3L1IA

Crystal structure of este5, was soaked by cuso4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Esterase/lipase
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
total genus 103
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1iA00
3U0VA 4EHBA 4A23A 1EK1A 4EY5A 2C0PA 3STWA 1TAHA 4AQDA 2J3QA 1TCCA 1ISPA 3W2TA 1N5MA 1XRRA 3U1TA 5ALJA 4X91A 2ONCA 2QT9A 3ICWA 1LPSA 1DT3A 4U2GA 4FNMA 1LPAB 2XMSA 3E0XA 4X6XA 4BP9A 2DHEA 2WIDA 5JASA 1AX9A 4J0HA 1GPNA 1QFSA 1G4HA 5BWCA 2VJCA 4Y2QA 5EFZA 4UFOA 2BFNA 3WK7A 1CR6A 1DX6A 2Y1KA 4LXHA 1XZFA 4GLBA 1VJ5A 1UOPA 3IBTA 2J3DA 5C81A 1EB8A 1EDBA 1XLWA 2CKMA 2YXPX 4FBLA 2PVSA 1CUHA 1JU4A 5ALNA 5CW2A 1CUBA 1IUPA 3UUEA 4GEGA 3H2HA 2PPLA 1VE6A 2HM7A 3OM8A 1MT3A 5CT6A 3ESBA 2PSHA 4LIPD 1L7AA 2QS9A 3FCYA 4KR0A 3G02A 5E4TA 2BAGA 3O0DA 4N8DA 2HRRA 5JZSA 1TKRA 5H3HA 4I3FA 4AMYA 2FJ0A 1U65A 5YASA 1UK8A 5A6VA 2WUEA 1R4ZA 4FOLA 5A62A 1H2WA 2W22A 4LHEA 4HXEB 2G63A 5EHXA 2CMFA 3I28A 3OURA 1E8NA 1IUNA 4AMZA 4ETWA 1BRTA 4BVKA 5AIBA 4KAFA 2OCLA 2Z8ZA 5FLKA 1EXWA 1S8OA 3H2KA 2VAXA 4FDMA 4B6GA 3AFIA 1QTRA 4XX1A 4DMFA 3VDXA 2HADA 1R3DA 4K6GA 5K3FA 5LZ2A 4HRYA 2X76A 3BWXA 5JYCA 3HRHA 5IVDA 2D0DA 1CVLA 5DNVA 1BN6A 4D9JA 4H7HA 2VSQA 1D07A 1CUEA 4QDTA 3M82A 1CLEA 1ZGBA 3M83A 1MJ5A 3QPAA 3HC7A 5LYYA 3PF9A 1XFDA 1QIGA 4W63A 3ZLVA 4G8DA 1P0PA 1QJ4A 2JF0A 1USWA 2XQFA 3WQHA 1ZI6A 5JAUA 5EGNA 2CB9A 2GZSA 2WG2A 3H17A 3D7RA 2OGSA 5SYNA 3WL5A 1IVYA 2QM0A 2BGNA 2ZJFA 4AZ3A 4X71A 5A2GA 3CCCA 3RK4A 2XUAA 3EQ9A 4K5QA 3FVTA 1Q0ZA 3EQ7A 1XQYA 1ZI9A 2H7YA 4N8EA 4JNCA 2Z8XA 3VXKA 1QIIA 3DQZA 1WB5A 2AJLI 3IVMA 3VISA 3WL6A 4YASA 4DIUA 3AZPA 2WUDA 1ZD5A 2ES4A 1WHTA 4X85A 3G0IA 4PF1A 2H7CA 4Z49A 1UOOA 4FLEA 1QOZA 4AO8A 1A8UA 1CUAA 4BAGA 4ZV7A 2AJDA 2HIHA 2J4CA 4OD0A 5LIPA 2O7VA 4C6HA 4EY4A 5KWIA 2JGEA 5CRIA 4FLMA 1E66A 4BE4A 1LPPA 1CV2A 4QDXA 1CUDA 1ZGCA 3ED1A 3G9TA 1MNQA 6YASA 4N5IX 4I4CA 3IULA 4BC0A 4X3CA 4A5SA 2BUCA 2QKYA 3GUUA 4H18A 2JGFA 1PFQA 4FHZA 3LIPA 2JEYA 4ROTA 1THGA 3WLAA 2C5GA 3ZLUA 3ZI7A 2B20A 2Z3WA 4AZ0A 5ALYA 5EHQA 1YA4A 3WK9A 3CXUA 2XT0A 1BS9A 3IIIA 1VKHA 5J3JA 3AJAA 4J0DA 4AO7A 2OGTA 4MEBA 4DMKA 3CN9A 5HF6A 4KE6A 5FV4A 1O6GA 5AOBA 1N8SA 3GBSA 1UT6A 2O2HA 3IUMA 1JFRA 1A8QA 4HS9A 5E4JA 4E11A 4RNCA 4UPDA 1MX5A 4C01A 2ZSHA 3BF8A 1GXSA 4H0CA 4LKOA 4DLNA 3F8SA 3AUKA 3DJYA 2I3ZA 3ZPXA 3D2CA 2WU4A 1EHYA 1XZEA 3B3QA 1T4MA 2QOEA 5FXMA 3PUIA 4PSCA 1CUGA 2IITA 1Q83A 3WKCA 5HKAA 4GECA 2HHAA 3O9VA 1WHSA 1JJBA 1R88A 2BCEA 2WILA 4FWBA 5AO9A 2AXEA 3WWEA 5FUMA 3D2AA 2XQJA 2NW6A 2XQGA 1CEXA 2P8SA 2WTNA 2ROQA 3HSSA 3DOIA 1YB7A 4IH4A 3ILSA 4J7AA 5AKZA 1K6EA 4Y2YA 5HFAA 5ALPA 1UFOA 1F6WA 1B41A 3ZWQA 5BOVA 5T4BA 2HU5A 2ZJ6A 3WKAA 2ZVDA 1DWQA 3I2FA 4G4GA 3OPMA 2WFLB 4FKBA 1F0NA 3N2ZB 4Q3KA 5AKIA 1DT5A 1IUOA 4X7BA 5IVIA 1W76A 1EB9A 5AKXA 3WI7A 3OTQA 4B7ZA 3WYNA 4QZVA 2GYVA 4KE7A 1IZ7A 1P0MA 3H2GA 2WUFA 1QO7A 2XMRA 3C87A 1QIJA 1XZAA 3I6ZA 3C6XA 1A88A 5DTIA 1LLFA 2PUHA 1RYYA 2XUIA 4IH1A 3O4JA 4ARBA 1Y7HA 4OB7A 4ZREA 3H2IA 3ZLTA 3R3WA 4RPCA 1EH5A 4Q1VA 1EX9A 3Q0TA 1FFCA 1QE3A 2WIGA 4PQEA 4H7EA 1XKLA 4FNGA 2JBWA 5IH7A 3V1LA 4KJXA 1AURA 1EA5A 3DCNA 5DYWA 5LZ4A 3FYUB 1XZLA 2PL5A 3IDAA 3QM1A 4TVKA 2GBGA 5AOAA 1MPXA 1U2EA 1C7IA 4INZA 4G8BA 1VXRA 4G4IA 2EEPA 4U2FA 2WIJA 1OXMA 3K9BA 4J0IA 2WJ4A 1U8EA 4DGQA 5A71A 4WFKA 4W1SA 1G42A 3NOXA 1ORWA 3LS2A 4HZGA 2RIPA 4H7IA 1UOQA 1LGYA 2OCIA 1UKAA 4FFWA 1TK3A 2HU7A 4W1PA 1E3QA 1Q0RA 3PFBA 4Q05A 3P2MA 4DSAA 2ORYA 3FSGD 4OYYA 4BYMA 4J0KA 3FWHA 3WKDA 3WMRA 1NU8A 4QWWA 4C87A 5AI9A 1YAHA 5AI4A 2RI6A 3I1IA 2HA7A 1LPNA 1UK9A 2DQYA 3NWOA 1SCIA 3O95A 3C8HA 5K3FB 4L9AA 1XRNA 1XZHA 1A7UA 4F0JA 3O4HA 3KXPA 3V1MA 4X00A 5I9IA 4G9GA 2ACKA 3QBJA 3A6ZA 5FPQA 3UMJA 4DNPA 2EDAA 5AI5A 4J3JA 4I19A 2QXUA 2BGRA 5C8VA 2JGKA 2QRUA 2XUQA 4CCYA 1XZBA 5AH0A 1XKTA 2HFKA 2VT7A 5AKGA 2PX6A 5D3ZA 2XUGA 3AILA 3VVLA 1UK7A 2XQIA 4K6KA 3H18A 3AIMA 4U2DA 5CH8A 4IHAA 5DLPA 1X2EA 4JYPA 3C5WP 4B85A 3DOHA 3D2BA 1GZ7A 3Q8WA 2DCMA 4IH9A 1P0QA 4P08A 4AB1A 2OLEA 3RM3A 4BAZA 4ZI5A 4UBLA 4KE9A 3FSGA 1YASA 5HCUA 5AP9A 1QTIA 1H2YA 4JH0A 5HKBA 2WSLA 2R8BA 4HXFB 2J4FA 3E3AA 5I7UA 5ALQA 1JKMA 1AZWA 5AI8A 4BVJA 3G0DA 4Y2XA 4CCWA 2I03A 3WKEA 2XLBA 4HTAA 1YB6A 4Y2JA 5AKEA 5ALSA 2O2IA 2WJ3A 2QTBA 1Z68A 3I2HA 5BWBA 5JD4A 1SOMA 1VLQA 2XUJA 1MO2A 3H04A 4X94A 5ALXA 4BE9A 4OUKX 2Z5GA 4QLAA 4BVLA 1JT2A 2XI4A 3UUFA 3W9BA 2UZ0A 3BIXA 3A2NA 3QZUA 1WB4A 1XQXA 1CQZA 4P9NA 3WJ2A 3HJUA 4P93A 1MAAA 4OYLA 5DTJA 4QDUA 1AC5A 1QIHA 1XZJA 2FX5A 1LZKA 3WK5A 1L7QA 2AJCA 1J2EA 2HL6A 4X6YA 2DFPA 2RHWA 4HAIA 5CH5A 4BBZA 5EIAA 1TQHA 3ESDA 4UHFA 3STUA 1W4LA 1R9MA 2VEOA 3R40A 5AICA 3G9ZA 5A7GA 3DL4A 4ZRDA 4H7DA 2WFMA 1CUCA 3PE6A 2XDWA 1FJ2A 5CH3A 3C6BA 1VZ3A 1H2XA 4QEKA 4PW0A 4EY6A 1HPLA 1ACJA 4WDRA 2BUAA 3HYSA 3EQ8A 4BTLA 3TRDA 1Y37A 3F96A 5D6OA 1WPXA 2QZPA 1QIMA 2CEKA 3C5VA 3QMWA 5ALEA 2B4KA 3I6MA 1JMYA 3HABA 2H9YA 1YR2A 1G5FA 1OCEA 4DNQA 1YCDA 4AXBA 3VJMA 1LZLA 1XRQA 3R3VA 5T4EA 2ZYSA 1ZD3A 3HEAA 5AK3A 3FLAA 4F5ZA 2VJDA 2XUOA 4PSUA 1JI3A 2OQVA 5AM5A 4RGYA 2V98A 2FUKA 2X5XA 4N5HX 4TPKA 4E14A 4GI1A 4W9RA 1E8MA 1KEZA 3GROA 4BCCA 3EIOA 2GBFA 1MTZA 4KRXA 2XMQA 1CUXA 3PI6A 1FFAA 3SWWA 3STTA 3L1JA 1Q84A 1CUUA 2WJ6A 4E15A 4EBBA 1UKCA 1CIJA 5T4HA 5AI6A 5FRDA 2WHPA 1ZICA 1EI9A 5EHZA 1CUVA 4K6HA 4MJ3A 3VJLA 1J07A 3WZLA 5CT4A 2PSEA 3KOOA 2WFZA 3G0CA 1ZI8A 5AM0A 4FTWA 4LXGA 2QR5A 2WHRA 5AKHA 2WG0A 1YA8A 1I6WA 3R41A 2WKWA 3D3NA 3CN7A 2DQZA 3E4DA 3QPDA 1DTEA 2G5TA 2K2QB 3WWPA 1HBJA 1DWPA 4N8SA 2IIVA 4Q82A 5HF8A 3D4LA 4FFVA 5EI5A 5CURA 2Z3ZA 4WDQA 1BU8A 5AJHA 1A8SA 2PBLA 3H1BA 1YS2X 1G66A 3OC0A 4DSZA 4V2IA 1W75A 2QUBA 3E1GA 5JAPA 5DNUA 1ZJ5A 1X2BA 5CXXA 1XZIA 3PDCA 3F97A 5F4ZA 4BC1A 3SX4A 2HDWA 4NMWA 1QZ3A 3ESAA 4Q3LA 5HZGA 5K3EA 1QIFA 2V9ZA 2BJHA 2C5FA 5ALWA 1SCQA 1CUYA 1EK2A 1AMNA 3MUOA 2GYUA 3LIIA 4RE5A 3QPCA 2OCKA 1CUIA 1XRLA 3OG9A 4AN1A 4C88A 3DYIA 5ALKA 3EBLA 4U2CA 4ARAA 2HFJA 4B80A 5DJ5A 3BL8A 3C8DA 1XZMA 3D5EA 3RLIA 3G8YA 1SC9A 5EIEA 3KDAA 5LKRA 4MQMA 3IB3A 5KWJA 3BIWA 3WL8A 4F60A 5LKAA 5DYTA 5JD6A 2YASA 4YK7A 1N1MA 3V48A 3VKFA 1TCAA 4LXIA 3ESCA 2H7XA 5LZ5A 2XMDA 3JWEA 4H7FA 2YYSA 3FLBA 1CPYA 4CIBA 1XZCA 4XVCA 4UFNA 3PUHA 3KWJA 4B83A 1GT6A 2XQKA 1XROA 3MVEA 5JADA 5LZ9A 1XZDA 2XUHA 4Q3OA 2YH2A 4YPVA 2AJ8A 1LBTA 1NX9A 4PO3X 4OB8A 2PKYX 3RKSA 3L1HA 5LZ7A 5AHXA 1O6FA 3H2JA 3AINA 3FNBA 1E8DA 2PM8A 2D5LA 3WIOA 4GWLA 3WWCA 1CFJA 2H1IA 3O4IA 1FFDA 1BCSA 1MX9A 2GBCA 1CRLA 3VVMA 1GKLA 3YASA 1DWOA 1XZKA 1W6RA 4NVRA 2WIFA 5JAHA 4BDTA 2OAGA 4Y2TA 1YS1X 1N5RA 4GHWA 1GPKA 5K3CA 5C8XA 5ALFA 2XMCA 1T2NA 3O4GA 2C58A 3W9UA 1K5PA 1QIDA 2WLSA 1B6GA 3STXA 2QXTA 3RARA 2CBGA 1ODCA 4PNZA 4UHEA 1JJIA 1K4YA 3FAKA 5ALMA 4H77A 4EA6A 4MWSA 2B61A 4DYHA 2HA0A 4J0JA 1TIBA 4J0CA 4G1FA 4W1RA 2V96A 4G5XA 1QGED 1ZOIA 4C4XA 3WK4A 3PICA 4C4ZA 1WM1A 4Y2PA 4MXDA 3H0CA 3HLKA 4Y2VA 3FBWA 2B9VA 2XMGA 4L0CA 3DLTA 5CT9A 1CUJA 2C7BA 4QDZA 3HZOA 5ALUA 3R0VA 3EF3A 4B0OA 3QITA 2XLCA 4JEIA 4X6UA 5AM4A 4GDMA 5JIBA 4QNNA 5AKLA 2Q0XA 4G8CA 2BUBA 3W06A 1SFRA 1EVQA 4LYDA 5FP0A 2HA5A 4Y7DA 4WJLA 2WQZA 2PSFA 4CFSA 1XZGA 3BDIA 2AJBA 1C4XA 1KU6A 4DNFA 1XRMA 4HVTA 2VQ6A 3STVA 3V1KA 4X93A 2PU7A 2QUAA 5ALDA 2VA9A 5A7HA 1R50A 1WPRA 1F0PA 3ICVA 4UBOA 3JW8A 2IX9A 4EUSA 1MAHA 1EVEA 4HXGA 4BRZA 3JYHA 1XRPA 3PF8A 3I2IA 2WUGA 4BB0A 4CG2A 3H19A 2WFLA 3H1AA 2XUKA 1YAJA 3WWDA 4XWGA 1H23A 1VOTA 1GQRA 3B12A 3O9MA 4G9EA 4IQ4A 4B82A 3WWOA 1EINA 4Y9SA 4KAJA 5ALOA 1IZ8A 1QIKA 1GPLA 2ZSIA 5AM1A 1FSSA 3HACA 3IUQA 5SYMA 4M0EA 1K63A 2JGIA 1MNAA 1ORVA 4KACA 5K3BA 5HF5A 3T4UA 3DD5A 1U4NA 4Y2RA 5ALVA 5HQ3A 3KSRA 3R3UA 1FFEA 1CUZA 4UFPA 5C7YA 3TEJA 1ACLA 2ECFA 1UZAA 4FLFA 2G5PA 3M3DA 1XLVA 4FBMA 3D59A 5ALIA 3FYUC 2JGJA 4OSEA 2V97A 1VE7A 5KREA 2PSDA 4KYVA 4G4JA 3A2MA 1QONA 4JUIA 1UK6A 3FYUA 1BCRA 4KAAA 5JD5A 5K3AA 4H35A 5AM3A 3C70A 4X90A 2WHPB 2ZYHA 1DU4A 1HL7A 2FJPA 4QWMA 5I8PA 2QVBA 3B5EA 2HA3A 4BCDA 2QJRA 1Y7IA 1EDEA 3DKKA 1W1IA 2XUPA 1BROA 5FDFA 4AX4A 5CXUA 1OILA 3F67A 2GZRA 2OQIA 3DKRA 4UHCA 2VF2A 3C6ZA 4ZWNA 2I78A 4X97A 2I3DA 3HXKA 2JGLA 4Y2SA 1AKNA 3OOSA 4CG1A 4DMCA 1WB6A 1W52X 3BF7A 2DR0A 1WCYA 2GYWA 4XJVA 4QA9A 1AUOA 1ZD2P 3WYDA 5FOQA 5JALA 3WK6A 1DX4A 1EDDA 4BZZA 2DSNA 1NU6A 4Q34A 4DTCA 5DYYA 4H7JA 1QIEA 1BEZA 3BDVA 4BZWA 5FPPA 1C7JA 2ZJ7A 3N0TA 3DDUA 1R1DA 2XE4A 5LLSA 3A70A 3K6KA 4P92A 5CMLA 5HK9A 2DHCA 2XMBA 4GXNA 4Y2UA 3S8YA 5ALRA 3MGAA 1E5TA 5IVKA 2QJWA 5AK6A 4MWTA 5K3DA 4UBMA 3FLEA 1BEEA 1F8UA 4H7KA 4CG3A 3QMMA 1VZ2A 4B9AA 4E46A 3VJKA 2C0QA 3C43A 1THTA 4MYDA 5JARA 4UBJA 1HKHA 1X70A 4YX9A 3LP5A 1CQWA 4A16A 1GQSA 3DYVA 2GBIA 3NUZA 2OXEA 1XQVA 5AM2A 4U2EA 3ANTA 3WA6A 4JYMA 1BE0A 1ZIXA 4S0XA 2HA4A 1TCBA 5JZ9A 4TGLA 4KRYA 5D3KA 1VA5A 2QMQA 3G9XA 2JIDA 2Y6VA 1CUSA 4BATA 3ANSA 3WA7A 3IUJA 3FCXA 4MEAA 4B81A 2WTMA 2LIPA 2PUJA 3BJRA 4UHHA 3AIOA 1LPMA 3DNMA 3WJ1A 2HA6A 4J03A 3KD2A 3MUNA 4O08A 4QDOA 4UBNA 4QE3A 5KBYA 1TRHA 5E4YA 2RONA 4IO0A 5BV7A 5ALGA 2WM2A 2PSJA 2Y6UA 1MN6A 4BRSA 1SCKA 3I6YA 3HI4A 4MQLA 4X95A 3K2IA 4M0FA 3C45A 5DNWA 3AZQA 4ZXFA 4OCZA 4NZZA 2RHTA 5JZBA 4EY8A 3FOBA 3R3YA 1WOMA 2HRQA 3QMVA 4C89A 5AIAA 3NGMA 1VA4A 2Y2UA 5HF9A 2E3JA 2XMZA 3LCRA 3G0GA 5EIHA 1LPBB 3M81A 2ZYIA 1MX1A 3WKBA 3BE8A 3SK0A 5E2IA 3IURA 2W6CX 4MYSA 5AKKA 3I2JA 2WIKA 4BTVA 3WZMA 3AZOA 3W05A 3V9AA 3D0KA 2VATA 5AK5A 1UKBA 1VXOA 5A7FA 5ALHA 1AQLA 3R3ZA 4U2BA 4PV7A 3LLCA 1ODSA 2RGUA 1GKKA 4DNOA 5FKJA 5K5EA 2ZYRA 2JEZA 1HQDA 3GZJA 2WHQA 2VJBA 5ALZA 2DHDA 2Y2VA 2C4HA 2OCGA 2RAUA 4PSDA 1QLWA 4ZGBA 2XUDA 3WK8A 4CI9A 3I2KA 1JJFA 3G0BA 2VJAA 2VT6A 3W04A 1YSCA 4XIIA 3DEAA 2ACEA 5ISMA 1JU3A 4OB6A 1CUFA 3DS8A 3F98A 4WY5A 3I2GA 4CCYB 1BN7A 4UBIA 4QLOA 5AI0A 1E89A 5CBKA 2X8BA 2OAEA 5LP1A 1DQYA 1M33A 3GFFA 1FFBA 1H22A 4WFIA 1AGYA 4EY7A 5HK8A 1UWCA 5JANA 3FVRA 3R3XA 4ITVA 5EHNA 4AN0A 3F9CA 1ODTC 1UXOA 3QVMA 2O2GA 3AIKA 4J0GA 2VAVA 2WU3A 4B84A 1L7RA 4OU4A 1XLUA 3QH4A 5CT8A 3TGLA 3V1NA 1ZJ4A 5IVHA 2OPHA 1R9NA 3C6YA 2G4LA 2CUTA 2R11A 5HQ3B 3BJMA 3GA7A 5AKJA 4KE8A 2CJPA 2O7RA 4B9EA 1RP1A 4AO6A 1ETHA 5AOCA 1QFMA 2JGMA 4OPMA 5ALLA 3G9UA 3STYA 4GW3A 3T52A 2HA2A 4UHDA 2OGZA 3SC2A 3KWFA 4CIAA 1XQWA 1JMKC 3PFCA 1ZIYA 2VTVA 5T4FA 5IKXA 2CZQA 4HRXA 3L1IA 3ZV7A 1K8QA 4BCBA 4L72A 3IA2A 1PJAA 4LYEA 1HLGA 1MU0A 4FMPA 5ALTA 2OG1A 4WFJA 1H2ZA 7YASA 1DQZA 1J06A 5JATA 4OU5A 1PV1A 1ZD4A 5AKYA 1RWQA 5AK4A 4K2AA 4RE6A 3S2ZA 3X3HA 1J1IA 5DWDA 4BAUA 3WL7A 3A2LA 4WCVA 5D7BA 4UBKA 3TJMA 4X92A 5LZ8A 2XB6A 4WY8A 3FYTA 4M0MA 5CTAA 5CT5A 3DL7A 5C8ZA 4UUQA 5HFNA 3QYJA 4ZV9A 4KEAA 1CUWA 5JAOA 4EB0A 4W1QA 3IUNA 3CCBA 4BP8A 2EDCA 1LNSA 1DINA 3BXPA 2WG1A 3WIBA 4DMHA 4L3WA 4C4YA 1KU0A 4GBGA 1GGVA 2XUFA 3GELA 1LPOA 1IMJA 4BDSA 4DM7A 2PU5A 4B0PA 2BKLA 1HDEA 1QO9A 3I1YA 2HU8A 4UHBA 4F21A 4NS4A 5ESRA 1LBSA 4EZIA 1P0IA 3G7NA
chains in the Genus database with same CATH superfamily
3T9DA 1NF3A 4A23A 4H0NA 4BVAA 3K16A 1SOUA 4CKEB 2EKDA 3OUTA 3L49A 5DHFA 4EY5A 2FZLA 3U5TA 5SZJA 3DPUA 1DKPA 2J0VA 1TAHA 2QRMA 3ZQUA 1PEAA 4HDCA 3MS2A 2OCXA 1Z4LA 1FVFA 2EP7A 3JQ8A 4XGNA 3WRXA 3ZWKA 2ZBQA 2QPLA 3PR2B 4LRSB 1ISPA 2GBPA 2IU4A 1Q0PA 1TMOA 1E9CA 2JCSA 2XWBF 4N9WA 3VZSA 5HKLA 4AJHA 4DLRA 4EPTA 4QX6A 3S2YA 3PHIA 4K88A 2O3TA 5IDWA 3NUGA 4AF7A 4O2LA 5CVDA 2ZXEA 4NL4H 5CW1A 5B6JA 3U1TA 1P1JA 2BBOA 3JD2A 3OH8A 1XTZA 2FN9A 4X91A 4C6TA 3FWKA 3IOCA 2DB3A 4PX9A 4EHHA 1DT3A 3PK0A 4ZTZB 4NENA 3U4AA 5LVAA 5A0TA 3KHUA 3IPRA 1LPAB 3HPRA 2B25A 2YQZA 4TRNA 5AXCA 2JVJA 2RARA 2XMSA 4DCNA 2YOFA 3KSZO 1ZGHA 1ZQ9A 2D5BA 4MGEA 4BO9A 2HIMA 4BP9A 5K05A 4GZ3A 4C4RA 4M0DA 4MRAA 3JVEA 1C9JA 1IG3A 3ACBA 3IE2A 1PEDA 4NABA 3TZQA 2YZKA 3KFVA 1H4QA 1TKCA 1P77A 1G4HA 5BWCA 5EFZA 4QG3A 3TWOA 1H42A 4UUPA 5HTKA 3GY0A 3NBFA 2CFTA 2F1KA 2QI9F 5E1DA 1DX6A 4C3ZA 4JENA 2ZE8A 4DCCA 2JH9A 4ARSA 1K92A 1MJNA 1VRCA 4GLBA 1VJ5A 2UZ1A 1SBNE 1WMDA 1Z0ZA 3LRTA 1W9HA 1W4CA 3BK1A 3OA2A 4CDRA 5FTWA 4HLNA 1DTWB 1EDBA 3I6IA 4Q4AB 3TR6A 4PG5A 2ZREA 1VGVA 2CKMA 2YXPX 3GJTA 4PS0A 4U5QA 2PVSA 2CHGA 1J21A 4PC1A 1JU4A 3BFJA 2OBNA 4NLLA 1V5IA 1Y3CE 3T3HA 3UB3A 5L3RA 1CUBA 3SE7A 3UXYA 4FSXA 5DBHX 3UUEA 2VDMB 4BS9A 1M2OB 2COUA 3L05A 4ZT2A 4GRDA 3H83A 4MROA 4A8JC 3JWPA 2A2ZA 4XUEA 1VE6A 1VKJA 1U0NA 3ADBA 4UVDA 1YOVA 4C0KA 4WOKA 2E4XA 3MMPA 4RPGA 2JFOA 1W1UA 2B6NA 1UM9B 3B1VA 3CUTA 1JLMA 1NI4A 3MYYA 3A3KA 2HDOA 1N8KA 4X62B 3W5IA 3I9LA 3EQ6A 2PGNA 2DUNA 4LIPD 3UJ9A 3BRSA 1BKYA 1IU9A 4E30A 4W5TA 3U9TA 2F59A 4M9QA 2QS9A 1RC0A 3HB9A 2ZUTA 3QRWA 4KSBA 3AEKA 3FCYA 4NBVA 4OFWA 3KKKA 1L7MA 1KQNA 3AP1A 5JQGA 5G3YA 1YBVA 2I6TA 2DAPA 1RYEA 3QEMB 4C1NA 2BGKA 2VP0A 1I3OA 4PR3A 1FQKA 3GX1A 2H3HA 4IQ8A 1GZSA 5KOJA 5JZSA 3KCQA 4RAQA 1O6ZA 3RNLA 2XCQA 3DMNA 4EHJA 4BB6A 1CU1A 4I3FA 3L4SO 4AMYA 1HNXB 1OX4A 3P1JA 4CMIB 1D6JA 1N2EA 1V43A 1ZJYA 2G1PA 2QT0A 1WEHA 4BKRA 3EDQA 1JXMA 3PENA 4BEWA 2JS7A 2AI1A 1EE1A 2IZ5A 4OAQA 2D0IA 3L4KA 2CDCA 2HXYA 2J59A 2LCFA 4DM4A 3UK2A 2X5NA 1CJKC 3T3OA 2R1UA 2WMOB 1AKVA 3A6HA 3QUQA 1KTVA 4P5PA 4FYYA 4ZVLA 4DWJA 2MYNA 2O5CA 4N3NA 3R23A 2W22A 3JRXA 5IKMA 1YJQA 1Q44A 4PYJA 5CFZA 1Z2DA 3DDSA 2VCHA 2R1VA 3UNXA 4FE7A 4AI6A 1EIWA 2GERA 3ENQA 1SJ9A 5EMMA 5E8RA 3TR0A 2BCJQ 1OROA 3N7UA 3PC4A 1IUNA 1JUDA 3GT3A 1DCKA 4KIJA 1UMKA 2X6TA 4HWRA 5AVOA 3TKLA 3VRHA 1BRTA 4MS1A 1I4TD 2J0EA 2GJ8A 2QRLA 1LS1A 4NZPA 3F5FA 2GAOA 2VPYA 5AVRA 3OLXA 1K98A 2XBMA 1NPYA 1E2HA 1HEIA 2NXNA 4PRYA 5D7NA 4DA8A 5EE3A 4XSGA 4DTIA 3SNHA 3UMGA 3RTBA 5A3RA 1QPZA 5JR3A 5BSWA 1EXWA 2QIOA 1RLTA 1S8OA 1YHZA 4PLYA 3H2KA 4BQIA 3U4HA 3CV3A 3E84A 2HUNA 4WLFA 1NG1A 1KP9A 4B6GA 3AFIA 1RJ9A 5CLJA 5ITWA 2WP0A 4XX1A 4B3MB 1GFSA 3AC0A 3I5AA 3VDXA 1SOAA 5B3KA 3L7YA 3T5PA 2QQEA 1WSWA 2KJQA 3OMWA 4YP0A 5LZ2A 3CVJA 2YZMA 3ACCA 3AVVA 3CNHA 5DHUA 4TWIA 3WZLA 3OY7A 2X76A 3JQBA 4JR0A 1SN7A 4B45A 3VPCA 2CDAA 1CZNA 4QGFA 5PGMA 4L1KA 3K5PA 3W3AD 2VDPB 3HRHA 5IVDA 1ADYA 4RL6A 1RJGA 3RRMA 3LG2A 4PWZA 2J5BA 4B6JA 2D0DA 2P90A 4L4XA 4RANA 2ODPA 4JLDA 2LIVA 4TN1A 1SHUX 1KR5A 3PFFA 4CN8A 2AFHA 4M87A 5E6UA 1TMGE 3I04M 4JHLA 2FOLA 4RPLA 1B73A 1KFCB 1KZ4A 1U98A 4JL8A 4X8LA 5JLAA 2VHJA 1R7RA 2ZB7A 4RTRA 1Y8QA 3EWAA 3QG5A 4P1ZA 4TV8F 1QG4A 4DARA 1VJRA 1XD2B 2GEKA 1MJ5A 1G7RA 2FFRA 4TN5A 3QPAA 4R2IA 3LC1O 4HQ0A 4RDCA 5LYYA 1I4LD 3USCS 4C07A 1TO6A 2LW7A 2EF1A 2W4IA 3L7DA 4YGXB 4D0RA 2AG1A 4LXYA 1Q7BA 5JH7B 2JF0A 1BE1A 1O9GA 2AT1A 2M2IA 1ZI6A 2HSEA 3Q7EA 1CD5A 5P8WA 1NN5A 3SLKA 4AK9A 4UU0A 4IR7A 4BKOA 3STHA 2PMFA 3X1XA 1HTWA 2OENG 4BO8A 2BRUA 1W2GA 1EE2A 1H0HA 3K7EA 2F43B 2GO1A 1XDUA 3X0DA 2F3RA 2ZRLA 1JG4A 3OLWA 2OPBA 1IVYA 3E0QA 3VOSA 4E4RA 2QM0A 3OIDA 1BMQA 1YR6A 2YXDA 3D5QA 2PZLA 3PQDA 4KV7A 4F5WA 3THOA 2XJ9A 4AZ3A 1I5OA 3EDCA 3MINB 1Y4AE 4HBGA 1SBQA 4KLNA 2N0SA 1QHNA 1URPA 2J45A 2HTFA 3I4CA 4JU9A 3PDIA 3FHJA 4HF7A 5I3ZA 3CCCA 4Z9BA 3OCJA 1P2GA 4XIYA 4ZN6A 4L9SA 1UR5A 4LOLA 5IYZB 1LX6A 1OF1A 2Z8XA 1XC7A 4LYGA 1VBKA 1U04A 4E6PA 3DQZA 5KVCA 1WB5A 1VMIA 2AJLI 5A06A 5JNTA 2SKDA 1RZUA 4N3AA 1QR2A 1U8UA 2KBEA 3WGLA 4DIUA 2AOTA 2BM9A 1C3VA 1ND5A 1SELA 4PGGA 5JLJA 4PX3A 1NRXA 4RXUA 2QG9A 2J3KA 4ZPJA 2JBHA 5J5AA 2ES4A 4IXNA 4NYJR 4KC0A 5CDUA 5LU8A 4Z49A 1XMQB 2NPIA 3ASUA 4QGAA 4RXTA 5CJ2A 4EF4A 3VO1A 5CB4A 1CY2A 1YB4A 3QOFA 3CPSA 2VZ8A 2RC5A 1TT7A 4ND3A 4WXPA 2GPSA 4R1QA 3PQ2A 1E0AA 2PSSA 3T61A 5COQA 4KNYA 3HFSA 3S2FA 3ZCPA 4AO8A 1H9AA 4GPZA 2D3WA 5JPIA 4R1PA 2QG4A 2FW0A 4BQEA 2AJDA 3S28A 4RLHA 1DMRA 2J4CA 4WBXC 2Q7OE 5LIPA 3DH0A 2QGFA 4DQVA 1C4WA 1HFKA 1II8B 4GBJA 1U2ZA 2WHEA 3GLFA 1LWOA 1ZQ1A 3QXHA 4U7HA 3LYLA 1EIZA 4EY4A 3HZHA 4QECA 3BEOA 4C0HA 5B2ZA 2JGEA 1HDOA 3HVUA 4FLMA 4QYIA 2CDNA 3DDCA 1E66A 1NBOA 4AS2A 4F93B 2QD1A 3RSSA 1POXA 3PI7A 4TXLA 1MD9A 3WAGA 4NE7A 1OY1A 1I3LA 3B3FA 2J3HA 3TR5A 3KBOA 1ZGCA 1LK0A 3G9TA 3K0HA 3SYKA 3HCEA 4N5IX 3RYHA 4EB6B 2P68A 4I4CA 4YNBA 1O87A 4BC0A 1WS6A 3KHKA 3P9YA 3RRJA 4HFJA 4XQEA 3IH5A 1T2EA 1N6OA 4Q03A 1VIVA 2TRSB 2EWWA 5DXFA 1TL7C 4OH1A 4DWWA 1W30A 3IAS1 1NWHA 4DN6A 4WMLA 2JEYA 1TD1A 4P7KA 1DUSA 3HV0A 3D8BA 3BBPA 3HVHA 3AL3A 3UENA 1SVSA 3AR8A 2WHYA 4YJ2F 3WLAA 2C5GA 3ZD9A 3TLMA 2IYVA 1Z0FA 4LDNA 4BWVA 1W47A 3BGVA 3BSWA 3A4MA 3DEZA 3SEFA 1B42A 4OIMA 3K0CC 3OZRA 4XAQA 2V55B 1HYGA 1YA4A 2HY7A 4MVJF 1A5BB 5F1OA 5FOVA 3TRHA 4XJTA 3HP7A 4C7XA 1LD3A 3WK9A 2WPNA 4JLNA 5LWQA 2NZ8A 2ADFA 3MCZA 5KTRA 2MR6A 3TCXB 2P79A 2V7UA 3GFPA 5K6RA 1VKHA 4Q24A 3HO8A 1USGA 4OHOA 4F85A 2PV0A 3TBFA 2HGSA 2JVKA 2XWSA 4J0DA 2AVNA 2VJMA 5J43A 4LS3A 5LYJA 3O8QB 4AO7A 1BOOA 4MEBA 4U8HA 1SWVA 4U8GA 3F46A 4CZ2A 3GCXA 1ZKMA 4KE6A 2NADA 2P2SA 3MGGA 3PXDA 3ZOKA 2E7ZA 4DILA 1EAYA 2XZOA 3NHYA 3FPKA 2C4UA 5AYVA 3LLUA 2W42A 1Z4KA 1H8EA 1NJ2A 1SOWA 1M1UA 1K6XA 2BLNA 1GGNA 3HU3A 5K8TA 3WMEA 4G01B 4E11A 4CVNA 1MX5A 4L08A 4N0QA 1PWYE 3S40A 3SF0A 4C01A 3JARA 4UTZA 4ASUD 1XA4A 3REOA 4QTUB 4GS5A 2ZSHA 4LE1A 1NBAA 2C3UA 1BQ3A 4Q15A 4D4MA 3BMXA 2YZGA 4H0CA 1P8AA 2FPGB 3F8SA 3ILVA 1VMAA 3U26A 3T0IA 5C1PA 2GK6A 3ZK8A 3B7PA 4I36A 1AMOA 5G0WA 4ZCRA 1W49A 3ZDAA 2WU4A 1KYYA 3L8ZA 2QV0A 3B3QA 3PHHA 2W4QA 3NWPA 3P2KA 4Q19A 1XFAA 1ZZEA 2QOEA 5FXMA 2JHFA 3QWBA 3LGXA 4PX5A 4X45A 4NFYA 1JAZA 3BK7A 1M1YE 4L15A 3A6JA 4PLGA 4PSCA 3U39A 4CF4A 4KU4A 4EARA 1GD1O 1Z5PA 3CKLA 9ABPA 3EPHA 3ER9A 1GSHA 5KWVA 2X9GA 3CIOA 5C52B 3PGA1 5LQNA 5FWXA 3LNTA 3SGLA 1A76A 3C7DB 5DM1A 1YIDA 5KTMA 1RKBA 3VPFA 1OKKD 2PUVA 4MR9A 4FWBA 3OEED 4V03A 2DJIA 1XVLA 4RVDA 3WWEA 3E8SA 5DASA 1A95A 1IHYA 1M7BA 4JGBA 2CD9A 2NW6A 1OBHA 1ZPDA 3K5HA 4O1IA 4ZQBA 1DFHA 2P8SA 1OHHD 3P9KA 4MWOA 1Z06A 2SKEA 3S68A 4AN4A 4EKIA 1PTJA 1SB8A 3DAGA 4M8KA 1YB7A 4IH4A 4NICA 1G7TA 1U5BA 1D09A 2X9LA 2Z04A 1GUDA 2FW1A 3N6VA 3QYFA 4G1UC 2R6JA 4G2TA 4NI5A 1JZTA 3V1YA 1LBQA 5KDDA 4PEVA 3VR6H 3OTHA 4G24A 3EBOA 3ET4A 4K05A 4F6RA 3NYQA 1E2PA 3ZWQA 4JS0A 2Y1WA 1RXUA 3HB1A 1E9RA 2A9RA 1DIHA 1MB9A 3T9FA 2B6HA 1Q0SA 5T6MA 3WKAA 1S4QA 3JQPA 4DLAA 3GDOA 3HUEA 4BLPA 5BSTA 1KY2A 1C0IA 1SKMA 4OKIA 4N9QA 2IPXA 1DWQA 2QG6A 3B5JA 4RZ3A 3B53X 4G4GA 5IUNC 3KETA 1TE2A 1AV7A 3ROMA 2FXVA 3RODA 1NONA 1QYIA 1WLSA 4JQOA 1J22A 3ZD8A 4Q3KA 4C76A 2R47A 4IJWA 1IUOA 3G2KA 3LUHA 4PO8A 2W70A 2X1VA 1QYXA 1Y9AA 4LZOA 4X7BA 5CDFE 1EB9A 4J1SA 4ER7A 2WSIA 1OIXA 3JD3A 1YZHA 5CPFA 3VH4A 3WGVA 3N59A 4TTQA 3HXPA 3VDRA 1UM8A 3D6UA 3GLIE 1FMCA 1GGKA 1M8FA 3VYWA 3IAUA 2GYVA 4G56A 4YRAA 4QZVA 4CEJB 2Y1EA 1IZ7A 1P0MA 1Z4IA 4N7JA 3IJ5A 1WRBA 3W1WA 5EIXA 4MS4A 1UQRA 2ATXA 3C6XA 4M22A 4PYMA 3RS5A 3V3TA 5JYEA 3EGXA 1A88A 5B57C 3SHOA 4KXNA 1QP7A 1LW7A 2NO7A 1ML3A 3LVBA 4K81B 1ZNWA 2VTKA 4MP3A 3MWGA 5CG2A 4G37A 3LCVB 1R0ZA 4PXYA 2GF0A 3KUKA 3HK2A 4GP7A 1DBPA 1SA0A 1N7IA 1TADA 1QYVA 2JJ1D 4HYTA 1Y6RA 4ZREA 2NNWB 2QVCA 4IJVA 5BWLA 4S05A 1L5MA 4OTZA 4Y2GA 3ZLTA 3MCWA 1XCLA 1BDBA 4QOEA 3KSAC 4RPCA 4P2BA 1EH5A 1S1MA 4HUQA 3LRXA 4Q1VA 4AKHA 2WTUA 1XD8A 3KZVA 1A04A 3KV3O 3WYCA 5JXWA 2ZS9A 5C3UA 4ENWA 2Q9BA 1W73A 1HR0B 4DXAA 2GD1O 1NMQA 5ENDA 5K0TA 2WF7A 2H9AA 2F2TA 1NATA 2O7SA 3OZTA 3PUKA 4PQEA 3UMRA 2O8BA 4NU8X 4G25A 2Q2QA 5T5QA 3U81A 2DSTA 2RGEA 4P54A 1A82A 4TUYB 2GAIA 4FNGA 2Q1SA 4GSLA 4KLRA 1GNPA 1HO3A 4GZ5A 5DN6A 3NBZC 1EZZA 1A0OA 1P7PA 2YMPA 3L0ZA 1O2DA 3DCNA 3LUFA 3KE8A 1N2GA 1CX9B 2O06A 3RE1A 1KTIA 1FNCA 2CJWB 2PL5A 3IDAA 4IXWA 4NYIR 3OPVA 4QFBA 2QQFA 3NBKA 3G5UA 3QLEA 3QFTA 4CCAA 4DRYA 5KDOA 5AOAA 1MPXA 1U2EA 3DOFA 3HXTA 4YP6A 4F3RA 1C7IA 4CLDA 1PDOA 1OXKB 1C2YA 1VXRA 3K9WA 3L6EA 1YVPA 2HF8A 1SAYA 5DH9A 3SZRA 2JPDA 3FCEA 4L50A 3T3GA 4B4VA 1IQPA 2PXCA 4YONB 4RJTA 5I4KA 1IEVA 4GPTA 4Z4HA 4G4IA 2DM6A 1JGTA 2R00A 1FE8A 1P31A 1G38A 3M89A 5CHYA 1OXMA 1KJYA 1RADA 3U48A 4D9KA 4J0IA 1Z5VA 4MX8A 4YCJA 4EA8A 2Q27A 1CJUC 3R7FA 3O92A 4KXLA 2OUKA 3WLTA 4D96A 2I7DA 4WFKA 4KRFA 2OD2A 3ISVA 1G21E 2IGTA 3TLGA 4TXNA 4DBZA 3OP1A 1GRRA 1I80A 1JEEA 1RQPA 4HZGA 3R7DA 3WISA 1DJPA 4H7IA 5H59A 5KMGA 1S02A 4A0RA 2HJWA 3NDIA 4KXYA 1RQXA 3FCCA 4LK2A 3UB2A 5IC5A 1L5VA 1LGYA 2OCIA 1UKAA 5BW5A 1SK8A 3IV7A 4IFBA 4TYPA 5JXHA 3S6JA 1SCDA 3ETJA 3LY7A 4IZIA 2Z5FA 3RT1A 1WQ1R 1Q0RA 1XALA 3VTKA 5DMHA 1V11B 5HP4A 3W5AA 2DWUA 2LTAA 5HIJA 3AH8A 1EEXB 3IQZA 4DSAA 1VFPA 3GB9A 1MHPA 1C7EA 1KSHA 1XGKA 1XZPA 3VHLB 5H9WA 1E4VA 1NKSA 2ARKA 3KAQA 4FHCA 4KQJA 1L5HA 4G0VA 4LJ5A 1N34B 4POOA 4J2HA 2KB0A 3EGWA 3MMSA 2D6FA 3LX5A 4J0KA 1PX0A 3ICOA 3WMRA 3HZRA 4IIJF 1E64A 3TZEA 1ANKA 3WAKA 4LSMA 3O6VA 2FFJA 5IYZA 1YR7A 3H9EO 4C4PA 1CY6A 1JDTA 3BJEA 2D13A 5AI9A 1RHRA 3O7WA 4CTNA 1OZ0A 3QVOA 3QW2A 3A6PC 2C9ZA 4ZOLB 1X9HA 3C97A 5IYZF 1V4BA 4O4HA 2DQYA 2WEKA 4XXHA 5HOQA 2O2YA 5A3VA 2G0TA 5EG5A 5K3FB 2C4MA 3NDJA 2V5VA 1DEOA 3QE2A 4GL4A 1RJEA 3PDJA 4L9AA 4LTDA 2GYYA 4MB2A 4WAUA 5K6AA 3R7NA 5GJBA 4DCJA 3NTUA 4X7PA 2HCTA 1XHLA 2Q7DA 3BICA 1OV4A 1JHXA 1LU9A 3CH7A 3HXOA 3P32A 3D6VA 10MHA 4UQPA 4X00A 4XM2A 2PV7A 1ADGA 3M4ZA 1XR3A 3QBJA 1COWA 4I55F 3NAGA 3UMJA 3A9WA 2Q7XA 2XNDD 2AUTA 4ID9A 1J7KA 2BEUB 2QROA 4I19A 4IOJA 1A4RA 1CYDA 4J3JA 3LVRE 1EU1A 2OILA 2JGKA 2WNIA 4RETA 3RJTA 2GILA 2VQDA 3RS9A 4J43A 4EKDA 1IVSA 3ZHQA 1OOEA 2HK7A 1XZBA 1ZLYA 5BP7A 3DGFC 1NIPA 3FFTA 3KQVA 3M2TA 1TT5A 3MXTA 4PFSA 3PZBA 4C0JA 4YR7A 3EFHA 2F9MA 5BRNA 4BWFB 1FTGA 2AW3A 1Y4ZA 2PZBA 3BXXA 3C8UA 5AKGA 4ZCQA 3VNQA 4ZEXA 4DCPA 3C5CA 4R5MA 1VHLA 2XUGA 3FPSA 4K3VA 1M6VB 2WWRA 1SB9A 4UE3S 1FUKA 4LJ9A 5EMJA 4OFZA 4PTYA 4Q01A 3U3ZA 4YR9A 3MWDB 3EZFA 1KZ7B 1GQYA 1TDJA 4RCVA 4TMXA 2PUEA 2Z1NA 1X42A 2PS9A 2XQIA 5AVUA 1YZUA 1R2QA 1EYZA 2X2FA 2D2VA 3G5TA 5E1BA 1OLSB 1E3EA 3ZIAD 2I4OA 3CG0A 2BR4A 3IVCA 2BP7B 2XA9A 2QQ0A 3HKBB 4CXMA 3DUFB 2C54A 3AUXA 1X2EA 4BX9A 1PUXA 3PCTA 2VVTA 3E9NA 3C5WP 4EX7A 3RUPA 4F97A 3TKAA 3B78A 2Z08A 3DOHA 5J4VA 3CW9A 3Q2OA 4Y9TA 3QLUC 4AT1A 1PV2A 2RAVA 3Q8WA 2XBLA 2DCMA 2YN2A 5CLIA 3WGOA 4I99A 2HBQA 3AM5A 1LJLA 3K1ZA 2JJMA 1K2WA 3OFKA 4RIGA 5E7JA 4OHMA 2OLEA 3RRZA 2BEVB 1DKRA 2EKQA 2CB0A 3BHJA 4K8RB 4ZI5A 3U37A 3UW3A 3NM6B 2W2OA 4R9SA 4F8YA 5BV2P 2Z9CA 4K9NA 3UHPA 4UHJA 3FSGA 1P60A 3B6KA 3DMFA 5AP9A 4HDNB 4MZDA 4OK3A 3SDBA 1XL1A 2VNIA 3RU7A 2WWXA 4JH0A 4AQ7A 3RAEC 3GPLA 2WSLA 1BA3A 1GN9A 3T0GA 4CM5A 3ZBTA 1PFUA 3F5QA 3FD8A 4QUBA 3HVRA 2I0FA 2OO5C 3ID6C 1PO7A 4NE9A 5REQA 1Q19A 3HVIA 2P7IA 1J2YA 1FFXA 5IK2A 1DXOA 3WIDA 5EPUA 2Z4TA 3HFRA 3FFWA 1T6ZA 3MJVA 4TTAA 3S8EA 3ZDBA 1GDTA 5ALQA 4QTZA 1GUZA 4WOCA 7REQA 2XD4A 2D1RA 1N32B 1DBQA 1JH8A 1ND6A 2CXQA 2OHXA 1PZFA 4M8NE 1EBUA 1S2NA 4X3OA 2HDHA 3G0DA 1WW2A 3MFYA 3RROA 2GT1A 2I4RA 3EY4A 2XLBA 5CNJA 5CVJA 3DV0A 1P2UA 1SKBA 1FOEB 4MYUA 4MLCA 3PT5A 1YS6A 5ALSA 1YE8A 4HYYA 2O2IA 3SQMA 2J3MA 4Y18A 1DAFA 1UBTS 2VF5X 1R3UA 1JLHA 2H1WA 4IJKA 3WDSA 3ZD7A 2NU9A 3PA8A 3T1HB 3V7NA 2ONJA 1TIPA 3ESYA 3RJ9A 5JD4A 4WTOA 3PKIA 4TYNA 1MO2A 3DWFA 1B0UA 1U2SA 3C3CA 4OUKX 4BE9A 4C3OB 1NYQA 4CJXA 4XWOA 1QP4A 3L4BC 4X1OA 1AT1A 1IC6A 4W9NC 3DT8A 2WWGA 3ASZA 2IOYA 4AQYB 3CRMA 4TV9B 3W9BA 3BIXA 4CKWB 1U3DA 3BN3A 4JEUA 4MWZA 4BNIA 1V5WA 3WHLA 3BXZA 4MKZA 2OFFA 2DBYA 4JBHA 1IBKB 1CQZA 1V8OA 4P9NA 1R0YA 2E82A 5TNXA 3BHIA 2FMHA 4GOXA 4YVFA 3RFTA 4CV1A 3HN6A 2O7QA 5ILQA 4OYLA 5J2TB 4C2AA 4MNTA 5I5EA 3RSQA 3KU4A 3NEAA 1AC5A 3ELBA 1XZJA 1HF3A 2E0IA 2PKXA 3DEJA 2FX5A 1LZKA 4AZ0B 3AKYA 1L7QA 1J2EA 1JR3E 2RHWA 1OA0A 3ODGA 1Q7CA 1U28A 4HAIA 4II3A 4NMHA 3DFKA 4NAHA 3I12A 4YRJA 2GD6A 3DWEX 2NP6A 1G3IA 2CWDA 1TQHA 2A3NA 4I9HA 4PANA 1PN3A 4G5QA 3STUA 1W4LA 3D3QA 3TX2A 5BXQC 1W4RA 3T5BA 3T1YB 5EE5B 5TPWA 3I5XA 3GPDG 4BOYA 1UAYA 5L3SB 1NXXA 1UAAA 3R40A 4FEGA 2QA5A 1L6RA 3ZW7A 2R62A 1NVEA 4ZJZA 4US1R 1YR3A 2BGUA 4NBTA 3MWLA 2WFMA 1UZLA 1CUCA 3O8OB 3T5AA 1UEIA 1Y9JA 1VGQA 2QORA 5ICFA 3R5HA 1PHPA 5EPOA 1VZ3A 2ZW9A 2FX3A 4RSHA 4A6XA 1WDWB 3FMVA 1YRWA 3ZU4A 3WB9A 2DECA 4IOKA 2X6QA 4WDRA 1QH0A 2NQ2C 4RIFA 3JALA 3FPEA 4O2AA 5F78A 4S1OA 5HE9A 3X1KA 2H2HA 1T2CA 3KQPA 4OAOA 3LC0A 5K20A 1H05A 3T9BA 4ZDIA 5TLSA 4OGLA 4BFSA 4ATNA 3D8HA 5FBRB 3PHBE 5G3ZA 1TEZA 2J9FB 5U4XA 3X43A 4DUGA 5ITZB 1CEYA 1A69A 4CM8B 1BWSA 2ZQYA 4OQFA 2VRNA 4WESB 1L8XA 1POWA 4XVRA 2O3QA 3FDXA 3KEQA 1ULBA 4HVLA 1BJRE 3LTNC 1SCUB 3ZNQA 3CRRA 3T06B 1KIAA 2JFXA 2AIRA 2Y68A 3BMQB 3OEHA 2OLKA 4DC0A 4RY2A 4CL0A 3RSCA 3LHFA 1QNLA 2VDWB 4DPMA 3K70B 1AN0A 3JSAA 1IN5A 1KVTA 4TKVA 1ONOA 3ZDCA 2V8OA 3AVOA 1KC3A 1OCEA 1U99A 2ZRPA 3PUVA 3NWJA 4RU1A 3OF5A 3EG9B 3PHGA 1TQDA 4AXBA 1A8IA 3A4IA 1D2MA 1IG0A 4G3XA 4XJSA 4KOEC 4WBNA 4FFDA 4BMOB 1VPTA 1Q7GA 1Y5RA 1IN1A 2A9QA 1YJBA 2VZEA 3CZ5A 4V0OA 1OR8A 2ZYSA 3WJ7A 5HZMA 1RHKA 1CQXA 4R41A 5I3CA 1QV7A 2QK4A 4MLDA 3F7MA 1MFPA 3E35A 1Y6FA 3VVBA 1PW5A 4F5ZA 1H6CA 2PHZA 4M9UA 4BZPA 2VJDA 2XUOA 4F2WA 2VJKA 4UQLA 4C5BA 3F0TA 1Y42X 4IX9A 3KEMA 2OQVA 3O75A 2FSFA 2B36A 1RD4A 2FUKA 2ZPTX 2JFBA 3OQ6A 1ZD8A 1XEXB 2GEBA 3AHEA 2GBLC 3H3JA 2YUIA 3ZXSA 5E0OA 1B8OA 5ULLA 3RREA 4Y6SA 5CAEA 1DRJA 1Z29A 2P9HA 4ZQIA 3UHJA 3TUZC 3QUSA 3PVZA 2PMWB 5DP1A 1Q6ZA 2N46A 4G0PA 4YJDA 4BEVA 2GZ2A 3HBFA 3U44B 1P29A 2GGSA 1SCBA 2CXTA 4YRKA 3GROA 1K0UA 4BCCA 4L4UA 4M2LA 5I7VA 3IYLW 5GVRA 2PIAA 3MB5A 2JJ2A 5CU7A 2C9BA 3DC2A 4QU0A 1JLSA 2XBUA 1LWNA 2YRWA 4J91A 3SD7A 1MB0A 4TKUB 1H3EA 4QPZA 4QSMA 3DXFA 4BXOB 4X64B 2WA1A 2EQBA 2F00A 2W6PA 3HH8A 3ABZA 3A4YA 3PI6A 1TEHA 4R4JA 1FFAA 4CKZA 2Q4RA 3L7KA 1U3TA 2IPMA 2LWIA 1BDMA 1I5EA 2OHOA 1UBJS 5EA2A 3S70A 3QQPA 1Y8ZA 2AH5A 4RQUA 2R65A 1M74A 4YT8A 4KYIB 4QIHA 4YJ3F 1NUTA 5DZSA 2ZT5A 5EKTA 1F6BA 1K75A 1TZ2A 1XA3A 1L4MA 5EJ2A 3VUEA 2FW6A 4DVGA 1OVGA 1QH8A 2JG3A 4X8HA 5FRDA 2WV9A 3J81k 2WJZB 4UEKA 2ZUVA 3G6WA 4ZZ0A 3DOJA 1JIKA 3RT7A 4DYVA 1XKQA 4YRMA 4M46A 4QOGA 2XZDA 3BG5A 5JMTA 1QZXA 5IAGA 5BMOA 1CUVA 4K6HA 4MJ3A 3VJLA 1CNFA 2JHCA 2IBSA 3NDPA 3CUSA 2X4IA 3R5TA 2NO5A 2VYCA 2C9YA 4HNQA 3JVVA 1EKXA 2NM0A 4MR8B 5CT4A 2A9KA 4D9FA 4MDFA 4ENTA 4CQMA 4YT2A 1EVLA 2ZR8A 4UZEA 3UA4A 3SYNA 1W94A 3TI9A 2NZJA 2WFZA 1W0KA 4E5VA 1GGHA 2E5LB 1FL9A 1G8YA 3G0CA 5HMMA 4BLQA 4ZI3A 5C4IA 3IIMA 5AM0A 2E87A 4FTWA 5TY0A 1PF7E 3ABIA 3GFVA 3MWFA 1YXMA 3NHAA 2WHRA 4Z86A 5AKHA 1MCZA 2YJ5A 1U9IA 2CVFA 2MYUA 5HBGA 2Q3HA 2QRJA 2WKWA 3SC2B 2A7QA 3BTVA 4LHYA 3CN7A 3MJSA 4W5QA 4URHA 4TS9A 2I55A 2NXCA 4HI0E 4HXYA 1HBJA 3N86A 4PAOA 1NN3A 1Q3HA 1VIDA 1W6UA 1Y7TA 2FFBA 2C4WA 3RBXA 3WS7A 1GGFA 4HHEA 3WGZA 4BO4A 2YICA 5EI5A 2BYTA 3UBMA 2MSKA 4M37A 2PH7A 5CURA 2P4HX 3U7RA 4ETNA 4EY3A 4YJHB 1A8SA 3T54A 1FP4A 4ZKDA 2PBLA 5FWYB 1M2EA 3LA8A 1Z13A 4QNRA 1I30A 5D5QA 3OC0A 4CLRA 3A6LA 3Q87B 2FQXA 4NYMQ 5AHWA 3IHTA 3QQ5A 5HUQA 3E1GA 2YFQA 3VKHA 1ZJ5A 4IGIA 3B1KA 1XZIA 3H0KA 3BMOA 3NVDA 4JB2A 1FCJA 2GD2A 1WZCA 4QUEA 1LSOA 5FNVF 3F97A 3JR3A 2HDWA 4HGOA 4ESEA 5FA8A 4NMWA 2IV7A 3ESAA 4WD3A 4Q3LA 2G8NA 4MRMA 3LQ2A 2GM9A 3RANA 1N1DA 1M0EA 1ZNZA 4UNPA 5FOTA 2BI7A 2C5FA 2AI2A 2PYZA 4KQEA 3VKWA 2RJOA 1UXGA 1CLUA 4JUCA 1U31A 1ZONA 2CUNA 5JRDS 1EK2A 3FR7A 3DBIA 1R6UA 3DKPA 3MUOA 1FP1D 1WUKS 1X8LA 3DEHA 4DLVA 2GXQA 1JZSA 1Z0JA 4CMAA 4OOFA 2DGDA 4BLTA 1JWBB 4YY3B 3RYFA 1E0JA 5JJ5A 2IPLA 4UNSA 5DLDA 4BEJA 4LPSA 1E2UA 4YMGA 3TMAA 4AN1A 3DYIA 2PE5A 2NO6A 3EAFA 3E53A 4RVUA 4LZAA 4OMFG 2ZJBA 3F1LA 1USKA 3C4JA 1LLUA 1KIFA 1N6RA 4NV3A 4RYLA 4FZJA 4BIMA 4I66A 1JX6A 3GJ5A 4QFCA 4BNJA 1YI1A 1T3LA 1W2WB 4XEUA 4B48A 4KO3S 4PGMA 4H4EA 1XZMA 3KQMA 1BXGA 3AG5A 3QKTA 2GJ9A 3ZJYA 1B7GO 1NW8A 2QQ5A 3SZUA 4DV5B 3RLIA 4L8FA 3MQFA 2IXFA 3G8YA 5SV2A 1WD5A 3CSSA 2GASA 2GVNA 3WO1A 2CXNA 4XFDA 3KDAA 3LT1A 1LLQA 4MQMA 5KSZA 3BIWA 4M9SA 2FDCA 4BECA 1G2PA 3LWDA 4H7PA 2JA1A 3FOZA 5FPSA 1DOHA 1U3CA 4O4JA 1VL0A 4LWZA 4W4TA 5LKAA 1N2IA 2RGNA 3L46A 4K6OA 1J00A 4FGKA 4NMMA 1JG2A 1N1MA 4RTSA 2CLIB 2L0XA 3PQ5A 1Z4OA 2XOXA 3X2EA 3TLAA 2F4VB 4S1PA 2J9XB 2BFBA 2I29A 5DNEA 3ROQA 1TCAA 2CCKA 2JJQA 4ME6A 1NGSA 4UMEA 1K08A 4M1SA 1BD4A 1OFUA 3D31A 2W48A 1BWQA 2H7XA 5LZ5A 3G2QA 2C3MA 1C1DB 1X80B 4LY9A 2IKSA 2IYLD 4ITRC 5FL7D 4C6RA 1SBHA 1TUBB 4Y0NA 4C9BA 2AFIE 3GHYA 2D4AA 1KKUA 2NVUA 3C7KA 5K8CA 3OF2A 1KMMA 4OA8A 1KOGA 5EQFA 2PTHA 2SNIE 3NASA 3R77A 3WGKA 4XVCA 1ZSNA 3VPAA 4QASA 2OWEA 4J1TC 3JQ8B 3A9UA 3WIEA 2XQVA 2QE6A 4FOTA 4BFLA 1QZTA 1G3RA 2XQKA 2I2FA 4HQFA 2FCRA 4CDMA 1M76A 3QF4A 2W6MA 4YPVA 4FMDB 4N5LA 5BPFA 2XZPA 3K9QO 1P44A 2P4EA 2WSBA 2WJHA 1AIPA 1TQ4A 1GVNB 1I4WA 3M5DA 1PYOA 4O8CA 4BEBA 1ZN8A 4NENB 4LTMA 1F4PA 2HSJA 3NIDB 1Z0KA 2R7NA 4E03A 3L1HA 1JG6A 2CT8A 2I2CA 1H5QA 1SD5A 1C3EA 3KZXA 1RWKA 4YMVA 4KKXB 3ZGYA 1N7HA 2YIJA 1P5RA 3M6XA 1G20E 4WK2B 3ECAA 3JASA 3RSOA 2ZAYA 3DVLA 4LK3A 4ESVA 3FNBA 1XNRB 2PUAA 3SMVA 5FI3A 2M6SA 2Q3DA 5A5GA 2BFMA 3EGOA 1OV6A 2HLPA 5A9TA 4GWLA 3WWCA 3DLBA 4KQ1A 1NW4A 1Q0UA 4NZ9A 4BU0A 3S99A 2XKKA 1KSJA 4DGSA 3O4IA 3S0JA 4JT2A 2ILTA 3IIKA 2UZ1B 5D87A 1YL7A 2RH4A 4Q00A 1BCSA 4KX5A 5KNBA 2ZWPA 4UOEA 3E58A 3EASA 4KR3A 5J2TF 3VVMA 1RXCA 2BMWA 4BX3A 1KMNA 3NT4A 2HJHA 2WIFA 5JAHA 3E27A 4XWYA 4BDTA 1KI4A 2BVNA 1YS1X 1YJ8A 3C3YA 4WNIA 3X1DA 5KVQA 2ZUBA 3T4PA 3VC1A 4DSNA 1W25A 5GOZA 3JAMA 1M66A 1ZLXA 1VYUA 5DLYA 4NHOA 5LQMA 3H11A 1YHYA 1NRIA 1E79D 1Z4MA 1J5XA 4X61A 3O4GA 3RWBA 5CDYA 4EQZA 3P8ZA 1J8DA 3F1KA 3RVOA 1QIDA 2I6FA 4NZMA 2WLSA 3OTWA 2NO9A 3GCZA 4QXQA 1J8YF 4DG5A 1D4AA 1NI4B 1M2KA 3CX8A 4QJBA 1M1NA 2NYVA 4INAA 4M8SA 5CBPA 1ODCA 3KXLA 3U3MA 3FI0A 1PKXA 4PSVA 2COKA 2IHNA 4UAUA 1K4YA 1SQSA 4AZVA 4XVUA 3FAKA 4LV5B 5ALMA 2ZCVA 1NQWA 4H77A 2FW7A 4MWSA 3VR2A 4BBAA 4OGGA 2NXJA 3DTVB 1H8HD 2QM7A 5CX1A 4KXWA 4RPHA 4G1FA 2RHHA 3B1YA 2GLUA 3EFOB 1X1CA 3DVRX 3INTA 4G5XA 5DYIA 5LQCA 4HPXB 2ZJZA 1WMAA 5A5DA 4NNPA 3PICA 1OWMA 5AW9A 4ALMA 2AUNA 4S3MA 4RACA 5HJEA 1CJTC 1WCV1 3ZC3A 1YRQA 4MXDA 3H0CA 2WC1A 2GFHA 3HLKA 4IUBS 4KZPA 2E49A 2ZUSA 5AVVA 3QIVA 1VCOA 2C4TA 3MMZA 1P1RA 2YDXA 2BDEA 4MRRA 3ENZA 2VUIB 3NHRA 2XMGA 1T1JA 4H1VA 4I6JA 1SC3A 3B2NA 2R1VB 3CPEA 4KLZA 4U00A 3BORA 3UJ8A 2YNMA 3WQSB 4L0CA 1XE3A 3UMFA 1UBUS 5CT9A 1CUJA 3IQIX 5B12A 1VLMA 1EBBA 3OPQA 5B6IA 1U0TA 3U1BA 4K9OA 4AJ2A 2NUPA 3CO5A 3RV4A 3X2FA 4YMTA 1X7XA 3HNOA 4MS1B 1T3SA 2EYUA 2HJGA 2I65A 3A1FA 4JV5B 1KAHA 2WINI 3R0VA 4BUZA 3EF3A 5KHAA 2Q6IA 2PWAA 2AX4A 2D5AA 4G0ZA 4F4UA 4FYVA 1NNUA 4X6UA 4NXMB 3RD5A 1BH6A 1E9EA 2R4TA 3SBXA 5JIBA 4KAXA 5H82A 1NFFA 1FNSA 2G3YA 3ZHRA 1RJ9B 4PLPA 3H5OA 2D0PB 1PT9A 5JDCC 3RRXA 2I7CA 1D1TA 2JKVA 3NH9A 2BMDA 3IHLA 2Y1GA 3EXFB 5BW4A 4J3FA 5A4MS 1T3ZA 2VRCA 2HA5A 3LDGA 3N75A 4L8GA 4DUYB 4OL0A 4LFCB 5CVVA 2BHNA 4JHXA 5JI2E 3P9SA 3VPGA 3OEWA 1SBTA 2ZULA 3NCHA 2R6ZA 1XZGA 4DZRA 3EHDA 4RF2A 3L9WA 1YQTA 3H2SA 1SUSA 2GCOB 1N8NA 2O2SA 4FUTA 1T5DX 1WV1A 2INGX 1PYGA 4PZ9A 1KDVA 4R71A 4TTVA 3IEVA 1A71A 3P2YA 3GLGE 1KPHA 1Z6QA 4D3XA 1VPDA 3OUZA 5BNWA 2ZDQA 2VQ6A 5E6UB 2VQ3A 2IHVA 4JYCA 5F51A 1LNQA 5BVHB 4G09A 3SOPA 5CDTA 1QG2A 3UGJA 1Q0TA 3KVOA 2GM5A 3Q88A 5CNKA 1B2LA 1Y8QB 4D9HA 1R50A 1F0PA 3TL6A 4XWWA 1D2HA 3HN2A 2Z2IA 3JW8A 2IX9A 3MQ2A 4D3YA 1MAHA 4HXGA 2GZAA 4ZTUB 3JYHA 1XRPA 4LX8A 1FMFA 2UDPA 3PF8A 3I2IA 2CZGA 4AROA 3UJCA 3HB5X 3ITKA 2F3UA 4Q7QA 4CTMA 2A0KA 2O9JA 1G8MA 2ZJ4A 3VPHA 2ZRFA 4MRPA 5ELMA 1EFCA 1IJEA 1IRIA 3O7MA 1EFLA 5F3WB 4F9GA 2WFLA 1U2GA 4QGSA 4YYZA 4C4OA 1H23A 3BB3A 3C7AA 2GK3A 2OCPA 3B12A 5F21A 5H3CA 4B4DA 2AYYA 4BGUA 4BLOA 2Q5FA 1SHKA 4GMGA 4RDXA 1QYDA 5DIZA 2EFCB 2WF6A 1P0CA 4J8PA 4CM3A 2C7PA 2QTTA 5ALOA 1IZ8A 1GDDA 1M2WA 2A9PA 3HADA 1Q1NA 1IQUA 4GX2A 3SC4A 1GPLA 4LOKA 2R8YA 3HACA 3TW6A 4H1WA 5H83A 4M0EA 3PDIB 4LBWA 1I3NA 4FWTA 1PBNA 3D4IA 4XARA 3L7LA 3CVYA 1SBZA 1UJ6A 2DFKB 5JDIA 2GZ3A 4R16A 1O8BA 3D0RA 5AW2A 2HZ7A 4R68A 1F2UA 1XKXA 1ARZA 2D7JA 2QX7A 3WHKA 4PN7A 5AOVA 2WICA 4YRIA 3R9XA 4AZTA 4C2BA 3DD5A 2PRZA 3K1JA 2AOTB 2F4NA 2XVAA 4YRBA 3OX2A 5HQ3A 3R3UA 3GVIA 2YWFA 3A9TA 3VOTA 2JLUA 2ZSKA 2XRMA 1TCVA 1NRJB 1CUZA 2H2IA 2P9CA 2Q4DA 3NT5A 4MCIA 4LEIA 4N3GA 2GETA 2XE6A 1X7ZA 2ZYUX 1U7HA 4PZEA 4WECA 5KNDD 2IX3A 1NBME 1E94E 3DMTA 3H97A 2OXFA 1RW4A 3DW1X 4C43A 5FBKA 5CB4B 4EZEA 2NUAA 3FJOA 3RR2A 1FUIA 1INLA 3T41A 4XYGA 2G5PA 3DMGA 1XLVA 4IGAA 1XTQA 4PZZA 3NVAA 1QFZA 1ORHA 4NC9A 1HNNA 4G1MB 3ZNNA 4H59A 4KITB 1FBTA 2X7HA 3N1UA 3QBVA 1YGPA 5KU7A 1NLMA 1RXVA 5B2FA 1GN8A 2WU0A 4G4JA 1TZCA 4LBVA 4RVOA 3RBZA 1LRJA 2XB8A 3A05A 5TT1A 3GO4A 2HRBA 3O03A 4RD2A 1ODIA 4N7BA 1BCRA 1H0KA 1Y1PA 3CLSD 3ELWA 4KAAA 4QYIB 4RAOA 5JD5A 1DAGA 1XLTA 3BGDA 1JHVA 1EX7A 3T5TA 2PJRA 1L7PA 2R60A 1W5TA 3V4FA 1UZNA 3KZNA 3GVHA 4BKPA 3RUCA 3FKJA 3KLOA 3L40A 4BB5A 3ZDRA 1HL7A 3PRYA 3B60A 3RYHB 1GCAA 2IZ6A 4MI6A 1OPRA 2FFAA 2I7TA 5TGZA 5IM4A 3EVFA 1YFJA 3D8SA 4RF3A 2ZWOA 1MQAA 1JA1A 2F1RA 1E6CA 2H1HA 2QJRA 3OP4A 4FFPA 1EDEA 1QP8A 3ZJTA 3L6DA 4N82A 4INJA 1YJAA 2NYRA 1N5JA 3G5AA 3MCTA 7ABPA 4MPDA 5AJTA 1AH2A 1T8SA 5KYXA 1OUMA 1NW3A 1ZVQA 5FDFA 3NVKI 3L0PA 4B76A 1JIVA 4ZAVA 5A4IS 1HDXA 3INNA 4V39A 1OILA 4PVDA 3UK7A 5J2UA 3WYEA 3GJ0A 3PWTA 2B21A 3F3SA 2OQIA 1FLVA 4EGFA 2AXNA 5JXJA 3DKRA 4BJ1A 3CRNA 4J9VA 1UXHA 2O59A 3GLRA 3WG9A 2X8AA 2A0YA 3R0ZA 3NONA 4JMLA 3NTLA 1SU8A 3DFMA 5B1SA 1D2NA 1VQ1A 4U4AA 1PBTA 1PU2A 2P2NA 1QB8A 2R7AA 2WTBA 4GVPA 2I78A 1M1YA 1PZXA 4X97A 3E7XA 5BYJA 1NXPA 3NIFB 1ISSA 1JQLB 4IS2A 2XSZA 2CNWD 4KMOA 1AKNA 2FUG1 4OMCA 4CG1A 5LYJB 3N58A 1NZDA 2VDVE 2UZAA 3KSDO 4DMCA 5DOZA 3BPSA 1GG2A 1S01A 3RGWS 3VI4B 4BRWA 2V7BA 4P3NA 1G8HA 1GZUA 1WCYA 2GCNA 2YWRA 3LC2O 2L17A 1L5GB 3S55A 3V4SA 1M7GA 2IW3A 2ZBVA 2A86A 1U1IA 1SQ6A 1I10A 4DV0B 1I51A 1Q1QA 1AUOA 3NWBA 1I7NA 4JROA 2VSXA 1FVOA 1NNLA 3Q5DA 4L28A 4YECA 3UFXA 1OYOA 4ZOCA 2MSNA 5JALA 2CLHB 1FXUA 2JIQA 5EINA 4E3ZA 3FW1A 4WEQA 3TINA 5MFZA 4XD7D 3HBMA 1V45E 4I9FA 1DAOA 2IZ7A 3BDVA 4NCNA 1C7JA 2XDYA 2ZJ7A 1L4GA 2Q99A 4EJSB 2WDPA 5JCOA 1FS4A 1V1RA 1Y0BA 2PGXA 1K4MA 2FG7C 1NC3A 1NQTA 2L69A 4LDPA 4Z2YA 5C31A 1GUAA 1EUCA 2WJAA 3K0FA 1DG1G 3C14C 2YFYA 4YJKA 5G1OA 4TMZA 4XOIA 3K6KA 3L7CA 5LLSA 4LF9B 1V8ZA 3BXGA 3QELB 3ZWYA 1AOXA 1ST2A 4F38A 1PJBA 5EWJA 2I22A 3R5KA 4DR5B 3OFVA 1Q12A 4MB6A 3EEIA 2ZANA 4Y2UA 3E2MA 3AVYA 3SICE 3U3DA 5JO0A 1NKTA 1Z0AA 1G59A 3LUCA 2ZIZA 1E5TA 1SVWA 3GLVA 4QELA 1XVUA 2AEJA 5FWAA 2G9VA 3GDWA 3K8YA 2HSWA 5CDFA 3VO8A 4YCNA 1RS0A 3H8SA 4ZMBA 1C7ZA 1ODJA 1NMEA 3VR5A 4MQUA 5FWXB 1WMBA 2K4MA 3M1YA 4LHSA 4XSHA 2EERA 2PK3A 2RHJA 2AEMA 1DS6A 4MR9B 5BUQA 2D7CA 5I7OA 5AFSA 1S3FA 3FLEA 3GRCA 2K7FA 2AKEA 3FKQA 4CG3A 3DHVA 1QC5A 2ETXA 3QTBA 4LAFA 4EW2A 5EJ9A 4E46A 2Z2JA 3AHIA 3VJKA 1EUDA 1W34A 1ZUD1 2O2XA 1CDOA 2WT8A 2RFLA 2ZXUA 3IV6A 3QOYA 2P67A 3AT1A 4KFTA 2PVPA 4WZAB 2IYNA 2JH3A 4XX0A 3WE7A 1KYZA 1NOKA 4LZNA 2XXAA 3LO8A 4MGZR 2QTMA 3DYVA 3BD8A 1PWZA 1E5DA 4CI0B 1EFKA 2OXEA 2G06A 1XQVA 4FKZA 3UJPA 3L41A 4QPJC 2VSOA 1I7SB 2B35A 1VSVA 2G6TA 2G71A 3QPUA 1RXIA 3H5TA 3T99A 4BGIA 1BE0A 1ZIXA 4YV7A 3LWNA 3Q9SA 1M10A 1IY9A 3EEQA 5FYDA 3L1VA 2FPLA 2HMUA 3GRKA 4D8XA 4JI7B 3WX0A 5D3KA 3ZS9A 3C5EA 2VHUA 1SIUA 3KBBA 3LO5A 4MQBA 4GRAA 3TQTA 1L2TA 5JQGF 3LUBA 5FTMA 4IYJA 2ZS7A 2C7QA 4MKGA 2X0IA 4AG5A 2O0HA 2G70A 4EG8A 3BIJA 3EZNA 4R69A 4EGCB 4LBYA 4GAEA 1HFJA 5EWLB 2GESA 1EGHA 3ZZMA 3LA6A 2OOSA 3REGA 4EMUA 4MEAA 2WT9A 4AJ1A 1R0XA 4MS4B 4RHFA 2LIPA 1OJ7A 4M0LA 1P17A 3EGXB 2GK7A 4W99A 4EKNB 4G65A 3RNOA 2JKYA 3O21A 3QVGA 1YS9A 2ZKIA 1EXVA 1THZA 4L07A 5F3DA 1SD2A 3AY6A 1DEHA 3BTOA 2X58A 2R4QA 4W5OA 1MEEA 3L8HA 1SA0B 4PR0A 3V32A 4CF5A 1HMYA 3DBLA 1THMA 3ICCA 4QQKA 2QRKA 4ILEA 5CYOA 1EGQA 1LVGA 1T3GA 2FMUA 1V25A 2WR8A 4N6GA 5BN3A 1SNYA 1X9GA 2JI8A 3CZ9A 3UT6A 4PGAA 2HA6A 3CVUA 2ZRAA 5D3QA 1G21A 1FYXA 3ECCA 5C1DA 2I1LA 4H4DA 1JSRA 4PC3A 1CRWG 1T0HB 1R6VA 1ZH4A 4JBGA 3SXUB 1M54A 2FQYA 5H3LA 4HPJB 5KBYA 1YWGO 3CUUA 1YNOA 1TRHA 5E4YA 1B8PA 1EGAA 1VL1A 4MAFA 3ZNPA 1BKDR 1CEQA 2WM2A 4HDMA 5ALGA 4W5HA 1KOJA 1C8BA 4MGIR 3HPQA 4WVFA 3TJZA 2O3JA 3F6RA 1M5UA 1OIWA 1KYIA 3HA2A 4BFYA 4Y3UA 2RH9B 3HI4A 2ZSAA 4MQLA 3WIUA 3VC2A 5I7WA 4ARCA 1N78A 1DUIA 3K2IA 4P3XA 4I1OA 3OI7A 3N87A 2IDKA 3EDYA 4DCVA 3UPTA 4CL8A 4OGWA 5BQXA 1TLTA 4P4TA 4K1LA 4B34A 1NP7A 1UANA 3PKJA 3VSCA 4DR1B 4XQ9A 3H87A 3L0BA 4JSRA 3G1TA 1SKYE 1Z2AA 3QMVA 5GV8A 4Z3DA 2IPOA 3LUPA 3MSXA 2XYPA 4MW0A 5DT2A 4HPWA 3RS8A 1VA4A 3A6DA 3PNSA 3V2HA 3W77A 2Y2UA 3WLOA 4J75A 5HF9A 3ZGLA 4R3NA 2XMZA 3K2BA 3M6FA 4ALJA 3L07A 2WF5A 3G0GA 4KBFA 4B31A 2DXIA 4MR7A 2JL1A 3W6PA 1ENPA 1LPBB 1YZVA 4BWYA 4JX8A 1EWTA 3TLGB 3U4GA 2CL0X 2RG1A 4FN4A 2OSVA 4TVOA 5CYFA 1XVAA 1E92A 1W88B 5KMGB 1Z6YA 2V65A 5BNZA 3Q9UA 1TM1E 2OXIA 3HUFA 4YMIA 4R2MA 6ADHA 1PSZA 2R2GA 1QDLB 4GI3A 4EOGA 1K88A 1U2QA 1GV1A 3MBKA 5AKKA 3WLIA 4O0MA 2PWBA 1PEYA 1S7CA 1ZD9A 2JDID 4I1VA 3KT8A 4OJTA 3ZWPA 3DCJA 4BTVA 4COOA 1YZFA 1TZMA 3ZZTA 1X1AA 4JK3A 3ZY3A 3AZOA 2D1YA 3K73O 4EHFA 1W9MA 2PBFA 4FR0A 2EW1A 2VJYA 1NKVA 3B13B 4IFTA 3N2YA 2VATA 4BVEA 1UKBA 2AZTA 1K3TA 2RHBA 1F38A 5BSRA 1PQ4A 3BTUA 1B93A 5TJ9A 4AMBA 4BVGA 4EFKA 4ZJUA 2HIGA 2OFXA 1AQLA 4AJOA 3I9OA 3C6QA 3KZKA 4LG1A 4PPYA 2GWHA 1F2TA 2RAFA 4PV7A 1ZINA 1B0AA 2ID4A 3LLCA 1ODSA 2RGUA 2ZIVB 2H1OA 4ZT5A 3BERA 1CB7A 1L0BA 3BB4A 3F9RA 3LFUA 2F7SA 1PDVA 1VI6A 2WHQA 4FU0A 1IB0A 1FU4A 4GPBA 1E9SA 2FPIA 4B74A 4P80A 5GONA 4IG4A 4CIVA 2CYCA 2Y2VA 4F5YA 4V1CA 5JZVA 1HT3A 4O4HB 3WLRA 1NUQA 1FNDA 3B1JA 5KHOC 1F6DA 5HCIA 3E23A 1XXHE 1PTJC 1JKIA 3SSMA 3TTTA 1T4CA 1RHJA 3D1LA 3UHOA 2CD7A 2TSYB 3ZY4A 3NDBB 2QNBA 4JVLA 4ZGBA 2IIQA 2XUDA 3DV9A 4LOAA 2B7BA 5TT0A 5ITVA 1PJ4A 1OH7A 4KH0A 2JGNA 3SM9A 1EZ4A 2RK3A 1A97A 2PMCA 2FFHA 2A4KA 4TL8A 1P1CA 2PUWA 2PT9A 3CUKA 1U63A 2VBIA 4XIIA 2E21A 5A5EA 5ISMA 3PJRA 4OB6A 4J94A 1CUFA 2FMIA 3HU2A 1AKMA 3SG0A 1PJ8A 1NUHA 1M34E 3BZWA 1U5CA 1XMIA 5LNK1 3G9QA 1WV0A 2B3TA 5EJ4A 1TT5B 1LRKA 3PGJA 3C2QA 3SSNA 1WZIA 3HCAA 2X8BA 4NYJQ 4A82A 3WOVA 5B1IA 2W8BB 4H3VA 4LDZA 5CM9C 5FQOA 4MYRA 1DQYA 1M33A 2H59A 2V7GA 3K30A 4KNVA 4JLVA 4WFIA 3UFBA 4BNMA 1ZITA 2BMAA 4DRXA 2H4WA 1AZLA 2C2XA 2Z56A 5DWQA 5F4BA 5JSZA 5HK8A 3TCNA 3I2YX 3OO0A 1XEAA 3PDHA 2X8LA 2XVZA 3AUSA 1BE6A 4PYNA 4DREA 2VC2B 2WMNB 5EHNA 1GGMA 1JDBB 1F9EA 2Q8PA 4AN0A 3E7WA 3F9CA 4FB4A 3T5GA 4M7PA 2C9CA 3MUEA 4IX1A 5TC4A 3SU8A 2PGJA 1A7KA 2PG3A 3AETB 1O5IA 1N0HA 4B6EA 2GRAA 1M73E 3AIKA 3O26A 2I8CA 1E1MA 3HUDA 4RPJA 1STOA 2VAVA 3BH7A 2NSJA 1C30A 2PVCA 1IEWA 2C2BA 3I01A 3EEFA 4CWAA 3GLHE 3LH5A 4NWIA 4QXAA 4MWCA 2G9RA 3PXUA 2F6RA 2BM8A 4ETIA 1KZ6A 3CKYA 3QH4A 5CT8A 3CVOA 1BMTA 2EIXA 3GH1A 2LCQA 3L82B 4ZALA 3V1NA 5JDCA 1WPQA 1G64A 1US8A 5JCJA 2QR2A 3BFVA 1PGQA 3KOUA 1GAEO 2FPPB 4X60A 2DFLA 3IVGA 4U6QA 2CGEA 4A1FA 5BMVA 2G4LA 2GAAA 3TRKA 2FV8A 1Y8AA 2Q62A 1YRLA 2IOHA 4LRYA 3GRFA 1ODKA 2ET6A 1TNDA 3EGVA 4NCIA 3ZCVA 1RXWA 1M8GA 3GA7A 4KE8A 3SX0A 2CJPA 1AGRA 3D4OA 2MSWA 3A04A 1PS9A 1RP1A 3KSMA 4UW9A 5REQB 4G0MA 4WY2A 3ND6A 1OD6A 3CPHA 5TPZD 1QRRA 3G88A 2CK3D 5AOCA 5JROA 1RPTA 4TS4A 3HB0A 1AKQA 4YRQA 1KY4A 2AXQA 1EPUA 1FYDA 4YLYA 1BX1A 1JIQA 2O3SA 5LYJF 3LKBA 4GW3A 3SEQA 4UHDA 1WBJB 2OGZA 1JR3A 1REQA 2P6RA 3WADA 3QHAA 1VE1A 3V97A 2RKOA 3KJIA 2QX6A 5EZSA 4ANFA 4RCZA 1E2MA 2EF0A 3PWZA 2NU8A 5KU1A 3E9QA 1KJJA 2OECA 3QE0A 4UD6A 5IKXA 5CK4A 3W5DA 1DG3A 2CZQA 3KKNA 5KTKA 1ABEA 4UUNA 5ADWA 4GPAA 3JYOA 4R9RA 2IXDA 5EE9A 4XEHA 1T5SA 4OQDA 3ZHOA 1Q5PA 3DL2A 4EI9A 4KDCA 1B76A 4UXHA 4CUZA 3IPLA 1WZ2A 4BMXA 3JATA 5BYKA 3S1SA 4YXFA 3P0JA 4M6WA 4FMPA 4NOJA 3I58A 3TNDA 1IN7A 1JTEA 1ODFA 1PNOA 5C5DA 1PDWA 4WFJA 1R0KA 4IOLA 5JY6A 2VQFB 3GDHA 1SZPA 1Z36A 4MTCA 3WNZA 3AOEA 3OCXA 2QTAA 3CSUA 4NH4A 3T7JA 4C7VA 1ZAKA 5IZCC 5IWCA 2GN9A 3H5NA 3QVVA 4OU5A 3SHFA 1PP4A 3IIJA 5LOVA 4I46A 5AKYA 2BZSA 3VHXA 2B7LA 2Y0PA 5AK4A 2CXUA 3QMPA 1OW3B 2FSVC 2HQBA 2UKDA 1D5CA 4HO1X 1K7FB 2OHJA 1J1IA 3LBNA 1A9SA 1DKMA 1J99A 3AKDA 4AF8A 3CFYA 2I4MA 4LHZA 1JHDA 3BH6A 3THRA 1LTHR 1RDFA 1W0JD 2YVQA 1ISRA 3IEPA 4CW7A 1EXDA 1JEDA 3EGDB 3OM9A 4O2BB 4UBKA 3ZWMA 3IQXA 5AUNB 4X92A 3QBTA 5I01A 3FGZA 4X7RA 3IFSA 5A3JA 2WE8A 1H6AA 3DONA 1SHJA 1XVIA 5JY1A 4GH5A 3L8CA 1L7EA 3L0SA 1XN4A 4KXQA 4LZWA 5CT5A 3ZKWB 3OMLA 3OQIA 1KZGB 3DL7A 5TPWB 1YF3A 4JEHA 3O83A 2GTPA 3UWSA 4AULA 3PS9A 5LQDA 3TZHA 1HI9A 4HMQA 5JQWA 4ILKA 3T38A 5IH3A 3TLKA 4ZRMA 5IW8A 3URMA 5TB5A 4YMHA 2PEZA 1F48A 1WULS 2JI6A 3QYJA 2VDQB 4O4IB 4UVHA 4EO9A 4KFCA 2OYRA 5JAOA 4EB0A 1OFIA 1WVMA 1U0FA 3DO6A 2RGRA 4OQPA 2IYEA 5IBCA 3ZV5A 3DF7A 1GCOA 1PZNA 4HQNA 5GIPE 1DINA 2O1XA 4MKFA 5K6AC 3BXPA 2WG1A 3I8SA 4DMHA 4EEZA 5KNBH 4ZGGA 4RD1A 3VU0A 2EU8A 4JA2A 1IXYA 1PT6A 2G7MC 3D4PA 3EYWA 2E37A 3JALB 4O2AB 5CD1A 1ZNQO 2HI0A 2P35A 1IATA 2DT8A 2D54A 2CUZA 5AVYA 1OYYA 4ZICA 4QTYA 1Q3KA 2R44A 2PT7A 2G4VA 4TM7A 3KZMA 5H4HA 4J07A 5LQKA 3B36A 1X1RA 1ZCBA 2JZNA 4DM7A 1J49A 5F2OA 1DV1A 1HDEA 4I8IA 3FYCA 4CM9D 1MG0A 4C2TA 1FDSA 1SG0A 1LBSA 4EZIA 4RTOA 1NNSA 2XOKA 4I1RA 2Q6KA 121PA 1S9DA 2JKZA 4RMJA 3TE7A 4PXSA 2FLWA 3DTVD 2Z58A 3MELA 4EHBA 4DEXA 2CNLA 4S1VA 3L7OA 3LY5A 2C0PA 5E1OA 4ZA2A 3VNRA 4XFKA 4S2UA 1JVSA 3GJYA 3WLNA 2J0UA 3OIFA 4OO3A 4OKSA 4RJKA 1TCCA 5E7MA 2W00A 4TKVB 1EP3B 5L7TA 1QGDA 3HDVA 2VIIA 4WOJA 4XA8A 1XNJA 3JZAA 3NRBA 4Z5XA 2OMKA 1V7ZA 2OQRA 1SHZA 3FWYA 4QC2A 4REQA 5HEKA 4MS3A 2ZIEA