3X1YA

Ras-related protein rap1b(l9v) with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MREYKLVVVGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
molecule keywords Ras-related protein Rap-1b
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1yA00
2Q9BA 4X8MA 5DISB 1IY0A 4Z1MA 2R6DA 4LJ7A 4M1SA 2CDNA 1J70A 4ACAA 1E0SA 1DG1G 2FFBA 5P21A 5K8IA 1VYVA 1KDRA 1SVLA 1P9NA 3QXHA 3U7HB 1VCOA 4XWAA 3GPLA 1A7JA 4AK9A 1IQPA 4LC1A 1DO0A 1JR3D 1QBKC 5IK2D 3PENA 1FFHA 2KJQA 1RPZA 4A2WA 3FHOA 2OLJA 2ZU0C 4FINA 4QFMA 1GTVA 2VQSA 1E2GA 1OW3B 4JYCA 5EP3A 4QHTA 3T12A 3DL0A 1XFAA 4H1UA 2IK8A 2QT0A 4GBMA 3LO5A 4DIDA 4DLWA 3WY9A 2G1JA 2NG1A 4EFLA 2ONJA 1AIPA 4CIDA 5H68A 1WE2A 4DVGA 4F4JA 3CF0A 1D9XA 3G0HA 1GL7A 2J7PA 3AKCA 3E70C 4CYMA 5JECA 3BB3A 4BUJA 3UPUA 1SXJC 1TF2A 1CRPA 2WTUA 3CWZA 1ODFA 1OJLA 3F8TA 3QXCA 3I1FA 5K8TA 5C4GB 3FMFA 1DELA 1G3IA 1R5NA 4DCSA 3QXSA 3FGNA 4QOSA 3I5YA 1GRQA 2QGNA 1J90A 1Q20A 1PVOA 1B23P 1W0JA 3WRYC 3LQRA 5E7JA 5KTYA 1EWRA 4JL6A 1Z5ZA 3EA0A 3IPXA 1KMHB 1XXHB 4LK2A 3DOEA 3THXB 1OYWA 1DAIA 4I81A 5CK4A 1E96A 4NDZA 2CL6X 2WM9B 5EXPA 5CB8A 3QG5A 1BYUA 2F43B 4L8GA 5LB2A 4I1VA 1YZQA 2I3BA 3AF2A 4Q48A 4TWZA 1CJUC 4V0NA 2WIAA 1S1MA 2XJ9A 3MSXA 4Q5IA 4BECA 4AYWA 5F9FA 2JJ2A 4U00A 3CX8A 3TIFA 1SKYB 2PJZA 3A1UA 4MGYR 4GP7A 3LFUA 3QY0A 3PG5A 3OIYA 3R9IA 4BQSA 3FKSD 1T5IA 1OFTA 1IN6A 2HCJB 4BE7B 1HQCA 2J46A 1DEKA 3W9YA 4ZCMA 2DCUA 4KFSA 2H1LA 5H70A 4NCKA 4DDTA 4AI6A 3EAQA 3BERA 2WJIA 5KO2A 2Z43A 3CRVA 2FU5C 3PCRB 2G1KA 3CPHA 5E7MA 1CEEA 1G5PA 5B58C 3N70A 1SVOA 1PUIA 4M1OA 2QAGC 4LYAA 5DO9A 1NSFA 1SGWA 4XTCS 3WBKA 4MKFA 1CJVC 1E32A 4O2RA 3GEHA 4OQXA 2PEZA 5DE3A 1G8GA 2W6JA 4B3DA 1ETUA 3LY5A 4XWOA 2ZJ5A 2HJGA 1Q0UA 1VHLA 4F93B 2GF0A 2IC5A 1XBTA 4JBYA 4TL8A 5FUXA 2XZOA 4CW7A 4QG7A 4CDGA 4DT1A 3P4XA 3AKYA 3CUEF 1FUUA 1SQ5A 1E0KA 2YC4C 4O2LA 2AXNA 4NPHA 3ND8A 2BVNA 2HEIA 2ZVPX 2MMCA 2Z83A 4G5GA 5AJZA 4ZDKA 2GDJA 3VX3A 5CJPA 2Q9CA 3HYRA 4U7DA 3CNLA 1S3SA 5EE1A 4A82A 1G4UR 1OHHD 4MRSA 3MWYW 4JT2A 2O8EA 5KDDA 2ODNA 3NKVA 3EZ2A 4M1YA 2QE7A 2VSOA 3CB4A 4XVQA 3HU3A 4AURA 4B43A 4OJKA 2WAYA 2QSYA 3RC3A 1WDTA 4JS0A 4M21A 1II8A 3RHFA 2HV8A 1G6HA 3WNBA 3KQUA 2WOJA 3I61A 4PC2A 2ZJOA 1FX0A 1CULC 1GWNA 5E7IA 2A30A 3U2QA 1RJ9B 2GVDC 1G3UA 1G7CA 4OI2A 1XJQA 1Z28A 3K09C 1Z8FA 2DFTA 3IEUA 1W4BA 3OAAA 3QJYA 1AA9A 1IN4A 4BLTA 2GETA 2VHTA 3A37A 4RZ3A 3TUZC 4V0ME 3AVUA 2F1HA 2O0KA 2D2FA 1LFDB 1RKBA 1VCNA 2XB4A 3T15A 3QI2A 3EPKA 2EYUA 2Z6VA 1XJCA 1JEEA 4ZV4A 1U9IA 3A36A 2CHQA 1OFUX 4PHHA 3GEEA 1KY2A 5LB4A 2PX0A 1LS1A 3B7GA 4JLDA 4PO9A 4RD4A 4TQAA 4GDFA 4LHXA 1T8UA 1P6XA 4BRUA 3UG6A 4JLVA 1EFCA 1Z07A 3VQTA 4PPFA 3C8UA 1N5JA 3DZ8A 1IAQA 3JZMA 4TSFA 3Q5EA 3I5XA 4UXHA 3AVWA 3G82C 4JLPA 2ZYUX 2J9RA 1B0UA 4LHZA 1OT3A 2BV3A 3F3YA 3N5CA 3E1SA 1P62B 1GP2A 2D06A 1YVDA 4Z1MD 2VPPA 3UMRA 4P4UA 3GJ0A 1MO5A 2CMKA 3U4QB 4F38A 2DFKB 2ZI3A 4FXPA 4GZLA 1Z0AA 3HP1A 2A5DA 2GBLA 3KJIA 2VLIA 4D6PA 4M9SA 2BWJA 3KXKA 5JFGA 2DB3A 1NG9A 3PEUA 4JBWA 1E2KA 3A1VA 3AEZA 4P33A 1JQLB 1KNXA 1KYIA 1MKYA 3DPUA 4IDPA 3IBYA 2EW1A 2IUSA 1CR0A 5BYKA 1KZ7B 4QJ4A 1SULA 1QHHB 3GJ3A 3K0CC 1BMFA 4KO8A 3ZS9A 2PZGA 4XD7D 4YXWD 1H8HA 3WMFA 4TLEA 4ZDWA 4B34A 4DBLC 2IS4A 2WSSA 3A1WA 4C9BA 3K0FA 2X1VA 2BCGY 1TAGA 4M53A 4Q01A 4YC7A 621PA 4KXFB 4RFSB 4LJ8A 4XSHA 1F3OA 1BIFA 4S35A 1P75A 1YKSA 2JLSA 4JLJA 3TLXA 1KSJA 1SXJD 2VTKA 3AM1A 4E03A 2WWGA 4M8NE 3KFXA 5EE3A 3H84A 4F7WA 2NQ2C 4AYXA 2CE2X 3RLFA 3A1TA 1YZLA 1GILA 3LW7A 5CLQA 1P2UA 4C2TA 3AP1A 1GNPA 5EXXA 3EA5A 5CK5A 3FE2A 2WKPA 2ZM5A 3AKEA 3PITA 1CS4C 1G1MA 1QHNA 1W4AA 2B7CA 3BOSA 5TY0A 3M1IA 5JEEA 1IJEA 3V4RA 2QORA 5G3YA 4CEJB 5B64A 3VKGA 2YZ2A 3UXMA 1GL9B 1S9DA 2KBFA 2GXQA 1XD2B 1TNDA 3KQLA 4HUTA 1MO4A 2KB0A 4Q9IA 2G9NA 421PA 3I32A 1ZRHA 2IT1A 4EKDA 2ZSEA 3K70B 2ZEJA 3K09A 5LBIA 2QSZA 4KFRA 4QL3A 2YWGA 2GEVA 3NC1C 3RRMA 5JJIA 1KO5A 2VP5A 2ZRLA 2BEKA 3VU9A 1JALA 1KI6A 2W00A 4ZDIA 1KI7A 2OM2A 1IN5A 3ZD7A 4L15A 2ATVA 2I1QA 4D80A 3CRMA 3AGPA 5ANRB 3VNUA 2RGNA 1LTQA 1XCMA 2ZRBA 1QHYA 2FX3A 2JIZD 4KCGA 4KBGA 2IYQA 4LGMA 4YMWA 1WB9A 2OFXA 3OFND 5BN5A 4LSGA 2BCJQ 1YZNA 2ASEA 2FJUA 1K8RA 4EPRA 1U99A 1E2JA 2O52A 4C0JA 4DDUA 1NL3A 1CRQA 4IVRA 2XNDD 5C2JB 5HR5A 2FSHA 1KAGA 3LBHA 2ODEA 2D4HA 2Z4RA 2Q21A 3TSZA 4M1WA 4G5SA 1E69A 4IDHA 4PSAA 2ODBA 2YINC 3DMDA 4FMCF 1J2JA 2NTYC 3CPJB 4LHYA 3VTKA 2ZS9A 4B76A 5FFMA 4HLCA 4IVQA 1J99A 5TDHA 1E1QA 2YV5A 4LWZA 4TMZA 1XMSA 4A36A 5JEDA 4XH9B 3GEIA 1MO6A 1JPJA 1T9HA 4FI3C 1HH4A 3UMSA 5FBLB 3ONWA 4OI1A 1NMYA 2ZRCA 4JSYA 2LKDA 2OXCA 1RC8A 1ZUIA 5JZVA 2G3YA 5CIWA 5IHPA 1E9CA 5BN3A 4LV5B 4M1TA 2ZTSA 4B35A 4CEIB 1ZU4A 3TRFA 4RVCA 4RD0A 3JVVA 1S3GA 2IYRA 4TYPA 5DIFA 4I1OA 3SFVA 1IOZA 1TF5A 3K0SA 4CVNA 4Q1EA 3ZVLA 4DB4A 3NBXX 5LPNA 4CZ2A 2JLQA 2WWXA 3T5DA 2QU8A 1KI8A 1II8B 4Y0VA 5AJVB 1W4CA 1AGPA 1N6OA 3Q7QA 1OH6A 3E2IA 3H2YA 2GK6A 3OIUA 1OFIA 3AVQA 3GCGA 1OB2A 3V4FA 4B74A 1NN0A 2G6BA 2ZRJA 2BJWA 5FOVA 1HY3A 4RFSA 3CW2A 2R8RA 1CJMA 1UPTA 5GJWC 3U6BA 3EPJA 2DWQA 1GITA 2FOLA 1U2RA 2WHXA 3Q8XB 3AB3A 2GVZC 3TW4A 4TTRA 1XCPA 2OV2A 3VFDA 1RRCA 1KIMA 3UANA 1H8EA 5L3QA 1Q21A 2DHRA 4HYYA 4OQNA 2AD5A 4EUNA 4UXJA 3QPWA 1RW4A 4WXRA 1YU9A 3GJ5A 4Q9KA 4FN5A 1Z47A 1CKEA 3EZ6A 1BO6A 4IXNA 4JSTA 4MQBA 1HV8A 3ICQB 4HUQB 1E1RA 2J1LA 1TADA 2KSQA 3R9WA 1CF4A 3W3AA 1CP2A 1E1QD 2QROA 3MLEA 4PANA 2ZRFA 4LOAA 4B2LA 1GOTA 3BH6A 1YR6A 2BMEA 2X2EA 3SFZA 2CE7A 4M2LA 3DM9B 2KBEA 1D5CA 3M4YA 2IYWA 3TUIC 2JLWA 3EZFA 1M7BA 3KL4A 3I8XA 5FH9A 3I73A 2H18A 1XPOA 3IEVA 2B7BA 1N6KA 3QXXA 2IL1A 2LWIA 4XVUA 1NVXQ 4NYJR 3K1JA 2F55A 5FR1A 2OBNA 4BFZA 1Y3AA 4AIIA 2JCSA 4TLCA 1TMKA 3E5HA 1S0UA 1TU3A 1G21E 4O3MA 4V0OA 4JJKA 4HDCA 5JSZB 1XP8A 3EWSA 3LBNA 1VIYA 2V9PA 1DAMA 2ZS7A 4Q4HA 1RYFA 5DYIA 2GJ8A 4PAMA 2WPDA 1KK2A 1GNRA 4PPNA 1E2EA 1KOFA 2OCYC 1FP7A 4KVGA 1SXJB 4M1KA 4BZQA 2VSFA 1JQJC 4WZBE 4B32A 2JLVA 1XTRA 2GJ9A 3RS3A 3H0KA 3CBQA 1SVWA 1E9AA 2YNMA 5FBWB 2EVWX 4HB0A 1VG0B 2FH5B 3KKNA 3B85A 4JLNA 3WMEA 4IRUB 2BBWA 2F9MA 1PZNA 1L4YA 4KVAA 2IYLD 2J5XA 1MABB 2PT7A 1R2QA 2JAQA 4N1AA 3P4YA 4OJQA 1Q1BA 2AK2A 1YR9A 3KKMA 1AJEA 5A0FA 1A82A 2W6ID 2XTNA 3FHCB 2ZI9A 4WXPA 2IYSA 3KB1A 4FCWA 4EPYA 3GJ7A 1XD2A 2RGEA 4Z54A 2O5VA 4M1MA 2VHUA 3SYKA 2AFHE 4F92B 2DYKA 3EC1A 3LQQA 4MGZR 4D4MA 4C0AC 3U7GA 2BMFA 1V5WA 5ELXA 4DSUA 2ZUBA 1XMVA 5AWFC 3TBKA 4MRPA 2IS2A 1E2IA 1PUJA 4G5RA 1D9ZA 1HA3A 1HEIA 2Z0MA 3U7EB 1DADA 3TQFA 2RGDA 1VTKA 3Q5DA 3MJHA 1LY1A 5FUWA 1P4SA 4C0BA 1P5ZB 5JWOA 4BFYA 1T3LA 5KHOC 4JT4A 1Q1ZA 4CF7A 2NPIA 4RZ2A 4FMBB 4GT1A 3W90A 1EG7A 2VL7A 4P4SA 2QP4A 1JECA 2G0NA 4LZZA 4Q7JB 1XMJA 1Z6GA 3SU8A 5JS8A 4YDSA 2O8FB 4N0EA 1S2MA 1Q22A 3AF4A 2RGCA 1UBEA 2A5YB 4Q47A 2SHKA 1T3SA 4ZIRA 2I1VB 4YLGA 1SKQA 3R8CA 1HQYE 1EFRD 2EYQA 5E4FA 2GXAA 4PX9A 1SKYE 4D0LB 3NDPA 4MKHA 1KGDA 3SYLA 3EASA 1O3YA 2EFEB 5FOWA 4YMUA 2ECKA 4I1UA 4US0R 2REBA 1RRGA 3BBPA 1RE0A 3SBDA 4TQ9A 2CVHA 1F6BA 3B1XA 3SR0A 1EX7A 1XEXB 3L0IB 1D2MA 2XZPA 1X3SA 4MKGA 1UBGA 3LH5A 4QGFA 1NP6A 3LLMA 4F4CA 4KITB 2GTPA 5FBRB 1NLFA 1JXMA 1XPUA 3OFNA 2QL6A 3NHAA 1KMHA 5GJVC 1AKYA 4RD3A 5AR1A 2FSIA 5FPHA 2GZDA 2P5SA 1GKIA 5J47A 3GLIA 4CEHA 4XWKA 4LHVA 2IYXA 2C8VA 1DAGA 2ZI5A 1D2EA 4JKYA 4A6PA 1II0A 4LI0A 4C7OA 1P72A 1G8YA 1SVIA 2CHGA 1BMFD 3DHWC 3PJRA 4KV9A 4UJ5A 4FWTA 4R71A 5LD2C 3HYTA 4HAVA 4OI0A 1KI3A 3EIQA 2QRZA 2JEOA 2GZHA 3L0OA 1Z2AA 2FDCA 2BBOA 1DE0A 3S1AA 1WMSA 1X8JA 2AR7A 2F1RA 2O0HA 3CX6A 3GLGE 1ZC4A 4AKGA 4Q66C 2JIZA 3B2EA 4DLTA 2N46A 4EJSB 4YQFA 4JKIA 1VCIA 1XTIA 3OEEA 4NYMR 2C78A 4EFMA 1E9RA 2WWIA 4GP6A 2P3SA 1VECA 1MO3A 3OE7D 3RDPA 4ZCIA 1UBFA 3NEJA 1MABA 3QQ5A 4NYJQ 1NBME 1ZNZA 3QNUA 2V55B 2YVUA 4EQ6A 2Q3MA 4OBEA 3X2SA 4QGHA 1GDDA 1NSTA 4B75A 2QG6A 1QHIA 1KI1A 5FTLA 2XOKD 4X8HA 5F3WB 2RAPA 3EIEA 5CDFA 4OK5A 3CR7A 1CR2A 4DT1B 1G8HA 2IYYA 2FSGA 1XXHA 2IHYA 2IUUA 3AUXA 3A4LA 4NTZA 3R9XA 3THXA 1QDEA 1T0HB 4WOPA 3ZD6A 1N5IA 4LYJA 1JB1A 4X8LA 5BXQC 1MV5A 2P5TB 4Q9HA 2J59A 2YHSA 1CLUA 4FD2A 3R8FA 5AJYA 5IF9A 5J4HA 1YQTA 2OEPA 3KZ1E 3WMGA 4F91B 1DAFA 1EFHA 4DUGA 1QHGA 1FL9A 4Q4HB 2FZ4A 5CITA 2CCJA 2J45A 5FOSA 2X2FA 3W6OA 1W49A 2C9YA 2CJWB 2ZANA 3B1WA 3RS5A 1KJYA 2UKDA 5KNCA 1P2TA 4B6FA 3THWB 2FFAA 3LRPA 3QPVA 4AYTA 3VNVA 3EW9A 3MFYA 1FNNA 2ZYVX 3WHLA 2JJ2D 2D7DA 1OIWA 4O25A 5GADl 2C95A 3QG1A 3PEYA 1EX6A 4POAA 1DBSA 3JZAA 3QKUA 4NHOA 3CF6R 3OHMA 3W3ZB 1G3RA 3B13B 2W0MA 1YZUA 2ZI7A 2AXPA 4BLPA 3KXIA 1AS2A 1GNQA 3QEOA 3F5FA 1ANKA 3T1VA 2GCOA 4NCIA 1DG3A 5HZHA 4QBIA 3GP8A 1QZXA 3PFIA 3MG9A 4MYCA 1BYIA 2YWEA 4Q4AB 4Q9LA 2NMVA 3FKQA 1COWA 1N0VC 2EU8A 2JA1A 1GUAA 4PHTA 4TLAA 1U0HC 2QP9X 4AKEA 2PL3A 3T1QA 1EK0A 3CZPA 1LW7A 4OQFA 2B8WA 1S9HA 2R6AA 3EXAA 4ITRC 5JCZA 1P2SA 1ZC3A 1ONBA 4DLRA 2V6JA 2GJKA 4L16A 4DWJA 1IXRC 2IHBA 2QP3A 4IDNA 3IHLA 4XD7A 1NLZA 3L0SA 2ORIA 5KSYA 1W36D 1KO7A 4RD6A 1E3MA 4BLSA 4Q7MB 1AM4D 3Q72A 2CHVA 3U3KA 4B3CA 2RGXA 1NJGA 2BJVA 2ZREA 4B73A 5HE8A 1BS1A 1ZM3A 4US1R 5JWHA 3SJZA 3THOA 3U3RA 3DM5A 2RH5A 2VIIA 3HWSA 1KSGA 3U5ZB 2ATXA 4DCTA 1OXUA 2IUTA 2PEYA 3PUVA 4MA4A 2P6NA 1Q57A 4LY6A 1C9KA 1CTQA 3MAAC 1RJ9A 5DI3A 3U3JA 3KQHA 3L82B 2YYZA 3FKSA 4A0HA 4XTRA 2QZ4A 1IONA 3DVLA 1UFQA 4Q9JA 1YZGA 4MRNA 3U3OA 2R62A 2FEMA 1VYUA 3KKQA 3VR4A 4A1FA 2OCAA 1I2DA 2BM1A 4JMPA 4HAZA 3M6AA 1XMIA 1SHKA 2A7QA 3IQXA 4HAWA 3ADBA 3ZGXA 3ZDQA 4D25A 4TTQA 4AWXA 2JLZA 2BMJA 1ZINA 2C9OA 3GFPA 3TR5A 1KO4A 3NBYC 2ZJ8A 5BQ5A 3X1ZA 3KX2A 1S8FA 4G5QA 2XITA 4TT3D 3U60B 4HLUA 3QXJA 4PZLA 4JVNA 5EE5B 1JPNA 1RRPA 5FI1B 2ERXA 1KK1A 2C04A 1E2NA 2VH5R 3NG1A 4IFEA 4NBSA 5JRJA 3IHWA 3K0CA 4GOXA 4D26A 4MYTA 4A8JA 3NBZC 3BFVA 4H9GA 5EZ6B 5C18A 1XEXA 1D6JA 2F3TA 1ZMXA 4TMWA 2O8CB 3ZIAA 1KI4A 5EP2A 5CYPA 1R8QA 3TSWA 5L3VA 1R0YA 2DFNA 1TQ2A 2ZJBA 3AP3A 3SQWA 3VR6A 1E1RD 2R6FA 4DUGD 1TQ6A 4A2QA 2EFDB 4OHXA 2PBRA 4ESVA 1O87A 5KDLA 2G88A 2J0UB 3HPRA 3EC2A 1BH2A 3P20A 1C4OA 5J4LA 4BZXA 3U4QA 3T34A 2WWYA 1N6RA 3RVBA 2NPFA 1PLJA 1GFIA 4LDJA 1NVWQ 4TMXA 1E99A 2IXFA 4P32A 4UXIA 1YRBA 4ESHA 1MRNA 3CX7A 3UWKA 4L9WA 3CZQA 5EUQB 3ZJYA 1OFHA 2J3EA 4IOJA 4P3YA 5C46F 1JR3A 2FGJA 3AF3A 3LD9A 3QE0A 4V03A 3IBGA 1NVVR 2FPMA 5AUOB 3LXRA 1I4TD 4RCYA 4LBWA 2BM0A 2O8DA 4JL8A 2IBMA 1SVSA 2ZRMA 3GFOA 4LV8B 4JL5A 3K8YA 1F2TB 3TKLA 2GXUA 2HT1A 3K0AA 4OL0A 1Z0DA 1HUQA 5HCIA 3WHKA 4HB3A 3WNDA 5CB6A 5KSZA 5JLJA 3QOFA 2GCOB 3GJ4A 4NU0A 2IYZA 2JJ1A 1VG1A 1U90A 5D3QA 1GKYA 2WWFA 5G41A 1N5KA 4Q19A 3GJXC 1FPMA 5FPYA 1Q3HA 4OHWA 3EG5A 3L8ZA 5DYGA 3DKPA 4EQ6B 3UWOA 2W2VA 1OXXK 4RJLA 1P61B 4CGZA 4OQMA 1ESMA 1W2GA 4UNSA 1G64A 1TPZA 4OI4A 4DCUA 3SC3A 2RKOA 3FYHA 3B9QA 3K9LA 4OHVA 3WYGA 3CRQA 4QM7A 4GL2A 5CYOA 2FA9A 2PZEA 1DTSA 2V54A 1E9EA 2HJVA 3EIHA 3K70C 1KKMA 1DAKA 2JJ8A 2FZLA 4PO1A 4IFBA 3VU9B 4PO8A 2WJGA 121PA 1SXJE 3GQBA 4H1VA 3TW8B 3PUYA 1NKSA 2OHFA 5TVKA 3LAWA 2NZ8A 3K53A 5FPSA 2W58A 2R44A 2EQBA 2ODWA 3HR7A 3MJRA 4TSFD 4X8OA 3QF4B 4LX0A 3EZ7A 5D3MA 3LA6A 3CRW1 3T06B 3DKVA 3RS7A 2RHDA 2CJWA 4MUBA 4UNNA 3DEFA 3FDIA 3Q9LA 1R6BX 1M34E 2NO0A 3CNOA 4NONA 3A4MA 3HPQA 4G0NA 4ERNA 4XOIA 2MSCB 3L43A 4OK3A 3UIEA 1OSNA 3TAUA 2GNOA 3P1JA 3R7WB 1MOZA 2NZJA 4A8JC 1G41A 1JXOA 4A92A 4ZI2A 3KQKA 1OB5A 2C2HA 1XD8A 2DR3A 1Q3TA 2IXEA 1J7KA 2VEDA 4BLQA 2WWHA 2D2EA 1IY1A 3D7MA 4PHGA 4IKEA 4QNRA 1MT0A 1GSIA 4B3BA 3DMNA 2ZRNA 1WBBA 3BORA 4BLOA 2AFIE 4JYBA 4G01B 2OAP1 1XZPA 4B2PA 1W47A 3QKSB 3KTAB 3GJ6A 4AG5A 4O0MA 4RKFA 2W6JD 3RANA 5TXGA 2QA5A 3GLFE 2C99A 4AKHA 4QJ3A 3FWYA 1ZM7A 3N2EA 3KJGA 3THYA 2HYDA 1VG9B 5A5GA 2VHJA 1I4LD 2NGRA 2DY1A 2NO6A 2J0UA 2H16A 3VR5A 3NH9A 2B6HA 4TTPA 4UKDA 2A2ZA 3HJNA 2OBLA 4II7A 3I3SR 4GSYA 4ZO4A 4MRRA 1P73A 1DO2A 4MDEA 1E2MA 2ZJ2A 3KJHA 5GVSA 2ERYA 4DLXA 1TEXA 4XSGA 4P31A 1ZP6A 3D8BA 5GVRA 2IEZA 2ZR7A 4WBSA 3TUJC 3HDTA 4Q02A 1JJVA 2OFWA 1OXVA 3VR2A 1EWQA 1E6CA 3BS4A 4PZYA 3IGFA 2RHMA 1N6HA 3KKPA 3O8RA 2QBYA 3LV8A 4V02A 1G8PA 2ZE8A 2QI9C 2YC2C 3B60A 2VF8A 2J41A 4DLZA 4ARZB 4TL9A 1W46A 2B8TA 4LRWA 4BEJA 3GD7A 4BLRA 1CBUA 2HLDA 1VCMA 2J7KA 1NKTA 5F2EA 4B3GA 3LW8A 2DWOA 4OKSA 4IDQA 2P67A 5DGXA 3NEYA 4HUQA 4A8JB 1KSHA 2ZRDA 2CLCX 3ZQ6A 1WCV1 1QG2A 2WMNB 5HE9A 1XF9A 3BC1A 4DDWA 2GRJA 4V0LA 4C0KA 2O8CA 2REOA 2XGJA 2ZYWX 1FTNA 5FUVA 1OF1A 4M22A 4URVR 2IYVA 5TMPA 2Q0HA 1R10A 3PXGA 5J4VA 1UKYA 4TMKA 2YKGA 2XX3A 3A8TA 2ZITA 4US2R 2XXAA 4DKXA 4EPTA 1ELOA 2QRNA 5EJEA 2KI5A 3LDAA 1E0AA 2W0SA 1HURA 1YHNA 2GK7A 4Z8YA 3BK7A 4FMCB 1RIFA 4C0LA 3VAAA 1W7AA 5IRCD 2J0VA 2ZRPA 4G3XA 2FFHA 1EFUA 3RS2A 3ZVRA 4IVPA 2QT1A 3HU1A 1JAHA 4K8OA 1ZD8A 3ZVNA 4RFVA 1FP6A 2A5GA 1KZGB 3IIMA 1AKEA 3P27A 4GNKA 2OLKA 2AKAB 4FCVA 3CO5A 2X19A 2VF7A 3PR1A 4W7SA 3ZVMA 5FUYA 4WW0A 1XTSA 4QBFA 1EFTA 6Q21A 2O8DB 1FX0B 1E9BA 3TAHA 5HCNA 3EPLA 3IIJA 1U8AA 4NKRA 3K0AB 1Z29A 3IUYA 4W5HA 1F2TA 4MYUA 1WRBA 4UQOA 4C4PA 1G5RA 1CR1A 2ZI4A 5CM8B 1R0WA 2OSBA 4KFTA 1GL6A 3D3QA 2XSZA 5FL3A 2CEAA 1E79D 1G8FA 4FMDF 1NJFA 1AS3A 1NY6A 1Z08A 1H8HD 1W0KD 5AJXA 1DARA 2W6IA 2ZVQX 4QRHA 1JI0A 4WAUA 3GLIE 4DCVA 1OIXA 2TMKA 1ZD1A 1WBDA 3QKRA 5BYJA 4BEBA 1OLOA 1T5LA 5E3HA 4MRVA 1OHHA 4RY2A 2F1JA 3CF2A 1OH8A 4E09A 1UADA 3QVUA 5FL7D 3LNCA 4C0HA 1E4YA 2HF8A 4LYFA 1XCGB 3HU2A 5DH9A 1VIAA 5IT5A 3LX8A 4TZ0A 3NVAA 4IEIA 4BWYA 2F43A 3ASYA 1Z6XA 3K9GA 3FVQA 4A6XA 2Z4SA 4PC1A 3T1TA 5J40A 3C15C 3EPHA 2WV9A 1UEIA 3UMFA 1T8TA 2R6CA 5FBQB 5FOTA 4UJ3A 4EDHA 4BFUA 1DPFA 3A58B 3QF4A 1ZJ6A 2GAOA 3M0EA 4D81A 1WF3A 4L5BA 3LWNA 4NCJA 4TYYA 4EPWA 3GLHA 2GJAA 1AK2A 3X1YA 1A2KC 5L3SB 1N0WA 2BEJA 3AV0B 1W5TA 3PIRA 4AC9A 3PUXA 5JMTA 1XEFA 4R2IA 3TQCA 3CIOA 5JWRA 5K8UA 3UK6A 3VHLB 2FN4A 1W1WA 1XXHE 1GIAA 2BBTA 1JNYA 2QMEA 3B8HA 4LJ6A 2QBYB 4HDOB 1P3JA 1SVKA 2VP4A 1LF0A 3R7WA 1NRJB 4Q00A 5FTMA 4RD1A 4QGAA 2A78A 3S1AB 5KYKA 1G7RA 2ZRKA 5J4YA 2OAQ1 2XJ4A 3QF7A 4URXR 2X77A 4FW9A 2VO1A 2ZJAA 1F5NA 1EXMA 4LC0A 1K5DA 4LHWA 1GRRA 4JZKA 1F48A 5JI2E 3NWJA 3QENA 2WOOA 3SHFA 2CK3A 3BD9A 2ZUDA 4B48A 3H86A 3QEJA 4JVLA 5KSPA 2IWHA 2ZSAA 4Q4LA 4DSTA 1E2LA 3SHWA 3FOZA 3KTAA 2XAUA 1XNJA 1ZIPA 2CLSA 2NO1A 1XZQA 4HZIA 4ZPXA 1ESNA 2EWVA 3AVVA 1NG1A 821PA 5H8WA 4DCNA 1C1YA 2HUPA 4C7OB 1NLYA 1W48A 2QTHA 3X1WA 1JBKA 1G20E 2BBSA 1T3HA 4KJZA 5HPYB 2PLFA 2IS1A 1G9XA 2HXYA 3BFKA 2FPLA 1GZSA 1KO1A 3L0PA 2GZAA 4A0FA 4LBZA 4LUCA 4A0GA 3I8SA 2FPKA 4IJMA 2OUKA 3LVQE 3TVDA 2FSFA 2AHOA 3U6KA 2XTMA 2O0JA 2PMKA 3GJ8A 3MGCA 2Q3FA 5E95A 2J7PD 1XTJA 4M9XA 1G3QA 4AG6A 4B3FX 5JI3E 4Z8XA 1QHHA 2E87A 2IYTA 4EJSA 2P65A 4HLQB 4TMTA 2WSSD 3FFBA 4TN1A 3GFTA 3WYFA 3TH5A 1ZAKA 1PV4A 4YMTA 4R98A 2Z5FA 2ZSFA 1UBCA 1IXZA 3K9NA 2FV8A 3C5HA 4KAXA 5BN4A 1YZKA 2FG5A 2QM8A 3MD0A 4OYHA 2H8KA 3W8RA 2V6IA 4QBGB 4U5XA 2ONKA 3GLHE 3ECCA 3L8YA 4RSGA 2A3RA 4BPBA 1M7HA 5AUPB 1N6LA 3PEVA 5AUQA 4JVMA 2ORWA 1QRAA 2WJYA 3OEHA 3B1VA 3A6PC 3V00A 4EFNA 2ZE5A 4LJ9A 1X8LA 2GHIA 4GZMA 3NDBB 1SZPA 4C2UA 3RS4A 2BDTA 3ZZUA 2XEXA 2WVJA 3NIBA 3X1DA 1UKEA 4Q1DA 2VHQA 2FFQA 2MMGA 5FTKA 5G40A 1FW6A 1NMXA 1ZBDA 2Q9AA 1VG8A 1H8ED 1VDZA 2QN6A 1UM8A 1TUIA 2GA8A 2QQEA 1Z6TA 4OHYA 1P9WA 3IQWA 3L2OB 5F9HA 3QBVA 1IXSB 2IW3A 2PCJA 4FWIB 4MYHA 4DRZA 4AY2A 3NC0C 4I4LA 5CIQA 3QBTA 1M7GA 4CT4B 2G83A 2K5UA 3BJIC 1ZW6A 1Z63A 3VKHA 1UF9A 5EXSA 1Y63A 1J8YF 4JBXA 5DN6A 1R0ZA 2VA8A 2PCLA 2PLRA 5GJCA 2YOHA 4Y0AA 3WNCA 1KI6B 1GAJA 2ZXUA 2ZRGA 3SQXA 3CNNA 1W36B 4OK6A 5CM9C 5DNYB 1KY3A 1K5GA 4NYMQ 2R65A 1F2UA 2GEDA 1S96A 2BC9A 2UVQA 1CJTC 5FI0B 2AN9A 2WJJA 1A2BA 3V9PA 4PSKA 1UAAA 4XIGS 2P6UA 1L2TA 4WA7A 3CH5A 2RB4A 2IA5A 2X8AA 4NYIQ 5SZHB 3AGQA 2QPOA 2OBMA 2REXB 4DLVA 3BRWD 1OKKA 4IEEA 3ZZ0A 4GMDA 4KYUA 3MWJA 3C14C 2ZROA 2GCNA 4URYR 1NI3A 4HB2A 3NTUA 1JEDA 5L3RA 2WZQA 1TUEA 4GOJA 4R7ZA 1JR3E 2OCPA 3FMPB 3W8NA 5CDFE 4GOKA 2QNRA 4JLMA 1WA5A 2JLRA 1UDXA 1US8A 5HZKA 3I4LA 3TGPA 4TYQA 2IEYA 2QAGB 1CIPA 4M9QA 2ZRHA 4MGIR 3Q3JB 4HI0E 1ZYUA 521PA 1XWIA 2LKCA 2ZIAA 1E4VA 5BW8A 2F1IA 4KU4A 3W6PA 2EFGA 2FGKA 3QKTA 4JVSB 1KKLA 1G7SA 3EWAA 3ADDA 1TQDA 1AZTA 3RSOA 4ACBA 4AD8A 1W4RA 2PX3A 3KFVA 4LYHA 2J87A 4EIWA 1FQKA 3ZS8A 5L3SA 2VRWA 3GLHB 1FMLA 4IOMA 5EP4A 2P6RA 2DPXA 1U8YA 3TMKA 3RS0A 5G3ZA 3HR8A 3N2IA 4EPXA 3CPEA 5AJWA 1I2MA 2JLYA 1N2CE 2OG2A 4XJXA 1Z83A 4U02A 1U98A 3BFXA 2V7QD 4PZZA 4TLBA 5KUTA 4N0DA 3O47A 2C9CA 3W34A 4ZCLA 2GJSA 2ZE7A 1Z22A 4YMSA 1KI9A 2CNWD 2PJRA 3A4NA 2OT3B 3J81k 1SXJA 4JLKA 1XB2A 1ZUHA 4LPSA 3WYAA 1N6NA 2DWPA 4PQFA 1ZVQA 1YE8A 4ON9A 1TL7C 1XEWY 2AL7A 3KQNA 4YMVA 3VX4A 1RZ3A 4D4LA 4LBVA 4QKQA 2D74A 3TK1A 2OZEA 4JLBA 2D62A 1ZUNB 1OH7A 2EWWA 5KPDA 1M2OB 2IX3A 2WBLC 4URUR 3T35A 4LJYA 2GEUA 3WRXC 1AZSC 2ZSBA 1ZCBA 2I4IA 3AVTA 1LS6A 2R6GA 3OIWA 3DO6A 3T5GA 5JHGB 2C96A 4IOKA 1ZIOA 4HZUB 1ZNYA 4FMDB 2P2LA 2NIPA 5CLLA 3ICEA 3BGWA 1RYHA 3ADKA 4C0QC 3U44A 3D6TB 4ZKEA 4W5WA 1KHTA 3ADCA 1YJ5A 3IO5A 1IBRA 2Y8EA 1N3BA 1KO8A 1Q1EA 1D2NA 1G4AE 3NH6A 3REFA 3TJZA 4YONB 1SHZA 2UZ3A 1PLLA 1Z6AA 1KMQA 1G7TA 3W5IA 3SNHA 2G77B 3LVRE 1Z2CA 1N25A 2R2AA 3SZRA 3U61B 2AD1A 1AQYA 3VKWA 3MRSA 1Z06A 4DLSA 2HF9A 4DDVA 2HXSA 5J4KA 5SZJA 2VP0A 5JSZA 3B9PA 4P0TA 4BRWA 4HSEA 4Q03A 3RWOA 3VMFA 5KSOA 2QE7D 4B2IA 1FQJA 4LJ4A 5DSZA 4B47A 1QHSA 2HLDD 2PMDA 2FF7A 2YWFA 1GG2A 2J0SA 3OF5A 4PHFA 1E2HA 4NL4H 3OAAD 4Q4JA 1M6NA 1E2DA 1NIPA 1ZM9A 5EE0A 4B6EA 3B82A 4BFVA 4C0SA 1MR3F 1MRSA 2B92A 3CM0A 2H92A 4D0GA 4KSCA 3SJAA 4QGGA 1FMJA 1F60A 1IJFA 3KKOA 2AK3A 2V8OA 3VHXA 5EQTA 1U9IC 1E94E 4NYIR 2JLXA 4IDOA 3I72A 4NZYA 3OEHD 4CT5A 4D0NA 2O8BB 3GLGB 1E2QA 2WSMA 1XRJA 4G1UC 3Q85A 1BKDR 3D31A 4PPQA 1K6MA 1W5SA 4C30A 3UATA 3RNLA 4B3XA 4D82A 3ND9A 1QG4A 2ZU6A 4E22A 221PA 1MH1A 4BGDA 4PAQA 1QVAA 4TZ6A 1KJZA 3CKLA 3EZ9A 1VHTA 1A5TA 4HATA 5KNBA 2H17A 2GBLC 4TL7A 3RWMB 2N1BA 3ZYCA 4DEXA 5JJLA 2XOKA 5AK0A 1TQ4A 3RAPR 5JS7A 4HB4A 3B5JA 2JJ1D 3BAFA 1G19A 1KAOA 2H5EA 4KYIB 2VP9A 3KUDA 1JR6A 5SZKB 1E9FA 3RABA 4LPKA 4P4SB 3C41J 2ZR0A 3AUYA 4IHQA 1LV7A 4JIMA 5H1YA 5B30A 2PT5A 4NP6A 1IN8A 4QM6A 1R5OA 3ZIAD 3NXSA 4DSOA 2E1RA 1X1SA 2O8FA 2FEOA 1JAIA 1CU1A 2G0TA 2LCFA 1VMAA 2F3RA 2JATA 3P32A 4ASUD 2QMHA 4KODA 3U7FB 2A5JA 4E5UA 4J0QA 4KI0A 4Q7LA 1OE0A 1Q44A 3LX5A 1YR7A 3FMOB 4MDFA 1P60A 3O8DA 4TYNA 4WZ6A 2QPTA 4F4IA 1W0JD 2BHRA 3MMPA 3K70D 5JBQA 1LNZA 3VR3A 5FR2A 4DHEA 2XB2A 2ZPTX 4MH0R 4I1SA 4P4TA 2QMOA 3RRNA 1US8B 2VP2A 5UKDA 2CNWA 2IF0A 1E2FA 1KDOA 3CRRA 3THYB 2ZQ5A 3EX7C 4V0KA 3AKDA 3SEAA 3BE4A 3MCAA 1P7CA 4HDQB 1EESA 2OE2A 1RVDA 2CCKA 4BFTA 1HE8B 2H57A 3IIKA 2RMKA 2ORVA 4ZDJA 2VP6A 4CEHB 1U8ZA 1OH5A 2ZUCA 3C4JA 4EJSC 1P2VA 4DJTA 4PC6A 4ZI3A 3GLIB 1R4AA 2QQ0A 2BKEA 4PPGA 3SOPA 5DN6D 3RSLA 1ZM4A 3MWKA 3O8CA 1U0LA 2PH1A 2B21A 1AS0A 1FTSA 1E9DA 1OIVA 3IPYA 4RD2A 1UJ2A 5GJBA 2ZE6A 3AF0A 2QUZA 5BWMA 1DAEA 3K0FB 1TTTA 1GM5A 4L9SA 4QHSA 2QTVB 2WPDD 4Q1CA 4ARZA 2KWIA 3WP0A 1LB1B 2ZYTX 4A0RA 1XX6A 4KHZA 4QC2A 5DHAA 2IWRA 4I99A 2WKRA 1G16A 2ZAMA 3DOFA 3GMTA 1ZNWA 3QPUA 1Q1QA 4PXAA 1XPRA 4M9ZA 4MUAA 5EXTA 4LJAA 5KDOA 4RCZA 3NHBA 4Z51A 2QTFA 4DC9A 4NCNA 1ZU5A 5A4JA 2WMOB 1AGRA 3IILA 1DVRA 1NVVQ 4FIDA 3ETLA 1UEJA 4QNMA 2CVFA 2GWHA 3FMIA 2AX4A 5B2ZA 4K46A 5KNDA 4Q4AA 3TSOA 5DI9A 2W83A 1Z3IX 3W5JA 4D4JA 1QHXA 2PZFA 3BXZA 3EARA 2XXAB 2ZR9A 3TVTA 2O8BA 4DXAA 2CL0X 3DZDA 3ZZTA 1YZTA 4HZUA 5C4MA 1NNEA 1V43A 3QKRB 3R20A 4PTLA 3U44B 1E79A 2NO9A 1ZM2A 2CBZA 2WICA 3SJCA 1YR8A 3B1ZA 5JHHB 5JRZA 1U81A 4K81B 3RRZA 4A9AA 2JASA 4EAQA 1KJWA 4W5JA 1FNMA 5FPTA 4CEJA 1NY5A 2QMUA 4NMMA 3SJBA 3K0EA 4LV6A 1NN3A 4QHYA 3ZH9B 1OYYA 3MWLA 2N42A 3QIAA 1OKKD 1FOEB 1CXZA 1ZNXA 4B44A 2WWWA 4OQLA 4QXAA 5EZ5A 2QPAA 1NVUQ 2RGNC 4GRAA 1D8TA 3PUWA 1KK0A 3THWA 2BKUA 3JVUA 3C16C 5LDDC 4PAOA 3CWQA 5SZIA 2L0XA 2HDNB 3SYNA 2RCNA 2V4ZA 4Q21A 1VPLA 1ZCAA 4IW3B 1XDBA 4Q1AA 3AVXA 2QEQA 4TMVA 2H7VA 2E9SA 5DLQC 1OXTA 4Q4JB 1G3MA 2W2TA 1COWD 2BIFA 1HT2E 2JDIA 4RZXA 1G6OA 2XNSA 4LJ5A 1S4QA 2NO7A 3PQCA 1L7VC 3OESA 2V3CC 3FHTA 3B1YA 4UNQA 5TV2A 4GI7A 1RFLA 3T61A 2YJTD 4WIAA 3PVSA 2J0QA 4KLNA 4KSBA 2BMDA 2EFCB 2QGZA 5TARA 2YWHA 1KNQA 3OEED 4PC3A 1GKUB 2F7SA 4TL6A 4TYWA 3AVYA 1II9A 4E07A 3GLGA 3GLFB 3QSYA 1YRAA 2FMXA 4NH0A 1KSFX 4DLYA 2GF9A 2IYUA 4UNPA 4CEIA 2XSZD 2A9KA 3C7KA 1XEWX 5K8LA 3H1TA 3VR1A 2FE4A 2OCBA 3RC8A 4C3ZA 4LCBA 4AKIA 1T6NA 3C5CA 3BH0A 3ZLJA 1XTKA 2Q6TA 3PV0A 4PR0A 1U94A 3CH4B 2RGBA 2ZS8A 3KUCA 1DS6A 2XTZA 2CCGA 4URZR 4TQUS 5M04A 2RGGA 5KPJA 1TX4B 2HT6A 3AH8A 4MITA 1NBMD 2EFHB 1Z0KA 1EGAA 4GFDA 2ZJZA 3B78A 4QBHA 4TLDA 2MSEB 3TNFA 4UNRA 2F6RA 4KFUA 5DI3B 2RGAA 1Z0JA 2ANBA 1XTQA 1Z0IA 2D3WA 1NMZA 3LXXA 4IXMA 1R0XA 1N6IA 2CXXA 4BFXA 2WIBA 2DBYA 4Q18A 3BB4A 2F9LA 2V1XA 1KK3A 2QAJA 2ZJYA 2WJVA 2FWRA 2Q3HA 1IN7A 1AQUA 1PJRA 1UKVY 2YOGA 1NN1A 3FTQA 3H4MA 3KXLA 4PQYA 4IOLA 4DEYA 3BWDD 2HYIC 3DDCA 1CJKC 2R9VA 3G5UA 4WVFA 4D2IA 3OE7A 2CLDX 3PUZA 1QVRA 8OHMA 4HAXA 2WKQA 4D4KA 1NN5A 5C1BA 1OV4A 1RRFA 1X1RA 4BASA 1EFRA 1A1VA 1NIJA 3O8BA 1N6PA 2P0EA 4PSVA 4MKIA 2GXSA 5L3QB 1XU4A 3MUFA 3T1OA 1P9RA 1KTVA 5CJ2A 5FOXA 4A2PA 3CR8A 2CK3D 5L8VA 2ZETA 3AP2A 1AN0A 3PEWA 2XZLA 3LLUA 2KE5A 3AF1A 1IHUA 4CRWB 1UDWA 1L4UA 1T0JB 4DB2A 1G17A 2GCPA 1Z6YA 5FBVB 3UG7A 1QF9A 1G291 1KI2A 1W2HA 3AVPA 3FB4A 1HTWA 1Q12A 2NOAA 2C77A 4PQRA 2C5LA 3UKDA 3ZQJA 3SN6A 1M8PA 1A4RA 1TF7A 1X8KA 1X86B 2CL7X 5EUMA 4Q1BA 4A15A 1R8SA 2QENA 1U0JA 5HKKD 3BB1A 4EPVA 4W9MC 1T4GA 4LBYA 4N3NA 5EE9A 2VSXA 2FNAA 4DLUA 2OILA 3TR0A 4DZZA 2IS6A 1WXQA 1VKJA 5G53C 3WBJA 1OXSC 5B57C 3ASZA 4FCTA 2AWNA 4XVRA 2OESA 4RKEA 2WAXA 3SDZA 4PFSA 4R2HA 5HKKA 3U3MA 1NBMA 4B71A 4V0MA 1G18A 3QVVA 1L8QA 2V7QA 4HLUC 2C98A 4DIEA 3B6EA 1R7RA 1E2PA 3LBIA 2ZRAA 2DFLA 1E98A 1WQ1R 4R9UC 5IK2A 1IM2A 1LVGA 1E9SA 3REGA 1PLKA 1R5BA 2BOVA 3RYTC 5TB5A 4ZKDA 5AUNB 5F98A 1ZD9A 2AKYA 2VHCA 1I4DD 1VYTA 5KU1A 2QM7A 2GKSA 1SVMA 3A1SA 1X6VA 1Z0FA 3CONA 3KDSE 5EP1A 4DSNA 2W2XA 1G5TA 2C03A 5FTJA 5J5CA 1M1YE 2IF2A 2MSDB 1S1CA 1W44A 2GESA 2JGNA 1FZQA 2AWOA 3QKSA 1UKZA 3SBEA 2UZIR 1W0KA 2VYFA 5FL7A 2OFOA 2ZAOA 1KDPA 3NBFA 2JDID 3FPAA 2QY9A 4RZUA 1KDTA 3OIVA 4HAUA 3F0TA 1OPXA 2QAGA 1DAHA 5JJKA 2D7CA 2XNDA 4NCHA 2ZRIA 3IO3A 1GRNA 2VBCA 4KBFA 4OHZA 2ZSDA 3W6NA 5JCPA 2O8EB 3SS8A 1BOFA 4NE2A 3CLVA 4BFWA 5FTNA 4YXWA 3P26A 3BH7A 1JJ7A 4URWR 1M74A 5D3MB 1F2UB 4YDHB 4M0LA 1WP9A 4GMXA 3SE0A 1GVNB 3BIFA 1LF5A 3KJEA 4HAYA 1XD9A 4B33A 3QUSA 2IXGA 4Q7KA 3I62A 1TU4A 5LD2B 4JJZA 4MGKR 4HLDA 4HEJA 3WXMA 4Q1FA 2HCBA 4ABYA 1T91A 4TT3A 1HYQA 4L4UA 5IDVA 1NF3A 4ILEA 2V1UA 4M4SA 1E0JA 2OXRA 2OO7A 4QJ5A 3KB2A 721PA 1J8MF 3TE6A 4ZIRB 4G5OA 5FOUA 3AVOA 4KLZA 2YOFA 3SI7A 3WP1B 2A5FA 1W36C 2GILA 2ZI6A 3RRYA 1HE1C 4ASUA 4BFSA 1N5LA 3IDQA 1XJ0A 5DHFA 5KOYA 4GPTA 3GLFA 2ANCA 4A4DA 1IY2A 3IKJA 1FUKA 3X1XA 3Q7PA 1H65A 4PC7A 4S2EA 1DOAA 1CR4A 3I92A 2WJHA 3K9HA 5HTKA 4BZPA 3FFAA 2JLUA 3AQ4A 3OZXA 4JLAA 5FPKA 4JLOA 1HT1E 4WZAE 1TEVA 2GAAA 1N0UA
chains in the Genus database with same CATH superfamily
1QANA 2Z2ZA 3KOUA 3OCWA 4UQPA 1NI5A 2QB5A 2HKIA 1XROA 1BW9A 3TLZA 3DEZA 2NT3A 2XDQB 2A0XA 5HXAA 1TZBA 1EEHA 1E0SA 4PFJA 5IM4A 2JIBA 4OH1A 1I0LA 1U2DA 2WZBA 3OZVA 3QHQA 3R0XA 4C03A 3GN1A 3GPLA 5AOCA 1IQPA 5PGMA 3R9XB 1DO0A 4WFQA 3ZHZA 1LDEA 1RWXA 1M1YB 2F90A 2QI9F 2Z3WA 3H8JA 4D0RA 4HNUA 3ZJ5A 1FFHA 2ZBGA 1RYEA 1ZI8A 4A2WA 1RPZA 2ZU0C 3OE1A 4FINA 1K98A 3TSAA 2I91A 5IAEA 2VQSA 4JYCA 4CGYA 1PFKA 4AY6A 1XFAA 3I52A 1H6AA 2HHLA 4GVLA 2I8CA 4YUAA 3LO5A 4TTAA 3ZXSA 1WV1A 2QUBA 4XE5A 1G66A 1LDBA 3TIIA 1KVQA 4EFLA 3F5DA 5CB0A 4GM4A 4R2KA 3G49A 1WE2A 1M1XB 4YMGA 3UGJA 2AQIA 4CPDA 2AEMA 1AU9A 5CH5A 1UQRA 1EGHA 1DT5A 2J7PA 2G8LA 3AKCA 3BD6A 3N6VA 2QRJA 3BB3A 1PZEA 4X84A 3IODA 5JECA 1GZ6A 1ZOLA 5CFNA 1P77A 4KQWA 1JYSA 3ELYA 2QVBA 3QXCA 2J0EA 3F8TA 2HPHA 3A7DA 3FMFA 1R5NA 2XVYA 4EMBA 1TI7A 1THGA 2FPXA 2W43A 4MLPA 4QATA 1LZKA 3IUQA 3P96A 3G7NA 4QOSA 1Z2EA 3I5YA 1RLTA 4EI8A 1KL7A 2H08A 1DBVO 1M2HA 1S2DA 1TJ4A 3GFQA 1H93A 2ECPA 2UVPB 3QMPA 4LNUA 1BWRA 1J0BA 2ODQA 5K6TA 5KYNA 3HA3A 2LR0A 2J5BA 1EWRA 4TKVB 3DULA 1Z5ZA 3WSWA 3UJCA 4BP3A 2V03A 1R0LA 3DOEA 4P2BA 3X2EA 5CK4A 1M5UA 1NJ1A 2CL6X 3CRNA 3C3PA 3KKEA 3Q3GE 5EXPA 5DGDA 3Q0EA 2FR1A 2QRGA 3HVJA 2I3BA 4I1VA 5LB2A 1Q0RA 5DJ5A 4F9TA 3ETCA 4WPGA 1P1HA 4HH3C 1U2ZA 2XJ9A 3MSXA 4Q5IA 5DXAA 4F4HA 2PKQP 4K9PA 3U4HA 2ZT5A 2PPLA 3OIFA 2ZFUA 3P94A 2BZGA 1N5MA 3RE1A 1SKYB 1LK7A 2PJZA 3A1UA 2GHTA 1TAUA 2PKCA 3LFUA 2BR5A 4KWCA 4PFQA 5TMDA 2IEDA 3LZ6A 4B80A 1VL5A 4RTQA 2GFIA 4J29A 4YWJA 3AOGA 2P2YA 5HJ7A 1HQCA 1PKEA 4DUPA 4DCJA 2PWPA 3HSKA 3AZOA 3KEOA 3OM8A 4KFSA 1QK3A 3WIUA 4NCKA 4WKPA 3EAQA 3BERA 3PNVA 2WG1A 4BZWA 5I8PA 2XIQA 3DH0A 4EH1A 1RHKA 2O0MA 3JQQA 3QYFA 4QWWA 1H1LA 1BVRA 9MHTA 1JBEA 1UCFA 3JYLA 2B8EA 2P9BA 3TZBA 2XB6A 1PUIA 1AX9A 1W93A 2W4MA 4LKRA 2VI5A 2Q41A 4C4SA 4LYAA 5DO9A 4DB2A 2O7VA 3AYXB 1E32A 4MKFA 3WGGA 1JZSA 2JJQA 4KXYA 1N2JA 2PX2A 3A26A 2JBHA 1G8GA 1SUDA 3GPBA 5D00A 4E2YA 3UBTA 1H4SA 5A4DA 5T8KA 3B7PA 3O4GA 4MINA 2ZJ5A 2WKWA 3EH1A 2YZGA 4KR2A 2FFRA 2IC5A 4HMQA 4JBYA 2C4HA 4CW7A 5MN4A 1AB5A 1YMQA 4JR2A 4D0SA 1FUUA 2VPWA 4O2LA 2V3WA 3K05A 3KR1A 3RJ5A 5CUQA 2OCGA 2QL7A 2Q8QA 4AP9A 2O0LA 3KEMA 4H6XA 2BVNA 4NEHB 1NAHA 2WJ6A 1ZH4A 3V2IA 2OXFA 5AJZA 4HNTA 2HGSA 3MM4A 1B14A 2A9FA 2B6NA 2GDJA 3N8KA 2Q9CA 5AJUA 4EY4A 1CZOA 3RAFC 3FI0A 3BMOA 1OHHD 4ONEA 3PPVA 4X60A 3AJDA 3M81A 3LC2O 1PAUA 1PR0A 3RVRA 5BR4A 4EHFA 5ARBA 2QE7A 1WXGA 1NQVA 1JVSA 2Q5JA 3HU3A 1Z5VA 3S1SA 4G97A 1YOBA 4JUCA 3RUCA 2HWYA 4OJKA 1SVUA 3BX1A 4MPDA 1WAMA 4W1RA 5FNVA 3TLGA 1UBRS 3U80A 1GGJA 2B8JA 1WDTA 2C0CA 4JS0A 5JAOA 4EMTA 5HM6A 5C32A 1GLNA 1HFJA 2FSVC 1VMEA 4OA5A 4X1YB 4UOQA 2JBWA 4NU8X 2WOJA 4X00A 3R0QA 5HYVA 2ABWA 4BEWA 3FJYA 3PIDA 3OQNA 2EZUA 4UEQA 3TQRA 1Z28A 2IGBA 1A2OA 4H7FA 5CTAA 1W4BA 1GPNA 2Q1YA 3D3WB 4G4SP 3TW0A 2YX1A 1JV2B 3GGPA 3H0CA 4DV0B 1JA1A 1Y3BE 4LOJA 4ZMSA 3S7ZA 3MGKA 4BUCA 3WLSA 2C7GA 3R0VA 4V0ME 4HNRA 2MT9A 1Q1AA 5EVJA 3AVUA 3BRCA 1GPYA 1SHUX 5DWVA 4MR9A 5JNRA 3EPKA 3L8FA 5K0SA 3E9NA 1XJCA 2QNIA 2Y93A 3PL1A 4ZV4A 1JL3A 1OYOA 3L4BA 4D3FA 3A36A 2CHQA 4PHHA 1CYDA 4ZJPA 5SYMA 1DQSA 2FR8A 4JLDA 1GPAA 1O89A 3RC9A 5HVNA 4TQAA 3L4JA 1BDIA 2D13A 4LHXA 1VBNA 1J8QA 3ZV4A 4JLVA 1DL5A 1EFCA 1XKTA 1B74A 1Z07A 2OY0A 4HGOA 4MUGA 3T3HA 3WLMA 1DWUA 3DZ8A 3JZMA 3H97A 4I4NA 4QD3A 4AS3A 1R0SA 4X1IB 3SYRA 2EGUA 2QMYA 5IM5A 1EQ2A 3OCYA 2B2XA 4NPCA 5A5EA 3AVWA 2Q8PA 5KYVA 2J9RA 3OOWA 1OT3A 3F3YA 1C14A 2OZPA 4J7XA 3OJXA 3N5CA 2NUAB 4FYIA 3B89A 3V32A 1GP2A 3ZBTA 1YVDA 4QAJA 4Z1MD 4QYSA 3TZLA 4P4UA 1VE7A 4IZHA 1KMIY 4YP1A 3IDSA 3F47A 4C29A 1CZRA 2DFKB 3AI3A 1IK4A 5HDBB 3HP1A 2QN9A 5A2QA 5ICCA 2A5DA 4ZALA 1TAQA 2E5LB 3ZW9A 1G2QA 1MGOA 1OXBB 3KJIA 4ZC8A 3KXKA 3CX3A 3IHKA 2WUFA 2V8BA 1EEXB 4NJOA 3BVPA 4C06A 4F7DA 5C8DA 5CBPA 5KBYA 4O3FA 2R6ZA 3AEZA 5C7LO 4Z4IA 1RXWA 3JQFA 4P33A 1JQLB 3CVOA 1V71A 4R0MA 2OCDA 4MVJH 4B81A 1MPTA 3NFYA 3WGZA 5BYKA 2AI3A 1QHHB 2DECA 4ND1A 1BMFA 4EKEA 1MEOA 1ESCA 1L4EA 1G5IA 2VWHA 1CQPA 4RA9B 4YB8A 1H8HA 1XCOA 2QT9A 3WMFA 1GTG1 4B34A 3LRTA 4FOTA 3M1YA 2X1VA 3L7JA 4H0NA 2BCGY 3C48A 1TAGA 2Y6VA 4Q01A 4AZ3B 1TYZA 3JASA 1J2YA 4XSHA 2G07A 3HB1A 3ZDFA 3ZWVA 4CMAA 3L7CA 4QDOA 2I2XB 4ND8B 4KO4S 2JLSA 3ZU4A 2HHAA 5DHPA 3AM1A 4ZN6A 4M8NE 2Z1MA 4EOGA 1UODA 2FQQA 4IILA 3WVNA 2CWWA 4ALLA 1MDFA 3COZA 2YJGA 1C9MA 5E1MA 4C01A 4QTXA 2NUPA 4I8XA 2NQ2C 1KYQA 4CLXA 3AHFA 2ZKLA 2CE2X 3RLFA 4BMVA 4O2BA 4DDKA 2X5XA 1RJEA 3R7SA 5KYWA 2ZIZA 2D0DA 1T4DA 3OZTA 3NTQA 4OB8A 4REQA 1FXSA 3LW7A 2H29A 3B6MA 4IEFB 4LNUB 1P2UA 4AJEA 2OV1A 4EG5A 3AP1A 2GHQA 4P7KA 3EA5A 5CK5A 3FE2A 2D1YA 5EXXA 3AKEA 5I7RA 2C94A 3AR3A 1U8CB 1I4EB 2B7CA 4H1HA 2ZYSA 3DGFC 5KC9A 2TS1A 5DK6A 2QORA 2QM3A 4DLPA 3DD5A 3VKGA 5AJHA 1GL9B 2CGEA 1XWFA 4N01A 5CHEA 1S9DA 3RFCA 4A16A 1XD2B 1YT5A 1LNQA 4ZZIA 3KQLA 3P19A 5E6SB 1YBMA 1S7CA 2G9NA 3SF8A 3HKEA 1K86A 4EGSA 2IT1A 3K70B 2ZSEA 2ZEJA 3GVIA 3N0TA 3SSMA 4D56A 5FWXB 2Q3CA 4GWLA 3OOEA 2DTEA 3L7LA 1JQKA 2XWPA 3I9JA 3ZWXA 5J5AA 2ZRLA 3BA1A 2UXBB 5EJ4A 1V0JA 1YQDA 4ZDIA 1R8YA 4YJFB 2HA6A 2FWNA 4L15A 1L6IA 2ATVA 4DY6A 5IWAB 2C5EA 3CRMA 5ANRB 2ZQZA 2RGNA 2DT5A 3GZTB 1P0FA 2H1HA 4GGPA 5DYGA 5K8CA 1WB9A 2IYQA 2HI0A 1H85A 1XZEA 4DJFC 1M6EX 2SCUA 3OFND 4WMLA 2GR9A 5KOIA 1EQAA 5JZMA 5HFNA 4AZVA 1XO1A 1H2ZA 2H2IA 1L7AA 2E4ZA 1I3LA 3A25A 2O52A 1JWLA 5AICA 5MGNA 2E1PA 1MQ8B 2HMSA 3NWBA 5AKHA 2O2GA 4HJXA 3GVXA 2ODEA 4QG3A 4OXNA 1A7KA 2Z08A 3M6LA 3TSZA 2DEUA 1U0EA 4M1WA 5LWQA 3QU5A 5JOQA 4ZQCB 4NZNA 4FMCF 4KMOA 2WM2A 3T7IA 4QZVA 1MFZA 2NTYC 1TYCA 3CPJB 3ZE8A 4AS2A 4LHYA 1MJ5A 1JDTA 3VTKA 4B4OA 4J0GA 5I7EA 3COVA 2I2BA 5FFMA 2FWIA 1CZKA 3EN0A 4L0DA 4EVSA 3D59A 1DBPA 3K1TA 4LWZA 1MENA 1SO8A 4O4JA 2N9UA 2RGRA 2PUHA 5I5GA 4CIXA 3LC7O 4A36A 1OPRA 3CVJA 3OZGA 2YFHA 5E4YA 4XH9B 1GZUA 4ZODA 3W7VA 3HBJA 4MW2A 1RXEA 2NSLA 4OSOA 5AFSA 3ONWA 4K87A 3BWCA 3NT2A 3M6WA 5B1YA 2XYQA 1FMCA 1K68A 3F74A 3G2PA 1HOTA 4Y2QA 5JPIA 1GY8A 3BXEA 5H81A 5EPUA 1A76A 3RIMA 2A0WA 3DZKA 3F6BX 4ALIA 2OGWA 5IULC 5BQPA 2PR7A 2MIIA 3HB7A 5IBCA 1MC1A 4I9GA 3AFIA 2RAFA 5F12A 4DIMA 4BVEA 4M1TA 2PKXA 2ZTSA 3Q2IA 5AHOA 4B35A 1ZU4A 3TRFA 1BMTA 1JDJA 3JVVA 1M1NB 1S3GA 3VVMA 1N9GA 2IYRA 4D8XA 16PKA 1BDBA 3COSA 4EARA 4R8LA 5TT0A 4PG7A 1ZS9A 2GO1A 5F33A 5A3VA 3ZVLA 4AJ2A 4CVNA 4O2AF 3TJMA 4D97A 1DWQA 1GT6A 1RXCA 2VXOA 2JLQA 3GLRA 4OHFA 2EX1A 3X2FA 3ZU6A 4CF4A 4Y0VA 4UBMA 2JFYA 4BBAA 1IDOA 1L7DA 1XL0A 2VHZA 1REQA 4FDTA 4YJ3A 1JEYA 4WKOA 1LSUA 1AKQA 1H5QA 2XVAA 1CB7A 1OH6A 4E4YA 3E2IA 4P4GA 1AUQA 4Z0NA 3H2YA 2GK6A 3GCGA 1FFXA 1GZHB 5EINA 5ICEA 1ZD5A 3A3PA 3KU4A 3G5LA 4LOIA 4B74A 1NN0A 2G6BA 2G6TA 3RW9A 3FTEA 2BJWA 2NW6A 3KOXA 2J4DA 4OXYA 4OP1A 4RFSA 4Z4GA 1CX9B 3UOAB 1JDVA 3ZGOA 1O9GA 3MWFA 4IICA 3GRUA 1FRZA 3ZCTA 2BFCB 3SQMA 2FOLA 1U2RA 3DD1A 5F2OA 4Q7QA 1T6ZA 3AB3A 2GVZC 3E4CA 4ZGWA 5C8YB 1XCPA 2NU6A 3KPYA 2OV2A 4PNEA 5M34A 4RTRA 3UOGA 4RIHA 1KIMA 3M6FA 1JS1X 1Y1RA 4YREA 4XIIA 1IC6A 1RAAA 4HH1A 4ZVNA 4OG2A 4UXJA 5MN6A 2IY7A 2R8ZA 1W1IA 1Q5PA 3R3SA 4FN5A 4L5AA 5TNXA 1CKEA 1BO6A 2HDWA 5AHKA 5KYTA 1HV8A 1N2HA 4C6SA 4HUQB 5F1OA 2HR1A 3JQBA 2KSQA 1F2VA 2ZJ1A 3LPNA 3W3AA 4K86A 5DLPA 4JB0A 4J9VA 4F8EA 4GR4A 1FEZA 1AHNA 5HQTA 9LDTA 4PANA 2ZRFA 4LOAA 3CUTA 4WOBA 2VHXA 4Y9DA 5FB3A 2X2EA 3VKVA 1BJRE 1NVGA 5F51A 2KBEA 2X13A 3HB9A 3OOYA 4H7PA 2GM9A 1E5VA 3L84A 3T5PA 2O2DA 3I8XA 1HZJA 2WWRA 2H2DA 4FEAA 3IEVA 1ZIYA 1KDYA 1ULSA 3ER8A 2IZZA 3PCXA 4YV0A 1SUBA 2OO5A 1PL6A 1MAUA 1V11A 2FQYA 3KYBA 4MAMA 5FR1A 4G56A 4BFZA 1Y3AA 1XLWA 3QU4A 4H3KB 1TMKA 4BVBA 3UKJA 1FJHA 4V0OA 4YGXB 3IUBA 1FY2A 2JFFA 1LPOA 3EWSA 1KYWA 3F78A 3LBNA 4O4LB 2RARA 2GZRA 3NETA 3D6HA 1NU8A 1VIYA 3G2JA 1I10A 3ID6C 1DAMA 1ENOA 1IOVA 2XF8A 4Q4HA 1LBQA 3BWMA 3HVRA 5DYIA 1VBKA 1Y80A 3VNBA 2H6EA 3BILA 3BREA 4C78A 3JASB 5B37A 1KOFA 4DGQA 3CLRC 1SXJB 3E7FA 4JEHA 2J85A 2FAXA 2W11A 4BZQA 1SN7A 1EDBA 2VSFA 5CFMA 3U19A 1Y4SA 3IQEA 3E81A 1FQWA 4Q9AA 1PGPA 4WZAB 4XRGA 4G8BA 3UCEA 3HNPA 4P4LA 2VH2A 3FB1A 2Z2IA 3LPDA 2HA5A 1UOEA 5GGYA 5FBWB 4HWPA 3ZNPA 2EVWX 1Y6ZA 4HB0A 1LRJA 2V7UA 3KKNA 3B85A 4JLNA 3PQDA 3G7SA 3KQVA 5CNKA 1XNHA 5FTWA 5L3ZA 2ESRA 5KYWB 3P2IA 4KVAA 1IEQA 3B9RA 1R2QA 3GXOA 5EFOA 3P4YA 2HNBA 3UICA 1Q1BA 1YR9A 2MHCA 2IOFK 3GA0A 1RBZA 5F5XA 1T36A 1IPHA 2W6ID 3E1GA 2JD2A 1ZOOA 2ZI9A 4UHEA 3O94A 4WXPA 1ORRA 4RFLA 2BY4A 1NXVA 3GJ7A 3JWJA 1NULA 1XD2A 3C70A 2GRAA 1MVLA 3SYKA 3FYUB 2DYKA 1NOKA 2RH9B 3LQQA 3MOGA 4MGZR 5CU7A 3VYRB 4F92B 3DZCA 2FW8A 4GC5A 4F11A 3U7GA 4N3GA 5ELXA 1THZA 4PNHA 1UFOA 5TVGA 4DSUA 2ALJA 3NKFA 3R0ZA 3U7EB 4C5AA 1P2GA 5HIJA 1NXSA 2VUIB 4C0BA 5JY1A 4BFYA 3MA0A 5CA1B 1P1RA 1XLVA 3F9IA 3PZBA 1FUIA 2PX5A 3E1KA 4RZ2A 1S2GA 3RSFA 3DFZA 3G23A 4KIJA 3HY3A 1X1CA 3HJBA 3NUZA 5THXA 4CL8A 4HC4A 3U7IA 1Z0UA 2R6JA 4NBKA 4Q7JB 1EP2B 4HNQA 3SU8A 3EFEA 5JS8A 1OXKB 5C81A 4IX1A 4N0EA 1J06A 1S2MA 1DWPA 1XDGA 2QZPA 3JQPA 1K6XA 1JHZA 1Q22A 1X39A 1UBEA 1YJAA 2AE1A 3MK31 4G8DA 4P54A 2I1VB 3S5UA 4C04A 4NBVA 1FB5A 4J75A 3UNXA 4H4CA 2JH3A 1WETA 3M89A 4FOPA 1SKYE 2H07A 1O0BA 1YQGA 2SBTA 3C87A 1HYBA 1JAYA 1BXRA 1Z15A 2ZW9A 4LXHA 1T3ZA 4MKHA 3HFRA 3TEJA 1MZPA 2V6GA 3KJXA 2CT8A 4S24A 3BBPA 4NJMB 4FGLA 3R3JA 1TJNA 1UFVA 1FFDA 4LF7B 2EARA 2XBUA 1RAHA 2RIRA 1JIXA 1L5QA 1J2RA 2OCLA 3L0IB 4HRYA 4LZPA 4FYXA 3ZCSA 1D2MA 2XZPA 3KAPA 1I8TA 3LH5A 2M9MA 2XUFA 4R69A 3TX6A 3V3KA 3CPSA 4CTKA 4MKZA 5HJEA 1U1EA 5FBRB 1J23A 3ZHRA 5BPHA 3U4MA 3ZEIA 2FRVA 2OORC 2J9XB 2QYSA 3HEAA 3U7QA 5LP6B 1KMHA 1PQUA 1U3VA 3KIPA 3KPVA 1XLUA 2XADA 4TYMA 2HBYA 4LJSA 1RYNA 1YS6A 1GU0A 1M2GA 2P2CA 3D2AA 2FSIA 3L46A 5IVIA 4EG3A 5J47A 1GKIA 1JHQA 1Y3IA 1C5KA 4K9OA 4GNRA 1DAGA 4A6PA 3RUIA 1HC7A 1R4ZA 1G9SA 3UJ8A 2OYCA 1BMFD 2VAVA 1SWWA 2C2OA 2Q5CA 4J7AA 5BUSA 1FIUA 4QLAA 1LU9A 1NFQA 3V34A 1FP4A 3RKSA 2ZB2A 1D6SA 2YVQA 4WLEA 1I80A 2P3OA 4LMRA 4MVXA 4XWYA 1T9AA 3BCSA 1W59A 3JQ9C 1G6Q1 3NKLA 1NZJA 2CEKA 2VZ0A 2QYOA 2JEOA 1K97A 1P7WA 3TQHA 1KQOA 3NIFB 4U6QA 2ODAA 3NV9A 4C20A 1PQWA 4TVBA 1OA1A 3C6QA 2F1RA 2XT6A 4FHGA 3Q1LA 2O0HA 3CX6A 4JV5B 2PT6A 2R6HA 5ICMA 4Q66C 1GR0A 1GGFA 3CVVA 4K2HA 1PSDA 5ITZA 4CHTA 3OM9A 4PWYA 3UHFA 1T1JA 1NWCA 2VTDA 4PGMA 3R2JA 3HJTA 3S6JA 2HW8A 1UPBA 4I1YA 1E9RA 1Y4AE 4C4XA 1D3AA 2GDZA 3KPJA 2PIAA 1HTTA 3ABRB 4LJKA 3MT9A 4BE9A 3NIGB 1ETHA 2GBIA 3A9WA 3GDOA 3OE7D 5EZYA 3RFXA 3FUUA 4KYVA 3CEHA 3NEJA 4QDKA 3UUWA 3IUSA 5KCZA 4NYJQ 1YUNA 5K6AC 1E7WA 8LDHA 4WASA 3LOQA 1D0VA 1A5AB 1MC5A 1H1DA 1SA0A 4IDBA 1EM8A 3ZUPA 4EQ6A 2FR0A 4ZVVA 3X2SA 2NAFA 1Q3KA 1ID1A 2IU4A 1GDDA 4B75A 3BEDA 3URMA 1QHIA 1DHRA 2Z6QA 3IV7A 5F3WB 3E7PA 2RAPA 1A8QA 1JFLA 4DT1B 1G8HA 3ZOKA 2CYBA 3AUTA 1N8NA 1MFPA 3GI1A 1XXHA 3PC8A 3ONFA 1XMOB 1I5OA 2OQ2A 1XDDA 3A4LA 4NBLA 4ZV9A 1QDEA 4WOPA 3CVYA 3THXA 1N5IA 3GWGA 1NM5A 1V1MA 1VFNA 3H9CA 2IEIA 5DLEA 4A23A 3ZTTA 3LI2A 3RCBA 3UJ6A 3UXEA 4JGIA 3RASA 3BZWA 5JD5A 3DBHB 4PXYA 1K9SA 2E85A 1R16A 4B09A 4EW1A 3CZ9A 3PIIA 4M86A 2JLAA 5IF9A 5JCPA 1A1SA 2QRKA 3VNAA 3GD5A 3UQYS 2OEPA 3WMGA 5BVGA 1QHGA 4L3VA 4MVJP 3WISA 5CITA 4YCLA 1Y8RA 2CCJA 3FPBA 3DLIA 2R4TA 1SIUA 2C9YA 4GKJB 3B1WA 2PYZA 1KJYA 1NU6A 2Q1UA 2UKDA 1P2TA 4LRUA 4B6FA 5F76A 2I4OA 1EVLA 3QPVA 3TIGA 3EW9A 5EI5A 4IUYA 4MV9A 3WHLA 2JJ2D 1NAIA 4WV3A 5LQDA 2NZVG 1IB0A 1DG9A 2DULA 3QG1A 4UVEA 3V4SA 1DBSA 2Z3VA 3I5UA 5IT0A 5ISMA 3QNMA 4BNHA 1LSOA 1PJAA 2BFOA 3LP5A 4IIBA 4TS1A 5G0UA 1K63A 4BLPA 1GNQA 3I42A 3QEOA 3F5FA 4MV8A 1GN8A 4WFIA 5EQDA 4C4AA 5LU9A 4P35A 2GCOA 3QH4A 3CJQA 4TVOA 4XOUA 1J0CA 1KMNA 4OAPA 4QE3A 5HZHA 4X1KB 4UMFA 3VSAA 4JWKA 4B9EA 1QZXA 2BUCA 3AJAA 4IJWA 4Z9XA 4LS3A 3VPAA 3E9DA 4Q9LA 5BSFA 4NV1A 5FORA 3F2IA 4TLAA 1TKRA 3SIPA 4YQYA 2QP9X 1TIBA 4BKUA 1EK0A 2OZVA 5LQNA 1LW7A 2C3OA 4XEUA 3T9AA 3ZHCA 5T4HA 4RY0A 4DZTA 4OQFA 4DV1B 2BMAA 3EXAA 5JCZA 3OY7A 4TM8A 1B2LA 3QTBA 4BP9A 4DMUB 4GXRA 2V6JA 4L16A 2GM4A 3E5RA 4IIXA 4PAWA 4CIWA 1NLZA 3L0SA 3UA4A 3M2PA 5FO1A 5CDUA 2D1RA 5KSYA 3KVYA 4KVZA 5A3QA 3OKPA 1FYVA 1UWVA 4PY2A 4RD6A 5BT9A 5F1YA 4BLSA 1ZZGA 1E3MA 2BONA 4YCAA 4Q3KA 3SZUA 3FTDA 4UAUA 2CHVA 4TRRA 5KQRA 4DAEA 2BJVA 3M49A 2IEBA 2MYPA 1LLDA 3DE4X 3N0VA 4KN9S 2QVYX 3U37A 2VA9A 1U7UA 3U3RA 1E0DA 1V3VA 3BMXA 4A91A 3LCVB 1KSGA 2XE8A 1OXUA 1CRLA 4GICA 3T1YB 3U3JA 5DI3A 2QD4A 1EK6A 3IQFA 4GBJA 5JAZA 2PWZA 4DR4B 3L82B 5K05A 3SKYA 2YYZA 4M0KA 2PZJA 3N8NA 1IONA 1R0KA 3D5EA 3TTXA 1E6MA 3HVKA 1QFSA 2PRJA 3B12A 2FEMA 4EYOA 2GLTA 4TS9A 3PVZA 4YO7A 3V1TC 3ILYA 1TCBA 4ZEVA 4OQYA 2BM1A 3A7EA 1RXSA 4HAZA 5LJIA 3IJRA 5AQ1A 1E3QA 2JCYA 3SDSA 3LF1A 4LSWA 5CJJA 5JVDF 3ZDQA 5DM1A 3UMYA 3BXPA 2DHEA 5T3UA 1KO4A 3NBYC 4QGSA 3N53A 3X1ZA 2JA2A 1QXSA 2WHEA 2XITA 3U60B 3D3KA 3MCTA 4UU8A 3DAYA 3P9PA 1XA0A 4E7OA 1M10A 2R7KA 1O94D 4JVNA 2WPNA 1A5BB 1N9ZA 1A71A 1KYZA 1RRPA 4G86A 5FI1B 1NNSA 1IPFA 2C04A 2VH5R 1WUJS 3C85A 4BKOA 1QIKA 1PYGA 2VCHA 2DX7A 3AIIA 3K0CA 4PCVA 4X20A 3TVYA 2QX9A 4KQ6A 3EVDA 1GRCA 1OZGA 4K6GA 3V1YA 2IJGX 1PS9A 4QOJA 1DJOA 2UUAB 3WGJA 1WV0A 4YR7A 1JTVA 2Q5HA 2QW0X 4GOND 1ULAA 3YASA 3ZIAA 4LEIA 2O8CB 5DDIP 3LCJA 3QEKA 5ALVA 2I4RA 4TLMB 4M1EA 1Z2PX 1G5QA 3ZHVA 2Y4OA 2ZIUB 3W8FA 1YL7A 1JLSA 3E9QA 5JNSA 2PGXA 3IDAA 1ID8A 3RRFA 4XGKA 4A2QA 3K9BA 3QVWA 1KTIA 1CY8A 4OHXA 1QNLA 4EGJA 4ESVA 1O87A 2J5KA 1QG6A 2J3KA 3DEIA 5J4LA 3HLYA 3U4QA 2UYOA 2EAUA 4CN9A 2E21A 3R3ZA 4KXXA 4DJEC 1PLJA 2V7VA 2REQA 1ECPA 3LK6A 2WIKA 5DHUA 4P32A 5HFJA 4UXIA 1FFBA 2JFGA 1MRNA 3O8QB 4FFWA 5IC5A 4L9WA 3HN7A 1TFRA 3CZQA 4FS3A 1OFHA 3FH0A 4FTWA 4G0WA 3IXLA 2GARA 3AF3A 3LD9A 4V03A 3BE6A 2I3ZA 3DTVD 1V2HE 2UXCB 3CX4A 3H6KA 4RCYA 2P2NA 4JL8A 1SVSA 1C4WA 3OWXA 2C8JA 4JL5A 5IFKA 1F2TB 3BSWA 1HZZA 2XUDA 3P2MA 2B1JA 2OC4A 2WSIA 3K0AA 1PTJC 1QRUA 2HT1A 1MAVA 2GM5A 5IZCC 4KE7A 5HCIA 3TO5A 3WNDA 3KWMA 1P4JA 4QFBA 3QOFA 1XZ8A 1BX3A 4NU0A 2OGSA 1U31A 3DFFA 1U90A 3LGAA 5A4IS 1D7OA 1TMOA 1F17A 1FPMA 1PKXA 3GJXC 1MU0A 5FPYA 3DKPA 4F60A 2W2VA 1OXXK 5HOEA 4MW1A 1P61B 4RJLA 4OQMA 1Q92A 4WZBA 5F1KA 5GOTA 5HZMA 5HF9A 1G64A 2HQBA 5BV0A 2HRRA 2JIDA 3DOJA 4DCUA 4WLOA 5IXYA 1PDVA 2PSDA 1T8YA 1MAHA 2YV4A 1M66A 5H3LA 1POXA 2OP0A 3CRQA 4RPCA 4GL2A 1XMQB 4RPLA 1M2KA 1DFHA 2WEKA 1U2GA 2V54A 4DQVA 3S55A 4FR2A 4KQXA 3LCCA 1KKMA 5K3CA 4CLOA 2FZLA 1HT3A 5T4EA 4YJ2F 2HRQA 1ZVJA 4JJ7A 3ROTA 2BR4A 4PO1A 3L3BA 3VU9B 3PDUA 4ZOEA 3SZMA 4PO8A 1CZLA 2O1EA 2WJGA 1V6SA 3BZUA 1W4LA 3OZSA 121PA 4HTFB 4M98A 4H1VA 4HGRA 5B7GA 2J6HA 3PUYA 1NKSA 2OHFA 2WYUA 3LAWA 5BUZA 2CF5A 2FUG6 5AH0A 3HZOA 2EQBA 3HR7A 1V4BA 2PWAA 1X0VA 1QIEA 3PQ5A 3I1JA 2FKNA 1RMTA 5I9IA 3TB4A 1IJBA 5D3MA 4AJHA 1G20B 4HK4A 3RS7A 2CLFB 3FCYA 4JBHA 1XQ1A 5E6RB 3WYBA 3DEFA 3FDIA 4JITA 1USKA 3T3PB 1B8NA 4ZHQF 2ONCA 1M34E 2Y1WA 3CNOA 4HDSB 1FSSA 4OLBA 3RYIA 4RY9A 2DLNA 5EN4A 3JRXA 1XK6A 1Y6QA 3PS9A 5ARCA 1FZTA 4ERNA 4XOIA 2JHFA 4ZZ1A 1QGYA 2MSCB 1QP7A 4OK3A 3QFRA 3GDGA 1KBQA 4YLEA 2GNOA 4W9NC 3S0JA 1MOZA 2NZJA 4HZGA 3HCOA 2JK0A 3F7OA 1OBOA 5JCOC 4BY9E 1XSEA 3WZLA 2VYNA 5CGQB 4BLQA 1QX3A 1BDMA 4DCPA 5ILQA 2D2EA 2RKWA 1FTQA 4V24A 5GONB 3JY6A 3UC5A 4YCDA 4A27A 4PHGA 1ZAYA 1LDMA 4IKEA 3FZYA 1WWKA 4PLTA 1QIGA 1TB4A 2DT8A 2GO7A 4MMXB 1FPQA 4XUGB 4JBGA 2HCFA 4UU1A 2RGUA 2Y1EA 3BORA 4H08A 4JYBA 4LSZA 5CNIA 1ZJJA 5IC6A 2IQIA 4B2PA 3QKSB 4DA0A 4FYKA 1K27A 1D1SA 2XODA 3QK7A 2JHCA 3OZCA 2C0QA 5DK4A 3WV5A 5TR9A 5TQ0B 5KI6A 3CE9A 3STUA 4AFNA 3QUAA 2VXYA 1C8LA 2PGIA 5K6RA 2VHJA 3KZOA 4XJSA 2J0UA 1YA6A 3TRKA 2YXBA 2HM7A 3NH9A 3VR5A 1C8VB 3MJCA 4MQMA 1PS8A 3HCWA 2OBLA 3QFFA 4ZO4A 4HVTA 3MTJA 4NENA 3U39A 1M1YA 1E2MA 3RFUA 3AHJA 2QUIA 2ZJ2A 3C3DA 3KJHA 4TMFA 3FY4A 5ENVA 6CHYA 2ERYA 5KOHA 4ZRMA 3VDQA 1VL6A 2WF9A 3IH5A 5IBPA 4P31A 2VXCA 3D8BA 4XWTA 3T3EA 2IEZA 5IBRA 3UJBA 3UW1A 3HDTA 1SEPA 2FK7A 3DG9A 4MW6A 4KR3A 2G5PA 4P0QB 2O3QA 1T13A 1VLJA 1I0IA 2J4FA 1D1QA 3V42A 3KKPA 1EVZA 3JTMA 1EHIA 2QBYA 6AT1A 3L8GA 4MWDA 1K8QA 3B60A 2YC2C 3FNHA 4TTIA 1IIBA 3ISVA 1LVHA 5IASA 4TL9A 4OHKA 2XRYA 2B8TA 3LHDA 4LRWA 3V4PB 3PA6A 4BEJA 1UL1X 1OZ0A 2J7KA 1VFPA 5F2EA 5HUHA 5AM1A 1DXYA 4ZT4A 2P67A 4BC0A 5F4BA 1XDZA 4A8JB 1JEQA 3QLUA 4HUJA 4X6LA 3U40A 2HTFA 4IH4A 3IKTA 2DUUA 1V5FA 4L0CA 3W79A 4BGIA 2IEGA 1XF9A 3V80A 2H0AA 2CYCA 1R6TA 4AIRA 4QEDA 5EIOA 3VPDA 4BQNA 4C0KA 1WY7A 1E3IA 1R0BA 2P69A 1FTNA 2ZSHA 2ZYWX 4M22A 3UWMA 2IYVA 4URVR 3WYGA 1QM5A 4Q93A 4Y8VA 3KETA 1R10A 2IITA 1L3BA 1D2RA 3DE1X 4JNKA 3H65A 4TMKA 5BWCA 1KVUA 2ZITA 3TNLA 3LO8A 2XXAA 5AM4A 1XNRB 4CN8A 4TN5A 3KKKA 1JDPA 5F7OA 4NOJA 1YHNA 1EIZA 1DRWA 1PZGA 2K7ZA 3K96A 1M54A 3EQ9A 5CAEB 1UDBA 3ENKA 4R8SA 3FCAA 4BFLA 3ZVRA 3DT9A 1QS0A 3B51X 5LFAA 1ICEA 1JAHA 2O3SA 1UMCB 1ZD8A 4JXJA 5SYNA 2H2HA 2N1MA 5IJ9B 5J3JA 1WVIA 4X54A 3RSSA 2A5GA 4BO0A 4INOA 3SAJA 4HNVA 4GNKA 1AKEA 2VJLA 2B7LA 2OLKA 4IO0A 1S8OA 4BN5A 2W7TA 2N3ZA 1BJTA 2XWBF 4A03A 2FPGA 2VF7A 5HRUA 1I33A 2YMQA 2Z8YM 3KHUA 3R3VA 4FDUA 4Y2RA 5FUYA 3AUKA 5B4UA 3ZVMA 3M7IA 1XTSA 2RAVA 1QRSA 3T95A 1U5CA 1UOQA 3TEMA 3G7UA 3TAHA 3N8GA 3I9NA 2FSUA 4JT8A 4PZCA 4NKRA 1STOA 3GG2A 3HA7A 3IUYA 1F2TA 4W5HA 3U5ZB 1UJCA 4OVKA 4ND5A 2J9FB 3FJ1A 3LCMA 3VZBA 1UPAA 5JNWA 1ECLA 1K8YB 4L7QA 3BMQA 1DDOA 4CTOA 4IXWA 3P5BA 4RTSA 2FWJA 4N8EA 4LXTA 4KFTA 3J81A 3D4LA 5DT2A 4BQRA 3WWYA 1LLQA 3D3QA 2NSYA 2CEAA 1ABEA 1RMQA 3IJ5A 4MR9B 5DT9A 1XQ6A 2DBRA 1DQYA 1I14A 1P0MA 3BMCA 3ROXA 1W0KD 4ZHSA 5K6AA 1M3SA 4WTOA 4QRHA 3GLIE 1JI0A 3Q9SA 1KQ3A 1YULA 4P7FA 4WE3A 3FDXA 5K45A 3EEOA 4RIGA 4QPZA 1D2CA 3FYSA 4MUKA 5EY5B 1PN3A 2V6MA 1OLOA 4Z3KA 5B3JC 5A0TA 3VC2A 4IDAA 2NZ2A 2XKBA 4E09A 1UADA 1DU4A 1FA9A 4BC1A 4KWHA 2PLWA 5TMBA 4B5KA 4KFCA 1NF9A 1E4YA 1T1GA 2HF8A 3F3MA 5DH9A 1ZXBA 5DP1A 3KUKA 5GQSA 3LX8A 5A7GA 1ZG3A 3ASYA 3K9GA 3D5QA 3C6KA 3ZOZA 3UV6A 3DMYA 3DMGA 1FDIA 4MWZA 1SD1A 3EWIA 1CRZA 3RV4A 2FWMX 1AQIA 2FYTA 2PX8A 3PXCX 5FOTA 1NP3A 1XZGA 2G4LA 1SJ9A 2YXLA 4G85A 4UJ3A 5HG0A 1VPTA 2JGLA 1JDZA 3QF4A 4L4XA 1ZJ6A 3N75A 4AG3A 4F84A 3M0EA 2VQ3A 1SQSA 3DF9A 2RGWA 2BR3A 1GJRA 4OP3A 2GJAA 3E27A 3IOBA 3JQAD 4D8VA 4OSEA 2YRFA