1ZUIA

Structural basis for shikimate-binding specificity of helicobacter pylori shikimate kinase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
160
structure length
158
Chain Sequence
QHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSVREIFEELGEDNFRMFEKNLIDELKTLKTPHVISTGGGIVMHENLKGLGTTFYLKMDFETLIKRLNQREKRPLLNNLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Structural basis for shikimate-binding specificity of Helicobacter pylori shikimate kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
total genus 51
structure length 158
sequence length 160
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2005-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zuiA00
2V1XA 2DWQA 2G0TA 1J8MF 3K9NA 5AJZA 5JJLA 2VHQA 2YINC 5HR5A 1TU4A 3DMNA 2A5JA 3LX5A 1UKZA 2PH1A 4RCYA 5CIWA 4Q21A 3S1AB 1CJKC 4A0FA 4DLVA 5FUVA 3DM5A 3F0TA 4E07A 4HLUA 3OZXA 3IKJA 1KHTA 5L8VA 4N0DA 4QGGA 3FMIA 3RHFA 1A2BA 1N0VC 1S9DA 1AKYA 4EPRA 1SXJA 2O8DB 2OAQ1 3EZ9A 5FL7A 3AGQA 2F1HA 4OQFA 2ZJ8A 3CZPA 4TL9A 1TUIA 2FZLA 4EFMA 3TAHA 2GJAA 1KO4A 1JEDA 4QM6A 2QQ0A 3B85A 4LHYA 2ZEJA 5E4FA 2JJ2A 5JHHB 2GJSA 5EP3A 1BS1A 4FCTA 1V43A 3D8BA 5LD2B 1ZM9A 3JVUA 1NI3A 3PUWA 3TUZC 2N46A 2WIBA 2O8BB 1P2SA 3CB4A 2GBLA 1ZW6A 3DL0A 4M0LA 3LX8A 5G53C 3FKSA 2ZIAA 1DAKA 2GKSA 1E9RA 4V0NA 1G4UR 1Z63A 2IYYA 1DAFA 2OFWA 1IY0A 1NVXQ 2F55A 1X8JA 4A0RA 3RANA 5L3RA 3BFKA 5EE1A 4TSFA 4EIWA 5GADl 4MRRA 221PA 2O0KA 1TUEA 1VCNA 2GRJA 2IEYA 1DELA 1GG2A 4BFVA 2VP5A 3KKNA 2XXAA 1K6MA 5LB4A 2FFHA 1LTQA 1M74A 1D2EA 4DT1A 1W0KA 5FBVB 3CX8A 5CYPA 2DWOA 4UXJA 1LY1A 2QUZA 2A9KA 2YOGA 3EAQA 1ETUA 2J7PA 3AP3A 4MITA 4WIAA 5EUQB 4B2IA 4B3GA 3IQWA 2FDCA 3LBIA 2FPLA 2LKCA 3GLHB 4MGYR 1T0HB 2RGDA 1QHGA 4IVRA 4LV8B 1YR8A 3FTQA 3VFDA 1GNQA 4GNKA 1UFQA 5DE3A 1E2PA 2NPIA 1OXTA 3HJNA 4Q19A 3LBNA 3VQTA 3O8BA 4HEJA 2WMOB 3LD9A 4AC9A 1AQUA 1XTIA 2BDTA 2BV3A 3CLVA 3L0PA 3M4YA 3UG6A 3D3QA 3QVUA 1NKSA 2A2ZA 1Q1QA 2ZRHA 1YRAA 1FX0B 1P3JA 2B8WA 5FTLA 5JRJA 1BH2A 4XWKA 3B13B 4Z1MA 2KE5A 3OIVA 3SC3A 3GD7A 4A2WA 4QM7A 4WZ6A 4P31A 1FP7A 1NVVQ 2GVDC 3RSOA 5KPJA 1Q1ZA 2P65A 3T1VA 4D2IA 1FW6A 5BWMA 1P6XA 2B6HA 2VQSA 3OE7D 4EQ6A 3ETLA 2I3BA 3H2YA 4BGDA 4M21A 3QXSA 521PA 4ASUA 1QF9A 5FTMA 4A92A 3DMDA 2JATA 1Y63A 4PFSA 3W8RA 4LBYA 4KI0A 4ARZB 4YDHB 5E3HA 5LBIA 1E9DA 1CU1A 1WRBA 4PQYA 3AP2A 1CKEA 4OQMA 3THWB 3FKQA 2GJ9A 2NTYC 4BZXA 3B78A 3CW2A 3QG1A 1AKEA 3Q85A 2F3RA 2RHDA 1VG8A 3I4LA 4HLDA 3L0IB 2OXCA 4NL4H 2J7KA 3EPKA 1U94A 2IYRA 2GK7A 2Y8EA 4D4JA 1WB9A 2O8DA 1E1RA 1KO8A 1SXJD 3SQWA 5FL7D 2RGGA 1P7CA 5C2JB 1NVUQ 1COWA 4Q03A 3DO6A 4TL8A 2IYZA 4M9SA 1DAGA 4AIIA 3C4JA 1IN8A 2BCJQ 1E99A 2F7SA 3BORA 4FMDB 3K70D 4QBGB 2A5FA 4JKYA 1W4RA 2A30A 4UJ3A 2JJ2D 1SVLA 3IIMA 3CWZA 1A2KC 4TQUS 3TBKA 3QJYA 2HJGA 1TX4B 2VP6A 4BLRA 4ZDIA 4JT4A 2P6UA 4OK5A 4QBHA 3REFA 1DAIA 1OLOA 3MD0A 4PHGA 3AKCA 1X6VA 3Q72A 4RD4A 1LFDB 3CNNA 2YVUA 3FKSD 5CM8B 1G8YA 1PLLA 2GXQA 1W36B 3ZH9B 1CJVC 2VHUA 4O2LA 5DISB 4IDPA 4RKEA 4HAWA 4B3DA 3ZGXA 3SJAA 3V4RA 3W6PA 3IGFA 5L3SB 3LXXA 4AWXA 2ZI5A 1GITA 2R6CA 5AUOB 3IEVA 4HLQB 4F7WA 2HT1A 1S8FA 1ESMA 5LB2A 1A4RA 2IHBA 2FE4A 4LYFA 3KQNA 4X8LA 5G3ZA 4HLUC 2OCPA 3ZIAA 4KSBA 5JFGA 1EFCA 4U7DA 1ZMXA 5K8LA 2J7PD 1DADA 1SXJC 1Z6YA 4JL6A 2NO9A 4QHTA 4CZ2A 4ZV4A 3GLHA 5KSPA 1YZLA 4TQ9A 2H1LA 4FWIB 2J59A 3RSLA 4O0MA 1NY5A 3BAFA 3K70C 1FNMA 1CULC 2ZUCA 5F9HA 4V0LA 2A5GA 1FUUA 5HTKA 1E98A 3DZDA 1N6KA 2NQ2C 2ZRGA 1KJYA 2JEOA 3QF4A 2P0EA 2IEZA 4PC1A 4Q00A 2FMXA 3R9XA 1N0WA 3UWOA 2GBLC 4BEJA 1BO6A 5GJWC 1OYYA 2GETA 1FX0A 2G77B 4C0QC 4Z54A 3K53A 1XEXB 3UMFA 4D4MA 4Q4HB 1UADA 1NN3A 2ERYA 1Z2AA 2AX4A 1U8YA 2XAUA 5BN5A 1NY6A 4M1WA 3MWJA 4RSGA 2ZE5A 3O47A 3OIWA 5CDFA 4Z1MD 1H8EA 4F4CA 2V1UA 2J3EA 3THOA 1VCMA 1XZPA 2CCKA 2D62A 3H0KA 4IVPA 4QBIA 1G17A 3I92A 1QHNA 2GWHA 2IT1A 2ZRKA 2CE7A 3PENA 1DO0A 3PUYA 4RFSB 3RRMA 3IPXA 3CPEA 4DLTA 3MAAC 3PEWA 2G83A 2Z4SA 3AVOA 1SULA 4TMVA 4ASUD 4XOIA 5P21A 1G8HA 3QG5A 4ARZA 2EFGA 4TLDA 1XTJA 2FV8A 1PJRA 3F8TA 4L9SA 5UKDA 3ADCA 1SKQA 1ZNXA 1TADA 3OEED 3THWA 4C9BA 4B3BA 1G19A 1KTVA 1TEVA 1Z22A 4NKRA 2R44A 4GL2A 2JDIA 1W49A 1R0WA 2W0MA 4V0ME 1UF9A 2RHMA 2V7QA 2QY9A 5HKKA 2FF7A 2W2VA 1BOFA 3FHCB 3R8CA 1AN0A 1JJVA 3MG9A 3U3JA 4A2PA 3BD9A 1SQ5A 4B32A 4GPTA 2F9LA 1W48A 2QM7A 2QPOA 3PG5A 2GZDA 4M1MA 4HZIA 1COWD 1CEEA 4OI2A 1YJ5A 1XPOA 2OBMA 3A36A 1XNJA 4TT3A 2KI5A 1PLJA 4BECA 2X77A 4A0HA 3P4XA 1GTVA 2FGKA 1C9KA 1ZBDA 4US1R 3LO5A 4JS0A 1KZ7B 1W1WA 4B3FX 4EFLA 2CCGA 4MDFA 1F2UB 1MABA 3TNFA 1IM2A 2HEIA 2GF9A 4PO8A 4Q5IA 2B21A 1F2TB 4JMPA 5F3WB 1OFIA 4NDZA 1JECA 1W2HA 4CEJB 4LZZA 4TZ6A 4D4LA 1FQKA 2ZI3A 5L3SA 4BFYA 4LRWA 1GVNB 1ZM4A 4GOXA 2CMKA 1Q57A 1NMZA 3WP1B 3GLFB 4PPQA 1D2NA 3GEEA 2UZ3A 1LF5A 1D9XA 2ATVA 2MMGA 4C4PA 2KWIA 1G3IA 3OEHA 3U3RA 1E9AA 1SKYB 2OCYC 4QJ4A 4XD7A 3AVQA 3GLGE 1U99A 1G3MA 2Q9BA 3FVQA 4HI0E 4C0JA 3ZIAD 1IJFA 4GOKA 2V6JA 2DCUA 2ZVQX 3IO3A 4EPYA 1ZCBA 4LGMA 2HLDA 1A7JA 4RZUA 5JSZB 2GF0A 1VIYA 1ZD9A 3IBYA 3MMPA 3AKDA 4DEXA 1ZUHA 2X8AA 4LJ6A 1KAOA 5B30A 1FFHA 1Z47A 1OB5A 4N1AA 1WDTA 2REXB 3QKRB 1TMKA 2VP9A 3T12A 2FZ4A 2C95A 1WMSA 2GZAA 2W6JA 4AYTA 4BFXA 1WXQA 4TYWA 5LD2C 4B73A 3GJ0A 1L8QA 4NP6A 4BFZA 4ZKDA 2RGCA 4URWR 2RCNA 2R2AA 4QBFA 3N5CA 2ZSEA 2GAOA 2YKGA 1EGAA 1KK3A 2X1VA 2OFOA 2WICA 4AKGA 4PZLA 1E2KA 1T0JB 4GBMA 5BXQC 1XEXA 4IEIA 4Q4HA 1ZP6A 1CRPA 1P4SA 3GPLA 2C98A 1N6NA 1ODFA 4RCZA 3AM1A 1N6LA 2QORA 1JR3A 3W3AA 4X8OA 5A0FA 2ZSBA 3LV8A 4A8JA 1ZD1A 3MWYW 1H8ED 1N5JA 4HDQB 3K0CC 2HYDA 4GOJA 5LDDC 4QHYA 3AVXA 4PAQA 4RFSA 4AY2A 2R62A 3A1SA 5IDVA 2VBCA 2X2FA 4P4SB 5DH9A 4XIGS 4L8GA 5CB8A 2YJTD 1NBME 4OK3A 4M1TA 5HZKA 3ICQB 2ZPTX 2ANBA 4OI1A 4PC2A 1U81A 3FOZA 1GL9B 3FPAA 2KJQA 4JBXA 1KK2A 1NVVR 1VPLA 2CLDX 1W4AA 1HA3A 2W83A 3NH9A 5KUTA 1ZYUA 1XF9A 5HZHA 4R9UC 1UBEA 4QNRA 5FTNA 2JDID 2DBYA 2NPFA 1AZTA 5HKKD 1M7GA 3IO5A 5BYKA 3IIJA 2AK3A 2OCAA 5BW8A 4IDNA 2D7CA 1GP2A 2YOHA 1IJEA 4NCKA 2KB0A 4KLZA 4LJAA 1R10A 4Q47A 1E9EA 2E9SA 2FNAA 2ZS8A 1W7AA 4AD8A 2BKEA 3RS0A 2L0XA 2IUTA 5JRZA 1NL3A 3WMGA 1E4VA 3ZVLA 2GAAA 3VKWA 1IXSB 5FL3A 2WWFA 2JLVA 3O8CA 4EAQA 3N70A 4US2R 2QU8A 1F60A 3UKDA 4M1OA 4Q7JB 4OQNA 3NDPA 2FSFA 1F2UA 4DHEA 3T1QA 2Q21A 5JWOA 3FHOA 4CT4B 4P4UA 4MDEA 1F2TA 1ZUIA 2CEAA 2QPTA 2ODBA 1ZRHA 2ZAMA 5KDLA 4B34A 4CEJA 3KJIA 3CONA 2P3SA 4LV6A 1EFUA 2W58A 3IILA 1P5ZB 2RMKA 4LBVA 3AV0B 1E79A 2ODNA 2WZQA 1OIVA 1KMHB 3NEYA 4HAVA 2OLKA 3KUCA 3RAPR 5SZIA 3TE6A 4KFSA 4JYCA 5KSOA 1R5OA 2WWXA 4XSGA 2GDJA 5KNDA 5SZHB 1RJ9B 4EFNA 2V3CC 2EQBA 3CUEF 4IDOA 3I61A 2WKQA 4RJLA 1LS6A 1KMQA 2Z6VA 3VMFA 1WA5A 2XTMA 4LBZA 2Z4RA 5JSZA 3K9LA 2JIZA 1ZU4A 1BMFA 2F1JA 1XJ0A 2JAQA 5SZKB 1CLUA 3NVAA 721PA 1T91A 4KV9A 1OH6A 2XTNA 1GDDA 3PVSA 5CK5A 3WYGA 2H17A 3NC0C 3BJIC 4JKIA 4ERNA 1U2RA 5DGXA 4LSGA 3X1DA 3HYRA 4KVGA 2CLSA 4JVNA 3TQCA 4GZLA 2QPAA 3B1XA 1LF0A 4W7SA 3B1YA 3HU1A 1N2CE 3PFIA 4EPXA 5B64A 3AVTA 1U0LA 2GEDA 3GEHA 1Z5ZA 2QAJA 3DM9B 4DVGA 3U7HB 1P60A 1HUQA 1XBTA 3ZS9A 1MRNA 1YZQA 2VTKA 1W36C 1AA9A 4NPHA 4QC2A 4UNQA 3X1XA 1NJFA 1GKYA 1N6RA 3UWKA 4K8OA 2QQEA 3ZZ0A 1G5PA 3BFXA 2QL6A 1V5WA 1OPXA 1FMLA 1P75A 1K8RA 4HB0A 5GJVC 5JS8A 4MA4A 3Q3JB 4AURA 2ODWA 1Z8FA 4P4SA 3MJHA 4ZCLA 3BH7A 2VPPA 1IN7A 1RRGA 4LHWA 5J4KA 1NRJB 4TMKA 2JJ8A 1TL7C 4OHWA 1IXRC 3LLUA 3SHWA 5L3QB 5F98A 3GFTA 3K0AB 2C9OA 1G4AE 3GJ4A 4B71A 4B44A 3SDZA 4Q66C 1M7HA 1OE0A 4ACBA 1E2QA 1OXSC 3CH4B 4M8NE 2JLWA 3K8YA 4OYHA 2O8FB 3H86A 3L0SA 2W2TA 3K0FB 4YMTA 4MKGA 3ZJYA 2HJVA 2NGRA 5FBRB 1E9FA 4MKFA 1M1YE 3ZD6A 1G64A 1G1MA 3U5ZB 3KKQA 4A9AA 1DE0A 2F1IA 5E7IA 3UANA 4EPWA 1Z3IX 3BRWD 1DG1G 3ICEA 4C3ZA 4F4JA 1U90A 4NTZA 4W5JA 2J0UB 3BIFA 4J0QA 1KY3A 2XZPA 4PX9A 4US0R 1NBMD 4G3XA 4LHZA 3RC3A 3ZD7A 2ZSAA 4JL5A 4LI0A 2PLRA 5ELXA 1JI0A 4A8JC 1AIPA 2IXEA 3LY5A 4WZBE 1XPRA 5JEDA 4TYQA 4B75A 1N5LA 4O2RA 5J40A 2ONJA 2ZRLA 4HUTA 2QP4A 2AWNA 2D3WA 5KSZA 3PUZA 5FBLB 1R0XA 2RGNA 5SZJA 5JMTA 3T5DA 4B48A 4TMTA 4M9QA 2ZR0A 4PZZA 3KDSE 2XJ9A 1CP2A 3N2IA 4NCIA 4PO1A 3NC1C 2QT0A 5EXTA 1Z6XA 3FFAA 2QBYA 1HY3A 4IKEA 3KQKA 4ZIRB 1KMHA 1XD2B 3GEIA 4JBWA 3FMOB 1E79D 3HPRA 1US8B 3PITA 1KI9A 5FBQB 2DHRA 3QOFA 1N6IA 1YE8A 1E6CA 1PUIA 4LPKA 3TAUA 3OESA 4C0BA 4OBEA 5D3MB 1R0YA 2ZJOA 2QTFA 1QVAA 3E1SA 4LV5B 2V6IA 3PR1A 4NZYA 4D4KA 2QROA 4TYYA 2JCSA 1KIMA 2QSYA 2ZRMA 1D2MA 3U60B 2IL1A 3EPLA 2JIZD 1Q1BA 1BMFD 4LK2A 2WIAA 3UIEA 5HCIA 1RW4A 3V9PA 5AR1A 1DOAA 3QPWA 3A4NA 3Q8XB 1G5TA 4BUJA 2IUSA 1EFTA 3EA5A 4P4TA 2BJVA 3O8RA 3AUYA 2J0QA 1ZM2A 4V02A 2IA5A 5DN6D 2Z5FA 3A1TA 5JLJA 1SZPA 4JJZA 3RRZA 3ZVRA 2X19A 3DVLA 4MRPA 2EFEB 4R7ZA 1X3SA 3K0SA 3MRSA 1KGDA 1HEIA 3CRMA 1MRSA 1NIPA 1X8LA 2ZRFA 4LHVA 1Z08A 2Q3HA 3TK1A 1E2NA 5FR2A 2JA1A 3GLIE 5JWRA 2AXPA 1OXXK 2OESA 1MO5A 2FOLA 2QENA 2WKRA 3BH6A 3QE0A 2OBNA 3R9IA 1HTWA 4LC0A 4H9GA 4M4SA 4ZCMA 4D26A 4UXIA 3VNUA 1XTQA 3CM0A 3LQRA 3PQCA 4IVQA 4Z8YA 1D9ZA 2BKUA 2FA9A 2K5UA 2JLRA 3CRW1 3K09A 1UEIA 1IN6A 2OBLA 4Q48A 4CDGA 2CK3A 4Y0VA 3HPQA 4GRAA 4ITRC 5JZVA 3K0AA 5TMPA 2ODEA 1KDTA 3CWQA 3VR5A 3W3ZB 1OJLA 1GRRA 4FCWA 2DFTA 3A37A 1OKKD 1QHXA 4PR0A 3RS4A 3GLIA 3HU2A 4QGFA 4R2HA 4AKEA 3LFUA 4IXNA 3K0FA 2CHQA 2F1RA 2ZTSA 4IXMA 1CXZA 1E9CA 2IYWA 3VTKA 5DHAA 2VHTA 4YXWA 3QEOA 2F43B 3SJCA 3P1JA 4CIDA 3TQFA 4A4DA 4BZPA 5AUNB 5B58C 1T9HA 2XB4A 2MSDB 3WHLA 3DDCA 3VR6A 4JLKA 2PZGA 3JZAA 1G3QA 3QKTA 1XPUA 2PL3A 3W9YA 4BWYA 1E2LA 2I1VB 2R65A 3G5UA 4A36A 4R98A 3ECCA 2WAYA 1KO5A 3A58B 3W8NA 5KHOC 4QL3A 2TMKA 3NBFA 3U44B 1RZ3A 3CR8A 2HF9A 5B2ZA 1E96A 4PQFA 2JLUA 5FOWA 2J0VA 1CBUA 2HXSA 1KI2A 4ZDJA 2CJWB 2WJGA 1YR7A 3UPUA 3ADBA 1H8HA 4OHXA 4DEYA 1NN5A 2VRWA 4QJ3A 3IPYA 2BMDA 2A5DA 2BHRA 1G20E 2BVNA 5JWHA 1NN0A 1NLYA 4ZIRA 4Q1BA 2GXSA 4HAXA 1XEWY 3RRNA 5FBWB 1RIFA 4QRHA 1OFTA 3A1UA 5KU1A 1FPMA 1U9IA 2FH5B 2OO7A 3B1ZA 3KXKA 2WSSA 621PA 1TNDA 4X8HA 5EUMA 3ASYA 1XZQA 2MSEB 5D3MA 4LHXA 3VR4A 5C4MA 3EZ2A 4OKSA 4W9MC 3L8ZA 3MSXA 1UDXA 3TRFA 1KDOA 4UKDA 2O8EB 4HUQB 1JAHA 3T35A 3S1AA 2NG1A 5CIQA 2ZROA 2VO1A 4HB4A 2ZE8A 2VEDA 3CF6R 4Q4JB 2WBLC 1KAGA 3DOFA 2CVFA 1TQ4A 1EFRA 2IS1A 1OB2A 4Q4AB 4X8MA 4C2UA 4Q1EA 2FSHA 4IOJA 1Z0FA 2CVHA 3BBPA 3M0EA 3THXB 1G6OA 4AKIA 2QP9X 2CL6X 2BMFA 3QNUA 1M34E 2I4IA 2QMUA 4DSOA 4G5SA 4HB3A 1KI6B 2VF8A 4LC1A 4LJ5A 3RS3A 3REGA 3U6KA 2GXAA 3FE2A 1NKTA 2WWYA 2H18A 1DAMA 3TH5A 1OIWA 3KJEA 5CB6A 2IBMA 2RGNC 3C8UA 3QSYA 4L16A 4HZUB 3W5JA 1CF4A 1JPNA 2O8BA 5TY0A 2ZRJA 3Q5EA 4AK9A 3GLHE 3VX4A 3I8XA 2PLFA 4LY6A 4DCUA 4Q9LA 2OM2A 1ZINA 4LOAA 5KPDA 1L4YA 2BMEA 1IXZA 5EXPA 5TB5A 3X1WA 2DY1A 1E2JA 4BRWA 1Z07A 4KFRA 1MO6A 2ZJYA 3WNDA 4Q7KA 4K81B 2V9PA 4TSFD 4NYJQ 4TLEA 5CK4A 4H1UA 4RY2A 3K0CA 1DEKA 2QMOA 2QRZA 4M2LA 4JT2A 5FUWA 3GJ6A 2IS6A 4LYAA 3CZQA 1J90A 2YNMA 1W0KD 4DIEA 5IK2A 1YZUA 4DKXA 3LBHA 1N3BA 2NZJA 3EWAA 3TMKA 5FPKA 4Y0AA 4DRZA 1QG4A 1T5IA 2IXFA 3I73A 4XVUA 5DI3B 1NMYA 4BFUA 4DSUA 4B2LA 4EPTA 1R2QA 2F43A 5CDFE 3GP8A 2O0HA 1E69A 1ONBA 1SVOA 1JB1A 3EW9A 3U61B 2N1BA 1KOFA 3A8TA 4HDCA 4DC9A 2ZI6A 4FXPA 3RABA 4C0KA 2N42A 5A5GA 2DWPA 2ZRIA 4KXFB 5C18A 2GTPA 1A82A 2PZFA 4I1VA 2ZU6A 1E0AA 3WXMA 3AKYA 3D31A 4OJKA 1JBKA 4GI7A 3KKMA 4LYJA 2IS4A 2WJIA 3O8DA 3ND9A 4MGKR 2PEZA 3SE0A 3TR0A 4CEHB 2RGEA 3CBQA 1S9HA 4DDUA 2NO6A 5JS7A 3QXXA 1PZNA 5FUYA 3TJZA 2AHOA 3C41J 4FIDA 1IOZA 2CJWA 3K09C 4O25A 4FINA 3BXZA 1J2JA 1Z0DA 2O0JA 1E0JA 1H8HD 5KDDA 1WCV1 2ZJBA 1XMVA 2WSMA 2ZRCA 3LAWA 4ESVA 1DPFA 2IX3A 2YWHA 1S96A 3LRPA 4HSEA 2QN6A 1KDPA 1FNNA 1X8KA 4F92B 2DFKB 421PA 4O3MA 2IYQA 4F4IA 3KX2A 2JLZA 3AH8A 2WSSD 4JVLA 3SI7A 2EU8A 4WXPA 3WP0A 2REBA 4WW0A 2WWHA 4LUCA 1OH7A 3MGCA 3MWLA 3TUIC 3ZZUA 4ZI3A 3QXJA 1X86B 3BC1A 1UBGA 4PTLA 4HUQA 1GAJA 4QXAA 5JJKA 2W2XA 4V03A 1EX7A 1AM4D 2CL0X 3WYAA 3ZQJA 1EFHA 1F48A 4Q9IA 5FPSA 2KSQA 4PO9A 2NMVA 4DIDA 4BLQA 2A78A 2FG5A 2GVZC 3SHFA 3QF7A 1N6HA 4XTCS 3VR2A 1Z2CA 1PV4A 1T5LA 3G0HA 1E1RD 4WXRA 1AQYA 2D7DA 2IXGA 2FN4A 2C5LA 2QI9C 4FWTA 4C30A 4BASA 5LPNA 1W47A 1NP6A 1KO1A 4Q9KA 3LNCA 4MRNA 4WBSA 2Q3FA 3U3MA 3A4LA 4R2IA 1WBBA 4JVSB 1HE1C 2YC4C 4MUBA 3EC2A 1DAEA 2BBOA 2ECKA 2O5VA 3U7EB 2XNSA 1VIAA 4IOLA 3BS4A 5ANRB 1U9IC 1A5TA 3EG5A 2XZOA 4Q7LA 5C46F 2EVWX 3B82A 1VYUA 3TR5A 4TTPA 2XGJA 2H7VA 2KBEA 2NO7A 4I81A 3VX3A 3RS7A 4R71A 2NIPA 2ZI9A 1TEXA 2GNOA 2ZSDA 2ZITA 4MYTA 3RVBA 3VAAA 1R7RA 1C1YA 3TGPA 4CVNA 1SVIA 2IHYA 5CITA 1E94E 4NBSA 3A4MA 2CNWA 1YHNA 1GKUB 4M22A 5J4VA 1FTSA 1E3MA 2D4HA 3M6AA 1G7RA 4KO8A 3IEUA 1BIFA 4HLCA 5JBQA 3AEZA 4JLBA 4YMUA 5FPTA 3LLMA 2XTZA 4GMDA 2AR7A 1KNQA 4IOMA 3B5JA 5IK2D 2PCJA 4UNPA 1J99A 4HATA 4UJ5A 1KKMA 2AKYA 1QHIA 4G01B 1JR3E 5EP4A 1II0A 1SHKA 3EIHA 4M1SA 1I4LD 2RGXA 2RAPA 1YZNA 3RWOA 3B7GA 5DO9A 2AXNA 3LDAA 1A1VA 4FI3C 2XOKA 4IOKA 4DB4A 3TVTA 2OCBA 5GVSA 2G0NA 1DBSA 3WY9A 1QVRA 2ZANA 2YV5A 4LX0A 2VF7A 3NKVA 2AFIE 4PHHA 4NCNA 1QZXA 2VHCA 1FUKA 1T8UA 1ZD8A 1TQ6A 4RD6A 2CHGA 2HCJB 4FMCF 5AUPB 1W4BA 3QQ5A 4CT5A 3SJBA 2JJ1A 5CJPA 4EKDA 4A15A 3IHLA 1XJCA 4C0LA 3LH5A 3GFPA 2J9RA 3K9HA 4KYUA 1TAGA 2XJ4A 1U8AA 1Z0KA 4Q01A 3KFXA 4TLCA 1VHLA 4YLGA 3B1VA 1OHHA 4PSAA 4TWZA 3P32A 1T8TA 5IRCD 4S35A 3HDTA 1CJMA 1X1RA 2BOVA 2XEXA 1Z6TA 1P9NA 4JJKA 4XSHA 3RNLA 5KO2A 1XD8A 3SOPA 1YR6A 1ZJ6A 4KVAA 4DLSA 4JYBA 4URXR 2ASEA 2FFBA 2CCJA 3AF4A 1NSFA 1T3LA 2HV8A 1KSJA 2WJYA 3AF1A 1OH5A 1P73A 4DCTA 3KQLA 3WBKA 4NONA 1XRJA 1VG0B 4C0SA 3WNCA 4YQFA 1UKVY 1IY2A 1G7TA 2PT5A 4TYNA 3I72A 1I2DA 2XZLA 4MQBA 2V7QD 4QJ5A 1ZC3A 4B3XA 5AUQA 5EXXA 5FTKA 3KQHA 2QA5A 3QXCA 2J5XA 3SEAA 4QNMA 3V00A 1NN1A 4DSTA 4I1UA 1ZC4A 5D3QA 3NTUA 4DBLC 3K0EA 4DDWA 5F2EA 2WWIA 3GLFE 3KQUA 3FYHA 4H1VA 1DS6A 1UPTA 2EYUA 4KLNA 1SKYE 5G3YA 2IWRA 1QBKC 3BERA 1AK2A 4TTQA 4KODA 5DSZA 2XB2A 4TT3D 1YZKA 3QI2A 1KI7A 1EG7A 5KNCA 2VP4A 4V0KA 2DB3A 3KKPA 3A1WA 3LXRA 2IYVA 4OI0A 3EARA 1AS2A 4BZQA 4V0OA 4Q1DA 2BJWA 2WOOA 2IYXA 3R8FA 1J70A 3HU3A 2P6NA 4RZ3A 3VHLB 3I5XA 1W36D 1IAQA 4KU4A 4Q9HA 3PXGA 4QGAA 2ORWA 4C7OB 1TU3A 3BWDD 4OQLA 2J87A 3PUVA 5BN3A 3GLFA 1IY1A 1KK1A 3I3SR 3OEHD 3RRYA 4B35A 4JLJA 4UNRA 4XD7D 5J47A 3QKSB 4S2EA 1ZU5A 2C03A 1QHHB 2ZVPX 4BLOA 2JLXA 4E22A 3UXMA 1W5TA 1Z0IA 2HLDD 4N0EA 1P62B 3KFVA 4NYJR 1H65A 1E32A 3L43A 4NMMA 1OT3A 2C96A 1VTKA 1E2DA 3QKRA 3SBDA 2Q3MA 5KYKA 1XJQA 1II8B 3W6NA 3ZDQA 2XOKD 2WMNB 2ZYTX 2W6JD 4LJ4A 2OEPA 1KK0A 3SN6A 1DTSA 3GMTA 2ERXA 5IT5A 2ZYUX 1N5IA 3U2QA 2P6RA 3E70C 1P9WA 2JLSA 3VNVA 1S4QA 1XXHB 2VSXA 1WP9A 3GJ3A 4D80A 1R4AA 3JZMA 4K46A 4PC3A 5JJIA 1C4OA 4DUGA 2JJ1D 1W0JA 5TARA 5M04A 3VR1A 5FOVA 2PZEA 1JR3D 3IUYA 1SXJB 4XWOA 1G16A 3TKLA 2P2LA 4MGZR 2RH5A 1E2MA 1RRFA 2IW3A 4BPBA 1Q22A 2YYZA 1II9A 3EZFA 4NYIQ 2QMHA 3J81k 3K70B 1TQDA 2QE7A 1HV8A 3TSZA 5DI9A 3EIEA 3I32A 1UDWA 1IONA 2ZAOA 3JVVA 2ZR9A 1J7KA 1GNPA 2IC5A 5FI0B 5H70A 2JGNA 2AD5A 2MSCB 3MWKA 2WJHA 1TQ2A 1YR9A 2CBZA 3IDQA 1XU4A 4P33A 4XVQA 3QIAA 3ONWA 3I5YA 2OXRA 1L7VC 3FFBA 2QAGB 2PMKA 4B76A 1JPJA 3KZ1E 2GCNA 1YU9A 1NMXA 2W6IA 4PAMA 1E1QA 1TF5A 5EXSA 3L82B 1XWIA 1AGPA 1M6NA 1G6HA 2GCOB 4C0AC 2ZSFA 1XEFA 1E0KA 4IRUB 4DT1B 1GIAA 2G88A 4L4UA 3H84A 4B6FA 1M7BA 2IS2A 4UQOA 3OIUA 1ANKA 4I99A 3RDPA 4PXAA 4HYYA 1GZSA 3QBTA 2AN9A 4M53A 4RKFA 4DLUA 5CJ2A 3FMPB 1SHZA 2EW1A 4Q1AA 3TIFA 4GFDA 3TUJC 1GRNA 1CIPA 4Z51A 3CRVA 1P2UA 1JAIA 3EA0A 5FR1A 4AYXA 4D0GA 4DCVA 5JCZA 5FTJA 3CRRA 1HURA 4JLPA 5TVKA 2WM9B 4C7OA 4PPFA 4Q18A 3WMEA 4QFMA 2VIIA 3AUXA 3FB4A 2JLQA 2Q9AA 2OZEA 2IF0A 4A6XA 4KJZA 4LWZA 4QKQA 3VKHA 4ABYA 3B2EA 1GFIA 1Q1EA 2Z83A 1Y3AA 2UVQA 1RJ9A 3K9GA 3B6EA 3QKSA 4TTRA 1IQPA 4DDVA 1Q20A 1QHHA 1GKIA 2ZS9A 4FD2A 4E5UA 4JL8A 2R6FA 1TPZA 4PC7A 4OHVA 3RS5A 4DCSA 2D06A 4ON9A 1DO2A 4PC6A 1KSFX 5JI2E 1I2MA 2DPXA 1XP8A 2F3TA 3OE7A 3U7GA 1JQJC 1VHTA 4EUNA 4EQ6B 3CO5A 2DYKA 4ZDKA 1II8A 3KUDA 4M1KA 5A4JA 1UEJA 1BYIA 4GT1A 5BQ5A 2OUKA 4WAUA 2OE2A 4RD1A 1E2EA 5J4YA 1ZIPA 3SQXA 2ZRDA 4HDOB 3UK6A 3WHKA 2C04A 4XJXA 2HCBA 3ZQ6A 1XXHA 3EZ6A 3B1WA 3EC1A 3QPVA 1MO3A 1VCOA 4IDQA 4YC7A 4DUGD 5E7MA 2C78A 4L5BA 4W5HA 1W0JD 1VCIA 2ZJZA 4NCHA 3ADKA 2ZJ5A 4B47A 2OILA 3SNHA 1FOEB 4I4LA 2C99A 3DOEA 4KBGA 4QGHA 4C0HA 2BEJA 5AJYA 4OL0A 4EJSB 4PSVA 1EWRA 1O3YA 2QE7D 5JECA 1RRPA 4NCJA 5TDHA 1VYVA 3QXHA 2ZUDA 5L3QA 1SVWA 1E2HA 2ZREA 4M9XA 2XX3A 4JLVA 4FW9A 4HB2A 3KB1A 2BM1A 1UKYA 1R5NA 1QRAA 4B2PA 2O8FA 3I8SA 2NO0A 3OAAA 3EIQA 3ZVMA 1ZVQA 2QAGA 4A1FA 1B23P 5GVRA 1AS3A 4Z8XA 4KBFA 3GJXC 1RRCA 1XCPA 2R8RA 4PPGA 4OHYA 1GL7A 4OK6A 1NF3A 1Q21A 1GRQA 1YRBA 2CL7X 2W6ID 2WAXA 1AZSC 1E1QD 2OHFA 2G1JA 1LB1B 2GCOA 1IHUA 1KI1A 1VG1A 2VP0A 4KCGA 2J0UA 5TXGA 4W5WA 2Q6TA 3NWJA 1MT0A 3VHXA 3QENA 4DWJA 3B9QA 4FMCB 1E2IA 2ZR7A 2ZE6A 4IFBA 3EX7C 1TF2A 4RD3A 2H16A 3AVUA 1Z83A 2V4ZA 2ZU0C 3BB4A 5J4HA 2C9CA 1J8YF 3WRYC 2QGNA 1VECA 2GJ8A 3M1IA 3SYLA 1Z0JA 2FFAA 2GILA 2VSOA 1R8QA 2G1KA 3G82C 3LA6A 4TN1A 1Z6AA 3R9WA 1I4DD 3OFNA 3IQXA 1KKLA 2GXUA 5CLLA 4KFTA 1Z0AA 2UZIR 4BLTA 3QF4B 5FPYA 1XD2A 1W4CA 2ZRNA 3EPJA 4L9WA 3T5GA 1SGWA 1US8A 1P2TA 3GQBA 3P27A 4TQAA 1ZAKA 5KSYA 4KYIB 4ZDWA 2J0SA 2OLJA 3FHTA 1RPZA 1Q3HA 4MRSA 1W44A 3WRXC 1VDZA 3ZVNA 3C5CA 3PEUA 2ONKA 3DKPA 3T61A 1PVOA 4B33A 3DHWC 3VR3A 3NEJA 4OI4A 4A0GA 1L2TA 2QP3A 4RD0A 4DLYA 1FL9A 2B8TA 5IF9A 1GNRA 1KI8A 5K8IA 1ELOA 4CRWB 4OJQA 1WQ1R 3MJRA 4PHFA 2AWOA 4D81A 1NLFA 1KYIA 2R6AA 3P26A 2OT3B 2FSIA 3WNBA 4XVRA 2D2FA 3CKLA 3T1OA 1S1CA 5F9FA 4TLBA 2JLYA 1PLKA 4UXHA 4FMBB 2HXYA 2A5YB 3LQQA 3OEEA 2QNRA 1F6BA 1OXVA 5FOUA 3QY0A 5EE3A 2ZRAA 1XFAA 1OW3B 3SFVA 2ZXUA 3AVVA 1R6BX 3AVPA 4L15A 5JHGB 4KFUA 3KXLA 5JI3E 1YZTA 4U5XA 3CNOA 5GJBA 1UJ2A 3BB3A 3IBGA 3VU9B 1S3GA 3C16C 2RGAA 2XITA 2YOFA 4TYPA 1KJWA 2P67A 4MYHA 5KDOA 1G9XA 2HDNB 4PANA 4CYMA 4MKHA 3GJ5A 3NBXX 2Z0MA 1TF7A 1MV5A 1X1SA 2JASA 4ZI2A 1E2GA 3R7WB 1R5BA 3QBVA 2D2EA 3AB3A 1XMIA 1XD9A 3BFVA 4YMWA 3TVDA 3UG7A 3TLXA 4EJSA 1JNYA 5AWFC 4D0NA 3U4QB 4P0TA 1MOZA 1N5KA 2ZQ5A 2FEMA 3EPHA 821PA 4AG5A 4AI6A 2CK3D 4CGZA 1KSHA 3NBZC 1G7SA 2Z43A 4DJTA 5IHPA 4TZ0A 1HE8B 1EESA 4YDSA 2CDNA 1MABB 4NYIR 3SS8A 3T15A 3Q9LA 2XSZA 3OAAD 3ASZA 2D74A 4YONB 1I4TD 3LVQE 2ZI4A 3Q5DA 1YQTA 3PV0A 2PMDA 5H1YA 1OXUA 1LV7A 5B57C 1GILA 2H8KA 3SZRA 3AVYA 1ZIOA 4YXWD 2V8OA 5CLQA 2QSZA 3HP1A 5G41A 1WF3A 2O8CB 4B3CA 3NG1A 4G0NA 1SVKA 2A3RA 3CPJB 3X1ZA 1QG2A 4NE2A 4Q4LA 4WOPA 5BN4A 2ZUBA 2EFDB 1CJTC 4G5OA 1AGRA 2BC9A 2NO1A 1ZUNB 2OFXA 3BH0A 2ZI7A 3C7KA 3U7FB 1RFLA 1MKYA 2W0SA 3U44A 4URZR 3WBJA 1DVRA 2YWEA 2Q0HA 2Q9CA 1Z29A 1UM8A 2WOJA 2NZ8A 3W5IA 3PJRA 2OG2A 4TL7A 3D6TB 1P9RA 1F5NA 4Q02A 4OHZA 1N25A 1B0UA 3THYB 2WVJA 3EZ7A 1WBDA 3OFND 1T3SA 2GEUA 3LWNA 4IHQA 2FJUA 4BEBA 1AS0A 4JBYA 5AJVB 4KITB 1VYTA 2HT6A 4D25A 2UKDA 3OF5A 2GESA 1GWNA 1YZGA 2CE2X 2PX0A 3GLGB 3FMFA 2ZE7A 1FMJA 2HF8A 2QG6A 3KXIA 2H5EA 2OSBA 3E5HA 2BWJA 4XH9B 2QAGC 2C77A 4LCBA 3GJ8A 4MUAA 2BBWA 5G40A 5E7JA 5FI1B 3ZYCA 3F3YA 1G8PA 2SHKA 2ZRBA 4I1OA 3X1YA 1DAHA 2PEYA 4LJYA 2R9VA 1RE0A 4CF7A 2O8EA 3KJGA 2WPDA 5KTYA 5GJCA 3NHBA 4A8JB 2IWHA 2FWRA 4IEEA 1G8FA 4MH0R 2EFCB 3CPHA 1M8PA 4Q4JA 2CLCX 2DFNA 2ZRPA 3BE4A 4MYUA 4RZ2A 4Q7MB 1CR4A 3AQ4A 4G5GA 4I1SA 4BLSA 3FWYA 4PPNA 4Q4AA 1EFRD 5DYIA 2WV9A 3CIOA 2FPMA 2OAP1 3L0OA 2AFHE 3THXA 4TMXA 1FQJA 3KL4A 3PIRA 1KI6A 1G3UA 3WYFA 5FPHA 5HE9A 2PT7A 1O87A 2E87A 4LYHA 4LBWA 3AP1A 3KJHA 4HZUA 2WHXA 4ZO4A 2QEQA 3PCRB 1VMAA 5TV2A 3ZLJA 2CHVA 3VU9A 4UNSA 2LCFA 4CEIB 1XTRA 4DSNA 3C14C 2ORIA 4BFWA 4G5RA 3AF0A 1XB2A 2ZYVX 3LW7A 3MFYA 4MKIA 1S2MA 2QT1A 4M9ZA 3R7WA 2AK2A 4LJ8A 1N6OA 3A1VA 2IYLD 4C2TA 1HT1E 2IYTA 3DKVA 3T06B 3AF3A 3U4QA 1GOTA 4F38A 3CF2A 3MLEA 5KNBA 2F9MA 3EWSA 3P20A 3FGNA 2VH5R 5DIFA 3AGPA 3SU8A 1PUJA 2VP2A 4AG6A 1L4UA 1OH8A 4B74A 3B9PA 4NYMQ 8OHMA 2C8VA 3RWMB 4WZAE 4V0MA 4XWAA 2VL7A 4ESHA 4DB2A 4NHOA 1YKSA 2J41A 4HAYA 4B6EA 2XSZD 3FDIA 5DI3A 1CTQA 1UBCA 1AJEA 1RKBA 3D7MA 5KOYA 4NU0A 1DARA 1F3OA 3CR7A 2ZYWX 1U98A 2O8CA 3W90A 1Z28A 3ZZTA 3LVRE 5CYOA 4E03A 4YMSA 1FZQA 1T3HA 3K1JA 2C9YA 1GM5A 1D5CA 5E95A 3EXAA 5EQTA 2P5SA 1ZNYA 1Z06A 1RVDA 1G3RA 4Q1FA 5EE0A 5EE9A 2FEOA 3A6PC 3RLFA 3U6BA 1KI3A 2WJVA 5FH9A 2ZS7A 2FU5C 4CEHA 5EJEA 3GFOA 1EWQA 4BFSA 2GCPA 4EJSC 3KTAB 2PJRA 2HUPA 3THYA 4GSYA 2J46A 2YWGA 3B8HA 2BBTA 3LW8A 2VSFA 4GP6A 3AF2A 2HYIC 1JQLB 4A2QA 4D82A 3W6OA 3DPUA 3KKOA 1EXMA 4Q1CA 1ESNA 1FTNA 2BEKA 4ZKEA 1IN4A 1QDEA 5JCPA 3H1TA 3PUXA 3L2OB 2GEVA 5JEEA 3GLGA 3H4MA 5HCNA 2R6DA 4JZKA 3NXSA 5FFMA 1KJZA 1G7CA 3GCGA 4DLRA 2DR3A 1Q12A 1OSNA 2BCGY 4PHTA 3UMSA 1GL6A 5AK0A 4EPVA 3SBEA 1KI4A 2WPDD 4E09A 5J4LA 2R6GA 5C1BA 1JR6A 2EYQA 1E4YA 4PAOA 1W2GA 2O52A 1HQCA 1OIXA 2ORVA 4U00A 4U02A 2VHJA 1D6JA 4KAXA 3P4YA 3TW8B 1NSTA 4GDFA 5J5CA 4PZYA 4A6PA 4G1UC 1JXOA 4D6PA 1G18A 1JALA 2V54A 3Q7QA 4KSCA 5AJXA 1CR0A 1G41A 1XCMA 1Z6GA 2VLIA 1NLZA 3MCAA 3NIBA 4P32A 1E2FA 3TSWA 2ATXA 2YWFA 1M2OB 2WKPA 1EK0A 4GZMA 4CEIA 4AKHA 1SVMA 1NJGA 4AYWA 1NG9A 5FOSA 4ZCIA 1UKEA 3C15C 1RC8A 1R8SA 1MH1A 1ZNWA 4TMWA 4QHSA 1QHSA 4YMVA 1OF1A 1KSGA 1IN5A 4JIMA 1E9BA 2GZHA 4EDHA 4TLAA 2LKDA 6Q21A 3VKGA 3DEFA 1NBMA 2FPKA 1E0SA 3NHAA 2QGZA 1JJ7A 4HAZA 1Q3TA 3AVWA 2I1QA 2EWVA 3HR7A 1UBFA 4FMDF 4JLMA 2CNWD 4LJ7A 2IYSA 2IF2A 2FFQA 1QHYA 2QTVB 2RB4A 2PCLA 1LS1A 2PX3A 5FOTA 4ZPXA 1K5GA 2B7BA 2PBRA 2B92A 1RYFA 1VG9B 4TMZA 1E9SA 1MO4A 4JSYA 4OQXA 4JVMA 1HQYE 3HYTA 4RZXA 3SJZA 2QRNA 5DHFA 5L3VA 3UMRA 4FN5A 2QBYB 3CH5A 2XNDA 3NH6A 2BM0A 3QPUA 1Q44A 2G6BA 1RYHA 4BRUA 2LWIA 1TTTA 3CX7A 4DXAA 4DDTA 1WE2A 3MUFA 1JXMA 4N3NA 4QG7A 3W34A 1GUAA 5BYJA 4M1YA 4F91B 4ILEA 2ZJ2A 3HWSA 3X2SA 2FGJA 1OFUX 2IK8A 4TL6A 3KB2A 5AJWA 4LJ9A 4P3YA 3U3KA 2YHSA 4DLZA 3IHWA 3EASA 2A7QA 1DG3A 1NNEA 1K5DA 2YZ2A 3SYKA 3TW4A 3V4FA 1XDBA 1HH4A 2ZETA 4LPSA 1T4GA 4BE7B 1HYQA 1T6NA 3KTAA 3QUSA 1NIJA 4UNNA 2IYUA 1LVGA 3RYTC 5HPYB 3AKEA 2J1LA 2P5TB 1FP6A 5K8UA 1ZNZA 2ZM5A 2AD1A 2B7CA 3BOSA 4BQSA 1KNXA 5DN6A 2G9NA 1S3SA 1N6PA 5C4GB 4A82A 1U8ZA 4IW3B 1G291 1MR3F 1OHHD 4II7A 4DZZA 3RC8A 4JLAA 1IBRA 2E1RA 4BFTA 1YVDA 2WWGA 2MMCA 3BB1A 4URVR 3I1FA 3BK7A 1BYUA 1P72A 1SVSA 2WWWA 4HAUA 2H57A 3C5HA 1CRQA 5EP2A 2C2HA 3RS2A 3N2EA 121PA 2VA8A 3T1TA 3GJ7A 4JLNA 1KY2A 2FSGA 4DLXA 1S0UA 1U0HC 1W5SA 4F93B 1BKDR 1S1MA 3E2IA 1LNZA 1OV4A 2X2EA 2FX3A 2RKOA 4JLOA 2VYFA 4IJMA 4PSKA 2BBSA 4URUR 5DLQC 5H68A 4MGIR 4IFEA 2EWWA 1XX6A 1OYWA 1NG1A 4PQRA 1HT2E 3CNLA 3PEVA 2XXAB 5FOXA 3T34A 1OKKA 4BLPA 1JEEA 4URYR 4GP7A 2QM8A 3GLIB 1W46A 5EE5B 1XMSA 4RFVA 3Q7PA 1XCGB 2W00A 2ZJAA 4MYCA 3NDBB 3CX6A 4D0LB 2J45A 1XEWX 1OFHA 5H8WA 1XTSA 2BIFA 1KO7A 3UATA 4JSTA 2YC2C 4CW7A 5CM9C 1ZM3A 3SYNA 4B43A 3R20A 4RVCA 3HR8A 1LW7A 2GA8A 3L8YA 4IDHA 1ZCAA 2AL7A 3B60A 1XTKA 3BGWA 4XTRA 2DFLA 2F6RA 3NBYC 3F5FA 3OIYA 4JLDA 1UAAA 2EFHB 3PEYA 4MRVA 2IUUA 5FUXA 5DNYB 3IIKA 5EZ5A 2GHIA 1GSIA 2GK6A 3CF0A 2QZ4A 4LDJA 4G5QA 2RGBA 1CR2A 5K8TA 1U0JA 1G5RA 4ACAA 1EX6A 4DLWA 5HE8A 4RD2A 1XXHE 1CR1A 3ND8A 4DCNA 2KBFA 3OHMA 4POAA 2QMEA 2CXXA 1G21E 3QVVA 2NOAA 1XMJA 5EZ6B 2V55B 2G3YA 1D8TA 3CRQA 1VKJA 2H92A 1NVWQ 4QOSA 3WMFA 2OV2A 3QKUA 4FCVA 1Q0UA 4KHZA 3SFZA 4NH0A 3TSOA 3U3OA 3ZS8A 1SXJE 3I62A 1CS4C 2REOA 1N0UA 2QTHA 4WVFA 1G8GA 2XNDD 5DYGA 1P2VA 1R0ZA 2GJKA 4NYMR 4WA7A 3SR0A 2BMJA 1KZGB 2PJZA 1ZM7A 2ANCA 2AKAB 5EP1A 4GMXA 1CJUC 1KDRA 1P61B 2WJJA 3DZ8A 4Q9JA 3QEJA 3ADDA 2WTUA
chains in the Genus database with same CATH superfamily
2CV1A 2PQ0A 1ESZA 3K9NA 3P5BA 4WZBA 5BNIA 5HR5A 2FR8C 3DMNA 3WWDA 3LX5A 2BTQB 5ELLA 3G9TA 5DHTA 4HWPA 4Y1RB 4DLVA 3DM5A 3F0TA 1VKZA 3KLOA 4J76A 1K3UB 2IX9A 2H1RA 3IKJA 2FSVC 3OZXA 4Y6GB 5L8VA 2FX2A 4UARA 4ZVKA 3RHFA 2HBRA 3E9ZA 1A2BA 1S9DA 2FKAA 3UCXA 2Y1CA 2OFPA 1G20B 2H1CA 4ZQCB 3WO0A 4EYKA 5JYBA 3AGQA 3NUQA 3DV0B 2BI7A 4GC5A 2IGTA 1PR5A 2HA2A 5F1PA 4F97A 4TVSA 4OQFA 3LBAA 2Z6QA 3C7AA 1TW2A 2X9NA 2X0KA 1I30A 4JKOA 3KALA 4RANA 1PQPA 3NW9A 3TAHA 3K72B 4UTRA 3GDFA 3RF7A 2QQ0A 1KBZA 3T7TA 5E4FA 3ITEA 2AF4C 2JJ2A 1XQVA 3DBOB 3NO4A 1UQRA 4PGMA 5DNEA 3ZHQA 5JHHB 3PQ3A 2GN6A 4LQDA 4G84A 5CP8A 1TJ3A 4FCTA 3TRDA 4C21A 2HC9A 5A5FA 4D98A 1ZM9A 1IPHA 3BMOA 3S2FA 4DPLA 4C4TA 1J9EA 1NYQA 3TNDA 2HW8A 4EOGA 3PX7A 2YH2A 3EUAA 4P36A 1P2SA 5IWAB 4R4JA 1BXRA 2GBLA 3DL0A 4M0LA 5G53C 2I2XB 2CT8A 1DXQA 4RENA 1G4UR 3NJRA 1B16A 2IYYA 3EUEA 4HS4A 2FVXA 2CZQA 1RHQA 2JVKA 1I3CA 1V7QA 4FJ0A 5D87A 5ALVA 3FNRA 4ZGBA 3UJ3X 2OQRA 1H05A 3ZBUA 4TSFA 1E8MA 4BNMA 4AMUA 4EIWA 5GADl 4F3TA 3OH8A 4MRRA 1JNXX 4ZQIA 1XMOB 1FS6A 4GLLA 3FSJX 1KORA 1LSOA 1NJSA 1ECJA 3KKNA 3LBFA 4HRYA 4MR7A 4PYNA 1K6MA 3RUAA 2EV9A 4UULA 1K5PA 1X9GA 3PD0A 4FLEA 5FBVB 2EG5A 3M9LA 3KZMA 1FF9A 3T8YA 4P58A 4F5DA 1JSLA 2YOGA 3BZBA 3EHEA 2J7PA 2Z58A 4B3GA 1XYGA 1H66A 1CR6A 1SA0A 5TRTA 2ONZA 1N2GA 3SZMA 2TMYA 4L0MA 2XY4A 1PJ2A 2FDCA 1TYEB 3LBIA 4RQBA 2FPLA 2YXDA 3FRJA 3GLHB 4J9VA 3UKJA 3P0HA 1O0BA 3GFFA 2BFDB 1QHGA 2GDZA 2VK4A 1YR8A 3FTQA 4IVRA 1MX1A 3BWCA 3F4KA 4PG8A 4FZ5A 4JHXA 1XZLA 3VFDA 3ASVA 1FXSA 1QZUA 4UNIA 5E6UB 1H2AS 4GNKA 4DABA 4DM4A 4OP1A 4EI2A 3B48A 3ICWA 3EVFA 4W5RA 2VSQA 2JI9A 1X42A 3BRCA 3MUEA 3Q41A 5D3KA 4CM3A 1OXTA 5LP6F 3KJQA 3PC2A 4HL6A 4AC9A 3QHAA 2BDTA 3WK4A 3EH1A 3B36A 3T5AA 1O6CA 2XV1A 3DW1X 4FP9A 2MTBA 1EVEA 3M4YA 3UG6A 4OB6A 3WGLA 3R9XB 5AFSA 4EJFA 1OLXA 2UYHA 4M6WA 5A02A 2EKLA 4KIWA 3ZHSA 2I4LA 1E66A 3WKAA 3FTCA 3UY4A 3N8IA 4OGKA 5H16A 5ISMA 1VJCA 1YT5A 2R7MA 3B13B 4KKXB 4Z1MA 1JDBB 1OX5A 4AXBA 1VPVA 3CVUA 1J21A 4P31A 1GNTA 2CNDA 1FW6A 2P65A 2QYSA 2YMPA 1TEHA 3OPXA 2NVUB 1P6XA 5EIBD 4EUEA 4G0UA 3OE7D 2D1RA 3ETLA 2I3BA 3PGA1 7GPBA 3QXSA 3COVA 4ASUA 1U6IA 1LEHA 1Y4SA 2ACVA 3H17A 3ZHUA 4B6PA 2VXYA 3L01A 3R0ZA 3W8RA 3OSUA 3GJRA 4PZDA 1ZICA 5E38A 4ARZB 5ICCA 5E3HA 3EWIA 3QVMA 1W52X 3FCUB 2O8NA 5LBTA 4Z7JA 1CU1A 1RXWA 4PQYA 1CKEA 4OQMA 1M66A 3P19A 1IXYA 4BZXA 1JUDA 3CW2A 4KWHA 2C5FA 3QG1A 4N8DA 2P9YA 4I66A 1THGA 2H3HA 1C50A 2WZBA 3HACA 3I4LA 4TWAA 2FZGA 3CUYA 4X3CA 3HP7A 4XEHA 4HYTA 5F33A 3UJ7A 2OXCA 4NICA 2MCFA 3IPRA 5CNIA 4ZV7A 1PWXA 3EXFA 1LBIA 4J43A 1FNBA 1NU8A 2GK7A 4FCCA 1L5HA 4CHGA 4ZCRA 5C2JB 5JXGA 4MV5A 1NVUQ 1GG5A 4EO7A 1S2IA 4DANA 2G28A 4TL8A 3DO6A 2IYZA 3EBLA 3MELA 3MRXA 2F7SA 4HD8A 2A5FA 3LVFO 2HRRA 2DFPA 4OXXA 3U26A 5HW0A 1SVLA 2Q2WA 4MVJE 1CNMA 3TBKA 1P91A 4PSDA 2VP6A 4KWEA 5SYNA 1MTOA 3CYFA 3KEFA 3EZNA 3HSSA 2INGX 3PK0A 2E21A 4G0QA 1A04A 1E7YA 2R48A 1U7OA 2PGDA 3LL4A 1NP3A 1X6VA 1R1DA 3IJPA 1IZ0A 5IVHA 1ZN7A 3MUOA 3Q72A 3ZXYA 5K0ZA 2YVUA 1TJ5A 2GXQA 1O89A 3G49A 1W36B 1CJVC 1E6UA 3KXDA 2QX8A 2I7XA 4O2LA 4YT8A 5LYJF 1T6BY 1OV6A 3JD3A 2HU7A 1P5HA 1V3UA 2LVBA 3IGFA 3GEPA 5J1SB 2ZI5A 1EVYA 1J2UA 1NP7A 4ALJA 2J9FB 4F7WA 2HT1A 1BCRB 2EARA 3TCNA 3NWBA 4DQLA 5LQAA 1PTKA 4ZVMA 1A4RA 2IHBA 3KQNA 3TD9A 3OTOB 2D5BA 4REQB 4LZOA 5DZSA 2FPWA 1GR1A 5JAZA 1PUXA 1T5DX 2PUJA 2UXDB 3CF4G 3V2IA 5JALA 4FZVA 2OCPA 3LXMA 4H1HA 4KSBA 5JFGA 1IH8A 2REQB 1EFCA 3L6EA 4HNGA 1RHMA 3OZUA 1QO7A 3PUIA 3UJNA 2WKWA 1L7RA 1B0AA 1SXJC 1I36A 1Z6YA 2NO9A 3DUWA 3VO1A 1YDGA 2E49A 3T6KA 1PDWA 1OI7A 3V3KA 5B7GA 1A9YA 5HQ3B 3N2KB 1SR8A 2W48A 3GQVA 4PBTA 4FWIB 3F7TA 3LC7O 1SPXA 3DR3A 5THQA 2TMDA 4XE5A 3MVEA 3K70C 2X14A 3KIPA 1FNMA 3FGZA 1F6WA 3HKDB 1HZZA 1BJTA 3IV9A 1FUUA 5JOQA 3I2FA 3WLSA 3G2MA 4BQPA 4EB8A 5LXTB 3DZDA 4C4SA 1XZJA 2NQ2C 4X24A 1OREA 2A84A 2JEOA 4OKIA 3HP4A 4E4YA 5CFNA 2P0EA 3NANA 3ZXSA 2OGTA 1Z73A 1U63A 5G4LA 2Q46A 3CG4A 3DYBA 3PHBE 3WE7A 3IXMA 3PXUA 5JG7A 4F71A 3DC2A 1UFVA 2BEVB 2HPAA 4IJ5A 1LNQA 1DGQA 3HCNA 3O91A 4OGLA 1XEXB 2AE2A 3R7BA 1QZZA 3U4AA 1LJ8A 3FCOA 1GN8A 4JR1A 2NN3C 1GCIA 2W4IA 4M1WA 4B7XA 5TS2A 1JLLB 3MLBA 1TCCA 5CDFA 4FYVA 3HUFA 2R6R1 3U3XA 2JFOA 1Y1LA 1OBFO 3OC0A 2XUHA 3GC6A 3C3BA 1RAGA 3L7NA 2ICAA 4QBIA 3CKMA 4K9RA 4IO1A 4PIVA 4DCMA 4YJGB 2A57A 3S7ZA 3I92A 3IPAA 2GWHA 1FVOA 2ZRKA 3PENA 4PYRA 4YHBA 4YRLA 1WUHS 4RC9A 3IPXA 2R1VB 3GJQA 2G83A 2Z4SA 1JX6A 3DZCA 3AHFA 3UOGA 5P21A 2B1QA 2XCOA 3WGKA 2XHZA 4FBLA 2EFGA 1R88A 4CMBA 4EI7A 4P98A 3IEMA 1IZYA 3Q9NA 1OA0A 5UKDA 1SKQA 1SRQA 3D6MA 4G41A 3QOWA 4PYKA 3ILVA 4B3BA 1ZG3A 2HB6A 4M60A 4S0ZA 1GO2A 1TEVA 3DE7X 1NW3A 5ALOA 5CCXA 1MZPA 3QA9A 5ALXA 3HN7A 3JRXA 3CX4A 1UXGA 4KQFA 2I67A 2VH1A 4LHEA 1RQNA 3VGJA 1PT8A 3E82A 2W2VA 5HKKA 2WD8A 3TJMA 3FHCB 4CL0A 3AKZA 4OUDA 2WT4A 1AN0A 5TGZA 4ZMBA 3MG9A 1OX6A 4OFWA 4MPDA 1Q2UA 3BD9A 3B6MA 2HADA 1Y4ZA 3EE6A 3DAHA 3UICA 2F9LA 3HNPA 3S8MA 1M0EA 4L0CA 5ALKA 4DV7B 1GPLA 4ECEA 1B43A 2Q4DA 5JNRA 4NC9A 1I4EB 1QONA 1COWD 1QS0B 2O3RA 3C3PA 1AKWA 3E15A 3H1FA 4FIZA 1DPGA 3GN1A 3PUJA 2R8BA 1HDOA 5C37A 2VYVD 1YKFA 2AQIA 3IUNA 4G0OA 2JFHA 2X77A 2Q99A 3PNQA 4U7FA 1RYEA 3WL7A 1QDUA 1T4MA 2WINI 4UATA 3P4XA 4LF5B 2FGKA 4FI3F 1DXHA 1ZBDA 2CDRA 5E9WA 2HK8A 1P1BA 2BFEA 2I4TA 1AC5A 1KVUA 2P2DA 3MIIA 3UJCA 4AWAA 5E4JA 1ZMTA 3S4YA 3DA8A 4RLFA 1DC8A 1OLSB 3MTJA 4H3VA 2I6GA 3GDWA 2B21A 4E1AA 1FSPA 3E3LA 4BFZA 6REQB 4W82A 4TZ6A 5LA6F 4D4LA 2BR4A 2B5OA 1CDDA 5ECGC 2Y66A 3ZWDA 4BFYA 1YGPA 3C24A 4TX1A 1ZM4A 4BDTA 2CMKA 1EXDA 5I7OA 1Q57A 1V8ZA 3WP1B 2VDJA 1AE1A 2UZ3A 5KYXA 3U9TA 1D9XA 2ATVA 2MMGA 4CIXA 4DC0A 2YXBA 3LOPA 2OCYC 4H7EA 3ZVKA 2WPNA 4QJ4A 4I5FA 3VJLA 3AVQA 3FPEA 4K7JA 2Q9BA 2UXBB 3ZIAD 1JQBA 2Q5IA 4ZVNA 1IJFA 2HA6A 4GOKA 4K9QA 3UFXB 2V6JA 4QEKA 5KJEA 4DLAA 4EPYA 3R3YA 1QH1B 4ZCQA 1FS4A 1WPQA 2B98A 1A7JA 4RZUA 5JSZB 2WF6A 2Z08A 4CU5A 4E5SA 2QD2A 2Y1OA 3IBYA 2Y1XA 4RIHA 2YJZA 5G4KA 1KAOA 1VLQA 1FFHA 4K9OA 2A1UA 5B30A 2AG5A 2WHYA 2VFAA 5IULC 1M6EX 4IH9A 2OO3A 1SEPA 2VP9A 3G2PA 3GL9A 3KBBA 4FFMA 4HQ0A 4IUDS 1DEHA 4OJNA 1TA0A 2W6JA 1WMSA 4WNIA 4E1BA 2E5LB 1JPUA 3CLTD 1T1GA 4ZTZB 3H5LA 3DULA 4OSOA 1L8QA 4DMFA 1B6TA 4L2IB 4G5HA 2RGCA 5G1NA 3IUPA 5KZMB 2RCNA 3B9BA 4TXHA 1FEZA 3T94A 2GHQA 2J6CA 3NXKA 5L53A 3OPNA 3SZ3A 3OA2A 2F67A 2VPZA 4XI9A 1VI2A 3PE3A 2X1VA 4PTYA 5ARDA 2WICA 4AS3A 1J1UA 4D4HA 3PRJA 4BNKA 2NTJA 3R40A 3DQZA 1A8UA 4IEIA 1PEYA 5DGDA 1U3FA 3GPLA 3GFVA 4AJEA 3TTXA 1EZZA 1JR3A 2A88A 3E53A 4X8OA 5BR7A 1GGNA 4C43A 4IZHA 4YN3A 5FPQA 5FHQA 2Y0CA 3LV8A 1ZD1A 1PQWA 5DULA 3SMVA 3SOZA 1UXKA 3MWYW 1NYLA 1H69A 1H8ED 1SOMA 3G0GA 5C9ZA 1SCAA 3LT0A 3QW4B 5K45A 1Z17A 3CRZA 3JAWB 2VF4X 4QHYA 4PAQA 4RESA 3H5AA 3KYDA 2OYCA 5ALJA 1XDSA 4CL8A 2A92A 4NBLA 1A98A 3IOMA 4IMPA 1DMRA 1JSRA 3C3DA 4XIGS 5CB8A 4BO8A 5K6AA 4N7BA 4OK3A 1M1UA 4OI1A 2ANBA 1SQSA 4PC2A 1U81A 3CGWA 4X1IB 2P7IA 2F1KA 3NATA 1U9YA 4FYJA 4U8HA 4MCHA 1AK9A 2JFQA 3A9TA 3JQDA 1PR0A 3UW3A 1RKUA 2VR1A 5C31A 1TW3A 2WAAA 4MR9B 3U1VA 1XWWA 2C58A 2QX9A 1ZYUA 5CW1A 4CUJA 5KQLA 4N3BA 3ZDEA 1WXDA 3GPCA 4QQFA 1E59A 4AP6A 2C3MA 5JDCA 4J0GA 1Y34E 3ZU3A 3MUNA 4ESEA 3YASA 4K6MA 2EGGA 3G7SA 4MP3A 1HG1A 2AK3A 5JISA 4LXUA 2ARKA 2NVBA 2BUCA 3O93A 4ZODA 4Z9XA 3ZQUA 5BW8A 1XFDA 2D7CA 2V5UA 1GP2A 1V9LA 2P79A 2YOHA 3PNSA 1P8JA 3IVGA 4KFCA 4NCKA 2KB0A 1Q84A 1LNSA 3HMQA 4LJAA 3TFQA 5KWJA 2IEDA 1RPNA 1TMYA 1XYYA 2E9SA 4ICIA 1WZIA 3H5RA 1O8BA 4WUVA 1DBPA 1ISHA 1KP9A 1DIAA 1WXHA 1Y7PA 3R44A 2AMFA 2W6OA 3IC5A 1KMCA 4GUDA 1L5QA 2GCEA 2LZ0A 3I6IA 2IEAA 3ZVLA 2HO5A 3LUDA 5KYYA 1NMSA 4RVNA 2HHLA 4EKNB 1QCDA 2FWAA 4EY4A 1J24A 4OKNA 3LCMA 2NQ8A 4US2R 1L1RA 2Z3VA 3RI3A 2YFHA 4M1OA 1XSEA 3UKDA 5C5DA 1YS4A 1N7GA 2WR8A 3NDPA 3OZTA 3OUZA 5CUQA 5F1KA 3GXOA 3ZCSA 1OPRA 4LFCB 4HDSB 3ER6A 1GPWB 3NZEA 2Q21A 4U7HA 5JWOA 4P4UA 3ADOA 2H11A 1ZUIA 3ZDYB 2CEAA 5IKEA 2ODBA 1ZRHA 4EYQA 4B34A 3IIIA 3H5VA 3C39A 3IOCA 3LO8A 3QFCA 4H60A 3KJIA 5TGTA 2P3SA 3AY7A 4MS3A 1EFUA 3N75A 3IILA 3RIYA 2HJ9A 4DARA 3FG9A 2P40A 2JAHA 3NEYA 1XL1A 3TRHA 4EG8A 1BD3A 2YJ6A 3BICA 3PDJA 2I2WA 2QQFA 3KEMA 3U4CA 5KSOA 2YIJA 1B2LA 4NLLA 1UBJS 4XSGA 1RAFA 1VJ5A 5KNDA 3O2SB 2FP4A 4EFNA 3ELUA 3QPAA 4IMJB 1LS6A 3PFNA 5BR4A 4EF4A 3VR4H 1W73A 4RGQA 1NBHA 2Z6VA 3RAGA 3UV6A 1WA5A 3A9CA 3ICOA 3OTQA 2BF7A 3F5MA 4RKRA 3IDFA 2JIZA 3OF3A 1NUTA 1BMFA 5TEVA 5L45A 1MJFA 4XGIA 3QLUC 1FP1D 2K4MA 1T91A 3L8CA 4KV9A 4OLBA 1K08A 1OH6A 1GDDA 3PVSA 4MWGA 3IP9A 2PZJA 3NC0C 4PLVA 1T5TA 4UU8A 2VHZA 3O1LA 1FFSA 3TNLA 4O2AA 4E5NA 2CLSA 4CKBA 3TQCA 3IJ5A 1NQWA 3JQAD 5EJAA 1JA1A 4M9CA 1LC3A 2EDCA 3DL2A 3B1XA 1LF0A 2IYAA 4W7SA 5D8DA 3JQ6A 1N2CE 3CLKA 3PFIA 4KSYA 3AVTA 4MUEA 2GEDA 3GEHA 1Z5ZA 2QAJA 3I6YA 2C57A 3QBJA 2DQZA 4HDNB 1P60A 3UCEA 2GN9A 3ZS9A 2VJDA 2FN9A 5JO0A 3O92A 2XB9A 3KEQA 3FPLA 4EYOA 2IHJA 1GKYA 4MQFB 3EWNA 1XAHA 1TECE 2HV9A 3W2TA 2AC7A 3COWA 3CZCA 3C6XA 4ZO6A 1JHPA 1GZ5A 1OPXA 2VJPA 2DKOA 1FMLA 1HEYA 1P75A 1K8RA 2VZLA 2CJXA 4G36A 4IQ0A 4NY1A 4W9NA 4XYGA 1O94C 4IWXA 1I33A 2VHXA 3KETA 3O4VA 4NAVA 1WMDA 4P4SA 2C5BA 4F11A 3MJHA 3BH7A 2NACA 4NBWA 2ZUTA 3ZGVA 3HC7A 1JKXA 2XCSB 2CLIB 1G5FA 3TW8A 1ZHFA 1IXRC 2WQ6A 3EFHA 2C92A 2X8JB 3RIXA 3HDQA 4N18A 2O48X 5HK8A 1LX7A 1MJ5A 3WWZA 4NSNA 2IP1A 4DMLA 2X5OA 1XVTA 1FRZA 4BVGA 4FGJA 4LOKA 1MNAA 2D3TA 3CH4B 5BUSA 4OYHA 1BGVA 3WB9A 2DSTA 1NLMA 1HLDA 2Z8ZA 3H86A 3L0SA 1P33A 2HRQA 1RI2A 1ZX1A 4LG1A 1O58A 2G08A 2QJWA 4ZD6A 4YUXA 3HJFA 4IGFA 4MNTA 1DCFA 3F71A 1M1YE 4Q15A 3FDZA 1XA4A 2PIAA 1N34B 4MINA 2Y92A 1OFGA 4EPWA 3LSYA 1PHRA 3BRWD 5DIZA 3OCWA 4MV7A 2DOKA 4YUZA 4NPAA 4A23A 3A9RA 3C3WA 3RYFB 3IEPA 2QD5A 3BIFA 1KMMA 3OBBA 4FNMA 1PR1A 1BEUB 4UCXA 3VHXB 4CODB 1RWKA 2XZPA 4DMGA 1ORVA 4IXDA 1NBMD 5GINE 2GBIA 1U2DC 1JA0A 3GGDA 4G3XA 1R4MB 2FN8A 4LHZA 2XLBA 1GU7A 2QR2A 4QPZA 2M6KA 3RVRA 2J3JA 1UKCA 3LY5A 4AQDA 5IJZA 1N5LA 4D79A 3NBQA 3GW8A 3MXTA 4JI6B 1GXSB 4A8HA 3H8VA 2GYVA 3F4LA 1IDOA 2IBTA 1H4SA 2OCKA 2QP4A 3CR3C 4LS3A 1T5OA 3QGMA 2VBIA 3WDSA 5SZJA 1BJKA 3MAJA 4ZXFA 3TSYA 4YDRA 1AQJA 3A0RB 5JMTA 1ZXBA 3K8QA 3QU5A 3WICA 1FQWA 3LUJA 1XC7A 4TMTA 3RSSA 2ZR0A 4PZZA 3KDSE 1CP2A 3N2IA 3WJ1A 1P9OA 3GR6A 1JG4A 2ZW9A 5EXTA 1HY3A 1TO1E 4IKEA 1GN9A 1SWVA 1CUDA 4XB2A 4UUAA 4ZIRB 2WIFA 2Q1SA 1EFDN 3H05A 5TQ2A 1JFFA 2QX6A 4MI1A 5EFOA 2X8WA 4E6PA 1MT3A 1GRVA 2DHRA 3ML1A 1N6IA 3TIXB 4CJXA 2VAMA 2ZWOA 2H06A 4IDFA 2HPZA 2HRBA 5I4IA 1WPRA 4JXZA 3L7KA 1ISSA 2J5QA 3NWPA 1AD2A 5REQA 4C0BA 5D3MB 4F4UA 4F2HA 1R0YA 1T8PA 1VRVA 2V6IA 3DKRA 3RG8A 4YCCA 2AOTA 1AKNA 1D3AA 1Z4MA 4BKOA 4D4KA 4NDAA 1R8XA 2JCSA 2NTVA 2QSYA 4L4ZA 2IL1A 1QR6A 4FGLA 4TWRA 2X4IA 5FT9A 2XNHA 4QYSA 3NX4A 1FY2A 3O21A 4ALIA 2AUMA 3ETGA 2PKQO 4FMPA 3V9PA 4D45A 4MDHA 1B1CA 1IZ7A 3EFBA 3QPWA 5AW8A 1G5TA 3M2TA 1RQGA 5CVTA 5EJGA 1XU7A 2IUSA 2OB1A 1EFTA 2JIRA 4P4TA 2BJVA 4TROA 1OA1A 3WQSB 5KOJB 4XPIA 3QMMA 2XYPA 1D8AA 4V02A 1N3IA 4C6HA 3AL2A 5JLJA 1SZPA 1S7CA 2XXBA 3KHSA 3NB0A 1TCBA 3QFFA 4MRPA 2EFEB 4BO0A 3RJ9A 5ELXA 1X3SA 3H5IA 2PGOA 3DTVA 1MRSA 4I0WB 2NZVG 3QWAA 2ZRFA 1DNPA 4KKVA 3G2HA 4C89A 1DRKA 1X80A 1Z08A 2SBTA 1E2NA 3TK1A 1XQ1A 1F0YA 1DJNA 3JQ7B 4PQEA 2QN3A 3TOSA 5JWRA 2AXPA 2HQRA 5JSHA 1OXXK 3TL2A 5C1IA 4Z9FA 3V2UA 4OBXA 2E5WA 1FP4B 1MO5A 2FOLA 1NHGA 2WKRA 2ZJ6A 3RE1A 4PCLA 4B3JA 4F8YA 4YPOA 1CD5A 3R9IA 2R85A 4H9GA 4M4SA 4RHEA 4UXIA 4UUPA 3DFKA 4J0DA 1H9BA 1XTQA 3CM0A 3LECA 2VDWB 4EBFA 5DGIA 1GQQA 4KPFC 3P9XA 4J07A 5F52A 1TT7A 3R3WA 2K5UA 4JXKA 2O5CA 4QUBA 2I3AA 2EFYA 1UEIA 1IN6A 2OBLA 1BWSA 3NHLA 2P41A 3NNSA 2CK3A 1XI2A 2J9GA 4Y0VA 1RWPA 4RADA 1W9MA 4W6QA 1SZJG 3IP6A 2NUAB 1TK3A 3CWQA 2PBLA 4L8FA 3W3ZB 3QK7A 3C6QA 4LF8B 1PFYA 5B1IA 2P2YA 1ONPA 13PKA 3A37A 3OQHA 1E3SA 1OKKD 4IH1A 2WJ4A 4KXMA 3V7YA 1PKXA 3EVNA 3F8WA 3KEOA 4GKBA 1XTZA 4Q6WA 4R2HA 4RAQA 4AKEA 5JR3A 2CHQA 3HBLA 2ZTSA 3CISA 1ODCA 1E9CA 4S0XA 3MHPA 3SP1A 3WJ7A 3DAYA 4DJFC 2F43B 3S81A 3KELA 3P1JA 4UZEA 4MTCA 1VE9A 2O2GA 2QMZA 3KBOA 1U7DA 4DMRA 3X43A 2PNFA 4K1LA 2NP6A 1XHFA 3PS9A 1HKUA 1C1DA 1I10A 2GFQA 1E2LA 4UUMA 4ZQHA 1X2EA 3JX9A 4R98A 3ECCA 2WAYA 1KO5A 5AVZA 5CTJA 4EHIA 2J9ZB 2F3UA 1C29B 2QNBA 2MYPA 4KLCA 1K86A 5LZ4A 3NGMA 3LT4A 2R3SA 4JODA 4JB2A 3OZGA 4ZI7A 1Q7BA 3PGKA 2Y05A 1PEDA 1CBUA 1F0NA 4RGYA 3DLPX 3O8NA 2C54A 4I50B 1MAHA 1VRCA 4E2WA 1ZFNA 3BMQB 3F1KA 3WIVA 3O74A 4ER0A 2BTOA 2X5XA 1NN5A 3G59A 3A0UA 2IHTA 5A4MS 5EGSA 1JN0A 2NM0A 3NIDB 5HOEA 3H9EO 2BMDA 3IR6A 2A5DA 4EGSA 2ZDGA 1TA4A 1HT0A 3ZWAA 3AFIA 1NN0A 3EJ6A 5JUWA 1KOLA 5FULA 5FBWB 3ZNOA 1OB5A 3LPDA 1ZLXA 4QRHA 3SY8A 4PLTA 1U1CA 4I6GA 5KU1A 1E61A 3KXKA 5BRJA 2G67A 1U8FO 4LE1A 4JUAA 5JE8A 4YS6A 1VL1A 4WKNA 2ZUFA 4LHXA 1SCUB 3KPVA 5ENDA 1G8KA 5H0IA 2JHFA 2AB0A 1RE1A 1UDXA 3TRFA 3IDSA 2N0SA 5D7NA 3QWFA 3T35A 4F4FA 5CA0F 3JD2A 3GVXA 3CVYA 2X86A 2HM7A 2XBLA 3VKUA 1CERA 2VEDA 2ROQA 3NONA 1KAGA 4M8SA 3UK0A 4J3NA 4CKEB 2CVFA 1U1EA 2DUJA 5EJ6A 1EFRA 1YS1X 3Q0IA 1SUAA 3AG6A 2VPQA 4Q4AB 2FKNA 2HSEA 2N75A 3EZGA 1G20A 4KQKA 1Z0FA 4Q1EA 4AULA 2BFCB 4IIJF 1X7DA 3QNUA 1LW6E 1M34E 2QMUA 2V6MA 3H3FA 4G8CA 4DSOA 1KAMA 5BT9A 1NE7A 4WPGA 3GMDA 4KQMA 1P4GA 2PKYX 2QUAA 4LWOA 4Y1FA 1M1NB 1P1KA 4BU0A 2H29A 4U8GA 5DSXA 1DAMA 5HXAA 3HCWA 1OIWA 2DGDA 1VGQA 2IBMA 3GH1A 5AVXA 4LDPA 2QTWB 4MQEB 3QSYA 1JIXA 1H2WA 5AH0A 3R6WA 4KGZA 3OQVA 4LHSA 1K6JA 1QGZA 5F2KA 5ILOA 2Z2IA 3B7PA 1TKRA 2AZTA 2HQBA 1R64A 2W71A 2GN4A 1PYOA 2QVLA 4ML3A 3RVOA 3W79A 3O82A 3NPAA 2PLFA 4RVSA 2H5LA 2JGDA 4K2HA 3UK2A 4YGYA 4RDXA 1ZINA 4LOAA 5KPDA 1EUCA 1UPXA 2BY4A 1FJGB 4QICA 5TB5A 5TC4A 2J3MA 4RE5A 4XRRA 2IGBA 2XUAA 1BXZA 5ALPA 4WKOA 1YOBA 4GWGA 2UVPB 4FGSA 4H6XA 1EJ0A 3INGA 2FW6A 2BCEA 4TSFD 1L5SA 4KHPB 4R2XA 3URKA 4H1UA 1D5WA 2FPRA 4UDNA 2CNKA 1DEKA 1O9HA 2QRZA 4YAKA 4M2LA 2L42A 3FIUA 3LX4A 4JT2A 2WJ6A 2ZBRA 4MQ6A 1EVLA 1SBNE 2YNMA 3OLYA 3ETHA 2X13A 4C20A 1VE5A 1N3BA 2NZJA 3U13A 4BCCA 5FPKA 2VDRB 2ZBQA 4RV9A 1U2QA 3Q2KA 5EMMA 5F21A 1NMYA 1T0UA 3UKOA 2BFDA 4JI5B 2RBKA 3GP8A 1SVOA 8MHTA 5DHQA 2Y0DA 3OCXA 5HILA 2HTEA 2OR3A 2H4HA 2FUG6 2O3QA 2ZI6A 2H7XA 3TNJA 4G25A 4W5QA 1R00A 3WXBA 1D6MA 1XCBA 5TQ0B 4ZEOA 4JNCA 4Y18A 3FOAA 3E05A 4OJKA 2PGAA 1JBKA 4QYMA 3KKMA 4L3OA 1VL6A 2IS4A 2JFPA 3RREA 2N1MA 2Q6KA 3RFVA 4C3UA 1IHXA 4YXFA 1N9KA 3DWIA 1VE6A 2VUUA 3LL7A 3NHSA 2HQSA 2QSJA 3T7EA 2Z2ZA 1PZNA 4DA7A 4YT2A 1T25A 2IHVA 4RFLA 3GUYA 1HE4A 1NXWA 3K09C 4EMUA 4JVOA 5BPHA 3WK5A 1CZRA 3OICA 2O0JA 3TJRA 5FI3A 2KW5A 1HE2A 3H2SA 2ZJBA 4UUBA 3KK0A 3LGXA 1Q74A 2OTCA 3C5VA 3NIFB 1S96A 1O96B 2H31A 1ZR4A 4EGQA 4AP9A 3IKTA 3Q15C 4F92B 1T6YA 2AZ4A 2WA2A 421PA 4P35A 3X2FA 4L5YA 4Q6BA 5KB3A 4WXPA 5CT4A 1VGVA 3A1DA 2WWHA 1CNFA 3SHQA 3VR4D 4HVAA 1I5OA 1Y1TA 3PC8A 3SXJA 2WTAA 1MQSA 3ABZA 5L4LA 1TZMA 2BJHA 1H0SA 4QXAA 1QFZA 2W2XA 3EIOA 5KX5B 2CL0X 4FEYA 3FWNA 3L7IA 2NMVA 5DBFA 2R8EA 2IELA 2A78A 5HBRA 1JG2A 1VCHA 1W8DA 2J07A 1DC4A 4M98A 1ISIA 1BN6A 1TZCA 3RS8A 1Z2CA 4MK4A 3IQEA 1T5LA 3MW8A 4TMFA 5EMNA 4EABA 1AQYA 2HDWA 1PV4A 1BVHA 2OV8A 3E8XA 4FYWA 4M0UA 2EKDA 4EKYA 5JDIA 1XK6A 2QI9C 1N0HA 1O9GA 3QBDA 2FUNB 5ALQA 1W47A 1IWPB 1KO1A 1NP6A 5CX1B 4L5AA 4YMLA 1QQ5A 1DQPA 5T67A 2YMQA 5DFAA 1WBBA 1NW9B 1HE1C 2G04A 2GD0A 2BZSA 1JZSA 2NAFA 2Q1XA 2YJ5A 2EZTA 3EC2A 1XHLA 1UQTA 1DAEA 3FOWA 1R74A 2NUTB 3G02A 2BBOA 2ECKA 2O5VA 3H65A 3LNTA 3PHCA 4KI7A 4X97A 1TQ8A 3VR0A 5A9RA 1V5IA 3CUWA 4R69A 4R51A 1SC6A 5KINB 3BS4A 2A0UA 1U9IC 4MVJP 4XUCA 1X1CA 5C46F 3B82A 5EL0A 3TR5A 4TTPA 4UUOA 5I9IA 4BO1A 1GY8A 1HDCA 3RS7A 1JHVA 3JYPA 4JCCA 4Q9DA 3VX3A 4RXUA 3EDYA 3PQFA 1Z37A 1C8VB 2GLUA 5IAOA 3STXA 2GA9A 1VJGA 2ZITA 4O33A 1R7RA 3MOGA 1MTZA 1C1YA 4CVNA 2J9FA 4JU8A 3T54A 3LUAA 4M22A 1Z9BA 2XKAA 3HBAA 4AJLA 1E3MA 4K9LA 2H2WA 3GVHA 3IEUA 5AKKA 1GHTA 2HSGA 1SPBS 2R5FA 2IW1A 2Y27A 3JQEA 5FPTA 2XTZA 3GCZA 1XTPA 3S8EA 1WB4A 5JQWA 2H9IA 5JZBA 5CA1B 4S1PA 4OMCA 5IK2D 2VWHA 1RBQA 3E1GA 2QB5A 3IAS6 1AXRA 1JHZA 2X5JO 5JLAA 1HR0B 4UJ5A 1E3WB 2AKYA 2ECPA 2YVLA 3ET4A 3EQ7A 3U49A 1J5XA 3EH2A 3WLQA 1QHIA 3H9UA 5HQ3A 5D5PA 3N2KA 4OX9Y 3HVJA 2XUZA 2EJUA 1DKQA 1YZNA 2P9ZA 1I24A 2RAPA 3R4CA 4MV3A 4OQZA 3IJEB 2C1EA 2XRYA 3HKDA 3IDAA 3R8XA 3LDAA 3A6HA 1OC4A 3R24A 2BGMA 1VE7A 3PPXA 4Q82A 2PG3A 4RPHA 3AIKA 3TVTA 4DIOA 5GVSA 4L4SA 5AM0A 1DBSA 3OCJA 1JIUA 4XLZA 1QVRA 2WUEA 2G9VA 3V1LA 2YV5A 1YA6A 4PHHA 1V2HE 2AFIE 4HZGA 1AUQA 3H5TA 2RBEA 3I5UA 1QZXA 4Z7NB 4BJHB 3EDOA 1SKBA 3VH2A 5L9AA 2Q5QA 4RD6A 5L7WA 3O1IC 4ARUA 4E21A 4QXMA 1BXKA 3WOHA 2JJ1A 5CJPA 3UM9A 1NPYA 3ZY3A 4EF6A 3RW9A 2PSFA 3LH5A 4C76A 4DEVA 1X8XA 1MIOB 1Y6JA 1X9IA 2EKBA 4ZMRA 3N0RA 1WMBA 1U8AA 4FSDA 4ZVPA 3TYXA 5LDHA 1VHLA 2C9ZA 1QO0D 2I78A 3WNQA 4LY9A 3F4BA 1Z2NX 4EZIA 1OHHA 2PKWA 2VXBA 1Z62A 2H9AA 1BTOA 3JWGA 3SKVA 5IRCD 3ONNA 2IPAB 4QDZA 2BOVA 1X1RA 4K40A 2YIMA 4GKAA 4BLUA 4RQUA 1JRLA 1P9NA 2R1VA 1IU9A 3RNLA 5LQJA 1XD8A 3SOPA 4JSRA 1J49A 2FLVA 2BGKA 1GTG1 3FYUC 4JENA 1T3LA 3CRNA 2HV8A 4BOYA 3KB6A 5F4ZA 1OH5A 1GAQA 5PGMA 1P73A 1NLUA 3CS3A 4D9CA 3WBKA 1PJ3A 4NONA 4J4HA 4C0SA 5C35A 3WNCA 1ULSA 3GGGA 1NOJA 4XGQA 1BZYA 3F3KA 4LDZA 1XVAA 4PFJA 1IY2A 4HFNA 3CGGA 4OU4A 1G7TA 4JMLA 1Y89A 5HKLA 5A5VA 1KAEA 1PGPA 3I72A 3GJTA 1NXTA 3R0VA 1UOPA 2Q28A 4HDKA 4MQBA 3DB2A 4F3YA 1ZISA 5EXXA 1B0PA 1BWPA 2HMYB 1NUUA 3D3KA 4HKTA 3KQHA 1ACLA 1JH8A 3RHTA 4EX7A 4CV2A 2IE0A 1SOWA 4DSTA 3VR2D 4H7IA 3NTUA 5C5EA 4LAFA 1AXEA 1WVIA 2WWIA 3GLFE 2Z8YA 3HWRA 4MP8A 1ZLYA 3ZGOA 1JVNA 1C7IA 1SKYE 5J58A 4Y9TA 2H4YA 3TLZA 1T24A 3BERA 1Z0SA 2WNHA 4UUQA 2XB2A 3OQJA 1WCWA 4TKUA 3OO1A 1BJRE 3WLNA 2NP7A 2GTIA 2MDTA 1IG0A 1KI7A 2YQ4A 4Z2YA 3ZWWA 2A7XA 2WMYA 4MW4A 1EG7A 2OSVA 3ZE0B 1VOTA 2EFJA 3M5DA 1GZ7A 1RHJA 4GPIB 4BJ1A 1ZA1A 4IG9A 1BC5A 1KR2A 1P1FA 1T5BA 3EARA 4OI0A 4Q1DA 1EQUA 2WOOA 2IYXA 3ZXIA 2HMWA 2DXIA 2C94A 4RZ3A 1UPFA 1GT91 3CURA 4LTDA 1IAQA 4GX2A 1KEUA 2VPTA 4KU4A 4PQGA 1NI5A 2V97A 2ZDHA 3N2LA 4Q9HA 4NV1A 5DM0A 4EB3A 1TU3A 5AESA 4H3KB 2GJ4A 2OV6A 4CFZA 3THSA 2HN9A 1J0AA 1NV8A