1ZUIA

Structural basis for shikimate-binding specificity of helicobacter pylori shikimate kinase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
158
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for shikimate-binding specificity of Helicobacter pylori shikimate kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Shikimate kinase
total genus 51
structure length 158
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zuiA00
4QHYA 5IF9A 3GLFA 1G4AE 2ZRCA 4LYAA 1S9HA 1Z0AA 5E7MA 2QMOA 3GD7A 3K9LA 5FOTA 3GEIA 621PA 5SZJA 2HLDA 4IOLA 3QPUA 3B9QA 1G8FA 3KL4A 3AUXA 3W6NA 4C2UA 1OH7A 1MV5A 4NONA 3GLGE 4ZCIA 2BBTA 3OESA 4EFNA 2J0VA 1E0AA 4C0HA 1QHIA 4TWZA 4LYFA 2OILA 3VKWA 3EZ2A 2AWOA 4OI2A 1DAIA 4V0ME 3BIFA 4X8HA 4EPTA 4DDWA 3Q7QA 4UJ3A 4D81A 4LJAA 3RS5A 1KK0A 4TQUS 3NBYC 3KB2A 4UJ5A 2NTYC 5FOVA 3PJRA 2WOJA 3ZDQA 2EQBA 2QBYB 2DHRA 4KV9A 3BERA 3KXIA 4FINA 2A9KA 4PSKA 1Q21A 5C4MA 5EE3A 3Q8XB 1TQ4A 2GEDA 2GF9A 3C5CA 4B44A 4BFSA 1ZMXA 3VR4A 4DLYA 2Q3HA 1EFUA 3MD0A 1Q1EA 2PLFA 2P2LA 4DVGA 4LJ6A 2QAGA 1W47A 2GZDA 3FKSA 2XZOA 5LPNA 1XD9A 2WPDD 2PZGA 2XB2A 1ZM7A 4GT1A 4BLPA 3QG5A 1D2MA 4MDEA 1SXJD 4MGYR 1E2MA 2H18A 3LFUA 5EP3A 4F4IA 5KPJA 1OFTA 1U2RA 3RRZA 4Q9KA 3C41J 5FTMA 1TU4A 2C95A 1GL6A 2FWRA 3TQFA 1M1YE 5G3ZA 3LXXA 3U44A 1NIJA 2H57A 1ODFA 2W6ID 1NL3A 4TMTA 3GEEA 1FL9A 1EFHA 4L15A 3UK6A 4BEJA 1NLZA 2FEOA 1YRBA 3VAAA 2YINC 1GZSA 2VSOA 1ZVQA 1XWIA 4B2PA 1RJ9B 2AHOA 4BLSA 5DI3B 2RKOA 2ZR9A 3QBVA 1PUIA 2AD1A 2WJYA 3IHLA 5A0FA 1TNDA 3RAPR 2VHCA 2W58A 5L3VA 1CR2A 4IJMA 4K46A 1OH8A 2IYYA 4FIDA 3Q9LA 3QJYA 3MJHA 2OAP1 3CWQA 3VR1A 1D9XA 2DFLA 4A6PA 2FPKA 4FWIB 2O5VA 5AUNB 2HLDD 4TTQA 2QY9A 4G5OA 3CF2A 3ONWA 3L2OB 5JBQA 2CXXA 1JXMA 1OKKA 4QGGA 1G6OA 5K8IA 4JBYA 2A2ZA 2D7CA 3AVQA 1GKIA 4DLUA 1IHUA 3ND8A 4RD6A 4M9ZA 1S3GA 4DLXA 1YE8A 2FMXA 2XB4A 5FBVB 1AGPA 1KMHA 2IS1A 4BPBA 3K1JA 4DWJA 1YZGA 5DI3A 3GLIB 1VYUA 3L82B 1US8B 1G9XA 4K8OA 3AEZA 2ZS7A 3B78A 3O47A 3OF5A 4BFTA 4TYYA 4YONB 2O0HA 1RRCA 2YC2C 1T0JB 2CJWA 3FPAA 1TF7A 2CE2X 5B57C 2AD5A 1UDWA 5ELXA 4F91B 1W0JA 2IT1A 1KHTA 1TF5A 2W2TA 3PUZA 2ORWA 1GRRA 1R5OA 1G7CA 1UFQA 3VR2A 3ZVLA 4C4PA 4PO1A 5F98A 2A7QA 2Z83A 1G3RA 2AWNA 2P67A 2YWEA 3ZIAA 2CBZA 3RSLA 2V54A 5HZKA 3U5ZB 2IXFA 3X1DA 4BGDA 1XCMA 2BBWA 1OXXK 2RGGA 3PEWA 1C4OA 2YJTD 3K9HA 3KKNA 5KHOC 3EZ6A 2GXSA 1OIWA 3WRXC 4YC7A 3L0IB 4B2LA 4RZ2A 4ZKDA 2FZ4A 5HR5A 4JT4A 1NG9A 3AKEA 2WKQA 4WZAE 4IEIA 3N2EA 1XD8A 1E99A 3WMEA 4Y0AA 4LUCA 1N6RA 1VCIA 3FWYA 1F2UA 2CL0X 2DFTA 2CDNA 1FPMA 5FBWB 1KO4A 3CRRA 1P6XA 4Q1CA 4YLGA 2ZJBA 1KO7A 1J2JA 4IXMA 4TSFA 3SQXA 1E32A 5JSZB 3ZD7A 4YDSA 2H8KA 3ZJYA 1XCPA 4F4JA 1VIAA 2ZI6A 3QF4B 3Q5EA 1IBRA 4QC2A 2OHFA 4QL3A 4R98A 4CDGA 2W6JA 1I2MA 4LHZA 1KJWA 2I3BA 5JCZA 2V7QA 2PBRA 2ZRLA 4UNPA 1XXHE 4Q4HB 2HV8A 2QUZA 3CNOA 1GILA 1ZCAA 2KI5A 3BK7A 4LHVA 4IFEA 2JJ8A 4M2LA 2IEZA 4EQ6A 2CE7A 4E5UA 2PCLA 3EASA 3F3YA 1PZNA 4TLDA 2PMKA 5DN6D 5AJWA 2HXSA 4HSEA 3U3MA 4YMTA 2OM2A 1T3LA 4XSGA 2HF9A 4NMMA 1N6NA 3GPLA 4MRPA 1XZQA 1HE1C 4TTRA 5CDFE 1UADA 2CLCX 3TR0A 1M7HA 2V7QD 1QF9A 5JEEA 3Q5DA 2F1HA 3CH5A 1DEKA 4TMKA 1NVUQ 1BYIA 3B1YA 3FGNA 5D3QA 5BN5A 1GDDA 1HT1E 2QGZA 5FBQB 2QPOA 4IVRA 2A5YB 1G18A 4ABYA 2H5EA 4U02A 2ZI4A 5DN6A 1LF0A 3O8DA 1R5BA 3ZVRA 2J0SA 1FX0A 3OIVA 1N25A 4R2IA 3C15C 2NPIA 3JZAA 4TL6A 4HATA 1A1VA 1W44A 1XFAA 4HLUC 4TYNA 1E79A 2AFHE 4GFDA 1DS6A 4TYQA 4CRWB 2OCBA 3LX5A 2O8EA 2TMKA 2ZJYA 1P72A 3KXKA 2D74A 4US2R 2O8FA 1QHYA 3CR7A 4D4LA 5LD2B 4MYCA 3EPJA 2ORIA 3DZDA 2IS2A 4GNKA 2IUSA 1G17A 1L2TA 4JZKA 1Y63A 4FMCF 4AYWA 1OLOA 1ZD1A 2FN4A 4RD3A 1ZYUA 3PUYA 4HZUB 4PQRA 1KK2A 5EP4A 1FTSA 1G3QA 2ZE5A 4EFMA 1BS1A 4C0SA 2O8BA 2JIZA 1AKEA 5FPHA 2BKEA 4IHQA 5FPKA 1E2GA 2VSFA 1ELOA 3W8RA 4GOJA 5KDLA 2ZS9A 5L3SB 2OBNA 1G8HA 4ILEA 1SXJA 3RC3A 4ARZB 1ZUHA 2ZRDA 4V0KA 1XDBA 3MWJA 1N5JA 4GSYA 2L0XA 4CEHA 3UG6A 1VHLA 2BJWA 4TQAA 3GLFE 4MDFA 4JLJA 1H8HD 4CGZA 1OFHA 3B1XA 5FOXA 2RHMA 1GL9B 1RE0A 2C96A 2IYSA 4HDCA 1MOZA 2VQSA 3LVQE 1MT0A 3QKSB 4G5SA 1K5GA 2OZEA 4C30A 4AURA 5C18A 1P2SA 5SZKB 2EFGA 2LKCA 4KAXA 2XSZD 1NNEA 2WWXA 3DL0A 2B7CA 3IEVA 3UG7A 3BWDD 3QBTA 1ESNA 1KAGA 2IYVA 2K5UA 3NHBA 4YDHB 4BZQA 2KB0A 3LRPA 3DOEA 2WWYA 1OF1A 4EIWA 3G5UA 4HB0A 4POAA 3H84A 1NVVQ 1PV4A 4G0NA 4RFSB 4GP7A 2MMGA 1VG8A 1OE0A 2ZE8A 1IN4A 1AKYA 5CDFA 3DM9B 1SVSA 2Q3MA 4NZYA 1E1QA 1HQCA 3EA5A 4B3CA 4HUQB 4DCNA 2FFHA 3JVUA 3Q3JB 3BH7A 3RC8A 2C98A 4FD2A 3B1ZA 1YZKA 1KI4A 4YQFA 4Q7MB 5C4GB 3ADBA 2QQ0A 3TSWA 5L3QA 2QQEA 4OKSA 4NDZA 4XTRA 1HYQA 1UBGA 1QHNA 1G20E 3K09C 1VHTA 3CR8A 3IPXA 4DSNA 5HKKA 1A4RA 3H86A 2LKDA 4O2RA 1OV4A 4NHOA 1E1RD 1TADA 4TSFD 2JLVA 1SKYE 4Y0VA 2A30A 2IHYA 3AP3A 1D5CA 3R8CA 1Z2AA 3T12A 3TJZA 4MKHA 5K8TA 2ZJ5A 4WA7A 2IW3A 5EE0A 4B3XA 4RD4A 4P0TA 1YR8A 4MKFA 4B3DA 1QVRA 3K9GA 4K81B 2FPMA 2GEVA 4KI0A 4PQYA 3U7EB 5C2JB 2LWIA 2ZXUA 4D4MA 2G3YA 1M7GA 3FVQA 1G64A 4PC1A 3EC1A 3GJ5A 3TBKA 4ASUA 1SVOA 1CR1A 4DCUA 1ONBA 1QZXA 2R2AA 4MYTA 1SVMA 2MMCA 2A5JA 3EPLA 1P9RA 1BYUA 1XJQA 2HCBA 1W4CA 3UMFA 5CYOA 2D4HA 2GXQA 4JLDA 1AS2A 4RZ3A 1GSIA 3HJNA 3W9YA 2OV2A 2FF7A 3AVXA 3TW8B 3BFXA 1LF5A 2IF0A 2H17A 2ZJ2A 4LWZA 3WNCA 4EJSC 4PO8A 1UKZA 4PXAA 5J4YA 1XTIA 4NCJA 1UM8A 4AC9A 4G5RA 3QKRB 5UKDA 4OQNA 1MO4A 2GTPA 4L9SA 3V4RA 1YHNA 4NBSA 1E2QA 2ZITA 4PANA 1CJMA 4EPYA 2C2HA 1OHHA 2PT7A 3LA6A 3P1JA 4MRSA 1KDTA 221PA 3T06B 5AK0A 4OJKA 3BS4A 3QXJA 5KYKA 4IOKA 2ZUDA 5J40A 1N6PA 5LBIA 2ZJAA 1NJFA 5LDDC 1CR4A 2REBA 2WIAA 2XOKA 3DM5A 4JLMA 1M34E 4M1KA 2FDCA 2IX3A 4UNRA 1T3HA 2QRNA 2XNSA 1ZD8A 3SJBA 2YWHA 3MSXA 2GNOA 3PUXA 4U5XA 3TAUA 3R9IA 4URVR 1W5TA 4GOKA 3L8YA 1T91A 2QP9X 2WV9A 3SJZA 2WAYA 3U7HB 1GG2A 4OQLA 2CVFA 1E2EA 4ACBA 5KOYA 2GJAA 3EG5A 1U81A 3GJ0A 1VYTA 5FPSA 3TIFA 4ESVA 4A36A 3PXGA 3HU2A 4V03A 1E2LA 3KDSE 4V02A 4UKDA 4WAUA 1LY1A 2GCOA 3EWAA 3K0CC 3IDQA 5EJEA 3MFYA 1RVDA 3BGWA 3LD9A 1KAOA 2KBFA 4LX0A 5FUWA 2PLRA 3P27A 1YKSA 2Z6VA 1RRGA 3I61A 1WA5A 4G5GA 4PSVA 4OHVA 1E4YA 3N70A 4LDJA 4TQ9A 4AKGA 5K8LA 4E03A 1JXOA 2C77A 5JRJA 2GJ9A 2VF8A 4LV5B 3QEJA 5JI3E 1LB1B 5TMPA 3QKUA 1Z6AA 1RYFA 5CK4A 5TV2A 1YZUA 1NMXA 3CNNA 3EAQA 1U8YA 2O0KA 5JMTA 4FWTA 1KK1A 3CF0A 3LBHA 2FFBA 2ZU0C 2WKRA 1DAFA 4C0QC 2D3WA 1TEVA 1KI7A 4Q1EA 2R9VA 2BDTA 4L5BA 1NI3A 2OFWA 2FFQA 1KI8A 1KY2A 4A8JA 1NKSA 2R44A 4YMWA 2JLSA 1NVXQ 3VMFA 5L3QB 1OXSC 2WTUA 3B9PA 1IY2A 4OI1A 1E2KA 2IL1A 2N42A 4JLPA 2QNRA 2GK6A 4RKEA 4QFMA 5DNYB 4RY2A 4E09A 1OPXA 2R62A 2JLZA 2OE2A 2YV5A 2OCYC 1N5LA 1SZPA 1F6BA 3M0EA 5GJWC 1MR3F 4CIDA 4DB4A 2IUTA 2HYIC 1FX0B 5JJLA 4TMXA 2H92A 3GEHA 1SVLA 2ZQ5A 4TN1A 5GADl 4XWOA 1UAAA 4YMVA 1PLLA 3R7WB 4B3BA 1W4RA 1R10A 4D82A 3AB3A 4Q03A 4WVFA 5E4FA 1DO2A 2BIFA 2YC4C 1OYWA 4I1SA 4RVCA 4PZLA 4HZUA 3A1VA 5AR1A 4CT5A 2IUUA 3UIEA 3THWA 4CEJA 2OCPA 1P75A 5KNDA 1NRJB 1S96A 1F60A 5EP2A 2ZVQX 1G21E 4W5WA 2QA5A 4B43A 1A2KC 3KXLA 4M1WA 2FSFA 3CH4B 3AVUA 2QT1A 1KJYA 2NZ8A 4PSAA 2QAGC 1IN5A 3L0SA 1RPZA 3K70D 1EFRA 2XTZA 4CF7A 2RGBA 2ZROA 3MAAC 5KO2A 4FCTA 1GKUB 5FR2A 1XBTA 1XD2A 2KSQA 1Z0IA 1KTVA 5B2ZA 4KFTA 3U61B 1EXMA 3CKLA 3DDCA 3KZ1E 5E7JA 1AM4D 3K0EA 3U4QA 3CB4A 1I4LD 3GJXC 3WBJA 3WMFA 4AWXA 4O2LA 2OEPA 4M8NE 3VU9B 3ZZTA 3BE4A 3NTUA 3TLXA 2VLIA 1W7AA 4FMDB 1R0YA 5KTYA 1U0JA 4TMVA 4DLRA 2OG2A 1OHHD 4RD0A 1ZM9A 4S2EA 3CRVA 2ZRBA 4LV8B 5M04A 2NO7A 2O8FB 5CB6A 5JS7A 4BLQA 1NBMA 2HCJB 2RMKA 3EA0A 1KY3A 1X8KA 3X1YA 1E0JA 1US8A 3THYB 1U90A 2EU8A 3C5HA 3SYNA 2OT3B 1KKMA 2X2EA 1S4QA 3RWOA 4I1VA 4A2WA 4AY2A 2Z5FA 4F4CA 3AF0A 3RVBA 2B8TA 3I92A 1TQ6A 4D0GA 4TL9A 1IY0A 4KBGA 4L8GA 1XEWY 5C1BA 1R7RA 3PEYA 3IBGA 3QXXA 2F43B 1LS1A 4XWKA 4ON9A 3ASYA 3CBQA 3LQRA 1KSGA 3BJIC 4NE2A 1YRAA 4KXFB 1FMJA 2SHKA 1Z0JA 2Q9AA 1Z63A 1N5KA 3ZVNA 2ZSFA 2FGJA 4R2HA 3THXB 2HDNB 1M2OB 4O3MA 1SQ5A 2OBMA 2X19A 2ZYTX 2F1RA 4ZPXA 1P5ZB 2QAJA 3NG1A 2ZE7A 1Y3AA 2DBYA 1AN0A 1E9FA 2VP2A 4FCVA 4WXPA 1KDOA 1XU4A 2FSGA 1Z8FA 2GAAA 4NKRA 1XTJA 1R0WA 4H9GA 2RGAA 4S35A 3FOZA 2NZJA 2X8AA 5B58C 1KOFA 4G01B 4A8JB 1Q3TA 1LW7A 5AUOB 2ASEA 3TRFA 4OHXA 3WHLA 1FMLA 2QMUA 3H2YA 1G3IA 4DXAA 2ATXA 3VTKA 3WNDA 2GRJA 4IKEA 2XXAB 2VL7A 4LOAA 1XZPA 1K5DA 3DVLA 4GRAA 3ETLA 4NP6A 1G3UA 2J7PD 4NU0A 3TMKA 2MSCB 1GM5A 5G53C 3LW8A 2ZRNA 3BD9A 4HDQB 4BFUA 3K0CA 1XB2A 4EPRA 1DOAA 3G0HA 3RRMA 1R5NA 2H16A 4KLNA 4NL4H 4GMXA 1EX7A 2QE7D 2Z0MA 5E7IA 5KPDA 1IY1A 4A9AA 2F3RA 3W3AA 2ZE6A 2GDJA 2J1LA 4PC2A 2BMJA 3L0PA 1DADA 2CEAA 2DWOA 1T3SA 2WMNB 3L0OA 1CJKC 1JR3A 3AF1A 4QOSA 5L3SA 3IQWA 4OK5A 1EFCA 2JLUA 4MKGA 3UATA 1PVOA 2GAOA 3EC2A 4BFZA 1OXVA 5CK5A 4A1FA 1D9ZA 3HPRA 1Q1BA 1MH1A 3T15A 3UXMA 2BCGY 2ZYUX 4A0FA 2ORVA 5AUQA 5HE9A 3MMPA 4OBEA 3X2SA 2WICA 3TUZC 2QRZA 1MO6A 1KNXA 1N6HA 4DSUA 1TPZA 1BH2A 2KJQA 4UXHA 4LHXA 3AVPA 4LBZA 5CLLA 1CF4A 2BKUA 5H70A 4MGIR 4PAQA 4PHFA 3NBZC 3ADDA 2ZREA 2JCSA 1AZSC 4M1YA 4TL8A 1XTSA 1QBKC 5GVSA 3MG9A 4DIDA 1Q12A 1G7SA 1N6KA 3VKHA 3AVOA 2JDIA 2QAGB 4B75A 1XMIA 3AV0B 3LBNA 2IF2A 2QORA 3KKOA 5FOUA 2WWWA 1TU3A 3SOPA 4BFYA 2VF7A 3DHWC 4J0QA 4HI0E 1JI0A 3NH6A 1HH4A 1U0HC 1EG7A 4DLVA 1ETUA 1E9RA 1W1WA 2ZYWX 1WBBA 3UANA 1IN6A 3O8RA 1HV8A 5EE1A 1II8B 1DELA 1GWNA 1FNMA 2JEOA 3K0SA 1Z6GA 3K70C 2JDID 4URUR 1HY3A 2G83A 5CM8B 3GJ3A 4R7ZA 3ZQ6A 1OB5A 2QM8A 3B6EA 1WE2A 5JZVA 3BB4A 1CULC 3KTAA 2CL6X 3CM0A 2VPPA 2OAQ1 4DEXA 4M21A 1Z6TA 3JZMA 1NSTA 2IA5A 1E9EA 2KWIA 3E1SA 2JLWA 3PFIA 1UJ2A 1U8AA 2ZRIA 2RGEA 1OT3A 4NYIR 3ECCA 4NYJR 4PHGA 4US1R 1XEXA 1WMSA 3GCGA 5FOWA 3TSOA 1G7RA 4DDTA 1G5PA 1MO5A 1GIAA 4DLTA 2OO7A 3GFPA 1DAGA 4URZR 3K09A 3IHWA 2C8VA 4LJ8A 4JLKA 3RSOA 5DGXA 2RB4A 2YNMA 3A1SA 1TTTA 1H8EA 1U99A 2GVZC 4JSTA 3A1UA 4PAMA 2EYUA 1NN3A 3VR5A 2J3EA 2WOOA 1KI3A 4C0JA 1CJUC 2IBMA 2Z4RA 4B48A 2GF0A 2JJ1A 3QG1A 1ZNWA 1CRPA 4F92B 4DHEA 4TT3A 5EE5B 3QI2A 3QKTA 3FHTA 1FP6A 4UNSA 5JWRA 4NPHA 2NOAA 2P0EA 4MITA 2EWVA 3GLGA 2Q0HA 1OJLA 2DWQA 4Q18A 5B30A 1VYVA 3CLVA 3W5IA 3SYKA 2BC9A 3QVVA 4BZXA 3THYA 1VCOA 5EXXA 1XMJA 1XTRA 2JGNA 4N3NA 3RS7A 2V1UA 2QSYA 2WJHA 4CEIB 3CF6R 4B73A 4JKYA 5BN4A 4U7DA 4C7OB 4A92A 1KO1A 3ZIAD 1T4GA 5JHGB 2WJJA 3CPJB 4C2TA 3RLFA 2CLSA 2QU8A 4M53A 4LJ5A 4M0LA 1X6VA 5IHPA 2PT5A 3W5JA 2GEUA 2E87A 5EP1A 1WRBA 4QBGB 2HXYA 4C0KA 3IBYA 4KU4A 3EZ9A 1XD2B 4Z8XA 2YYZA 3LW7A 1W49A 2YZ2A 1EFRD 3RDPA 4ZDIA 4C7OA 4QG7A 5A5GA 1ZU5A 5TDHA 3IUYA 2VEDA 1VIYA 4KSBA 1UEIA 2V6JA 3PEVA 3LO5A 1SKYB 3ZVMA 2G77B 4PQFA 3FMOB 1NP6A 4Z54A 3UWOA 2W6JD 4KO8A 4Q4AA 4LBWA 1FUUA 5JCPA 4TZ0A 1OH5A 2ZU6A 4NTZA 3KQKA 3A4MA 2NQ2C 5LB4A 3TVDA 1IOZA 5KDOA 2ZRAA 4N0EA 3VHLB 4URYR 3PCRB 2OFXA 3A4NA 5DH9A 1JAHA 3HDTA 1U8ZA 3FKQA 4R9UC 1P2UA 4IDNA 5J4LA 1XP8A 4BLRA 4AKEA 2XJ4A 2OXRA 2PZEA 2NG1A 3IIJA 4Q5IA 4EAQA 1W36D 2XAUA 2A5DA 2GK7A 5LB2A 2W2VA 4Z1MA 121PA 3W6OA 2WHXA 3I32A 2PZFA 1F3OA 3AF2A 2BJVA 1X8LA 2CL7X 3AF4A 3THOA 2MSDB 2V8OA 2G88A 2DB3A 1J8YF 1EWRA 2XTMA 2NMVA 4M1OA 1W5SA 2HT1A 1SULA 2HEIA 2WSSA 3DKVA 1ZRHA 4HB3A 2RGXA 2QTHA 1V43A 3TGPA 1S9DA 5D3MB 2J0UB 3CONA 4ASUD 4MUBA 3KQHA 4C3ZA 1KMQA 3SHWA 4DBLC 2IYQA 1XJ0A 1RJ9A 1W2HA 2FE4A 2G0NA 5E3HA 3SEAA 1HEIA 2WJIA 1IJFA 1IM2A 4V0LA 4XSHA 4DDUA 2JIZD 5DHFA 2I1VB 2FSIA 2QT0A 4TYPA 2BMDA 1AS3A 2BVNA 1CRQA 3K0FB 1NLYA 1OFUX 2FZLA 3IIKA 2PJZA 5EUMA 4GZMA 4JSYA 1IONA 1JQLB 3BOSA 4NCHA 3D8BA 3B13B 3U3RA 1N0WA 3LWNA 4PHHA 3NKVA 4Q1AA 3GP8A 4GDFA 1H8ED 2VP0A 3TNFA 2P6RA 2XX3A 4F38A 2O8DA 2V1XA 3M4YA 4B33A 1BIFA 1XJCA 3FTQA 5JJIA 1KGDA 3DMNA 4TYWA 1E0KA 4WOPA 1K8RA 1KO5A 3QOFA 4GI7A 2V4ZA 4NCIA 2AK3A 5CIQA 3DZ8A 3TW4A 1A7JA 2GBLC 2C03A 4A82A 4NYJQ 4DT1B 3HWSA 4B71A 1Q44A 3AKYA 1AQUA 1SGWA 4H1UA 2GVDC 4XTCS 3A1TA 3SJAA 3AH8A 4D0LB 5C46F 4OI4A 2GXAA 4A0GA 1EGAA 1XXHA 1XTQA 1FOEB 5J47A 1ZNYA 1BKDR 4B6FA 3C7KA 3PIRA 2VHJA 4I4LA 3DO6A 2Q9BA 4FW9A 1KDPA 5FR1A 2JAQA 1EX6A 5HKKD 2ZSEA 2ZTSA 2IK8A 4BFWA 2D7DA 3UKDA 3ZZUA 3EPHA 1SKQA 3JVVA 4DT1A 2JLRA 2PMDA 3N5CA 4N0DA 3H4MA 4IFBA 4M1MA 3QXHA 3I8XA 1QRAA 1JEEA 3E5HA 3KTAB 1EFTA 1Q20A 1N6LA 3AM1A 2ODNA 1Q0UA 1L8QA 4D80A 4XVRA 1FQKA 5AWFC 4AYXA 3ZS9A 4QM7A 2REXB 2C99A 3HU1A 4A15A 1GUAA 1G4UR 2ZSBA 1Q3HA 4GMDA 2BEKA 3VR6A 4D0NA 2GBLA 3OZXA 4MRVA 4M1TA 1DTSA 2BCJQ 1Z07A 2ANBA 3RS0A 3IIMA 2ZAMA 1E6CA 4JJZA 4AG5A 4W5HA 1UBCA 5CM9C 4DSTA 2F55A 2YWGA 3CWZA 1Z28A 1U98A 2WWGA 3A36A 2XSZA 3KX2A 2NO1A 5CB8A 3VNUA 3MGCA 1HT2E 4KYIB 1SXJB 1RKBA 4I99A 4ARZA 4F93B 4ZCLA 2IYWA 4DCSA 4LC0A 2QE7A 4X8OA 1E98A 3T61A 3P4YA 3NHAA 5HTKA 2JLQA 5EXSA 4P4SB 3CNLA 1DVRA 1B0UA 2IYLD 4EFLA 3THWB 3SQWA 1B23P 1JR3D 2DWPA 1JAIA 2F1JA 3C8UA 1Z47A 4FN5A 1MKYA 2IEYA 3X1ZA 4BRUA 2IXEA 2J87A 1Z0KA 1TX4B 5EZ5A 3R9XA 5G3YA 3X1WA 5JJKA 2ODWA 4QXAA 1BOFA 2JASA 2ANCA 1KSJA 2QGNA 3K0AA 1AK2A 3NH9A 4IOMA 4D4KA 1TQDA 2GZHA 4EKDA 5BWMA 3WXMA 1UBFA 4LBVA 4NYMQ 1VG0B 3T1QA 2BMFA 4RD1A 5JRZA 2ZETA 1YR9A 5KSZA 1ZC4A 3FFBA 3MWYW 4ZDKA 1E79D 2CNWA 1A2BA 1AQYA 2ZS8A 5BW8A 1MRSA 1JJ7A 1OH6A 3T1OA 2EFHB 4E07A 3LQQA 4JVSB 2AKYA 4P31A 2G0TA 4B74A 2WWHA 4D26A 2PX0A 2QG6A 4IDOA 2ERXA 4ZIRA 1L4UA 4FI3C 2VP4A 4DCVA 3X1XA 4PC6A 5SZHB 3ICQB 2QPTA 1M74A 2VRWA 3BH6A 3FHCB 3OEED 1S1CA 3I1FA 3N2IA 1G7TA 2F43A 1RW4A 2FOLA 4AI6A 2QPAA 2FJUA 3AKDA 2ZR7A 4YXWD 1P9NA 1W46A 1ZBDA 1IN8A 1RIFA 3CRMA 3A6PC 3WHKA 3WYGA 3U60B 1KMHB 1T6NA 1P61B 1MABA 1J90A 1ZINA 1CR0A 3VX4A 1RFLA 1GNPA 3PENA 3LNCA 4R71A 2ZRKA 1AA9A 4X8MA 2GXUA 1E4VA 4W7SA 4Q9HA 5AJYA 1GKYA 2ZJOA 5EZ6B 4BQSA 4ERNA 1OIVA 1R2QA 2F9LA 2GCOB 1A82A 1OIXA 1QHHA 3LAWA 1QHGA 2WM9B 3IPYA 3U6BA 1KI6B 3TSZA 5GJBA 2RGNC 1E2HA 3NC1C 5DSZA 3QENA 4IXNA 2ZSAA 4OL0A 4P4UA 4L16A 5JS8A 3DMDA 3KQUA 2WVJA 3OE7D 4PFSA 1U0LA 4G5QA 3NDBB 3AVTA 2XXAA 3CRQA 2I4IA 2NO6A 3IO5A 2RGDA 4Q01A 1G8YA 3KKPA 3SFZA 1HUQA 1NKTA 1P3JA 4QHSA 4MRRA 4F7WA 4URXR 2XJ9A 3A4LA 3EZFA 5FUYA 4QBIA 1T5IA 1XTKA 1NN5A 3QPVA 1KI6A 1UKYA 3QQ5A 1VTKA 5D3MA 3WY9A 4MUAA 1TUIA 3B60A 3QF7A 5J5CA 1E2NA 2ATVA 3PG5A 3CPEA 4A2QA 1FZQA 1PJRA 5G41A 5J4VA 1GNQA 4EJSB 5FBRB 1G291 3B85A 4WZ6A 1E2FA 2J0QA 1FQJA 1SHKA 2O8CA 1LS6A 4A2PA 1T8UA 1NY6A 3ND9A 4DDVA 2XEXA 1G8PA 2GILA 2QMHA 5JEDA 1W0KA 4KODA 4QKQA 1J8MF 1LFDB 4JLBA 2OBLA 2C9CA 3A1WA 5FTNA 1OFIA 2O8BB 3FYHA 5EXPA 1G8GA 3NEJA 3OFNA 4KVGA 5IT5A 1P7CA 3AVVA 1RYHA 1GITA 3U6KA 3TUIC 3Q7PA 3R7WA 2PJRA 1E2PA 4A4DA 3U3OA 1II9A 4ZDWA 3K9NA 3U3KA 1DG1G 3WYAA 5BYKA 1S2MA 2JA1A 4HB2A 5JWHA 1WDTA 2NGRA 3SN6A 5FH9A 5DO9A 4IDPA 2GETA 2QENA 2VA8A 4RCYA 3BH0A 4M9XA 5DIFA 2HF8A 1X86B 2Q9CA 3OFND 4HLQB 3B82A 2J5XA 1P4SA 4QJ4A 3KUDA 2PX3A 3AVWA 4PPQA 1N0UA 4W9MC 721PA 4XOIA 2QMEA 3ZH9B 4JBWA 1IXZA 4UNNA 3EIEA 2J0UA 1WCV1 1G16A 3PR1A 2H7VA 1IXSB 1X3SA 1VG1A 3J81k 5JSZA 2NPFA 1WP9A 1S1MA 4QJ5A 3PUVA 3THXA 3PQCA 4ZIRB 2DYKA 4HLUA 1DAEA 5H1YA 1F5NA 1HA3A 2BMEA 2BOVA 2VSXA 3V4FA 1NY5A 5DLQC 2ZSDA 4RFSA 5FUVA 3SFVA 5IDVA 2CJWB 2YWFA 1G6HA 4QRHA 1VKJA 1MRNA 1E1RA 2ZUBA 2RCNA 4FXPA 4D6PA 5H8WA 2W0SA 3I62A 2EW1A 3KFVA 3OEHA 5F2EA 3GJ4A 4MKIA 2XZPA 3HP1A 4TTPA 3NBFA 3RANA 4OHYA 4KLZA 4BASA 2X77A 2OUKA 5FPYA 2ONJA 1T9HA 2PEZA 2BHRA 2WPDA 2YOFA 3GFTA 4QNMA 4LC1A 4B2IA 1WF3A 2D2FA 2MSEB 2ZRGA 5HE8A 4M4SA 3K0AB 5SZIA 1IXRC 4XWAA 1CU1A 2JLXA 4JMPA 4P33A 4QGHA 2A5GA 2GJKA 2QP3A 4KFUA 2LCFA 3NEYA 3L43A 5TVKA 2WZQA 3KJIA 1KO8A 1DBSA 1Z06A 1WB9A 1X1RA 1ZAKA 4GBMA 4RCZA 4QHTA 2VHQA 2WMOB 2YOHA 4WW0A 2QTVB 1II8A 3T1VA 5B64A 1Z2CA 4LJ4A 4C0LA 3HR8A 5AJVB 2G1KA 2AXPA 5FI0B 2PL3A 3TR5A 2ZUCA 3K8YA 3SS8A 1ZJ6A 1DPFA 3VQTA 1FNNA 5EQTA 1N6OA 2J7PA 4A0RA 2BBOA 1NG1A 4P4TA 3TVTA 3C16C 4LJYA 4I1UA 3GQBA 1KKLA 2HJGA 2PEYA 3OE7A 2DPXA 5CYPA 1E2JA 3ZS8A 4DRZA 2AKAB 1IN7A 2C04A 1QVAA 2CK3A 4KCGA 3REFA 4BECA 2W0MA 4KVAA 4U00A 2O8CB 1DARA 3EX7C 3BORA 4HAWA 5FPTA 4V0NA 2VP6A 2DFKB 4GL2A 2V6IA 1TEXA 3CUEF 1E9DA 1XPRA 5F3WB 4B3FX 2UVQA 3B2EA 1EESA 2F7SA 2XNDA 4JS0A 5CJ2A 3DOFA 2YVUA 5BN3A 1OXTA 3ICEA 4BFXA 3LBIA 4RZUA 4TLCA 3SYLA 3WBKA 3LLMA 1VMAA 2FG5A 1N0VC 1JPNA 1S3SA 4A6XA 4ZI3A 4OK3A 4NCKA 4BLTA 4Z1MD 2IYUA 4AK9A 4US0R 2ZRMA 4Q1BA 2CCJA 2IWRA 2P65A 1J7KA 1NBME 1Q1ZA 1W4AA 2O52A 3QY0A 4HAXA 4MQBA 1X1SA 2ZJZA 2JATA 3L8ZA 3RABA 3REGA 3RHFA 3EIQA 1CJTC 3CZQA 2BWJA 821PA 4DIEA 5KSYA 4WBSA 2R65A 2CNWD 2O8EB 1A5TA 1GFIA 3HPQA 4XIGS 4DUGA 3GLGB 4QM6A 3CZPA 5FL3A 4PX9A 2J9RA 3QSYA 4ITRC 1N2CE 2BM1A 4HAUA 4JVNA 2C5LA 2FU5C 3GLIA 3HYRA 3KKQA 2QN6A 4JT2A 4B32A 2QTFA 2FFAA 2ZR0A 1G19A 3TH5A 4HDOB 1L7VC 5FTLA 4DKXA 1NMYA 3AF3A 1UBEA 5CITA 1OYYA 2GHIA 3M6AA 1YU9A 4GOXA 1UPTA 3EWSA 4DB2A 4EQ6B 1LV7A 2V55B 1EWQA 3IGFA 1R6BX 1QDEA 1XX6A 3E70C 5TXGA 2GKSA 4URWR 1XRJA 4IDQA 1E9BA 4BRWA 4Q9IA 3ZD6A 2FV8A 5AJXA 4JL6A 1KIMA 1CTQA 4B47A 5J4HA 4LY6A 3D6TB 3EPKA 2QZ4A 1HURA 2IC5A 3IKJA 4LHWA 4XD7D 3VHXA 1F2TB 1LNZA 4AIIA 2DR3A 1CP2A 2PCJA 1F48A 1Z83A 1TAGA 1LTQA 1SVIA 1X8JA 2FA9A 1TF2A 5L3RA 1NJGA 4PC3A 1KI2A 2AX4A 3ZLJA 1QHXA 3BFVA 3GLHB 1S8FA 2ZI7A 1W4BA 1E96A 2CCGA 5TY0A 4XVUA 1CKEA 4JBXA 5IRCD 1CEEA 1JNYA 2ZPTX 3D31A 3QNUA 2ONKA 1NBMD 2WSMA 2CCKA 2NO0A 3NDPA 4CVNA 2IYXA 2EYQA 1NN1A 4MRNA 1Q22A 4DZZA 1Z3IX 3O8CA 5JLJA 3GMTA 3H0KA 1I4DD 1T0HB 4IOJA 4Q7JB 5HZHA 1COWD 1K6MA 2CVHA 1JR3E 2ERYA 4Q4JB 3I3SR 4EPVA 4LRWA 4JLVA 3TQCA 2GCNA 5IK2D 1N6IA 4Q4HA 1VCMA 4TLAA 1G3MA 2OSBA 5EXTA 2O0JA 3MCAA 3RS4A 2R6FA 3GJ7A 4RKFA 4UXJA 2Q6TA 1GRNA 4Q7LA 1TUEA 5JFGA 3T5GA 1W2GA 1E9CA 3ADKA 1VCNA 5GVRA 2OLKA 1XMSA 2IS6A 3MLEA 3LH5A 1UKVY 1FP7A 3OEEA 1GOTA 1KK3A 3OEHD 5FOSA 1DG3A 3WYFA 4W5JA 4B34A 1OSNA 1UDXA 5KNBA 2E9SA 2J46A 1Z29A 1PLJA 4BWYA 3W6PA 3IEUA 1JJVA 1RRFA 4RFVA 3F0TA 1G5TA 4LHYA 3GLIE 5KUTA 3SZRA 2IHBA 5F9FA 3OIWA 3PEUA 2EFDB 1W0KD 3MWKA 2BV3A 3ZGXA 3UMRA 4JLAA 1ZM3A 2CK3D 3DPUA 4HZIA 3U3JA 3M1IA 1R4AA 5P21A 3R20A 2RGCA 3UPUA 4A8JC 3QF4A 4BEBA 3FMIA 2GCPA 3SU8A 3D7MA 4JVLA 3V00A 5KU1A 1CIPA 1NN0A 1XF9A 5HCNA 1KJZA 1FUKA 3K0FA 1JQJC 3GLHA 4XD7A 3K53A 4BE7B 1E3MA 3TE6A 3NVAA 1ZM2A 4HUTA 1DE0A 3U44B 4D25A 2BM0A 1LVGA 1C1YA 4TT3D 1YVDA 2QEQA 2RHDA 1SVWA 1ANKA 2W00A 2ZI5A 3EIHA 3LV8A 4BFVA 4ACAA 2EVWX 4OYHA 1L4YA 2XOKD 3CIOA 4H1VA 5FFMA 2HUPA 2AXNA 1T5LA 4RSGA 1BMFD 2E1RA 3WP1B 1P9WA 2GWHA 4O25A 3TUJC 1E1QD 4G3XA 1GTVA 4MGZR 2ZRHA 4ZCMA 4KFSA 1Z08A 3SBDA 4OQFA 3GJ8A 4LI0A 1N5IA 2VHUA 2JLYA 3RWMB 2WJVA 4DSOA 3LVRE 2XNDD 3AGQA 3ADCA 1COWA 1HQYE 3TAHA 2FSHA 3NXSA 3FKSD 2WIBA 3W3ZB 3OAAA 4DC9A 2BBSA 1GL7A 1KZGB 5DI9A 4DLZA 1ESMA 1VDZA 2CMKA 5FL7D 2W2XA 2ZRJA 4Q48A 1FFHA 2VHTA 3U7GA 2ZRFA 1YR6A 4UXIA 1P2TA 3AP2A 1I2DA 1QG2A 3NBXX 3O8BA 1J99A 2ZRPA 2FH5B 3LLUA 4LYHA 4I81A 5FI1B 4II7A 4MA4A 3KQNA 4QGFA 2P5SA 3SDZA 4LCBA 4TLEA 4CZ2A 2QP4A 1YZTA 4HUQA 2ECKA 3QUSA 4FCWA 5BQ5A 1E2DA 1H8HA 4NCNA 4PPNA 2GESA 4HB4A 2VO1A 3ZYCA 3B5JA 4TZ6A 3CW2A 2JJ2A 2XITA 3FMPB 4DCTA 2R6GA 4WIAA 1NVVR 1KSFX 2B6HA 3BAFA 2F3TA 3AGPA 4EJSA 1QG4A 5E95A 3ZQJA 3U7FB 4HLDA 1Q1QA 2ZM5A 3QXSA 2G9NA 4JKIA 3TK1A 1JR6A 3U2QA 3I5XA 4N1AA 2Z4SA 1OKKD 2ZI3A 4JLOA 4ZO4A 3I72A 1D8TA 5AJZA 2ZJ8A 4RZXA 3TKLA 4CEJB 3Q72A 1QHHB 4PC7A 3UWKA 1KDRA 2AK2A 4B3GA 2IS4A 1RC8A 3SNHA 3S1AA 3I5YA 3IILA 4FMBB 4M9SA 2ZI9A 5L8VA 4O0MA 1JB1A 5JHHB 4NYMR 2DCUA 3IQXA 4Q4AB 5A4JA 2P5TB 4UQOA 4X8LA 3RRNA 4ZV4A 3GFOA 1E69A 4JLNA 1D2EA 4AG6A 2JJ1D 5KNCA 1W0JD 4Q00A 2R6CA 3U4QB 2WKPA 1J70A 2D06A 4P4SA 2XGJA 1G1MA 1SXJE 4DLWA 4OI0A 2F6RA 2IYZA 1MO3A 3BB3A 1E0SA 1XEWX 2ZAOA 4JL8A 4OJQA 4Q02A 2N1BA 3A8TA 1JECA 3FFAA 2REOA 4QGAA 1D2NA 4D4JA 1ZD9A 2P3SA 2Q3FA 3CX6A 5FTKA 4OQXA 4EPXA 3DEFA 1P62B 4XVQA 4TMWA 4KHZA 2C9OA 4IDHA 4PZYA 3QE0A 3CPHA 2UZIR 2IWHA 1PUJA 3B1WA 3PV0A 1ZIPA 4MYUA 5FL7A 3SR0A 3A37A 2QBYA 4C0AC 3H1TA 3C14C 2HJVA 1PLKA 4OK6A 2R6DA 5CIWA 2KBEA 1DAHA 1R8SA 3BXZA 3GJ6A 4OHWA 2J59A 2P6UA 4Q9JA 3V9PA 3B8HA 5H68A 2AL7A 3EARA 4ZKEA 4JL5A 2Y8EA 5BYJA 2DY1A 1R0XA 3I73A 3OIUA 4Q1DA 3VX3A 1KI1A 4LPKA 3QPWA 1Z5ZA 3LDAA 2B92A 1WXQA 4MYHA 4Q4LA 1FW6A 4QJ3A 3HYTA 2B7BA 3QVUA 3WP0A 2KE5A 1XXHB 3F5FA 3EXAA 3PVSA 5KSPA 2W6IA 1ZNXA 3QXCA 1P60A 3BRWD 3A58B 5JI2E 1RZ3A 3KFXA 4Q21A 4KITB 4JYBA 4B35A 4NYIQ 4V0MA 4DJTA 3AP1A 3AQ4A 2ODBA 2FEMA 1KYIA 4DLSA 4BZPA 1BMFA 3UMSA 4Z8YA 1YZNA 4JIMA 4B76A 2RAPA 1ZM4A 4ZI2A 2OXCA 1U9IA 2H1LA 4QNRA 4KSCA 5FTJA 1P73A 2FNAA 1TMKA 2VBCA 1Z6YA 1Z0FA 2P6NA 3KUCA 5EUQB 1YR7A 3HR7A 4P32A 2R6AA 3I8SA 4I1OA 3EW9A 1SXJC 4E22A 5LD2C 2VP9A 1KSHA 1NVWQ 4L4UA 3KJHA 4AKIA 3FMFA 4P3YA 1E9SA 3AKCA 2AN9A 2A78A 3NWJA 1NLFA 1P2VA 1T8TA 4HYYA 3HU3A 4XH9B 4B6EA 4PZZA 1UEJA 3SI7A 1Q57A 4IVPA 3DKPA 1SVKA 5AUPB 2I1QA 3MUFA 2YHSA 4EPWA 3SE0A 1NSFA 3LY5A 4BUJA 4LGMA 4ESHA 4HAYA 1SHZA 3FHOA 3Q85A 4LBYA 1GNRA 2NIPA 2J41A 2D62A 4M22A 3GLFB 1M7BA 1R0ZA 3W8NA 2ZEJA 3WRYC 4CYMA 1II0A 2QROA 4PPGA 2B8WA 2IYRA 4LK2A 1YQTA 1E94E 5KSOA 1XNJA 1I4TD 3KQLA 3D3QA 1U9IC 2QL6A 4OQMA 5CJPA 3PITA 2F9MA 4CEIA 1ZUNB 5CLQA 1D6JA 1Z0DA 3BB1A 1OW3B 4YMSA 5G40A 2BEJA 5DISB 4FMDF 1JEDA 2JJ2D 1XEXB 4MH0R 1KNQA 1VG9B 1S0UA 4AKHA 1GP2A 4DEYA 2ZYVX 1IJEA 2C9YA 3CX8A 4GZLA 2O8DB 5KDDA 3FB4A 1IQPA 4CT4B 4LPSA 4C9BA 3QKRA 1UKEA 2A3RA 1O3YA 1W36C 1OB2A 2VP5A 2YOGA 1AJEA 1YJ5A 5DYGA 4Q4JA 3KJEA 3KJGA 1GVNB 2CHGA 3T35A 4WZBE 4EDHA 4HAVA 3RS2A 4PO9A 4HAZA 4IVQA 1AS0A 1NF3A 3P4XA 2F1IA 4KFRA 2GJSA 421PA 3LXRA 1VECA 4Q47A 3FDIA 5EE9A 1XPUA 1CJVC 4PR0A 2QM7A 2WWFA 3QIAA 3VNVA 2OLJA 1CS4C 2WBLC 3MWLA 4XJXA 4EUNA 3GLHE 3BC1A 4GP6A 1HTWA 1JBKA 4IEEA 2VIIA 521PA 4ZDJA 4GPTA 4BLOA 3PUWA 4Q66C 3SC3A 3B1VA 1NMZA 3VKGA 1TQ2A 1UF9A 1FTNA 2X2FA 4AD8A 4KBFA 4Q1FA 4JVMA 3RS3A 1AGRA 3ASZA 5ANRB 1ZC3A 1H65A 1QHSA 4OHZA 4G1UC 1ZUIA 3I4LA 3R8FA 1R8QA 4IW3B 2ZVPX 2CHQA 4M9QA 4Q9LA 1E9AA 1M6NA 2ODEA 2X1VA 3B7GA 2ZIAA 1ZNZA 1CLUA 1Z22A 4QBHA 4TMZA 5TB5A 4FMCB 2NO9A 4TLBA 1OXUA 2G6BA 5GJCA 5J4KA 2R8RA 5TARA 1W48A 1MABB 3ZZ0A 2UKDA 3VFDA 5IK2A 3WNBA 1XCGB 1NIPA 3SHFA 3AVYA 1JPJA 1O87A 4Q7KA 4CEHB 1KI9A 1TL7C 2DFNA 2IXGA 2A5FA 3CX7A 3VR3A 4Z51A 2XZLA 1AIPA 8OHMA 2GZAA 3RYTC 4AYTA 2UZ3A 2XTNA 4YXWA 2J7KA 1W36B 3T1TA 3AUYA 4M1SA 2D2EA 1Z6XA 2PH1A 5DHAA 1CBUA 4NH0A 2HT6A 2Z43A 1E2IA 4KYUA 3P32A 4LZZA 6Q21A 1U94A 3FE2A 1XEFA 4UNQA 4MGKR 1XMVA 2GA8A 3G82C 5JWOA 3CO5A 1C9KA 4PTLA 4IRUB 1BO6A 3NIBA 1WBDA 1F2TA 3WMGA 2VH5R 2EWWA 2B21A 3T5DA 5FUXA 1KZ7B 4HLCA 3BBPA 3CRW1 3W34A 1GRQA 5BXQC 2AFIE 5K8UA 1DO0A 3F8TA 3VU9A 4A0HA 2FX3A 2WAXA 2WJGA 1DAMA 2WWIA 4RD2A 3W90A 3SJCA 4CW7A 3E2IA 2OFOA 3LX8A 1ZCBA 2YKGA 1YZQA 5DE3A 3S1AB 2N46A 2EFEB 3EZ7A 3C4JA 1WQ1R 5DYIA 5HCIA 3RNLA 2QSZA 2OCAA 3OIYA 4LSGA 2IYTA 3P26A 4JJKA 1ZIOA 2G1JA 2RGNA 4L9WA 4D2IA 2V9PA 4PPFA 1G41A 4LJ7A 3KB1A 1IAQA 5FBLB 2VYFA 4PHTA 1VPLA 3OAAD 4RJLA 2EFCB 3RRYA 1YZLA 2FPLA 3OHMA 2ZANA 1RRPA 4LJ9A 5HPYB 4DUGD 2GJ8A 3QKSA 4KJZA 1F2UB 1V5WA 1ZU4A 5JECA 3MJRA 1XPOA 2V3CC 2CHVA 1CXZA 4TL7A 1EK0A 4C0BA 3T34A 1DAKA 2AR7A 3NC0C 1GAJA 3IO3A 1HE8B 3KKMA 4LV6A 2QI9C 4JYCA 1G5RA 2HYDA 2J45A 2Q21A 5GJVC 4LYJA 3K70B 5F9HA 4WXRA 2WSSD 2FGKA 3SBEA 2VTKA 4QBFA 2RH5A 4YMUA 1AZTA 3BFKA 3P20A 4PAOA 1JALA 2OESA 4HEJA 3MRSA 4V0OA 1ZP6A 3R9WA 1N3BA 2W83A 2CLDX 4Q19A 1ZW6A 2C78A 3QEOA 1M8PA
chains in the Genus database with same CATH superfamily
4QHYA 2YN0A 3BRCA 4HDMA 4F3KA 3VZRA 4LYAA 4TV9A 1Z0AA 2A0UA 1P7VA 2QMOA 3GD7A 3FTFA 1UWVA 4I2VA 1V4BA 2WNHA 5FOTA 1NU8A 1O94D 1J42A 1JLHA 3JQQA 1P4JA 1VJ0A 2LCQA 4XM2A 2O2GA 3D6UA 4C2UA 5U1PA 4IIGA 1MV5A 1IULA 1C9YA 2HPHA 3HCPA 5ALEA 2BBTA 3C1AA 1KBOA 3DFUA 3GJRA 2GO1A 5CJJA 1T5TA 3STWA 1SMKA 3S40A 1N2CB 4H7EA 1Z7GA 1BG6A 4LYFA 4Y98A 2H1IA 4YWJA 4DWWA 1EM8B 3B7PA 3HP4A 4OATA 1PVDA 4REQA 5AOCA 1JR4A 3CKKA 3FZGA 3LC1O 4QATA 1EMDA 4LJAA 5IJ9A 1LBEA 2OZPA 3OPQA 3RS5A 4FPXA 1XG5A 1ZH6A 3NBYC 2CXHA 3ZU3A 2J4FA 3AJDA 4Y3UA 4YPOA 1FK8A 4PWYA 4EI9A 4AZVA 1PFUA 1W0CA 2QMQA 3W2IA 2EQBA 2L42A 4FHDA 4E5MA 2IXTA 2V0NA 5FOQA 4I6GA 3EXFB 2WYOA 3BERA 3KXIA 4MR8A 2HD4A 1N0IA 1OROA 3JWJA 5IMBA 5TF4A 3X2FA 4MW2A 2NADA 3LDFA 4XQCA 1AKTA 1W9MA 2JGMA 3IUEA 4UAVA 3R6WA 3ZW8A 4B44A 2XRMA 3ADOA 5ILQA 3ICOA 1T9AA 3V8PA 5AVTA 5D5HA 1EFUA 1EUCA 2H7CA 4YO8A 2Z3ZA 1N78A 2VUHB 4W5QA 3MD0A 2J31A 2PLFA 1Z5PA 2C2ZA 2C4HA 1M0SA 2XB8A 1SD1A 4ARCA 1K98A 3PUJA 1N1GA 2II6A 3EZXA 2WPDD 1DJNA 4LJKA 2XB2A 4GT1A 4X7RA 4I1IA 2B8JA 3QG5A 1E3WA 1EXWA 3GRFA 4U1RA 5CURA 2XBMA 3DMGA 1E2MA 2CHEA 1UUFA 5EP3A 1ULHA 5JO9A 3R7BA 5JD4A 5JXHA 5D51S 1U2RA 5HRAA 4AS1A 3WLSA 2GT1A 2Y68A 4YJGB 1WXHA 2VK1A 2REQB 3F74A 2C95A 3AYZB 4XFJA 2GZ2A 4O29A 1M1YE 3TQFA 1H23A 1ZHFA 5KWJA 4TMTA 1SKBA 1U11A 3UK6A 4DJAA 2IY8A 4TM8A 5INTA 1GVHA 1EGQA 1H85A 3ZU2A 4OB8A 1OI3A 4WK2B 5EFZA 1G8JA 3HYSA 1XWIA 4HUJA 3G5AA 4QVGA 3NQ41 5FNVF 2GNPA 1YS1X 1RKUA 4QYXA 3QBVA 3ZEIA 4QE3A 2AD1A 4KGVA 1FP4A 3IA2A 3PFCA 5GZ3A 3QNMA 4BLWA 1JQ5A 3QJYA 3CWQA 1D9XA 2DFLA 1VZ2A 2O5VA 5CMLA 2QY9A 1M9NA 4G5OA 2E4AA 4S1PA 3L2OB 5DZSA 4AJ2A 4C4SA 2CXXA 2A7XA 2ABWA 4EUSA 5C81A 1VBMA 1G6OA 1R0CA 3AVQA 3MCWA 3UHJA 1IZYA 2O2HA 2P9QA 3C39A 4G4SP 1U6KA 5HEKA 8GPBA 4JK3A 1DKPA 2ATCA 2GMWA 1P4RA 2PSEA 3ND8A 4GX1A 4DNFA 3UOGA 4DLXA 1YE8A 4F9EA 4W99A 3DF7A 5IBPA 1AGPA 3HA3A 4Q15A 2EKDA 3OM9A 4MQ5A 2B5WA 1KE1A 2MIIA 3W06A 3H5NA 5I4CA 1YUBA 2BFFB 1US8B 2IV7A 3EOAI 4J4TA 4K8OA 4Q82A 2ZS7A 3E3LA 3OF5A 4K6OA 1M34A 4RH1A 3S2UA 2QW0X 4NG4A 3H7AA 3CXUA 2YC2C 5I3CA 5CBPA 3TNLA 3UV6A 2AD5A 1NJ6A 1NNUA 4XX0A 1O96A 2X2PA 4UFNA 3GROA 4F91B 1KHTA 4EMBA 2W2TA 2XTJA 3LVBA 3PUZA 4U0JA 1GRRA 1PI3A 1Z2EA 2BMWA 1G7CA 1Q7BA 2R11A 2GH1A 1N2BA 1H0SA 2HIGA 4YT5A 1QJ4A 4ZOLB 5MN4A 1C1DA 1SH7A 5DCYA 2P67A 4WH0A 4DR3B 2JHFA 4M0DA 2H1OA 3KYDB 3O3OB 5HZKA 4DA0A 5D84A 5EUCA 3M5WA 4BGDA 2YN4A 2RGGA 4XGIA 3OU6A 3WAKA 2YJTD 1Y34E 1YDFA 3PEWA 2FPOA 4YJ3B 4ZCPA 3W9UA 1OIWA 3L04A 2F59A 2TS1A 4UQPA 3TRIA 4PS0A 1W30A 4F60A 2FZ4A 3MPOA 1JTEA 1VLMA 5E2BA 4ZHQB 3DXXA 2EOAA 4IEIA 1HNZB 5IN4A 4M99A 4ZAVA 1NWCA 3WMEA 2AW5A 3TW6A 2GTIA 4OQDA 4BNLA 3L8EA 2HLNA 3H5AA 1F2UA 3QE4A 4TWBA 3EBOA 3NDIA 4Q9NA 4X7BA 4DCOA 5FBWB 1A27A 1FPMA 2EP5A 4FFLA 4YLGA 2OPBA 4YP6A 4CLHA 4TMYA 2HJHA 5JSZB 3ZD7A 3GGPA 2H8KA 3PQEA 4O4LA 3ZJYA 2FAXA 3KOYA 1VIAA 2AZDA 4M37A 2ZI6A 4O4JA 5T3UA 3BMNA 1ZMBA 4BVKA 1U5AA 5TQ0A 4E32A 3KOZA 5BWNA 4I66A 4JZYA 3TLGA 2V7BA 3QVGA 4EHIA 3VA7A 3KAQA 2DQSA 2I3BA 5JCZA 3GB9A 2EX0A 4FFMA 5E0OA 2PBRA 4IDEA 2PVSA 2PFSA 1IWBB 1M76A 3G1WA 2QUZA 3CNOA 2PSJA 1GILA 1KA9H 4L8WB 5HQJA 5C4IA 3OPMA 5HKBA 4E5UA 5ITWA 1QCYA 5F5XA 2FRDA 1Q6YA 4X1IB 1QFSA 1KAQA 3CTMA 3AY6A 3PIIA 2HF9A 4NMMA 3FOBA 4MRPA 5CDFE 4GZ5A 1CRZA 3TQRA 3VZBA 3MW8A 4TMKA 1FRQA 2LUOA 1NVUQ 1BYIA 3B1YA 3PSAA 5BN5A 2FZVA 3T94A 3U0VA 1JAZA 5B7NA 1CLEA 4U6QA 5JZ9A 3QWHA 3ZDAA 3AFGA 4PFKA 4LMRA 3OO1A 5A7HA 1G18A 2ODTX 2G82A 1A9OA 5JCOA 3ZE7A 4WV3A 3ZTTA 4UU8A 1THGA 4A73A 4EGAA 3D5EA 3THSA 2PFGA 3FZQA 1FVXA 4EWLA 1OZHA 2Q5IA 1EU1A 3EF3A 4HATA 4TL6A 1P0MA 3ENZA 2Y05A 3CW8X 1QH0A 4KAFA 4GFDA 3O73A 1N32B 5EG5A 4G23A 3VGJA 2O8EA 1P72A 3KXKA 1M54A 1MB2A 2QYSA 1QHYA 2XKBA 1O94C 1GUBA 3FPLA 4OHMA 4E6PA 5LD2B 4KIGA 4C6HA 3DZDA 2DY0A 4BXOB 2VZLA 3O84A 1MQ8B 2IUSA 3LJKA 1G17A 4MWTA 3TRJA 1GSHA 2I3GA 4LMBA 1NZJA 1DKQA 1Y63A 3E53A 3G0OA 4CMCA 3ICWA 5CYGA 1M8GA 2YW9A 4HZUB 4RA9B 4EJMA 3F6RA 5IG2A 1V7CA 3IKTA 4XLLA 4YRKA 2ZE5A 3X1MA 1N7IA 1H2WA 2E5LB 5LUBA 4UVIA 1OV6A 4NS4A 4MWZA 3VNAA 3E0XA 4FUTA 2LZ0A 2FXVA 4MS3B 1ELOA 2I4NA 3BQ9A 3ROKA 2JI7A 3IJ5A 3PHLA 5GAJA 4UW9A 3S29A 5L3SB 4GGPA 2ZPAA 5K3BA 1F2VA 2PZ8A 4ARZB 5LJIA 5MDHA 3A28A 3C5EA 4TTTS 2Q2NA 4V0KA 3I58A 3MWJA 1JHOA 4G0ZA 3PJGA 1W52X 1K3TA 1NJ2A 3DZGA 1KR2A 2SKCA 1IIBA 2G9ZA 1KERA 1RTTA 2B3DA 1Y3IA 3B1XA 3BULA 5FOXA 5JZBA 2BH9A 1GTRA 2C96A 1SC9A 4D8WA 3LK7A 5CA1F 4LZLA 3E9CA 4RS4A 5JJCA 5IKEA 3DJYA 4HXFB 2G5TA 4IXDA 1QGOA 5FLKA 2P62A 4Y1GA 2OLEA 3RUHA 3U7RA 3SWWA 2FWPA 1I1NA 4JMLA 5CBKA 2OZEA 1M6HA 4KMRA 1M1XB 4AURA 4KNYA 3BXOA 4BMPB 4ZVVA 1RZUA 4N9QA 4MROA 2WWXA 1JI3A 3DL0A 1GPMA 4KNVA 4WKNA 2GBCA 4DCGA 4ZGGA 3JWIA 3IEVA 4AG3A 3BWDD 4O4JF 4XCVA 2WWYA 2MDTA 1WG8A 5K0SA 2O8CB 1UK9A 3G5UA 1FTQA 2ONYA 3GGOA 3KD3A 4B4UA 3S8YA 1PV4A 3W2FA 3MBIA 3KT3A 4GP7A 2MMGA 2ZE8A 1G42A 1UAGA 4QTZA 3QUQA 3ET5A 4YV7A 1SVSA 2YXPX 3GH3A 1E1QA 3KP1A 3EA5A 3IX7A 4B3CA 3GCXA 2X4LA 4C05A 3CLKA 4DCNA 2R7MA 1WZEA 3BH7A 3IAAA 5H3LA 1XHFA 4BMDA 4CUKA 2GS9A 3S2IA 1RCUA 2C8JA 3UTCA 4FD2A 4NECA 4YQFA 4ZK2A 5U4QA 4K9MA 2CLIB 4OB7A 5C4GB 5LOVB 2FR8A 1R6XA 5AVKA 4C2BA 2FJ0A 3LCJA 1SHLA 3RADC 3K09C 4UZSA 1FMFA 3WL8A 2B30A 4H7IA 4DSNA 4L5IA 1RXUA 4O2RA 4PRKA 4TOIA 3JW8A 4NHOA 5DLPA 2BHNA 1LNSA 2WW8A 1PR9A 1E64A 1SKYE 4MUNA 4Y0VA 2C2MA 2A30A 1EB8A 2IHYA 3BWCA 4HEHA 2JZOA 4B8WA 3R5FA 3EDYA 2XVZA 4NX2A 4R9NA 4EYQA 3L84A 2ACEA 1RT9A 2AX3A 2OSVA 3ENKA 3WLRA 1FSGA 4CEHA 1WHSA 2XRFA 2BR5A 4H1TA 4FU0A 4P0TA 2AEJA 4R1SA 5ICSA 3OUUA 1DV2A 2D59A 3EUAA 5T41A 2XXJA 5C2JB 2Y0PA 3O2QB 2QD3A 2HRQA 1YDGA 1M7GA 1C4XA 3N7UA 3FVQA 1QIKA 3EC1A 3MCVA 2B4RO 2FLVA 1BCSA 2YYAA 5IT4A 4ASUA 2HF7A 1PIWA 3K8OE 1OBVA 1RHKA 3Q41A 2JHGA 3QMVA 2G08A 5DRYA 3WB2A 4DCUA 4IUCS 3W1EA 3HUTA 1ULBA 4PLGA 3FH0A 3H8SA 1OT5A 5BV0A 1WZCA 1XYGA 2O50A 2C0QA 5E6SA 1GPAA 1OA1A 1XJQA 2LDBA 1PJTA 3UMFA 1TE2A 1HSOA 2F8TA 2IKSA 4RZ3A 1Y8ZA 5LBUA 5K0JA 1DBPA 1Y6RA 2E4WA 1JW9B 1PX0A 3WDSA 1RYEA 3EF0A 4RESA 4XGNA 3ZDBA 5LVAA 3MD9A 2R00A 2IF0A 3KVYA 1QIIA 2GSWA 2R84A 2ZJ2A 4Q3KA 4I3FA 3KHKA 3SFTA 2CVQA 3T3EA 1RCFA 1HL7A 1E8NA 1UKZA 4PXAA 5FJJA 1BHJA 1AO0A 4NCJA 4L5CA 4YWHA 5F2OA 1CQPA 1Z5UA 2H06A 3IT0A 4DQVA 5G1NA 3FGPA 3N2YA 4UE2A 1MO4A 4L9SA 3V4RA 4NBSA 1XQ1A 1IK4A 2A4KA 4S2UA 4UREA 4PCLA 3WB9A 4PANA 4YALA 5BSWA 2C2HA 3LA6A 2PT7A 4RPKA 1BFKA 4MRSA 1KDTA 4YUVA 3H5OA 2IUFA 221PA 3VZPA 1Z35A 1BFUA 3HNOA 4IOKA 2R96A 2C5FA 4ZQCB 2TSYB 5AOAA 2IH5A 5BQPA 1T4CA 2REBA 2WIAA 4R84A 2NYRA 2GN1A 3DDUA 4M1KA 5FWYA 1DQNA 1BE8A 3W7BA 3A1NA 2ADFA 4UNRA 2BFCA 1GT6A 2Q6IA 2QD1A 2NU7A 2QPLA 2X4DA 5HKAA 1SQFA 4QUKA 3SJBA 2E21A 4KOEC 2YWHA 3MSXA 3RYHB 4CQNA 3HUDA 4IYRA 4CL8A 3PPYA 5FBHA 1T91A 4L78A 1X1DA 2ZWIA 3K2QA 3A3PA 3HCOA 4ITUA 4NAHA 4RJTA 4DPKA 3LHKA 3EG5A 3JQDA 4P98A 1VYTA 1YRYE 2A59A 2HK9A 3PDWA 4I8XA 3GJQA 2EZ8A 3OY7A 4V03A 4WAUA 3WGOA 1YVUA 4B4KA 2GCOA 2EX1A 4ZTBA 1U1EA 2QNIA 3IDQA 5EJEA 3MFYA 2PUCA 4KIJA 1TEZA 1KAOA 2IHUA 4FUQA 4LX0A 1MIOB 5KKAA 1UDBA 5EJGA 3Q40A 3CWCA 4KTTE 1WZNA 1XTBA 1MA0A 4MK4A 1NYTA 1VHWA 3BT7A 1RRGA 3N53A 1EVYA 1WA5A 5F4ZA 4G5GA 4PSVA 1HKUA 3EHDA 3GLUA 4JNCA 3CVYA 3N70A 4TQ9A 1QANA 5B12A 5C51B 1VXRA 2XUJA 5K8LA 1P0PA 2ZJ0A 5JRJA 2GJ9A 1ZZGA 4MLZA 4CU2A 4EGSA 1JPVA 4QDTA 3T3NA 1YZUA 1NMXA 5BW6B 1X92A 2XNKA 2IZ6A 2YMMA 5JMTA 1TM4E 2B4YA 3LBHA 3KOUA 2CF6A 2EKZA 2KQUA 1NATA 2FFBA 3AXSA 3LT2A 4LJRA 3HB0A 2D3WA 1TEVA 1QK4A 2BDTA 1BXRB 3G13A 3HI6A 1V4NA 1Y1RA 1KY2A 3L7NA 3LOPA 2R44A 2YR0A 4P5DA 4YMWA 1WXWA 5CW1A 1OU4A 2WTUA 2Y4NA 1TM3E 3LIIA 4OI1A 3AF5A 4YH1A 2N42A 4HWOA 2GK6A 4GU5A 4RKEA 4QUBA 5LMUB 2WB2A 4ARSA 2QQGA 4KIUA 4NCBA 2IRWA 3KALA 3L8FA 2JLZA 2XCIA 2OCYC 4WACA 2PWAA 4IIYA 1NUSA 1F6BA 1EVLA 1SD5A 1SZPA 1MR3F 2J3DA 3L05A 3M0EA 5GJWC 5J1TB 3SF8A 4CIDA 1I36A 1MA3A 4LGCA 3SSOA 5JJLA 2G9UA 4WXEA 1DC8A 3HB9A 3GEHA 2ZCJA 1SVLA 4TN1A 3HDJA 4D3FA 5GADl 4GWLA 3V1YA 1H0KA 1QGUB 4WHMA 4JJ8A 4YAGA 1O95D 5K3OA 3V6LA 4BJ3A 4RHXA 1W4RA 3NJRA 5JANA 3JAKB 5ADVA 2SCUA 5L7WA 1Y81A 3VNSA 2DR2A 1S2GA 4D82A 1L0BA 1SWVA 1JFLA 1W85B 1YO6A 3CT6A 4Q03A 5K2OA 1I2CA 1HKHA 2AN3A 1DO2A 4M9UA 2OB1A 4WVFA 3EYAA 3HCEA 3S8MA 1OYWA 4PU0A 3A6LA 3HJUA 2Z5GA 4E2ZA 1FBNA 1Z9BA 3NLLA 4C20A 5AR1A 1WU8A 1Z4MA 2VJNA 3ANNA 3ZV4A 2HBRA 4NXMB 2CUNA 3KS9A 2AC4A 3THWA 2OCPA 1S96A 1Z4PX 2Q1UA 1DC3A 2HN9A 5KVCA 2AN5A 3LI2A 5COAA 3ZY6A 4B43A 2DX7A 4L8FA 1POXA 3PC7A 4UE6A 5D6OA 3KXLA 5AP9A 3HKDA 5FWDA 2HBQA 2ZJ3A 3CH4B 4PCVA 1RM0A 2ES4A 4X94A 5K0ZA 3KM0A 1QTNA 1CUIA 1IN5A 1SAYA 1LTKA 1RHQA 1R8JA 1VLVA 3L0SA 4H2DA 4XW2A 2O2DA 4IKPA 1YKFA 1ZSVA 3MAAC 4GEGA 4AMGA 3JPWA 3M4JA 5BN5B 5FR2A 5KO2A 4KX5A 4FB4A 1NVBA 4CF6A 1EXMA 2I7DA 3CKLA 4H7HA 4MEAA 3KZ1E 5AM5A 5HUQA 3WBJA 1MD9A 3QX3A 5IAKA 3WMFA 3V8EA 5HZMA 3DT6A 4O2LA 4M8NE 1TYBE 2JH3A 1JBQA 1W25A 3NTUA 4NBRA 3WZ2A 3QW2A 1X7GA 3ZZTA 5KTYA 4DQLA 1QLWA 4E5PA 4ZT3A 4TMVA 2TMDA 4DLRA 4YLYA 1XYYA 3F5QA 3GH1A 4FYKA 5DYYA 5JAZA 2P30A 4ASUD 3GLQA 2AF4C 4N7BA 1L7BA 1FZTA 4BVHA 4Z9YA 5C37A 3CRVA 4CM5A 4LV8B 4X91A 1RYMA 2WIKA 1V25A 3R23A 4OHFA 4EHHA 1SY7A 3N2GB 2EU8A 5FEMA 3SYNA 2X2EA 2YQ5A 1FTGA 2RCYA 1YAHA 4D57A 2AS0A 3A3YA 3OKCA 1MHTA 2Z5FA 4F4CA 1MJGA 4BNKA 3AF0A 4TSRA 3RVBA 1RVV1 4KWEA 5I9LA 1AO3A 4TL9A 4C7KA 1XEWY 1WD5A 8MHTA 3VYVA 1CE8A 2ZB3A 1YF3A 4XWKA 4B5LA 5KYXA 4DV2B 3LQRA 4LRQA 3BJIC 3U09A 1YRAA 1A8SA 1DQRA 3HBAA 5IT0A 4WX2B 4BCBA 3DF9A 2VNAA 3IR6A 1HZZC 1Z0JA 2Q9AA 1Z63A 2PK3A 4NFLA 2VUUA 1SQ5A 1ZQ9A 3KZXA 5AKYA 3A3NA 3GWZA 4RHFA 2QAJA 3NG1A 3FPEA 3P71T 4FDMA 2VQDA 1NQTA 1ONOA 1V6SA 2XNHA 2GNAA 4QD3A 4ZO9A 1AN0A 1E9FA 1CQIB 5T57A 5T4EA 2D2XA 3FDZA 2E48A 3GMIA 1JMYA 1Z8FA 3SXPA 4NKRA 1BWQA 3NM5A 4MPPA 5AQ1A 4M0KA 4H9GA 4ZZ0A 1FJXA 2P6OA 4OSOA 5KWEA 2NZJA 1GQOA 2F64A 3BZWA 3WWOA 1SO8A 3CEHA 4MI9A 5B58C 1Z4NA 3Q8LA 4G01B 4ED9A 1JQKA 1LW7A 3V8NA 5AUOB 1R66A 3V8RA 2OGWA 2QMUA 2HIAA 1G3IA 3BDAA 4RFLA 4J3NA 3TM4A 3KR2A 2AI2A 4MS1A 2C4VA 4LOAA 1XZPA 1K5DA 4AQYB 2BFFA 1ZA2A 2EBHX 3JQPA 4NU0A 5KJ6A 3AFMA 3BD9A 3FTNA 5CXSA 4HDQB 5F78A 3AF6A 4UE3S 4CLOA 3IAHA 3RRMA 5AW7A 3SK0A 3HZRA 4EG4A 1SCKA 2QE7D 2Z0MA 5D7BA 5EQFA 4A9AA 1ODIA 5LL6P 4G85A 2B2NA 3DQQA 4B79A 1BWSA 4NOKA 1F6WA 2JCXA 3L0PA 1RRKA 3IV7A 2Y1CA 3DZFA 3H83A 3Q0IA 4MIYA 4QOSA 1JR3A 4DKJA 3L5OA 5L3SA 1I4OA 2JLUA 3HFSA 1Y5IA 1PS9A 4K6KA 1PVOA 5JY6A 4BFZA 1OXVA 1X1AA 5CK5A 1L7AA 2WZDA 3AR2A 1D9ZA 4MDYA 5ALYA 4NU5A 3C0KA 3DONA 3E5NA 3NHYA 3UXMA 3NYRA 4A0FA 4DIEA 1N8TA 2V58A 3IXLA 4Z99A 3SXUA 3QU9A 3TUZC 2QRZA 2ODPA 1KNXA 4AVYA 4F9GA 4DSUA 3EA4A 5I7EA 1BH2A 2JAPA 5C3MA 4P7JA 2Q2WA 1DXQA 4LHXA 8ADHA 2DLNA 1CF4A 1TKAA 3O1JC 4PHFA 2VDPB 4WI1A 5KX5F 3I2KA 2NX2A 3ZX5A 3PF8A 3ADDA 2JCSA 3U3ZA 3UCFA 1XTSA 3OJ0A 4DIDA 1Z4QA 1CNFA 2EIHA 5F3DA 1GUZA 4C4XA 4F4JA 2NYUA 3NC4A 5C5EA 2GQ0A 1J5PA 2AT1A 3CQ9A 1XMIA 2BAGA 3OOSA 4A1OA 1MHPA 2QORA 2A0FA 3NUQA 2FX5A 1TU3A 3SOPA 3T7EA 4BFYA 5CW2A 4HK4A 4HOYA 1IG0A 4KXXA 3STYA 4Z1OA 1UOQA 2B98A 1JI0A 2IVFA 1JHZA 1CQIA 1HH4A 1U0HC 4UMFA 1EG7A 2AG1A 2FG7C 1W1WA 5REQB 2AZMA 3QELA 4GKKB 5EE1A 3KT0A 3L9XA 3UN1A 3ZX4A 4X61A 1FNMA 1RJDA 4LVCA 3K0SA 1CHDA 2JARA 3L1JA 5DTRA 2XAAA 1R6UA 1HY3A 2ZCVA 2XRZA 2TECE 2GCGA 3M6IA 3KB6A 4KIFA 1YFLA 3FYUC 2G1PA 4K9QA 5A71A 1NGSA 4HV4A 3JR7A 6CHYA 3P9RA 5I7OA 1UAYA 2FUG6 2PLWA 3CW9A 1ZRMA 4Y7CA 1RKQA 4D8YA 2ON6A 3Q87B 2OAQ1 2BZGA 2OTCA 4ZT6A 5H16A 1UBTS 2DFVA 4M21A 4KPFC 2PKYX 1V4VA 3PKJA 3ZBUA 1XL1A 1CY7A 3JZMA 4ETWA 1I8TA 1KAMA 2IA5A 3I6ZA 1M2KA 4GVLA 4X1KB 1DV1A 5AVOA 3PFIA 1GHTA 3IALA 4YP9A 3ZBPA 4J7XA 2X0KA 3L46A 4B4WA 4DG9A 3PNQA 1ZWKA 5F7XA 5K51A 4X60A 2F17A 4KXMA 4NENB 4IMPA 2R66A 1VSTA 3GCGA 3DMFA 3H42B 1G7RA 3VYTB 4DDTA 3KR1A 1R4MB 3FHLA 5L4NA 1YXMA 1GIAA 3ZPXA 1QGYA 1BS2A 2OO7A 1OGJA 4KP7A 1O6FA 1PL8A 4DE5A 3R3XA 4WZAA 1UWCA 3MRTA 3T9DA 4LY3A 3BMOA 2YNMA 3O1IC 3GCWA 4C06A 2PGLA 3CGGA 4QUIA 1C30B 4ZPJA 3GVCA 4IF6A 1OLXA 4QIHA 1KI3A 2YUIA 3OBBA 3K71B 2GF0A 4I9NA 3GPLA 3G2KA 4BGEA 5E6SB 1RJGA 1DDGA 1WR8A 3WLLA 4DNXA 4DC1A 4EHKA 1MW9X 2WKSA 3KZMA 3BXEA 4TT3A 3FKJA 1S4MA 5CNKA 3I2FA 4CLXA 3V2HA 2O3UA 1RMTA 2YYYA 4Z6KA 5CTJA 1FP6A 2O9JA 3GFVA 4UNSA 2NNLD 3NBUA 4IQFA 4NPHA 3FHTA 2NOAA 3PQ5A 5HKLA 4JLUA 3JZDA 4DQ0A 1M2FA 1MX1A 3GBSA 3LDHA 3NYWA 3ZY3A 1FLAA 4Y2QA 5B30A 1VYVA 3FI9A 1W35A 4JOQA 4ENTA 5L4LA 4JBLA 2WUFA 3SYKA 1CR6A 4J9UE 4BZXA 3THYA 1RZRD 3KQPA 3JVDA 3SEQA 3H2HA 1XMJA 1XTRA 2JGNA 3FTPA 2PU5A 4YRMA 4WEQA 2EL9A 1AN9A 1CYDA 2QSYA 2WJHA 2WTMA 3QVKA 4I5FA 3EFEA 3PU6A 1KY5A 4J75A 1KRWA 1KO1A 3NNSA 5JHGB 2BTOA 1K9SA 3OLQA 2AG8A 3OF3A 1O57A 4KQEA 1SC1A 1RP1A 3RIYA 4G0WA 2QTMA 3V7YA 4M0LA 5ALSA 2PE5A 3ZHCA 1SQGA 3TOZA 2GEUA 5GM2A 2K6GA 1R8XA 1RLOA 4GPAA 4MWSA 1LRLA 1GR0A 1VLLA 4RDIA 3BMNB 4RK0A 4U63A 3RYHA 2YN2A 3WJ1A 4B8ZA 4GLLA 3EZ9A 4GR5A 2C7OA 4RPIA 3T4UA 1XMOB 2C92A 3EDCA 3MUOA 1U2GA 4RGVA 4LF9B 1EFRD 1ZCZA 3RDPA 4AMZA 2YJZA 1B0ZA 4DABA 2H48A 1BXKA 1OLUA 3OZBA 4EH1A 2HLPA 3BTUA 2VNIA 3IUYA 1VIYA 1WXEA 1Z2NX 1EJBA 3TTXA 3ZY4A 4R0NA 3T7KA 1YACA 1LDNA 1HDIA 2V03A 2XT0A 4OBXA 1P5RA 3BM5A 3FMOB 3OICA 5A3JA 4N6NA 5KYVA 1C3XA 3CF4A 3L6CA 3WV5A 5JCPA 3D8SA 3TSAA 1G2IA 4MDHA 1QGAA 4PZUA 3JYLA 3FYTA 1Q1NA 2VWQA 1SRQA 3DLIA 3ONVA 4WLNA 2VCEA 3PDIB 4TM7A 3V7WA 3RUDA 4OEHA 3I39X 3CUVA 4TRJA 4ENSA 3H2SA 1IOZA 4HR7A 1YL5A 3E27A 1HFWA 3QPBA 4TS3A 3OUTA 5IAAA 3BHIA 3PGKA 4KQGA 4D45A 3DVAA 1P2UA 4FDAA 4RXUA 4YCAA 1GUYA 3CG4A 5AM4A 3VUEA 3GFQA 1UT6A 1XP8A 4HH3C 2K7ZA 4PLFA 2PZEA 3IIJA 1PJ2A 4K2HA 4Q5IA 4QECA 3WK7A 1N77A 1A4IA 3GDFA 2A5DA 1CVIA 2W43A 3N2NA 5FRDA 4Z1MA 2WHXA 3B53X 1ND6A 1X8LA 3CU5A 3AF4A 3PHIA 1NM5C 1XTUA 5GGYA 2FETA 1KOLA 3RI3A 2AFRA 3O8LA 4BEWA 4CIYA 3MHTA 2V8OA 3SQNA 5FD8A 3AHIA 1EWRA 3GBPA 3B5IA 1CCWA 5KTPA 5MGNA 1XCJA 2GEFA 3EEBA 5CX1B 1W88A 2HT1A 2HEIA 1I6LA 3NWPA 4U0KA 2B8NA 1YOVA 1EM6A 1ZRHA 4HB3A 2RGXA 4G0PA 5LXTF 4PIMA 5IZCA 5IDQA 3VC1A 1WCIA 4GM4A 4U7HA 1V45E 4ZANA 1B15A 2VF4X 2PKCA 3O7MA 3CS3A 2ET6A 4KDRA 1IZ7A 4HN4B 4IIFA 4OHCA 3OHSX 1UBKS 3B7WA 4C3ZA 1KMQA 2SCUB 3IEKA 1AKVA 2C97A 3KLNA 1N3LA 3QFCA 3RJZA 2A1UA 1D3AA 2G0NA 2OP0A 5E3HA 1T5HX 4A5OA 1GNTA 1L6RA 1YVEI 2O1EA 2PH3A 1NDUA 2WJIA 4EG5A 2W2LD 4V0LA 1SCUA 2H2AA 4DDUA 5HQ3B 3CVXA 1SXPA 4WKGA 3M4NA 2VHXA 2BKAA 2I1VB 1L4KA 4QRIA 2QY6A 3NR2A 5HW0A 2QRUA 1NLYA 2FZLA 3EFOA 3IIKA 4I55B 1J0XO 2PJZA 2UDPA 3O2JA 4GZMA 3LCUA 2Q2QA 3P8ZA 4Z0NA 3BOSA 2I8AA 3D8BA 2VK2A 3L8MA 3EK2A 4R1NA 5AI8A 2PXHA 4BNNA 4Z9FA 4EB8A 4PHHA 3NKVA 4Q1AA 3SYMA 3GP8A 4G8DA 2B36A 2ZUWA 1G59A 1NAIA 3I9OA 2P6RA 3KBBA 4UARA 3R0JA 4Q4CA 1QTIA 1SC4A 2YCLA 4J2HA 3DNFA 1NHWA 1RC1A 2W2KA 3FYCA 4IV8A 1RBQA 3HLTA 2O4CA 3RSSA 4W5NA 1T10A 5JJIA 4IIVA 1IMJA 4CM1A 3COPA 5LWQA 1U1CA 1FDTA 3Q88A 5KAPA 3SZ3A 4NCIA 1NVGA 4Q39A 3VOTA 1DCTA 3ZY5A 1NAHA 4UHJA 3PE4A 3HCRA 3SHVA 3TW4A 5BN4B 3GFBA 5F2NA 1SHUX 2IVZA 1SZDA 4A82A 4ENRA 2R0QC 4NYJQ 2X8LA 1VFNA 4UULA 4KR0A 5AW6A 4B71A 4WZZA 4DNOA 3V6MA 1KMMA 5DW3A 4YFVA 4XTCS 3U3XA 1G98A 3CBGA 4OI4A 3RSFA 1XXHA 1E4OA 5J4YA 2NWQA 4F12A 3KPWA 4B83A 1FOEB 5C35A 1HYHA 5EMJA 5DLDA 2A88A 5CRIA 1OBFO 2G7MC 3C7KA 4F5ZA 2DH5A 5JO0A 3GU3A 2XGGA 2XOEA 4ND7A 4I4LA 5KQMA 4J6FA 2EF0A 3SLRA 3TPCA 4ZVKA 5IC4A 2JGLA 4FW9A 2ZAGA 2PSDA 3MWEA 1EX6A 1CW2B 2ZSEA 2IK8A 3RT9A 2D7DA 1W94A 3U80A 2GHRA 3JVVA 1D5WA 1PR1A 4NAUA 4PG8A 2YFYA 1QOQB 2BONA 3T0IA 3F71A 2XCQA 4ZRMA 2B78A 2XA1A 3R7FA 4PXYA 3E5HA 4MV4A 3GEMA 2Y0CA 3BWMA 3B89A 5AMXA 2ZW9A 4MWOA 4POOA 5JS6A 2Z9DA 2F4VB 3LIPA 2ODNA 1JLLB 3HUFA 3Q11A 1EP1B 5DK6A 4AX8A 5IXJA 3CVVA 3DWEX 1FQKA 4QM7A 3QNWA 4KVZA 5FTWA 2A67A 3D4IA 2REXB 1R8YA 4MUHA 4RC9A 4LRYA 4G86A 3WIOA 5AVZA 4QULA 2APJA 4GMDA 1U3GA 2BEKA 2GBLA 2UUOA 2HWKA 3F46A 3L0YA 3KLBA 4MW1A 4AZ0A 3IIMA 4MW6A 1MZVA 1GU7A 1MC5A 2ZUVA 4C7MA 4OQPA 1KEZA 1QIFA 1L4NA 1U0TA 3H2BA 5L9AA 4IH1A 2H07A 3A36A 4GSLA 5KKCA 1YE5A 3VNUA 2QL5A 1PV2A 4TGLA 4Z4QA 1TMGE 4PN7A 4XB2A 2CSUA 2WDZA 4E15A 3MGAA 2ZOSA 3LTEA 2ZIGA 3BRSA 1ENPA 4PY2A 2IEIA 3TRDA 2XXBA 3WGYA 4LC0A 2QE7A 3OHPA 5GOZA 5DV9A 1K6EA 2Q6OA 3AW8A 3P4YA 3OIGA 4IRXA 5B6IA 3OD5A 1QR6A 4TN5A 1C9EA 1CF2O 2FOXA 3W5HA 1B0UA 2I80A 3DTTA 4U6NA 4UFPA 3NUZA 1ZI9A 3EE6A 1PFGA 1FNCA 4EFLA 2DWPA 2F1JA 4O8CA 4Q3LA 4NBVA 1AG9A 3L93A 1MKYA 2H0QA 2IEYA 4BRUA 5KSWB 3VSAA 2DT5A 1JH9A 2NT3A 1CJSA 4WGFA 1BA3A 2EQ5A 2KPOA 1BOFA 1F1BA 2JASA 3EGDB 4O1MA 1UKBA 2AQ8A 3GI1A 2JL1A 2X3UA 2R6ZA 4FGKA 3NPAA 4Z3DA 1SC6A 5HTOA 4J3JA 3NEAA 4JUAA 4MVWA 3T9AA 5BRNA 1L5GB 2ZQYA 4MV3A 4RD1A 4FN4A 3K4HA 5KSZA 3RJTA 3HNRA 4A2CA 1PNQA 3SYTA 1HE4A 3BA6A 2JLAA 2NU6A 4JELA 4YQZA 1E79D 4PQEA 2CNWA 1AQYA 1LPOA 4JXJA 4JYMA 4B46A 3MWDA 2GO7A 1DSSG 1MRSA 2Q46A 4YJHB 4ND8B 3VI4B 1OH6A 1DG9A 3R7DA 3NWOA 5SY6A 3MAGA 4MS3A 4P34A 1UFKA 2NSJA 4KQ9A 2M1ZA 2QG6A 3OFSA 4D26A 5TEVA 1JSRA 4P4NA 2GBFA 4ZIRA 3HFRA 1L4UA 3QV1A 3EVEA 1DKMA 2FCRA 2PRYA 2NN3C 3X1XA 1NVMB 3UHFA 3M1AA 4JR2A 1PRYA 4PC6A 3WOVA 3L77A 3BF7A 3KVRA 5BSVA 4FWBA 2VRWA 3LHDA 2GLTA 2JA2A 3FD8A 2JLYA 2WU3A 3NCTA 4JC0A 5DX0A 1XRRA 4Y2JA 5K0EA 4PE5B 3Q7EA 5JXIA 4ZK6A 3VVLA 1BDHA 1SBZA 4MAAA 1J39A 4GRDA 4DY4A 1YRHA 1UBMS 2OC9A 1Y42X 4YXWD 9ATCA 5E1OA 2E2WA 2G17A 2AOUB 2G67A 1D07A 3BSFA 5EGNA 3U60B 4FYPA 1T6NA 2Q8QA 2RJOA 3Q4GA 1MABA 1J90A 1ZINA 2QR5A 3BEOA 3VX4A 3RTDA 2RK3A 2OORA 1W4ZA 4WEOA 1WY7A 1ZEMA 3AL3A 3LPAA 1Y5LA 1AMOA 1KYQA 1L5HB 2I2AA 4FD3A 1AA9A 1WCWA 3TQTA 3RIHA 1E4VA 1GKYA 1CQXA 1UZLA 2EXXA 3A6KA 4YAFA 1U2PA 2PKQO 3DVRX 4YUYA 3UAWA 3UFBA 1U28A 3R7LA 2LNDA 4UVEA 3U6BA 4FZVA 4XWTA 4XVCA 5GJBA 3P45A 3LRTA 3ONNA 3OX3A 2AE1A 5TQJA 5DSZA 3U4GA 1DU4A 3JYHA 4N9WA 4HWRA 3KT8A 4R1UA 4PFSA 1U0LA 3Q0TA 1F1JA 4BJHB 3AVTA 5JJBA 4J7AA 4F4HA 1UZAA 3E8MA 2XXAA 1H1TA 1QRUA 3CRQA 1F4PA 2I4IA 2NO6A 3D5TA 1GCUA 4BNFA 1NV9A 3KKPA 5DTMA 3VAZA 3EN0A 2C2YA 1RC0A 4IZHA 1WB6A 1JLSA 5JS2A 1P3JA 4YK7A 4MRRA 3BGSA 2FWIA 1I01A 4XJSA 3A4LA 1BMTA 1QS0A 1WLSA 2Z2XA 2XUFA 3EZFA 1ZVMA 2XB6A