IXGA 4AKIA 2F1JA 2OCBA 2WHXA 5JCZA 3AF3A 2QROA 1TMKA 5FTMA 2G1JA 5EUMA 2F55A 5KPDA 1OHHD 1EXMA 4KFUA 2R6FA 4N0EA 1GRQA 1KMHA 1Z6AA 5EXSA 3LV8A 3AGQA 4LHWA 4Q4HB 4F92B 3MWJA 3C8UA 4B74A 2MMCA 3TR0A 2XTNA 4FCWA 2DFNA 1FTNA 2WIBA 3NH6A 4QHSA 2G83A 4PO9A 5FOTA 4OK6A 4PPFA 4FWIB 5TB5A 1RYHA 2AFHE 1VTKA 1ZCBA 3ONWA 3ZD6A 2BKUA 4GDFA 2ZSDA 3VKHA 1VG9B 3BB1A 3RWMB 1D8TA 4IVRA 4M1KA 3IIJA 1JAHA 1SXJC 1ZJ6A 4PQYA 3PG5A 1RFLA 4IDQA 1BIFA 2IHBA 3IHLA 3KQUA 1OXUA 4HUQA 4B76A 2A3RA 3TNFA 2ZM5A 3UATA 3LXXA 3BOSA 1G3IA 4EPRA 3I8SA 3THXA 4BLQA 1SHZA 2GAAA 2JJ2D 3CH4B 4HB0A 4X8LA 5FUWA 2OAP1 3M4YA 4QL3A 4A2WA 4YMSA 1RZ3A 1NI3A 4Y0AA 4CEHB 4I4LA 1P2SA 2BV3A 4B43A 4DDWA 4AK9A 1KI2A 4MUAA 1OFIA 2G0NA 1WDTA 4O2LA 2BIFA 2QG6A 3N2EA 1Q44A 4PHHA 4BFZA 3RYTC 2NO7A 4IOKA 4IVPA 1KIMA 1TUEA 1Z06A 3AP3A 2FFHA 4TQAA 4WZ6A 1GNPA 4QG7A 1Z0AA 3FKSA 2ZPTX 4HAUA 4JL8A 1KI4A 4GMXA 2FEOA 4Z1MA 3FDIA 4LX0A 3U4QA 1Q22A 1OXVA 4E03A 3GLFE 3W5IA 3AVWA 4PZLA 3EPKA 4LJ4A 3NBFA 1Z07A 4I1VA 4IW3B 2BDTA 2GJ8A 1OF1A 4DBLC 1GL6A 2GCOB 5JLJA 4HLQB 4HLUA 5L3QA 1P9RA 1PLJA 1E2HA 2DWOA 3B82A 2QAGB 1G21E 4E09A 3HP1A 5H8WA 1P75A 4B3XA 3GLFA 4P32A 3P20A 1U0HC 4LRWA 1RPZA 4NYMR 3KKPA 4HLCA 2ZYTX 4JS0A 4TLBA 4DCNA 1WBDA 2RGEA 3BH7A 2NMVA 5AJVB 2D7DA 5GJCA 3EIQA 5BYKA 3MMPA 4POAA 3P27A 4JL5A 5E7IA 4D4KA 1L8QA 4JBXA 1ZRHA 4D25A 2BMEA 2HUPA 4BRUA 1KO5A 1W46A 3WRYC 2A2ZA 2W0MA 2WTUA 1N5IA 5CM8B 2QBYB 3BERA 1R8SA 3TIFA 4B48A 2GVDC 3WRXC 2IUTA 2W2TA 3I72A 3GFPA 4D0GA 4L16A 2VP9A 1RJ9A 4II7A 3OIUA 4Q9LA 4B3CA 3LVRE 1UBEA 3IDQA 1K5GA 1MT0A 4MKHA 3LQQA 4Z8XA 1W47A 4A92A 5J4LA 3LNCA 4KFSA 3I1FA 2DB3A 5IF9A 5D3MB 2A7QA 2OLJA 3FKQA 2ANBA 1M8PA 1P73A 1R6BX 3K0FB 1V5WA 2WICA 1KSGA 4IFEA 3T12A 2BHRA 3QXJA 3A1VA 5KNCA 3QKSA 4ZIRB 1PUIA 4C0LA 2HJGA 2O5VA 1ZC4A 2G77B 4U5XA 2IYVA 3LFUA 1NKSA 4KBFA 3K53A 2F1RA 3MSXA 4KXFB 3VAAA 2JLXA 4DCSA 3B1YA 1PUJA 3K9LA 4I1UA 4TZ6A 3G0HA 2OBMA 2WZQA 3IIKA 4M1OA 3SQXA 2WWWA 4LGMA 1IM2A 2ZRMA 1F2TB 2WPDD 2W6JA 5HKKD 2RGDA 2ZI7A 3TJZA 3VMFA 5FUVA 5FOUA 4AURA 3DZDA 4Q7JB 1CBUA 4BGDA 3KQLA 5K8TA 1NG9A 3RSOA 2IS2A 1OSNA 1CR0A 3NDBB 3H1TA 1TL7C 3BXZA 3FFAA 5FBLB 4B47A 2V8OA 3QF4B 1ZBDA 4LJ6A 5F9HA 4A15A 5EZ5A 1R5OA 4R9UC 2ATXA 1W1WA 1CULC 2ZTSA 3GEEA 3KKQA 5H68A 1HQCA 4EJSC 4DDTA 5L3VA 1PVOA 3AVPA 1AZTA 4WVFA 3OEED 3FYHA 2H1LA 2OUKA 5EE0A 3AF0A 2ZS8A 3QG5A 1O87A 2C8VA 5ELXA 4DC9A 5FTJA 5A4JA 3U3KA 4UXIA 1C4OA 4DUGA 1II8B 4IRUB 3TSZA 1E1RD 4JLOA 3RS0A 2A5GA 1WA5A 1M7BA 1U90A 4A8JC 4C2UA 2BJVA 3VQTA 3GLIA 1A2KC 2WMOB 1RYFA 2XEXA 5EXTA 1E9CA 2Z6VA 1N5LA 3DOEA 2OBNA 3BC1A 2RGBA 3AKEA 1DELA 1GP2A 4ZPXA 4WA7A 4NZYA 3Q85A 2ZVQX 2QT1A 3L0IB 2NO1A 2DFLA 3ZDQA 3F0TA 3MLEA 4TT3A 3MCAA 1E0SA 3B85A 3T5GA 3EA5A 2JIZA 3N5CA 5EE3A 4IXMA 4ZKEA 121PA 2QRZA 1P2UA 3NTUA 4GP7A 2DY1A 1UDWA 1IY1A 1VDZA 4MKIA 4KSCA 3QXXA 4O3MA 2WAYA 4CEIA 4JLBA 1R5NA 2O8FA 3PUWA 1R0XA 4PC1A 1O3YA 1YQTA 4OK5A 5TY0A 2GEDA 4NYIR 2O8EA 5LPNA 2YJTD 1MABB 3HPRA 1LB1B 3BBPA 2RGCA 4FIDA 4HB4A 4IOLA 1ZD8A 2CNWA 3U7HB 1US8B 1QF9A 1XCGB 4US0R 2J46A 2F3RA 5FBVB 3GLIE 3B60A 5FPYA 4CZ2A 1X3SA 1OXXK 3GQBA 5FL3A 3GCGA 3EASA 5JJIA 4L5BA 3KQNA 4BFSA 1P7CA 3NHBA 4LBYA 2IBMA 1XXHB 4TLAA 3L0SA 1M74A 3A4MA 2IYSA 4V03A 4DLVA 3P1JA 2ZEJA 2H7VA 4Q9KA 2CL6X 3BIFA 4BFUA 4WZAE 4TL7A 1IONA 3D8BA 2VBCA 4LV6A 5DN6D 1RRPA 3DEFA 2CE2X 4DVGA 2ODEA 1WCV1 1QHNA 2QZ4A 3AP2A 4X8OA 2GJ9A 1KDRA 4KYUA 1SVWA 3GLIB 1EFUA 1KK0A 4N0DA 3D3QA 2BM1A 3HDTA 3AKCA 2XNSA 4AG6A 3NDPA 4RCZA 3N2IA 4IJMA 4KVGA 2GF0A 5LBIA 1AS0A 2IYUA 2EVWX 2K5UA 4MYUA 4TL9A 3KXIA 4GMDA 5JBQA 3TSWA 4LBWA 1WQ1R 1JECA 3LLMA 4L9SA 5L3RA 2G1KA 1W44A 3LW7A 3B6EA 2RCNA 3I8XA 4ZKDA 4IVQA 1T91A 4V0LA 4DHEA 2OE2A 2NOAA 2IWRA 1E69A 2L0XA 5EE9A 5BW8A 2F7SA 4YDHB 4PQFA 1BYIA 1NP6A 4B71A 2XOKD 1TEVA 1NSFA 1RIFA 1XWIA 2GDJA 4PHFA 3SZRA 2N1BA 1XEXA 2FPLA 4DB2A 4RFVA 4F93B 1NJFA 1Z83A 4JLNA 2ERYA 2P2LA 3W9YA 1S9DA 4TYWA 3PITA 2RMKA 1ZD1A 1XF9A 3NBXX 3U6KA 1KDTA 2J0SA 4Q7MB 4OJKA 4TTPA 3PUXA 1NMYA 3MJHA 2BM0A 3PQCA 3MAAC 3ZVNA 4NCJA 1LS6A 1ZW6A 1N6HA 4YLGA 4AG5A 4YMUA 1QDEA 1T4GA 2YZ2A 4JMPA 3BH0A 4JBWA 3WNBA 2AKYA 4G0NA 5IK2D 4BLTA 2DWQA 4C0AC 1F2UA 5JI3E 2UZ3A 4D80A 4R2HA 3ASZA 3W34A 4RKEA 1GRNA 1G9XA 2H16A 2KWIA 2OAQ1 4H1UA 2J7PD 2WV9A 1ZUHA 1NNEA 3O8DA 1E2KA 4ACAA 1RRGA 1ZM7A 1XDBA 2BCJQ 4C0SA 3GLGE 3R9WA 4A0RA 5ANRB 5FOXA 4KO8A 4B3FX 2IXFA 2HXYA 3CX6A 3OIYA 4TN1A 4EDHA 1IN4A 2BEKA 2C95A 3M6AA 3CWQA 4OQXA 4RFSB 3WMFA 3CZPA 5KU1A 2EWVA 4TSFA 5FFMA 3VR3A 2QNRA 2IX3A 2B92A 3GLHE 1ZP6A 2C2HA 2XTMA 1Q57A 4AD8A 4B2IA 2G3YA 3BFVA 4PAQA 3C15C 3W5JA 2AD1A 4NMMA 4CYMA 4Q4JB 1G8YA 3FMFA 5JWOA 4PPQA 2OEPA 2EW1A 3QF7A 2YWHA 2OSBA 1SXJA 2YV5A 3VR2A 4RY2A 5DHFA 4P4SA 4EUNA 5JHGB 2XZOA 2JLWA 3W6PA 4D2IA 4LHYA 4P4TA 3QI2A 2RHMA 1Q1ZA 4BZPA 4DWJA 4F4IA 4OQLA 5KNBA 2CE7A 4HYYA 5FPTA 1W36D 2NPFA 4DUGD 3TGPA 1LF0A 2GETA 3EC2A 4U00A 2J7PA 2QMHA 1JEEA 2BBWA 2DR3A 1N0VC 1KKLA 1NN1A 4ZDWA 2BCGY 2Y8EA 3U3JA 2N42A 5FOWA 1I4LD 4Q19A 2GILA 4BEBA 1IN7A 1IXZA 4NONA 1TF7A 2OZEA 4TYPA 2FFQA 4U02A 4Q1FA 1OIXA 4IXNA 5TXGA 1CR2A 2VO1A 1KGDA 1P3JA 1XTKA 1T0JB 1QHSA 1TNDA 4RCYA 4EPVA 1IAQA 2JAQA 1RJ9B 4R71A 5L3QB 3X2SA 3ADCA 5EP3A 4TTQA 5HE8A 1S1MA 1N3BA 2XNDA 3SHWA 4PQRA 2QL6A 1E2LA 1XPUA 1GILA 3RLFA 1XXHA 2XZLA 1E2FA 5JWRA 2PCJA 2F1HA 1N5JA 3HU1A 1ZUNB 2V54A 3RC3A 2IEYA 3DKVA 4LJ8A 1XTIA 2QM7A 2R8RA 4DLUA 4I99A 3DZ8A 5E95A 1N6RA 5KOYA 2NGRA 5J5CA 4ZDIA 1US8A 1ZNXA 4URZR 3P4YA 1NLFA 5DSZA 2XB4A 3R7WB 1QHHB 4QHYA 2O8CB 2VA8A 4OK3A 4LHXA 1TQ4A 2FMXA 1HE1C 5AR1A 3T06B 1Z2AA 4ZV4A 4GBMA 3GJ6A 2GHIA 2J0UA 3IO5A 4FMDF 4ILEA 5C2JB 4GSYA 5EP2A 4OI1A 3RS7A 2X1VA 4KBGA 1W36B 3HYRA 1CP2A 2ZI9A 3KJIA 2P5TB 3QG1A 3ZQJA 4URVR 1NVUQ 2EFCB 2C5LA 5H1YA 3GJ7A 2VP2A 3GLGA 3IHWA 4ABYA 4B6EA 1CS4C 4Q4JA 4AIIA 3THXB 1AK2A 2JLRA 2C78A 1MRNA 5FI0B 5FOVA 1KZGB 1YKSA 3Q3JB 4B3GA 1G5TA 2ZI4A 1VYTA 4EJSB 4RD4A 2YWFA 5DYIA 2JASA 4YMVA 5J4KA 3BWDD 4ASUA 2W0SA 3W6OA 5KTYA 2FF7A 1EX6A 1FOEB 3CIOA 3CX8A 4LSGA 4Q18A 1CEEA 5FUYA 1RKBA 2IYXA 1A82A 4XTRA 5JWHA 3J81k 1AGRA 1P4SA 3IBGA 3QIAA 4ON9A 3U61B 1COWA 2V6JA 3QEJA 3E5HA 2OFOA 1WMSA 3U7EB 3QSYA 3LO5A 1G8PA 2DFKB 1Z6GA 1UAAA 1IY2A 3CF2A 3DPUA 1KI6B 4G5SA 4PANA 1W7AA 3PJRA 4AKGA 4B34A 1F2UB 1DE0A 3GJ0A 3TW8B 5FPKA 1KY3A 2MSCB 5IRCD 2O8DA 3ZH9B 3HYTA 1GSIA 2NTYC 1Q20A 4CEJB 1Q3TA 4BLOA 1AGPA 1FL9A 1UPTA 2GJAA 4XD7A 2FNAA 2ZU0C 3B5JA 1I4TD 2BBTA 1MR3F 1TF5A 1UDXA 3KB1A 2P67A 4LWZA 1R0YA 1KI3A 3Q5EA 4FMCF 8OHMA 5EE1A 1KO7A 1IOZA 3MFYA 4Q9HA 3ZZTA 2ZRDA 1UADA 3ZD7A 2VP0A 3ADDA 2WWGA 4OYHA 3TUIC 2WOOA 2VH5R 4HB2A 621PA 2W6JD 1E0JA 1OFUX 4KFTA 2GK6A 2QPAA 2FH5B 1U94A 3U7GA 3EARA 1II9A 4AY2A 1M2OB 4Q4AA 1HEIA 3SR0A 4A2QA 4QGHA 4Q7KA 3S1AB 2GA8A 3TSOA 2JA1A 1AQYA 1WXQA 4IDOA 2C99A 2Q3MA 3QKTA 2PZGA 4G5OA 4JL6A 2B8TA 3VR4A 3IO3A 1OH6A 4RZXA 5D3MA 2ZYUX 3RHFA 1XFAA 3CRMA 3H86A 2C98A 5JFGA 1G64A 1ZM2A 4HAXA 2Q9BA 1M34E 3KXKA 2BKEA 2W00A 1N2CE 5CM9C 2G9NA 1OT3A 5UKDA 3TUJC 1EESA 3LBIA 4RSGA 4C0JA 3WMGA 4TMZA 1E79D 1QVAA 3A58B 4QBGB 5J4HA 2A30A 5SZKB 1UM8A 2VP4A 3R8FA 1XXHE 4LV8B 2XTZA 3CX7A 4QNRA 2BMJA 1N6OA 2F43A 1SVOA 1W36C 1LY1A 5J4VA 2VHTA 3K0SA 2AXNA 3L8ZA 2KBFA 2ZI5A 2IUUA 4ASUD 1KSHA 4JYCA 4CGZA 1CJTC 5JHHB 1J99A 3B1XA 4TQUS 2GESA 2R6CA 3FFBA 3UXMA 1GTVA 4GOJA 1D2EA 2QRNA 2AD5A 2AWNA 1FQJA 2D74A 4O25A 1KK1A 1ODFA 4DJTA 1YZTA 4F4CA 1VCNA 3CNNA 1A7JA 3RWOA 2XITA 4EQ6A 2J0VA 2XGJA 1TU4A 3CH5A 3U3RA 4HDOB 4EAQA 2SHKA 1F6BA 4RD1A 2QE7A 4QBIA 5EQTA 3ZZ0A 3A1UA 4HLUC 5LD2B 1T3LA 1SXJD 1E9BA 3ND9A 1HV8A 1I4DD 5KSOA 5LD2C 2V7QD 3TLXA 2KE5A 5DI3A 3KQKA 2J59A 3BB4A 2WKQA 4TL8A 4A0GA 4OKSA 3GEIA 5BWMA 2ZRIA 3FE2A 4MRNA 1VCIA 1S3GA 5IDVA 2UZIR 4NDZA 2HJVA 2J9RA 3QEOA 4MGYR 4A0FA 2CDNA 1E9FA 1HY3A 1EWRA 1U8YA 3I32A 4LBZA 1IQPA 3SOPA 1U8ZA 3PXGA 3QNUA 2Q3HA 2QMEA 4J0QA 4MUBA 4PR0A 4RKFA 4AC9A 3KFXA 3MUFA 3KQHA 2N46A 4HAWA 4KSBA 2ZJAA 1XJCA 4EFLA 1AKEA 2ZQ5A 3C5CA 3CF6R 3EZFA 5JSZB 3QXHA 5FPHA 3IEVA 4Q4AB 1YR7A 1BMFA 3TK1A 1TU3A 1CJMA 1OFTA 1TQ6A 4GOKA 2FN4A 3UG7A 3SJCA 4Q47A 5C46F 4Z54A 4CW7A 4XWOA 2VHCA 4MGKR 1OPXA 2E1RA 1H65A 2YYZA 2X19A 3KKOA 1U9IA 3LRPA 2ZJ8A 4QM7A 4B35A 2A78A 6Q21A 4LUCA 3I3SR 4YMTA 2CHGA 2PMDA 3A36A 5GJWC 1Z0DA 3I5YA 2YOGA 2NO6A 1JBKA 2WWXA 3KJGA 4MDFA 1JALA 1CU1A 1KI7A 2VIIA 4DLYA 4US2R 1TTTA 3TE6A 1G5RA 4HZUB 4HAVA 2CEAA 4HSEA 4D0NA 3K0AB 4OL0A 5DE3A 3CLVA 5AUPB 1UF9A 4HDCA 5E4FA 5FTKA 1T5LA 2UVQA 3OAAA 2GXUA 3QKSB 4M1TA 3ASYA 1ZU5A 1E96A 2QGZA 1E1QD 2NO9A 3P32A 4JT4A 1YR8A 1OKKD 4QBHA 2QENA 4EPWA 1Z6XA 5GJBA 4UNSA 1GG2A 3B7GA 2JJ2A 5JJLA 2GWHA 3A6PC 4LBVA 2VRWA 2IYYA 4Q5IA 4LJ5A 4NCHA 4HATA 2QTHA 3ZQ6A 2WWYA 3B1VA 2A5FA 1SVMA 3CF0A 3HR8A 4TMVA 3VU9A 2FSGA 2VF8A 1YRBA 4PAMA 1Q0UA 3BRWD 3FKSD 1G16A 3F8TA 4XSGA 3T34A 5JEEA 4Q1DA 1AJEA 2UKDA 3LD9A 1ZAKA 1P62B 1SZPA 3KJHA 5FH9A 4MITA 1VHLA 2H92A 1NY5A 2CHQA 3WHKA 3D7MA 4W5WA 2Q9AA 2VEDA 3SI7A 2H8KA 1KNQA 2GNOA 4QNMA 2JLZA 1T8TA 4PHTA 1EK0A 1KO4A 4PHGA 4UNRA 1XPRA 2IS1A 4EPXA 3OF5A 1NBMD 5BN4A 1PJRA 1LTQA 3NIBA 3NWJA 4D82A 3DMNA 1LF5A 1Q1QA 1ZCAA 1IXRC 2CLCX 2I1QA 1KOFA 4GPTA 2DWPA 1W2HA 3QPVA 4DSOA 1Z0IA 3OEHD 3KZ1E 3MRSA 1KNXA 2ZITA 4FN5A 1W5SA 3ZVRA 4WIAA 2ZS9A 2G6BA 2R65A 2VQSA 1NVXQ 2W2VA 3GJ5A 3VR6A 1UKVY 2F1IA 3U3OA 2OV2A 4BLPA 4PPNA 1BOFA 1OXSC 2KJQA 2C9CA 4DLZA 1EGAA 3KXLA 4K8OA 4IOJA 3IBYA 3LLUA 1YR6A 1Z0KA 4NCKA 4YDSA 3VX3A 3FGNA 3B13B 1W4BA 3UIEA 4QFMA 5FR1A 1SGWA 3KJEA 4HDQB 1J2JA 2BMFA 2QP9X 4C0QC 4PX9A 1JAIA 3JZMA 1SQ5A 2P6UA 5EUQB 5FUXA 2PJRA 2Z43A 5FBRB 2XNDD 3T1VA 2V9PA 1XZQA 1IN5A 1OYWA 3ECCA 2FZ4A 1G20E 2ZR7A 2YNMA 3C41J 3RC8A 4G3XA 4MA4A 1N6NA 3OEHA 3CNLA 2EFHB 1G5PA 4MRPA 3WBKA 3HR7A 5JI2E 4LJ7A 4OHZA 2Z0MA 1JR6A 5CJ2A 2QY9A 3KKMA 5C18A 3DM5A 3K0CA 1AN0A 2YHSA 1DAEA 1PLKA 1K5DA 2WKRA 3CRRA 3WNCA 1NBMA 3M0EA 5KSZA 4IEEA 3CZQA 3LY5A 2R9VA 3BE4A 3NVAA 3OE7D 4G01B 2CLDX 5KPJA 2R6AA 2NPIA 1RC8A 1W4AA 1MOZA 2RGAA 2ZI3A 4P4SB 5B58C 1N6IA 2P6NA 2QP3A 3NBYC 1NIPA 1G18A 3AQ4A 1W0JD 4M1SA 1F48A 1XMIA 4DSTA 3LWNA 1GNRA 1H8HD 2QQ0A 2CHVA 4JLDA 2YINC 5FBQB 2ZROA 4MGIR 1COWD 2RGXA 4D6PA 2BC9A 2RB4A 5G40A 4MYTA 1OH7A 4QJ5A 3CRW1 4TMTA 3W8RA 3G5UA 4DLTA 2AWOA 3O8BA 1S9HA 1U99A 2WSSA 5JCPA 2RKOA 2WWHA 1YHNA 3LBHA 3ZIAA 3SE0A 2OXCA 5A0FA 3BK7A 2ASEA 4LYAA 1KO8A 1JQLB 3SS8A 1BKDR 3WYGA 4XVRA 1Z3IX 2JEOA 1S96A 2ZRPA 3FMPB 3OZXA 1XEWX 4NE2A 4PXAA 4DEXA 2WJHA 3OIWA 4DIEA 2O8EB 5CYOA 3FHCB 1FP6A 4LPSA 1YJ5A 4BEJA 3I92A 1XJQA 5EZ6B 5KUTA 3THWA 3M1IA 5B2ZA 2P6RA 3VX4A 1T5IA 1JR3E 1KTVA 4M1MA 2ORWA 4QKQA 1GAJA 3W3ZB 2I1VB 3AF1A 1YZGA 3UG6A 3EPJA 5C4MA 5DYGA 4JBYA 1E2QA 4PZZA 2VP5A 4OI2A 2GRJA 3CBQA 1BYUA 5KSPA 3X1WA 1CJVC 1T0HB 4NYIQ 3CNOA 2A5JA 4JKIA 3AV0B 4RD0A 4QM6A 4R98A 2PH1A 2VSOA 2ZXUA 1B23P 4GOXA 4PC2A 5G41A 2IXEA 3RAPR 3OE7A
chains in the Genus database with same CATH superfamily
1P1JA 4D4MA 2J4CA 1XMSA 5IM5A 1UC5B 2PGAA 4O5AA 4Q9JA 2VLIA 3QJYA 5FADA 4MTLA 1I5EA 2QBYA 4D5EA 1PN3A 3C4QA 2MIIA 4KW7A 5IVIA 3CUUA 3DQPA 4RQAA 5EYPB 2J3HA 3QU2A 3B7WA 5ULLA 3SPXA 1DX4A 5JD5A 5F9FA 1A4IA 1B6TA 1YZQA 4E1BA 3W5SA 1DAHA 4FBMA 4NNPA 1ZGJA 5T57A 3W05A 5JZVA 2W2MA 2PD6A 1E2PA 1EUCB 1PT5A 3GIWA 2QL9A 3V7FA 4P33A 9LDBA 3HP4A 2AOUA 3U40A 1LD3A 4QATA 1QQAA 2FMFA 3LF2A 5FFFA 5LA6B 4DIBA 1RI4A 2JFNA 3MN1A 4IRMA 3N75A 1WXWA 4C30A 1OLXA 2UUOA 5C1BA 2ACKA 3GYBA 3OIVA 1HLPA 1UBUS 1NNSA 4IKEA 4N40A 1T5BA 2BHLA 3FYUC 5JU6A 1GKKA 3DTVA 3NB0A 3W5HA 4G4IA 4I4CA 2C5EA 2HL6A 3N87A 5CDFA 3UMRA 3HI6A 4MX8A 1GKIA 2XA1A 1NIJA 1AXEA 1L7OA 1S8FA 2CW5A 3D7NA 3AW8A 3RAJA 2ES4A 4DJEC 3DVLA 4IMJB 3NBZC 5LQKA 4DIFA 3FPCA 4KXLA 4RBNA 2RG1A 3GT0A 1G41A 3AFGA 3SR3A 1N7IA 4M1YA 1S3SA 2RHWA 4B3BA 1N2GA 4OHYA 1JJ7A 1FVOA 2ZBGA 2ZJ0A 3C6YA 1GTL1 1QHXA 3O3OB 4RD3A 3WGHA 1V1JA 3EZLA 3JQGB 4WY2A 1RACA 3SKVA 4NCAA 3KETA 1T8SA 1GGVA 3LPNA 1RS0A 3PQ8A 1DU4A 1M5RA 2VZ0A 3L6UA 3WYBA 4MQBA 1VPVA 3NJ4A 2GGSA 1R0RE 2ZSBA 5AK4A 4C6SA 1E7QA 1EHYA 1QV9A 4V0NA 1NHGA 4J1QA 1SOWA 1HYGA 1CUYA 1UZUA 2ZYAA 3WGNA 3OM1A 2B5WA 2Q6OA 2XCTB 1Z36A 4G0UA 4GYWA 3KSDO 5E4YA 1QU2A 4ZCIA 2HCBA 3AUSA 3LQ1A 4I50B 2CUZA 5HKAA 3GUHA 4IV8A 2IOFK 4BZQA 4KN9S 1EJ0A 3SSMA 1JAXA 3UWSA 3HZZA 1W30A 3C5VA 5DNUA 1TQ2A 2Q07A 1ELOA 2JBWA 4GP6A 4OYRA 1DINA 1WMBA 3UMFA 1R5BA 2PUWA 2AR9A 1FDTA 3PX2A 4HWRA 3L4SO 4WX2B 4PM4A 3QVLA 1SCBA 2I99A 5J23A 2Z5FA 3HHEA 1MZPA 5GIOE 1YZLA 3RRYA 3A28A 4GYJA 4K5QA 4ARZB 5FB3A 3HB0A 4UXHA 3VBCA 1I2CA 2IZ7A 4QDJA 4YRIA 3HFJA 2C5AA 2OFXA 4ZQFA 4W7SA 5LB2A 1CDZA 1KYIA 3S68A 5CP8A 3J7TA 4ND6A 3U3ZA 2R79A 4QBFA 4QDUA 1Z2CA 2X42A 1EXWA 1UKZA 3WO1A 3F71A 4EX6A 1PNVA 1PYDA 4LY6A 1PU2A 4QTXA 1U3DA 5DW0A 4W7IA 3LCMA 4EZIA 5A7FA 1T36B 2WF5A 5KDLA 1ZITA 2GD2A 2IITA 2O59A 3ZI4A 1CUIA 1XDUA 1XTVA 5CMLA 1YZKA 1U3GA 4FMPA 4E32A 5K8IA 1UDBA 4C7KA 4DJJA 4QDOA 3CJQA 1SXQA 5DSTA 1CNEA 1KH1A 2ZVPX 3DT9A 4X20B 4YBRA 3VU9B 2J0EA 2ZM6B 3SQWA 2WSBA 1HFEL 3E7XA 4WOKA 4KQ6A 4LISA 2OCAA 2R8ZA 4EO9A 3FSJX 2WVAA 3X2EA 5JS7A 1VJGA 3DW1X 3TQHA 3LW8A 3BMCB 4UM5A 4WTOA 1XRQA 4MCJA 3V1KA 4RH0A 3MTIA 4RDHA 2ADFA 4BNTA 2V3WA 1TEHA 2GPBA 3N2KA 3QFFA 4OQPA 5LYJA 3RU7A 3SDZA 4Y2GA 3QPDA 1YI1A 1U5BA 5CLGA 2SNIE 2O20A 1L1EA 5BQ5A 3W9SA 3WWYA 4G5FA 1SUPA 5ALPA 4BECA 4O63O 3S5JA 3Q8XB 1GKYA 2HIAA 3OEEA 4GZMA 5I9MA 4R7TA 2XGSA 3UJ7A 2VHWA 4G1UC 1WXHA 3BXHA 3R77A 4YASA 1DQZA 1YQWA 4M0KA 2IQ5A 2W8BB 2QUIA 4BPBA 2GD0A 1JU9A 1ESDA 1R6VA 1X1RA 1JDJA 2P9YA 3B8EA 2C42A 3VPBA 3WLTA 1RXVA 1KVRA 4CF3A 4JR1A 2B83A 2D8MA 1AQJA 2RHBA 3GYGA 3U09A 1KFKB 1P1CA 1YWGO 3BH6A 1GGNA 3FJ1A 4GI2A 2X2EA 1CEXA 4LK2A 1Z4QA 4DBLE 5LXTA 5KOJB 5FV7A 4G37A 3DZFA 2BW0A 3T41A 5KKNB 5DIZA 4JJEA 3IT3A 2O2XA 1PEAA 2AJ8A 1PV1A 4ZAFA 1FMFA 5LQNA 2ID4A 4MSUA 3R7WA 1GZ6A 5CHYA 3C1TA 4MS3B 3QY0A 3SF0A 1LPPA 2WHPA 4JU8A 4RTQA 1XLTA 3MWGA 4ZAYA 3PEYA 4QYIB 3L0OA 4MR9B 4R5HA 4XQEA 4AF6A 1SULA 3EULA 4WLEA 3HB7A 1DVRA 2CVQA 4JFAA 4QLOA 1ODCA 2EF1A 4LVUA 5D85A 3EXAA 3B1KA 3QLUC 1N5RA 2ZRAA 3Q8LA 5D8DA 1AA9A 3DMFA 1OLOA 3O4GA 4Z3OA 5A3SA 4I9FA 4D0SA 5IKXA 4ESVA 1JMVA 3S7TA 4F91B 1BX0A 1ZN7A 3PNVA 3MOIA 5T64A 2ZIZA 2XD4A 5TV2A 2WY2D 1LPNA 1GPJA 4F4HA 2H07A 2BT4A 4LYHA 1TVMA 3WYEA 4ZMRA 3VMMA 3LWBA 3DLBA 2XCIA 2V6BA 4QVGA 4NJEB 2BJWA 5EIHA 3FWNA 5TQ2A 4N6OA 4P31A 2WUWE 2VC2B 3G5MA 5FI1B 1V6AA 1RLOA 3L0PA 3LOPA 5C8XA 3I9V1 3SJAA 3B78A 3X43A 2CL5A 2Q0XA 5DH9A 5KCMA 4BEVA 1ZLYA 5L4SA 4MTCA 2FE1A 3IUYA 3FOZA 2BP7B 2BWJA 3QHPA 3B20A 4LDNA 3WLAA 5L3SA 4TUYA 5DBIA 4JSRA 4PGFA 1LQTA 4BIMA 1CK4A 1U1CA 5U1PA 4NECA 2ACVA 1NFRA 4YYEA 4OBEA 3S2FA 1FPMA 1QB7A 4K6OA 2CHFA 2P0EA 2P9CA 2R7NA 3AUYA 1TAGA 1YR3A 4V2UA 3W2HA 2FSVA 2Q1WA 3K6KA 4IIJF 2F6RA 4IG9A 2QVGA 2FUEA 2XUJA 1XC7A 1JKIA 1OWLA 2J5XA 4JITA 4KQFA 5JZOA 1GOTA 1KKMA 3PHJA 2ANCA 1R7RA 2H8GA 3MWLA 2GJSA 4XGIA 4GZ5A 5CW1A 2WJ4A 2JGDA 2G07A 4U7FA 4ZK6A 3H8VA 4RLHA 4CWAA 1HX7A 3TIIA 1Q3KA 2JJ1D 3IT1A 1TYDE 3GRPA 4MV0A 5DYYA 4RCVA 5JSKA 1P0QA 3ZCUA 2XQIA 4AO6A 5B4UA 5JMWA 3TCKA 1NE7A 4TTRA 1A5ZA 3PNPA 3BE5A 3PJEA 1VIAA 3UHOA 2IDKA 3VR5D 4YIKA 2E21A 4YFYA 1NLUA 1OAAA 2XHEA 3IHKA 4INAA 3CE6A 3FDJA 3KDAA 2W6IA 4S2UA 3AJAA 5EINA 1XEWY 5KYUA 4N5DA 3H4VA 2CT8A 1KJWA 1QG2A 2GTPA 5HILA 4F7DA 4AUKA 1OXKB 1PR1A 3LL7A 1U7HA 2ECFA 5JZSA 4WOPA 1JIJA 3ROKA 2UVDA 1WBJB 3AR6A 4YXWA 1NSTA 3NTLA 1Z34A 1JSZA 1ZJJA 4GM0A 2QTBA 3PHGA 3T5DA 2DHDA 3EQ2A 4A6EA 2QZSA 4C6TB 1KH3A 3EGEA 1FVXA 3EXEA 3IESA 3B2QA 2B7BA 4PG4A 4KU4A 2D54A 4DEYA 5KS2A 1OGYA 4ICIA 5M04A 3F3KA 2IS4A 4OHOA 4IR7A 3M6FA 1XEFA 2QYSA 1RRCA 1KVUA 1OUMA 1E1CA 3IGFA 2CLIB 3O21A 1PLLA 1DZIA 2I4TA 4MW2A 3MT8A 2IH5A 3GP8A 1MJNA 3PT9A 4E2WA 2FDCA 5J63A 4B6PA 1J56A 3AUJB 2VTKA 4OQMA 1DEAA 2UYCA 1F8UA 4RXTA 5IBQA 5CA1A 1B00A 2ZR9A 2ZTMA 5K4GA 4A8TA 1EBUA 3PLRA 1SM4A 3PUHA 2YZKA 3ZIAD 3WNZA 4C7XA 1XLTC 4MV6A 5K3CA 2K2QB 3WISA 2LVBA 1Y4SA 2FKAA 3PFIA 5CFNA 4LCBA 5HZKA 1N5KA 1G0NA 2BFAA 3L6RA 1LLFA 1GL9B 1WZNA 4I3HA 3S6JA 1ZD2P 1H3EA 4UBIA 4CKEB 1AHNA 2JK1A 4H9GA 4BLSA 1HKHA 4KPEC 4I14A 2LIVA 5CNKA 3M82A 1Q84A 5AXBA 3SF8A 1OPRA 3IJ5A 3NBQA 5JQGF 4EZBA 3P2OA 1KDOA 3U2QA 3BK2A 3T4PA 3UFXA 4O4JA 1ZLXA 3OO0A 3SD7A 3SEQA 1YHYA 4L2IB 4W1RA 4WXYB 5FNVF 5FKJA 5L3SB 1PR9A 1U81A 3IELA 3VDMA 1NBAA 3HM9A 1MA3A 3DMTA 4KI7A 4LGCA 4ECAA 4M87A 1KQGA 1A9PA 1J8MF 1WF3A 2RBKA 4XQ0A 5EJIA 5U4QA 4V1CI 1W5FA 1UXIA 3OY2A 4KUHA 4LPKA 5H59A 3KPUA 1C7RA 3KSUA 4S1NA 4GXTA 4UOEA 3LPLA 1C2TA 3EG9B 4DL9A 1H8ED 1V47A 5IZ4A 3BMNA 4HWKA 4MEBA 2DG2A 3M81A 2NVWA 1SK9A 3KDSE 3QE2A 1USUA 5U4XA 1TUGA 1G4AE 3ADPA 4YAGA 2IGTA 2EERA 2NZVG 1JXOA 3FETA 4JY7A 2FSIA 4UVIA 3RS4A 4D42A 2PQ2A 2NZ8A 2X6TA 4QQRA 1FRZA 1ZIOA 2HFJA 4IO1A 4QXMA 3TZBA 2YWBA 2FZLA 1SMKA 2D4HA 2D1TA 4UEQA 3GEHA 2XGMA 1Q91A 3Q98A 1DKNA 3ZZ1A 2AI1A 2PZFA 1D2HA 2BGIA 3FPKA 1NJGA 2YX1A 2HA5A 1OFHA 2H0RA 4X41A 1X77A 1T24A 4A6DA 3MBOA 4GH5A 5KTOA 5MGBA 4LV5B 4INPA 3WLJA 4RHTA 4F4UA 2O8NA 4ZU3A 1AY0A 4PSDA 3KJFA 2ZXEA 3THRA 4BGIA 3AM3A 3BGWA 4ZFNA 3TL3A 4BN5A 3UJ6A 1V3UA 4BTEA 1J8YF 3ZHVA 3MVEA 4INOA 1QG6A 1YDHA 4XOUA 3CY6A 2A0WA 2PM8A 1D6SA 1CVLA 5B4VA 5CD9A 2HHLA 4XW2A 5EEGA 4YJFA 5BOVA 4EG3A 1BRMA 5E9AA 1T8RA 1U65A 1BS9A 2OVFA 3R76A 3R74A 4A0HA 4AYWA 2YWDA 3M6XA 2H1IA 3K72B 3LUKA 2TMKA 3DO6A 3WYNA 3VTKA 3DLAA 1M10A 1RJDA 4GE3A 3AO0B 2Z09A 3O2JA 4AL4A 3JS5A 3T1TA 2UYOA 2BFOA 3EDYA 4V3BA 1OQAA 2ZJOA 2LGJA 1Z8DA 4MR7B 2YXDA 3CG0A 1ZVJA 4YRPA 3T1NA 3QUSA 2AYXA 5IABA 1NVMB 3RK0A 4FJ2A 3CVJA 4BO3A 1QRDA 4CI9A 2R8XA 4E2ZA 3EIEA 4D4IA 2WF9A 3AUXA 4EPYA 2Z58A 2FWBA 1QQBA 4BO1A 2NAFA 3L41A 1WSBA 4L22A 2PBRA 3G9TA 5LIPA 6ADHA 4FONA 6PFKA 2A57A 4AYXA 4N41A 3GQVA 3REQB 2ZIXA 4KC0A 1STOA 2ZUBA 7ADHA 3DL2A 1FNMA 4TYNA 1K9VF 1VYUA 2D5LA 2OMEA 1DAFA 3GUYA 421PA 1LJUA 1T8WA 2Q3CA 1ZOIA 4TXLA 3EA4A 3FVWA 3KK0A 5DTQA 1HQKA 3M1LA 3QM1A 1KP9A 5FF9A 4BMVA 1X1QA 3CLRD 5DGCA 3VZQA 4QULA 4J1TA 5IVPA 2RH8A 1NQUA 1T0UA 4V0SA 5B55A 3NETA 2WFZA 2GN9A 1GPYA 2XE4A 3WZMA 4FLFA 2VQFB 3JQEA 1WCIB 1SIWA 4IDNA 1IZYA 2PD3A 3AY7A 3FCOA 4LZZA 3TLMA 1PJ3A 4L73A 1R8JA 1ADGA 2H17A 4ENTA 4YRSA 4C2TA 3ZJTA 4OX9B 3MA0A 4M49A 2AXQA 3OUUA 2A0UA 3KL4A 5F76A 4C1BA 3O7MA 3HDHA 4CUZA 4EHDA 2C96A 2X8JA 3C6MA 3D5EA 5KTNA 1UMBB 3KKNA 3LIPA 4R9RA 3JD1A 5EKSA 5KYWA 3SC3A 5SY4A 2YWXA 2DHEA 2I4NA 3G2NA 3I1YA 4UVGA 3VOBA 1XCLA 2P9GA 1WHSA 1BJKA 1Z9BA 2HSWA 1EWQA 5C1IA 2EZ4A 3AR4A 2ZYSA 3SC6A 4L15A 1IB0A 2HRCA 1NT2A 2O2ZA 2VSQA 3I9JA 3LGAA 1W52X 3NC4A 4G56A 4HEA1 4NQZA 4Q48A 4PX5A 5K51A 4DBVO 4HLDA 3V7WA 1MCZA 3QBTA 1VCOA 3NM4A 3D3KA 1A4XA 2B9EA 1NBIA 1O54A 4MW9A 4O5OA 3MLBA 2KYRA 4UMVA 2OC9A 4GQAA 1LBIA 1AUVA 5TMBA 2QM3A 5SYNA 3WTBA 3WMRA 2VDPB 4HL6A 1Y0BA 3OPYA 3AF2A 3AILA 4NF2A 3PIIA 1OY1A 1QNLA 4B75A 4DLXA 1OLUA 3A37A 3H7IA 1CQJB 3F5FA 3FB1A 4Y9TA 2MMGA 3CLKA 5CH8A 3QTLA 3I42A 2WA1A 3OWOA 5CFPA 1Z0UA 1X80B 3UT5A 3CZ5A 2B8WA 4M0EA 2XI4A 4MMZB 2OGTA 3ZY3A 3TLCA 3B1ZA 4OJQA 4WFKA 3HCBA 2EQAA 2VBFA 2IHJA 1F5NA 3RVOA 1S3FA 1DB3A 5H82A 1L7VC 4BQEA 4EYEA 1B3BA 4RPLA 5AJXA 1ZM3A 2BOVA 4ARBA 2Z9BA 3HNOA 2EJVA 4JBGA 1II0A 3I0NA 2IPLA 2GXQA 1P2GA 1JJAA 2PL3A 2UYGA 2DQKA 4A8JB 4E51A 2XT0A 3ZU4A 2AFRA 2X4IA 5ICGA 1SBTA 4EVIA 6GPBA 1PV2A 3L07A 4EGFA 1BH2A 2OQRA 1CV2A 2ZJ6A 1I01A 2H59A 4BVLA 5BT8A 1QE3A 2FEPA 4QUAA 5IH3A 3CJRA 5CLIA 2R8OA 1JQ3A 1M8GA 1H42A 3LH5A 4R2JA 1XZHA 4MIYA 1A72A 3LC0A 4GRAA 1X6VA 4GO1A 1KEKA 3R5FA 4CF4A 1Z2PX 4PZYA 2GO7A 3WLKX 4O8ZA 4WV3A 3FTQA 1IBRA 3E8SA 5K01A 1BHJA 2A5LA 3E0QA 3KQVA 1WB5A 4HUQB 1G21A 3C97A 3TIGA 3BTUA 1ENYA 2FUNB 3BXGA 2VAXA 4LC0A 1VLZA 1YA4A 1N6PA 4DIUA 4D8XA 6REQB 1XE3A 4GGOA 2P6OA 2XB2A 1UDCA 1QJ4A 3JZAA 3M7IA 3NHJA 3OT5A 4NG4A 2EOAA 4XDZA 3VKVA 5HRUA 4MB0A 4D45A 1CRPA 1L5MA 4GWGA 3WYAA 1E3WB 5DDIP 2FWRA 4G2TA 3PDUA 4ZOEA 5JASA 1NLMA 4YJ2F 5I8ZA 4DRZA 3R3JA 2BBSA 2JATA 4RIHA 1NAIA 4LSMA 4RIEA 2ZZMA 2JFUA 1RW4A 3MD0A 3PXBA 2PSJA 1O0SA 3IKJA 3JQCA 3KO8A 4N3NA 5C7OO 1T6XA 2KB0A 1ISHA 1NL3A 1NY6A 2R7LA 2QTCA 3MCZA 1YR9A 4JEUA 2XMPA 4ZVLA 1AB5A 3RPEA 1G17A 2C9OA 1J49A 2Q1UA 3REGA 2OO5C 1EIZA 1AE1A 4Y67A 2JNWA 2RG7A 4HSGA 3T15A 4YJ2B 1E59A 2QUJA 4Q3BA 1ZUD1 2GEVA 2Z3ZA 5EIWA 4MVWA 4B3DA 2GF2A 5E38A 4MWZA 4A8JA 1C7JA 3AVVA 3VU1A 2NP7A 4JBHA 4IEFB 2YWEA 4JD5A 4TKVA 1U2RA 3AOGA 2L19A 2GPSA 4TT8A 2PS3A 1T4CB 2DGDA 2QE7D 2RFLA 5JCOA 2IOYA 3OU7A 2BZ0A 1O2DA 2C94A 4X0EA 5BQ3A 4YRFA 4K8RB 4RMHA 1S7GA 4K9RA 1TQDA 4EQZA 3WGVA 2HCJB 1F60A 5I7WA 2O7VA 1EK5A 4LNAA 5IMSA 2GMWA 5FWNA 1M6YA 4K6FA 4DMFA 2QXYA 3RBVA 3GW8A 3L7OA 1W0JA 2ZYDA 3P45A 4LHVA 3JQGA 3DDZX 3BEDA 4YREA 3RVJA 2E48A 3MCWA 5HSGA 1ZD9A 1MT3A 1SWWA 2Q3JA 4WUTA 3RADC 2JIBA 1QHGA 2AR7A 5GONA 1X2BA 5IJ0A 3KE9A 4KXUA 2W6ID 4U7JA 3BCRA 3BULA 3T4XA 1F2TA 4ES6A 3T52A 1CLEA 4JR2A 4UTPA 5HFJA 4RF5A 3VPGA 1GPBA 1XTUA 2GEJA 2HM7A 2COUA 1YS6A 3PB3A 3N74A 3Q1KA 3UK1A 4E31A 4EPTA 4DPKA 4OXKA 1QP0A 4BFVA 3UWPA 1LJ8A 3R6TA 1TCCA 1L7DA 1QMPA 3D6HA 4KJZA 4TS9A 1GARA 2HLDA 4WDRA 3WOVA 4LYJA 1ULTA 3KZXA 4PZAA 5DB4A 5C3UA 1BDIA 4EF6A 2Q9UA 3GROA 1C1YA 2W71A 4KUEA 3QSGA 2IZOA 2ZRBA 1KJ9A 4REQA 1FUKA 3TRHA 4B82A 1VJ0A 3ERCA 1B74A 4Q02A 1SZJG 5JVDB 4PC7A 4TV8A 5BORA 2QD3A 4HX9A 4FFLA 4BV9A 1GQQA 5JO0A 3SEFA 1YOVB 1P1IA 3W8DA 4WJLA 2QY6A 2FWAA 3ELYA 1UMDB 4D9BA 1FLVA 2IDMA 2AHOA 1TZMA 3OI7A 2FZ5A 1EX1A 2GAFA 1PQ4A 1JB9A 1NP7A 5ENZA 3WOHA 5IJ9B 3DL0A 3IPYA 2NU9A 2LBPA 4FMDB 4G25A 4BUCA 1XQ9A 4ZEWA 1ODLA 1Z63A 1M72A 3FFXA 2IP2A 2FEWB 4IJKA 3DL4A 1QHHA 3ILYA 1DWUA 3PGKA 4FDUA 4WMLA 5IT5A 3SLKA 2HZ7A 3FOAA 3OLYA 2IEDA 4KBYA 3IILA 4BHTA 1Y9JA 1JA1A 2VLBA 5AWFC 3UJBA 1SB8A 2H85A 3W5VA 1E5QA 1GCOA 4OJMX 3QF4A 3RF6A 5L4LA 3ZY6A 1D4AA 3NFRA 5K0FA 1EVEA 1WB9A 2CDCA 2BZ1A 1TECE 3HVIA 4R8MA 2F9LA 1KP2A 3GMSA 3IEIA 1QHIA 4WCFA 2GYVA 5THXA 4MHSA 5IAGA 2CXXA 2KLHA 3CUYA 1CD5A 1CR1A 3IAM1 3QU5A 1VE9A 3PDCA 4KAXA 2OSVA 2IPOA 4CIDA 2X0RA 4DG8A 4DYDA 1OH5A 1YZYA 4R2IA 5B36A 1ND6A 1IHXA 4C4SA 2YH2A 2ZSJA 5KQGA 2QN9A 1M8KA 2E5WA 4UHFA 2RC6A 1Z2OX 5E6SB 3EVFA 2CMGA 5T8KA 3RNOA 3KUUA 3ONEA 3ZY4A 1E8MA 2A33A 4RY9A 4NBSA 2R2GA 5ILQA 3HY3A 4MYCA 4PWZA 5D84A 3R3VA 5ALVA 2O8BB 2W2LA 2R1ZA 5LZ2A 3ZH2A 2H1HA 3UMSA 1Z2DA 1G8AA 3L77A 2RIPA 3JCZA 3LZ6A 3MWYW 2OXRA 3PF9A 5KTRA 2MSEB 2P1ZA 1ZM4A 3SAJA 1E62A 2BEWA 2GERA 4FBGA 4EG5A 2AF4C 3EXHC 4EW3A 4QE3A 2Y99A 3H16A 4N01A 1WTCA 3ZEIA 4BNDA 3IAUA 2BISA 1VSTA 3ESXA 2E1PA 3FIJA 1RAIA 3G1WA 2LCIA 2WI8A 3GA7A 3L1JA 1MF7A 4LYYA 4QUJA 3ZW8A 3CUWA 4UTNA 3BIJA 3OFND 1EFAA 1N9GA 1DX6A 3EGDB 5H02A 4KRXA 1N2XA 2ODTX 2QJFA 3JQQA 3EISA 5HOQA 2X6RA 1X1EA 1KZ6A 2AG8A 4AUEA 3GNQA 3DG9A 2JJMA 3AKDA 3LLVA 4LWOA 1VLHA 4MW5A 3Q7PA 4HC4A 5INTA 3PPYA 2PPVA 3PFGA 1YB6A 1KQ3A 4F71A 4GGPA 3EWNA 1CZHA 4G5RA 2LCFA 2DSTA 3TQFA 2VRCA 3LQ4A 3HMKA 4Q3NA 2OHIA 3RIEA 1L7XA 4NENA 3DLIA 3ZOZA 2ZU6A 4Y6SA 5EJ7A 4R3UC 3TZKA 3DAFA 3C16C 1WP9A 3ENVA 1IFXA 4HJRA 4R2WA 2NXWA 1WDKA 2Q6KA 3LYAA 1FUYB 1PZNA 2YXPX 5EZSA 1U2SA 4M88A 3TMYA 3X1XA 4D4LA 3EMVA 4CDNA 1XRNA 1U0LA 4M9QA 2NTJA 2VJKA 3FA2A 2JLSA 2D06A 4DRXB 1DARA 4CM4A 4ENPA 3ONFA 5EFZA 1E92A 1YRHA 3Q40A 5KTPA 3HGMA 1U0NA 3A9WA 1OYYA 3D6FA 3QKRA 2NAPA 4B4KA 2Q6VA 1C1DB 1S7CA 1C80A 3W8FA 1T2UA 3TH5A 1F0YA 1E4VA 5JO9A 3WWZA 1XCJA 1T9KA 4UJ3A 4EW2A 1DP4A 3F9CA 4IICA 1FFAA 1APBA 3D4IA 3OP1A 3E6AA 3I2GA 1GQYA 3WBFA 2B36A 2BFDB 1OX5A 1JLMA 2D3WA 5AKYA 3PA6A 4EECA 2RHJA 4DJAA 1NOJA 2AYZA 2H63A 3OOEA 2QX9A 1UFVA 3QQ5A 1RXCA 4G5HA 4PLWA 4Y2UA 1SXJB 1ZZGA 3AR3A 2DUNA 5FCDA 4C0BA 1YS7A 3NRBA 1QS0A 2O07A 3LIIA 2AOXA 1UFKA 1L2TA 2ECKA 4LOAA 5CA1F 2VSNA 4FEEA 1NN3A 1R00A 3DM9B 4AJKA 2CLEB 1QV6A 2F3TA 2AC4A 4MQUA 3GUVA 1OA0A 1WVMA 3Q6NA 1FFXA 2E4VA 2OZVA 3OZGA 4JB3A 4JIMA 5H70A 3KELA 3RRBA 4IH1A 2EYQA 1XB2A 3T3HA 5HCIA 1SUEA 1G5QA 5DSXA 4OKNA 3R7DA 1Z0ZA 4MI9A 1O9GA 2IL1A 2IPAB 4V0OA 2HF9A 2VT2A 1J0EA 1KI9A 3EXIB 2R6DA 3K9QO 3KVOA 2QIPA 3OX1A 4HADA 4N18A 5AW4A 3S4YA 3OJWA 3D4BA 2OFPA 4H0NA 2QQEA 4JJKA 3MS4A 1Q0TA 1H4TA 2G88A 3INYA 1NNLA 1XRJA 3QQPA 3RFTA 5BPHA 3TZCA 4XRGA 3CUTA 2C5FA 1I9GA 5ESRA 4GKKB 2EX0A 2J87A 1NMSA 3BPSA 5LMUB 4B3IA 2SKCA 4XYMA 1BHSA 5F64A 1J21A 5DN6A 5DTMA 4IFIA 1L6RA 1OI4A 2OD7A 2YMPA 4IIUA 3HXMA 1D2MA 2QW1A 4NHOA 4NK5A 4EA9A 4LF5B 1JNYA 1P29A 1X86B 1Z4JA 3TOCA 2GARA 2I3GA 1G1MA 1KPHA 1Y82A 4DDKA 1BVHA 1IUPA 1FS6A 3MJCA 4O1MA 1MC1A 2XHZA 7REQA 3E70C 4RA9B 1VKNA 1CRLA 1KYZA 5HRAA 2BEUA 2J48A 1Y4DE 3RRNA 3CWCA 1IVSA 2FB9A 3Q72A 4WY5A 4A2PA 4MUKA 5B37A 4QOIA 3ACDA 4V02A 5KWVA 3I4LA 2WAXA 2I8AA 2WOJA 3EAFA 3DLPX 3ANSA 3HVHA 3FTNA 5DGHA 4A26A 4ZARA 4ALKA 4Q82A 4RTNA 1E7SA 2E4AA 3GGOA 4YCDA 4ME6A 2OORA 1SRRA 2QX6A 5REQA 5IDXA 3OOSA 1U63A 1O7JA 3FPFA 3SIRA 3WBJA 3C6QA 1GKUB 1OYVA 2J0UB 3O82A 5DLPA 2GUGA 3UO8B 5IT0A 1PS8A 4HH0A 5TX7A 1TUIA 4CT0A 4KR0A 4BFTA 2XSZA 2PUAA 2PWZA 5A6SB 4ZD6A 1HMPA 2NT4A 2QMUA 4AG3A 3P0IA 1XD9A 3EVGA 4MHTA 1E7YA 3CW2A 4D8UA 3Q9SA 2J9YB 1A8IA 3GPLA 2J6BA 2J08A 2VPYA 1UBSB 3SHQA 3WQQA 4CLHA 1JJBA 4MPDA 5MHTA 2B6NA 3DKIA 3RVQA 4C4PA 2PZEA 2Q5LA 3QLVA 1O1YA 1TD9A 4RDCA 5DMXA 1JQ5A 1V1MB 1RCTE 1CZUA 2APJA 4WZBA 3ZV7A 4EELA 1C9NA 3RG8A 2GVNA 5C7LO 4XD2A 3BICA 3GDOA 3AT1A 4H08A 4U0JA 1YMVA 3HDJA 1GNSA 1ZEMA 2DFTA 1YR1A 2BUBA 2QN7A 4B79A 1Y3AA 1PVDA 1OJ7A 3P9ZA 4QRDA 1EX7A 1DTEA 5CYPA 3WL7A 3COPA 4LTDA 1SR8A 4QQ8A 5G3YA 3W78A 2WZBA 2R1UA 2J9XB 2CVHA 3NHWA 2DT8A 1R0CA 2DCUA 4P83A 4TV8F 4BS9A 5IKMA 3E3MA 3CR7A 4GGMX 4MRVA 4RH3A 1BA2A 3R0IA 1WB4A 1TUBA 1UIRA 1TCBA 2ADMA 1PK9A 1UK7A 2FJUA 3OE4A 4K9KA 4RPJA 4ZDKA 3QJ5A 3CR8A 1I33A 2GF9A 3EPPA 3TQSA 5KBYA 1DO0A 1JIVA 1NR1A 3VZBA 3HJRA 2LXNA 3ZLUA 1RI3A 3LUHA 3MG9A 2Y0DA 5K6AA 1VZ3A 2XDYA 3HN6A 4JIGA 4B17A 4X97A 3ZK7A 1G3MA 1N2IA 3H5IA 1I2MA 1DG3A 2BGJA 4JP8A 4KGVA 3W1EA 1GJRA 1SURA 3GRAA 1S02A 1UBJS 3L1VA 4FCVA 3S27A 1AS2A 1MABA 1Z5OA 4ZYYA 3FBWA 5KX5F 1GM5A 3GC6A 4FVTA 1QTIA 1YVDA 3F3YA 3C3EA 5A9SA 1DT5A 2OGZA 3OKFA 1U0SY 4QHTA 1YDEA 1QZUA 3U5ZB 3TWOA 3H83A 4K3UA 1Z5ZA 2JGEA 2G9RA 3NX4A 1IZ7A 5C7IO 2OV6A 1T4DA 3IEKA 1UBMS 5BUZA 5AW7A 1SPXA 4QU9A 3VYVA 4CCYA 5A62A 4RV9A 1W4RA 1AA6A 3WB9A 3UAGA 2ONKA 4DT1B 1UEXC 4YUVA 1WEKA 3JPWA 1F3OA 2WSSD 3ZXSA 5HHTA 2NZ2A 4FXPA 3PDHA 1L4EA 4BFWA 1WETA 2QPOA 5G4KB 1LU9A 4PLZA 3EUFA 4MDEA 2WG1A 2RH5A 3PXXA 1CG6A 2QKYA 4UUAA 4I5DA 3ADBA 3FOCA 4ZOAA 1DXHA 3E18A 4H60A 3GX1A 2X9NA 3C0KA 1KF0A 4IQ8A 3AL2A 2GD1O 1NYRA 4KWTA 5KOHA 5AUOB 3JQ9A 2VXCA 1UJ2A 1L8LA 4OXQA 4XUCA 1VB5A 3Q3CA 5FEUA 4F6CA 4HJXA 1T0BA 1QUEA 4WN3A 3ZX4A 4YDQA 5JD3A 5I48A 5JAHA 2JCBA 1Z6YA 4L3WA 4U0KA 1NRIA 1Y3CE 1NVGA 3PWZA 3RQSA 3U26A 1L4YA 1XVTA 2X13A 1J7JA 1XHLA 1EFCA 2WMYA 4FSHA 4CNQA 4RADA 3OZSA 5JECA 2ORIA 4PS1A 2RI1A 1KRWA 4MV3A 4EO7A 5JXIA 5HNKA 3W6ZA 1OB5A 2PNJA 1PFWA 1N25A 1T5DX 2FE4A 4UNQA 4YJHA 5ALZA 4CE6A 1ENPA 3HGTA 4PXYA 4UBNA 3BQNB 1U0EA 4UM9D 5HCUA 3D81A 2ZQYA 3RT9A 5I7VA 4QGAA 5HRCA 2HI0A 5J2TA 4EMUA 1NQTA 3TZHA 1JILA 3C87A 2GT1A 3NATA 3EY9A 1VG1A 3LRTA 1PR0A 4YEDA 3ELWA 5FWXA 1P72A 2IK8A 3ZY5A 3EZ7A 4TWRA 1MO5A 1K6IA 3VNQA 3U16A 1AV6A 1E79A 1D4ZA 1TJ5A 3CLSC 3RU2A 5FR2A 4O29A 3W5UA 1K3TA 1CPYA 3H6KA 4Q3AA 3TQOA 2ODWA 1YBHA 3JAWB 3ZU2A 5BSFA 3HGQA 1SXHA 1NYTA 3AYZB 5BN5A 1TA0A 2QVYX 2QVBA 2PZJA 4NNOA 3EWSA 1RNLA 2VUTA 2WJJA 4J3FA 5ALJA 4HNAA 2OC4A 1F6DA 2IEAA 5IBCA 3AETA 1QQ6A 4G5QA 2FRXA 2P41A 2B4TO 1NJ2A 1CRZA 4AN1A 1JWAB 3A9SA 1QIMA 4FZVA 4LKRA 5AH0A 3DVAA 5EJMA 5F5NA 1HETA 3KYBA 3OZWA 1AV7A 5CD1A 4GECA 2HWWA 1YE3A 5JRJA 1EWTA 4MWTA 3K0CC 1KIFA 2VS1A 4RVGA 4NAVA 1EP2B 2AMVA 3WL5A 3OQMA 3FUWA 3ZWCA 3BD8A 1DBWA 1CIPA 1KI8A 3VGPA 3DE1X 4BVBA 3B9RA 3LI2A 1ESMA 2EIHA 1J25A 3IAXA 3HLYA 3MGBA 5AIAA 2QTNA 3PPIA 4BKUA 1DOHA 1RWVA 1R6DA 2Q7DA 4QICA 1V9SA 4EUKA 4AKIA 4A0QA 3Q0IA 5LYYA 2R87A 1CFJA 2VJMA 4TRNA 4CCAA 2QROA 4XE5A 2VNHA 2AQHA 1P33A 4G63A 5FTMA 1FW8A 2AEMA 3LQKA 3ROXA 5KPDA 2F55A 3DUFA 4ND8B 1OHHD 4YCNA 2Z8YM 2UUCB 4N0EA 4X1IA 1GRQA 5EXSA 1Z6AA 3AEUA 3B2NA 5IC6A 3L49A 5HQ3A 3AGQA 5LBUA 2ODPA 3MWJA 2PN1A 3C8UA 4DR2B 3H87A 2MMCA 3C8ZA 3TR0A 2A59A 4FCWA 5BRNA 2DFNA 3UJCA 4D3XA 2WIBA 2NP6A 5I8PA 1LXCA 1EK2A 2G83A 1E2BA 5FOTA 1Q74A 2D1FA 5ALNA 4BP9A 2YV1A 5TB5A 4FFRA 1MN6A 4RNCA 1ECGA 5BN1A 2ZSDA 2HUNA 3SR4A 4BBPA 4QPNA 3GBVA 5DM2A 1VG9B 4XJSA 3ZV5A 2Q1XA 3JARB 5A71A 5FD8A 5BWBA 5CDUA 4O4LA 3LDHA 5K5EA 1LX6A 2VUSA 3EMDA 1F2DA 3M5CA 4CTOA 4DR6B 3OWHA 4M1KA 3MSCA 2P3LA 1N1MA 4DNPA 1KIAA 1S8OA 4IDAA 3ZTWA 1M2GA 2PUVA 3WKAA 2WVGA 1E8DA 2GBPA 3E0XA 4X66B 2QYHA 1QGDA 4GSLA 1LDNA 2IVFA 4JGGA 3J80A 4YI3A 2OV1A 3RVRA 1P74A 3TNFA 4MWOA 2A1UB 1G3IA 4R2KA 3REOA 3BREA 1VA4A 1K7FB 3DH0A 4CN9A 4FB4A 7ABPA 2MSLA 4HB0A 4A2WA 2FPOA 4XGQA 1XCBA 3VHXB 1S2GA 4YMSA 4G0VA 1V4BA 4N6NA 4Y0AA 5F35A 3EC7A 4KO3S 1M1ZA 2CLHB 4I4LA 5E8JA 4DA7A 3P9PA 2CLLB 2VK1A 2QUHA 3D3NA 3R6LA 5H16A 4P9NA 1KI2A 5HBRA 1J07A 3O1LA 3WXBA 1FP1D 2IHUA 4BFZA 2II6A 2DTDA 1JVNA 1CQJA 2NO7A 1UMBA 2X7JA 1XZFA 5LOVF 4MXDA 1M5UA