3X1YA

Ras-related protein rap1b(l9v) with gppnhp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
b'MREYKLVVVGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWSNCAFLESSAKSKINVNEIFYDLVRQIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras-related protein Rap-1b
molecule tags Signaling protein
source organism Rattus norvegicus
publication title The structure and conformational switching of Rap1B
pubmed doi rcsb
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3x1yA00
5FTJA 1UKYA 2ZJZA 2QZ4A 4PAOA 5IK2D 1G4UR 2XTZA 2IHBA 3KFXA 3EASA 4R2IA 1TUIA 4A8JC 2A5YB 5IF9A 3AM1A 1JXMA 1ZD8A 5TY0A 2G88A 1NG9A 1ZIOA 1XP8A 1NN0A 4IXNA 3WNBA 4A15A 3GMTA 4TT3A 4U5XA 1UM8A 2MMCA 2AFHE 2HT6A 4FMBB 4IRUB 1W0KD 3CB4A 5CYOA 3TSOA 1W4RA 3EIHA 2IXGA 2CHGA 4PPNA 1TTTA 4Q01A 1R2QA 2G77B 1EWQA 2GVDC 1PLLA 4PZYA 2HJVA 5JI2E 2ATXA 2IS2A 5JJLA 1P62B 4BECA 5CB8A 2VIIA 4MGIR 1J2JA 1XPUA 4JSTA 4H1UA 1NRJB 4M22A 3U3RA 3FOZA 3IQXA 4C0AC 4B32A 5HR5A 1G6HA 1UJ2A 2HXYA 2ZRIA 2OT3B 3NBZC 3QBVA 1TF5A 2DBYA 1D2EA 1XD8A 2ZSAA 4TZ6A 2OHFA 1DOAA 2WM9B 4PC3A 4ZDWA 3T1QA 1ZC3A 1ZM3A 2A5GA 1Q21A 5HCNA 1GL9B 2BKUA 4BFVA 1HQYE 2WMNB 3FVQA 1LS1A 1YRAA 3LY5A 4DEYA 3ICEA 2GJSA 2JLQA 4NP6A 1P2VA 2OCPA 1P6XA 4DDVA 3IO3A 4PO8A 1OB2A 1NSTA 3EZ2A 1G3RA 1AGPA 5DYGA 4DBLC 1IJFA 1X8JA 3PEYA 4XVQA 3REGA 2FSFA 3H1TA 4GMDA 1FTSA 1QHHB 521PA 1WQ1R 1M7HA 4RSGA 1RE0A 3GLHE 1OE0A 3WMEA 2EVWX 1CRQA 5EE5B 1I2MA 4B3CA 4E5UA 1L4YA 3QF4A 2ZRNA 4B3BA 2FU5C 1QHGA 3LX8A 2FSIA 2VLIA 3G5UA 4QNRA 1KSGA 2IYWA 4C0QC 4YMVA 4B2PA 3DVLA 1FMJA 3VHXA 2QBYB 1GAJA 2P5TB 1WBBA 1GFIA 1CJMA 2ODNA 2DWQA 4GZLA 2JJ8A 1WMSA 2FWRA 4KVGA 2ZRBA 4JBWA 2GNOA 4IFEA 3U3JA 1CULC 5EXTA 2H16A 5DN6A 4LPKA 4TMXA 3P1JA 4WBSA 3KJHA 2I1QA 1W7AA 3I72A 3QKRB 1BYUA 2VP0A 4FI3C 5AJZA 1N6RA 2V55B 1VYVA 1XJ0A 1S1MA 4GPTA 4WXRA 4DKXA 1T3HA 4EPTA 4Q7MB 2JJ2D 2CL0X 3K9GA 5AJXA 4EPYA 4AY2A 2KE5A 3KXLA 3KFVA 1IXRC 2BWJA 3RHFA 4D80A 3DOFA 3PUWA 3AV0B 5KNCA 1HE8B 1UBGA 2ZE5A 1G5PA 2YYZA 1WDTA 1ELOA 4LY6A 1DS6A 5EXSA 2OEPA 3QOFA 4L16A 4Q19A 4NYMQ 3WRYC 1ZINA 1GRQA 1R0ZA 4UNRA 4XWKA 5BYKA 5L3RA 2IWRA 1XMVA 3R7WA 2IWHA 4EJSC 5JI3E 3IPYA 3KZ1E 1PUIA 3CO5A 1RPZA 3IEUA 1X1RA 2EWVA 4B6EA 2CHVA 2ZR0A 3L8YA 3NBYC 1QDEA 4MRSA 3AVPA 2VP9A 3EZ6A 1AK2A 5EP3A 4RKEA 4OHVA 3TW8B 4GI7A 2WWWA 2G6BA 1YRBA 2ZRHA 5DNYB 1BS1A 2RGCA 2WHXA 3EAQA 1XZQA 1CJVC 3RDPA 3X2SA 2EFGA 1VMAA 2OSBA 4A9AA 1VDZA 3KQUA 3MJHA 3HPQA 1YHNA 4KSCA 2WAYA 3DMDA 5KSOA 4AYWA 2F6RA 3KQKA 3W8NA 3U2QA 4DUGD 1NY6A 5LB4A 1Z6YA 2DB3A 5KDDA 2ZJYA 2E9SA 1DPFA 4QHYA 4P4TA 3KL4A 4HYYA 2YWHA 3BB4A 4Q1DA 3N5CA 4WA7A 2KWIA 1CR1A 4I81A 1M6NA 1NBMD 1P2UA 1AJEA 2CHQA 3AP1A 5BN3A 1KNXA 3AVOA 4TT3D 2ZJAA 1XJQA 4NU0A 3K09C 3QE0A 1KMHB 3WNCA 5DISB 5A0FA 5CLQA 3OEHD 4G01B 5JRJA 1U8YA 1Y63A 2WWIA 4Q00A 3U5ZB 3AF2A 3T5GA 1N6HA 2FFAA 3Q7PA 3KKQA 1BYIA 2V6IA 3ECCA 3NEJA 2GJKA 5FOWA 2IBMA 1IXSB 1IHUA 4LGMA 5H68A 821PA 2C98A 1K5GA 1S0UA 1JI0A 2JATA 5BYJA 4KODA 3LQRA 5CB6A 1XF9A 1ZRHA 2WZQA 1A5TA 4IKEA 5C4GB 4MYTA 2L0XA 5DN6D 2AK3A 4R7ZA 3AVUA 4QC2A 3FFAA 1Z6TA 4AIIA 1KNQA 2UZIR 4EPVA 4QM6A 4PTLA 5H70A 3H4MA 1M1YE 2A5FA 5DIFA 121PA 3SHFA 3U4QA 1IY2A 2N42A 1KK0A 5DHFA 1L2TA 4QBIA 4PHHA 2NO6A 2QRNA 3QKTA 4TWZA 1IY0A 1NIJA 2PMKA 4FMCF 2ZRFA 3C5CA 3PEWA 2J7PA 1DAKA 3CM0A 4TTPA 5L8VA 3I3SR 5J4KA 1WXQA 4JBYA 1W1WA 1C4OA 1IY1A 3ZYCA 5K8LA 1P2TA 1Z47A 2BBWA 1T91A 2LWIA 1JJVA 4JL8A 2ZS8A 1XEFA 2VHUA 4Q1FA 2WAXA 3PVSA 5EQTA 3FTQA 1XTKA 4ZDIA 1E2JA 2VEDA 4KXFB 4YLGA 3BAFA 1KTVA 3TAHA 4B33A 2ZYVX 1N0VC 4CEIA 1XFAA 2JLSA 3B9PA 5H1YA 1W2HA 4B3GA 1EFTA 5B58C 4M1KA 1VTKA 4Q5IA 2ZS9A 5D3MB 1GUAA 3I1FA 5TV2A 2NO1A 2CCKA 2XAUA 2GDJA 2W83A 3FHOA 3UXMA 1OXUA 3FKSD 3L0IB 3UWKA 3GLHB 1LTQA 4HAYA 1Z29A 1G3IA 4JLKA 1R5NA 3RS3A 1PLJA 5G3ZA 2IF2A 1J99A 3K70D 1F3OA 4CVNA 3NDPA 1ZU5A 2NZ8A 4FWTA 3SJBA 3QVVA 1SVSA 3TQFA 1N6LA 4LJ5A 3QXXA 1WA5A 4IEIA 4O25A 1UF9A 3K8YA 4DCNA 1DG1G 2AKYA 3TUJC 5F3WB 4OK3A 4LC0A 4C9BA 2ZI3A 3I73A 3JZAA 1GP2A 1P5ZB 1CF4A 5FOVA 4TMWA 5A4JA 2W00A 1HT2E 4OYHA 2ONJA 2O8FB 2ZJBA 2JIZD 4MUAA 5FI1B 4KAXA 4CEHB 2QM8A 3QEJA 4DLTA 1ZW6A 2GWHA 3TW4A 4TYNA 2HF8A 2J5XA 2VH5R 1UBCA 5DHAA 1M7GA 2RGBA 1V5WA 3OIVA 4GSYA 3ZVRA 4DLRA 5TB5A 721PA 1OH6A 4ZCMA 1Z3IX 3GJ3A 3GLFE 2YVUA 1G8GA 3NVAA 2ZR7A 4M1WA 4MRRA 3PG5A 4Q66C 3R9IA 3UANA 3KTAB 4C3ZA 1S3GA 3CH5A 2YKGA 1P9RA 1E2GA 4LYJA 3VR2A 4HAVA 3WP1B 3KKPA 3TE6A 1XU4A 3WRXC 1NMXA 5DLQC 3AH8A 2YC2C 3B1YA 4W7SA 4UNQA 5GADl 4MKFA 2X1VA 2AHOA 1U81A 1VCMA 1VPLA 1OYWA 1N6PA 1C1YA 3K09A 3PEUA 1OXXK 4M1OA 1DEKA 4LPSA 3GLHA 2C9CA 1FMLA 1E2PA 4UNSA 2J45A 4UXIA 2GESA 1NVVQ 3ZS9A 1QHXA 5JWRA 5IRCD 2ZS7A 1SXJC 5D3MA 4FINA 4CGZA 4LC1A 2QTHA 3BH6A 5FBRB 2GF9A 1Q57A 1UEJA 1AIPA 1KSHA 1NBMA 4H1VA 1U9IC 5EUQB 3K0CA 2O8CA 2JJ1A 3AVVA 1KK1A 2ZJ5A 4PANA 4K8OA 3C8UA 2QY9A 3GFTA 4NBSA 3F8TA 5CIWA 2YJTD 3QXHA 4M9XA 4JLOA 1OV4A 5G53C 4KFRA 4CF7A 2OCYC 2QL6A 1NY5A 2QP4A 4I4LA 2ZE7A 1WRBA 1G5RA 3Q85A 4EUNA 4US2R 1SXJB 2CEAA 2YWFA 1T6NA 4RD6A 1N5JA 1LF0A 3FMIA 5IK2A 3VMFA 2JCSA 1MKYA 1G6OA 1NVVR 1I4DD 2ANCA 2ODBA 3DM5A 4TMZA 1QF9A 2ZRJA 2ZUDA 2QG6A 1YVDA 1IN6A 1G8PA 2VL7A 2ZUCA 4D4LA 4TYPA 3K70B 2BM1A 2MSDB 4R98A 3HPRA 3QIAA 2SHKA 2J0UA 1NN1A 3SR0A 4IDHA 4DHEA 5CIQA 4TL9A 1JAHA 1XTIA 4ERNA 5EE3A 2IW3A 2XNSA 3K0AA 3OFND 5CYPA 2IEZA 2J7PD 4NDZA 3NBFA 2BMDA 2GEVA 4A1FA 1G3QA 2WOJA 2TMKA 2JLVA 4BEBA 1ONBA 2F1HA 2DPXA 3AQ4A 3T35A 4ASUA 4QGAA 3M1IA 4B3FX 5KSYA 2V6JA 4HUTA 3CWZA 1KO5A 3RAPR 3WP0A 1NF3A 1E2FA 4F7WA 4JIMA 1RFLA 3IUYA 4Q02A 1YZQA 1T3LA 4WIAA 2VHCA 1HTWA 1P9WA 2GRJA 4TL8A 4NCKA 3ZZ0A 2QU8A 3U6KA 4YMSA 5D3QA 2E87A 1E9FA 3PXGA 3AUYA 2OAQ1 4G0NA 1UFQA 1XD2A 3KKMA 5JCPA 2FX3A 3HJNA 1YZTA 3CW2A 3MG9A 3ZVNA 1ZD1A 1BH2A 2OCBA 2XOKA 3QKSB 4AD8A 3I62A 3VKHA 4G5QA 3B1ZA 2GXQA 1AQUA 3C4JA 2C96A 4TMKA 1GRNA 1KY3A 1ZM4A 2OBMA 4NHOA 1D8TA 2Q9BA 4UKDA 4OI1A 1AKYA 4IHQA 1UEIA 3AKCA 3VHLB 3LBNA 2FGKA 3MWJA 5CK5A 4A8JB 3UPUA 4NONA 3RNLA 4NCNA 1KKLA 4V0LA 1CU1A 4M9SA 1E98A 3EG5A 3GD7A 4Z8YA 1CLUA 3FPAA 4A2WA 2GCPA 1TMKA 3THXA 2AWOA 2O8BA 3JVUA 1VG0B 2G0TA 4ZPXA 5C46F 5JMTA 1DG3A 5KNBA 3MAAC 4HB3A 5B2ZA 4ZCIA 4WOPA 5E7IA 1EFRD 1G7TA 1E9SA 1I2DA 2XXAA 3R9WA 3VR4A 1G19A 2QNRA 3IGFA 4CW7A 2RGDA 4MGZR 4YDHB 4JMPA 1KHTA 4XTRA 1CTQA 4EFNA 2IUUA 3B85A 3OIUA 1MOZA 3AVYA 2AXPA 4CYMA 3WHLA 4CZ2A 3CUEF 4IOMA 3AVQA 3BD9A 3OF5A 1WB9A 1L8QA 4MYUA 4XTCS 3AKYA 1Z63A 4CEJA 4CIDA 2OUKA 1ZCAA 1IBRA 2BHRA 2GJ9A 4HLDA 1HQCA 5GJCA 1N3BA 4QGFA 4BEJA 4TQUS 2WOOA 3WBJA 1R5OA 4IOJA 2V4ZA 1X86B 3K1JA 1JR3D 4LHYA 1ZMXA 2CL6X 1XTRA 4OKSA 2QPOA 1U99A 1Z6XA 2BBSA 2F7SA 1DBSA 3QENA 4DB4A 2A78A 4PHGA 3VNUA 5K8TA 2Z43A 2QAGC 4AKEA 4A8JA 4TL7A 1T4GA 2J59A 3LRPA 1E6CA 2OBNA 1R7RA 2YOHA 3T1VA 2ZSEA 1G8HA 3SJAA 3TVDA 4DDTA 5AJVB 3DL0A 3KQNA 5FUYA 2CE2X 2I3BA 5GJVC 4ZDJA 2ORIA 1Z0KA 3ND9A 4MITA 2P6UA 1D2NA 2FGJA 2A7QA 3PUZA 1G9XA 5EXXA 4YXWA 1W2GA 1T5LA 2C95A 2RGEA 2GZDA 2WVJA 4LV8B 4CT4B 2FSHA 1P72A 2QAGB 3F5FA 5L3SA 4LX0A 3CPJB 1OHHA 3X1YA 2AD5A 2VHTA 4KVAA 4G5RA 2RGNA 1QHNA 4G5GA 1VKJA 4PAQA 3QEOA 2FZLA 4L4UA 2JDIA 3AP2A 3ZQJA 1GITA 2GBLC 2ZJOA 1E0SA 2PX3A 4PC2A 4NTZA 1E0KA 1Z5ZA 4EPRA 3SEAA 3RRYA 3ADDA 1KYIA 2IS4A 2REBA 2B8TA 3A8TA 1WE2A 1P7CA 2K5UA 2MSCB 4N0EA 3R8CA 3SYNA 5FBVB 1KI2A 4Q18A 1GKYA 3R8FA 2J3EA 1WCV1 5JHGB 2ZE8A 3RC3A 1P2SA 1B23P 5TVKA 3SJZA 3ADBA 2EFHB 3BFVA 5EXPA 3I4LA 1KAOA 2IXEA 1XEXB 4PQYA 4NYIR 3WNDA 4XD7A 4U02A 2BDTA 1N0UA 4LJ8A 1FW6A 4EJSB 2PX0A 4ASUD 1SVKA 4L9SA 4B71A 2JA1A 2ZREA 4QFMA 2PJRA 1XTJA 4RZ3A 4DIDA 3VKGA 3IILA 1XPOA 2VP4A 3ZD6A 4AYTA 1BIFA 5JHHB 1KI6B 4LBZA 3RS4A 1IONA 2ANBA 4PSVA 4Q47A 3OAAD 2AXNA 2XZPA 1W36C 1COWD 4AG6A 4URXR 2OFXA 2J7KA 1Z08A 2RGGA 3SS8A 2KBFA 1H8EA 1XMIA 2P3SA 4PHFA 3KDSE 5CK4A 1T8TA 3EWSA 3QQ5A 4E22A 4PQFA 5J4HA 3THWB 2ORWA 3KB1A 5KNDA 1UKZA 3H84A 2IYYA 1KJZA 4TLDA 4OJQA 1G17A 3H0KA 4LJ6A 3OIWA 4OL0A 1R10A 3P4XA 3THYB 5IDVA 3GLIA 2QMOA 4KSBA 3ZH9B 1OT3A 3MSXA 2ZYUX 1CEEA 4NKRA 2P6NA 2Q3FA 2YC4C 3QNUA 5IHPA 1SGWA 1R5BA 4OQNA 2ZI9A 2HYIC 1PLKA 3X1ZA 1E2EA 1KO4A 1QHSA 2IYLD 4Q21A 3X1XA 4IDNA 5DGXA 4ZIRA 2QT0A 2OLJA 2DHRA 4LV5B 4RZ2A 3LX5A 3TBKA 2XSZD 4XJXA 1II8B 3PUVA 4US0R 1DADA 4IFBA 1OH7A 1X1SA 1BMFD 1NVWQ 3SQXA 2H8KA 3FYHA 4KU4A 1Q1ZA 4QGHA 4LOAA 1QG2A 3F0TA 3LBIA 4RZUA 3GLGA 3GJ7A 4MKGA 2O8DA 3QJYA 1G3MA 1XDBA 1JBKA 3T1TA 2I1VB 5E7MA 2PBRA 2HDNB 3OEHA 4RKFA 4ZDKA 2GVZC 4BQSA 1KDOA 4NCJA 1S1CA 2VHJA 4M2LA 2F1IA 1QG4A 4WW0A 2AKAB 2FV8A 4LWZA 4F4IA 4KLZA 1KZ7B 2IX3A 3NH9A 1HT1E 3W6OA 2WWHA 5DI3B 4B76A 1A2KC 3N2IA 3D7MA 3DEFA 4ZV4A 4Z51A 1NG1A 1E2KA 3UG6A 2ZEJA 3A1VA 1NKTA 4NMMA 1R0XA 4A92A 5JCZA 2R6GA 3K0FB 5FPKA 3SBDA 5FL3A 1KI8A 1E4YA 1QRAA 5DI9A 4ZI2A 2F3TA 2PZFA 1CXZA 1TL7C 3QXCA 3B1XA 4KFSA 2JASA 4R2HA 4WZBE 4ESHA 1S9DA 3KJEA 1Q12A 3QG5A 2D74A 1GILA 2O0KA 4ABYA 2QGZA 4XVUA 3BB1A 4OJKA 1JALA 4PQRA 4RD4A 2JAQA 2RH5A 2BJVA 2W6IA 5KSPA 4NH0A 2XZLA 1F2UA 2PCLA 4ZI3A 2CLCX 4CEIB 4BLPA 2P65A 4G3XA 1GNPA 3C7KA 4IW3B 2KSQA 4M21A 2X8AA 4C30A 1W46A 1ZYUA 1D6JA 5JS7A 3D6TB 2JLWA 1XRJA 1IN7A 3BGWA 3I8SA 4KO8A 3TSWA 3W5IA 4DDUA 1W0JD 2PL3A 3FGNA 4GZMA 5JJKA 1R0WA 2F43A 2O8EA 1UBEA 3LXXA 1YR6A 2WKRA 2EFEB 2RMKA 3ZZTA 2FJUA 3GPLA 1SVWA 2FG5A 5FBWB 1CJUC 2VQSA 1MABA 3U60B 3DHWC 4O3MA 3RS5A 4Q9KA 4P4SA 1ZM9A 4FCTA 3TVTA 5F98A 4GL2A 4PZLA 1VG9B 221PA 4IXMA 4U00A 4OK6A 1NJGA 2C9OA 4M1YA 4POAA 1W0KA 3GQBA 4JLNA 2DFTA 4C2TA 1M74A 4GRAA 4GNKA 2FZ4A 1KK2A 2J46A 3ASZA 1XNJA 3CRMA 3CRW1 2O0HA 1GNRA 2NTYC 2C77A 4P3YA 3R9XA 4W9MC 4BZPA 4A0RA 1EFHA 5CDFE 1W4CA 4PPGA 4LHWA 4I1SA 1UKVY 3Q3JB 1NN3A 1GSIA 2ZPTX 2HCBA 1MH1A 2IHYA 2QPAA 2ZI7A 4QBGB 4TQ9A 2FA9A 4K46A 5TXGA 1GTVA 1SVOA 2D7CA 1AKEA 1US8B 1TX4B 3RYTC 1T0HB 4Z8XA 4QKQA 5LBIA 1LY1A 4LI0A 5P21A 2D2EA 5FOUA 3NTUA 1H8ED 4URWR 4RZXA 3KQHA 4JT2A 1ZP6A 1DVRA 1VG1A 3R20A 3O8BA 4QL3A 1OSNA 2PCJA 3LFUA 1OH5A 4LJ9A 1ZNYA 3QSYA 1G8FA 3E70C 2HF9A 1G7RA 1ZNXA 2GCOB 2H1LA 3QXJA 3SN6A 2OFOA 2C99A 3IBGA 4BFWA 3CNNA 4AG5A 1O87A 4DLYA 2OCAA 1JEEA 3PQCA 5GJWC 2FFQA 2LKDA 2ZU6A 3RC8A 5BQ5A 3CRRA 1SVMA 4UJ5A 1F2TB 1KI3A 2C8VA 2R6AA 3A1TA 4ARZB 3GLFA 3NDBB 1SKYE 4EPXA 5HKKD 5E7JA 4MYHA 2YWEA 3CF6R 4A2PA 1UDWA 1Q0UA 2XOKD 3K53A 3KXIA 3FMPB 5FPYA 3TSZA 1OFUX 3P20A 3SOPA 5K8UA 3AGPA 1YZNA 1LW7A 1U0LA 4PPQA 4D0GA 2AR7A 5BXQC 4W5WA 5L3VA 3GJ6A 3KUCA 3OEED 2F1RA 5J4LA 2GK6A 2UKDA 3AB3A 4EIWA 1SKQA 1B0UA 2CK3D 2GXAA 2QROA 4C7OB 3NBXX 4P33A 4A4DA 3K70C 5BW8A 1F5NA 4TMVA 4BZQA 4LYHA 4DZZA 2BC9A 1SHZA 1Q20A 2AN9A 1E99A 3N70A 4OHXA 3AUXA 3UKDA 5CJ2A 1E79D 2NPFA 3BK7A 4HAZA 5JEEA 4R71A 2WIAA 3C41J 3DKVA 3AVXA 2CDNA 3VR5A 4HUQB 1YZGA 4Y0AA 2YOFA 2ZJ8A 1TPZA 4D0LB 2BBTA 4EFMA 4V02A 2C5LA 1JQLB 4LHVA 1ZIPA 3CLVA 5AUQA 2C78A 5GVRA 1W44A 4Q9LA 2FN4A 4C0BA 1GNQA 1W5TA 3IDQA 5AJWA 4FMDF 5E3HA 4O2RA 5KOYA 4PXAA 2CCGA 3V00A 3EWAA 3EPHA 1SQ5A 1N6KA 2A3RA 4ZKDA 3W3ZB 2W6ID 3AGQA 4B44A 1XWIA 4Q4HA 2Z83A 3BFKA 3B13B 4LUCA 4P0TA 1II8A 4FCVA 4XVRA 2NO9A 3LLMA 4WVFA 3CR8A 3SI7A 3WYGA 2GZAA 2QM7A 3PIRA 4DSUA 1E9BA 4F4CA 3UATA 4DUGA 1C9KA 4F91B 4ZIRB 1W48A 2NQ2C 1QVAA 4DEXA 3KXKA 3PUXA 3LVQE 5FFMA 5JWHA 2CVHA 2WMOB 1IQPA 3S1AB 2BMFA 2QGNA 5KPDA 4YONB 2X2EA 3A4MA 4RD2A 3TJZA 2CLSA 3EX7C 3T06B 3WMFA 2OESA 5BN5A 5KSZA 4NPHA 2F55A 1TF2A 3A1SA 4HLUC 2NO7A 3SZRA 4KJZA 2LKCA 3VAAA 4Q4JB 4MRPA 3C15C 6Q21A 2FH5B 4NYMR 2IYZA 4EDHA 4D0NA 2RHMA 2W0SA 3NEYA 2HJGA 1S96A 3TR0A 4AC9A 4EQ6A 1GKUB 5EJEA 621PA 1NBME 4KFTA 4Q4AB 2BIFA 3V9PA 4DLZA 1N5IA 2JDID 5FOTA 4JYBA 2IF0A 2D3WA 3IIKA 1MV5A 1LVGA 2A2ZA 2W6JA 4MYCA 1NIPA 1J8MF 2F3RA 3LD9A 3Q7QA 5JJIA 1G8YA 2H7VA 1G18A 1RJ9B 4IOLA 4PC7A 4G5SA 2V1XA 3HWSA 5FBLB 1G41A 5LPNA 3LH5A 4X8OA 3L0PA 5FL7A 2QP3A 5EE1A 2ZRLA 4Z1MA 1P3JA 2ZU0C 5HCIA 1DAFA 2ZETA 3H2YA 1D9XA 2VBCA 3CZPA 1KI1A 4MH0R 8OHMA 5G3YA 4DVGA 2IS1A 2CNWD 1W49A 1E2IA 1PJRA 2CCJA 1ZUIA 1JB1A 1RIFA 2XNDA 1E4VA 3ADKA 4RD3A 5ANRB 1GG2A 1EWRA 3VR3A 2IT1A 2KB0A 4EQ6B 3VU9B 4YMTA 4DLVA 1ZC4A 3LQQA 5UKDA 4JBXA 4JLDA 1NI3A 3UIEA 5TARA 2ZITA 2WWYA 2XX3A 1KMQA 4ACBA 4Q4JA 2FPLA 1E9EA 3OZXA 2AK2A 2GCNA 4TTQA 4HATA 4UNNA 1YZLA 3CF2A 2YV5A 1FFHA 2NGRA 5FI0B 1K5DA 5E95A 4NZYA 2W2TA 3P26A 5FH9A 2QAJA 5CITA 4BPBA 1IN4A 2IK8A 2OILA 4KV9A 3AF3A 4TYWA 3Q72A 1M8PA 3NWJA 2QMEA 3O8CA 1XCMA 5JS8A 1GZSA 1XTSA 3OEEA 4I1UA 2FEOA 4DLSA 1WF3A 3VU9A 2PEYA 4W5HA 1RW4A 1E1QD 5KTYA 2HT1A 1CRPA 4D4MA 3CONA 1ZNZA 1KDTA 2GAOA 1NP6A 2DR3A 3GEEA 2BMEA 2BKEA 1R8SA 2N1BA 3JZMA 4JYCA 1TNDA 1E94E 3QKUA 3EZ9A 4IDOA 4I1VA 4JVMA 4PO1A 4N1AA 4YXWD 1KI9A 2VRWA 3L0SA 3EZ7A 2XTNA 1HV8A 2QPTA 4GMXA 1PZNA 1RRPA 1OFIA 2IYSA 3GJ4A 5SZJA 3PENA 2QE7D 2VYFA 2CXXA 2ZM5A 3ASYA 2OG2A 1UADA 5DSZA 4QM7A 2PMDA 4QBHA 3GFPA 4LYFA 2NIPA 2XGJA 1E79A 2C03A 3I92A 4HUQA 5TMPA 1KSFX 1SXJD 1M7BA 4Q48A 5HE8A 2JLXA 2FNAA 4QJ3A 3B6EA 4CEJB 5K8IA 1GRRA 3B78A 2NOAA 4Q7LA 4BFUA 2OBLA 5FPTA 3DO6A 2D7DA 2I4IA 4DCVA 1W36B 2B7BA 1OFHA 1G16A 1GWNA 1S2MA 5CJPA 2AFIE 2FPMA 3BE4A 3LDAA 4XD7D 4C7OA 4Z54A 3CRQA 3KJGA 1TAGA 1E2NA 2B6HA 1GDDA 3ZGXA 4HDOB 1OJLA 1RZ3A 3OHMA 1NVUQ 3F3YA 1KGDA 1N5LA 2WJJA 2ZVQX 3Q5DA 3VKWA 2X77A 1NLYA 3RANA 2A5DA 4OQFA 1AZTA 1KO7A 1IXZA 5JZVA 2R6FA 5HE9A 2WICA 3IIMA 1HEIA 2V8OA 1S3SA 3L43A 1ZJ6A 2H57A 4DJTA 4PSKA 2O8BB 4DT1B 1FOEB 4R9UC 1ESMA 4OK5A 4QHSA 4B3DA 3IEVA 4GOJA 1DAMA 1LV7A 4XWAA 1UDXA 3AP3A 5FPSA 1U94A 4Q4HB 5SZKB 1W36D 3MGCA 5KYKA 2F1JA 3MJRA 5AUPB 4B48A 1MR3F 1ZU4A 3BB3A 4LV6A 3O47A 3I8XA 1MT0A 4NE2A 3TRFA 2PEZA 1Z2AA 4RVCA 2R9VA 1FL9A 4BWYA 1HYQA 1EGAA 4FD2A 4M1MA 4FMDB 2PH1A 4ZCLA 1CJTC 4PHTA 5KDLA 3SDZA 3ND8A 2VP6A 1Q44A 1KDRA 1ETUA 1YZKA 2O0JA 4D26A 1CIPA 3GJ5A 1VG8A 3UMSA 5C1BA 1Z0IA 4BUJA 2DYKA 3B8HA 3EC1A 3FKQA 4LHZA 2XJ9A 5FL7D 2IUTA 4WZAE 1L7VC 1OW3B 4M1SA 3AKDA 2IYVA 3LO5A 5FBQB 2ZRAA 5AR1A 4PO9A 3TH5A 3CZQA 2W6JD 2GJAA 1M2OB 1T5IA 1YR9A 1KOFA 1RRGA 4DXAA 3UMRA 2XSZA 2Z0MA 2ZQ5A 4EFLA 1S4QA 4E03A 4I1OA 1EXMA 1KO1A 2C9YA 1RC8A 2JLYA 2GTPA 3KKOA 2ZTSA 2PT5A 4OQXA 2V3CC 1Z6GA 3FKSA 3B1WA 1CR0A 2XEXA 3D3QA 4HI0E 4BE7B 2O52A 1JXOA 2FF7A 1VCNA 5EP4A 4D4JA 4HAXA 4V0ME 2QE7A 5B64A 2CNWA 2GEDA 4DCUA 5J4YA 3EC2A 1ZAKA 1TQ6A 3K9LA 1XD9A 3TUZC 5KUTA 4UXJA 2BMJA 1U9IA 3QBTA 1K8RA 1AS0A 3DZDA 1TU3A 4LJ7A 4ARZA 2DFLA 2OO7A 3DZ8A 1G4AE 3UMFA 5HZKA 1DAEA 3ZVMA 2VO1A 5EE9A 5JFGA 4M9QA 4RD1A 4ZKEA 1R0YA 4OHYA 4FWIB 4A82A 1PV4A 2O8EB 3WMGA 2F43B 2H17A 3U7EB 1LF5A 3MUFA 3B9QA 1VHTA 2IC5A 4OI4A 4WZ6A 1GKIA 1QVRA 3KJIA 5GVSA 2WTUA 3ZLJA 3ETLA 4TQAA 3LW7A 3MD0A 3EARA 1VCIA 1OLOA 4QRHA 1W4BA 3S1AA 4JKYA 3W34A 4MQBA 1Q1BA 1US8A 5CM9C 5KPJA 3DM9B 2ZANA 3QG1A 5FOSA 1A1VA 2W58A 1KI4A 3RS7A 3L0OA 3MWLA 2WKQA 2RB4A 1E1QA 2R65A 2CL7X 3CNLA 2ORVA 4LBWA 4A0HA 1A82A 4JLMA 2GAAA 1OYYA 4DC9A 2ZI6A 3LVRE 4QXAA 5C4MA 2F9MA 3BBPA 4BLSA 2UZ3A 4F4JA 1TQDA 3E1SA 1XXHB 4IEEA 1JEDA 3MLEA 1DO0A 3OE7A 1ZM7A 2VTKA 2VSXA 1EFRA 3CBQA 5C2JB 5HZHA 3QY0A 5HTKA 3FMOB 4RFSA 2BCJQ 4GP6A 1FX0B 4B34A 4MRNA 1EG7A 1GVNB 4KI0A 4N0DA 3MWYW 2GF0A 1N6IA 2QA5A 1KDPA 3GEIA 1AA9A 3KTAA 4TLCA 2QORA 4ESVA 1HUQA 4FCWA 1GIAA 4L5BA 1R8QA 5B30A 2KI5A 5IT5A 4JLAA 4A36A 1ANKA 4LJ4A 1MABB 4B47A 2QMUA 2VHQA 1OIXA 1XEWX 1FP6A 2R8RA 2IA5A 4RFSB 2P0EA 3QF7A 1E9CA 4XOIA 1E2DA 2QTFA 3HR7A 3E5HA 1II9A 3VNVA 3BERA 4H9GA 1Z2CA 1XXHA 3P4YA 3IPXA 4QJ4A 1AS3A 1Z8FA 3LBHA 4URYR 1NL3A 4PR0A 3RLFA 1KJWA 1FQKA 1GOTA 2G3YA 1TADA 2C2HA 4A0FA 5FTLA 1E9DA 4BFYA 2ODEA 1H8HD 3AF4A 2RGXA 2QQEA 2YHSA 1N25A 2DY1A 2G1JA 4IDPA 1IM2A 2B21A 3K9NA 4BZXA 5FUXA 4C4PA 2Z6VA 3VX3A 3DOEA 1Z28A 4HZIA 1MRSA 4GFDA 4DRZA 3Q8XB 2OM2A 4HDCA 5DYIA 1OIWA 2D2FA 4OQMA 1RYFA 3EXAA 2YOGA 2JJ2A 3KKNA 1KJYA 3AEZA 4IOKA 2R2AA 3PJRA 1DAHA 2OAP1 1ODFA 1FUUA 3OFNA 3K0FA 2J0QA 3ZD7A 1JECA 4HZUA 1HH4A 1U98A 2VP2A 1JPJA 5AWFC 4BLQA 1OHHD 2EQBA 2GCOA 3FHTA 2QEQA 4U7DA 1Y3AA 2EYQA 2A5JA 5DI3A 3MMPA 2W2XA 4RCYA 4MDEA 2Q9CA 3B1VA 4JVSB 4JKIA 1MO5A 4RFVA 3ZQ6A 1ZD9A 1DARA 4QGGA 5AK0A 4NYJQ 3SQWA 4P4UA 4FIDA 4PC6A 2QT1A 5FUVA 1J8YF 1W47A 1FX0A 2QMHA 2GA8A 3W90A 2ZUBA 2VP5A 1U2RA 4P32A 2RHDA 3HU2A 3I5YA 1NNEA 4OHWA 3A1UA 4P31A 4LK2A 1U90A 1XEXA 3GP8A 4DSOA 2J0SA 1T9HA 1J7KA 2VPPA 3O8RA 2A9KA 3SYKA 4C0KA 2A30A 2W0MA 1Z6AA 5B57C 3L82B 2WWGA 3OE7D 5CM8B 4G1UC 2FOLA 1G5TA 3CX7A 3OAAA 4FXPA 4Q7JB 3U7FB 2WIBA 1GL7A 3SC3A 1IAQA 2ZRKA 2FMXA 3EPLA 3V4FA 3EZFA 2ZSFA 3BXZA 4JVNA 4AKHA 2WJVA 3QI2A 1BKDR 3TAUA 3THYA 5DH9A 1VIYA 2XZOA 2NZJA 2KBEA 3KQLA 5C18A 4HB4A 4JLPA 2ECKA 4JL5A 1U0JA 4LHXA 1CS4C 4KHZA 4OI2A 1FUKA 4UNPA 1JR3E 2WWFA 1LB1B 1OF1A 3HYRA 4PFSA 1QHIA 1NN5A 1XMSA 1S9HA 1E0JA 1Z22A 4UJ3A 5HPYB 4XIGS 2YINC 4D82A 4DT1A 4D25A 3AVWA 4JLJA 2GILA 1XZPA 1IOZA 4DSNA 5G40A 3ZIAA 4B2LA 3LWNA 5H8WA 421PA 4XH9B 2JLUA 4C0JA 2ZI5A 4IJMA 4JJKA 3EA0A 1RJ9A 3VR6A 3RRMA 2V1UA 1W5SA 2DCUA 2HCJB 3PUYA 2JLZA 1XJCA 2XTMA 1KZGB 2RAPA 1VECA 4MKIA 4AK9A 4C0LA 2Q0HA 4TN1A 4NCIA 3DPUA 3NXSA 1W0JA 4GP7A 2BJWA 3W8RA 1A2BA 2HYDA 4LBYA 4YDSA 2J1LA 4G5OA 2B92A 3BH0A 4ZO4A 4YMWA 3C14C 4HAWA 5FR2A 3SYLA 3LAWA 4GBMA 2OXCA 5FTNA 2WPDA 1MRNA 4HLQB 2XB2A 2Z4RA 5FOXA 3SFVA 3U44B 2IYRA 1H8HA 3D31A 4NYIQ 5J5CA 3FB4A 5FTKA 2WKPA 1E3MA 1QHYA 1S8FA 3B60A 3EIEA 4V0KA 3W9YA 1TEXA 4DSTA 4LYAA 4V0MA 5J4VA 4KFUA 1O3YA 1CR4A 5BWMA 1E2MA 1Q22A 3ZZUA 1CP2A 1G21E 4Z1MD 3WXMA 3ONWA 1FTNA 4JSYA 4JZKA 1P60A 2HXSA 2IUSA 4MGKR 4L9WA 3RSLA 1XB2A 1Q3TA 2AL7A 2PJZA 2HUPA 2GBLA 4AKIA 1XX6A 4Q9JA 3BFXA 3DMNA 3QKRA 3TR5A 2QP9X 1K6MA 2ZROA 5LDDC 3EPJA 2GKSA 4KLNA 3PCRB 5FR1A 4HAUA 2IL1A 3GJ0A 2VF7A 4LCBA 3G0HA 1D5CA 3RSOA 2R6CA 2Y8EA 2OZEA 5A5GA 4DLUA 4B74A 3U44A 1G3UA 2JLRA 3GCGA 3P32A 2QBYA 3T5DA 3BC1A 4RD0A 3ZS8A 1XD2B 2ZSBA 3LLUA 4F93B 3TUIC 2EFDB 1G291 2N46A 4LRWA 1FPMA 5KU1A 1P9NA 1Z83A 3NKVA 2VA8A 1FZQA 1COWA 1QHHA 4LSGA 1JQJC 4F92B 2P2LA 4TLAA 4ON9A 1N0WA 1I4TD 2GZHA 2JEOA 2Z4SA 3TK1A 2MSEB 4BLOA 4PPFA 1FQJA 1RRFA 3A36A 4EPWA 1XMJA 3CF0A 1E69A 3QVUA 4DWJA 5FPHA 3LXRA 2Z5FA 2ZE6A 4Y0VA 1NMYA 2KJQA 3RABA 4FN5A 3K9HA 4A6PA 1CBUA 1G64A 1KK3A 3EW9A 1SULA 4LBVA 1XCGB 1E1RD 3K0AB 3ZIAD 1N6OA 3TNFA 2ONKA 4HB2A 4DIEA 1PUJA 3IHLA 4JT4A 2OV2A 2GETA 3HDTA 3LNCA 3KX2A 4B6FA 2BEKA 4HLCA 2QRZA 3JVVA 1W4AA 4EKDA 3IQWA 1IJEA 2DWPA 3NH6A 1TU4A 2J0UB 2GK7A 4MUBA 3X1DA 1EESA 2BM0A 4E07A 3T34A 1NJFA 2G83A 4GT1A 3K0CC 4DDWA 1RRCA 4L15A 3QPVA 1TQ4A 2W2VA 1F2TA 2ZSDA 1VIAA 2EYUA 4Q1BA 5J40A 5FTMA 4I99A 4OHZA 1OFTA 3PITA 1Q1EA 4B3XA 2IYXA 2H5EA 4X8HA 1E32A 2IS6A 3NC1C 4S35A 4AI6A 2ZXUA 4F38A 2O8CB 4BFTA 3SJCA 3J81k 3AF1A 4TSFA 3ZDQA 1EFUA 2WPDD 3CKLA 2DFNA 3CRVA 1DE0A 3I61A 5JRZA 1NSFA 1EK0A 4JLVA 5L3SB 4IDQA 3NHAA 1P75A 2QAGA 3GFOA 4A0GA 4W5JA 3CNOA 5L3QA 1XPRA 3TKLA 1AGRA 2AX4A 1BO6A 2V54A 4AURA 3PFIA 4QHTA 4V0NA 3X1WA 2V7QD 5J47A 4M53A 1KY2A 3NHBA 3VR1A 2P6RA 2WJIA 3BH7A 1EX7A 1I4LD 5DO9A 3BRWD 3EA5A 3B2EA 4JS0A 1Z0DA 3CX6A 4D6PA 4KCGA 4IVRA 3EIQA 2PZEA 3FFBA 1R6BX 2HLDA 3WY9A 5G41A 1M34E 3A4LA 4CDGA 2CK3A 3MWKA 3O8DA 2WV9A 3ICQB 1NKSA 1T8UA 1SXJE 4S2EA 3NG1A 1II0A 1GM5A 2WBLC 4A6XA 1DELA 1KKMA 5EZ6B 4A2QA 4PC1A 3CPHA 1RVDA 1AN0A 2PLFA 2ZI4A 2GXSA 1NLFA 4QJ5A 3IHWA 5CDFA 4DCSA 4BLTA 2JGNA 4TLBA 4Q4AA 1VHLA 1E9RA 3TMKA 1ZCBA 3VTKA 2VSOA 4RCZA 2OFWA 4MDFA 2DWOA 2J0VA 2ZAMA 4HZUB 2G9NA 2QSYA 2QUZA 4E09A 1KSJA 1RYHA 2OLKA 4JVLA 3GLIE 3W6NA 1OXTA 4DCTA 4DLWA 4TL6A 5E4FA 1Z0JA 2NO0A 4BFXA 4QBFA 3RS0A 2RGAA 1YE8A 2QSZA 3VX4A 2WSSD 4BFZA 3T12A 3FE2A 2ASEA 4KYUA 4PSAA 1R4AA 1FP7A 1UBFA 1F2UB 1MO4A 2GHIA 1AQYA 1DTSA 1JJ7A 1X8LA 4NL4H 1CKEA 3UWOA 4BFSA 4KITB 2CE7A 2IXFA 3BWDD 3H86A 3WHKA 3I5XA 2V9PA 2ZRMA 4Q4LA 3SE0A 4C2UA 1TEVA 1NMZA 1VYUA 2NPIA 3GJXC 3CIOA 1VCOA 3LW8A 4HLUA 1ZUNB 3RVBA 3VQTA 1D9ZA 4GOXA 5JSZA 2MMGA 1PVOA 5CLLA 2ERYA 3THXB 2X19A 1P61B 2BVNA 3GLFB 4ILEA 2CMKA 3A58B 4FMCB 5AUNB 2CBZA 3UK6A 1XCPA 1AM4D 2AD1A 3K0SA 1Z0FA 2CJWA 4KYIB 1JNYA 1QZXA 4PAMA 1VYTA 2B7CA 3EPKA 1YZUA 4LJAA 4TZ0A 4V03A 3T15A 2BV3A 3DKPA 1U8AA 2FE4A 3CX8A 2G0NA 1X6VA 4NYJR 3P27A 4D81A 3M6AA 5JBQA 1SKYB 2OXRA 2GJ8A 3HR8A 1SZPA 4QG7A 1NLZA 3HU1A 2YWGA 4BGDA 1QBKC 4B43A 1JPNA 1U0HC 3TIFA 2QQ0A 1OXVA 1SVLA 4TSFD 3RRNA 1E1RA 4XSGA 1HA3A 4B35A 3ADCA 1DAIA 2J9RA 4CEHA 2FSGA 3MCAA 3QPUA 4MRVA 3VFDA 3A1WA 1SHKA 2ZYTX 1LNZA 4L8GA 2LCFA 2O8FA 5EUMA 1ZUHA 1JR3A 4Q03A 2BOVA 4UXHA 2Q21A 4WAUA 5F9FA 4HEJA 2RCNA 3IBYA 4OI0A 2Q9AA 4XSHA 4URUR 4J0QA 2CVFA 1BOFA 1Z07A 1YJ5A 2Q3MA 3IIJA 4D2IA 5BN4A 1E2QA 5AJYA 2EFCB 1KI7A 2ZRPA 5KO2A 2WJHA 3AF0A 3M4YA 1E96A 3WYAA 5GJBA 2GXUA 3Q9LA 3SHWA 4WXPA 2FEMA 5HKKA 2D62A 1ZBDA 3TGPA 2WJGA 4BRUA 3RS2A 3T61A 2EU8A 4TYQA 1V43A 4NCHA 2PLRA 1JAIA 2WJYA 5JLJA 1EFCA 3U3KA 2ERXA 1MO3A 4DB2A 4O2LA 4JLBA 3GLIB 1SVIA 1E9AA 3FHCB 2P5SA 2ZVPX 4M0LA 4N3NA 4B73A 2HEIA 4Q9IA 1N5KA 2FFBA 2P67A 2QTVB 5LD2B 3AVTA 4Q1AA 2BEJA 3U3OA 5EE0A 1EX6A 1SXJA 4HDQB 4JJZA 3WBKA 4KBFA 1KMHA 5TDHA 3BOSA 3A4NA 3OESA 4MKHA 4BRWA 2R44A 4PZZA 4D4KA 3HP1A 4C0HA 2NG1A 4M4SA 3CR7A 3U7HB 2V7QA 3AKEA 3FDIA 3QXSA 3DDCA 1MO6A 1P4SA 3IO5A 1F48A 3Q5EA 1A7JA 3HYTA 4URVR 3PR1A 4OQLA 2IEYA 4O0MA 5KHOC 2HV8A 3PEVA 1F6BA 4X8LA 5EP1A 4YMUA 3U61B 5F9HA 1FNNA 2O5VA 1WP9A 3U6BA 5LD2C 2WSMA 1KAGA 2R62A 4KBGA 1A4RA 1KIMA 1AS2A 5FUWA 4B2IA 1Q3HA 3CPEA 1U8ZA 3UG7A 5JWOA 3L8ZA 3U4QB 1JR6A 3C16C 1DO2A 2IYTA 4LJYA 3KB2A 4EJSA 1ZVQA 3FMFA 3MFYA 1OKKA 2XJ4A 5KDOA 1F60A 2IYUA 2ZRDA 4YC7A 2BCGY 1YU9A 2YZ2A 2J41A 1CJKC 2PZGA 2H92A 4RY2A 2IYQA 2HLDD 3NIBA 2B8WA 4ITRC 3I32A 4MGYR 4UQOA 2VSFA 1KO8A 1X3SA 2QN6A 2QENA 1J70A 3ZVLA 2J87A 2DFKB 1J90A 3KUDA 4X8MA 4AKGA 4MA4A 3N2EA 1E2LA 1UPTA 1DAGA 3R7WB 2ZRGA 4QNMA 2OE2A 3C5HA 5JECA 2X2FA 2FFHA 4II7A 1N6NA 4P4SB 3CWQA 3D8BA 1OIVA 2Q6TA 5AUOB 2QI9C 4CRWB 1XEWY 3OIYA 5EZ5A 2O8DB 1LS6A 1TF7A 3W6PA 3GLGB 2RKOA 5DE3A 4K81B 2JJ1D 4M9ZA 1LFDB 5EP2A 1UKEA 3CH4B 1XTQA 3L2OB 3LV8A 2D06A 2ZR9A 2ODWA 3SBEA 1GL6A 2GEUA 1ZM2A 1T0JB 1YQTA 3GEHA 2WSSA 2E1RA 2EW1A 4Q9HA 1HE1C 3W5JA 2AWNA 1Q1QA 1Z0AA 2RGNC 3RWMB 2CJWB 4V0OA 4BLRA 1T3SA 4EAQA 3RWOA 3B7GA 1XXHE 3RRZA 2UVQA 3E2IA 1TQ2A 2G1KA 4HSEA 1G20E 1D2MA 1UAAA 4GDFA 4Q7KA 3HU3A 2ZAOA 4IVQA 5JSZB 2PT7A 1RKBA 4IVPA 1WBDA 2NMVA 2ZIAA 2ZRCA 2XB4A 1N2CE 4Q1EA 1P73A 2JIZA 3PV0A 3QF4B 3QUSA 3BIFA 3V4RA 2Q3HA 3NC0C 3M0EA 3B82A 3TLXA 2ZYWX 2REOA 4PX9A 2FDCA 4TLEA 2VF8A 1AZSC 1G7SA 3THWA 4ACAA 4TYYA 3BS4A 1HY3A 2XNDD 4Q1CA 5SZIA 1TUEA 2ATVA 3WYFA 2REXB 1E0AA 2WWXA 4FW9A 4M1TA 3THOA 3U3MA 4US1R 4LZZA 4OBEA 4M8NE 2XITA 1ZNWA 1H65A 2D4HA 2H18A 3BJIC 2ZJ2A 1IN5A 4YQFA 2XXAB 1KI6A 3SU8A 3A6PC 1YR7A 1NVXQ 1IN8A 1FNMA 5SZHB 4AWXA 2R6DA 4C0SA 2EWWA 1L4UA 4HB0A 2C04A 3GJ8A 4TTRA 4RJLA 4BASA 4XWOA 3LA6A 4TMTA 2FPKA 1Z06A 3TQCA 4DLXA 3REFA 3IKJA 1HURA 1E2HA 1CR2A 1ESNA 2F9LA 3MRSA 4GOKA 3W3AA 4QOSA 3T1OA 3BORA 5F2EA 1OKKD 3FWYA 3SFZA 1G1MA 2YNMA 1OXSC 1YR8A 3K0EA 4LDJA 5JEDA 1YKSA 1OB5A 5M04A 2CLDX 3SNHA 2BBOA 3QPWA 3A37A 1OPXA 1BMFA 4CT5A 3QKSA 1XBTA 4AYXA 1X8KA 3G82C 4B75A 5ELXA 3GLGE 1G7CA 4URZR 3U7GA 4JL6A 3B5JA 3ZJYA 5LB2A 1OH8A 5L3QB
chains in the Genus database with same CATH superfamily
3J7TA 3R24A 4CKXA 2XWBF 3B5IA 4PAOA 3URMA 4OHUA 4WCVA 3EVCA 5IK2D 3ZU4A 4R2IA 3PPWA 1N8TA 3EASA 4A8JC 2O2CA 3BXXA 2G88A 1NG9A 3BMOB 2YH2A 4LHEA 3DAGA 3GJZA 3EOAI 1XP8A 2ZCUA 1K7YA 4C3OB 2Z2JA 1NT2A 3UW3A 2NV2B 1WEHA 1WBJB 2ZBEA 1Y6JA 3GUYA 4A15A 4P36A 4DA4A 2FQYA 4U5XA 1NRWA 1P2FA 1UM8A 1TE2A 3VMMA 2FX5A 3SGLA 1C8BA 1Z12A 5CYOA 4P84A 2ZZKA 4RLQA 4B7AA 1TTTA 4MIEA 3V4VB 1MN6A 2OOKA 2W93A 1G0OA 3JD4A 1YBFA 3AZQA 1PR3A 3S0JA 2ATXA 5JI2E 5JZBA 1P62B 2PO5A 1KKUA 1N2EA 2E6KA 2NAFA 4KN5A 4OV6B 5DCUA 3TI9A 4YVFA 1LVHA 2OCIA 5EIAA 3FGOA 1B6TA 4TMYA 3A2KA 4U63A 3R6LA 4RKRA 4C4ZA 1XPUA 4H1UA 1NRJB 3L8CA 3FOZA 1N3IA 1XFDA 3AJAA 3GLTA 3B20A 4FS8A 3ZWOA 1GQRA 2Q8QA 4NCNA 2HXYA 4NCXA 2OT3B 1AKNA 3NBZC 1INLA 3K94A 1D2EA 2CB9A 4CMBA 5HXAA 1DOAA 1FYVA 2WM9B 2Y9PB 4PC3A 1KHHA 4U2CA 4ZDWA 3T54A 1ZM3A 4YUAA 3AUTA 3D2CA 2M2IA 5F73A 2VJOA 5JAHA 1FLNA 1JUDA 3HXLA 3VAYA 2WMNB 4C1NA 1LS1A 2XOEA 1YWGO 3LY5A 2CZQA 3ZDZB 4YJHA 5FWAA 2HH9A 2OCPA 5AVYA 1FVHA 3ETHA 4PO8A 3DMRA 1JXAA 1F6WA 5CEJA 3JAMA 1AGPA 2WABA 1IJFA 3TSYA 2FSFA 4CM8A 4OFWA 4PCAA 4MZXA 4CR8A 1A95A 1QHHB 4DRXB 1WQ1R 1RE0A 4I3FA 1OE0A 3HB5X 1KPIA 3KZNA 4IMRA 3B1KA 4E5UA 7REQB 3QF4A 2JD2A 4UOZA 4G0UA 2HHCA 2F8SA 1M2WA 1GPLA 2O3SA 3JPYA 5I9BA 2B36A 3QUAA 5K2MA 1EBBA 4QNRA 5KCZA 4N5MA 4LY3A 4C0QC 2I62A 1FFSA 2OWDA 3Q1KA 4NMXB 1XPRA 2P5YA 2QBYB 4MLCA 5GINE 2WWVD 4ZJPA 5T41A 4UTPA 2DWQA 2MR5A 4OLHA 3AUSA 4GZLA 3U16A 1EWVA 2FWRA 3BVPA 3GBSA 4RLSA 1F0KA 5LP1A 4JBWA 5A3JA 2WV7A 5IUNC 2FPRA 3V7NA 1A9PA 1PJ3A 3R1IA 1GTJ1 2PGXA 3IPRA 3P1JA 4LPKA 4TMXA 2AE2A 4WBSA 4DOMA 2H1OA 1W7AA 3I72A 1TAQA 1BYUA 3QUBA 3ZZ1A 2LIPA 2IS1A 5B3JC 1RXUA 4G4JA 2ILVA 1ZMOA 1EPUA 1XVIA 4D3ZA 1ZK4A 3GVPA 3N75A 4IHJF 2CV2A 3PPIA 2DF8A 2BFBA 5AK6A 3M3DA 3C24A 1P39A 1U5BA 2G72A 4K6CA 2F64A 3IKMB 4AY2A 2KE5A 3KXLA 5IZCA 1GADO 1VBKA 1N1EA 1B8OA 4D80A 3BWMA 3PTZA 4B79A 2AT1A 3CLRC 3DOFA 3PUWA 2R3SA 1EK1A 3BILA 3EMDA 3RW9A 1DC6A 2DQSA 2X9NA 2Z1MA 4NESA 4UTOA 4LDZA 3RTAA 4EZIA 1NM5A 4B3MB 4Q19A 2H2DA 4L16A 1SEVA 1GJRA 1GRQA 1R0ZA 4UNRA 3JQAA 4TUYB 4WASA 1XMVA 3ETNA 3R7WA 1RXEA 5A7HA 2ZBFA 4AMGA 1PUIA 4YRFA 4OBXA 1JHYA 3O83A 1X1RA 3TZKA 2ZPUA 4FW8A 1YVUA 2ZBPA 3R7FA 3F3SA 1ODLA 3A2LA 3HKCB 3L8YA 4KIWA 1QDEA 4GZ3A 4LY0A 1JA0A 3I1IA 5AKLA 4RKEA 4EW6A 4OHVA 1FDSA 1QK4A 4JJGA 4YB8A 3EGVA 3QV1A 1YRBA 5DNYB 4QBTA 3EMVA 5BW6B 1BS1A 1DV2A 2Y67A 3I6IA 3EAQA 3UF0A 1VL1A 2ZVJA 3X2SA 5LKRA 3FYUA 2SECE 1VDZA 2NSJA 1WXHA 3QA9A 3HPQA 4UUOA 5BV7A 5B6IA 1JWLA 1LPNA 3G6WA 1PW7A 2OHGA 5K3CA 4NDAA 2WAYA 4DDKA 5GTDA 2Z09A 3GFRA 4MB2A 3CEAA 3VYWA 4AYWA 4BB9A 1O95D 3R7NA 2EF1A 1WW3A 3I9KA 2C4WA 3DXZA 4BB6A 5A4MS 1ZUWA 1HG0A 3UGQA 1WO8A 4K03A 2VHVA 4QHYA 4P4TA 1CP3A 5JRDS 1IH8A 1Y6QA 4Q1DA 1C7FA 3WLNA 3N5CA 3P19A 2XDQA 5M5BA 3FUWA 4X1IA 4ZREA 2DJ5A 3OKPA 4R8MA 1P2UA 2QRJA 2CHQA 1CS0B 3SP1A 5D5PA 4EL0A 4JBIA 1LWNA 1KNXA 4HHEA 2JFXA 3NYRA 1XJQA 3O4GA 4UAGA 2ARKA 2PSEA 2TECE 3F4BA 1ZA2A 4Z6KA 2RHRA 4A91A 2CZGA 3VYRB 2EKZA 4KL8S 1YHYA 3HGTA 5CLQA 4OX9B 1RWWA 4DFDA 2WIJA 1MBZA 1QRDA 1KJIA 1G8JA 2I9PA 5JRJA 1Y63A 3R3JA 3ZXSA 2HRZA 3ZKWA 3PA8A 3A70A 2ZDHA 4MI6A 4O02B 3KKQA 4KN8A 1NDUA 2C1ZA 5AM1A 4JXZA 4BWVA 2Q4DA 4B83A 2GN4A 1BG6A 1IHUA 3HUTA 4LN1A 1X87A 3SEFA 2WB4A 4D9BA 2M32A 4HX2A 4E4TA 821PA 3BMCB 1JI0A 2JATA 3MW8A 4Z99A 3MJTA 4X6XA 4J7UA 4KODA 3ZIUA 3LQRA 1DJMA 3O5AA 2OXEA 2Q1XA 1DKPA 3PXBA 4ZJZA 1A5TA 4EYGA 3LMKA 4MYTA 4G25A 3MLBA 1MAWA 2AE1A 4JZYA 1KMCA 4PBSA 3SC2B 2X5XA 2WVHA 1IB0A 2PFKA 5EMLA 1DU4A 4AIIA 4YRMA 4B82A 7MDHA 5AVXA 4QM6A 2A5FA 2CFIA 1PQ4A 5DIFA 1VJCA 4O2AB 4WESB 3UHOA 1Q6YA 5MF6A 2I8CA 1FXUA 1N5RA 1S2IA 4PHHA 2XODA 4N8SA 2ZUTA 4AP6A 2H6EA 3DW3X 3IBFA 3PGA1 4U8HA 4FFBB 3ZXUB 1EIZA 1L3IA 1PZFA 2ZRFA 3GCDA 4FMCF 5F1PA 2J7PA 4FDUA 5CFPA 3MCUA 2DFVA 3V1YA 4ZYZA 1UEXC 2EF0A 4JBYA 1IY1A 3H9BA 5F1OA 1P2TA 3ZYCA 3DHVA 3BWYA 1JJVA 3GARA 3BUSA 2VHUA 3TBFA 3M9WA 2M1XA 4XM1A 4YLGA 2AJTA 3P0FA 4HQ0A 2D0DA 3MK31 3TAHA 1N78A 3B51X 1P5JA 4OJMX 4H3KB 1XFAA 1ZCFA 4ZZIA 5ECDA 4N47A 1W2HA 4B3GA 3ZPXA 4AJLA 3KZVA 3P94A 4MQFA 3FW1A 3Q3IA 4Q5IA 1GUAA 2R8EA 5K0GA 5TV2A 2XYGA 1D5WA 1VL8A 2CNNA 2W83A 2XAUA 4P2BA 3W5UA 4DVJA 3NONA 3FHOA 1OXUA 3FKSD 3OZRA 3NC4A 4H6VA 4UQPA 4LF5B 4F6RB 4EYEA 1JTEA 1CSEE 1TT5B 4PM4A 3GGGA 4JLKA 2IHZA 4IRXA 3RS3A 3IQHX 1XMOB 3COJA 1TA4A 3K70D 3GBPA 1NW4A 1Y7IA 2YHAA 2O57A 1OZHA 3MB5A 4M0DA 4XR9A 3SXUA 3QEBZ 2AFVA 4NH4A 4Y2PA 5K6RA 4DV1B 4RCVA 3KEOA 3TQFA 4EA9A 4NXMB 1EVIA 3HO8A 2PGNA 1YQGA 1Y3DE 3EDCA 2Y0EA 4O25A 1MO2A 2EP7A 5F64A 3DGFC 1EAYA 1GTMA 3TUJC 5IDYA 3UNXA 1M0TA 2LGJA 4LC0A 4WGGA 2CLLB 1J5XA 3ST7A 4ARCA 5FOVA 3IAFA 5D1NA 2FJ0A 3GJRA 2FUCA 2H0RA 1E89A 2O6LA 2F8MA 1HT2E 1Z4IA 4GVLA 2O8FB 3EUEA 3SFTA 3FTEA 3UN1A 4RHTA 2EP8A 5JO0A 2BKLA 1FLAA 3BTSA 1YRQA 2CJFA 3TW4A 3I8OA 3AL3A 4KQGA 1KMIY 1XAGA 4TYNA 4NNPA 1QS0A 2FKAA 1P8AA 3KUKA 2RGBA 3DB2A 3H9QA 3OIVA 1ONPA 4J91A 4ZCMA 3DLBA 2J08A 2H2WA 4C3ZA 1T8PA 5CFNA 1L7OA 3KTAB 4I8XA 2LW7A 2HA4A 2J4CA 5J5VA 3UAVA 2YKGA 1QP0A 1VSQA 3EF0A 2NVBA 4NMLA 4DJFC 3HYSA 1TQ8A 4JX9A 3KKPA 3BGSA 3SBXA 3TE6A 2P4HX 2L17A 4LVCA 1U28C 1U5CA 1JAXA 1H93A 4EI8A 3B1YA 4GMFA 4W7SA 4YCSA 2W90A 2Y2UA 6REQA 3TZQA 2NADA 2X1VA 3QBDA 2ZIXB 4K6MA 2UUCB 1VPLA 1OYWA 3NTLA 2D2VA 2Y77A 1OXXK 2VDJA 3MBKA 3D8NA 1OTYA 1U8CB 4LPSA 3U3ZA 1IBMB 1ZUNA 2C9CA 4I08A 3EVBA 3TCKA 4EG4A 2VPXA 5E38A 2J45A 3N7AA 2RGRA 2Z8XA 3H4IA 3LNTA 3LPDA 4MOWA 1NVVQ 4UXIA 1QHXA 2XUGA 4PYMA 3DOHA 1SXJC 4GPIB 5ILGA 4CGZA 2QTHA 1PJ2A 1E5DA 2RJNA 4ZZ3A 3P97A 4XJTA 3VR6D 3QMWA 2GF9A 1Q57A 4X61A 3B3FA 4BIIA 4ZI7A 5FADA 1UMBB 3CVXA 3T9AA 1I1QB 1KS2A 1KSHA 1NBMA 1U9IC 2DBRA 6AT1A 2JJ1A 4HADA 1KK1A 1M83A 1B0PA 2PN1A 2ZJ5A 4M83A 4RPCA 1YC2A 3GFTA 4YT8A 5CIWA 3QXHA 4EHBA 1BJTA 3HJAA 3P9NA 2DTDA 4Z53A 5G53C 1N9ZA 3C45A 4RABA 1HNWB 2Q99A 3SQLA 1QPZA 4PZEA 4EUNA 2GZ1A 4R9SA 2CEAA 1V4BA 1V3TA 4RD6A 1T15A 4XUCA 1N5JA 3RVLA 4TV8A 3FMIA 5JIBA 4AJ4A 5K4HA 1A96A 1MKYA 3N86A 2HA7A 1I4DD 4DJDC 1Q3KA 1QF9A 4NZ9A 4H0CA 5COAA 1IHDA 4GDMA 5BMOA 3B6ZA 4NK5A 5F52A 2JL1A 4KB5A 4R98A 4TS1A 2LCQA 1YS2X 4I4TF 3GHHA 4ZVRA 3X44A 4C03A 2F00A 3W5CA 3SR0A 4WFQA 4O2BB 3QE4A 1G8AA 3ONNA 4DHEA 2AR9A 2P27A 4TL9A 2I6TA 2O3TA 1XTIA 3TQSA 3RYHA 4ERNA 4C07A 5BQPA 3EG9B 1HLDA 2IW3A 2FG7C 2XNSA 4FCCA 5EZYB 4EL5A 1FSPA 1EWYA 1H94A 4K6GA 1GZDA 3NW9A 2BMDA 5DHSA 1CQIB 3A4YA 3AHIA 3NORA 1PJBA 2GNPA 2WOJA 2TMKA 4GYKA 4NQZA 4ONEA 3BZUA 1JHDA 5AOCA 1ZGGA 3HVIA 2XRZA 3M1IA 4I9GA 1RYYA 1JR2A 4B3FX 3C2QA 2V6JA 4PU0A 2HDWA 4BV8A 3B1JA 3HB9A 1JU9A 2H3HA 2PNJA 4HUTA 2IY8A 4L1KA 4AY4A 1W35A 3OTIA 2PWZA 4QQNA 4JIMA 1RFLA 1WCIB 1HMYA 4WIAA 5ALPA 1AMUA 2ZRQA 1ZR4A 1ZR2A 1KFCB 2CFCA 4EB6B 3TXYA 2VP3A 2ABWA 3AHDA 5BUQA 4MUXA 5IC5A 1KIFA 2QU8A 2V3VA 4YMSA 2BGUA 1JVBA 2XKKA 4KP7A 1EWKA 3PXGA 3T5AA 1Y8ZA 5LQRA 2V96A 4IHJB 2O59A 1YDFA 2JBAA 1O0CA 1MEEA 1UFQA 1QB8A 1QZTA 1XKQA 1XD2A 3KKMA 1K89A 5E3JA 5LYYA 1YZTA 3MG9A 1CUHA 4HDMB 1QYIA 3W8FA 4D9IA 3ZVNA 2XOKA 4O4JA 3I62A 3RFVA 2W2PA 4FOTA 2BAGA 4R1PA 3ESRA 4DG5A 1FFCA 1YAJA 3C4JA 3R6DA 1AC5A 2C96A 3PNQA 1GRNA 1M2FA 3C3DA 3O7MA 4I50B 2QX7A 4JB2A 4LDQA 4TKZA 2B9VA 1ZM4A 1FYFA 5DLYA 1D8TA 2Q9BA 4UKDA 3IT3A 4ZVLA 1KH2A 4IHQA 3NKFA 1UEIA 3AKCA 3NJ8A 3O2SB 1C4WA 4FK8A 4A8JB 2ZUUA 3BGDA 4Q4DA 4Y9SA 4Z8YA 3N2KA 3OI7A 3PDWA 1E98A 5E1MA 1CLUA 2M6LA 1XQYA 3HI6A 3FPAA 4A2WA 2GCPA 1TMKA 1BWPA 2OMEA 3T7RA 4ARAA 4EHJA 2V65A 1VG0B 3V48A 2SKDA 1RC0A 4IJ5A 1NKVA 2D1TA 5D85A 2QZPA 1R27A 3ZJ5A 5KNBA 1BA2A 2ZB7A 3G9ZA 5KVCA 2R5FA 2HJSA 2Z04A 1XU7A 4BNHA 1G7TA 5G0VA 5ICGA 3F78A 2XXAA 3VR4A 4ALIA 1I7PA 4P93A 3AEQA 1WMAA 2GM3A 4KOEC 5EQJB 1KHTA 4BNGA 3FZEA 3BDIA 4XTRA 4EFNA 4P83A 1H2EA 2A84A 2CVOA 3OIUA 4RF3A 4MWZA 1YZFA 3BWEA 3A4VA 4CZ2A 3CUEF 1MFZA 4OB7A 1RJFA 1QIMA 2HHJA 3OF5A 3STXA 1XZLA 4BP9A 1F8UA 5JH7F 2R6HA 3JQAB 4TUYA 1G8KA 1GAQA 4A8TA 3BRCA 1RHKA 7AT1A 3AKYA 1RADA 1TJ4A 2FVYA 2H4YA 5EIFA 4MUNA 1IBRA 5A3RA 3DBHA 2IDKA 3ELYA 5BMVF 5LN1A 2XMCA 4HLDA 5TNXA 4EJ0A 2RC5A 2QR5A 1UFVA 1N3BA 1NVBA 1U0NA 4FC7A 3F8WA 3AWDA 3PGKA 4DQUA 2C2OA 1VOTA 1ORDA 2VSQA 4LHYA 4C7KA 3ZBTA 3ZE8A 4YHHB 2J67A 1FMTA 1FRQA 2VT2A 3FBTA 5JC1A 3GFBA 4AULA 3EEYA 1J8QA 4N5DA 1JFTA 2JHCA 3WGTA 2MDTA 1X14A 2OV4A 4DILA 4P35A 2Q27A 1MTOA 2EJTA 2FSSA 1QIGA 3T6KA 5T6MA 4A8JA 2VJAA 3ZLTA 3IR6A 3LRPA 1E6CA 1R7RA 1SC4A 3T1VA 5KNLA 4B3HA 2JCYA 1U0FA 4XIJA 3UMBA 1QC5A 3KO8A 5AJVB 3A32A 5H83A 3H87A 4IV0A 4LZPA 3GZJA 3HN2A 3ND9A 4AZSA 1GYRA 1D2NA 4WNAA 3EVGA 2C5FA 2FGJA 4I14A 4YCJA 4BNDA 2RGEA 2EFJA 2GZDA 4LV8B 4NABA 2JGRA 4PG6A 4WMLA 2FEAA 2CHEA 4MV6A 2IHNA 5KVAA 5KTKA 1P72A 1I4WA 1MB9A 1J07A 2J9GA 2X8WA 5BQOA 3X1YA 2VHTA 3ICCA 2C3PA 1EK5A 4YJDA 2FZLA 2PPLA 3M1AA 4L4UA 2ONCA 5CA1B 3AUFA 1AU9A 1JAZA 2ZJOA 4CM8B 5LMCA 3QYPA 3IAXA 3HA2A 4NTZA 2VAMA 2VT3A 4WI1A 4EPRA 1AMOA 1CERA 4X3CA 3PXEA 1NNI1 1ECCA 2QOEA 2REBA 4NV3A 4BP3A 2K5UA 1ST2A 3L77A 3R7SA 1HNNA 4Q9NA 3O94A 5SICE 1GKYA 1JEJA 2YDXA 1RLOA 1W1UA 2GZSA 4Y2XA 5HW0A 5JHGB 1JP7A 1Q0SA 2I2BA 1F38A 1XLVA 2CF6A 2EFHB 2PZAA 4E6EA 5B4TA 1XEXB 1LI4A 2VUSA 1PIWA 2BZ0A 1C80A 2H5JA 3F6EX 2BDTA 1QX3A 1N7IA 1N0UA 3KSMA 3NNNA 3QITA 1SCQA 4KXXA 4U5QA 4ASUD 1J0BA 2WLTA 4GI3A 4B71A 4F06A 2JA1A 3BJMA 4QFMA 2IU6A 4QUHA 3W2EA 1XTJA 4X20A 2WIGA 5A9RA 2GPBA 1R0LA 3M70A 2FUKA 3IILA 2A0UA 2LDBA 2VP4A 5DBHX 1QIKA 2F62A 2XYQA 4JI4B 5AOVA 1CEYA 4OXQA 3RS4A 5C5IA 4JOQA 1DINA 1R8JA 4Q47A 1U1FA 3OAAD 4YAFA 2XZPA 3OP1A 3DEKA 4DLBA 1YU6A 4RENA 5ECYA 2ZCVA 1COWD 5GGYA 3WSTA 4URXR 5JDIA 1DQPA 1RWNA 2F2TA 4CKCB 1XMXA 2AMVA 1I8TA 1V2HE 2KBFA 4UC0A 2D5AA 1DT5A 3W0LB 1NV8A 3UK0A 4DUZB 2G67A 1N8SA 2ZG6A 1T8TA 1XA4A 3EWSA 4M7RA 3S8MA 1SOVA 4M99A 3E9YA 1T36A 3RIEA 3CY6A 4RPGA 3ROQA 1UKZA 3H84A 1E7SA 4X91A 2IYYA 3WDSA 3ZW8A 4C7VA 2ODQA 4IH9A 5L4SA 5TIIA 2IIBA 4DR2B 4MS4B 3H0KA 1Y8AA 2PBZA 5DXFA 1ADGA 5DSTA 4BQPA 1VBFA 5TJHA 4OL0A 3FAZA 5IKXA 4M88A 5FD8A 3PL1A 5KNCH 2CLEB 3ER8A 2CMGA 1N2OA 1OQAA 2POCA 4F4DA 3FOEC 5DCLA 5KWSA 3TQTA 1CZNA 3CG0A 4KSBA 3ZH9B 2QKYA 4RPLA 5EPOA 1HOXA 1JHPA 1XJ5A 2P6NA 2YC4C 1OBVA 4N3BA 5LDHA 4OXNA 1I7DA 1EGQA 1GPUA 3EEIA 1QGDA 4D9GA 1C7QA 1PLKA 2IYOA 4YAUA 3E3OA 1E2EA 2VJBA 3CE9A 4PZUA 1FRNA 2IYLD 1LVUA 3BTUA 3LDFA 2C1EA 2IXDA 3CS3A 4Q21A 4WCDA 4WZZA 3X1XA 1XMQB 4N8EA 1TECE 2CDCA 1P4AA 2DHRA 2OLJA 4XFJA 4AU1A 5FWNA 2E55A 4G1BA 4GM1A 1J9ZA 1FJHA 2QQGA 3QPBA 1M66A 4L08A 5TT0A 5IAJA 4D9MA 2Q07A 3GUZA 3LX5A 3FPEA 4ZOBA 4XJXA 5CEEA 1U0SY 3NM5A 4M0EA 1W59A 3M5PA 3ITKA 4IFBA 3UUFA 1PNTA 1X39A 3GP5A 3OTOB 1GCIA 2PGLA 1ORHA 2JANA 3FYHA 1FJ2A 4QGHA 1NBOA 3U62A 3R9KA 1JG1A 4CLOA 1QS0B 1ISHA 4IGIA 1YE5A 4MKGA 4JXKA 4ES6A 4JXXA 2O8DA 2H9IA 1U2TA 3M1LA 1H22A 1G3MA 1XDBA 3K8ZA 4CGYA 3MQ2A 5JDCA 4BNKA 3T1TA 4GLLA 2HDNB 3COSA 1VSUA 1EVLA 4L27A 3M2PA 1KAEA 2X9LA 4ZICA 2VXYA 3ZE9A 1WDWB 4PLGA 1R5JA 3FNQA 1O0SA 2NNLD 4FSHA 1J2UA 1TLLA 2UVPA 4J03A 3CF4G 4HBGA 2WM8A 1KP9A 2Q5JA 2JFGA 2C00A 1OLSB 1SY7A 1IZ9A 3S6JA 3WGLA 2PUCA 3KR1A 1HT1E 2QUBA 4D3DA 3FGZA 2C4TA 4H17A 1A2KC 2XKJE 3R5FA 4ZCTA 1G6Q1 4PG8A 1TK3A 1EP3B 1NG1A 2CXRA 1E2KA 4BQFA 1PQWA 2GZ3A 1VI5A 4DTIA 1KEVA 2ZEJA 2XGSA 4NMMA 4A92A 5JCZA 1R15A 3K0FB 5FPKA 1QM5A 1AZLA 1XT6A 1JWAB 5FTKA 3IMKA 4QYMA 4PXYA 2QSUA 4RWZA 1JZTA 4WZBE 3Q7RA 1VXRA 4KFSA 5IHXA 3K8OE 5EWMA 4ESHA 2H1RA 2MSLA 1RQLA 1Q12A 3JS5A 4PLZA 3QG5A 1Q2XA 2IPOA 4GKVA 1Z4MA 3Q7TA 3AFHA 2FHPA 4FB4A 2QGZA 4WLVA 3DDHA 4OJKA 1JALA 1J22A 2H5IA 1HYBA 4FS3A 2NVUB 2BFCA 1ZN9A 2QNIA 3CZ9A 4D9JA 3VYSB 4ZI3A 4GU5A 4ZAWA 3C6QA 2P65A 2NM0A 3ZV4A 3O31A 2KSQA 4M21A 1X1CA 5H81A 3IV6A 3TE7A 3LJKA 2ON6A 2CW5A 2Q2OA 8ABPA 4Z54A 3E1KA 1PZGA 1UPCA 2O1WA 3OM0A 1Y1PA 2PL3A 4KO8A 3W5IA 3E5RA 3HSKA 1C30A 4BLUA 4WY5A 3ZJVA 2O8EA 1GZ3A 3SMQA 4ZOEA 2A1IA 2JIOA 2QV7A 4AZ3A 3LXXA 3EBOA 3C7AA 2EFEB 5F4ZA 3ZZTA 2FJUA 3MXTA 5AKKA 1SVWA 4Z9YA 5LA6A 2FG5A 1CJUC 3A11A 2P8SA 3GJYA 2QU7A 2AQ8A 2H2FA 2BCEA 2OORC 5DWVA 2ISSD 4P4SA 3N05A 3H11A 4FCTA 5L51A 5IM5A 3IXQA 5T8KC 1PJSA 2AN4A 3HFJA 4PZLA 3A25A 3KQOA 1H0KA 3KXPA 4FFDA 1NJGA 3F47A 3I9V6 3NZEA 3T9FA 3GQBA 2DFTA 1BX3A 4Z3KA 3EQ9A 1CJBA 2WU1A 3JASA 4C2TA 4Z4EA 4LXYA 4QOJA 1XHFA 5FPQA 2GJ4A 2C5HA 1U0RA 1VPTA 3PL5A 4GNKA 3RAPR 1FPQA 4WOCA 2P9ZA 2IZZA 4I55F 3RYFA 3QEMB 4C06A 4F3RA 3CF4A 1W93A 4W1RA 2P4SA 1GNRA 2NTYC 4YLEA 3M89A 3EVEA 4G5XA 4L95C 2I0FA 1Y4UA 1J00A 4NAVA 3L8MA 3R9XA 3BQMB 2QWXA 5KJEA 1X7WA 2PIDA 2PUJA 3R9XB 1LEHA 3NHLA 1FSGA 4M89A 1RQPA 3Q3JB 4QTXA 4EBBA 2Q5OA 1QX4A 4P86A 4J3NA 3W9UA 2F48A 3RYFB 1VP9A 1JDSA 2R7AA 5TXGA 3LCVB 1U4NA 3CN9A 2HR1A 1AKEA 1US8B 2RHGB 4RW0A 1JGTA 4BBPA 5LYJB 2AZXA 1TTHA 2HQ1A 2OHHA 3GZTB 5LBIA 5BNTA 2WTAA 5DM60 4G5YA 3AFOA 3R77A 3A9RA 2D8MA 5FOUA 3HMKA 1XQ9A 3ROPA 4ZXFA 4JT2A 2X4GA 1GTZA 1PJCA 3FOAA 1QQ6A 1VG1A 5A7FA 3UCEA 3DE0X 3DJFA 3IVCA 4JX8A 4L7QA 4MDYA 4WKNA 5K3DA 3TX6A 4Z4HA 1P44A 1G8FA 1MA3A 5KTMA 1G7RA 1K75A 3IVXA 5BSRA 4GOOD 2LD4A 2C99A 3IBGA 4KGDA 4BFWA 1X1TA 5E9WA 3V8RA 2OCAA 1JEEA 2JFVA 2OBYA 2FFQA 3PQCA 2O23A 1V16B 4IIHA 2DECA 4L72A 4UUAA 3CRRA 4Y1FA 5CFQA 3A1TA 4HY3A 4Y7CA 3GLFA 4HEQA 4BC1A 1NUTA 3SR3A 5KYWA 4AJHA 4V0SA 1ODTC 1Y0BA 1HRKA 4MYHA 3IP1A 3RG8A 2EX0A 4MR8A 4O4IB 2E5FA 1GEEA 2XOKD 3IOBA 3DC2A 3W1WA 3FMPB 1ICEA 3KYJB 5FPYA 1L5LA 3LLSA 3P20A 4PYOA 1V3VA 2WE8A 3VPXA 4I9UA 4XYGA 1LW7A 4D0GA 1Y5RA 1FDIA 2AR7A 4C04A 4BFLA 5L3VA 2R0QC 4P80A 4F9GA 4HFNA 3PE4A 4L9AA 1BA3A 2VDRB 4M7PA 3RK4A 3UFBA 4OHKA 1IE3A 4DLLA 4ZV7A 3WS7A 4UU7A 4JCCA 3BMNB 3JQ9A 4H15A 4RXMA 4MRMA 1XLWA 3NBXX 4P33A 3E9MA 2GBIA 3TGWA 2OCGA 4ID3A 1ESEA 1T4MA 4LYHA 4TRJA 4FEYA 1B43A 1QUFA 3RBXA 4ENUA 1K63A 1XWFA 1E99A 4F0JA 5C7LO 3QMPA 3HU5A 1ILEA 3QVSA 5IVKA 4OHXA 4KPEC 5CJ2A 3T3GA 5EN4A 5JEEA 5G0UA 4LX8A 2HA3A 1Z2OX 1KZ9A 1MQ8B 3QLVA 3DKVA 4CM4B 2XCRB 4ZI5A 4HUQB 1EE2A 4CR7A 4UD2A 4V3CA 1T2FA 1MEJA 4G89A 1KEWA 2G8NA 1A50B 2PPVA 5CX1B 2ZJ8A 4BNIA 4EFMA 3C6BA 1A77A 4OOEA 5INTA 1YIOA 1MX5A 3JQEA 1UP6A 5K20A 1PNOA 3OD1A 1V6AA 3TQHA 1EXWA 4XUDA 4M9RA 4F2PA 1W5TA 4M1EA 5AJWA 3WKCA 2X14A 5E3HA 4YT5A 4Q6WA 1RMYA 1C2YA 1T2UA 2DQKA 1P3DA 2RHTA 1W6RA 4IBOA 5HFJA 1UZMA 1CUYA 1N6KA 4UATA 1Y8QB 4TWAA 4KH1A 2EC5A 4AN1A 4C7XA 3EULA 4G0QA 2IY7A 4FHGA 4Q4HA 5CT9A 5KYXA 4UVEA 3IJPA 5D3ZA 1D0IA 3CB2A 5A0VA 3DQPA 4BO3A 3D0KA 4R2JA 3U1BA 3A6LA 2ZT8A 3C8DA 4GXQA 1WW2A 2FEPA 3SI7A 1WD7A 1QQBA 2QM7A 3OT1A 3PIRA 4IDCA 3KUXA 3MIZA 3PXDA 2G8LA 1SD2A 4F4CA 2H31A 3I39X 4ZIRB 1IPEA 4HDNA 1PKEA 3KETA 4F11A 3F6CA 3Q7IA 1E77A 3KDAA 1V41E 4Q3CA 3AV3A 5FFMA 4OBBA 5DM4A 2W2LD 1IQPA 3E9RA 2Y1FA 3S1AB 1MH9A 5EMJA 2ONZA 2Y1GA 1Z4OA 2R96A 4BVGA 1RQXA 2BMFA 3FLEA 2QGNA 3ZY2A 5KPDA 1JFFB 3A4MA 5EWLA 2CLSA 3BCRA 2Q9UA 3L0ZA 2ZFUA 1I94B 1TMGE 1PL8A 1TF2A 1Y89A 3PUHA 1EJ2A 4HQNA 4MYSA 2YWRA 4OIMA 3RU2A 2P2SA 4DYDA 1I7SB 2LUOA 2ZUWA 2B8JA 4PFQA 4Q4JB 4YWHA 5EINA 3VAAA 3ISVA 3LXUX 2QDKA 2FQWA 3OSZA 3ZEIA 2D59A 4EDHA 2BW0A 2Q3JA 2PZLA 1CCWA 3BJZA 3DJYA 4W8HA 2RARA 4HWGA 1X7YA 3TR0A 2DOKA 3JQ8A 4EQ6A 1DKUA 2QUIA 3HY4A 4KFTA 4TLLB 4DLZA 3MELA 4ZU1X 3DP7A 3RTGA 4INPA 1D03A 2BTQA 4FYXA 5K9ZA 4ETMA 5JMWA 2LR0A 1LVGA 2A2ZA 4HQRA 4AROA 1NIPA 1ID8A 1J8MF 1G6KA 5MFPA 3TEMA 1SXGA 4OGLA 2D6FA 2R1UA 4IOLA 4ZT7A 4D9NA 4AJ9A 1DXOA 2V1XA 4G5FA 2YV1A 1Z7GA 2J6BA 2ICAA 5LPNA 4CMIA 1H85A 3LH5A 2J9FB 4JB8A 5B1IA 5FL7A 1TKBA 1PZMA 4TYMA 2F8LA 4JSRA 5IKMA 1NNSA 1SEPA 2XF8A 3OE5A 4PFJA 3QI7A 1YFJA 9MHTA 2HMSA 4R69A 4E94A 1K2WA 2VPYA 3DDNA 3CT6A 4MH0R 4MJ3A 2CNWD 1H0HA 1XK6A 1WQ4A 1U0TA 1YA8A 2EEPA 3COVA 2Y6VA 3DTVA 2DGDA 1RIFA 2XNDA 5ANRB 1ZD5A 4D3SA 2EZ9A 1K5HA 4RY9A 2OHVA 3EZYA 3EIFA 2XNKA 1ZA1A 3DV9A 2FR1A 3E9ZA 3P0JA 4DLVA 1DOZA 1HO3A 4JBXA 4MYRA 5ETJA 2P9EA 5G0TA 1R6XA 4B7ZA 4PGHA 3DTNA 5B5SA 5TARA 4BNYA 2ZITA 1YOVA 2XX3A 1RE1A 2RH4A 5E9QA 4ACBA 5CD1A 1M6EX 4I1IA 1E9EA 4C14A 3DOOA 4UNNA 5HTOA 2FRDC 1Q5PA 5B53A 2CXQA 2R5WA 3IE0A 2IP4A 4EK9A 5COQA 2VPIA 3U4MA 2FPGB 4G26A 3UJ3X 4ENTA 5E95A 1XXLA 2HBZA 4NZYA 2DXIA 2Q5HA 3P26A 2RHCA 5FH9A 5KTRA 2B30A 4RTJA 2G40A 3KWFA 4Z4IA 1E6KA 1E3EA 2B94A 2IK8A 2WM2A 4JJ4A 2POQX 4K1XA 1I33A 3EMBA 4C7MA 2V58A 3OEEA 1MIOA 4HN9A 4QTUB 2FEOA 4ZYWA 1RLMA 3FTCA 4QQ8A 1WF3A 4ZT5A 1NNLA 1UBUS 4XM2A 5CGQB 5CNMA 5C4IA 1RW4A 1E1QD 2P7HA 2JH9A 1ILWA 3RARA 5EZQA 1ZNZA 5EHNA 1T34A 1P7ZA 2XQGA 2PLWA 2QT9A 2G63A 1SXQA 4U2KA 1ZICA 2XE6A 5KYXB 4B80A 2B37A 4DJEC 1P3Y1 3L79A 4P7JA 4ME6A 1LDMA 2Q0SA 4JYCA 1TNDA 3EZ9A 4YXWD 1IAVA 1TM3E 4N1AA 4Q1VA 5JJBA 2VRWA 2YUIA 3L0SA 4RTPA 2XTNA 1HV8A 1XZDA 1G5IA 3OZTA 3TPZA 1YFLA 4AM8A 9ABPA 3L7DA 3AJDA 3PENA 3OJEA 2QE7D 3JQGA 4YCNA 5A9SB 5CG1A 3H1FA 3BXHA 4UFNA 3DXFA 4ZVQA 1PR6A 1YB1A 2OG2A 3ANTA 3M4ZA 3MEQA 4KYTA 3GWZA 1CVIA 4YJ3B 5DSZA 3NUGA 2DZDA 4I9NA 4PG7A 4YCCA 2QTBA 4Y1RA 4YO8A 4H1WA 1O94D 5E6UB 1AXRA 1QIIA 3WLMA 2NIPA 3IT0A 3TI7A 5IJ0B 5TMPA 1PS8A 3EEBA 1DQZA 4CTMA 1M7BA 4FONA 3ZN2A 6PFKA 3ESBA 3VNBA 3QE9Y 4ISBA 3VPDA 1GVHA 1CUFA 5K8IA 4MVJA 3B78A 4NOLA 2OFFA 5CBPA 1PWHA 2IZOA 2NOAA 3O92A 2OBLA 4Q7LA 3DO6A 3DLPX 4QDKA 5FPTA 1CF2O 2I4IA 4GR5A 4F7DA 5A4KA 1B0ZA 1OFHA 3HWX1 4INAA 3OURA 2OGSA 3BTOA 2GHQA 3OECA 2MJLA 3SEZA 5TQVA 5CJPA 5FEMA 1S3FA 4BVFA 2QZ9A 4HRAA 2X3FA 1ZJ4A 4AZ0A 4X65B 3J7AC 3GAMA 2VAVA 4IJVA 2B6HA 2EZ8A 2D7JA 3K0HA 4OA5A 4QE3A 3JQGB 4M0CA 4HDOB 5FLKA 4XX0A 2QUKA 2GLUA 3CLUC 3CZCA 5MN4A 1F12A 5FA6A 1NVUQ 1K6EA 2BLLA 1KGDA 2WJJA 2SKCA 5TQJA 5CLFA 1NLYA 2A5DA 3EUFA 1C7ZA 4GEKA 4B6OA 3QA3E 5EG5A 2R6FA 4FNMA 2JLAA 4Y8VA 1DRKA 9ATCA 3L43A 1F2DA 1KRHA 2O8BB 1FOEB 1ESMA 4IDFA 4OK5A 3UPTA 4G0WA 1WZEA 1BGVA 4CM7A 4GOJA 3IEVA 4BVHA 1ZISA 1NXQA 1LV7A 1NVDA 3LBAA 4ZVPA 3AP3A 4LVOA 1V16A 5FPSA 1W36D 2QRQA 4Y7DA 4R51A 4B6SA 3BIJA 4N6NA 3SDBA 2F1JA 5JNRA 1MIOB 3MJRA 5AUPB 3GW8A 4B48A 1MR3F 3BB3A 1CFJA 1UMCB 1ZLXA 5KNDD 3O47A 1QTNA 2ATIA 3D6HA 2IYAA 3I8XA 1MT0A 3K05A 4PTZA 3W5DA 3FPCA 1NXOA 3FNFA 3CNBA 1OY1A 1CUEA 2GN9A 2PEZA 2E6UX 4RVCA 3Q0TA 1JTFA 1SUBA 1Z4QA 3RM3A 1VLZA 5I6DA 5JPCA 1BH6A