1JHZA

Purine repressor mutant corepressor binding domain structure
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
276
Chain Sequence
KSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 91
structure length 276
sequence length 282
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jhzA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jhzA01
1YS7A 3H75A 2O20A 3B2NA 2HQRA 1QO0A 1UDRA 5CHYA 4YRZA 1A2OA 1P6UA 2A9OA 3O1IC 5IULC 1I3CA 2MYPA 2P4UA 4W5QA 3IP7A 1BVHA 1FSPA 3I45A 1PUXA 4IGAA 4HNRA 4LDZA 1DRKA 1PEYA 3E61A 1KRXA 1ZH2A 1K66A 3HUUA 3IP6A 4XAQA 3UUGA 2JVKA 2MYUA 1FFWA 4MGEA 4MLDA 4D6YA 2YHAA 3C3MA 2E4ZA 2LBPA 4YLEA 2NUBA 3ILYA 1S8NA 4KFCA 3O21A 3OLXA 4WXEA 5IEBA 3HSYA 4IMJB 1Z2DA 1QNLA 2VK2A 5IX8A 1APBA 3BBLA 1ISRA 1NXTA 4LRQA 2F8TA 3H1EA 3Q7TA 3QEMA 5T3YA 2M1ZA 3NHMA 3JTEA 4G0QA 2A9RA 3TD9A 3TO5A 1CYEA 2J48A 3ILHA 7ABPA 4G0OA 3M6MD 3N0XA 5TE9A 1ZHHA 3SAJA 1C4WA 4Y9TA 1LBIA 1GUBA 1J56A 4FB4A 4PEVA 1U2PA 3GL9A 3LUHA 5TQ0B 5HM6A 3KG2A 1PEAA 2R47A 2FTKE 3FDFA 1ISSA 4Z4CA 4MQFB 4RK7A 2RJNA 3F6PA 4G97A 4DN6A 1PNRA 5BRJA 5CNJA 4F06A 4OLBA 3NNNA 2JCGA 3GYBA 1W25A 2H0AA 1EHCA 5GOTA 5TQ2A 1EFAA 1JH9A 1NXOA 4MS3B 2FQXA 3F7NA 2GBPA 4IILA 3T8YA 4EUKA 3M9WA 3KS9A 4GNRA 4N47A 4EYKA 3EQZA 4EYGA 5HKOA 1M2EA 3OLYA 3OQOA 1LJUA 4RY8A 5JNTA 1EWKA 1P8AA 3SQNA 2GKGA 4PZ0A 4MR7B 2LP4Y 2E4VA 2FMHA 4YCSA 5KC8A 1QP7A 1JX6A 5EWLB 3F6CA 2PUDA 5B3JC 1JFVA 2VYCA 3IPCA 5IUJC 3FFXA 2MYTA 1DJMA 3KLNA 3DGFC 1XWWA 3N8IA 1JDNA 4XARA 3S99A 3OQNA 4G86A 4OLAA 3NNDA 2QZJA 5ED4A 1DBQA 3OM0A 1OXBB 5FWYA 2PE5A 3DLBA 3MQ4A 3C97A 1USIA 4ZMRA 1SD5A 4XXHA 1K68A 1DCFA 1SXGA 2E4XA 2M98A 3LUKA 4Z4FA 4HNQA 1BDIA 2FLWA 3Q41A 4WT7A 2HQBA 4KV7A 1DBPA 4RY0A 2JB9A 5EWMB 4D6XA 3QX8A 4NICA 1D1QA 1VPWA 3HS3A 4NV3A 3MM4A 3CHYA 4ZYLA 4QPJC 3RVNA 2A9QA 1D1PA 2ZAYA 3UKJA 4KNYA 1YIOA 5E3JA 4YR7A 3K9CA 4MQEA 3RVKA 4W5OA 4Z4GA 5B3JA 5KC9A 3CG4A 1F51E 2IPLA 3OMXA 4LE0A 5DGCA 3EQ2A 4O1HA 5IEJA 4WWHA 3NBMA 2PMCA 3CTPA 2I6FA 5IUNC 2PL9A 3K4HA 4RWEA 3HEBA 4GPAA 3Q15C 4NQRA 2JVJA 1QO0D 2HJ9A 4KREA 1RXEA 2NZVG 4E7PA 4EY3A 3N6VA 2MSLA 3ROTA 2AYXA 2FVYA 1U04A 1NY5A 1URPA 3FMVA 4N0QA 4QICA 4MS1A 4W5NA 1ZGGA 2WY2D 1VRVA 3OLWA 3DLHA 4JA2A 4MR8A 4ML3A 4S04A 3OQMA 1DCKA 1P6QA 2P9HA 2R25B 5KQGA 1ABEA 3JVDA 3JVIA 4B09A 3O74A 3QELB 4RK5A 4G0PA 3TB6A 3BREA 3C6QA 4MS4A 5DCLA 2FQYA 4RZSA 2IPAB 3G1WA 3IP5A 1JLKA 4YO7A 5TPWA 3URMA 3LTEA 5EWJA 3EODA 3JY6A 1M2FA 2CD7A 4RV5A 3LUFA 3KCNA 1ZVVA 2MSWA 3RQIA 3T6KA 2QW1A 3Q7RA 3GRCA 3RVQA 4ZJPA 2PUEA 3SG0A 2B1JA 1E2BA 2WB4A 3RVMA 1TVMA 4LX8A 3F73A 1Z18A 4RK6A 4S05A 2X7XA 1USGA 4Q7EA 2LUOA 3QEMB 1GCAA 3FGZA 2W42A 4IRXA 8ABPA 4DADA 1Z2EA 3BILA 4TLLB 1ZESA 5JNSA 1QP4A 1F4VA 4JASB 4Z4HA 5DLEA 1TJYA 4TN5A 1DC7A 2PKXA 3GV0A 3I42A 5T7BA 4RXTA 2GX6A 1BAPA 2FLKA 4TMYA 3EGCA 2GI4A 4W5RA 3W9SA 1JFTA 1DBWA 1NTRA 1QPZA 4RSMA 3OO0A 2IPMA 5CNKA 2FN9A 5FWXB 3RVJA 2JK1A 2PUCA 3T38A 1NXVA 4DQDA 1JDPA 1YK1A 1MIHA 1CEYA 1ZGZA 2IYNA 4L4UA 4P98A 4RS3A 5D2CA 4MPTA 3UK0A 4IF4A 4G0YA 3MMNA 1D2AA 1GUDA 4YGXB 1ZN2A 4QYMA 3GBPA 2JVIA 3QLVC 2NT4A 1EWVA 4RK0A 5TQ0A 4KK3A 3D8UA 4JB2A 4NCBA 4XASA 3H6GA 4MQFA 3DBIA 3T95A 4FE4A 2NZUG 4Q6BA 3L6UA 4EYQA 3A0RB 3LKBA 3N0WA 3H5TA 3H5VA 4Z0NA 3DZDA 4G0ZA 4N03A 3HV2A 5KQMA 2KYRA 3HJFA 3CRNA 4MS3A 1LJLA 4Z9BA 3Q7SA 4YP9A 2H3HA 5TQJA 3LKVA 2QVCA 3OLZA 5CNMA 2PJUA 4PYRA 4RK1A 3HK2A 2N9UA 4WUTA 3IPAA 3KYIB 4KQCA 3EJWA 1DC8A 2FW0A 2QXYA 1ZH4A 4MR7A 2PUBA 1AB5A 1FFGA 5EWLA 4F3TA 4ZMSA 3D02A 2WMYA 4H3KB 4RK4A 5CNIA 5TPZA 3C3KA 4LDAA 3TMYA 1CHNA 3G85A 1Y1LA 2E4YA 2PL1A 4N0PA 1MB0A 1USKA 3BRSA 1BA2A 1WETA 3QLVA 1LK0A 1BDJA 2FEWB 3HDGA 4Z4EA 1RPJA 1U0SY 2JBAB 1Z13A 1SXIA 1TLFA 2IKSA 4RXUA 4E7OA 3I09A 5HQJA 3EAFA 1JYFA 2GWRA 4MQEB 5IC5A 3RVOA 4EGSA 4N41A 2IDMA 2WJAA 3M9XA 4TLMB 4LE1A 4M88A 1Z15A 4MYRA 4MRMB 4Z99A 1NATA 5EWMA 5DTEA 1JWLA 2L17A 4RKQA 4FE7A 3RVLA 3H5OA 4CBVA 2FEPA 3LUCA 2WWVD 4MLCA 1NXWA 5GQSA 3N0RA 2FN8A 2CWDA 3RVRA 3L49A 1A04A 3H1GA 2XDYA 5C5CA 3BRQA 1QQAA 3ROFA 1M5UA 2MYNA 3H5IA 2FXIA 3QLTA 3H5LA 4Q6WA 2YHBA 2QSJA 3CKMA 3HVRA 1E6LA 2OQRA 3OMWA 3VNBA 2ID9A 4MR9A 4F11A 4OTZA 2QV0A 1Z16A 3H5WA 1DG9A 1YK0A 1QKKA 2PLNA 5HSGA 5FBHA 3C3WA 1P2FA 5JS2A 2FMIA 3KLOA 4KZKA 1DP4A 2CHEA 3OLVA 5TPWB 3MF4A 1JF8A 4W5TA 1YS6A 3CZCA 3R0JA 3FFTA 3GBVA 1KMIY 4KVFA 1MB3A 1TM2A 1U8TA 3TX6A 4G0XA 4XFKA 1EWTA 1QMPA 1L5YA 3A10A 3GWGA 1ABFA 3O1JC 5IBQA 5JNRA 1DZ3A 1FFSA 1Z26A 3CFYA 3O2QB 3QELA 3MIZA 3VNAA 1JL3A 3KHTA 3CG0A 4ETMA 4KQ9A 3MYYA 3MA0A 2FMKA 1U2QA 1D5WA 4JB0A 4RU1A 4D74A 4UHJA 3LMKA 1DRJA 3SNKA 2NT3A 1RZRA 1H9CA 1IIBA 2E4UA 3P9YA 3HUTA 4IMIB 5I4CA 3NHZA 2WJWA 5JNWA 2WRZA 4YS6A 2L19A 1KGSA 3FFWA 2ZWMA 2MSKA 2PUAA 3N53A 4RKRA 3E3MA 4RDCA 4RXMA 4F8JA 4NCAA 9ABPA 2OENG 4UHKA 4N76A 2FQWA 1L5ZA 2HQOA 4RY9A 4PICA 5DKFA 4O5AA 2HPHA 2RDMA 4KMRA 1JBEA 2FKAA 1XHFA 4KPYA 3EDCA 3RH0A 4OBBA 3LUAA 5BR1A 4YWHA 2E4WA 5KWSA 2FSPA 5TQ2B 3JPYA 1D4ZA 3IDOA 3RVSA 4YV7A 3I5AA 1OXKB 1PNTA 4JP1A 4LZLA 5JNUA 3QEKA 1SRRA 2FEKA 3KYJB 4H60A 5FWXA 3IP9A 3JS5A 4EVQA 4ETIA 1JYEA 1RNLA 1JHZA 3QLUC 1SXHA 1R8JA 1RXIA 1NXPA 1YVUA 1E6MA 3KJXA 2PAFA 4EVRA 5F64A 1Z25A 5BQ3A 1YMVA 5TPZD 4ETNA 5BRAA 1YTUA 1BDHA 3CZ5A 3HDVA 5FWYB 6ABPA 4XLTA 3LUDA 2IPNA 1DCMA 4O1IA 4PE5B 4EYOA 1E6KA 2TMYA 1M5TA 3O2SB 3HO1A 2FMFA 4P1ZA 2F8SA 4MAAA 1AB6A 1B00A 3HCWA 1ZDMA 4OATA 6CHYA 4LE2A 1ZAYA 3O1HB 3HM9A 4Z4IA 4JAVC 2L2QA 3GA5A 4G0MA 1FQWA 2IOYA 2LIVA 2PUGA 3A0UA 3A3KA 3OM1A 1Z12A 5C5EA 3KSMA 4WZZA 3HXMA 2JRLA 1T34A 3QK7A 5KQPA 1TMYA 1W9HA 2V0NA 3CLKA 3QLUA 3JPWA 3H6HA 3O75A 1NXXA 4KRFA 3SY8A 2DRIA 4KK4A 3LOPA 4WXMA 5IUKC 1MAVA 1GCGA 4L85A 1YMUA 1LBHA 1NXSA 3HZHA 2ID7A 2VUIB 1VLZA 1PHRA 1KRWA 2QU7A 2AYZA 3DGEC 4EVSA 2JBAA 5KQLA 2A9PA 3QX9A 4JOQA 5KI6A 3CNBA 3SM9A 1XHEA 2VUHB 2LPMA 1GLGA 3N75A 4MS1B 4F12A 3LFTA 1Z17A 1JFSA 4MR8B 5ABPA 2Q5CA 3H1FA 2B4AA 1C0EA 3CU5A 4MRMA 4MR9B 1QQBA 2R4QA 2HSGA 4H3HB 1MVOA 3KTOA 4MS4B 2BGGA 1HEYA 4QYWA 5JS1A 1VKRA 2QR3A 5PNTA 1QP0A 2RJOA 2QVGA 3CS3A 3RVPA 2RGYA 5EWJB 4HYEA 2CHFA 1ZY2A 2L18A 3NNSA 3OO1A 4ZPJA 4OG2A 3LUJA 1EAYA 3EULA 2R48A 3O2JA 3GT7A 4HNSA 3LUGA 5FBKA 3Q9SA 1ZITA 1A0OA 1RZRD 2PUFA 3KKEA 4Z9AA 5JNVA
chains in the Genus database with same CATH superfamily
2R6DA 3K5PA 3Q0TA 3FPSA 1T1IA 1ZRSA 2O20A 2B34A 1VMAA 3ZY4A 1IE3A 2QVZX 2XIQA 3GZTB 4JXXA 4KP7A 4I50A 4ZAXA 1KAGA 3PQEA 4YBRA 1H6BA 4HNRA 5IJWA 4H7FA 4QUBA 4Q34A 5AYVA 1DS6A 1EK6A 4P2BA 1W5FA 1NW9B 1FFWA 3UO8B 1N5DA 2L0XA 4BVGA 5IH7A 2X5XA 4LRTB 1FFBA 1PLLA 2VWHA 1TM7E 3KU4A 4XSVA 4YAKA 3JZDA 2IITA 3ZE2B 2QL9A 4Q9IA 4B6EA 4QT0A 3U7HB 1WDTA 4KN5A 4JI4B 3IUNA 5J2TA 1DTWA 1OAOC 3CN7A 1PW5A 5JAHA 2CVPA 1H2EA 3LQFA 3FGOA 4QDTA 5FV7A 4OI1A 2VI5A 5F23A 4YT2A 3JTEA 3QOXA 1M1YE 1QPGA 1WMEA 2JGLA 1Z5NA 2ZTUA 1XP8A 2PRYA 1VA5A 1UC5B 5AI8A 2UXDB 2A9JA 3Q5DA 1B6GA 2V0CA 5EIEA 4L5YA 3NVDA 2IOFK 3TBKA 1YQTA 4CLHA 3S1LA 1KZ6A 2VA9A 3IHWA 5BN5B 4NXMB 2IY7A 3VC2A 1W75A 5HX7A 1ZM3A 3HHPA 4BJ3A 3UYLA 3DBVO 2I9PA 2CUNA 3HCOA 2ECFA 2ZTHA 2AOUB 3I04A 2WU8A 3ABZA 3LRXA 1T5BA 1NW6A 1D2GA 2C2XA 2C5LA 3O94A 3H2SA 4E6PA 1CUWA 1PNRA 3E1SA 2M9MA 5ENVA 2HY7A 3MWLA 1CY7A 1KO5A 4TZTA 2NSYA 1O08A 1P77A 3FSEA 3O4RA 3PENA 3P9CA 4KFSA 1F2VA 1LPPA 2JCYA 4ARZA 1YCDA 1ECBA 4B79A 4D97A 1K7EB 3PEVA 4BQFA 4RULA 1BE8A 3T8YA 3R5FA 3CURA 5I7AA 3NVAA 1VMEA 2P90A 3WXMA 4EYSA 3CR7A 2JATA 2ZAOA 2REQA 4H6VA 4DQ0A 2VTVA 1M2EA 3EISA 5HFJA 1UODA 4H15A 4L8YA 4OJNA 1P8AA 1UAAA 3OKAA 3B6JA 4N5MA 3C5CA 5KC8A 2AJDA 4XTRA 1UPCA 2BFNA 4U5XA 2PUDA 5FBRB 3CZ9A 1XZCA 2P2ZA 2G0NA 3O3MB 4QRIA 1NFFA 5IM4F 2GJ8A 5BSEA 4Q93A 2YWHA 3FTFA 5DNDA 4FDTA 1E66A 2XDQB 2JRCA 4QWMA 3OQNA 3ZHRA 2ZRMA 2HU7A 2CNDA 3P0RA 4UBIA 1O95C 2IZ6A 2OE2A 3CA8A 3IYLW 4YNBA 1PZEA 3B6EA 3DKKA 1OTXA 3F3KA 4PBRA 5IVDA 1XFAA 1GGHA 3ZWMA 4AUEA 2QT1A 1B2RA 1HTWA 2HDNB 1NP3A 3Q41A 4GI1A 1TA9A 4R5MA 4M7PA 4NHEA 2QTVA 3RT1A 3TJZA 1GPKA 1OWMA 4UXJA 3ZWCA 3IEPA 4E5MA 1L9XA 1Y3CE 2ZQ5A 4NICA 3R6LA 1CJMA 3KQMA 5YASA 4TS9A 5AT1A 3CLRD 3RVNA 5IRCD 2AV6A 2J46A 1TIKA 3DTTA 4L3VA 4LKRA 3SBOA 1BCSA 5T4BA 2PR7A 2E82A 3D6JA 3SIWA 5MN6A 1GKKA 3ZWNA 4HHEA 2W22A 3VU0A 1GG5A 2M6LA 3S28A 1B74A 2XBMA 4GRDA 5DWQA 2CNWA 1XNGA 4ZCSA 3QEOA 3AKZA 4IHJA 1ESZA 1JDZA 1FA9A 2DPXA 2GRAA 4RWEA 2RAFA 3Q15C 2PO5A 4UMFA 4EBFA 3SEZA 3I53A 1KMHB 3BMOB 3ZDQA 5ALHA 1RP1A 1W4AA 2I78A 1ZN7A 1CK4A 1IQRA 4EY3A 3TKLA 2AKYA 1SG0A 5DTQA 1XC7A 1U7HA 5L9AA 3IIJA 1MV8A 4Y6OA 4MUEA 1P0PA 3WYBA 2P1RA 5HCNA 1CQZA 1JJ7A 3BRCA 3BE8A 3T5GA 3GGGA 1DCKA 4BKPA 3KSBC 5BN3A 3TB6A 4NWIA 3DE4X 2XMGA 3FWZA 1SEVA 5IBCA 1QTIA 4HWPA 2FNAA 1DBVO 3FCOA 1K8QA 4GKBA 5ALEA 5EHGA 5AUQA 5JDCC 4PX2A 1LSOA 4AY3A 2BTQB 2XEXA 5ALQA 2BP7B 3D59A 1XEAA 2ZUBA 3U62A 2F4NA 2WG1A 3FYDA 3QKSB 5CA1A 3KCNA 4W8HA 1R8SA 1VBFA 3VDRA 3ETEA 2YJNA 1MRZA 4FP9A 3B1YA 2R85A 3EXAA 3FHJA 4LZWA 4QQKA 2CV1A 1E0DA 2E18A 3QVGA 4MUFA 5ILGA 4Q1AA 1REQB 1CS4C 1PT9A 1Q57A 2CE2X 3LA8A 4JKYA 3ZU2A 4DDTA 1B6SA 1CRQA 3AGPA 4L5AA 4EELA 2NGRA 4S05A 3WIDA 1GSOA 2XF2A 4DG9A 1K9VF 3QEJA 3ZHVA 4QNMA 1V9CA 1P7CA 2O3QA 4IRXA 4K0KB 3R8XA 5JPIA 1Z2EA 3SFVA 4YLGA 5AW5A 2Q2OA 2XQKA 4PTYA 4UU8A 5I8PA 5JJLA 1C8BA 1BXKA 3GEDA 3H04A 4TN5A 4YY3B 1GQRA 4M36A 3H2GA 1BROA 3EGXB 3NDJA 4IR7A 1P6XA 2IZ7A 3GD7A 3JQQA 4LWQA 4UW9A 4LPSA 4IDCA 4IFEA 3UB3A 2PZFA 2WB2A 1DBWA 2X8BA 1ELOA 2GERA 3BFJA 2ARKA 1L4NA 1DC3A 3M8KA 4X7PA 121PA 5DBIA 3KQQA 3RVJA 5BVGB 1EWQA 3T38A 1YUBA 3K09C 1J07A 1JXOA 1GM5A 3LNTA 4XB2A 4ED9A 2C7QA 3EVTA 2BEWA 4RA9A 4L8GA 1B42A 1W30A 4YCDA 1AQJA 4EQ6B 3V4RA 5BWMA 1CDEA 3RYIA 1NY6A 3R7WB 1SPXA 5IJ0A 2UYGA 2CFOA 1ZM4A 4Y2GA 2CFCA 1X14A 4KK3A 1NBHA 1RAFA 4NCBA 3E3LA 2FPLA 2ZUVA 3IQHX 3Q8KA 1ENZA 2C29D 2NZUG 1D09A 4PYOA 3I4FA 4W9NC 1YIAA 3NIFB 4DCMA 3PITA 3BCUA 1AKNA 3N0WA 5C7YA 1NP7A 2VDQB 1UDXA 2ZBVA 3HV2A 4D6PA 5P8WA 4FR0A 4BB9A 4BQIA 4P93A 3CGGA 4CKCA 3G8AA 1ZSNA 3CVYA 5TB5A 4RBNA 3Q7SA 2A1IA 2OP0A 2GD0A 4O8CA 2IPXA 3WO0A 3BA1A 1U8YA 3K4PA 2X5NA 4CKBB 3EG9A 2HU5A 3BHIA 4RK1A 1C2YA 1BEUB 1GEGA 4TQ9A 3F4KA 3KKPA 4AKTA 3SC6A 3TIFA 1EYZA 1QUFA 3EJWA 3HCBA 3HZRA 1KPIA 1C7IA 4BLTA 3F4LA 5LA6A 4W1RA 1QVWA 9ATCA 2XMZA 3WTBA 4R71A 4UJ5A 1N2HA 1SHLA 4ZMSA 1JJFA 1VB3A 3D4PA 4ZEOA 1I4WA 3RRZA 4UVDA 4DLVA 3HKBB 3FETA 3F6BX 1Z29A 5KPDA 2XJ4A 3BRSA 4P80A 2P40A 5CFMA 3OLCX 3QQ5A 1NLYA 4LZZA 3SS9X 1P75A 3V6LA 3A6JA 4EA7A 4EMBA 1RPJA 1U0SY 4EGQA 4BVBA 4I6JA 3HR4A 4TKUA 1LDMA 4MCHA 3RVOA 5BNFA 4YJ3F 5BQFA 2J33A 3DF7A 4INPA 5D00A 4ZARA 3A1TA 2ZUWA 2SKEA 1NQXA 1HF3A 5EWMA 4LZOA 2L17A 4CG3A 4QGSA 5ARCA 4A92A 4Q3OA 1WSBA 1GWNA 4AJKA 1I51A 3B6ZA 2VEDA 2WHQA 2RHCA 1VG9B 4YMLA 2XZTA 5L7YA 2Q21A 3G0OA 3O3OB 1WDWB 3NDIA 1QVVA 1XZEA 3IMEA 3ONDA 1EQAA 1XNHA 4GRIA 3NHKA 5FO1A 1QQAA 3OAAD 3SZ3A 5JC8A 3HBMA 2YZGA 5EFOA 2RONA 3RIGA 1N2ZA 4ZHQA 2G72A 2GN6A 4A8PA 3E4DA 2OCXA 2C2BA 3H2KA 3W5DA 1FMFA 2VF4X 1YKGA 2EQBA 1GR1A 2ZM5A 1U7OA 5HOEA 3O91A 3A1CA 4OXQA 3C1AA 4LVOA 4EX6A 1RJ9B 1U99A 5FBHA 4GVPA 2H3EA 2O7RA 1D6NA 2A7XA 2HGZA 4Q9HA 4RZHA 5CCXA 1HZZC 3FROA 3DXZA 4Z49A 3G9TA 1IUPA 2FU5C 4MO2A 3JZIA 5DM2A 4IJKA 1M72A 1X7XA 1SUAA 3ZGOA 5BPHA 5HQ3B 1EGHA 4FDAA 4Q1EA 4CMHA 4IV0A 3ESBA 4URVR 1E2MA 1ZQ1A 2XX3A 5B12A 5C81A 1TI7A 3L7YA 2WDZA 5AI9A 3CONA 1EFCA 2DFDA 3CG0A 2JJ8A 4WBNF 1XNJA 3MYYA 5LD2C 1CE8B 4FGJA 3AIOA 3R0XA 4K87A 4B9AA 1P1CA 1U0NA 2CHQA 3EOBI 4RYDA 2HWWA 5I3CA 1CY1A 4Z4QA 1N2CE 3M3HA 2V98A 5D7BA 1BX1A 2XE7A 4GU5A 1HQCA 2I7CA 2VS1A 1QZTA 4C7BA 1ST3A 4DEYA 1X7DA 2WJWA 2P6RA 5JTTA 1AKMA 2QNRA 2WRZA 2WYIA 4S35A 4PZYA 1QO7A 2QIPA 2F9MA 1XQYA 2VNHA 5CUQA 2XOKA 5F35A 2VQ3A 5I7OA 2PUVA 1ORTA 1VSTA 3WNVA 5JDCA 2V7PA 3PQ7A 4BNDB 4HYQA 1OYVA 4O6VA 4TV9B 5FLKA 1JBEA 5JFOA 1I3MA 4JBXA 3I2KA 1CUAA 4IIUA 4F84A 1FVXA 4TZKA 1JAIA 4IVRA 5AKJA 3TS1A 3S40A 4G37A 5J2UA 4EPXA 3C43A 2BONA 1XKQA 3R0IA 3AVOA 1DINA 4MW0A 1YQUA 4J6FA 1XPOA 1O58A 3CF4A 3QE2A 3U3RA 3HCNA 4X45A 2JLVA 3UKDA 4DCVA 3LC0A 2WUWE 1GYQA 1HFWA 2ZRAA 4PXYA 1Z5WA 3YASA 4WMLA 3ZD7A 2DJ5A 2O0LA 3SHFA 1KDOA 3OIWA 2QUHA 2FSIA 4H59A 4X9XA 2PT5A 4BE9A 1O03A 2JEYA 3EVFA 1I01A 3VI3B 1OJLA 3FNHA 2EZ8A 3QBJA 4G2TA 2YXPX 5F64A 2GLXA 1AUPA 1F6BA 1Q1QA 221PA 4MAFA 4NYJR 4W7IA 3TDKA 1XXLA 4IWXA 3UH1A 3CVOA 4L3OA 2IXAA 4FYIA 4Q66C 5EKDA 2GARA 4D3ZA 2MTBA 1T1EA 1YS2X 5DLPA 3DLAA 4I5FA 4N1AA 5EQJB 1OASA 2SNIE 5HW0A 3ISVA 1E8DA 1JUDA 1TMGE 2HADA 2Q8NA 4ZQBA 1DZIA 4R9NA 4D92A 5L3QA 5EZ5A 1KVRA 1VE1A 3NBQA 4N48A 2OYSA 3K0AA 3IVAA 3S68A 5B4TA 2JBWA 3O1HB 4Y2QA 2JLXA 3FKJA 5DX8A 4AXBA 3EZ6A 4RSRA 3AB7A 4Y2YA 5DPMA 2L2QA 4B87A 3T5DA 5LLDA 1HPLA 1GCIA 2BI8A 1RADA 4MTLA 1RWMA 2Z1MA 3NH9A 4URFA 4WZZA 4XIFA 4YVFA 1Q0TA 2BGUA 3CISA 4DG8A 3ELUA 3CLKA 4ZVPA 2VPZA 4JJIA 5C4GB 2IF0A 4N0PA 2PL5A 3K6JA 1L0BA 1PO7A 3PWSA 1W44A 3TXYA 1M2OB 4NK5A 4Q02A 5FEMA 2W6IA 4YRRA 1KETA 2OT3B 3H5AA 4X1KB 1PEKE 3UM9A 1AS3A 1OT3A 1TA0A 3GT0A 4RMJA 3WDMA 4D0GA 1RRFA 4X94A 2ZTLA 3U4QA 3C2QA 5LP6B 4NBWA 2GD6A 4MNTA 4H7PA 4JHLA 2G76A 1X7YB 2WHXA 1CUYA 4M87A 4TYMA 2C2ZA 4RD1A 4ZQCB 5ESXA 2GN9A 1G5PA 3CZRA 1U0GA 3TBFA 1JKFA 2J6BA 3H19A 4OYHA 2V8OA 3LYUA 1U31A 2VPIA 5FOUA 3R9IA 3KOWA 4H16A 4Q9KA 1XVLA 1I4LD 1M73E 1UMCB 3GCGA 1LK7A 2IEYA 4H1HA 2AFIB 1X2EA 2GDJA 2NTJA 3LU1A 4BJ5A 2XMSA 3JD0A 4B3CA 1MVOA 1ZI6A 2XB9A 1EGMB 1MLDA 1UJBA 2A58A 2C95A 5GM1A 3R8CA 2BGGA 2VDLB 2ZOSA 2VDRB 2AR9A 3D4IA 4M4SA 4NJEB 1Q1BA 3BMOA 5IFKA 2ZU6A 1FUIA 2L82A 1EXWA 2HK7A 4Y1FA 3EW7A 2FWNA 3M81A 1VFNA 1QJ4A 3BBPA 4PG6A 1L3IA 5EJ9A 2NM0A 2YY5A 1FMCA 1FTSA 4HDKA 2B7LA 4EG8A 2X6TA 3AVUA 3JVVA 2V59A 3GT7A 3JZFA 1JAHA 4D8VA 2H5EA 2R97A 4NESA 4FFBB 5EFZA 3HE3A 3DMGA 1A4XA 1H9BA 1VI2A 1VMKA 3RRNA 1JLLA 3PNPA 3AVTA 4P5PA 3RSZA 1VJ5A 2NAPA 3CWQA 2WP8J 2H2GA 3VFDA 3AR8A 3ESRA 1V8PA 1A2OA 3GQVA 4QA9A 4RZ2A 4KW7A 4AJ1A 4FS8A 1JDBB 1E9RA 1XCGB 3BTSA 3DB2A 1M1UA 1OKKD 2WQZA 4HTFB 3WL7A 4DMRA 3WLHA 1YQ9A 4LJLA 1ODIA 1TLTA 2OXFA 1J8QA 4MGEA 4OHKA 4OHOA 2H4HA 4XPZA 4JI6B 1W2HA 1IXZA 2PX8A 4LC1A 3WQQA 2GAFA 3D2AA 3U3OA 4DQKA 2E4ZA 3WGZA 4HSGA 2GNAA 2RG7A 4P36A 3I9V1 1KQ3A 1R0XA 2YWJA 2VHCA 2ZIWB 4WA8A 3OCUA 2FN4A 3ZDXB 2A9VA 2UZ0A 1P3DA 1BMTA 1D4FA 2X13A 2AN1A 2CVHA 1SQ0A 3HWWA 1H42A 3RLFA 3ILHA 3ORFA 3FZEA 3OEWA 1XRMA 1SUDA 2C4KA 2Q1XA 4ENSA 1DIAA 1ESNA 1DX9A 4DLUA 4MP3A 4Y9TA 3OZRA 1R0LA 4NS4A 2GEDA 3EGXA 1JZSA 2N47A 5DNYB 3HXQA 1TUGA 4U0JA 1U2PA 3BSSA 2JAQA 3A9CA 2XQFA 3GUYA 3PD7A 4CM7A 1IBRA 1JA9A 1Z2CA 3DT8A 5KKNB 5CJJA 2AD1A 5BVGA 4K5QA 2RKWA 4BO9A 1MEEA 2OBNA 4OGLA 5DW0A 3HVJA 2FX2A 1L5LA 1DRUA 4EMSA 1WDLA 1GZ4A 3M5CA 1AUVA 3AL2A 5P21A 4UCWA 3RYCB 3RAGA 3N8HA 2O5CA 2FPRA 2WDPA 3A05A 4N0EA 4D8YA 2I6QA 4ONEA 2C96A 4I4TF 1NURA 4WLNA 5ENZA 4EQ6A 3HA7A 1ZA1A 4KLCA 5K3DA 3USES 4LJ6A 3FPFA 3ZWKA 4EUKA 2FPKA 5KEIA 5LZ8A 3CBGA 3KPWA 4CEHB 4QHYA 1N2EA 1SU6A 1PTKA 1YO6A 1J8MF 2OG2A 3ND7A 4MYHA 4R3NA 3L8HA 5ER6A 1LBSA 3DR3A 5DJ5A 4HVLA 1KHHA 2V7BA 3ELYA 1CERA 4MR7B 4LV6A 2E4VA 2FMHA 4P3PA 4F2HA 4IJUA 5B7PA 1YZKA 4D0SA 2CY0A 1I5OA 2OCDA 2C9ZA 2JFGA 3UJ9A 1YZQA 3R3SA 2YMQA 2CNOA 4GDMA 1KZ9A 2GF0A 3KLNA 3O8LA 4B31A 3HKCA 3GFGA 1XMVA 3F5MA 5IZCC 1MH9A 4XARA 3AUJB 4GQBA 4G86A 4PHFA 3RE1A 3T94A 2G1PA 2EBFX 5EL0A 4OQEA 4ZZ0A 2AOXA 3OM0A 2F1IA 3PCXA 4MKZA 4C0XA 5LP6C 3CUWA 4M1TA 1UC9A 3RUCA 3THOA 3IDSA 2DT8A 1XZ8A 1XCPA 2ZUUA 3HZOA 4ISBA 2DFLA 4DJAA 3GELA 2CYCA 2Q49A 4HX5A 3FWKA 2DVMA 4AG5A 1KDTA 3OZGA 4ROSA 1NQAO 4B6RA 2MSDB 2WYHA 3HKBA 3CLUC 4WT7A 1WMBA 3L2OB 4KV7A 3W1EA 4YDRA 1I10A 4LC9A 1IL0A 4WL0A 2XCSB 1E2NA 2G5TA 1XOIA 1ZD9A 4NNJA 5B2FA 4KHZA 2VPYA 3TINA 2HA2A 2IHTA 1EP3B 2P9CA 3GN2A 3O73A 4REMA 3FXAA 3SLKA 3TNFA 2ZAYA 2EIHA 5CX1A 2VHQA 3I12A 2PYDA 1YIOA 4HT3B 1R5NA 3PHJA 2PRSA 2BFFB 3L7LA 3OPYB 5HBRA 4BRUA 1N2GA 2GB4A 3T7JA 2XUJA 1JNYA 3FKSD 4D4JA 1WCV1 1E4EA 3LRTA 4H0FA 3OTOB 2Z2IA 2OV6A 1UZAA 3V2GA 1JPNA 3CTPA 4WTOA 3TEJA 3WK7A 1Z83A 4ER7A 3Q8MA 4D4MA 2UU9B 3B51X 3JD3A 2WWYA 2BEJA 1KJNA 3MHTA 3L0CA 5DRYA 1TTPB 5LKRA 1KIAA 2ZREA 4DV7B 4QVIA 2BM1A 1B8UA 1E3IA 1JDBC 1TCVA 2NZVG 4EL5A 5KVSA 3N6VA 3CLSD 1IHPA 4MWBA 5LP1A 1NC1A 1M6WA 3JRWA 3TLGB 4BGIA 3S7TA 5GM2A 1IK4A 3K8OE 5IYZB 5HRUA 1EG2A 4V24A 1B8PA 4Y6GB 5K0FA 1ZCBA 2FDCA 2NYUA 1K63A 1NOKA 4OV6B 4A0HA 1RM3A 4X44A 5AQEA 4YECA 2VRNA 2IUEA 4IH9A 4B6QA 1AH2A 3UMFA 1FIUA 1OC4A 1CQIA 4B09A 3CNEA 4QOEA 4RF4A 2JD1A 1PR6A 2IL1A 1E77A 3C6KA 3WP0A 4D99A 2VSQA 1LLFA 2FRDC 1PJSA 1YJCA 1K9SA 2WJGA 1GD1O 4YMIA 1XLTA 1DFGA 2SKCA 3D6NB 2CD7A 4IL5A 1DUSA 2VHWA 1KYTA 1YRBA 3RWMB 1I24A 3HSKA 1A7AA 2J6IA 2PX5A 2BCGY 1O6BA 3TZLA 3PDJA 3WG9A 1YRQA 4DF3A 2K2QB 4TZ0A 3LKZA 1GPNA 3VQTA 4B0PA 3GRCA 1KJYA 1O8BA 1RIFA 3LPDA 1JBQA 2Q9BA 1U11A 5BSFA 1OR8A 1ZICA 2JI4A 1TK2A 5KSWB 1FUKA 2AA3A 1AVTA 3BWVA 3PHLA 4R9UC 2Q6IA 4RK6A 3UA3A 1WZEA 4X5OA 1DU4A 4Q7EA 3VHRA 3Q3VA 4GGPA 1DRWA 1RI3A 3DQPA 3H99A 4Z53A 1GCAA 3FGZA 4HH1A 4JMPA 2W42A 5IVKA 3BZBA 5L4LA 3N7TA 5AI6A 1QP4A 3KV1A 3HB5X 3LF2A 3VZCA 3IS3A 1F5SA 2H59A 3SBDA 4Z4HA 3MHPA 2CVOA 3FUCA 2FE4A 3ECAA 1KJIA 1N2CB 3NGXA 5FXMA 4RENA 3CXUA 2GI4A 4BB5A 3FD8A 1XAGA 1RPZA 5DBEX 1G20B 2G5GX 2WWTA 2IGTA 4JBIA 4YJHB 3PFGA 2P6NA 2I2AA 4HAZA 1ZEMA 2G1KA 1OX4B 4TV9A 5ALMA 1KBOA 3LV8A 3HG7A 3RUPA 2CZGA 1MH1A 2IP4A 4IFIA 4OX9Y 2Q99A 4E5YA 3A58B 5EE3A 4OXYA 4EZEA 2J30A 3LHIA 1GLNA 4Z0PA 2JANA 1NU6A 3FTPA 3TL2A 4B34A 4YGXB 3VO2A 4TTVA 5JATA 1EUZA 4OGWA 1ZL2A 5JYDA 5K0SA 1P7PA 2PRZA 4PZEA 3S70A 1UKYA 5L40A 2GM4A 1TD1A 3MJFA 5AH0A 2NO5A 2ANBA 2I65A 1DJOA 4HO1X 3LBNA 4MQFA 5FKJA 3ZDAA 2V5AA 1OLUB 2O2SA 2NVBA 4MDYA 2HJWA 1K6XA 1PU2A 1W6RA 2WJJA 3O4FA 4PSCA 5TSDA 1RAAA 4DJTA 4G9BA 2P2SA 4OL9A 5AM3A 2CHVA 4QDUA 1SOVA 4F3YA 4DA9A 4QDJA 2CL0X 2IYZA 5F12A 1AV7A 2V55B 5FLYA 3WR5A 4C0AC 2ZYUX 3DEAA 2B4KA 3B52X 1C4XA 4KNVA 2OAQ1 2PTHA 2MJLA 2VH5R 4R05A 4RPIA 4Z9XA 3NAQA 1E92A 4BNWA 4LXTA 3FNBA 2JFPA 3N0TA 2ZTSA 2WSSD 1YQQA 3R3HA 5CB4F 3H5NA 4B17A 4C6RA 2R0QC 1M2HA 5EWLA 3VR6A 3AETA 1CG6A 3L1UA 1E2LA 4RK4A 3THSA 4BEJA 4B6JA 5KNBA 4E2ZA 3KVYA 4OA8A 3C98A 3RARA 1BA2A 2DKOA 3RRJA 3E1GA 4YLYA 3I9OA 3EY9A 1T4BA 2FEWB 5K0GA 3CRVA 2VKQA 4NNPA 3FWNA 2UXCB 3GLHB 1TLFA 2IKSA 2NV6A 1LSJA 3CEPB 3EGWA 3EYWA 2BFCB 621PA 4WV3A 3U9LA 1R88A 2OGZA 1NYRA 2QL6A 1CX9B 4J8PA 1GRQA 1TT5B 2JJYA 4QUAA 2OXCA 2XKAA 1EVLA 5FHRA 1M2OA 4M88A 4ZOLF 3NWEA 5JAOA 2ENWA 1U3VA 1ZZGA 1BOFA 2O23A 4MWCA 2HF8A 4X1KA 5DTEA 5JVDB 2K2WA 4XUDA 3WFZA 4BMZA 1IN6A 4DCSA 1ZNYA 3PNKA 1ORRA 2FSFA 5KTNA 4WW0A 2VZLA 4XVUA 4Z6KA 3ZK8A 2VF8A 2XUHA 4QUEA 4EJMA 2WQ6A 1KI3A 2DOKA 3E15A 2I3DA 5ELLA 3IPRA 4Q19A 4HGOA 4UNQA 1BQ4A 2CFIA 2IYRA 3JR7A 3RTGA 3UFBA 1YI0A 3MWFA 1YFKA 2QMUA 3P32A 1UMCA 1E6LA 3OMWA 2OFFA 2GKSA 1F17A 4R0MA 2H16A 3A1UA 1HDZA 1VMDA 1PLKA 1DJNA 2BEUA 2G9NA 4ZN6A 3S81A 3KQNA 3JVEA 3IQXA 4JK3A 4NJEA 1S02A 2AUTA 1V16A 1G8FA 2OCAA 2RBEA 3BWCA 3DZGA 4AX4A 1J0EA 3OPMA 3CTMA 1NVMB 1UPTA 1QLHA 1T9AA 4W5TA 2Q50A 1CUUA 1G41A 4FWTA 3CZCA 2KM1A 3FN4A 2EZ4A 1PNOA 2FEXA 2R1VB 3DBHB 3EDQA 4NPCA 2F8MA 5KNDA 1U0FA 2DCUA 1WV1A 5CFPA 5JHGB 1TFRA 3UPDA 1BG6A 2GN0A 3AFNA 3R4VA 1L5YA 3LZDA 2H7CA 4ZAFA 2YVLA 1YBFA 2X9LA 3G79A 3QGMA 5IBQA 4PLZA 4DSZA 5DNUA 3OZ7A 1EBFA 3ZNQA 5BVHB 1GRCA 3MD0A 2QS9A 4AZ3B 4F4UA 4KQ2A 2TS1A 3OTGA 3N76A 4K6FA 4PLVA 5HG0A 3T9CA 4AECA 3PEYA 4RVHA 4HTFA 4QYIA 1MT0A 4WY5A 2FFJA 3PU6A 2P6OA 3L4JA 1U2TA 1WXDA 4ENRA 4CIWA 4O4HA 2XBUA 2E4UA 3TK1A 2JLQA 4GQIA 1F0KA 1M6NA 1VJCA 1IBMB 3ZOKA 2F67A 2MSKA 3D2CA 3JWPA 2FFAA 1GSIA 1RWBA 3K35A 5K0EA 2PUAA 4Y6RA 3I2YX 5HGJA 1NIJA 1JN0A 1OBOA 4XRGA 2XW6A 5EC8A 4D43A 4I99A 1SMKA 5T6BA 3KEFA 1GGEA 3G82C 3F74A 3P8ZA 1P1RA 3OG9A 3WS7A 4A8TA 2VHJA 3WK5A 3K15A 4OBBA 3ZXYA 1VCMA 3GGCA 3QJ5A 3BORA 4G07A 4KO4S 1QFZA 1UKBA 1VA4A 3T35A 3RASA 4PHHA 1PCXA 1FTWA 2IYUA 4ND8B 3ZGVA 4CCYB 5CPFA 1DG1G 2Z5GA 4HFNA 3Q7EA 2EP8A 1I33A 4KG7A 2VH1A 2X8JA 1GPUA 2P0YA 4J3JA 4D0LB 4TQUS 4MO9A 1OMOA 3KLMX 3AJEA 3AI1A 3QEKA 2IODA 4RELA 4QG3A 3P19A 2R8XA 1E1LA 3EVDA 5KAMA 4AP6A 2J08A 4B2LA 1JYEA 2YINC 4FHZA 2BGMA 1RNLA 2ZUCA 4L74A 5FWNA 2B0CA 1WNTA 4YH1A 2C3YA 2R2AA 5IP5A 1CQWA 3WLQA 3D8RA 1RKBA 5KNCD 5AVYA 4IQGA 4BN0A 1QGED 2QUIA 1ES9A 4AZ0A 4BU0A 2ZJFA 3Q11A 1TU3A 4AZWA 3DV9A 3C6XA 1Q12A 1G3IA 1Z9BA 3A9SA 5DHTA 4BMNA 1F5NA 3MCZA 3BIJA 4ETNA 4L4RA 4YXWD 2YQZA 2H06A 3K8ZA 2UZIR 3E1KA 1SBIA 1EVZA 6ABPA 4FYYA 4IDDA 4WECA 5ELMA 4EP1A 1CNEA 1NF8A 2NV0A 2ORYA 5DT9A 3JXEA 3LCCA 4IIEA 1FYEA 2V7EA 3JD1A 3WL8A 2ZBPA 3GNLA 4J0DA 2YZKA 4AYTA 1VJDA 1M5TA 3L7OA 3O2SB 1R50A 5BV7A 1UPFA 1VDMA 2DH5A 2FMFA 3SDBA 3WB0A 4AMVA 4F86A 2WSMA 2NSHA 3I0MA 2GESA 3ZZTA 2DHCA 4WINA 4EF5A 3SYNA 1W0JD 4BX0A 4FNGA 2I03A 2PJZA 4DV4B 3OHMA 1I3KA 1QLJA 5FPPA 1W52X 2CL6X 3AR9A 4DLTA 1FQWA 4B74A 3H8SA 4HG2A 3OM1A 2JFQA 2D74A 4Y2XA 4BAUA 2GILA 3ONWA 2VH2A 1G9TA 1ZC3A 3ZW8A 2RG1A 1ZM2A 3H6HA 4C7VA 2M6KA 4NHOA 1II9A 2LIPA 3O75A 4QKQA 4F3KA 5KJFA 3KPVA 4JV5B 4TOIA 4IX9A 1UMBA 3R1IA 4HZIA 5DM60 1XJQA 1Y7PA 2HIGA 4CT5A 5KTMA 3PX7A 3G1UA 5AJWA 1TAQA 5CMLA 1MNQA 2XT6A 3E27A 2PKRA 4EYEA 4ABTA 1H3EA 4E4TA 2A9PA 2ZJBA 4H1TA 4JOQA 3A25A 4A27A 2BFFA 3ER6A 3OPYA 2ZRIA 3WQHA 2O7NA 1MCZA 4ARUA 4URUR 4F12A 2YWXA 1JFSA 5IHPA 1Y82A 5ABPA 1KSJA 1K6MA 4PO9A 4B4UA 3ED5A 2B4AA 4L4ZA 5JQGB 2IZ5A 4QQRA 1ZJYA 2R4QA 5MN5A 2R8BA 2BM0A 3P4YA 4S24A 4CIYA 4PYLA 5EUBA 1FTYA 4DLKA 3KQLA 5PNTA 1WUJS 4RJKA 2OHGA 2HA6A 1I0LA 1I5EA 2R6GA 1P31A 1TCUA 2ZWAA 3GLQA 3IPLA 3IUJA 3JD2A 5AVSA 3TLGA 1Z33A 4LRUA 3EUFA 4RFVA 1QZXA 1M54A 4D1YA 1D4AA 3LUJA 1UM8A 5LQCA 2FEAA 1CRWG 1S01A 4BNMA 3VZDA 3OFKA 4O2AA 4J07A 3LHDA 5FL7A 1JU4A 3F2IA 4GP7A 1E6CA 3TW4A 1ZD1A 2Q2NA 3QPWA 4J3FA 4K3VA 3U7FB 2AG5A 4QYSA 1J2JA 2A9OA 2DLCX 2V6BA 1Q19A 2V6MA 4NV1A 5EJGA 5TV2A 1SKMA 5J59A 1YNOA 6REQA 3B7WA 3OBBA 1G3UA 1SWVA 1U8XX 4M8SA 3ZK9A 2GCIA 1MJFA 4DLSA 2FPGB 3QE4A 5A7HA 1ZHOA 2C94A 3PXUA 1W4CA 2EERA 4K46A 1VE9A 2FI1A 2P67A 4CKWB 3HYSA 3KUCA 5F9FA 4HLCA 3QLJA 3S8MA 2X1HA 3GCZA 4F5ZA 5EMKA 5EZSA 1NUPA 4YQZA 2Z95A 4TTIA 1NMEA 2OESA 1TM1E 2AN3A 5IEBA 4KO3S 5ALZA 1A9PA 3N86A 2ZCVA 1A5TA 1QR6A 4FNAA 2FSUA 1XVUA 1X38A 2VT7A 4DSAA 3FZNA 1JIIA 3OIYA 1WL8A 4CDGA 2VDNB 2OVBA 2BYTA 5D5PA 4LDRA 3RNLA 5TNXA 3QWAA 4KFTA 2J3LA 4BQPA 4G0OA 1ZD5A 4BS9A 2BLNA 4LRYA 2JJ1A 1U3CA 2QTFA 3LAWA 5DLYA 4QBHA 2X14A 4BEWA 1YVPA 4FB4A 3VPBA 1N2CA 4KAXA 3A9RA 1RJDA 4LHSA 2R47A 3GRUA 5A6SB 3H13A 3QXSA 1B0ZA 1IHXA 2AC7A 3Q9LA 4K9NA 1WMFA 1OX4A 1QDLB 2A2ZA 4MGHA 1P5ZB 2G0AA 2EFGA 3UK2A 3B7PA 4D8WA 3JQGB 1ZUNB 3QKTA 3MBIA 4H2DA 2NXNA 4F06A 5BRJA 3AY6A 2QMOA 1H8HD 2JCGA 2XB8A 5IAGA 1RBYA 4Q4AA 3WBBA 4EG7A 1UH5A 1QX4A 2P9JA 5CIQA 2IYVA 4G9EA 4FWIB 2J4FA 4FPXA 4UREA 3JYHA 1G5FA 2MWMA 3GRRA 2QRGA 3V1YA 2D2IA 4P6VF 1GPBA 3QXXA 4BLOA 2IT1A 1A4IA 4MICA 3L4BC 2INGX 5TGZA 4X0EA 3SQNA 1A9SA 2O2DA 1I3NA 3RRMA 4LYYA 5LZ5A 3UAOA 1CUVA 1EH5A 2J41A 1SCDA 4B48A 4AJ2A 2IYWA 1VL5A 1G64A 3PC7A 3PUYA 4B4DA 4A91A 2Q3CA 2I54A 3DLIA 5ECYA 3RDPA 5A3SA 3UJCA 1J0BA 2PA3A 1YC5A 4BCCA 4F7DA 5JXWA 3RKRA 4CIDA 1IBKB 3IJEB 1ZJJA 2CZQA 1BMDA 3JR3A 3R7FA 3NAZA 3K70D 4GI7A 3EIQA 3ASUA 4WH0A 2VQEB 1U3FA 3GJYA 4MVWA 1LZLA 3OURA 3PWKA 5FA5A 2PGJA 1HMYA 3NASA 5DI3A 2VYFA 1ZXBA 5F7JA 2QBYB 3Q1LA 1SD5A 1VECA 1RI4A 4JUDX 4TS3A 3OE4A 2QF7A 4CLXA 2W6NA 4HAYA 2CJPA 4NV0A 3BWMA 1E1KA 1P5JA 4HNQA 3G2LA 3V1TC 3ZH9B 1F2DA 2G08A 2RE8A 3IUSA 2C5FA 2CD9A 5JTUA 4D6XA 1G7CA 2ODNA 2ADFA 1T9GR 4QGBA 1X1SA 1SXJE 1CUXA 5ICCA 421PA 1LSUA 1DKRA 3TZCA 4GVXA 5AO9A 5U4QA 1RQGA 5K3BA 1XLVA 3CVVA 2BFCA 2XADA 5ALTA 3R7SA 3R75A 1TGYA 5JH7F 3EH2A 3CLHA 3PNVA 4CF5A 3KB1A 1C7FA 1TT5A 2RMKA 1KFJB 1YDEA 3D6TB 5JI3E 3G7NA 4KLNA 3GIDA 5IFLA 2QX7A 1XWIA 2P4HX 3ELDA 1QVRA 1JEJA 1XYVA 3BDIA 4PLTA 5I4KA 3AVXA 1EZ4A 3UAZA 4MI6A 2Q9UA 4AT1A 1RABA 1PLJA 3TLAA 4CEJA 1NPYA 4LISA 1DARA 2ZIXA 1CNFA 4RACA 5FCDA 2QM0A 4PG5A 4E6EA 1WCXA 4YT4A 1R3UA 1XTSA 1BS2A 1FDTA 2DPMA 5LXTF 1VCNA 3DVQX 4IHQA 4PVDA 5D5QA 4CG2A 2OZLB 4DM7A 3U3MA 4LF9B 4FD3A 1U04A 3UYKA 1R0WA 1XCLA 4YRQA 2ZB8A 4BNVA 5BUZA 5HA5A 2Z56A 3EXG1 4A8JB 2CF6A 1QRDA 1HNWB 1QF6A 2R25B 2I6XA 2ZE5A 4FZVA 1DHRA 4TQGA 1P1KA 3FVVA 1OF1A 4ZT3A 1PFGA 3K92A 3J7TA 3H42B 1P3JA 1NP6A 3B3QA 3ML1A 4I50F 5EPEA 4EFMA 4I8IA 3L8GA 1WLYA 4XFJA 5EQFA 3QYAA 4GEKA 5IH3A 4MJ7A 1R3DA 4JENA 2B2NA 3FDJA 6LDHA 1XDGA 2BKUA 5A3JA 4CL3A 3UANA 3DBHA 3EVAA 3IFSA 4KPUA 2I4IA 2XHEA 1J2UA 2WM2A 4NZPA 3C16C 1BKYA 3DEFA 1KC3A 3OZXA 1DIOB 3T7KA 4DG5A 1JQEA 5JE8A 4ZJPA 3BWYA 3SG0A 2PUEA 3COVA 5G4KB 3RVMA 3ZQJA 2NZ2A 3HNPA 4HWGA 5EEHA 3FDZA 4EW1A 5BVHA 2ZANA 4AZ3A 13PKA 1Z36A 2GXUA 3F98A 4K9QA 1HDOA 1UBFA 1IULA 1G8SA 3ELBA 4KMMA 2DUMA 3HP4A 4HTAA 3H05A 4F6RB 1VDZA 2FOLA 4Z7OB 2E5WA 3BX1A 1ADCA 4PRLA 4D4KA 1H3FA 5EOVA 4DKJA 4OHYA 4YJDA 1QC5B 4AUNA 1XAJA 2HHCA 5DYIA 4WFJA 1I6LA 1A88A 4G24A 2PUHA 3FVQA 1F8FA 1CEEA 3U2QA 1E60A 4P53A 3G9UA 5JCJA 4KWHA 3RK0A 1TF5A 4ZT6A 1GJRA 1GHTA 1ZUIA 3E70C 3GJZA 3L82B 3SQDA 3TQRA 2PQ2A 3PRYA 4CETA 1K8RA 2FPIA 2ZYGA 2W6OA 2XWQA 4IDFA 4Q3EA 4RSMA 4JUAA 2JDIA 3NWPA 4B3HA 1U0TA 1PYOA 5I51A 5LFAA 4BC0A 2B7BA 1Z0IA 4R3UC 4IWNA 5LC1A 3VOAA 1J97A 4M38A 2XMRA 3HNRA 4FJ1A 1JR3A 3AR7A 4L4UA 4UVGA 1XEXA 4OYLA 3RSHA 4YCAA 4J94A 1P0CA 3TL3A 3DE5X 4ND8A 3I01M 5G41A 4ENTA 4YRMA 1RCUA 2FEOA 1ZN2A 1JECA 1DBIA 4HMPA 1YR8A 2B5OA 2HO4A 2HMSA 4RORA 2DFNA 5K20A 4U7PB 5EZ6B 5FWDA 5E38A 3SHOA 7AT1A 2Q4DA 4Q1BA 2KW5A 3GLRA 3GRPA 2CKDA 3EH1A 4TWRA 2O8EB 3LKBA 1XMJA 1HI9A 5B7NA 3H5VA 4HB2A 4PZLA 2PBRA 4IMRA 4TXLA 2Y92A 2JZNA 3PKZA 3GNTA 3N39C 4RCVA 3PJGA 3BL5A 4ZO7A 2GXSA 4CMBA 5LVAA 2V9ZA 1LJLA 2OCIA 2X42A 4WKOA 4YP9A 4D9FA 5KOIA 3ZDCA 2C42A 1FRFS 2D0OB 3DZCA 5LR6A 1U1GA 1QE3A 2A5FA 4HAOA 4K3UA 2RH5A 2P6UA 2MT9A 1JB1A 1D5CA 1QG4A 1TVCA 2JZCA 3U3XA 3ZIDA 4F3TA 1IM5A 3DV0A 3WNZA 5TIIA 2ZBQA 2DWCA 5EIFA 3R6TA 5K3SA 3N2NA 4UC0A 2VHEA 1USKA 1EM8B 4H7HA 1JS1X 4QBIA 2VL7A 4J16A 1NI4A 4Y2JA 4GLFA 2JAWA 1N5KA 4GZ5A 2WOJA 3IT3A 5EIBC 1UQRA 1P39A 1DEOA 4C4TA 2YHSA 1DWOA 2DECA 3LXUX 3PK0A 1BYUA 3HXKA 3SD7A 5K3CA 5BWLA 4G85A 1E5QA 1HWYA 5KVQA 2VK8A 2QR2A 1ZK3A 2FJPA 1CJKC 3GLGB 1RHMA 1D2NA 3NI2A 1V8FA 1K4YA 4A8JC 4HL6A 1CVLA 4MRMB 4IHJF 4RPLA 3UJNA 5CCBA 1L5HB 3K0BA 1ACJA 1LRLA 4CLOB 5EGSA 2PEZA 1AK9A 3D7LA 4MUGA 2UYHA 1SBYA 1Z56C 3VR5D 2OHXA 2PMFA 5CG1A 2OMKA 4BNNA 4XQCA 1F0NA 1SWWA 1N3IA 3UW3A 4Y98A 5GQSA 2AXNA 3O38A 3BD9A 1Y63A 3WLJA 4B6GA 2WD7A 5CDSA 4FLMA 1Y3FE 3LQRA 2EEZA 5ITZA 4PTLA 3H5LA 1JVSA 3TCNA 4ENVA 1ZM7A 1Y6JA 2H7XA 2WIAA 3EIHA 1KK2A 4NMWA 2C2MA 5FORA 4BZPA 2YH2A 4RHEA 3KPJA 4YXFA 5ALXA 1SUCA 4B4OA 4PLGA 1RTTA 1QKKA 5DBOA 2B30A 2H51A 5FUQA 5C7IO 2YXBA 2JBHA 3M4NA 3QA3E 5IJ9B 3STUA 1JZQA 2VHVA 1K86A 1VKNA 3GK3A 3PL1A 3K31A 3LFUA 3OWOA 1DEHA 1G8PA 4XDHA 4R40A 4GRAA 3LDUA 4F4JA 3T54A 4FGLA 3JQ8B 3PSAA 1PK8A 4RPKA 3GGSA 2NO7A 3TAUA 1QMPA 3S8YA 3PYMA 1L7EA 4P0TA 1PDVA 2XGMA 3GWGA 4F8YA 4XD7A 1QIGA 2PTGA 2HLNA 3ZHUA 1JL3A 3GFSA 4EBBA 4GPEA 1XZBA 4R6XA 2O8DA 1EP1B 1XDBA 3AEKB 1LNQA 1ZGHA 2QG4A 4DT1B 3QHQA 1D6SA 3EVZA 2PKYX 2VAVA 2VNJA 3WTCA 5B3AA 1XZHA 1E0JA 2IBMA 4KB5A 5LQAA 3K6SB 3P9YA 1HT0A 3STTA 1GAJA 3H0KA 1OA0A 5B37A 2FV8A 1XTRA 3MGBA 3UV7A 3VYWA 4AJPA 3MINA 2QRKA 4BMDA 2RGAA 1Z73A 1JEAA 4BVFA 2OBYA 1HYBA 3F97A 5CDHA 1LSSA 4L5JA 3N5CA 4U2EA 3GJ7A 5AK6A 3OF5A 3ZV7A 2A84A 2JD2A 3O92A 2O3TA 5L95A 2HRZA 2HQOA 1MABB 2ZSUA 1Y4SA 2QD3A 1RLOA 1ODCA 2B82A 3NKLA 4M9CA 4Q3BA 1M6YA 4RIGA 5J1TB 2WMDA 2PDAA 1B93A 4IH1A 3F49S 2BFMA 1OHHA 1W4BA 3IO3A 2CKMA 3C8HA 1D1TA 3A37A 3TE7A 5HIAA 1QYRA 4RM2A 4HQ6A 2GN8A 2Q3EA 3TTSA 2F7SA 4AMUA 2GCNA 4RHYA 3ZE6A 1D4ZA 3IDOA 3SR4A 1XZIA 2E2WA 4E11A 5JDIC 1G5HA 2X0DA 4XGRA 3TLEA 1M8PA 4X54A 3T5PA 4JI0B 3MC1A 2H4FA 2O2HA 3HR7A 1YDFA 3JQAB 3AESA 3QG5A 1HDIA 4LRWA 3U0VA 4RE5A 1GPDG 1SOMA 3P26A 3FUXA 2PGAA 1IZYA 1ONPA 3QLUC 5EHQA 1FP4A 3I61A 5IT4A 3RU2A 2XWPA 3EMKA 3GVPA 2FR1A 3BHMA 3K05A 4IF6A 4L8FA 4F2GA 5H9WA 2VIIA 4EVRA 2CCJA 1SQSA 1AXGA 4P84A 2HA0A 2IF2A 4KOEC 2BOVA 1E1RA 2WU1A 4LQDA 1B43A 1CY8A 1F48A 1GZSA 4DB2A 2VYND 4XX0B 4HPXB 3K5IA 2QW8A 3K6RA 3ZK7A 5IT0A 3Q7PA 5LA6F 5KNCH 5ILOA 1ULHA 3C24A 2C5GA 3IBYA 3M6LA 1E6KA 1UKVY 4XE5A 2WINI 2Q8PA 2JIZA 4J2OA 1GQFA 2VJQA 3RUEA 1F7VA 2VRCA 1IONA 1PSWA 2CSXA 4IIGA 2VSXA 5EESA 3RANA 5GIPE 2CV2A 1OWOA 1UXHA 4RE6A 4R69A 2VSOA 1TIBA 2Q3MA 3PHBE 2I29A 2X0KA 4BO2A 3ABSB 5F7ZA 3PCRB 3D2LA 2FZ4A 1WX1A 1YU9A 3PKJA 5I7HA 2UVPB 2GH1A 1K7FB 3L7KA 1TK9A 5KQPA 2GZRA 3ZS8A 1EBUA 4GGOA 1ATIA 1ECGA 2C59A 4AJNA 4Z54A 2WKSA 1WD7A 1G1MA 3QUCA 5T41A 1NXXA 4J6EA 4C14A 4V1CB 4KRFA 4CM9A 1KEZA 1GQQA 1NV9A 3LOPA 3DL2A 4RV9A 3A04A 2J0VA 3P0JA 5HFNA 4ZOEA 1EHIA 4PPGA 5FQOA 3VM6A 4WDQA 5H59A 2F17A 2GDZA 4BVEA 1SURA 1PHRA 2EG5A 3JARB 4ZAYA 3CVUA 3O8QA 3PC2A 1NL3A 4FDMA 4JUBA 1IUKA 3SBXA 3Q12A 4R3WA 3P45A 4QBKA 1LJ8A 2LPMA 2B8NA 4N40A 1BMQA 4RVNA 1XTQA 4Y1GA 5E0KB 1Z7GA 1IMJA 2FP3A 5ECWA 2Q0HA 5EQTA 1JKIA 4C5BA 3R0QA 4LDPA 4R2JA 4OCZA 1C7EA 1M67A 2QLNA 3WZMA 2A9FA 1LLUA 2O8BB 4CTJA 1JHVA 3OQIB 3UOWA 4RTMA 3MN1A 4EHAA 2OL4A 4AY2A 2I3GA 4MS4B 3AJRA 1IJKA 5CBPB 2PD4A 1PNQA 3TKAA 2YFYA 1T6ZA 2PM8A 3NTXA 2OQVA 3C5EA 1U2ZA 1JA1A 5K4HA 3L4EA 3A1WA 2QLMA 2OZLA 3NO4A 4GUAA 1G2OA 3BYZA 3K94A 3FTDA 1N6PA 2QLTA 2G17A 1TUEA 3QUSA 4GUDA 2H29A 4ZT5A 1XRRA 2W6CX 3QITA 4NCIA 4OP1A 5L7WA 2HCRA 2Z09A 3EZ9A 3RHTA 4A8JA 3BDVA 4G0UA 1A0OA 1HYQA 1J9EA 3AM4A 3LI2A 4GOMD 5H16A 3HDHA 3JD4A 4JLNA 1W1UA 3B2NA 3JWGA 1NUSA 3NBYC 1ZUD1 5FULA 3HVUA 1I3CA 4H35A 5BYBA 3WDKA 2MIIA 3ASYA 5IDVA 1USWA 2Q28A 1SIBE 3LQ4A 2YASA 3T4EA 3OY7A 3IELA 2DP4E 2A30A 4FYHA 3F8SA 4GOND 3UBTA 3PGLA 3IP6A 3IP1A 5IVHA 1HKUA 2VNSA 3HBNA 4KGXA 2OHIA 5TJ9A 1X7WB 3V97A 3KE9A 4BV9A 1L7RA 3V1UA 4B6PA 4D9CA 1ZUWA 1IG0A 2CXPA 2J5BA 2H2HA 1ZK2A 3ILYA 1MOSA 3OQJA 4BZZA 3TZEA 2WFZA 3HSYA 4IMJB 2KB0A 3OJLA 2VK2A 2WMOB 1K4MA 1SUIA 1IZ0A 4AWAA 4GI5A 2F8TA 1BN6A 4FLFA 3V33A 1NF9A 3WQRA 3V8MA 3ZXSA 1JVNA 3E84A 1GV1A 1Y3IA 4BFLA 1G0OA 4F6RA 2M1ZA 2VHTA 2RHBA 3BS4A 1XKXA 3I92A 1IC6A 3DAGA 1E5TA 4GI2A 3AY3A 4TTJA 2QQ5A 3PR2B 5J2UF 1ULSA 2B2XA 2O3JA 5B58C 2Z83A 1VIAA 1M6VB 2VBCA 3KEOA 5DYGA 2IOHA 4KI7A 3U49A 2ONCA 3SAJA 3NRCA 1Y8QA 3SKYA 2PJRA 5AVQA 1A98A 1G6Q1 2EL9A 2PUJA 4ZYYA 4EZBA 3K0KA 5E7QA 2O8FB 1Q17A 1DADA 3ISTA 5B2ZA 4FQ8A 1UQTA 4JLKA 3WK9A 3VISA 2XITA 5ALRA 2EQ5A 4KSBA 5JNLA 2OLEA 5CK4A 1G291 5DTIA 2NU8A 1GR0A 3HPQA 4DNQA 2C5AA 2GUGA 4C2AA 1W25A 2D1YA 1M0WA 1XVIA 3IVXA 1AGXA 5TQ2A 4DQXA 3NOXA 2J4CA 1S2MA 4V2IA 3WJ1A 1GTG1 4BBAA 1VXRA 2GBPA 3T9EA 3TOZA 1J4AA 1NRIA 1ZX1A 3IQZA 4J7UA 1FNSA 5T6MA 1IUOA 2QORA 4FS3A 3T0FA 1JEQA 3Q98A 3EQZA 1DIBA 4Q1CA 1DJLA 3OHSX 2DE0X 16PKA 5JNTA 1E3MA 2Y1KA 2Z30A 3OZFA 4X7RA 1NYLA 2B6HA 2G6TA 1KI8A 4FVTA 4GMKA 2O8EA 3WGGA 4ZFNA 3LLUA 1E5VA 1WV0A 1PQPA 1YDHA 3EX7C 2VJMB 1Q0ZA 4I4LA 3VV3A 2WF8A 2JGIA 2EG9A 1J5EB 1XWWA 4CI9A 1E7SA 5C8YA 3KD2A 3MMXA 1IHUA 1Z0UA 2J0UA 1E64A 1G55A 1XQ6A 2QL5A 3NP9A 4HPWA 2WHRA 3B8HA 4HQKA 4HDMB 5EGNA 4ZVLA 5JD6A 3GFFA 4OGFA 1O8CA 3AOEA 1OXBB 3OQVA 2X5OA 4EGFA 1YGYA 4EHNA 3DLBA 3A9VA 3ZCTA 1HSOA 2C97A 2K87A 3FOCA 1TQDA 5HP4A 4NFLA 3FRJA 1HA3A 1P3Y1 2HMAA 2QEQA 2QTLA 2B1RA 2E4XA 5EE5B 4KQ1A 3DKPA 2LKCA 3H3FA 4XRRA 2FLWA 4XIJA 2C7PA 2W2LD 4LG1A 5JJKA 2CUTA 3MUNA 1FUEA 3IH5A 3W06A 4FX5A 3JAMA 1M8FA 2B1IA 4XWGA 4Y2VA 4C22A 4HYYA 1RHRA 4KODA 3WLFA 1EM8A 1U2RA 4MVJD 5JS7A 1AY0A 1HFKA 5EHXA 4RNCA 2WJVA 4UXIA 1WSWA 2XTAA 2NZXA 3X2SA 4Z5XA 2COEA 5H02A 5E3JA 5A5DA 5HK9A 5JAPA 3ROEA 4REQB 4GSLA 2BEVA 3FPGA 1G42A 5B3JA 1EMDA 1HE3A 2WLTA 4Y2HA 1FDSA 2H9YA 3GLGA 2IPLA 5IC4A 3HFSA 3IR6A 2QUAA 1HDRA 2CT8A 5H4HA 3T5AA 3PDHA 5J5AA 3R5JA 4JU8A 1DAFA 1KDVA 3K2BA 4N7RA 1C0KA 4ALNA 4TLBA 1M1ZA 1YOBA 3R6WA 5LB4A 3ST7A 3DJYA 4EKDA 4Y0VA 1YQWA 4KAFA 5LUBA 1QS0B 5KWIA 1RMQA 4QICA 2LCIA 1HMPA 4MS1A 4Z2YA 2DTXA 3DMPA 1JDTA 5DULA 1DKPA 5KYTA 4JUCA 2J8ZA 5CD1A 2YS6A 2C8VA 1ENOA 1RDFA 3V2HA 5KQGA 3WGIA 2PV7A 1V47A 2H2DA 1I6MA 1WXGA 2B9EA 4YMSA 1HDXA 1M66A 4JLSA 3LY7A 3EXFB 1R15A 1YHNA 1WD5A 3HB9A 4XQ9A 3V9AA 2RSLA 5HM8A 3UJAA 3KDSE 4RVCA 4K7JA 1GTVA 2H4ZA 3FB4A 4EGJA 4AS1A 2ZUDA 1RMTA 3QENA 2QN9A 1P9NA 2ZJOA 4IIJB 3C5WP 3HZZA 3JQ8A 3GJSA 2I3AA 4QXMA 4WN3A 3M7IA 5AHRA 4BNHA 2O7SA 4KQHA 4G67A 4RHXA 3ZHTA 3NHUA 1E9CA 2HTEA 5CW2A 3NX4A 5BSKA 5KJ6A 3QMMA 4YMTA 1TVMA 3JX9A 4LGYA 2HA4A 1AE1A 2X7XA 5DIFA 5BW6B 3RIMA 5DM70 1UEXC 1G9SA 5KYNA 5K8VA 1LPMA 4G1CA 2IHNA 2GZ1A 4OBEA 2SBTA 1CUZA 1OXMA 5HIIA 1H66A 4BO4A 2XQVA 3CEJA 4MKXA 2O05A 1DX4A 3RBXA 4DUGD 5KOJB 4O4LB 3ONNA 2XXAB 2W90A 5DLEA 1E2IA 4CTNA 3GAMA 2Q6LA 5JY6A 3G2NA 4R8VA 1PJ2A 1JEYB 4LY6A 3NHLA 2HXSA 2JJ2A 4E33A 1QHYA 4QBTA 3RJTA 5KOHA 1IVYA 2AFRA 3S1SA 2Y1EA 4KMSA 3UPTA 3D4NA 1KQNA 5G53C 1XXHB 3X3HA 1EFLA 3R9WA 2ODEA 3NWBA 1WCIB 3ZY2A 1Z4QA 5HR5A 2XH8A 3MSCA 3GIWA 2CL5A 1A5ZA 3TH5A 2O8CA 1N9GB 4FFDA 4HX2A 3BH6A 1TMKA 1XDZA 1LEHA 2W4IA 1K5HA 1D2AA 4ESEA 1I9CA 4DARA 1GLVA 2JVIA 1DEAA 1EWVA 2O48X 3EXHB 3OTQA 4JT8A 3UB4A 3NGMA 3AP2A 4TXJA 1E7RA 3I5YA 1QR2A 3JQAA 4UVHA 1R16A 2KQUA 4XQ0A 3T95A 5J4YA 3AHIA 4EHBA 4LGVA 5EAIA 2NUPA 1JG6A 2WWIA 2X2PA 3OCCA 3R3YA 4NRDA 2GCEA 4OD0A 4QWWA 4Q16A 3IQWA 1Z4NA 2YHUA 5KQMA 3I1JA 3PTZA 3N9IA 2ABWA 4MS3A 1AKYA 1T8SA 4CM5A 3CIFA 3E7WA 2NNLD 1JWBB 3HI4A 2QVCA 1J06A 1PQYA 4TRJA 3I37X 2IYLD 2QVBA 1ODTC 4N5NA 3AG6A 4ND6A 4XX0A 5KAPA 3V7FA 1PG0A 1HORA 2PLWA 2WFAA 5ALNA 2ZSDA 5LUAA 3ILSA 1UOQA 4AJHA 2K7FA 2AQHA 1MU0A 1NMYA 1XZQA 4OJQA 4WLFA 5CVUA 2OD7A 4CIBA 5BMVB 4OX9B 1FSFA 3PS9A 4H31A 2VATA 1XAIA 1BCRA 3UXMA 4BP9A 2RHTA 5KWVA 1NJ2A 2W8BA 2E5LB 1ADFA 3CF2A 3HPRA 5EYPB 4NBRA 5MN4A 4GBJA 4LVUA 2JGDB 3CSSA 2BFDB 1WETA 1IOLA 1PUJA 1UBJS 5DOZA 3SP1A 1DFHA 1SBHA 1WF6A 5J47A 5AESA 2XNJA 2JLRA 3HN7A 1QF9A 4KTTE 2Q5FA 2C1EA 3OSUA 4WBSA 4E5DA 5INTA 5JALA 1U98A 2ADMA 4FN4A 4TWBA 3TMKA 3TZQA 1KQGA 5F9HA 1H4TA 2GVDC 4UZFA 4NOJA 4C89A 4HGQA 3DB1A 3KKOA 3SYLA 4Y6QA 1KDYA 1IY1A 1KVUA 1EK2A 3CJTA 2V3CC 4HLUC 4BUCA 5FOQA 1M7GA 1OUMA 3SF8B 2C5HA 3DPIA 4IZ6A 2X4GA 4LVNA 2VHZA 1U7DA 3JARA 1Z6AA 3KFVA 7MHTA 3LUCA 4RZUA 1A1SA 2FUCA 3N0RA 1I2BA 5EXEA 1D2HA 2CWDA 1PUIA 1U28C 2JFFA 3AHFA 3QA9A 3H1GA 2GTHA 2Q7OE 4BWGA 4DSOA 1VJRA 3BF8A 1CNMA 3ROFA 1YVDA 2XCIA 1NV8A 4WKCA 1UDCA 4ER3A 4MITA 1VKZA 2QSJA 4BHTA 3VR5H 2ONJA 3OQIA 3VNBA 1PN3A 3QTBA 5DHSA 5D8DA 4F91B 1WUYA 4RJ2A 1RD4A 1THZA 1V1MB 1JEOA 2W2TA 3KR2A 5CBPA 1WEKA 1GP2A 3FCCA 3TRKA 1S9HA 3NM6B 4JB8A 4AIIA 1OAAA 3DNFA 4B2YA 3ADCA 1HFJA 4N65A 3QU7A 4DR3B 3HC7A 3GBVA 4HAUA 4RZ3A 3A6HA 3C8DA 1AA9A 1RRGA 1JSRA 4XFKA 2BSQA 1W59A 1ZN8A 3BB3A 3LT5A 1BH6A 1EWTA 1E9FA 2ETVA 2QP4A 2LTAA 5DGDA 1VP3A 2EBUA 4BB0A 5JANA 2VF5X 1ABFA 2ZIAA 1FFSA 3CFYA 2Y77A 3O2QB 4JJ8A 4FSHA 1L5WA 3DE0X 2B6NA 1A7KA 3AJAA 4OKNA 4PAOA 4YBZA 4YASA 2C9MA 2OCBA 4EHDA 1N7JA 4WCVA 1T0BA 4JB0A 3RC2A 2EX1A 2AOVA 4E1AA 5CLJA 1UINA 2P2YA 3F4BA 5F77A 3PG5A 4RKEA 5DZSA 4B6OA 3E9RA 2FK8A 3BKWA 2OYRA 4NFHA 4LPKA 3RPEA 1UJCA 1X7WA 2VAWA 3K2QA 3A2KA 4EA9A 4GKJB 2PX3A 4RD4A 5FI5A 1GTL1 2F8LA 3B53X 3R3XA 5KSOA 4F46A 2UUAB 4N76A 5L4SA 3LFHA 5HILA 3T7TA 4AJ9A 4TV9F 2OYCA 2HRQA 2RDMA 3ZEIA 1NNUA 1WE2A 2CWWA 4FYMA 2JS7A 3RG8A 3INTA 3ZCXA 3SPXA 2WR8A 1II0A 2QTTA 5JRJA 5HZKA 3B48A 3BE6A 2FUG6 1L8AA 2CXSA 2P9BA 4KZPA 3MJTA 2ZCUA 3EF1A 1KC1A 4R2WA 4X1YB 4GWLA 4NC9A 3RVSA 4YV7A 3KQSA 3V4VB 3USCS 3DMRA 3HO8A 4P08A 3DC7A 2YXNA 1PV1A 5KQRA 4BFYA 4P7GA 4DZTA 2FEKA 1CQXA 3MTAA 3QPAA 3BSYA 3U3KA 2ERYA 4PSVA 2ZPAA 4N82A 3SE7A 4LXXA 3WMEA 2PBLA 1UT6A 2R5WA 5ALSA 3NJ8A 4C4AA 1BX0A 4GIBA 1SHTX 1JHMA 4GBGA 5KS2A 1Q7BA 4UAGA 4R84A 1BS9A 2I22A 4JC5A 5IK2D 3EGDA 3KZNA 2Y66A 3FRHA 1NQUA 4E5SA 1C50A 2BCEA 2DZDA 4FFMA 1MAHA 1AM4D 2BMJA 4YP0A 4AJ4A 4QU8A 4XLTA 1FX1A 1BVUA 1FLNA 3R24A 1QG6A 3G7UA 3R5HA 5FFFA 3B82A 4H7IA 3DG9A 3EW9A 3FB1A 1E6UA 2AC2A 4FOTA 5JV5A 3LCVB 1WMSA 3IAS6 2ODAA 1TT7A 4MW9A 2DYKA 4CF6A 5HWSA 1LB1B 1JXAA 3GLUA 3EPKA 3GZ4A 4MB6A 1QZ3A 2B25A 1KI2A 2VTKA 2XE8A 3CX7A 3QW2A 4U3JB 4HDMA 4ZCMA 3PJFA 4WRRA 3CCCA 4S1NA 3TQIA 2PT7A 1H8ED 4D0NA 3P4UA 4Z7NB 3OFND 3VPDA 1N6NA 4M76B 4C05A 4DA8A 2RB4A 2EGGA 2KMLA 5JS8A 3IEMA 3M0EA 2FW7A 4JJZA 3CV3A 3FIUA 3U13A 1ABBA 1UBCA 2R66A 4HGZA 2M1XA 5IUKC 3U19A 3OUUA 3L4KA 2B99A 3MUEA 4GI3A 1JEEA 4UUPA 1YMUA 5THKA 3CLVA 5JLJA 1XTVA 3VX4A 3DLTA 1K4KA 2F59A 1HNNA 3NALA 1J00A 1F60A 1NF2A 1YZYA 3OE5A 4HRXA 3EC1A 3WIEA 2AW5A 3HU2A 3M2TA 4I1SA 3U7QA 3AT1A 1RFGE 5EA2A 3CVXA 1T8UA 3SM9A 4E15A 2B2CA 4CQLB 1EXDA 2YMLA 2UXBB 1EJ2A 4K6CA 3V8RA 3N75A 3LDAA 4NG4A 1UBTS 4KI0A 4LQ4A 2GEUA 2IWHA 1OYWA 1NVGA 3IE0A 3BULA 4HLNA 1LGYA 1Z0DA 1ZVJA 2OD9A 2BE9A 5CK5A 1TL7C 3MFQA 4EOGA 2JH3A 2CDBA 3OJ0A 4QYXA 1OX6A 3KCQA 1FUYB 2DQKA 1VG1A 3TLXA 3OHPA 1PZXA 3HY4A 1FUUA 5DB4A 1T9KA 2O1WA 1PR2A 4GC9A 3N6XA 4HDOB 5AUPB 1U7XA 1WY7A 2X0EA 1G59A 2PPLA 1E0SA 2JAHA 3NNSA 5EERA 4HGPA 1CZUA 2GFQA 2WI8A 2BGIA 3WSVA 3KWJA 4ZKEA 1T25A 3ZKWB 3EC7A 5FHQA 5IMBA 4B33A 3E7PA 4JOCA 1NVBA 1PJZA 2TMGA 1NFRA 5EN4A 2EZUA 5ADVA 4GP6A 2Y76A 5CITA 5HJEA 3FLAA 1U9IA 2P4UA 5DWDA 4UBJA 3AEXA 3VBEA 3I8XA 2EKDA 3EB9A 2XVZA 3MS2A 4MWOA 4IOLA 1J49A 5EQDA 3WLKX 4O4HF 3SFTA 3CXRA 3VO8A 2AI3A 4FINA 2WOOA 4IIJA 2C00A 4Y2PA 4YHBA 4YAIA 2R6FA 2ZSJA 4L3WA 2VF7A 2Q5EA 3ZIAD 4CM6A 4FB5A 3F5DA 4EUEA 1A7UA 1J1ZA 4FGWA 5JBNA 3CF0A 2QRQA 3F7MA 3OF3A 1K88A 4GICA 1NQ5A 2IOQA 3AFMA 4EGAA 3B1XA 2VEOA 2BT4A 1QNLA 1C0LA 4XOUA 3KSUA 5EXDA 4C07A 3MXOA 4EZIA 1ISRA 1NXTA 2DSTA 5JBQA 2JCBA 2QTGA 5A1JA 1W85B 1Z2OX 3RS2A 1QGZA 2DJIA 3WYNA 2FPPB 3TO5A 1WXIA 5CVDA 3ZZ1A 3QF4B 1J8FA 1Q14A 3K2IA 4U9IS 3K9QO 1N0VC 2XXAA 5KHAA 1LBIA 4HNAB 4NYIR 1QV7A 3DEIA 4KEAA 4H0CA 1J56A 1SK9A 3A9TA 3E8XA 5DK4A 1GQYA 4ZU6X 3RU9A 1JEYA 3KG2A 3LUPA 5A06A 4Q1VA 4HKTA 2PX2A 2Q1UA 2ZQZA 4KOAA 4LY0A 4BJ1A 4L9RA 1XXHA 1SJ9A 3LHFA 5LPNA 5ULLA 4B84A 2YIVX 1WCIA 3L84A 1X77A 2PD6A 1OQAA 2VNKA 2XRFA 1ORWA 2G9UA 5CNJA 1JHXA 3GARA 4KO8A 5KCMA 1R00A 3RSFA 1A69A 1GN8A 2AMYA 2K6GA 2PVPA 2YUIA 1CETA 4QD3A 5CGQB 5G0UA 3TE6A 1N78A 3IA2A 2YW2A 3EXHA 3D7RA 4EFDA 1HGXA 4IVQA 3O26A 3VO1A 2FFRA 2X8AA 1B16A 1NRXA 4PAWA 2CLKB 4DSUA 5BN4A 5TMPA 3I64A 3A6ZA 3OECA 3KVRA 1KZYC 1WW3A 1J21A 5CDUA 4C29A 2EF1A 3FSJX 4EKGA 1SC9A 1RLTA 1MAWA 2LD4A 1HLFA 1V11B 2YS7A 3K2EA 4TGLA 3BF7A 3H2ZA 5ARBA 1A9YA 2EFDB 2RHGB 4LHXA 4PC1A 2XT0A 4C4SA 1NPDA 3RLIA 5E3IA 4D9EA 2YOHA 1H2XA 1ZG3A 3I73A 1Q92A 2QZJA 2HYIC 3PQDA 4ZRNA 2A0XA 1FQOA 2DG2A 3I28A 1AMOA 5FRDA 4CW7A 1ZEJA 2VHXA 3GCWA 5HJ2A 1DEXA 3PD0A 1O94C 2WPNA 1OY1A 1HTBA 3HKEA 4IG4A 1PAUA 3ECSA 1KVTA 3JATB 3EK2A 4N54A 4US0R 3ZWXA 1K68A 2C92A 4MQUA 5BMVA 3VNVA 3KYBA 1EDDA 2BBTA 3GOHA 4WZAB 1KFBB 4MV3A 3UMCA 3UUFA 1SVUA 4DR1B 3SX4A 4WFQA 3WVNA 4RPHA 4X1IB 3TDMA 1RQRA 2JGDA 4FEYA 3PLNA 3VKVA 3GRAA 2IA5A 2QJFA 1ZJ5A 4C01A 1BOOA 1OBFO 3CM0A 2HPVA 2J3KA 3BK1A 3KLBA 1S0UA 1IZ7A 5A5VA 1QGYA 5DN6A 1V71A 1IEXA 1AKUA 2WKRA 3AC0A 2A94A 2YXDA 3HYNA 4IGKA 4LXQA 4EA6A 1S5PA 3BFVA 2JW5A 1CP2A 3WYDA 1W94A 3L5OA 2IS4A 2JIDA 1Y3DE 2RFLA 4AX8A 2VDMB 1HL7A 3T9DA 3MWJA 1NR5A 4MVJH 1YB4A 1G0NA 5IEJA 1WSDA 4FZJA 3KXLA 4ARVA 3SF8A 2QKYA 2FSVC 2OXRA 2I0FA 3AKDA 5GTDA 4B4KA 3WWZA 3UC9A 1EDEA 1YXMA 3EARA 3L8YA 4DYHA 2J9GA 2JVJA 4YDQA 1QU2A 4JITA 3LK7A 3EA0A 5IYZF 5CB6A 4PTZA 3SGLA 5I48A 2XGGA 2ZR9A 3O8NA 4L8LA 2YZNA 1A9QA 1V8OA 1YU6A 1SHUX 3JASB 3NCTA 3OD1A 4G4GA 4G56A 3SHQA 5A4JA 4O2AF 5EJ6A 2JARA 2O1XA 3UAXA 4S04A 1GG9A 4Z9YA 1NKTA 3KDAA 3M1LA 2BISA 3BRWA 3HYCA 3LO5A 3RTDA 4F04A 4MQ5A 3BREA 2XA9A 2WJ6A 1T0JB 3K0CA 5EPUA 1PJ4A 3E5RA 4D5EA 4CR6A 3FH0A 3OAAA 4WLUA 5CVJA 2IXFA 3PE4A 3VR3D 1K98A 3VPFA 5FUMA 3HBFA 3W4JA 1QNFA 4KR0A 2GPJA 1ZO8A 2C3OA 4OAQA 1Q21A 3BG5A 1LDBA 1LPNA 1DE0A 3LH5A 3SZRA 3QX7A 4TYQA 5LZ9A 3Q3CA 3EG5A 4KKVA 5CHEA 3AF1A 3NORA 3C6YA 4PINA 2V7WA 1EVJA 1GSHA 3D5TA 3H1AA 1E69A 1N6IA 2G7MC 5B30A 1RVV1 4JI5B 2HBYA 3WK6A 4MGZR 5JFTA 4LX8A 2IYXA 4K2HA 3OT1A 1YAJA 4ZYXA 4RD0A 3I9KA 5BT8A 5KNLA 1J2EA 2R7NA 4JQSA 3NKFA 1HO3A 3B6MA 3ENKA 1F4VA 1UOPA 5AJUA 3BJIC 1QQTA 5LLSA 4DLYA 4YPVA 5A0TA 1ZIXA 1Z6ZA 3I83A 1SQFA 4C7KA 4V0NA 4TYWA 1CUCA 5T7BA 2YJ5A 5ALFA 4JLJA 4N5IX 3ZXXA 3MWKA 4Q48A 3WQBA 5HKAA 4JIMA 2D8MA 1FVOA 3IILA 3X1KA 1W88B 2C2GA 3DA8A 2XXBA 5AXAA 1JDVA 2C20A 1JALA 5AXDA 4RA6A 1PKXA 4DV2B 4MRAA 3ZR4B 4DDVA 3P2EA 1OJ7A 1NXVA 4OLJA 2ZI9A 4LXIA 4DQDA 1U5BB 3NHWA 1O6ZA 1QONA 1Z37A 1Z07A 4IEEA 1ZGZA 3VYUB 1YZHA 3ACDA 1JSZA 4HATA 4KIFA 2ORED 3REOA 3X1XA 2Y0PA 3TJMA 2GN2A 4L4YA 2K4MA 4X1YA 3L8FA 1KA9H 1MKYA 3WV5A 5E1MA 2QI9F 2IIBA 5J4HA 4XGNA 2QM8A 4TWIA 1H85A 1Z8DA 4JC0A 3EVEA 4BB6A 1NZJA 4JLMA 4ND1A 4U00A 4Q6BA 2O4UX 5LQSA 1XMXA 1OC2A 2AW3A 3F6RA 2CSUA 1BQEA 3ZDEA 3W0LB 3SZOA 4BASA 3EIUA 3ORQA 2FH5B 2IIPA 2WU4A 3A7DA 3NFRA 2P9QA 2VBIA 2Z2KA 1GOTA 5KOYA 2YYSA 4CRWB 3KR9A 4NMLA 4XTCS 2O6LA 1KOGA 1ZD8A 3W8DA 1RRMA 4JIGA 1TX4B 1IPEA 3UT6A 1NN3A 1TXGA 1NMXA 4KDCA 1NUTA 4ND7A 4BFXA 3HK2A 3IPAA 3LPMA 1QVAA