3L1IA

Crystal structure of este5, was soaked by cuso4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 103
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1iA00
1YCDA 5HQ3B 3L1HA 2OAEA 2WU3A 4QWWA 4I4CA 3MUNA 3OURA 1VLQA 3FYUB 1H22A 3WL6A 3AUKA 5T4HA 5A71A 1U2EA 4WCVA 1YASA 2I3DA 1CIJA 1R4ZA 2CUTA 1U8EA 4Y2XA 1VJ5A 4ZGBA 1UWCA 3C6YA 1ZOIA 1HKHA 1LZKA 1ORVA 4E46A 3DS8A 2GBIA 2I03A 1GXSA 2RGUA 1PV1A 1JMYA 2WG0A 4UBMA 3ILSA 4X93A 3S8YA 1JFRA 1FFBA 2WIJA 1MO2A 1X2BA 2XMZA 5LZ4A 2VT7A 1QOZA 1C7IA 3WA6A 1J1IA 1ODCA 1MAAA 4F60A 3VISA 1NU8A 2DHEA 1GQSA 4H7DA 1XZCA 5I8PA 3HI4A 3HSSA 3C45A 1Z68A 1N1MA 3YASA 3NOXA 2ZJ6A 1XZIA 5ALDA 2XUGA 4MJ3A 4GDMA 1WHSA 4B83A 1JJIA 5I9IA 1USWA 1WM1A 5EGNA 5AI9A 5AKKA 5AKLA 3HZOA 4JYMA 2VQ6A 1ACLA 1CUXA 3O9VA 3C6ZA 3IUQA 4U2DA 1ZI9A 1LPMA 3UUEA 2ZVDA 4DMCA 2PSDA 5CT4A 2ZSIA 1XKLA 1QIMA 2VAXA 3H0CA 3A6ZA 4UBOA 2FJ0A 2WIDA 3V1LA 5LZ9A 2WJ4A 4CIBA 2R8BA 1D07A 2OGTA 2WHPA 5A7HA 1A8QA 3KSRA 1EI9A 4V2IA 5LKAA 4ZV7A 4Z49A 3FWHA 3MUOA 3OC0A 3WWEA 2WG1A 1LPOA 4TGLA 3JWEA 2HU7A 2C5FA 2BGNA 1WPXA 2AJ8A 2XUHA 1QONA 1BCSA 2XQFA 4RE5A 4IO0A 5K3AA 4M0MA 3D2AA 3V9AA 2ROQA 4Y2UA 3DQZA 2BGRA 2VTVA 2AJLI 4KR0A 1DX4A 4OPMA 1IUOA 4Q1VA 4FNMA 2CB9A 3HABA 4WDRA 4ZREA 4OSEA 3WZMA 3HYSA 3CCCA 3STXA 2JGLA 3QPCA 1K63A 1IZ8A 1P0QA 2C0QA 3WWPA 4DMKA 1RYYA 3MVEA 4DGQA 1MTZA 1W4LA 2VF2A 1R88A 4Y7DA 5FOQA 4B80A 1QIKA 3DOHA 2WQZA 1YR2A 4UFPA 3H1BA 5AOAA 2YYSA 4JH0A 1JU3A 3RLIA 3WI7A 4WY5A 4GWLA 4AZ3A 2DHCA 5IVDA 3H2GA 3ANSA 3BIWA 4B9AA 5JIBA 2CKMA 3A2LA 3G9ZA 3TEJA 2DQZA 2G4LA 4J0KA 1ETHA 4BCBA 5DYYA 1CUBA 1VZ2A 3OPMA 3RARA 6YASA 7YASA 5C8VA 1EB9A 1U65A 1XRLA 1CUZA 1CR6A 2OQIA 1QE3A 4H7KA 1G5FA 3ESDA 2FJPA 1R50A 2QJRA 5AM5A 2WJ6A 1F0PA 4EB0A 4AMZA 3PUIA 4I3FA 5ALUA 5ALKA 4KRYA 3WWDA 3O4HA 3GROA 4P93A 1VA4A 2D0DA 3E1GA 3R3YA 4YPVA 3FSGD 3DCNA 3B5EA 4E15A 1LGYA 5AK3A 4ETWA 2JEZA 4X90A 1G66A 5JAHA 3I6ZA 2WHQA 2O7RA 5HFNA 3I2JA 2CJPA 4HVTA 5FXMA 3WKBA 4MQLA 1PJAA 1AUOA 5ALNA 1BS9A 5E4YA 4GW3A 1BEZA 1DINA 5CW2A 1GPKA 1CUIA 1CUJA 2GBCA 1EXWA 2R11A 1XKTA 2H7CA 5AM2A 3ZV7A 1QGED 1DT5A 2VATA 3K2IA 3HC7A 3LS2A 1A88A 3ANTA 3U0VA 2WUGA 1THTA 2RAUA 2ORYA 5A7GA 1ZGCA 5ALVA 5BWBA 2OAGA 4K6GA 2B4KA 2VJBA 3DOIA 4J0DA 1DQZA 2WTMA 3UMJA 5CH8A 2Z8XA 3NUZA 1N5MA 2XMGA 1C4XA 2J4FA 1P0MA 5HK8A 4C4XA 4UHBA 1UT6A 3SC2A 3ICVA 5K3DA 3A70A 5JD4A 2BKLA 1KU6A 3FYUA 3WWOA 1QIJA 1QZ3A 1XQVA 4IH1A 1QTIA 1AGYA 4GECA 1CEXA 1XRRA 4W1RA 3PUHA 5CT8A 2UZ0A 5JARA 4B9EA 4LXHA 4X94A 3ZPXA 2JGIA 1WB5A 1CUHA 1LBTA 4UFNA 3AJAA 3I1YA 3JW8A 2WILA 3N2ZB 4PO3X 1VE6A 3EBLA 5ALQA 3VXKA 5JANA 4ZI5A 4WJLA 2ZSHA 5ALLA 1CQWA 4Q3KA 3O4GA 1FSSA 2WLSA 3C5WP 4RNCA 4BAGA 1LBSA 3BL8A 5AKEA 3QH4A 4MWTA 1MX5A 4WDQA 3G0CA 3I2FA 1MJ5A 3FNBA 2WFLA 1H2XA 1G42A 5HK9A 4AN0A 1XZHA 4NMWA 1AMNA 4JNCA 1XQYA 3H04A 3Q0TA 3BDIA 3KXPA 4KEAA 1XRMA 3D4LA 4JUIA 2PVSA 1UOQA 3G0DA 1DWPA 1L7QA 5AM0A 1OCEA 5LIPA 4KE8A 4UBJA 5EIHA 2PSEA 3IA2A 2XUKA 3AZQA 3DNMA 1MNAA 1UK6A 1YB7A 4U2CA 1K4YA 1XZDA 2OXEA 3WL7A 3G0IA 2RI6A 1QTRA 2VEOA 1UZAA 2PBLA 4QLOA 3EIOA 2XMSA 1AC5A 4W1PA 3D5EA 1F8UA 3W9UA 4WFKA 1A8UA 1HDEA 2GBFA 4YASA 1YA4A 2WSLA 3FLEA 2ACEA 4QEKA 2DFPA 1EDEA 2HFJA 4PSDA 5JAUA 3AIMA 1DTEA 3D2CA 3DL7A 1E5TA 5C81A 2WKWA 3STWA 4OYYA 5AIAA 4OYLA 3ZWQA 4BBZA 4OU5A 1DQYA 3W2TA 1XZJA 2JGMA 2B20A 4KAFA 2QM0A 5IVIA 3PICA 4TVKA 1R9NA 3PI6A 1QO9A 3G8YA 5CH3A 5BOVA 3G9TA 4EY7A 1LPPA 1R3DA 4F21A 1YS1X 2EEPA 3QPAA 4KE7A 4WY8A 3FSGA 5JZSA 1QFMA 2OGZA 5HF9A 4K5QA 3ZLTA 3VJLA 5ALEA 4FFVA 4ITVA 4OU4A 3H2KA 3KOOA 4EY5A 4W1SA 4ZXFA 2ZYIA 4K2AA 2XUDA 4AQDA 4PQEA 4W1QA 4UHHA 1XLVA 2Y2UA 1IUNA 3OG9A 3W9BA 1IMJA 2CZQA 3I28A 1E3QA 4DSAA 5A62A 4MQMA 3WJ1A 5ALFA 2XUAA 2PU7A 4G8CA 5DNUA 3HACA 3H19A 3I2HA 3D0KA 1XZFA 5AKGA 4CCYA 3S2ZA 1VA5A 5JAOA 5ALJA 4H7HA 4X91A 1JMKC 4X7BA 3FBWA 1XRPA 3IVMA 2J4CA 3D3NA 2JGKA 1PFQA 4BATA 4QDTA 5IVHA 4PNZA 1O6GA 3CN9A 3M81A 1HLGA 1MT3A 1CUSA 3AZOA 4RE6A 5LP1A 3HEAA 5I7UA 3R3UA 5AKZA 1YS2X 3WKDA 4B0PA 4LYEA 2RIPA 4X6YA 4WFJA 1Q0ZA 1ZD3A 5EHZA 1CUVA 1LPAB 3N0TA 1K8QA 2GZSA 5JYCA 2HADA 3O4JA 4OB8A 3QYJA 3PF8A 2WFMA 4I19A 1EHYA 2XQIA 4W9RA 5EFZA 3AFIA 4C89A 3R40A 5AK4A 1HL7A 1CUDA 2HL6A 3STUA 3CXUA 5CBKA 1H2WA 2AXEA 3DYVA 2DR0A 3GFFA 1QO7A 5JD6A 2VSQA 2WHRA 3IULA 3IUMA 5AJHA 3WK6A 3WWCA 3F9CA 1UFOA 3WK8A 4Y2YA 4BTLA 1GQRA 4BVKA 3R41A 4H7FA 4H0CA 1UK9A 4Y2SA 3G9UA 5EHQA 1Y7IA 1Q0RA 2XUIA 1FJ2A 4BZWA 5AICA 4AZ0A 1SC9A 1TK3A 2GBGA 4EZIA 3DD5A 5IH7A 2Z3ZA 5CURA 2WFLB 1WPRA 4X3CA 5JADA 4DNPA 1ISPA 1AKNA 4FLMA 4E14A 3FLAA 4MEBA 1LPBB 2BAGA 4DM7A 1KU0A 1E8DA 5IVKA 1VXRA 4LXGA 3I6YA 5EHNA 3FYTA 4DYHA 2LIPA 4DMHA 1EDBA 3DJYA 4AO8A 4UBLA 4QDUA 4G4IA 1JT2A 3ICWA 3KDAA 4XVCA 1TAHA 2XI4A 2JGFA 4GXNA 2PL5A 1TCBA 4NZZA 3RKSA 3BJRA 3GZJA 5FRDA 5CXUA 4M0FA 4DTCA 4BVLA 2HU5A 5ALTA 1P0PA 1LPNA 4X97A 1B6GA 5D3ZA 3X3HA 1JU4A 4PV7A 2WIGA 1QFSA 4CFSA 2CEKA 1EA5A 3A2MA 1XRQA 2P8SA 5AKHA 1EDDA 1T4MA 2OPHA 1OXMA 5ALGA 4KJXA 4J3JA 3WL5A 3C70A 5K3CA 4A23A 2HA3A 4BAUA 1XZMA 1L7RA 1UKBA 1K6EA 4A16A 3E3AA 4IHAA 3FCYA 2ES4A 2XUQA 3WLAA 3WIOA 4BTVA 3KWJA 3F98A 2QOEA 2HIHA 1ODTC 2HU8A 5KREA 2HA0A 3GBSA 5D7BA 4U2GA 1XZKA 1QIEA 5SYMA 3C8HA 1DT3A 2XLBA 4UHFA 3QMMA 5LYYA 1JJBA 1QLWA 2DQYA 3SX4A 4GBGA 2WIFA 4CG1A 3A2NA 4QLAA 5JD5A 4Y2JA 1R9MA 1J06A 2XQGA 1W1IA 3H1AA 4EY8A 1EK2A 3ESCA 4HXEB 4CIAA 3I1IA 4G9EA 4B81A 4HTAA 1VXOA 4BYMA 4C4ZA 3WYDA 2YXPX 4U2BA 4AMYA 5SYNA 1AX9A 5FDFA 5CT5A 4K6HA 1WOMA 3BDVA 4BRSA 3IB3A 1E8NA 4P92A 5DYTA 2C7BA 2XQJA 3EQ7A 2JGJA 5ALHA 4BC1A 1LZLA 4OUKX 5F4ZA 4AO7A 1J07A 4JEIA 2X8BA 5AO9A 3RM3A 4BB0A 5HF6A 3G02A 2BUAA 4L72A 5HKBA 3P2MA 4IH4A 5HF8A 1MX9A 1BCRA 5IKXA 2C5GA 3E0XA 4C4YA 3FVTA 5FKJA 2QJWA 1FFEA 2ZJ7A 4N8EA 4KACA 5DTIA 1UK8A 3JYHA 2V9ZA 3STTA 1U4NA 1QIIA 5BV7A 3IDAA 3LIPA 1FFCA 1K5PA 1P0IA 2O7VA 5EIAA 2RONA 3R3VA 3K9BA 5FV4A 2JF0A 2Y6VA 4QDXA 3VJKA 1EINA 4KAAA 4N5IX 1TKRA 2RHTA 3IURA 1XQWA 3D7RA 4FLEA 1KEZA 4FDMA 1CUYA 3WK9A 2QT9A 3I2IA 2I3ZA 1BU8A 4J03A 3UUFA 2GYWA 5HZGA 2XMCA 5CRIA 4F0JA 2XMRA 3FYUC 4B6GA 2QTBA 3W06A 4E11A 3AIKA 1GKLA 2WJ3A 1RP1A 4OB6A 3ED1A 5YASA 5ALZA 2QKYA 3GELA 5T4FA 4BE4A 5BWCA 5HQ3A 1WHTA 3IUJA 4CCWA 4W63A 1EVQA 3ESBA 1UOPA 3D2BA 4CCYB 2XT0A 3W05A 1LPSA 5A2GA 3R3ZA 2QMQA 4UUQA 4PSCA 1VOTA 2CMFA 5AH0A 1XZEA 4P08A 2EDCA 3C87A 4Y2TA 2AJBA 4BVJA 4X85A 2G5PA 3G7NA 3O95A 3I2KA 2OQVA 1H2YA 4B84A 5A6VA 5CH5A 4G8BA 4XX1A 4KE6A 4IH9A 3G9XA 3LLCA 4FWBA 5K5EA 2Z8ZA 1VE7A 2BJHA 1NX9A 4FFWA 3C6BA 1GPLA 4A5SA 3L1IA 3R3XA 3NGMA 5JALA 1W52X 3AILA 2GYUA 5CMLA 3L1JA 1SCIA 4QZVA 5EHXA 1SCKA 2XQKA 2BCEA 5DNWA 5FP0A 4L9AA 2JBWA 5KBYA 2HA5A 5AP9A 1EX9A 4GI1A 5FPQA 4H7EA 1GZ7A 4QDOA 2VT6A 4BE9A 3VDXA 4H7JA 1ZD5A 1MNQA 1ZICA 3BF7A 5J3JA 4X6UA 4Q05A 1CV2A 1WCYA 1YSCA 3STVA 1ODSA 2QXUA 3FVRA 2O2GA 4FTWA 5FUMA 3WKCA 4B85A 4INZA 1RWQA 1TRHA 1JJFA 3DL4A 2HA2A 1ZIYA 2H7YA 1F0NA 2YASA 2QR5A 3I6MA 3IUNA 4X71A 4HS9A 4J0GA 5EI5A 2QZPA 3WMRA 3D59A 4QA9A 4HXGA 3WA7A 1WB6A 4H77A 3WKEA 5AM1A 2IIVA 3QM1A 2I78A 3PE6A 2PUJA 4L3WA 1VKHA 3M83A 2XMQA 4BDTA 4PW0A 5AOCA 4BCDA 2B9VA 1SOMA 4S0XA 1XQXA 2XE4A 4FLFA 2ZJFA 4QDZA 5EIEA 4MYSA 1IVYA 1YAHA 1VZ3A 2XLCA 2PSJA 1GGVA 2DHDA 4HAIA 4DNQA 3M82A 4MXDA 1XZGA 2V98A 2HRRA 2XUPA 5DJ5A 4CG2A 1ZJ4A 5ALWA 3OM8A 3BF8A 4P9NA 4N8SA 2X76A 3FLBA 5A7FA 2QUBA 4HXFB 4O08A 2FX5A 1LLFA 1ORWA 2J3QA 3C6XA 3Q8WA 4BC0A 5DWDA 4BCCA 4AO6A 1TCCA 2HA4A 2PKYX 1CUCA 5HFAA 4EA6A 1BN6A 3C43A 5LKRA 4QE3A 1A8SA 2JEYA 2GZRA 3KD2A 5AM4A 1CUAA 5K3EA 3W04A 1TCAA 4YX9A 1XZBA 4G8DA 2RHWA 3QMVA 4M0EA 1F6WA 1FFDA 3VVLA 4AN1A 2FUKA 5DNVA 2H1IA 3R3WA 3AINA 4ARAA 1UXOA 2PX6A 3TJMA 3KWFA 2WG2A 1SFRA 4FNGA 1DU4A 1M33A 4YK7A 4DNFA 1XZAA 5AI5A 3EF3A 2XDWA 2PSHA 4RGYA 5AKIA 3FCXA 2QUAA 1GPNA 1LNSA 3T4UA 1E8MA 3B3QA 4DNOA 4FHZA 5E4TA 1EVEA 1I6WA 4N8DA 5AKJA 1MAHA 1TIBA 2ONCA 2QVBA 5DTJA 1R1DA 2VA9A 1CUUA 1QIFA 2O2IA 1CQZA 1ACJA 4JYPA 3SK0A 5AI6A 4UFOA 4UHDA 4PSUA 3QPDA 4UHCA 3AZPA 1E89A 3K6KA 2V96A 2YH2A 5LZ5A 4XIIA 2Y1KA 3ZI7A 3F97A 1QIHA 3TGLA 5E2IA 4EUSA 3B12A 1BN7A 1ZJ5A 1DWQA 1O6FA 4BP9A 2CBGA 1MPXA 1SCQA 2ZYSA 4Y9SA 1BRTA 1CVLA 4F5ZA 5FLKA 1IZ7A 2XUFA 4BRZA 3WL8A 5JASA 2HDWA 3V1KA 2E3JA 4MWSA 3ESAA 2VJCA 3PFBA 5FPPA 4C88A 3OTQA 1XROA 4BZZA 3GUUA 3O0DA 4J0CA 4KAJA 2PUHA 2VJAA 2EDAA 3VKFA 1EB8A 2ACKA 1YB6A 5LLSA 3F96A 3QVMA 4FBLA 4U2FA 5C8ZA 4BDSA 1WB4A 2WHPB 2ZYRA 4G4GA 3O4IA 4G9GA 2GYVA 4ZV9A 3WK7A 1MN6A 2BUBA 4LHEA 5DLPA 3WQHA 4GLBA 1ZGBA 2QXTA 2XUJA 5LZ7A 4J7AA 5JZ9A 1BE0A 1J2EA 2G63A 4KYVA 4MYDA 2J3DA 4X92A 4ZWNA 5JATA 4ROTA 3EQ8A 3HLKA 5T4BA 3V1NA 4C01A 4RPCA 2PPLA 2IX9A 2VJDA 2AJDA 1G4HA 2OLEA 5AKXA 2Y2VA 5KWIA 4UBIA 4IQ4A 4Y2PA 5E4JA 2XB6A 2WUDA 1HPLA 1GKKA 1QIDA 4CG3A 1DX6A 1XLUA 1ZD2P 2Z3WA 4UHEA 5D6OA 4G4JA 4B7ZA 4WFIA 3WYNA 4LYDA 2WUEA 5LZ8A 5ALMA 3DEAA 4AX4A 1UKAA 1CLEA 1Y7HA 4J0IA 1BROA 5AIBA 2WFZA 2Q0XA 5D3KA 1ZIXA 1CPYA 3BXPA 3V1MA 4AB1A 4NS4A 1ZD4A 5CT9A 3TRDA 1T2NA 3DLTA 4BAZA 1W76A 2DSNA 2AJCA 3QZUA 4PF1A 3DKRA 1B41A 4XWGA 1CUFA 1DWOA 2XUOA 2HM7A 1XZLA 5ALIA 5K3FB 3ZLVA 2Y6UA 4XJVA 1BEEA 3MGAA 2OCLA 4FBMA 4GEGA 4Q34A 3QMWA 4OCZA 4DSZA 4C6HA 4HRXA 4KE9A 5HKAA 5CTAA 4EHBA 1AZWA 1CUEA 2G5TA 4H7IA 3CCBA 4UPDA 1FFAA 3R0VA 3QITA 1EK1A 2C0PA 4HRYA 4LKOA 4BP8A 2W6CX 3WK4A 2HA7A 4GHWA 1HQDA 3WKAA 4KRXA 2X5XA 2XMDA 4HZGA 1N5RA 2PU5A 1ZI6A 2K2QB 5AI4A 1YA8A 2W22A 1CRLA 2ECFA 4QNNA 4QWMA 3BIXA 4G5XA 4Q82A 5T4EA 2QS9A 3G0BA 3VVMA 1TQHA 1HBJA 3ZLUA 4MEAA 2OG1A 2PM8A 1MU0A 1CUGA 1QJ4A 4EY6A 2D5LA 2WTNA 2NW6A 4UBNA 5DYWA 2DCMA 1IUPA 2JGEA 2BFNA 2V97A 4Q3OA 1ZI8A 1UK7A 2WIKA 4Y2QA 3BWXA 4C87A 2OCIA 3H18A 3PFCA 5AK5A 3FOBA 4B0OA 1H2ZA 3FAKA 5HF5A 4UBKA 4J0JA 4OD0A 4TPKA 3U1TA 3GA7A 5K3BA 4Q3LA 1JI3A 1CUWA 5JZBA 5AOBA 1X2EA 3DDUA 3H2IA 4NVRA 4B82A 4AXBA 1XLWA 3AIOA 1UOOA 4Y2VA 4FOLA 5KWJA 3LIIA 4U2EA 3WK5A 1UKCA 4G1FA 1A7UA 1JKMA 1W75A 2OCKA 2WU4A 3BE8A 2QRUA 2BUCA 4D9JA 3C8DA 1N8SA 3WZLA 3OOSA 4H35A 1THGA 1YAJA 3VJMA 3DKKA 2O2HA 3QBJA 4ARBA 4DLNA 1AQLA 1XFDA 3V48A 1Y37A 1Q84A 5AK6A 1XRNA 3T52A 2HRQA 1GT6A 2B61A 5HCUA 2OCGA 1QIGA 4X6XA 1MX1A 4EBBA 4N5HX 3WIBA 1NU6A 4OB7A 3M3DA 3WJ2A 3DYIA 3H17A 3F8SA 3O9MA 2PSFA 4FMPA 5ISMA 2XMBA 3EQ9A 3SWWA 2VAVA 5CXXA 1W6RA 4J0HA 2HA6A 3I2GA 5AKYA 3H2JA 5CT6A 3CN7A 4L0CA 4DMFA 3E4DA 3PF9A 4EY4A 4CI9A 3HXKA 2H7XA 5ALYA 2ZYHA 1OILA 3HJUA 1EH5A 5ALOA 5JAPA 3C5VA 4LIPD 3IIIA 4LXIA 2IITA 1X70A 3BJMA 4DIUA 2WM2A 5AM3A 5LZ2A 3IBTA 1S8OA 3NWOA 5C7YA 1CFJA 2C58A 2Z5GA 1L7AA 1E66A 2HFKA 4H18A 5ALPA 5ALXA 1H23A 3RK4A 5H3HA 2OGSA 4K6KA 3F67A 1C7JA 4X00A 5C8XA 3G0GA 3H2HA 3STYA 4X95A 3HRHA 1AURA 2WUFA 4FKBA 2C4HA 2HHAA 3PDCA 2JIDA 5ALRA 5K3FA 5ALSA 2H9YA 5AI0A 5AHXA 4Y2RA 4ZRDA 5ESRA 3LP5A 5AI8A 1Q83A 3LCRA
chains in the Genus database with same CATH superfamily
1YCDA 2FN4A 2YFKA 1IUKA 1AS0A 4MR8B 4UXIA 2QTGA 2O3TA 2L69A 3PR1A 3VBCA 5I7FA 2O5EA 1CJSA 1EVIA 3ROPA 4KRFA 1U11A 3KSBC 1WUHS 1J33A 3EGCA 3MUNA 3ZBQA 3PNQA 1B16A 1VLQA 2R751 1YOBA 2FX3A 3NALA 4JUCA 4KTVE 2XCIA 2W2PA 4ONEA 4P3XA 4RIIA 4RBNA 4X1KB 5KKAA 3ADKA 1MUUA 1Z4KA 5KNCD 2YVQA 4MS1B 4OHFA 4QVKA 3CZMA 4KOAA 1LBEA 4MS4A 4O6VA 3S99A 1EXNA 2JH3A 2QQ0A 1X7WA 4B76A 2FLVA 4XLZA 1E1RD 1IEQA 2O1EA 3B8EA 3AR6A 3MOSA 3A1DA 5CXSA 5D1NA 3TXXA 3V4ZA 4A2PA 4ZTUB 5KJEA 2C83A 2HUNA 2XGOA 2CFOA 3PSAA 4MUXA 4Q6BA 4B6QA 1EXMA 1LEHA 2VWHA 4IGAA 3ZX5A 5KNDH 4R2WA 3VQTA 3MUFA 1KEUA 2P9GA 1XF1A 3UMBA 2YHUA 1WMAA 4OFXA 3BHIA 1Q74A 5E9AA 4QOGA 2R8XA 4I6EA 4ZGBA 1OGJA 2O8FB 1NW6A 2EEZA 3C6YA 4Z4EA 4YHBA 3C74A 1LZKA 2IP1A 2G8NA 4D43A 3BRWA 3QE2A 2O54A 3AF4A 1ZIDA 4N3BA 1JG3A 5JSKA 3EYAA 1K6MA 3ZGOA 5BQ3A 1KJJA 1N2SA 2NYRA 1AKUA 2IYOA 2WLTA 2X4GA 1KH1A 4DQKA 1NC3A 3G89A 4GI5A 3R4VA 4KK4A 5C34B 3K9FC 4YAIA 1RRCA 1T35A 2HHJA 2XTJA 3FPAA 1GU0A 4WEQA 4QPDA 3UK6A 2RGUA 3ZHUA 3NHJA 3CJTA 1RQ7A 2XNDA 1CDDA 4D81A 2ZRDA 2H00A 1G7RA 3AF6A 1SN7A 3Q7SA 1YACA 3SPXA 3WICA 3OI7A 1HQCA 2DY1A 1SR8A 3L6EA 3OKPA 5BY2A 3OPNA 4BWVA 3CPHA 3UJBA 3PK0A 4DRZA 3K05A 4G8JA 1FFSA 5CCDA 5EHGA 2AZTA 4HDSA 3GW8A 4BXOA 2WIJA 5G1PA 3H9CA 4V1CB 1HNNA 1YOVA 3TOZA 4Q16A 3PENA 3UHFA 3VUFA 1GFIA 5CVDA 3UMRA 3FPLA 2BGKA 3NKLA 1SD5A 4J1TC 3L8GA 2I3BA 1FDVA 1WVMA 2H18A 2VT7A 4MEJA 2PN1A 3F7MA 1OZGA 3JWPA 2ZTMA 1A5BB 1J1IA 4RQTA 3UXMA 3WA6A 1MAAA 4DC0A 5JCJA 3VISA 3RF7A 3AYXB 2ZQ5A 3L4EA 2B4YA 3LUBA 4F4FA 1DJOA 2OM2A 2TMGA 1TJPB 1XZCA 4IOLA 1C81A 2YHIA 2CLKB 3X44A 4K05A 2HMTA 5HUJA 4LDJA 1QXSA 2WWFA 2BTQA 3PC2A 4DCNA 1JLSA 1U3FA 1FRQA 3SF0A 2P9JA 3C7KA 1G8SA 1FTWA 2VFAA 1LS1A 2ODAA 3YASA 1SUIA 2Q3MA 3NNDA 4G56A 2ZJ6A 1RPZA 1XZIA 3D43A 4EHLA 3IT2A 2R9VA 4H1VA 2W8BA 1EFHA 3VYWA 1U0FA 4BFUA 3IDSA 1DXOA 5TNXA 1PBTA 3IKVA 4NL4H 1WHSA 3BE6A 1EK6A 3VA7A 5AJYA 2IEIA 1RPAA 2M1XA 4L4RA 4R31A 4RGVA 3TOSA 4B83A 4ZZ3A 3AU8A 4YUWA 4JA2A 4FFMA 2DLCX 1FZQA 5EP2A 1YFJA 2QTZA 5E3IA 4DS3A 1DB3A 2R7AA 2IBMA 5DNCA 1AZLA 3RRJA 4CDNA 1KR5A 5LQSA 1XOIA 3M4NA 4JCCA 1YXMA 3HZOA 1IOZA 4TZKA 2BFFA 2BR5A 4JYMA 3WC4A 721PA 1KYXA 2CVQA 2VNAA 3IVCA 4BE7B 4YRFA 4XVHA 4OEHA 1BKDR 3C6ZA 1ADYA 3E18A 1OF1A 3PHGA 1WSAA 2ZR9A 3FSRA 4HDMB 2HF2A 3GAFA 3KQLA 1EXDA 3HJFA 3WRYA 1ZI9A 5K8TA 5ECDA 2W6OA 1YS7A 1LPMA 4ZYUA 3I4LA 3UUEA 3CR7A 3A31A 3A6EA 2ZRIA 4IW3B 4DMCA 1I24A 4B1FA 2PSDA 2QLLA 4LMPA 4RD0A 3LUGA 5CT4A 1CRZA 5FA8A 4I66A 2Y3IA 2RI1A 1V9CA 5CIYA 1U0JA 2QE7D 2WKPA 3PDIA 4R1OA 3I9V1 1QRUA 2WIDA 3L9WA 2RGNA 3ZHSA 6LDHA 1XPJA 3V1LA 2H17A 4MCHA 3W8EA 2X3YA 5ULLA 3ZX4A 1L4BA 4B87A 4DLSA 3G2IA 4EKIA 13PKA 4ID3A 3SVTA 3TLKA 4PCLA 1DEKA 1PR1A 1A8QA 4ZAVA 4QFDA 1QYCA 5JSFA 4Z1MD 1FPQA 4NABA 4ZV7A 4OATA 1DNPA 2WM3A 2QUIA 1N2ZA 3P7MA 3A0UA 2SNIE 5IBPA 4GMFA 1TIKA 1DKNA 1UXJA 2CJXA 4IZIA 4Z9FA 3OC0A 5GVRA 5B2ZA 3U3DA 5C4MA 1CJMA 1E6MA 3DE5X 1LPOA 4YS6A 1EE9A 2ODBA 4R0NA 2RGEA 1NQTA 2YWCA 4JLSA 1NZJA 3ZW7A 2Q9CA 5DBFA 3UBTA 4C7BA 1K66A 4HDKB 1JDNA 2C03A 1SCUB 1X8LA 5FPKA 2FSVA 3EGWA 1II0A 1NTOA 1E7QA 4UATA 2NWQA 1H2BA 3CE6A 3FVQA 5AK0A 1QH8A 2B82A 2VJYA 4NCKA 4BEBA 1U1FA 2YW9A 1KAGA 3KOWA 4U00A 4Q7LA 4BMSA 1BCSA 4NQRA 3ROXA 1KS2A 4RE5A 5EIFA 1E6LA 2OVFA 3R23A 4IO0A 5JQGF 3JX9A 1WXGA 4G0OA 4RY9A 1Y42X 3ENZA 1M6EX 5KOHA 4C4SA 3RS3A 3B1YA 3EVGA 1A9YA 1KDTA 2CDBA 4NONA 5DHAA 5FWDA 2YN2A 1HM5A 3DQZA 3KFXA 4QTXA 4WLOA 1KE2A 4F9TA 4KMSA 4BKOA 3AU9A 1ZBDA 4NBSA 5DLQC 1G2QA 3GCWA 5CNJA 3WLQA 1T8YA 2O4CA 3KHKA 1SVNA 1EMDA 4WJKB 4MZDA 2YXNA 2F1RA 4W7HA 2UVPA 2R6FA 2CEAA 3K9GA 2HY7A 4P58A 3IERA 1L4UA 1Z7GA 4FXOA 3OWXA 3O8DA 4YWHA 3RSQA 4OPMA 4CQLA 4OGLA 3O1LA 4JLBA 1L7VC 1M1YE 2Y93A 1GITA 4D44A 1E9DA 3GNQA 2FG6C 3EXHB 2QG6A 3HYSA 5K4GA 4EIWA 4QBFA 3HVKA 2P4QA 1Z2DA 2Y9PB 3H6GA 2CW5A 5TS2A 1AU9A 1VL0A 2P9YA 3WGIA 1MOSA 5FAKA 3N2EA 5CA1F 4A15A 4KGDA 4FX5A 2YHBA 3KCNA 3NBAA 4L22A 4TROA 4YYEA 4DMKA 5DTRA 1YZHA 2GEVA 3P20A 3E5MA 2Q5JA 3EZ7A 3F6SA 1MTZA 4FINA 3AHJA 2KLHA 5EC8A 4E5KA 4CTKA 5DN9A 5C52B 4GKVA 3LHIA 1KDPA 4NLLA 3V2HA 4OYRA 3RTEA 1JBQA 3UJDA 4AZVA 1T15A 2AW3A 1DXHA 4LFCB 1NE7A 3S0JA 2AIRA 4MMZB 1QIKA 2YTZA 4WKPA 1G20B 2JFHA 1I7QB 1Z0ZA 3VPBA 1IRIA 1OD6A 3H1BA 4V0RA 3EXEB 5FJJA 4HNSA 1TOAA 4JLMA 1C9NA 2YYSA 1I4OA 1PL8A 1IY8A 2Z9CA 3PIDA 2OO3A 3SFTA 2P91A 4AS2A 4BJ6A 2GWRA 5IK2A 4CEIA 3CKLA 5DYNA 2FK7A 1NPYA 1CNFA 3GEPA 1RYMA 3MF4A 4LHWA 3WI7A 5CB6A 3INRA 2IPXA 3O8QA 1FRZA 3TLBA 4WY5A 4XEHA 1GGJA 4FP9A 4BIIA 4XUCA 5HKKD 4X20B 4F2HA 4FYIA 1REQA 2ZJ5A 1XN1A 2R79A 4UEQA 2J5KA 5KYWA 1OBVA 4EVQA 5ANRB 4AZ3A 1AMOA 1SBZA 3P9ZA 2O5CA 1C9JA 1E2FA 2KLBA 3IDZA 3M6WA 4XASA 4RVSA 4ALIA 4EB6A 3TIFA 2VDPB 9ABPA 1HYEA 4P7FA 5LLTA 1T9BA 2HHCA 4WKCA 3M6LA 4PYOA 4DSUA 2X40A 3A11A 4O1MA 3TEJA 4YQFA 1GWNA 1XAGA 2DQZA 4J0KA 1ETHA 2Q2WA 1M54A 1Q7BA 2R8YA 1VZ2A 5DYYA 1K7EB 3RARA 2HRZA 4EUHA 1SELA 4KFRA 3SJBA 2ZBQA 4KLAA 2WYVA 3CA8A 2NU7A 4HVCA 1QE3A 2FN8A 4IXDA 2FOLA 2Y1EA 5LB4A 3W1VA 4ZHQA 3ZBUA 2FJPA 5AM5A 4Z3DA 1ZR4A 2WJ6A 1F0PA 1ZH4A 1K6XA 9LDBA 1ZM4A 3E9YA 3MWGA 3LPNA 2C7VA 1AQJA 3CURA 1J00A 1QVWA 4K9NA 1T3LA 5EKDA 5ALUA 2E6KA 3VU0A 4U9IS 1GV1A 5K2MA 3O4HA 1XNRB 5EN4A 2E89A 2W6JD 4F5YA 1VA4A 3MERA 10MHA 1JHRA 2FWJA 3R3YA 2EQ5A 3FSGD 3IEPA 4NX2A 1RQLA 1M76A 4MP6A 4E15A 1LGYA 4ETWA 3DZKA 1UJ4A 4EM6A 4P0QB 4X90A 7REQB 4DG8A 1JXAA 2FMUA 3TZHA 4MWBA 4XYGA 2WSYB 1A5TA 2GERA 4DLKA 4LJYA 3D6MA 2R44A 2VZEA 3EXIA 1VJCA 5L3QB 2PAAA 5ICFA 4CL2A 1MHTA 4ZAYA 2OXRA 4AP5A 4CLOB 2C9BA 3CV3A 1H4SA 1C2YA 2H1FA 4UM7A 1Z5PA 3HFJA 1ZM3A 3OKCA 4PLCA 5A0FA 3WKBA 1KGSA 3LHDA 2BI8A 2ZUDA 2ZBGA 3CX6A 3P2OA 3QHAA 2YX1A 3R0JA 4REQB 4TRMA 1FNSA 3ZJ4A 4FMBB 2QM3A 2IS1A 2J9FA 1G5HA 1GTVA 4CKBB 4CF5A 3R7NA 3W8DA 4CETA 1RS0A 2YFQA 3AFNA 4WCFA 1NV9A 3ROZA 2AMLA 4G97A 4PONA 2JFWA 3F1KA 3ZDZB 4F6LA 1JNXX 2QRGA 3D1VA 3L7KA 2AXPA 4KLZA 5GONB 5GJVC 5KWEA 3Q15C 1PFVA 1M1NA 3SJ7A 1SXHA 1B0ZA 1DBWA 4HGQA 1UL1X 3FMVA 4P4SA 3DFUA 2I5PO 2OO5A 5D86A 2H7CA 1KFKB 1WCIA 4ZOAA 4NBVA 1TRKA 3KWMA 2OBLA 2Q9BA 4AZ0B 2ISQA 4UKDA 1DT5A 1RCFA 2AMJA 3K2IA 3EXHA 4WLEA 2OY0A 3SQOA 2VXOA 2QR3A 2VT3A 1U3VA 1NNLA 1IU9A 4LY0A 4W6QA 3TNFA 1A88A 4B47A 1QP8A 4EL5A 3REOA 5LD2C 2XH8A 2OZKA 2WAXA 5CHEA 2BZ1A 4L4ZA 4B3SB 1U7HA 3KYCA 4ZEVA 1UBOS 1THTA 3RIXA 4BNDB 3ZKWB 3WY9A 2JJQA 2JHGA 4IFBA 4M0UA 4MI6A 2QPLA 2OAGA 1VL2A 2WWYA 2B21A 4MR7B 1VL8A 1AUXA 2WTMA 4MITA 4M9CA 4QOHA 4O4HA 2UVDA 1LK7A 1RYBA 1XIVA 2ENWA 2O0MA 3FHCB 2GPNA 3GDHA 2ZSEA 1F6BA 3I0NA 3NUZA 1PGQA 4G5YA 3N8GA 4OOEA 1LI4A 1RQRA 2VO1A 5KVQA 4U7JA 3WJ7A 4ZHQF 4IDNA 1YU6A 2Z6AA 1M8PA 5FCDA 1H2AS 4FOTA 1SKBA 3SC2A 4CFZA 2PHZA 2F3TA 5K3DA 5ELLA 5BSMA 3GEGA 1XI2A 2FTKE 2JIOA 3QE3A 5AUNB 2V5UA 3EZFA 4FGJA 1KU6A 1TZKA 4GL2A 2L17A 1Y9JA 2GTIA 1ZQ9A 3O94A 1P4SA 4X1KA 1FDWA 1N2CA 3BE4A 3AB7A 1T29A 3ZNNA 5EYPA 4MS4B 3DE1X 4PO1A 3MCUA 4UW9A 4A73A 2N1BA 3I32A 3N3AC 1QNFA 5F33A 3QVJA 5BWNA 1XQVA 2BCGY 3VR3A 1LCIA 2NU8B 4BFXA 1XDDA 2K2WA 2NP6A 1QTIA 4R8RA 4ESOA 3T1HB 1I7DA 5H3LA 5C3MA 5FUWA 2MDTA 3Q8MA 4CU2A 4OFBA 1X1EA 1CE8A 1V45E 3PUHA 1NF2A 3PXXA 3W3AA 3FOFC 1O97C 5FBQB 2UZ0A 3BVPA 4I2NA 2FRVA 3BXFA 5JARA 3KUCA 1NN5A 4WXHA 2Q7OE 1OE0A 4X94A 4EYGA 4RAOA 4O4IB 1YRAA 2JGIA 4RESA 1MVLA 2QU8A 3ZCUA 3ETDA 1FP7A 2OFWA 3CNEA 3EPKA 4LDRA 1U2TA 3WGLA 3NUGA 3W5UA 3ER8A 4LTNA 3VI3B 4UFNA 1PX2A 4IWXA 3AJAA 1TNDA 5KYVA 4AX8A 5HX7A 3D6JA 3JW8A 2P5YA 1JAHA 3N2ZB 4L6CA 3M5WA 4XPIA 5BP7A 5JZMA 1NLZA 1PG0A 2LIVA 4Q3BA 3F6EX 1JFFA 4XCXA 1TMKA 1E3DA 5ALQA 3J7AC 5DCUA 3LT0A 2W0SA 5IHPA 1F4VA 1KFJB 2JIZA 3FR7A 2ECKA 4FCTA 2XCUA 4OM8A 4M9QA 1P33A 2Q3BA 5ALLA 3F8TA 3MT9A 4OQYA 2C4KA 1XMQB 3W7BA 5HILA 3M4YA 4EYSA 4Q3KA 1JLKA 2VF4X 3EXIB 3RJZA 1XSEA 2B98A 4DWJA 3QFHA 4DCJA 4MUHA 2WLSA 2VP5A 4ML3A 2VAPA 3OOEA 1APBA 1BA3A 3CZPA 4LF4B 3O4VA 3AHHA 4JLAA 4YB8A 1Z7WA 3WLRA 3QI2A 5AKEA 4O4JB 3UK0A 3UJAA 3SDZA 4LNAA 5FOSA 3AR3A 1GQFA 2AHOA 3VI4B 3ST7A 1FZTA 1NLFA 1MJ5A 2DT5A 3U81A 621PA 1L5VA 4UM8B 1JR6A 2QW0X 1IQ0A 1FS4A 4XXHA 4RVHA 4AN0A 3TIXB 3P94A 1GYQA 4KQJA 2E4AA 2UUAB 5PGMA 1O95A 4BLWA 2W2LA 2PAFA 3RQIA 2ZXFA 5C1BA 4IQ0A 4JNCA 1DFGA 1L1RA 4LJ8A 3H04A 2L2QA 3O38A 1Y9ZA 2HRDA 3GFOA 3BDIA 3Q0TA 1EGAA 3RT1A 1PX0A 2VH2A 3GEEA 3KXPA 4KEAA 4BFWA 4TV8F 421PA 1KRWA 3D4LA 4P4UA 3ISJA 1QP0A 4JJEA 1N7IA 1NRXA 3ROGA 3BCRA 3U3ZA 1UOQA 2ILVA 3G0DA 3NHBA 1BO6A 1DWPA 1JDBB 3AJRA 4G24A 3TD9A 1KJ8A 2JK1A 4TMTA 1F5SA 5EIHA 5F12A 2YIMA 4I2VA 1K7CA 3WQBA 4IDBA 3QW4B 3ZQUA 4G5RA 3KBOA 3C3KA 2PSEA 4NQZA 2OB1A 2BW0A 1XP8A 3QHPA 1RTTA 1ODIA 2XXJA 3K7EA 3GU3A 1J22A 4FFLA 4K1XA 4OSPA 1C3EA 2RHOA 4HDAA 4R3WA 3UT0A 1PN3A 1DV2A 4MQFA 2ADOA 3OQNA 1ND5A 1E9CA 4FN5A 3IQXA 4G09A 2IZZA 3DNMA 3V46A 1MNAA 1KO7A 1UK6A 1P2UA 1CIPA 1YMVA 3BTOA 3QFRA 1I6LA 1KPIA 1JR2A 1U9JA 3OLQA 3GJZA 1RSZA 3FY4A 2GEFA 5J2TA 3F6BX 1JECA 2PWBA 1DKQA 1GGKA 3A27A 4JSRA 2YCLA 4PZUA 4TL8A 1OOEA 1NXXA 1L4HA 4NZOA 1LF5A 3DO8A 4WSOA 4Q19A 1UZAA 5CU7A 3WIVA 5H4HA 4RY8A 3ENQA 1ZP6A 3RIEA 3CNBA 3FI9A 4E07A 1CVRA 2O3QA 3DKPA 3F4LA 3IBGA 3WADA 3VYRB 1E1QD 1BJTA 3AP1A 1T36A 1IEXA 2ZT6A 3OCWA 3PUWA 5IBRA 3RVPA 4H0FA 4OMUA 4YASA 2I55A 5TT0A 4EG8A 1POWA 2XE6A 3T5CA 3FLEA 4BNGA 2HBQA 5BQFA 4KN8A 4MKFA 1VIVA 2EJUA 4R0VA 5A4KA 2DFPA 1NLYA 2QJFA 4PO8A 4PSDA 3WYAA 2OC4A 4D9KA 2J41A 3EC2A 1TKBA 3BJZA 4YAOA 4KQEA 3ZWBA 1S8FA 4ZQIA 1ORTA 2NU8A 4B75A 4P36A 3HMKA 2PUWA 3MXOA 4JT8A 1H8HA 3FVWA 3M33A 3NTRA 4L27A 3WYFA 2VG8A 5IMBA 4BBZA 1II8A 2G6TA 4MVJI 3WMGA 4DCMA 1CS0A 4UAGA 4OU5A 1Y6FA 1CQJA 1V5WA 1QUFA 2EL7A 2R25B 2GZ1A 2D2IA 2GB4A 3GJXC 3T4XA 2GXUA 3DZGA 4M1QA 2I99A 2JGMA 3I1JA 1R0CA 1W5FA 2B20A 2YUIA 4KAFA 4BLUA 4CLEA 2QM0A 2YL2A 3WMWA 4DVGA 3RC8A 3QX8A 3X0DA 5ENVA 1ECFA 2NO4A 1R9NA 1O1YA 3COZA 3PJDA 5GMOA 3S44A 3CVUA 2RSLA 5EJ4A 2ZB2A 4O63O 2AN4A 4C4OA 3DEKA 4PGFA 2XNCA 3OQIB 1Q5PA 4RMNA 3Q12A 5HEKA 1P2FA 3KQYA 1LPPA 4EY7A 5KQPA 1R3DA 3TB4A 1VFPA 1SCDA 1MD9A 2QZJA 3PGKA 3OZFA 1WJGA 5EJ8A 2EEPA 3W79A 3VAAA 2BH9A 4OXRA 5JJCA 4RL6A 4KE7A 4C22A 4WY8A 4BY9E 2ADMA 4LY6A 1QFMA 1R5NA 1R4MA 3H8WA 3O84A 4OHKA 5IW8A 3WGNA 2BEWB 2YZKA 4ZCLA 2A5FA 1C3JA 1Y98A 5DE3A 5FI0B 4Z3OA 3ZLTA 1VE1A 3BD6A 9GPBA 3AXSA 1MB0A 2JVJA 2WWGA 2X42A 5JT1A 1ESNA 2MSLA 3FPKA 2QROA 4PE5B 2W6JA 5ALEA 2ID7A 4AF8A 4FFVA 1HXHA 2YHSA 2I7VA 2NU6B 3DE3X 1GYRA 3KEOA 3QFCA 3H2KA 1KO1A 4OU4A 2CXXA 3CONA 3FWYA 5FI5A 4DA0A 2RGGA 4G4SP 3C0KA 2J5RA 2JAWA 4ZVPA 2GO7A 4B35A 4YT2A 4ZXFA 2C42A 2C4TA 3LUPA 5IDYA 1OASA 1E2BA 1R37A 2XUDA 2NV0A 5DGIA 3AOGA 4GLOA 4W1QA 4UHHA 2NUBA 3ZZ1A 1EQUA 1XLVA 1UMCB 1RC0A 3AJEA 4NCXA 1O4VA 4LNHA 4IJMA 1T9ZA 3ABSB 3BPSA 2WYUA 3OG9A 1G4AE 1IG3A 3HI6A 3O1IC 3HBMA 4CMEA 6PFKA 3WAJA 1IMJA 2VS1A 3R9WA 2YWRA 4DSAA 3W5JA 3UMFA 5A62A 1CJKC 2G4CA 1G20A 4R16A 2PD4A 5ALFA 2JJYA 3DC2A 1NXTA 1Z16A 5JDCA 2XCRB 1Y82A 1N6IA 4FSDA 1PF7E 2V5VA 2XT6A 1NUHA 4L5YA 2CDAA 1RBZA 3KOZA 2J0QA 2A0FA 1Z0JA 3FFXA 1E2GA 1QF6A 1OLSB 4G8CA 2R65A 4C7XA 2PCJA 1NWHA 1ULSA 3AGPA 4E3ZA 3ZZMA 5EXDA 5K99A 3D0KA 4REQA 1XZFA 3JSAA 1NKVA 1U31A 5AKGA 3T5PA 4REMA 2IW1A 4ALLA 4UPEA 5F7ZA 1CY1A 6GPBA 2COKA 3MC1A 2ZRNA 3DBLA 3KU4A 5JS6A 2J07A 4H7HA 2REBA 3SFVA 4BJ5A 3V34A 4UTOA 5BSHA 3TQSA 2WSSD 4UMDA 4J16C 3IVMA 3L41A 3H5TA 1BE6A 5HTKA 1TC1A 4KO4S 2X22A 4ASUA 1TUBA 4I1RA 1ZEJA 4UTXA 1ZMOA 4BATA 4QXPA 1C0EA 3OY7A 4MJ7A 1IPEA 4E5DA 5IVHA 1O6GA 3HCBA 1SULA 3CN9A 2WB4A 4HAVA 4TLMB 5EZQA 3W77A 5G53C 1E59A 1VP9A 3B20A 4WNCA 1KVRA 1UCFA 1YS2X 1NVGA 3WKDA 4YV1A 3G13A 3QJ5A 3T8YA 4LYEA 3OMLA 1MOZA 3ME5A 3VC3A 1ZD3A 4HWSA 2E49A 4RDIA 5F23A 1CP2A 2FZEA 2P69A 1GNPA 2HCBA 1ID1A 4IBOA 4LXUA 3W4IA 3KC2A 4B48A 1DI0A 3VH4A 5C7IO 1Z5VA 4ZYTA 1Z5WA 1F0KA 4PXAA 1QHHB 4QUBA 3W5AA 4WGGA 3RC2A 3EG9A 2WFMA 3P4UA 3SYTA 3NOQA 4ZEOA 2XW6A 3I05A 3OLWA 5TPZA 4RYDA 2PDAA 5FLYA 1I9GA 4E5SA 4G23A 5B1EA 4P6VF 2CNLA 1V2GA 3AFIA 3R40A 5DX1A 4ZMSA 2GCPA 5EJFA 1OZAA 1V16B 1XYVA 4FYVA 2ZYWX 4MA5A 4TVBA 4EMSA 5AQEA 1I8TA 2W98A 1IN7A 1LBHA 4E32A 1TT7A 3D1LA 4RS3A 1UZLA 4X9XA 3CXUA 1XD2B 2CNDA 1DC7A 1S2LA 1NYRA 5ED4A 1H2WA 5JY6A 2QE7A 1I3LA 1EVYA 1DKPA 3ZN2A 3HPQA 1KL7A 4CT5A 2LNDA 4PO9A 3KETA 3PIRA 2OXCA 4FDAA 4RWEA 1GL9B 1PD0A 4DKJA 4MQ4A 3IUMA 4RGQA 4DV5B 3U4HA 3ZNQA 3UTDA 4YCSA 1JQ5A 3IQHX 4BVEA 1KA9H 1XVUA 1Y6QA 3HWRA 4LF7B 8ABPA 1UFOA 4FR5A 5KUTA 1CR1A 2DFLA 1AKYA 1DBPA 4X0EA 2EG5A 3SN6A 2C7PA 1M34E 2EFDB 4EG7A 2FQ1A 3A05A 3A1WA 3IP8A 4H7FA 1TVMA 1EFTA 4YV0A 1FYVA 5DB4A 3AX6A 3UUWA 4YXFA 4RTLA 5EHQA 4CJXA 4D5GA 3WDKA 3ZJUA 1Y7IA 5AUQA 2QT1A 2EKZA 1FJ2A 5IKOA 3HU2A 4YCMA 1UMBA 1ZXXA 2ZATA 3QX7A 3QXHA 4K6OA 2WD9A 5KCMA 2PJDA 1ZVMA 3HXLA 4LZOA 4EZIA 3MWYW 3A4NA 4LBYA 1DZ3A 1K7XB 1O54A 2Q49A 2Z3ZA 4FBGA 3ED5A 4L4YA 4C14A 2YJ5A 4KQWA 4GWKA 4N3NA 4CM1A 1FMTA 1T5IA 1TQ8A 2WFAA 3MJDA 1O0BA 3K09A 3T7DA 4Q7QA 1F20A 1ST2A 3IE1A 4XZ3A 2FMTA 1NUSA 4HPXB 3NHSA 3CM0A 3HJHA 1VL5A 2HCTA 3IEKA 2CC2A 2Y1FA 3D6TB 5ITWA 1AJEA 1P39A 3REQA 4LXGA 3LWBA 3B52X 3FYTA 1C4WA 1HRDA 3U80A 1NMQA 2CXTA 4GDFA 1JHYA 3F6PA 5ICMA 1DAFA 1A8PA 5JRJA 1PHPA 4Y9DA 1DBSA 4H08A 2OV1A 4UBLA 2WD7B 4UQLA 1M0TA 1SC4A 2X8WA 3R5KA 5P8WA 2F7SA 2HJVA 2O8EA 4GXNA 2XI4A 2JGFA 3EVEA 2IXBA 3LBAA 2PL5A 1TCBA 1JDTA 4LOHA 3IS3A 1OFHA 3RKSA 4DRYA 4HS4A 1U2DC 2ZSBA 3LUFA 4LRWA 2J0UA 1E94E 2ZIUB 3T3IA 1EWRA 3GLVA 3NM6B 2VJOA 3RPEA 3KQOA 1O6BA 4RSMA 3KFVA 3SHVA 4XIGS 1WMDA 4C7MA 5JPCA 3H3XA 1BD4A 4M0FA 1ZW1A 4ZK2A 5ALTA 5FD8A 3EEIA 1LPNA 2PUEA 1R8SA 2J3EA 3NM5A 2HJGA 2PO5A 5EE9A 4IF6A 1Y6JA 2GHRA 2ZJ0A 4IIDA 4QXRA 2OZVA 3DBRB 2FRDC 4PV7A 4IVQA 1UJ6A 1UBNA 1MRSA 2WIGA 3HY6A 1OXKB 3IJEB 4MQ6A 5IP5A 3RGGA 5F2EA 3SOPA 1XRQA 4CFSA 1Z35A 1T4MA 1IN5A 4O4HF 5JHHB 4CM9A 1MB9A 1A2KC 4CEHB 1SQ6A 1OXMA 4QU0A 1M5TA 2G70A 4XJSA 5TJHA 3WL5A 3C70A 3CNQS 3I9FA 5FWAA 3VPAA 3DAGA 3PPIA 1EUCA 3K0AB 4BN0A 5LXTB 1A82A 1DHRA 2X0RA 2HJSA 3TLJA 4LISA 4EFLA 1FJXA 1GGHA 3K32A 5KOJB 1CY8A 2ZTHA 2EWMA 3GEDA 1SEVA 2AE1A 4B6OA 4ZOLA 1Q0SA 3FCYA 4J29A 1YIDA 1Z29A 3ACBA 1UKZA 2XVYA 2ZRCA 4WZ6A 1XJ0A 1USUA 2EATA 1Z4QA 1W7AA 2EIHA 3CUUA 3KT3A 3IOCA 4RJIA 4KIJA 4BAZA 3GGCA 3FRJA 3SQWA 1B8UA 1OIVA 2XUZA 4HX2A 4KDEA 4S35A 2YWJA 3F98A 2EERA 1OPRA 1ODTC 1RLUA 2Y05A 2OGUA 1JHXA 4HB0A 3VX4A 5EJ9A 4HTFA 2PH3A 4YGXB 3TSAA 4MUJA 4NE9A 3R3HA 5AHRA 4CV1A 4L4UA 3W6UA 4M0CA 3VYVA 4U2GA 2O2DA 3NZEA 1CQIA 3T7JA 4MCJA 2OVBA 2BFFB 4HWGA 1TVKA 4Q1BA 3T1NA 4UHFA 4MVJP 2AD1A 2ZWMA 3K16A 3NPAA 3KX2A 4TS9A 5LQKA 1CYEA 4FZ3A 1XD2A 1JJBA 1G2IA 3A4VA 1BXZA 1QLWA 5TY0A 1V35A 3EIXA 2PBRA 4Q3AA 4L75A 3VR5A 1Y7TA 4GBGA 2X9GA 4L16A 3CNHA 3CWQA 4DHEA 3BWCA 5F1KA 4KXQA 3PEWA 5JMTA 4QLAA 2BZSA 3TIVA 2G72A 3AEKA 4ZIRB 4NC9A 3TW8A 3H0KA 3K15A 1DRVA 4OQDA 3BSWA 2NUAB 5A4JA 2O2JA 4KC0A 5JG7A 4I55B 5H59A 3CT6A 1NVTA 4RLSA 1SC6A 4CW7A 1AG9A 2XQGA 3L8EA 3RUCA 3C5HA 4P33A 1GQYA 1W1IA 2B2CA 1N5OX 4EY8A 3A4IA 3N7AA 4U8GA 4WASA 3SKXA 3PJEA 4MNTA 3AFOA 1BWQA 2ZE6A 2BHLA 2GUGA 3I1IA 1XNHA 4G9EA 4WOBA 2JLSA 4OH1A 5H0IA 3UFXB 4S1PA 5TGDA 2IYNA 4DADA 3P0IA 4GSYA 1T2FA 2NSJA 1J4AA 2YXPX 4AY2A 2AZXA 1CETA 1JDZA 1OHHA 5LNK1 1KI2A 3HDHA 5AW1A 3WGVA 1Y1LA 1JTFA 3QEMB 2NQ8A 3OQIA 1C3XA 1AX9A 2GN0A 2ZTVA 3N0XA 5F35A 3LZCA 4CUKA 1QDEA 4WJZA 5HGJA 1F6DA 2CNBA 1LDEA 3PQ3A 4J7CA 1COWA 5B1DA 5JC1A 1DPFA 2CK3A 2WICA 1W49A 4ZZ2A 5CG1A 2AE2A 4LV8B 2I8CA 2PRKA 4Q21A 4X1YB 3FFBA 3BDVA 2OP0A 3FHLA 4PLHA 2EIXA 1YS9A 3PFWO 4BS9A 5KHLB 4H1HA 2Z2YA 1U5CA 5H9VA 2AYYA 1V3UA 3MLAA 5DYTA 2XQJA 3EQ7A 2FLWA 3ZGNA 1AS3A 3NXSA 3JQ9A 1CJVC 1M75A 1OZFA 2B8EA 2DTDA 1A5ZA 4J6FA 2JGJA 4XLLA 5ALHA 5GV8A 5J5CA 2QAGA 4LC1A 4PLYA 1L9KA 1YOVB 4QFBA 2W71A 1JB1A 4KQFA 4OUKX 4AUKA 2QVGA 1X7ZA 3JZIA 2ZR8A 3QLVC 1TA9A 3L7MA 2O6HA 4HDCA 5AUOB 1LRJA 4YROA 5AO9A 4MS3B 3ZUGA 2CDRA 3B13B 4JQYA 4HEA1 3ZU3A 4L72A 4D41A 3G23A 2BM8A 2HH9A 3P2MA 5HF8A 5GINE 2RARA 2HWWA 2Z58A 2I4LA 1I5RA 5IKXA 2BDTA 4MP3A 1GNRA 4PG5A 2KJQA 4R2HA 5JV5A 3EDQA 5IAOA 5JSZB 5EVCA 2QHXA 1ZGZA 4MYRA 4N7BA 3P9IA 2Q29A 3W34A 1P60A 5HBGA 5HE9A 3BERA 4XQGA 2QJWA 3QXGA 4D0RA 2HSEA 1MTOA 3MBOA 1K2WA 3PT9A 4NP6A 1Q16A 1UBUS 1VIYA 1UUFA 1PVVA 4HBZA 1T3GA 1YFZA 3FNGA 3N2GB 1X1AA 1PS9A 4ND8B 4LX8A 5HNKA 2BZGA 4KACA 3VAYA 5DTIA 2Y77A 1L5QA 3MTIA 3DFZA 3JYHA 1SUEA 1VCNA 4HI0E 2V9ZA 4MQFB 4ZDWA 3CMCO 4AJ4A 3AI1A 1BX0A 2CLMB 2ZVJA 4X54A 1Q22A 2HUPA 2BTEA 3BKXA 1FFCA 1AKWA 1RXUA 3P19A 4E2ZA 3OJWA 4YAWA 5GVSA 2DKFA 3J81k 2H0QA 3PQEA 1J0DA 2DTXA 2JAXA 4P0PB 3ELUA 5EIAA 1VE3A 5F52A 5CB4A 3Q3CA 5I9SA 3TQRA 4BO0A 3OZDA 2FWPA 3B1JA 2FW8A 5FV4A 2JF0A 1KGDA 4PEVA 1KOFA 1AM4D 4GOLD 3LI2A 2QGZA 1FFGA 1IATA 2AR7A 2OZPA 2RJNA 2E21A 2ZI4A 4L0MA 2A0XA 3I9LA 4RW0A 5IJ9A 4YONB 1ZSNA 3GAZA 2MOKA 2BHRA 2ZBPA 1IBKB 3L0ZA 3I2YX 2B37A 2H1CA 4HXYA 3UCXA 4KBFA 4YI3A 4DA6A 1DARA 1KETA 3WSVA 2XX3A 2NACA 2Z1DA 3PGMA 4O29A 1L7NA 1LLQA 3EE6A 4BNUA 3QEKA 2IV7A 1EFAA 3FM9A 4LZJA 4PAOA 2FPRA 4RHXA 4EGQA 4EABA 1RCUA 1RT9A 1UBLS 2NTYC 4WI1A 1KBZA 3MGKA 4NSNA 2IKSA 3UUFA 4G0UA 2NP7A 1EEXB 3V32A 4WRRA 1E69A 2FB9A 1AK9A 2HYIC 4BX8A 2XMCA 3A3OA 3FDXA 3IAUA 1B6RA 4TKVB 3VR5H 2G67A 3W5SA 2P40A 1BOFA 4WNAA 3TZKA 2FXIA 1OX6A 1A7JA 2O9JA 4JSTA 1WLYA 2ZRMA 4JFRA 5JROA 4TKZA 2I62A 3N05A 4D4JA 2WJ3A 4PYKA 4TMWA 1PR2A 2ZIXB 4DRXB 1I01A 1P1RA 1RE0A 3E2MA 3NBFA 3PFGA 4KO3S 4OB6A 5GJWC 3S1AB 3UK2A 3L8DA 3IV9A 4EX6A 2EBUA 4IIYA 3PPYA 4W5HA 2QKYA 5HQ3A 2R1TB 1U5BB 1O2DA 4BE4A 1B2LA 2W37A 4DR3B 4QICA 3ZHTA 1QQ5A 5FB3A 4YQZA 4CCWA 1MJHA 3AY6A 2IGTA 3P0RA 2R87A 3ESBA 1ACMA 1CB7A 1D5CA 4IRUB 5C0OE 4NF2A 4YMTA 5KMGA 1WSBA 4NV1A 4GU5A 4TYQA 4GRIA 1N4DA 2GK7A 2FFJA 3FB1A 4H6VA 2X1LA 1PFWA 1TL7C 1C7FA 1Z39A 5KOHB 2VNJA 4BLRA 4GWGA 2ECOA 1T3TA 1KZ6A 3F6YA 4MCIA 2P1ZA 3QEBZ 1M6HA 3GFPA 1UWKA 5JH7B 4EFMA 1LPSA 1U4SA 3IHKA 5U9CA 1O9HA 5BORA 3SEFA 1TIPA 4BZQA 1E1CB 1T9AA 2QMQA 3CRQA 3JQFC 4PSCA 1CLUA 1RHQA 1VOTA 2YDYA 4QFCA 1Z7BA 3LDGA 3BWDD 1FE8A 1XZEA 4YA6A 3NASA 3RAFC 2HR1A 1NW5A 2QRQA 4V1CA 2JLRA 4UJ5A 4QPZA 3COSA 4IJUA 4Z8YA 5EWMA 1OX4B 4X85A 3T7IA 3WGHA 1E99A 3QGMA 4PC1A 4BVJA 4YRZA 2F43A 2BELA 2ENUA 3H1GA 4NU0A 3U7FB 3TJRA 1CVIA 5KHAA 3I2KA 3Q3JB 4PYLA 1ZJ6A 1UBKS 3V1UA 2D7DA 4KTTE 3I5XA 1GLVA 4PINA 1H2YA 5LLDA 1MW8X 2Z2IA 1KO8A 1L8OA 3U1BA 1E6WA 1O03A 2EFYA 4KE6A 1YFKA 4PNPA 5DCLA 3I34X 3LLCA 4AJIA 3QUSA 1T6ZA 1VL6A 2BJHA 5ADUS 1IM8A 4O3FA 2GQ0A 4FFWA 5I9NA 5CCXA 2GM4A 4WTOA 1T2UA 3D3WB 1YV9A 3UCFA 1E2MA 5DM0A 1QHFA 4FQ7A 4JQSA 1CCWA 4DPKA 4YCJA 2XQVA 2VHCA 1OX5A 5B36A 2AB0A 4HD8A 4CEIB 1UF9A 1ODJA 4ZYYA 1K3FA 5CMLA 5A9SA 1U3TA 1SCIA 3PDUA 1LBIA 5EHXA 3DBIA 3FI0A 1F3OA 2IZ7A 3LC1O 1Z37A 1F14A 2VHVA 5AW9A 5B30A 1KNQA 1M7HA 2QRZA 3PZRA 3EBOA 4NFHA 2BVNA 3DV0B 4OLBA 1Y3CE 4YH1A 1WR8A 1AF7A 5FP0A 2FK8A 2RGBA 1Y5MA 4MVJA 1QGUB 3RQSA 2A4MA 2OAP1 4A8JC 4TZ6A 1WL8A 1ZITA 4NEHB 1RHRA 1JFFB 2FGKA 3L6DA 3EXFA 3FYHA 2BRUA 4GI1A 4QU9A 4I14A 1R5BA 1SU4A 1J0CA 1GZ7A 2CNOA 4EI8A 5JWOA 2VT6A 4QM7A 1HO3A 4BE9A 3HA2A 3OEHD 5IF3A 2PS3A 1P1BA 4K28A 4P54A 3FWPA 3VDXA 4EJFA 3ZLJA 4BECA 3G5MA 2CSXA 1L6RA 4I9FA 4PBRA 3G6KA 2IY9A 1G8GA 1PL0A 2Q28A 3BF7A 3ESXA 3RS2A 5KYXB 5J3JA 3BSFA 3U4DA 3PUZA 2Q1SA 4Q05A 3B3GA 3S7TA 1ZCAA 3MJHA 3KXLA 3LLMA 3TRKA 1U3UA 4HEA6 3T9AA 4ZI7A 4WBNA 3WOVA 1ODSA 2OK8A 3ZH2A 3U7JA 1P77A 4LOLA 3AT1A 2OMEA 4Z99A 3LXXA 5HOQA 2FPKA 2ZFUA 4INZA 5J1TB 4ZGGA 2O3SA 5FBVB 2FGJA 3DT8A 4Q9HA 2ZPUA 5CR9A 2KW5A 2R6R1 1E3TA 1HZZA 4M8KA 5LC1A 5KOIA 1ZIYA 1BE8A 1F0NA 3K70C 5BQXA 2Q3EA 1M2OA 1RWVA 3QUTA 4CE6A 2IOYA 4ZYZA 3IUNA 4X71A 3TRJA 4GNKA 1FFWA 4NH0A 1EFPA 1T1SA 3K0HA 4JBLA 3KPJA 1OWMA 1AO3A 3PNLA 5G3ZA 3IUBA 1PGJA 3CZCA 2F3UA 2ZI5A 1PHRA 1SCJA 2JDID 1KJNA 3G2QA 2MSEB 1M1ZA 3D59A 3IEIA 1AKQA 3KR9A 1BX1A 3R4CA 1WB6A 1EZ1A 3DBOB 3JAKB 3PV0A 4H77A 2OV8A 5AM1A 3WKEA 3FWNA 1V6SA 5KC9A 1KI3A 4K7JA 2P35A 4Y98A 3QPVA 1Y5IA 4XR9A 1G5TA 2UV8A 1OI2A 4BN5A 2CD7A 2GEUA 1XEWY 2RGXA 1FXWA 4DDHA 3RV3A 2E5LB 4OBEA 4DA9A 1XQ9A 4QVGA 3V8RA 2EJCA 1NKTA 2UVQA 1HEIA 1X87A 4RVGA 3QLUA 4OREX 1JBEA 1NVDA 1KPGA 1QANA 2BBOA 2BGMA 3NVAA 3QW2A 4W7SA 2F3QA 2J9ZB 3N7UA 3N8DA 1JQLB 2HEIA 1PJ8A 5DNEA 4FYWA 4GM0A 3RU2A 4B4WA 4MVXA 1K3TA 3LPDA 5ECYA 4YAFA 3IHLA 1NFQA 4UNIA 1QK5A 1M5UA 4B43A 3UAYA 2WDZA 2O7NA 5K4AA 1RZVA 3PQ4A 1WLSA 4FN4A 4P80A 5LDDC 2Y8EA 4HADA 1GGVA 2GCNA 5JNSA 4HB2A 1KERA 4GZ3A 4HAIA 3K5PA 3UK7A 5EXEA 1WW2A 1PWHA 4DNQA 4GVPA 1U8ZA 4OJKA 2P6NA 1UBGA 4FFRA 2J85A 2UYOA 2XUPA 4JB8A 2HC9A 3UAXA 1XO1A 2QRLA 3IT1A 1U9IC 3HBNA 4MWZA 1XTJA 1WUJS 4GZ5A 1VE5A 1YQWA 4CU5A 2R6AA 3PRHA 4ZO8A 3WRWA 1F48A 4HGYA 5ALWA 1XAJA 2J32A 2LPMA 5U4QA 4H6PA 4DVJA 3JWJA 1Y63A 1V43A 2RCYA 3D3JA 3N8HA 1W4CA 1EDZA 2JFOA 5CAEA 2H2DA 4Z0TA 5J2UF 1G291 5K8JB 2BGWA 1LI7A 1S2IA 1SIBE 2QUBA 3K30A 4IPTA 3B2QA 4HUTA 1RXIA 1WEKA 2P2DA 3HH8A 1ISIA 3PITA 2O8EB 2LE0A 3Q9SA 1ORWA 1U7TA 3RUHA 2VDLB 3C6XA 1HNXB 1A9PA 4L7VA 3PP8A 4UDYX 1YKFA 3U61B 4RFLA 1Z45A 1TYAE 2QAIA 4R83A 4GX0A 3DDZX 5DWDA 5HDBB 3VTKA 5E7IA 3CTPA 5K8VA 2ZB3A 1F60A 1ZDMA 2DHQA 1IFXA 4XPIB 1EM8A 1NAIA 2ECQA 1B14A 2BMEA 3PC6A 3HR8A 1IM2A 4FX2A 4JFAA 1VLZA 3EMDA 1TUGA 5I45A 1FSPA 2C77A 1RYDA 3LUHA 1PCXA 2P68A 3PC3A 4EA6A 2EWVA 3MFQA 4M7RA 4OJMX 4JASB 3CRRA 1TYZA 3DXYA 4TTPA 3LFTA 4N18A 3KL4A 3RJTA 5CM2Z 2PXHA 1B2RA 1LDBA 5DX0A 2DQ4A 1ISRA 2XEXA 2ZE7A 3GEIA 4QDKA 5DSTA 4B32A 1E9BA 1WRBA 1Y7PA 2GZRA 2JEYA 2XAAA 1FUKA 5BNZA 1TT5B 5CVTA 4HB4A 1CZNA 1T8TA 3UMVA 3AEKB 3S8MA 4P31A 1QH9A 1PEYA 3TJZA 3U4GA 3W04A 4DPLA 1TCAA 4MHTA 3VZBA 3ANLA 3QWHA 3PQCA 4FDTA 4RO0A 3B5IA 4TWJA 4XYBA 4G8DA 5EMLA 3AESA 1L7XA 1YVRA 4LPKA 3ROQA 3QMVA 4UTZA 3AWIA 1US8A 2YVAA 4M0EA 3TWOA 2I6FA 2V8BA 4K03A 2C8KA 1ORDA 5DNVA 5CLHA 1C1HA 2AKEA 2I7DA 3AGQA 3K1JA 3R7DA 2FH5B 3R74A 1QRRA 2I65A 5AVUA 2PX6A 3KWFA 2QSYA 2H1WA 1VLMA 5CVVA 4G1MB 5KWVA 5K6TA 4MRAA 3O2SB 3VHXA 3EPJA 4WACA 1UPFA 1KSFX 2O48X 3VDNB 2QT0A 1I36A 3KLMX 4NAUA 1KQ3A 3I04M 4MW9A 5SZKB 4GVXA 2P79A 3F1LA 1XZAA 4NR0A 4BUZA 4YV2A 5AI5A 4Z7NB 2GCOB 2XDWA 3EF3A 2AZDA 3OQBA 3DO6A 1HY3A 4RKRA 3ZHBA 5EJEA 3WQQA 2Q5QA 3EDRA 4RUKA 4GFDA 1NJFA 3C98A 1GPNA 1F8FA 5JVDB 4XCQA 2FZWA 3LY9A 4AJJA 1D5WA 4V38A 1ZCZA 2XE7A 4Q12A 1NX6A 2ETVA 1UC5B 3G17A 1LWNA 3E53A 4WINA 4BNMA 1DCKA 1ENYA 1IHUA 4TUYF 4XOIA 2VP6A 5BV1A 1QHGA 2PH1A 5GGYA 2P75A 5CXQA 1HSOA 1KE1A 3B6IA 3M9XA 3N2LA 4M0KA 4YUYA 3DBVO 1LS6A 4N8DA 3EASA 3UQYS 4MV0A 3ND7A 2PT9A 3EGOA 2DWQA 4QQFA 4OY3A 2VA9A 4CT0A 4FFDA 4FOPA 3ZG6A 2R5WA 4ZVRA 1Q1AA 2B2NA 2YS7A 3CJQA 4CKBA 4EHDA 1L6IA 3IV7A 3LA6A 5JH7A 3WO0A 4R0MA 4PYQA 2BFEA 3GEMA 5C51B 4Y6RA 3FZEA 3SK0A 2B5WA 1NP3A 2V0NA 2REQB 2XGSA 4B7AA 2E4ZA 3V00A 3QVGB 5BN4A 5KINB 5AI6A 4QGAA 2FR1A 1MQSA 2HCJB 1EVJA 1KY4A 5LP6B 3FOEC 3QPDA 4EI9A 2A33A 1UFKA 2AK3A 3AF2A 1E1QA 1YBAA 1E89A 3AZPA 4OHWA 5DNDA 3Q2IA 4KOEC 5BVHA 4YNBA 3LBFA 4BKRA 4J0QA 2JI9A 1HLPA 2P9BA 2AZ4A 5CIWA 2DYKA 5F4BA 3GFSA 2ZT5A 2VPTA 5LZ5A 5A6SA 2CXPA 4KBGA 2BKVA 4BVHA 3DMTA 4N0DA 4OMFG 4XRGA 2P7HA 2JFBA 1Q17A 1VG1A 3DLBA 4RZ2A 1LLDA 5A3SA 1EWVA 4XM0A 5I9LA 2H6EA 4DA4A 1DOHA 3LGAA 4A91A 1HNZB 2WM8A 3ULKA 3HO1A 3GRCA 2IPNA 3F78A 4AJ1A 2QLFA 2PXAA 1MBZA 4UM9B 1ZC4A 3K5IA 2VKQA 3DDCA 5EKTA 4YRPA 1KMHA 1UT8A 1PR6A 3BTVA 5JEDA 3D5QA 5E2IA 4QBIA 5DM70 1JR3E 1JXOA 5DTQA 5KTRA 1V48A 5JI2E 4H1UA 2CLOB 1DFIA 1CHNA 1KMQA 3N2YA 3OM9A 4QM6A 1P6UA 1ZW6A 2E37A 2JLAA 2VBCA 4WZAB 2QTHA 4RSGA 4RXMA 4BP9A 5FWYA 3W5CA 1CZRA 1P91A 2ESRA 3JQ7A 3P9PA 2CVOA 3JARA 2YC4C 3K1TA 2NO5A 3P97A 4JP1A 4CV3A 3E9DA 1CVLA 3PHLA 4RZHA 1A8IA 3MB5A 1IZ7A 4Z2YA 1YBHA 1JIXA 3L05A 1FYFA 4PAGA 2GPYA 3E9MA 2PT5A 1T10A 3SKYA 1N3YA 1ULBA 4YJFA 2AD5A 4B3TB 1SWVA 1OYOA 2Q8PA 2B8WA 4WT7A 3EJ6A 3ZU4A 1X0VA 4BNXA 1YQQA 2VVTA 5FUBA 3U4MA 1KEWA 1AQNA 2VJCA 1JUDA 1N8KA 4YREA 2I6QA 3CVWA 2WI8A 3EXFB 3RS7A 4D9GA 3OTQA 3L8ZA 4GPTA 4IICA 4O2AA 3UJ9A 1HH4A 2QIOA 1Y1QA 3OF3A 4PAQA 5F64A 3GV0A 1P1IA 3JASA 4JB3A 5BNIA 2PUHA 4TWRA 5EEHA 3SSNA 3CEHA 3PKIA 3CRW1 4K9SA 3TZCA 2EBFX 4L8LA 5KSOA 3VKFA 1EB8A 2ACKA 3F96A 2ONYA 3QVMA 4U2FA 2BT4A 1Q7RA 4BDSA 2WAOA 1I10A 3KAPA 4BMVA 2FFQA 2W6ZA 1ZLXA 2WHPB 4KXYA 4N5NA 2ZYRA 5IS2A 1KKMA 2Z4TA 3RC7A 3VTAA 1E32A 2NSHA 1ATZA 1CDOA 1X3LA 2XDYA 2XTAA 3FPEA 4EYKA 1SAYA 1EK5A 4CHGA 3HCAA 3WNVA 1SHJA 1SJ9A 1S1MA 2XB9A 3H8VA 4KNWA 4MKIA 4R69A 3T95A 2ZWOA 1CFZA 1QX4A 1NUAA 4V0NA 4G9GA 1JEAA 1HFEL 2HNBA 2DE0X 1YGPA 2GYVA 4ZV9A 4AURA 4AYTA 3HNOA 2BUBA 2HZ7A 3GMIA 3PWSA 1QG2A 3J7TA 4ZP1A 2WRZA 3RTGA 3EIHA 2J5BA 2PD6A 2XKAA 4DGSA 4NBTA 3TSZA 1FNMA 4MV6A 4XIFA 4EG4A 1NJ1A 4PQGA 1G8MA 3T06B 3CRNA 1FP2A 3LLVA 4DLYA 5BYBA 5I8WA 2WPDA 4EHIA 5JYDA 2OHXA 4EO9A 4N3GA 5KSZA 1J2EA 4IDHA 4LMRA 5JNRA 1C5KA 2FUG1 3KUKA 4UXJA 3HK2A 1SVOA 3EVAA 4YFVA 2YWEA 4X92A 3ZJ5A 2V45A 4DLXA 1EFRD 1Y8AA 2YRFA 1YJXA 2P90A 4IIBA 4GE3A 3JVDA 3LXRA 2NU9B 4L4XA 1W0CA 3NAGA 1JQBA 1IQPA 4L4SA 1T8WA 1YJCA 2XSZD 1U94A 1BMDA 1WXEA 2EP7A 3ABZA 3GEBA 5AWFC 4C01A 3GZ4A 4U5QA 1M1YB 1T0HB 2IX9A 1MEJA 4EB3A 2MR6A 3WMXA 1O0SA 3RT7A 3R5TA 1HG0A 2AFIA 1NR5A 3LPAA 3M6UA 4DQDA 5ICCA 4OBBA 5LUBA 1QV7A 3ADCA 2FN7A 4IQ4A 1WKBA 2Q6KA 3TH5A 4QGBA 4ZCSA 2WYWA 4Y1RB 4KPUA 4LQ4A 4EQ6B 1G6KA 5HR5A 1QIDA 4CG3A 2AK2A 1ZD2P 2P2GA 4DGQA 4QU8A 2ZSUA 2IT1A 1XL0A 3OA2A 3RRZA 4NXMB 2E9SA 4G4JA 4MP8A 1ZUNA 1EEHA 5DBHX 3CLSD 1SVMA 2AR9A 4OXNA 3ZDQA 4XB2A 3BJIC 1G5RA 3HFRA 4P3YA 3T0FA 1UKAA 4XLTA 3EMKA 4Q3EA 3ANMA 5DGTA 4ZOQI 2VDJA 2NVBA 2ZVPX 1RRMA 3U4QA 4MI9A 4J0IA 4UQOA 2HLNA 3EGXB 3Q2OA 3SXUB 3AHCA 1X8XA 3JATB 3THSA 3H8SA 2QORA 4D6YA 5M2QA 4A1OA 3A37A 3LHSA 2Q8NA 4AZWA 1U28A 4NS4A 5B7PA 4TYWA 2ZZKA 3TRDA 2FG7C 1S7CA 2HQBA 1XCOA 2W58A 3JQRA 1ZN8A 3SHTA 2VTBB 3BJEA 3QP9A 5FTJA 4YJ3A 2I2DA 5K4HA 4CUZA 2ZM5A 3GP8A 4L3OA 4B5KA 1WKVA 4X1IB 2DSNA 3LRPA 2AJCA 2GRAA 4H59A 4MPJA 4C0WA 5IZCC 3QZUA 1HWYA 1Z33A 2O5RA 4ER6A 3WYCA 3T5TA 3JALB 5EUCA 1E1KA 2Q2QA 3CEJA 3NYQA 3AVUA 1E3MA 4AZ3B 3Q7QA 4G81A 3TSYA 2VN8A 4Y0NA 3UG7A 4TXJA 2NXCA 3I12A 1LNQA 4AMUA 3QA9A 4AJ9A 1EAMA 4XWGA 2A7XA 1ZOPA 1DMRA 4ISCA 1CUFA 3HXTA 4H3VA 5IH3A 4GYWA 3FDZA 1P1FA 2HM7A 1D2NA 1IAVA 1GNQA 1ZC3A 5FOUA 4QBTA 3ZLVA 2PMKA 3WGGA 5HJEA 2FP4A 3ACDA 4RZIA 3C24A 1KYWA 1J8DA 2CMDA 5FA5A 3RRXA 1J8QA 1U5AA 1PNRA 4IIEA 5BV8A 3GIWA 1GZDA 4KFCA 4KU4A 1NG1A 2WKQA 2G76A 2YW2A 4GEGA 5I9MA 3WV5A 1SO8A 1WV0A 1M2KA 3QENA 4ND5A 4Q34A 4RIGA 2WAMA 5IX8A 4B71A 3ZTTA 3MAJA 4KO2S 4WL0A 3ADPA 3L7IA 5EI5A 5EMNA 5FNVA 3NIBA 3ZY2A 3R5JA 4BO8A 2H1VA 1NQVA 4OV6B 1DC4A 5CTAA 5FFNA 4BVFA 1NC1A 5EXPA 3IQIX 4ZARA 1ZWLA 1FDTA 1JA1A 2WHEA 1P9OA 3GZTB 3CCBA 2AEJA 1R4MB 1VFNA 5D7NA 4NBUA 1UPCA 1ZCFA 1VRCA 1HURA 5C32A 3FUCA 3RKRA 2NVUA 4KR6A 2D4HA 2N9UA 2YXLA 3BHNA 3DEIA 4XFJA 2IXGA 2J7KA 4LQCA 1Y6ZA 1NXSA 1UT5A 2ODWA 2WD7A 3L6CA 3P52A 5HRUA 3NOVA 1DIRA 1JSLA 4O4LA 2C04A 4MKZA 2RC6A 2GSWA 1BE1A 5EWJB 3I9KA 1P7CA 2X5XA 5FNZA 4WHMA 2LBPA 2V9CA 5ER9A 5JI3E 2XMDA 5JMWA 1M8JA 3OZIA 1L3BA 1RJ9A 1KOJA 4HZGA 3K0CC 5EIXA 5AW0A 4AKGA 1GG9A 4U7TB 1UMCA 2PX5A 3EFEA 3HJAA 4PZZA 4FEAA 4WWHA 4ZEWA 5F1OA 4QFMA 1L5SA 5DXAA 4I50F 4F4DA 3S3TA 3W3ZB 1XE3A 4DR4B 1YZFA 4LVNA 1WNFA 2YIDA 2PGLA 4LRQA 5EJMA 4OF4A 4IIFA 4RSRA 1H0HA 4TTRA 3DLAA 4V0ME 4G5XA 1NE2A 2C2GA 4Q82A 2FW7A 3WLEA 4OGWA 1SWWA 5B2FA 1BDMA 1X19A 4XYMA 1SA0B 3DQPA 1ECGA 3BMOB 4KSYA 3W3AH 1P4RA 2H52A 3EC1A 3HDJA 4HPJB 3BQMB 3TMAA 1XJQA 3IQFA 5FR1A 1HQKA 1PS0A 3WDSA 1W19A 2PY6A 4C3OB 3KJHA 1U2GC 4PC7A 4YQYA 2GVZC 4LV6A 5A1TA 3AETB 1UEIA 1YULA 1JWAB 4KBYA 3ZE9A 1ISMA 4DV0B 2QV7A 1RJFA 1J1ZA 1X7YA 1L5GB 1RI3A 1X1TA 3K09C 1P72A 4Y18A 3V4LA 4F7WA 2CHGA 2Y4NA 1T6YA 4ANFA 1GPAA 2C7OA 1SKYE 3FJYA 3K9NA 1M1XB 3M8KA 4HNRA 1G9XA 1RACA 1SHTX 2FR8C 4BX0A 1IUPA 4MR7A 1C1XB 4NZNA 2JGEA 3CF0A 3E03A 4F3NA 2QG4A 1NPTO 2XZTA 4II7A 1PQ4A 4RTQA 2WTAA 1F12A 3CVOA 3I64A 3N58A 4PZLA 2IZ1A 1WKCA 4RVUA 1ZVJA 4C87A 3HYLA 2JAOA 5DHRA 4RDXA 5KPDA 3Q98A 4IDAA 4MGHA 1E77A 5JNUA 5DEIA 3RW9A 3NIFB 3BGSA 2IUUA 2PLNA 1CQIB 3H18A 3PFCA 1SXJC 3UKOA 2LZ0A 3NTLA 2ZI7A 3VZSA 1AV6A 4F1WA 2CBZA 3BGOS 3PDIB 2IOFK 4UCWA 5AJXA 3SEZA 4Y9RA 4B0OA 3D8HA 3FAKA 4JR1A 1T2VA 4IQ8A 3QQPA 4UBKA 8LDHA 5H02A 3RWMB 4ED9A 4ITRC 3CW9A 5K8LA 5KOJA 1W1UA 4KFSA 1RKUA 4RK4A 2VXCA 3KVYA 5JCPA 3U7HB 1NVVQ 2FFAA 1TU0A 3MJVA 5T41A 3GN2A 5JSQA 4H7PA 1Z8HA 3EDYA 4Q3LA 2EJBA 2JLYA 1TMGE 1JI3A 1TM2A 1CUWA 5EPUA 2BFPA 3DDUA 5JZBA 1H4TA 1H85A 1JDPA 4BEVA 4S12A 2GZ2A 1DDGA 3VO2A 4UM5A 1UPXA 1ZVQA 1IQUA 1T26A 4K88A 2F9FA 1Q0HA 4WZAE 5LYJB 2JD2A 4EHFA 1XLWA 3VDQA 1JAIA 2JFGA 4L7QA 3FCUB 3EMVA 2YMMA 3GJTA 5B3KA 2KQUA 3KJEA 3LIIA 4PYMA 3MS2A 4AMBA 4Z7QB 3FPBA 4Z1MA 4LYFA 4KI7A 2WOJA 3H65A 2GN8A 3RBXA 4GP9A 5TSDA 3DL2A 3V7NA 1YB2A 2PJZA 4JI3B 4CEJB 2GRJA 1RI1A 3NV9A 2C3MA 3BDAA 4IWNA 3H5IA 4KHZA 4PYNA 1N6LA 3VPFA 1CC1S 1WZUA 3G59A 1LDGA 4PTYA 4DQXA 4X62B 1RI4A 3CU5A 4MB6A 2RHGB 3OOSA 4X24A 3WZLA 3KYBA 1ML4A 3AYZB 5I5EA 4OUDB 2J9FB 1ZNXA 2RBGA 4UPVA 3TW8B 4Z4CA 2Z08A 4IDEA 4X1YA 5GAJA 3B5JA 1O7JA 2PLFA 2DKOA 2B61A 2JLWA 1L5RA 1N2XA 4RY2A 5JYEA 1FDIA 4F06A 1NUPA 2HF8A 5JOQA 1D2AA 4XQ0A 1DXQA 2L82A 1KI8A 3NHZA 2R5FA 3QF4B 4EBBA 2O19A 4GXRA 4N5HX 3M3HA 1HDRA 4FONA 3WIBA 2FFHA 1NU6A 2FP3A 4RA6B 3RYFB 4EJSC 2I67A 2CVFA 4CZ2A 4I5DA 1IMOA 3IGFA 3QBTA 4OI2A 3OZTA 4ABTA 5TS3A 3NYRA 2VTDA 3H17A 4IS2A 3OU7A 1HE3A 2PSFA 4FMPA 5ISMA 1J2TA 4NJMA 3BCHA 3P4XA 1YRWA 1O08A 1PGOA 3V7YA 1D03A 1JKJB 2QG9A 4IG9A 4MV9A 3KOMA 2AQ8A 5DCWA 1GVNB 3AL0C 2H11A 4CKWB 1EGMB 2Q9AA 1W2GA 1YI1A 1N8NA 4HNTA 4EY4A 1N4AA 5J59A 2H7XA 3FKQA 3FVVA 2FV8A 4R3NA 2FUEA 3IBFA 2WNSA 1OLXA 4RAQA 4JLOA 5MDHA 1OJLA 1JHPA 1WVIA 3TMYA 4BYGA 4J1QA 4OHMA 2Y9MB 3WGTA 4S2UA 2DY0A 1P80A 1E9FA 1GGNA 1OGIA 1VPDA 1XTQA 2VUHB 2QZSA 3KPYA 3U7IA 2NXJA 2DULA 4PHGA 4CLXA 4ZKEA 4HNVA 5KTTA 3BAFA 5EZYF 1IH8A 1R0YA 2X0JA 3B6KA 1SXGA 5C1DA 3S40A 3CBGA 4ZK6A 2PGIA 3IBTA 4DMGA 5FWXA 1TE2A 1KQGA 3HU1A 4Q93A 2V3VA 4M1MA 1JEQB 4CQMA 5IYZB 2FDCA