3X1YA

Ras-related protein rap1b(l9v) with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
MREYKLVVVGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Ras-related protein Rap-1b
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
source organism Rattus norvegicus
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1yA00
1SVWA 3ZDQA 2FE4A 1J2JA 5L3SA 4BFZA 5DISB 1EFUA 5FPTA 1YZLA 2GHIA 3W6OA 1NI3A 1W0JA 3FYHA 1QHXA 1TEVA 2FSHA 3BFKA 4XSHA 3BFVA 2CLDX 1RPZA 4M9ZA 3SFZA 2GXSA 3VKWA 4G3XA 4D4JA 4LWZA 4Q7LA 1XTJA 4F93B 4DCVA 2FWRA 2GJSA 4EPVA 2RGNA 4D4KA 1KK3A 3AF0A 1N3BA 1S4QA 2VO1A 4V0NA 4L4UA 4ZDIA 3RS4A 1H8EA 2JGNA 3TUIC 2ZSAA 3NH9A 2RGGA 3CR7A 3U7EB 2EWVA 2ZI5A 4QJ3A 3QEJA 3RC8A 1E2QA 4QOSA 4NDZA 5GVSA 4QM6A 3K53A 2IYUA 421PA 1PUJA 3DKVA 1VCIA 5BW8A 1AM4D 4BGDA 2GRJA 2AFIE 2RGDA 1GNPA 1JEDA 3I92A 3LBNA 2RGEA 1JI0A 1T5IA 2F55A 1W36B 3P20A 1OYWA 3MCAA 4UNRA 4RD0A 4KU4A 4YMSA 3WNDA 4IVRA 3ICQB 2O5VA 3Q72A 1NBME 1ZVQA 1EFTA 2GF0A 2PMKA 4IRUB 2EU8A 4LHZA 1E2HA 5J4HA 1UKZA 1N6IA 2JJ1A 3LY5A 3AF3A 1ZM2A 3ZQJA 4B3XA 1X1RA 4CEJB 4JVSB 2H5EA 2OXCA 1G5PA 1G16A 1GRRA 1D9ZA 4KFSA 4WW0A 4LJ8A 2FFQA 3HYTA 1TAGA 1E96A 2V1UA 4GT1A 2X8AA 4TMZA 1YRAA 4ZI3A 2TMKA 2WWHA 3W5JA 2X77A 2QTFA 3K9NA 5C1BA 2MSCB 4B75A 4BE7B 3UWKA 4OK5A 2IEYA 4TN1A 3FVQA 3OIVA 1ZW6A 3TAUA 4BLRA 3K09A 2DFLA 3OIUA 1XD2A 1X86B 2AR7A 3T61A 5FOUA 3KKNA 2O8DB 2D62A 2O8FB 2BBSA 3TQCA 3QENA 4LBWA 3WMFA 1LF5A 1QHIA 2J7KA 6Q21A 1KKLA 3OZXA 3OFNA 4PC1A 2IXGA 3NIBA 1W5TA 5KUTA 2CJWA 1O87A 3LBIA 3CNLA 3EPKA 4Q01A 2O8CB 2BMJA 2IS2A 3EIHA 4DXAA 1HYQA 5JJIA 5KPJA 1IN5A 2H7VA 1D6JA 1VHLA 3IEUA 5FTMA 2ZSBA 3EZ7A 4R2IA 4Z1MA 1T8TA 5L8VA 3T1VA 1M7BA 3TUJC 4A0RA 1COWA 5J4VA 1FW6A 1E2EA 4NKRA 3GJXC 5AJZA 1II8A 3TW4A 2AHOA 1W1WA 1Z08A 4FD2A 1R7RA 4CYMA 1M1YE 4KJZA 4MRVA 4Q7KA 4LX0A 3T35A 3KJIA 1OKKA 4TYPA 4NHOA 121PA 1SXJD 2W6ID 3A1WA 4PHTA 4D80A 3RDPA 5KHOC 3TUZC 3THWB 4I1UA 5FI0B 1GL6A 3I3SR 4V0OA 1NY5A 5KSOA 3FB4A 4HDCA 5AK0A 5FI1B 1ZNZA 3GEHA 4LI0A 1KZGB 1BKDR 1KAOA 4M53A 3EAQA 4PO1A 5M04A 4LHVA 3QEOA 4KLNA 4EJSC 4OI0A 2WM9B 1ESNA 2GA8A 4PO9A 1AJEA 4IJMA 1TQ2A 4AURA 3P32A 1G9XA 2ZS8A 4IVQA 4MGYR 5KSPA 1X8KA 1QG2A 1IJEA 1N5IA 4GOJA 3O8DA 3QG5A 1E9AA 3L8ZA 2EYQA 2DWOA 1KI2A 2KE5A 1IJFA 5CK5A 2ASEA 1DELA 3A1TA 3U61B 4ITRC 1J8MF 1NJFA 3W3AA 3KKPA 2IUSA 5TY0A 2ZRIA 1GG2A 1ZCAA 3IKJA 3LXRA 5FOXA 2C04A 4TT3D 2HUPA 4TL7A 2CEAA 3NHBA 4R7ZA 1JJVA 4HLUA 1GRQA 2MSEB 2ZIAA 4BQSA 2IXEA 2IK8A 4BECA 1SXJC 4URUR 4XWOA 3OEHD 4IFEA 5K8UA 2VEDA 4WZ6A 2J87A 2VP6A 3I4LA 5A5GA 5L3QA 4Q5IA 2QMHA 4Q1DA 1G5RA 3GLHE 5L3RA 3QVUA 1OIWA 3P27A 1XBTA 3TBKA 3GLFE 2GEUA 1NKSA 1N6PA 2QZ4A 5JWHA 5KTYA 2C8VA 4Q00A 4WIAA 2PZGA 1JR6A 1JR3A 4LGMA 2PX0A 3GJ4A 4O2RA 2ZYWX 3ZD6A 4K8OA 1OFUX 1Q1ZA 3X1DA 4M1SA 5CYPA 2PEYA 3WNBA 2YKGA 1KK1A 1QHYA 4MUAA 4EFNA 1AS3A 4IXNA 4M21A 1E99A 3NBZC 2V9PA 3HU2A 4A15A 1AS0A 1UM8A 4M1YA 1DO2A 2NG1A 3M1IA 2J0UA 2CL6X 1X6VA 4HB4A 3LA6A 4MKIA 4I81A 3M0EA 1MO4A 4PANA 4PFSA 3KB1A 4B34A 2ZRHA 3K9LA 2RB4A 4NTZA 2NPFA 1P75A 2AN9A 1OF1A 3PEUA 3PENA 4TQAA 3RRYA 3TKLA 2IWHA 4IFBA 3AVYA 4RD2A 2VBCA 5CJPA 1NSFA 1E4YA 2OBNA 4D4MA 1IQPA 1UDXA 2QM8A 2BHRA 3CX6A 5AJXA 3GLIA 2R6AA 3L0PA 4P33A 3EPHA 3RWMB 1RRFA 2JAQA 2FPMA 2UZIR 2Z4SA 2O52A 1WE2A 2D74A 3JZAA 4JKIA 5FTKA 4Q1EA 5C2JB 4L9SA 2QGZA 1E0JA 3TMKA 5D3MA 3EASA 3BH0A 1KOFA 1UBFA 3GQBA 3I32A 3AVXA 3QF7A 3F3YA 1GNRA 2OM2A 4KFUA 3DM5A 4FWTA 3ND8A 2W83A 2QL6A 1ZM9A 2WTUA 3H2YA 4Q9LA 1PVOA 1JBKA 4FCTA 3U3JA 2AXPA 2ZUCA 3AGQA 2V55B 3OE7A 5JI3E 5J4LA 3T06B 3SR0A 4A6PA 1YE8A 1P2SA 3GLHB 1CR1A 1UBEA 3O8BA 5EZ6B 3RRMA 1OXTA 3GLFB 4LYFA 3EZFA 2VL7A 2B6HA 4K46A 1EXMA 1DE0A 2REOA 3PR1A 4F4JA 1QDEA 2CMKA 5AUOB 1LTQA 2O8EA 4MRSA 5CK4A 1E9EA 3RS3A 2OFWA 2RHDA 1RYFA 4B6EA 4R98A 1NVVR 4B73A 2KBFA 1XXHE 2FZLA 2PLRA 1F2UA 2YINC 1NIJA 2ZVQX 3L0IB 3QF4A 1KAGA 2BM0A 4L16A 4XWAA 2XJ9A 1WA5A 1UKVY 4LDJA 2AL7A 4C9BA 1M7GA 2AD1A 2ZITA 4G01B 1UEJA 3TAHA 4EFLA 1E0SA 2AFHE 3CB4A 2FFAA 4V02A 3ADCA 3CIOA 4AYWA 4PPGA 4XOIA 3I61A 4TYYA 2VHQA 1GFIA 4LJ4A 4ABYA 3RAPR 1YZKA 3U4QA 2KWIA 1VG1A 2WMNB 2X2EA 4PC7A 4GMDA 4NCNA 1SHZA 2WBLC 4YMTA 3A4LA 3JVVA 5AWFC 4US1R 3GLGA 1CULC 2GEDA 1AK2A 4C0HA 1G41A 3AV0B 4D6PA 1KSGA 3EC1A 1UBCA 3ZVLA 2JCSA 3Q5DA 5DHFA 1W5SA 2HJGA 2OG2A 3NWJA 1KGDA 4GRAA 3B1YA 4GSYA 1RC8A 1FMJA 1C4OA 2K5UA 3FMIA 2PBRA 1PUIA 1L4UA 2XSZD 4C4PA 3SEAA 3S1AA 4NYMQ 1OH7A 1E2FA 1NG9A 4II7A 4LV8B 1XMVA 4IOKA 5J40A 4BLQA 4DCNA 3QXCA 1G64A 3U60B 1IN4A 3NC1C 1V43A 4OK6A 2IYRA 2B7CA 2A2ZA 2IL1A 2IYXA 2VH5R 4TL8A 3PEYA 3ZS8A 1AKYA 4AKGA 4CVNA 5HZHA 3HU1A 4C2TA 1SVKA 2ZRJA 3B1VA 1P7CA 3G0HA 1SKYB 2CCGA 1LF0A 2ORVA 5GJVC 2F1RA 2J0VA 4GOXA 4XWKA 5JHHB 5KO2A 2OBLA 4JSYA 1BO6A 4E03A 1XRJA 4WXPA 2IYWA 1FUUA 2ZYTX 4XD7A 3U7GA 2DFTA 4GPTA 4Q9JA 3BE4A 3VQTA 1GVNB 4Q9IA 5BN4A 2GZDA 3T1OA 5FH9A 3V4FA 2IA5A 3A37A 1ZIPA 2BCJQ 2JEOA 1EFCA 4GOKA 5FPHA 3R7WA 3BB1A 2OT3B 4ZDWA 3Q5EA 1R8SA 3B13B 3VX4A 4BZXA 4DEYA 4DSOA 3K70B 2AK2A 3ZZTA 5E95A 3KXKA 4OQNA 2GXQA 5CJ2A 2V6JA 5AJVB 3E2IA 2Q6TA 4EFMA 3F0TA 4GP7A 2IBMA 3W5IA 4Q9KA 1E69A 2CNWD 2WJYA 2IHYA 1N6HA 721PA 2GJKA 2WMOB 5JZVA 2QP3A 2C99A 4NONA 2EWWA 4YMUA 1N6NA 2ZRAA 3QXXA 5BWMA 4DT1A 3KTAA 3B1WA 2Z6VA 4YXWD 3NHAA 2A30A 1CJMA 1G4UR 1KI3A 1WRBA 3SI7A 2HCBA 1FP7A 2FZ4A 3L8YA 2B21A 3HP1A 1M2OB 3FFBA 3I8XA 4TSFD 4DIDA 1CTQA 4C0SA 2YYZA 3BFXA 4AKHA 3EW9A 3FPAA 5P21A 4TLAA 1Q12A 2ZRBA 3W90A 3PV0A 1NIPA 3WBKA 3LBHA 1W4BA 5JBQA 5FOWA 5K8TA 1E1QD 2EFHB 2QORA 1Q22A 1YZQA 2A9KA 3KKOA 1KMHB 1JAIA 1N0WA 4UJ5A 3KQNA 2F1IA 1DO0A 4LV6A 2ZRLA 5EXPA 4MKFA 1XTRA 3FMFA 3IPYA 4WZBE 3BIFA 3QIAA 4NBSA 2OCPA 3MSXA 3SZRA 2Z83A 4AC9A 3B60A 4UNSA 2RGAA 1DARA 4ZI2A 4KI0A 2ERXA 2Q9AA 5C4MA 2QROA 4KITB 4PTLA 1XTKA 4IDQA 4PAQA 4Q18A 1XU4A 4FN5A 3O47A 1JXOA 3EZ6A 4HAVA 2NPIA 1ZAKA 2V54A 4A2QA 4DUGA 2R6CA 1BOFA 4OI2A 2C9OA 3DVLA 2BMDA 3ONWA 1IN6A 2BCGY 1W0JD 2WJIA 1E98A 4DLYA 2ZI6A 3H84A 3AVTA 4LBYA 4DC9A 1PZNA 1R6BX 4M9SA 4PSKA 4TQUS 5FPKA 5L3VA 5LDDC 4M1OA 4D0LB 1TUIA 2NO7A 3BH6A 1BMFA 1B0UA 5GVRA 4LJYA 1QRAA 5BN3A 2IUUA 1SVSA 4PPNA 4A8JC 1H8ED 2B8WA 2W00A 2PLFA 1RVDA 4MRNA 1AN0A 5AR1A 4O2LA 2VSOA 1E2JA 3CWZA 3FKQA 2HV8A 4MA4A 2QAGB 2J1LA 2NOAA 2ZAMA 4GNKA 4QGGA 3TR0A 2ANBA 3L0SA 2ZJ5A 3WMEA 3FHOA 2GAOA 4RFVA 2AWNA 1Z6XA 4N1AA 1NBMA 4HAWA 1NMZA 3PQCA 2PJRA 2VHJA 3N2IA 2JJ1D 3FE2A 2B7BA 3QF4B 2GJ8A 4UQOA 1RE0A 4Q1AA 5FUVA 2G77B 3EX7C 3BC1A 1KK0A 1N6OA 4MYUA 3UMFA 1XFAA 1RRCA 1P9NA 3ZGXA 1K8RA 2JLRA 2V1XA 3H0KA 1I4LD 4RFSB 3REGA 2QSYA 1S3SA 2IS6A 1HUQA 4F4CA 1E2IA 2NZJA 2ZJYA 3K9HA 2PL3A 5CLQA 1W4CA 3RYTC 5HZKA 3U4QB 4FMDF 2RGNC 4DBLC 2VTKA 5FTJA 1G291 2GZAA 3EXAA 3I8SA 4IOMA 3UG6A 4YMVA 5BYKA 3ZZUA 3GLGB 2GAAA 2BMFA 3QPUA 4QGFA 1TQDA 1Q3TA 2WICA 2NQ2C 3OFND 1NLFA 4F7WA 5F2EA 1MOZA 3FMOB 4UNPA 1E2KA 521PA 1N2CE 4A2WA 1YR7A 2D7DA 4DJTA 4U00A 1ANKA 4URXR 4O3MA 4JL5A 2FFBA 5J4YA 4L5BA 1H8HA 2QMOA 1Z06A 3U6BA 3QE0A 4Z1MD 4US0R 3EA5A 3B82A 2ZJ2A 5SZKB 4MYTA 1COWD 1JALA 3LVRE 4BFYA 1NY6A 1XZPA 4DDWA 3NEJA 4QBIA 4IDPA 3SHWA 1Z3IX 5KSZA 2XNDA 2E87A 4G5SA 2BEJA 2QN6A 4DCTA 1KJZA 5KNBA 1OKKD 4TYWA 3CF2A 2J0SA 3I62A 1EG7A 3R9IA 5IT5A 1II0A 2NO6A 3C4JA 2OSBA 1RYHA 1IN7A 2KSQA 2OO7A 1GAJA 1G18A 3CF0A 5IK2A 2FA9A 5JI2E 3IBGA 3BGWA 3K09C 4FMDB 4TMKA 3LQRA 3B85A 1KZ7B 5BQ5A 2WJGA 2LKCA 3FHCB 4BUJA 2H92A 4PAMA 3QXSA 4LUCA 3CBQA 3TW8B 5H8WA 4Q48A 5C46F 3L82B 1YZNA 2ZU6A 1E32A 3UMSA 4Q4AB 4BZQA 4EKDA 2GZHA 1E9BA 2BWJA 1XCMA 4KV9A 5D3QA 4Z8XA 1VDZA 1KO8A 1SVMA 2RCNA 1ZM7A 3N2EA 3R7WB 4B2LA 4DHEA 3AF2A 3OIWA 1F3OA 2VLIA 3BXZA 3K70D 5KNDA 1IXSB 1C1YA 3REFA 2ZRNA 5LD2C 3B1ZA 1MO5A 3GJ7A 3SE0A 2XOKD 2P0EA 2V6IA 4KBGA 2DFKB 2FJUA 2OESA 2R44A 5FUWA 2O8CA 1Q1QA 1P60A 4RD3A 4EDHA 1XDBA 3I72A 3RWOA 3U3OA 4IKEA 5B64A 2XGJA 2QBYB 2Q21A 3D31A 3RANA 2GF9A 3THOA 4IDOA 1UBGA 1QHGA 2A5JA 2AWOA 2W0MA 3CNOA 4KLZA 4KYUA 4RZ2A 1EESA 3MGCA 2ZTSA 3OF5A 5A0FA 5H68A 4MKGA 4DT1B 3KTAB 4HUQB 4M22A 1YR8A 4W5JA 1KY2A 3BS4A 3VX3A 5CDFE 1GTVA 2Q3FA 3V9PA 3A4NA 4GI7A 2QEQA 3GLHA 1GP2A 2G1JA 1Z29A 3GPLA 5FTNA 1OXSC 2J7PA 2QQ0A 1XEFA 4S35A 3GLFA 1Z6GA 2WZQA 1P73A 4UNNA 2LCFA 2JLQA 1IY0A 1JR3D 2VP2A 2ZJ8A 3WY9A 1L8QA 1P5ZB 2GJAA 4HZUA 3QNUA 4OHWA 1G17A 2DBYA 5JHGB 4LJ5A 3EZ9A 4JT2A 3AH8A 4XVUA 3VKGA 1HQCA 5AJYA 2OZEA 4JL8A 2AKYA 1OH5A 2FGJA 1CF4A 1E94E 3MRSA 1F2TA 1XTIA 3WYAA 5C18A 3K70C 1TF5A 2C9CA 3Q7PA 4NYIQ 4G5GA 2ZXUA 5DIFA 1U90A 3A4MA 1KSHA 2ZS7A 4DZZA 2DFNA 3UKDA 5H70A 2H16A 4X8MA 2ZE8A 4QM7A 2AX4A 2Z4RA 4ZDJA 2A5YB 4OYHA 1G1MA 4KFRA 1CRPA 4MITA 3SDZA 2F6RA 4HLUC 3BBPA 1OB5A 2C95A 1Z0IA 1C9KA 2YC4C 3B2EA 1OE0A 2ZRMA 5E7MA 1G3IA 3R8CA 2FSIA 2RGXA 2F1JA 2F1HA 2R6DA 4DDTA 5EE3A 4HLDA 3EIQA 2WAXA 2F3TA 2W0SA 4B71A 2IYVA 2JIZA 4W7SA 1XZQA 4TTQA 4A92A 3K0EA 1A2BA 4LJ9A 1Z2CA 1MO3A 1HH4A 4FMCB 4XSGA 5B30A 3THYB 3A6PC 4Q4HA 1FX0A 4MYCA 1A2KC 3ETLA 2DYKA 4A2PA 5CB6A 1FPMA 4OQMA 3TIFA 4RZ3A 1OH6A 5G3YA 1G3RA 2OCYC 1U8AA 2C2HA 4NCJA 1NLYA 3HYRA 4TMXA 3OE7D 2YV5A 4QHSA 1BYIA 5DI3B 4DLSA 1GKUB 1N5KA 4LK2A 3IPXA 5FBQB 3NVAA 2ZJOA 4PSAA 5J47A 1HTWA 221PA 2NO0A 2BMEA 2PX3A 1ZD1A 2ODEA 4ARZB 1TX4B 1NNEA 3KQHA 1WDTA 4LYHA 4G5OA 3UIEA 5GJBA 1NVXQ 3PIRA 4ZO4A 3M4YA 4WBSA 1S9HA 2ZREA 4TZ0A 3SYKA 3OIYA 4PHFA 1ZD8A 1E3MA 4M1TA 3P4XA 3BD9A 1CIPA 1XXHA 1GUAA 2KB0A 2DWPA 2A3RA 4DLXA 3NEYA 2VPPA 4B3FX 5HCNA 5FL7D 5TMPA 2RGBA 1WQ1R 3WYFA 1XJCA 2UVQA 4JJKA 2ONKA 2WWFA 2G0NA 2WWIA 4HB3A 4B48A 1FQKA 4JBXA 3VTKA 3QG1A 1VPLA 2GBLA 4IW3B 1P2TA 4JMPA 1Z0FA 4TZ6A 2CXXA 2IXFA 1KDOA 5ANRB 3UMRA 2G6BA 4HB0A 4XIGS 2JLSA 5IF9A 2G3YA 5KOYA 2QAJA 1CP2A 1RRPA 2D4HA 2PT5A 3MWJA 3VR5A 5BYJA 1E79A 1YKSA 1R5OA 2BVNA 3TSZA 4DSUA 4DLRA 1T5LA 2WV9A 5JEDA 4TMTA 4RKFA 2FOLA 1YZTA 3O8RA 2WHXA 2X1VA 3SC3A 1KJYA 1MO6A 2HYIC 3CRW1 2ZYUX 2A5DA 4QXAA 4MGIR 1AIPA 1G3QA 4Z54A 4ZKEA 4B2PA 1M8PA 3LFUA 5FBVB 4F91B 3IDQA 3DOFA 2FSFA 3K0SA 1KDPA 2IYZA 3H4MA 3OESA 1SKQA 2G9NA 4FCVA 2D3WA 2WJJA 4OQXA 4TTPA 1X8LA 1D8TA 4NYJR 1Q44A 1XJ0A 2BBWA 3LDAA 4WA7A 2RH5A 2QPTA 1G8PA 4Q02A 3WP1B 1EK0A 1U8ZA 2XEXA 1AGRA 4NP6A 4YLGA 1QVAA 5KU1A 3PEVA 3C16C 4RD1A 2ZEJA 2WVJA 3NBXX 1G3UA 3ZIAA 1CRQA 4MKHA 1KMHA 2ZI3A 1W49A 1I4DD 4JLPA 4PHGA 1MT0A 2HDNB 2KJQA 5EP2A 2IS4A 4EPWA 2C5LA 2IS1A 1Z0KA 4GDFA 1IXZA 3U5ZB 3MAAC 2ODNA 4L9WA 4KAXA 4XD7D 1HQYE 2QM7A 3T1QA 1VCMA 3QKSA 1VIAA 1OIVA 4GL2A 2A5GA 4DLUA 2Q3HA 3C7KA 5K8IA 2V7QA 1T0JB 3ZQ6A 3FDIA 3GFTA 3NDPA 1ZJ6A 3VHXA 1U9IA 4QHYA 1KHTA 3GFOA 3FKSA 1DAMA 1FOEB 1Q20A 4D0NA 1HURA 2QPAA 2DB3A 4AYXA 1A1VA 3VU9B 1NKTA 4GMXA 3TGPA 4HSEA 3SQWA 2N46A 2BOVA 4QGHA 4ERNA 3I1FA 1E2MA 2L0XA 1HT1E 1M7HA 2QU8A 3O8CA 3JVUA 2NGRA 5JCZA 5GJWC 4D4LA 3SJAA 3HPRA 2IYQA 1E9CA 1TPZA 1YR9A 1DTSA 2HCJB 2X2FA 4HUTA 3ZVNA 2VP5A 3PFIA 1Z47A 1S96A 1N6KA 4QC2A 4RCYA 3E70C 1YHNA 4NPHA 2ZRFA 4H1VA 1EX6A 4KSCA 3GP8A 3CPEA 3K0FA 1KMQA 1OXXK 2OCAA 2P3SA 3KKQA 4JLJA 5BXQC 3AKYA 3T12A 2QAGA 4FINA 4G5RA 4Q7MB 1ZC4A 2REBA 4JLOA 1IY1A 4QBFA 2C78A 1W36D 5A4JA 3DHWC 4L8GA 3QSYA 4TMWA 4OHVA 1KNQA 4HZIA 2YWFA 5KYKA 2YC2C 3C8UA 1E1RA 3JZMA 2AXNA 2J41A 4A0FA 1E9RA 621PA 1OB2A 3SJBA 2LKDA 2RAPA 4HZUB 4QGAA 1XMJA 4B2IA 2W6JA 1GNQA 5KDOA 3DPUA 4QNRA 1R0ZA 2FFHA 2ZR7A 3EPLA 3ECCA 4CZ2A 2V4ZA 3AB3A 1UKEA 4P4TA 1F2TB 3CRVA 2WKQA 2GK7A 3F8TA 1T0HB 3L2OB 2VHUA 4MDFA 3MJHA 3GEIA 1DAHA 4RFSA 1ONBA 2G0TA 3LQQA 2J3EA 4OK3A 5HTKA 3KJGA 1LS1A 4OQFA 5UKDA 1Z63A 2QA5A 3LLMA 2ZRPA 5G40A 4BFXA 1HA3A 1T3SA 3CRRA 2LWIA 4DUGD 2XAUA 3CF6R 2HLDA 2Z0MA 2F43B 2NTYC 5FOTA 4DSNA 2NZ8A 4JJZA 2PT7A 3GFPA 5E3HA 1IONA 4HI0E 3B8HA 4KHZA 1SVLA 1X3SA 4GZMA 3IHWA 1B23P 1W47A 1BMFD 3MWYW 1W36C 1J7KA 4BPBA 1DAGA 2CVHA 1KJWA 4G1UC 4RCZA 1KO7A 4RJLA 3X1WA 4AKEA 4RD4A 4B33A 1SZPA 3BH7A 2JDIA 2OXRA 2CVFA 5LBIA 1Z5ZA 2OBMA 4Q4HB 1WBDA 1CLUA 1FX0B 2OAP1 4FW9A 1M34E 1OHHA 1U98A 4MQBA 2HEIA 3WYGA 4IDHA 4XVQA 3QVVA 5HPYB 821PA 3AKCA 1DAIA 4BFSA 4D25A 1IAQA 4C7OA 4PZLA 3VR4A 4UXJA 5HE8A 4V0KA 5FOVA 1BYUA 3K9GA 1G4AE 3X1YA 5BN5A 2MSDB 4FMBB 3RS7A 1ZP6A 4DKXA 4DCSA 1BIFA 1E0AA 4PX9A 5E7IA 5FR2A 1FTNA 3KQKA 4IHQA 4I1SA 1NN5A 3MG9A 4F4IA 2VQSA 2W2TA 2QRNA 3GJ8A 1NBMD 2PH1A 2ODWA 3ZD7A 4R71A 4ZDKA 2HT6A 1Z6YA 2QGNA 3GMTA 2IHBA 5KSYA 1GILA 3C14C 1XXHB 3OEEA 4BLOA 1OYYA 2ZRGA 1Z8FA 1YRBA 1O3YA 1JR3E 2VHCA 2WSSA 4TTRA 5DO9A 1XD9A 4Q4AA 2P65A 3KX2A 5EQTA 5IDVA 3THXB 5FUXA 1YZUA 5LB4A 3T1TA 4E07A 4M1WA 3Q85A 1EFRA 4OL0A 1OW3B 3ASYA 1NSTA 1XNJA 2QMEA 4LV5B 3A1UA 1KSFX 2O0JA 2VP4A 4NL4H 1X8JA 2XTMA 2IWRA 1U2RA 1R2QA 2JJ2A 3VR3A 5JCPA 3K1JA 4RKEA 1ZNWA 5CB8A 2GTPA 2O0KA 1W0KA 3SNHA 1E2GA 2VSFA 2QBYA 2ATXA 3MUFA 4JL6A 1E2PA 3BAFA 5AUPB 5EE1A 1XP8A 3BOSA 4XJXA 1HT2E 4ZCIA 3VHLB 3QQ5A 3DMNA 2UKDA 3AEZA 3DMDA 4EPRA 3CLVA 3PUXA 1N6RA 1J8YF 1H8HD 2IW3A 4HUQA 5JWRA 3HU3A 2GESA 4I99A 3GLIE 4KO8A 1WCV1 1Z28A 1U81A 4S2EA 3K0AA 5FUYA 3D7MA 4TL6A 4N0EA 4MGKR 4QBGB 1MKYA 3GEEA 2HXYA 4RY2A 1IOZA 5C4GB 3N70A 1OFIA 1A82A 2XNDD 2JLYA 1IY2A 4B35A 3SJZA 2V8OA 1I2DA 4BFUA 1LS6A 2HYDA 4Q47A 1T3LA 3R20A 1LVGA 4B3GA 2ZSFA 5IK2D 1YJ5A 1K5GA 3MFYA 1ZINA 3IIKA 1Q0UA 2ERYA 4US2R 1V5WA 4XTCS 3W3ZB 5JRJA 3NC0C 4U5XA 3HJNA 5DSZA 3WRYC 1UPTA 1IHUA 4B32A 3QKSB 2Q3MA 5KDLA 1SXJE 2ZI4A 1Z6AA 1F6BA 2WWYA 1TADA 4WXRA 4NZYA 2MMCA 2CHQA 2XJ4A 4DLZA 3ICEA 1US8B 1SVIA 1QHHB 1II9A 2GDJA 2CCJA 3EZ2A 1GWNA 3NBYC 4XH9B 1E4VA 4NE2A 3CONA 2ONJA 1KO1A 4LHWA 3RSOA 3WP0A 3KZ1E 4TQ9A 2FF7A 1WB9A 5F98A 2XTNA 1Z22A 3C5CA 4KSBA 5KNCA 3PUZA 4G5QA 1GL9B 2BKEA 3THYA 2ZAOA 4W9MC 4PC3A 5CM8B 3UATA 1TF2A 1Z2AA 3KXLA 3W6PA 1G20E 3KQUA 1VYUA 1OIXA 2HJVA 2ZSDA 4XTRA 3RS0A 3AVUA 2Y8EA 4TLDA 3L43A 2EQBA 4BZPA 3K0FB 3ASZA 1F60A 1N5JA 3BERA 5DI3A 5CDFA 4D2IA 1J99A 4DCUA 3U7HB 3V00A 1VIYA 3BORA 4PC2A 1OXUA 2GEVA 2VP0A 4TL9A 2J7PD 1EGAA 2ODBA 1UAAA 4ARZA 1T6NA 2IT1A 4EPXA 3QBVA 2VA8A 4UKDA 1ESMA 1DVRA 1CS4C 2RHMA 4PZYA 4EAQA 1DAFA 2N1BA 4V03A 4ZCMA 1VG0B 4QL3A 3QBTA 4HLCA 4ZKDA 1P2UA 1E9DA 4EQ6B 4BLSA 4P32A 2REXB 4Y0VA 1N25A 5F9HA 3QOFA 4POAA 5J4KA 4ZIRB 3ZYCA 1ZUIA 1DS6A 1UF9A 2J46A 2FU5C 1DG3A 1KDRA 1PLKA 1JNYA 3T5DA 1FQJA 1T8UA 2YZ2A 4GP6A 1P62B 2RKOA 4A0GA 4TYNA 3AUXA 3TSOA 1XPOA 3PJRA 4AKIA 1WP9A 1SXJB 3AVQA 1DADA 2GNOA 4AG6A 2C98A 5K8LA 4NYMR 5HKKA 3A8TA 4YDHB 2W58A 2VHTA 3CR8A 2YNMA 1IBRA 2WJHA 3MD0A 4MUBA 1P72A 2R8RA 4AYTA 3OAAA 3SFVA 4C0QC 4QFMA 5FPSA 3VR2A 2HF9A 4WZAE 2WKPA 5G3ZA 1F48A 1H65A 2JASA 4AWXA 4N0DA 1TQ6A 4NMMA 1NMYA 1XD8A 4URVR 3WHKA 3J81k 4Q4JB 5TV2A 1D9XA 3DM9B 4GFDA 2FMXA 2ZM5A 3AM1A 3RABA 5HCIA 3U44B 3KDSE 4V0ME 4DB4A 3KUDA 3IEVA 2QNRA 1XEXB 5EP3A 2P67A 4PQYA 1FFHA 3A1VA 3IQWA 2BJWA 3H1TA 1TU3A 3RHFA 3LLUA 1KI8A 5CYOA 3AKEA 4C7OB 1R0WA 4MRRA 1XTSA 3R8FA 2P6NA 4RVCA 5F9FA 1CR4A 4X8LA 1UKYA 2QUZA 4OBEA 1GKIA 4H1UA 3P26A 4YXWA 3NXSA 2GK6A 2QE7A 3L0OA 2BV3A 2J5XA 3LW7A 1EFHA 2R6FA 1OFHA 2J9RA 2YOHA 4CT4B 2UZ3A 1FP6A 1A4RA 3A36A 4BFVA 3CH4B 2G1KA 1G8HA 2A5FA 4FCWA 1P3JA 4OQLA 2OEPA 4ZPXA 2J0QA 4Q4LA 3RRNA 4DLVA 4W5WA 1HV8A 2WWWA 1NN0A 4G0NA 4TWZA 4YONB 3VU9A 1HE1C 3P4YA 2ECKA 2X19A 5B57C 1E2LA 4CEHA 1CJTC 2D06A 2QMUA 3K0CA 1JB1A 8OHMA 3OHMA 1JPNA 2PZFA 3GJ0A 2YWGA 1E79D 4HYYA 4B3DA 2YOFA 1KI7A 3BRWD 3C5HA 1SGWA 2ZYVX 4IEEA 1XPUA 1TTTA 1IXRC 2OCBA 1R0YA 3EWSA 1JJ7A 2F9LA 1GRNA 2QT1A 3B1XA 4I1VA 4URYR 4MH0R 1EX7A 2VIIA 4YQFA 3PCRB 1LNZA 4D26A 2D2FA 2OUKA 5FL3A 4QJ4A 3U3RA 1U94A 4KVGA 3TNFA 3K0AB 1W4AA 2R2AA 4BLPA 5F3WB 2Z43A 4BEJA 1U0HC 3VKHA 1SVOA 4JVLA 4B74A 3GJ5A 3I73A 3BB4A 3IIJA 4CIDA 2BBOA 2GWHA 1WXQA 4FMCF 3DO6A 4LJ6A 1JQJC 3TVTA 3AVOA 1N6LA 1ELOA 5CIQA 3T34A 4MDEA 3ZIAD 5JJLA 1NVUQ 3LWNA 2KI5A 2F3RA 2GBLC 2WIBA 2CE2X 4PSVA 2IX3A 4Z8YA 3E1SA 4OJQA 4Z51A 2GVZC 4O0MA 4X8OA 2JLZA 3TSWA 4U7DA 1MH1A 1ODFA 4FXPA 1A5TA 4PR0A 4HATA 3TQFA 2XXAB 2BKUA 3LH5A 2V7QD 1XCPA 2H8KA 1KI6A 4DIEA 3DEFA 2XX3A 3X1ZA 4M9XA 3LW8A 2JLUA 1U0LA 3FKSD 5EUQB 2ZPTX 3QJYA 4LHXA 1TF7A 3SBEA 2N42A 4B6FA 3R9XA 2F43A 1G7SA 3BB3A 3AGPA 3RSLA 2I1QA 4Q1FA 2QI9C 4Q9HA 1TEXA 5JSZA 2WPDA 1R5NA 4I1OA 3B9QA 2P6UA 3WRXC 1L7VC 2VF7A 1KKMA 1J70A 4CT5A 4QKQA 2G83A 3HR7A 3CO5A 2ZJBA 1ZNXA 4AK9A 1OV4A 2C77A 2W2XA 3PUWA 2AK3A 1D2NA 1YU9A 3LV8A 4LZZA 1R4AA 2C96A 2JATA 3NH6A 1CU1A 2FPLA 4Q03A 2NIPA 1NVVQ 2CK3A 3EARA 1KI4A 1J90A 2BC9A 2NMVA 1GITA 1JXMA 1NVWQ 4LJAA 1ZRHA 3LRPA 5EXXA 2JLWA 3CRMA 3NTUA 3RLFA 5JECA 1X1SA 2GXAA 2ZR9A 3AP1A 1S1CA 3ZLJA 3QKRB 5CLLA 2PZEA 5EXTA 3AQ4A 1XCGB 4NCKA 1P4SA 2HF8A 1ZU5A 4CW7A 2C03A 3VFDA 1CXZA 1DOAA 1E1RD 1KO4A 1RFLA 2FSGA 2OFOA 4ON9A 3B5JA 2ZJAA 4DWJA 2W6JD 1K6MA 2PCJA 1U9IC 1NF3A 1U8YA 3W6NA 4M4SA 3KKMA 4JKYA 4JIMA 5FPYA 1YVDA 3BJIC 1S3GA 3Q3JB 4OI4A 1Q57A 3ADDA 3VNVA 1RRGA 4QRHA 1CBUA 1L2TA 3W8NA 4Q21A 5AJWA 3THXA 3GCGA 4KBFA 4TLBA 1PLJA 1G6HA 3IO3A 4P3YA 1UEIA 4B47A 4ASUA 1KIMA 2ZSEA 1GKYA 4PZZA 4DDVA 2OILA 4H9GA 1KY3A 4RSGA 2EFDB 4UNQA 2F9MA 1G7RA 4IVPA 4PAOA 2HLDD 3D6TB 1WBBA 3QKUA 3UXMA 2IYLD 1AKEA 1NP6A 2QTHA 2WOOA 4NH0A 2O0HA 3ZJYA 4AI6A 3N5CA 2ZR0A 1W7AA 1Z83A 1JEEA 1W2HA 5JFGA 1G6OA 2QAGC 3FMPB 3NBFA 3PITA 1D2MA 5DN6A 5AUQA 3ZZ0A 1VMAA 1NN1A 4JS0A 1WMSA 1ZUNB 1S0UA 2F7SA 3LAWA 1XEWY 4YC7A 3UK6A 2JDID 1JECA 5JEEA 2OV2A 2GILA 3DKPA 4AIIA 4C0LA 4LJ7A 2DPXA 5EP1A 2XOKA 1OLOA 1OHHD 5JMTA 4M2LA 2C9YA 1VKJA 5SZIA 1SQ5A 4NCIA 3SS8A 3W8RA 2ZE5A 4B76A 1R10A 2IYTA 4FI3C 3AF1A 1G7TA 3I5YA 3CZQA 3TRFA 1T91A 2R62A 2BIFA 4V0LA 4M1MA 1HEIA 1GSIA 1TU4A 1MR3F 1G3MA 2DHRA 3LX8A 1Q21A 4X8HA 3QPVA 3AVVA 1IM2A 4FWIB 3AKDA 1CR2A 1AS2A 2EFEB 5FFMA 3OEED 3IILA 3KUCA 5HE9A 4OKSA 3X1XA 4PQRA 2GKSA 3B6EA 5DHAA 2Q0HA 1VYVA 2WSSD 4HB2A 1AQUA 1Z6TA 4A8JB 4B43A 2OFXA 4BFWA 2BJVA 2EFGA 1US8A 3UG7A 1MRNA 5IHPA 1RKBA 1TUEA 5G41A 2ZE7A 1JAHA 1NN3A 2IF0A 1YQTA 1AZSC 1QHHA 1ZMXA 2YOGA 4B44A 5JWOA 4LY6A 1EFRD 3IUYA 1VYTA 5G53C 3CPJB 3CNNA 3T5GA 1G8GA 2FDCA 3UANA 4BWYA 1E2NA 1NRJB 1W48A 2JJ2D 2ZJZA 2H18A 4ILEA 4OHXA 4DDUA 4CEHB 1ZNYA 4DLTA 4P4UA 4BRWA 1W0KD 1Z0DA 4JBYA 1CJVC 4JBWA 2VRWA 1QHSA 1ZD9A 3AVWA 1MABA 5EXSA 2A7QA 4KODA 1E0KA 1ZUHA 1E9SA 2WOJA 3RS5A 2ANCA 3R9WA 4HEJA 3X2SA 1YR6A 3A1SA 5EP4A 1ZC3A 2PJZA 1QHNA 2JA1A 4XVRA 3ADBA 4M1KA 2WWXA 5L3SB 1GDDA 4NYIR 3ZVMA 1XJQA 5E4FA 2R6GA 4EJSA 5HR5A 2G88A 5JLJA 5JS7A 4JYCA 4E22A 1HE8B 1JPJA 2BDTA 2DCUA 5SZHB 3U3KA 1R8QA 3MWKA 4JLKA 2MMGA 3F5FA 5KDDA 4QHTA 1ZBDA 3C15C 1AQYA 2ZQ5A 5DYGA 4EQ6A 1W46A 2QY9A 3KJHA 1P6XA 3W9YA 1GOTA 1NJGA 3U3MA 4JLNA 1VTKA 4IDNA 4EPTA 5LPNA 1KDTA 3DL0A 4CGZA 3TVDA 2H1LA 2VYFA 4ZIRA 4JYBA 5EJEA 3NKVA 2XZLA 4K81B 3LVQE 4HLQB 4A6XA 4BRUA 5B58C 2R9VA 4P0TA 3KL4A 3FOZA 3AVPA 3IHLA 2WAYA 1VG8A 1RW4A 1TNDA 1SKYE 1ZCBA 2ZANA 1A7JA 1S9DA 1SXJA 2W6IA 4JLVA 3W34A 4LPSA 5TXGA 1NL3A 3RVBA 3C41J 1BH2A 1KI6B 4GZLA 1E2DA 2QPOA 1UADA 1RIFA 1CJKC 4NCHA 3H86A 1LFDB 2GCOA 2FGKA 5TDHA 2ZVPX 4MYHA 2ZS9A 4WVFA 4B3BA 1VCNA 5FL7A 1TL7C 2I1VB 3ZVRA 1KSJA 3HWSA 5CIWA 2FN4A 4C0AC 5JSZB 2P2LA 1XTQA 1CJUC 1QF9A 1T3HA 2KBEA 4PPQA 2XITA 4JSTA 4U02A 4D81A 4Q4JA 1XPRA 4IEIA 1R0XA 4AG5A 4QNMA 2VF8A 2YHSA 3EG5A 1M74A 4MRPA 5CM9C 4JLBA 1XD2B 4Q1CA 5DNYB 3U44A 1PV4A 3QI2A 2CLSA 4HAZA 3SYLA 2QENA 2AKAB 1N5LA 1XWIA 1I2MA 2ZRCA 2YVUA 1XEXA 4URWR 4R9UC 4URZR 4YDSA 1OFTA 1Z07A 3KFXA 4QJ5A 1EWQA 3HDTA 4N3NA 3UPUA 3CWQA 5DGXA 1UDWA 1G8FA 3I5XA 2CL7X 2CJWB 3Q9LA 4TT3A 4WAUA 5EE0A 3CUEF 2I3BA 4PC6A 4A82A 1XX6A 2WIAA 4ESHA 3HPQA 4JVNA 1P9RA 4CEIA 5IRCD 3OEHA 1SHKA 2QTVB 1LV7A 4LSGA 5LD2B 2IC5A 2VP9A 3ND9A 4ACBA 3WHLA 5JS8A 1LB1B 3D3QA 3TLXA 3Q7QA 3BK7A 1E9FA 1I4TD 1D2EA 1RJ9A 1WF3A 1II8B 4BASA 2YWHA 2BBTA 5DLQC 1FNNA 3LD9A 4W5HA 3CRQA 1XMSA 1VECA 2JLVA 2D2EA 1PLLA 4KYIB 3U7FB 1T9HA 3ZS9A 2CHVA 2O8BA 1DAKA 2QQEA 4LPKA 1KYIA 3SU8A 3EC2A 3CZPA 3IGFA 2Q9CA 2ZUBA 3B9PA 1ZU4A 3PUVA 5DH9A 4TMVA 3TH5A 4ZV4A 4AY2A 4Y0AA 2YWEA 3KFVA 5HKKD 2AD5A 4PHHA 4KFTA 4P4SA 3RRZA 4DB2A 1Q1EA 3SYNA 2EYUA 3OAAD 1W44A 1QZXA 1OSNA 2QP9X 4BLTA 2ZI9A 1LY1A 1CKEA 1ZM3A 5EE9A 4LYJA 3KXIA 3B78A 2A78A 1OH8A 3LNCA 3EWAA 1GIAA 4M9QA 1MRSA 3EA0A 3SQXA 3CM0A 3MWLA 4DRZA 1GM5A 3IBYA 4QG7A 1P9WA 1FTSA 4GBMA 4TLEA 3WMGA 2B8TA 2GCNA 4V0MA 1KTVA 3KQLA 1DPFA 2CHGA 5E7JA 4DVGA 1KI1A 4C30A 1ZYUA 1T4GA 5AUNB 4UXIA 5DI9A 1Z0JA 4LC1A 2PEZA 4WOPA 4LCBA 1RZ3A 4CF7A 1XB2A 4LRWA 5SZJA 5ELXA 2ZRKA 2WKRA 2OHFA 4F38A 2DY1A 1CR0A 1OJLA 2GVDC 4IOJA 4BEBA 5TARA 1G7CA 1AZTA 3AUYA 1XMIA 2QE7D 3MMPA 5DE3A 2ORWA 5L3QB 4ESVA 2QSZA 2FG5A 2IYSA 3QUSA 4Q1BA 4UJ3A 3GD7A 4A1FA 2XXAA 1GZSA 5LB2A 4A36A 2VSXA 3DZDA 3CKLA 1NMXA 4Q19A 4EIWA 4OI1A 2FEOA 4LBZA 3DOEA 5TVKA 1G8YA 3G5UA 3LX5A 2P5TB 2FEMA 3CH5A 1DG1G 4C0JA 4CEJA 5GADl 1ZM4A 4M0LA 5GJCA 3EIEA 2ZI7A 5EE5B 4LBVA 2GCPA 4KXFB 4A0HA 3G82C 1KK2A 2FNAA 4JLAA 4ACAA 2OLJA 2J45A 4O25A 2J0UB 2BM1A 4C2UA 4I4LA 3RC3A 2B92A 1FZQA 4HDOB 4Q7JB 3AF4A 1F5NA 3PG5A 3PVSA 1N0UA 2FV8A 3UWOA 5JJKA 2Z5FA 5J5CA 3VNUA 4JLMA 1MABB 4RZXA 2GETA 2XB4A 3LXXA 3GJ3A 4OHYA 1BS1A 2FPKA 1AGPA 1S2MA 2O8DA 2XZPA 2O8FA 1AA9A 1GL7A 4IXMA 3GLGE 3FWYA 4KCGA 4E5UA 2JLXA 5FBLB 2CCKA 2P5SA 4PPFA 2E1RA 1UJ2A 2XNSA 3GLIB 1XEWX 2ZUDA 3QKRA 4C0KA 4M8NE 2Q9BA 1FL9A 2ORIA 4A4DA 4BFTA 4EJSB 2EFCB 5FR1A 1CEEA 3VR6A 4TYQA 1N0VC 5D3MB 3TE6A 1U99A 3AP2A 3U6KA 2OLKA 4JVMA 2XSZA 2YJTD 3WXMA 2ATVA 3LO5A 3Q8XB 3PUYA 1LW7A 2CE7A 1S1MA 2QRZA 4RD6A 1ZIOA 2HT1A 3A58B 1TMKA 3DZ8A 1TQ4A 4PO8A 3SJCA 5FTLA 1W4RA 2RMKA 1E6CA 5TB5A 3RNLA 3WBJA 2IF2A 4CDGA 1VHTA 3K0CC 2J59A 2IYYA 3CX7A 1XF9A 3ZH9B 3V4RA 4C3ZA 3HR8A 4LOAA 2JJ8A 4D82A 3THWA 3FHTA 3CX8A 3QKTA 2FX3A 4JT4A 2XZOA 4E09A 3P1JA 2O8EB 1NLZA 1U0JA 5JRZA 3NG1A 3D8BA 3QXHA 3FGNA 1UFQA 2ZETA 4LC0A 4NU0A 2WSMA 1FMLA 2EW1A 3QXJA 2HXSA 4R2HA 4DSTA 1F2UB 2DR3A 2PCLA 2ZE6A 4HDQB 4YMWA 5B2ZA 1KO5A 2W2VA 1SULA 2GCOB 2XTZA 1OPXA 1P61B 1VCOA 2ZRDA 2WPDD 2CL0X 2NO1A 2ZROA 3BWDD 4F92B 3IQXA 3MJRA 2IEZA 3T15A 1IN8A 2JIZD 1D5CA 3ADKA 1L4YA 5FBWB 2OE2A 4A9AA 3SHFA 3TK1A 4P31A 1NG1A 2ZU0C 3B7GA 1VG9B 4OHZA 4MGZR 2H17A 3E5HA 2CK3D 2CDNA 1G21E 3MLEA 1Y3AA 4EUNA 4FIDA 1MV5A 2RGCA 3IO5A 3KJEA 5KPDA 2CNWA 4D0GA 3U2QA 3K8YA 1P2VA 5H1YA 1K5DA 1Q3HA 2XB2A 2BEKA 1G5TA 1Q1BA 4PQFA 2V3CC 1EWRA 4ZCLA 1OT3A 3TJZA 3QPWA 1KNXA 3QY0A 3NDBB 1R5BA 3SBDA 1DBSA 5EZ5A 4UXHA 4CEIB 3GJ6A 3DDCA 5CITA 3WNCA 5DYIA 4DEXA 4CRWB 4KVAA 3PXGA 3S1AB 3VR1A 2WWGA 1ETUA 4TSFA 3SOPA 1KI9A 2H57A 1QVRA 4QBHA 1YZGA 4RZUA 4DLWA 3PEWA 1RJ9B 4B3CA 3RS2A 2R65A 2WJVA 4J0QA 3IIMA 3TR5A 4TLCA 1DEKA 4A8JA 3AP3A 4HAXA 2E9SA 2QT0A 3VAAA 2FH5B 4HAUA 1HY3A 1Z0AA 2PMDA 2NO9A 2DWQA 4ASUD 2CBZA 1E1QA 2O8BB 2OAQ1 4LYAA 1W2GA 3EPJA 4C0BA 1OXVA 2EVWX 4AD8A 4P4SB 2P6RA 1PJRA 2CLCX 3CW2A 3M6AA 1FUKA 4L15A 4NYJQ 3FTQA 1JQLB 2SHKA 3FFAA 4Q66C 4JLDA 1DAEA 4OJKA 4HAYA 2IUTA 1G19A 2D7CA 3VMFA 5EUMA 1QBKC 1S8FA 4JZKA 4LHYA 2GJ9A 5FBRB 1Y63A 1M6NA 4EPYA 5FOSA 5DN6D 3SN6A 2I4IA 2QG6A 4IOLA 2GXUA 1QG4A 4PXAA 3CPHA 2QP4A 3KB2A 1FNMA
chains in the Genus database with same CATH superfamily
1SVWA 4MGEA 3HYLA 1J2JA 5L3SA 4BFZA 5DISB 5LVAA 4I8XA 1P2FA 3W6OA 1JX6A 1W0JA 3EY9A 3QA9A 1BX0A 3RT9A 4XSHA 1WABA 1LBQA 2PU7A 2WIKA 4L5CA 4M9ZA 1RPZA 1NRXA 4YGXB 1IZ7A 1VJ1A 4CMCA 2YQ4A 3UY4A 2V3WA 4J0GA 4LE1A 3CVWA 1G2QA 1PZMA 3TOXA 4F93B 1J2RA 1OWNA 2OCKA 1M0SA 1GL3A 1ADYA 1QK5A 2VO1A 2GH1A 1H8EA 3PVZA 3M1YA 2V8BA 5CPFA 2ZSAA 1GPDG 3AUUA 1GAWA 5FPQA 2EWVA 2ZI5A 4QJ3A 3QEJA 2NZ2A 5ES3A 1H4QA 4YI5A 3ETEA 4H7IA 2H7XA 5DBHX 4OLAA 1THTA 3LPNA 421PA 1EJ6A 5BW8A 3H4TA 2AFIE 4IJQA 1FPQA 1GNPA 3C8HA 3LBNA 1XAJA 2ZJFA 4R40A 4F3KA 1QHFA 3UGKA 3BGVA 1OYWA 4DMHA 4UNRA 2CC2A 1QC5B 3EVNA 3T5MA 2B61A 3N2NA 4IVRA 5DRTA 5AM0A 5KQGA 2I78A 3ETCA 2AG0A 4Z4HA 1YH3A 3O8QA 4IRUB 3IURA 1YZYA 2PMEA 4EY6A 3QJGA 4LQDA 5I9NA 1N6IA 1HYEA 4WBNF 2VDLB 4EUEA 4R9VA 5ARBA 1V3TA 3AF3A 1CC1S 4B3XA 3MIZA 1Q83A 3BE8A 4CEJB 4KPEC 1DKRA 4NR0A 4WNYA 3UAZA 1I6KA 3H2KA 2ISQA 1FDOA 2MINB 3HYTA 4F6RB 1E96A 4IGKA 4YIKA 3HA5A 5JFTA 3RVNA 3A7DA 3DCYA 4ZVSA 5JMPA 1JMKC 3WGGA 4ZI3A 1RLOA 2X77A 1KU0A 3CUTA 1LX7A 4B75A 2OL4A 4I4IA 4KQ6A 4OK5A 4UHDA 3UWKA 4TN1A 1ZW6A 3UH0A 3U4CA 1YL6A 1WLSA 3E9CA 4KIWA 4QOIA 3DJYA 3DVAB 4J16A 5DHTA 5FULA 5PNTA 4H77A 2A33A 4KQXA 3ADOA 3DLCA 1Z38A 4LBWA 3O8OA 1JAXA 1LF5A 1QHIA 2XUOA 2FQWA 2G08A 3OZXA 4M89A 4WJZA 2ZW9A 4PC1A 2IXGA 3O92A 3K92A 5EYPB 1Y9DA 4EHBA 5KUTA 2ZYGA 3CNLA 3IQEA 1HE4A 3GBVA 4QT0A 1PR6A 4BNFA 1E6KA 3E84A 2KM1A 3QTBA 2OQ2A 1WNFA 1MOPA 4YDQA 3R41A 4CDNA 1OI3A 3DA8A 1L5RA 3IJEB 4MW2A 4NC9A 1KC1A 1B41A 3IIEA 1IN5A 1YJ8A 5BN3B 4WKNA 1VHLA 5FTMA 2ZSBA 1Y3DE 1GCAA 4R2IA 4Z1MA 4GOLD 4C1NA 2QG9A 1TIKA 1AY0A 2GK3A 2PKCA 2DF8A 3EGXB 4K6FA 5ADWA 5J4VA 1FW6A 1KXZA 1E66A 2QXUA 3SLGA 2Z1MA 3I04M 1L0BA 4A2CA 3HJFA 1AKMA 4D96A 1D09A 1E6LA 4HEQA 4CYMA 4LX0A 1JQ3A 1Q91A 3HXKA 3KJIA 4NJOA 2FW6A 3TRHA 2W22A 5L53A 1ZJWA 5J5VA 3GJQA 5I51A 4EG6A 1YDGA 4FYVA 4DA6A 4JEHA 2O19A 5EZYF 3T3NA 1UZLA 2HBZA 3PCTA 2W6ID 2C5EA 3BMCA 1J33A 2L42A 3ROQA 4D80A 2C31A 3SSOA 5KOJB 4I1UA 3THWB 4I55A 2WHPA 2FOXA 3HI6A 1NY5A 2WDZA 1D7AA 1C3OB 3DMRA 3ZWPA 3FB4A 5AK0A 4EZBA 2JIMA 5FI1B 5ITVA 1X13A 5JFOA 2R8BA 3HGMA 3WLLA 1S2DA 4EEXA 3TDNA 2VJOA 3AIIA 3NONA 4QASA 3QU7A 3RJZA 4UM5A 1DUVG 4OF4A 3D3JA 2DHCA 4FOLA 2VJYA 5AVYA 1JZSA 4WQMA 1H2HA 4LVUA 3SQMA 3KT6A 1A4IA 4EB6B 3TZKA 1LC3A 1ESNA 2GA8A 1TTHA 3FUTA 1EMDA 1P1CA 4DM3A 3BHNA 4IVQA 3F96A 5I3ZA 2JJYA 4KR6A 1BQ3A 2VDQB 3TIXB 5LJLA 4P8RA 4OLFA 2HI0A 3C7DB 3L8ZA 3NHJA 2APJA 2JHFA 2BZGA 4JP8A 5JARA 8AT1A 1T9CA 2TMYA 4OXNA 3BGOS 3OKAA 3A1TA 3U61B 3N59A 1NJFA 3O7MA 3MJ4A 3BSWA 4KSYA 5J2UB 2OGZA 2QN9A 3EISA 3F1LA 1JHXA 5TY0A 4J2TA 4QD3A 5EN4A 3D7KA 3C6MA 3GR6A 3VAZA 2MYUA 2C04A 2FUNB 2WUEA 2HUPA 3I8OA 4LWOA 3QVKA 4X60A 4BO5A 3IRVA 1RM3A 2BDEA 1IZ9A 2P9HA 4X1IA 1ZXLA 2FRDC 3OOJA 3JD1A 4R7ZA 1VL8A 1T24A 1XLUA 2I4RA 1GRQA 1O1YA 2FR8A 4PYJA 2W4IA 2Y67A 4GRIA 5IEBA 4B46A 3NO4A 4FC7A 2RGYA 3TZLA 3H83A 1OX6A 3OEHD 1VLJA 4IFEA 2ZSHA 3LYAA 3OCUA 5E9QA 4PG8A 5K8UA 4O1HA 2P9CA 5A5GA 4HX5A 1OVMA 4C3OB 4WLOA 2D8MA 2WTEA 3BXGA 4D02A 1OIWA 3TBKA 1MGPA 1XBTA 3PF9A 3GLFE 4ZQCB 3E27A 4EF4A 3HNPA 5JWHA 1SCBA 5KTYA 4K0RA 5E1MA 3Q87B 1PJTA 4E31A 1JR3A 2X14A 2PX0A 5TGZA 3HABA 4O2RA 1WSBA 5CU7A 1DIOB 4RHTA 5LMNB 3FOWA 4FIZA 4K8OA 4WPGA 1MIOA 3V8QA 4DJJA 1NBIA 2BISA 2PEYA 1I3LA 4UE3S 1GN9A 4N6NA 1GN8A 1L7PA 3TTXA 3W06A 1G98A 1DJPA 3F78A 3Q6MA 3OCCA 2PV0A 4OKNA 4Z0PA 1UM8A 4M1YA 1ODJA 1CB0A 4W9NC 1MEJA 4OGKA 3M2TA 2YZ7A 5K8JB 2WU8A 2Y05A 1XQVA 1X6VA 4O2BB 4B4WA 3M1LA 1Z4IA 4I81A 1UMDA 2FWNA 3B70A 3KEGA 4KLRA 4ZXPA 4V1CA 1Y9ZA 1LDEA 4DY4A 3K9LA 2DECA 2RB4A 5IJ0A 5CFQA 2NU9A 3VNSA 1NW4A 1G60A 1OF1A 5SY9A 3RRYA 3TKLA 5AKHA 2EC5A 2YRXA 2VBCA 1I7PA 1EP1B 1E4YA 3F5DA 3TEMA 2GZSA 1V48A 1HOTA 3HBNA 3U0BA 4D9CA 2R0QC 3LUBA 3UHJA 2P69A 2BGKA 3ZCPA 1JILA 1OBCA 5JPDA 5NLLA 3GLIA 2X41A 1ES9A 1WCIA 3MXTA 2JAQA 1F8UA 3DAGA 5FTKA 4ECEA 3OQ6A 2FQ1A 2QZPA 2XCOA 3CZCA 4W7HA 1C2YA 1JR4A 3GRFA 4O08A 3GH3A 1GTJ1 3BH0A 3EASA 5D3MA 3PC8A 1RXYA 5B1IA 2G7MC 2FKAA 5EKSA 4G07A 3AVXA 3QF7A 1GNRA 4Q24A 5NULA 3U1BA 3BQNB 2EHJA 1NOKA 4IMIB 1DINA 3SVLA 1C0KA 3ND8A 3ROXA 1CUSA 1ZM9A 2J08A 2OWEA 3AOEC 3EYAA 2B82A 3QHAA 4K9NA 2WTUA 3A05A 1JBKA 4ZU6X 1PVOA 1SN7A 5ITSA 1U28A 5AKIA 2X76A 1TCBA 3KPVA 4EG7A 4DIMA 5J4LA 5JI3E 2WYWA 3V1LA 1UBEA 3O8BA 1GCIA 2JAPA 2H1FA 3DE6X 1H2BA 1PK7A 1OXTA 1YBFA 4U9UA 5EZ6B 3RRMA 4XB6B 3EGDA 2NV2B 3EZFA 3QW4B 3IJPA 2B8EA 4TLLB 1U6KA 4K46A 3SJ7A 4F4JA 4LF6B 5AUOB 3RFUA 1F8YA 2HBRA 5HQ3B 2XMPA 3R44A 2R3SA 1FFEA 2QV7A 1GQ2A 4MRSA 4MINA 3K6KA 2FSSA 4WKBA 1K4MA 1YZFA 3BD6A 2WQ6A 3D81A 1ZMOA 3NM6B 2C4TA 1NIJA 1NQ5A 4XWTA 3OPMA 2R4QA 4WH0A 4H4EA 3AILA 4H08A 3WB9A 1CUVA 2MU1A 1YRYE 2BY4A 3IR6A 3GGGA 4U8GA 1N9ZA 3UCEA 2X7JA 1E92A 1JLLB 1UEJA 3TAHA 1ORRA 4HDRB 3CVXA 3I61A 5B1DA 2OKGA 1NUTA 1ZH4A 3RRBA 4RO0A 5BQ3A 4GR5A 1P77A 2PWYA 3QWFA 5GZ3A 3TNLA 1C7QA 3FVRA 3U4QA 2FZGA 1LVHA 3D6NB 4MW7A 4N49A 4I55F 4AO8A 3L4BA 1SHZA 3FZYA 2WBLC 2IU0A 3PQ2A 5AWFC 1BXGB 3GLGA 1YGPA 5K5EA 3QITA 1AK2A 3C7AA 4BP1A 4MVJH 1G41A 2G9QA 3RARA 4C0HA 5KTNA 2AI2A 3EUAA 1G4HA 2CLOB 2QIOA 4C05A 2JCSA 1H93A 2V65A 3CX3A 2GBFA 3ZC3A 3ZQ4A 2EERA 2HJGA 4GRAA 2PYZA 4ILKA 4GSYA 2HMVA 4Q0MA 1MJGM 3GP5A 3ZJVA 4BAUA 2J9FA 1C4OA 2H2HA 2ZBFA 1XTPA 3QH4A 5FYQA 1ETHA 1YQXA 4A7PA 4S1VA 3AU8A 2NYAA 4C4PA 1THMA 2VAVA 2FSPA 5C7YA 1E2FA 4XIFA 4X00A 2UYHA 1VDMA 1VKZA 1T34A 4V3CA 2WF7A 1FVHA 2ZTMA 5ICMA 2B83A 3IQIX 1V43A 4OK6A 4TL8A 2IL1A 3B3JA 5BSVA 2ZR8A 3EF3A 1ATZA 1XK7A 5FADA 4CVNA 3QFSA 2Q3CA 5LYYA 4YHBA 2WNIA 2DT5A 1O0BA 3HU1A 4PVDA 1SVKA 2ZRJA 4W6QA 3MD9A 3B1VA 1TOAA 4N9QA 3U49A 1NW5A 1QS0B 4HGPA 3AJAA 2CCGA 4GOXA 4ZT3A 3DYBA 4BV3A 1SCNE 4NV1A 4JSYA 4X7RA 1GAXA 1XRJA 2CUTA 1N2ZA 1FUUA 1UC5B 2IYWA 2ZBGA 2ZYTX 1DZIA 1Q1AA 1A5ZA 2FW0A 1T6ZA 2QUKA 4E88A 4QQNA 5HCUA 1XRMA 4F1KA 4IDAA 3VQTA 1VZ2A 3JWIA 3D4NA 4PYIA 2GZDA 5BN4A 4Z0TA 3ZWQA 1L1QA 3UTCA 2IZZA 1QE5A 3ABIA 2IA5A 3CVVA 3UMYA 1U2GA 1BE0A 4X20B 4WZAA 5IBCA 1CVLA 3CSSA 1SIOA 5P8WA 4GOKA 1ACJA 3O83A 2CXTA 2FXVA 1V96A 2VYNA 1FYXA 5HA5A 1RM5A 4ZDWA 3VX4A 4BZXA 4DEYA 7MDHA 2X0KA 3DOOA 3ZZTA 3BRQA 1QE0A 3DUWA 4MEJA 1NVBA 5E95A 2OQVA 1ZGHA 2D2VA 3HEMA 3E03A 3JZDA 2ZSUA 4M49A 3V8VA 2XQKA 3R24A 2IHTA 3DF7A 1H5QA 1A8QA 3GGJA 2G9UA 4A0SA 1T9GS 1W1IA 1J8VA 1E69A 4RF2A 3UC5A 1N6HA 1T8YA 1MB0A 2AUTA 2GJKA 3OTHA 2IEDA 2ACEA 1WPQA 4HT3B 4JOCA 5BPHA 3HZOA 1EDBA 2DZDA 3N2YA 3DYIA 5HF9A 4DT1A 4D98A 4KPFC 1QIFA 3LE8A 1CD5A 1G4UR 3SI7A 3FETA 1BGXT 2HCBA 2WIJA 2YZNA 3PXXA 2FZ4A 3V2IA 4CMEA 4JC4A 1EGQA 3ZHZA 3D6HA 4TSFD 4DIDA 4FYKA 2HA0A 1CTQA 2GR9A 1I2BA 4L8YA 3FPAA 1RACA 1KR5A 3C4QA 2VUUA 1YI0A 3OMLA 2OAGA 3PV0A 3BT7A 3HO1A 1FXWA 3CT6A 5FX2A 1I5RA 2XIJA 3LBHA 3WBKA 1W4BA 3W6UA 5K8TA 2EFHB 3NOQA 3RW9A 1J39A 2HRBA 1LEHA 4MQFA 2C07A 2B99A 2VDVE 2W8ZA 4AJOA 2F1IA 4LV6A 4HADA 1DHRA 4JZYA 4UBMA 2GZRA 4JP1A 1QV6A 2GX6A 3V42A 3IPYA 1NJ8A 5IHXA 5HKBA 1LNSA 2LDXA 3KQNA 3QIAA 4EF5A 4AC9A 3KBOA 1P74A 3FVTA 3N1UA 4O02B 1SFRA 4HTFB 4NSNA 2O5EA 4KI0A 3HJUA 3LSYA 3OU6A 2AJTA 4UM8B 1QV7A 3WB1A 1G5QA 4U4AA 3ESBA 4KDFA 1EWVA 5IWAB 3QNMA 5CBKA 4KITB 2DR2A 2K2QB 2C58A 5E6SB 4PAQA 4GYKA 2J48A 3KIPA 2YV3A 4ZCPA 1JXOA 1CS0A 5E2BA 4Q6WA 5I7FA 2NPIA 1DBVO 4DUGA 3W4KA 2CV1A 3ZE8A 2ZCVA 1BOFA 5I45A 3DVLA 1FYFA 3A9WA 2C2XA 2BMDA 3MMXA 3N5KA 1NUQA 4I9FA 4R31A 3S2YA 4DE5A 3GOQA 2O2YA 2XY4A 4F2DA 3PPWA 5JMWA 4ARIA 4UM9D 5L3VA 3LPDA 3LT0A 4GYYA 4UE6A 5LDDC 3QRWA 4DL9A 3BL8A 4W5NA 1BMFA 2COEA 5F12A 3I2GA 5C8VA 3EGWA 3TLYA 1ITZA 3JQBA 1JIUA 5SV2A 2X1MA 1GEGA 4L85A 4A8JC 1O94A 5H59A 1MP0A 1HC7A 5E4TA 3ZE7A 4ZYZA 2W00A 4N4AA 3V1MA 3ZE6A 3CUYA 3H5IA 4CLEA 5C7IO 3F7NA 1TTPB 2C2YA 2H8GA 5EJIA 1IEXA 5KNLA 4WL0A 1GCGA 2XE4A 5WRFA 1FYEA 5LC1A 1E2JA 2J67A 3ENKA 1XDDA 1X14A 3G68A 5A4FS 1PFUA 2JB9A 4FCCA 3AM3A 1GTSA 2P78A 1JSRA 4DA0A 2CHUA 2GYUA 3H11B 4E2XA 4FSDA 2F8TA 2ZAMA 4GNKA 4IHJF 3WWCA 3TR0A 2ZJ6A 1UPUA 1HZZC 3QKIA 5E6UA 4AY5A 4F11A 3VJRA 3ISTA 2ANBA 3WGYA 2WYVA 3MELA 1ABEA 1UXOA 1FDTA 1PWZA 3FHOA 3K32A 5CURA 5DMHA 2AWNA 3UJHA 3VOAA 4POOA 5EIFA 3G5TA 4H7KA 2H4ZA 1Q19A 3NTLA 4ZT7A 4GLBA 1J49A 3FTNA 2BFFB 4FEYA 4HAWA 5A2QA 4JT9A 1U1CA 2R6HA 4ZMBA 1JAZA 1ZK1A 2C9BA 4J4BA 4N3AA 4CKZA 2JJ1D 3C6ZA 2AZXA 3KJNA 1RE0A 4Q1AA 5FUVA 3DDNA 1GZUA 3F7MA 3M5WA 3NOXA 4YRIA 1IE3A 4R05A 1EDEA 1N6OA 4PNHA 3TECE 4WZBB 2NZUG 3ZGYA 1I4LD 3G8DA 5KQRA 3A70A 2BUBA 4NS1A 1USIA 2UZ1A 4CKEA 1T3ZA 5IVPA 4HMQA 2NZJA 2ZJYA 1O6GA 2PL3A 4RXMA 3TNDA 4CLRA 3HL0A 4K9LA 4B7AA 3KLPX 1G291 1N2IA 3GCZA 3LT2A 4MUKA 1VE3A 4R2JA 3TIVA 3P0IA 5IJWA 3I8SA 2F9FA 2HMWA 3QV2A 4EGFA 2ZBRA 4YMVA 3URKA 4R0NA 4YWHA 5BYKA 2FEPA 1U3FA 5K1ZA 2GAAA 4B7ZA 2BMFA 1L7NA 3ECSA 3KOWA 1KAMA 1UFKA 3O2QB 3VXKA 4M6WB 4F7WA 5JAQA 5F2EA 1JTFA 4RAOA 2HPZA 521PA 3WGVA 3SXJA 3GT7A 5DSXA 1IUNA 4WOBA 4ETNA 4JBNA 5LZ5A 2O54A 1U7ZA 1KPIA 3HRHA 3PA6A 4UE2A 5EMHA 3H5NA 4DJTA 4URXR 4O3MA 4MLDA 2DRIA 2HHLA 3NTOA 5J4YA 1Z5OA 1KPHA 1Z3CA 1H8HA 3LOUA 4M1QA 1IIRA 5AT1A 1Z06A 1CHDA 3N3AC 3QE0A 3ZD9A 2G67A 1ZGAA 4YT8A 1CY2A 2ZXFA 2EX0A 3I9JA 5SZKB 4MYTA 3KKLA 4JB3A 3W05A 4RK6A 1XZPA 4PFQA 4Q9NA 1XCOA 3N8KA 4QFCA 4DR2B 1U3TA 4G5SA 2M32A 1M1YA 2QN6A 1WBJB 3SEQA 1FYVA 2CVQA 3CF2A 3RSCA 2DJIA 2YJGA 4MV1A 3E1GA 3WK7A 1ZVMA 5BN5B 2J0SA 3I62A 3RUFA 5IN5A 3WIVA 1ZOIA 5ENVA 1P4HA 3HB9A 4KG7A 3DV0B 3CF0A 5EJAA 1ZN9A 3L4JA 5COQA 3D64A 2FA9A 4UUNA 1J5PA 1DC5A 1Z26A 3CKMA 4UPVA 1NZFA 3DBLA 4Y18A 3VGJA 4UASA 4CM6A 3K71B 4NIMA 3DGEC 5EZQA 1KZ7B 2JFBA 2LKCA 3D54D 3MRXA 3FPJA 4BUJA 2IGBA 1TYEB 3FBTA 1E0DA 2Q5OA 3QXSA 4BDSA 4ENTA 3CBQA 1USKA 2AFVA 3JWPA 1NZJA 1FXWF 5H8WA 1R12A 3V97A 4K9RA 1J2EA 1N57A 1DX6A 1OLSB 1YZNA 4G2NA 1E32A 3JTMA 4QU5A 4BZQA 5A1JA 3H2GA 4J9VA 3H6HA 1FU4A 2BWJA 3KQOA 4Z8XA 4Y6PA 2B4KA 5IXJA 4BXOB 1KO8A 4UHKA 2LBPA 5DLEA 1T5SA 3R7WB 2B9EA 2RKBA 4RK1A 1L4FA 2VLIA 1OUMA 3BXZA 4MCJA 1OJ7A 4CV3A 2Q1UA 4DBZA 2L82A 1BRMA 3R40A 1KVTA 3TNYA 2XWQA 3EEIA 3GJ7A 3SE0A 1COZA 2H5LA 2I7CA 2R44A 2CB9A 5GPBA 1B74A 2PWBA 4MVYA 2RHRA 2O8CA 1K7CA 1N2GA 2J31A 2I1LA 4L9AA 5JBNA 4FM9A 2XGJA 1DZ3A 2QBYB 3IAHA 3TR6A 3OZVA 4AY6A 4XIJA 2AWOA 4RZ2A 3KE9A 2WJPA 5CA1A 5A2GA 2PFGA 3OF5A 5A0FA 2PUAA 3PHHA 4GF5A 4FUQA 4E70A 5HRAA 4XA8A 4BGVA 4QEZA 4K8RB 1QFJA 3D8NA 4RETA 3ZE2B 2JI9A 2WB2A 2LD4A 3V9PA 4D97A 2KLHA 3K1AA 4BQOA 1XOIA 4W8HA 2RG1A 1W19A 3GLHA 4MVJD 3U4HA 1OXSC 1XZHA 1XEFA 4IRXA 4Q39A 1GU1A 2JC3A 3KU4A 3TAXA 1UIMA 2Q0XA 1SNYA 4TVBA 2QD1A 1I14A 1WZUA 2P4HX 4P93A 3UAYA 2I33A 2JGDA 1BU5A 1G17A 5CAEA 3MXOA 2Q4EA 4LJ5A 3L79A 2R68A 4OHRA 4XVUA 1DTEA 1YC2A 3H7AA 3KXDA 4Z53A 1SCJA 3GDOA 3PWTA 1YC5A 3EUWA 3UJCA 5LU9A 1E94E 3QX9A 1VBKA 1XTIA 2BGJA 4LOKA 4WCVA 1O58A 2IYFA 1ZK3A 3F5SA 3LUDA 4RF5A 4ZAVA 3ZOKA 3Q7PA 4BNDA 2P9QA 1KAHA 2YWRA 3CO0S 4LVOA 2HJ9A 3A4MA 3TFQA 1KSHA 3DE0X 5H83A 4ZANA 2OD9A 3OJ0A 1KJ9A 4GBED 5C34B 1UJBA 4HXYA 2ZE8A 5DT2A 3R8XA 5F76A 2JBAB 4RLFA 3AT1A 1JTEA 4AJEA 2WAOA 2AX4A 2CFCA 2ZSJA 2JKYA 2LRHA 4DKJA 4LNUA 3KZOA 3RUHA 2H07A 4PZCA 3NYQA 4ZDJA 2A5YB 3HUEA 4GQIA 4OYHA 3L7YA 4KFRA 4JB8A 3SDZA 1OWLA 2WMYA 1Z0IA 3B2EA 1Q95A 3WG9A 3SIXA 2X23A 4RTKA 2CUZA 4KR2A 2A35A 2Z08A 1C29B 2F1JA 5CDGA 1U3CA 1B6SA 2RKWA 2LE0A 4IMRA 2B5WA 3EIQA 2O07A 4IDFA 2O2JA 2XKAA 5LXTA 4TRMA 4ZAFA 2NZYA 2WM8A 4FYMA 2DMRA 2O1XA 3WLKX 2IYVA 5JC8A 4OQ4A 1NXQA 4A6DA 3M89A 4EA9A 2C7BA 1A2BA 2Q1XA 3R6LA 1KE2A 4LJ9A 4XSGA 4FMCB 4XX0B 4UDXX 3A6PC 1JQKA 3ZK8A 1KU6A 2GJ4A 2W2MA 4F2PA 4Q4HA 4QXRA 1FX0A 2QZJA 2QF7A 4JLSA 4KQMA 2DTEA 3II6X 5BRNA 1UBTS 4A2PA 3ILHA 4OQMA 1HFWA 4RZ3A 1V4VA 1T10A 1G3RA 2OCYC 4W8OA 3FWHA 1QXSA 3OTIA 4NCJA 4EECA 5KQSA 3OE7D 2YV5A 1GUDA 4JOBA 4DLSA 4FNAA 1SHJA 5J47A 221PA 5I3CA 1O77A 5TQ0A 4ARZB 3S7ZA 5CRIA 4RIFA 1ZFNA 4U2KA 3KQHA 3FXAA 3VM6A 3NWBA 1JR2A 1RQXA 3OZAA 4G5OA 4MDHA 3UNXA 1QG0A 1NVXQ 4G67A 1QSGA 1QUFA 2O3QA 1RHUA 3M4YA 1N4DA 1Q7EA 3PDWA 4BAGA 3RIEA 1E3MA 2QLFA 1YF3A 3COPA 4M1TA 3OZTA 3P4XA 3U31A 1XXHA 4ND7A 2WQ7A 2CZGA 4DLXA 2Y9PB 4OUDB 2E0IA 4U6SA 3EAGA 3SCZA 1W0CA 4B3FX 5J2TB 5HCNA 1I3OA 3HSYA 2X86A 3F6BX 5I01A 3ELWA 1AD2A 3DMHA 3DBIA 4BV2A 1QGZA 4EGQA 4NEGA 1XJCA 2C20A 2ACKA 4JJKA 4CETA 4RQUA 3C8MA 2VNJA 1SUPA 3K2IA 1VPLA 5FXMA 4IW3B 5CVEA 1NW3A 2IXFA 2R1VA 1PL6A 1KDOA 5ANRB 5FWYB 3HACA 2Z1DA 3WA7A 1OT5A 1RKVA 2I8AA 2G6BA 4F12A 3QUCA 1FF9A 1SUIA 2JLSA 3ZV5A 2G3YA 1G2IA 4K28A 4R7TA 1DWPA 1O2DA 2P27A 2PT5A 3SQLA 3VR5A 4QDOA 5I4IA 4F9EA 1YKSA 5JNTA 2PNJA 2I6QA 4DMFA 4ZMSA 2BVNA 5EVCA 4YMHA 1LA2A 3F6RA 3DZGA 1RJDA 5HM8A 1N7JA 5JEDA 4LMBA 2FOLA 4DILA 5LL6P 1FMTA 4PYNA 5HBGA 2MR6A 2WHXA 4Z3OA 1TZMA 5AK3A 1JHRA 4FT2A 3UEOA 1G59A 1P1BA 2ZYUX 3EW7A 3I6IA 4MGIR 3EVEA 1OGYA 1TLFA 4JGBA 5DDIP 5HUHA 4ZKEA 1S2IA 1DEAA 2QSUA 3LFUA 4IFIA 5FBVB 2A88A 1D4OA 3EBLA 1KDPA 1KRHA 4XZ3A 5F9MA 1SKQA 4RA9A 3VPAA 3ZHXA 4AN1A 5HNKA 2WDPA 1TFRA 4OQXA 4TV9B 4TTPA 1V8DA 1X8LA 2O3SA 4K3UA 4BZZA 3J80A 1Q44A 4DGQA 2CNBA 1ISHA 1ZXBA 3ICWA 5FEUA 2RH5A 3FPSA 1TO1E 4IDGA 1T2FA 5JXIA 2P7IA 2OY0A 3EYWA 4WESB 1Y3HA 1U8ZA 5E3JA 5CVCA 4EFLA 4NOKA 3GOHA 5H3CA 4QUKA 4B83A 5L6LB 5KU1A 4HWPA 1KYWA 3V4LA 2P9FA 4ZVVA 1G3UA 1P91A 1QZ3A 4MKHA 3T3DA 3VZDA 2ZI3A 3FOFC 4TKUA 2QD2A 4PHGA 1C3EA 3PGKA 4Y30A 1C3LA 1R00A 2AYXA 1JE1A 4LZPA 4X3PA 3U40A 2F4VB 1D1QA 4IJ6A 3TLMA 4GDFA 3I1JA 3SPXA 2OXTA 2HQRA 2ODNA 4L9WA 4KAXA 5D01A 1HQYE 3EXIB 3EXG1 4R2XA 3T1QA 3ZZNA 1VCMA 3CG0A 3OY2A 2RHTA 4RACA 4B6SA 1SRQA 1VIAA 1Z5PA 3R9KA 1A8SA 3TCNA 3I9FA 5IAAA 3NCHA 3ZY5A 2KX7A 5HXAA 4WV3A 3ZQ6A 1T0JB 5K8IA 2YJZA 1J5EB 2FP4A 3ZKAA 4Z0NA 1DJOA 3VHXA 1A4UA 2NO5A 2QT9A 1DPGA 1U9IA 2R1TB 4GXRA 4ZQIA 1KHTA 3LYUA 4AKSA 3ELDA 1DAMA 4LXTA 3WGTA 5FBZA 1HURA 4ALMA 2DB3A 3K2QA 3IDFA 4HPXB 4YRSA 3VU9B 1NKTA 4GMXA 3PIIA 3K1TA 5D87A 3RYCA 4HSEA 4MJLA 2BOVA 4QGHA 2H2FA 2IHUA 1E2MA 1X87A 2GPYA 2L0XA 2QU8A 3L6CA 4JODA 4YP9A 2NGRA 5KX5B 2BONA 3GY0A 2CFRA 4CM3A 3KOZA 4D4LA 3Q7EA 5HQJA 5YASA 1U4OA 4UOQA 6AT1A 2GCIA 2IYQA 1E9CA 1BHO1 1TPZA 3L6RA 4K87A 7REQA 3WC4A 5CCBA 2X2FA 4MR7B 4HUTA 2VP5A 3PFIA 3NBUA 3C6QA 3PUHA 4HQKA 1GJRA 4R54A 1KQGA 4UCWA 1S96A 2VCEA 3NVMB 1U3VA 4H7JA 4RCYA 1XL1A 1EVLA 4R8LA 1YHNA 1Y7HA 1Z82A 2R8XA 1L6RA 1OXMA 2DM6A 4H1VA 4E5KA 2AVDA 3QWAA 3EEOA 4KSCA 2PV7A 3GP8A 3ISJA 2E4VA 2P90A 4CBVA 2OCAA 4JLJA 5CP8A 3B52X 1M75A 2QAGA 2TECE 3CLUC 2PS9A 4YJ3B 1WZIA 5ALKA 3ZY2A 4JLOA 4ZN6A 1OZHA 3VSCA 2ZYHA 3MLAA 4FGKA 4QBFA 4GUAA 5F64A 3HRKA 1MA0A 2QVLA 1THGA 4OHVA 4B4UA 5KYKA 1JDJA 2QN7A 2YC2C 3C8UA 3FUCA 2AXNA 3AIOA 1E9RA 3R4CA 3SBOA 3SJBA 4HZUB 1FDUA 1WX1A 2SECE 4EO4A 2QMZA 4Y2HA 2IEBA 3FN4A 3PC7A 1JFFA 3FYUC 4P0QB 1K92A 3HJTA 2WHRA 4FDUA 4PTZA 5TMBA 3GLRA 2KW5A 2GK7A 2AB0A 3F3SA 5IBRA 2HTFA 2VAWA 3U16A 1V8PA 4RUKA 3ZI0A 5LMUB 3OWXA 2QHXA 5A6VA 2A94A 1XZGA 2J3EA 3RKUA 3KJGA 3W1EA 3I76A 1PJSA 2XUKA 2VT6A 4OQFA 4WCFB 5UKDA 4X7PA 3U9LA 1YGYA 5BNFA 4JFAA 3NRBA 2QA5A 3R8FA 3SC2B 3V46A 3NM5A 4CKBA 1IWBB 1T3SA 1BCSA 2LWIA 3CRRA 4N5IX 4DQLA 4YCCA 2XAUA 4H7EA 5BO5A 2F3SA 2GEBA 3P0EA 4UMEA 4ZVPA 5BOSA 1QQ5A 4NU6A 3I4FA 4DSNA 2XB9A 1Z5VA 4CDRA 3N87A 2NZ8A 1U2PA 1L5MA 2PT7A 3DEKA 4QU0A 3PFWO 4C6TA 4KHZA 1X3SA 4GXQA 2GM9A 1SG0A 3AG6A 3IHWA 4GZMA 4JHXA 4NI5A 4BX3A 1WMEA 1B23P 1O9GA 3LCCA 3NRCA 3W5CA 2H7CA 3PPXA 4OMUA 4LFCB 4BPBA 1DAGA 3JAKB 1KJWA 4UMVA 4RJLA 2RD2A 2HAEA 1SZPA 1XF1A 5HIIA 2YUIA 4JT8A 4TOIA 4D9EA 2JDIA 4DV7B 2OHIA 4FKZA 3MT0A 2DXIA 4B45A 3EAFA 1U98A 2I6GA 3OC0A 4MQBA 1HDZA 2HCFA 3AQIA 4C43A 4EVRA 4GR4A 3AKCA 3DCJA 4L78A 5HPYB 1XA4A 2ICAA 1DAIA 4BFSA 3SQOA 1ZKDA 3WMRA 2VHEA 4QDZA 4PZLA 1IQ0A 2Q5IA 1WMFA 2ZG6A 1GLVA 4V0KA 4KQIA 5FOVA 1BYUA 3K9GA 5EIBC 1RCFA 3KP1A 1QFMA 1Y33E 3X1YA 1P44A 1WS6A 2I2AA 2QIPA 2SBTA 3FR8A 5ICGA 1YR2A 1ZP6A 3IA7A 4KTVE 4DCSA 3F9CA 4PX9A 3KQKA 3KEQA 3IP5A 4MICA 2UZ0A 2A9VA 2VQSA 5CLIA 3K4PA 3EFEA 4MKXA 3VMMA 5IKEA 2ODWA 4O4HF 1Z88A 2HT6A 3QWIA 3GMTA 4MVJE 1H3NA 2EJTA 4NPAA 1FSPA 4BGEA 2O5RA 3VTZA 4U7GA 1U31A 3N3BC 1MFPA 4M0UA 1YRBA 3H2ZA 3TW8A 1VRWA 2V3VA 3W7BA 5I9LA 3UUGA 1XD9A 2DUNA 3IT1A 3ZXSA 1RRKA 3AUFA 4KMMA 2AOUA 2Y66A 1HMYA 1HQKA 3LHIA 4NMXB 3THXB 3DLBA 3WSTA 5LB4A 2Z30A 2H4FA 3LX4A 1M66A 4YV2A 5HHTA 2NSYA 4ROTA 1XNJA 3R3SA 3D7SA 4I5EA 1KSFX 5DNAA 4TWAA 4L73A 4JWTA 1QF6A 1X8JA 1IIBA 2HF2A 2XYHA 3QMVA 5AM4A 1EWYA 4ZU3A 2IUYA 4KH0A 2ID7A 5KVCA 2AFRA 1G21A 4RKEA 4DXDA 1X7XA 3E0QA 2RGWA 5DHUA 4G26A 3MCUA 4B8WA 2R47A 2O0KA 4CTKA 1W0KA 2FW7A 4UUQA 4QBKA 2B1GA 4JL6A 3BJRA 3SJUA 4BN4A 3FTDA 4ZCIA 1N2CA 3OZRA 4XJXA 1RAFA 4UCFA 3TZ6A 4I2VA 3QQ5A 3EXHB 3AEZA 1Z68A 3UCFA 4E1AA 1MUUA 4YRAA 3VBCA 1ADBA 4HKTA 3PUXA 5CNKA 1J8YF 2IW3A 3AZOA 5JH7F 3WSVA 3G59A 5JWRA 1UL1X 3HU3A 3G7SA 2D0IA 3N39C 1WCV1 2IDKA 3UKJA 3OTOB 1EEXB 4S2EA 1HDIA 3K0AA 3D7MA 3MTDA 3VH3A 3QBDA 5TRTA 2VJLA 4MGKR 3ZDCA 1D2CA 1L7DA 2HXYA 4KN5A 1IOZA 1V6CA 3KZMA 3LCVB 2AZTA 4PRLA 3D4IA 4D0SA 5K0ZA 3DCIA 5CMLA 2FZVA 2WJAA 4L07A 3MTGA 3ZHCA 4C08A 3AXSA 1I2DA 1LS6A 1K7YA 2BM8A 4Q47A 4J0DA 1QGUA 1U7PA 4NZMA 4AT1A 3DBHB 4HBZA 1YJ5A 2I7DA 3T9DA 1GUYA 3YASA 3K05A 3JQAB 3GXOA 1C4KA 3MFYA 2D1RA 3C1AA 5KREA 5FLKA 2QXTA 4L5JA 1ZAYA 5HK8A 1XR3A 1MDFA 2Y1GA 5KQLA 1PEDA 3GPDG 5JRJA 3EH2A 3IE2A 4U5XA 4E4YA 4YUWA 4ZZ3A 4DV5B 4NK5A 5DSZA 3WRYC 4FFMA 1MC1A 4KXWA 2Q4OA 3QKSB 3SXUB 2VTDA 2ZI4A 5AI9A 1Z6AA 2WA1A 2QUHA 1YCHA 1TADA 1SXQA 5I47A 5JS1A 1ZD2P 4U39A 3H16A 3PR2B 4P38A 1SVIA 3CEHA 3T3IA 1MB9A 4D0RA 1B76A 1II9A 2PK3A 2N3ZA 4LISA 2CCJA 3EZ2A 1CY7A 1GWNA 4ZRDA 1UM9B 2EDCA 2YN4A 1H2AS 2C61A 4NE2A 4ZU1X 5A4DA 1J42A 4MP6A 2ONJA 3UXYA 5A3SA 2YY6A 3CLSD 1O5IA 3ECAA 4R0VA 3RSOA 4XPIA 4BMNA 3KZ1E 2PVCA 2FF7A 1WB9A 3EXFB 2XTNA 1W5EA 1Z22A 3AERA 2H2IA 5E8RA 2EP8A 3PUZA 4RF4A 1GL9B 1ORHA 1PDWA 2HSZA 4RY9A 4DBVO 2J4CA 3Q9SA 1NLUA 4PPYA 2B36A 3THYA 5CHYA 1WPGA 1D4AA 4GVLA 5LYJA 2P35A 4W9MC 1TF2A 1V7QA 1L4BA 3KXLA 4HGYA 4O4LF 1L9XA 4MMXB 1KEVA 3W6PA 3R0XA 4CLDA 1I01A 1VYUA 5GGXA 2ZSDA 3AVUA 1UXHA 3RS0A 4QUHA 4RORA 3TI9A 4I9HA 4J3JA 4ZFNA 2JI6A 4TLDA 4C6S<