1ZUIA

Structural basis for shikimate-binding specificity of helicobacter pylori shikimate kinase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
158
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Shikimate kinase
publication title Structural basis for shikimate-binding specificity of Helicobacter pylori shikimate kinase
pubmed doi rcsb
source organism Helicobacter pylori
total genus 51
structure length 158
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zuiA00
4TYNA 5L3VA 2C96A 3MMPA 3LO5A 4JLOA 5FTJA 4Z1MA 2YC4C 5JMTA 1KK1A 2DBYA 2PBRA 3DO6A 3IPXA 4HSEA 1MOZA 4BFZA 3ND8A 5FPTA 3VMFA 3WMFA 3VTKA 3MRSA 3PFIA 1G3MA 2A5YB 5EXTA 1XXHA 4C2TA 1X8JA 1P9RA 1SVOA 3AVQA 1D2EA 1SVLA 2F9MA 3GFPA 3K0EA 3EG5A 1IN7A 4AKEA 4AKIA 3HWSA 2P6NA 2EWVA 2CCJA 4NYMQ 4G5SA 4MRRA 1FUKA 2GXSA 3SNHA 5EXSA 3SBDA 4WZ6A 3H2YA 4RD0A 3AF3A 3MWJA 1XCPA 4TYWA 1E9CA 4FIDA 5J4VA 1GNRA 1H8HA 2J7PA 4CT4B 5KYKA 2EFEB 4EPTA 3KJHA 3EZFA 1PJRA 2VHJA 4ILEA 4BFUA 5CJ2A 4DB2A 4M1WA 3I72A 4B43A 4S2EA 1QHXA 3RS3A 2FSFA 2C2HA 2PCJA 3RDPA 2G77B 4EFNA 4XVUA 1G8GA 1WRBA 3PITA 1ZD9A 2CJWA 2QQ0A 1G7CA 4JLPA 1U98A 3GJ5A 3AVUA 1OH6A 1T6NA 3GJ6A 1DELA 2HDNB 2XSZD 1EFRA 2ZRPA 1D5CA 1Z8FA 5CB8A 5K8UA 3B5JA 1J99A 2ZI6A 3DMDA 3NBFA 4PHGA 4DBLC 4N3NA 3AUYA 2BVNA 2J0UB 1N6LA 3NXSA 4GSYA 5HPYB 4W5HA 4B76A 4B3FX 4JLNA 2H17A 4ZIRB 4LDJA 1E6CA 4RZXA 2R8RA 1AN0A 2VHUA 2GILA 3ADDA 4FMCF 4BUJA 2RGBA 1OH8A 3U3OA 3QY0A 2HUPA 2QPTA 3QOFA 4QBFA 1P73A 1N0VC 5EXXA 2GWHA 4PO9A 1NBME 2WJYA 4QXAA 3H0KA 1HT1E 3AF0A 4IEIA 4MYTA 1YR6A 4ZDJA 3TVTA 2AFIE 3W9YA 3LA6A 3WYFA 2B6HA 1CP2A 2JA1A 4MRPA 5FPHA 1P60A 4URUR 4Z1MD 1YZUA 3SEAA 2BMFA 3BS4A 4IW3B 3QVUA 5AUQA 2Z83A 4AWXA 3ASZA 1KI2A 2Q3FA 2ORWA 4TQUS 1S9DA 1ZM2A 4LJ4A 1P4SA 4M0LA 2CDNA 1Z28A 4F93B 4I1UA 2IYYA 3AVOA 4PXAA 2ATVA 3QEOA 4Q5IA 1JNYA 4LX0A 1G7SA 4Q4LA 2CMKA 3CO5A 4LJ6A 3K0SA 2A3RA 3GLFE 1VDZA 2F1RA 3U2QA 5FBRB 2Z43A 3PEYA 5J4KA 4RSGA 1Q44A 4IXMA 5AUNB 4BFTA 3W5IA 1G7RA 5KOYA 4XOIA 1WDTA 1H8HD 2J7PD 4NE2A 4DCVA 1VCMA 4URXR 3K09C 3LBHA 1XMJA 1GAJA 4DCSA 1W4BA 4GOJA 1HYQA 1G4AE 1XTIA 2J1LA 2KI5A 2ZM5A 1ZCAA 1E2PA 1CJMA 1FZQA 4IVRA 1VG0B 4YC7A 4LYFA 1DAHA 3AP2A 4BLPA 2FZ4A 2X77A 1OW3B 1NMXA 3B1YA 2ZI7A 4ZDIA 1KI6A 3R20A 4GZMA 1EFRD 3NC0C 4D4KA 4Q9KA 4P4SA 1VG1A 2BMJA 3KQLA 5KPJA 1CEEA 4J0QA 2LWIA 4C2UA 3BERA 1PV4A 4DKXA 4HLQB 3CH5A 2ZJZA 4D4LA 3HR7A 1S0UA 2WOJA 1LY1A 1GSIA 1W36B 2WIBA 3SYNA 4NCKA 4EJSB 4OI2A 3EC1A 2PX3A 2OXCA 1S9HA 1DVRA 4OQMA 5FTMA 3EPLA 1NVVR 2C99A 5GJCA 1CRQA 1HTWA 1EX7A 3GLFA 5DHAA 4JSTA 2Z5FA 2BM1A 3LQQA 1MRSA 2Q21A 4TTRA 4AIIA 2OCAA 1X8KA 3K09A 4QG7A 3TH5A 4DVGA 4JLBA 1GUAA 1T5IA 1QHHA 1H65A 2BHRA 2GK6A 3QEJA 3VAAA 3O8BA 2DB3A 2JATA 1KSGA 1TEVA 4R98A 3BE4A 1TQ4A 2IS4A 4DLUA 4TLAA 2QPOA 3FPAA 1SXJB 2XGJA 1AQYA 1II0A 4Z8XA 1W0KA 3B6EA 3VQTA 4N1AA 3NEJA 3THYB 1Z6TA 2R6GA 1QHYA 1Q1QA 2OUKA 4BRUA 5FUXA 5JECA 2VP0A 4HAVA 1W48A 1OFIA 4TYPA 4HAZA 3CWQA 2AK2A 4XH9B 3K1JA 3Q72A 2R6AA 5J4LA 4KXFB 1HQCA 2X19A 1LV7A 3T06B 1MO4A 4MA4A 3K0AB 4FINA 1KO1A 1KJZA 4IVQA 5CDFA 2QMUA 5L3QB 2OHFA 1DG3A 3LXXA 1OB2A 1GZSA 4MDEA 1AS0A 3BIFA 2V4ZA 5L8VA 5A4JA 2OV2A 1XMSA 2VHQA 2J0VA 2Z0MA 3FWYA 1P5ZB 2AKYA 3U3MA 2D3WA 1G6HA 2ZRKA 3Q5EA 1YKSA 3L2OB 4EPWA 2C98A 3L8YA 1KO4A 1Z6XA 4XSHA 3HYRA 5E7MA 3W5JA 5IRCD 5D3MB 2PEYA 1XP8A 5DLQC 4JVLA 2MSDB 3IEUA 2SHKA 1EFCA 5H70A 3AVYA 4LUCA 3ZVNA 2EFDB 2GEVA 2ODBA 3FHCB 3C7KA 3T1QA 1NRJB 1U8AA 4LV5B 1R5BA 3SDZA 3HJNA 1U90A 1E4YA 1F5NA 1KMHA 1AQUA 2ZYWX 2WBLC 4FWIB 4I81A 4WXPA 3SQXA 1K8RA 1Y63A 4G5QA 3B1ZA 4DEYA 1WP9A 2J0SA 5AR1A 1KMQA 4NH0A 4RFVA 5K8TA 3OEEA 1G3UA 4DDWA 4M1KA 3IPYA 3SJAA 2A5FA 4XSGA 1R7RA 1X8LA 2FPKA 2N42A 3T61A 1QG2A 4M1OA 1SVWA 3K9NA 1W5SA 1Z6YA 5EZ5A 3SC3A 1DS6A 2YKGA 1AJEA 1TU4A 2NZJA 2G88A 5HKKA 3CNNA 1L7VC 5TV2A 1W0KD 3K8YA 4GNKA 3SHWA 4DC9A 1TX4B 2YINC 4PAQA 5G40A 3U6KA 1KKLA 1RKBA 2OAP1 1NN3A 4ARZB 1OYWA 2CL6X 4CRWB 4US0R 2QTHA 4NYMR 3FB4A 3IIKA 2B92A 1OFTA 2WAXA 5JEEA 2GJ8A 4PTLA 3WHLA 4PHFA 2J41A 3THWB 2BBWA 2D4HA 4B32A 5DN6A 2DPXA 1Q0UA 2H57A 2J0UA 5H68A 2NPFA 3QKRA 4LJYA 2OLJA 5LD2B 1XEWY 2RHMA 1QRAA 4ZIRA 1WMSA 1O87A 5ANRB 4KBFA 5IK2A 5C2JB 2BJWA 4V03A 1M7GA 4JZKA 1DAMA 1Z63A 4JLVA 1CTQA 2IW3A 1KGDA 1AZTA 4PFSA 1QHSA 1IOZA 1GKIA 2I4IA 1GILA 4B3BA 2BIFA 5EE9A 3GLGB 3FMFA 2FG5A 1JQJC 3T5DA 3VNVA 2DHRA 2V3CC 2CVHA 2FPMA 521PA 3GD7A 4XD7A 2IWRA 2W2VA 4IOJA 4JYBA 1SGWA 4Q7LA 3IKJA 2BBOA 2C78A 2BEJA 3BAFA 5FUVA 2I3BA 3VHLB 2UKDA 3W34A 1ODFA 1HT2E 3KTAB 3TW8B 3WYAA 3R8FA 4CEHA 1N6HA 3IGFA 1TU3A 1BMFA 4V0OA 1US8B 1M74A 4NU0A 4N0DA 4PHHA 1P6XA 4A9AA 4C9BA 1GL9B 2WPDA 4BZPA 5FOWA 2R65A 1NG1A 2ZRNA 4KAXA 4LBWA 3B1VA 3I3SR 3IQWA 4EJSC 4G1UC 3FGNA 3LBNA 1KHTA 2V6IA 4G0NA 4Q4HB 2A2ZA 2ZRHA 1UKEA 2X2FA 2ZTSA 4B47A 3GCGA 4HUQB 3I62A 5HKKD 3LV8A 1RRCA 2AHOA 1J70A 1NI3A 1SXJE 1NL3A 3CR7A 1PVOA 3GJ3A 3IEVA 2ZRAA 1BIFA 2IXEA 3WYGA 4GP6A 1B0UA 4OK6A 3M0EA 4K8OA 2ZI5A 1V5WA 1LNZA 2VO1A 3PUVA 5LPNA 4B3CA 3CPHA 4UQOA 3U7EB 1VYVA 4PPFA 2XEXA 2RGNC 1SVIA 2ZROA 4JBWA 5DN6D 5J5CA 3TUIC 4TWZA 3KJIA 3RS7A 3PG5A 3QXHA 5K8LA 2ZE6A 2HCBA 4HLUC 4IKEA 2O5VA 2QY9A 4MQBA 4KHZA 3UKDA 5IK2D 4Q7MB 2PJRA 2O8BA 2D2EA 3NTUA 5JSZB 4IDOA 1UF9A 4URZR 1NIPA 4H1VA 3A8TA 4Q03A 3U60B 3K0FA 3EWAA 1JEDA 5AJXA 2PZGA 4BEJA 4PAOA 1EX6A 2VRWA 4Q1DA 2EU8A 4EJSA 2OFWA 4M9XA 1VMAA 1F2TB 1W49A 4JT4A 3KZ1E 3WNBA 3K70B 4XD7D 2PMKA 2ZRIA 3BJIC 3W3AA 1X6VA 1VTKA 5EUQB 3EWSA 2BJVA 1T8TA 1KK3A 1ZMXA 5KNCA 1E94E 1U99A 1SHKA 1XZPA 3IILA 1E96A 3B1XA 4PC3A 4YONB 3NIBA 1ZNWA 4TLCA 4A36A 2P67A 1BMFD 2WAYA 4BQSA 5JWRA 2WPDD 1MO6A 5KU1A 2FSIA 2VP5A 1SXJA 3LLMA 4TLEA 2V1XA 4KFRA 4W7SA 2BBSA 3KQNA 4B33A 3THYA 2IUTA 5GADl 1OLOA 1XF9A 1DO2A 4RZ2A 1G8PA 4MYHA 4QNMA 3PV0A 4HAWA 2Q3HA 4EPYA 4PPQA 1E9EA 2RGNA 4TT3A 4TL7A 5FPKA 4B2IA 3ADKA 4N0EA 1OKKA 3WMGA 4XIGS 2CL0X 2QT1A 4XVQA 2XAUA 2IX3A 4HLUA 3G82C 4F7WA 2NOAA 2ZSAA 3AVTA 3B8HA 2O0JA 4YDHB 4TLBA 3K0AA 5J47A 1FP6A 3GLHE 5L3QA 1XJ0A 1VKJA 3TNFA 2CVFA 1Q3TA 3TW4A 2IYVA 2QE7A 1II9A 1Q21A 3QKTA 4OQNA 5EP4A 5LB4A 1XD8A 2J59A 1E99A 1KOFA 2G3YA 2AXNA 1G64A 2GRJA 3P1JA 1ZJ6A 5DH9A 1KSJA 4JKYA 2G0TA 4ZCMA 2JDIA 3CX6A 2CHQA 3PEUA 3QBVA 1QHIA 4R7ZA 1Z83A 3AF2A 3THXB 1FNNA 5D3MA 1C4OA 2HEIA 2CLSA 4Q9IA 4ZDKA 2HF9A 4RCZA 1CU1A 3A4LA 1G3RA 1KSFX 3GMTA 3KJEA 4B6EA 2IK8A 1KO7A 2QEQA 4EDHA 3ZD6A 4MKHA 2KWIA 5LD2C 3EPJA 3DMNA 3DOEA 1V43A 4A2QA 2ZRJA 5JJKA 4LJ7A 3E2IA 3GLGE 2FNAA 1OT3A 1UFQA 4ZI3A 1N5LA 3BFVA 3M1IA 4DCUA 2ORVA 1IXRC 3SU8A 3TK1A 5CK4A 2H92A 2OCPA 1E32A 5EXPA 4A2PA 2CLCX 2ZE8A 5BXQC 2GK7A 3H1TA 4B2PA 4D25A 3CONA 4HB3A 3L0IB 1N6NA 1AIPA 4MRNA 1XMIA 4Q4JB 1ANKA 1KNXA 3X1YA 2CEAA 4ZI2A 1OSNA 3FYHA 1G18A 2ERXA 4A82A 2R9VA 1GRRA 3T1TA 3PEWA 1XZQA 4R2IA 2IL1A 3H84A 3P26A 3LD9A 4QRHA 1MRNA 4RZUA 4MDFA 1S4QA 1G5RA 2P5SA 2IYZA 5KDOA 2JLSA 2WWYA 1EESA 4W9MC 5KSZA 4ARZA 3RNLA 5JZVA 4TT3D 4I1SA 5EE1A 1OKKD 1Z0FA 1UEJA 2YYZA 4U00A 3OIVA 1EWQA 1FNMA 4BE7B 2QRNA 5FL3A 4CF7A 5JWHA 5E4FA 3AKEA 2WIAA 3AUXA 4Q1AA 5E95A 1O3YA 2J45A 1NY6A 4NDZA 4GI7A 2GNOA 5HE8A 3PEVA 1ZD1A 4DDTA 2QE7D 1JEEA 4LC0A 3VR5A 4EUNA 5TMPA 3QBTA 4PX9A 2X8AA 4B73A 2XJ4A 2H1LA 1WBDA 1P2UA 1IN5A 1Z0IA 3A1UA 1E9FA 4TTPA 4URVR 2FFHA 2B8TA 3QG5A 4JJZA 2UZIR 2QG6A 4MYCA 2JDID 3ZLJA 3QF4B 3GLGA 2GCOB 3FMOB 4KYUA 1ZUHA 1ZM7A 3NBYC 1NLFA 2WICA 3QKSB 4O2RA 2VF8A 1E0JA 4TL8A 4V0ME 3CUEF 2PEZA 1JR3E 2DYKA 3FHOA 3R8CA 5EP1A 5FBLB 1NN5A 2Q9CA 4LC1A 2V7QA 2CHVA 1U0JA 4CEJB 1IAQA 2OILA 5KHOC 4D0GA 2N46A 1TF5A 4HAUA 2D2FA 3KTAA 5BW8A 4LWZA 2ZRLA 3RRMA 3ZGXA 3TVDA 4CIDA 1KY2A 2QGNA 3OZXA 3D8BA 4BFYA 1J90A 3QQ5A 4O0MA 4GMDA 3UK6A 3UWKA 1KDPA 1SKYB 1EGAA 2BCGY 5FTNA 2GCPA 1XB2A 2WKQA 1SVMA 3S1AB 3K70C 2EYUA 4Q4HA 4KODA 1ZYUA 4LK2A 2RMKA 2H7VA 4US1R 2WWIA 2EQBA 1NIJA 1XWIA 3H86A 4RFSB 1XPRA 4HUQA 5FOSA 2F55A 1E0SA 5CIQA 5M04A 1EFHA 4D82A 3MJRA 4KFTA 1E3MA 1JPNA 2A30A 2NO6A 4ESHA 4BFSA 2FEMA 4C30A 1E1QA 6Q21A 2OT3B 4UNPA 1G5TA 5AUPB 1QBKC 2QPAA 5H8WA 4MYUA 4Q1BA 4E07A 1II8B 2FZLA 2P6RA 1ZC4A 1E2IA 2KJQA 5JS7A 3V4RA 3U7GA 5FI0B 1FW6A 3MGCA 4TN1A 2IEZA 4Q48A 2DY1A 1XU4A 2J3EA 3SFVA 3L43A 5E3HA 2ONKA 1NVWQ 4EIWA 3AGQA 3QJYA 2HCJB 3Q9LA 1G16A 3CRW1 5JCPA 2P5TB 1YU9A 3PVSA 4WBSA 1U0HC 1L8QA 3GQBA 2IYWA 4V0MA 4B35A 5DISB 1AGPA 3HDTA 1G291 5G3ZA 1MT0A 3LX8A 2JLXA 5JSZA 4LJ8A 2FN4A 4HZUB 1Q1EA 2FDCA 2DWOA 4JMPA 4DXAA 3G0HA 2RGGA 4B3DA 4DLRA 1S1MA 3UG7A 1Z22A 2CCGA 5LB2A 1SHZA 1TL7C 2ZJOA 3EAQA 3ADBA 3F8TA 2A5DA 5LDDC 2ZU0C 4ZPXA 1NKTA 1WE2A 2ZJAA 4DIDA 4UNRA 1F2TA 1LB1B 3RRNA 4EFLA 4MKIA 1E2QA 4GL2A 4D4JA 1K6MA 3UMSA 5BYJA 1R4AA 2V7QD 3BWDD 3DDCA 5DYIA 2W0MA 1QVAA 4QNRA 3I61A 4YLGA 3U3JA 3JVVA 1CR2A 4LCBA 3PENA 4JBXA 4IOLA 2GXAA 4Z8YA 2QRZA 1I4DD 1ZU5A 5AJZA 2PT5A 1IY1A 3X1XA 1XX6A 3FMIA 2GEDA 1UEIA 3EZ7A 3F3YA 3IBGA 1CJKC 2FX3A 5EQTA 1NN0A 4KITB 2PZEA 4DSTA 1YZTA 4ZO4A 2P3SA 3B78A 3EXAA 1RE0A 2FMXA 2WWHA 2GZDA 2EYQA 5GJWC 3QE0A 4I4LA 5FUYA 1B23P 1GWNA 1OXVA 2IYUA 2VP6A 2O8CB 1GL6A 4OI4A 1Q12A 3U3RA 2WJIA 4NYJQ 1E1QD 3WP1B 4QGGA 1DEKA 3SHFA 5JHHB 3AKDA 2GA8A 2A5GA 2FSHA 1Q1BA 2BMDA 3UIEA 2OCBA 3WY9A 1T9HA 3BH6A 3PUZA 1G5PA 1N6RA 4JYCA 1VCNA 3B82A 1OXUA 4FCWA 3AVPA 3W6OA 3RS0A 2OEPA 4KFUA 4ACAA 2YOHA 3H4MA 2ZR7A 1NKSA 1YR7A 4DUGA 1CR4A 1DAFA 1W46A 1NNEA 4Q7JB 1MR3F 3HU2A 5J4HA 3VU9B 3SQWA 1TF7A 2WWXA 2XTZA 2CHGA 1NP6A 2HT1A 2ZSEA 4QHYA 2H5EA 3KKPA 2YC2C 3LBIA 3ONWA 3P4XA 4NL4H 4OHVA 1NBMA 4LBVA 4PC1A 5HCNA 1JAIA 1I4TD 1OE0A 3VR1A 1GM5A 3VX4A 1BO6A 2QI9C 4A92A 3KDSE 5B57C 2IS6A 2RB4A 3EC2A 2QQEA 3K70D 1KO5A 2DR3A 4HDOB 3RRZA 1XTKA 1OH7A 2WWFA 3L0SA 2RGEA 1CR1A 5DI3B 1Z0JA 1U0LA 1HV8A 1QHGA 2WSMA 5F3WB 3GFTA 1KZGB 3DKPA 1ZINA 4L4UA 1IY0A 3K0CC 4TMZA 3GEHA 1E2LA 3MFYA 4C7OB 1OIXA 2W6IA 4AURA 1KNQA 5CITA 1LS1A 1CR0A 4A4DA 1K5DA 4Q4JA 1VG9B 2F43B 3Q3JB 4M9QA 4DIEA 1JXMA 2BMEA 3LRPA 2W58A 1AA9A 1YZLA 3CBQA 1DG1G 1OPXA 2QAJA 4KJZA 3O47A 4A2WA 4LV8B 1JXOA 1EWRA 1SKYE 4EPVA 1R8QA 5AJVB 3I92A 5FI1B 1U9IC 4A6XA 2ASEA 1GTVA 2Z6VA 3OF5A 5C18A 4HDCA 1A2BA 2YOFA 1OIVA 1ZD8A 2BC9A 3TAHA 1Z0AA 4NCJA 1KJYA 1H8EA 1G1MA 3RSLA 4DT1A 4BLTA 4FMCB 2NQ2C 3EX7C 4QL3A 3C8UA 5FBQB 3D6TB 4MKGA 1DAGA 4OQFA 1E79A 2JLQA 3ZS9A 2IS1A 4V0NA 4IDNA 1KK0A 3IUYA 2ZI4A 3LH5A 1RJ9B 1Z2AA 2HYDA 1OFHA 1SVKA 1ZIPA 3CRRA 2BKEA 4MGIR 2OSBA 3MJHA 2GBLC 3V4FA 2GZHA 2J5XA 2J0QA 1M7HA 1QHNA 1HQYE 1MO3A 4LHXA 4PSVA 5CLLA 3QF4A 2HF8A 2QSZA 2GCOA 3IHLA 1ZRHA 5CYPA 4DUGD 2DWQA 2QAGB 3QKSA 1AM4D 2XNDA 3K0CA 1VCOA 3K53A 3VR6A 3TUJC 1N6OA 1OF1A 4IDHA 4RD1A 1E69A 1TQ2A 2XNSA 2ZJ8A 5KUTA 2AWOA 3T12A 3IO3A 1W4CA 4U02A 3FTQA 1TF2A 1NBMD 1YR9A 3ZH9B 2W2TA 2JJ1A 1KI8A 4V0LA 2WWWA 2JCSA 1GITA 3W3ZB 3DZ8A 1W7AA 1E2DA 2XTMA 2FEOA 4NYIR 4RKFA 3TJZA 1U9IA 1M6NA 1PLLA 4M1YA 4HI0E 1PLKA 2Z4SA 1FTNA 2EFHB 2RKOA 3HU1A 3S1AA 2QENA 1ZBDA 2C77A 1KO8A 2IYQA 1UDXA 2WM9B 3CRVA 2W6ID 1P2SA 4YDSA 1GL7A 2F3RA 5EP2A 3KFVA 3EZ9A 4DEXA 3E70C 1TQ6A 4RFSA 1HA3A 2ZUDA 3PUWA 3K9GA 3WHKA 1E0AA 4QGAA 2FFQA 4TSFA 3E5HA 2NO7A 2VSOA 4PHTA 4D81A 3A37A 4Q66C 4QFMA 2EFGA 4QJ5A 2GBLA 5SZHB 1II8A 3PXGA 3GPLA 1VCIA 2B7BA 1R6BX 3BFKA 3D31A 3QI2A 5L3RA 3FFAA 4KYIB 3A1WA 5IHPA 4I99A 5CYOA 1H8ED 2WJVA 4DCNA 2OZEA 5JS8A 1L4YA 2CL7X 2NGRA 4ESVA 1L2TA 3GLIB 3W90A 2GXQA 221PA 3GLHB 2C8VA 2FOLA 1E79D 3THOA 3L0PA 4G3XA 4PC2A 1DAEA 1MABB 1KKMA 5JHGB 3AVXA 1E0KA 1F3OA 2ZYUX 2FGKA 2GF9A 2IBMA 2VEDA 4HZUA 5BWMA 4PC7A 4HAYA 2NO1A 1T3HA 1F6BA 1KAOA 2IS2A 5E7JA 3KJGA 2A9KA 1QG4A 2CE2X 2FF7A 3MSXA 1VIYA 2UZ3A 5G41A 4JL6A 3REFA 2OFOA 2XNDD 3DHWC 4B6FA 4OHYA 1XJCA 5C4GB 1F2UB 5P21A 4L16A 5FOTA 2F7SA 2IC5A 2HXYA 1LS6A 2PL3A 2QL6A 3J81k 4TLDA 2ZS7A 1W1WA 4PR0A 4UNSA 2GETA 2OE2A 3KB1A 3ZDQA 4ZKDA 2BV3A 4UXHA 4A0HA 2GKSA 1Z0DA 2JJ1D 3PIRA 4BRWA 5C4MA 4DLVA 2QT0A 1YHNA 3TSWA 2ZRFA 1ZM4A 5GVSA 4EKDA 1BOFA 3N5CA 2IF2A 621PA 3T1OA 2YV5A 1OXXK 4IDPA 2LKCA 2RGXA 4M2LA 4MGZR 4PO8A 1P2VA 2QTFA 5FL7A 4M22A 2X2EA 4KSCA 1XDBA 3NEYA 1KSHA 4M9ZA 2VP4A 2VF7A 2WKRA 2QORA 1W36C 1Q20A 4TSFD 1OFUX 5TY0A 2ONJA 2O8CA 2RHDA 5C46F 1E4VA 2QU8A 3CLVA 4M21A 1G3IA 1KY3A 4HB2A 4RD6A 3TMKA 5HZKA 3F5FA 1VYTA 4BGDA 3OEED 3ZVLA 4LZZA 4RCYA 3I32A 3SS8A 3PJRA 1GKUB 1OIWA 4JS0A 2V6JA 3VFDA 2HJVA 4XTCS 1DTSA 4YMUA 1XEXB 2NTYC 1NY5A 3TSOA 1T3LA 2R6DA 5TDHA 1PLJA 4JT2A 4QGFA 3A58B 4MH0R 2G9NA 5KTYA 1W4RA 2ZI9A 4TZ0A 4Y0AA 1DE0A 3A1SA 1XTSA 1SXJC 4Y0VA 5A5GA 4NYJR 1XD2B 4LHYA 5FBVB 4RKEA 4DZZA 3VU9A 2ORIA 3SOPA 3WBKA 4LJAA 1G8HA 3C16C 1Z2CA 5EZ6B 2XXAB 5HTKA 1DARA 4MUBA 4Q7KA 4JLMA 5JJLA 4DDVA 3AVWA 3I4LA 3LXRA 4QKQA 1U94A 4MRVA 2R44A 2XZLA 5DI3A 5FR1A 2F1IA 1ESMA 3NBXX 4KVAA 4KSBA 5DO9A 2DFTA 4X8OA 1RC8A 3FFBA 3FKQA 4RZ3A 2VIIA 3KQHA 1OHHA 3SJBA 4BLSA 3OEHA 1YJ5A 2D06A 2HT6A 2IXFA 3AP1A 4KLZA 3CPJB 4IOKA 3REGA 3I8XA 3WRYC 5L3SB 3UWOA 2F43A 4L8GA 3VKHA 1N5IA 1Q1ZA 4X8LA 2NO0A 1Z06A 3B13B 3F0TA 3GJ4A 3MWYW 4YMVA 1Z29A 4AKGA 3IQXA 3U7HB 3QF7A 2CK3A 5KDDA 4ABYA 2YJTD 3RABA 3QSYA 1BS1A 2WKPA 2CLDX 2Q6TA 1LVGA 5ELXA 1XCMA 2OESA 5G53C 2IYTA 5FL7D 1R5OA 4IVPA 2VP9A 3RC3A 2G0NA 2GF0A 4OI1A 2GTPA 2K5UA 3KXLA 3Q7PA 5K8IA 1D6JA 2WWGA 4DWJA 1VHLA 2ZJBA 4WA7A 1FOEB 4C0BA 3TAUA 4O2LA 1ZVQA 2BOVA 2FPLA 1NMZA 3V9PA 4A8JB 2OCYC 1VHTA 2E1RA 3D7MA 3ETLA 1RJ9A 1G6OA 1IXSB 4NTZA 3KUCA 3QG1A 4F4IA 3RS4A 2A78A 2WMNB 2Q9AA 4OYHA 2GVZC 3HYTA 4KCGA 4PAMA 3Q85A 1E9RA 1LF0A 3BB4A 3GLIE 1NLYA 3KB2A 1LF5A 2DCUA 1CJTC 4LJ9A 1FFHA 2RH5A 2AX4A 4RD3A 4PZYA 1JECA 1VG8A 2QGZA 1E9DA 3KKNA 4HZIA 2JAQA 3A4NA 4KV9A 4E5UA 2XZPA 1L4UA 4EPXA 1VPLA 4FMDF 4XVRA 3KFXA 4ASUA 3O8RA 5KPDA 2Q9BA 1E1RA 4MGYR 1QVRA 2AK3A 5KSPA 1A5TA 3LQRA 2V9PA 2HJGA 4GP7A 4HDQB 4KBGA 3FOZA 2Q0HA 1XFAA 4AG5A 3RC8A 3CF2A 2H18A 2P2LA 1KI4A 2IEYA 3M4YA 3DPUA 3CF6R 3OHMA 4PZLA 2O8EB 4LI0A 1R0XA 2REXB 1SQ5A 4OI0A 3AF1A 5DSZA 3IBYA 2OLKA 1W36D 4X8MA 1OHHD 1JPJA 2WZQA 4OHZA 1G21E 4G5GA 4EQ6B 3OEHD 4D2IA 2CXXA 2CBZA 3RVBA 2VLIA 2IYSA 3EARA 2QMEA 3IIJA 1JI0A 3C4JA 3DM5A 2X1VA 4TTQA 3KKQA 3X2SA 3O8DA 2D74A 4P4TA 3EA0A 1Y3AA 3EIHA 4IJMA 1IONA 3LVRE 4CEIB 3L8ZA 1XTRA 5FOXA 3LY5A 3P4YA 1KZ7B 1NSFA 2ZETA 2ZEJA 1PUJA 5JWOA 4QM6A 2PX0A 3EIEA 3GJ0A 3WP0A 3RWMB 1WBBA 1N3BA 3MWKA 1SXJD 3CX8A 4OHXA 4U5XA 5HZHA 3GLIA 1C1YA 2KBFA 4DLXA 3IDQA 3GLHA 1ZC3A 4MITA 5TVKA 2W6JA 1N6IA 1MABA 2F1JA 2Z4RA 1WXQA 2DFNA 2PH1A 1FUUA 3SJCA 1BYIA 1KI7A 3G5UA 4OK3A 3T15A 2YVUA 4UXIA 4GMXA 5F98A 1NG9A 2O0HA 4CDGA 4I1VA 4OKSA 2GJ9A 2JLZA 3THWA 1ZNYA 1G4UR 2WMOB 2XTNA 5EE0A 1UAAA 1IHUA 4Q4AB 2XJ9A 3B9PA 4WZAE 1F2UA 5SZIA 2XX3A 4ASUD 1FPMA 3AH8A 1E1RD 3DVLA 1CLUA 2AXPA 5JI3E 1T8UA 4LGMA 5AJYA 3ZZTA 2ZE5A 4C0LA 2GAOA 5CM8B 4QJ3A 2QBYB 2YHSA 3HPRA 4GFDA 2KSQA 1NSTA 3ZZUA 4NHOA 3EZ2A 4DCTA 3U44B 1S8FA 2VH5R 1J2JA 1G8YA 2PZFA 2VBCA 3NKVA 1DO0A 4XWKA 5JRJA 1XTJA 4WZBE 3C41J 3M6AA 4M1SA 4AKHA 1CJUC 4ZDWA 1RFLA 1ZUNB 2REOA 1IXZA 2PMDA 821PA 2V54A 1FP7A 1W44A 3BK7A 4Q19A 1XEWX 3KKMA 3L82B 1W2HA 1VECA 2BWJA 4JVSB 3ZZ0A 3RYTC 4IOMA 3IO5A 4M9SA 4FI3C 5CB6A 2ANBA 3CNLA 2CCKA 4FCVA 1P72A 1US8A 3OIWA 1XTQA 1GRNA 3Q5DA 5AWFC 2ODEA 3OIYA 2ODNA 1M1YE 1IBRA 4F38A 1D8TA 1RIFA 2C03A 2QM7A 3QIAA 3B1WA 1XPOA 3TGPA 4FN5A 3NHAA 1S96A 4TZ6A 5CM9C 2ZRGA 1RVDA 4JL8A 3TQFA 2DFLA 3VX3A 2J87A 4D26A 1P61B 1FMLA 1T91A 1IJEA 2VYFA 3CH4B 3ND9A 2F1HA 2H8KA 8OHMA 3U61B 2XB4A 4NCNA 1RRPA 1JB1A 1ZP6A 2QMHA 4MGKR 3UATA 3C5HA 4CT5A 4ZCIA 2IT1A 2W6JD 3ZVRA 4DLYA 5FH9A 2O8FB 1P7CA 2D7CA 1XD2A 5JLJA 2IYXA 5AK0A 3UXMA 1OXSC 4PQFA 1GKYA 4ERNA 3HR8A 4A8JC 5DE3A 1WF3A 2ZAMA 3GJ7A 1KMHB 1R0YA 1Z6GA 4URWR 4DSUA 1GRQA 5B2ZA 2XXAA 4DJTA 1OJLA 4Q9JA 2NMVA 4HB0A 2ZUBA 4QHTA 1T3SA 1IN6A 5DNYB 3CM0A 1UBEA 1HE1C 1UKVY 4B48A 2P65A 1HH4A 1NF3A 2OG2A 2PT7A 1XMVA 1SULA 2CE7A 3AKCA 2I1QA 1JALA 2IYLD 1JR3A 1MH1A 4B74A 3ICQB 2D7DA 1ZNXA 1G19A 5B30A 1D9XA 1TNDA 2KBEA 4A0FA 4A0RA 2FH5B 4IFBA 4NKRA 2GJAA 3KQKA 2FGJA 2O52A 2WJGA 4JLJA 3WRXC 5L3SA 1ZCBA 2ZYTX 2UVQA 4ITRC 1WA5A 4A6PA 4QHSA 1G7TA 1D9ZA 2BDTA 2MSEB 3OFNA 3MLEA 2G1JA 4M4SA 4C0SA 3GP8A 3LLUA 1F60A 4NZYA 4UKDA 2ZPTX 2RCNA 4QGHA 3LW8A 1IN4A 4BZXA 4L9SA 4LYAA 1TQDA 5H1YA 1KI1A 1HURA 3QNUA 4M1MA 2EW1A 1AK2A 1YRBA 3A1TA 5FOVA 1KIMA 3BB1A 4G5OA 4V0KA 4ZV4A 4MRSA 4EPRA 2FJUA 2AD5A 3QKRB 5AUOB 1CS4C 4Q01A 5A0FA 4B3GA 1GOTA 2W83A 4JLKA 4RJLA 1Q3HA 3B85A 5FBWB 3BH0A 3DEFA 3QKUA 1W4AA 4TMTA 4UXJA 1KJWA 1R8SA 1N0WA 4Q02A 4A8JA 2QUZA 2EFCB 4UNNA 2PJZA 2ZVPX 4IEEA 2G1KA 1G3QA 2F3TA 2YWFA 2NZ8A 1KTVA 4A15A 1AZSC 3DM9B 2ZSFA 1JR6A 4OQLA 1M8PA 4AD8A 1F48A 1U2RA 2ZIAA 2ZSDA 3CNOA 3VKWA 5KDLA 3I8SA 1N2CE 5EE3A 1CF4A 4NP6A 4WVFA 1W47A 4FXPA 5J40A 3RS2A 1W2GA 4UNQA 3V00A 2ANCA 3CR8A 3BBPA 2J46A 4B3XA 4D4MA 4TQAA 2WV9A 1HUQA 2ZQ5A 3ZS8A 1FX0B 4XTRA 3RWOA 4CEHB 1CIPA 4ZKEA 4TMKA 2MSCB 1P62B 4XWOA 1UADA 3KL4A 4NCIA 3LNCA 4YXWA 1RYHA 5KNDA 2W2XA 3FE2A 4MUAA 1G9XA 1IY2A 1E2KA 2GJKA 4IFEA 2YOGA 4C0JA 3THXA 3C14C 1EG7A 2O8DB 2O8EA 1JR3D 4C4PA 3GJXC 4M8NE 1UPTA 3W6NA 3RANA 1IJFA 3HPQA 2JEOA 2XB2A 1CXZA 3JVUA 1GG2A 1ZAKA 1NLZA 3FKSA 2GJSA 4QBIA 4DLTA 4EQ6A 2JLVA 1OV4A 4D80A 5CK5A 3BH7A 3OIUA 4DSNA 3TR0A 4O25A 2IHBA 1N0UA 3RSOA 3OFND 5B58C 1EFUA 2AL7A 3QUSA 3L0OA 1Z5ZA 3VR3A 5FR2A 1JQLB 4RVCA 3NVAA 4L9WA 4B2LA 1A2KC 4CEIA 1BH2A 3P32A 5IDVA 4BFXA 5JJIA 2A7QA 4D0LB 1MV5A 4H1UA 2YWEA 4DRZA 4FD2A 3IIMA 2D62A 5SZKB 2JJ2A 3TIFA 4TMVA 4PANA 4B34A 4C3ZA 5BN4A 3U4QB 2JIZA 4JJKA 1X86B 2VQSA 4R9UC 1YR8A 4BZQA 3W8NA 4P33A 5CDFE 1Z6AA 4LHWA 3ZD7A 1CBUA 3TBKA 1AKEA 5FPSA 3ADCA 2O8BB 2DWPA 3WBJA 2C9CA 3KQUA 5J4YA 3EA5A 2HYIC 5B64A 5GJBA 1A1VA 3EZ6A 3X1WA 3ZIAA 5KSOA 1OYYA 3VR4A 1Z07A 1W0JA 3LAWA 4Z51A 3K0FB 2ZRDA 1J7KA 1XRJA 2GESA 2IUUA 1A7JA 4KVGA 3BORA 2ZYVX 3D3QA 1E9AA 4Z54A 2OM2A 3SYKA 4R71A 2IHYA 4OJQA 4G5RA 3NH9A 5SZJA 1YE8A 4Q4AA 2WJHA 4JLAA 2EVWX 3JZMA 4IHQA 4Q47A 3DZDA 1PUIA 1SKQA 3UMFA 3NC1C 1UM8A 4Q1EA 1BYUA 1XEFA 2PLFA 1ZIOA 4F91B 3NG1A 1EK0A 2AKAB 2P6UA 4TQ9A 5D3QA 3TLXA 4TMXA 2R62A 2LKDA 2W00A 2QBYA 2JLUA 1FQJA 2R6FA 4AG6A 4K46A 4YXWD 3U44A 4LSGA 4DHEA 4GOXA 3KXIA 4FWTA 1N6KA 3CF0A 1M34E 1FTSA 4TL6A 4JSYA 4F4CA 4LYHA 3AM1A 1Q57A 2GDJA 4G01B 3CKLA 2ZJ5A 2ZSBA 3AF4A 2PCLA 3FKSD 1JJ7A 2NO9A 3W6PA 4X8HA 2VSXA 2OBMA 5TB5A 2REBA 4CEJA 1UDWA 5BYKA 4TL9A 5JFGA 1J8YF 1GNPA 4QC2A 3HP1A 3ZVMA 2IYRA 3I5YA 3I5XA 2GVDC 3VR2A 1Z3IX 1YZNA 4LYJA 2JLYA 2ZI3A 2BEKA 4P3YA 2C95A 4FCTA 2C5LA 5HCIA 4DSOA 3PR1A 2ZRMA 3ASYA 3QPVA 2VP2A 4AYTA 2DFKB 4POAA 4JIMA 3U5ZB 5F2EA 1XNJA 3P20A 3WMEA 4LOAA 3EPKA 3LDAA 3GJ8A 1S3GA 4RY2A 1HY3A 1T0JB 2JJ2D 3OAAA 4LBZA 1MO5A 2WOOA 4Q00A 5KO2A 5JCZA 2JIZD 5KSYA 5JRZA 1D2MA 1KI9A 4Q1FA 4AYXA 1UBCA 2ZRBA 3NH6A 1RPZA 4YMSA 5EP3A 1QDEA 4Q1CA 4FW9A 4BLQA 3EASA 3GEEA 3UANA 3CW2A 1UJ2A 2L0XA 3ZIAD 2O8FA 4BECA 1EFTA 1I4LD 2ZUCA 3VHXA 1W0JD 3UPUA 1DOAA 1G17A 2GHIA 1KDRA 4U7DA 1E98A 1T5LA 4QM7A 5GJVC 1SVSA 1ESNA 3A1VA 1RRFA 3U7FB 4K81B 3QVVA 2O0KA 4E22A 5TARA 4DDUA 4TMWA 3SI7A 1WQ1R 4QBHA 2AN9A 2EWWA 2VHTA 2VTKA 3AGPA 4YMWA 4WAUA 3CB4A 3SE0A 4B71A 4DLZA 1TAGA 2C04A 3PUXA 2RAPA 2A5JA 4B75A 4Q9LA 3TUZC 2FA9A 1GIAA 3KKOA 4TYQA 1QZXA 2YWHA 2VA8A 4BWYA 4JKIA 1N5JA 1YRAA 1NVXQ 1MKYA 4C0AC 2WJJA 3R9WA 1N5KA 1DAIA 1NJFA 4PC6A 1OH5A 2VL7A 3NBZC 1U8YA 4KO8A 3BGWA 5DHFA 3U3KA 3SN6A 3TSZA 4YQFA 5G3YA 4UJ3A 4AC9A 2ATXA 1A82A 1AGRA 1GP2A 4F4JA 3B7GA 4DLWA 1TUIA 4HYYA 1E2MA 1A4RA 4LRWA 3KX2A 1Q22A 4LJ5A 4GDFA 2BCJQ 1YZQA 4HLCA 3NDBB 1ZU4A 4BPBA 4HLDA 2B21A 4OJKA 5DI9A 1M2OB 4JBYA 4BLOA 1HEIA 1COWA 1I2MA 2YNMA 3OAAD 3P27A 3QXJA 4LPSA 3QXSA 4LV6A 5LBIA 3CRQA 3SR0A 5FUWA 4CYMA 1FL9A 4H9GA 1VIAA 1J8MF 4OQXA 3LW7A 3Q8XB 3LX5A 2FU5C 3MAAC 4PSKA 4PO1A 1G8FA 2OXRA 3BOSA 2AR7A 3ZQ6A 4E09A 1TPZA 2MMCA 1VYUA 3AQ4A 2HXSA 2QP9X 1OXTA 3BC1A 4A1FA 2Y8EA 2QN6A 4BASA 1XBTA 4EAQA 4GZLA 4S35A 3BRWD 3WNCA 1G41A 3K9HA 1FX0A 4GBMA 421PA 4MKFA 3TKLA 4D6PA 5IT5A 2CNWA 5BN3A 1HE8B 3OE7A 1TTTA 3NWJA 2QA5A 2R2AA 1M7BA 1GNQA 3R7WB 2QP3A 1IN8A 1W5TA 2IA5A 2O8DA 2XOKA 4QBGB 4F92B 3TE6A 1P9WA 2PLRA 3SZRA 1KDTA 3PCRB 4W5WA 3Q7QA 3FVQA 3UG6A 1UKYA 3N2IA 2JLWA 4IDQA 1ZNZA 1FMJA 4Q9HA 2QSYA 4URYR 1ETUA 4W5JA 5FTLA 2BM0A 1XXHB 1FQKA 5GVRA 3RHFA 1GVNB 2ERYA 2ODWA 2ZREA 4CGZA 4LBYA 3ICEA 4JL5A 4HAXA 1DADA 3T5GA 4NMMA 2WTUA 1IM2A 4NPHA 2BBTA 2V55B 4IXNA 2RGCA 1TADA 1UBGA 2RGAA 4DB4A 1XPUA 4DLSA 2I1VB 3MWLA 2QAGC 2HV8A 1R5NA 5FOUA 3U6BA 4ACBA 3QXXA 4C7OA 2ZE7A 5HE9A 1RYFA 2N1BA 5BQ5A 1TUEA 2FSGA 3AKYA 2FWRA 1S3SA 3U4QA 4P32A 2ZAOA 1NVUQ 1X1RA 3RRYA 4Q18A 3SJZA 4CVNA 1KYIA 5E7IA 4OL0A 1P9NA 2QTVB 4HATA 2WHXA 4C0KA 2CJWB 1I2DA 2WVJA 4GRAA 2KB0A 2OO7A 3N70A 1COWD 1RW4A 2VSFA 4US2R 5BN5A 2ZS8A 4QJ4A 4TYYA 4O3MA 4M1TA 3DKVA 1X1SA 1JBKA 4KU4A 2HLDA 4I1OA 2WSSA 1NN1A 1RRGA 3ZJYA 1AS2A 4XWAA 4JVNA 1ZM9A 3QXCA 4AI6A 1WB9A 2G83A 5AJWA 2QMOA 3IHWA 3AVVA 2OFXA 3B60A 1U81A 4BLRA 2J7KA 2C9YA 4C0HA 1KDOA 2ZU6A 5HR5A 1XJQA 2IF0A 1ZM3A 3GFOA 3AEZA 4BEBA 1YZGA 5UKDA 3C5CA 2ZANA 4HB4A 2CNWD 3X1DA 3OE7D 5CLQA 2GEUA 2G6BA 1N6PA 4II7A 2OBNA 3DL0A 2OBLA 1Z47A 3KXKA 3FHTA 1KK2A 3BFXA 1YZKA 1ZW6A 1TEXA 2QAGA 2XOKD 3EW9A 2FFBA 4PQYA 1JJVA 4FMBB 3AB3A 4JLDA 5TXGA 4V02A 3QENA 1E2GA 1NJGA 2VPPA 3E1SA 3A4MA 2GAAA 2ECKA 1S1CA 2QNRA 2ZR9A 4KFSA 4P31A 1UKZA 2LCFA 4WOPA 4ZCLA 4P0TA 4LPKA 1LW7A 1K5GA 4BFVA 3B2EA 2ZJYA 2XITA 1UBFA 2GCNA 3C15C 2OAQ1 4JVMA 2E9SA 4KI0A 4YMTA 4NCHA 721PA 2C9OA 2AWNA 4D0NA 2MMGA 3RS5A 1IQPA 2GZAA 5DGXA 2JGNA 4CZ2A 3MUFA 3A6PC 3VKGA 3BD9A 1E2EA 1DPFA 5F9HA 2JJ8A 3EIQA 5JEDA 3RAPR 5IF9A 4XJXA 4PPNA 2B8WA 1E2JA 4QOSA 5C1BA 1E9SA 1ELOA 4Q21A 3LFUA 1XCGB 2RGDA 1YVDA 2B7CA 3EPHA 4C0QC 1RZ3A 2NG1A 121PA 1AKYA 2CK3D 2VHCA 3KUDA 3O8CA 2JLRA 4L5BA 3NDPA 4WIAA 4KLNA 1R0ZA 4WXRA 2KE5A 3WNDA 4GT1A 4PQRA 5JBQA 4LHZA 2IUSA 1KI6B 2ZJ2A 3QPUA 4HEJA 3SYLA 5JI2E 1ONBA 4IRUB 1ZUIA 3CIOA 3R9IA 4P4SB 1TMKA 3I1FA 4B44A 2HLDD 2V8OA 1NVVQ 2IXGA 3AV0B 4M53A 1PZNA 2WSSD 5F9FA 3TR5A 1X3SA 3ECCA 5FFMA 5FPYA 3TRFA 4OK5A 2J9RA 4R2HA 4HUTA 2E87A 3K9LA 5CIWA 4BFWA 1SZPA 2V1UA 3SBEA 1S2MA 2BKUA 4NONA 1R2QA 1LFDB 3CZPA 4EFMA 4LY6A 3ZYCA 2Q3MA 3A36A 3RLFA 2FFAA 4A0GA 1CRPA 3BXZA 1C9KA 2AD1A 1CJVC 2F6RA 1CULC 3MG9A 3N2EA 4GOKA 3WXMA 3CPEA 2P0EA 3MD0A 4PPGA 1T4GA 2W0SA 5DIFA 3GLFB 1R10A 2QM8A 3I73A 4E03A 4RD2A 1GDDA 3JZAA 1G20E 4LHVA 1E9BA 1QHHB 3B9QA 2NIPA 1N25A 1P2TA 2TMKA 3DOFA 5EE5B 2YZ2A 2NPIA 2R6CA 1XXHE 2XZOA 3CZQA 1T0HB 4DT1B 2YWGA 3OESA 1NMYA 2FV8A 3LWNA 1EXMA 1Z08A 4PSAA 1KAGA 3MCAA 2H16A 1U8ZA 2GXUA 3AP3A 4P4UA 1LTQA 1WCV1 4CW7A 1P75A 1DBSA 3FMPB 3X1ZA 5KNBA 1E2FA 5CJPA 4NBSA 3CX7A 1KI3A 1BKDR 1E2HA 3TQCA 1XD9A 2ZRCA 1P3JA 5FTKA 1D2NA 2QP4A 2ZS9A 1OB5A 1YQTA 3PQCA 3W8RA 3ZQJA 4OBEA 2XSZA 3BB3A 1CKEA 4NYIQ 4OHWA 4GPTA 4FMDB 2ZITA 1Z0KA 2F9LA 5EJEA 5EUMA 3QPWA 1AS3A 1DAKA 2QZ4A 3LVQE 5DYGA 4UJ5A 1JAHA 4AY2A 1QF9A 4AK9A 2AFHE 4WW0A 2IWHA 3NHBA 4PZZA 2ZVQX 3CRMA 4RD4A 3CWZA 1R0WA 2ZR0A 3VNUA 1E2NA 1XEXA 2JASA 3GEIA 3T35A 2QROA 3UMRA 4L15A 4AYWA 1GFIA 2ZXUA 3SFZA 3HU3A 3FDIA 4ON9A 3T34A 3R7WA 2FE4A 3PUYA 3R9XA 3T1VA
chains in the Genus database with same CATH superfamily
2HTEA 1DX4A 6REQA 2OA0A 2C96A 1J25A 2YHIB 1KK1A 3HUTA 3ROQA 1Y1LA 3IPXA 2CXHA 1MOZA 3LBFA 3ND8A 4OYLA 5DM0A 3IMKA 2J30A 1R16A 1UAYA 1PL6A 2FN7A 1E61A 2X5OA 3C3PA 4HP8A 5EXTA 1BSVA 5BSHA 3TTUA 1AMNA 5DHUA 4KO1S 1U2TA 1JVNA 2ODPA 2BFAA 5LZ7A 2F1KA 2IZ5A 1D2EA 1SVLA 3KD3A 1YL7A 3D6JA 5GY7A 4OV6B 4DG9A 4BNTA 3HWSA 5CAEB 1XNQB 2EWVA 2GEJA 1H4TA 4MRRA 4P7JA 3N8DA 2I80A 1C8BA 3AFNA 4J1SA 4OXQA 3SNHA 1LDGA 3SBDA 3CLSD 3KLOA 3JQBA 2TSYB 3AF3A 1HRDA 2HU2A 2ODAA 1EUCA 1Z35A 4FIDA 5DRTA 2JFXA 2OCKA 4D8UA 5IVHA 2EFEB 4EPTA 3VTZA 3HVRA 3EZFA 2MR5A 1XTTA 3C1TA 2Y77A 2DQ4A 3FOFC 4QGBA 4EB6A 2A88A 1V5FA 2GS9A 2O2EA 3E7FA 3T54A 3UWSA 1QZTA 1ZD9A 4JELA 5DM60 3EG9A 1CS0B 4HR7A 1G7CA 4JLPA 1N8KA 3I9LA 2YBDA 3LPAA 3MOGA 1E5TA 4RE6A 1LVUA 1YQXA 2G8NA 3TG8A 1DELA 1L7MA 1EZ4A 2PVPA 2R66A 2VFAA 2BFWA 3BXGA 2ZRPA 3OF3A 4HF7A 5CB8A 3AL0C 3B5JA 1VB5A 1J99A 3D6HA 3QBDA 1Q7GA 4WEOA 3NBFA 3QUAA 4PHGA 1AKNA 4DBLC 3AUYA 4I0WB 5GAJA 2BVNA 4HPXB 3NXSA 1UPCA 3CSSA 3K92A 4IUCS 4XYMA 5DV9A 1RBZA 1ORWA 5E1MA 2H17A 4ZIRB 2RHBA 3E3NA 4LDJA 4MS1A 3QYPA 4PG4A 2WFLA 2VHUA 2CLMB 3NPMA 1UXOA 4FMCF 3HXOA 2X2PA 3NV9A 4FLMA 2PT9A 3QY0A 1O58A 3E6AA 2JHAA 1BFUA 1ISRA 2HPAA 3IUPA 5EXXA 3W5UA 1MFZA 1LQ2A 1NBME 1U5CA 1PBNA 3F3MA 3H0KA 4LOKA 1SOAA 4QXAA 4ZALA 1HT1E 2G9ZA 2V03A 3DZGA 4KWEA 4IEIA 4F2PA 4JGIA 2HHHB 1QCDA 3HDYA 1YR6A 4IV8A 2YWBA 1I2BA 1Z6QA 4J0FA 3B3GA 4BOYA 3DOCA 3VZPA 1AO0A 3FPKA 4F3RA 2ZIUB 1KMIY 2N1MA 2CFRA 2JA1A 3I9KA 5EL0A 2NSHA 5JCXA 3BS4A 1UT8A 2A9VA 3UBTA 4OXIA 4M46A 2AE1A 2VSQA 2COKA 5JALA 1EB9A 1TYCA 3ASZA 4ZQHA 4B7XA 5JAPA 2Y1DA 4JQSA 3ZR4B 4YAJA 5BV7A 4TQUS 4HADA 1I3OA 1ORHA 1ZM2A 1M6WA 5FWYB 4XCVA 2K2WA 5BVHB 2CDNA 1JVSA 3I1JA 4PXAA 1IQRA 1M72A 2KS6A 1MRZA 5JXJA 2YXNA 3E9ZA 2FWBA 4CR7A 3CO5A 3ZCRA 1O9GA 3ELWA 1TJNA 4JHLA 1IL0A 1C1DB 1ST2A 2J3DA 2WLSA 3CZ5A 4MUFA 1E6MA 3RG8A 3VPGA 1D7AA 5FBRB 2ZXFA 1PJ4A 2Z43A 5A5DA 3Q8LA 2Q1SA 4RSGA 2P3QA 1NUPA 5LOVA 1QFMA 3KIPA 4XQEA 4NIMA 4XOIA 1U80A 1WDTA 3HXQA 2J7PD 3GZNB 2IFTA 4HEQA 1NW6A 4YP0A 3ZU3A 3RVLA 3C6XA 2P79A 4B40A 1YI0A 2AS0A 3T1NA 1F2DA 3QYAA 3G1UA 3T0GA 4PFQA 2RONA 4I1IA 3INYA 2KI5A 2PH7A 3Q7IA 4H0CA 3NJ8A 2RHLA 1FZQA 1CJMA 2YQ5A 3D1VA 5AW1A 2K7ZA 3LOPA 3WWYA 2X77A 3I39X 3B1YA 3L7IA 3OZGA 3QW2A 4ZHSA 1H2YA 2PD6A 2ZI7A 1QRSA 4B4KA 1HETA 4RZHA 1IM8A 4BVAA 3F6PA 4ZT7A 2O2XA 1A5BB 1UXKA 4P4SA 5BN1A 1IWBB 1VG1A 1ESCA 2BMJA 2OYSA 4UARA 4UHDA 2PANA 5KPJA 1CEEA 1PN3A 1HQDA 1F8GA 4C2UA 5IDXA 2PUEA 2KYRA 1EZZA 1ADYA 4JJ4A 2BF4A 1PV4A 1X74A 2XXBA 4XX0A 1SBHA 3CH5A 3EGOA 1YB4A 3WKAA 4YRNA 1YE5A 3FVVA 1OY1A 1RT9A 1U0TA 1YL6A 1S0UA 3C7TA 3HR7A 3LXMA 4O4JB 5TVGA 2A6PA 3D4BA 3OE4A 4MQEA 2EF0A 4L4ZA 2V4MA 2WOJA 4LMRA 1GSIA 1Y8RB 4IWNA 4ND4A 4XWYA 3QUCA 3QVKA 2WHEA 2V7BA 1O6GA 4G09A 2IH4A 2HBYA 2AH5A 1KJ8A 2R1TB 2PX3A 2OXCA 1C9MA 4J0HA 1K06A 5EJ6A 1MAHA 4OQMA 5LQAA 3JSAA 4CDMA 3EPLA 4D5EA 1C2YA 3B6MA 2Z56A 3R5TA 2B5OA 1FU8A 2G67A 5F64A 3GLFA 2ECOA 1E20A 2YUTA 4DVJA 2C54A 3LQQA 3NORA 3GH3A 5DGDA 2Q21A 4LYEA 4HDMB 5HSGA 2EBHX 5T8KA 3PQ6A 3AUSA 1KVSA 1FK8A 1NHWA 3TH5A 5JRDS 1QGAA 3P5SA 3KALA 2BHRA 3ZU2A 1H42A 2HWKA 3O8BA 4DLAA 4R98A 1TQ4A 1TUGA 4HNGA 2IPAB 3MD9A 4TLAA 5DGTA 3A1EA 2QQ5A 3CSUA 2AI1A 1AQYA 5TSDA 2Z9BA 4OP3A 4QOGA 1DKQA 1ZJ5A 5ES4B 2Q5JA 2V7VA 3AR2A 4GC5A 4LA4A 5IAEA 4WK0B 1FU7A 2HL6A 2OUKA 4FWBA 3PT5A 5BMVA 3WL4A 1LC0A 1TT5A 1W48A 3A7EA 5BUZA 5LDHA 1E1LA 2IKQA 2QRKA 3W7AA 3OLCX 1JZSA 3BGIA 3L1JA 4H4CA 3CWQA 3MAGA 4XH9B 4WGFA 1HDYA 3A28A 4OXNA 5KOHB 2FWIA 3L8EA 3Q72A 2R6AA 3IDFA 5DSTA 2OKCA 2CXQA 3A70A 3DFKA 1HQCA 1PNVA 2FPUA 4N7RA 3MJCA 3UHAA 1F2VA 1IHPA 1MO4A 3K0AB 3BCSA 1KJZA 3KVOA 4FINA 4DAEA 3KKLA 3WMWA 5KTMA 1ORRA 5DHPA 2RAUA 1GZSA 1ULTA 4KDFA 3RVJA 1HE2A 4MDEA 3A1CA 5L8VA 1JTVA 2VHQA 1XMSA 2Z0MA 4I8IA 1P5ZB 2Z5LA 2PKQO 4WZZA 4F85A 1GPYA 3AB7A 2GI4A 2AKYA 5EHXA 3HSYA 1JUDA 4LIPD 1DKLA 1PSWA 3L8YA 4XSHA 1T8PA 4EUSA 2FZ5A 4O4IB 2NU8A 3CT4A 4M7WA 5IRCD 2XKKA 2K7FA 5DLQC 2J3QA 3G2OA 4JVLA 3IQEA 2MSDB 4J07A 4UUMA 4WXEA 2SHKA 2VWHA 3FPEA 2GQ0A 1R37A 4L28A 4J0KA 2XOXA 4LUCA 2HA5A 4CTNA 3AVYA 2EFDB 4OX9B 1CV2A 1OLUB 1PZHA 3NM5A 4WN3A 4IH9A 3SC6A 3X43A 4HNQA 1PSZA 3PC8A 1R5BA 3SDZA 1SK9A 1SWWA 3JASB 2DJIA 4QU9A 4WCFB 1UOEA 4B7CA 5G0VA 1AGXA 1AQUA 1ISMA 1KMHA 2EJCA 3CUVA 2DT8A 2JGKA 3ETDA 3CVWA 1IOWA 1K8RA 3PWZA 3EIFA 5IBPA 1P6QA 4G5QA 5LQUA 1IOVA 4P08A 4ZTZB 2ZPAA 4EY7A 4FNAA 1M34A 3HJTA 4ZV7A 1HYGA 1QBGA 4EHJA 3AEKA 2PGJA 5LCXA 3AI3A 3ESBA 1C9EA 2B0JA 1PJSA 2CDCA 5FQNA 1G3UA 2AUMA 2W2KA 3NFRA 2POCA 1JG1A 2R3SA 4UFPA 3W2TA 2Q50A 5K6AC 1V8PA 4LDNA 3SC2B 2EARA 2FPKA 4IV0A 4N3CA 4M1OA 1YR2A 2AJLI 2FSVA 2JD2A 5GP1A 3SC3A 2EZ8A 1B14A 3UK7A 5LU8A 1AJEA 1TU4A 4TMYA 1RWPA 1R27A 1QO9A 3OIFA 3HBLA 5JV5A 5MN5A 3S8EA 3NBMA 1LC3A 4AXBA 1L7VC 4NFSA 1V1RB 3QY9A 5B1DA 3SHWA 1O03A 1M75A 1EX1A 1EUQA 2A4MA 4XQCA 1TX4B 4GKJB 1I30A 1Z13A 4FC6A 5ALGA 3CLTC 3U4AA 4N6GA 1PJCA 3DDWA 1NN3A 4ARZB 2J67A 3DVAA 2PBLA 4G0ZA 5FPPA 1N3YA 2WT4A 1TLLA 2W4QA 4MVCA 3IIKA 1WCXA 2PX8A 1WPQA 1OFTA 1XG5A 5CFQA 5JEEA 4QTUB 4DM4A 2GJ8A 1XLTC 4PTLA 3WHLA 5JAMA 2Y0CA 3NVDA 3C3DA 4DHWA 4B3HA 2JLCA 4EO7A 2M9MA 2BBWA 3OEWA 2P9TA 1C80A 3IMCA 3NOQA 1TB4A 1GTJ1 4PQEA 1N77A 1NI5A 1Q0UA 5U4XA 1NONA 2H57A 5H68A 3SZMA 4ZYWA 5IT4A 3QKRA 4D42A 4RK7A 1QRAA 3EFBA 1WMSA 4KRGA 3DAHA 5J58A 3N8KA 1N2XA 3WGYA 1XV5A 3BXXA 5B36A 1I6WA 2BRUC 1M7GA 2Q0XA 2YW2A 4V03A 3VSAA 4KP7A 3DHNA 2H1CA 4YJGB 3EWIA 5AVKA 1T15A 3TOSA 1G1AA 3OT1B 1HM5A 3GLGB 4YHHB 5I7EA 1O0CA 2K6GA 1LA2A 2FG5A 4I2VA 2DHRA 4TM8A 1A9XA 1W6RA 5ICEA 3AIOA 1B26A 2CJPA 2FPMA 3EIXA 521PA 2W6OA 1RYMA 2YZMA 2MINA 2Q4OA 3CYFA 3IBSA 3VSEA 1B74A 1FVHA 3W1WA 4EK9A 1UL1X 1J2TA 4KR0A 4N01A 8AT1A 5ITSA 5FUVA 1IDOA 1ODFA 4RV9A 1HT2E 3RADC 4JT8A 3KTAB 2I2XB 1NV8A 3R8FA 3UJHA 1E3QA 1N6HA 1UZLA 4YRQA 2R60A 2P9EA 4KLCA 1YB2A 2FEAA 5ECWA 4A9AA 4ANFA 1NPYA 2Z1DA 3IOYA 4FSXA 4C9BA 5IF3A 1CT9A 4N12A 3BJMA 3H42B 4W8GA 1M1NB 3CLRC 2V98A 2FOIA 3KV1A 2I3AA 4D9BA 1QWSA 4DIOA 3B1VA 3IQWA 3TLMA 4EJSC 1ZHOA 2JH3A 2D6FA 3LBNA 1AQIA 2V6IA 3ZK7A 1KRHA 4F4UA 3PT9A 4B3MB 2VPXA 4Q4HB 1GN9A 1YASA 2J32A 1UKEA 1E1CB 4C21A 4Y1GA 4E15A 1S02A 2RIPA 1Y7IA 2ZTSA 4R84A 3AEQA 3I8OA 2AGVA 1BC5A 2DHQA 2WG0A 3AFHA 1K98A 3VRHA 4EUKA 2VRNA 2CFCA 3DMGA 3VC1A 5KMGA 1FDTA 1J70A 1NI3A 2NZYA 4YJHB 1PFVA 5CYFA 1YOVA 4FFMA 1PVOA 1J0BA 3BHNA 3H8WA 3ENWA 4FFNA 3ZDYB 5KBYA 1GNVA 1XAGA 2XCLA 5I6DA 1NYRA 1RWNA 2BP7B 1EFVA 2DY0A 1OZGA 1LSSA 3E58A 4ND5A 4WCVA 2NX2A 1NNI1 1VPVA 4KPUA 2XCTB 1PGQA 1O9HA 4FVTA 4B3CA 1IBLB 4QJIA 2H85A 4WJKB 3AKZA 1HDRA 1PR1A 5F3RA 4CV1A 5A0TA 3DZBA 1V96A 5LA6A 2HQSA 1GUYA 4U9UA 4F11A 5FI5A 5AXCA 4FJ2A 1D07A 2O8NA 4TUYF 1UDRA 2FEKA 3T9FA 3RS7A 3KJIA 1UJCA 3V32A 5HOEA 4MINA 4OLBA 3A9UA 1AO3A 2V6GA 2FFRA 3GQBB 1YQGA 2QY9A 1N4DA 1A95A 4KHZA 1WV1A 1NV9A 2BGNA 3HZOA 2PKCA 4JMLA 5D5PA 5IK2D 1PL8A 5JSQA 5HZMA 1QYWA 4NR0A 5E4TA 4FYWA 4TPKA 2WTBA 4FW8A 4Q03A 3MLBA 4ZCQA 3WJAA 2LPMA 3EWAA 2HMAA 4MPTA 3DV0B 3IMFA 3K4PA 3VH1A 5AOVA 2Q6VA 4DA9A 3MF4A 1EX6A 2VRWA 4Q1DA 4QUDA 3L4BC 3T9BA 4D8TA 1UIRA 1C30A 3I23A 3IQFA 4M9XA 4JI6B 1VMAA 4FOPA 1W49A 3G5LA 1SB9A 3KZ1E 1J23A 2KHZA 2FCRA 4M7OA 2ZRIA 3M4ZA 2X0JA 4U63A 3V9AA 2GT1A 2HU8A 1OZ0A 3WLFA 4PGAA 4BL5A 2J09A 2Q5CA 4CDRA 1LLCA 1U99A 1DBPA 3W04A 1E96A 4PC3A 4W7HA 4CIWA 1QOQB 1ZNWA 4AICA 1SUWA 3E0XA 3DE4X 1Y7PA 2WAYA 1HFWA 3C97A 3H6HA 4I9FA 1WMFA 2QF7A 3DCJA 3CLTD 3A9CA 3ORFA 3PHJA 5KU1A 1YRWA 4Y6SA 3PYXA 4TLEA 5M7EA 3M6UA 4W7SA 1NDHA 3IAEA 1E6LA 2ETXA 4KQWA 3ZEIA 3THYA 2IUTA 3Q1LA 5GADl 1XF9A 3CJQA 5A3QA 3KEMA 3U7RA 5DOZA 1UXIA 1Q0ZA 2P9JA 4PPQA 2RGNA 3GDOA 3WLQA 2ZTVA 4ILKA 2AF4C 1HI9A 5DWDA 3WFZA 2QL7A 5CH8A 2A0UA 4TL7A 3WMGA 3UJPA 3NDIA 4COKA 3A31A 2CL0X 1ZH2A 2RB5A 1E59A 1Y9JA 2VLBA 5AW4A 2XAAA 2VJBA 3G82C 3FLMA 1PL7A 3PNYA 4F7WA 3PP8A 4X3OA 4MIKA 4EZBA 1VJCA 3AUAA 4TZ0A 1QGOA 4GEKA 2DAPA 2O6HA 4GPBA 5L3QA 1HSZA 2E6KA 3GUHA 3MW8A 5AKLA 2IYVA 4YK7A 3TW4A 3OWOA 3QKTA 1II9A 3N2ZB 4DRYA 1ZI9A 4OQNA 4MIOA 5LB4A 3ABIA 3N2LA 3PJFA 4QLOA 2JCXA 1KOFA 2AXNA 1R0SA 3W8EA 3AHGA 3FVRA 2GRJA 5EPEA 1CJCA 1KSJA 1F4LA 3D02A 4U7GA 3H9CA 5EPUA 4ZCMA 5K20A 2JDIA 3CX6A 1OUMA 2CHQA 2NU9A 4ZWNA 1GRCA 1W9HA 2KPOA 1P0MA 3T5CA 4CODB 3AF2A 6GPBA 3THXB 5D3MA 1KOLA 3P45A 2DQZA 2HEIA 5HBGA 2WV7A 2HF9A 3E1KA 3H2GA 1FYXA 1CUJA 5TMEA 3NYQA 5JFTA 3SK0A 3L6DA 1J06A 2G5CA 5K8VA 3WS7A 4EI9A 1UFVA 2ZRJA 3CLRD 4K9QA 4UOEA 3LDHA 3E2IA 1M8FA 6LDHA 1MEEA 2J8ZA 5AOAA 3VU8A 4HZGA 1K97A 3A1DA 1KMCA 1D4OA 1N5LA 1T5BA 2ORVA 3FN4A 1YR3A 3W3AD 4D3XA 3SU8A 3QYJA 4OSPA 2JJMA 2H92A 2QX7A 1LJUA 3NPAA 3OQIB 4XVHA 5MFZA 3G79A 3IVCA 3GRRA 4CKYA 4MJXA 5BXQC 3DQPA 1XKQA 2EKDA 5REQA 1TA4A 4HB3A 2R8YA 4P92A 1KQGA 3L0IB 4JT9A 3QEMA 4OL9A 3FLBA 4Z9XA 1RQNA 2GBIA 4R6WA 4RA9B 2X6QA 1AIPA 2QJTA 3ZGNA 4QXMA 1ANKA 2Z2IA 2L2QA 1KNXA 5EJ2A 3X1YA 4G67A 4ZI2A 5CDYA 1B8UA 2PLWA 2FWPA 3FYHA 3LG2A 2ERXA 2YTZA 4QYWA 1GRRA 1L5NA 3PEWA 1XZQA 3G0GA 5A3VA 2E2WA 2B3TA 2YJ4A 1JI3A 1PDVA 3VISA 2I0FA 5J2TF 2QRVA 4Z3DA 3E5MA 5B37A 1VLZA 3FOZA 1DNPA 2Q4RA 5E1OA 4W9MC 2Z09A 3BMOA 4NICA 5KSZA 2ZW9A 1PR0A 2P9YA 3K2EA 3TLJA 3VM6A 3BWXA 1EWYA 4G4JA 4I1SA 5T41A 2PMEA 1MA0A 3G59A 1OKKD 4TKUB 5IUNC 5A9RA 1PSDA 1UEJA 1X1TA 4HKTA 4LQDA 4R7TA 3OIVA 4O2AF 1Z34A 1FS4A 3AG5A 5LQRA 3G0BA 3KWFA 5JWHA 1Z4OA 2WIAA 5CT9A 2FP4B 4TWJA 3D8HA 4WH0A 4NDZA 5U9CA 4J16C 3KHSA 5C32A 2IZ6A 4LXGA 5KYGA 3PEVA 3NVMB 3BWEA 3WIOA 2C0PA 2NUTA 5ESRA 3VR5A 4B8ZA 5TMPA 3HGTA 4PX9A 2H1LA 4TXNA 3VR0A 2RK3A 4DNQA 2VTBB 1Z0IA 3A1UA 3RFCA 4FQ7A 1E9FA 3OQ1A 1C3OA 1P44A 3HZZA 4N3BA 2QD5A 5DCWA 5DW0A 4URVR 1WS6A 3PNBA 4YRBA 1JR4A 3QG5A 2I66A 2UZIR 3C3BA 3EVBA 4ZCRA 4ZXPA 3D4PA 5EI5A 2MIIA 5K0ZA 2E48A 3EA4A 3OJCA 4KYUA 4ISBA 3IUEA 1NLFA 3ZOZA 5KB3A 2HRZA 3TPZA 2E5WA 4OMFG 1NNSA 2NQ8A 4UPEA 3AIMA 4V0ME 4OKIA 1JR3E 4CKBB 3R8CA 1HBJA 1OPRA 2VI5A 3CUWA 1NN5A 4JQYA 4P80A 5FBLB 2X7HA 3EPPA 5IM4F 1FFYA 4F2GA 1NW4A 5I4BA 4PRYA 5KHOC 5JQGF 4CEJB 2BKLA 1KBOA 2N46A 4HAUA 3HXPA 3TDMA 2BEWB 3EW7A 4P5PA 1Y1RA 3TW8A 3VSBA 3QE4A 3RRMA 3TVDA 4RH1A 3NI2A 3G3EA 5HBRA 1RXIA 1FRNA 2PRYA 3QQ5A 5CFNA 5DZSA 3FHLA 1YK1A 2XMSA 3TCKA 1XZCA 1A9OA 4OHMA 2C97A 1EFDN 4WI1A 1PD1A 3IAS1 1SKYB 3U7JA 3WK6A 1ZK1A 1EGAA 4Y9SA 5JMOA 3PE6A 5FTNA 3DE0X 2GCPA 2Y1FA 1Z0UA 1IB0A 4IJUA 1I14A 4J7AA 2EYUA 2G4LA 1EI9A 3K70C 1BFDA 1Q2UA 1ZYUA 1GNSA 2QW0X 2XUIA 3AFIA 1QHEA 2WINI 2QQFA 5HIIA 2ISQA 5IABA 5DM70 2O8FA 1CUVA 5GQSA 2DPGA 4EA8A 2EQBA 1NIJA 2Y6VA 1XPRA 4RK6A 3AY0A 5CIQA 3WMXA 4YNBA 3QGMA 3VYUB 3HMKA 4II3A 7REQA 5F1OA 5EIHA 1JPNA 1C0PA 4ESHA 3K15A 4BFSA 2PWZA 4NZZA 4C30A 4JDPA 4UNPA 3GLTA 5AUPB 5H8WA 2I29A 3HKBB 1M5RA 4Y2QA 1P7YA 2Q1UA 1AZWA 2AR0A 2FZLA 2J6HA 2VHEA 1E2IA 3ORQA 2YW9A 3OM9A 2E1PA 4UMVA 5FI0B 2RHOA 3T4EA 3O7MA 2NYUA 4Q48A 2DY1A 2J3EA 4HTAA 4ZAGA 3SFVA 1UK7A 3OE1A 1U2EA 5C31A 4JI1B 3C6MA 4G63A 4QG3A 5CA0A 2VAWA 5KX5A 2ONKA 4WOKA 4EIWA 2I67A 1LWOA 3QJYA 2IZ7A 2QD1A 3EBPA 1ZD4A 3Q9LA 4WRRA 1O5OA 5EWMB 4U7FA 4IBOA 4ML3A 1BMQA 2G17A 5DHQA 1XVLA 2JFHA 3FUWA 5KQPA 2IYWA 3I42A 4LWQA 1KWKA 1AGPA 1KQFA 2AFHA 3JTEA 2H4XA 2FN4A 2I54A 4HZUB 1Q1EA 3DC2A 4JMPA 3ZHCA 2QLNA 4GQAA 4RX1A 5I9NA 4FM9A 3G0HA 4B3DA 3GK3A 2GZ2A 4NH4A 2CCGA 3UG7A 2BF7A 3AM5A 3G13A 1JMVA 2J9ZB 3DF7A 1Z8HA 1GTMA 1TL7C 3QFRA 5LDDC 3PQEA 1H2BA 4ZPXA 4KR7A 4X00A 3R3YA 3UOWA 4B6OA 5JD4A 3I9FA 3GNTA 4JNCA 4MARA 1E2QA 1XDDA 3FZGA 4MKIA 3RRNA 4P3PA 3WGQA 5JUWA 2YJ6A 3EXHA 4AQ7A 3SF8A 3N8HA 2W0MA 1QVAA 4YP7A 3DD1A 4QNRA 3KB6A 1CR2A 3G0IA 4H6WA 3C3JA 2NSYA 3Q3GE 3R24A 1ECJA 4XPIB 3WWEA 1UBMS 1ZU5A 3QA3E 3O95A 4IKOA 3DKKA 4OAQA 4WACA 5AJZA 1CJSA 1IY1A 4IF4A 4J9VA 2PN1A 4NAHA 1N2OA 3X1XA 5F7ZA 4MWOA 3ZCSA 4EB8A 1CUYA 2PUAA 4TV8F 3F3YA 3IBGA 2C29D 1CY6A 4QDUA 2RGRA 4WOBA 5EQTA 1NN0A 4N54A 1GQRA 1KAHA 4H7DA 4LZPA 3PD0A 1WW2A 3Q10A 1IYZA 1ONOA 5AHRA 5C4IA 2GA9A 4DSTA 1SIBE 5HKOA 4JXZA 5KCMA 2G5PA 4ZO4A 1F7UA 4M1ZA 1LQTA 2G4CA 2P40A 1SWVA 2VJYA 4OEHA 3W2GA 4L73A 3ZCUA 4B0PA 3QE0A 5FWNA 1JQAA 1VIDA 3KD2A 3G5MA 4TOIA 4MMZB 3RSCA 2WJIA 4HJRA 4AN1A 4D3YA 5CFLA 3EGWA 1DXOA 4IHJB 2WA2A 1E1QD 1ZH4A 2OD9A 5JDCA 4LXYA 1WSWA 1WXXA 4QGGA 1D2GA 3ZHZA 5IX8A 3SG0A 1MD9A 2X9LA 1EXWA 2C8JA 3K9QO 3C2QA 4V2UA 3UV6A 4RS4A 4C05A 2H0QA 4G81A 1BGXT 4H31A 1KFBB 1QIDA 2Z3VA 4XR4A 1BA3A 2GUWA 5HJ2A 4RTJA 4NXMB 4J91A 4L8LA 1T9HA 3WY9A 1L5SA 3TRDA 1N6RA 4K9LA 4PCAA 4BBJA 3B82A 1R15A 4D3SA 1EYZA 3PFGA 2R6ZA 3LU1A 1ORIA 3O8OB 5D6OA 5JYDA 3ZGZA 4X1OA 2YOHA 3ABZA 2YMQA 1J00A 4DUGA 3M49A 2H5LA 4AUNA 4HAIA 3IVAA 1MR3F 1V16A 3DT8A 4DQVA 3TCXB 3MCWA 4ZVRA 2QHXA 4H7HA 3G9TA 1DRUA 4LGCA 1RXEA 2XT0A 1OLXA 1BAPA 2BGJA 2NXWA 3B1JA 4CM9A 2A59A 4FGKA 1RBYA 1T2EA 2H5EA 3K96A 3ONWA 3T5DA 3VR1A 1BHO1 1NBMA 4MR7B 4XXHA 3UKJA 1JAIA 4IJVA 1MU0A 4Z4EA 3O0TA 4MCIA 4FS3A 1ZGJA 2QI9C 3PD7A 1I1QB 1RU3A 4RJJA 3ZWCA 4A92A 5B3KA 3K70D 4ZYZA 2DR3A 4HDOB 2WT8A 2WWFA 2RGEA 4PYOA 4D4HA 5CDSA 2O2ZA 3UMMA 1U0LA 4F4DA 2C9ZA 5EXEA 4DQUA 3LGXA 3PHLA 1KZGB 1XVTA 4KV7A 1ZINA 2FAXA 3EMBA 2Q4EA 4I1RA 1WTAA 2FMKA 2ZUUA 4L4UA 2YV4A 2VDNB 4PIMA 4TMZA 5EUBA 1ULBA 2RGWA 1KNQA 1G5IA 1P8AA 1LS1A 2ZR8A 1DIBA 2RJOA 3D2AA 4OUDA 4Q4JA 2I65A 1JXMA 4GPZA 4IIHA 2GAJA 3VKFA 3ZUPA 1RHQA 3CBQA 4JJEA 1OPXA 4NMLA 4A2WA 1S8AA 1EWRA 3FWZA 4EPVA 1FB5A 2XVZA 4S04A 1JXQA 1WZNA 5AJVB 2RI0A 5K0GA 2UUOA 1NT4A 1THTA 1U9IC 2EHDA 1PD0A 3R9KA 4D6XA 2Q2QA 2ASEA 4YBRA 5AW5A 5C18A 4KUGA 1WBJB 1G5HA 1O08A 1OIVA 4U7WA 1KJIA 3INTA 2G09A 5J1SB 3W6ZA 5A71A 2BLLA 3TZCA 1ONSA 2O1WA 3R3VA 3UXYA 1G1MA 4E3WA 1SVNA 4IG4A 1YTLA 4QL3A 4G89A 4RTPA 5BV1A 2A84A 1DAGA 2IX9A 5DTMA 4BB5A 4IDNA 3IUYA 1RWQA 1X7ZB 2HYDA 3L49A 4BE4A 1JW9B 1M8GA 3SSOA 5C8YB 1CNFA 1JS1X 2OSBA 2P69A 3MJHA 3MMSA 4MGIR 3VAYA 1VKNA 1AA6A 4KEAA 5KTKA 1LLUA 2GZHA 4R9RA 5EIFA 1QQTA 2J0QA 1M7HA 1QHNA 4PSVA 3TKYA 5CLLA 2R68A 2HF8A 4DV2B 1HDEA 2HC9A 2C4HA 2YFHA 4AMZA 1OLSB 4DA6A 7YASA 2C2WA 3IR5A 1E58A 4GO1A 1AM4D 2X4DA 3K72B 4CKZA 2HMUA 3TQHA 2G9VA 3TW6A 3CF4G 4MP6A 3RV4A 1N6OA 1OF1A 3TUJC 2ZATA 4KAJA 4RADA 4BC1A 3AMVA 4BX3A 3I58A 2LVBA 5TEVA 2DR0A 2F4VB 3IO3A 1WZUA 1YR9A 4YO8A 3ZH9B 1PEAA 1TMYA 2SKDA 1TKBA 3JQ9A 2ZWVA 3JD1A 2GHQA 3USZA 4V0LA 4HNAA 4F6LA 5MHTA 2CJXA 4LFBB 3LCRA 2HY7A 2Q3CA 3DZ8A 4C6TA 1W7AA 1WZCA 3MWEA 3ND6A 4TTJA 4RKFA 3TJZA 1ZD3A 5IJZA 1F8FA 1UFRA 3EQ2A 2XE7A 1PLKA 2DMRA 1H2RS 3LP5A 2FR8C 3MWFA 3QV2A 4RCVA 3IQIX 4YDSA 3U48A 2X58A 1EFKA 3B6IA 4LRUA 4R3UC 1CZKA 1DQNA 1IATA 1J0XO 1NW9B 3I30X 4S1TA 2TYSB 1JSRA 3JD3A 4RABA 5THXA 4DEXA 1BZYA 4TTTS 1TQ6A 3T5MA 4UBOA 1CEYA 3WHKA 4XSVA 3ZXXA 2QSUA 5I8WA 3EVEA 2IU0A 2OCLA 4TSFA 1R6TA 4XDHA 3GX1A 1NVKA 1SCAA 3V4VB 1BA2A 2VJMA 3TZEA 1YC2A 2XYGA 1DAOA 3M9XA 5ALDA 4F1JA 2GBLA 2SKEA 4UHFA 4L76A 1ATZA 1GTZA 3LC0A 1L1FA 1R6BX 3ZE9A 1U8FO 1ZWKA 2H63A 4CM8B 1HF3A 3LIIA 4A6DA 1TU0A 3HO6A 2GYYA 4EW3A 5A0VA 4Q9NA 3LLCA 4WDRA 4I99A 4F45A 2C7RA 4HL6A 1H8ED 2VXCA 2NGRA 2W6QA 2GR9A 1FP1D 2PLAA 5FBHA 4UAJA 2GXQA 2BGUA 5M29A 221PA 4C04A 3OCYA 5C51B 3GLHB 1H9CA 3C6QA 4EB0A 2XUQA 1U2ZA 3THOA 3DP7A 4G3XA 4PC2A 5JBNA 3C74A 4L0CA 5BWLA 4HN9A 5C8ZA 1PR9A 2AOTB 4KE8A 3UWPA 5JHGB 1TC2A 3J7TA 4YWJA 2FGKA 4QFCA 1JYSA 2G72A 2VEDA 2ERCA 5IBRA 1T9KA 5EIWA 4ECEA 4HAYA 1T3HA 4MYSA 1F6BA 4LOIA 3U4DA 3RCBA 2GVNA 2J33A 3UFBA 1MGPA 1QG4A 1KOGA 1X1AA 3FYTA 2PZLA 3MJVA 2FF7A 1QYRA 3DZJA 3MSXA 4AMYA 4GOOD 5ALJA 1QIJA 1BXZA 1FJ2A 1QO0D 3P9RA 4MPRA 1VBKA 4MUYA 1XJCA 3CZCA 1VDMA 1YK0A 1T3TA 3K6SA 2Y1CA 3GMSA 4JCOA 3EVDA 4M1EA 5IKMA 3JALB 3J81k 1LS6A 2ZWOA 4R05A 1WXDA 2IYFA 2P4QA 2ZS7A 3BQ9A 3FPJA 4PR0A 1DPGA 5KWVA 3ZDQA 1VKOA 3OO0A 3T99A 3TEMA 1XROA 2RC5A 2Y1LA 3KYCB 4JB8A 1IULA 3TJRA 3U16A 2CKMA 4UW9A 4Q3OA 4DLVA 2QT0A 1GPDG 2Y1XA 3N0RA 3BMXA 2FR1A 2W6ZA 3N05A 3NT4A 5ALWA 1Q0PA 2ZRFA 4LMPA 3RUHA 5DGHA 1WDWB 1A97A 1BOFA 3N5CA 5P8WA 1ZCFA 2Q99A 3T3MB 1BVUA 3CH7A 1A1SA 1MORA 2HK7A 4ND2A 5AVXA 3MEQA 1KYVA 1SUBA 1V48A 3FA2A 3FCCA 3OCCA 4R1PA 3VO1A 4EG0A 2QTFA 5FL7A 3TS1A 4HFNA 4M22A 1B16A 4JR1A 4ZYLA 3NEYA 1KSHA 1S8OA 2VP4A 2VF7A 2OHHA 3T52A 3VPBA 3U4IA 2WKRA 5D51S 2FPPB 5I01A 5CCBA 1T9DA 1OFUX 2HJWA 3T9DA 5F1YA 4XGIA 2ZVDA 3QYFA 4IHKA 4YJ2F 2AC7A 1I2ZA 2GRUA 3EDYA 4M21A 1G3IA 1KY3A 2C7VA 4IIXA 5HX7A 2WUWE 3F5FA 3I2IA 4BQFA 3WGZA 1F12A 4BGDA 1U3DA 5K3FA 3ZVLA 4RCYA 4I4TB 3D6VA 1OAOC 4GKKB 3SS8A 3GB9A 2OECA 4IILA 5I3ZA 4JS0A 3OQPA 3VXKA 3SM3A 3JWPA 1W73A 2HJVA 2ZYDA 4O4HB 1DTSA 4R1SA 3VFDA 4F0JA 4YMUA 1J7JA 1Y82A 3F1LA 2QLFA 5BMOA 2BTOA 4G0WA 1GL3A 1LBQA 2IJGX 2BEUA 3D8NA 3T5TA 5EKUA 1U2PA 3MJTA 1VLHA 1HEUA 1VLVA 1O0BA 1USUA 5ALVA 4Y0AA 4ZMSA 2DUWA 1XTSA 2Q0QA 3FJYA 3MUOA 3HBFA 2LP4Y 5KYWA 1T5DX 4JQOA 2AUNA 5K3AA 3V46A 1JA1A 3VU9A 5C3UA 3SOPA 3WBKA 2B9EA 2BFOA 1VKZA 1GFSA 4KUEA 1M2FA 1YV9A 1L7RA 2IOFK 4LJAA 5B3JA 4E46A 1G8HA 3C16C 3UMCA 1G38A 1I7SB 3ENKA 4HVTA 1HNXB 2FZKA 3O8LA 4ZPJA 4Q7KA 1LX7A 4K05A 2EIHA 4DDVA 1QX4A 4HDNA 4TKMA 2WEKA 3QVTA 1XF1A 2P9QA 3KZOA 4G36A 4HQKA 4NU6A 2E4XA 3HDJA 2W2LD 2P7IA 3IAUA 4MB6A 2QNIA 4MRVA 3E9RA 4BV3A 4GXRA 3DOJA 1J33A 2CT8A 1A96A 3NBXX 4KVAA 3FFBA 3FKQA 4RZ3A 4XWTA 3U9LA 2RG1A 3ZTTA 3KQHA 2BHNA 1OHHA 4FB4A 1ML4A 4BBAA 5K7SA 4DDKA 3GCDA 4AZ0A 2I62A 1YJ5A 3ZYZA 4UHKA 3AP1A 3WB9A 1FDSA 4IOKA 3I8XA 1W96A 2F8LA 3D0RA 5F5XA 5KKCA 1C3JA 2F43A 3LYUA 5F78A 4AWAA 1Q1ZA 3AG6A 2QLMA 2R00C 1LQUA 3MWYW 4MVJE 2HDHA 2PX6A 3F0TA 4WVLA 4YMVA 1QTNA 4DV6B 2FW0A 4O0LA 3IQXA 2MDTA 3EXIB 3U7HB 1GZ3A 2VT7A 2HIGA 4ABYA 1Y37A 2YJTD 1T24A 3FDXA 2PA3A 2V58A 1RZUA 4FOTA 2FSSA 3VZQA 4A26A 4ZQFA 5G53C 3A6KA 4CMEA 4CLRA 1R5OA 3HI6A 5EZYA 2VP9A 1XN1A 5H3CA 4ZVTA 2WG2A 2VH1A 1XOIA 2GTPA 2ESRA 4BO9A 1XRMA 3WGHA 5K8IA 1B8VA 1PT5A 1D6JA 5CH5A 2G04A 4DWJA 4Q34A 5EQDA 2I6SA 4EF4A 3ASVA 3I28A 2WDPA 2O0LA 4AJKA 1FOEB 3KJFA 1QZZA 1E6EA 4L0MA 2MWMA 2Z04A 3HV2A 3AIKA 4MS1B 3UJBA 1HLDA 3JQDA 1NF8A 5F51A 4ARUA 3GLRA 4D4IA 1E5LA 1VHTA 3LQYA 3D7MA 3ETLA 4NLLA 3QPAA 2O7NA 2J31A <