3L1IA

Crystal structure of este5, was soaked by cuso4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 103
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1iA00
3G9ZA 4FBLA 4HAIA 2XUQA 3AJAA 4QLAA 4L3WA 2RI6A 5FDFA 2CEKA 4J0GA 3DS8A 2HU8A 1UT6A 5DLPA 1JMYA 2XQIA 1XKLA 1CUHA 4MEAA 4AB1A 2JIDA 4WDQA 1LBSA 2CKMA 1QOZA 5ALSA 2QR5A 5EIEA 4O08A 3G9UA 5ALRA 5JANA 1KEZA 2QM0A 5ALPA 1AUOA 4X00A 1HL7A 4TVKA 1R9NA 1E8DA 1BE0A 4C4YA 1ZD5A 2DCMA 4UBIA 4C01A 2WU4A 5ALNA 4B82A 4OB8A 4C89A 2WM2A 5AOBA 1ZGCA 4EHBA 4Y2TA 3WK7A 3C8DA 1G5FA 4AMYA 4BP9A 5CH8A 1C4XA 3IVMA 2IITA 5AKYA 4QA9A 4RNCA 1QTRA 1H2WA 3VKFA 1K63A 2YASA 1CIJA 1GGVA 1CUYA 1AKNA 3HXKA 3I28A 5ALEA 3WKCA 1TCCA 4PSCA 4BCDA 3D0KA 3O4JA 3HRHA 1SFRA 1A8UA 4HXFB 4GWLA 5CT6A 4QDTA 1SC9A 2XMGA 4ZV7A 5ALZA 4GDMA 4WFKA 3WMRA 3HSSA 1YB6A 3WKBA 2GZSA 2EDCA 2HM7A 4FDMA 3WQHA 5CTAA 4WFJA 3FSGA 5DYWA 3QVMA 2XQKA 3JWEA 3L1IA 2C4HA 2DHCA 3C5WP 5DNWA 1ZD3A 2W6CX 3C6XA 1B41A 1CUAA 1Y37A 3M83A 1IZ7A 4LYDA 3KWFA 3YASA 1CUZA 3RLIA 1ZJ4A 2XLCA 1ODTC 1XRRA 2PSHA 1XLUA 4EBBA 3R3YA 4Y2PA 1CVLA 3GELA 4UFNA 2C5GA 3AZPA 3I1IA 5FUMA 4PSUA 3CCCA 2AJLI 2ES4A 4C4XA 3MVEA 4RPCA 4BDTA 3DOIA 4AZ3A 2P8SA 5JIBA 4JH0A 1J1IA 1EVQA 1E8NA 4F0JA 2ZJFA 4UBNA 5ALOA 3QPAA 4FWBA 4CIBA 3H2GA 3DNMA 4G8CA 1TAHA 4K5QA 4I19A 1UWCA 3PDCA 1FJ2A 1I6WA 1B6GA 1VJ5A 2GBFA 4G5XA 1MO2A 4ZV9A 3DOHA 5EI5A 2VATA 5HFAA 1WM1A 3I2FA 4H7IA 4CG3A 1HBJA 3NOXA 5K3CA 1LLFA 4D9JA 3KDAA 4WDRA 4LHEA 4F21A 1JJIA 3DQZA 1XZIA 1YSCA 2WIGA 5LYYA 5CRIA 2XUPA 1BS9A 4IHAA 2WUDA 1XRPA 3HI4A 2QXUA 2O2HA 4X6YA 4OSEA 2ZJ6A 3WI7A 1TRHA 3BF7A 3OPMA 5FXMA 1AURA 1EDDA 3WK9A 5CXXA 4B0OA 2O7VA 1OCEA 4J0KA 4N8EA 4W63A 1THGA 4WCVA 4W1RA 1KU6A 3N0TA 1IVYA 3VISA 4EA6A 4IH9A 4DMHA 4CIAA 3PF9A 3E1GA 5FPPA 3LS2A 5AKGA 2HU7A 4PF1A 3VJMA 1H2YA 4HXGA 3FWHA 2Z8XA 4UFOA 4Y2XA 1UK6A 2XQFA 4Q1VA 1TQHA 2OXEA 1MPXA 3STYA 1HKHA 2XUDA 1IMJA 4L72A 2PSJA 1F6WA 2ZVDA 1W6RA 3V1KA 2ZSIA 1CFJA 3X3HA 1N5RA 4BZZA 1P0PA 4HS9A 4AX4A 2VAXA 1MTZA 1ACLA 3ZLVA 4RGYA 3UUEA 3O9MA 3NWOA 3EBLA 1UK7A 4QDOA 1L7QA 3L1HA 2HRQA 4H35A 1GKLA 5AHXA 5ALLA 3FOBA 5AI5A 4UHHA 4HRXA 2VEOA 4JEIA 4Y9SA 5JAOA 3ZLTA 4AN1A 4X91A 3RM3A 4ZGBA 4NMWA 2BJHA 3QM1A 1P0MA 4X85A 2GBGA 3O4HA 5LP1A 3WYNA 1CR6A 4MWTA 4EZIA 1XZHA 1YR2A 2Y6VA 3WIBA 4BZWA 3FLBA 2XLBA 3G9XA 2HIHA 3QPCA 4Y7DA 4CCWA 2E3JA 4PO3X 1GPLA 5T4BA 1TK3A 3OG9A 1VLQA 3U0VA 1DWQA 2JBWA 3C5VA 2W22A 2J4CA 5DTIA 1UOOA 1UKBA 4KE8A 4DMKA 5ALFA 3IIIA 2V98A 5LZ9A 2QVBA 1S8OA 5K3BA 2QTBA 4AN0A 3G0CA 2YYSA 2O2GA 4H7KA 2WFMA 2ZYIA 3E3AA 5ALUA 5E4YA 5IVKA 4J7AA 4MYDA 4RE6A 2J4FA 4DSAA 1MX9A 3NUZA 3H2JA 1H2XA 5CT5A 4C88A 1QFMA 3G0IA 1QZ3A 1ORWA 3UMJA 4X90A 4J0JA 3ESCA 4W9RA 1VXRA 4KACA 4UBMA 4QZVA 1UFOA 3PUHA 4HRYA 2WTNA 1CUWA 1X2BA 4ZWNA 1AQLA 5EHQA 1BROA 4ZXFA 3WK6A 3L1JA 2WKWA 1EDBA 2AJDA 1Q84A 2WG1A 1JKMA 1RWQA 5EIAA 1PJAA 3AFIA 4G9GA 5CT4A 3WKDA 2G5TA 3FLEA 4OU5A 3B5EA 3WK8A 4WY8A 2J3DA 4A5SA 3BE8A 1Y7IA 2CZQA 1CQWA 3I2JA 3DEAA 4UHBA 4XJVA 4Z49A 3CN9A 3D2CA 3D5EA 2RHWA 4GI1A 1SCQA 2XUFA 1UKCA 2JGMA 4OCZA 3RKSA 4GHWA 5K3DA 3VJKA 3K6KA 3HEAA 4PW0A 1FFAA 5AK6A 2X5XA 2WILA 3PF8A 2HL6A 4AXBA 4EB0A 1CLEA 1GT6A 2RAUA 3WLAA 3WIOA 2VJDA 1XLWA 2RHTA 5AOAA 5HF8A 4FFWA 1JU3A 1LPAB 5LKAA 1R1DA 5JZSA 5JAHA 1JJBA 2H1IA 1CUIA 3F98A 2GBIA 2JGKA 1ZIYA 5T4EA 1UK8A 4QEKA 1ZI9A 4G8DA 2XMRA 1CUUA 4YASA 5ALHA 4J3JA 5AK5A 5T4FA 3QH4A 4LXHA 3R40A 2XE4A 2D0DA 2Z3WA 1H22A 4QLOA 1EDEA 4UBOA 4DMFA 4NVRA 1VKHA 1QIJA 1CV2A 2DQZA 4PSDA 1QIGA 2XUAA 4N5HX 1N5MA 1MT3A 2H7XA 1NU8A 3WWEA 2WFZA 3WL6A 4H0CA 3TJMA 4P9NA 3HC7A 3WWPA 2Z3ZA 1O6FA 4MQLA 2HDWA 3F8SA 3PUIA 4BCCA 5EHXA 2PPLA 1GQRA 1WHTA 1A7UA 1ZOIA 3C6BA 2H9YA 2HA0A 3AIKA 6YASA 3O9VA 1WHSA 1FFBA 1EK1A 4I3FA 4BAUA 2XUGA 4IH4A 5I9IA 3BJRA 5ALTA 3CXUA 3OURA 2DQYA 4EY8A 4DSZA 5LZ4A 3WL7A 2OCLA 4IO0A 4AO7A 5JD4A 1JI3A 3T4UA 2CMFA 3AIMA 3OM8A 1ZI8A 1C7IA 1VA5A 3V9AA 1AX9A 4W1QA 4OB7A 3WL8A 4GBGA 3R3ZA 2EDAA 1H23A 1GPNA 4UBLA 2PKYX 4J0CA 2PM8A 1Q0RA 4GECA 4BAGA 1BCRA 2YXPX 2Y2UA 4B6GA 2V96A 1VOTA 2XUOA 1UOPA 3H18A 2I03A 3EF3A 4DMCA 1CUSA 3WKEA 4QDZA 1IUPA 1LPSA 3IUMA 2ZYRA 3DYIA 3IA2A 2WHRA 3SK0A 3H1AA 2VTVA 3D2AA 5AICA 1WB4A 3OTQA 1YCDA 2C0PA 4Q3KA 1MN6A 2HADA 2JGEA 1CRLA 2OCKA 1EH5A 2C7BA 2QRUA 4QWWA 1VZ2A 4B0PA 3DKKA 5HQ3B 5JASA 1P0QA 4HVTA 1RP1A 2BFNA 5SYMA 5IVDA 1AGYA 1E5TA 4Y2UA 5BV7A 1ZD2P 3R3UA 1QGED 1VA4A 3RARA 4J0DA 4QWMA 1LPPA 2OQIA 3G02A 2XUIA 4KEAA 2VQ6A 4H7HA 1HPLA 4BC0A 5JD6A 1ORVA 4FFVA 3WJ1A 1CUGA 5K5EA 5CH3A 1MJ5A 4B7ZA 1WB5A 1JMKC 1VE6A 1LZLA 4F5ZA 5BWCA 4L9AA 3R0VA 3DCNA 1LNSA 4K6GA 1EHYA 5HQ3A 5CBKA 1EVEA 1CQZA 5AKLA 5C8ZA 3FBWA 3PFCA 5YASA 1EINA 4BRZA 2D5LA 1BN7A 3V48A 4UFPA 3HLKA 5I8PA 2FJPA 2YH2A 3I6YA 5D6OA 4GLBA 5BOVA 3Q0TA 3F67A 3S8YA 2GYUA 4S0XA 1U65A 4H18A 2R11A 4GW3A 5AKJA 1EB9A 4LXGA 2JGFA 3I2HA 1J2EA 1BRTA 5JD5A 3WA6A 3D59A 1EI9A 1W1IA 4MQMA 1EB8A 5FPQA 4WJLA 3AZOA 5F4ZA 3I2KA 4KE7A 3W06A 1TCAA 3O4IA 1THTA 3KWJA 1F0PA 4OU4A 4EY7A 1SCIA 1DT5A 3OOSA 2ORYA 3C6YA 3E0XA 2CJPA 3VVLA 4KR0A 3WK4A 1N1MA 4MWSA 4PQEA 4JUIA 2C58A 5A62A 1GQSA 1WCYA 2ECFA 4DYHA 3ICWA 4G4IA 4E14A 5AIBA 2QMQA 1P0IA 1XZKA 4YK7A 2JGLA 3IURA 4KE9A 5EIHA 1MAAA 3EQ9A 4H7JA 1M33A 2OAEA 2HA5A 1AZWA 1E89A 1USWA 1VZ3A 1XZCA 4X95A 5C7YA 3QZUA 3VDXA 5LZ7A 4JYPA 3WWOA 1XZEA 2ZJ7A 4E15A 5LIPA 2VF2A 3EQ8A 5CW2A 2B9VA 3BDVA 1HDEA 1DINA 2XI4A 4FLEA 2WQZA 2IIVA 5AKXA 4HZGA 2VSQA 5AI4A 3EIOA 4GEGA 5HK8A 5CURA 1F0NA 4X94A 5LZ5A 3B3QA 1L7AA 3R3WA 5A7FA 1A88A 4KAJA 5IKXA 3I6MA 2DHEA 3JW8A 4IH1A 1ZJ5A 2FJ0A 4UPDA 3H2KA 5HK9A 2RONA 4MJ3A 5AK4A 4E46A 1DX6A 3R3VA 4U2FA 5FRDA 1VXOA 2QXTA 3HJUA 2J3QA 3STXA 2JGJA 1AC5A 1IZ8A 3BXPA 3PI6A 2PL5A 1DT3A 4Y2VA 5A71A 2GYVA 4ZI5A 5LZ8A 4FBMA 1XQYA 4KRXA 1QFSA 1XQWA 3QMMA 4I4CA 3D2BA 3A70A 4BVKA 2CBGA 1QIHA 2R8BA 3WYDA 1MU0A 4W1PA 2QJRA 5ESRA 3FYUC 3AZQA 4IQ4A 4DIUA 1CEXA 3FLAA 3OC0A 5AM2A 3BWXA 4A16A 4WY5A 2QJWA 5DTJA 4BC1A 1ETHA 5J3JA 1DX4A 3IUJA 3ZV7A 2OG1A 4CFSA 2XQJA 2XDWA 1QLWA 1UKAA 3H04A 4AO8A 5HF6A 1QO7A 1UK9A 2HFJA 4AO6A 4OYYA 5AO9A 3CCBA 3DYVA 4H7EA 2BCEA 1J06A 2XMZA 1GPKA 4Y2QA 2WHPA 1YB7A 3LIIA 2OAGA 2WUGA 5FKJA 4P92A 3SWWA 4LKOA 1E3QA 3TEJA 3STUA 3DD5A 2QUAA 4DNQA 1BEEA 4EY4A 4CCYA 2HHAA 1X70A 1UOQA 2G5PA 2WJ4A 1CUEA 2XMBA 3A6ZA 4Q82A 2BKLA 3H2HA 1XQXA 3FSGD 3WZLA 1G4HA 4KJXA 3AILA 1R9MA 2VJCA 3STVA 3H1BA 4ZRDA 4LXIA 3HABA 1ZICA 2H7CA 2WU3A 3O4GA 4HXEB 7YASA 3ILSA 5ALQA 2HA3A 2AJBA 4K6HA 4JNCA 1ISPA 1FFEA 4ARAA 4DGQA 5LLSA 3FVTA 1ZIXA 5HZGA 3W2TA 5BWBA 1XQVA 1YS1X 3BDIA 4XWGA 3MUOA 3M82A 3IUNA 5AKIA 3WK5A 5ALVA 1OXMA 1PFQA 2VJBA 2WLSA 2V97A 5A7HA 1W4LA 4DTCA 1MX1A 2DFPA 3BJMA 2PUJA 3QMWA 4UHEA 5HKBA 1LPOA 1QONA 1QIKA 1CUCA 3IULA 2PUHA 1EK2A 3G0DA 3V1LA 4OUKX 1OILA 3KD2A 3JYHA 3M3DA 4UBJA 2XQGA 5EGNA 5D3ZA 4BDSA 4Q34A 3NGMA 2RGUA 2XB6A 2WIKA 4J0IA 4UUQA 2WG0A 2DHDA 5JZBA 1BEZA 5DYYA 4KRYA 2I3DA 5DNVA 1TKRA 5AI9A 5JZ9A 5T4HA 3WWDA 2JEYA 4U2DA 3IUQA 3FYUB 4FNMA 5AI8A 5ALXA 3HYSA 1FFDA 2OGZA 3PICA 2WHQA 2IX9A 3GFFA 5K3EA 5DWDA 1TCBA 5HFNA 5JARA 4KYVA 3FCXA 1DWPA 4ARBA 5KWJA 1XRMA 3ICVA 4KAAA 4B81A 2K2QB 5AOCA 1LPBB 1R3DA 4H7FA 3QPDA 1ZI6A 2QS9A 1XROA 2QOEA 1RYYA 4UHFA 2RIPA 3HZOA 2WUFA 3W9BA 3AUKA 3CN7A 3H2IA 1LBTA 1XLVA 2UZ0A 3TRDA 1BCSA 1D07A 4BP8A 1NX9A 5KREA 3HACA 3WKAA 2VA9A 4C6HA 1XZFA 2I78A 4C87A 1Q83A 2CB9A 3H19A 2C0QA 1XRLA 4BCBA 5ISMA 4OD0A 1HQDA 1QE3A 5ALGA 3ZLUA 1W75A 2WUEA 2OQVA 4Y2YA 2HFKA 2VT7A 1MX5A 5HF9A 3UUFA 2O7RA 1W76A 5AKZA 3F97A 1GZ7A 2H7YA 1FFCA 1K4YA 4M0EA 1LPMA 1LPNA 2Q0XA 4J03A 5KBYA 1AMNA 2VAVA 4XX1A 4X6XA 3VJLA 5A2GA 4P93A 3KSRA 2WFLB 1R4ZA 3S2ZA 3LLCA 3DJYA 4FNGA 1H2ZA 4H7DA 2PSFA 5IVIA 4AQDA 1T4MA 5C8XA 2WG2A 5CH5A 3H17A 5EHZA 1F8UA 4G4JA 4Y2JA 1MNQA 2AJ8A 2WIJA 1NU6A 2B61A 3QMVA 3C45A 4ROTA 4J0HA 4B85A 3QITA 2BUBA 3P2MA 5C81A 4RE5A 5CT9A 1XZGA 5IVHA 4CG1A 3GUUA 2G4LA 3IDAA 3F9CA 1XZJA 3A2LA 4XIIA 4QE3A 3D3NA 3KOOA 5EFZA 5ALKA 3G0GA 4N8DA 2ACKA 2Y2VA 4OPMA 4ETWA 4X3CA 5JALA 5CXUA 5I7UA 1U4NA 2PX6A 4TPKA 4MEBA 1FSSA 3U1TA 5DJ5A 2JGIA 3W04A 5C8VA 3AINA 1CUJA 5JAUA 2DSNA 5AP9A 2ROQA 1Y7HA 3FCYA 2OGTA 3BIXA 4U2BA 3T52A 5JAPA 1GXSA 1K5PA 1IUNA 2OPHA 3I1YA 3N2ZB 4BB0A 4G8BA 3V1MA 2NW6A 4CI9A 3G7NA 3V1NA 4Q3LA 5LKRA 4F60A 1A8SA 2FUKA 3TGLA 1R88A 5AI0A 3EQ7A 5A7GA 5AJHA 5LZ2A 3FNBA 3C70A 3DL4A 4LYEA 4DLNA 1R50A 1G42A 1CPYA 3DKRA 3I2IA 5E4JA 2BGNA 4U2EA 4DM7A 2ZSHA 4BRSA 4U2GA 4DNPA 2BAGA 4FTWA 4INZA 5D3KA 4C4ZA 5FV4A 5AM0A 4K2AA 4PV7A 4E11A 2XT0A 1XZAA 4UBKA 5CMLA 4A23A 2HA4A 4FLMA 3WWCA 5ALIA 2O2IA 5FP0A 1YAJA 1UZAA 2ZYHA 3BF8A 1SOMA 2PSDA 4X92A 3GZJA 4X71A 3LP5A 2VJAA 4X6UA 2Y6UA 2OCGA 5HKAA 3SC2A 3MUNA 1YAHA 4PNZA 2OGSA 3STWA 5FOQA 2FX5A 1MNAA 2PBLA 4BE9A 3BIWA 4FHZA 1XRNA 1SCKA 4AMZA 1UXOA 4G4GA 2XMDA 4TGLA 5K3FB 4B80A 4XVCA 1DTEA 1CUXA 3QBJA 4BVLA 2EEPA 1WPXA 4W1SA 3G9TA 1L7RA 2ACEA 3BL8A 1A8QA 2V9ZA 4H77A 4NZZA 5ALMA 5DYTA 3WZMA 1QO9A 1WOMA 3ESAA 4ITVA 5IH7A 1XZDA 4YPVA 2C5FA 4JYMA 4B9AA 4NS4A 1EXWA 1QIFA 4B84A 2Z5GA 5H3HA 5AM5A 4WFIA 2GZRA 4X97A 2AJCA 4BYMA 5DNUA 3FYUA 4M0FA 1E8MA 3I6ZA 4BE4A 2HA2A 2OCIA 4ZREA 2XUHA 3PFBA 4KE6A 4G1FA 4P08A 2X76A 3ZWQA 2BGRA 2I3ZA 5AM3A 4BTLA 4HTAA 3DL7A 4UHDA 3D7RA 3ESDA 2WJ3A 3GA7A 2VT6A 3W05A 1LGYA 2WTMA 4QNNA 4EY6A 3KXPA 2X8BA 3M81A 2QKYA 3SX4A 1JT2A 2PVSA 1DQYA 2G63A 5ALYA 2ZYSA 3GROA 3DLTA 1EX9A 3I2GA 1XZMA 2WFLA 2JF0A 1WPRA 4L0CA 3MGAA 1VE7A 4K6KA 5ALDA 1K8QA 2B4KA 3C87A 5E2IA 3WL5A 3VVMA 4CG2A 1N8SA 2B20A 2GYWA 4G9EA 1JU4A 4X7BA 3C8HA 1CUFA 1JFRA 3A2NA 2HRRA 3PE6A 4BTVA 2PU5A 2XUJA 4OYLA 3VXKA 3A2MA 3FYTA 5K3AA 4MXDA 2XMSA 5AKHA 5AKKA 4N5IX 5D7BA 4U2CA 3IB3A 1GKKA 5EHNA 1C7JA 2PSEA 1QIIA 3E4DA 3H0CA 4MYSA 1YA4A 1Q0ZA 2QT9A 1G66A 1KU0A 3AIOA 1CUVA 1Z68A 2ONCA 1ACJA 5HF5A 2WHPB 4N8SA 3ESBA 5AKEA 3ZPXA 3LIPA 1QIMA 4QDXA 3ANSA 1WB6A 1CUBA 3C6ZA 5SYNA 3G8YA 1U2EA 4YX9A 5CT8A 2CUTA 3ZI7A 2JEZA 1J07A 2Y1KA 5AM4A 1CUDA 3R41A 4V2IA 3Q8WA 2WIDA 3ANTA 5JATA 1W52X 1YASA 2BUAA 3R3XA 5ALWA 3W9UA 1EA5A 1BU8A 3G0BA 4KAFA 2LIPA 1DQZA 2Z8ZA 2HA6A 2WSLA 4BVJA 3WJ2A 1DWOA 3IBTA 3RK4A 3GBSA 3FAKA 4UHCA 4AZ0A 1BN6A 1YA8A 4X93A 4OB6A 2DR0A 3B12A 3O0DA 4DNFA 1PV1A 4FKBA 4GXNA 4Y2RA 5JYCA 2XUKA 3WA7A 4B83A 3FVRA 2XMCA 1XKTA 1K6EA 5JADA 5AIAA 2BUCA 1LZKA 2WJ6A 2HU5A 4EY5A 1QIDA 4Q3OA 4FMPA 4M0MA 4BATA 3F96A 1XZBA 1U8EA 3ED1A 1HLGA 2XMQA 1QJ4A 1ODCA 3O95A 5K3FA 4Q05A 1TIBA 5ALJA 4B9EA 1X2EA 1MAHA 1XZLA 1QTIA 1ZGBA 4BBZA 3K2IA 5KWIA 1O6GA 4EUSA 3LCRA 4CCYB 1E66A 5FLKA 2GBCA 3D4LA 1ODSA 2OLEA 5A6VA 3K9BA 1JJFA 4QDUA 1YS2X 4Y2SA 3QYJA 1T2NA 5AH0A 3DDUA 2HA7A 1XFDA 2PU7A 4FLFA 5AI6A 1QIEA 3C43A 5AM1A 5HCUA 5AK3A 4FOLA 1XRQA 1DU4A 2QZPA 4LIPD 5E4TA 2WIFA 4BAZA 2QUBA 1ZD4A 4DNOA 1IUOA 2AXEA 3STTA
chains in the Genus database with same CATH superfamily
3G9ZA 1BG6A 1E1RA 1T6NA 1H42A 5MN5A 4AQYB 1KZ6A 4QLAA 2IIBA 2IPOA 1N34B 1KBQA 4P33A 1W8IA 1XCGB 2PCLA 4MUHA 3WYGA 1FP2A 3DQPA 5TDHA 4EZEA 2CEKA 4J0GA 5KHLB 2R8PA 3DS8A 2PY6A 4JLSA 3GDFA 3Q6MA 3TI7A 3DQQA 1JMYA 1I3OA 2HJHA 5E8RA 3T7SA 2XQIA 4M9UA 4KVAA 3ZE2B 3JAWB 4ENQA 1KJQA 3MWKA 3EHEA 4R1QA 4U63A 2CKMA 3PUXA 4R8VA 2XB2A 1QR6A 1J8MF 3CLTC 3FUTA 1N8NA 1K5GA 2RK3A 5BRJA 1MEOA 5KMGB 4I9GA 1SVKA 4PSVA 4ZYXA 6Q21A 1E9DA 3TMKA 2A9QA 3GYGA 4O08A 1A1VA 4QRDA 4TXNA 1NMYA 4WADA 3VZQA 1GEGA 1OFVA 2O0LA 3NM5A 4G23A 4RD2A 5JANA 4JVSB 1FP6A 3I83A 5A04A 5BSUA 1H3NA 5ICSA 2ZT8A 2QPLA 4DXDA 3MIZA 4RMHA 2GBLC 1E8DA 4HH4A 1SXJD 2RHRA 5H8WA 4BZPA 3Q3IA 1ZD5A 4YUWA 2C83A 2IUYA 3AVUA 1CYEA 1DAFA 2EJBA 1JMVA 4MDYA 4YUYA 4C01A 3JVVA 3V2UA 2NO7A 1XO1A 5ALNA 4B82A 5ADWA 1JLMA 4MR9A 4WK4B 4X8LA 2QTZA 2B8EA 2B34A 3ZKWB 4NZ9A 2GTHA 2VJPA 4AS3A 1YT5A 1VCNA 5D1NA 1PDVA 1MJGA 1O2DA 2G8LA 2Q5IA 4QUEA 2E6UX 2R4TA 2VF7A 2XZDA 1N2HA 3G8DA 4HH1A 5E9WA 1P1IA 4OQXA 3ZVMA 2ID4A 3QIAA 3L7OA 5BN4A 1OQAA 3PCRB 1OBCA 4D56A 3CVUA 4JUDX 2YXDA 2IITA 2PS9A 1SC6A 1NF3A 5HCIA 1TI7A 1KJWA 1UWLA 2CLHB 4IRUB 1RD4A 4NU5A 2WWHA 4Y9UA 3K20A 2ZB4A 3CF4A 1RHJA 2Z6UA 2Z5VA 4ZOCA 4B3SB 2GMWA 4QG7A 5EGSA 3P52A 3VKFA 3VHXB 2Z43A 4JOBA 2JD0A 5F64A 2IY8A 1JKJB 2FN4A 4YA6A 4DRZA 4QM7A 2DUJA 4U9HS 5J43A 1L5GB 5ALEA 1AXEA 3WKCA 2PH7A 4XQGA 4A2QA 3PUZA 3LOQA 4PSCA 3DCIA 4BCDA 4BV3A 2D2FA 4PLVA 3LT2A 2JFBA 3PQ6A 1GUZA 4D8TA 4HXFB 2YVQA 4L0DA 2WM9B 1A5ZA 5A6SB 3QWHA 1I2AA 4C05A 1L7XA 1ZRMA 3F6EX 4ZV7A 5K8LA 1HLDA 2DBYA 2GH1A 3ZVLA 3NANA 4PS0A 4UE3S 4PU0A 4M86A 1Z22A 1S5PA 4GDMA 2D7DA 2D1RA 3WKBA 5E6SA 1VL6A 3M3HA 1VG0B 4I5IA 3RS8A 2HM7A 1EG7A 1ZH6A 2I5PO 3FNEA 3R24A 1KIAA 1FQJA 4KMMA 4DS3A 3KFVA 1KVTA 4YQFA 2NO1A 1WXXA 5HP4A 3KB2A 4WFJA 4FB5A 1V43A 1SQ6A 1A98A 3AXTA 3CWQA 2HSGA 9MHTA 2B9EA 3JAKB 3JWEA 5JFGA 3L1IA 2C4HA 2D2EA 2DHCA 3MRVA 4FZ3A 1PT9A 4OV6B 1CRQA 2HOQA 3SLRA 3EAFA 4BO8A 2GEBA 2JIPA 2NXJA 1ND6A 3D6AA 4B6PA 2J7PA 2NTNA 3EDQA 1L4UA 2X3FA 5GGYA 4BNNA 1L1EA 2R4QA 4TTPA 2OAP1 4E5PA 4DV3B 1RYBA 1D2GA 2E6KA 4JMPA 4NHOA 2I66A 1XCPA 1Y37A 3GGPA 3KSUA 3MJ4A 3K9HA 4E94A 2PGOA 4EO9A 3LJKA 5KCMA 1YIDA 3RUDA 4QECA 5LMCA 1I5EA 3IVXA 3OPYB 3VDNB 1CUZA 3KYDB 1UPTA 2UUPA 3P9PA 4Y30A 4HDNA 1CFZA 3QVGA 1Y3IA 2CLDX 3ZY2A 3K9CA 3WGMA 1GZ6A 2WYIA 3R4VA 5KSPA 3DEJA 5H9VA 3A4TA 4F3RA 2CDCA 3D8RA 4UFNA 2OSVA 4A0QA 5FUMA 4B3CA 1F60A 2ZVJA 5EMMA 1VIMA 3CZRA 3T5PA 4PZ0A 5ADVA 2Q49A 4Z2YA 4B32A 4PINA 1UXKA 1IBSA 1EUCB 1ZH0A 3HB0A 3PQDA 4OIMA 3T6KA 3GGJA 1BCRB 1FS5A 1ZVKA 2OHOA 4RPCA 4LQ4A 5G0SA 3DOIA 2OCXA 1A2QA 4L5JA 4OKSA 4OQMA 3RJ9A 4MI9A 4AZVA 1J1IA 3DVLA 3A32A 3P9XA 4HNVA 3OZDA 2CNKA 2ZJFA 1X6VA 2YOGA 4J43A 4LG1A 3RAFC 1VDZA 1SKUA 5A3JA 5ALOA 3QPAA 3O3MB 1UJ4A 4YBZA 1Z8NA 4CIBA 1M2NA 3WGIA 1Z45A 4AUMA 2VOEA 2JLRA 3DMNA 4V2UA 2A3NA 3CRNA 2VWQA 2BYTA 1TAHA 4WSOA 1KRWA 3AERB 2J46A 1H0KA 2JHFA 4NRDA 1XU4A 1J0AA 1J2RA 4RY2A 4EG5A 1TQ4A 1AKEA 4YCBA 3C7AA 1UWCA 3PDCA 5SYNA 1I6WA 2DPGA 3OJLA 2TSYB 1VJ5A 3PE4A 4YALA 2WTAA 4L15A 5AVVA 2R85A 4FIDA 4GMGA 3BGSA 1R0BA 3VNAA 5TLSA 3OZSA 1YHYA 1MFZA 4X45A 5EI5A 2VATA 2ZUFA 4I55A 1GYRA 3F5SA 4RHFA 4RZQA 4E09A 4E6PA 1NR5A 1JLSA 4YMTA 3TG2A 4OI4A 4ZVVA 1NHWA 5BW4A 1G2PA 1XXHA 2BFCB 1QNLA 4XEUA 4F56A 2OSBA 4DDUA 2C94A 4J16C 4DV2B 1K86A 2ZIAA 2O8CB 2ISQA 4M1WA 4NXNB 3AWIA 3NP7A 5ILGA 2FPPA 4NOJA 2OXRA 1DE0A 3ETJA 1B8VA 4GQBA 1H8HA 4F3KA 1HBJA 4Q9JA 1FW8A 1P72A 3EXHB 1D6MA 1T2FA 3U26A 3N6VA 2YIJA 5K3CA 1SUPA 1G2OA 4PCVA 5TPZA 2Z6AA 4ODIA 4LHEA 4F7DA 3H9GA 3H9QA 2OCPA 1JJIA 3H97A 2QYTA 1COWD 4F21A 9GPBA 3JQGA 2V03A 2OLJA 4JB0A 3OZCA 5BNZA 4BQQA 2Y9PB 2WIGA 3A58B 3PNPA 1KI4A 3B1VA 2IEIA 1JECA 3IRVA 4H2DA 1SKMA 4L7VA 1WCIB 5LYYA 3C8MA 3TD9A 3RADC 2ZKLA 4TXJA 5CRIA 1I36A 3CY6A 4FCVA 3DGFC 1BS9A 3GDHA 1HI9A 1L5YA 3O5AA 3NT2A 1XRPA 3DC2A 4TXMA 4EAAA 2R751 2WZDA 2F62A 3K9QO 2PDAA 2K4MA 1FUUA 3P32A 4HG2A 4I1YA 2EIXA 2GPTA 4I4IA 1T9AA 4D46A 3INGA 3DBHB 4TLCA 2XADA 5GZ6A 4AWBA 4C0AC 5K0JA 1GVNB 1SVIA 2B21A 4GGMX 3TW8A 4BBPA 3CEJA 3RYIB 3RHTA 2GBPA 4I46A 3N28A 2QQ5A 1EDDA 4M1EA 1ES9A 1ZM2A 1E9CA 9ABPA 5IYZB 5JZMA 5KEIA 2VFAA 5FTWA 2XAAA 3BK2A 4B0OA 3R6WA 2WWYA 1DCTA 1ZJYA 4BVBA 1CRWG 2GJAA 4JGIA 3TSAA 4EKNB 2A0UA 1XEWY 2Q2VA 5E6RA 2IWHA 1W581 4WLVA 5TPZD 1KE1A 4A7PA 4CEIB 4F6RA 3OCYA 2EAUA 5IC6A 4Q21A 1NE7A 1QV7A 3MK31 4N8EA 4W63A 1NW7A 4EYEA 2P0YA 1N8KA 5EKDA 3BGOS 4W1RA 4M3NA 5DW0A 1YFZA 5LP6C 3VISA 3GPIA 2AF4C 4CIVA 3AI3A 4MYHA 2GETA 5K4AA 1NNUA 1K92A 3QLUA 1U8YA 3DPSA 3ZQ6A 1CIPA 4CUJA 4RVGA 5HOEA 3ZZ0A 2O23A 2C2OA 5CX1A 2G9UA 1RPJA 3C97A 2H51A 2P3LA 1D0SA 2XOKA 4HJXA 2VHVA 3OCXA 4TKMA 1H2YA 3VJMA 1IDN1 3H6KA 1BKSB 1M72A 3DCYA 1MAUA 4G4SP 4JU9A 4PYQA 3WDLA 1I51A 2C03A 2FSUA 4UFOA 4UUNA 3KZKA 4NU8X 1FJXA 1K9VF 4XD2A 2RB4A 3CS3A 4LJKA 4E5KA 5E8JA 4I6GA 1F06A 1TQHA 2OXEA 5REQA 1CJUC 1Q0LA 2CHFA 1FA9A 1WKVA 2NNWB 4YNBA 4ZO9A 3STYA 1PDWA 1CK4A 2ADMA 3N5CA 3AJ9A 4G0NA 5L6LB 2QPOA 4A8JC 4BWFB 3K9FC 1JLRA 4FFBA 1KSJA 3MAAC 1AGRA 1E3DA 5EXDA 1LLCA 4DLYA 1S3GA 2W2NA 1ESNA 4ARUA 5TE9A 1RBZA 1JL3A 2Q27A 4PWYA 3VH3A 2ZAMA 2ZSIA 3DLPX 1T8TA 1UZNA 1E4VA 1VM6A 4JUCA 3WTBA 2BV3A 1IHDA 2OCAA 2COKA 3OHMA 4N0EA 3X3HA 1FTWA 2DM6A 5B6IA 3HTXA 1L1FA 4FOTA 4TOIA 1RSZA 1XPJA 2G83A 1QLJA 3PNSA 3RYHA 5I7WA 4MH0R 2ONJA 3VC3A 4WW0A 3MWFA 1EWKA 1KOJA 3ZLVA 1L8AA 4G2TA 1JRLA 3K7EA 1E1CA 1N6LA 2EZ9A 4FGWA 3BAZA 3NWOA 2RGNC 2XH8A 3UWPA 1STOA 2OWEA 4F4UA 5LYJB 2XVXA 2FMFA 1U2QA 4ZKEA 1BJRE 1EX7A 5H70A 1LVHA 2GCNA 2W58A 4GMKA 1VMEA 4N82A 3C24A 4RLQA 2HRQA 2VL7A 3KYCB 4CKCB 2V6IA 1E2NA 4QJ5A 4ARVA 4D0LB 5DGTA 4JOQA 1W36B 4HMQA 3OCCA 2WYWA 1SG0A 3O94A 1WMBA 4HAXA 4W5JA 3LCCA 4J29A 4IEIA 5D7NA 4HSEA 4H6XA 1FEZA 1GPBA 2ONKA 2VEOA 3F2IA 1GPMA 3CWZA 4HJRA 4KMRA 4X91A 3WBJA 2XECA 2ZZMA 1TZJA 2ZDHA 4WHMA 2GPBA 4Z3DA 1GRCA 4MVJM 4QL3A 3EVEA 2ATCA 1PT6A 3V7YA 4ROSA 4W5TA 4L75A 4ALMA 2AA3A 3OX2A 4X85A 1E99A 4BFUA 2REQA 1IJFA 4HP8A 4R1LA 5LP1A 4L28A 4Q37A 2PO5A 2QWXA 3OKFA 5DE3A 3S55A 3EDMA 2D3WA 2ID8A 1MB4A 2P2ZA 5IDXA 3S1LA 4RF4A 2V8BA 1CR6A 5IUJC 1NOIA 3EEOA 5EP2A 2IYNA 4MWTA 5BURA 2YWBA 4LWPA 3RYFA 2G9RA 2Y1WA 2NYVA 3CUKA 2PLRA 1P5ZB 1RCFA 2NV2B 3P8ZA 1DV1A 4FHCA 4G26A 5K0TA 1IM8A 2DFKB 2QP4A 3MS7A 3ZK7A 2Y6VA 1HTTA 2WF5A 1ZD9A 1WCXA 5JBNA 1CZUA 5LP6B 3U4MA 1U4OA 3DE6X 4OUDA 3EOAI 2BI4A 3SQMA 4R83A 4BZWA 2JH9A 1UBRS 5GJCA 3QX9A 3ZE8A 4M46A 2TMYA 2BWJA 3FLBA 1Y3BE 2AV6A 4CEJA 1MABB 2XLBA 1OYVA 3EC2A 1XL1A 1MORA 2Q21A 3OZTA 3KS9A 1FCJA 4ARZA 1F3OA 1B43A 2HK8A 3NXKA 4TSRA 4K9PA 3E8MA 4E3WA 1E9RA 3GD5A 4PO3X 4TX1A 1T1EA 2BBWA 1BIFA 1BA2A 3UKOA 3N3BC 4L85A 4XIGS 5T4BA 2GAAA 2D1SA 2I7DA 5DP1A 4LHSA 3TLBA 3BHIA 1HDXA 3PVCA 3UYLA 2EWWA 2XGGA 4F92B 2A30A 2MWMA 4B3DA 2FUNB 3K96A 1VLQA 3PPIA 2PZBA 4M54A 1TPYA 3SC3A 1KEVA 1G17A 2FW8A 4H1VA 4ZHQB 5LSAA 2JBWA 3QEMB 3TSYA 1M1YB 2O48X 1V8DA 2P1RA 1X1DA 1XWIA 4KO3S 4ANFA 1F9AA 1R8QA 4P83A 5DTIA 1M2EA 1UOOA 1ISGA 1KDPA 1KRXA 1EQAA 1TU3A 2J0UB 4QULA 3MLBA 4HNSA 1OXSC 4CU2A 4JJ6A 1HR0B 3DMDA 4LHYA 1BGVA 2A9PA 2ZIVB 3MTQA 1T36B 2QVBA 3E5HA 3QE2A 4BB5A 1QZXA 4INOA 1U9YA 3DMHA 4TMYA 1ORTA 3W6ZA 5KVVA 3D5TA 2YRFA 4JP8A 2M9MA 3A1SA 2CV2A 1TTHA 4RIIA 2PUAA 1X13A 3DE1X 3UV6A 1L8OA 4P6VF 1BDBA 1P73A 4PAQA 4P2GA 4YQZA 1U9ZA 2JCVA 4LQDA 3M6UA 2ZR8A 4CKEA 2C3PA 4M9QA 2ZYIA 4G84A 4Z0PA 4I8IA 3KTAB 4HB2A 2P67A 3E3AA 3B5IA 2C7GA 4IHKA 2J0UA 4Z9AA 2DP4E 5K8VA 3T61A 1Z6AA 4MYDA 1W4ZA 1ZLYA 2J4FA 2XWSA 4KDCA 4LDJA 4RE6A 2IHZA 5FA6A 1BFDA 4YJDA 3VQTA 4CUZA 4DKXA 1E2JA 1H2XA 5J63A 3BTSA 5TEWA 1FYWA 4EO4A 1B1AA 2E4AA 4NAUA 1JIQA 2X6QA 4H1UA 1D1PA 2ECKA 5CT5A 4NFLA 3IIEA 4C88A 1NP7A 4ZP1A 3UA3A 3WDSA 1ZEMA 1QFMA 4BB9A 2XZLA 3QOXA 4C30A 2FQXA 1B6TA 5EIWA 3MTIA 4X3OA 4M1YA 1ORWA 1Z4KA 4LSZA 4X90A 3OJCA 1EP2B 3HI6A 3RVPA 4IGEA 3GNQA 2ZUBA 3RU3A 2CV0A 3NVKI 4F86A 4QTZA 5KAMA 1VXRA 3AFMA 2VYVA 4QIHA 4DYDA 1UJ6A 3WV4A 3MZ0A 4RVNA 2QENA 4DA7A 1HYEA 4FEYA 4QZVA 3EPJA 1SURA 1FX1A 1IPHA 2XDQB 2PJUA 4GKAA 1VE3A 4HRYA 3K5WA 1YQXA 2HCBA 4MUKA 4KX3A 4RL6A 1CUWA 5KB3A 2NU7A 4OVKA 4ZWNA 3K35A 1BROA 3RT7A 3WK6A 5CPFA 2GPSA 3EC7A 4GOXA 2SNIE 4LDQA 2FSVA 2NN3C 4RVOA 1NDHA 1TCUA 2VWPA 3AKZA 4LGVA 3IH5A 1RKUA 1DKRA 1JKMA 1CQPA 3AFIA 4O4HB 2G5TA 5T64A 4F5WA 1OMOA 1IRXA 1MA0A 3RTCA 2Z98A 3B5EA 4GI7A 1HRDA 1GYPA 4D2IA 4NE2A 3ESQA 4C78A 4EKDA 5A3RA 1HQCA 4C4RA 5IWCA 4AY4A 4AJJA 2P69A 3E9YA 7GPBA 3I72A 4DT1B 1FQOA 3K9GA 2JBAB 3FHCB 1TKBA 3UK7A 1IXKA 4K9QA 5K0LA 1QKJA 2J45A 2GZMA 3ELWA 3EXG1 2ZSBA 1RWNA 1YUBA 2Z2XA 3GFRA 3MINA 4OL0A 4PG8A 2QBYB 5FPSA 2BGTA 4HTFA 4RZXA 1X15A 3BA6A 3I2JA 2FZKA 1HT3A 1OWMA 2IHKA 3ESZA 4PG6A 2RKWA 2GESA 2HH9A 3DEAA 4PPYA 2W2LA 3TS1A 5L7TA 1MR3F 2IBTA 5ITVA 2FSIA 4D4JA 4Z49A 1GL6A 5DHTA 3EIEA 1HORA 2FGJA 2V4MA 3AEYA 2OO7A 2XUFA 3KAJA 2FDCA 1PEDA 3RC7A 2JGMA 4FUQA 1CDZA 1M76A 3GXOA 4GM1A 3BJEA 3TR0A 5TF0A 1SG6A 1NUSA 5ECWA 1KS9A 3BIFA 5K3DA 1K8RA 1P1HA 4QD3A 4FT4A 3VAAA 4HF7A 4TQGA 3L4SO 1YRHA 4L74A 3OETA 4UVGA 4B71A 1FFAA 2KHZA 1UMKA 1LU9A 5AK6A 2A67A 2QA5A 3TI9A 4YCMA 1GUYA 4FMDB 1QYRA 3QKTA 1FMCA 3ILVA 2P9HA 5M3BA 3C5EA 3AM3A 4E7OA 5F9HA 4AXBA 4CCAA 3EPLA 1X1QA 2RGAA 4DQKA 4EB0A 1IQ0A 2PH3A 1CLEA 3MG9A 4HKTA 4M88A 2P8JA 4QSHA 2ODAA 3BH0A 3NFRA 4JKOA 5FWDA 3RV3A 3WIOA 3WLAA 1RC8A 1WW8A 2GK7A 4JVMA 3WY9A 3MJDA 4LGCA 2EWMA 2AR7A 2RHTA 5AOAA 3AOGA 3KUCA 1FNBA 3T7DA 5FWXA 4L6CA 2W2LD 1JU3A 1P4SA 1WNFA 2C8JA 4MWCA 4OK6A 1R5NA 4MQFB 1LPAB 1S6YA 5IABA 1KMHB 4RK6A 3U4IA 4K3UA 4JEMA 5JAHA 1JJBA 3JZAA 3KYIB 4S1NA 5EZ6B 4B6SA 3LY7A 2RK4A 4F71A 4LTMA 1CUIA 4WN3A 3L7NA 3OUZA 3ZHRA 5MF6A 2RAPA 3F46A 4UEOA 1U1DA 1Y8AA 2NSYA 1AK1A 4FZVA 4K1LA 3ZHYA 1ZIYA 2HK9A 4KIFA 4W6ZA 4WEOA 1UK8A 4EPXA 5AUOB 2PGXA 5FLYA 1K5HA 3NATA 3DFFA 2HYDA 3ZHVA 4Q1CA 1MZVA 5DBOA 121PA 5FLXA 1SBYA 2XMRA 1AKWA 1B2LA 1Z2PX 2VHXA 4YAOA 2FMTA 1YJ8A 3DV9A 2FTKE 2J59A 4DDMA 4YASA 3DUFB 4M0DA 2AZDA 1M1UA 2GM5A 2JHPA 4NZPA 4J3JA 3P1JA 3QLJA 4GOKA 2IP1A 2HNAA 1C9DB 4O2AF 4PX5A 1CR0A 1ZQ1A 4RLHA 5L3SB 3CX4A 4LXHA 4Z2AA 1S9DA 1T4CA 2FP3A 3L7LA 3N74A 1F14A 1H22A 1NBHA 2FKAA 3OFND 4GYKA 2VK8A 2DVMA 4P3OA 3NV7A 4RETA 1E4EB 3LO8A 1TTTA 3Q15C 4RKYA 3LK6A 4JYCA 5CVVA 3IDQA 2X8WA 4JUBA 4BPRA 4XM1A 3VU0A 3CRW1 4LTDA 3LTNC 1A7AA 1MIOA 1DCFA 2VXCA 4NVRA 3ZZUA 5EJ7A 4KWIA 1REQA 4B3BA 1G0OA 2W6ID 1P19A 2MCFA 1PG5A 2VSYA 4M37A 1Q1BA 1RVV1 4D41A 1FYVA 3ORSA 4KN5A 3LKBA 3S68A 1Q5PA 2J5QA 2NU9A 2NVWA 3AFGA 2V9CA 4K7JA 3VSCA 2HZ7A 1QIGA 2XUAA 4F9GA 1RAGA 5I01A 4G0YA 1B76A 2XCRB 2H92A 4JOSA 5C5CA 1NU8A 2CFIA 4IMIB 1JWBB 3WWEA 1OVMA 1C3JA 2J5BA 3AI2A 3M4ZA 4HWPA 3PDJA 4R1MA 3WL6A 1W9HA 1UDXA 1NLUA 2BEVA 2X4GA 2Q2QA 4JLDA 3SSOA 3TJMA 1JN0A 3KAPA 4MKIA 5DP2A 4UMEA 2Z3ZA 5DHUA 3KUKA 2C42A 4KZPA 2PT6A 2HDWA 2YWJA 2G5GX 1WS6A 3V3KA 2C5HA 4KQ2A 4RKFA 4A2WA 3UUWA 5EHXA 3T54A 1GQRA 3OKPA 1WHTA 4UM9B 1RFLA 3I8OA 5FX2A 3KB1A 2HWWA 3C6BA 3ZTTA 5SZKB 5JDIA 1SQSA 1K27A 3LC7O 5KU1A 2I6TA 3B6JA 4ZCSA 1K5DA 3IIMA 4XIYA 1WHSA 1EK1A 4R1PA 1ETUA 1EM8A 4I3FA 2V7TA 3VX4A 1JPVA 4AU1A 4J6EA 3PI7A 3Q88A 3CX6A 1KARA 4B4KA 3W34A 5IXYA 1KI6B 3FNQA 4IS2A 5IXSA 3FTFA 4K40A 4R7GA 2Y76A 2CNNA 5KVSA 3CXUA 5D86A 4GRDA 4DSZA 4EY8A 2HF7A 1UPXA 4P4SB 5LZ4A 1S2IA 4OX9B 2OYRA 4IO0A 4IICA 2X4DA 3UKDA 3U9LA 2UXCB 1MC1A 1JI3A 2JI4A 2PGIA 5CA1F 4BNUA 3O3NB 2C7VA 1FSGA 1KBZA 1II9A 1T4DA 3PXBA 5TS2A 3SKYA 1A9OA 4JHLA 1JJVA 4UUAA 3ZBTA 4Q9LA 2C84A 3PGJA 1J2JA 5P8WA 4OB7A 3WL8A 4GBGA 5K6RA 3M89A 3R3ZA 4K88A 1DARA 3IKVA 4TV9A 1ZCBA 3VC2A 1C41A 1GPNA 3HDQA 2Q5FA 5AK0A 2KW5A 1VCIA 2KQUA 1T15A 4J0CA 4JZKA 3UJ7A 2CMGA 3KOYA 1VHLA 2VPIA 1EXMA 1UAYA 2PM8A 4FYVA 1OU4A 2ODWA 2J31A 3EXFA 1T2VA 4B6GA 3MRTA 2HJSA 4NBSA 1JEYA 4A8JA 4MJLA 4BNTA 2NADA 2MYUA 1UOPA 3ANYB 1PE0A 4OQDA 4PHGA 4RU1A 5TGDA 3A7DA 4GO1A 3ZJ4A 2H11A 3FWZA 2IPMA 2P68A 3G7SA 4RH3A 3WMEA 3W1VA 2R48A 2JHAA 1RWBA 4IYJA 2GO7A 3JATA 1EESA 3GPBA 1FW6A 2GJ9A 2ZYRA 1LWNA 2WHRA 3H1AA 4G5GA 4KJZA 4XI9A 3AGQA 1WB4A 2YINC 4EF5A 2JVJA 2IUEA 4QEDA 2BGWA 3OAAA 2CXRA 3G17A 5BV2P 3OM9A 1KHHA 3FRHA 4Q3KA 3UTDA 5K0ZA 1MN6A 5FYQA 3E9QA 5FJJA 3S29A 1SZPA 4WKPA 4XX0B 2QSYA 3K31A 3M1IA 4B33A 2QVCA 3C4QA 4TVSA 1I1QB 4RHEA 1IN7A 4DR5B 6REQB 3ZWYA 4ZKDA 3MWJA 3QI2A 1KAGA 1RABA 4BY9E 2D0OB 1M0SA 1SUFA 2ZBPA 1IHOA 3KD3A 3R0XA 3KCQA 4N9QA 4A0GA 4DSUA 4LF6B 1P2BA 1K2WA 2FVYA 1V3TA 3QV2A 1FX0B 1ZGGA 3OIWA 2OFFA 1QS0A 3EGVA 3GGCA 1GXSB 4TV8B 3X1KA 2BMDA 2Q3HA 1YHZA 4URWR 3N59A 3E1KA 3M6AA 3UHPA 1V8ZA 2Q4TA 1ADCA 4TMXA 5E6RB 1W0KD 1AM4D 1UBSB 5K51A 1G8PA 1AK9A 3JY6A 3EDCA 3Q7RA 4LSMA 3LOPA 3GRAA 4P38A 4QU8A 1G7RA 4RFLA 1QK4A 1QGED 3OOWA 2VYCA 1PLKA 1VA4A 2Y71A 3CO0S 3EXEB 5IYZA 3GJTA 1RCTE 2PWAA 3NPAA 4J0DA 4YMLA 5JVDA 1C3EA 1QPBA 1KVQA 3IE2A 4WY2A 3UCEA 2PL1A 3DLAA 2H1LA 3DA8A 3OAAD 1AZSC 1C3XA 3RVQA 2GD6A 2J3MA 5AUNB 3OZIA 5T3UA 3UK6A 3L6UA 3UZUA 4XQ0A 1R15A 4KRGA 1RLMA 2MYNA 3G8AA 4KNVA 4R5HA 3H84A 5F1KA 5JD6A 3HUTA 1ORVA 1TDJA 5A5VA 5JHGB 5L3QB 2P4SA 3WL4A 3LGXA 4JP1A 1EE9A 3QLUC 2ONYA 3WJ1A 3U9SA 5TMPA 3FF1A 3LA6A 3CZPA 3PHCA 4FJ0A 4EARA 1MJ5A 3MGGA 1CBUA 1VBFA 3K6SB 2O54A 5ICFA 4ZYYA 1KOGA 2VYNA 1UXJA 5H59A 2D59A 1LNSA 3N8DA 3ELDA 3FPCA 4MGYR 4IM7A 1YKSA 3KCNA 4R84A 5A4AA 4BXOB 3WRVA 1Z2DA 3UWOA 2IGBA 2VJLA 5TV2A 5CBKA 4E1AA 1CQZA 3UENA 1I1OA 1ZHFA 2BGLA 2R1UA 1AKMA 2WJWA 3FBWA 5AKLA 3ZNQA 2EJVA 3PFCA 5HYVA 2GFHA 2GWRA 2P78A 1LDGA 1N9KA 2NVOA 5CXSA 2FPPB 1AHHA 3CZAA 2P40A 3IEUA 1EINA 4R40A 1E4OA 1YKGA 3OWXA 2D4AA 2PZLA 4UFPA 3AHFA 5AW5A 5KJ1A 3FNFA 4JVNA 1LA2A 1T3SA 5D5PA 4CKYA 4KO4S 1GAEO 2VQDA 3SHVA 4QBKA 3ZKWA 3VU9A 3EUAA 2YUTA 4DLKA 2OKGA 1N5DA 1MXHA 3V4FA 4LMPA 1YB2A 3OWOA 4PBTA 4YB8A 5I9NA 4FCTA 2V5UA 4ZT5A 2D62A 3S3TA 3RIXA 2ZRQA 4P4UA 3WADA 5BR1A 1V8PA 2FZ4A 1SWVA 3B6IA 4K1XA 4YQYA 3QXHA 3ICEA 2SECE 3FNRA 4H18A 2BY4A 2R11A 4Y9RA 4GW3A 3U3OA 4AG6A 3AERA 4FYIA 1EFDN 1E2QA 2O8EB 1EXNA 1W29A 2QGFA 1BMTA 1SEPA 3AK4A 2R2AA 2P27A 3BMCB 4LXGA 2EFCB 2BE9A 2P3OA 1NMQA 1WUYA 2BGKA 3K0CC 5DWVA 3V8PA 1MVLA 4CF6A 5KYYA 3I2HA 5DTRA 3LQ1A 3WA6A 3KOXA 2I2AA 1Y6QA 3RVOA 4ZVLA 1KEEA 2C2BA 5B1SA 1YR3A 4MQ4A 2W0SA 1YVRA 5ENDA 4GKKB 4EHJA 4I5EA 3IPLA 4AZSA 4OYHA 3NW9A 2DTXA 3NNSA 5FPQA 2QMOA 3AZOA 1USKA 3CZCA 1H0HA 5JV5A 3ZE7A 2IYYA 3DZ8A 4IIXA 5BW8A 1YFJA 3UPTA 1RXVA 2IJGX 4Q93A 2H2DA 3KU1A 1DXHA 2QNIA 3LHIA 5B12A 1KQGA 1YTUA 4HQ0A 3KWJA 4BNHA 4REQA 2WAXA 4ZVTA 3EGCA 3WLJA 3GL9A 4BKQA 4KK3A 1R10A 3C5CA 4L50A 3MB8A 3TQRA 3WJAA 4FBGA 1SCIA 2ORYA 4DMMA 4XYLA 5BSHA 3PWZA 3LUJA 3K92A 1DTWA 3BSFA 1KA9H 4H08A 4KR0A 1XMXA 4NYJR 4QXMA 5B64A 8AT1A 1IQUA 3HYRA 1KXZA 4HNRA 1ZSNA 1L9KA 4MWSA 3DZJA 3U81A 5JXWA 1JFSA 2L82A 1XTJA 5D3MB 5FNVA 2R00C 2C58A 1JIJA 3K5IA 3COYA 4KYIB 2IU4A 4PYLA 4L76A 4NJEB 4BYGA 3JWGA 5KSZA 1I3KA 3KV3O 4TUYF 3ADKA 4TWAA 4DYHA 3KE9A 4XVHA 3WGVA 1E2HA 1BGWA 3KALA 4XD7D 4BFTA 3KOWA 3QTBA 3SE0A 5AIBA 2QMQA 1JVBA 5BSFA 1P0IA 3HMKA 2XMPA 1TF7A 1INLA 2XE8A 2C4VA 4YK7A 1U9IC 4BMZA 3L5OA 3O7MA 3DZKA 2PUFA 1C7FA 4RTSA 3O84A 4V03A 1GJRA 1Z56C 2LKCA 1MO5A 1POWA 2JGAA 4JOCA 5E6SB 1WZEA 5KZMB 2UYHA 4AS1A 4Z4EA 4PG5A 4MARA 3W0LB 1K6MA 1E89A 5J4HA 1XZCA 5FEMA 3W1EA 1H3FA 1VB3A 4IJVA 3NBFA 3SMQA 5CA0B 3ZYZA 3IP9A 1B0ZA 4BKMA 3FWNA 1OXXK 4LDNA 4JYPA 4MIOA 1F0KA 4Y1RB 3VDRA 4MCJA 3PHJA 4XYBA 4E15A 4C03A 1OFGA 4B8WA 1K0UA 3EQ8A 4YRQA 1FQWA 2QDKA 2QUZA 3A6HA 3AH8A 3BDVA 5D84A 2ZGVA 1QP7A 3I5YA 2OZPA 3Q1LA 1W6UA 2I80A 4GZ6A 3F2VA 3PHGA 5CGZA 5CLLA 4DYVA 1TZKA 3QOYA 3WSVA 2YN2A 2REXB 4EF4A 3CKLA 1NXWA 4JEHA 5AI4A 4CL0A 4MCIA 5B6JA 3GLQA 1RQ7A 5HK8A 1DBPA 4S24A 1SA0A 4EJSA 4D9IA 1PEAA 3B3QA 4MJ7A 4B83A 2I7TA 1SO8A 2XJ9A 5EMLA 4XDZA 3H86A 3JZIA 3P2KA 3ND7A 3B60A 3LQFA 3UB2A 3R3WA 4IBOA 4OGWA 3L04A 4HYTA 4TLAA 1EWQA 4KAJA 1NV9A 3EGDA 1FSFA 1DKNA 2MR6A 1J6UA 2DHEA 1OT3A 2H2GA 4N03A 4DA4A 1Y7LA 1KYYA 3H2KA 1VIAA 5L53A 4E46A 3I76A 3L4JA 3LUAA 3EAQA 2PZGA 4OXNA 1JDPA 4Q3NA 1UJNA 1US8A 4BLOA 2WKSA 4NENB 1XNRB 1RXUA 3ZCPA 1Y9EA 2IY9A 5AW6A 3DHVA 4LZLA 3STXA 3RRBA 4HT3B 1BMDA 2R84A 1RHUA 2ZRBA 2A78A 2GKGA 3PLRA 4HBZA 1TAUA 5A71A 3EGEA 2GYVA 1MG0A 3P2YA 4G41A 4NWIA 3JSAA 3NBAA 5BQ5A 4EW2A 2WAYA 3R6TA 4RD6A 4ZI5A 4QJ4A 4J9UE 3GT3A 2JI7A 4RABA 1LDYA 4PGMA 1XQYA 4J3FA 1NXOA 2KLHA 1XQWA 3Q5GA 4HL6A 3ZXXA 2R79A 4E7PA 5TQJA 3AR4A 4Z8XA 4DQXA 2BD0A 3CF4G 3LP6A 3E4CA 3VR6A 4K0RA 1JH9A 1K7FB 4IZHA 3LPNA 1NJ1A 1QIHA 2R8BA 2C4UA 2OGWA 3EQZA 1Z4QA 4IF4A 4OHWA 4P3NA 4XE5A 3EG9B 2FW7A 2LCFA 2NO9A 1NY6A 4BBAA 1Y6GA 3FBTA 3U4AA 1R74A 2GK3A 4OQYA 4C06A 3H7AA 3D8UA 3X1WA 1LBHA 1GZ5A 2V65A 5BRAA 3FYUC 1I13A 5LDDC 3AZQA 3FLAA 5AM2A 5F5NA 2Q4EA 4WY5A 1NJ5A 4RPJA 1E61A 3KPUA 1G3QA 2H18A 3GAZA 1P1JA 1NLFA 1QC5A 4XUEA 4CTNA 3FZGA 3K0FA 3KQNA 1JXAA 2AN1A 2O52A 5G1PA 2BLNA 5AWFC 4YV2A 5TMDA 2PH5A 5TX7A 1MH9A 4L07A 2X5OA 1VLMA 4FGUA 3T7KA 5C1PA 2ALJA 5KTRA 4RF2A 5HQTA 4QGHA 3ND9A 3Q9NA 3P5BA 1E2MA 2XQJA 2ZEJA 4KO1S 3EN0A 1UKAA 1AIPA 1V0JA 3I1FA 3FPAA 3FPJA 3DDCA 4FX5A 4XLLA 3JWJA 4EGCB 4IXNA 4R3NA 4IZOA 5AO9A 3CCBA 4ZEWA 1ZL0A 4H7EA 3R9IA 1U6IA 5C31A 1T8RA 3TIVA 1U7PA 4OHMA 2H5IA 4RULA 1V6AA 2BR3A 3DKIA 1UM9A 1GPKA 1TMOA 3HKEA 3A04A 1R5JA 1XV5A 2OK8A 4JJZA 2Q4DA 3UIEA 4Y2QA 2PUBA 4YAKA 1YB7A 5AJWA 2L69A 2OAGA 3F71A 3LIIA 3RANA 1SKBA 2MSCB 3N8HA 4GLJA 2HMTA 4ON9A 2UZAA 1Q2UA 4LF8B 1E3QA 3CNEA 2JRCA 2VYQA 3DD5A 3FTCA 1AXGA 1Z7EA 2YFYA 3W7BA 4KMOA 3Q8KA 4LNUB 3ND6A 1BEEA 1Y34E 4FFMA 4CCYA 5A4MS 3GIWA 3N9IA 1RMTA 2HSWA 5E7MA 4YAIA 1GPDG 4FJ1A 2O20A 2WJ4A 1V8BA 4R5MA 1VKZA 4ZAXA 5KJEA 1JTEA 1U7TA 2XMBA 3T1VA 3V7WA 4ZEMA 3U4HA 1JSZA 1W47A 1N1EA 4HRAA 3H2HA 3WOVA 1C9EA 1VL5A 3IXQA 4QUJA 5ETJA 3WZLA 3ZLBA 4OH1A 4HZUA 1II0A 3AILA 4Q4JA 5F52A 3OIGA 4HY3A 4K9KA 2OHXA 4WN9B 5J47A 3NC0C 4TRNA 2HCTA 2Y1LA 1Y3FE 1ZSVA 3H1BA 2G40A 5KIAA 3GMTA 4LXIA 5IJ0B 1NPDA 3T95A 3NQ41 3SOPA 2H5JA 4JIMA 2H7CA 3OFKA 2PFSA 2OBBA 3O4GA 1XTRA 3F3SA 3ILSA 4L16A 4PQFA 2D8AA 3PE3A 4Q3DA 4HSGA 3ZWBA 1FXWA 2B1GA 4X1OA 3LQYA 2YY5A 1SHLA 4F4FA 3SZGA 4AIIA 5BSWA 5E6UB 4RY9A 2P9TA 1GZ4A 4JNCA 4RIFA 2QL5A 3ZE6A 1L4LA 4ARAA 5HRUA 3LZDA 4QO7A 1WKCA 5DI3A 3R5FA 2ZRGA 4O59O 1BX3A 3VBCA 1ZIXA 2YWXA 3V2IA 1L0BA 1C29B 2AC7A 5HZGA 1DRVA 4H3HB 3W2TA 4IG9A 1XI2A 1XTVA 2WP0A 2HT6A 1V4VA 2FMIA 2O8FA 5CLJA 4PAGA 1BRMA 4K28A 1ZDMA 2G08A 1EFUA 1EBUA 5CLGA 5IAOA 1HNXB 4ND7A 2IYOA 1ZKMA 1BVUA 2BF4A 1OBFO 1UBJS 3BDIA 1EFHA 3CH5A 1YZNA 1MC4A 4I6EA 4FI3C 5FWAA 1DIHA 4MW4A 1WMFA 1M2OB 2E82A 2P91A 1RBQA 3M82A 5BT8A 2VJNA 2XITA 3ON5A 2C7QA 2JAPA 1GP2A 5AKIA 4Z9FA 5FPYA 5ALVA 1SEVA 2X7HA 3K0CA 2GUWA 4N76A 3NIBA 5FI5A 5JE8A 5JPIA 3RS5A 3PFKA 4R2IA 3E3MA 3OE7A 4ESEA 2WV7A 1MV5A 5ARCA 4AJLA 1W4LA 3MAJA 4DTCA 5DULA 1DB3A 2DAPA 1F5NA 1E9FA 1NQUA 3OY2A 3QMWA 4UHEA 4WWHA 3IJEB 3K70C 1MIHA 2J7KA 1WXWA 5JBIA 1CDDA 4DA9A 1SBNE 1QIKA 4ARZB 5BW6B 4E51A 1SQ0A 2PUHA 1C1DA 1JKFA 1H2BA 2CDAA 1L4YA 3KKMA 3NKVA 3QRWA 4A27A 3CW2A 5CVEA 2CYBA 5JCOA 1KY5A 3DVQX 4Y98A 1LQ2A 5GM2A 5HFJA 3KD2A 4DG5A 4CEJB 1TK9A 4HRVA 3M3DA 4RTMA 1HYGA 2XQGA 5M29A 2H6EA 2ODTX 4ZI7A 2O0HA 1EXVA 5D3ZA 3EX7C 4Q34A 4DLSA 3WGUA 6ADHA 3ZU3A 2XB6A 4GGPA 4ND4A 2WSIA 3ROMA 2Y1EA 1MFPA 2DFLA 4FYMA 4YRRA 1I7SB 1ZM9A 1U5CA 3R09A 1B7GO 2JJ2D 1PEYA 4WZ6A 5COAA 5DYYA 4KRYA 3DB2A 5DNVA 5LQNA 1T8YA 2QW1A 4N6GA 4YFVA 3L7IA 2VH1A 5T4HA 3RRJA 2UZ1B 4PSAA 3ZDDA 3NM6B 3RT1A 2M6KA 2JEYA 1A2BA 2H3HA 4U2DA 3IBSA 5A9SB 3CPJB 3ITNA 3IUQA 2YV2A 3LBFA 4W82A 2JCGA 2VBGA 5JNVA 1OWNA 1T9CA 3NMUF 3A6FA 2PL9A 2PZFA 4LBZA 4RVFA 4EG7A 1NT4A 1FFDA 1RLOA 2B2NA 1SUWA 3KT0A 2OZLA 4GICA 3HB4X 3V9PA 2QJTA 5I7RA 4BGEA 4NLLA 3IAM6 1T5DX 2P11A 3GFFA 4X0EA 4YRFA 1JDZA 1CY6A 4JVLA 3F8WA 1UJBA 4L4SA 2B1IA 1LRLA 4QQ8A 3DJFA 3FOZA 1M54A 5G0UA 1XCLA 3DFZA 3DVAA 1TGVA 3I58A 3LF2A 1DWPA 1S7GA 4IOMA 1YXMA 4KUHA 4RKEA 5HTKA 4LOJA 3TH5A 1U28C 2GQ0A 3FTQA 3GQBA 3QU9A 5A9RA 3JYOA 4JCCA 1ZU5A 2FV8A 3TJRA 3ORFA 1JYEA 2C96A 3S40A 4XSVA 2ODBA 2QTHA 3DOUA 5T8KC 1QVWA 2WOJA 3L06A 5DH9A 5FQNA 2YTZA 4CQLA 2K7ZA 4UHFA 1J22A 2GF0A 4XTCS 3T3DA 3UT6A 2WBLC 3BSYA 1I4WA 2I67A 3DDNA 4MUGA 2JJ2A 2PRSA 4NEHB 3UKJA 4HAOA 5JCZA 4C2BA 2RC5A 4I99A 1AV6A 3BK7A 3CN7A 4IDDA 4HWTA 2YFHA 5AVOA 1GZVA 3AR8A 4Q4CA 1T2EA 5ITZB 2Q3JA 3STHA 1OXKB 1GAJA 1HDOA 1HF3A 4JC4A 3WNVA 1Q7TA 1ZM3A 3CTPA 1WO8A 3VOSA 2Z4TA 5BN3B 3HN6A 1WVMA 3SXUA 2Y93A 4U7DA 2CV1A 2RGRA 2GLTA 1GZ3A 3TTWA 4BU1A 2OV6A 1VKJA 5GY7A 4WZAA 1BHQ1 5IK2D 2PTGA 4B3GA 1TIPA 1UT8A 3WKAA 3D1JA 1FDOA 2VA9A 4UHJA 3F49S 3HVRA 3OEEA 3OTWA 1NP6A 4CF7A 1AUQA 3KX2A 1E7SA 2CB9A 4IDOA 4BU0A 3P9ZA 4QXAA 1ZU4A 5EHIA 3SF8A 1RZRD 2J3IA 2O2YA 4OXRA 3ZLUA 4F5EA 4I81A 3TD6A 1HLPA 1W75A 4GLOA 4KFRA 1B73A 1TEXA 3ROQA 4Y2YA 2PNFA 2HFKA 2HYIC 1MX5A 4ZVKA 5CVTA 4K0KB 2YHBA 2VS1A 4KVFA 2AKYA 4C1NA 2R6FA 4NE7A 1NMXA 1W76A 2IYAA 2PH1A 1P2SA 3Q7IA 2P6RA 1G63A 2QF7A 4QUHA 3F97A 2A9RA 1GZ7A 1X3SA 5JYEA 1CJTC 3H2SA 3QWIA 5D3MA 4M0EA 1SELA 3IC5A 5FNVB 4BWVA 5JJ5A 2BELA 2AUTA 3AFHA 3GUYA 4PANA 5EQJB 3ZGZA 4HN9A 1UXGA 2QMHA 3D31A 3FFBA 3UMRA 4JA2A 1Y6ZA 3FFWA 3GGGA 3ZGLA 4W5RA 4P98A 4F04A 4YI5A 3EASA 3KSRA 3K1YA 2IH5A 1R4ZA 3QPWA 4YJ2A 1SCBA 4CIDA 3UC9A 4FCWA 3GLIE 5KYNA 4A6PA 1EVZA 4H7DA 4D82A 5B57C 1W1UA 2PSFA 4BP3A 2I4TA 2CXSA 1CB7A 2F00A 3PS9A 2VNKA 3QFFA 4PGAA 2POCA 4YIKA 5IVIA 4MTCA 4N4AA 1JDVA 5FI1B 1CJCA 5G3ZA 3MGCA 3S1AB 3H17A 4HDSA 5ABPA 4PO9A 1KEKA 4DB4A 3KTOA 4NDAA 1NMEA 4X1IA 4XPIA 5JSFA 5IXJA 1Y8RA 3ELBA 1Y82A 1JWAB 5LBUA 2Q3CA 3LBIA 3BC1A 3D3WB 3ENQA 4MS4A 4PTZA 2WIJA 3URKA 4DSTA 2FPLA 3H1PA 2B61A 1GQ2A 1N6KA 2WPDD 3C45A 4ROTA 4BX0A 1LC3A 4BX3A 3IHLA 1IH8A 5BWLA 5KX5F 4S05A 2BUBA 4NG5A 1HSOA 1S3FA 1VLJA 1XOIA 1OAOA 1Y80A 2MINA 3GRPA 3L8EA 2Q6KA 3OPQA 3WGYA 2R0QC 1H9BA 3OQIB 4QQFA 1L8QA 3RK1A 4BQNA 3R1IA 1SUIA 1F8GA 5EUMA 5IVHA 2QNBA 3TRJA 4D1YA 4I1UA 1TEHA 2PN1A 3PGLA 3ZJVA 1K66A 2RHMA 3REQA 3T7IA 1PNOA 3N7TA 5C1IA 3RFXA 2H3EA 4Y9TA 5EL0A 4FGKA 1VSTA 1DJPA 1OA0A 4X8MA 1E3WA 1ZRNA 1A4XA 3ELUA 5DN6A 3CPHA 3D3NA 3B5JA 5KAPA 5C3UA 2ENUA 2BZ0A 2GLUA 5IEJA 4GOJA 2NV6A 2R8YA 3KOOA 5EFZA 1GNRA 3G0GA 4KYUA 1NOJA 3D3JA 4N8DA 1O03A 4S2EA 4AX8A 4XUDA 1DIRA 1J9EA 3VKHA 2RCYA 3WYBA 5JNLA 1C0PA 3GFBA 3VO1A 3THWA 1XMOB 2B1RA 1RRCA 5EJFA 2C57A 2A84A 2CUKA 4MWOA 1FSSA 5KX5A 4OFZA 5JPCA 4DNXA 5DJ5A 1NM5A 2BTQB 2JGIA 1PZHA 3JALB 4C0XA 4RZHA 4GX1A 2PWYA 4MVJH 5JAUA 2DSNA 3B6KA 2YIVX 3IQHX 3IEPA 3N0WA 5DKFA 3R9XB 4JJKA 1K7EB 5ENVA 2FPIA 1M1ZA 4YMGA 2YKGA 1RW4A 1CY7A 1Q22A 1J9ZA 4Q16A 3WE7A 3GDWA 1R5OA 3HS3A 3PIIA 1E7RA 2IUTA 3BIXA 3FUCA 2O1SA 4KXFB 1GHTA 4Y6RA 4ZN6A 3RYCB 1XMQB 3TZ6A 4RPKA 1C7ZA 2IUSA 4KFTA 1HURA 1L5NA 5J23A 3ET5A 1QX3A 1A9PA 3NOOA 3EXHA 2A4MA 4F2GA 4YAGA 5CCEA 3V1MA 4NCJA 2QX7A 4R2MA 4CI9A 3H8WA 1QVRA 4RC9A 2ZWIA 1JLLB 1R9GA 4Q3LA 1K8ZB 4M8SA 3O73A 2IYFA 2BFPA 1A8SA 1XJCA 3INYA 3QLEA 4FYYA 4HB0A 3IP1A 3JCZA 3PQ8A 4D9BA 5DNDA 2CB0A 2I6QA 3OSUA 1EG2A 1V25A 2OM2A 4W9NC 3OIVA 1E18A 1DEXA 4I9FA 3SLGA 1EPUA 1NWCA 1Q2XA 2AUNA 2XVMA 5JH7B 4YAWA 5AJHA 4PZAA 3U6KA 3FPHA 3WRYA 1AO0A 2HO4A 1N75A 1U8ZA 3FF4A 3ZXYA 1QPZA 3C70A 3IQZA 2OXTA 2CVPA 5IDYA 3BWDD 1R50A 1YK1A 3PIRA 1G42A 4R8SA 4B8YA 3RK0A 3WHKA 4DJTA 5JQWA 2PRJA 2QNRA 2BGNA 3JATB 3SYMA 4NCAA 4DM7A 1F9EA 2OTCA 2WF9A 4JX9A 1V7ZA 3RCBA 1ZOOA 2XXAA 2GRAA 4YXWA 1ONPA 2YHUA 1J56A 2I4IA 3UHJA 1NSTA 2QSJA 4UULA 4QVKA 4QLBA 1FVHA 3IEXA 3NNNA 5T7BA 4GFDA 5DLDA 3WYEA 2HMAA 5D3KA 5KYUB 1YQGA 4TTQA 1QH1B 4ID3A 4ZO6A 4YREA 4JS0A 4V0ME 5AW1A 3OECA 5I4IA 1AG9A 5MGNA 4UKDA 3CRVA 2R5NA 2JI8A 3OQHA 1AUXA 3VR4D 1FRQA 1P4GA 1EUCA 3FRJA 1LDEA 1QH8B 5BWMA 2IOFA 1ZA1A 4GS5A 3I9OA 3T1OA 4CDGA 4E22A 1RTKA 4PYIA 4RCVA 5IARA 4ZEVA 4ZJUA 3NWEA 4YP9A 2Z09A 3PNMA 3OQ6A 3I4LA 4RGBA 4PC2A 1AKTA 3CLVA 2C04A 4CIXA 1ATIA 3ACBA 1QF7A 5JNTA 4KODA 4RADA 3B36A 1M2KA 2Q8NA 2QR3A 3L0CA 3HYLA 3OLXA 3QVGB 3RUEA 3GAMA 5JR3A 3FNHA 3T15A 2VHCA 3BXFA 3V33A 1YAJA 1UZAA 1G2QA 4M36A 2JAOA 3EVCA 4F3NA 1U9JA 3PPXA 2PSDA 4A0RA 4WZAB 1R4NA 2UVDA 2WKQA 1U3DA 1KYTA 4FYXA 3RFFA 5CEJA 3RGWS 2AK3A 3U17A 1HEIA 3CVVA 2BT4A 4X6UA 1G8HA 3LO5A 3NR2A 1Z0JA 4WXRA 2XNDD 2XAUA 4FQ7A 3EF1A 2XNKA 1T6ZA 2PO7A 3OICA 3RKRA 2ZSJA 5K1ZA 3SC2A 4MZDA 3K71B 4I4TF 1KAHA 1YAHA 3FOEC 1PT5A 2X8JB 2ZYGA 2OGSA 3STWA 3VGPA 4H7PA 4UDYX 2FX5A 5ICMA 2ZU6A 4TZ6A 5DBGA 4BE9A 4CFYA 3GGOA 2WTUA 4P4NA 2CLLB 1TUGA 1EAYA 1KQOA 2I4RA 4JP2A 4CV3A 5HRAA 4QT4A 5TMEA 1V3QE 1W8DA 4QODA 5SZHB 2L2QA 3C15C 2BN4A 4DGSA 1Z4OA 3B8EA 4P3XA 4TGLA 2PL3A 2Q7OE 3DV2A 1C14A 4XVCA 1C81A 3D8TA 1NRIA 3GRCA 4I0WB 4RA6B 4PC3A 4LMBA 4B76A 1NDUA 4ZI7F 3V2HA 1C7RA 3QBJA 4UOZA 3VZDA 3SZOA 3VMMA 4KQIA 4CNQA 4BWGA 2AFIA 1X42A 1T3GA 3G9TA 2OHJA 1VCOA 5LDHA 4H1HA 1REQB 3SR4A 5BV1A 4B87A 1O6ZA 2G28A 4LNHA 4L4XA 1A8QA 3KT6A 2V9ZA 5IJWA 3GLIA 3FGZA 5BSEA 5ALMA 4ZU6X 1I7PA 1U5AA 2QVLA 3ETLA 3T5GA 2GD1O 3I45A 2X0JA 4RJ2A 2AZXA 1QO9A 4LV5B 4DVJA 1F2VA 3ZOZA 1RWMA 1KKLA 1WOMA 3RSLA 1DBVO 2BEVB 1W49A 4KNWA 3TQTA 4YDSA 1FDIA 3W9YA 4C08A 1E5VA 2BHTA 4EJSC 2NO0A 5EJ8A 4KQXA 4DDVA 1X7ZB 5EZYB 3H11B 1E3TA 4E4YA 1T9HA 4WBXC 5BVHA 1OB2A 4NS4A 4UUOA 3U4DA 1N2JA 4UCXA 5HBRA 1G98A 5EZ5A 5AM5A 2X5KO 4X97A 2XNJA 4BUZA 1TVCA 4INJA 5DNUA 2VTKA 4HWKA 5J2TB 1TCVA 5TQ2B 1CS0B 3DZHA 3LCMA 1R8XA 3GAFA 1YVEI 3BRQA 4ZOEA 4ZREA 1OZGA 1K08A 5CB4A 2EARA 1UMDB 1DAIA 1NJGA 2VXYA 1QVVA 2LBPA 2Y3IA 3QGMA 1P2UA 3D6TB 4AJIA 3RS2A 1A1SA 1LDNA 4AD8A 4CLRA 3KXIA 3NCTA 5TC4A 4D9GA 1VJCA 2QK4A 3F47A 1YS6A 3HE3A 4MW9A 2M6LA 4EM6A 1XHLA 3N05A 2ZDQA 3CIOA 1ULBA 1PGJA 3AX6A 2PAFA 3E48A 4QFBA 4UHDA 5FWXB 1OI4A 2HPZA 2R5FA 3ZYCA 2B35A 1MBZA 4E4TA 1RE0A 1U6KA 3UJ3X 1CE8A 1K88A 3GA7A 1TIKA 2DLNA 2XSZA 3W05A 3PGMA 1JLKA 5F35A 5FOSA 1LBIA 4RYLA 3ROXA 4IKEA 1H4QA 1E2GA 3AGPA 3UV7A 4RFSB 5CITA 2NU6B 4YUZA 1JT9A 1PUJA 3MMNA 5BNIA 1C9YA 4XQEA 4GPIB 4MUYA 5BR4A 1BVYF 3HVIA 1P62B 3RHZA 5F5LA 4DIBA 4DRXB 3MWLA 2MTBA 1HOTA 3VNRA 2PVSA 1R0YA 2ENWA 2JVKA 2BM0A 3L2OB 4B79A 1HNNA 1TOAA 3ITDA 4BO6A 5HNKA 5CCXA 1W36D 3TEFA 3AUAA 2EFDB 1THZA 1SXJE 4WUVA 3ZDCA 1HETA 5ALYA 2R8OA 5C32A 3PCXA 3VZPA 4ZMBA 2F43B 1VFNA 3UW3A 4D8YA 1PV4A 1YIAA 1KC3A 3D1VA 4N3CA 2QN2A 1Z4MA 2RB5A 2WK1A 2Z95A 5J4YA 2Z5LA 4KXMA 2Y67A 3E3OA 4LY3A 4EJ0A 4WRRA 4CMEA 4HDMB 1O7JA 4IZIA 4DUZB 4CHGA 2QY9A 4MKFA 1VYHA 3ROZA 4CM9A 1M74A 1KOFA 3QEJA 4LCEA 2GEVA 4ETNA 2EYUA 3MGAA 5INTA 4UCWA 4EHNA 2LKDA 3GPCA 1Y8CA 2R1VA 4JK3A 1E60A 4MQBA 2XJ4A 3HK2A 5DIZA 4E2YA 3C87A 2ZSAA 1KJYA 5E2IA 3EDYA 3LPCA 3LTEA 3QPBA 5DO9A 1H1LB 2HJVA 4UPEA 2B20A 1FDTA 3D9QX 1FRZA 4KR7A 4EG4A 2WTXA 1GDTA 4ZDJA 1S2DA 1IULA 1TLTA 2HN9A 2O2DA 3COPA 4GP9A 4JEUA 1FL9A 1PL7A 2Z9BA 4PLCA 1JFRA 2HF8A 3LT0A 4EUEA 3D4PA 4M83A 4F72A 1PNQA 2ZTMA 3E70C 1N0HA 1YZ3A 2W98A 3H9BA 2PU5A 3GJ5A 3I12A 4ICIA 4OYLA 3QF7A 1GNQA 1WF3A 2O8DA 5BMOA 4TWRA 1A8HA 1GG9A 1TVEA 3A05A 3OT4A 4PHHA 4Q0MA 2I29A 2C2WA 4CIYA 2AT1A 2NXEA 1TW3A 3A2MA 2PD4A 3QHAA 4JBYA 3QLVC 2XMSA 1G20A 1JTVA 1BAPA 1L3BA 1OSNA 1OBOA 2Q3MA 3AB7A 1T0IA 3FMFA 3HCEA 1I4OA 1ZK1A 3FVWA 5FBWB 4CM9D 4Z4FA 4MYTA 3WSWA 2Y4NA 3D6FA 4PCLA 2R65A 5D7BA 2WQ7A 1QK3A 2PRZA 1VC2A 4P7JA 3U39A 1O77A 1EVIA 4MNTA 2DJ5A 1XDBA 1U11A 3RRFA 3RVBA 2O50A 3INTA 4LNUA 2PSEA 1QIIA 3I09A 2YWGA 3G2KA 4KR9A 1E94E 4QHTA 4LDAA 1B93A 1KDZA 3ZDRA 1WW2A 1CD5A 3K0KA 4MB2A 3T0IA 1M34B 2QT9A 1KYIA 1F2UB 1JHMA 1GM5A 4WOCA 3T5TA 3AEUB 1V2HE 1G66A 1KU0A 2C5AA 4EBFA 1CUVA 2ONCA 4OLJA 5L4LA 1WP9A 5HF5A 4CR6A 1E1LA 4NY1A 3NOVA 1MENA 4H16A 5CFZA 5AKEA 1PSWA 5BV0A 4W5QA 2CXNA 1TO1E 1DJLA 3C6ZA 2FPWA 3K9LA 4JIGA 2XCIA 3G8YA 3TOSA 2TECE 4EP1A 1VMAA 5A4KA 1FFSA 3DNFA 3E7DA 4H0NA 3J81k 2OESA 4X6LA 1WVGA 3U1BA 5I51A 4I5DA 3LWNA 2L17A 1T2UA 2X42A 3GLRA 1FMFA 2FUG1 4R6XA 5IVPA 1GU7A 2RHJA 1YZGA 2FNAA 5KO2A 3MT0A 5CT8A 2B82A 5EMHA 4AROA 3ZI7A 1GZDA 1J49A 4P8RA 2WRZA 1XCMA 1WETA 2WLTA 1NULA 2YZGA 2G07A 2GERA 3M1AA 3NKFA 4XFKA 5E0OA 1GPH1 3H13A 1T36A 4NNJA 3A4YA 1U1EA 1JXQA 2WB4A 3Q9SA 3NAGA 4ENVA 4JMLA 3M1YA 3BULA 3G82C 3ANTA 1U2PA 5EOVA 3VTFA 3OU6A 1AGNA 4BMPB 2FFJA 1FS4A 2FPSA 2IHJA 4NJMA 3BD6A 4ZVQA 3QLVA 4DEYA 1TEZA 3EMBA 1EFVA 2RKOA 2VYFA 4I4LA 5TGZA 4H9GA 3IEIA 4MO2A 5BQXA 2OHFA 4AP9A 5AW2A 2J67A 3ILYA 2VCHA 3EISA 2CZGA 2MMCA 4C43A 1N3BA 3PSHA 5HIKA 2X1LA 1DQZA 1VSUA 3PC6A 4GUDA 4B43A 3GLFE 1YQDA 3FH0A 2HA6A 3UAVA 3KQUA 2M2IA 4EGAA 3A9SA 1BVHA 2QM3A 1V45E 4O4LB 2IYLD 1P1BA 3RK4A 4EFKA 1L4MA 2GB4A 1ZMBA 3GBSA 1Z36A 4LXXA 5CEFA 4PHCA 2IBMA 3LUHA 1T0JB 3NFYA 2PEYA 2NO6A 4IVRA 4M49A 1W0JD 5E9JA 4DSNA 5TT0A 3WGQA 5J4KA 3MAGA 3V4OA 1FP4A 1NATA 1X86B 1YA8A 1BH6A 4MAMA 1N4AA 3NDIA 3UEOA 3G85A 2PXCA 2QUHA 4L4RA 4DNFA 1PV1A 1WOYA 2AC4A 1DRUA 1B3RA 1W88B 4FKMA 1I5RA 2FG6C 4C3VA 5KOJB 2P9FA 3AYZB 4LOAA 2GOYA 4MUBA 1X9HA 3CMCO 3CURA 4MLCA 2C20A 3EFBA 1YRBA 3EW9A 4NCIA 2YW9A 3AESA 4YRLA 1NYQA 1U7HA 1FOEB 2Q9BA 2YYYA 1W5SA 3P7MA 4P2BA 1YZQA 1V96A 4AW9A 4A36A 3D4IA 5EP4A 1KQNA 3FOFC 1Z7GA 1KO4A 1QP8A 4JJGA 2C78A 2GCOA 1SKAA 5FUYA 1PHPA 2SKDA 3IR7A 4HQKA 2IYEA 1QAMA 2GXSA 3TKAA 2BUCA 5ECYA 4D6YA 5BV8A 3UJDA 4URFA 3DAGA 1QQ7A 3FKSA 1ZMRA 4RZUA 3L7JA 3HM2A 1K3UB 1DEHA 4RJTA 4C0LA 2R6AA 4BATA 3KYBA 3EGDB 2FXVA 4HDRB 3ED1A 3CWCA 1T5BA 3KB6A 3VYUB 3WISA 3P9CA 5M5BA 2JDIA 4P81A 3T35A 4AWXA 1HLGA 2XMQA 4DCMA 1IC6A 2ZBQA 3CZ4A 1M2JA 1QJ4A 1UBNA 3MWEB 4QOJA 3ZY5A 1RJDA 5B58T 1ZFNA 1ODCA 1SIOA 3LA8A 1KPGA 3A1VA 1I5OA 4Q05A 4Q4LA 1OI7A 4UTXA 4X7PA 4QHSA 1T26A 2GEJA 5JCPA 3AHGA 1I0ZA 3CVJA 1DELA 1MAHA 3KL2A 2A5YB 3T5CA 4JV5B 3FKQA 2IXGA 2PCJA 2VSOA 4QREA 1V4NA 1XXLA 2JIOA 4S3MA 1GFWA 3ZNOA 4O33A 2M6SA 4PZEA 3CF6R 2PA0A 2VH2A 4JHXA 4IMRA 1BW9A 3VPHA 3VU8A 1H1LA 2V6BA 3L7YA 4ZTBA 1Z2NX 4EL5A 2X9QA 2JATA 4FMDF 3ZH2A 4G1CA 3U0BA 3USCS 3QVXA 5KNDD 3TYXA 1HLFA 3EODA 3OESA 4CQMA 1IBMB 1GCOA 1IEVA 1U3UA 3LCRA 4FYPA 2NLOA 3UMCA 3ZR4B 4FS3A 2JCSA 4R4JA 4B4UA 2G70A 1LVUA 2WT9A 4GOMD 3NASA 2OLEA 3A4NA 4JC8A 5BN5B 1Q15A