3L1IA

Crystal structure of este5, was soaked by cuso4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Esterase/lipase
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 103
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1iA00
2WFLB 1EVQA 3LCRA 4EA6A 2BUBA 5J3JA 3WKBA 1QFSA 2O7VA 1XZAA 4G4GA 3O4IA 2WHPB 4UPDA 4KJXA 5ALRA 1AURA 1WOMA 1QFMA 3WKAA 1S8OA 3QMVA 1CPYA 1QLWA 1MAHA 5EHNA 4Y2TA 4N8SA 4G9GA 1EI9A 2DFPA 1YA8A 6YASA 3N0TA 2B4KA 2C5GA 5DNVA 4ROTA 1W75A 4W1RA 2OQIA 4OB8A 5LIPA 5AJHA 5KWIA 1WCYA 1YA4A 1B41A 1VZ2A 2DQZA 1ZIYA 1U8EA 2OCLA 4QDTA 2BGNA 1FFCA 1Y7HA 2AJCA 2GBIA 4BDTA 2ZYIA 4J0IA 4UBIA 4C01A 3I2FA 1H2YA 5ALEA 2C7BA 4ZV7A 4GBGA 2QKYA 3TEJA 2OCGA 2PSHA 2VF2A 4X6UA 4PV7A 2ZSHA 5C7YA 1LLFA 4BVLA 1K4YA 5ALDA 5FPQA 2QXTA 5DYYA 1VKHA 2AXEA 2OGZA 2WSLA 1BEEA 1ODCA 3DJYA 4K2AA 2RHTA 1XKTA 2ZJ6A 5A62A 4RNCA 1ZGBA 3JWEA 3WWCA 1EDDA 2PSEA 3C6BA 5HKBA 5AKIA 4EY4A 3V9AA 3TGLA 3WIOA 2ZSIA 1QIFA 1BROA 1CUYA 1RYYA 4G4IA 4H18A 1J2EA 4XX1A 1W1IA 3C8DA 1MO2A 4FWBA 5DNWA 4EBBA 4J0KA 3KWJA 4OU4A 3UUFA 3ANSA 5CMLA 5EFZA 4FKBA 4IH1A 4EY8A 1UXOA 2WHRA 1CUEA 4MQMA 2ONCA 3IUMA 1WHTA 2VQ6A 3FLEA 5BOVA 5EHQA 5ESRA 4UHEA 1FFBA 4X90A 4Q3OA 1THGA 3A2NA 2HADA 1W4LA 1JJFA 1C7IA 1Q0RA 4FHZA 3QM1A 4LXHA 3R3VA 1JMYA 4X71A 3AILA 5AICA 4YX9A 2YASA 3V1LA 4CG3A 3GUUA 2QT9A 3S8YA 4HZGA 4J0GA 3HYSA 5C8ZA 4INZA 4I4CA 1XLWA 3R40A 2VT7A 3STTA 4HXFB 4BP9A 2OCKA 3DQZA 2QUBA 2O2IA 1QO7A 2J4CA 2VEOA 1GQSA 1DT5A 1X70A 1YAHA 5HFNA 3STUA 2P8SA 1VA4A 3VJMA 3HC7A 5AM5A 5AI4A 5ALFA 2WTMA 3DCNA 4FLMA 2OCIA 3FLBA 4H7KA 4FDMA 3IUNA 2VJCA 5CRIA 1XZIA 4FBLA 5K5EA 1A7UA 5JD6A 5ALZA 1MX9A 1C4XA 5ALXA 3W06A 5EIAA 4QLAA 3A2MA 3X3HA 2RGUA 3CXUA 5JZ9A 5E2IA 2WUDA 1Y7IA 4W1PA 4H7DA 4F5ZA 3YASA 1J06A 5D3KA 2DQYA 1TRHA 1ZD2P 3FAKA 4AX4A 5AKZA 1UK9A 3W9BA 1ZOIA 4F21A 4E11A 1EA5A 2ECFA 3R3UA 1HKHA 5H3HA 4MQLA 4DMHA 1P0IA 2BGRA 3DLTA 4H0CA 5DYTA 5DTIA 5BWCA 3OC0A 3BE8A 3KDAA 4DM7A 4GWLA 3PFCA 4F0JA 4Y2VA 3FYUB 5LZ7A 5ALSA 1MX5A 3JW8A 2DHDA 5D6OA 2R11A 2X5XA 4LHEA 4DLNA 4M0EA 4C6HA 4G9EA 4CG1A 1XROA 2NW6A 4G8CA 1H2WA 1QE3A 4X6YA 4Q82A 1EHYA 3Q8WA 3M81A 4WFJA 4WY8A 4IQ4A 3WZLA 4BC1A 1CV2A 5HK8A 4B9EA 4YASA 3HJUA 2VJBA 5FDFA 2XQIA 2UZ0A 1GPLA 3DKRA 4Y9SA 2WQZA 1CUHA 2XLBA 2WIDA 4WCVA 2QXUA 1LBSA 1DX4A 2PSDA 4RPCA 1XRLA 3V1MA 1W76A 2C58A 4FLFA 1EINA 4IO0A 1LPNA 4ITVA 4EB0A 4EY7A 5HZGA 4K5QA 2HA7A 4C88A 4W1SA 2HA6A 2HA2A 3WI7A 3B5EA 2PM8A 2W6CX 1U4NA 3A6ZA 2OAEA 3LIIA 4Q1VA 5JIBA 3WK7A 3BIWA 3N2ZB 1FFDA 3ESBA 2XT0A 1XQXA 1QIMA 3C5WP 2VATA 3O9VA 4BBZA 3D3NA 2ROQA 4RE5A 1CUGA 3R41A 3EBLA 4M0MA 2AJLI 2G5PA 4OPMA 1MNQA 4UFOA 3V1KA 1XZFA 1ACLA 5JADA 1CLEA 1MT3A 3HSSA 5HF5A 4LYEA 5AI5A 4NMWA 3T4UA 1IZ8A 1L7QA 2PBLA 3AFIA 3I2HA 2FX5A 3AIOA 2RIPA 3DL4A 1VLQA 4HRXA 2FJPA 2JGJA 3K2IA 4BC0A 4P9NA 3WWDA 2Z8XA 4J0CA 1XZLA 1J07A 2VAXA 1LZLA 1YS1X 1P0MA 4ZWNA 3Q0TA 5K3FA 3ESDA 1LPAB 5AKYA 4QWMA 3BWXA 4ZREA 2PPLA 5AI6A 3H0CA 5T4FA 3RK4A 1HL7A 5ALTA 5C8XA 4QEKA 1AGYA 3H2KA 4X6XA 3F96A 2C4HA 3DDUA 4WFKA 3PF8A 3MGAA 3QPAA 2E3JA 3KXPA 5AM3A 5KWJA 2QJRA 4Y2QA 1XZDA 5I8PA 3H19A 1ZGCA 5CXUA 2Y2VA 3WK8A 4O08A 5K3DA 1WB5A 3BJMA 3OURA 3U0VA 3WL6A 1JJIA 3G0DA 1UOQA 3NWOA 3GBSA 2WIGA 5C8VA 3BXPA 4DMKA 3FNBA 4F60A 4BRSA 2JF0A 2Q0XA 2OLEA 5K3CA 4NZZA 2OQVA 1A8UA 1H23A 4PSUA 2Y1KA 4QZVA 5KREA 5JASA 2RONA 2XUJA 5IKXA 5CW2A 3VXKA 4AO7A 1ISPA 4EZIA 4ZRDA 2XMGA 1NU8A 3R3ZA 1CUIA 4KR0A 3WKEA 3IBTA 1UZAA 5DYWA 3CCBA 1WPRA 2ORYA 3C43A 3I6MA 4JUIA 5LZ8A 4U2FA 4U2BA 4QWWA 5A71A 4ETWA 5DTJA 4Y2XA 1VXRA 5HQ3B 3PDCA 2ES4A 1U2EA 2WG2A 3I2GA 3OM8A 4IHAA 4WJLA 3DOHA 2Z8ZA 5I7UA 1E89A 4UHDA 2HU7A 5F4ZA 4GDMA 1WPXA 3L1IA 3IULA 2QJWA 1GXSA 3WJ2A 4Q05A 3DYVA 4E14A 4PQEA 2JEYA 2PVSA 2HM7A 2I03A 1LPPA 4JNCA 2I3ZA 2HA4A 4XVCA 1SC9A 3R3XA 4X93A 2OXEA 4B81A 5K3BA 5ALQA 4C4ZA 4JYMA 1IUOA 1MU0A 1BCSA 5AOBA 4DIUA 3M82A 3FVRA 4BATA 2V96A 2HA3A 2O2GA 2VT6A 3BDIA 2I78A 5JD5A 1Q0ZA 4X3CA 3OG9A 3IB3A 3L1JA 1R1DA 1WM1A 4N8EA 3K6KA 5AKKA 1DX6A 4UBJA 4E46A 2JGKA 3GA7A 1ZD5A 3EQ7A 3I1IA 3C6YA 4Q34A 1ORWA 2CBGA 4KE8A 2QTBA 3OOSA 3MUNA 3QYJA 4Q3LA 2WKWA 4J3JA 5T4BA 4KE6A 4MEBA 3VKFA 3WA6A 4BZWA 4QDZA 3BJRA 1BS9A 1IUPA 1TCBA 3VJLA 1P0QA 3C70A 2CKMA 3G9UA 5AOCA 3HABA 4HAIA 1F6WA 3WK4A 3WWEA 1FFEA 1EDBA 4GEGA 1GT6A 4P92A 2IX9A 5IVIA 2XUDA 4MYSA 3D0KA 1X2BA 2WUGA 2D0DA 4WDQA 1JFRA 5EIEA 1O6FA 1AUOA 1CVLA 2AJBA 3E0XA 1R9MA 2JEZA 4DYHA 5CT5A 1XRPA 5KBYA 4G5XA 2DHCA 1E5TA 1ZD3A 2XQJA 2WTNA 4W63A 2PL5A 2XMCA 4EHBA 3D59A 1IMJA 2EDAA 4FOLA 2WIKA 2Y6VA 5AIBA 4OD0A 3IUQA 4HVTA 3ZI7A 4W1QA 3I28A 3FYTA 5DJ5A 3O0DA 3I6ZA 3KD2A 5AK4A 3O95A 1YCDA 2PU7A 4L0CA 3WWPA 5JZBA 4CCWA 2WIJA 3RLIA 2J4FA 4B84A 1UT6A 4CCYA 3AZPA 3D2BA 4MWSA 2J3DA 4H7IA 1KU0A 1L7AA 1UKAA 4C87A 4AZ0A 1BN6A 4ZGBA 3FBWA 1Y37A 3STXA 4QA9A 1RWQA 4UBOA 4BP8A 4L9AA 4X85A 3ZLUA 4BVKA 1R9NA 1XZJA 1DQZA 4LXIA 3AINA 2HDWA 3WZMA 7YASA 1WB4A 3NUZA 2HHAA 1EK2A 1GGVA 1UFOA 3D2CA 5FUMA 3VISA 3QZUA 2WJ3A 4GW3A 1Q84A 1QIEA 1XRMA 1CUCA 4QNNA 1FSSA 3FSGA 5JARA 3WK5A 4B9AA 2QRUA 2C0PA 4D9JA 2VJAA 5IVHA 3AIKA 1T4MA 1YB6A 3C6ZA 4AN0A 3NOXA 4LXGA 4DNQA 2CB9A 1IVYA 1ZD4A 4A16A 2C0QA 2DHEA 1MX1A 5AKEA 4MXDA 3H18A 4CIBA 1R50A 3DNMA 3NGMA 1JU4A 3G9ZA 2XUGA 4KAFA 4UUQA 4MJ3A 5EGNA 3O9MA 1CUXA 4I19A 5IVDA 2PKYX 2GYUA 4YPVA 3STYA 5JZSA 5T4EA 1QOZA 3DOIA 4CI9A 4QDUA 3FCYA 5ALNA 5JANA 3ZPXA 1K8QA 2WFLA 1MNAA 4FNGA 2X8BA 3E1GA 3MVEA 1DWQA 4RE6A 5AH0A 3WK6A 2GYVA 2JIDA 4UBMA 4BCCA 2WHPA 2O7RA 1EH5A 3BF7A 4DNFA 4UHFA 3QMMA 5LYYA 1XQWA 2QMQA 4PW0A 1W6RA 1HBJA 2EDCA 3AUKA 1OXMA 3SX4A 3ZV7A 5HFAA 1BEZA 1LGYA 1PFQA 4XWGA 4IH4A 2XUFA 4BCDA 1EK1A 1LPOA 2RHWA 2XUQA 2XQKA 2WU3A 3LLCA 4AN1A 3FCXA 5LZ2A 4BE4A 2PSFA 3B12A 1JT2A 4L72A 2WJ4A 1QJ4A 3G02A 3WKDA 4BAZA 4A5SA 4HXGA 4DTCA 2XMRA 3WK9A 1F0NA 4TGLA 1THTA 5FPPA 3GROA 4BVJA 3IDAA 5AP9A 1TK3A 2OGTA 2BJHA 4Y2YA 2G4LA 3QPCA 2XUHA 4CFSA 3FOBA 1UOOA 1LPSA 2QUAA 3WL8A 5AM0A 3OTQA 3HACA 4E15A 4UFPA 3KWFA 3EQ9A 4HRYA 2W22A 5JD4A 2QS9A 4G8DA 3ESAA 2V98A 5CH8A 2XLCA 4H7FA 5ALOA 2WLSA 4ARAA 3QBJA 4TPKA 1O6GA 3QITA 4G4JA 4X7BA 3CN9A 2WUEA 5A7GA 1GPKA 3IA2A 4ARBA 2XMZA 3W2TA 2HRQA 2XMQA 5CTAA 3DKKA 4GI1A 1ZICA 4WY5A 3P2MA 5FOQA 3WL5A 4BYMA 4U2CA 4FNMA 2WFMA 3ESCA 4BCBA 3BF8A 4X91A 1H22A 1GKKA 2WG0A 5IH7A 4PSCA 5ALUA 3H2IA 2HL6A 1USWA 3H04A 3PICA 4KE9A 3MUOA 5LKAA 4Y2RA 4N5IX 4G8BA 1TCCA 5HF9A 3CN7A 2XUPA 1VA5A 3RKSA 5T4HA 5ALPA 1AZWA 3FYUC 4S0XA 2H1IA 1JJBA 1N1MA 4C89A 1YSCA 5JATA 1CQZA 2XB6A 4XIIA 2JGMA 4U2GA 3QPDA 1AC5A 2DCMA 4WDRA 2YYSA 4KRXA 4KYVA 1R3DA 4UHHA 1HDEA 3F97A 2VAVA 5ALIA 3ZLTA 4QE3A 1E8MA 1ODSA 5E4YA 3TRDA 3HI4A 5K3AA 5LKRA 1QIDA 1A8QA 2BUAA 4UFNA 2GBFA 2DSNA 5DNUA 3G0IA 3VVMA 1XLVA 3VDXA 3LP5A 5BV7A 3PFBA 1QO9A 5AO9A 3E4DA 4BDSA 3I2KA 4MWTA 2GZRA 2WILA 3C6XA 5ISMA 5D7BA 4DGQA 3W9UA 3E3AA 2Y6UA 4U2EA 3ILSA 4UBLA 1CRLA 1PV1A 3PE6A 4OUKX 4FFWA 1QONA 3WYDA 3PI6A 1DQYA 1I6WA 1UK6A 1CEXA 4QDOA 3GFFA 3I2IA 3T52A 3WA7A 4B83A 4G1FA 5ALYA 1TKRA 2PU5A 2Y2UA 4UBKA 3BDVA 3EIOA 2BUCA 4B7ZA 1H2ZA 3D4LA 2X76A 1H2XA 1XZKA 4EY5A 3FYUA 1DINA 1EXWA 2XUIA 1C7JA 3K9BA 1VE6A 1ZI8A 3WWOA 5LZ9A 3I2JA 3EF3A 3R3YA 4NS4A 3O4JA 1E8DA 3IUJA 4Y2JA 3C87A 2K2QB 4NVRA 1UK7A 5EIHA 3WL7A 3L1HA 2ACKA 4QDXA 5SYMA 2XMDA 3H1BA 3FLAA 3G9XA 3R3WA 4OYYA 1JKMA 1ZI9A 4DMCA 2RAUA 1IUNA 1GQRA 1QIJA 2ZVDA 1LPBB 1LNSA 1BCRA 2V9ZA 4P93A 3JYHA 2XE4A 3RARA 4Y7DA 3UUEA 5HF6A 4KEAA 1XZGA 1ZJ5A 4Y2UA 5AKHA 3H2GA 4JEIA 2AJ8A 1JI3A 1SCIA 2GBGA 1YB7A 4B80A 1CFJA 3DD5A 4PO3X 4DNPA 2D5LA 2B61A 1VJ5A 2J3QA 2BCEA 4FMPA 2H7CA 4IH9A 3PUHA 1TCAA 1F8UA 4J0JA 1JU3A 3ZWQA 1VOTA 2Z5GA 3ICVA 1BU8A 1DU4A 3A70A 1NU6A 5JAOA 1IZ7A 4DNOA 4P08A 3F67A 2QVBA 1EDEA 3IURA 3GELA 4DMFA 2OPHA 1EB9A 1K5PA 4Y2PA 4KE7A 1MJ5A 1QGED 2PUHA 2VTVA 5FP0A 3ANTA 4N5HX 1FJ2A 1LZKA 1RP1A 1QIHA 1QIGA 3KSRA 4X00A 2I3DA 1QIKA 1XRQA 2PSJA 3DS8A 5CH5A 2XQGA 4PSDA 3H17A 4OB7A 3AJAA 1N8SA 3HEAA 3I6YA 1ORVA 4B82A 1GPNA 5ALHA 5BWBA 2HA5A 1XZMA 4FLEA 3WIBA 3WMRA 1HLGA 3OPMA 3F8SA 2HIHA 5CT6A 3VJKA 1J1IA 2CMFA 4CIAA 1E8NA 3G7NA 1CIJA 2OAGA 1XZCA 4OCZA 1G66A 4ZI5A 3H2HA 4J03A 1CUDA 1R88A 4QLOA 1CUBA 1SCKA 2VSQA 3EQ8A 2QZPA 4H35A 3PUIA 2GBCA 3G8YA 5CBKA 1G4HA 1CUVA 1DWOA 2BFNA 3M3DA 1QTRA 5A7HA 1GKLA 1X2EA 4U2DA 2WUFA 5ALWA 5AK6A 4DSAA 4LKOA 2HFJA 3KOOA 2XUKA 1CUFA 3ZLVA 1EB8A 5I9IA 1E66A 2WHQA 3D5EA 4H7JA 4L3WA 4X92A 4AO6A 3C5VA 3FVTA 2GZSA 4ZXFA 5LZ5A 5K3FB 1DWPA 5JALA 2EEPA 4H77A 2WU4A 1UOPA 3ICWA 4MYDA 4B6GA 2JGEA 5AK5A 4K6HA 5DLPA 4C4YA 4OSEA 4FFVA 4GXNA 1AKNA 1F0PA 1MPXA 4AQDA 5HQ3A 1UKBA 3PF9A 4AMYA 1DTEA 3SC2A 1VZ3A 5AHXA 4LYDA 3V48A 3F9CA 1BN7A 3AZQA 2ZJ7A 3IIIA 5CT9A 3G0BA 3TJMA 2ZYHA 3C45A 1AX9A 4AO8A 2VA9A 3QH4A 3G9TA 2V97A 3I1YA 2IITA 3IVMA 1SOMA 1OILA 1XZEA 5AKJA 1NX9A 3WLAA 4AZ3A 3G0CA 4W9RA 2DR0A 2HRRA 3LS2A 4J0DA 1QZ3A 1XFDA 2HFKA 2HU8A 1XRRA 5EHXA 4Y2SA 4ZV9A 1XZBA 1U65A 3B3QA 4LIPD 4EY6A 5ALLA 2ZJFA 3WJ1A 4BB0A 1TAHA 4OYLA 5LZ4A 2G63A 1QTIA 4Z49A 3LIPA 2BKLA 2XUOA 2JGFA 1MN6A 4EUSA 1XQYA 3A2LA 1N5MA 2G5TA 5ALJA 1CUUA 2CJPA 1TIBA 5AKGA 1TQHA 2B20A 1N5RA 2H7YA 2JGIA 2XDWA 3M83A 4H7EA 3D2AA 4WFIA 5AM2A 4UHCA 3FWHA 2R8BA 5AK3A 5LP1A 1P0PA 2B9VA 4BAGA 4GHWA 4K6GA 1GZ7A 5FKJA 1CUJA 4A23A 2XMSA 4KACA 4UHBA 1LBTA 5A2GA 1L7RA 4GLBA 1K6EA 1M33A 3RM3A 5AI9A 1T2NA 1BRTA 3SK0A 5YASA 3S2ZA 1DT3A 1SFRA 2WJ6A 2PX6A 4PF1A 1E3QA 3STWA 4HXEB 1HPLA 2C5FA 1UKCA 2YH2A 3DYIA 3QMWA 4PNZA 1ZI6A 2QM0A 4K6KA 1KEZA 4BAUA 1G42A 2GYWA 4OU5A 4RGYA 5CH3A 1Z68A 4C4XA 2WIFA 3R0VA 4BTLA 2ACEA 2XUAA 4X97A 3GZJA 1LPMA 5ALKA 4AMZA 3WYNA 5CT8A 3H2JA 4J0HA 3SWWA 1YR2A 3U1TA 4M0FA 2H9YA 1Q83A 3D7RA 1HQDA 3HXKA 3O4HA 5HK9A 5E4JA 1ODTC 1AQLA 1AMNA 3AZOA 5FRDA 4KAJA 2PUJA 5CXXA 1MAAA 4CG2A 4YK7A 5AOAA 1BE0A 4JH0A 5HKAA 3UMJA 3DL7A 4BE9A 1KU6A 2HA0A 4FTWA 3FSGD 3HRHA 1JMKC 3WKCA 1FFAA 1UK8A 5DWDA 1XQVA 4KAAA 3O4GA 3G0GA 5AKXA 5AKLA 3H1AA 5JYCA 5AIAA 1XLUA 4B85A 3F98A 3CCCA 1CQWA 5K3EA 5HCUA 5A6VA 2FJ0A 1MTZA 2HU5A 5IVKA 4UBNA 4XJVA 1VE7A 1A8SA 1G5FA 2Z3WA 4MEAA 5C81A 5AI8A 5A7FA 1UWCA 2BAGA 4JYPA 2VJDA 3BL8A 5FV4A 2WG1A 1B6GA 2ZYSA 2XI4A 4AXBA 5ALVA 2QR5A 1D07A 1WHSA 4BTVA 1K63A 1ETHA 5E4TA 3V1NA 5EHZA 2AJDA 4AB1A 4X94A 2WM2A 5AI0A 1CR6A 4HTAA 3ED1A 4GECA 3STVA 4J7AA 1ACJA 3VVLA 2Z3ZA 5HF8A 1EX9A 2LIPA 3WQHA 2CUTA 4DSZA 4BZZA 2XQFA 4CCYB 4N8DA 4V2IA 3W04A 2OG1A 3W05A 2JBWA 1EVEA 2QOEA 5D3ZA 5SYNA 3C8HA 3BIXA 1CUAA 1VXOA 1XZHA 3QVMA 1OCEA 2CZQA 5JAPA 1YAJA 1CUSA 5AM1A 1ZIXA 5EI5A 5LLSA 4KRYA 5JAHA 4BRZA 1QIIA 2RI6A 2XMBA 1CUZA 5ALGA 2CEKA 3HLKA 1A88A 2FUKA 3AIMA 1YASA 1ZJ4A 4H7HA 2ZYRA 2H7XA 4X95A 1SCQA 4I3FA 1W52X 1PJAA 4HS9A 1R4ZA 4OB6A 5CT4A 2O2HA 3DEAA 1WB6A 2YXPX 4B0PA 5AM4A 4B0OA 4FBMA 5ALMA 1CUWA 2OGSA 2IIVA 5FLKA 5JAUA 1YS2X 3HZOA 2JGLA 1XKLA 5CURA 4TVKA 2WFZA 5FXMA 1XRNA 4Q3KA
chains in the Genus database with same CATH superfamily
2WFLB 3CC8A 5FFFA 1EVQA 1CEYA 2EWWA 1HE5A 4R0NA 2CHEA 3HM2A 2JGDB 3UHFA 1GZ5A 2H2IA 3FHCB 3A4YA 3GUHA 5E9QA 2OA0A 2KMLA 3ETEA 3ROPA 1Y89A 2R85A 5JS8A 4QJ3A 1FXWF 2YV4A 1NATA 2GHIA 2XIJA 3EDQA 4PHCA 4ZOAA 4BFTA 1A2KC 1JR3E 2WHPB 4N18A 3WISA 1GCGA 2ZTSA 4ZAFA 3VPHA 1YFKA 4L02A 1OV6A 3DL0A 3C7CB 1G60A 2G09A 4O4HA 4OQQA 4R9SA 4BASA 4J3NA 1RZRA 1MGOA 3DDZX 1R6AA 1BWRA 4HZIA 1DOZA 1I10A 3QMVA 2QTWB 3SDZA 3ZGOA 2AQIA 2MR6A 3HKBB 3ANNA 1JXOA 3GA0A 5H80A 1UXKA 4E07A 1W2WB 4CDRA 3TD6A 3D54D 4X66B 1U2PA 2YZGA 1QLWA 3A1SA 3UCEA 1MAHA 1AXRA 5EHIA 5EHNA 2VNKA 4NG4A 3N9IA 5DK6A 4FI3F 2C2KA 5KCMA 2BRUA 5JR3A 2IUYA 2NPOA 3NYWA 5K3SA 3VR6A 3ZHRA 6YASA 2NQ8A 3K5WA 3N0TA 2JH9A 4KNYA 4IV5A 4ROTA 1W75A 1SG0A 2CY0A 4NE2A 4DSUA 3FA2A 1SIWA 2BZ1A 2OQIA 3R3SA 2EKPA 5DM70 1ZIDA 5DNCA 1EFPA 1A2BA 1CC1S 1SCUA 3RI3A 5KWIA 1WCYA 1U0OC 1NBEA 2Z2KA 5B4VA 3EPJA 2R1TA 1RC8A 4K7JA 4KTVE 2CBZA 5TX7A 5KQMA 1EVZA 5IM4F 3W8EA 1VZ2A 5FLXA 3N39C 3QF7A 2WKPA 1ZIYA 2W98A 3TR5A 1U8EA 2A58A 2B2NA 2NO0A 2OCLA 4Q9NA 2Z2JA 3EWSA 2HNKA 3PFNA 2IYEA 1YZFA 1WLSA 2AJCA 5LCXA 1PR6A 2AS0A 2CL7X 1TC1A 3HB9A 4QREA 1MDBA 3P2YA 2JKZA 4K3UA 4INPA 2D74A 3OSUA 4BDTA 3W8FA 2QMOA 4JI7B 1NQTA 3GU3A 4AJPA 3LPCA 4EQ6A 5KNBH 2WW8A 3COJA 4C01A 2FW9A 2H51A 5KNDH 1DZIA 3QV2A 1RPTA 4RK7A 4CTNA 4CF5A 3WXBA 2UXDB 4AMGA 4XJXA 2NACA 1FQOA 2NSYA 3A1NA 4RVDA 3S8MA 2C7BA 2OLKA 2D1TA 3HH8A 4MMYB 2X0DA 2UYHA 2FE4A 2CF6A 2ZAIA 1J0EA 2J6HA 2XJ4A 2FWAA 3LUKA 3QVGA 4ZVUA 3S1LA 3ZNOA 4D25A 4X6LA 1XEFA 2OCGA 1O77A 1LRKA 1PJBA 2H31A 2FPRA 2WF7A 2KS6A 5BY2A 1Q74A 3II6X 3GEDA 4GNKA 4LV8B 1U0EA 2AFRA 4WVLA 3SXPA 5L3SB 2GVNA 3AERA 2A9KA 4BVLA 3WE7A 3CWZA 3PRHA 4GYYA 1A04A 5CBPA 1JNYA 2BR5A 2R1VA 2AMJA 3MNFA 5ALDA 3GIDA 2IHNA 4E12A 9ATCA 5DYYA 3HFJA 5E38A 4DM4A 1S01A 4JI4B 1E3LA 3QELA 1ODCA 1FSGA 1X7YA 3ELDA 1HEUA 1WQ4A 1JFSA 1P2DA 1I4TD 4JUBA 4OMFG 4XCQA 2CHQA 4MV4A 4RNCA 3ENKA 1RKUA 1ZGBA 2FZEA 3DOFA 3DTNA 3B1KA 3JWEA 3OIUA 4MICA 4PHGA 3WYCA 3ZHSA 3W5CA 3AUYA 1I7SB 2I7CA 5A06A 5AKIA 4EY4A 3OCXA 4IIJB 1G0NA 4LJ6A 4QATA 2QSYA 3DPSA 3QXJA 2O0MA 3OPYA 4ZQGA 4WK4B 1BROA 5C0OE 2Z09A 4BN4A 5B2EA 4MPDA 1VP9A 4O4HF 1WP9A 3EW7A 1KPHA 3U16A 3A7EA 3RUHA 4G4IA 1SO8A 2H00A 4Y3UA 4QLBA 4U6SA 3C8DA 4QQKA 3ZHBA 1MO2A 1W8DA 4NY1A 2B82A 5DNWA 3E61A 5FPSA 5EXDA 3ZI4A 2QBYB 2V7QA 1P2FA 5BW5A 4DG8A 1TM3E 5GM2A 2XVXA 4F3YA 4XGIA 3THWA 1U7UA 2C88A 5ETJA 2PUFA 4Q21A 3IERA 5EP3A 3EW9A 1AUXA 2QU7A 2QZJA 4P36A 4UOZA 4MQMA 4CVNA 4N6NA 3QU5A 4LHSA 2OV3A 1WPGA 2VZ0A 3FCAA 3IQIX 2YHIA 3IUMA 1LDBA 1UAYA 4RTMA 2NLOA 3I9NA 4Z0HO 3SJ7A 5E6RA 5ESRA 3S2IA 4UHEA 1NT2A 1M54A 3CB2A 1Z6XA 1OW3B 2B6NA 3GAAA 2BHTA 3NU1A 4QEZA 2AZXA 1LS1A 1NVTA 1LVGA 2ZPAA 3A4IA 4Q24A 4Q3OA 4YWJA 4RPLA 2JFVA 2HADA 3LYHA 2H3EA 2VTEA 4NAHA 3RHTA 4JSRA 5IDQA 4IDAA 3TECE 1XLTC 1ZZGA 2HV8A 1S7GA 4D6YA 4NICA 3KKQA 2CUKA 2J67A 4N5DA 4UOQA 3PS9A 4ZT5A 3FZEA 3T4XA 5HJ7A 1UBJS 3CVVA 2DUNA 3EAGA 4KPYA 2WYWA 1WSWA 1HDZA 1KZ1A 2X8AA 1RIFA 2NO1A 2YASA 1NOJA 2ZE5A 3EGVA 3A9SA 3H1GA 5AW4A 4OM8A 1LX6A 1PV4A 1L5SA 5JE8A 1GCOA 2OV4A 4KSCA 3QY0A 2I5PO 1BJRE 1URPA 1XJ0A 4AULA 3PX7A 2ODBA 4B6EA 4JJKA 1OC2A 2JGRA 2ZB3A 1WKVA 1DAFA 4PS0A 4CQMA 4INZA 1XLWA 3AESB 3VZSA 4BVHA 2OG2A 3K7EA 1FNBA 4I50A 4E5YA 4H1WA 4CM1A 3N8HA 3LWDA 4B73A 1YJAA 1Z5UA 3AG5A 2YXEA 3AEUA 1FLAA 3ZXYA 4ZI7B 3SJAA 2OZLB 2I4TA 2VEOA 2W2KB 4J29A 1ZVMA 2C29D 4ZVQA 2ZIVB 3JZIA 3RYHA 1KFJB 3TTWA 4E5VA 4ZIRA 1DT5A 1KJJA 3BUSA 3VO9A 3ZJ4A 4TZ6A 4BMNA 3H1FA 4FB5A 3KQOA 4DXAA 5CPFA 4U3JA 4L8WB 1IWOA 1VA4A 1L7MA 3VJMA 4MB6A 2WZDA 3EXIB 3IIKA 5LQDA 3WRYC 1RHMA 2Q8NA 4U9UA 1GO2A 3FNGA 1TCUA 3AP2A 3B7GA 4HYQA 2IK8A 3VPBA 1C3EA 3DA8A 4TMXA 2ZBFA 3I45A 4FLMA 2GERA 4DUGD 1XWWA 2XCUA 4IGIA 2O0JA 3T7RA 2VHYA 1MCZA 1PX0A 4YMGA 2QW0X 4LJAA 1YQWA 1QPGA 1QLJA 4ZMRA 5LOVF 1N77A 3K1TA 3CY6A 2JHPA 4OA5A 5JD6A 2DYKA 2JJQA 1T6XA 3JYQA 1M7BA 3IIJA 1N4AA 3A1DA 4JYCA 2FSVC 5C1IA 1CK4A 2YRFA 4FYYA 1P17A 3RAJA 3MFYA 4F5YA 3BK7A 4QO8A 3OEHD 1QG6A 5E3HA 2D1YA 1Z2EA 3TMKA 1QK3A 1RWOA 1UPAA 4EYSA 2ZRIA 3ASVA 2BM9A 5GJVC 5CLJA 3NDBB 1UM8A 2QRGA 5EIAA 4QLAA 2VJYA 2DBQA 3ABOB 3KCNA 3D6AA 4YCMA 3N5CA 4EJSC 1U5AA 4B6SA 3CXUA 3QEBZ 2H5JA 3R76A 5I9TA 1KDRA 2HCJB 3NV9A 5CTJA 1QP7A 2EXXA 4BPRA 4C3ZA 3LC0A 4W1PA 3IT0A 4DCCA 4F5ZA 3LVFO 1M10A 1QB7A 2CDAA 4HVCA 5KQPA 1BG6A 1Y34E 1KJIA 3DCIA 3LO5A 2DQYA 4HPXB 1EXVA 1CR0A 1Z17A 4QVKA 5BVHB 5FX2A 1UK9A 2BC9A 2Y1FA 3RFTA 4EKNB 4NZOA 2ZAOA 4YNBA 3U5TA 1VLVA 1QTNA 4JR1A 3SIRA 1XLTA 1XTKA 5I4CA 1EA5A 4JR2A 3WAJA 2ORVA 2ECFA 3R3UA 4X62B 1TUIA 1G8MA 5CVUA 5H3HA 3ROKA 3ANYB 4GOKA 1MB3A 4MQLA 4XUGB 2Y1WA 3EEOA 4RORA 2BGRA 5L9AA 3O8OB 3TTXA 1HYEA 4NCNA 1KSJA 1ECPA 2DT8A 2XCIA 1ESEA 2K6GA 3CPEA 3ITEA 4IJVA 5FJIA 1M6EX 1P5ZB 4EX7A 1SIOA 1F4VA 5BWCA 3OC0A 3NONA 3BE8A 4Q19A 2XNCA 2ZSJA 3ZHOA 2F8TA 3K9HA 4KW7A 3M6IA 3OZSA 3QEOA 5G1OA 4B4WA 4BLOA 4DZZA 4GWLA 5CXQA 2ORIA 2AW5A 2I76A 4RZHA 1YZLA 4XLTA 4P3KA 3RFXA 4AKGA 1QDLB 5LZ7A 1O89A 3NHLA 2Q9CA 1MX5A 2WD7B 2NQTA 4GX2A 2DHDA 3FNRA 4DLNA 3DE7X 3K6JA 2ZRKA 4I14A 2QTMA 4U7PB 1W4RA 1E1LA 2XSZD 2YS7A 2A5FA 3ADPA 4LGCA 4LISA 3MTJA 1V16B 3AKDA 3TSWA 3CU5A 1CSEE 4RJLA 1P7WA 2BR3A 1KJWA 2GZMA 3A31A 2SKDA 3BRWA 3H75A 2X22A 3IEIA 4KOAA 1QO0A 2XF8A 3TS1A 3WRYA 5B3JC 4OXKA 3RGGA 1ND5A 1EHYA 1AMUA 3ZWCA 1U8FO 1YS7A 5BSMA 3QVLA 2BEVB 4PQFA 5KNCD 4W5WA 3QFHA 5CA0A 4FD2A 2QMZA 4EW6A 4OJYA 4RKQA 3WZLA 4UPVA 1JFFA 1OZHA 2F3PA 5HK8A 4BC1A 5K8LA 5KKCA 1MB9A 3IVRA 3P4XA 1RJFA 3HJUA 2VJBA 3UWOA 5KEIA 4D4GA 3GEEA 1EJBA 1PTJC 3U3JA 1FP2A 3PC8C 4A36A 2GJAA 2ZSBA 4MQFA 2FSVA 2XOKA 4RQTA 4Y9SA 2WQZA 2HBZA 2WM8A 3DE1X 1UWVA 5JPCA 4V0RA 4Y0AA 2VAWA 4BNKA 3RRZA 2B0JA 2WIDA 3FYCA 3IV6A 4WCVA 2QXUA 1A8HA 4MULA 1H2HA 5FCDA 4EG1A 1VHQA 1BCRB 2PA0A 1VPDA 5KTYA 1WUJS 2C58A 3EPRA 3ADOA 4OAPA 3RJTA 4EJSA 3O8RA 3RBZA 4ASUD 1OHHD 1GOTA 2RHRA 1SA0A 3OZAA 4ZAGA 3TW8B 4NU8X 1SVOA 1D2NA 1MO6A 1XN4A 4EI7A 4ITVA 4CIYA 3SQXA 4A10A 3K8OE 2Z4TA 4QUIA 4K5QA 4H6XA 3B5IA 4O4LA 5LB4A 1Q1QA 3BSYA 4UCQA 2HA2A 2A78A 1LSJA 1MXFA 2X7JA 3AB3A 3B5EA 4WXHA 1MF7A 2YFQA 1JZSA 4TKVA 2MMCA 2W6CX 1T2CA 4IUBS 5IM5A 2OGUA 2OAEA 2XW6A 3OEYA 5A05A 1OF1A 2UVDA 3BIWA 3GJ0A 4QM7A 5LA6A 3RHFA 2IZZA 2Z5VA 2IEAA 4QTTB 3N2ZB 5CR9A 5JECA 2VHQA 2W6JD 5K7SA 3ESBA 3L4JA 2XT0A 4MRRA 1E0AA 3CKKA 1QIMA 4OFZA 3HB5X 2C5EA 3C5WP 3EH2A 4GXQA 2HBQA 5A9SA 2ROQA 4CLRA 1ZONA 1Z62A 3P45A 3V8NA 3ZW8A 4DJJA 4EJ6A 3KZ1E 3R41A 4QC2A 4M0MA 5IANA 4HQ0A 1L4BA 2AJLI 1QQ5A 1FNCA 4G5FA 4RGQA 4ZVTA 5C53B 4TTVA 4DHWA 4HXYA 1ZMOA 3DZJA 4XEUA 4UFOA 1Q92A 3EC1A 3R5FA 4I55A 2ENUA 3PGKA 5CYGA 2FPOA 2VYFA 3EXAA 1ACLA 4KAXA 5HE9A 5BQFA 5L3QB 5HF5A 5MDHA 2AOXA 2ZYDA 1MR3F 3W5DA 3B1FA 4Q7EA 1USUA 1IZ8A 2PBLA 4F8EA 4NCHA 3WBFA 1X1RA 1JDJA 2IBSA 1DCMA 4LYYA 2YVQA 3CUYA 3LDFA 3N86A 2H65A 3H99A 4EI2A 3Q7TA 2O6LA 5B3JA 4LC0A 1HFKA 4A9AA 1VLQA 2D3TA 5ECGC 3SZGA 2JGJA 3F6CA 5AUNB 5BYBA 1OR8A 1ENOA 4JYAB 2NXEA 2Z8XA 4Y9RA 5DRTA 3S5UA 1XGKA 1XZLA 2OCAA 1K7FB 4C4OA 1HEIA 3IAFA 4FUTA 4BRUA 4ZDJA 5JQGF 1IJFA 1LZLA 4RZXA 5TQ2A 3W6ZA 1TQ2A 5FBRB 1F8FA 1JLSA 1PTJA 1PFWA 5FQOA 4Q4CA 1P29A 4NCKA 2DFTA 5EZ6B 3PJEA 1WOYA 2J4DA 2IQ5A 5LYJA 2XY4A 1Y8QB 2RKOA 2PGLA 2WJHA 3ESDA 3K9GA 1LPAB 4OATA 1A4RA 1BE1A 5I7AA 4K6MA 4QWMA 5I7HA 1CE8A 3TAUA 5KYYB 1THMA 3EZLA 2UZ1A 1YC5A 3ZQUA 5DT9A 4NMLA 2IYFA 3AM5A 3F6BX 1E7YA 3NFRA 3ZC3A 4BEVA 2C92A 3CNNA 1CRQA 2R6GA 4NDNE 1B8NA 5ALTA 2DPMA 3WOHA 2PQ0A 4DQLA 5E6UA 1JN0A 4WLOA 1C0LA 2GQ0A 1ZOSA 4UU1A 5B53A 4BE7B 1Z5PA 2DU8A 1RXWA 1IK4A 1BVRA 1FDIA 4X6XA 1B2LA 3QGMA 5EMLA 4GVLA 2C4HA 2X3FA 2G0TA 4EK9A 2FMHA 3DDUA 3OIDA 1PX2A 1MENA 3SJCA 3HKCA 4EZBA 1PN3A 2A9QA 2QLJA 1JHUA 1GYPA 5MN4A 4LOHA 5JJCA 2QUHA 4N47A 2BI8A 3A06A 2QJRA 3CTMA 3OCZA 5MN6A 1PR3A 2CLMB 5ESDA 3MQFA 1C9MA 1SVMA 1ZGCA 5JV5A 3F46A 4P80A 4RDCA 1ORHA 2Q5EA 3RRJA 2F3TA 5J23A 5TRTA 1IE3A 3VZQA 4O2LA 4PFJA 5HBRA 4GT1A 4JUAA 3U39A 3WK8A 5C8DA 1OOEA 3A14A 2ZJ5A 2I54A 2P27A 2GD6A 5K3DA 2RHMA 1ECJA 4MUJA 1HWYA 3HY3A 1VG8A 4LOAA 1WB5A 2NU8B 5FEUA 5HMMA 3F7OA 3QBVA 5J47A 1R37A 1H1DA 1DP4A 1PWXA 4X20A 4B5KA 5CEJA 2CYCA 4LGMA 2P7HA 2DHRA 1NMYA 1Z4MA 3PFIA 4IKPA 2V3CC 3WAGA 2W2QA 1JEYA 5MGNA 4KO1S 1NUSA 3OUTA 4X63A 2ZBRA 2REBA 2H18A 1UBHS 3BXPA 3PKJA 3QWFA 4BGUA 2C5BA 3R7NA 3VR5D 3EIWA 3KD3A 1BA3A 3DT8A 2PZKA 4HJRA 1YDMA 2G71A 1A1VA 2GAOA 3KFLA 4YAFA 1O9BA 4BYGA 2ZIXA 3Q9NA 5DHPA 3ER9A 4N9WA 4EL5A 1Y7TA 3R8FA 2PJZA 2Q5QA 3G13A 2ZS7A 4GZLA 5E4FA 3T9AA 2JZCA 5DP2A 3BMOB 1I7QB 5IXSA 5K3CA 1KO4A 2XGGA 4HAXA 2D7CA 2JA2A 4FT2A 1R6BX 2OQVA 1VLLA 1WCIA 3HU5A 2QTNA 2XYVA 3MCUA 4TMKA 1JEAA 4YV0A 2P0EA 1J8DA 3H2BA 3ZCPA 1S1MA 2YDXA 1FRZA 1BZYA 3HBJA 1B76A 4PSUA 4LBZA 4RW0A 3O47A 2B94A 5K3OA 2YWFA 3DLAA 4E7OA 3PHIA 5AVZA 4CKWA 5KREA 3JZAA 4RVGA 3GF4A 3WLHA 2XUJA 3D3WA 1ISPA 1RR6A 2O2JA 4FCCA 3IJRA 5JW6A 4JEUA 1D2GA 1BC5A 3WGZA 2VUIB 2XMGA 2W42A 2WT9A 3W1WA 3FWNA 2XA1A 4JC5A 3BGOS 1J99A 1TC2A 4DC9A 3G5UA 3NHMA 4OXNA 3QBDA 3AM1A 2NZYA 4LYFA 3WKEA 1W36C 1Q0PA 3HUUA 4L28A 4K0KB 4XIFA 1E2NA 3BSSA 3HKEB 5DYWA 1ZK0A 3OJCA 5G0WA 1Z07A 5JISA 2ILVA 3WYAA 3SSNA 2PBZA 3F3MA 5COAA 5AW7A 3FWPA 1YKFA 4UDNA 3N53A 2BCJQ 3HUTA 3RTBA 5LZ8A 5CB8A 1MOPA 4U2BA 3LY5A 4YRAA 5BVGA 1BDHA 3T7AA 2A9OA 3C5HA 5BV0A 1A9XB 4QWWA 3BWVA 2XCRB 3WYEA 3IPRA 1J9GA 3ZNPA 5DTJA 3U17A 2Z3VA 1ZJZA 1S2NA 3NM4A 3TJZA 4AJEA 3WDKA 4DN6A 4TYNA 3H7AA 1IU9A 4IFTA 1NXWA 1OWNA 1QGUA 2XCQA 1II8B 1GEEA 4QOEA 4O0MA 4UUOA 3RVRA 4EG7A 4I1IA 2PWZA 3V2GA 1NJSA 3SX2A 4I1SA 4IG4A 3BHJA 4ZJZA 1GARA 4MB0A 4F9GA 3DVAA 4N7RA 4EYKA 5FNVB 4Q7JB 1N7JA 2P3LA 4GKAA 4F4CA 4EITA 2RDMA 1A0OA 1NNUA 4UHDA 1XDBA 1E4VA 1R6TA 1WPXA 1GPBA 3BRCA 4LFCB 3IEXA 4KQ2A 2ZBUA 2QLBA 4DB4A 2JCYA 3LGSA 1SXIA 3UUGA 3TW0A 2EL7A 4EZEA 4RSGA 5CPBA 4CEIB 1QRAA 1WUYA 2PKQO 3HB7A 1GXSA 1QV9A 4LNAA 4X1KB 3UGQA 5BR1A 1HDCA 3AK4A 1C9KA 3BB1A 4DQXA 3OMWA 4YJ2B 4PQEA 3P1JA 1RI2A 2I03A 4XOIA 4CLOB 3FHTA 2WJVA 3WGYA 3MB5A 2HA4A 1SN7A 4H2DA 2JLWA 5JXIA 3LT2A 3SC6A 3AETB 3HCDA 1SC9A 2PYZA 5KJCA 4X93A 1LSSA 4JLDA 3DUWA 4C4ZA 3CONA 4R7ZA 5BUCA 3AEQA 4REQB 1G5PA 3DR3A 4RC9A 3TGPA 1MP0A 4JYMA 4LOKA 4CCAA 1I5OA 2TMYA 4CL0A 3EVCA 4AWBA 3OD1A 4BZPA 1Y3CE 3D7MA 4BKMA 2MYTA 4F2WA 2CNWD 3QP9A 5IHPA 1WDMA 4J8PA 4L7VA 2VT6A 4IF6A 3ONVA 1Q7GA 4OK5A 2ZW9A 4PZYA 5M7EA 1FW8A 5I4IA 2IELA 2NTYC 1ISFA 1WVIA 2I2FA 3ITDA 3L1JA 3OG9A 4GSYA 4C0JA 1WM1A 4HAYA 2CL6X 3AHCA 3DEZA 4BX9A 4ZTBA 5JHHB 2CLKB 3JZFA 4PFSA 3K6KA 3BHMA 4G37A 5AKKA 2NWQA 1B42A 5K0NA 2IV7A 5KYUB 1IQUA 1NFQA 1TO1E 3CA8A 4EQZA 4E1VA 1Y8ZA 4LE2A 1P4HA 2I2XB 4MHTA 1F60A 1ZD5A 3SIXA 2VHXA 2I67A 4KLRA 4A8TA 3B2EA 3KV1A 1RC1A 4YA6A 2GA8A 1QRUA 2HEIA 4HGYA 3D02A 5DBOA 3MWEA 2HMWA 4R05A 1OKKA 3OOSA 1UBOS 2NUPB 5BQ3A 1L5KA 2FFJA 3R9IA 3LDHA 3NBKA 3DNFA 2WFAA 3QOYA 4J3JA 4LHVA 2OC9A 4ZC8A 3OQJA 5T4BA 4KE6A 3UNXA 1KEPA 1OZ0A 1X1BA 3HFSA 5DLEA 1NVXQ 2Q46A 4KIWA 3V46A 4BFXA 4BZWA 2Q5LA 3NNNA 2FEXA 4LXUA 4DDWA 5I3CA 3VU0A 3F5MA 1XNHA 1BXGA 5LPNA 2OHJA 2C2WA 5JSKA 1V11A 1AQNA 4F6CA 3EULA 3M70A 3C70A 1Y4AE 3A10A 2BFDB 4V38A 4C4AA 2AFVA 5AOCA 1Q0SA 1M8KA 2JFUA 4NOMA 1HO3A 1SC4A 3MPUA 4MW2A 2ENWA 4N3AA 1CZUA 1Z13A 2E2WA 1EA7A 1T0JB 2H92A 4XLZA 4PYJA 5BOSB 2JNWA 3GD7A 4Q4LA 2GCOA 4M1EA 4RCYA 3KOYA 2PKWA 4JU8A 5BNFA 1RACA 1KMHA 1HG1A 4F2GA 3QV1A 3ZIDA 1U1DA 3DMRA 3CW8X 3L8CA 4MV1A 4EOGA 2X9QA 3QE4A 4HWSA 4A0HA 4C4SA 1IAQA 4WADA 4KVFA 1NM5C 2EP5A 3L46A 4M49A 3TZCA 3GCGA 3PD1A 2DBRA 1JFRA 2H07A 1P2BA 1JFLA 1RLOA 1JJVA 2LRHA 3G2MA 1UXHA 2BFMA 1O6FA 3MZ0A 3B3JA 4PXAA 4U7HA 3TPFA 3U3OA 4CTKA 5LNK1 2V7EA 3S2UA 4YJKA 2CLSA 4ARVA 4U7FA 4B47A 1LNZA 4PIMA 2CFCA 1LBEA 3F6YA 3VPDA 3M6AA 3I4LA 3PIDA 3OWHA 1R9MA 3HGQA 1G59A 4MKXA 4IUYA 5CLHA 2JEZA 1T9GR 4EIWA 5GTDA 5JNUA 1RE0A 3VDRA 4QU8A 1ULTA 4TV8A 5K8CA 4NJMA 1SRRA 3OQIA 1V4BA 1DS6A 1GGMA 3L7NA 3H5LA 1QM5A 2DHCA 3L92A 1RT9A 1N0IA 4TTSA 1NPDA 3IP8A 1WDKA 3DBLB 2Q1SA 5IPFA 4MVJH 4F85A 1KO1A 2FF7A 1V39A 2MMGA 4WJKB 1F8YA 2Q49A 3MG9A 5FWDA 4RK0A 1YR7A 3LYUA 5EE9A 3HCPA 4D8XA 2ZXEA 4PX9A 4RZIA 4M46A 3UT5B 2BFFB 1FTGA 1V9SA 2CNNA 3W7VA 4A5OA 1Y5MA 2IYVA 3OSZA 5EGSA 3IUQA 1YTLA 3NBXX 4HVTA 1L5NA 5K8VA 2QM7A 3I28A 1DI0A 4HBZA 4HFMA 4HEHA 2PQ6A 1E1RD 1N6RA 3LHIA 3VI3B 3VPGA 1JF8A 3IVGA 1V35A 2AOVA 2BBSA 3KD2A 5IXJA 1EFHA 1F51E 1M1YA 4QUEA 4I1PA 1BE6A 1PQWA 1QS0A 1WXXA 5K2MA 3DL2A 2G17A 4OKNA 3KBOA 1WW3A 4LDPA 4D3FA 3I61A 1F8GA 5C1OA 4W99A 3IH5A 3L3BA 2MSEB 2I33A 5JLJA 2AOTA 3I9LA 1UKVY 1PJ4A 3OH8A 3SOZA 3EFBA 1YR6A 3HVJA 3WWPA 1OGYA 4CCWA 4DV5B 3CRRA 5IEJA 3EVEA 4RELA 1BHQ1 1I5EA 2WWTA 5IUJC 4ISCA 4NZYA 4TLEA 4Q16A 4ZOEA 4L5BA 2IPXA 3MS4A 3QTLA 1GTZA 1O9GA 3MGBA 2GK7A 4MKFA 3FXAA 2GD2A 2AZTA 2AF3C 3D2BA 2OFOA 2FJUA 4INOA 4MWSA 1QAQA 1QFJA 4KO4S 1J2JA 1Y98A 2P1DA 3JQAB 4PCAA 3O4RA 4I5IA 3O8QB 3MT8A 4I5DA 5T41A 4AZ0A 3ZHCA 4G5RA 2HMTA 5ESWA 4DWOA 4Q1DA 4MOWA 4LJKA 3GL9A 2PAAA 4MH0R 9LDTA 1S8NA 1RWQA 2Q99A 4FGUA 2YY5A 4PAGA 3X0DA 4BP8A 4ND2A 1DIHA 4X85A 4E7PA 4DQKA 1C5KA 4O1HA 1M6YA 1C80A 1S7CA 4J0FA 1JLHA 2VTBB 4YHHB 1KEEB 4IIGA 2Q6IA 3R0XA 1PTKA 7YASA 2P9HA 2QTVA 1DC3A 3K0AA 4ACBA 1VJRA 5JXHA 5KOJB 1WXEA 3D2CA 4HT3B 1FS4A 3QZUA 4GUDA 1I2MA 2GFHA 4G5OA 3ZE2B 4YIHA 4XWYA 3D8UA 5DGCA 2BEWB 1DBPA 2RK4A 4I4TA 4MX8A 4RD0A 2ZUBA 3W5UA 3ZDFA 5F33A 5HJ2A 4UTNA 3S5JA 3WK5A 2HIMA 3CX8A 3LL4A 2W37A 1KZYC 1IH8A 1W46A 5CP8A 1FTQA 4B9AA 1RYEA 3K0CC 2LGJA 4D9JA 1NBHA 5C9ZA 5IVHA 3CLTC 1C7ZA 2Q5CA 1T8SA 1YB6A 1NW6A 3C6ZA 2AMYA 4K46A 3LX8A 3K0FA 4DCVA 1XU9A 1KYWA 2HSJA 1T34A 3G5TA 4LXGA 4TV8F 3B5JA 4BO0A 2BYTA 2A0FA 1IVYA 1M73E 2R6HA 3DWEX 4KV7A 1ZD4A 1XMOB 2C0QA 1BD3A 4R1MA 3TNFA 3OQVA 3H4MA 1DEAA 1JAHA 3FCCA 1QVRA 1FUEA 3FRJA 1M2VB 1SVNA 4NABA 2KX7A 4NU5A 5CB4B 3R2JA 2W58A 1C7FA 1Q7EA 2WJAA 2AFIA 3G9ZA 4TROA 1U1IA 3REOA 4MJ3A 5A6SA 2LP4Y 1X42A 2F9LA 4JUCA 5EGNA 1UC4B 3D9QX 3IMFA 3W4KA 2EWMA 4ZQCB 1JHVA 1DWUA 4M1WA 4AZVA 4MUIA 4FGZA 3STYA 4BLSA 1JW9B 5KTMA 1K8ZB 1M34B 3DC7A 4G0OA 3RO7A 2ATVA 1SK8A 1H0HA 2GM3A 2JARA 1T5IA 1JXAA 3MW8A 5JZSA 3WSWA 5TGZA 3LOQA 1AT1A 1N5KA 3KQYA 5DSXA 4MGKR 5B1IA 4CI9A 4MR8B 4LXTA 1XUOA 3FCYA 2GN8A 2CE2X 1VJGA 1NQ5A 3IEKA 4OJQA 4UUAA 1SR8A 1P77A 2BSAA 4PYLA 1FF9A 4XDGA 3RS8A 1V3QE 3T4UA 4J9UE 4BNLA 5LFAA 2RCNA 3OOEA 4OBWA 3T9BA 5K0BA 5LXTB 1K8QA 1RI4A 3NXKA 3BPSA 1A1SA 1MNAA 1VB5A 3ZYCA 1V5GA 4FNGA 3FNQA 3GRAA 2UUPA 4GI5A 2R86A 4ZCRA 1DWQA 1UJNA 4UMVA 1RLTA 3I5AA 5EKXA 5AH0A 3ZHXA 2ZIWB 3Q6IA 1YR1A 5IBPA 1RPZA 3WK6A 4MW6A 3GBVA 1XVVA 1CJVC 1QUEA 3BCRA 4MUMA 4Q1EA 5A1JA 1Q1EA 3I9JA 4YHBA 4ZDKA 3KSAC 2Y1XA 1V1RA 1Z8DA 3QA3E 5HIMA 1JHDA 1PUXA 2AUNA 2YW2A 3C4QA 1L3IA 2CSUA 3JZDA 1TU3A 1K5GA 3LZDA 3N1UA 5AVVA 2XHZA 1ZVJA 2IHUA 3OTWA 3BF7A 2FKNA 3A1CA 4K86A 2TSYB 4L8VA 4UKDA 3U7QB 4KDCA 4AIIA 2GN9A 4WD3A 3ZKWB 1N8TA 5B7QA 5LYYA 4LQCA 1JKIA 4ZA2A 1Z7BA 3VR3D 1J8YF 2XYRA 2K7ZA 1CKEA 1FX0B 2ASVA 3GJRA 3U7IA 4A1OA 5I5EA 5AVUA 5K0SA 3AUKA 3OQPA 2A0UA 5C7OO 4NYIR 1DQNA 3ZV7A 2Y99A 1GEGA 1JZQA 2YMMA 3L0PA 5JYEA 1VCNA 1JKFA 4A0SA 4DIMA 1BEZA 1GSIA 4MYCA 1BHO1 1LV7A 1PFQA 2OECA 3GOQA 4I4TF 2WPDD 3DZDA 5BN5B 1AHIA 5H82A 2BFAA 4IH4A 2VJLA 3MCZA 1K6MA 1C9DB 3K0CA 3PHLA 1SUSA 1ZN2A 4E1AA 3PQ5A 1E7MA 2P3OA 5I7VA 1VM6A 3JRWA 1FY2A 5KMGA 3K1AA 3EUFA 1MB4A 3RANA 3I64A 3C7DB 3OFND 1I2ZA 3F90A 3PZRA 3VU9A 1C30A 4MLZA 4CDGA 1Z0DA 4C4PA 3Q1LA 1DIRA 1NNSA 1SCJA 5CUQA 1I3CA 1H9BA 1OTXA 1RHUA 2ODEA 3PNSA 4LJ5A 3KJNA 4BEJA 3LX4A 2QP4A 5TQJA 4Q9KA 3LLCA 1L8XA 4G5SA 4DYDA 4BE4A 3SKVA 4CF7A 3B12A 4LN1A 2PT9A 1GSAA 1OLUB 2Y93A 3G02A 4H6WA 3G3EA 1Z06A 4H7PA 4XASA 4G84A 3WKDA 2YFYA 4BAZA 4JN6B 4ZD6A 4EKYA 2O3SA 5EE1A 4I36A 4I81A 3HXMA 3FWKA 3LY8A 4DCMA 2W8BB 4H15A 1QMGA 1IXSB 3IFSA 2XMRA 2C03A 4NSNA 3WK9A 1DBRA 2XAAA 2IL1A 2L19A 5E6SA 3SZ3A 4BV3A 8ATCA 2GCIA 2PR7A 1I1QB 4IIYA 3OLWA 4D57A 1DAIA 1C3OA 1Q21A 2OBLA 3TZKA 2P6OA 3HZZA 2V7UA 4K6FA 4Y2YA 2YYZA 1E4YA 3KK0A 3KJZA 3HJAA 3T5BA 2XITA 1VIAA 4HQNA 4DR3B 4CFSA 1MD9A 2ZBGA 4YP1A 3DO6A 1P9LA 3ILXA 3GH1A 1Z12A 3OTQA 1N33B 3R5XA 3E5NA 2G0AA 4UTOA 2D2EA 1I01A 3Q3IA 3W6NA 5JS2A 3TOVA 1CZNA 5JAIA 3IBYA 2H0RA 5JWHA 4CR6A 3Q8XB 3DH0A 4F1KA 4Z7QB 2CXUA 2W22A 5KSWB 1N92A 2QS9A 5NLLA 2V7QD 5B7NA 4CN8A 1RBYA 3HJTA 1KZGB 1XOIA 3ESAA 3KZCA 2UVPA 3BTSA 2REOA 4YRPA 1A9TA 2ZB8A 1KORA 4I66A 4KWIA 2WC1A 4YUWA 2Y1LA 2JCGA 1T2AA 4L76A 2GA9A 1OD6A 2DCUA 2ZIFA 4H7FA 4S1TA 4DY4A 1U99A 2D54A 2IJGX 4HNRA 2DUMA 4O4HB 1IONA 1M2FA 1Z08A 3C4VA 1XTRA 3E6AA 2PUGA 4L8LA 4RJ2A 3A27A 4P38A 5HIIA 1W35A 4OJTA 1SD2A 2JD2A 3KKPA 2AI3A 4LZWA 2CVFA 4XYMA 1IMOA 1FDSA 2QB5A 3UOWA 1GPKA 2WVJA 4ARBA 1RHRA 4MW0A 4HQ6A 4MYHA 3VYTB 4PLCA 3JPYA 2HRQA 5CTAA 3DKKA 2EKZA 1TM4E 4QBIA 2BDUA 2HIGA 4JCCA 5HS6A 2ZUUA 4EFLA 3DAGA 3PFGA 4XCVA 2C9MA 3SQOA 1IY0A 3U40A 4KBGA 1ONPA 3TNJA 4WY5A 4CGZA 3VZRA 4UXHA 4WZBE 4UTPA 5FOQA 3ET5A 1MAVA 3WL5A 1P7CA 3EXHC 1O94C 2C3UA 1EFPB 1FSZA 3QXXA 1KDVA 4U2CA 3W2EA 4N6GA 2B8JA 2PZJA 2R1TB 3MWYW 3EISA 4B1FA 1OLSA 1CR2A 2G5GX 1JKJB 4YI5A 4W8HA 3TLKA 1QRTA 3R5JA 1Q2XA 4AQ7A 4XRGA 3E1KA 2VK1A 1GKKA 2RG7A 3ORFA 4BO1A 1F14A 2C54A 4H16A 5IH7A 4NE7A 1WZ2A 3ZEAA 2Q9BA 2WV7A 1TYAE 2WYOA 4BQSA 1HUQA 1USWA 2Q45A 3PHGA 3PICA 1ABEA 3BWEA 3KL2A 3MUOA 4I5GA 4JLNA 4KE9A 4EPVA 2X23A 1G4UR 3V8VA 4EQ6B 3EZNA 5EMHA 1V7ZA 1TF2A 1NR5A 2J0VA 1Q12A 1XR3A 3ZK9A 5ES4B 2R3SA 4WOCA 1TCCA 3DWFA 1WTAA 1N9GA 1K27A 2GSWA 2XUPA 2ZBEA 3CN7A 3FTCA 3WLTA 5T4HA 1YZHA 4ML3A 2J0SA 4LF7B 1P73A 3QVGB 2QVYX 3IAAA 2EARA 4L73A 4GL2A 4GC9A 4RS3A 3Q10A 1U2ZA 1IDOA 4S0XA 4LTMA 1EX1A 2VCYA 4V0QA 1F0YA 4HD8A 3ZY2A 5JATA 3AERB 3MJTA 4H31A 3TX6A 3JQ9C 5AJYA 2O2XA 4HEA1 5EXTA 3BXEA 3W9YA 1BMFA 1TF7A 2R1VB 2D5AA 1WSAA 1T43A 3LQFA 2QRVA 4EO7A 4F45A 1H4QA 2B4TO 1DG3A 1PGNA 1K7YA 2ZRPA 3FFWA 3QKSA 4JFRA 3KB1A 4KPGA 2J46A 4ODIA 5JI2E 4YFYA 3ZWYA 3QELB 4UD2A 1R3DA 1L9KA 1SVLA 1X7YB 2EZ9A 2I1WA 4YB8A 3HXLA 4KDRA 3FZGA 4UHHA 1O0BA 1HDEA 4BU0A 1T9DA 3F97A 3RT7A 1PKEA 2HWWA 1Y5LA 3QHPA 4EF6A 2C99A 4R69A 2D0PB 2I7VA 4D9EA 4JCOA 1ODSA 1QBGA 5SZHB 5LU9A 4LJSA 1HMYA 3RF7A 3TVYA 3WBJA 3VDQA 3VR1A 1NVWQ 3MXOA 5F2KA 2O8FA 4N48A 2WYIA 4CV0A 1A8QA 1TJ3A 3OPYB 1P33A 3QXSA 5DXJA 3CUWA 1GG5A 3F2VA 4B4DA 4URXR 1X13A 1JR6A 5BUQA 1I24A 3P4UA 3GP8A 3R5KA 3U2QA 4BWVA 1HE8B 3HVKA 5F1PA 3D1VA 2H17A 1DDIA 3H9JA 3UJ3X 4I7EA 1AKTA 3KZVA 4QGFA 3N6XA 3THWB 5A4KA 1A5BB 5IAEA 5BV7A 4IW3B 4JWKA 4XQGA 2ZT6A 4U1RA 2XKJE 4NOJA 4V02A 1I36A 1A4IA 1FRNA 1T0IA 2EAUA 4MWTA 4D82A 1Q0TA 3RTGA 1CHNA 1O94A 3ZD7A 1KP2A 3HJBA 4Q1CA 4Y7CA 2YHIB 3W79A 8ABPA 2WTUA 2VHVA 1OFVA 1U3WA 3FPHA 3WHPA 5E6RB 1QQTA 4ND6A 4DGQA 1CVRA 1R0YA 2A35A 3EUAA 3HMQA 1TJNA 2FPPB 3RVOA 1ZCAA 1MO4A 3TUJC 1NSFA 3H4TA 4OUKX 4UM7A 1MDFA 2BKVA 3MFQA 2PMBA 1I6WA 4LQDA 1VJDA 2ZSDA 2ZUTA 3U7EB 4N76A 3GFFA 1YFZA 1O96A 5DB4A 5LUAA 2Q3CA 4B6OA 3ZVMA 2KYRA 2B0CA 2C7OA 3PGVA 1DV1A 2R7LA 2ETXA 1J5XA 1Y80A 2FW8A 2H1OA 1VCIA 2D1QA 4KUGA 4O8ZA 2JPDA 4LPSA 1DOAA 4JBWA 1COZA 1VIYA 3EIOA 4GMHA 1Z7WA 3LF1A 3KPWA 3UMYA 1RRKA 2ZWPA 2X76A 4G86A 5ELLA 4U0JA 1V8BA 4WXPA 1TVMA 3LM8A 1J1UA 2VAMA 2YV3A 1D6JA 3TR6A 3Q3GE 4ND8A 4CQMB 2YJ3A 1P2TA 1T26A 1ZGHA 4I50B 5B58C 3JQ9A 3AEUB 5IT9A 5G0UA 1BGWA 2Q4TA 4CMBA 4RPIA 1K9SA 2YVUA 4NIMA 5ICGA 1ZI8A 2GO1A 3OUUA 4ZIRB 3CTPA 3CNOA 5I6DA 1INLA 1WD7A 3USZA 2C1XA 2ZPUA 4WW0A 3NHZA 3V4SA 4AU1A 2ZTMA 3ZU6A 4K03A 4G25A 1KIMA 3A6PC 3CEAA 2AWNA 1D1PA 4U3JB 5BSKA 1PFYA 1RJEA 1UQRA 4E32A 3HYTA 3WGHA 3PWSA 4Y2JA 2P6RA 3C87A 1E2PA 2V6JA 2ZUVA 4M1KA 4WRRA 2D2IA 5B6JA 4KQXA 4GZ3A 1YJ5A 3MD9A 4MMXB 2FFBA 4MS1B 4HAUA 1J09A 1OI7A 1IY1A 4II3A 3LXXA 3H1BA 3FLAA 4CRWB 4EGAA 5CCXA 3MN1A 3UPTA 2I2WA 4MZDA 3OE7A 4OYYA 4P4UA 2VN8A 1PRYA 1SUIA 3GFOA 3GLKA 5F5LA 2RAUA 3BBPA 1Z0ZA 3BJZA 3DDHA 3TRJA 4E5PA 4PYOA 2ZVDA 3Q7RA 3MJFA 4RH0A 4NZPA 1EXDA 2PIAA 4MR9A 1XXHA 4AZ3B 3WJ7A 2O1SA 2QR3A 1Z0UA 3NT2A 1IG0A 1OFTA 2GASA 3CH4B 1P18A 4LZOA 3RARA 1KL7A 2P4HX 4DBLC 2FXVA 1PR4A 2A9FA 3FROA 4PRYA 1EX6A 4QQFA 1ODFA 1KZ6A 5CDSA 4PQGA 5LQJA 1EZ4A 4I9NA 2W11A 3LK6A 5JCPA 1KFCB 3GWGA 5JRZA 4GR4A 3W2FA 2IZ1A 4D3YA 3GRCA 1PL6A 1BQ4A 1CW2B 1E2FA 3M4YA 4RVCA 4WECA 4FR5A 1IXZA 3CLUC 3G2PA 3P9XA 2OUIA 3B9QA 4CKEA 4IAOA 4IEIA 2GO7A 3S1SA 4Y2UA 3ZH2A 4RKWA 4Y9TA 4E2WA 3DFIA 4TRNA 2YVLA 3H5WA 5CU7A 3OQMA 3H2GA 5U9CA 1QVVA 4QX6A 1L5ZA 1D8TA 4HGQA 3T6KA 3Q3JB 1H69A 2A86A 4C06A 3I2YX 4D3DA 4LOLA 2TECE 1G21A 1B6SA 2F6RA 1KRWA 1CFJA 1NJFA 1V45E 4P53A 4UASA 1RYMA 2RH5A 3I04M 1EU1A 4YVFA 2YFHA 4AF8A 4PO3X 2D5LA 3TINA 4Z2YA 1Y82A 4HS4A 3GC6A 1L4UA 4GM1A 2WT4A 1AH2A 3ICPA 3TLXA 3NX4A 1V0JA 3CR7A 3NETA 2RGCA 3HZHA 4R1NA 4DLPA 4U4AA 3LPLA 1W59A 2VYCA 2XBUA 1OZAA 3PUHA 1TCAA 1XTUA 4P0TA 4BFSA 1EGMB 5HKKA 1DFIA 3GQVA 1P31A 3L7MA 4J1TC 2C1EA 3L0DA 3P9ZA 3WYFA 4R8LA 4BNZA 1VOTA 1DKUA 4QXAA 1HR0B 3INYA 4BOYA 1U8YA 4F97A 4U6NA 2Q2OA 3BAFA 3SOPA 4UQLA 2GAJA 3SXJA 1BU8A 3GJSA 2AHOA 1DU4A 1PWZA 5KNCH 4R9NA 3GAFA 1YHNA 5AWFC 3QVTA 4FGJA 2P2CA 3DTVA 4PTLA 2C59A 2IHKA 1IZ7A 3BIJA 1G8GA 4FC7A 3O03A 3WL4A 4EFKA 2XXAA 4GPD1 5KB3A 3WXMA 4GP9A 1PFGA 4IM7A 2CWWA 1T9HA 2R2GA 2PIDA 4M87A 3WYGA 3BOSA 3OCCA 3GGSA 2PRZA 1R5NA 2OPHA 1ZU4A 5CA0B 3K35A 1FFWA 1TT5A 3ND8A 4X7MA 1K5PA 4FN5A 3KWMA 4KE7A 1JFFB 1MJ5A 4V2UA 2BGKA 1LC3A 2FX3A 3C41J 3HGTA 3QW4B 4IGFA 4KQCA 2B4YA 5FP0A 3ANTA 4BP3A 4QPDA 1I3NA 4RZQA 1VDZA 3RVLA 10MHA 1Z0AA 1F1BA 1TX4B 4MQFB 3KSRA 1P3JA 2XECA 3AP3A 4ONEA 1MUUA 4JI6B 5JEDA 4PSDA 2QN8A 4HVAA 4OB7A 5HEKA 4DIKA 3BEDA 3CG4A 1U8AA 2H5LA 5LL6P 4W7IA 3O1IC 4EABA 3C1TA 4NX2A 1H65A 2ATCA 2ATXA 3EOAI 4DDTA 4K1XA 1KO8A 1FMFA 2ET6A 4XZ3A 1RTTA 4EJSB 3PA8A 3V8RA 1WZIA 3X1DA 3O2QB 4Z0TA 1SA0B 4JJ7A 4NFYA 1XZMA 5EMNA 5HCIA 2HPAA 4EB6A 2XGMA 3GPDG 2HJSA 1I8TA 1Q1BA 4HHEA 1SHLA 3LP8A 5ICEA 1BAPA 5E0OA 4U7JA 1OXSC 5DCYA 5J5CA 1USVA 1E8NA 2Q0SA 4OAQA 2PTHA 3JQPA 4UE6A 1TZ2A 2WV9A 1ISRA 2IEGA 3G2IA 1Y9DA 3QLUC 1X1TA 2YJ5A 4BNVA 3KVRA 4TKVB 4XGKA 1D4AA 4NK4A 3H2HA 2GPJA 3KALA 4PBRA 5B12A 2CXQA 4FYWA 3HU1A 1DSSG 4J03A 2QAIA 3W5JA 2PFSA 5LA6B 2AKYA 1VJ0A 3D8TA 1R88A 4QLOA 4TMYA 2L17A 3ZTYA 2CKDA 2CW5A 2EKBA 3Q0IA 4G1EB 3GV0A 5IAOA 3UMBA 1HSZA 1MW8X 1ZSYA 5DM60 1PCXA 2XDQA 2FZCA 2WVAA 2PXXA 3GJXC 4HH0A 2LIVA 2GBCA 5A9SB 1NKSA 4L3VA 4RXTA 3VUFA 1PR9A 3LXUX 4CLRB 2QAJA 4RKRA 3LY7A 4M8LA 3B2NA 1N2CA 3PA6A 4ZANA 1CUVA 3TAHA 3ZJ5A 2P9YA 2JKYA 3RVBA 1YRAA 1QTRA 2MTBA 1DTSA 4J1TA 5IS2A 5EWMA 1RI3A 5TLSA 1GKLA 3EEBA 3O3MB 2X15A 1EG7A 2RHGB 1KQOA 4N7MA 1QYWA 3MWKA 4MDHA 2H4XA 4MR7A 4U2DA 4AIRA 4DIEA 4ZC1A 3DGFC 2OD7A 2OZKA 2YN0A 5GVSA 2WI8A 4JVLA 4TL6A 3A4TA 1OZFA 4RM2A 2G1JA 1FFXA 2WRZA 3UQYS 4KVGA 3DDWA 1Y5NA 2Y0PA 3ROQA 2GESA 5LJIA 1K97A 4UE2A 2X4GA 4PGMA 1JQLB 1YB1A 3ZLVA 1OB2A 1KR2A 2H0QA 2AG1A 2Q5FA 4G5YA 4IV8A 3SNHA 5FYDA 3TL3A 4ERXA 1XVUA 1O3YA 1GR1A 5I9IA 4D74A 3OHPA 4C3UA 4U5XA 4RKYA 3OT5A 3UKJA 1T5DX 4RHXA 1FVOA 4HYEA 5TQ2B 1LDEA 4DC0A 1UPXA 4B8YA 5CDGA 4PLYA 2OPBA 3A05A 3C5VA 3KM0A 4TWIA 3TFWA 4CM9A 1T8WA 1JVSA 1SUCA 2LUOA 2ZSKA 4AS2A 1NKTA 2HYIC 2POQX 4EMTA 5JO0A 1MKYA 4EAQA 1Q20A 5LYJB 2IYUA 2HEGA 3T3OA 1IDN1 4P82A 4C21A 4H77A 1P1FA 1EVYA 1OBHA 4MYDA 2VPIA 1EFAA 5LD2C 1CE8B 2ZJ4A 1DRJA 5G02A 2R68A 1AGXA 2H4HA 3HCOA 1TTQB 2HWXA 4C4YA 5IC5A 1WRBA 4V0SA 3L4EA 4PANA 1YUMA 1K5HA 5JCZA 2DZDA 3SDBA 5JEEA 1DBVO 3OF2A 2GYYA 3T1OA 3KB6A 4BFYA 2JCBA 1AKNA 4G1MB 1BH2A 3MJDA 5E6UB 3ZWAA 4ZZ2A 5HQ3A 2NSJA 3TLCA 2O3JA 5CVTA 1DTEA 2FXIA 3S0JA 1V8ZA 5IF9A 1KJ8A 1UBMS 1VZ3A 1XZ8A 2VT3A 3H5RA 3I1JA 4WCFA 5H9VA 5GIOE 5B7PA 1GPWB 2X8WA 1C1XA 3PT5A 4BRWA 4HMQA 5DM4A 3HKCB 2NU6A 1IN6A 2AI2A 2VNAA 4BKOA 5CITA 2OAQ1 1QPBA 3QLUA 3S7TA 4BB5A 3IIIA 2E1PA 3UW3A 3V3TA 4A03A 1P3Y1 2IW3A 2IOYA 3MS7A 3PU6A 2CNBA 3C45A 3M3PA 4KDFA 5CNJA 3TJMA 5G0VA 3X2FA 3EXFA 5EPUA 1IBKB 2LR0A 2IYTA 4GL4A 4YJHA 3P0JA 1GL6A 1JDSA 1OGJA 3FUVA 4YLEA 1YNSA 3AI3A 3OLCX 3WWZA 2RGRA 1U8CB 4PPFA 4R7TA 5FBWB 1Z9BA 3AR8A 2W2XA 4BJ1A 3VR5H 3FOCA 4N7BA 2P78A 2H2FA 1CZLA 4YDRA 1YZGA 2NVUA 2PBRA 3AFHA 3GT7A 1NX9A 1WV1A 4PPYA 3VYVA 5A3JA 4X20B 1C9EA 1P7PA 1OPXA 2HHCA 2YYAA 3C3DA 4YRKA 4K9RA 2MU1A 3ZWNA 2CC2A 2HMUA 1EBUA 1NQXA 5L51A 4X64B 1XFDA 3N74A 2WM9B 2HFKA 4P3YA 2CJXA 3SHQA 2Q50A 2VH2A 3H5IA 4RY2A 5EKSA 3UVEA 1GUZA 1XRRA 3R7DA 3ZBPA 4DV4B 2GTIA 1RFGE 1VYVA 2Z56A 1UT5A 2ZIXB 3G7UA 3KU4A 1IM2A 4NBLA 2B3DA 1XZBA 1HYQA 4D96A 4MQBA 4QPCA 5KKAA 4QOHA 2C5SA 1S89A 4MVJM 1ZR2A 3FFTA 5CLQA 3C4JA 2WSYB 3B3QA 1X3LA 1NWHA 3PQ6A 1EFLA 2HMVA 1GAEO 1WCIB 1DELA 3DUFA 1ZXLA 1O57A 3O93A 3UJDA 1W36D 2ZJFA 4FDTA 4YCSA 2B1QA 1ECCA 1OKKD 1W5BA 2CFRA 1QTIA 4Z49A 3GEGA 1J0DA 4M8IA 4YR7A 1U28A 2Q7OE 3DB1A 2HJHA 5ILGA 2E55A 3L0SA 4HN2A 1O5TA 1BDJA 4CKWB 1E32A 3D3WB 3CZRA 2VZEA 1N5MA 4BMYA 4KI0A 3NB0A 5AW8A 2G5TA 4ECEA 4MJ7A 2CJPA 1TIBA 3FOAA 4LE0A 5LNK6 2YV5A 3BZUA 2I6UA 4KNWA 2IH4A 4WLEA 3FG9A 1XRJA 1M0EA 3NALA 1JHMA 1VYTA 3GIWA 1V5IA 3M83A 4J7UA 4ZO7A 1XEXA 4M8SA 2KI5A 3NW9A 3KKKA 5GJCA 4DIOA 2YHBA 4EYGA 1QR2A 1U2SA 1ESCA 3E82A 3JSXA 5BVGB 3D2AA 5MFZA 2H1RA 4G26A 3WP0A 1GPYA 3BGVA 4WLUA 4F71A 3GMIA 1O8BA 2ZRAA 3LGXA 4HDCA 4BLWA 1QGUB 1KAHA 1M8GA 2QRKA 2C8LA 5LP1A 3QG1A 3CJTA 4J91A 2EBFX 4K6GA 4MVYA 1Y42X 2C00A 4HSEA 1BJTA 2DY1A 5DO9A 5EAIA 1NAHA 2XNDA 1GU1A 1P5HA 1Y1KE 1GZ7A 3DVAB 3O1JC 5FKJA 4M1OA 3TVDA 3VAZA 3CNLA 1UQTA 6REQA 1KOJA 5LDDC 3GAZA 1RIIA 4QUDA 2VPYA 4BGIA 3PWKA 1LBTA 3NHWA 1AQJA 3EQ2A 4YFVA 4B7CA 1XMIA 3T3NA 3G5AA 1VTKA 3HMKA 3P94A 3QIAA 4PLTA 5A3SA 2FMXA 5CG2A 5EZQA 3RM3A 1H85A 1KK0A 1LQ2A 3OJLA 1QHXA 1BRTA 1GXSB 1E1DA 2WABA 1UPBA 1L4MA 3OVMA 1ZP6A 3WGLA 5YASA 1T25A 2CLLB 1DT3A 3UICA 1U3VA 4ZU1X 5FULA 3UJCA 4R0MA 4ZEMA 3BE6A 1E3QA 1ZHHA 3GNQA 4GMGA 3WMWA 2RB4A 4HYYA 5D84A 2OQ2A 1HPLA 2ODQA 1WMAA 4TMWA 2O14A 2XAUA 1SU7A 3VV2A 4EKIA 1UKCA 3HN2A 5C32A 1LSOA 3NHPA 5CVVA 3VHLB 4X60A 1E69A 3AEQB 4PNZA 5DDIP 4ZAVA 5AJTA 1AKWA 2QM0A 3CPHA 2QIOA 2ZCUA 1G42A 2JFQA 4NONA 2FK8A 2EJWA 1FVXA 1JRLA 2NZWA 3K8QA 3KKNA 2FPIB 4OU5A 4C87A 4DTIA 5JPDA 4QOJA 3AHEA 2QWXA 1ZMRA 4JFAA 2A33A 3SCZA 5A3RA 1QU2A 4LZAA 1LK7A 5F23A 3A04A 4NPHA 5F7ZA 4DQDA 5ADHA 2F1JA 4XTCS 5KYWA 3DZGA 2XUAA 1G19A 1WXGA 4X97A 1CQXA 2IXTA 2JHFA 3VBEA 3BTOA 1X0XA 1P8JA 1VL8A 2VJKA 4XGNA 1N2BA 2Z08A 5SY6A 1SVKA 2I6SA 2PLNA 2V6FA 3BXXA 1WW8A 2QMEA 2QI9C 4HQFA 4QXMA 3WYNA 4CMHA 1EWVA 2A4KA 3W3AA 1YBVA 3PNQA 4MIKA 4NZMA 3REQB 4B45A 3SWWA 3CNQS 1ODJA 2V5UA 4L74A 4S1OA 3U1TA 3LUGA 1JP7A 3AP1A 3CX3A 3MMNA 1KNXA 2CCJA 2PX3A 2P69A 3CGWA 3U3KA 3WGTA 1DBSA 5EXSA 4AYTA 4DZRA 3A6HA 1W36B 1CQPA 2PO7A 2ZRBA 4HWRA 4B3FX 5HK9A 5E4JA 3RAGA 4EO4A 1W88A 3IOEA 3MWEB 2J41A 2P35A 1DRWA 3ZQ4A 1L7OA 2QF7A 1AMNA 1I1HA 3BJIC 4IKEA 1OH6A 1N2XA 1V9LA 4FS3A 2G67A 3TQRA 3T35A 1XB2A 4X8LA 3GT4A 1MAAA 2YZNA 3DG9A 4YBRA 1XPRA 4KN5A 4PXYA 2Q21A 5BW8A 2OBMA 1BXGB 4JH0A 3K9CA 1GGHA 1V11B 4CF6A 2XCSB 4XWOA 3HDVA 3OECA 1PJSA 1KU6A 4R8VA 1KQFA 1X8JA 5BXQC 1XFAA 2X3UA 1NW5A 5JMOA 2IY8A 3WKCA 1RQLA 1SU6A 3UT0A 1UK8A 3P19A 1NUPA 2YMLA 4L6AA 3OKAA 4OMUA 4HDSA 4WOJA 4GZ6A 3WTCA 3GNTA 2AZ4A 2GCOB 3QLJA 3ENZA 4U39A 2IU3A 4UZSA 2PZEA 3OZWA 4UD6A 3DYBA 3H1AA 3UY4A 5JYCA 1KMHB 3CEMA 3FETA 4NXMB 2VVTA 5AW1A 2HB6A 4CQLA 2D62A 4DJAA 2JJ8A 2HJGA 4OXQA 1XMSA 5TJHA 1FX1A 2VDOB 4QYXA 3GJ4A 2W83A 2G70A 5BMVA 2XPCA 1NQOA 5IVKA 1CRPA 1MEJA 1D6SA 4D4MA 2KM1A 3KQHA 2BJVA 2IOQA 2R44A 3SQNA 3N0XA 1GKUB 2M32A 2BT4A 3CSUA 1FP6A 5LWQA 1QK5A 4UU0A 1HT2E 2CFOA 5AI8A 2XR1A 3VSCA 5A7FA 5IX8A 2FVXA 1UJBA 2MSCB 2Q3EA 4KWHA 1EWQA 4TV8B 4NJMB 2C20A 1T0UA 2BAGA 2W6MA 4BGVA 1Y3IA 3OQIB 3DXYA 1PEDA 3H2YA 5GPBA 2WG1A 4J43A 1AQYA 4O2RA 1NBMD 1CZOA 2FCAA 4LSZA 2Y0BA 2PX5A 3AU9A 3WG9A 3HNRA 4ENTA 3JCZA 5BW4A 1UJMA 2HW8A 2Y68A 1OTYA 2PH5A 4PTZA 4LXQA 4V3BA 4P7KA 3LA8A 1SD5A 1NUUA 1D07A 3OPYI 2QTLA 3G2LA 1VPWA 4AJIA 2D8MA 3N3AC 4LKRA 4RA9A 3K70C 1C4WA 1ADYA 2OB1A 3FCUB 3NPMA 3IPYA 5HG0A 1ZBQA 3V1NA 3U37A 4C78A 2Z98A 5C4GB 3RS7A 1YRYE 2BKEA 4HGOA 1PT5A 2BGMA 2DP4E 3DHNA 2IODA 3VMMA 1QV7A 3GGOA 4YUAA 2R8OA 2CXTA 3DM9B 3LYAA 5JYBA 4AP9A 5IKPA 4IDDA 4WZAA 2WNSA 3KKMA 2ID8A 2GARA 1KC3A 1M1YB 2P1ZA 3PXUA 1SBZA 2I4IA 3FMGA 5CVDA 3FNFA 4CF4A 1DHRA 1N2EA 3ZCSA 1V3VA 1ZM4A 3MGCA 4GECA 1V5EA 4LE1A 1ACJA 4AS3A 1BKYA 2YN4A 1S6YA 3HVIA 4RPKA 2LD4A 1ZUNA 4QODA 2AOTB 3SKXA 1RKQA 3HCBA 2FG7C 4TX1A 2J09A 4EG4A 3LRPA 1YI1A 2JLQA 2LIPA 3GLTA 2FCRA 3JARA 4GGPA 1AA6A 2ZT5A 4YCBA 3WQHA 4BZQA 4MDEA 1IY9A 3HUFA 5LBUA 3NOVA 4BZZA 2G07A 3QNWA 3ZJTA 2OP1A 2XQFA 2Y4NA 3PNPA 2R47A 4L08A 2OG1A 4DQVA 1IG3A 2VDKB 1TYBE 5LR6A 1PYGA 3QXHA 4R6XA 1EVEA 5BQ5A 2QOEA 2YJ6A 4XWWA 4AZ0B 3ELWA 2INGX 4M9UA 4X8MA 1EP1B 1RBMA 2YVAA 3I04A 5ES3A 4IIDA 3WHLA 821PA 4DLYA 7GPBA 3DP9A 1GKIA 1J9ZA 2G08A 3BIXA 3OCUA 1CUAA 3Q5EA 3BORA 3EZGA 1PNTA 1R8QA 3PEVA 3TCKA 3ZD9A 2QG6A 3DBVO 3GFQA 5EP4A 2R5NA 3RYCA 2KW5A 2OXTA 5DBIA 1OCEA 2CZQA 5B6IA 1LWNA 1YAJA 3U1VA 3TD9A 3GJQA 3MT9A 3B9RA 2QTVB 2QTGA 3TI9A 3K0AB 2NO6A 2D8AA 4H4DA 4AZWA 2QVXX 3KYDB 1KMNA 3VKWA 1UP7A 4JY7A 3VPAA 1BX1A 2AVDA 3DBHA 1K6JA 5LLSA 3SFTA 4I4TB 2WICA 3ZVRA 1VMAA 5ITVA 1QIIA 2HI0A 5HXAA 4DQ0A 3DHYA 1SKUA 3ISJA 1FP1D 5CCEA 1RHKA 2XWSA 1FRFS 2AIRA 2Q1XA 5THQA 4EVRA 1F6DA 2DFLA 3OF3A 5KQRA 3HO6A 1DEOA 1PS0A 3K0FB 4RHCA 2NTVA 2CEKA 1TVKA 3DFUA 2QX6A 1VRVA 1Z37A 1SXHA 3NM5A 2F8SA 1KI8A 2OHOA 3GP3A 4KXYA 4FZRA 3TRIA 2EQBA 4ZKDA 2EBWA 4ZEVA 5F9FA 1XDDA 3RC8A 4CDMA 3DE3X 2FZWA 3N6VA 2L42A 3P4YA 4K8OA 4S2EA 3FM9A 1VDMA 2C3YA 2H1SA 2R96A 3K3PA 3K8ZA 3F74A 1Z5NA 1OXBB 3BGWA 2EBHX 2O2HA 3I1FA 4RMNA 3VZPA 2AFIB 4C04A 1OROA 1RW4A 3OLXA 5A6SB 4R5HA 4ZQIA 3L4BA 4B0PA 4DKJA 2XB9A 4QFMA 4QGHA 3U4QA 1I7DA 4G23A 1GPH1 5KTTA 1BMDA 1YH3A 4D92A 3IIEA 4FBMA 1SC6A 3CWCA 2C98A 2H54A 2AXPA 2QI9F 5F9MA 1CUWA 1LH0A 2OGSA 1Z4OA 1Y1PA 1RQXA 1USIA 2CZGA 2IIVA 3AC0A 4EGFA 1VL5A 3Q40A 5FLKA 3AJEA 1XWFA 5BV1A 4OI0A 3PPXA 3UBTA 2Q4RA 3IXMA 3SVZA 5JAUA 2OHXA