1ZUIA

Structural basis for shikimate-binding specificity of helicobacter pylori shikimate kinase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
158
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for shikimate-binding specificity of Helicobacter pylori shikimate kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords Shikimate kinase
total genus 51
structure length 158
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zuiA00
2X77A 1Z0KA 4Q7JB 4UJ3A 1QBKC 4WZBE 3G82C 4EQ6B 1OFIA 3W3ZB 1P61B 4DLZA 3CUEF 3ZQ6A 2J0SA 4IDNA 2XX3A 2IC5A 2A30A 2NO0A 1LY1A 2WAXA 2YV5A 3WRYC 1XPUA 3AB3A 3RSLA 4E09A 1UKVY 3DDCA 3VHXA 3W34A 1NJGA 2A2ZA 4KFUA 1IY1A 3KTAA 2JLQA 3HU1A 4LPKA 5KYKA 4NONA 3K9HA 2OAP1 2CLDX 2F9MA 3A1UA 4OK3A 4LSGA 3QBTA 4D81A 1VCIA 2JEOA 2XNSA 5L3SA 1OXXK 2N42A 4TL8A 4M21A 3CWZA 4JLNA 4RFSA 4AYWA 4JLKA 2QMHA 4HAWA 1SKQA 3FKSD 4N1AA 1T9HA 1E1QA 4BE7B 3Q8XB 2YOFA 5SZKB 1NRJB 4PHFA 2ZR0A 2OFWA 2ZJ8A 3D31A 3THXB 1T8TA 1XTIA 1E96A 4XOIA 2PEYA 3SOPA 4UNQA 1HT1E 1NL3A 3BFXA 4Q9IA 2MSEB 2R62A 2E9SA 3KQLA 3F8TA 1E0AA 2XB4A 1II9A 4C3ZA 3VX4A 4BECA 2XSZA 4TSFA 1VCNA 2A5GA 3MFYA 4CF7A 5DI3A 4GOJA 1XDBA 4G3XA 4URVR 2X2FA 4Z1MD 2OCAA 3ADDA 1OYWA 2JA1A 1HT2E 2FFAA 2AL7A 4PX9A 1GOTA 5JECA 2V55B 3QKRB 1AS3A 3SYKA 2ZETA 1ZC3A 1CRQA 2WZQA 3E1SA 2VQSA 3AF2A 3EC1A 1LV7A 2IXGA 4IKEA 1HQCA 3WYFA 1ZYUA 2BHRA 2EYQA 1M7BA 4RCYA 4DZZA 3ETLA 3PCRB 2GNOA 3RABA 3R20A 1CU1A 2VP5A 4Q4JA 4NYMQ 4KFSA 5TY0A 3T06B 2PT7A 1NVVR 4EUNA 4OK5A 5G40A 2ZRFA 3B2EA 4IDHA 3Q72A 2IYZA 2CHVA 4BLOA 3B1VA 1U81A 2ZS7A 1RRGA 1VIAA 2NOAA 4ZDKA 2OBMA 521PA 4R71A 3H1TA 1TQDA 6Q21A 1KJZA 2FFQA 3FGNA 2GCOA 4M4SA 4E07A 4IRUB 1KI6B 4QNMA 1JAHA 2DPXA 4TTPA 3PENA 1E2NA 4MGIR 3LXRA 4LGMA 1TF5A 3VFDA 4YC7A 3A1TA 2IYQA 2J9RA 4PFSA 4PAOA 3UMFA 4D4LA 4KODA 3U5ZB 4QHSA 4QHTA 2C2HA 2ERXA 2ONKA 1CXZA 4LX0A 1S1CA 1XTKA 3BAFA 2IYLD 2OLJA 2WKQA 4KLZA 5TARA 1E2QA 4JKYA 2REBA 4EPXA 3IBYA 4TLBA 3MSXA 2H1LA 2RHMA 1SKYE 2FH5B 5BW8A 1NNEA 3CF0A 2FA9A 2G1KA 4NCKA 3GJ8A 4OQNA 2IXEA 3KQNA 2JIZA 2ZRIA 2WWYA 1ZNWA 3T1TA 1SXJD 1COWD 4AD8A 5EUQB 2CNWD 5JSZA 3I5XA 1DS6A 4EPYA 2UKDA 5FPTA 2R6GA 3P1JA 3QVUA 3I5YA 4A6PA 2WOJA 2R6CA 2VP6A 3LY5A 2CLCX 1NKSA 1K6MA 1L4UA 4BGDA 4AI6A 2QAJA 4B34A 2FZLA 1W48A 2JDID 2Z6VA 1G1MA 4LYFA 4OQMA 1F6BA 4A8JA 2ZQ5A 1UEIA 1NLFA 1JAIA 2BJWA 2XZPA 1MABB 1G5TA 4P4UA 4RD1A 2OCYC 4DHEA 1CBUA 1IOZA 3I1FA 4KBFA 3DMDA 2PJRA 4BFZA 2W0SA 3WMFA 2X1VA 1IBRA 3KKMA 2ZRGA 4R2IA 5DIFA 1A82A 1KO4A 3EASA 4AK9A 2F55A 721PA 2WBLC 4UXIA 2FDCA 2XEXA 1Z06A 3V4RA 2LKCA 4HYYA 1N5JA 2ZVPX 3EIEA 3IQXA 1T5LA 4D4KA 3RWOA 1T6NA 1SXJC 2C8VA 3GLGB 2W58A 1S1MA 4QGFA 3L8ZA 2VO1A 1KDRA 1G5PA 2ZUCA 1CR4A 2JATA 1E69A 3IBGA 4HB0A 3LD9A 2OXCA 2ZTSA 4LJ7A 1E2IA 4TSFD 3EIHA 2OXRA 1FTNA 3KFVA 1FQKA 3RDPA 3LFUA 3I8SA 1G6OA 1U0JA 2ZE7A 1C4OA 1JQLB 3OE7D 1P6XA 1VG8A 3AP1A 3DHWC 1E32A 3C14C 3AVXA 3TKLA 4H1VA 2B7CA 1KI2A 5KSZA 1VMAA 3B78A 2XNDD 2G77B 4XD7A 2QE7D 1KOFA 4G5QA 2ZS9A 4HB2A 2F9LA 4IVQA 5GJBA 1DAIA 2EFGA 3BGWA 2RKOA 1OFTA 5HCIA 1YU9A 4XVRA 3UATA 2VP4A 3AVPA 1NY5A 2XB2A 3U44A 4M8NE 2IT1A 3NHAA 4V03A 2Q3FA 4KU4A 3H2YA 1SZPA 2CCGA 4YXWA 2BMFA 1E2GA 3NH9A 1ZD8A 4MKGA 3LBHA 1KSGA 3QUSA 4X8HA 4DCSA 3QJYA 3IEUA 5JI2E 1KMQA 1XTJA 1XU4A 1QHHB 4W5JA 5FPYA 3W9YA 3SU8A 1FFHA 4C9BA 2FJUA 1KI8A 4YDHB 3CZPA 3AKCA 1GWNA 5B64A 1GM5A 4S35A 3P4YA 3LAWA 1AJEA 1H8HD 5G3ZA 3OIYA 4F7WA 5M04A 2WICA 1JR3D 3SFZA 4B73A 1UKZA 2LWIA 2VHUA 3L43A 5B30A 1IAQA 4DCTA 1NN0A 2EU8A 4OL0A 1IY2A 3K53A 1F3OA 3VR5A 3VU9B 1NN5A 2I1QA 1YQTA 2QP3A 5EP1A 4RJLA 3TR0A 4H1UA 4GOKA 2ODWA 2A3RA 2ODNA 4TQAA 3V00A 2WAYA 1I4TD 4EPVA 4DSNA 2KSQA 1XD2A 1XJQA 3LDAA 4GL2A 4EPWA 3U3OA 4TMXA 4DLUA 1IN4A 1T5IA 4JKIA 5K8UA 1JQJC 3F5FA 2C96A 3I4LA 4CIDA 1ZC4A 2HUPA 3UG6A 1EESA 1WMSA 4QFMA 621PA 1EGAA 1F2TA 2UZ3A 4Q5IA 3BOSA 4D26A 2IS1A 2GDJA 2R6FA 1SVIA 3RWMB 2W6JA 3GJ5A 3OAAA 4AG6A 5LD2C 2C9YA 4I1UA 3AQ4A 3T1VA 1E0JA 2HT6A 4Y0VA 1AS0A 4DEYA 2IYXA 1U9IA 4EFMA 3AVVA 3R9XA 4QL3A 4DSTA 3Q3JB 3CRQA 4A0HA 1G8FA 1SVOA 4TQUS 2YOGA 3MJRA 5AJXA 1N6RA 2WIAA 3VKHA 1U8ZA 2PLFA 5AUPB 1NVXQ 5FBLB 1JR3A 1R5OA 4FI3C 1Q21A 4B43A 3H4MA 1SHKA 1NKTA 4G01B 1I4DD 1QG2A 5HCNA 1J99A 4JL6A 1NG9A 2CK3D 5KSYA 1F60A 4LBYA 2OO7A 2BKUA 5C1BA 1EG7A 3THOA 4NBSA 5ANRB 2NQ2C 1E4YA 4HDCA 3DMNA 4TMKA 1YZTA 5J4KA 3E5HA 1P60A 3I61A 2YWHA 5J5CA 1BMFD 4Q48A 3BFKA 3GJXC 3QVVA 2LCFA 2V54A 3SZRA 4DLXA 1JEEA 1KAGA 5DSZA 2ZR7A 2FSHA 4M0LA 1AIPA 1YR8A 2H92A 3X1WA 4C0LA 4WXRA 1P3JA 1E94E 3ZYCA 1F48A 4JYBA 4RKEA 1KMHB 3ND8A 2IS4A 3IKJA 4BLQA 5FUVA 5IDVA 4C0AC 3CX7A 1OT3A 2OUKA 4A8JC 3T1QA 4TYWA 4JLDA 1R5NA 1YR7A 2FEOA 4L9SA 2QM7A 3K70C 3IUYA 3AGQA 4R2HA 4ZIRB 1XD2B 1KY3A 1TEXA 3ASYA 5C46F 2KJQA 3PEVA 4R9UC 2O8CB 3U3RA 2WJVA 3NWJA 2WV9A 4FMCF 3VR1A 4IOKA 4QBIA 1TADA 3UKDA 1US8A 5AUQA 1N5IA 2JLRA 2GILA 2O8FA 1G21E 2X19A 4W7SA 1ETUA 4G5RA 3B13B 3WNDA 5IF9A 3DZ8A 3LA6A 4L8GA 4N0DA 3GLFA 1JJ7A 4DCUA 3ZVMA 4U7DA 2OFXA 1NF3A 4JLMA 3KB2A 4HZIA 1UKYA 5FBWB 5E7IA 3A37A 4F4IA 1WRBA 1MO4A 4NP6A 4RZ2A 1UDXA 4N0EA 5L3VA 1PUJA 2FPMA 3O8DA 5BQ5A 3BC1A 3LVQE 1VHLA 2GXSA 4GFDA 1M7HA 4DSUA 3D6TB 1RPZA 1R4AA 3D7MA 3HJNA 2P6RA 4LHWA 4TTRA 4LPSA 1SQ5A 5H8WA 2FN4A 2RB4A 2Z43A 1BH2A 2YVUA 4XWKA 1GKUB 3KKNA 4GDFA 4MYCA 2ZM5A 3L0OA 3VKWA 2RGNC 4DSOA 5HZKA 3CX6A 2I1VB 2Z0MA 4NCJA 1JEDA 1DTSA 1XTSA 2IHYA 3W3AA 1GTVA 1NLYA 1E4VA 4ARZA 4AKIA 2GJSA 4Q1BA 4D2IA 1NJFA 4BZPA 2O8DA 3UPUA 3MWKA 821PA 5FPHA 4QGGA 3U6KA 1GRQA 2WSMA 1A4RA 5D3QA 1I4LD 1E2MA 4NYJR 2QQEA 4MUBA 1E9RA 1UDWA 1WA5A 3EZ9A 3HR7A 3ZH9B 1GIAA 1N0VC 2AR7A 2ZE5A 2JLVA 4D25A 2IW3A 4PAQA 1DPFA 4PHTA 4BRUA 2AFHE 2HCJB 5JZVA 3GLIA 4OJKA 2CK3A 2DCUA 4OJQA 2DHRA 3RS5A 4AKGA 3WHKA 4ILEA 2WWHA 4DUGD 1ZJ6A 5L8VA 2ZSAA 2V3CC 1Q3TA 4R7ZA 3PUWA 4LJYA 2C04A 2XITA 3KB1A 5CJPA 4URZR 2V8OA 4URXR 1DAHA 2OFOA 4Q4AB 4GPTA 1KIMA 4LC1A 2YWFA 4A8JB 4EJSB 2F1RA 1XXHB 2QY9A 3NEYA 4DLYA 1RC8A 1Q1ZA 2KBFA 4IFEA 3DPUA 4IJMA 3CLVA 4C2TA 3GLHB 3SJAA 3EW9A 3GLHA 1D2MA 1N6LA 3PR1A 4Q4HB 4NYJQ 4US2R 3QOFA 2DFLA 3CRRA 3SI7A 2F1JA 3AUYA 4QNRA 3BRWD 5F2EA 5JWRA 2Z4SA 1WDTA 4DDTA 1XWIA 1J8MF 1KI6A 3ZLJA 1KSFX 1WXQA 5JRZA 3MCAA 3FMPB 1W0JA 3EG5A 4DWJA 2QSZA 1M74A 1IN7A 4B35A 5C18A 2ZU6A 3IQWA 2WIBA 1XZQA 1COWA 3CF2A 3FTQA 3GJ4A 2FFBA 3CM0A 4TL6A 3K9LA 1OXVA 4LC0A 1NG1A 4FWTA 1U2RA 1W0JD 3BJIC 4M1YA 4BLSA 4Q4LA 1Q20A 2IBMA 3GLIE 1CR1A 2O52A 5SZJA 4B3GA 3QBVA 3DKVA 4JSTA 2ZI4A 3RVBA 3UWKA 2WJIA 4M1TA 4M9SA 1DAEA 1NN3A 4GP6A 1IXZA 4OHVA 4MYUA 4TLCA 1N6NA 5LPNA 3T5DA 2RGBA 4QJ5A 3BWDD 4V0MA 2ZUDA 2QAGB 1R8SA 3KUDA 1OH5A 1ZUNB 2GK6A 1KNXA 4KI0A 4JBWA 3HPQA 1FP7A 5AJYA 1UFQA 4LYJA 2F7SA 5EXTA 2WSSD 2G83A 1HH4A 2JAQA 3WBJA 1GAJA 3GFPA 3NXSA 4IFBA 1JNYA 1W36D 2P0EA 1S96A 2HV8A 3VX3A 2ZREA 5FI0B 4QKQA 3IPXA 5KHOC 3THWA 4BPBA 1VYUA 4QGHA 4M53A 4HAUA 1L2TA 4QGAA 3WNCA 2ZYVX 1KO8A 1E2PA 2OT3B 4D80A 4TYNA 2V1UA 1UAAA 3LVRE 2GCNA 2R65A 4EIWA 3PEWA 3KTAB 1G7TA 3DEFA 1FMLA 2IYWA 5EP2A 1ELOA 4GRAA 1G19A 4E5UA 1QHIA 5H68A 4DDWA 1W7AA 2GJ8A 2PLRA 1GG2A 4NZYA 2QRZA 3OE7A 2AXPA 2V7QA 5DISB 3RANA 3MWYW 3GD7A 4J0QA 4NDZA 1LFDB 4D82A 2ZVQX 3FMFA 3KQKA 4ABYA 1D6JA 1GKYA 1YR9A 3OHMA 4TT3D 4BRWA 4DCVA 2O0JA 4QG7A 5C4MA 3KJEA 1N25A 2B8TA 4TZ6A 3D8BA 4Q9LA 4P33A 4XSHA 1OH7A 1Z07A 2ZE6A 3TVDA 4G5GA 1G7RA 1OW3B 2G9NA 4XJXA 4D0NA 4HAXA 1KAOA 2OILA 4PR0A 5FBQB 2ZJZA 4EAQA 4UQOA 1W0KD 2CJWA 2XGJA 1SVSA 4AIIA 3BIFA 2C5LA 4B3FX 5LDDC 1Z6TA 1W49A 4EJSA 1OB5A 2PEZA 2D4HA 1Z6GA 5DHAA 3SC3A 1TF2A 5HKKA 2D62A 3T34A 1W1WA 1M8PA 4ZDIA 2QUZA 5GADl 1ZM9A 1P62B 1UBEA 4UJ5A 1G17A 5TXGA 1GL7A 2ANCA 5HZHA 4ACBA 1N0UA 1KJWA 3OIVA 3GP8A 3FFAA 1E1RA 1NSTA 4Q9JA 4IVPA 4DB2A 3Q5DA 1SVLA 4M22A 5JWOA 5FBVB 2RHDA 4WZAE 1E1RD 5FH9A 1CLUA 2A5YB 3C15C 2FG5A 3OEEA 4ZCLA 2ZYWX 3A4NA 3H84A 3FYHA 3ND9A 2JLZA 5AUNB 1P9RA 2C99A 1O3YA 3Q5EA 1VG1A 2QE7A 2O8DB 2QPOA 2CL0X 1V43A 4Q01A 4G5SA 5JCZA 1DADA 1S0UA 4FINA 3IO3A 3QKTA 5TVKA 1Q1EA 2IYVA 3OAAD 4WZ6A 1H65A 3QEOA 4RZUA 5CLLA 2RCNA 2P6NA 3ZJYA 4MRPA 2P3SA 4BEBA 1G8PA 4HZUA 4C7OB 1W2GA 4I81A 5KOYA 2EWWA 3LXXA 4TN1A 1GNRA 1H8ED 1R5BA 1KK2A 2QT1A 1TEVA 3QXSA 3U2QA 1CULC 2HEIA 4NMMA 3U6BA 2W2VA 4CEHA 4F38A 5JEEA 3C4JA 3WP1B 4KCGA 3K0SA 3RS7A 1MKYA 4Z51A 1T8UA 3VTKA 1M34E 1KGDA 1C1YA 5D3MB 2PCLA 3L82B 1OPXA 1XD9A 4CEIB 1IN8A 2NO9A 2ZJYA 4A15A 3R7WB 3C7KA 3M0EA 2EFHB 1PZNA 2ZSDA 3FE2A 1J8YF 1Z29A 3FKSA 4FMCB 5JJIA 1YZNA 3MWLA 4LHZA 1BO6A 2IF2A 4JVSB 5IHPA 4IXNA 4B3XA 1NIJA 1XEWX 3PUZA 1GL9B 2TMKA 4OQFA 4F4JA 5J47A 5TV2A 3N2EA 1B0UA 3OIUA 3GEIA 2EFDB 1KK3A 1ZRHA 2ZXUA 1XCPA 1E9AA 1IM2A 4TMWA 3OZXA 2SHKA 3GEHA 5KU1A 1QHNA 3KX2A 2KI5A 2ZRCA 3QF4B 4TYQA 2OHFA 3QY0A 1R10A 4MQBA 4URYR 3NHBA 4RD6A 2YINC 4B32A 3LQRA 1PUIA 1M7GA 2WJJA 1N2CE 1W44A 1XMVA 1CR0A 3SQXA 1KI1A 3V9PA 2ZJ5A 3ZVNA 2RGEA 5JJKA 3LO5A 1N6PA 3S1AA 1WP9A 1P7CA 1OIXA 4YONB 1VYVA 4DCNA 1GVNB 3R8CA 4HLCA 3PXGA 1G41A 4P4SB 3AP2A 3ZQJA 1KI7A 1XMIA 1FQJA 1TNDA 1CIPA 3SBEA 2EYUA 1G9XA 2OCBA 2CHGA 4GMDA 3UK6A 4ESVA 5EE0A 4KFTA 3S1AB 4URUR 1YE8A 2D06A 5CDFA 3ZZUA 2ORIA 2WTUA 1E0KA 3K8YA 4ZI2A 1P9NA 4PPFA 3RAPR 3X1XA 3ZDQA 4Z8XA 3NBXX 1G291 1TMKA 1TQ4A 2Q9CA 4ZO4A 3TSWA 4IEIA 4LYAA 3AM1A 2QORA 1DVRA 4TZ0A 2DBYA 4HEJA 1AKEA 5GJCA 5TB5A 4CW7A 4HATA 2RGDA 4OBEA 4V0NA 2YNMA 4LY6A 4O25A 2WWGA 1U0HC 2REXB 3JVVA 1N5KA 1MH1A 2BV3A 3LNCA 2KWIA 1DBSA 1S9HA 1D2NA 1KDTA 2HLDD 3TSOA 1MRNA 2ZROA 1U8YA 4WVFA 1FUUA 2D2EA 3WMEA 1L4YA 4P0TA 3QEJA 2W6IA 1OIWA 1QRAA 4OKSA 4DT1B 3TLXA 4MUAA 4O2LA 5CYPA 2OCPA 3LV8A 2VA8A 1YZGA 4JT2A 1OF1A 5KDOA 4LJ6A 4A2QA 4MGYR 5KO2A 4B75A 2Q9AA 2XXAB 2W6ID 5AR1A 3CF6R 3Q85A 4DRZA 4D0GA 3VU9A 2ZJOA 2FOLA 1NVWQ 4EDHA 3L2OB 5D3MA 2Y8EA 1MO5A 3TK1A 1UBCA 2WJYA 4YQFA 1A7JA 2EQBA 2Q6TA 3DVLA 4UNSA 3BXZA 1ANKA 4FMDB 2GXAA 3R7WA 3THYB 1SVMA 3HPRA 2QP9X 3KQUA 2ZJBA 2OAQ1 2JLUA 1DAKA 3UMSA 4P4TA 1HA3A 4LWZA 2AKAB 1JALA 3P32A 4A9AA 1EXMA 1XEWY 4Q18A 5HR5A 3CNLA 1CP2A 1GNQA 4JZKA 4LK2A 1WCV1 3EPHA 1HYQA 1TTTA 1O87A 1XJCA 1LB1B 4F4CA 1JR6A 2RGGA 1X1RA 2ZJAA 2J0QA 5LBIA 1HTWA 2CLSA 4QBFA 5FPSA 2CXXA 2N1BA 2ODBA 1XEXB 1E79D 2AN9A 5BN4A 1TL7C 2R6AA 3F3YA 3MAAC 3HU2A 2PZFA 1E98A 1G3IA 1NMYA 4XSGA 2HYIC 3D3QA 5FL3A 5F9HA 4BASA 2CJWB 1X86B 1KY2A 2OBNA 2W0MA 2ZUBA 4C0HA 4A0RA 2R6DA 5A0FA 1KI9A 3PUVA 3TBKA 1I2DA 4FWIB 1R8QA 1PJRA 3CKLA 3KXIA 4FW9A 1AGRA 2BJVA 3B1WA 4A92A 1XF9A 2WJHA 1II8A 3CZQA 4YMUA 3HP1A 2ZI3A 1U98A 5JLJA 3DO6A 1QVRA 3KJGA 3KXLA 1UKEA 2MMGA 3K0EA 4PSAA 2YC2C 5JEDA 4ZCMA 5A4JA 2GEDA 2BDTA 2ZRMA 4DBLC 4ZI3A 2NIPA 2PX3A 4CT5A 3TIFA 4UXJA 5FOXA 1CJKC 4BZXA 2QNRA 1JB1A 1UM8A 4MITA 1UPTA 3C16C 3R9WA 2NPIA 2AX4A 3T15A 4WIAA 4G5OA 1ZNYA 4PAMA 2REOA 4OQLA 4CEHB 2O0KA 4MYTA 1H8HA 4LJ9A 2NMVA 4DXAA 3CW2A 4QM7A 2FU5C 4Q4HA 4TTQA 4NL4H 1XD8A 3QG1A 1F5NA 4LUCA 4W9MC 1P2UA 2AD5A 1DE0A 4RD2A 5HPYB 4LJAA 1WBBA 1M2OB 2QEQA 2WWWA 1MABA 4RY2A 1WB9A 4LZZA 4AYXA 4XH9B 3EIQA 1GRNA 2JLSA 1OB2A 1ZU5A 1NBMD 1UBGA 1ZM3A 2QAGA 3GMTA 1II0A 5C2JB 3TQCA 3FHTA 2CCJA 2GAAA 1NBMA 1OH6A 1SVKA 2ZRAA 5JJLA 2FGKA 2VRWA 2GBLA 1NI3A 1R2QA 4GZMA 3FWYA 1E9FA 5KSPA 3O8RA 2Q3MA 2H8KA 4GOXA 4LV6A 3NDBB 2DYKA 1UADA 4RD0A 4Q1CA 1ODFA 2BMEA 5JFGA 3REFA 4AKEA 3LX8A 3NBZC 2IX3A 4AY2A 4KO8A 1EWQA 1DAFA 4NTZA 3B85A 3GCGA 1J90A 2HXSA 1G3QA 1P9WA 5EXSA 2V4ZA 3K70D 4ASUA 3QNUA 2CDNA 2VHQA 2JASA 3CRMA 1G8YA 1KJYA 2P5SA 3WXMA 5L3RA 2VPPA 2WSSA 2Z5FA 1U90A 4IDOA 4ASUD 3JZMA 3OF5A 2JLXA 2VYFA 3NKVA 3AGPA 1KO5A 3EZ2A 4LJ5A 4MKIA 3WMGA 2JJ2D 1ZD1A 5FTJA 3SHFA 4Z54A 3FDIA 3CONA 2QBYA 2VSOA 5E7MA 4K81B 1ZU4A 2DWPA 2BEJA 2WMNB 4YLGA 3DOFA 4M1SA 1XMJA 2J5XA 1DG3A 1XXHE 1KDPA 4HDOB 1R7RA 2PX0A 1S2MA 1W47A 3B82A 4A82A 4Q03A 2ZAMA 4LBWA 2P67A 1RJ9A 2GTPA 2W2XA 3NEJA 2XJ9A 5G3YA 1JBKA 4W5WA 3FB4A 1LTQA 2CL6X 3C5CA 1I2MA 1ZM2A 3SR0A 1CJMA 5JSZB 1MT0A 4NHOA 2Z83A 3IIJA 1FPMA 2J59A 2W00A 3GQBA 2XNDA 1Y3AA 4CRWB 4C0JA 1W4RA 2RGNA 2ZI7A 3VNVA 4RFSB 2A9KA 1MV5A 5FOSA 3O8BA 1Z0IA 3BB3A 1GSIA 4KYIB 5FFMA 3GJ3A 3TUZC 1FZQA 4TT3A 3FPAA 3W6NA 2AWOA 1RRCA 1EK0A 1VCMA 4NCNA 1W5TA 3FVQA 1TUIA 2OG2A 2QAGC 2IA5A 2DWOA 3T12A 4IDQA 3WY9A 2QENA 2YKGA 2BBTA 3QKRA 4IEEA 4QC2A 3M4YA 2D3WA 2FSIA 2GF9A 4KBGA 3NC0C 1E2EA 1UJ2A 3GLFE 2NZJA 4KSBA 1E9EA 5FUYA 3X1DA 4MYHA 4WBSA 4LV5B 1T3LA 1YZUA 1AN0A 4KYUA 3VHLB 1W4BA 5JMTA 2I4IA 3ZVLA 3RC8A 5JBQA 2FNAA 5FTMA 1U99A 2IUUA 1NMXA 3BORA 3UANA 2ZEJA 3E2IA 2DFTA 1LW7A 5EE1A 1OH8A 4S2EA 5F3WB 5B2ZA 1HV8A 1II8B 4BFTA 4PSVA 4HLQB 3AVWA 3EXAA 2O8EA 4L5BA 4XWOA 1OIVA 4NCHA 1NY6A 3CH5A 5L3SB 1HURA 5JHHB 1T4GA 1VECA 2EFCB 5FUXA 4EPTA 4PC7A 2P6UA 1XFAA 2O8BB 2FFHA 1ZW6A 1AQYA 3GJ7A 1US8B 1PLJA 3AEZA 4Q1DA 2DWQA 3L0IB 3SBDA 1Z3IX 4JSYA 1E2JA 5FTKA 2C95A 1RJ9B 5KNBA 3TQFA 1VTKA 4IOLA 4MGKR 2VTKA 5LB2A 2ORVA 3OFND 1L8QA 3TJZA 3QPWA 1Q57A 3TH5A 1IXSB 3NC1C 3B1ZA 2GVZC 2CCKA 3GEEA 4UXHA 3UMRA 3FHCB 3A1WA 3QPUA 5BN3A 1FUKA 4H9GA 2VP2A 4KLNA 1D9ZA 4XVQA 4LYHA 1H8EA 3ADBA 4MKHA 2XSZD 1ZM4A 2WM9B 3VR3A 4OHXA 1P75A 5K8TA 1CR2A 5F9FA 3N5CA 3X1ZA 1JXMA 1E9CA 2J7KA 1G7CA 5FUWA 2J0UA 5K8IA 3MLEA 3QENA 1AS2A 1TU4A 5C4GB 1Z83A 1EFRA 1PVOA 1W4CA 4CGZA 1QZXA 4GSYA 3W6PA 5DNYB 4EFNA 1AK2A 1Z0AA 2WKRA 5H1YA 4XWAA 4HB3A 4OQXA 5JS7A 2O8FB 4EPRA 5FBRB 1Z08A 2FX3A 2D7DA 1ZD9A 1QG4A 3I92A 1E2FA 4F91B 2B6HA 4DIEA 2WPDA 2C9OA 2BCJQ 2QZ4A 3TNFA 5TDHA 3AVTA 2VHCA 4FIDA 5FOVA 1DELA 1KYIA 2A5DA 4DLWA 3ADKA 1ZINA 1FNNA 2IYRA 3KL4A 4FD2A 1YKSA 4GMXA 4AWXA 4DEXA 3SQWA 4I1OA 2QPTA 5EP4A 3JVUA 4ARZB 4AYTA 2QSYA 2VSFA 3NTUA 4DB4A 1VG9B 2IS6A 2ZI5A 4NKRA 4PQFA 1OYYA 1OXTA 2BMJA 2EWVA 4C2UA 3EPJA 3UXMA 1G8HA 4NYMR 2FZ4A 2ATXA 2QI9C 4PPQA 4DC9A 5TMPA 4W5HA 1BMFA 2Q0HA 2UVQA 4P4SA 2PMKA 4BFYA 4NYIQ 3WYGA 1RKBA 3AKEA 2NO1A 1GNPA 3RHFA 4R98A 1L7VC 2F1HA 4Q1FA 3QQ5A 5E3HA 4C7OA 4K8OA 4B74A 3C5HA 1BYIA 5G41A 2V1XA 1XP8A 3EWAA 4C4PA 4PHHA 1ZVQA 4RD4A 2G88A 1Q22A 2WJGA 4IXMA 4M2LA 1EFRD 1U9IC 4K46A 1TQ2A 4DLVA 1FOEB 2XZOA 4PZZA 3VKGA 1KZGB 2UZIR 3AVQA 4QOSA 3RS2A 3WYAA 1LNZA 4OI1A 2R2AA 3FMIA 4Q7LA 1P5ZB 1BOFA 4B76A 4QM6A 3B1XA 1S3GA 2FF7A 4OHWA 1NSFA 4QXAA 5IT5A 5IRCD 3KUCA 2D2FA 1P2VA 1OLOA 5J4YA 2QTFA 1FW6A 1Q0UA 1X8LA 2ZSFA 1NVUQ 2NO7A 4KVGA 3CBQA 4I99A 4BFWA 2VHJA 2P2LA 2A7QA 4V0OA 4FMDF 1GL6A 3NH6A 4TMVA 2HYDA 4L4UA 1JPNA 1G4UR 5BN5A 3B60A 5KNDA 3TUJC 1XCMA 4NU0A 4RKFA 4TL9A 4AKHA 1RE0A 2GEUA 2YOHA 2KB0A 221PA 4A1FA 3MJHA 3I3SR 1T91A 1U8AA 4JBXA 3ZS8A 2GZDA 2FE4A 1CF4A 1G3UA 2IF0A 1OKKD 3BD9A 4ON9A 1B23P 1E99A 4NCIA 1KK0A 4URWR 5EP3A 2J3EA 1D9XA 1ZIOA 2OESA 4QJ3A 3IIMA 4RD3A 1S9DA 4IW3B 2J46A 2PBRA 5E4FA 4F93B 2FEMA 4CYMA 2ZRLA 5SZIA 2DFKB 5J4HA 1D8TA 3QXCA 1YJ5A 2JIZD 4B71A 1J70A 2BCGY 4KSCA 3UIEA 4TLAA 3W90A 3DL0A 4B3CA 3MMPA 2CVHA 3M1IA 3MUFA 3U3KA 5FPKA 3AVOA 3PFIA 4HAZA 5AJWA 3QKSB 2FWRA 3KDSE 1G3MA 3KZ1E 4KXFB 2O8BA 1W4AA 4Q9KA 1ESMA 2E87A 1E3MA 4PHGA 4HB4A 4DDVA 4ERNA 3A8TA 3AV0B 1K5GA 4FN5A 3BB1A 4JVNA 4HUTA 5KUTA 3ASZA 1SXJA 4KVAA 1MO3A 3PVSA 3V4FA 1D5CA 1R0ZA 1T0HB 2C77A 4JMPA 5DN6A 4B44A 1R0XA 2OEPA 2PH1A 4MH0R 2W2TA 1HY3A 1KZ7B 5EE3A 3EZ6A 4KV9A 3ECCA 2G3YA 2QMUA 4U5XA 4LHVA 3LRPA 1ESNA 3VR2A 2H17A 3DZDA 4UNPA 3P20A 2GF0A 1KHTA 4I1VA 2JDIA 4LJ4A 4BFXA 1WQ1R 3HDTA 1E2KA 5LD2B 4NYIR 1YZLA 4DDUA 1AQUA 4XVUA 1NVVQ 2BMDA 4LCBA 1W5SA 2ZE8A 4DUGA 2ZRNA 3WHLA 2HCBA 2ZSEA 4IOMA 3QKSA 2J0VA 2G0NA 1A5TA 1GITA 1XEXA 3NG1A 4MKFA 5EE9A 5FTLA 1RZ3A 1YVDA 2ZI9A 3EARA 3LH5A 4B3BA 3PEUA 2ZR9A 1FMJA 2FV8A 4DLTA 4ITRC 4JL5A 5EXPA 5JI3E 2BBOA 4JS0A 4IOJA 1QHXA 4V02A 4Z8YA 4YMVA 1RW4A 3GLGE 1IN6A 3RSOA 1IXRC 4FXPA 3A1SA 5FR2A 2GJAA 3P4XA 4B2IA 1SXJE 3OFNA 4MDFA 1XX6A 1AGPA 3GJ0A 4OK6A 4C0KA 1Z47A 2ERYA 5L3QA 3EX7C 2G0TA 3L8YA 4ZKDA 1G7SA 3JZAA 1Q3HA 3IIKA 1N6HA 2IXFA 3THYA 1CEEA 4RVCA 2KE5A 2F43A 2CE2X 2CNWA 4OI4A 1KO7A 2QN6A 3VMFA 3IDQA 1OJLA 1EFUA 4PC6A 1E2DA 3B6EA 2IYUA 4AC9A 4X8OA 4ZKEA 1OFHA 3QI2A 3HYTA 4HAVA 3MD0A 3TAHA 2ODEA 1CRPA 2GVDC 421PA 1KO1A 4MRVA 4Q1AA 4PZLA 1LF0A 2C98A 1U94A 3LLMA 2X2EA 4M9XA 5CK4A 1GKIA 2ZRBA 4PANA 3WNBA 4D0LB 3U7GA 1NMZA 1Q1QA 1J2JA 1IJFA 1FTSA 1YZKA 3I62A 2IYSA 3FKQA 2J1LA 2H18A 3SNHA 1DO0A 4ZIRA 1XPOA 1XPRA 2FPLA 3TUIC 3FMOB 2OLKA 4BZQA 1QVAA 5BXQC 2IUTA 4QRHA 3EPKA 3O8CA 2WVJA 1VIYA 3GJ6A 3NVAA 5GVRA 3CRW1 3UG7A 4BUJA 2GA8A 3K70B 1N5LA 4PPGA 2NPFA 1DEKA 1R0YA 5EQTA 1ZCAA 5B57C 2X8AA 4LDJA 4D4JA 2ZRJA 5KTYA 3Q7QA 2DB3A 2VP0A 2PZGA 3G5UA 3PG5A 5BYJA 1C9KA 4HUQB 5DE3A 1G64A 1W46A 3RC3A 1EFCA 5H70A 4JLOA 4NE2A 1NN1A 4IHQA 4Q4JB 1CJVC 3U60B 3BERA 1LVGA 1V5WA 3PJRA 4MDEA 2VEDA 2P65A 3X1YA 1WE2A 1G3RA 1XNJA 1FNMA 1JPJA 2YJTD 4XD7D 1X1SA 3KKQA 2BBSA 3H0KA 4GP7A 3ZZ0A 2IL1A 4PO8A 2MSDB 2XOKA 4UNNA 4Q9HA 3THWB 1VPLA 2PJZA 1UBFA 1X8JA 3T1OA 4D4MA 1E9DA 3IPYA 5IK2A 4HLUA 3EZFA 3BH6A 2FSFA 5AJVB 3SYNA 4ESHA 3PQCA 2ZSBA 5GJWC 4CDGA 3KJIA 4LRWA 3AF1A 3ONWA 5DYGA 3PV0A 4CT4B 1EX7A 2VLIA 5F98A 2QPAA 3CH4B 3T61A 4PC2A 3WRXC 4V0KA 3TSZA 5SZHB 3SHWA 2E1RA 1JECA 4B2PA 4YXWD 2JLYA 3DOEA 4B48A 2ZYUX 3U7HB 2KBEA 3OIWA 4GNKA 3BS4A 4HZUB 3G0HA 4JL8A 2WWIA 2QRNA 4ZDWA 2ECKA 2EFEB 4PC3A 1VG0B 5KSOA 3AF4A 5BWMA 3EA0A 3L0PA 3QE0A 3W8RA 2Q9BA 2VH5R 4WA7A 1LS1A 2B21A 3A4LA 5CM9C 3LQQA 2A5JA 4JIMA 3RS3A 1A2BA 1T0JB 3CNOA 3HU3A 4C30A 4D6PA 2GESA 4WW0A 2GZHA 4LHXA 4US1R 1IN5A 1KDOA 2XAUA 2XJ4A 1LS6A 1Z28A 3B5JA 5HTKA 3TAUA 4PXAA 5HE9A 3ZIAD 3W5IA 2NGRA 2CBZA 2ZITA 3PIRA 1W36C 1TQ6A 3OEHD 2WPDD 5FL7D 2VIIA 1KK1A 1DARA 5KDLA 1BIFA 3RS0A 3U7EB 1CKEA 5FOWA 3VNUA 4O0MA 2G6BA 4A6XA 4HI0E 4X8MA 4FCWA 1AM4D 1GILA 2F3RA 2ZPTX 4TLEA 4WXPA 1OKKA 3VAAA 1Z8FA 1Z2AA 2V6JA 5IK2D 3QF7A 1S4QA 1RRFA 2CL7X 4P3YA 3U61B 2ZANA 2B92A 4POAA 3SJZA 3QSYA 2R44A 3CB4A 3VQTA 4L15A 4BQSA 3NDPA 2BBWA 4II7A 1QHYA 2O8EB 2EW1A 2O8CA 2ORWA 2QT0A 1N6IA 2CHQA 2YHSA 1NLZA 2QTVB 2DFNA 3AKDA 3CPJB 3T35A 4PPNA 2FPKA 1KKLA 1XZPA 2NTYC 3AH8A 3EAQA 3K0AB 2OZEA 3QF4A 4LOAA 5CB8A 2IK8A 1XMSA 3HR8A 1VHTA 1Z6YA 3GFOA 3IGFA 2HDNB 3K9NA 1DAMA 2PCJA 5J4VA 2XTNA 3MWJA 5CB6A 3Q7PA 4MRNA 1G18A 5A5GA 2IYYA 2QMOA 2QQ0A 1KI4A 3TGPA 2GJ9A 4L16A 2BOVA 1MRSA 4HLUC 2A5FA 3SJCA 1CJUC 4U02A 3AVUA 3I72A 4IVRA 4LV8B 1ZUHA 3EZ7A 3DM5A 2RAPA 1ZMXA 3I73A 5CITA 4TWZA 3FFBA 4MRSA 2LKDA 1A2KC 1GP2A 2XTMA 3QPVA 1EFTA 1ZM7A 2G1JA 1QF9A 4DVGA 3R9IA 4M9ZA 2GJKA 3AVYA 5ELXA 2CE7A 2QU8A 5K8LA 1HQYE 3IHLA 4HSEA 1Z0DA 3ZD7A 1BS1A 3O47A 1X8KA 4Q7KA 1G20E 5BYKA 3KJHA 2GZAA 2QGNA 4C0SA 4EQ6A 4M1KA 1JI0A 4A0GA 2OSBA 4KHZA 3FHOA 3CIOA 2H16A 3SJBA 1G4AE 1YHNA 3WP0A 4O3MA 1TAGA 2FGJA 3PUYA 2MSCB 2QGZA 2HF9A 2VF8A 2YYZA 4ZDJA 3THXA 4B33A 3KFXA 4DLRA 4JYCA 3GLHE 5GVSA 3AKYA 4QHYA 2H7VA 3K1JA 3K9GA 5HE8A 4JLAA 1E79A 1NIPA 2HF8A 1VDZA 3P27A 2QBYB 4JLPA 4DJTA 1Z63A 2V6IA 2ANBA 3L0SA 1ONBA 1Z0JA 5GJVC 4YDSA 4CEJA 1KMHA 1OHHA 4LBZA 1KKMA 2Z4RA 2J7PD 3W6OA 2DY1A 1LF5A 4U00A 1ZP6A 2PMDA 3HWSA 4M1WA 1YZQA 2MMCA 4Q02A 5CIWA 1QDEA 4NPHA 1DAGA 2PL3A 3MGCA 4QJ4A 3IHWA 2Q21A 3E70C 4JJKA 3ZS9A 2D7CA 2F3TA 2BM0A 1K8RA 3TRFA 2JCSA 2F6RA 2YZ2A 5AWFC 3CX8A 2XTZA 4G0NA 3M6AA 3CR7A 1R0WA 4GBMA 4HUQA 1AZSC 1WF3A 5UKDA 4DKXA 2CMKA 4O2RA 2AKYA 1S3SA 4US0R 4BFUA 1KI3A 2D74A 5E95A 4Y0AA 3H86A 4CVNA 3SEAA 2RGAA 2ZS8A 2OM2A 5DI9A 3T5GA 2ASEA 2QG6A 5EJEA 1VKJA 2R8RA 2WOOA 4MA4A 4MGZR 4C0QC 4I4LA 5CIQA 1XXHA 4FCTA 2VP9A 3LLUA 1OSNA 4Q00A 5CJ2A 1F2UA 4V0ME 2GBLC 1FX0B 1XTQA 3K0FB 4RCZA 1E9BA 1P2SA 1G6HA 4OHZA 2HJVA 2WWXA 2GEVA 2ZJ2A 1T3HA 1XEFA 1GRRA 3VR6A 2BEKA 4IDPA 4HDQB 1HE1C 3CNNA 4QBHA 4ACAA 4Q47A 1X3SA 1A1VA 1UEJA 1HEIA 3ICEA 3TVTA 2FMXA 3I8XA 5CK5A 5EZ6B 3K09A 2ZI6A 2I3BA 3KKPA 2O0HA 4B2LA 4CZ2A 2XZLA 1RFLA 4C0BA 2J7PA 4XIGS 1XRJA 3CO5A 5J40A 5JWHA 2A78A 1IY0A 1R6BX 5CLQA 5JS8A 3J81k 2QMEA 5DYIA 1OV4A 1M1YE 2QA5A 3KQHA 2ZIAA 2GAOA 3BBPA 4NH0A 5EUMA 1IJEA 4FCVA 2GWHA 4KAXA 3GPLA 4GT1A 2OBLA 1SVWA 1PLLA 1OXSC 2NZ8A 3BH0A 4BEJA 2JJ8A 3U7FB 1IHUA 4M9QA 4L9WA 3RYTC 1Q1BA 3A58B 1E6CA 4ZPXA 5DLQC 5L3QB 1P73A 3NIBA 3LBNA 1AA9A 3OESA 1E1QD 3B9PA 5JCPA 1Y63A 3AF0A 2N46A 4JLJA 4TQ9A 3K0CC 2C03A 1N3BA 4FMBB 2AK3A 3ZZTA 4E22A 2BIFA 1Q44A 4A36A 3A36A 4B6FA 3DM9B 4Q1EA 2AD1A 4RZXA 2JGNA 1TUEA 5FR1A 1XBTA 3RS4A 1M6NA 3ICQB 2B7BA 1IQPA 121PA 2NG1A 1FL9A 3BFVA 3P26A 4RSGA 4BFSA 4A2PA 3B9QA 2WHXA 4Q7MB 4B3DA 2J87A 4B47A 4Z1MA 3X2SA 4DIDA 8OHMA 2IWRA 1TF7A 3PITA 1Z0FA 3B1YA 5KDDA 1BKDR 3AP3A 3U44B 4TMTA 1P2TA 4JT4A 3I32A 4PZYA 3Q9LA 3AF3A 4P32A 2F43B 2QROA 3QXHA 5KNCA 4RFVA 3REGA 3RRZA 4WAUA 4OHYA 3TMKA 1MR3F 1EWRA 5AK0A 4LHYA 1QHHA 3A4MA 1CTQA 2P5TB 5DN6D 4XTCS 1ZIPA 1WBDA 1CJTC 1SXJB 4X8LA 4BLPA 1N6KA 1TU3A 5EXXA 5G53C 2IWHA 2DR3A 1XB2A 2QP4A 1RYHA 2RMKA 4A2WA 4TYYA 3A1VA 3SDZA 3RRMA 2VF7A 4KITB 3QXXA 1EFHA 4HLDA 1D2EA 2EVWX 2JJ2A 1ZBDA 5DHFA 3W8NA 4DLSA 2AK2A 3B7GA 3IILA 2ZRDA 4Q4AA 1W0KA 4TMZA 5LB4A 2YWGA 1U0LA 4V0LA 1GFIA 2J41A 4I1SA 3U4QA 1XTRA 2RH5A 3LW7A 3LWNA 1JXOA 4OI2A 2GCOB 2BM1A 2CVFA 1RYFA 4PO9A 4AG5A 1P4SA 1MO6A 3EC2A 2B8WA 3MRSA 2GETA 3K0CA 3QKUA 1DOAA 3SE0A 4BLTA 1G8GA 2HJGA 2YC4C 2XXAA 1KSHA 2GXUA 1QHSA 1OFUX 1YRBA 3TR5A 1GDDA 3F0TA 1UF9A 2WWFA 2RGXA 3AUXA 4M1MA 1X6VA 2AFIE 1SGWA 4UNRA 2OV2A 2L0XA 4TL7A 2IS2A 3WBKA 1NP6A 3BB4A 1DO2A 2C78A 1Z6AA 4M1OA 3SS8A 3K0FA 1OXUA 2HXYA 1FX0A 2ZAOA 2W6JD 4KJZA 1J7KA 2V7QD 3N70A 4RZ3A 3SYLA 2GRJA 4G1UC 4UKDA 1P72A 1MOZA 1W36B 5P21A 5EE5B 3U4QB 1E9SA 2QM8A 5KPJA 3IEVA 4MRRA 1SULA 1ZNXA 4PC1A 3GLGA 2AXNA 2JJ1A 4PTLA 2GKSA 3NBYC 5DGXA 4EFLA 1BYUA 2R9VA 4ZV4A 2IEYA 1OHHD 4TYPA 5JHGB 3KXKA 4DT1A 2PZEA 4Q19A 5J4LA 1ZAKA 3VR4A 1EX6A 1OE0A 5HKKD 5E7JA 3FOZA 2ZRKA 5FI1B 2WMOB 4ZCIA 1F2UB 4B6EA 4AURA 3B8HA 4E03A 3C8UA 3QIAA 4A4DA 5AUOB 1Z2CA 3U3JA 3UWOA 4OI0A 3HYRA 3CWQA 3OEHA 1Z5ZA 3PUXA 3BH7A 5FL7A 5CYOA 3U3MA 1KTVA 2AHOA 2VBCA 1NBME 2V9PA 5CM8B 4YMTA 2W83A 1RRPA 1K5DA 1QHGA 4GZLA 3BK7A 5DO9A 1JJVA 1Q12A 2RGCA 1SHZA 5DH9A 2ZRPA 3GLIB 1CS4C 1DG1G 1G16A 1RIFA 2AWNA 3DKPA 3EWSA 3OEED 1GZSA 4N3NA 5FOTA 5FTNA 2XOKD 2F1IA 3ZD6A 4PO1A 4CEJB 2VL7A 5FOUA 1N0WA 1FP6A 3A6PC 4Q21A 4EJSC 1E2HA 2BKEA 1TPZA 3KKOA 3PEYA 1E2LA 1SKYB 1G5RA 2HLDA 4EKDA 1PLKA 3CR8A 4QBGB 4HAYA 2OE2A 3RRYA 4JVLA 2VHTA 4TLDA 2ZU0C 3R8FA 1TX4B 3BE4A 3ADCA 4YMSA 3K09C 1T3SA 1VCOA 2PT5A 1HE8B 1XJ0A 2IYTA 2NO6A 3MG9A 3TE6A 4XTRA 1S8FA 4OYHA 3K0AA 2Q3HA 4JJZA 4F92B 2H5EA 4PSKA 2O5VA 2GHIA 3CPHA 2ATVA 5CDFE 5KPDA 2J45A 3NBFA 4YMWA 2GK7A 3LBIA 3ZIAA 5AJZA 1YR6A 4JVMA 1XCGB 1W2HA 2ZRHA 3TW8B 5B58C 4LJ8A 2IEZA 2ZYTX 3W5JA 1F2TB 2YWEA 4WOPA 1HUQA 4A0FA 3ZVRA 1YRAA 2C9CA 4LBVA 3LX5A 1Z6XA 4LI0A 2HT1A 4BLRA 1N6OA 3SFVA 1GUAA 2K5UA 4JLBA 4Q66C 2BWJA 1ZNZA 4JBYA 1JR3E 2CEAA 2QL6A 4JLVA 2VSXA 4PQYA 3IO5A 2IUSA 2WKPA 4BFVA 3RNLA 4GI7A 4KFRA 3GLFB 1AZTA 3RRNA 3SN6A 3RLFA 2FSGA 1IONA 1KNQA 3QXJA 1PV4A 3CRVA 5JRJA 3GFTA 3ZGXA 1AKYA 2BC9A 1RVDA 2GCPA 5DI3B 3QG5A 2ONJA 1ZCBA 3TW4A 4CEIA 1VYTA 2GXQA 5EZ5A 1KSJA 4BWYA 4PQRA 3LW8A 3C41J 2H57A 2JJ1D 3EPLA 2JLWA 2J0UB 2QTHA 2BVNA 2IHBA 4P31A 3CPEA 3N2IA 1ZUIA 3EA5A 1E0SA 1Z22A
chains in the Genus database with same CATH superfamily
3HL4A 5EI5A 1HC7A 5K6TA 5C51B 4XD2A 1GGEA 4FQ5A 2MINA 2NO5A 5BQFA 3CFYA 3MEQA 5EIBD 2PRKA 5KBYA 5E4JA 3ZQ6A 4RJTA 1JKFA 1CUFA 5ICEA 4DMGA 2AOWA 2BFWA 2VRNA 3GUCA 3GZ4A 1LY1A 2WAXA 4QUDA 4UEWA 5FLEX 3RH0A 3ZE2B 4E09A 5CX4A 3GPCA 1XP5A 1ZH4A 4Y6GB 1NJGA 1LBQA 2VCYA 2VHVA 3KTAA 3LPNA 3PRHA 2OZLB 4LPKA 3WLOA 3MHTA 3UC5A 3H7AA 3MLBA 3GA0A 3AXSA 2JI9A 2XRMA 4C08A 2OZLA 4G8JA 4BCCA 1NF2A 2F9MA 4LSGA 5C81A 3QBTA 1G0NA 2BFFA 5A4AA 5IAAA 1W87A 1YZYA 4Q3EA 1JL3A 5CDHA 3NTVA 3NKFA 1WPGA 1EWTA 4B46A 2YTZA 4Z6KA 4JLNA 2VEOA 4RFSA 1Z13A 5CVTA 4AJ4A 1GA4A 3CPSA 3FF1A 1YBVA 3IP6A 4ZVPA 3FKSD 4CN8A 2ZSJA 4BATA 1XZNA 2ECQA 1NURA 2NT3A 3AFNA 1T9HA 3LC0A 1RHJA 3N76A 3QLUA 1PGNA 4BE7B 2KX7A 2P11A 3IJEB 2J5RA 1NRJB 4B4KA 2ZR0A 5LMNB 5K51A 5K45A 4JYAB 4M86A 3KQPA 3THXB 2AMLA 2PT9A 1E96A 1ISHA 3PKJA 1KBZA 4KE8A 4UNQA 4Q9IA 3SOPA 4FB4A 3TZHA 2WTEA 1NWHA 2MSEB 1DKOA 3S70A 2R62A 3ZY4A 3F8TA 2XB4A 2UZ1B 4C3ZA 2O6HA 3I04A 2XSZA 4TSFA 1W25A 3DT8A 2A9VA 3MFYA 3QVSA 4UTRA 3EOBI 4ATNA 1XDBA 4G3XA 1S7GA 1NZFA 4LNUA 1RRKA 2B1RA 2JA1A 2FFAA 1MVOA 3MRVA 4DA6A 1BCRA 1C3OB 2WJPA 1BDMA 2A1UB 2YJ5A 3OD5A 4KWTA 1U6IA 1BMDA 2AJDA 2EGHA 2JD2A 5AK5A 3T38A 3V1NA 1ZLYA 1ZC3A 1GFWA 2X3UA 4M6WA 4X3PA 2NU9B 4CN9A 1CRQA 2A84A 3H11B 1DKRA 2XUJA 5JAUA 3KLBA 3RKUA 2GHRA 1R16A 1U7XA 3HXTA 1ODKA 1LV7A 1D4ZA 4UVIA 1WW2A 3RJZA 1M7BA 4RCYA 2X1LA 5CNMA 3MOSA 2QX9A 4HOYA 3ZV5A 1T36B 4TZTA 2H6EA 5TY0A 3VR5H 4Q4CA 4E51A 2PT7A 2J4CA 1A9XA 5G40A 3PNVA 4IDEA 4C3UA 3O82A 3V7UA 3Q72A 8ADHA 3QFTA 2AN5A 2CHVA 4BLOA 2HSGA 3HZRA 3P2KA 1U81A 4QTZA 4B84A 2BRUC 1O6FA 2VT3A 3I2YX 4GX1A 4ZDKA 4D96A 3N7UA 5A06A 1LD3A 1CWUA 3KQQA 4NECA 3FIUA 3A9UA 3OLYA 5A5VA 2PZAA 3AHGA 4HFJA 2JCYA 4CLOA 3TYXA 1JAHA 1JDBC 2DPXA 2R25B 4ARAA 1CETA 4KQMA 5A4IS 1MUUA 3SF8B 1U0RA 3BWVA 5U1PA 1HTBA 1U2DA 4LWOA 1LLDA 1TF5A 1GCAA 3VFDA 3NB0A 3TRKA 1B16A 3W79A 3UV6A 2IYQA 5DNAA 1JR2A 2HZBA 1Z4MA 3HU5A 2OENG 4X91A 1VBFA 3K7EA 3P2EA 4QHSA 1ZH2A 2ERXA 2EBWA 3KPVA 5IARA 5LR6A 3E5RA 3TO5A 4I5EA 5CB4F 2WKQA 1GKKA 2IU3A 3CT4A 4FN4A 4KLZA 1E2QA 1PKEA 2REBA 4KAJA 3OZWA 2C7GA 1W5AA 2H1LA 2FH5B 2RHMA 5J2TF 5BW8A 4JEHA 5JVDB 3VC7A 2G1KA 4I14A 4OQNA 2W2MA 2CSUA 4D41A 4R0MA 4DPKA 4K0KB 3VDNB 2ZRIA 3H9CA 6REQB 3T1TA 1SXJD 4AD8A 2IZ6A 5JSZA 1HL7A 5KYVA 3QITA 4ZTZB 2PT6A 1Q50A 3EZYA 2AVDA 1PTKA 4AU1A 5B37A 2HU5A 4JC5A 5DFAA 4A6PA 3IMKA 4AUNA 1UFRA 2VP6A 2WUFA 3IOMA 5JW6A 2Z8YM 1K6MA 1CY0A 1L4UA 3NIGB 4GYWA 1TTTA 1GG8A 4AI6A 3IOYA 2QAJA 1XJWA 2ZYDA 2JDID 2VRCA 3MJFA 1GTZA 4INPA 1FX1A 3GPDG 1F6BA 3IAXA 2ZQ5A 1YZHA 5SY6A 4RD1A 4ER3A 2XZPA 1EE2A 1MABB 4UHJA 3VU3A 4JR0A 1CBUA 4QLBA 4WT7A 1F06A 2KMLA 3DMDA 1G5QA 3Q7EA 2YQ5A 4B81A 4CKCA 5BT8A 6NULA 1D4FA 1FTWA 2D1TA 3AU8A 2CXPA 2X1VA 4EZIA 2IHUA 1CCWA 2CLHB 3ZBUA 1KO4A 2Q3BA 3K4HA 4JC4A 3PKIA 4HVLA 4IXTA 5AVYA 2WBLC 1PJCA 1Y9DA 3B1KA 4XCVA 4P7JA 3B6JA 2FDCA 5AI8A 3I8OA 5ALSA 1R6XA 4HYYA 2X0EA 5K0BA 1PYGA 3EIEA 1T5LA 4RHTA 3V1LA 1T6NA 2C8VA 3L04A 1TUGA 4QGFA 1HBJA 3D4NA 3KYCB 1NX6A 2VO1A 3JATA 3N74A 1G5PA 1XRMA 2ZUCA 4UATA 1U80A 1CR4A 2WT8A 1E69A 1LTHR 3HR4A 1ORRA 3IBGA 3LD9A 5CA1B 1E2IA 5KWSA 5L51A 4CR8A 2ZJ6A 1WTCA 3ZE6A 2WSIA 3KHTA 3SLGA 1DV1A 4DDKA 1XWFA 1DLIA 4G1BA 1HT0A 1VBMA 3LFUA 4ZREA 5G4LA 4BMPB 1CVRA 5FX2A 2HIAA 1D2RA 1G6OA 1U3GA 1OX5A 2ZE7A 1M6HA 1JQLB 3V2HA 1T6BY 1P6XA 1I3NA 1M0WA 1CB7A 4I1PA 4IDDA 3MCUA 3PF8A 1AGYA 4H1VA 4KQGA 4JA0A 2B7CA 3WNZA 1XZGA 4DZTA 5KSZA 1KOFA 2EL9A 3F47A 4AJNA 1CQJA 2MOKA 4UEQA 4CTKA 5DM70 1NULA 2NZUG 2EEPA 1G0OA 1IB0A 5FQNA 3RK4A 3RW9A 1JBQA 3ZWCA 2GHQA 2RKOA 4Y18A 1I1QB 2JFZA 4AJHA 4ECEA 2BDUA 1H5UA 3DCIA 3LWBA 1YU9A 4KAFA 4GNRA 4NE7A 3RB8A 2UUCB 1DXHA 5SYAA 2GM3A 2HEGA 2QMYA 4RNDB 4XDZA 5EJ4A 1AF4A 2XB2A 1MVNA 2JJYA 2PGJA 3G0GA 3NHAA 3CF4A 2EKPA 1CK4A 2Q3FA 4J03A 4Y8VA 3VU8A 2ACKA 5JMPA 5BOSB 2HO5A 5IZCA 4UMEA 1NVTA 4QXQA 3L1KA 1E2GA 2DSNA 3E22A 4YXWA 4Y67A 3TDKA 4UM9D 4JP1A 2FQ1A 3YASA 2G80A 4IHJF 1KMQA 1ZD5A 3EIXA 4FPXA 5ER9A 3WR5A 4E4RA 3NT4A 5KJ1A 1U6JA 1V1RB 1XCJA 4W5JA 5DEIA 3TRIA 3VR4H 1ODSA 1SKUA 2FJUA 4N7BA 4C9BA 1EI9A 1KI8A 2VYVA 4D4IA 1PR1A 1SBHA 3WZLA 5WRFA 1INLA 1SUSA 3WLKX 1XCBA 1K6EA 1U28C 4EUHA 3OZUA 7GPBA 2H29A 2QDKA 2NUPB 1YB5A 2QZ9A 3DLAA 3FCYA 5M04A 1JR3D 1JZTA 1M8FA 2FWIA 2FXVA 2J33A 2JFGA 3SFZA 4D42A 5LJLA 4IHJA 3WQRA 4RLSA 1NN0A 4C6HA 3RV4A 1XKTA 2AIRA 2WSYB 1U04A 1IY2A 5C52B 1F3OA 1Y4ZA 4O4IA 4FDVA 3A6FA 1NN5A 4N5LA 4RZIA 2ZBPA 3FTDA 2ZT8A 4H1UA 4MQ6A 3E7WA 4TQAA 4IHKA 1EA7A 1QB7A 2P6PA 5HXAA 1AQ6A 4QGBA 4TLLB 1EZZA 4WEOA 4DSNA 5HM6A 1YQXA 4JNKA 3AI7A 3QVGA 1LBTA 3G5MA 1O89A 3TQQA 3EY9A 2IPNA 2M1XA 4JKIA 4YYEA 1V5GA 4RY8A 1JQJC 3SF0A 5K8UA 2EFYA 1FFEA 3T4XA 4CIDA 1U3TA 9MHTA 1U4SA 1IVYA 1ZC4A 4UREA 5E1MA 2D0OB 1EESA 4QFMA 621PA 2AF3C 5DGCA 3BOSA 3HSKA 4D26A 2IS1A 3R6GA 5CMLA 3RWMB 3U4CA 2GM4A 1JTEA 5CXSA 1NXXA 3OAAA 4AG6A 5FUQA 1YJQA 2AC7A 4I1UA 2LDBA 4EBFA 2OOKA 1Z5NA 1SOVA 2VNHA 4OA5A 4KXYA 2Y4OA 4PLWA 1FRFS 4EFMA 1Z4QA 3H13A 3R9XA 3AVVA 1HYBA 2VC2B 1HT3A 1J9ZA 2B94A 4DSTA 1VP3A 1Z33A 2G9UA 3Q3JB 3RS8A 1G8FA 3NM4A 4A0HA 4EP1A 1KRXA 1AKQA 4EHAA 3LE8A 5AJXA 3SSMA 2WQZA 3DPIA 2F1OA 2R86A 3CZ5A 4FXOA 3RPEA 2GK4A 1N6RA 3TLEA 3DZIA 1U8ZA 1ZISA 4A8TA 4MUMA 1XI2A 4O02B 3ZJ4A 1NVXQ 3H3XA 5AUPB 2JCBA 1E7MA 1JR3A 1QQTA 1SELA 2COEA 3OM1A 3H4MA 4M54A 4UTZA 4LDQA 3WOVA 3KB8A 1CFJA 4G01B 4YY3B 1QG2A 1Q17A 4TVBA 4KE7A 4JL6A 1OAOA 1NG9A 2PO7A 2CK3D 3CN9A 5KSYA 1ODCA 2QRKA 3V33A 4AUEA 4JT9A 3BIWA 4UCQA 4WCFC 4CF3A 1REQB 3BGDA 3AOEA 2PRIA 4TMKA 1BHQ1 3AB7A 5J4KA 5I7AA 4BKQA 1P60A 3DBOB 4J0IA 2XCRB 2EDAA 1THZA 3E8SA 3N1UA 4AWAA 3HVUA 3UHFA 3S0JA 1EDBA 3LCCA 4Q48A 3OTWA 3BFKA 3GJXC 3QVVA 3T52A 3VZCA 3F6EX 1J2EA 4DLXA 4F9GA 1FYXA 3LZCA 1N1EA 4H4CA 2JFQA 2RBKA 4MR9B 5MDHA 4MOWA 2QRVB 1KYXA 1F8XA 4HDRA 3SZGA 4QFBA 3A6JA 1VIVA 4M55A 4M0LA 3AZPA 3QK7A 2V7VA 5G4KA 5IAEA 2X4GA 1NMEA 2EP5A 2R5NA 2H1FA 1P3JA 1K86A 3BX1A 1F48A 3LQYA 4JYBA 4UBMA 4KVZA 4BU1A 1QZTA 3L4EA 2YXNA 4JFAA 4OAOA 1LPSA 5IDVA 1MGOA 1QP4A 2E6KA 3HB9A 3NZEA 1GGHA 3T1QA 1G8SA 5EG5A 3TLBA 1PI3A 1SIUA 3BEOA 3IUYA 2DBRA 3P0EA 4R2HA 4ZIRB 2DFVA 3WI7A 2Z8YA 2GM5A 2KJQA 3UA3A 5DN9A 1E7YA 1WXWA 2WV9A 4EOGA 1P91A 1PYDA 3VKVA 1TADA 1US8A 5AUQA 1Q19A 4MVJI 3WYCA 4I50F 2GILA 3ZCXA 3H2KA 4V2IA 1F6DA 1ETUA 4KX3A 5DTMA 4L3VA 1VI5A 4JV5B 2JZNA 5DM4A 3DZ8A 3AYXB 1R64A 3IT1A 4IUBS 4N0DA 2E21A 5ECYA 5EEHA 4BNUA 4F84A 2E7ZA 3GLFA 5CD9A 1QLWA 3LU1A 2WR8A 1FNCA 3FVTA 3L1JA 3QXGA 2O2XA 4F4IA 1XG5A 2PBLA 3LPLA 4ZVTA 5HJEA 5ITSA 4RXMA 3FH0A 3WYEA 1HDGO 4O4HA 4N0EA 5L3VA 1PUJA 2R3SA 3O8DA 4UOEA 5BQ5A 4FYJA 2PUTA 1FDIA 1VHLA 3WAGA 2WYIA 3ZUGA 2DX7A 2OZVA 5E6SA 1E6KA 3LPCA 2RARA 4GFDA 1J0EA 1PTJC 1MTZA 1PNRA 2PVSA 5CFQA 3AHDA 4LPSA 1P1CA 1PJ4A 1SQ5A 2XZDA 3MS4A 4EYSA 4NAVA 1TT5A 3IPCA 1I7LA 5M34A 3KKNA 3TTTA 4EMUA 1JA0A 5K3BA 3UXYA 2WVHA 5CW1A 4OXKA 2GAFA 5HSGA 3VKWA 4HDNB 4DR4B 4KRYA 1U9CA 4O63O 2CWWA 2IEBA 4K9MA 2I1VB 4QT0A 1QUFA 2IKSA 1EXWA 1RRMA 2Z0MA 1SBCA 3B70A 4MV3A 4ZRMA 1JEDA 1LJLA 3VXKA 3OTOB 4QWMA 2RH9B 1GTVA 3DVQX 3SDBA 1TA4A 1T9CA 2WP0A 4DE5A 3QFFA 1PO7A 1L5WA 4Q1BA 4K9DA 4Y6SA 3WL3A 1WW3A 2Q27A 2PUJA 1NJFA 3O2NA 1BWRA 2A4MA 3DDUA 4LDRA 4PNZA 1TO1E 3MWKA 4CM4B 821PA 3B6ZA 1A95A 3G9QA 4QGGA 2G04A 3U6KA 1GRQA 4FSXA 3EGEA 3UZUA 3W8DA 5KNDH 1F7UA 1KETA 4E08A 4GGOA 1G2QA 3VSDA 4IUDS 1E2MA 4NYJR 4BNVA 2QQEA 4YAIA 1Z4PX 4XRGA 1UDWA 1ZK1A 3DLPX 1M5UA 3HR7A 1GIAA 1S02A 2ZE5A 4JXKA 4D25A 2XY4A 4BMYA 4PHTA 1JBEA 3GLIA 2FAXA 3VPFA 1Y1KE 4ZJZA 3QUBA 1N9ZA 4GQBA 2DCUA 3RS5A 5CCXA 1U2ZA 1PS0A 3LBYA 4ILEA 1RYEA 4DUGD 4IX9A 2ZSAA 4X63A 1U0OC 2IDZA 5JBNA 5L8VA 4KC0A 5JH7A 1C8VB 2J4DA 3PUWA 1QX4A 2X5OA 2C04A 2XITA 3VM6A 3UYLA 1H69A 1CDEA 3NS7A 5M3BA 5AI4A 4KL8S 3ZHTA 1HYEA 3QYPA 3C6XA 1MENA 4EJSB 3D6NB 4LYDA 2QY9A 2ZSHA 3VRHA 4DLYA 2WUWE 1ZAYA 4IFEA 1UXIA 4IJMA 5CT9A 4C2TA 5IYZF 4CKWB 1JXQA 1Y82A 2Q2NA 2I6TA 3AHFA 4IRMA 1LTKA 3BKWA 4WMLA 1Q84A 3H42B 1D2MA 1N6LA 2NV6A 4Q4HB 2H9IA 2HA2A 4B1FA 3SI7A 1SUAA 3V1MA 1JA9A 1TA9A 4AN4A 4OHPA 2WSLA 4GE0A 4X20A 4D3YA 4YRKA 1UL1X 1BS2A 2R8PA 2QVLA 5JWRA 3OJWA 3JYHA 4N12A 1V11A 1DDIA 2JKYA 1E7SA 3TPCA 1M2KA 2CD7A 5DB4A 3UHOA 3ZLJA 3HCBA 1E2BA 1JNXX 3LIIA 3OMWA 1AE1A 3WWEA 4G8BA 3O8OA 4A8HA 3IXMA 3RD5A 4BP1A 3EG5A 4DWJA 3G2MA 1WQ4A 2LP4Y 4H6VA 1V71A 1XZQA 1COWA 2WIBA 2YZ7A 4IWXA 4L2IB 4ZWNA 3S1SA 1RAAA 2FFBA 4C1NA 4X62B 2IX9A 5H3LA 4ZT6A 4E3WA 4H4EA 3R5SA 4P9NA 1NG1A 5DNDA 4HQKA 3VPCA 4F85A 1JFLA 3HABA 1Q20A 1KVRA 4JB2A 1T4MA 2R00C 1Q83A 1N8KA 2P2DA 2WIFA 1LBHA 1CR1A 3K16A 3N2ZB 4H18A 1UBNA 5AHKA 4DMCA 3LGAA 5CTJA 1X15A 2ADOA 5A04A 5A5EA 1ES9A 5C34B 1H94A 2HPHA 3QELB 2BJHA 1BVUA 3HS3A 3OOJA 4M9SA 4EYEA 5KQLA 1ZRNA 4GR5A 3EVGA 4RA9B 3PXBA 2JRLA 2VZ8A 4KLRA 1UK9A 4M0DA 2POCA 4LDAA 2ZXEA 4X90A 1G20B 2HADA 3VI3B 2OB2A 3T5DA 3PGXA 3W7VA 1C3OA 2RGBA 1ECFA 4KMRA 3WJ7A 3P19A 4V0MA 1VJRA 1ZW1A 3C6QA 3HPQA 2ICAA 1UFQA 3HO1A 2LZ0A 4QOIA 2F7SA 5EVJA 1N9KA 2WV7A 2G83A 3HA3A 3H9BA 1EFVB 4HBGA 2VDMB 3LHFA 3T0FA 4IFBA 5CDUA 4CKZA 2MSKA 4MWCA 1JNYA 2AZDA 1IEXA 4MVWA 2P0EA 1S96A 5IBPA 2A0XA 5FI0B 1XZKA 3UCXA 5AVZA 1SXQA 4BPBA 4Z86A 4QGHA 4B7CA 2IKQA 3WRXA 4ENRA 4HAUA 5TMBA 3E5NA 3EZNA 1D09A 3WNCA 1GPLA 4Y6PA 3K8OE 3KZKA 4D80A 1EDOA 3AHJA 3OE4A 1FBNA 1IG0A 1WLYA 4K9QA 5I3ZA 1BDHA 1RQLA 2BEUB 2P1ZA 3UH0A 3EIUA 4GOLD 2G5PA 4OFBA 2KYRA 2G9RA 3KTAB 1Q7RA 1Z4IA 3I45A 1VZ2A 1ZJJA 2I6QA 2IYWA 4GRAA 1G19A 1MVLA 4ZXFA 1UBUS 2W5UA 2GJ8A 3QU5A 3EEBA 3GC6A 1B0AA 4NZYA 3IQGX 1LZLA 1W5BA 2R60A 1L5MA 3CUSA 4TN5A 4GM4A 2HTFA 3K92A 3OE7A 5I7UA 4QTYA 2RHTA 3MWYW 1C9NA 3EY4A 2DQKA 2VNSA 3FPSA 3I01M 4NICA 1HOXA 3TIGA 4D82A 1KZ6A 1YZ3A 4ZEWA 1QYCA 4GVLA 3U80A 3KQKA 3KFLA 4ABYA 1D6JA 4BRWA 3E3LA 5GOZA 1JW9B 1HM5A 2LIVA 3ZD9A 3ZE0B 3HVRA 4X20B 4ZI7F 2DHQA 4MVCA 2JVKA 3W6UA 2RJ3A 3U16A 2X7HA 1Z07A 3WNQA 3UT5B 2VK1A 3DBRB 4QU8A 5ALGA 1O1YA 5FV7A 3UUFA 3DMTA 4TM8A 3IUPA 3A4YA 4Q3AA 3RVPA 4D0NA 2V98A 2D2VA 2FN9A 2ZJZA 5FBQB 5GAJA 4UQOA 2HWXA 2CDBA 4YUAA 2XGJA 2D2XA 2C5LA 5LDDC 1RACA 2SECE 5DYYA 1V95A 3N2GB 2D4HA 5DHAA 2C2GA 3SC3A 3E84A 3TXYA 1YS9A 1L8AA 1YIDA 3R0JA 2QUZA 5GADl 1F2DA 1GNLA 2BFBA 1VL8A 3E48A 1ND6A 1NOIA 3EDMA 1TZJA 3KQTA 4HNQA 5IG2A 1ZH6A 4ACBA 1CQJB 3AI3A 3GP8A 2SICE 4LXUA 2GVNA 2IW1A 4I4CA 1L3CA 4B40A 2C5SA 2YHIA 4X6LA 4E0BA 1BFDA 4DJDC 1GT6A 4M0MA 4C0XA 2L42A 4ZPJA 2W6PA 4RUKA 1E1RD 5AVUA 3DTNA 4I2VA 3C87A 2XA2A 2A5YB 4M6WB 5ICCA 2NV2B 1JSXA 4HPXB 3LA8A 2FG5A 3ZV4A 3KVNA 3TD2A 1NWCA 3OKAA 3PNYA 4XR9A 4CIWA 1C14A 2AJTA 4INAA 3A4NA 3ND9A 4OLBA 1D6NA 5I48A 3D4OA 2HBRA 1E61A 1A50B 2QPOA 2CL0X 1H9BA 1QKIA 3H7IA 1MA3A 1N4DA 4TTSA 4QDXA 2WU0A 3HN7A 2QNBA 4CM9A 3BEDA 1WDWB 1DADA 2DTEA 1S0UA 2ZT6A 1Q1EA 2IYVA 3F6PA 1H65A 2F67A 3PHIA 5CLLA 5DT2A 1DCKA 2C59A 1GUFA 1U5BA 3JWEA 4L0MA 4KPUB 4YCNA 4TUYA 2I2BA 4I81A 2EWWA 1ZS9A 1KA9H 2OO5C 3KEOA 3AFMA 1H8ED 2R48A 1TEVA 3QXSA 4FE7A 4M7RA 5FAXA 5CIYA 1TRKA 5CPBA 5KVVA 4V38A 3U6BA 3Q9UA 1V1JA 2FP4A 2YY5A 3AIKA 4RM2A 5BURA 4PYIA 4WACA 3C4JA 3LF2A 3S5JA 3NT5A 4D7AA 9ABPA 1HYGA 1XO1A 3MM4A 1EQUA 3OQPA 3R44A 4MUFA 3BHNA 1IATA 1KGDA 1AKNA 5D3MB 2H4XA 4PRKA 5HMLA 5F9MA 3VJRA 3L82B 4CEIB 1IN8A 2GSDA 2C3PA 4IYJA 1RLMA 1S2OA 3LZ6A 3R09A 1M1YA 2ZJYA 4BMZA 4A15A 5EJAA 2XHEA 3N07A 2EFHB 2PBFA 3ZY5A 1ZPDA 2ZSDA 3JQEA 5GGYA 1J8YF 1Z29A 5JJIA 4FMCB 1TKBA 3LOQA 3SHQA 5B2EA 1G21B 2X0RA 2O3RA 4R3WA 4B3MB 2IF2A 2K6GA 4EUKA 2VUSA 4IXNA 4B3XA 1IUPA 4HMOA 3VVCA 5K4HA 3LFTA 5IN4A 1CZOA 1DMSA 1E89A 2PWAA 4FOSA 5J47A 5JAMA 1JHVA 3H9JA 4YPOA 3GEIA 2EFDB 4AJJA 4MHTA 4NWIA 1K0FA 2ZXUA 3DSRA 3HFRA 3FOBA 3H5RA 5CAEB 2G40A 5BV2P 4TMWA 1KP2A 4J16A 3KX2A 4F4DA 3F9IA 3RVOA 3E3NA 3DFUA 2XKJE 1C7JA 1R10A 1GUDA 5IUJC 2ZSIA 4B32A 2R1ZA 1UFKA 2HJSA 5KKAA 5CXQA 1RCUA 2VT6A 1MAUA 1IZ9A 4RF5A 3K71B 1WKCA 4RU1A 3GDOA 2CZQA 1KI1A 1DTWA 2JBWA 4BO1A 2AJ8A 5GIOE 2QXUA 4OMDA 1ST2A 5JJKA 2IV3A 2EQ5A 2FZ5A 3AW9A 4LNHA 3K6RA 3BIJA 2FG7C 2JGMA 1P7CA 4EGCB 1OIXA 5BVHA 5ED4A 4MS4B 1E7RA 3R8CA 1YB7A 3AW8A 1G41A 4ZAYA 2VYCA 3ZJTA 4KOAA 2XR1A 1DXQA 1KI7A 3VOTA 4DG8A 1FQJA 3OZSA 3E53A 2X0FA 1SO8A 3H65A 1VPWA 1NVKA 2ESRA 1VMKA 2EGGA 1FFXA 1R5JA 2HNAA 4GMDA 3UK6A 1OTHA 3FWKA 3K2IA 4NATA 5FNVB 4KFTA 2PL9A 3SIXA 3GPIA 3TN7A 3ISVA 4J16C 1Q74A 1SU8A 1Y8QB 2HA3A 4HYQA 4TXHA 4YRGA 2HJWA 3UMYA 1I6LA 4TXNA 1VSQA 4ED9A 3K8YA 1NXWA 4PYNA 4OQZA 2PGNA 4KMOA 4WEQA 5ALUA 1CQZA 1ITZA 2DKNA 3NBXX 2QWXA 4Z8XA 4AZWA 2RAVA 1RC0A 5LQKA 5FPPA 2A1IA 2XXJA 1PGQA 1RZVA 1ZVJA 2QORA 3AY3A 3L4BC 3QU4A 1K5PA 3V3TA 4TZ0A 2DBYA 4HEJA 4PSDA 5TB5A 5K2OA 4R1NA 4KRFA 4W8GA 2XCOA 3O4FA 3O1IC 3UJAA 5C1PA 1LQTA 2FX5A 2EP7A 1OAOC 3MC1A 5JJBA 5J2UA 3IIEA 2PKXA 4XXHA 4TS3A 4WI1A 4JROA 4BP8A 3KNZA 3LMKA 3LNCA 2WJ4A 2XA9A 3LLVA 1DBSA 4W63A 2AXQA 4HGOA 3BUSA 4XYGA 3THSA 1K7SN 3FRHA 1M83A 1U8YA 4WVFA 1K0UA 5DBGA 4BNNA 1GL3A 4MA0A 3HRKA 1T4DA 3AIOA 1D2HA 1YVEI 3IQZA 3TLXA 4MUAA 4O2LA 3JQ9C 1RXWA 4W5OA 1OF1A 1U2GC 1X7ZA 2B1QA 2ZB7A 3CLRC 3RO7A 4A2QA 4MGYR 3EVTA 4B75A 2Q9AA 4E3ZA 4NR0A 4Z0PA 1X1EA 3IOCA 5JAPA 2XXAB 3M6IA 1UZLA 4XJSA 4DRZA 5IKXA 3EHEA 4RMNA 3E6AA 3ED5A 4ANFA 1CEXA 2IXDA 3DVSX 4ZVUA 2BGIA 1D07A 3NTLA 1Q7GA 2ZAIA 5AIBA 1NVWQ 4RE6A 3CV3A 5L4SA 5H9WA 3PC6A 1Z2PX 2F3PA 2PYZA 2PZJA 3LXUX 3OZCA 5D3MA 4LZAA 2Q5JA 3WLNA 3I2FA 4P2BA 1XDDA 4MIKA 2GXAA 1N2XA 2JKVA 2IIPA 1TOAA 4PINA 3THYB 2Z8ZA 2R87A 2XQGA 4X1KB 2Q46A 2QP9X 5E4YA 4K86A 5ITZB 1QMGA 3UBMA 3DHNA 5EZSA 1F8YA 4P4TA 4UW9A 1IEWA 5DBIA 4E2ZA 3IL2A 4JJGA 4G0YA 1AVTA 3QVXA 3WGTA 1CP2A 1GNQA 2PMWB 4UPVA 4UMFA 3LJKA 3IURA 3NGLA 3UMBA 3LQ2A 4RKRA 1B3BA 3IEIA 3UT5A 2ECPA 2YNMD 4AQDA 4MVJA 3KJNA 4F4CA 3ZKWA 1X1RA 1Y7TA 1QAQA 2CLSA 3QFSA 3AEQB 4ZEVA 1JHOA 2QW1A 4CL2A 1XRSB 2R8BA 1B42A 2BMWA 3VH4A 1E79D 3VU0A 2NSDA 4MP3A 3WTBA 3F3YA 3T3OA 3HU2A 3KV1A 4UOQA 3I5AA 2R11A 2GCEA 3HJAA 1U3FA 4RIEA 1GT91 3ICWA 1N8NA 3D3QA 4KO1S 5FL3A 5F9HA 3KYDA 4BASA 2ZUEA 2CJWB 1QP7A 3QOWA 3VR6D 1PSZA 5A0FA 1KI9A 3IIIA 1CVLA 1JQDA 1I2DA 4OLFA 5E9WA 3EFEA 1NAHA 1MJGM 4MP6A 1PJRA 3KXIA 2CW5A 1TUBA 3BRWA 3WB0A 4WY8A 1QO0D 4XDYA 5A4FS 3B1WA 4LGYA 3TNYA 5K8JB 2XNJA 3ORRA 4JI4B 2XODA 3O3OB 2O5RA 2W37A 2WHPB 3JQ7B 4DDMA 5JLJA 4O4LF 2FW0A 4OY3A 4Z3KA 3IPAA 1XVTA 2YC2C 3WIUA 2R7MA 4C76A 5DSTA 1Y3DE 2C92A 2RGWA 3DO5A 3HUEA 1M8KA 3OEWA 1JB1A 2ZTMA 2X0JA 2X42A 3C24A 4GI2A 4M7PA 4MITA 1OZAA 1WB5A 3C16C 2NPIA 1X7GA 2P27A 5AVRA 3INTA 3EUWA 1M0SA 3DBLA 4WIAA 5JTTA 5HOQA 2O5EA 1EM8A 2ZAYA 4PAMA 4ZEOA 3D0KA 2HF2A 1JUDA 4LF4B 4P92A 2P1RA 3IRVA 1FSGA 4WXHA 1VKZA 1XKLA 3L8MA 1DIOB 1ORVA 2XF2A 3OLQA 4FJ1A 4TTQA 3FCAA 5TMEA 3HLYA 2Q4DA 5HDBB 1OBCA 2NO4A 2O6LA 3GEGA 2Q41A 2GR9A 3AERA 3JAKB 3P9XA 4LMBA 4TSKA 4BKPA 4CQMB 1DC6A 1J0BA 4E5YA 2XGOA 1YRHA 4QXPA 3GX1A 4H0NA 4KIFA 4RD2A 1Y5IA 4H7HA 4LZNA 4YFYA 2FPGA 5DHSA 3R74A 4LJAA 5EA2A 4BX9A 5EIXA 3H8SA 1CUCA 1WB9A 4OATA 2MSLA 1I0IA 3EEFA 4AYXA 1X9GA 1OXBB 2I4NA 2P4QA 4S1VA 3KO8A 4I55A 3PRJA 1L1RA 4G0WA 4CQNA 2W6ZA 5K0EA 1U3UA 5GIPE 3HDYA 1DOZA 4R2KA 2IE8A 5C2JB 5ETJA 3WLPA 1LRLA 2E18A 2PVPA 3H04A 1TYDE 2CCJA 4M1QA 1Z35A 2GAAA 2Q5LA 3DTVD 1NBMA 3G0DA 3OUZA 4K28A 1SVKA 3H1AA 4E12A 1BNCA 4F5EA 1H66A 2ATEA 2OCLA 3C6BA 4KQ1A 2P9TA 2GBLA 2C3MA 3R3WA 3GUVA 3TQHA 4AS1A 3KVVA 1L4GA 4GOXA 3WB1A 2C5EA 1RMYA 1XC7A 2XW6A 3NDBB 2DYKA 3N9IA 5IBRA 2RJOA 3P9KA 2FSSA 1S7CA 3TZ6A 5EKTA 4BO7A 4DCPA 4OXYA 5CG2A 4COOA 1RCFA 1ORWA 1SPXA 3IJRA 3GCGA 4UHEA 1P9WA 1IIRA 2P9CA 1T3GA 3ZWQA 4EI9A 1TGYA 2CDNA 4WGGA 2HWKA 3CRMA 2B83A 2DHEA 1GTRA 2P5SA 1W581 4Y2JA 1G2PA 1ESDA 1IXYA 5L3RA 4CKBB 3H99A 2WB4A 3FJYA 3IVRA 3IUQA 4ASUD 3U31A 3EQ9A 1YH3A 3AGPA 4MKIA 4O1IA 2JJ2D 2BTOA 1UBTS 3CISA 1VJDA 1HG1A 3CONA 2A58A 1ENZA 2QBYA 3K35A 2NYAA 1PEAA 2RBGA 2FWAA 1SHTX 3WQSB 5M2QA 2GOYA 2J5XA 2H31A 3ADPA 3PXCX 3OTHA 4KQFA 5IWAB 1EGHA 4ZO6A 4BL5A 4ZTBA 2Z58A 5JYCA 1W47A 3VVLA 4A82A 1IK4A 2UYOA 3QVJA 2GTPA 2FPIA 2RKWA 3HYLA 2VOJA 1ZM2A 4Q0MA 1SN7A 4QLAA 4BV3A 5KOHA 2Z83A 1RC1A 3NRCA 4M99A 3GQBA 1YUMA 2XQJA 3O9VA 3D1LA 3RJMA 2WLTA 1E64A 1Y8RB 1MB3A 2FWMX 4CRWB 5EUCA 3O95A 2KQUA 2EBFX 2RGNA 5HX7A 2A9KA 3BD6A 3NANA 4NPCA 3O8BA 4X5OA 2EZ4A 5FOSA 4LDNA 1RCTE 1N1MA 1R66A 3GJ3A 2YFYA 2GZ3A 4HZGA 4FYIA 1YZVA 4FDLA 3DT6A 1PFYA 1UC4B 3E82A 1W5TA 5EHNA 5FD8A 3EQ2A 1PW7A 1XA0A 3LFHA 3MIZA 1Z62A 1TUIA 1VKHA 5IKMA 4U8HA 4F56A 1BCSB 1GPKA 1ND5A 1FBTA 3P0RA 4JCOA 4LX8A 4O5AA 4Q39A 4ZC8A 3HYSA 2YKGA 2BBTA 2J9YB 4IEEA 1PWHA 2I66A 4W5TA 2A6PA 3M4YA 4DC0A 5K4GA 3IODA 3WG9A 1E2EA 2IGTA 4RKQA 1CFZA 3ZCPA 4LC9A 2NZJA 5EGNA 4IJQA 1XTUA 2MT9A 5IKEA 1RWVA 2DECA 1ZIDA 5FWDA 4N41A 3TOXA 1N33B 1SJ9A 1W4BA 3W05A 2QZZA 3NJ8A 4HEA1 3S8YA 4MV8A 2XRZA 1U99A 2J6HA 5GINE 4IICA 4DJJA 1I30A 2ZEJA 4ZI5A 3UANA 1TI7A 2IITA 3KSZO 4S2EA 4UNIA 1GZHB 3QMMA 1FDTA 3UV7A 4CTMA 4ZZ1A 4MPJA 4Y1RB 1P0MA 1JFFB 3JAWA 3DUFB 1EQAA 1OLXA 2O8EA 2HFKA 2JFVA 2D8AA 4L5BA 1OIVA 4XIJA 1NY6A 4HGQA 4CQJA 3FVVA 4XWOA 3TTSA 5IASA 1WWKA 1UPAA 4EPTA 1ONPA 2FUG1 4IH1A 5ALOA 4Z0HO 1ZVKA 3QPBA 1H0RA 1AQYA 3GJ7A 4KAAA 1PLJA 4EG1A 1Y9EA 3WKCA 1C8KA 1RJ9B 5KNBA 1U0BB 1K88A 1NR7A 3WWYA 1JQ5A 2WTMA 3HFGA 1GYPA 4N8EA 3NC1C 4F2GA 4F96A 4X45A 4MLCA 1Z2OX 3KQYA 3FNBA 3QPUA 3DEIA 1FUKA 2CUNA 1UQUA 4WZAA 4H9GA 4WNAA 4DV0B 2FVXA 1YUNA 3R0QA 4L07A 1SEVA 4QDOA 4LFCB 4ND3A 5T6MA 5AW8A 4MKHA 2CFRA 4FU0A 5TGZA 1GADO 4OJYA 1B00A 2G06A 2FHPA 1PR3A 1U0EA 3SPXA 3VR3A 4OHXA 3VKFA 5K8TA 4ROSA 1YQ9A 1NDHA 3MOIA 4BQIA 2AOTA 3VSCA 3IEMA 3WYNA 3TLYA 1JXMA 5FF9A 3PFWO 1C0EA 3RG8A 3U26A 4CGYA 1G7CA 2YBEA 1FP4B 2UYYA 5DTIA 5M5BA 1KOGA 3OHPA 1FU4A 3PQFA 5C7LO 2R6JA 4P98A 3NIWA 4FYWA 4X54A 2XE8A 3VNQA 1PVOA 1ZH8A 1QZXA 4GPZA 3DCJA 2HRRA 5KOJB 4BKOA 1ZGHA 3JQGA 4PV7A 4MROA 2O50A 4EYOA 4KK4A 5CBKA 2WKRA 2XWJI 10MHA 1ZWLA 3MTQA 2Q7DA 5LWQA 1UT8A 3FWHA 3FIJA 5FBRB 1JZSA 4NZZA 4NJEA 2FUNB 1NAIA 4RMHA 4F91B 2B6HA 3D3JA 4PICA 4FQ7A 2WPDA 2C9OA 4XM2A 4RADA 4MTCA 3OP4A 4RENA 1X13A 2CB9A 4ZJPA