2BGTA

Crystal structure of the dna modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
351
structure length
329
Chain Sequence
b'MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-GLUCOSYLTRANSFERASE
publication title Crystal structure of the DNA modifying enzyme beta-glucosyltransferase in the presence and absence of the substrate uridine diphosphoglucose.
pubmed rcsb
source organism Enterobacteria phage t4
molecule tags Transferase (glycosyltransferase)
total genus 115
structure length 329
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 1994-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bgtA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2bgtA02
3G2IA 2QN8A 3L7AA 1L5RA 3GPBA 3ZCVA 2X0EA 4EL0A 4PQGA 4X7MA 4X7PA 2QRQA 3AMVA 3MSCA 4G2TA 3OKCA 3MS4A 4HLNA 2OFFA 3OTIA 4BQEA 1XL0A 3DDSA 3WC4A 1O6CA 3NPAA 2ACVA 3NB0A 3CUYA 2R66A 3Q3EA 3DDWA 2GPAA 3MTAA 3BDAA 4YI3A 1QKJA 3C4VA 3VDNB 3DZCA 1L5QA 2HY7A 5D01A 1F6DA 1RZVA 2G9VA 2QN2A 1P4JA 1GFZA 1UZUA 2G9UA 3MQFA 2GEKA 2VCHA 1L7XA 2VSYA 3D1JA 3E3OA 1M5RA 3BD6A 3BD8A 1JG7A 3VDMA 1UQUA 1SXPA 2XGOA 4NESA 2ASVA 2ECPA 4WACA 2X0DA 1PYGA 1XC7A 2R4TA 3QHPA 1RRVA 1WV0A 4Z5XA 3MRVA 3IAAA 1F0KA 1WUTA 2PRIA 4XIFA 3H4TA 3PE3A 3T7DA 3G2LA 4RIEA 3S28A 4GYWA 3OY7A 2QRHA 1XL1A 1FA9A 4N3BA 4RENA 4BQFA 3QKWA 2AV6A 2F3QA 2R68A 2BGTA 1FTWA 2VSNA 3OKAA 2X6RA 2QLLA 1Z8DA 3UYLA 2YJNA 4KQ2A 1P4GA 3C48A 4CTOA 1FC0A 1QM5A 2F3SA 1NZFA 1Y6GA 3T3GA 3T3DA 3MRTA 4FZRA 1NOJA 2FFRA 1B4DA 3SYRA 4LDPA 1A8IA 3ZCSA 4GYYA 3O3CA 3G2NA 3BD7A 2QN9A 1FS4A 1JIXA 4FKZA 1LWNA 3H4IA 5LQDA 4AMGA 1C8KA 3IA7A 3CEMA 2BGUA 4RIFA 2XMPA 5TMEA 1RZUA 2R60A 3Q3IA 3NP7A 4WHMA 6GPBA 4M83A 2H1HA 1ABBA 3SYMA 3EBPA 1P2DA 3NCHA 3ZCPA 1FTYA 5DLDA 2ACWA 3OKPA 4AY5A 5BNWA 2IW1A 3L01A 1BX3A 1IIRA 3ZCRA 3MT7A 2ZB2A 1PSWA 9GPBA 3BCSA 4N39A 4X6LA 1J39A 3RHZA 2GPNA 1LWOA 2VG8A 1V4VA 2O6LA 1NZDA 3GUHA 4AY6A 3BEOA 1PN3A 1KTIA 2G9QA 4RELA 2QN3A 2AMVA 3MTBA 2XCUA 4L22A 2KS6A 3CUUA 3T3IA 3L7CA 4KQMA 4F97A 4RIGA 1Z6QA 3S27A 2AW3A 2GPBA 2GM9A 2GJ4A 1XKXA 1L5SA 3CUTA 3FROA 1FU8A 3VUEA 2PYIA 2FETA 3ZCQA 4MHOA 4KQ1A 2GEJA 3E3NA 3G2JA 4GZ5A 1P2BA 3G2HA 1NOIA 3MT9A 2C1ZA 5TVGA 5JTTA 4W6QA 4HWGA 1VGVA 1EM6A 2QN7A 3TSAA 4F96A 3HBNA 2JLBA 2PYDA 4CTNA 3CX4A 3S0JA 1PNVA 3NP9A 4F9FA 2XCIA 2QLMA 1Z6PA 2G9RA 2GT1A 3PE4A 1E4OA 3MRXA 1FU7A 3CUVA 1H5UA 1WV1A 1P2GA 4GZ3A 1JIUA 1UQTA 2JZCA 3Q3HA 1XV5A 2AZDA 3C4QA 3MTDA 3L7BA 3T3EA 2F3UA 2PQ6A 1YA6A 2QNBA 3RT1A 4CDRA 1NOKA 5JTUA 2IYFA 4BFCA 4GPBA 1WUYA 4YUAA 2IV7A 4BQIA 2QRGA 3OTHA 2VCEA 1GZ5A 4NEQA 2FF5A 1XOIA 4WADA 2SKEA 2IEGA 1E1YA 2X6QA 1JIVA 4NC9A 4AMBA 5TMDA 7GPBA 5ENZA 3OTGA 4EL5A 1GPYA 1WW3A 1YGPA 3T3HA 1Y6FA 1C8LA 1P4HA 1GG8A 3OY2A 3CUWA 4MICA 3DD1A 3T5TA 3HBMA 2F9FA 4MI9A 5GPBA 2P6PA 1Y8ZA 3HBJA 5DU2A 3COPA 1Z62A 4MHSA 1C3JA 2QLNA 3CV3A 3RSCA 3S29A 4N3CA 2BFWA 1FU4A 3ZCUA 3S2UA 3VUFA 2SKCA 2QRPA 4MI6A 1L5WA 3WADA 3MS2A 3TAXA 2C4MA 3L79A 2PRJA 2C1XA 3G2KA 3CEJA 3ZCTA 1L6IA 3EBOA 5IKPA 1P29A 3WAGA 2SKDA 5D00A 4AN4A 1GGNA 3BCUA 4XI9A 5C1DA 2C9ZA 2R4UA 2XA1A 1EXVA 4MI3A 1GPBA 3TOVA 2IUYA 3OT5A 4GZ6A 1K08A 2IYAA 2F3PA 3NC4A 4QLBA 4RBNA 5TMBA 2ATIA 2IEIA 2H1FA 2X0FA 2Q6VA 1IXYA 3D0RA 4N9WA 2XA2A 1AHPA 1GPAA 4RIIA 1NVKA 2IV3A 4EKYA 5IKOA 1NLMA 1HLFA 4CTMA 3L7DA 3CEHA 4EJ2A 4M7PA 1L5VA 3MS7A 1JG6A 3UYKA 4REMA 4MRAA 2QN1A 2XGMA 5DXFA 5HXAA 3D0QA 3HBFA 4N3AA 1K06A 1WW2A 4EKEA 2XGSA 4X7RA 2WTXA 4M60A 1SXQA 3MT8A 2XA9A 3E3LA 2QRMA 3NAZA 8GPBA 1FTQA 2QZSA 4RIHA 2BISA 3MBOA 3BCRA 1C50A 5I45A 4YI5A 2JJMA 1AXRA 1JEJA 4LEIA 3RSZA
chains in the Genus database with same CATH superfamily
2AFVA 3OAAD 4ZT7A 1N9GB 1CC1S 4EMTA 1JHXA 4AUNA 1XK6A 2AXNA 3G2MA 2DWUA 3DE5X 2QB5A 3NM4A 4II2A 4JZYA 2NU8B 1OXXK 3QEKA 1ODFA 3GFGA 2Y9MB 3TK1A 3U60B 1QYVA 2IBTA 3SHVA 5EVJA 1GPLA 4BUCA 5E6RB 2O2HA 2X1HA 4W5RA 3C8MA 2J0VA 3OX1A 5TV2A 5ICEA 4XQEA 3LBYA 1Z2AA 2XVZA 2QQ5A 3DV9A 5EHNA 1TZCA 2GN2A 3QI7A 5AXDA 2QBYA 1GZUA 1GL9B 2W2XA 4FQ7A 4B17A 4HNUA 4CT0A 1KXZA 4BEJA 4QTUB 2XZPA 3ETNA 2G36A 3C7CB 2B6NA 1IZ7A 2HYDA 3KTOA 4FKBA 4IH1A 4BVBA 4BVLA 3NPAA 1QTIA 1X92A 1PGPA 2H5EA 2MJLA 1WTCA 5ALIA 3KQHA 2WB2A 1C1XA 4C4OA 5LQKA 3E5HA 3UEOA 4ITUA 2G6TA 1KJIA 2F9MA 3EAFA 5H80A 3FKSD 5JIBA 2L2QA 1E4VA 1KEEA 3NATA 4DSZA 1JU9A 1WDMA 1Y8AA 2PO7A 4LDRA 2IXGA 1YL7A 4WVLA 2GJAA 3L40A 2DBZA 1R6DA 2PKYX 1F8XA 1U11A 5K09A 3OWOA 4K8OA 2QU8A 3T35A 3IHWA 4JGIA 3WL7A 1J8FA 1EE2A 3AEQA 2FZCA 2JCBA 3JU3A 3QYAA 1QQBA 3ZK8A 1XYGA 3GFVA 1OLOA 2R47A 3BH7A 3BK7A 3IUBA 4U7WA 4DMGA 5L51A 1W35A 4HO1X 2GO7A 3TBHA 1SG0A 5JSFA 4YP0A 3KSZO 1BD4A 1HC7A 5LD2B 1PNOA 1UQUA 5JXJA 3FSRA 3NNSA 1AN9A 5AR1A 2JGJA 5HA5A 1T15A 5BORA 4AZSA 1UP7A 4IJ5A 3WK6A 4X1OA 3AI7A 5FUQA 1KY3A 4NF2A 2H4ZA 3IQGX 1JSZA 5JAHA 2D2FA 1I7LA 1NJ2A 5DLPA 3KOMA 4Z7NB 1M34E 1M1UA 1TVEA 1XPJA 3GEBA 3OJEA 4LPKA 2ZU0C 1I80A 1MJGA 1ZN8A 2QGNA 2ZJFA 3I37X 4GXQA 3B48A 4K6MA 3ZHXA 1UBSB 2UUOA 3M49A 3KB1A 3G0OA 3C0KA 4G2NA 2UZIR 3RR2A 1VE7A 4DWOA 3AP3A 3RTCA 2OGSA 3OY7A 5DV9A 2NADA 1AUVA 2HIAA 3EASA 4QGGA 4MQMA 1P4RA 1L7QA 2K87A 3JSAA 5TRTA 3GMDA 3M9XA 5I47A 1FA9A 4UQLA 4JIMA 1U8ZA 4LXXA 3DL0A 3N8DA 4HV4A 1Q2UA 4ARZA 2FMFA 3FNEA 5AW4A 4ZI7B 3C8UA 1IN5A 1TO2E 4RM3A 4DV7B 5GJBA 1BIFA 5TGTA 5B2FA 2VRWA 3X1DA 2N0SA 5J2UB 2AB0A 4LN1A 1UT6A 2VSNA 2XDQB 3GFPA 1U2EA 5AW2A 1KC3A 3DW3X 1TZKA 2CDRA 4LWZA 2FWAA 4Q1FA 3HA2A 4RLHA 1QQ6A 4B87A 3P9NA 1QWOA 1XN1A 4NOJA 5JJLA 4NABA 2PZJA 2V7GA 2MINA 4ZQHA 4ALLA 4YAUA 3Q0TA 4I5EA 4V0SA 3O47A 4ZYLA 4Q7KA 1A97A 1MOPA 4JOSA 3WDKA 4EHIA 1UM9A 2XVMA 1V4BA 3BSWA 3LO5A 1FP1D 4NQRA 4KX3A 4QOSA 3T1OA 4TV8B 1IZ9A 1ISIA 5AKHA 1PKXA 4YJHB 2QVGA 1IY0A 2YY5A 2ZI3A 4DPKA 4S05A 5EP4A 1E6MA 4HRVA 4B09A 5BWCA 1E7YA 3GA5A 5G4LA 3TNLA 2D8AA 2QJTA 4ANFA 1VJRA 1WXXA 2CXNA 1QZUA 2PX5A 2XB4A 3K4HA 5G0TA 3EGEA 3RKSA 2C5FA 3HO6A 3MNFA 4EKDA 4XB6B 3MJCA 3QY0A 5DGCA 5G0WA 1OBOA 3MMZA 1Q22A 3U4AA 3WO0A 3U4IA 1KA9H 2WABA 1TMGE 4ML3A 4MIEA 1A5BB 1QF6A 1NC1A 2BKXA 3NT4A 4YUWA 5DRYA 3WL3A 1QB8A 1ZD2P 2WJIA 3RB8A 4RH1A 4IF4A 2ZROA 3BFVA 2WSYB 2PRSA 2VP9A 1EFTA 1BRTA 3T7JA 3AUJB 1RI1A 1D3AA 4QQFA 5G4KA 4MJLA 5G40A 3ZIAD 4BNDB 1CERA 1RZUA 3KT6A 1HRDA 1ZIXA 4BQRA 4G0MA 3ZDFA 2GS9A 1JQDA 4ZCTA 3L0SA 3FR7A 4A0HA 1WRBA 1FMJA 2EGUA 3QEMB 1T1JA 5CJJA 1W4ZA 2R62A 2H5LA 1ID1A 1OFVA 3C3CA 2VDOB 4MW0A 2CV0A 4FWBA 5MFPA 1WDLA 2ACWA 3DG9A 3RFXA 2C3YA 1Q0QA 4LISA 5B4UA 3UC5A 2L69A 3AG6A 4AJ2A 4ED9A 2VPYA 1XTIA 4ZO6A 3UKOA 3HG7A 5EP1A 3E9CA 4V38A 4AURA 1BX3A 1JXMA 3EIUA 4ARIA 1GPNA 2JEZA 1P7YA 4OD0A 5HM6A 5E7QA 5FQOA 3WGZA 3LNTA 2O3TA 5HM8A 3PUXA 4N39A 2BI7A 4EUSA 1CVLA 1WNTA 5DULA 4IH9A 3X1MA 1NMZA 1OU4A 4WKGA 1HR0B 1O94C 2EGGA 2D0IA 4ZZ2A 3IIMA 1NVAA 2QW8A 5CIQA 3SP1A 4C0BA 4J7CA 1MB0A 3H99A 3IEKA 2HV9A 1SBYA 3WKDA 4ZOLA 5EQTA 1OC4A 1SVOA 1L3IA 2O6LA 4ZO7A 1BFDA 3LG2A 2C58A 4Z2YA 4D74A 3OZCA 1JKXA 2ZAGA 1U8YA 3MAJA 3BEOA 5JATA 2BP7B 1JN0A 1J2RA 2BMWA 3WKEA 4V24A 2G9QA 4MR8A 2JI8A 5IN5A 4ZAFA 4ZVLA 4ZCMA 5JHGB 3ETDA 1K2WA 4WBNB 3L49A 1KQFA 4D25A 3SLRA 2BUCA 3DBRA 2BTQA 4ODIA 4FVTA 1A71A 2KS6A 4XASA 1XHFA 1F8FA 2FPWA 2OC4A 4S1WA 3U5TA 5TQVA 4KQMA 1R8JA 4BLWA 1A9SA 3IR5A 4RDHA 1Z29A 4TPKA 1Q7GA 3HS3A 2ZB8A 2PGOA 3C7AA 4GGPA 3DE7X 1EXDA 1ZRMA 3OIVA 3VH2A 2IYXA 1G5IA 3LC7O 3GRKA 3HRIA 5E95A 2H3HA 5F35A 1TPYA 1CD5A 2VTKA 1VCOA 1IUPA 3LVBA 1AHNA 4RZXA 1EESA 2BEWA 5IJ0A 3QVGB 3BXGA 1XKXA 3BGSA 3ANNA 5CVVA 2RGNA 3ZDRA 3GUVA 2Q1XA 4JB0A 3LX8A 2WYVA 1Q21A 5EWJA 2NO7A 5CCBA 4DY4A 2N47A 5E1DA 3EVGA 3RVPA 4EVRA 4E3ZA 2YRFA 4Y9DA 1NPDA 2JLVA 1DFGA 3DTVD 5DH9A 4ITRC 2LR0A 3PVCA 3JQAD 1KNXA 4XWYA 2HT6A 4PO8A 5I7EA 4B44A 2J5QA 3K30A 4WN9B 3UFBA 3QU5A 3ZY2A 4D9GA 4DFDA 1XX6A 2FPIA 1W0JD 3S4YA 1DLJA 4DA7A 1XZ8A 1TCBA 4GZ5A 5K0LA 2X8AA 4RGBA 3EEQA 3P7MA 1PR0A 3MT9A 1CF2O 1XU9A 4QBFA 3SKXA 2OP0A 1OH7A 4OP3A 3IDQA 3GFRA 1GT6A 1M2KA 1P2TA 3KFXA 1ZQ1A 3PB3A 4HWGA 4W6QA 5FIUA 4DBLC 2I71A 4AP5A 3QV2A 5ES3A 4OLHA 5EMJA 3TSAA 3V80A 4OXIA 3UMVA 4PVDA 1MABA 3R44A 1S9DA 3F5QA 4CLOA 5TVKA 3CLUD 5CLIA 4KOAA 4ZJUA 3PSHA 5CLQA 2H85A 4D4GA 3CX4A 3I72A 5CG2A 1R1DA 3Q9LA 4GLJA 4KHPB 2IZOA 4Q7LA 4ROSA 3GQVA 2XMQA 3D8RA 2PKRA 4INPA 3WTBA 1X7YB 1FBNA 3E15A 2COUA 2JLXA 2Q5QA 3PF8A 2EERA 3PFHA 4R8RA 2KX7A 3IVMA 3FWKA 1KRXA 1KGDA 1OY1A 1JQKA 1IXRC 4YROA 1YOVB 2AJCA 2G4VA 1G8HA 1LW6E 2HGZA 1M2FA 3GJSA 3SE7A 3C6XA 2QLTA 3O91A 5HS4A 3I39X 3U1BA 2BCJQ 1FFAA 4I55B 3ZIAA 3BK2A 1L1RA 2QP9X 5BMOA 1ZJ6A 2NU9A 2G83A 3HVUA 4EUHA 3UXMA 4DEVA 4JUFA 5FO1A 2JAPA 4ND3A 3Q3HA 2O7RA 2PBFA 1DIHA 3IPCA 3C4QA 1O0CA 3EXEA 4DUPA 4DYDA 1RPAA 5K01A 3EZ6A 3CJQA 1DQSA 3OJFA 2XOXA 3KWFA 3UOGA 4CT4B 4V3BA 2ZSHA 4EMSA 4MGIR 1XZJA 5J5AA 2QAJA 4BLOA 1C0KA 4EPTA 2DVMA 3LVQE 5M7EA 3QSYA 2OUIA 2ROQA 3QVVA 3E7XA 2F1IA 1N2CB 1BZYA 2PK3A 4YCLA 2YJ5A 1ZAYA 2ZB7A 2ZJOA 5DP1A 4DLZA 4GPBA 1WUYA 3BB4A 3WHKA 2RI0A 4OQYA 2Z1DA 1FDOA 3F6EX 1Q0PA 5JRZA 1VYHA 2ZSAA 2RCNA 1I3LA 1V6AA 4INZA 4I50A 3I9LA 2J46A 2R48A 4IHJB 1GSHA 1SRRA 2APJA 2R85A 3IOCA 4IXNA 4R7ZA 4UU8A 1NW4A 1XOIA 1P1JA 4CL3A 5A5FA 3K3PA 1EHYA 4ND6A 4KRXA 4JLAA 5J5VA 5JO9A 5TMDA 5FTLA 3KVVA 2ZJBA 4XUEA 3MWKA 3P0FA 5ENZA 2HMVA 2PMWB 5KREA 1CS4C 1RXSA 3MELA 1R2QA 1G7SA 1JB1A 1ZBQA 4LNUA 4XGNA 3FPEA 3WGNA 4A8JB 4BVJA 2GX6A 5BSGA 2ZRMA 3T7AA 1ZGAA 3BWCA 3W34A 2KE5A 2ZAIA 1YQWA 3ACDA 3FFXA 5JNRA 3R9XA 3VSCA 3QV1A 1U2TA 1GDHA 3HBMA 1ZONA 5EMKA 2F9FA 4P3NA 3S2EA 2XKKA 1Z63A 1GCGA 2PX0A 4IIGA 4Q4HB 1NF9A 1Z4PX 5U9CA 1VYUA 4M53A 1AMUA 4FSDA 4BEBA 1ZCFA 2XNSA 2J32A 2G0TA 2GVZC 2HUPA 3G5LA 1S8NA 3SF0A 8OHMA 2WF6A 3GRZA 5KTYA 2F1JA 3BH6A 5BVGB 4M9ZA 5K0SA 5K05A 4YUYA 5CVUA 3WWYA 1KRHA 3UNXA 4ZKDA 4BAGA 4M6WA 1UJ6A 5I9SA 2NZYA 4DV0B 3SYLA 1WXWA 2ID8A 5GMOA 4YRJA 4JA2A 1XJ5A 2OWDA 2YV5A 5IARA 3AKDA 3OCVA 2TECE 1KY5A 3UICA 4DJTA 1QYXA 4UTZA 5KSOA 5CPFA 2J0UA 2Z09A 3WLHA 2B9VA 2C2BA 2VWQA 4QDXA 1GGNA 2B0CA 1A4XA 1HYQA 1KMNA 5H02A 3DTVA 2D7DA 3GPDG 2R7AA 3X1ZA 4BV3A 2Z1MA 1RS0A 3VR2A 2V4MA 4J4TA 4FYMA 1R18A 4CKCA 1ENYA 2Y1LA 5KYXA 3II6X 1KY4A 1DSSG 3SICE 3MT0A 1UJ5A 3IEVA 4D4MA 2QJRA 5KKNB 3CZQA 4GZ6A 3JR7A 4F92B 2ZM5A 2PZ8A 2AMLA 4WCVA 1FSZA 1SXJB 4E7OA 4KUHA 3USES 4DS3A 4MWTA 5EUMA 4LGVA 4P31A 2D2EA 5EKSA 4XEHA 2X8WA 2EDCA 1DPFA 1AKWA 2XYGA 1PGJA 2ZRNA 3IIJA 4TQUS 4F4DA 5BN1A 1FF9A 3AB3A 3AF6A 2CBGA 3M6FA 1L4YA 2X0FA 2ECFA 4MDHA 1LK7A 4LMPA 3O0DA 5C5DA 5IPFA 1PS9A 2CXHA 4ICIA 4GU5A 3MYYA 1MH1A 3CB2A 3EGXB 1QV9A 2M6KA 3OM8A 3UOWA 4OL9A 2EP5A 3A3YA 3HLTA 4RY8A 2IV3A 2XRFA 4IIYA 5ICMA 4L07A 2YX1A 1HT3A 1N0WA 1GAJA 4I2VA 4B3MB 1LPSA 4R3UC 2GWHA 4C0WA 1NV9A 5CH8A 4I8DA 4M1QA 5AM1A 1WSWA 4GWLA 5D3MA 5CH5A 1M1NB 1E2PA 1WWKA 1DUVG 2OLJA 3SE0A 3INTA 4G65A 1KZ4A 3UJ8A 3DB1A 1RLMA 1VSTA 2GETA 1IM2A 1PAUA 4FYPA 4LY9A 2HA5A 4MRAA 1O8CA 4CQLA 3MCTA 2FG6C 3BK1A 5BUZA 2P9JA 3OJWA 5FORA 3H5IA 1UBCA 3JQDA 4LHXA 5DOVA 4EZBA 4IXWA 3FMFA 4IZ6A 4ASUD 1PZMA 3WAKA 2CK3D 4KOEC 1QDLB 4NU0A 4ZMRA 4CUZA 3PRKE 2A1TS 2GK7A 2DLCX 1K92A 3GCXA 1V39A 4GKJB 2CE7A 3G6KA 2JK1A 3JAKB 3KJGA 2FSVA 4M8NE 3JQBA 3W2FA 1I7PA 1B3BA 1QFZA 1XEXB 3D3JA 3E3LA 3P8ZA 4RY2A 3V55A 1SUPA 3KL2A 4IQFA 5JCZA 4NCAA 3LSYA 5EHIA 2WTNA 5AUQA 4Z49A 3JWIA 4B79A 4BNIA 4AKEA 2DFPA 1QHFA 4IV5A 2FV8A 2GERA 1TFUA 2G3YA 2J7PD 1E5QA 4MI1A 3LCUA 5HRUA 3ICQB 1W44A 3NQ41 1KZHA 2R96A 4IUBS 4OI1A 3VRHA 4NIMA 4RVDA 3VR5D 1RBMA 3LPNA 4GHWA 3NI2A 2XB6A 3L7AA 4RCVA 3EF3A 3OQMA 1QP7A 4YHHB 3P32A 3RU3A 5AI4A 4BAUA 2XWPA 3PIRA 3TRKA 3CJTA 2P5UA 2XMGA 4MCJA 4R9VA 2DPLA 5AP9A 2YZ2A 1JBEA 4PQGA 2GHRA 4B3CA 3C45A 2P40A 3P52A 2RSLA 3AKZA 3IEMA 1Z07A 1Z39A 3KQVA 1ZRNA 4G2TA 5CMLA 4TYPA 4TOIA 1Z4NA 4KMRA 3DPIA 4KEAA 4CM1A 1TQ2A 1C0EA 3R0IA 3KKEA 2YJ6A 3NVDA 5IKEA 5JXWA 1J8QA 1VJ1A 3IQDB 1O6CA 3PVZA 5LLSA 1YJQA 3GLGE 1RM0A 1OAAA 3CUYA 4Y7DA 1WZUA 3IVGA 1BA3A 4PZUA 3V6LA 4HWRA 1SD5A 3EIHA 3NVMB 1KIAA 5FBHA 4CGYA 5BNIA 1LC3A 2JHFA 5DTIA 1SIUA 2M2IA 4MS3A 2VNKA 3HJRA 4UDXX 4WNIA 4C7VA 4DQUA 3O8OA 3T34A 1G2IA 2CKDA 4EA7A 2ZETA 5GM1A 4DG5A 3AKCA 1U0BB 5P21A 5KJFA 5JAIA 1CG6A 4K88A 1E3QA 2HA0A 2GEBA 4KNWA 2H17A 3PPWA 3WL4A 3FDXA 3LWBA 4TRMA 1BVHA 1EUCB 1UKAA 2QMUA 3KLMX 1WVIA 2UUAB 1IHPA 2D7CA 4RTKA 3N2KB 3P20A 5BT8A 3FLEA 2WWYA 4D8YA 3ZDEA 4WKCA 3KQSA 4ZANA 1PEKE 2YIDA 4QYIB 4BNLA 4N7JA 1SVWA 4XWTA 3OIDA 2WPDA 3VDQA 5K3AA 3HXMA 1A7AA 4TL9A 1VE1A 1XC7A 4F0JA 3B3QA 3QYFA 3TX6A 3MJHA 2D4AA 1RRVA 4U7HA 3GCGA 3U3JA 3LV8A 2A35A 4CJXA 4D3XA 1DRJA 1SHKA 1T24A 3RS9A 3SYNA 3VYRB 2NP6A 2WWHA 3N0XA 2PRIA 1QO7A 3A27A 4K8RB 2P30A 2QNIA 2GWRA 1Z47A 4JBXA 2C20A 3SNKA 1XD2A 4RIEA 5HFJA 4L8GA 2RI6A 1W36D 4HAZA 3EPPA 1O2DA 2PBLA 2VJNA 1KWGA 1R16A 5IT5A 3WA7A 1GU0A 1HQDA 2IE8A 4YMSA 2QT0A 1CJTC 4L95C 5ITWA 1FZTA 4LFAB 4RS4A 3INRA 3R3JA 1E2JA 2Y9PB 4L8FA 4ENUA 1CR2A 1NVVQ 1UKZA 2HF9A 1JIIA 1MJFA 4RHEA 3D81A 1ZR2A 2FWMX 4CF4A 5G2OA 2Y2UA 4HSGA 1TVKB 1O6BA 4OMFG 3SKYA 4R71A 2G70A 4ZGBA 1F4LA 2XRMA 3TTWA 3U61B 1U6KA 4EA8A 1SBTA 1NNI1 2RC6A 5DXAA 1NNUA 5C1OA 4FE7A 4N7RA 3RJZA 3T0FA 1Z8DA 2IGTA 3F98A 1ECLA 3D6TB 4XCVA 2ZT8A 5FPYA 4H7IA 1FC0A 4H6WA 1D5WA 1CUAA 5HF6A 2P41A 1E3EA 2O07A 4YAWA 4JYZA 4B83A 4L72A 3ZH9B 6LDHA 5CM2Z 3PX7A 3GA0A 3E1KA 4KWTA 5CP8A 4IQ0A 1SCBA 4N47A 4CM7A 4C7OA 3RK4A 3JVDA 4A8HA 4PX9A 1YUBA 1EXWA 2PH1A 3LDFA 1LVUA 1EGAA 3R7FA 3WY9A 5F5NA 5JI3E 1KS2A 5JPCA 4TQAA 4I4IA 2H3EA 2CHUA 5FUVA 3F74A 3OHMA 3QKUA 5HR5A 1C0PA 5LYJF 1NHGA 3GWZA 1FX0A 4E5MA 4BY9E 4LWOA 4Y2PA 3RYIA 2VLBA 3KQLA 3I61A 3H8VA 1YU9A 3M6LA 1PJZA 4Y6LA 5HFNA 2XDYA 4DM7A 4DUGA 1NQTA 5KUTA 2P6MA 1IRXA 5SYAA 3VYSB 5JOQA 5LM3A 5HFAA 1FS4A 1CR0A 5FPKA 3VR5A 3IOEA 3Q9SA 4QXMA 5F2EA 4DQKA 3BIXA 3UK7A 4PTYA 5HIIA 3TZHA 1GV0A 1REQA 4FC6A 3P2IA 4WY2A 3RC1A 5LMUB 1L8XA 4ZGWA 2YXEA 5DHUA 3OCXA 1WEKA 4DDKA 2V0GA 4BFVA 3W9BA 4J6EA 3IQHX 3NJ4A 3TLXA 3F5DA 4U2DA 3PPYA 3AHCA 1RD4A 5DEOA 1W6RA 2D0OB 2I3DA 4Q6BA 2YYAA 3C97A 2XE6A 4WHMA 3IXLA 1ABBA 2FR8A 4EEKA 2JD2A 1LW7A 3WGQA 1R8QA 3SYMA 4M4SA 5J1SB 2QYHA 4ZODA 2BGRA 3RPEA 2X41A 2EYQA 3TL6A 3V9PA 1IZ8A 3UGQA 2H48A 4AM8A 1TVMA 3LGAA 2P3LA 1XXHB 4O63O 2O7NA 1EK1A 2XWSA 4KYVA 1IWOA 4YDQA 3MRSA 2PVSA 1LDYA 4LDNA 3V46A 5MF6A 2W2LD 1V16A 4MW5A 1YR1A 1GN9A 1TLFA 1Z37A 4J29A 1SQ0A 1AXGA 3DVQX 2OB2A 2HL6A 4CZ2A 3OPMA 3QEOA 2HSZA 2VAVA 2F62A 3BCSA 1L5MA 2AXPA 3MWFA 5HKOA 3HB5X 1P0FA 4HVLA 5LZ9A 2JLZA 1F7VA 4GDMA 3THSA 3FX2A 4L57A 4YJFA 2GESA 3FYHA 3OETA 4RWZA 1VPTA 3QWFA 3QPAA 4DV5B 1F7UA 4ZQBA 2XCQA 4YECA 3WB9A 1NXXA 2IU6A 1BMDA 1O4VA 3W05A 4L7VA 1O1YA 2Q8NA 2VG8A 1DC6A 4V0LA 4F60A 3BMOB 3WFJA 1CP3A 1Y80A 3W8FA 1XHLA 3N3AC 1OLSA 4IJQA 3TZKA 2IK8A 1DIBA 4Y0AA 4BYMA 4LQCA 5T5QA 3MFYA 2C61A 4PRYA 2BGKA 3DBOB 3LS2A 4QXQA 4ZOQI 1RU3A 2H0RA 3QQPA 1I32A 5JEEA 5AKEA 5FRDA 3ULKA 4HBZA 1PT7A 2YYZA 2O8CB 1E5VA 3HYCA 4C21A 1A9RA 5C1PA 2A0WA 1G55A 4TXJA 1R4NA 2YHIA 4FE3A 1QGUB 4P4TA 3IDSA 4NV3A 4XXHA 2H1WA 4J9VA 5K3EA 1PRYA 4GBGA 1O0SA 1GXSB 2WPNA 1ZJZA 3O2NA 3OQVA 5DIFA 4CQMA 3SC2B 1ZK2A 5JCPA 1DPGA 1IWPB 1O5IA 2OK8A 4AECA 4AN1A 1SWVA 1UR5A 4FZVA 1XQXA 4HP8A 4INAA 1K7CA 1T36A 1LRLA 2OG2A 1QIGA 4ZT3A 4DR2B 1JIQA 3IAHA 1QSGA 5GJVC 4DIEA 5DJ5A 4PVCA 1PNQA 1EI9A 1RZ3A 3CA8A 3CLUC 5FTNA 1D2GA 2JGIA 2ZYTX 3LPCA 2J9RA 1CRZA 1G7RA 1HA3A 3K6JA 4G81A 3TL3A 3K71B 1I33A 1V11A 2EJCA 4KZPA 1Z4OA 3W7AA 3G8AA 2PMDA 5AJYA 4OHYA 3LOPA 1EGHA 2Y93A 3OCWA 2WD9A 2SICE 4JLKA 521PA 2QENA 2BFBB 1MW8X 2PPVA 4UOZA 1M67A 4CG1A 2VK2A 3EN0A 1ECGA 1WR8A 2VXCA 1MX1A 2JFZA 4GI7A 4R1LA 2WW8A 3KUCA 4POOA 3PTAA 3ADDA 1KJ9A 1XG5A 2C9BA 1VGVA 2PZKA 5IC4A 4QATA 1F8YA 2C29D 1FYFA 4HVCA 4I8XA 4RQAA 4D9FA 4F56A 3I6QA 3STWA 3RVJA 2CXOA 3AJRA 1WZEA 4N12A 3OF3A 1YS7A 2FKNA 1QONA 2PO5A 4FEAA 2YICA 2E49A 3AR8A 4BRZA 4E09A 2NOAA 3TNJA 4PR3A 3H5AA 5DWDA 2JD0A 4EZEA 1YF3A 4LY3A 4Q1CA 3U31A 4GF5A 3ZE8A 1RTTA 1W88B 3AYXB 2I4NA 2VRCD 3A6DA 1YRHA 3FLMA 2FN7A 4O2BF 5BPHA 3A1CA 4V02A 1TZMA 2IPNA 2ZZMA 4NZPA 2H08A 2ZS7A 3BOSA 1QH8A 1ADFA 1AUQA 4MV9A 3ZWVA 4NYJQ 3NONA 4BO3A 2EFCB 4C6SA 2ZAOA 2C0QA 3B9QA 3EXG1 4HPXB 4YR9A 1COZA 3IP3A 4PAMA 3IBCA 1NMYA 1TD1A 4GZ3A 1GDDA 1KU0A 5J2TF 1N36B 3KELA 1EG7A 5HZGA 2JZCA 1X94A 2P4QA 1YL6A 2IDZA 4HNHA 4P33A 4LGCA 1IN8A 5E9WA 2XCRB 3M4JA 4NBWA 4N7MA 1NUSA 5I48A 3CS3A 4IKPA 3B3AA 4GUAA 3F97A 3HBAA 2BH2A 1IXZA 4QOEA 1M1ZA 1OXBB 5JD4A 2RHHA 1DMSA 5FTWA 3LUBA 2C4NA 1W25A 4RVSA 1OPXA 4W63A 1PVDA 1QX4A 5CNKA 4WOJA 3WYGA 4ZYWA 4O3MA 3AF5A 3LX4A 3EC2A 1FSFA 1KARA 1I5RA 1ZW1A 3VR4D 1ITZA 1QZXA 3DKVA 1JH8A 3TMAA 2PUTA 2FSHA 1WXEA 2W8ZA 2G04A 3ZJ5A 4EVQA 3IODA 3SHOA 1HTWA 3REQA 1TD9A 4B5KA 2JBAA 3K09C 4WNAB 1GYQA 3F7NA 4FE4A 2OECA 2GPTA 2QL6A 3TW8A 3ZBUA 1GCUA 2G17A 4RZHA 3T9EA 4EK9A 4PLGA 1F2TA 1XZAA 1Z9BA 3LT4A 3N6XA 2PH7A 2OQVA 2GILA 4PSKA 4E7PA 2J5BA 2DC1A 4KG7A 2K2QB 4R2KA 1RXCA 3ESBA 3CH5A 4X41A 4X60A 4ZOAA 5BN3B 4QVIA 3Q7QA 3ZGNA 3FYDA 1Z6XA 3SK0A 1Y9AA 2XQIA 3A2KA 4WWHA 2WP0A 2QLNA 1ELOA 3HCEA 4LF5B 4RWEA 2XBUA 3ONNA 3DTNA 2WNIA 1H4SA 1IJFA 2Q9UA 1JQ5A 4QNRA 1MZPA 2DKOA 2H9AA 3I6ZA 4Z8YA 2I2AA 3LBAA 2ZZNA 3RRNA 4EG3A 4PIPA 1BS9A 5IN4A 1O6FA 1U2ZA 2ZRHA 4FFMA 4XSGA 5CRIA 2EC5A 4HGRA 1VI2A 1TZ2A 2BZGA 4NEHB 3AO0B 1TMOA 4ETWA 4R9SA 4OIMA 2ZTMA 2MHCA 1SD1A 4YLEA 3IX7A 1OWMA 3SHQA 3VI3B 1EFPA 2X2FA 3QVLA 3S99A 3LPAA 3CNOA 3CPJB 1N7IA 2P27A 1B8PA 2ZKIA 3PQEA 4MW7A 4AWXA 5JQGF 4K03A 3BAFA 3C87A 1FYVA 2ONYA 2LKDA 3UWPA 1Q11A 2GOYA 5IC5A 1X1DA 2XD9A 3PNQA 4U2BA 4R98A 5EJ5A 1LVGA 1MQAA 1QIIA 3UO8B 1VHJA 3OT5A 2I78A 4C3ZA 3LZDA 3WWZA 4X97A 3SX2A 3OI7A 3F2IA 1PG2A 3STYA 1U8AA 1YR3A 3CXUA 1KOGA 1JHUA 1C7ZA 2XGJA 1DBPA 2CBZA 2GJ8A 2O7QA 4Y1EA 4CG3A 5BNFA 3L9XA 2H4WA 2VPPA 1U81A 3E5NA 2RMKA 1K7YA 1V8PA 4YRQA 3EAQA 5F9FA 4GBED 2DECA 1NUUA 4JGGA 1A3CA 2H1FA 1C4XA 4NYJR 3NHWA 5BSUA 5CXUA 4FUQA 3DYVA 2GJ9A 1BDBA 4MMZB 3L93A 2Z5FA 2FMXA 3V1LA 3RRFA 3WWEA 2P9GA 4N9WA 2NZUG 3D43A 1D8AA 1WO8A 2L0XA 2ID4A 1SCNE 2YV1A 3ECCA 4IM7A 2OYRA 4BASA 3MPUA 3SLGA 2VRCA 4FBGA 1W581 2WKWA 5EMMA 4F45A 5LOVA 3K73O 2BRUC 3D5TA 1BXZA 2BEKA 3SD7A 1CZUA 1VSQA 5DCWA 4OAOA 3N7TA 3DXFA 3OEHD 5CXQA 3GJZA 1I7NA 3PFFA 4Q05A 4GOLD 2C9CA 5T41A 1NXPA 4DQ0A 4EW6A 4AKTA 3ZY3A 3OTOB 2X9QA 4NATA 2C5LA 3PWZA 1J0DA 4KR0A 4Q7MB 1DXQA 4BC1A 4GX2A 3R7BA 1IZ0A 1PG0A 1A4IA 3WI7A 1GY8A 4U0KA 4YA6A 4H1TA 1O7JA 2QI9F 1ZUIA 4Z53A 2V58A 4WESB 4QO8A 5C1BA 1TT5A 1IY1A 3UMFA 4UVGA 3D8SA 4LJKA 3U9TA 2QD2A 4UCFA 3SS9X 3A1WA 3DJYA 1N2IA 3RKUA 2ORVA 1I1QB 2VJDA 4A6PA 1SUFA 4ENSA 4GR5A 4B34A 2JH3A 4B2YA 5GWXA 1ZD4A 1DO2A 3B13B 4RPJA 3UFXB 3MFQA 3EZ7A 4FFSA 3U0BA 4NCKA 3KBBA 4XE5A 2WIAA 2CC2A 2F48A 4NJOA 1U0EA 1ZN9A 3NXKA 5KYVA 3VR4A 5AWFC 4A8PA 1DEXA 1GU1A 4GX1A 2OWEA 5TE9A 2YMPA 3EVCA 3EQ7A 2OCGA 5BMVA 2QZSA 4ND5A 4I08A 5A9TA 5H8WA 2VT6A 2NYAA 4H7DA 2FFHA 1FBTA 1L7RA 1U7XA 2D2IA 3JD3A 3T9FA 1FJGB 4QRIA 1W75A 3DQZA 3S68A 3GEIA 3NOQA 3CC8A 4BNHA 3PLRA 1E77A 1B16A 1I6KA 2GAFA 1PFWA 4GXNA 1YQGA 4HQKA 5A7HA 4EENA 4YV1A 4FIZA 4JVSB 2C4TA 3HP4A 4JWKA 1NI4B 2HU5A 4YXFA 4KMOA 2QU7A 4QUHA 3AM4A 4AFNA 4AMUA 4RJJA 1XTBA 3FHCB 1XA3A 3V2GA 3DNFA 2IHUA 2EJBA 1M3SA 2AG1A 2P2GA 3M1IA 4HWPA 5D3ZA 2IYPA 4DEXA 3QP9A 3BF8A 2ZWIA 1PWZA 2ZXEA 3R5JA 1U63A 5B3JC 2HHAA 4OQDA 3RSQA 4B3XA 4ZU3A 3LCRA 1DFIA 4M0MA 5DGDA 1M6HA 3NW9A 3ZWPA 3VFDA 5IAOA 2QR2A 2XOKA 3UB4A 1FFBA 2B8NA 2G7ZA 4KK3A 2AFHE 3CU5A 4A6DA 1YDWA 4YN3A 1HUQA 3VAYA 3LC0A 3QOXA 1T6YA 1HDRA 1LUAA 5DKFA 4Q9HA 3HKBA 5ADVA 5IJZA 5HK8A 2WJVA 1DBWA 1J0BA 1JKJB 3EVTA 3EXHB 3MTAA 2P78A 4HDMA 4MUJA 5EKTA 3QWIA 4BB0A 1MGOA 3MIIA 4CEJA 1P17A 2HGSA 3ZDDA 1QOQB 2D5CA 1LI5A 2B4KA 2IITA 1MXHA 2WG1A 2YIVX 4GKKB 7ADHA 2VYNA 1ZGCA 2V45A 1G7CA 1Z0JA 5C4IA 1AQIA 1M1YB 4TN1A 5CUQA 3QG1A 4IDQA 4OQEA 1JE0A 5A04A 4J03A 4BNVA 2X9VA 1E2DA 2AFHA 4S0ZA 3WB1A 1Z83A 1X80B 2JFVA 5KSYA 4ZT2A 4GOKA 2HWXA 2DFDA 3HGTA 1JG7A 1ZD8A 1IY2A 4DDMA 4EX7A 4EGSA 3G82C 1C80A 4RD3A 1B1AA 1IHXA 2ECPA 2V7EA 3O7MA 3R0ZA 1P31A 4LZJA 3KVOA 4M86A 4FLEA 3RWMB 4FR5A 2QXTA 3FMPB 4XQCA 4E5UA 1R3UA 4Z5XA 1NUHA 4CMKA 3VU9B 1X7WA 1TOAA 3NEPX 3AJ9A 5KYNA 3FPFA 4B73A 3S8EA 3OFND 4QASA 3G5TA 1K7XB 1EZ4A 2HLPA 4Y9UA 3N5CA 4QPCA 4TZKA 5B1EA 3RS4A 1MX3A 4CMIA 3KEOA 3ILSA 1QRAA 3M82A 2B21A 3OZIA 2QRHA 5TQ0B 3B1YA 3AW8A 2ZJ4A 1FNMA 2EIHA 3KSBC 1LSUA 1LFAA 3EZGA 1C7IA 1I3CA 1NBOA 3URMA 3OEHA 2JI6A 3QE0A 3OVMA 3O21A 2HF7A 3R0VA 3WLQA 4BO8A 1MQSA 2PQ0A 3DOFA 3AESB 1O57A 2OCIA 4BYGA 4ZK6A 3RRMA 3VNRA 3FSGD 2C78A 4GMHA 2R68A 4RESA 3F5SA 2WA1A 1CQJB 1KAEA 3VKVA 4ESVA 1SA0B 1R6BX 4MWDA 1V95A 1NN3A 4U7GA 1CJKC 1GEGA 1NR7A 2IYQA 3FXAA 3ZYZA 2ATEA 1RMTA 3VSEA 1X1RA 3R3VA 4XX0A 4IZHA 1YUMA 2Q49A 1PZXA 3MJSA 1JXAA 1P6XA 2KYRA 3GAFA 1NY6A 2VCYA 3I8OA 3RADC 4KLRA 2HRDA 2PJDA 4PZLA 3CZ9A 1EBUA 4JK3A 2QSZA 2PEYA 3UCEA 3PGVA 1C3OA 1OBHA 4NENB 3T5AA 2I67A 1EFUA 2EATA 4R8MA 4G24A 2B99A 3CX3A 3D3WB 3Q7SA 2AD5A 5EKXA 5B37A 5EZQA 4I1YA 4RTMA 5BR4A 2JB9A 1MJ5A 1KAQA 2JFXA 2ORED 2B94A 3OZXA 1B73A 1E7WA 1W1IA 3PEUA 3VOBA 3W8NA 3S2GA 1NHWA 1R7RA 3H2YA 4MVYA 2QTRA 4PNPA 1S2DA 2EGHA 2WMNB 1P81A 4GWGA 5JAUA 3O3CA 3UAXA 3G8BA 4JY7A 1QGAA 3OUZA 4GMFA 6YASA 5KO2A 3S6JA 4HZUB 4DHEA 1QQ5A 1SU7A 3IUJA 1Y33E 2VK8A 4FKZA 2ERXA 4HDKA 1E64A 1KDOA 1T2DA 5AJWA 4B4OA 4D45A 4QWMA 2WSIA 1UDXA 2RGXA 1LWNA 5B7NA 4F4UA 4RFSB 4RU1A 2NO9A 2IXBA 4GX0A 1IVSA 1K0UA 4J49A 3L5OA 5LA6A 2DHCA 4KRYA 3ZE7A 3ROFA 3RWOA 5D7NA 1D07A 2ZB3A 4RIFA 3Q8MA 4LJ4A 3VKHA 4JT2A 5K3FB 1QB7A 4EYEA 1AURA 2PWAA 1VPWA 2XXAB 1B7GO 4Y2RA 3TVYA 4KZKA 3LTNC 1TW2A 2I80A 4LMRA 5C34B 3RRJA 1O96B 1XZBA 2Q5JA 2GZ2A 5HG0A 4AS1A 4K2AA 4G23A 4MV3A 1FTYA 4LW8A 5JU6A 1GSAA 3JWEA 4GVXA 4RVNA 4DBVO 3AEKA 4D0GA 3PYXA 3QNUA 3DZHA 2CLLB 1FCJA 1FMTA 1ZH4A 2HC9A 4PNEA 2E5FA 2YQZA 1TI7A 3SC6A 4AJOA 1LLCA 1K3UB 2WV7A 1YKFA 2IHYA 5DHRA 3H04A 1DEHA 1GPMA 2G1UA 1PSWA 3M9WA 3TEFA 1MEEA 4UM9B 3MLEA 1MA3A 1BVYF 2P2ZA 5DASA 4WMLA 3SM3A 3SSOA 3NBFA 2XQKA 5BWBA 2WJGA 4Z1OA 1ZDMA 3ANTA 4IMPA 3N2EA 1U7TA 2R751 4QTXA 4R83A 1YNOA 2XR1A 1DADA 1B0AA 2CUKA 1VKRA 2YXBA 1Y3CE 1C30B 2RK4A 1P44A 1YBAA 2J4DA 1Y4ZA 3UJHA 4B31A 5CFNA 4I4LA 1ZXLA 3DZGA 1ECJA 3OQJA 4WLOA 3VTZA 3ZU2A 4PBTA 3EMVA 1EX1A 3QBTA 1G17A 1NVMB 1CZHA 1XRNA 2QV7A 4ZZIA 5L7TA 3K1ZA 3EE6A 2WWTA 1KFJB 5DK6A 5EWLA 1CJSA 2YWBA 5LDGA 3TIVA 5AK5A 1PIWA 3OWHA 4TZ0A 4FJ0A 3K0FB 3B3JA 1E0KA 3PFKA 1RQPA 5AW0A 2K6GA 2ZE6A 3CNHA 4A0RA 4BNUA 4KDRA 1SK8A 2ONJA 4YJ2A 1CUUA 1M8FA 2INGX 1HBJA 2OG1A 2WJYA 3IAFA 1G42A 1Z7BA 3CTMA 1ORVA 1OI2A 2E1RA 1S1CA 4F2PA 4R69A 4Y6OA 2HMYB 3S7ZA 5CLGA 1RHMA 3KJZA 2GGSA 3LY5A 3AXTA 1YFLA 3E7FA 4P34A 2X2EA 5KYGA 3SVTA 3D0OA 5K6AA 1I4TD 3M4ZA 3QLTA 2ZDHA 1RE1A 2ZBPA 4HQNA 3TXXA 1Q50A 3GN1A 1JLLA 2J59A 2BFPA 4LYYA 1FVXA 2X7HA 1M0TA 5LU8A 2Z6VA 1T0HB 2Q4OA 4RW0A 2YC4C 4LS3A 3LBIA 3RH0A 2XIJA 2VJLA 1J9EA 4HY3A 4OHWA 4KXLA 4K0RA 4W6ZA 2R86A 2ZUWA 3SXUA 3WRWA 4TWIA 3ZD7A 3C6KA 4D57A 1FDUA 1WD7A 2OKGA 2Q07A 4UTVA 4Q3BA 2HIHA 3PQ6A 2FZ4A 5TVGA 4BNKA 1QZ3A 4OHFA 4US2R 1JB9A 1U0GA 4H18A 1NVXQ 4F86A 2ZIXB 1MPXA 2VHWA 3D6VA 3QA3E 4QOIA 4XWKA 1PJTA 3HBNA 3A70A 3GXBA 1N2EA 1PJAA 1WVGA 2AA3A 3IKVA 3MCZA 3NU1A 3NX4A 5HQ3A 5CGZA 4QPNA 1SO8A 3SOPA 2E4VA 1LLQA 2BBSA 3KYDA 4H1VA 4L9WA 4KXWA 4ALMA 4CV0A 5EJIA 1LJLA 4FW8A 2D0PB 3CVWA 3URKA 1WZIA 2WJHA 1MG0A 3ENZA 3ONFA 3Q3JB 4I9GA 3MGGA 3VAAA 1XJWA 5JEDA 2XB8A 3AYZB 4RADA 4MYCA 5SZKB 3T1TA 1K66A 1TL7C 2AMJA 1LPBB 3K32A 1GRNA 5IEBA 4BCBA 2B5VA 4RMHA 1KEVA 1U1CA 4IAOA 4KAAA 1Y5IA 3WJAA 4EH1A 5HHTA 3DEJA 1KQNA 3SVZA 3HJTA 1HNXB 3RSHA 2WAXA 3FGPA 4XJTA 3OA0A 1BN6A 1XMXA 5FUWA 3E5MA 3JRWA 5EIHA 3TJRA 5HW0A 5HJEA 4MZDA 3K15A 3OOSA 2WF8A 1EUYA 4F1WA 4X44A 1L7BA 2JHAA 3R5SA 4DV6B 4JZKA 1Z35A 3GBVA 1T6NA 2OV2A 2O5VA 3A6ZA 3V1UA 1DKQA 4UUBA 2F3UA 1A96A 2YQ5A 3B85A 4MVCA 4B6RA 5JWOA 1T4CA 2QNBA 3PLNA 4LKRA 2ZRDA 4XLLA 1W48A 4PHGA 2A9FA 4YLGA 3EZXA 1ZRSA 3BSYA 3T5MA 2V7PA 3M2PA 3DNPA 3HKEB 4HLCA 1D7AA 4BGVA 1QMPA 3KETA 1W0KD 4ON9A 3O9VA 1TU4A 3HDGA 5AKYA 1TM7E 4URXR 4NC9A 2AHOA 1ML4A 1E7MA 2WIFA 1YZLA 3FH0A 3J80A 1PJ8A 3LUHA 1FOEB 1RBYA 2Q1WA 4JLOA 7ABPA 1VBMA 2XIQA 3HY3A 4W5NA 2PLFA 1QJCA 2Y1DA 5A05A 1GKIA 1D6NA 1Y6FA 1U3GA 3DDCA 2PFKA 2ZUBA 1TYCA 3K2BA 3BA1A 1ENPA 1L8QA 3MCUA 1KI4A 3TWOA 1YMVA 3R3UA 2J3DA 4JQSA 3TZCA 4R0MA 1UP4A 3I1YA 4YRTA 4NFYA 4XUCA 2OHOA 2BI8A 3DUFA 4Q15A 5JAPA 5CDUA 4ZPXA 5BOVA 5LLTA 1LEHA 4QULA 3FIUA 4HQ0A 1HTBA 3E22B 1J4AA 2EYUA 4OBXA 2B1GA 2BKLA 4NMHA 3K0AB 2HEGA 5A0VA 4IJ6A 3IAUA 1DGQA 2IYNA 5M29A 1BO6A 2Z5LA 1PX2A 4CG2A 1TKCA 1CR4A 3QUCA 1ZHOA 3IGFA 4X1KB 7MHTA 3MG9A 1NC3A 1VXRA 4M0LA 1U9JA 1L4LA 1YIOA 5CX1A 4BJ5A 2GCPA 4D9NA 5LKAA 1O58A 2XGGA 4KI7A 1BGWA 1FP7A 1PU2A 1T10A 3ICPA 3NHZA 2PUHA 4ZJYA 2X7JA 2PWPA 3B8EA 4LE2A 4R7TA 2DJ5A 1QQAA 5M3BA 4KK4A 2FA9A 2KQUA 2DYKA 3D0KA 4RLSA 1RI3A 2IFTA 1EVKA 4YEDA 2X5OA 3R6GA 1I1NA 1RQLA 1LQUA 2QVLA 3CCFA 3IDOA 4IWYA 2FZWA 5B1YA 2LW7A 4A82A 2JA1A 2VDRB 3LQ1A 2J85A 2C9ZA 3NYRA 4FCCA 1CBUA 4ZALA 1PEYA 1W94A 1R6XA 5LYJB 4AWAA 2IWHA 1CYDA 3W5IA 1HE4A 3MVEA 1LNZA 2CB9A 4C0QC 1CETA 1HV8A 4L8WB 1A2BA 2IYAA 1FS6A 1H93A 2M9MA 4DPLA 5L4LA 4BE7B 1XDSA 1FSGA 4OREX 4F4IA 2KPOA 3PVSA 3PWTA 2Q2VA 3K9FC 3TD9A 2GXSA 1SC6A 2BSAA 2PVCA 3EG9B 3G0GA 3HDVA 3E81A 1PK9A 2G7MC 4WZBE 1TA0A 1QK5A 1OXSC 3W8EA 1DCKA 4LQ4A 1IXYA 1ORHA 4S24A 3VTAA 3RNOA 5F5LA 2IPMA 4CYMA 4ZN6A 1V1RB 2AD1A 2AOTB 2BMJA 3HCCA 4X8OA 4IHAA 2DFVA 1CUBA 2IWRA 5KHOC 3HM9A 7AT1A 4G1UC 4F3NA 2OMEA 3CRRA 3SX4A 4LHEA 1CRPA 3R9IA 1LI7A 3FLBA 2O3SA 1MUUA 1PJLA 5HKKD 4DIOA 4FEGA 2CLSA 1YASA 2DR0A 3DOJA 5FBLB 3UTDA 1ADJA 1USGA 3IP9A 2WYOA 3TQCA 4IDBA 4EGQA 1DQNA 3EWNA 3KT3A 1YB7A 2PFSA 4QUJA 4TS4A 4YP6A 3SQNA 4KL8S 2ZWVA 3OZDA 4TKVB 621PA 2NXNA 1J7KA 3GJ4A 4IV0A 3UV3A 3KJFA 4C4ZA 1GYPA 2AF4C 4FYIA 3V2UA 1GRCA 3VPCA 3KKNA 1ZK4A 4N8EA 4YYZA 4AY3A 1G6HA 5FR1A 4XM0A 3KTAA 5EERA 1T2AA 2DSNA 4YASA 3WKBA 5IFKA 4BAZA 2BLNA 4XTCS 1HYHA 2H2HA 4YUZA 1U3TA 2J7KA 3HJCA 1EWQA 5DN6A 2OFWA 3FWZA 1GJRA 2R1TA 2YVAA 3NDJA 1N0UA 1RI5A 3NOVA 3S70A 4KXMA 4F5EA 3MLAA 3BJZA 3TAHA 1H8HD 1ZA2A 5KDOA 3K9QO 4O25A 2H31A 5IWAB 3K70B 4RIHA 4DLYA 3D1VA 3BB3A 4ZQCB 5F12A 5I45A 1U28C 2QGZA 4B71A 4ZZ3A 1B0ZA 1P9WA 1ZR4A 3C2QA 1E5TA 1QAOA 2ZI6A 2VNSA 3NIDB 1W9MA 5JG7A 4EUEA 5F7ZA 1ZLYA 4G0UA 1DE0A 3QVMA 1JIKA 2ADOA 4N7BA 2NXEA 4F84A 2HK9A 4GRDA 2WYIA 4B32A 4JJAA 1VIMA 3SBOA 4ZFNA 2B8EA 4HGPA 1DBRA 2O8BA 1J1ZA 3SFZA 1M73E 1JV2B 1PTJA 1WF3A 3PXXA 4YO7A 1ISHA 1RWPA 2W2KB 3WK9A 2Y0EA 1F2UB 1X1QA 4X7MA 4BMYA 5C8YF 1W76A 1MB9A 2ZYSA 1P1IA 1ZAKA 2VIIA 3CY6A 4KKXB 4UHFA 2OXEA 5FF9A 2EZ4A 1UBOS 3FG9A 4P35A 2CKMA 3UKJA 3O8LA 1CUIA 2I87A 3CURA 4HLNA 4KVZA 4O4JA 4DJ5X 4DA4A 2IV2X 4KXNA 3I2JA 1P5JA 3O38A 4BS9A 4TM7A 4YJGA 5DGHA 5DNEA 1RCUA 4DLRA 1IOWA 4ZTUB 4MWEA 3ZLJA 2Y1WA 1ZPDA 4GPTA 3PC8A 4Q7QA 2NSYA 1ZGBA 3FUUA 1M2WA 1NUTA 1RTKA 2JJ8A 4HDRA 2HRBA 3EZNA 3A05A 3QELA 4KODA 1FLNA 1U31A 4XYGA 2H4HA 4BECA 4OMDA 3FVVA 1K97A 4IEEA 2A1UB 1XNRB 3CB4A 1YE3A 4LJLA 3QWAA 3SI7A 1WMAA 1A9YA 5JJIA 3GT3A 2ANCA 2I9PA 1T4MA 3ORSA 4HFRA 2NWQA 4TUYF 3AHDA 3AERB 4DBZA 1SCKA 3OOHA 1L7PA 1Y6ZA 4OFBA 4UAUA 2AN9A 4BV9A 2PUCA 4KO4S 1T4GA 1F4VA 4I0WB 1RE0A 3PNPA 4LSMA 1FUUA 2QQ0A 1ADCA 3H1GA 4B7CA 1H6BA 3ZDAA 4G0WA 1AJEA 2J31A 1P74A 1GL6A 4HGOA 1N6LA 3O8QB 1UWVA 4HZGA 2PV7A 4OLFA 4DIFA 3HJUA 4PG8A 3A4TA 4O3FA 2Q6OA 5CH3A 2PZBA 1UBJS 5JMOA 2VNIA 1QG6A 2IUEA 2O0MA 4IBOA 1U6IA 4PZEA 4B5LA 1NW5A 2F90A 5IM4A 4O2BB 1NLFA 1M2HA 2OAGA 3DMRA 3G2LA 4BJHB 2WM8A 2ZJ3A 3GFQA 4ER7A 4YRGA 1D5CA 3D1LA 4XVCA 3PRYA 4NZ9A 2YVKA 1TYZA 2X8JA 3EPJA 1XRRA 4NS1A 4J4HA 2Q4TA 4BV2A 3AFOA 2EFGA 2QPTA 3WWDA 2Q3HA 2VSXA 1GAWA 1QVVA 3DHWC 3R4CA 5HKKA 5IG2A 3ACBA 5J2TB 1X7ZA 3HCAA 3IS3A 2HJVA 3CHYA 1QC5A 1ZH6A 3LWNA 4LIPD 3SHFA 3HMKA 1RQ7A 1ZFNA 5HE9A 3H2HA 1Q0UA 3OKAA 1O5OA 4CM3A 1SQFA 3HTXA 4FHDA 1O8BA 1LBHA 2GYYA 1YTUA 1QV6A 4CMCA 3KJHA 4EYGA 5DX8A 3C48A 1L7AA 1A1VA 2V1UA 3ICOA 4TMKA 4U7DA 3QFSA 4IRMA 2WYUA 4JYCA 2AMYA 2NU6A 5I3CA 1WY7A 2CFRA 3DCJA 3T3DA 3VHQA 4F04A 5LSAA 2BGMA 1ONSA 2Q99A 3HB0A 4RK1A 4F8YA 3A9UA 3CLTD 2Y0DA 3OZWA 3TSOA 3JRXA 2AXQA 3LK6A 4AMYA 1GLVA 1SOAA 1P1HA 1X8LA 2WR8A 4BLPA 3GJXC 1H8HA 3R5TA 2V6GA 3ZBPA 4LVUA 3CZCA 1KH2A 2GH1A 2PFGA 3FYCA 2GCOB 2GTIA 4KV7A 4WINA 2X4LA 3FCXA 3EYAA 5AW3A 1DJMA 2QPLA 2DBQA 1HG0A 5AM4A 5EZ5A 2O54A 4R0VA 4LOJA 3ROZA 4DRYA 4KLCA 3COVA 4URHA 4IF6A 1UJCA 1Y34E 1GG9A 1BFKA 2R6JA 2DX7A 4IINA 1U3DA 2Q27A 4K05A 3OECA 4UBIA 1P2SA 9LDBA 2O8EA 1GTG1 3WBBA 4MROA 2X9NA 4Q4AB 3DKRA 4Q47A 1PFVA 4ZQIA 4NRDA 1H2HA 5L53A 1ID8A 4N40A 1RI2A 3ETCA 4GG1A 2FUCA 4O6VA 3LL4A 5LYYA 3S55A 2JASA 3TG2A 1V96A 3KWLA 3AP2A 1ACJA 4UBLA 6GPBA 2X13A 4IDNA 3RV4A 4EP1A 3IHLA 2YWJA 5L3SA 1PJSA 5KTNA 2ADFA 3GO4A 4KNYA 2Y71A 3PI6A 1J5XA 3NCHA 3H8JA 1QK4A 1Q3TA 3N05A 4GQBA 3OLZA 4TLDA 2MCFA 4CEHB 4W1QA 5FWDA 2PT5A 3UJ7A 2WG2A 4L9SA 4EFNA 5JQGB 4IDDA 2IX9A 3IMGA 1V8OA 5FBWB 4AU1A 3PGXA 4REOA 4NZYA 3T95A 2RB4A 2LCIA 3FTPA 3L8DA 3ZNNA 1AO0A 3F6PA 4HMQA 3S7TA 3OE7D 5CPBA 5DLEA 1SOVA 1YZTA 5KTMA 2OBYA 5L45A 1R9GA 1QUFA 3VZCA 4KYUA 1LKZA 1TM1E 4G3XA 3SZMA 2NU7B 2XYPA 2SCUA 2ZB2A 4I9NA 4TLEA 4JV5B 2QTVB 9GPBA 4LZLA 1Z5PA 4JKYA 4W5JA 2Q3FA 5INTA 1FRVA 1N78A 1SC4A 2PCJA 3MTEA 4IIJA 2WQZA 1EGMB 3W5CA 3R3SA 2VXBA 4FTWA 2GNOA 2JPDA 4GXTA 4Q7JB 2DLNA 3K0HA 3ZNOA 1YZNA 3ZU5A 1G8GA 1L9XA 3OZBA 2BR3A 5JRDS 3TOCA 4GMGA 5FNVA 3LQ4A 3OPXA 1OGIA 4KQ6A 4M1YA 1FFEA 1NBHA 5AMXA 2ZQYA 1JPVA 1RP7A 1JTFA 1NI5A 1NRXA 5CDYA 4XWGA 1EBFA 3UMRA 4ALNA 4FWIB 3UIEA 3B6EA 2R11A 1MTZA 2ZSDA 5G0VA 2AMVA 3PG5A 2HJSA 3AU9A 4A2WA 3VPAA 1L8AA 3ZHSA 4MGZR 2ZCVA 3IUSA 4JR1A 2CXXA 1JEAA 2IYRA 3FYUC 3ELBA 3NBXX 4E5VA 4WFKA 4XPIB 1VTKA 4IDPA 1CWUA 1FFCA 1UADA 1T9GR 4NYMR 4P3YA 1SD2A 1ZSYA 3HXLA 4EFDA 4EFMA 3OZEA 1VLJA 3B12A 5EGNA 2H29A 1AT1A 4PSVA 2V7UA 4QZVA 3CXRA 5D84A 5KKAA 1XZCA 4UHEA 2Y0CA 5ECGC 5F51A 3ZJUA 1T35A 3ASYA 1FU8A 1TRKA 4XVUA 4RCYA 5JBNA 4YWJA 3DOCA 2OV1A 2BH9A 5DB4A 3IYLW 2IA5A 4L5IA 4KQ1A 2IEDA 4RZSA 2JAXA 3QXSA 2Y8EA 2PIDA 4MQEA 2GZSA 3PGMA 2IHTA 4NARA 4RDIA 1JSLA 4KXXA 3PICA 2QMQA 3DC2A 2N9UA 3ADKA 4NJMA 1RAAA 1SKYB 3DR3A 3STHA 2O3RA 1NOIA 1U7ZA 2BZ0A 3A7DA 3VI4B 3VOAA 3WXMA 1JP7A 3CNNA 2JIRA 5FFNA 2WF5A 4HR7A 3DAHA 1G6Q1 2RBEA 3CF0A 3QVOA 4N0DA 2J9FA 4WK2B 3R7NA 5EWMA 2WVGA 2WP8J 4BGEA 4MUNA 1EP9A 3F9CA 5HKAA 3AP1A 4GP7A 4JJ8A 4ZI3A 1D1QA 4OQXA 1F3LA 3GLHB 4TYWA 5KNBA 1N0HA 3SC3A 1L4BA 2C95A 2JLRA 3DCYA 2OCLA 1J1UA 1ZOOA 3DH0A 5FV4A 3U4QA 5B5SA 3I5YA 2VPZA 1DAPA 3ZLTA 3HRHA 1T8SA 2BFOA 3VPSA 4MMYB 5T3YA 4ENWA 1OR8A 1AN0A 1DB3A 5LXTF 2UKDA 1QO9A 1UPTA 4RV5A 5JI2E 5A3RA 1TK9A 5J59A 4LZAA 3IIEA 4CNBA 2B2NA 2HO5A 3HNOA 1D09A 4BO9A 2UVPB 2YH2A 2PQ2A 4NU5A 1ADGA 3MB8A 3PYMA 2P5TB 2VEOA 2V7WA 3KYCB 3JATA 4M0DA 4YJDA 4JVNA 1WV1A 1G21E 4LMAA 1T8UA 2DB3A 3E9EA 4X3PA 4W1RA 3UAGA 4B46A 3UVEA 1OLXB 3CWQA 2Z4TA 1TLTA 3L7BA 5L3RA 1F2DA 2IL1A 2ZS9A 4AQ7A 3MMPA 3IMCA 2WUDA 1IVYA 5HUHA 5BUQA 5NULA 1YRQA 2G6BA 4RKRA 2B9EA 1MEJA 3BJIC 1YA6A 1WF6A 5KI6A 3FNFA 3U6KA 2Z98A 2ZJ8A 4GFDA 2O3UA 5K3DA 4WL0A 4DMKA 4UULA 4K9SA 2J48A 1AMNA 3PEWA 4NV1A 2W6JD 1V3TA 3UWSA 4C5BA 2Z8YM 4QDKA 3MBIA 3GLFE 3HCOA 3DP9A 1DQRA 2R8PA 1HE3A 2RGRA 1EA7A 3Q8XB 4JHLA 4EATA 3L4BA 5FPSA 3OICA 1U7DA 2SKEA 2IEGA 3M83A 4CXMA 4P7GA 4XSVA 2B3TA 4DA9A 2EQ5A 3KT8A 2R7LA 7GPBA 1RNLA 2Q6TA 5ICGA 1EDOA 4RJKA 3CKLA 3M3HA 4KQHA 3AUAA 2XB2A 1UKBA 4W4TA 1OX6A 2HRRA 3ILHA 4W7SA 3WGYA 1IUNA 3D7RA 3FFTA 4C87A 4C4AA 2RE8A 1C1HA 1A5TA 3V4RA 4UHCA 2G0NA 1TF2A 2I1QA 3PXGA 4OHKA 3T5TA 1EX7A 1SUEA 2H52A 1DQZA 1YQEA 3IO3A 4GLLA 3I01M 4MAMA 2BR5A 3G6WA 3GV0A 1E9RA 1T0JB 2H7XA 4G4GA 4YCBA 3RV3A 3GLFA 4WUTA 5H83A 2WVJA 4A9AA 5JYBA 1SBZA 2FN3A 3U7GA 3STXA 1CF4A 4H77A 3W2TA 2QSUA 3SX0A 2QLFA 4AG5A 3HGMA 2OV4A 2B37A 3IO5A 3QE2A 3TTXA 3PV0A 2VRNA 5G1OA 1G59A 1V1MA 1E7RA 3GUCA 3P2JA 2R2AA 1VJ0A 1NASA 4RMIA 3VZBA 1TJYA 3WADA 2A67A 1RFGE 2E7ZA 4ABTA 3BRWD 3FFAA 4JQCA 2OOKA 5AW5A 2B4TO 4ARAA 4DRXA 2W48A 1V9CA 1E2NA 1LGYA 1R3DA 2XOEA 1XP5A 1VIYA 4JYPA 4PPGA 4DE5A 1ZCAA 5T7BA 1ULAA 2O2IA 3O0TA 5FKJA 5F7OA 3MWLA 1RLJA 1Z0AA 3NDPA 1ISSA 2NACA 3GP5A 4ZYYA 3WV5A 4LE0A 3P9KA 4WE3A 5ER9A 5HKLA 2ZS8A 1WPGA 4EF5A 4OXYA 3ZU6A 1U90A 2RHOA 4G8DA 3AGPA 1KZ1A 3HADA 4HH0A 3ZY5A 3HI4A 4BX3A 4MCIA 4BU1A 5HUQA 5JSZA 2MYUA 1X8XA 2NO1A 2ZCJA 3OM9A 3NWEA 3PR3A 1EXVA 1I3KA 2FQXA 5D7BA 3BHNA 3A3NA 2FP3A 3PT9A 1UK6A 4HTAA 1J2UA 1O4WA 2NUTB 1E66A 2MTBA 3DO6A 2BFFB 3DD5A 3F67A 3PF9A 3LXMA 3RYHA 3VR0A 4AXBA 3D3QA 1J9ZA 1JA1A 1OGYA 4ZHQF 4D4HA 1LTKA 4OAPA 1PQPA 5TS2A 3LKBA 4I50F 5JV5A 5IKMA 3VH3A 1EVJA 2KSQA 1DARA 5EYPA 4PCAA 5FI5A 5H16A 3U80A 2WIDA 3RUAA 4AZ0A 1CTQA 4LKOA 2ZUUA 1GKKA 1HXHA 4X1YB 1IE3A 1PSDA 5EZSA 2XRZA 2QR5A 4EFLA 2AHRA 3AM5A 3ZQ4A 2QRNA 3D0RA 3EOZA 2V4ZA 3HCFA 1RKVA 3QVJA 1E1KA 3LDUA 4ID3A 4PLZA 1BVUA 4AQDA 3ZQJA 4E21A 4LG1A 3VGPA 1M7BA 3I1IA 1OHHD 3I2IA 3I73A 4C7KA 2NUAA 3F4KA 4EJMA 3HZRA 4AF8A 3FBGA 1T8YA 1UMBA 5FWYA 1ZY2A 4AKIA 1GHTA 2X1VA 3HFJA 4RE6A 4KQ9A 1D1PA 4UPVA 2VWGA 3EFOB 2C7BA 2CUZA 1V43A 3HR4A 1KDYA 2Y68A 1KO7A 1K98A 1VDZA 4A23A 3L8MA 3CEHA 3FOBA 1EXNA 3RQIA 2RKBA 2XQGA 4XARA 5GY7A 3WL5A 1HSZA 1WDWB 3NEAA 1ZD5A 4HX5A 1PJCA 2HJWA 2LWIA 5E4TA 1Z5UA 1TEHA 2BKUA 4TTRA 3MTIA 3E1SA 1FB5A 4NBUA 3THRA 5BYJA 4IL5A 5AKKA 3ZJVA 4I1IA 5GM2A 4YRBA 1GT91 1QWSA 4MEBA 4J3NA 5IASA 5T8KA 1GU7A 3QITA 3TLJA 2NPIA 2E9SA 3T3OA 3EDRA 3IBTA 3IURA 2QX8A 2I2FA 3P4YA 4OJKA 4RHYA 3VM6A 3N59A 2GASA 4COOA 4NNPA 4OP2A 1NPYA 4YWHA 4V1CA 3NLLA 5HDQA 4L3OA 1J22A 4N3AA 2DTDA 2YW2A 1K06A 1R37A 3L0DA 3OLWA 1AQNA 2ZJ0A 5JC8A 1ZN2A 5DT2A 1I0ZA 2M6LA 3RYFA 5HJ2A 1VFPA 2Y1OA 1T2EA 5FOXA 4DYHA 3MGBA 3QOFA 1SBNE 1YR6A 4UM8B 1NRJB 1S5PA 1CJMA 1UXIA 2PXCA 3F78A 3HHEA 3GP3A 1I3OA 2HPAA 4FINA 2WUFA 4WNYA 2JGDA 4QODA 4RFLA 3WMWA 1WUIS 5EE3A 1NVWQ 3DTYA 4OA8A 4ZICA 1KMIY 1UP6A 2FFQA 4KUEA 1TQ6A 2XF2A 1R6UA 3U44B 4RPCA 2YFQA 4ZOBA 1GGJA 1P1FA 2J5XA 1SURA 1VKJA 4YV0A 4NQZA 4CR7A 1L5OA 4UHDA 5KYWA 1YA8A 5IWCA 3H5VA 4H7FA 5AQEA 3OQ1A 2GEFA 4AF6A 4IIXA 1Z88A 5F1YA 3H5RA 1JHDA 1X9HA 1FTNA 2V59A 2YW9A 2PG3A 3H9EO 3GUUA 1UJ4A 2RHDA 3WGLA 4EL0A 2NYUA 3TLKA 3TLZA 3ZLUA 4PRZA 2AX4A 3ZN2A 3P4XA 5DM2A 1WM1A 1Q1ZA 4PZDA 5IBPA 5A06A 4MV8A 3OEYA 1X1TA 1M1XB 3BRWA 2PH3A 3PJGA 3X43A 3HN7A 3HYNA 1CV2A 4FGWA 5H1YA 4D9EA 5ALHA 1PL0A 2XX3A 3N53A 2CLOB 2NG1A 3KHTA 1EQUA 2A3NA 5H82A 5IW8A 4Z3KA 4IX9A 4QWWA 1MGPA 2GPAA 3LCMA 3W5DA 4OYRA 2XQVA 4CM5A 2CNDA 4MHTA 2EVWX 2I8AA 3D6FA 2YMMA 1GTZA 1ULUA 1D2MA 5HZKA 5C1IA 4ZK2A 2OK7A 4UMEA 1RXVA 1Z16A 1X70A 1A98A 5FUBA 1YB1A 5JCJD 2KHZA 3TGWA 1ZM4A 3GW8A 4PQEA 1P4JA 2VDUE 4UU0A 3PEYA 5AIBA 4JDUA 4HLQB 4RORA 3SCZA 1GUAA 1OV4A 5DCUA 3NETA 4CIVA 1HDIA 1K7FB 2CLFB 3MMNA 2J1LA 3WYBA 2L18A 3TZQA 3A4LA 4IOKA 2O20A 2GK4A 4J2HA 4DCPA 4B6QA 4FHZA 3NTLA 1K75A 4ZO8A 3R5HA 4CKBB 5FOWA 1MPTA 2Z2IA 4J0JA 1N9ZA 4YAEA 4DZRA 5JAZA 2WHEA 4PN3A 4XVQA 4IGAA 1GGHA 1T25A 1V7ZA 4L3WA 4MTLA 4RVCA 3ONDA 3ZVLA 4AY2A 4BO7A 4ECAA 1CU1A 3LYHA 3MRVA 3C3WA 4M9XA 1T8WA 1DEAA 3HACA 3NBMA 1IVNA 3R2JA 3OQIA 3LLVA 4QE3A 4X9XA 3UUWA 4CM8A 4XR4A 4UHBA 2Q9BA 3C3AA 3EXFB 3FNRA 4N18A 1TUBB 3NJ8A 3FUXA 5EZ6B 1OHHA 4EI9A 2FG7C 3WSWA 1I8TA 2GTPA 4II3A 1GFIA 4HXGA 2JCYA 2DPYA 1SCIA 4MR7A 4A4DA 1CJCA 2QX4A 4JP2A 3MW8A 4FMDF 5KJCA 1J33A 3ZDZB 1TPZA 2VDLB 3CLTC 3CRVA 4RF2A 4YDRA 3KQTA 1E7QA 1R0ZA 4RL4A 3RUPA 1U2GA 2JCGA 2PEZA 4N01A 2IHNA 4I6GA 4U8GA 3BFJA 4MYTA 4P4GA 3UGTA 3WLEA 4BKPA 2FU5C 2WV9A 3MGAA 1OX4A 4JLWA 5EPEA 3UQZA 4AVYA 3SC4A 1RT9A 2P0EA 1IOLA 1IB6A 1PZNA 2QMHA 3AIMA 4MV7A 4XDZA 4P58A 4MA4A 4X84A 4ZVMA 1T9GS 2PLNA 1CJBA 2YJNA 4H7HA 4HN2A 1D9ZA 4QBHA 4XDGA 3ZBTA 4Z6KA 5ALVA 5MDHA 2LNDA 4MQLA 1O9HA 1MNQA 3ZZTA 5HEKA 1ZP6A 1Q2XA 4AP9A 2IPLA 1BS2A 3ABIA 1Y6GA 4EB6B 1A9OA 2JLSA 5HSGA 3P97A 5M34A 3G13A 3V7FA 1BDIA 3QLUC 2B83A 3LUPA 1EUDB 1NMXA 1E4EA 1UDBA 3REFA 3AUKA 1NXVA 3UK6A 1VHWA 3LPDA 3I53A 5FPQA 4A2PA 1Q5PA 3E5RA 3GGOA 1K68A 1NTRA 3ND8A 3OEWA 1G60A 5AM0A 1BWQA 2QNRA 1FVHA 1MRZA 1Z3IX 2WMOB 4QICA 1JDPA 5ULLA 3WAJA 4AJ4A 3I4CA 4BFLA 1HK7A 1K6MA 4JYBA 2DOKA 4HZIA 1L1FA 2PX3A 3DEIA 3TLAA 1BNCA 2WB4A 4YBZA 2P9TA 5EZYF 1FMLA 3WGOA 4B80A 5A7FA 1Q20A 1F20A 1WHSB 4DC1A 4C2BA 3D4LA 1BRMA 1R8XA 3M5PA 4KNVA 5CU7A 4DNXA 3THWA 4OHMA 1CUGA 1K8ZB 1PL7A 2XTZA 4Q39A 1XRLA 1OBFO 4TVBA 2Y4NA 4F85A 3FZYA 5KCZA 1VLHA 3RS0A 1W5EA 1QHXA 3I62A 2BJWA 3WHPA 4BKOA 4FCTA 1Y5MA 5FWAA 4N6NA 2IXTA 3B3GA 1E6CA 1V7CA 2R60A 1HYBA 2YVLA 3KKLA 3KQPA 2QL5A 1TFRA 1HF3A 1QYWA 1VP9A 4J9UE 3K6RA 3OD1A 2P2CA 3E6AA 1IG0A 4UOQA 3A4IA 4YQFA 2ZR8A 1E62A 1RKUA 1I36A 2QMYA 4H4DA 4AMZA 2ZBEA 4XVHA 3ZCPA 1G3MA 4GWKA 5AM3A 5HTOA 2BJVA 2ZTSA 1C8BA 2F67A 3KYJB 4WNCA 2PU7A 4BMVA 5JNLA 5FAXA 3TZ6A 5CLLA 2F6RA 4ZAXA 2DG2A 4IFIA 2FWBA 1S96A 2VDPB 5SY6A 4LYAA 3SF8B 3H1FA 4HAWA 4BFTA 1A2QA 3EMBA 1ZJYA 3IR7A 4FX2A 3RVOA 3UKDA 3TF5A 4ARVA 4KC0A 1PSZA 4F2HA 2R0QC 3B60A 1DQPA 1SBCA 3OQ6A 1X6VA 1Q74A 3F3KA 3P0IA 3H9BA 4JJKA 1CUDA 3IXMA 4NE2A 5HRCA 3B1KA 1XLUA 4RVFA 3KTDA 2GPSA 2WVAA 3KYBA 3Q3GE 2O06A 3FF4A 3R5XA 3OOYA 4G5GA 4MVJG 4PYRA 2H54A 2DH5A 1AS0A 4MS4B 4EGCB 1Y63A 2JD1A 1P33A 3IUPA 4R01A 2NO4A 2QUKA 1ZWKA 3W5JA 3WNDA 3TLBA 3D2BA 1N2OA 1POXA 4M3NA 3W8DA 1VI6A 1PN3A 4FMCF 4WCFA 4EY7A 5L7YA 4QT4A 2PMCA 4I3GA 1VJ5A 1VYVA 3EXIB 4O2AB 2ZYAA 5G0UA 4AY4A 5DX0A 1WZ2A 3HXPA 4LQLA 2FEPA 3KIPA 2GJKA 4HJRA 4C2AA 5HKBA 4BX9A 4FGZA 4Z4FA 5AOAA 1PT6A 1F1JA 4L22A 4UUNA 4B4UA 4DMLA 1SC9A 2I5PO 3LHKA 5E6UB 5LBIA 2LPMA 3NHSA 2XUAA 4X92A 3WNBA 1EX6A 2Q8PA 3ZWOA 2AT1A 1N5DA 3CE6A 4XD7D 1LXCA 2G06A 1OLUA 2GBFA 5K4GA 2DUUA 2JLYA 5B3AA 1G4UR 4DHWA 1VA5A 4K46A 1RYBA 1NDQA 4IGFA 3PQ8A 4MAFA 1KU6A 3JQ8B 1MCZA 3RU7A 4XD2A 3HBLA 3HLYA 1ZBDA 2I03A 3SNHA 5ICCA 4ZDKA 4J0QA 2WEKA 3GJ8A 1IUKA 3A1NA 3ZY6A 1XVTA 3A06A 1AK1A 2F1HA 1DZ3A 2YL2A 3T38A 2G5GX 2PYIA 3JD1A 3ZCXA 2DZDA 1XK7A 2W11A 3ED1A 3GK3A 3QFFA 1Q6YA 1RVDA 3HC7A 2YNMA 3ECSA 4JS0A 3IXQA 4FMBB 5IS2A 1V3UA 4A27A 4P9NA 3GDHA 1JR6A 1D6JA 1RCFA 2YXLA 3M2TA 1CY0A 5EJFA 1X77A 4MGHA 3CVOA 1BJRE 4C14A 2NZWA 4WZAB 3L7JA 1X8KA 2R5WA 4FN5A 1P2BA 1IY9A 3Q1LA 4G4SP 1SZCA 4HWSA 4PHFA 5CFPA 5CLJA 1GL3A 2I4OA 3TG8A 2V5VA 3R7SA 2QX9A 4JENA 5H70A 1QYIA 3S1AB 3DONA 3VC3A 4ZEVA 5JTTA 1XLTA 1JWAB 1R00A 2Q2OA 3IFSA 1JAIA 1DHRA 1XTQA 1YRYE 4R2HA 4RA6A 3IDFA 4FHFA 3M6UA 5B53A 3JQ7B 1LD3A 4JJ6A 3EOAI 3GRCA 5JUWA 3WYFA 2PYDA 4CCYB 3NDBB 3RK1A 5CFRA 4NU8X 5HBRA 1KR5A 3DMYA 5FL7A 2QVYX 3S0JA 3JZAA 4P4SA 5JSQA 4FBMA 5AKXA 1CLUA 4H4EA 4BRSA 2ZVQX 5C8YB 3BB1A 3UV6A 3L1JA 1NPTO 5DI3A 1DAEA 1GILA 3U26A 2GDJA 4QU9A 1V9LA 4CFZA 3VBEA 3VKFA 1VGRA 2RIPA 3PJFA 1IXSB 1RYZA 4LTDA 4FFWA 4B6EA 1QMGA 4CUKA 3UJCA 1SQSA 1G8PA 4X94A 1H5UA 1Y8CA 4HVAA 1MR3F 1PR1A 2FQ1A 2AYZA 5DSTA 4EJSA 2EARA 4G5FA 3H84A 3U7JA 2N1BA 2RBGA 1THGA 5FBQB 4L6AA 3PWKA 4G0OA 1SVMA 2O5CA 3KPVA 1C5KA 1DWUA 2AJTA 4QG7A 2DHQA 4JQYA 4FOLA 2IDJA 1PQWA 3RAEC 5DNAA 3AGQA 3P9RA 1Z5GA 3WS7A 1PV4A 1FP6A 2D00A 3FTDA 3OCJA 3PFWO 3V8MA 4EUNA 4RPKA 2PX6A 1WW8A 4HB4A 1QF9A 1P1BA 4DMFA 1J6UA 1U9YA 1CJVC 2W00A 3I1JA 2OFXA 2FPLA 3K5IA 3OEEA 3IH5A 4MKHA 4DCOA 1WLSA 3VO8A 4TUYB 3BZUA 2CCJA 1U2SA 2UYGA 3HJAA 4GPD1 4MUGA 2DU8A 4QT0A 1L1EA 1S2NA 1M6YA 1U1EA 4WK0B 4XGIA 4BQIA 4B3BA 2FQYA 1TAUA 2YBDA 3T4XA 5AVWA 2VSFA 3CR7A 1U9IA 3PNBA 1MJGM 2Y6VA 4Q3EA 1KJ8A 5FLKA 3IL2A 3GPLA 4MWCA 4HXYA 2CLCX 2JDID 2W8BA 3DL2A 4F3TA 1I4EB 1YUNA 2Q0SA 3UJPA 4R51A 5BRJA 4EVIA 5A1JA 3RC9A 2DWOA 1NUPA 3GOQA 1T91A 1C8VB 3INYA 4W9NA 1CIJA 3EFBA 1THTA 4HYEA 2JJ1D 1C8LA 2OILA 3QU4A 3E9NA 1HKUA 2PZLA 3G2OA 4F72A 4UEJA 4URVR 3D2LA 4WK4B 3UJ9A 2R6FA 2CHGA 2JLQA 1PZFA 2ZSFA 5ICFA 4TTPA 3IULA 3RC3A 3L1KA 1WKBA 2JLAA 2Q1UA 2GBLA 3HKDA 5UKDA 4IMIB 4LRTB 2V54A 4BEWA 2Q2NA 4GUDA 4MHSA 5CIWA 4B3JA 4LXTA 4E0BA 1OYWA 2PSJA 3B70A 4GOND 4LZNA 1RJ9A 4KPEC 2J9XB 2FWPA 1CQXA 4IXDA 3PXDA 4PEVA 5T57A 1RKBA 5AXBA 4BNWA 2PA3A 4P4NA 4BO4A 4EW2A 1G8AA 2QRVA 3CF4G 5FA6A 1KY2A 1VKZA 4AICA 4FCWA 3IQZA 4JLDA 4NMWA 3V97A 4C4RA 3TGPA 1MJNA 1FUKA 2DULA 2AJLI 2ZREA 2OXCA 4QUKA 2C4KA 4RVOA 3RTBA 1W6UA 5GIOE 2VJKA 3ROGA 1DP4A 4ACAA 2CDAA 1MLDA 4TTSA 5LQMA 1U5BA 3PCTA 4I6EA 4LF4B 5K8JB 1M8JA 1Z4MA 1HNZB 1C1XB 2MU1A 1F5SA 3KD2A 3N6RA 2ZRAA 4MW2A 4KCGA 2ILVA 2O2DA 2C84A 3H3FA 3HJHA 3TH5A 2J3JA 1YB5A 1KEEB 2BEUB 4M38A 4GYKA 5AK6A 5J2UA 4QECA 1BOOA 4Y2SA 5E7IA 5FNZA 1TJ3A 2QTLA 2R4UA 4G0PA 4JOCA 4L4UA 2WD7A 2QUIA 3MZ0A 3LOUA 3TXAA 4KI0A 5CR9A 5C2JB 3L6UA 4LHYA 5AOBA 5KDLA 2YS6A 1SG9A 1PLKA 3U39A 2AE1A 1YR9A 5CT4A 2B30A 1JG2A 1K4KA 3H1BA 3GMSA 2HNAA 4OFXA 4X00A 3M34A 2CY0A 1THMA 2IYLD 2W71A 1A5SB 2TRSB 2RH4A 3OP1A 2ZBRA 3GVCA 1SC1A 2IODA 4AO6A 1JECA 2CL5A 3FPBA 1U2GC 4UM5A 1GFSA 3D6UA 3WQBA 2Q0XA 3MCVA 3R40A 4RBNA 2P2SA 1MO4A 4QXAA 1WU7A 4HJXA 1N25A 3LGXA 4TKLA 3H87A 3QRWA 2Q6VA 1YS6A 5BRAA 4KTTE 4IMJB 4S1TA 4R1MA 3KXKA 4LXQA 1B0PA 4G5HA 3H9QA 1GZDA 4CMHA 3FCAA 2Y3IA 3TM5A 3R3ZA 1RC8A 4OQMA 1ZW6A 4XIJA 4H7EA 3BYZA 4MS1B 4MKXA 1ULTA 1YJBA 2RIRA 4LOAA 4RPHA 3I8XA 3L6OO 3W1WA 4V0QA 4FDVA 2ABWA 4KE8A 5IF3A 4EQ6B 4MV5A 1KP2A 2VDJA 1YOBA 5LIRA 5FWXA 2WTUA 2X22A 3DE0X 1U4SA 1ORTA 2IIVA 1E8NA 4PYLA 4ARZB 1ZSVA 1LK0A 3E9RA 4Y2QA 5J63A 1V8FA 1L5VA 2YZKA 3G1TA 1RRPA 1T5BA 2E37A