1ZUIA

Structural basis for shikimate-binding specificity of helicobacter pylori shikimate kinase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
158
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for shikimate-binding specificity of Helicobacter pylori shikimate kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Shikimate kinase
total genus 51
structure length 158
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zuiA00
5KDOA 4D4KA 1WF3A 1N6HA 4PHTA 4XIGS 3ZYCA 3OIUA 2ZJOA 1Z47A 2ZSAA 2BVNA 1CJKC 1G9XA 2ZJ8A 4C2UA 3AVQA 3H0KA 4TMKA 2KWIA 4YONB 2CHQA 5FH9A 1Z0AA 3K0FB 3F3YA 4JBWA 5H70A 3OIWA 4A15A 4XWKA 3IKJA 1GKIA 2QZ4A 4QM6A 1TQ4A 2ZSBA 3DO6A 2NZJA 1R5OA 1T5LA 2N1BA 3EXAA 3I72A 5FPYA 4XOIA 4P4SB 5IRCD 5TXGA 1PLJA 3AM1A 2WM9B 3MGCA 4BFTA 1OFUX 2F6RA 2FSHA 3GLFE 2QMUA 1QG4A 3QJYA 1EX6A 4JJZA 2Q9BA 4WVFA 5CYOA 2H8KA 2FDCA 1UFQA 1Y3AA 2R62A 3QXHA 4JLBA 4HAZA 1Z6GA 1E2DA 2V6JA 3L43A 3PR1A 1E9AA 2ZRGA 4KHZA 2VO1A 3OEED 5AJYA 5EXSA 2VBCA 4QNMA 1W36D 3VU9B 3I5YA 4LWZA 2HCBA 3QPWA 3U61B 1LY1A 3NIBA 1GTVA 2XAUA 1RFLA 4NPHA 3OEHD 1KZ7B 3H86A 2J0UA 3SDZA 2ZXUA 4EKDA 2B8WA 5AUPB 2ZTSA 1KY2A 2V7QA 2D62A 2DFLA 1US8A 1X1SA 3Q7PA 2R6CA 1AK2A 4KBFA 3ZS9A 4TQ9A 4BZXA 2W0SA 1ZNYA 2AD1A 2BJVA 5CLLA 4GFDA 2P5SA 1ZNXA 3NTUA 3CH5A 4TSFD 3DZDA 4RFVA 3L2OB 4LJ5A 4PAMA 4ACBA 4URUR 1AJEA 3SU8A 4UQOA 3T34A 1N0VC 3OFNA 3VTKA 3NKVA 3KB1A 5G40A 5H1YA 2QP4A 2EU8A 1W2HA 2RGXA 1EGAA 1XEXB 4JT2A 2WWIA 5DE3A 2IWRA 3EZ7A 4FWTA 1ANKA 2A5YB 1HURA 2IBMA 1IBRA 4DCUA 1HE8B 4PFSA 3RS3A 1P9RA 5FTNA 2WIAA 1I2DA 1UEIA 1OKKA 4B71A 1CR4A 2C99A 2HXYA 2JAQA 3LBIA 1QG2A 2BJWA 4V0MA 4TYPA 4PSVA 3JZAA 1CR2A 1P4SA 2YJTD 3M0EA 4PHHA 3CRMA 4UXIA 4XSGA 3WMEA 4DZZA 2J0UB 2ZRFA 4ABYA 2HJVA 2GJKA 3SBDA 1XX6A 3ICQB 3D7MA 1FPMA 3NDPA 2EW1A 5JS7A 5DNYB 3ZIAA 2OHFA 5AR1A 5FOSA 1NBMA 1Q12A 4JLDA 1E32A 4JLAA 1MABA 1ELOA 1RIFA 4M1KA 3AF2A 4HZIA 1XRJA 2IT1A 2VL7A 2Z83A 3FB4A 3MWYW 4PAQA 2WKRA 5EUMA 1S9HA 4U5XA 2ORIA 2ZJAA 5FOWA 4LHWA 2YWHA 4DDUA 2A2ZA 2XZPA 4D25A 4M2LA 3TJZA 3FKQA 3ZDQA 3GJXC 4I1VA 4OJKA 3W90A 2ZJ5A 1FUKA 1OIXA 1LNZA 4LK2A 4A1FA 1OB2A 1EFCA 2BHRA 2H16A 3AUXA 4Q9JA 5A5GA 5BN4A 5TY0A 2HEIA 2OCYC 2PMDA 2QQ0A 3CO5A 1XCGB 3W3AA 4QNRA 4YMSA 1US8B 2XITA 4DC9A 3SEAA 2J5XA 1NMXA 2MSEB 2VF8A 3B9PA 4B3CA 1WDTA 1WBDA 4E22A 3AP2A 5D3MB 1SHKA 1ZAKA 3VKWA 3AUYA 2NGRA 2H92A 3IILA 3IIKA 4F92B 2RHDA 5SZKB 5JBQA 3GJ6A 5C2JB 3J81k 1NG1A 2IYTA 1R0XA 1F3OA 3CPHA 4JVSB 3RANA 4B34A 4I81A 2GESA 2NZ8A 2SHKA 4NU0A 1E2PA 3T06B 1JQJC 2LKDA 3DDCA 4CF7A 2FSFA 3WHKA 5DISB 5J4LA 4CW7A 5AUQA 4TZ0A 1D8TA 4IVQA 3R9XA 1W49A 2CJWB 3A36A 1FP7A 2WWHA 2OM2A 2C9OA 3FDIA 4W5JA 3S1AA 3KJHA 2PMKA 4M1MA 3CIOA 4XJXA 1NKTA 3GCGA 3L0OA 1NNEA 3ND8A 2W2TA 1FTSA 3IO5A 1XJ0A 3LAWA 3WMFA 2JDID 4TMVA 1BKDR 1NSTA 2CCKA 1FUUA 2O0KA 2PZGA 3LQRA 4C0JA 5HCIA 4RSGA 4XH9B 4HUQB 2ODEA 1HT1E 4IKEA 2A7QA 3UMRA 4AKEA 1YZNA 3TIFA 1P62B 3B13B 4POAA 1ETUA 3ZQJA 2GTPA 2WOJA 4AKHA 2FG5A 2VHJA 1GKYA 4C0SA 2PZEA 1DG1G 4QHYA 2WPDA 2QAGC 2WWYA 1Z6YA 3ZQ6A 2J45A 1GNQA 4B6FA 3PUWA 2GAOA 2BMJA 1E1RD 3ZVLA 1SVKA 4L9SA 1BMFA 1E2IA 4US0R 2DFTA 3IQXA 1QZXA 2B7CA 3HJNA 1KSGA 1TAGA 2CL0X 1XZPA 3B5JA 4BFUA 2W6ID 1R0YA 2CE2X 4LPKA 2D3WA 2G83A 3QBTA 2DFNA 4FMCF 1M2OB 1ESMA 2QORA 5D3MA 5EE0A 3MRSA 2OZEA 5P21A 3SJAA 1E0KA 1P6XA 2V3CC 1GAJA 4DLZA 2HF9A 2ZRCA 3THWA 1KMHB 3QEJA 2FPLA 3W9YA 3THXA 3CRQA 3KXLA 1JBKA 2W6JD 2ZJYA 4XWAA 3I62A 1YR6A 1XWIA 2XNDD 3RS0A 2C04A 5KPDA 1TU4A 4GMDA 4MGZR 1RRGA 2ZR9A 1A7JA 3FMOB 3FPAA 3AVXA 1EG7A 2C96A 1D6JA 4OQNA 4PX9A 5J40A 5GADl 2CDNA 3RS2A 4PPGA 3QG5A 3CH4B 4KFRA 1GFIA 4EPWA 3ADKA 3R7WB 3KQNA 3I5XA 4QBIA 1I4DD 2NO0A 4M22A 4ASUD 4BLSA 1F2TA 3SS8A 2REOA 3ZH9B 1J99A 1U0JA 1U9IC 4LYAA 4MYHA 3UWKA 3CM0A 5GVRA 3UXMA 1SXJB 4LSGA 3L82B 1NBME 3MJHA 4PC1A 3T5DA 3QI2A 2QM7A 4ZDKA 4CEJA 3I92A 2WIBA 2YC4C 3FMIA 5JJKA 4OK6A 1Z6XA 1LF5A 1G4UR 4GP6A 2QPAA 3GFOA 4BRUA 3K9GA 3GLGA 1RW4A 4LJYA 1W47A 3JZMA 1X86B 2XXAB 3EZFA 1F60A 1P5ZB 3QKSA 4RJLA 3RNLA 1KMHA 1WCV1 2HT6A 5SZJA 3LXXA 3LRPA 4C0QC 3AH8A 4M8NE 3R9WA 5F9HA 2ZS7A 2ZRPA 2O8EA 4NYJQ 3R9IA 3U60B 2ZSDA 1KKMA 2G77B 4W5WA 1HTWA 5KTYA 1Z07A 3AQ4A 2R6AA 3E1SA 1AQYA 5LBIA 2ZEJA 4MKIA 2ZI9A 3WYGA 2JLWA 2YOGA 1W7AA 2F9LA 5FL3A 5LD2C 1N6KA 4LPSA 3EARA 4NBSA 2AWNA 3RHFA 3A1UA 5HCNA 5E7MA 4N3NA 4NDZA 1R0ZA 3QSYA 4TTRA 3SR0A 2EFDB 2FF7A 2FNAA 2RAPA 3HR8A 3N2EA 3BD9A 5AUNB 1KHTA 1E2MA 4HDCA 4EUNA 1ZW6A 2OAQ1 5HKKA 2ONJA 2H5EA 4D2IA 1GRNA 2DWPA 2ZE5A 5AK0A 2B21A 3UANA 5CIQA 5BYJA 3U5ZB 4MDFA 1D5CA 1PVOA 3BFKA 1S8FA 2DBYA 2PL3A 1EFUA 4BFYA 5JRZA 1KDPA 2FH5B 2JA1A 4IDQA 3SYNA 3LW8A 2O8EB 4B47A 3AVWA 1G7SA 4NCHA 2WWGA 4D0NA 1CEEA 3LLUA 4NH0A 3O8BA 4PAOA 3QVUA 1W0JD 3CWQA 3SFZA 2GEUA 4ESVA 2PT7A 1AZTA 5GVSA 2J9RA 1Z22A 1N6LA 2NPFA 3TMKA 2BMFA 5G53C 5F9FA 5GJCA 5H68A 1X1RA 4QJ5A 1E9SA 2EYQA 2UKDA 3F0TA 4M0LA 1VYUA 2Q9CA 5UKDA 4MYTA 2R6FA 2GJAA 3BB3A 2CNWA 4PO9A 5EP2A 3IO3A 1FMJA 4R9UC 3UG6A 1IY0A 3AF4A 1ZM3A 3PENA 4CDGA 2O8CA 3EZ2A 4D4LA 1ZIPA 5ANRB 4BASA 1BS1A 2WPDD 4TN1A 2OT3B 2CJWA 1XPUA 3B2EA 2EFCB 2WOOA 3VR1A 3GLIE 1EX7A 4D0LB 2GXSA 2KI5A 1YQTA 4H1VA 2FN4A 1X8JA 5C1BA 4B3GA 1G8HA 1VDZA 5EE1A 1G5RA 3THOA 5K8UA 4GRAA 1E2EA 4HAXA 2YWFA 1YR7A 3NH9A 1JJ7A 1QF9A 3D31A 3FE2A 1DAMA 1N25A 1UBCA 4IEEA 3N5CA 5EE9A 1NVVQ 4JT4A 3GD7A 1W4CA 2ZJBA 4HSEA 4MRRA 3ZD6A 2DY1A 2IYYA 2O8BA 4JL6A 4PZZA 2GK6A 3CKLA 1KO4A 1UPTA 1IONA 2XJ4A 2ZREA 3PUXA 4IEIA 1E3MA 1OXVA 3SI7A 2HJGA 3CRRA 4N0DA 3KJGA 4PO1A 2XTNA 4CZ2A 3IIJA 2P67A 2ZETA 4EFLA 4OYHA 4A0FA 4AYWA 2P6NA 1JXMA 4JYCA 1VPLA 1T0JB 3CNNA 4V0NA 2KJQA 2EWVA 2ASEA 3N2IA 1EK0A 1SKQA 4H1UA 4YDHB 3GLFB 2QSZA 3BFXA 2IYQA 1P2TA 2Q3MA 5KDDA 3I32A 3AVOA 3AF1A 2N46A 3T1TA 2RGAA 1VYTA 3TNFA 3IEUA 1R2QA 1CF4A 4UNSA 1ZD9A 5A4JA 4GBMA 2YINC 2GXUA 3KL4A 4JZKA 4PPQA 3THWB 1Z8FA 1P9WA 4PQFA 1DADA 1X8LA 4HLUA 4WZBE 4YDSA 3ASZA 1E9CA 1NY5A 4B48A 2W2VA 4JBYA 3W5IA 4B76A 3CNOA 1JXOA 3G82C 4JLPA 3NHAA 2AR7A 3CX8A 3P26A 4C3ZA 1EFRD 1XEWY 1KOFA 5FTKA 4DB4A 3CX7A 2VA8A 3CRVA 4P33A 3ND9A 1E69A 5E7JA 4JLVA 1OLOA 4PZYA 2DHRA 1T8UA 4Q9LA 5KU1A 2IYSA 4I1UA 3EWSA 1DOAA 4GT1A 1ZIOA 1I2MA 4KVAA 4MGIR 1UBFA 5FBRB 4BFXA 4BWYA 3SJZA 4O2RA 4AWXA 2RGEA 1KDRA 3FYHA 3A4MA 3QOFA 4OI1A 2ECKA 4QJ3A 4DVGA 4XVQA 2OSBA 3U44B 2AFIE 4ZDWA 4GP7A 1Z6TA 2PZFA 3TK1A 3AKYA 1ZC3A 2QI9C 4D6PA 1COWA 1TMKA 4FCWA 2RH5A 4PZLA 4Q5IA 1UKEA 3KXIA 2V1XA 4M1OA 2IUTA 3SHWA 4IW3B 3REFA 2FGKA 2FJUA 3RABA 2QMOA 2C03A 1E2LA 4P0TA 3PEVA 4P4UA 1CR1A 2ERYA 4RFSB 1YZTA 2CVFA 1P61B 1TUEA 5H8WA 2B6HA 2GJ8A 1XD2B 2ZE8A 2D4HA 4KV9A 1FQKA 1SGWA 2DPXA 3P32A 2R44A 4W9MC 1W44A 1QVRA 1NVWQ 2F43A 5DI9A 1LV7A 1W0KD 4JJKA 2ANCA 1E2FA 1D2MA 3WRYC 3K9HA 3GEHA 3VX3A 1XTJA 3V4RA 3S1AB 1UDXA 1EXMA 4FIDA 4LC1A 1FMLA 3FKSA 5G41A 4CRWB 5J4VA 3U7EB 4QGGA 2VHCA 3B85A 1WB9A 4TLEA 3B1ZA 3BERA 5C4MA 3L0SA 1XCMA 4B6EA 4B3DA 1M7HA 2QBYB 1Q20A 4QM7A 2OFXA 5KYKA 3B7GA 1J7KA 2WMNB 1Z0IA 3TW8B 2ZI6A 4US2R 4B74A 1IN5A 4M9QA 2JJ2A 4IFEA 5JMTA 3MLEA 3GLIA 3IPXA 3PFIA 4Q02A 1OSNA 2VSOA 5DI3B 4HAYA 3VR4A 3QPUA 3DM5A 4Q1EA 4RKFA 1IJEA 4OHVA 3GFTA 4PPNA 4ZCLA 1XTQA 5CB6A 2CE7A 2P6UA 4I4LA 4C0BA 4EFMA 1D9XA 1R5BA 3EA0A 1KYIA 2QAGB 3NHBA 5M04A 1JR3A 3FFBA 4OL0A 2VP0A 5FOVA 4A8JA 1E2QA 1MRNA 4P31A 4BEBA 5TV2A 5CJ2A 3KX2A 2GCOA 3SYKA 2ZYWX 1UBEA 4IDHA 5HR5A 2OEPA 3KQLA 2ZITA 3UPUA 2E1RA 2D06A 4YMTA 4NYMR 2CBZA 1DAHA 2LWIA 1EWRA 3HDTA 3JVUA 4S2EA 3VQTA 5CIWA 1E0JA 4Q7MB 3WXMA 3DOEA 4AKIA 3AKEA 2YOHA 3U7HB 1WA5A 2QRNA 2BMDA 1CIPA 1ZVQA 1A2KC 1OYYA 4U02A 2G1KA 1E9FA 3EZ6A 1OH7A 2J7PA 421PA 3FVQA 4GI7A 4NYIQ 1ESNA 1G8GA 4X8LA 2AKAB 3AV0B 4OHZA 2AXPA 1MO5A 4B44A 4WAUA 2ZVQX 4BLPA 2J0QA 2GNOA 1XFAA 3TUIC 5KNBA 5C4GB 4B2LA 1MO3A 3OEHA 3GFPA 1NJGA 5KHOC 4RCYA 4BE7B 2JLRA 4MA4A 1VG8A 2OV2A 2ZYTX 2WVJA 4TL7A 4WOPA 1OF1A 1RRCA 4ARZB 4ZCMA 2GILA 2H7VA 1G5TA 4TMXA 4R2HA 4TSFA 4P4TA 3A4NA 4TTPA 8OHMA 5BWMA 1ZINA 4URZR 3AVYA 2FFAA 4XSHA 3AGQA 1ZBDA 3K70D 3PJRA 5EXXA 2FU5C 4V03A 1SVMA 2FZ4A 3G0HA 5JSZA 2J87A 2JLYA 3W34A 1AKYA 4A82A 4YXWD 2OCPA 1HQYE 3D3QA 4FI3C 4Q01A 1E6CA 2UVQA 4G5QA 3K9NA 4M21A 1CP2A 3RRYA 1KO1A 1FNNA 2W6JA 4R98A 1LS6A 4P32A 3QE0A 1R8SA 2OBMA 2IUUA 2QT0A 1OH8A 2MSDB 4GPTA 4NMMA 2AKYA 4IDPA 1AS2A 4Q00A 4A8JB 2RKOA 1DAFA 3GQBA 1FP6A 3EIEA 5DSZA 5BW8A 2ZJ2A 1ZC4A 5CLQA 2JLVA 1R4AA 3ONWA 4DLRA 4KAXA 3B1VA 1DG3A 1Q3TA 5DH9A 1TEVA 1RYFA 4TTQA 3QXXA 2XB4A 3OIYA 1R10A 4LV8B 3EW9A 3GLHA 3A4LA 4Z51A 3PEWA 1UEJA 3SN6A 3BB1A 2GJ9A 3KB2A 2H1LA 3QXSA 3RS4A 1XTIA 3GJ5A 2JIZD 3EC2A 5IF9A 1J70A 2F1JA 1W5TA 2W00A 4DDTA 3ZJYA 2O8FA 3KFXA 2OFWA 3X1ZA 3IHWA 4Q1BA 3SYLA 1GRRA 4C7OA 5FPHA 2H17A 4QBFA 2RB4A 1TNDA 5KO2A 1S2MA 4ZI3A 1IXRC 2D2EA 4UNNA 2MMGA 3HYTA 2GHIA 5AJXA 4ARZA 1LTQA 4DSNA 4XTCS 4DIDA 4PPFA 4GDFA 2BEKA 1RRFA 1KSFX 4PC7A 4MITA 4WXRA 5FUWA 1GRQA 3NEYA 1Q1QA 3SQWA 2G6BA 1RZ3A 4YC7A 1DVRA 1YRBA 2VIIA 3TW4A 1E4VA 2ZPTX 4O3MA 2J7PD 4LC0A 2V6IA 1Z63A 1XEFA 2Z6VA 4OK3A 4TLDA 4US1R 3SJBA 1X6VA 1RYHA 1M1YE 1Z6AA 1PUJA 3B1XA 3GLHE 2ZI3A 4TWZA 1NLZA 2IXGA 4NTZA 1E0AA 3NWJA 1W2GA 2EFHB 4OHYA 2VP2A 2OILA 4HDQB 3WP0A 3QF7A 4HLQB 1HUQA 2ZRIA 5HKKD 3EPLA 1M8PA 5HZKA 2CMKA 2BV3A 3QEOA 1CKEA 1S3GA 6Q21A 4F4JA 3THXB 1OKKD 2J46A 2VEDA 1JAHA 1G18A 3NEJA 4C7OB 4OHXA 1TF7A 3O8RA 4WIAA 4JKIA 4U00A 3U3JA 4Q1CA 3W8RA 1NRJB 1XB2A 2QE7D 3U4QA 2DWOA 4HDOB 4G0NA 2O8BB 4B3BA 5L3SA 3F8TA 2JJ1A 5KNDA 1QBKC 4PR0A 2FSGA 4Z54A 1E94E 1QHXA 5IK2A 1KGDA 4CEIA 2GEVA 2IXEA 4PTLA 2O8CB 1YVDA 4FW9A 4OI4A 3GLHB 3WP1B 5EXPA 1KK3A 1P73A 1Z0DA 3LVRE 3KTAA 4TYWA 1KO5A 5FBVB 2IF2A 4MGKR 4PANA 1QHSA 2ZM5A 3DZ8A 3GJ0A 4E03A 3LA6A 721PA 2CHVA 2O8FB 1KI9A 1NMYA 2HDNB 4RZXA 3QXCA 3GEEA 3RLFA 1HT2E 3OZXA 1XF9A 4BLOA 2C9CA 2QSYA 4ZDJA 4V0ME 4NCJA 3FKSD 1XCPA 4GOXA 1W4RA 2C95A 1F2UA 3LD9A 3KKMA 3Q85A 2F1RA 3U7FB 5SZIA 3MAAC 3SE0A 5DLQC 2AD5A 3SOPA 1WRBA 3CX6A 4HAWA 1MH1A 5KSYA 4M4SA 3I61A 3DKVA 3B82A 4AD8A 2CK3D 4LJ6A 1OB5A 4Q19A 2GCPA 2YVUA 1ZU5A 1XXHA 1OFIA 1TPZA 1SVLA 4A2PA 1E9EA 1SHZA 2ZJZA 3ZLJA 3QUSA 2XTMA 4KU4A 1XBTA 2IYXA 2R8RA 1TUIA 2NPIA 4M1YA 4UNQA 1Q44A 1N5IA 4Y0VA 3P4YA 2GZAA 3OHMA 2O8DA 3L0PA 1WBBA 3U3MA 2XOKA 4L4UA 2ZIAA 2XX3A 3KTAB 4CGZA 2OESA 3A1SA 1IHUA 4YXWA 4IHQA 1VG9B 1VYVA 1TF5A 4OQFA 2XB2A 2MSCB 1AN0A 3LDAA 2WKQA 2PX3A 1SKYB 621PA 821PA 2ZSEA 3KJIA 5JEEA 1A5TA 3QKRA 4Q18A 4QGHA 2P5TB 3VR2A 3U4QB 4NL4H 5F3WB 4LHZA 2GF0A 4WBSA 3TGPA 2CEAA 3AGPA 5BN5A 1UF9A 2FSIA 4KFTA 2Z5FA 4EPRA 4L15A 3EPHA 3TRFA 1T91A 2FPMA 4KSBA 5FL7D 1O87A 5HZHA 4URVR 1XU4A 4QBHA 1E2GA 1SXJC 4AY2A 1XMIA 3SNHA 3C41J 1XJQA 2GETA 2KBEA 4DB2A 1ODFA 2ZRKA 2RGNC 2FX3A 4M9XA 2RGGA 1NVVR 1XD2A 2V4ZA 3FGNA 4URYR 3T1VA 3BGWA 4Q66C 5J4YA 2X8AA 3MCAA 1KI4A 1SXJE 1GL9B 4I1OA 3GLGE 1G3IA 2D7DA 4L9WA 2IUSA 1C1YA 3W5JA 2GVDC 4ZV4A 4DLXA 1U9IA 4YMUA 5KUTA 4KI0A 1NF3A 2GBLC 3HU3A 2IC5A 1KO7A 4GL2A 4C0LA 1ZUNB 1N6RA 3KZ1E 3BJIC 4QHSA 4IXMA 3BXZA 4NP6A 1AM4D 4TQUS 3HU2A 1JAIA 3K70C 3A37A 3BB4A 4NCIA 1KDOA 1CJUC 3A8TA 1U2RA 2PEZA 3VFDA 2ODWA 3AKCA 1VCIA 1K5DA 2G0TA 221PA 4ZDIA 2BOVA 2GWHA 2I1QA 4RFSA 3RRZA 2Q3HA 3EAQA 3QPVA 1FTNA 2YZ2A 3VNVA 2VTKA 3E2IA 1D2EA 2ZRBA 4Q9HA 3C8UA 3AVUA 5JJIA 2G0NA 1RRPA 3PIRA 3Q9LA 1ZMXA 5DI3A 3NBFA 4A92A 3EWAA 3Q72A 3KQUA 5C46F 1E9DA 1TL7C 4M1SA 1DO0A 4XWOA 4A4DA 4Q1AA 4LGMA 3KUDA 4FWIB 2GXQA 2ZRAA 3CPEA 3QBVA 3TSWA 1OIVA 1XTSA 4Z8XA 2OLJA 3QVVA 1AA9A 2GCNA 4G5SA 4OJQA 2KBFA 1PLLA 4PSKA 1XP8A 4Q1DA 1XJCA 2GCOB 1HEIA 2WWXA 1E98A 3QKRB 1OPXA 1II9A 5HPYB 4FXPA 5GJWC 4IVPA 4LHVA 4XD7A 1H8HD 3MUFA 1L7VC 2W2XA 2IYRA 2X77A 4ZKDA 2ODNA 1IAQA 1MRSA 5FUXA 5FBLB 3GLFA 4MRNA 4MUBA 2CLCX 1AZSC 2CCGA 2PX0A 1G8YA 3THYB 2BBOA 1OXUA 3W8NA 4EFNA 2IS2A 5JFGA 3LBHA 4EJSA 1P9NA 2RGNA 4Q4HA 2QA5A 2ZRMA 2J59A 4Q9IA 4V0KA 4URWR 3UIEA 4UJ5A 1W5SA 4O2LA 1G7CA 1A82A 3AKDA 4MGYR 4RKEA 4BLRA 3BBPA 3WNDA 5CDFE 4LJ4A 3LVQE 3SC3A 2GF9A 4ZPXA 1JALA 4A6XA 2J1LA 3PUYA 2OG2A 3PG5A 3HPQA 3KKQA 1NP6A 1OXXK 3V00A 4PC3A 3IIMA 3QG1A 1U81A 3PV0A 1MKYA 2O0JA 1WE2A 3WNBA 3WBKA 5JCPA 2HYIC 3Q8XB 2ZRJA 4UJ3A 3VU9A 1GL7A 1ZM2A 1L8QA 2AN9A 1VG1A 2WZQA 3NDBB 1GUAA 2IEZA 3MMPA 1NKSA 1XPRA 3CRW1 2O52A 1KK1A 2O0HA 3ZZUA 2WJYA 4Q4JB 5D3QA 1YU9A 2DWQA 4PC6A 1NY6A 5F2EA 5K8TA 4BLTA 1OIWA 1E1RA 1NSFA 3T15A 1VIYA 1YJ5A 2F1IA 1BIFA 4FMDF 5G3YA 3THYA 3I3SR 4PQYA 3I8XA 4WW0A 5FUYA 1I4TD 4ACAA 1J90A 2PLRA 2JLQA 4JL8A 5J5CA 4D26A 4N1AA 3WMGA 3BC1A 3LXRA 1JB1A 3RDPA 1VKJA 4XTRA 3I8SA 4ZI2A 5FR2A 1SKYE 5CITA 1BYIA 1G3UA 4BRWA 1DO2A 4JS0A 4G01B 3PCRB 4IOJA 1E9BA 3O8CA 3LH5A 3LNCA 2LCFA 1G1MA 3KXKA 3TBKA 5CM8B 2XEXA 4MYCA 4TQAA 5JRJA 1YHNA 3AVPA 3QENA 3TVDA 5F98A 2XZLA 2NQ2C 4EJSC 4LCBA 4BFVA 4PHFA 3U3KA 2FMXA 1R8QA 4TL9A 2QBYA 5L3QB 2IYZA 3CUEF 3RC3A 1GM5A 1JR6A 3RYTC 3L0IB 1X3SA 4HEJA 2WSMA 1ZNZA 2WJJA 1ZNWA 4IJMA 1XMJA 1KNXA 2WJHA 4DKXA 2NO1A 1LW7A 1U8AA 1MT0A 2QUZA 3BK7A 1NN3A 1OV4A 1XEXA 3ZZTA 2H18A 4QJ4A 3X1XA 2GVZC 3PUVA 4DLVA 3M4YA 4OQLA 1UKVY 2BBTA 3K09A 4LJ9A 1F5NA 4DUGD 4A0GA 1RJ9B 4OHWA 1C4OA 4FD2A 1G8PA 1Q1BA 3VKGA 4Q4JA 4B2IA 1S96A 3BRWD 4WZ6A 4OI0A 2RHMA 1NI3A 1E79D 2OXRA 2Q0HA 1S9DA 4JLOA 2PT5A 2ZR7A 4ON9A 3QKTA 4JSTA 4TLAA 4A0HA 2W58A 3U2QA 5CDFA 1KNQA 1KZGB 4NYIR 4Q4AB 1BMFD 1Z0JA 3CBQA 5B57C 5TVKA 1JECA 1DAIA 3FHCB 2FE4A 5IHPA 5L3VA 1E96A 2FPKA 2G3YA 3UK6A 2W0MA 2PJZA 1AGPA 3FWYA 2A30A 2GA8A 3ZZ0A 4NYMQ 4RD6A 1VECA 2Q3FA 1MO4A 2WAYA 1KI7A 4B73A 1NMZA 1RVDA 1HV8A 2KSQA 2QU8A 3NG1A 1NIPA 3P1JA 3ECCA 2F55A 4TYYA 2B8TA 3W6NA 3LY5A 3M1IA 3DVLA 2VSXA 1L4YA 1OT3A 1T6NA 2KE5A 2X1VA 1COWD 1Q57A 3U6BA 1IN4A 2PEYA 4KLZA 1XTKA 3LW7A 2BBSA 2GDJA 4QGFA 1CBUA 4F93B 4F4CA 3TH5A 2ZYVX 2GRJA 3DPUA 4A2QA 1W0KA 2FFBA 1GNRA 2KB0A 3KFVA 3KUCA 1J8YF 1ZU4A 3VR5A 2P65A 3OE7D 2R65A 1JPJA 5KSZA 1OXSC 3DMNA 2C8VA 2X19A 4DCTA 2Z4RA 1GWNA 1TU3A 3H4MA 4AYXA 4PQRA 1F2UB 3NVAA 5L3QA 3BH6A 2ZE7A 5E7IA 2IYWA 2J0VA 3DMDA 3K0CC 1Q3HA 3N70A 4RD0A 2GZDA 1OHHA 1V5WA 3AP3A 5JWOA 2ZUBA 4KYIB 1EFHA 1FX0B 4GMXA 2OE2A 1XXHE 5LB4A 1KAOA 1XXHB 1SVSA 2ZR0A 3K0AB 4BZPA 4NZYA 4IRUB 1AIPA 2VHTA 1GDDA 1NIJA 1S1MA 2NG1A 4BFSA 4O25A 2JJ2D 3MJRA 3LWNA 1CR0A 4MH0R 2HYDA 3VAAA 4JLNA 2FEOA 1VCNA 2JGNA 1G21E 3SFVA 4IXNA 2O8DB 4TMWA 1B0UA 4GNKA 1KDTA 5DYIA 5KNCA 4EDHA 5EP1A 3NXSA 2ZUDA 2G1JA 5KOYA 3GJ4A 5FUVA 4EQ6A 1IN6A 5HTKA 2IF0A 1II8B 4B43A 2DYKA 3GMTA 4RZUA 2OFOA 4Q4AA 1TX4B 4LYHA 4X8HA 4QOSA 2C5LA 2IEYA 2J3EA 4DSUA 1YRAA 4CT4B 4O0MA 3KJEA 4KXFB 3ZGXA 1KKLA 3NC1C 2REXB 2F9MA 2EVWX 4DT1A 5TMPA 2PCLA 3CONA 1NN5A 4EPTA 4HB2A 4X8MA 2G9NA 3RWMB 3CF2A 1AGRA 1IY1A 3KKOA 1T9HA 1GIAA 2WWWA 1CU1A 4CEHB 1DAEA 1II0A 2CK3A 1PV4A 3AP1A 3T5GA 2ZRNA 1T4GA 1S4QA 2C98A 2F3TA 1LFDB 1T3SA 3MFYA 3RVBA 1Z83A 1XDBA 5JHHB 1OH5A 2QENA 4KYUA 3CB4A 1KMQA 3BOSA 3Q7QA 5FOXA 1S0UA 5ELXA 1SULA 4OQXA 1XZQA 2FWRA 4ZO4A 2ORWA 4EQ6B 1IXSB 2VYFA 3HPRA 4PXAA 4BEJA 4HB0A 2XXAA 2EQBA 2IA5A 1HY3A 1NVUQ 4F91B 1T5IA 4K8OA 1FNMA 3ICEA 3H1TA 2Y8EA 3AB3A 4Z1MD 1RE0A 3KQHA 2W6IA 1CJMA 5JZVA 2WV9A 3UMFA 2FV8A 4V0OA 1NL3A 5LPNA 2IK8A 2JCSA 2OUKA 2QTHA 2ZRHA 4QHTA 2AL7A 1SVOA 3KDSE 1OE0A 3WYAA 4Q03A 3BH7A 1GILA 5FTMA 4GOJA 4YLGA 4LJ8A 2BM1A 4QC2A 3K0EA 5DYGA 4MRVA 4OK5A 3UWOA 3WNCA 2OCAA 2JASA 1N6IA 2HLDA 5DGXA 1Z3IX 5L3SB 1Z08A 3ADCA 2JIZA 4EAQA 3IGFA 3K0CA 3IQWA 4KCGA 3CPJB 5EE5B 4NONA 5DO9A 2VSFA 5TDHA 3MWLA 5LDDC 1EWQA 3IUYA 1U98A 1P2SA 2WAXA 3ADBA 2NO7A 4E07A 1ZUIA 1UKZA 1P7CA 4JIMA 4XVRA 3GLGB 5A0FA 4PHGA 2R6GA 2AXNA 3TE6A 4HAUA 2IWHA 4EIWA 3A1WA 3IBYA 1JPNA 2VP5A 3EZ9A 4DBLC 1Z06A 4MQBA 2P6RA 3T1OA 5J4HA 1G16A 2QPTA 4C4PA 1S3SA 4CEHA 4A36A 3TAHA 3MSXA 1GZSA 4M9ZA 4NCKA 2FFQA 3CZQA 3FHOA 3ZVMA 1W1WA 3X1WA 5AWFC 3VHLB 3VKHA 4F4IA 1GSIA 1CULC 5CK4A 1KSJA 3IPYA 2GBLA 2UZ3A 5FBQB 1KY3A 1VIAA 1W4BA 4AG5A 3MD0A 2ZAOA 2ZSFA 1IY2A 2EWWA 2Z0MA 4EPVA 1TTTA 3K1JA 1LVGA 1SQ5A 4GZMA 4UXHA 1E1QD 1EFTA 2BWJA 1QHGA 2CLDX 4JVNA 4AKGA 1SVIA 1Q0UA 4DSTA 1QHHA 1YZGA 3C5HA 4N0EA 4AC9A 1MOZA 2FOLA 3LBNA 2QRZA 1E9RA 2E87A 5DN6A 2YWEA 3RRMA 2VP4A 1T3HA 1EFRA 2FA9A 3PVSA 4HUTA 2J41A 5FL7A 2QMHA 4H9GA 1OXTA 3RS7A 4DCNA 4TMTA 1G20E 4YMVA 2WJIA 3O8DA 4LBVA 1H8EA 2VHQA 5HE8A 4B33A 3GP8A 5DN6D 5CB8A 1V43A 2JATA 2VQSA 2BCGY 3X1YA 2HUPA 1NN1A 4FMBB 1E2NA 3TUZC 2AHOA 3HU1A 4Q4LA 4BZQA 5LB2A 4DEYA 3TKLA 4YQFA 4CYMA 2X2EA 4FN5A 4RZ3A 3ASYA 2OXCA 2WWFA 3TAUA 1UKYA 1CRQA 1BO6A 2ZE6A 1G7TA 4XVUA 4W7SA 4DIEA 2QTVB 3C15C 1H8ED 2QY9A 2QN6A 1IQPA 1K8RA 1DBSA 3HWSA 3NH6A 2IX3A 2B92A 5DHAA 1QHNA 2C2HA 1WP9A 4G1UC 1IXZA 4RZ2A 1DAGA 1G41A 3BORA 2D74A 4TT3A 2I3BA 3LLMA 4AI6A 2ZROA 4L8GA 1P72A 3V9PA 4IFBA 1XNJA 5FPSA 1EESA 4DRZA 5B58C 3BH0A 4JYBA 2BM0A 1R7RA 1OHHD 3GPLA 4GOKA 1JI0A 3DEFA 4KJZA 5FPKA 2NOAA 2XTZA 2QAJA 4C0HA 1GL6A 4LI0A 4QGAA 2YC2C 2DB3A 1KI3A 1IJFA 1ZCAA 1JEEA 1GITA 4QL3A 1VTKA 3QNUA 4P3YA 5B30A 1S1CA 1W0JA 4Y0AA 3PXGA 4HZUB 3M6AA 2BKEA 3C7KA 2YKGA 2VP9A 1VCOA 3PQCA 5AJVB 5DIFA 2ZRDA 3DL0A 3B8HA 3TSOA 2JJ8A 1IM2A 3FOZA 1I4LD 5FPTA 4DLUA 3AVVA 4IDOA 5E4FA 5L8VA 4X8OA 3BE4A 3EC1A 1N6NA 4DLTA 2B7BA 1CJVC 5J4KA 1IOZA 3FMPB 2QTFA 5C18A 1N5JA 1U90A 2IYLD 3U44A 3U3OA 1HH4A 2OAP1 4RY2A 3FTQA 4KVGA 3K9LA 4M9SA 4J0QA 5JHGB 1DAKA 3C14C 4QKQA 4FMCB 1WQ1R 2BCJQ 3R20A 1G7RA 4A2WA 4F7WA 3TR0A 2AK2A 4PC2A 4B3XA 3QY0A 3QQ5A 4DDVA 2WSSA 1T3LA 2V7QD 4FCTA 4BLQA 2JLXA 4RD1A 2V1UA 2V9PA 3RWOA 4EJSB 4ZKEA 4Q4HB 5EZ5A 4DXAA 1N3BA 2ZYUX 1R0WA 5BN3A 2F43B 4MYUA 2QQEA 3KQKA 1KI8A 2I4IA 1RC8A 4DSOA 2EFEB 1HE1C 1KK2A 1Q1EA 5CM9C 4HAVA 4B3FX 1IN8A 2QM8A 4LX0A 2YYZA 3OF5A 4LBWA 3I1FA 1E2KA 2NIPA 4BGDA 2JLSA 3VNUA 3HP1A 1G64A 4LV6A 1MO6A 4DLSA 4Q7KA 3RSOA 1YKSA 5FR1A 3V4FA 5GJBA 5FFMA 1PLKA 2ONKA 3CR8A 3EIHA 3W6PA 4KITB 2QL6A 2Z43A 3MWJA 2WTUA 4AYTA 1E2HA 3IBGA 3K09C 4NKRA 2FFHA 3NBZC 4B32A 5AJWA 4D81A 4TYNA 2CXXA 1CTQA 1W36C 2VP6A 3Q3JB 1GNPA 3OFND 3WHLA 4B75A 1BH2A 3VMFA 4TLCA 3SQXA 5G3ZA 3NC0C 1OFTA 1P2VA 2ATVA 2IS4A 3FFAA 1G4AE 5EP4A 1WMSA 5JJLA 2GKSA 4LYFA 3IHLA 2RGBA 1J8MF 4BFWA 1XD8A 1L4UA 1FZQA 1N6OA 2QROA 2ZAMA 3VR3A 1Q21A 1QVAA 2QP3A 3AF3A 2UZIR 4D4MA 5TARA 2GEDA 4W5HA 1WXQA 4JKYA 4EPXA 2JDIA 2Q6TA 3PUZA 3EPJA 5CJPA 3TQFA 4A9AA 1KI6B 2P3SA 4K81B 3IDQA 4QXAA 4Q47A 3AF0A 4URXR 3PEUA 2A78A 3L8YA 1OFHA 2HF8A 1J2JA 2ZI5A 1FX0A 1XPOA 1DS6A 3BWDD 1R6BX 4HB3A 4UNPA 3HR7A 1QHHB 2C78A 1YE8A 5KPJA 1H65A 2FEMA 4ZIRA 4JVMA 4A8JC 4DWJA 1Q22A 4F38A 1MABB 3QIAA 1ONBA 4LDJA 2OBLA 3REGA 2JLUA 1TQ2A 5FI1B 1YR8A 3GLIB 3EA5A 4JLMA 2GZHA 4JL5A 4DDWA 1G3MA 1ZYUA 3KKPA 4MUAA 3SHFA 4E09A 4RD4A 5B64A 1K5GA 4ESHA 1Z2AA 2XNDA 4HLCA 5JECA 5FTJA 5EQTA 1D9ZA 4Q7JB 1UM8A 1N0WA 1TF2A 4K46A 2QAGA 5FOTA 4LJ7A 3RAPR 2V54A 1QHIA 3D6TB 4QFMA 3T12A 2E9SA 2CHGA 3CWZA 1KI2A 4TL6A 3QXJA 3W6OA 4B2PA 4JBXA 4A0RA 2C9YA 2BBWA 1YZQA 2OBNA 2D2FA 1FW6A 2A9KA 2AX4A 1GP2A 1CLUA 1OW3B 2QPOA 4M1TA 4KSCA 2REBA 5CYPA 4Q7LA 5KDLA 4ITRC 2CNWD 2RGCA 3LO5A 4LJAA 4QRHA 5JWRA 3T35A 2Z4SA 4LYJA 2VRWA 1P3JA 1U94A 2WBLC 2ZS9A 1NN0A 4YMWA 3TVTA 4HI0E 2W83A 5JSZB 3BFVA 3IEVA 3RC8A 3MG9A 4Q21A 3TSZA 2HCJB 1AQUA 1Y63A 1XD9A 4KLNA 5FOUA 3B6EA 2HT1A 4R2IA 4LY6A 5K8LA 2IS6A 3C5CA 2ZQ5A 5EUQB 1E2JA 3U3RA 2IYVA 1E79A 1XTRA 4ZIRB 4D4JA 5JCZA 2IS1A 2FGJA 3QKUA 1H8HA 2WMOB 2ZS8A 4KBGA 2DFKB 4LHYA 2WJVA 1L2TA 1FFHA 3CF0A 4D0GA 1G19A 4TT3D 1Z0FA 1KO8A 3OESA 1P75A 2HLDD 4LHXA 5BXQC 2QP9X 3HYRA 4TL8A 3CNLA 1UAAA 4FINA 1GG2A 2A5JA 3A6PC 3ZVRA 4KODA 1NLYA 2GXAA 1VMAA 2D7CA 4AURA 1VCMA 3I4LA 3OIVA 2PCJA 1UADA 4FCVA 1UDWA 2ODBA 1ZP6A 4Z8YA 4C0AC 5E95A 1F6BA 1O3YA 4RVCA 2CL6X 4TZ6A 2IHBA 5KSPA 2ZANA 1W46A 3EPKA 2IXFA 5BYKA 4BPBA 4MDEA 2ZRLA 4PO8A 2QG6A 4CVNA 3WBJA 2CLSA 3ADDA 5IT5A 5JWHA 5JI3E 3GJ7A 1U8YA 1Z2CA 1AS3A 3C16C 2G88A 4EPYA 2J0SA 1IN7A 1NBMD 1Z5ZA 5AJZA 4LBZA 1N6PA 1TQDA 2ZU0C 3Q5EA 2ZUCA 3A1TA 2PBRA 1CXZA 5FBWB 4KFSA 1DELA 1NJFA 2RMKA 2R9VA 4JVLA 3R8CA 4BUJA 1AS0A 1ZRHA 2IW3A 1T0HB 1E1QA 4MKFA 2O5VA 3CW2A 2JEOA 4MRPA 5FI0B 1XMSA 3C4JA 4C2TA 1JNYA 2OO7A 4RD2A 4HLUC 3NBYC 5IDVA 4HB4A 5AUOB 1B23P 2LKCA 2OLKA 4TLBA 1F48A 2K5UA 1OJLA 2ZI7A 3EASA 3B1YA 3I73A 2ZVPX 4QG7A 2NO6A 3L8ZA 1TADA 1ZD8A 4QBGB 4BFZA 4G5RA 3U6KA 4G5GA 1G291 2H57A 4ILEA 1K6MA 3RRNA 5EJEA 1CJTC 1G3RA 2Q9AA 1KSHA 1G17A 1VG0B 3CF6R 1A1VA 3SBEA 4JMPA 4WXPA 3TUJC 2WHXA 1D2NA 4DUGA 4DCSA 3BIFA 121PA 1R5NA 3E70C 2BEJA 4LV5B 4M53A 3OE7A 1P2UA 1NG9A 4DJTA 4ZCIA 1LB1B 1U0HC 4I1SA 1U99A 1MV5A 4Q9KA 1N0UA 1Z29A 1N5LA 4CEIB 1YZUA 3LQQA 2PH1A 2WSSD 1SXJA 4C30A 4LZZA 3LFUA 3TQCA 1RKBA 4CT5A 2V55B 1DPFA 1OH6A 4IOLA 1W48A 2XOKD 3P20A 3B78A 1M6NA 3H2YA 1ZD1A 4GZLA 4NCNA 1G3QA 5L3RA 2ERXA 4C9BA 4DLYA 2XZOA 4HLDA 1TQ6A 1G6HA 1VHLA 2QT1A 1KJYA 1M7GA 5JS8A 1NLFA 2V8OA 2PJRA 1Q1ZA 3UG7A 1Z0KA 1RJ9A 1PJRA 2AFHE 3P4XA 4UKDA 3EX7C 4PSAA 4FMDB 3CLVA 5J47A 1P60A 4HATA 4NE2A 4GSYA 2RCNA 2X2FA 2R2AA 1RPZA 3T1QA 2VHUA 1ZUHA 2GAAA 2VPPA 1X8KA 5CK5A 3B9QA 2N42A 3R8FA 1A2BA 4NHOA 1LF0A 1BOFA 1KI1A 4D82A 2QGNA 4S35A 1U0LA 1NVXQ 4XD7D 3NBXX 3RS5A 3K0SA 4ASUA 3T61A 2NTYC 5DHFA 1Z28A 4HUQA 3D8BA 1DEKA 1FQJA 3B60A 3FMFA 4G3XA 1BYUA 2Q21A 2BDTA 3K53A 3X2SA 3H84A 1UJ2A 1CRPA 2YWGA 3A1VA 1QHYA 3WYFA 4IDNA 1KTVA 2CCJA 1ZCBA 1N5KA 4C0KA 1QRAA 2WJGA 4Q48A 2YNMA 4UXJA 3BS4A 2VH5R 2CVHA 4TMZA 4OQMA 3EG5A 2YOFA 5B2ZA 4AG6A 2F7SA 4Z1MA 2XJ9A 4B35A 4R71A 3U7GA 4IVRA 4BQSA 3X1DA 1G8FA 3GJ3A 1N2CE 1PZNA 3BAFA 2P2LA 3QF4A 3OAAA 5SZHB 2QGZA 3TLXA 2XSZD 2QMEA 2AK3A 2J7KA 4U7DA 1M74A 1C9KA 4WA7A 2TMKA 1KAGA 1E4YA 3TR5A 4Q1FA 2BMEA 1TEXA 5TB5A 2BIFA 1M34E 2YV5A 4LRWA 4BECA 1SXJD 1GOTA 4RCZA 4AK9A 4V02A 1JJVA 4II7A 3B1WA 5FTLA 2A5GA 2F3RA 3K0AA 5EE3A 1A4RA 2IYUA 2XSZA 521PA 3ZD7A 3FHTA 3E5HA 1HQCA 1CS4C 2VLIA 2CL7X 3K8YA 3LX5A 5EXTA 3UATA 5JEDA 4JSYA 1SZPA 1F2TB 1YZKA 4L5BA 1GKUB 2A5DA 4MRSA 2A5FA 3KKNA 5BQ5A 5JLJA 5KSOA 4NYJR 4LBYA 4R7ZA 3RSLA 4E5UA 3UMSA 2RGDA 3DHWC 2A3RA 4V0LA 3DM9B 2NMVA 1SVWA 1II8A 3MWKA 3GEIA 3OEEA 3VHXA 1JEDA 4CEJB 4MKGA 3P27A 1DE0A 2QE7A 4KFUA 1HA3A 2WKPA 3LV8A 4LUCA 1G5PA 5K8IA 3LX8A 4OI2A 3R7WA 1AKEA 1E99A 2VF7A 3F5FA 4LOAA 1DTSA 4OKSA 4DT1B 5GJVC 1JQLB 4DLWA 1FL9A 4L16A 2QEQA 2YHSA 1KJWA 4I99A 3CZPA 2WICA 3O47A 2ANBA 1UBGA 2HV8A 1VHTA 3ZS8A 2BC9A 1KJZA 4IOMA 1W36B 3K0FA 1U8ZA 4D80A 2AWOA 2EYUA 3AEZA 2DCUA 2XGJA 2FZLA 4UNRA 4OBEA 5IK2D 1QDEA 4M1WA 2R6DA 3CR7A 2OCBA 2IL1A 3SJCA 3VX4A 2NO9A 2BKUA 3QF4B 3UKDA 1DARA 3OAAD 1MR3F 3W3ZB 4IOKA 1ZM7A 1PUIA 1XEWX 2ZU6A 1KIMA 3JVVA 2MMCA 5E3HA 3K70B 5JI2E 3Q5DA 2P0EA 3QKSB 3PEYA 1KK0A 2QNRA 3PITA 3VR6A 1ZM9A 3AVTA 3WY9A 2ZI4A 3EIQA 3G5UA 3ETLA 1GVNB 5LD2B 1G6OA 1LS1A 4RD3A 1ZM4A 5EP3A 1E0SA 2EFGA 2L0XA 3SZRA 2C77A 1T8TA 4JLJA 1OYWA 2ATXA 2JLZA 3DKPA 1YZLA 2GK7A 4KO8A 1JR3D 4HYYA 4WZAE 4CIDA 4JLKA 1HYQA 1YR9A 3ZIAD 3GJ8A 3DOFA 4P4SA 2IHYA 2PLFA 5HE9A 4DCVA 1W4AA 3WRXC 2I1VB 2HXSA 2ORVA 1KI6A 2GJSA 3ZVNA 3A58B 4HZUA 4MKHA 4TYQA 1FOEB 4DHEA 4ERNA 1XMVA 4A6PA 4G5OA 1M7BA 5EZ6B 2F1HA 4AIIA 1ZJ6A 2XNSA 4DEXA 2DR3A 2JJ1D 1JR3E
chains in the Genus database with same CATH superfamily
5KNBD 3ZK9A 2O8NA 5BVGB 4PHTA 5C8DA 4FYWA 3ZYCA 2FUKA 2M6KA 3EDMA 3OIUA 2ZJOA 1Z47A 4WKBA 3ABOB 1D6SA 3B3JA 3I53A 4Z0PA 5NULA 3TUIC 4C2UA 1PNTA 1YBMA 2G28A 3AVQA 4PYKA 4TMKA 1TECE 4B80A 2QPLA 3DFUA 2CHQA 1WMFA 4BO1A 5HIIA 4RIIA 4ZK2A 2C4WA 2NVOA 3BEOA 5H70A 2JFVA 1N2HA 1TEZA 4LF6B 3CKYA 3W2GA 4Q9DA 1CQIA 3NR2A 4HS4A 3W5BA 3ENKA 2GD0A 5M2QA 2Y1CA 3SSAA 3SQMA 1IZ9A 4QM6A 1TQ4A 1P19A 3ZI0A 3OU6A 1PR4A 1PZGA 1V9SA 3I72A 4XOIA 3D7LA 3DLIA 3AM1A 1QTQA 4BMYA 1AGNA 4B17A 1B7GO 2F6RA 1TZCA 3EBLA 2GO1A 1RDFA 2QMUA 4NU8X 3QJYA 1V3QE 4WVFA 3GLFE 4QDXA 3V8QA 1IOWA 3EXEB 4MVYA 1Y3AA 2R62A 3DMRA 4JLBA 4D9HA 4HAZA 1E2DA 3L43A 4UTOA 2J67A 2W90A 2ZRGA 3BWBA 2E0IA 3R5KA 4JJEA 2HY7A 2VBCA 4EF4A 1COZA 4D02A 1LQTA 4R01A 1W36D 5G0SA 3I5YA 3FGOA 1VRCA 3H17A 3AILA 1I3KA 3CUKA 1WCIA 4K6FA 1ZH6A 2XVMA 3P5SA 4M1ZA 1F6DA 1ODKA 2OBXA 4EKDA 4J6EA 3FPJA 3H1EA 2PXHA 4WBNA 5AUPB 1M34B 2CLMB 2ZTSA 2V7QA 1NOJA 1RHQA 2HFKA 2WG0A 1X1SA 4MKZA 4ANFA 5K4HA 1WSAA 1AK2A 4QPJC 1AHNA 4CU5A 4BN0A 2FEWB 3GV0A 3DL4A 4RDXA 2DTXA 1WZNA 2WUDA 3CH5A 4YGYA 2JAUA 3C2QA 3DZDA 4OSEA 2XQFA 4KVZA 4R7TA 1WXEA 4URUR 2RBGA 5GMOA 3IPRA 2IV2X 3SU8A 1SHJA 3MMNA 5CFPA 2Q5EA 4L3WA 4R41A 5CVEA 1DC7A 3AJ9A 3PLRA 5G40A 3ZQ4A 1JTEA 3DDNA 2GAJA 2RGXA 5K3DA 3UHPA 5E6SA 2Z58A 4ADSG 1ENYA 4MOWA 3M89A 4I8XA 3DL7A 2H3EA 4EDFA 2A5YB 3I2FA 4LXIA 4C4XA 1PFUA 5H3CA 2BFDB 1V47A 3QQPA 1V39A 3R4VA 4E2ZA 1MHTA 4PFSA 1TJ4A 5FTNA 1UEIA 2FRXA 4BUCA 4DM7A 2CNNA 2JFHA 5GGXA 1ZXBA 1ML3A 4BVEA 3GRKA 2JAQA 5AKLA 1UMDA 4RSMA 3KETA 1GPYA 3JYHA 3M0EA 4RIFA 1E92A 5JADA 1HL3A 2I91A 3LGAA 1XJ5A 1REQA 5BNWA 4HGYA 3COSA 3CZAA 5IYZA 1Z17A 2J0UB 2J48A 5B3JC 1JLLB 3QA9A 2GJKA 2VH2A 3SBDA 1V9LA 1XX6A 5LP6F 4R51A 3N39C 4I7EA 1E7WA 4QDJA 5JS7A 2OHFA 3GGOA 4ETWA 4BMOB 4JLAA 3UA4A 4Z7QB 1YK0A 3L8EA 3AF2A 2B78A 3LCMA 1XALA 3GJQA 1XRJA 3MPOA 3P0FA 2Z83A 1STOA 2PSJA 4HQ0A 3U1VA 3PI7A 4F46A 4R1NA 3CE9A 4DDUA 3MWEA 2QTMA 2XZPA 4E14A 4EO7A 2NTVA 4EY8A 3L3BA 5GWXA 1XA3A 3F49S 3KNZA 5TS3A 3H8JA 1WHSB 1FNSA 2GF2A 5E2IA 2GEJA 3DZKA 1JFLA 4OJKA 4QODA 3PYLA 1OIXA 2VBGA 4GX5A 3T3PB 4C6HA 4A1FA 1EFCA 2QUBA 4J9VA 1TVKA 4OMFG 4FX2A 3UKOA 4DPLA 4N47A 4XIYA 4W6ZA 4O4LB 3B6ZA 1EWKA 3ZU5A 1AQIA 4GYYA 2PMDA 3PSAA 1PT7A 2HSGA 3RV4A 1Z5PA 3ZWWA 2XF8A 4DC9A 4XUCA 5B55A 2EIHA 2MSEB 2G36A 4QELA 3B9PA 1A4UA 4LOIA 1S5PA 2IEIA 2HZBA 4WLVA 5EJIA 2NU7B 5KEIA 5LQRA 2BTQB 5D3MB 3FCYA 3PXAA 3G49A 3VKWA 2XUOA 4Y98A 4YJGB 1XAHA 3X2EA 2NGRA 3EFOB 2H92A 3GNQA 2C5HA 2B34A 1RBQA 2RHDA 5SZKB 4FDVA 5ARCA 1WY5A 5C2JB 4C2BA 4K9LA 2IYTA 1JQEA 2Q3EA 1ACJA 4FFPA 4B9EA 1B76A 1OILA 1R0XA 3CPHA 1DBQA 1ORHA 2LIVA 4JVSB 1GDTA 1DG9A 3JQAD 1DTEA 3N7AA 4E94A 4B9AA 1E2PA 3ZE8A 3MD9A 4GWLA 5FEMA 3OPYI 1YBFA 3H5VA 3DNMA 5DISB 3PDCA 5L7WA 2BE7A 4F3CA 3HDJA 3E7WA 3AY0A 4RK6A 1J21A 1N2BA 2CXTA 2J6BA 3ICPA 4A7PA 3R9XA 3R7FA 2XXJA 3BSSA 3DE3X 4NFSA 2Q3BA 4BCDA 4C4YA 5HUJA 4R1LA 3IQEA 2WWHA 1L7QA 3E7PA 4WJLA 2C9OA 4ZFNA 4W5JA 4IX9A 3JY6A 3S1AA 5DHRA 4NU6A 4YFVA 1SUDA 4XJXA 1NKTA 2F4VB 5KTKA 3ZJTA 1SBQA 2I2WA 2BI4A 3UW1A 2PAAA 2WFMA 3DDOA 2FPPB 4F96A 5I7EA 4G0WA 1XJ0A 3BGDA 2OTCA 3LQ1A 2JDID 2XTJA 4TMVA 4JB3A 2PZGA 1JIQA 1NSTA 2CCKA 4RS4A 1SUBA 4HQKA 4UE2A 5DCYA 2J3KA 5HCIA 4C0JA 4CE6A 2ZTLA 4ENPA 1BHJA 2P62A 4AF7A 1HT1E 3D4PA 4IKEA 3W2TA 3WGGA 4Z53A 2X8WA 3ROQA 1J4AA 1IK6A 1U7PA 1YZNA 2FR0A 2ZG6A 2O06A 2GTPA 2WOJA 5FWXB 2QW8A 4X7BA 1YWGO 2VHJA 1GKYA 3M4XA 1YULA 2A35A 3R7BA 3WLSA 3SIPA 3EH2A 1NR7A 8GPBA 2Q50A 1MJGM 2FCAA 2QD1A 1KVSA 4JODA 1YS2X 5MF6A 3FBTA 2FSVC 1A76A 4MS3B 4OXKA 3THWA 4CLRB 1BAPA 4HN9A 6GPBA 2I65A 3A3YA 3N8DA 4UREA 1E1RD 2LXNA 5DGHA 2G9UA 2EZ9A 5IH3A 1SCQA 4US0R 3CLSC 2X76A 4HQRA 4EB6A 2CFCA 1D2GA 2HMSA 1KSGA 1XZPA 3LG2A 3EGXB 2F3PA 2W6ID 4BFUA 2GZ2A 4ND8B 4YQZA 3U3ZA 2CE2X 4LPKA 4MMZB 4MPTA 5TMDA 4G5XA 2HFJA 2QORA 2BTQA 5D3MA 4KSYA 5C8YA 1E0KA 1FA9A 1I5OA 1L4KA 1T4DA 1GAJA 3KV3O 4BX3A 3NGXA 2RIRA 4DLZA 4E7OA 1KMHB 3W9YA 4D56A 1XC7A 4Z5XA 3IQGX 4CDMA 3CRQA 5B3AA 1JBKA 2ZJYA 1Y3IA 3AOEC 4XW2A 3HQ4O 2C04A 5KPDA 2VHEA 3FPAA 3FMOB 4U2KA 1H94A 2V9ZA 3B3QA 4OQNA 5J40A 5GADl 1VC2A 2YIMA 4K9NA 3STXA 1BXGB 3DBHB 3RS2A 2FN8A 5DSXA 4BO5A 1D1TA 4KFRA 3K7EA 2E82A 2TYSB 3HKCB 1LU9A 3D2BA 2O2JA 4G1VA 3K1TA 3ADKA 3L6BA 3R7WB 3DAYA 1Q83A 1GAQA 1I4DD 2NO0A 4FYVA 5JY6A 4F1KA 3RC1A 4BLSA 4EVIA 3JVEA 2HJHA 4BDTA 3ZH9B 1EEXB 1VBFA 1FYEA 4K0RA 2Y67A 4J0CA 1J99A 4ETNA 1E61A 1X0XA 2GN2A 3II6X 4FWBA 4KQWA 4MYHA 4H1TA 2NU9B 4Z2AA 3HUUA 4YRTA 1EJ0A 5AKJA 2CFRA 1SXJB 3NP7A 1JKFA 3L82B 3C3WA 4PC1A 1SBZA 4E2WA 2FVYA 3IR6A 4ZZ1A 4RVUA 3EMDA 4ZDKA 5BO5A 1ZCJA 4BLVA 2VNAA 4EB6B 1SUEA 3REOA 3QK7A 2JIDA 4OK6A 3B5IA 4A8TA 3LKZA 3O8OA 4ETMA 2VXYA 3U4AA 5AM3A 2PYZA 3K9GA 3PVCA 3ZK7A 1O77A 3GLGA 2VPXA 1DV2A 5H9WA 2A59A 3WGLA 3RJZA 5C8YB 5JARA 4L4YA 2DZDA 3NYIA 4LWPA 5TQVA 3TRKA 3PGXA 5SZJA 5C53B 2QTWB 2F2TA 2GYYA 1RXIA 4K26A 4YP5A 2CUZA 4DSZA 3R9IA 2I34A 1RXYA 3IVXA 4JKOA 2G77B 4G9GA 3LOPA 1BXGA 1R6AA 2R6AA 2Y9PB 1F5SA 3JD3A 1TMYA 2D00A 3QUBA 3IELA 3OJ0A 5ARDA 5FL3A 5J2TF 4EHNA 4FDUA 2PPVA 3G7UA 5JUWA 3O2JA 1J5PA 2HA2A 1TTQB 3F9RA 1NJ5A 2O7QA 2X0JA 1GFSA 2Y2UA 5TQ0A 4B81A 4WESB 2VLBA 1JMKC 4NDZA 3EYWA 1Y4DE 5KSWB 5J2UF 1U0EA 4MR9A 2GPJA 2JPDA 4G97A 4UC0A 1I13A 2AOWA 3ZC3A 1F20A 2PNFA 4RVOA 4B45A 5DTIA 3OOEA 1QANA 4D41A 5L53A 1XRSB 1UQRA 1KHTA 1T5HX 1RBZA 4LVCA 1HEUA 3GP5A 2OAQ1 4D4IA 3HJGA 3C3KA 3NASA 2AG5A 3B2QA 1EHCA 3G9XA 4KC0A 1M1NA 2ZYDA 2WFAA 3CURA 1Y0BA 4J0DA 2DWPA 2GASA 1BFDA 1U0GA 2GN6A 2XT9A 2LUOA 4MAAA 2IKSA 4F6RB 3RC2A 4EF5A 3ANSA 5JRZA 1FYVA 2AX3A 2PRSA 3NJ8A 2WIJA 1OWPA 4GVPA 4Z9BA 3T0FA 1FZTA 3KO8A 3ZDZB 2PV0A 2QDXA 3OF3A 3H2JA 5KVSA 4H60A 4MVWA 5LR6A 1IVYA 1AGXA 2NVUB 3GXBA 3LLUA 4RPJA 1CQWA 2IUYA 3O8BA 3LHSA 3UJ6A 4EX6A 3CWQA 1DC4A 2AHRA 2YIVX 3R5JA 1AZTA 1B6GA 3C4QA 2J9RA 1Z22A 2NPFA 3V8PA 1OI2A 2XHEA 1OU4A 5LBTA 2ZWIA 4M7WA 2E5LB 2CVZA 3NFYA 5GJCA 2I6SA 4QJ5A 1E9SA 5H68A 2EYQA 3HKBA 3WQSB 4M0LA 1A50B 2BEWB 2VRCA 3HUEA 5UKDA 1YRLA 2VF2A 2J31A 3ER9A 3HJFA 5EP2A 1FMJA 3LDFA 4R9UC 1IY0A 1B93A 2DQSA 3K2BA 3NDIA 3GF4A 1FDVA 3NZEA 1YUNA 3U56A 2O8CA 4MROA 1YFZA 3D4OA 4CDRA 3T52A 1GPUA 3LFTA 5H82A 5ENZA 1CDOA 1NX6A 2Y6UA 1U7HA 2CJWA 3EUFA 3U09A 2EFCB 2ZSUA 3VR1A 3M70A 3E81A 2V97A 1EX7A 4D0LB 1R66A 1YQTA 3RUEA 5LP6B 2FN4A 1TKBA 2V74B 4E1VA 3ZHUA 1DHRA 1RC0A 4KNWA 1AHHA 1E2EA 2G6TA 2J9FA 4HAXA 5GOZA 4G67A 1L1FA 2INGX 3WK4A 4KMOA 4C0XA 2PX4A 1GT91 1JJ7A 3AG5A 2OXFA 3D31A 3TLYA 1G4HA 4IEEA 1Z7GA 1U1IA 4KWCA 5THKA 1RU3A 1H9AA 5TQ0B 3OX2A 1TC1A 3KTDA 2D5LA 4HSEA 2AEJA 4YRJA 3H8SA 2IYYA 5K8JB 3O2NA 4Y9RA 3D3EA 1OGJA 4KH1A 2LBPA 5U4XA 3CKLA 1E3MA 3W1VA 1E3EA 3H5AA 1C8LA 4HC4A 1BWSA 3SI7A 1DMSA 4DL9A 2QTAA 4BAGA 4I1IA 1A7KA 3TAXA 4GHWA 4GVLA 4CZ2A 1M67A 3WZ2A 3P0HA 4TX1A 2W4QA 3BIXA 3WSWA 2O3QA 3F90A 3L93A 2R8OA 4HGZA 1CQPA 3JQ9C 4H4DA 3LUDA 4OYHA 5SYMA 4EFLA 2DH6A 2I3GA 4YLYA 2EP5A 1O9GA 2X4LA 1QGZA 1BWQA 1VPLA 3CNNA 4YRQA 2AZTA 3Q1KA 3BSYA 1EGMB 5D85A 3M6IA 1WNFA 4LFCB 2HWKA 1EK0A 3Q9UA 1U2ZA 3L6CA 1I7LA 3ZTYA 2ADFA 2R2GA 3CSSA 1N2CB 3Q8KA 4Z4FA 4DBLE 3BFXA 1L1RA 5DHTA 1HDZA 1P2TA 5KDDA 1X1BA 4X45A 5LA6B 2JL1A 1VYTA 2YQ5A 2Z1NA 1R2QA 4EB8A 5K0ZA 5A4JA 1UKCA 1VJ5A 2NVUA 2AF3C 3HFRA 2CLKB 4HG2A 1LSJA 4PQFA 4YDSA 1NONA 1X8LA 2EF1A 4WZBE 2NU8B 1E9CA 4J0FA 4R54A 3UN1A 1ODTC 5D6OA 4F72A 1LC0A 1T1RA 4RC9A 1U2QA 4NV3A 3VR6H 1VLZA 4GM1A 1X3LA 3EZGA 4I55B 4QRDA 4FT4A 3U4CA 5CFOA 3RIEA 4ZEMA 2R1VA 3H9QA 1U04A 5A5EA 2AW5A 3BULA 3I39X 2IUEA 1KMIY 4W1PA 4KX3A 1HF3A 3GLKA 5IMSA 2ZCUA 4BQOA 4X93A 2X40A 2M6RA 5K20A 1PR0A 2VQEB 2WINI 4Q9LA 4CF6A 3FR7A 3NIFB 4I50B 4N4AA 5KU1A 1DZ3A 1VCHA 1X7ZB 1V4VA 2VCYA 3A14A 1P7ZA 1TUBB 1JZTA 1PTKA 2XT6A 4ZZ0A 1I36A 1SFRA 3HABA 2XD4A 1EDZA 3O91A 3WA6A 1IOVA 1SCKA 2Q7OE 4BWYA 1S7CA 3PJDA 3QYAA 3KPJA 3SJZA 3UC9A 4AWXA 2HH9A 3TL6A 3WKCA 1GNVA 1SCUA 3U44B 2EERA 2QJOA 4YREA 4ZV9A 2ZB2A 4NZOA 1AB5A 1U7OA 1N3LA 1VPTA 3TNDA 1COWA 2HHHB 3E8XA 1JHMA 4H3KB 1UKEA 3KXIA 4XQCA 2ZUUA 3REFA 2RHHA 2FJUA 3L7KA 1I6KA 2QMOA 4M76B 3RABA 3E5MA 4FZJA 4P4UA 4MUHA 3OF2A 4B0OA 3ZUPA 4D9BA 1X9IA 1K0FA 3C8MA 5F1YA 3O8LA 3EOZA 5ER9A 2A0KA 2HXGA 3IB6A 5H8WA 3QU7A 4O1IA 4RF4A 2D4HA 1BJRE 2P7IA 2XKAA 2QVGA 4UTXA 4EHBA 1ID8A 5ESWA 2OLEA 1SGWA 2DPXA 3P32A 4RM3A 2Q4DA 5CFRA 1NW3A 1QVRA 2H48A 1BC5A 4IWYA 1RWOA 3EC7A 2VT6A 3MT9A 4P7JA 2CW5A 1E2FA 2DBZA 1D2MA 2OGSA 2IV3A 3R5XA 1WKBA 3GEHA 1B1CA 3K9HA 3RVLA 4S1VA 4KHPB 1V8DA 5COBA 5A4MS 2DJIA 1WM1A 2ZYIA 4CRWB 2GNPA 4KDCA 1NAIA 1CR6A 2ES4A 3QSGA 1MG5A 2NU8A 4S04A 1VE3A 3L77A 4NOJA 1ABFA 1WB9A 1YHZA 3B1ZA 5ED4A 2QRKA 3GYGA 3OP4A 4XGRA 3ROEA 1QLJA 5F64A 2I3DA 1ENZA 1LBEA 1YL6A 3GDGA 3KC2A 4FS3A 4XWYA 4B6EA 2OY0A 3DTTA 3GH3A 2OFXA 4RY9A 4WTOA 4BVKA 5IT9A 1HG0A 3K9WA 4ME6A 4QM7A 1Z4JA 1Z0IA 2X9LA 4YUYA 3TW8B 1YCFA 4US2R 1IN5A 2BFWA 4MB0A 4AMGA 2JBAB 3GN2A 3TXXA 3TBFA 5JDIC 3IPXA 2WJ6A 3BXXA 1VFPA 2VSOA 3KB8A 5F33A 3F98A 2J32A 3VR4A 4YYZA 3QPUA 1ONPA 1TRKA 3P2JA 5CEEA 4ILKA 4FYYA 2A1UB 3U26A 1IJEA 2G9RA 1T8SA 2M1XA 2AFVA 5K9ZA 3FBGA 3IS3A 3OUUA 1XTQA 1TZ2A 2P6UA 5ENVA 2GPYA 2WHEA 1D9XA 1MAVA 1GT6A 1JU4A 3DTVA 3M3HA 4Y2XA 2VXBA 5DSTA 4PLVA 1KYQA 3VZPA 5JQWA 5M04A 2PG3A 3WRVA 2VP0A 2J5QA 4A8JA 4CKEA 3UJBA 5LLDA 5EEHA 2A67A 3V34A 4P31A 2B4RO 4C6TA 2WTMA 3SYKA 3OT1B 4DV5B 5C32A 2C61A 2KPOA 2FI1A 3KQLA 1RXSA 4Z9FA 2I99A 2CBZA 2VZ8A 2DLNA 2LWIA 4MS4B 4P5EA 4ZAWA 1WIWA 3RU9A 5JZOA 3KWFA 1U2PA 1MC5A 2YWDA 3UMMA 4Q7MB 3WXMA 5F77A 3DOEA 4KQGA 1VSBA 1K66A 3NKFA 3PICA 4WASA 3A6GA 3HHEA 1LQ2A 2PL9A 2X5OA 1OYYA 1U0FA 2G1KA 4FGSA 1GUDA 1SRQA 1ULAA 4L7QA 4U02A 4K9DA 5MGBA 3OBIA 3S2IA 2G9ZA 2XNHA 5HKOA 1AZLA 1BX0A 3LQKA 4B44A 1EMDA 1IH8A 2AXPA 4QUBA 1LBSA 4H0CA 4B6GA 1NQUA 2ZATA 3FJOA 3ZCTA 1MO3A 4RF5A 3KBOA 4F2HA 3FZQA 3NJRA 5BSUA 5H02A 2X5KO 1YRQA 4WOPA 3BDVA 4M0EA 4Y2PA 5AK5A 1JEOA 2P78A 4MVJP 1VP9A 3U3DA 4JP8A 4GPZA 1W9MA 4NI5A 2QVCA 2OWDA 3L7AA 4GYWA 4MRAA 3V6LA 2H7VA 1MW8X 2PBZA 3QLUC 1BU8A 3C3BA 4YCNA 3A4NA 3BEDA 3DFFA 4M1QA 5J2TB 1S2NA 1ZINA 3A6FA 3AVYA 2W4MA 4DIUA 2E48A 2FFAA 1SU4A 2H5LA 4RACA 4XSHA 2BGTA 4Y6QA 2HV9A 2VCHA 4UCWA 3N2LA 3KZXA 1TJ5A 2X14A 1O03A 1TVKB 3BRQA 2FZ4A 5CTAA 2VT2A 1HYGA 3DVAB 3T9EA 3EJWA 1WDMA 1AKYA 2NZWA 3DCJA 1CP3A 1FFEA 4A82A 1RZUA 4B7CA 4MUGA 5DW0A 4TKVB 1WNTA 3NTXA 3UJ7A 3GT3A 5FNVF 2NVWA 4KW7A 3RRYA 2IPMA 3CCBA 3MTIA 1G9TA 3D0RA 1X80B 3C6YA 5A62A 5DK4A 1BX3A 3QE0A 1FS5A 3WAKA 2IUUA 1ZIYA 1POXA 1TYDE 2QT0A 1Z5UA 1ZOPA 2MSDB 3AUFA 3OKAA 4WLFA 3ZZNA 3RFTA 5I8PA 2ZYHA 4K6HA 2IH2A 4Q00A 4A8JB 2RKOA 3GQBA 4N0MA 3AL2A 3NTRA 3FPFA 1WV0A 3O84A 4Q3LA 3E84A 3GU3A 4MIEA 3UEOA 4CMEC 4KAXA 3B1VA 2HK8A 1Q3TA 3GCXA 3GDWA 2ZBFA 1HEYA 4V39A 3TM5A 1DLIA 3CSUA 2AUNA 4EHAA 3K5PA 3PNYA 2UYYA 2XB4A 3OIYA 3F3SA 4I4TB 4NAHA 3PLNA 1VM6A 4GKBA 4K6GA 1AMOA 2H1WA 3A4LA 2G5GX 1IM8A 4CDNA 2YZ7A 1UEJA 3G2PA 3BB1A 3SN6A 3KOUA 2DG2A 1SQSA 3EC2A 5IF9A 1U0RA 2G07A 4EECA 4MP8A 2F4NA 1PJ2A 2W00A 2FWPA 3DJFA 3PUKA 1E59A 5CCDA 3SCZA 3WS7A 1W581 5BUZA 2DTDA 3EXIB 1CUHA 3EW7A 4KB5A 1C3JA 3DHYA 1GRRA 4GLJA 4D9EA 4WBNB 2I55A 5GIPE 2YZMA 4LECA 1M2GA 1W5AA 2RB4A 3N75A 1PV1A 4LMBA 4QBFA 3U81A 3V8EA 4OGWA 3FI9A 2BEUB 1N92A 1SKUA 2QX8A 2XYRA 3C3AA 2MMGA 2XQGA 5K0SA 5HM6A 2OBBA 3O94A 2FPRA 4KN5A 1SVNA 4TV9A 4IGIA 2BI8A 5FIUA 4HDRB 2WTNA 4GDFA 1R15A 5LXTF 4PC7A 5IJ0B 2Q46A 1GRQA 1Q1QA 2N75A 5ESRA 3GQBB 5JCOC 3DDUA 2F59A 3ZHXA 5AW9A 3ED1A 2VIIA 4K6CA 2FQYA 3H5OA 1H6BA 5TLSA 3UT6A 5K09A 2R751 3OCWA 2FPIB 4NBNA 3TTTA 5BYBA 4O3MA 1NE7A 2V6IA 5REQA 1I0LA 2V6FA 3A3OA 3GRZA 1OAKA 4NENB 1XEFA 3FOCA 4TLDA 4BYGA 5LU8A 3WLPA 4W8HA 1L5RA 3B1XA 4DCJA 2QYOA 1QM5A 3EWNA 3IRUA 3PRJA 5IEJA 2IXGA 4EUSA 2OD2A 3FZNA 4X6XA 1QC5B 3UHFA 4YT8A 4F3TA 2RB5A 2YYSA 3BL5A 3S70A 4OHYA 2FOIA 2PS0A 4BVAA 4U7FA 1IRIA 1PRYA 1QOQB 1W93A 2JHCA 2V6BA 3WP0A 5K05A 1MXFA 1GKKA 1FP4A 1XG5A 3GT7A 4X7PA 1ORTA 3AIMA 4YV0A 5HZKA 2BV3A 2O9JA 3C3EA 2JB9A 1T15A 1CKEA 1N7IA 1EUDA 2UZAA 4LRUA 5F3RA 3NQ41 1OKKD 4ZI7B 1GGEA 1JAHA 1G18A 1NVAA 2PKYX 3SC2A 3V4VB 2CXNA 1IUOA 2P5YA 2ZBVA 4BWVA 2DWOA 3DTVD 3U4QA 1EUQA 4R05A 4C4TA 4KREA 2WW8A 3CLUC 3EE6A 4Y9SA 3ETHA 4Z54A 1CY4A 1E94E 3LC1O 4ABTA 1FRNA 3K3PA 5GP1A 5IK2A 3BQNB 4CEIA 2GEVA 3WTCA 4YLEA 4UZSA 2Q5FA 3CH7A 1PWYE 3LBAA 4J1NA 3WLTA 3WADA 1P73A 1V48A 2HDWA 4QJIA 1NXVA 2HIHA 1AH2A 5JANA 1VPWA 4OHCA 3JQBA 2AVNA 3G79A 3VGJA 4DG9A 5JC1A 2ZXEA 3V1TC 3DZ8A 1VXRA 2HRQA 1T0IA 4H27A 4IUYA 4E03A 5LQAA 5F52A 1YMQA 1NMYA 2HDNB 4WHMA 4DLLA 3GEEA 3RLFA 4BLOA 3PD7A 1J0AA 3HO8A 5GY7A 2P9HA 3O83A 2C9CA 4TXMA 3QBEA 1DIOB 3G2NA 4Y2TA 2GX6A 3H97A 3DC7A 4Y1FA 4V0ME 1MA3A 3GP3A 1XCPA 2CF6A 1F2UA 4PG5A 1P4GA 3KKMA 1P8JA 3IOMA 3IQFA 3AZQA 2YRFA 1VE5A 1L4HA 3GGPA 1MPTA 4X6LA 3CX6A 3HUFA 4P58A 2GJ4A 4KWTA 1W8IA 1NNI1 2DECA 2YX1A 4CF5A 4TM8A 3FYSA 4WL0A 3W8DA 4P5PA 1OB5A 5DT9A 4C7VA 1U2EA 1ZU5A 1AK9A 4GOND 2HGSA 2WAOA 1GPDG 2BCEA 3MINA 3O82A 4MQEA 1SVLA 4DPKA 2AKEA 3DDZX 1E9EA 1SHZA 1ZOOA 2ZJZA 4WCFB 3ZLJA 2XTMA 5EIAA 3ER8A 5JMOA 1CHDA 1KEVA 2VQFB 3EUWA 5EINA 4UNQA 1AQ6A 3SEQA 5KKNB 1APBA 2OV4A 1Q44A 2PD6A 4B7UA 3P4YA 2PPLA 3OZVA 5AKKA 4I5GA 3W5CA 3A6ZA 1G8JA 2XOKA 2ZIAA 3KR9A 4P6VF 5LWQA 1A69A 1Y80A 1NX9A 3WL3A 2VK8A 2CNOA 4UCQA 4CGZA 5EHZA 3KR2A 1IHUA 3LUCA 3U3XA 4LNHA 2Q2VA 3GO4A 1B3BA 3ZVKA 1NATA 2IYEA 1TF5A 3FIUA 4KQMA 1HETA 1GZ7A 3A1CA 3AFMA 4Q3DA 3W2EA 3RE1A 4AJKA 1NVFA 2WKQA 4IIEA 4MUNA 1RSZA 1Y3FE 2R7NA 4DMRA 2J07A 1A5TA 2QD4A 4Q18A 4QGHA 5EJ4A 2P5TB 3CUUA 4MEBA 3OFJA 3KPUA 4Q12A 1B2RA 1EVEA 3UJ9A 3H5WA 2AFHA 4NAUA 3H2SA 1NXQA 5EJ6A 2Z5FA 4EPRA 4F6RA 2CKMA 1E3TA 4MTCA 4M9RA 2YWBA 4QQ8A 1PJCA 2PRJA 4G8DA 1OZAA 1KGSA 3DBIA 3HDYA 3QFCA 4CL8A 2AOUB 4QBHA 4URVR 5FA6A 5IZCA 3PS9A 3W7AA 3HCCA 2ZBEA 4TVKA 3IDZA 3AFIA 1ODFA 1D1PA 2I78A 2V59A 3PEEA 2FX3A 4CMIA 1H4QA 2P9JA 4YRBA 1NVVR 3I9V6 4URYR 2VKQA 3AEUB 5A6SB 2YYAA 3T1VA 2X8AA 3QU2A 1KI4A 5IC4A 3IV7A 3HUTA 1UXOA 2D7DA 1K0UA 3I6IA 3OIFA 3N9IA 5D5PA 4WCVA 4DLXA 1PL0A 1Z73A 3PFFA 4KI0A 1ZIDA 1Q7TA 1NQOA 2ZDQA 2IC5A 2PUBA 1ZUNB 1I1HA 4PTYA 1RWXA 1QFSA 4QHSA 2WDPA 5IABA 1JI3A 1XWWA 1XZJA 1AM4D 4QU8A 1JAIA 2KYRA 1Y3DE 2H9YA 1XTVA 3BB4A 2OQVA 3W5DA 4ZAFA 5AOCA 4KPUA 1KDOA 4N82A 3A9SA 3A8TA 1PJ4A 1U2RA 2IIVA 1S8AA 2L82A 2PEZA 4TSRA 4WFIA 3VFDA 4I6JA 2XCUA 3A05A 4D9FA 1K5DA 2BGUA 4BX9A 1P91A 4MVJM 3RLIA 3ZJVA 1RPAA 1TO6A 2BOVA 2X5NA 1J25A 3OY7A 1V16A 4ZGGA 2X2OA 5ESXA 2Q3HA 2QRQA 1SXPA 2B2NA 4IF6A 2YZ2A 4M9CA 4N6NA 2GPSA 2VTKA 3ILSA 1XR3A 3E2IA 3EIWA 1MO2A 1Y1SA 2WHQA 4JEHA 1KJQA 3JTEA 4TWRA 4CJXA 1EP3B 3C8UA 3AVUA 1RRPA 4YTEA 4YAGA 1UIMA 4G5FA 4O4IF 2BFBA 4PGHA 4A92A 4E51A 4ZHQF 1MT3A 2K2WA 4OX9B 4CTKA 1PP4A 2IYAA 4J2HA 5C46F 4A16A 4LC9A 4A3SA 1PFQA 3OMXA 3ZHTA 2VYQA 3DV2A 5BNZA 3ZEAA 3GA5A 3OCJA 4ALMA 4HAIA 1OIVA 1PWXA 4Z8XA 3UYKA 5ITZA 1P17A 2FLWA 5IMBA 2PU5A 3HI6A 2YICA 4EUHA 4OJQA 1UJCA 4MPDA 4AF6A 1PLLA 5CJJA 4YCCA 1QU2A 3BL8A 3UMCA 5AW0A 3RI3A 2WF9A 1B0ZA 4OSOA 2GCOB 1PS9A 1ZXXA 2WWXA 3B1JA 3QKRB 1QPGA 4CKBA 4YRZA 1ESEA 3OKFA 1OPXA 3WWYA 1II9A 2QRHA 1QCYA 4BEBA 4E0BA 2XWPA 5HPYB 1ZJWA 4XD7A 1AC5A 3MUFA 2C2KA 4KAAA 3RTAA 4BNMA 2IYRA 4ENQA 4ZKDA 1EDOA 1MRSA 2XMZA 4CG2A 1U7ZA 2XMGA 4R2JA 1NXOA 5GPBA 4ENUA 4MRNA 2G0AA 4JEUA 2C94A 1H2XA 1LK0A 3L7MA 4DA4A 3TO5A 1O1YA 1O6GA 1V7QA 5LLSA 4CIBA 4EFNA 5IDQA 4YUZA 5T8KA 1P9NA 2QUJA 3DYVA 1U4NA 4PRZA 2XRZA 2J59A 1IZZA 4FQ5A 4YRPA 5BSMA 1VSQA 2GBFA 1GJRA 5AI4A 3ZE2B 1FFYA 5KTYA 2BFBB 1E6EA 1U2DA 3DHVA 5LMUB 5K51A 3UXHA 2G71A 4G4IA 3AKDA 4BLRA 2FP3A 3HCRA 3SC3A 3QNWA 4A6XA 1SBIA 1JALA 3AESA 1ISHA 3UWDA 4EG4A 3BM5A 3MCTA 1ISFA 5DJ5A 3KKQA 1R18A 3KLNA 1T29A 4BIMA 5A4AA 4G1CA 3A70A 3V00A 3IIMA 5IW8A 1CZUA 4DWVA 2XUHA 3TTWA 5BV7A 4MQUA 4JYAB 1WKCA 2HYIC 1U7WA 2FETA 2X5XA 4UJ3A 2HA3A 2YHUA 3VU9A 3W2IA 2QTVA 1JQBA 1GL7A 2GYUA 3G02A 1QF7A 1ZM2A 4Q37A 4YP7A 2B35A 1EZ1A 3PNQA 4R2MA 3B38A 3WDSA 1GUAA 3KOYA 5IXJA 2IEZA 1KTIA 5J43A 3DO8A 5HDBB 3RAEC 3HO6A 1O8CA 1NKSA 4I2NA 1T1SA 2G1UA 1RQXA 2O52A 1KK1A 3CRW1 2ZUWA 3KYBA 3K32A 3O75A 2WJYA 1GQRA 4X91A 3Q0TA 4Q4JB 1YU9A 3TGWA 5TJ9A 1R0BA 1SOMA 1CRWG 4XGIA 1P29A 2XMQA 1NY6A 5EZQA 1SUAA 1OIWA 1DCMA 3DGFC 3T15A 4AUMA 3IE1A 1OY1A 4NEQA 3ZHQA 3NUQA 1JEYB 3VAZA 3H05A 1TIPA 1P7YA 1INLA 1TJPB 2EKBA 2NLOA 3LK6A 3PDIB 1QYXA 4WW0A 5FUYA 3HV2A 2PX6A 1XOIA 1KRWA 3BC1A 3LXRA 1JB1A 3PQ5A 4FGJA 3RG8A 1JDPA 4AZSA 5ILGA 5CB0A 1SKYE 4RESA 4JITA 3QRWA 2VTBB 3HVIA 1XCBA 4ZVRA 3SAJA 1U28C 4RQAA 4BX8A 1GAEO 4KIGA 5B3LA 4P3OA 2VDNB 4G01B 2PTHA 4B6SA 2EKLA 3VH1A 3O8CA 1BMQA 3LH5A 5LYJF 2Q5JA 3H04A 1FFWA 4IHAA 4J43A 4KGDA 3A1EA 2A84A 2X3UA 3QENA 3MCUA 4EELA 4OQEA 5KMGB 5ARBA 5FUQA 2NQ2C 2HN9A 1CUVA 2JVIA 4LCBA 4BY9E 3A27A 3WRWA 4PHFA 1O9BA 2AC7A 3KLPX 5IEBA 2FMXA 4TL9A 4NULA 3L8DA 4OU5A 4D9NA 5KYTA 1ECFA 2IYZA 3TGLA 1NMSA 4ZVUA 5BSRA 2Y66A 3RC3A 3GNLA 3TTSA 3L0IB 4CCYA 1JR6A 2ILTA 2O2SA 2PO5A 2NSDA 1JFVA 2NSJA 5ALSA 1EP9A 2NUPA 5LQMA 3WQRA 1U0TA 2WJHA 4RZHA 2VYNA 1MDBA 4JBNA 3MGBA 4F45A 4QBKA 1U8AA 4PZ9A 3T8YA 2EW2A 1H1DA 3EEBA 4AUEA 1VPDA 3LJKA 1FDRA 2VHWA 4KI7A 1U9JA 1ZHHA 2P91A 2PYDA 1E5XA 3RUIA 2JFUA 3BWVA 3M4YA 4U9UA 1BHO1 1UKVY 2W8BB 3H11B 4KQ6A 5LYYA 3QLUA 1EBBA 5K4GA 5K45A 3ZKWA 2XHZA 5G0WA 5JPDA 2I7VA 4C6TB 4ZYXA 3QE9Y 5MHTA 1BOOA 4Q4JA 1JMYA 3BRWD 4WZ6A 2OZKA 1EUZA 4D97A 1E79D 4TTTS 1LSUA 2A9OA 2Q0HA 4AU1A 4N7BA 4YS6A 5AESA 4MLDA 4JLOA 2PT5A 4RBNA 1KZ9A 2QN1A 4UUNA 1KNQA 3TKYA 2IU3A 1LNQA 3L4BA 2XD9A 3OEYA 5CVUA 1KFBB 1V3UA 1DAIA 5BXYA 2BMAA 5JYDA 1E96A 2G7ZA 2JZOA 1N0IA 4UAGA 2W0MA 2QX4A 2V5VA 4ARVA 4BP3A 1UM9A 3L4KA 2Q3FA 4PGGA 3ZGNA 3EQ9A 1XUOA 3W05A 1U7XA 4RTNA 5BYAA 1NMZA 4HQNA 2WYUA 1HV8A 1WUJS 3ZXUB 2R96A 1I94B 4IKOA 1IQ0A 4QT4A 3GZNA 1O94C 4RGBA 4TYYA 4B2YA 5FO0A 1IBKB 3M1IA 1NU8A 1L4YA 2KE5A 3L8HA 1Q57A 3MJSA 2PEYA 4KLZA 4UZEA 5L7YA 1O0CA 3NUGA 4RV5A 1T9GR 1YOVA 4JP1A 3VNAA 2AZDA 5HHTA 5K6RA 3MCVA 2ZYVX 2GRJA 4OIMA 3RG2A 4MVXA