1JHZA

Purine repressor mutant corepressor binding domain structure
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
282
structure length
276
Chain Sequence
b'KSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDFGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOTIDE SYNTHESIS REPRESSOR
publication title Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 91
structure length 276
sequence length 282
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jhzA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1jhzA01
4JP1A 3BBLA 4N0PA 4MS1B 1QO0D 1U2QA 4XFKA 3KS9A 5KC8A 1RZRD 3RVNA 1YMUA 4MPTA 3TO5A 2PMCA 4EYGA 1ZY2A 3HEBA 4JAVC 4MYRA 2JRLA 2PKXA 2IPAB 4H3KB 2ZAYA 3JTEA 2FQWA 3LOPA 2CHFA 4N03A 4S04A 4EUKA 1M5UA 4RS3A 3IP6A 2FQXA 2A9RA 3OLZA 1ABFA 3CG4A 4JB2A 4QYMA 3IDOA 1LK0A 3A0RB 5CNIA 2E4UA 3RVSA 4MLCA 4IGAA 4NQRA 3HUTA 3RVMA 2WB4A 4RDCA 3LKBA 2VUIB 4MRMA 4P98A 2P9HA 3SY8A 4RK5A 4Z4HA 3HO1A 1U2PA 5EWMA 4RZSA 3LTEA 4W5QA 1F51E 1GUBA 3N8IA 5DTEA 3NHMA 5IX8A 2RDMA 1P8AA 3QEMA 1FQWA 2WY2D 3GBVA 3NHZA 1B00A 4RWEA 1SD5A 4PYRA 5JNSA 1LJLA 3T95A 3OO0A 2H0AA 3C3WA 3ILHA 3OM1A 2P4UA 3IPCA 5EWLA 2HQOA 3N0WA 5IUKC 1JLKA 1ZGGA 2IPNA 2R47A 7ABPA 3K9CA 3TB6A 1Y1LA 5KQPA 4RK4A 2V0NA 1C4WA 1D1QA 1LBHA 3LUJA 4DADA 2IPLA 2E4ZA 5CNMA 3CTPA 3QLUA 1MB0A 3F7NA 4Z4CA 5JNUA 3E61A 3NNNA 1QO0A 3DGEC 4MGEA 3O2SB 4YWHA 1RZRA 1ZAYA 1LJUA 1Z16A 2QVGA 1QP7A 1TMYA 4MRMB 4WXEA 4CBVA 3Q15C 4Z4EA 4G0OA 3EAFA 5EWMB 5IUJC 4IMJB 1K68A 3KLOA 5B3JC 1YVUA 3FFXA 3QEMB 1DBWA 5GOTA 4TLLB 3DGFC 5KWSA 5JS1A 1D5WA 3MF4A 5GQSA 1M5TA 1W25A 3M6MD 2FW0A 2CD7A 5EWLB 3SAJA 4RXMA 2WJAA 4JA2A 3H1EA 1MB3A 4LE2A 2MYUA 4OLAA 3C3KA 3RVLA 3URMA 3C3MA 1OXKB 1JYFA 2PJUA 4KPYA 1TJYA 3NBMA 3HJFA 4RK7A 4MR8A 3OLWA 4WZZA 1RPJA 3C97A 4L85A 3EODA 4G0PA 1TM2A 3B2NA 2FKAA 4LX8A 1APBA 4MQEB 1EHCA 3MMNA 3IPAA 3JS5A 3OO1A 5PNTA 3OM0A 1RXEA 2MSLA 3QEKA 3OLXA 1EWKA 2GX6A 4FE7A 4YGXB 2JBAA 1BDIA 5CNKA 4YP9A 4ETMA 4ZMRA 1NXWA 2IOYA 2NZUG 3G85A 2A9OA 3N75A 1U04A 4MS3A 4EYKA 3ROFA 2F8SA 4IF4A 3A0UA 2YHAA 3CLKA 3QX9A 4WWHA 1ABEA 2PUGA 2FMHA 2QR3A 3LUGA 2JK1A 1I3CA 3BRQA 3UUGA 2PL1A 2GBPA 4PEVA 3SQNA 2BGGA 2AYZA 4RV5A 1EWVA 3F6PA 4O1HA 3QK7A 1Z25A 3HVRA 3FDFA 1QNLA 1ZESA 1MIHA 1ISRA 4EY3A 4ML3A 3K4HA 1JBEA 3O75A 3O74A 4UHKA 4XARA 2FMFA 4WUTA 4XASA 3I09A 5KI6A 2JBAB 1E2BA 5TPZD 6CHYA 2E4VA 1L5ZA 3UK0A 4Z4IA 4G86A 3KLNA 4MS3B 2QSJA 4DQDA 3C6QA 3LUKA 3RVPA 4F8JA 2AYXA 4Z0NA 3RVJA 3OMWA 5C5CA 1GCAA 3LUAA 2PAFA 1DCMA 4XAQA 1KRWA 4QYWA 3LUCA 3O2JA 4EYOA 1QP0A 3Q7RA 1PUXA 3CZ5A 3HK2A 3OQOA 4RSMA 1DCFA 4RY0A 1Z13A 2IKSA 3A10A 2FN9A 3H5IA 3L6UA 1T34A 1ZH2A 1C0EA 1BDJA 3O1HB 1ZH4A 2JCGA 5DCLA 4NICA 3TD9A 4LZLA 4EVRA 3NNSA 3R0JA 2HJ9A 4HNSA 5FBHA 4ZMSA 2ID9A 1AB6A 3LFTA 3QLUC 2I6FA 1DJMA 1A04A 2FLKA 3OQMA 4JB0A 1DRJA 1ZGZA 3ILYA 2KYRA 2FLWA 1KMIY 2XDYA 1M2FA 3Q9SA 4PZ0A 5HQJA 2OENG 4XXHA 3OLVA 1USIA 3FFWA 2X7XA 4MLDA 4LDAA 1VLZA 3EGCA 3GWGA 3JPWA 4Q7EA 1VPWA 4F11A 3L49A 3JVDA 4LDZA 3TMYA 2B4AA 3UKJA 1F4VA 4G0MA 5BQ3A 3HV2A 2NZVG 1CYEA 1JHZA 1NXXA 4Z9BA 5HM6A 2NT4A 1DRKA 1JL3A 3CKMA 3IP9A 3O21A 3T6KA 5E3JA 2FVYA 5IEBA 1DZ3A 1SXHA 3MM4A 2WMYA 1S8NA 3QLVC 4ZJPA 5JNVA 3VNBA 1PEAA 1PNTA 2YHBA 3QELA 2L19A 3QX8A 2NT3A 5TPZA 5BR1A 4OLBA 4E7PA 2PLNA 4MQEA 1DC8A 1MVOA 1P6QA 3H1FA 4MAAA 3TX6A 4S05A 1DBQA 2MYPA 2QW1A 4D6YA 1Z18A 2RJOA 1YIOA 4XLTA 3IP5A 4N0QA 2FEPA 2JVJA 2O20A 2QU7A 1BA2A 1Z17A 4FE4A 1PNRA 1YS7A 4PICA 1QMPA 2PUBA 2FQYA 3VNAA 4LE1A 3F73A 1KGSA 1NXTA 5FWYA 2FXIA 5JNTA 3T38A 1Z15A 5KQGA 3M9XA 4GPAA 3I5AA 4OTZA 4RXUA 5FWXA 3EJWA 3CS3A 3I45A 1JFSA 1Z2EA 3CNBA 4RXTA 3H5LA 5BRJA 3CRNA 4KK4A 3HXMA 2CHEA 3S99A 3HUUA 2WRZA 1JX6A 2PUDA 3QELB 4YV7A 5KC9A 3H1GA 2WJWA 2HSGA 3LMKA 3GA5A 4OATA 4B09A 3NNDA 3EDCA 3KJXA 5IBQA 4TN5A 1QQAA 5IEJA 2VK2A 1FFSA 2GKGA 4JASB 4FB4A 3BRSA 3HDVA 4WXMA 3KG2A 5DGCA 3HZHA 1BDHA 1HEYA 1URPA 2ZWMA 3GBPA 1D4ZA 2QV0A 4OG2A 4RK6A 3SNKA 5FWYB 2FMIA 3FMVA 5HSGA 3O2QB 4MR9A 4MR7A 2R48A 3CHYA 2PUAA 4F12A 1NXPA 1JWLA 1JYEA 2A9QA 5FWXB 3HSYA 4D74A 1Z12A 4HNRA 4F06A 4YR7A 1NTRA 4EVSA 4GNRA 4RK0A 4Z9AA 3DBIA 5DKFA 4YLEA 2VUHB 2MYNA 4YS6A 1SXGA 3JVIA 3MQ4A 4RU1A 4QPJC 5KQMA 5IC5A 1DP4A 3I42A 2LUOA 1JDNA 1NATA 4H60A 2LIVA 2QVCA 1ZN2A 3KYIB 4TMYA 3CZCA 1WETA 4Z99A 1JH9A 5TPWA 3H5OA 2HPHA 1FFGA 9ABPA 1IIBA 1P2FA 1DG9A 3CG0A 4O1IA 4QICA 4Y9TA 4KREA 1XWWA 2B1JA 2PL9A 4MS4A 2W42A 1R8JA 4G0ZA 1OXBB 4MR7B 4MR9B 5JS2A 3N0XA 4L4UA 2Q5CA 3HS3A 2F8TA 1ISSA 1K66A 1RXIA 5JNRA 5TQ0A 2IPMA 2PUCA 1ZDMA 4IRXA 2JVKA 5TQJA 3MA0A 3OLYA 5JNWA 3KSMA 1BAPA 3H5WA 3GT7A 2FEWB 3W9SA 1J56A 5D2CA 5KQLA 4G97A 5EWJA 2HQRA 2M1ZA 3IP7A 1JDPA 1NXVA 4G0QA 5TPWB 4EVQA 3H75A 1EFAA 4W5OA 5CHYA 4W5TA 3EULA 1E6KA 4HNQA 2HQBA 1CEYA 3DLBA 4EYQA 4MQFA 4G0YA 1VRVA 5TE9A 4MS4B 4Z4FA 4RY9A 4YRZA 1A2OA 1M2EA 3HCWA 1YMVA 2E4XA 2QXYA 2IDMA 4KRFA 2M98A 3FGZA 1EAYA 4WT7A 3O1IC 1NXSA 2OQRA 3LKVA 3F6CA 4NCAA 4ETIA 4KNYA 6ABPA 1ZITA 1XHFA 5TQ0B 4DN6A 5CNJA 1DC7A 2PUEA 1XHEA 3RVKA 1D1PA 2GWRA 3H5VA 3T8YA 4F3TA 4NV3A 5EWJB 1YK0A 1USKA 2FTKE 3GYBA 4KZKA 4YO7A 4IMIB 2WWVD 3P9YA 3D02A 3OQNA 4KFCA 3Q7TA 1CHNA 1W9HA 1GLGA 3MYYA 1FSPA 1YS6A 2PE5A 3RQIA 1BVHA 4D6XA 1L5YA 3QLTA 1RNLA 3KTOA 1DBPA 3G1WA 5IULC 2H3HA 4MQFB 4Q6BA 1QP4A 3KHTA 2A9PA 2L17A 3H6HA 1YTUA 1PHRA 4KQ9A 3BILA 2E4WA 1FFWA 2LP4Y 3M9WA 2J48A 1JFTA 3KKEA 3A3KA 1ZVVA 2JVIA 1P6UA 4IILA 5T3YA 4KK3A 4ZPJA 4NCBA 5T7BA 3FFTA 1SRRA 1ZHHA 3KCNA 2TMYA 1DCKA 2DRIA 3RVQA 2GI4A 4YCSA 1D2AA 2LPMA 4TLMB 3H5TA 3RH0A 5HKOA 5DLEA 1JF8A 2FN8A 4N47A 3ROTA 3RVRA 3DLHA 4RY8A 3GRCA 8ABPA 3O1JC 3BREA 4UHJA 3Q7SA 3LUDA 1GCGA 3JPYA 3GL9A 1VKRA 4RKQA 5TQ2A 1YK1A 2MSKA 5I4CA 2R25B 1NY5A 3LUFA 3N6VA 4O5AA 2LBPA 1U8TA 5F64A 4Z4GA 3QLVA 3SM9A 4ETNA 1TVMA 2IYNA 1QPZA 4ZYLA 4KVFA 2FEKA 3DZDA 3GV0A 1MAVA 1NXOA 4N41A 3D8UA 4PE5B 4KV7A 2FMKA 2MSWA 5FBKA 2VYCA 3RVOA 3SG0A 2CWDA 3LUHA 4Q6WA 1U0SY 5IUNC 3H6GA 1GUDA 4H3HB 3HDGA 1USGA 1QKKA 2MYTA 4G0XA 1LBIA 1Z2DA 4M88A 5B3JA 1Z26A 4OBBA 5ED4A 2E4YA 3EQZA 4KMRA 3JY6A 1E6LA 2L18A 3CFYA 4JOQA 4RKRA 4W5RA 1H9CA 4MS1A 1SXIA 2N9UA 3MIZA 2FSPA 3OMXA 4W5NA 5TQ2B 4EGSA 2QZJA 3KYJB 2JB9A 5BRAA 2R4QA 4KQCA 2NUBA 2RGYA 2L2QA 3N0RA 3CU5A 4E7OA 4N76A 2ID7A 4MR8B 4LE0A 1TLFA 1E6MA 2PUFA 5C5EA 4LRQA 3HM9A 2RJNA 1EWTA 3EQ2A 3N53A 4HYEA 5ABPA 1UDRA 4P1ZA 1A0OA 4RK1A 1KRXA 3Q41A 3E3MA 1JFVA 1AB5A 1PEYA 1QQBA
chains in the Genus database with same CATH superfamily
3TXYA 1MDFA 3INRA 3I6ZA 4F60A 1FVFA 1C1XB 1ZM9A 2V65A 3PE4A 4WESB 1RWNA 1XLVA 4DEVA 3SU8A 2WJYA 3ES9A 4PW0A 3RVNA 2GYVA 4IRUB 2ZE6A 3JSXA 3TO5A 3WNDA 3WV4A 3HBAA 3T5PA 5J2UF 2E7ZA 3SF8A 3LT5A 4I1UA 2C5GA 4EI2A 2QYSA 1SPXA 3CNNA 5CLHA 1K6IA 3GFFA 3ZHZA 3BGVA 1UJ2A 1L8XA 4N65A 4X24A 1L4KA 2CHFA 5BPFA 2W8ZA 1MMFB 4KR6A 1M0WA 1BS9A 1U2RA 2BY4A 3GLVA 3JYHA 1Z63A 3B2EA 5EIBD 5ALWA 3QTTA 4MLCA 3OP4A 3KBOA 5IW8A 2WTBA 2R4TA 1UWVA 3R3SA 4NHOA 4TT3A 1E20A 1P9NA 2GCIA 2QRZA 2CLHB 3QVKA 4P3NA 5L3SA 3CPJB 1KFKB 2G83A 2HFJA 5CA0B 2HI0A 3DEFA 4MB6A 4AWXA 1S89A 4YHHB 1TGYA 3NWPA 3HO1A 5DW3A 4JODA 5GAJA 2WF7A 1B6TA 3OE1A 4LDNA 4PYKA 3IE2A 1KP2A 4RCVA 1MNAA 4UMFA 2P11A 3RODA 3UHOA 4GIBA 1CUVA 4JOCA 3IE1A 4AUKA 1DCTA 1N7GA 4DLWA 2PLRA 4HFRA 1GHTA 5EHZA 1CERA 1VI5A 1YL5A 1YOVA 4QTZA 2ZE5A 4ZOLF 1O0CA 5ALHA 3V55A 3QVGB 2AMJA 2DHDA 1ZK0A 2ZU6A 2QZZA 2RHMA 3OM1A 3BSYA 3IPCA 5FA8A 1DHTA 1KI3A 4H6WA 4D0SA 3AY6A 4M0DA 5KDDA 1RLOA 1BTOA 1RTTA 4O4LA 1QH8B 4RK4A 3LUJA 1C4WA 1D1QA 3ICCA 4DADA 5HX7A 3T1YB 4P84A 1LVHA 3KP1A 3OCUA 1JJBA 4ZI7A 1W88A 4E5KA 1G18A 1UBLS 2OXCA 2P4SA 2LCIA 3D5EA 2I87A 2W2QA 2H18A 2QMOA 2YNMC 4IDAA 2J9XB 2VF4X 1XA0A 2WFAA 2G36A 1DQYA 3OF2A 1FUIA 2ACEA 2OHGA 5I3ZA 2ZPUA 4FR2A 3OZGA 3DZGA 3D6TB 1CKEA 4Z4EA 2DR0A 2YW9A 5EWMB 4IMJB 3RUHA 5TLSA 1JSXA 3SJCA 2PSFA 3RK4A 4IVRA 3A9UA 1JAIA 3SMQA 5ALRA 5C8YF 1CUUA 2BH9A 2DUUA 4BJ6A 1QU3A 3L9WA 3FBTA 1JZQA 2CFTA 4ER7A 2D1QA 4LHVA 4ZU6X 4GRAA 1E9VA 3DW1X 3TI9A 3GVXA 1MPXA 1O57A 2V4ZA 2VHJA 2NVUB 4LE2A 4Q0MA 2D3TA 1KO5A 3E7WA 3ONVA 2I3AA 3AINA 3WGZA 4LZJA 3AUXA 2EP7A 1G8FA 1WY5A 3K6RA 4QARA 3OSZA 1OVGA 2XGOA 5FPPA 1VE6A 3MILA 2EX1A 4HX9A 1LNQA 4U8HA 2VRCA 2VJOA 4U00A 2MU1A 1HT3A 4HUQB 3HR7A 4OUKX 4EF4A 3QMPA 3R7NA 5CXUA 1QO9A 5KTNA 3RFTA 5GIOE 4KN6A 2IYXA 3G7UA 5AW3A 1OBCA 2A35A 1V8OA 4BMNA 2OKCA 4WFKA 3ZU5A 3W1WA 2BUAA 4M1OA 2DR2A 1OPXA 3EGXB 3AK4A 5CFZA 2YHIA 4BY9E 2EFGA 3A0UA 4WFIA 3I3OA 3CC8A 3TEMA 1LX6A 1I3KA 2BMDA 4EO7A 5BW8A 4QYSA 4BNLA 3RUFA 4EQ6A 1RM3A 1V39A 3JXEA 1WDWB 3QXGA 4NAVA 5C4GB 4MGKR 2RIRA 2QMEA 4L4XA 4BO9A 3F1KA 5JVDB 3FHTA 4BLWA 3K15A 4M0EA 3VHXB 1NM5C 1OIXA 2C88A 5CIWA 1RXUA 2KI5A 3CLSD 3BJRA 2DPXA 4LF7B 2DXIA 4HP8A 1MIOB 1JR3E 4NR0A 4A0FA 2ZATA 4WQMA 5TX7A 2GEDA 3WMRA 1L3CA 4R3UC 5KNDA 5EIOA 4EK9A 5CVCA 3WK9A 4H27A 4ARAA 2E2WA 3GNLA 3KXIA 4RCZA 2VQFB 1NVVR 4UFOA 3OPYB 1JHQA 6CHYA 3BAFA 5FTNA 1N5LA 2EJWA 3A2KA 1M6NA 4XSGA 3WNZA 2AYXA 1E9RA 4YJFB 3SE7A 5DMHA 3U0BA 3VR1A 2QK4A 3P32A 2OYCA 3RUCA 2HH9A 3T06B 1SBCA 3B5JA 2RK4A 3W6UA 4E2WA 3PXGA 4CQNA 2YS7A 1XP8A 1TJ4A 4LI3X 1V8BA 1RYEA 4HAOA 1VL0A 2ONYA 3LPCA 1VI6A 3RSGA 1OV6A 3TRJA 5KS2A 1TF7A 2IKSA 1PIWA 5C1PA 2VF2A 3NBYC 3PGJA 1UANA 2PSEA 1USWA 1NP3A 4DXAA 3D8BA 2VHQA 1A9XB 2ONZA 2R7NA 4HNSA 4CT5A 3FJOA 1MFZA 1IK6A 3NETA 1NQ5A 3EF3A 3ETDA 3SZGA 1FYEA 3AJ8A 3AZOA 3K20A 1WMDA 2KYRA 2ODEA 4KO1S 4PQRA 5CRIA 4R1QA 1XQYA 5BW6B 5DSTA 5FX2A 5H8WA 2VYNA 3W7BA 2ZM5A 1ZNXA 1FP7A 2XQKA 3KD3A 4M0MA 3VC3A 3F4BA 3W8FA 3KJGA 1AKRA 4HWKA 1V7PC 1UKAA 5H3HA 2CHGA 2Q62A 5BUSA 3MSXA 4OJTA 3GMSA 3HYSA 1CZRA 3G0HA 4PNZA 2FWJA 2GCOA 4HTFA 1FMCA 1B76A 1J1ZA 2FU5C 5LDDC 1EWQA 1ZA2A 3R3UA 4Q7LA 3WBKA 2BE7A 1AK9A 7ADHA 2C2YA 5HVNA 5LQDA 1RQNA 1ZK2A 4HLDA 4QQFA 5JNVA 1JLLB 4V0KA 1II0A 3IKTA 2G1PA 4HQRA 2NT3A 3F8SA 5E4JA 1SBNE 1V45E 4AF7A 1OWOA 3DOIA 4KWTA 4EOGA 5AM1A 4BEJA 4CMIA 4K6KA 2F4VB 1KWGA 1LRJA 2QW1A 3GROA 2AZ4A 3VZRA 5HHTA 1II8B 5A4JA 3O3NB 3AP2A 2WOJA 4FZ5A 4H0NA 4B82A 1CY0A 1G8GA 4JKOA 1YAHA 2EDCA 2F3TA 4MB2A 3DB2A 4Q05A 4EY4A 4NBLA 2E1PA 3D2CA 3EZLA 3HU5A 4UULA 3LL4A 3F73A 5JNTA 4AT1A 3AQIA 4ZOBA 1V96A 5C32A 3HBFA 2Z08A 4G2NA 1OKKD 1ZN9A 5FUXA 1CX9B 4S2UA 3A6DA 4UBJA 1N6IA 4MKHA 2X5NA 1VBFA 2LD4A 2EKDA 1Q44A 1D0SA 3RJ5A 4IEFB 4Q4AB 1XVTA 2JI7A 7MHTA 2PGNA 2HLPA 3WRXA 3GFRA 1LUAA 2H63A 4WADA 2H4FA 2QMQA 3PG5A 4WASA 2JEYA 2C7GA 3TOVA 1CUGA 1DX4A 4V1CB 2R86A 5EHGA 3W2GA 2PMEA 1X0XA 1UBJS 3VU0A 5AUNB 2Z2YA 2ANCA 4H7IA 2O48X 2GN6A 2W22A 2H2IA 1QQAA 1SCUA 3EF1A 4QWWA 1IY9A 1OXXK 2YVKA 4NMWA 1VCIA 2C2XA 4PX5A 5G0VA 1OIVA 1WL8A 3RHTA 3TM5A 1QE5A 2ZJ4A 4BMZA 4HEA1 3GBPA 3ZIAA 4BQEA 2ZYUX 3B78A 3KYBA 3KRTA 4IIUA 2FOLA 5FOUA 5K3EA 3OZEA 2HD4A 1GSHA 5B64A 4R7GA 2GERA 1Y9AA 2DULA 4FLMA 1DLIA 1RYBA 3GRVA 3I2KA 4JNCA 1W4AA 4KAJA 5FUBA 3CA8A 2HNBA 3GA7A 4P81A 2YZ7A 1EP9A 4CR6A 1EYZA 3FOAA 1N5DA 1RIFA 3EVAA 4GNRA 5HEKA 5C3UA 3H7AA 1FMLA 2QTBA 1I3LA 4YS6A 4B83A 4BVHA 2IYAA 4QPJC 5IASA 1NW3A 4IWXA 1V43A 2RAVA 4B7AA 3FGNA 1O8BA 1VIVA 3JQPA 4IIFA 4L5IA 2XYPA 4HMOA 3GGOA 4IDFA 4LJKA 3DONA 2I2CA 1HYEA 2GK3A 3EK2A 4P5EA 4TWIA 4MV5A 4ZT7A 3T3MB 4DUPA 2ZT7A 1V0JA 3OTHA 4JJ6A 3ZS8A 1DAKA 2NUTB 3NDRA 4KQFA 1P2DA 3ZE8A 1HNXB 1J2TA 4YAUA 4KREA 3GHHA 2B1JA 5G4LA 1QR2A 4UU7A 1WPGA 2B78A 3ZI7A 3O8DA 3HR4A 2O05A 4MS4A 1NKVA 2DEUA 1GRRA 4HTAA 3IMGA 2FZGA 1UMBA 3PFFA 4IXDA 3ZE0B 1SC4A 3D4NA 3GT0A 3L8YA 4MR9B 2ACWA 5DHAA 2AKEA 4M9SA 1YA8A 1MQ9A 3H0CA 4LXHA 4UHFA 4RQTA 3WGOA 3AJRA 1K6XA 2C5EA 5LP6F 3IP1A 3QM1A 2Q5CA 5BV7A 1AN0A 2ZVJA 1SNYA 2BW0A 2KE5A 4PHFA 1YZLA 5AXBA 2CJXA 4URFA 4AZVA 4TS1A 4U3JB 4EX7A 4G4SP 4C4OA 2J3KA 2B4RO 4XDYA 4B7CA 2AMFA 3LO5A 1TC2A 3D59A 3HXTA 1PG2A 4FS3A 3C5VA 3UFBA 3UW3A 2R97A 1AUPA 4DMRA 4P35A 4WKPA 4HJRA 4QU5A 3LXXA 4M38A 4PLGA 5TPWB 2ZUUA 4EVQA 4K7JA 2WIJA 1B7GO 1K9SA 1RQXA 1PDVA 3C7AA 4HH1A 1HUQA 2XB6A 2XX3A 3AI1A 4KGVA 5LZ7A 4IUYA 3OQBA 4G0YA 5ELMA 3CLUC 3KT6A 3M89A 2G5GX 4WBNA 1NQVA 4OMCA 3VZDA 4BKOA 3WGVA 4FQ7A 5K0NA 5CDTA 2GR9A 2PK3A 1VCOA 3Q40A 3I53A 1N92A 2UYOA 1QOPB 4PFSA 3SICE 4BU0A 4MJXA 2M98A 3C87A 3HDTA 2HBQA 1JEAA 1RHUA 2J3DA 4RJ2A 3ETEA 3PZBA 4Q1CA 4AS1A 3HPRA 1PFQA 3UA3A 1HDCA 2AUMA 2BI8A 3BDIA 3PRHA 4BZQA 2AJ8A 3VR5H 1AKYA 3G88A 5KX5B 4KGDA 1DTWA 2JC3A 3AV0B 4DR4B 2WWVD 2QTTA 3L0BA 3IDAA 2QR2A 4UQLA 1DAOA 4RYLA 4UNIA 1J8QA 1SCBA 3WX0A 2BCJQ 2QQGA 3GCGA 4M0CA 4YAWA 5A1JA 1MHTA 4KQJA 3K0AA 3T5MA 5E6RB 3DL2A 3G1WA 4G85A 5CYOA 5I7AA 1EDOA 1RBYA 3C8MA 1E6CA 1YKFA 2NTEA 2VK8A 3GQVA 3GIWA 1O95A 3GRRA 3KHTA 1Z6YA 1PHRA 1W0JD 3G8DA 3NYIA 5ALPA 5KYVA 2VK1A 3VNVA 3ABQB 3ENNA 3GT4A 2O6HA 3QE0A 1LB1B 2ZI6A 4DA7A 1G6KA 4ISBA 5SZJA 3WWEA 5IH7A 2C31A 3IT2A 3N8GA 3ZCVA 1IN8A 2JH8A 4A1FA 4D4IA 1REQA 3MAAC 1RXWA 5JUWA 3VNRA 3SQDA 3VPBA 1UBMS 5JEDA 3RVQA 3AQ4A 4RIFA 4XD7D 2EZTA 4HEHA 4BX0A 3DPIA 3T5CA 4EL0A 1SVKA 3ZTWA 5CB4A 3TVDA 2FN8A 1WV1A 1LRLA 3TZKA 2MR6A 4NYIR 2AQ8A 3P27A 5KMGA 1G8HA 3D3NA 3SIRA 4KSYA 3TM4A 3CH4B 1EJ2A 5EZQA 3RYCB 3KWMA 3LK6A 1VA4A 1YF3A 1WMSA 4WCDA 3VZQA 5D1HA 1JVBA 4QU9A 4ASUD 4AX4A 2FZ5A 4Y6QA 4IDDA 1QZXA 2ZWVA 1WIWA 1BEUB 4EDFA 3GDWA 3DHWC 3MTIA 3FUXA 2DBVO 5KBYA 1T1SA 1VE9A 2HLDD 2IYNA 2YZMA 5LD2C 4KR7A 1C1DA 2XCUA 3AUKA 2RH4A 3K1AB 3PVSA 3FLMA 2A14A 4X1KB 4RVUA 2JLCA 5DK4A 2I03A 1T24A 4JU8A 4NV1A 4P4SB 2GZ1A 3T4UA 1Y5IA 4U9IS 3UT6A 4BB9A 1P0PA 1Q1ZA 3MT9A 2BP7A 2BN4A 2FPIB 1GKUB 3Q87B 2ZAMA 5L8VA 5JSZB 5JYEA 3GGCA 3HYCA 2YJNA 4I9NA 3QKRA 2D5LA 1Y6GA 2CEAA 4WPGA 5EE0A 2DFNA 4U2KA 5LQJA 2H3EA 1VBNA 1Z2DA 1RDFA 2NO6A 3GP5A 2WWXA 4BNTA 5LL6P 3JY6A 1D2NA 1O97D 3PX3A 2DZDA 4KQMA 1F12A 3IBGA 4FX5A 5FQNA 1Y37A 4MGZR 2P5SA 3P94A 3QY0A 1O9GA 5FUVA 3TLYA 3RG2A 1GTG1 1N2BA 1JRLA 1WJGA 2FSPA 2HWWA 1Y1KE 2F90A 3A6FA 5D3QA 3VPAA 1T36B 3P45A 2MINB 3TYXA 2HIGA 2A9JA 4O2BF 4QELA 1EA7A 1PGJA 1WXFA 4XIGS 1L4UA 3ZZ0A 1ARZA 4QOJA 2QOEA 2EZ8A 1SJ9A 2AN5A 2RHWA 2DG2A 2GBIA 2QN3A 3ZQ4A 4BXOA 5M5BA 2RGYA 2SHKA 2NUPA 4RSGA 4RHXA 4QGFA 4F4HA 1HFKA 2WB2A 4N76A 4M2LA 3RAGA 4OA8A 5KCMA 1ODSA 4GZ6A 4K26A 3E7XA 4EJMA 3PDIB 4Q1BA 3RT9A 5C5EA 1E59A 2Y1LA 3M6XA 2WP0A 3TIXB 3KEFA 3V7YA 3CURA 3VR6A 2NOAA 5CGZA 1AXGA 1OQAA 4ZVSA 1YB6A 3A3YA 3BN3A 3A9RA 1XRSB 3F3YA 3M4NA 3QJYA 4GXNA 4P1ZA 4QOSA 5C53B 4IW3B 3FW1A 1UM9B 2HZBA 1NKTA 1ODFA 1YZKA 2J0UB 2GUWA 4JP1A 4BPRA 4HX5A 5EIEA 2VKTA 2XYGA 1RWVA 3KS9A 1RZRD 3G0GA 4GI7A 3UMFA 2VIIA 4XX0B 4IHJB 1G291 1IN6A 2X0JA 3OFJA 1RCFA 4O4HA 1KARA 1YA6A 3TTYA 4H3KB 4QSMA 1ZD4A 4AKHA 1RQ2A 1RBQA 2WJ4A 2XY4A 5REQB 1VPVA 4L78A 1I4LD 1P0MA 1QKJA 4IJQA 4MRVA 4HEQA 4DVJA 4NFSA 2ZGVA 2HXGA 1QG2A 5AM2A 4NJOA 1C7FA 2HXSA 4IGAA 1O2DA 1WVGA 1TPYA 4CU2A 2EGHA 2VBFA 2CE2X 2DKFA 3KYCA 4NMXB 2WNIA 3RGWS 3D1JA 1TM4E 2A1TS 1NG9A 3ANYB 2CJPA 2PS3A 3QY9A 4WXRA 3WRXC 5GONF 4BNXA 1CEEA 2YW2A 3DEKA 5DTEA 3AIIA 3GFGA 3NT4A 5E9QA 2ZE7A 3LX5A 1DWPA 1FQWA 3I4LA 1T0PA 3FTPA 4CT0A 5BVGA 2CKDA 4I4TA 2WUGA 3PXDA 4PYRA 1XN4A 2PBFA 2OBXA 2J5BA 2R66A 4POAA 1VCHA 5LC1A 3A6ZA 1RI3A 3B1KA 4RTJA 2HIAA 4HFNA 3OQVA 2PZJA 4F4JA 4JT9A 4TN1A 5BR7A 4G8JA 1LI7A 3OZCA 2WWFA 4RE6A 2P79A 1EIZA 2BFCA 1MEEA 2HAEA 2IPLA 2W2OA 4YRRA 1TJPB 3WP1B 2IXAA 2FG6C 3BXHA 2LRHA 3BMOA 3QOYA 5EXDA 3WTCA 2ZZMA 1YH3A 4YRGA 3NM4A 3TCKA 3USZA 1W96A 1YONA 2XCTB 4TXMA 1FDTA 1JZTA 1IAVA 1Y3AA 5SZIA 5JROA 5IWAB 3B6MA 1V1MA 1JQBA 5COBA 4D4LA 1YFKA 1DBRA 3CLTD 2D2EA 1DJLA 5EUMA 5IUJC 2PA0A 1PQYA 1R66A 1LPMA 2IP2A 1KIFA 5ULLA 3UK7A 1OIWA 1VL5A 1YVUA 1MENA 3LJKA 4HYYA 4J0HA 2ZVQX 4QKQA 1DBWA 1FLNA 1T0UA 2FHPA 3IIIA 3ZNQA 1OTYA 2BGJA 2H5EA 4KX5A 1IZYA 5CT9A 4HUTA 1XTZA 5K0JA 3UPUA 2XD4A 3CIOA 3H86A 3FVVA 2QTHA 5EG5A 4HYQA 3NS7A 3RRXA 2B3TA 3I73A 4EPXA 5JHHB 1JDUA 4EG3A 1OAOA 3ID6C 3SBEA 2J9YB 5DCYA 3O7WA 2PT7A 1A8HA 3DXFA 5K0CA 1ECGA 4XYMA 3TLMA 1VP3A 1AF7A 3ZVLA 4CVNA 3GLGE 3IBYA 3M2TA 3IAHA 3PLRA 1KZHA 1HFJA 3KT8A 5BNTA 3R9WA 4CE6A 4D9GA 2PWYA 4Y9RA 1JA9A 4H6VA 3QEKA 1CDEA 1R6UA 4AYTA 2C0QA 6REQA 2JGJA 3O94A 2HTEA 1GAQA 2WTEA 4K6GA 4FYYA 4CQMA 4F85A 1NXWA 1XDDA 5IG2A 3SZ3A 2VDJA 1N3IA 4LY3A 1VGQA 4ODIA 4IF4A 1I7QB 1Z83A 2JLBA 3ODGA 3B85A 3WGGA 1EIWA 4MWGA 4JUFA 3JATB 4YCBA 1SHUX 4UEWA 2HRQA 3QPDA 2QT1A 4AI6A 1IZ8A 4BC1A 1OYYA 2YYSA 1KEUA 2PL1A 4WL0A 4CIWA 3KQVA 3EEYA 3HVUA 4JZKA 3MMPA 1ZIXA 1CDOA 4UHBA 5DW0A 2AT1A 2XT6A 4JYCA 3UBMA 1EE1A 2I80A 4C6RA 4QBIA 1OWLA 1AUQA 2GK7A 2FB9A 2ASVA 4OAQA 4K9PA 1ZC3A 3WE7A 5HKKD 3D5QA 1XL0A 3MJ4A 4KZPA 5BSVA 5ERXA 4YAGA 2JA2A 1Z38A 4OQPA 1GT6A 3BXFA 1MAAA 2D5CA 3SN6A 4WK2B 4KJZA 4HVLA 3B6JA 3CGGA 2H17A 2GAFA 3PNVA 5JSHA 4B5LA 3L8FA 3TDKA 3RVPA 1TCAA 3LYUA 2Y0EA 3DG9A 1DKLA 3RVJA 4BWVA 4CMKA 3BGIA 1CUWA 1NPDA 1PX2A 1MQ8B 2PAFA 1DCMA 3ZHBA 4INOA 1YR6A 1QG4A 2QEQA 3HDYA 3O8BA 4FFSA 1EA5A 1NDUA 1YS4A 1U1DA 4OQZA 4ZVQA 1GZDA 3THWB 3CZ5A 2RC6A 4B84A 1ECLA 2HA0A 4JI6B 4RNDB 1O95C 4CLOA 4OXIA 1Z13A 4KQEA 4IQ8A 3X1YA 1BU8A 3RD5A 3UHPA 3AJ9A 4G26A 5I8ZA 1W5SA 3IDZA 1JKMA 1JHYA 2VYVA 5IYZA 3GEMA 1VYUA 4OEHA 2Y05A 3IALA 3EUAA 4EENA 3NNSA 1ZSVA 1VJDA 4JQCA 1AB6A 1UK9A 1G5FA 1S4QA 2LDBA 4GM0A 3AR9A 5EZYB 3LC2O 2ISCA 4F3KA 1AV6A 1L7OA 2PEYA 4JJZA 4NG4A 3I9LA 3SDBA 3E3NA 2R8OA 4Z4QA 1FRQA 3CZPA 4B31A 3MS7A 5L4LA 4DIBA 2UZAA 1XZEA 2NAPA 2ALJA 3DOUA 4KW7A 5B57C 2O52A 4EUHA 2H65A 3X1WA 5LB4A 3WSTA 3EC1A 2CD9A 1PG5A 1YDGA 1X0VA 1GUZA 2HHHB 4ZO8A 4J1SA 1D9XA 1P3Y1 4JLKA 5BURA 1M6YA 3RQSA 1QMGA 3TMKA 3SJZA 5HM6A 5JH7A 2PZFA 3CKMA 3D0QA 2VDPB 2X8LA 2HU8A 2VJMB 3OIDA 3GX1A 1KS2A 4U5QA 4FGWA 4L75A 1S8NA 4CM3A 7MDHA 1I4EB 1HRDA 1MRZA 3HGMA 2NM0A 4OLBA 3MJHA 4JK3A 4E7PA 4OP1A 4GX1A 4IZOA 4YMUA 1J5XA 2P5TB 4RGYA 4XPZA 4BQOA 1J23A 2O0LA 3I72A 1WPRA 2Y0PA 2IBTA 1XDWA 2I2WA 1H1LB 3AXTA 2ZRPA 1PZHA 1WLYA 2NXNA 2WAAA 3EEIA 3S2FA 3DM9B 1ESMA 1IEWA 4YJ3F 4N0QA 5DOVA 2PWPA 5IAOA 4LJ8A 3ZE9A 4FE4A 4YPFA 5J4YA 3Q88A 3K0KA 4FGLA 3BFXA 1C9MA 1R50A 4DV7B 1OI7A 1KGSA 4JLBA 3LSYA 2FXIA 1UBNA 1QG6A 4KNWA 3O0TA 4Z86A 3WTBA 6NULA 5KQGA 2HYIC 3PLAE 4Y2SA 3TQCA 4OH1A 1QONA 5FWXA 1S2OA 5DASA 4D3SA 5KTPA 4GE3A 1YMQA 1ZD3A 3CNBA 3RC3A 2Q99A 1IN4A 1NY6A 4N54A 5JTTA 4L2IB 1WDTA 1ZI6A 2ZJ3A 1I0ZA 2ODWA 4HAZA 5DGXA 4B6PA 3C2QA 1WZEA 2B94A 2J7PD 3CX6A 4PM4A 4DUGA 5CM9C 5NULA 1E3IA 3RSFA 4B6GA 2O2HA 3PUXA 2CUNA 2W58A 2NSJA 2UZIR 1AVTA 2HCFA 2VXYA 5AIAA 5EIHA 5AVYA 2ADFA 2X5KO 1KE2A 2GT1A 1WVIA 5H9WA 1CNFA 2XIQA 5JXWA 1W5AA 4P86A 4AVYA 4ZTZB 2F2TA 1XZFA 1W1WA 3H2IA 3EDMA 7GPBA 5HIIA 1TAQA 3ZJVA 3DLAA 1T8UA 2K87A 2QUAA 3TR0A 1E2JA 3KZ1E 3PFBA 5F7OA 1JVSA 2RBEA 3PQ5A 4EZEA 4QDXA 4YI5A 3RI3A 1PJ2A 1PT9A 4MNTA 5I01A 2AHOA 1W4BA 4J7AA 5T8KC 2VT2A 3O83A 1QGED 1L5VA 3D7RA 3USCS 3ZI4A 2EBUA 1Z5NA 1NC1A 4BDSA 4L4ZA 5HSGA 5HUHA 4ND4A 4LV5B 4HLNA 4YUWA 4Y2XA 3PTZA 4YN3A 1XCMA 2BLNA 3H99A 4YMWA 4I6EA 1IOLA 4TKVA 3ASZA 4WOCA 3ULKA 4YMLA 5HRCA 4UM8B 1GAJA 1OXSC 1JZSA 3NHSA 3QIVA 5IN5A 3UKOA 2XBMA 5ICMA 1RHJA 5DKFA 3B60A 1Q1BA 3MPUA 3H8JA 3WNQA 4HB0A 5IMBA 4EX6A 8OHMA 1SOMA 1Y1RA 3WLOA 4DA4A 1GTVA 3J80A 2YHSA 1DUVG 4LA4A 4K8OA 2NVBA 1VKNA 3KUCA 4LVNA 5A0FA 1K8QA 3CZCA 2BEUB 3JQ9A 3WGLA 1BD4A 2WAMA 3RTGA 5HE8A 4LN1A 4E14A 9ABPA 1NBAA 5A3VA 1MJGA 3DZKA 4O29A 4W82A 2RGEA 1G3RA 4BO6A 5HF6A 4AULA 3MCZA 2JRCA 3NATA 2WTNA 1ECCA 3QKTA 4JIMA 5CM8B 2PMDA 2J33A 5EKTA 4CL3A 2P6RA 2YH2A 5EXSA 3X1KA 1GGKA 2BMJA 3U7GA 2DM6A 2VSOA 2IYYA 3KKQA 5PGMA 1MVLA 3A04A 2PCLA 2VDMB 3AR5A 1MA3A 1ISSA 1MX3A 1XZGA 1K66A 4PQFA 1PZXA 4YXFA 2WD8A 3K6KA 1NW8A 2WU1A 3MJRA 4ROSA 1WTCA 4S0XA 3RFXA 4YT8A 4GPEA 2ADMA 2JVKA 4RORA 5JNLA 1VECA 2AG5A 4PINA 5HW0A 5B2ZA 2WSMA 3PU6A 4YACA 4FNMA 3JCZA 3VKFA 2BJWA 2VVTA 5DLPA 2YYZA 3VR5D 1ZUD1 3ZCQA 4NTZA 1LZKA 1CZNA 1JNXX 5IKMA 2Q3MA 1SG6A 3EOZA 3I2JA 5D5QA 1ZK4A 1E6KA 1DU4A 1G8YA 1BOFA 2JBWA 3KSDO 2H1SA 4ZRDA 1SOUA 1KERA 1NI4A 3QKWA 4IKEA 5E3IA 3VH2A 2O1SA 4EJ6A 1QH0A 1E4EB 1IXSB 1L5RA 1N1DA 3KQQA 1WZ2A 2OC9A 4L9AA 1M2EA 3SPXA 2AJDA 3AFMA 1Q0QA 3PR2B 5EUQB 4JI0B 3W3AH 1P2GA 2ARKA 2P67A 3SJBA 1OTXA 2IEYA 1NDQA 1FTWA 1KZGB 1NXSA 2A86A 1JAHA 2LWIA 1K5DA 3E18A 3LKVA 4GVLA 4P4LA 3TQTA 1U9CA 3WIDA 3VZPA 3X1XA 4C0HA 5CB0A 4KNYA 3ZGZA 1LDMA 1I6WA 1UJ4A 4RZUA 1IYZA 2OSBA 2QJTA 2VPXA 4FHGA 3QFTA 4ZCLA 1P8JA 1S0UA 4BKUA 4MKXA 2ZTLA 5JXHA 2R8PA 1WXIA 1YK0A 3OEED 1QCYA 3RS4A 5LIRA 1OAOC 4F46A 4KFCA 2Z8YA 2J46A 3REFA 5BMVA 2QUHA 1KYZA 4QTTB 3ADKA 4ZYTA 3B53X 4D6XA 1M7BA 1ZNWA 3NJRA 1Q91A 1TM7E 1DBVO 1KYTA 1U90A 4FOTA 4RNCA 2WICA 4CM8B 3FYCA 4UOZA 3H6HA 5FDFA 2XV1A 2YMPA 5F5NA 4CCWA 1FFWA 2P4QA 1KBOA 3HO8A 4IRMA 4PONA 4WVFA 3MWDA 1MC1A 1X7XB 1ZVVA 2ZQZA 2K7FA 2C5FA 3CR7A 3LX8A 4JA0A 5I7FA 3B1WA 1SRRA 3OFND 3IPXA 3O9ZA 3OP1A 4BO4A 3PE3A 1JEOA 1LTQA 2Q8NA 3F2IA 1N77A 1XU4A 1N57A 3K31A 4HAWA 2XOKD 2DQ4A 1SEPA 3E8SA 4YONB 3ROTA 3IMEA 1XU7A 3C3EA 4MOWA 1BIFA 1N1EA 2Q2QA 2ZROA 1SIUA 3PJFA 5AK0A 5KAMA 2IH5A 4D26A 4HAIA 1N2XA 4IXNA 5JZBA 2HQSA 2HDWA 5EZ6B 2CBGA 1TAUA 3G2QA 2BFEB 3GRAA 4I0WB 2UZ1A 3FR8A 2GYUA 1FU7A 1RCTE 3GL9A 2JI6A 1QFZA 2B8TA 5LZ5A 3QU2A 3KR0A 4TUYB 2H7CA 4W8HA 2MSKA 3AUFA 3IUJA 2R8ZA 3BGWA 3LDAA 4L7QA 4O5AA 3G0CA 4EB6B 3K9WA 2HJGA 4OGKA 2C58A 1P3DA 2XIJA 3PXAA 4ER6A 2JLZA 3F90A 2AX4A 1CQZA 4RQBA 3AVYA 2H1IA 2OV4A 1VXOA 3SSMA 1X3LA 2FEKA 2P91A 2G63A 2PIDA 1U4NA 3GVIA 3JQ8B 4FD3A 4XJTA 2WPDD 3B89A 2I2DA 3NHUA 2XCQA 4F1WA 1UBSB 3OZUA 3PITA 4W99A 3G1UA 3TQQA 3ZWMA 2V7TA 2MSWA 3WZLA 2XE7A 4JLPA 4ZZ1A 2JFNA 4B81A 2C20A 2Z8XA 3E0XA 3K70D 3COZA 4H7EA 5HPYB 4YECA 2B5VA 1FUEA 1N8NA 2H2FA 1Y8QB 3NEYA 4G1EB 3ZWBA 4B3JA 1O0BA 3I8SA 1O94A 5H1YA 1SCKA 4RKRA 1K7CA 1DKNA 1F2VA 1Z0JA 2L18A 3MJCA 2IUUA 2HU2A 3EOAI 4UUMA 4JI4B 1U9ZA 4S35A 1Z06A 4TT3D 4DLLA 2Y76A 1XRRA 2WM8A 1TZJA 2N9UA 3LUPA 3NHYA 2OV2A 4HL6A 4QE3A 4Y0AA 4E88A 2R84A 1AQIA 2JB9A 2KMLA 3CRZA 3X1JA 1E7MA 4JU9A 2FUKA 4XIYA 1SCJA 2C8JA 2JAQA 3HJAA 3UN1A 4BKPA 1N2EA 2QS9A 3AR2A 4X60A 1HDEA 1DGQA 1PFUA 2L2QA 2R65A 1SU6A 4M54A 3HZRA 3Q0IA 2J08A 3WWOA 4E7OA 1BD3A 2RHJA 2V1XA 3HCPA 4G8BA 3K0SA 3OQHA 4RTOA 4OB8A 2I7VA 4LRQA 1OHHA 4XR9A 1Q7GA 5F21A 4F84A 4TYQA 1ZVQA 3LP6A 3U7IA 1G21B 4BO8A 3E9NA 3NRJA 2PJZA 5A9SA 5LA6A 4UFPA 1PKXA 1SOWA 3L7BA 2QTAA 1UPBA 5G53C 4CF5A 3DLTA 3KV1A 4RWZA 2BF7A 1GTSA 2W2NA 4WKNA 3I64A 5BSEA 1KK0A 4WUVA 1AB5A 4I6GA 3PDUA 1DRWA 1ZAKA 4MS1B 1Z4MA 5H81A 2JI8A 3DYBA 2J1LA 4NIMA 2Z2ZA 4Y30A 1YL7A 3FOBA 3MHTA 3FKSA 3CLUD 5CH8A 5CX1A 1KKUA 3DDNA 5GM1A 5FBVB 4PLTA 3BGDA 1FP4B 5BOVA 3NVDA 4NPCA 5LKRA 1KIAA 1Y7IA 3DZJA 3MS4A 4I9FA 2WYWA 3A14A 2YFHA 1SBYA 3L02A 3LOPA 3DMDA 3O4IA 3OJEA 4KPGA 1Y8AA 5AJVB 1IPHA 3CJQA 5SYMA 3RYIB 4YDQA 3RIYA 1KAMA 1CR6A 1R3UA 1WUIS 4OXRA 1ABFA 5P8WA 3VFDA 4K6MA 2R1TB 3L6DA 1U7WA 4F0JA 3KPYA 2NTJA 1FIUA 3ZZMA 2D54A 4KQ2A 2ZE8A 3HUTA 5A6VA 1ZRMA 2D2IA 2XMPA 3QVLA 4N5LA 3JQBA 1EESA 5IHXA 3THXA 2EWMA 4J4BA 1RLIA 1W44A 3R23A 2TRSB 3TEJA 3B5EA 1SUWA 2CNLA 2H31A 1G1AA 4G84A 1KHHA 4KXWA 1TYCA 4KXVA 3WBJA 5D7NA 1T8RA 2EYUA 4DBLC 3T1QA 2RDMA 3BSWA 4NZ9A 1XRQA 1E0SA 2CF6A 1JQDA 1VIAA 4I7EA 5C31A 5JNSA 5KJCA 5T67A 3QX3A 3S1AA 1IAQA 4TLBA 4C0WA 4KV9A 1U0EA 2P4UA 4V24A 5KU7A 2CBXA 4KBGA 3GZNB 3A4IA 3PX2A 1Y4ZA 4JQOA 4IOLA 2IPNA 3H19A 1U1GA 1OJLA 1NAIA 2GZSA 2DT8A 1X1DA 3L1IA 5CA0F 2WZCA 5B58T 2DC1A 5F51A 4KBYA 1Y0BA 3ZY6A 3ZHRA 1X8JA 2VBIA 5THQA 3L07A 4WX2B 3BD6A 5E1DA 4L6CA 1XCGB 1BHJA 3A3OA 2O8NA 3E61A 3NNNA 3KFVA 1NV9A 3H8WA 4RH0A 4F21A 3SJAA 1CUSA 3PF8A 1W4RA 2ZI7A 4OMUA 4RH1A 4I1RA 5IJWA 1K8RA 1QHHA 2ZSDA 4BYGA 1Y5MA 3LG2A 2QUZA 3TQSA 4TYNA 4AKIA 3VOBA 3GEBA 2OCYC 1X7WB 3C5EA 1Z5OA 1TQ4A 4GO1A 3TFQA 5IT9A 1P4SA 4RM2A 5K6RA 3AZPA 3FPEA 3JQ9C 3PJEA 5K3BA 1M5RA 3DT8A 2VDVE 2W6PA 2BBSA 3PJGA 3ASUA 4IHAA 3HADA 4BWFB 3ZQKA 3C3KA 3TAHA 1C4XA 1U3DA 3RVDA 3ZDBA 3TLGB 3HU1A 3D1VA 2VEOA 4OYLA 4LYYA 1UJCA 3C3DA 3SS9X 3WHKA 5DBOA 4EJ0A 3UBTA 4RH3A 2FW6A 2HHCA 3RW9A 3RHFA 4L85A 1KQNA 1UMKA 1VFPA 4YQEA 4D8TA 3EGDB 3EBOA 3OO1A 5I7VA 4OAOA 5BSHA 2EWVA 1W36C 3RSQA 4MVJI 3D81A 1W6RA 1N5OX 3I2IA 4JKYA 4JC8A 4BASA 5IZ4A 1T3HA 2P90A 3A6LA 4DLUA 4RANA 4HOYA 4E4RA 2DWUA 3R3WA 3WLSA 4FE7A 2BFWA 2WKPA 2ZYHA 5AI4A 1OBHA 2IOYA 2NZUG 2XYQA 1IXZA 3BXOA 4WHMA 2EJTA 3G85A 4TSKA 3V3TA 4ZDKA 4B9EA 2X9QA 4UM5A 2BBOA 3P2KA 4IL5A 4EELA 3I04A 1VL2A 1Y9JA 2AJBA 3P9QA 4FKZA 4HEJA 4XI9A 3LFUA 2FX3A 3MHPA 5E6UB 2VYND 5IFLA 5J4LA 3KQUA 3BRQA 4HS4A 5B3LA 3OT1B 2OLKA 3CF4G 3U60B 3SZMA 4L28A 1EFPA 1ANKA 5DWVA 5F1YA 1UOQA 2XCSB 2YRFA 1YJXA 1CJUC 2QN1A 3KLBA 4C6TA 5A0VA 3ONEA 4G1FA 3DDWA 4KVAA 4BDTA 3UQZA 4AKTA 1TGVA 1QVVA 1W8IA 4LXQA 3K4HA 1QK3A 5LLTA 2G1KA 4UTXA 5DH9A 1EUZA 2EARA 4MQUA 3ASYA 2ZBPA 1NJGA 3DMPA 3CKLA 4PF1A 1U0GA 2VUSA 3JWPA 5U1PA 3TLAA 3WQRA 4YPOA 2P7IA 1XJCA 1N1MA 2PKEA 3FMGA 1ZZGA 4URXR 3KLNA 4JOSA 5JVDF 3OZBA 1ONOA 4U6SA 5BN3B 5ER9A 4WFJA 2J4DA 4DBVO 1GVNB 1M1YB 3QBEA 5HOEA 1SUSA 2CYAA 2Z2KA 3NGXA 1DIRA 3E5HA 5JHGB 3NDIA 2PR7A 3EE6A 3I0MA 3FHJA 1Q19A 2A0FA 2OBMA 2TS1A 5IM4A 1RXVA 1UKBA 2Q1YA 2C59A 3DOOA 4GOMD 3EMBA 2AHRA 5AW9A 1ZLYA 1PD1A 4TYYA 1R0YA 2QN8A 4LCJA 1JEEA 2OKGA 1MABA 2ZJ8A 1DIOB 1QANA 1QHIA 1Z07A 2QVBA 1HF3A 4PXYA 5DCLA 4JP2A 4KFSA 1ULTA 3ZE7A 2NWQA 1A8SA 5BNZA 1R5NA 4GEKA 3DLIA 3A1SA 3GDFA 3NPAA 1N8KA 4KGZA 1CQIB 3R7SA 1VSTA 1XZNA 1E77A 2OK8A 4JT8A 3MTAA 4JB0A 2Y1KA 1ZGZA 1VE1A 2ODAA 4PAQA 1NJ6A 3H9BA 3O8LA 4AN0A 4CTOA 4W7HA 1QYRA 4DUYB 1NOKA 3GLQA 3QU7A 3RT1A 3JQDA 2G70A 1A8PA 3CXUA 3F71A 3F7TA 2IBSA 4JL6A 4Z49A 3AI3A 3E7DA 3OJXA 1VMDA 3RO7A 5DYNA 1FU8A 1B1AA 5CVDA 1KYYA 4WZAA 2IT1A 3GAFA 4R16A 4TMXA 3C4VA 5IJ0A 4CLRB 3BMCB 5AKJA 1K4MA 4LJLA 1BMTA 3JR3A 1E96A 1AK2A 3EQ9A 1GGMA 1EB9A 3PRJA 4RAOA 4E6PA 1F6BA 3ZIAD 4XSVA 1L0BA 1KI6B 5IEBA 1VA5A 3QLEA 1R18A 1Z39A 4G41A 1Q2UA 4ZFNA 1TZBA 4OK3A 1PNTA 4WN9B 3BZBA 4YJDA 5JRZA 4BU1A 5BR1A 3JV7A 3LQFA 3NALA 1EXWA 5LP6B 5K99A 4AJHA 4V0OA 5AW4A 4HSGA 1DBQA 4DNXA 5BORA 3KUDA 2X0EA 4D6YA 1HXHA 1CUFA 1WS6A 1E5XA 2GZRA 2X5XA 2RFLA 3BIOA 1BXZA 1FUUA 2NO0A 2VUTA 3HV0A 4XWWA 4FE3A 1YB7A 4W5JA 4KI0A 2O2SA 3H8VA 3RRZA 3LBHA 1UAYA 4UNNA 1XBTA 4QEZA 5HS6A 3IURA 2JW5A 1O94C 4ND8B 3WBFA 4B80A 1PJZA 1KYQA 4XGRA 4DNPA 3WLHA 4IMPA 3I5AA 2QIOA 2QRHA 2F3PA 1OH6A 1R0CA 4LSWA 5LWQA 1KRHA 4JI3B 1PSDA 3W6ZA 2BEWA 4YUAA 3JYLA 3T9BA 3DAOA 3AEQB 2X8JB 3RSOA 4FB5A 3U44A 3L0PA 1CJKC 2SCUB 3F8WA 3IMFA 3KVYA 4OYRA 5B36A 2MHCA 1JX6A 2PUDA 2OAGA 1VRWA 1WB5A 2HSGA 4KLZA 1HZJA 2SKDA 1Z6TA 2OMEA 2RGNA 4FI3C 4M8NE 2I7TA 4ZO7A 3ZK7A 2Z8ZA 1J8DA 2X9GA 3EDCA 5JQGA 1BQ4A 1WNTA 3FXAA 5F9HA 3TRKA 4YMGA 4N0DA 4BNGA 1X80A 2JHPA 2UXDB 3A26A 4FKBA 4DLAA 4QTXA 1EHYA 1KAEA 1TJ3A 1IBRA 1QAMA 3IEMA 2G6TA 3VPXA 5FV7A 2DPHA 3LD9A 4RL4A 1LSOA 5HBRA 4QASA 4MRRA 2O1EA 1ZFNA 1HPLA 1YZUA 4LPSA 1EXDA 1A9PA 4GZLA 2CNOA 1Q0UA 3CO0S 3ZNPA 2QNBA 2H4WA 3ZWPA 2NU6A 1E1DA 2ZANA 3ISTA 3AHFA 3NC4A 3PR1A 3E9EA 3IX7A 3LF1A 4KQ1A 4R1NA 5TB5A 1JPVA 5BNWA 2IBMA 3NTRA 1FFCA 4GBGA 4TLDA 3FNRA 4QDJA 1ZOLA 1NN3A 4RJKA 3FRJA 2PZEA 4D80A 1E0DA 2KW5A 3RJTA 2G4VA 2CHVA 2YCBA 2C9CA 2DWPA 3PL1A 4IIEA 1JH9A 4P36A 3PQ4A 3MWEA 1EZ1A 1KXZA 3GGJA 1IE3A 3FYUC 1IL0A 3JQBC 1CUYA 4XVRA 3VSEA 1Y7HA 2X40A 1VMIA 4CF7A 1DB3A 4LOIA 1NVGA 1Z0UA 1H6BA 3QYFA 2QENA 1LRKA 2BHLA 4B4OA 3DMNA 1B23P 1JR4A 2WINI 3JR7A 5HZGA 2IXFA 1BE6A 1I32A 4O4JB 3I5MA 3M6VA 2XVZA 4A8JB 4CEHB 3R09A 1Z0IA 5SZKB 1E9EA 1ZIPA 4LKRA 1NFRA 1Z35A 4M8SA 5TGZA 5A2QA 1AMOA 3TLKA 2XKKA 5L7WA 1WBBA 1G9TA 1HSOA 2P40A 2REOA 3OOWA 4YRJA 1BAPA 2C7BA 4EYEA 1A50B 1J56A 2FN3A 3UWSA 4BNUA 4FC6A 4FM9A 1EGAA 1PZEA 2F48A 2SKEA 3MLEA 4HGQA 4I3FA 1CRLA 2M1ZA 2YQ5A 4YASA 2W4IA 4UXIA 2Q6TA 3ROPA 4QG3A 5LQNA 5I5EA 2WOOA 1KJNA 4ON9A 2Z4SA 2O7VA 1XZIA 2D1SA 3CF2A 3SVTA 4UCWA 3UGKA 2YUIA 3DUFA 3G6KA 3JWIA 2ZR8A 3KUXA 1XTPA 1M6VB 5I8PA 3F46A 1D2MA 3WJ2A 5EA2A 4TL8A 4F6RB 1CIVA 1BE1A 1YMVA 2FEMA 2J7KA 2OHJA 2VSFA 3LFHA 3SFZA 4HY3A 5DYTA 2XQJA 3HCCA 3TDMA 1FSFA 1G2OA 2QRUA 1C1HA 3EARA 3L05A 1CRQA 4N3GA 4TXHA 5EKDA 5SV2A 1KOLA 4TZ0A 1WQ3A 2XTMA 3I2HA 5FLKA 2ZIXA 1JEYA 3TZQA 1YD7A 3HB7A 3A2LA 1T2CA 3QNMA 4DZTA 1Y7TA 3N5CA 3ZYZA 4RPHA 2MCFA 2E82A 2ZB8A 5J1TB 1QYVA 2ZRNA 2P9BA 2CY0A 1X39A 4F3TA 4QPPA 2FRVA 4Y6OA 4XQCA 5EWJB 1D03A 5KYGA 3BZWA 3CMMA 2KBEA 4QXPA 1NXQA 1W9HA 4ARVA 4P58A 1MKYA 3HSKA 3CKKA 2FSGA 4BNVA 3LHKA 4XLLA 4FILA 1DBPA 1IVYA 4RFLA 4LRUA 4Q6BA 4B8YA 1R9MA 3FRIA 1VTKA 2JKZA 3G9ZA 5FAKA 2A9PA 3KQLA 2RGDA 3E9QA 2P2YA 1MFPA 3N3BC 3CMCO 4UU8A 3ADDA 4W5WA 4JXJA 3F67A 5KX5F 3K8ZA 1NNSA 1Q3KA 3A3KA 3CM0A 5CTJA 4WK6A 4N9QA 3RROA 1DT5A 3Q4GA 3UUWA 3KVNA 2VQ3A 1KJZA 3KB8A 1VM6A 3ZE1B 2GZAA 4TMKA 4X71A 3E35A 3B9BA 3U6BA 3NOVA 3OIYA 4JUAA 5GV8A 1ZA1A 3PVCA 4CQLB 4DC1A 1DRVA 5EXXA 1JF8A 4YIKA 5CLLA 3VDQA 4L22A 4BGUA 5AI0A 1QV6A 4MRNA 4QM7A 5DXAA 3H9EO 1EM6A 2VAWA 3KALA 1M34E 3QBVA 3QPUA 5K3DA 2J45A 5DM70 1IOVA 1L4HA 3AUYA 1M0SA 2VP2A 4IS2A 4AJ4A 3WAKA 2FMXA 2P9TA 5DI3B 3VR6D 1Z33A 2GD1O 4RKQA 1J9EA 1ZJZA 2I9PA 1O8CA 4NH0A 3PICA 1JALA 4X54A 3P9SA 4LDPA 4AL4A 3LA8A 2F6RA 2VDQB 1AQ6A 2BKLA 3B1JA 3PR3A 2OO5A 1JH8A 1H5NA 1H2XA 1JW9B 1XTJA 2A8YA 2ONKA 3TIIA 1KR5A 1TCVA 2ZUWA 3DZDA 2ATIA 3KR9A 3OI7A 4MPDA 5IARA 2O3TA 5CYGA 5A3QA 4JBGA 2HHAA 3SX4A 4GL4A 3AF6A 2PSSA 1Q15A 1QVAA 2QUIA 4FR5A 4TSFD 1UUFA 3P52A 4AJKA 2Q4BA 3W7VA 1U0SY 2QQFA 3OQIB 2AYYA 2Z4RA 4OXXA 2ZUEA 3ZHTA 4YAJA 1NVMB 3NVAA 4KDRA 4YRFA 1ECPA 3AKYA 4WAUA 3EVBA 3OKAA 1KVRA 2FSSA 3SC2B 3HB5X 4B71A 1O5IA 1NF9A 4OA5A 1R0SA 4PC2A 1ZINA 3A4LA 5K4AA 3ZQ6A 3LC0A 1IMOA 1EVIA 1Y8RA 4ZOAA 4EG7A 2BTQB 1D6JA 1PG0A 2R6DA 4EY7A 4GBED 4GR5A 3HBLA 3B1XA 4EATA 2DQSA 2NVOA 3SDSA 4MVWA 3CU5A 4GX2A 4H1UA 4GGPA 4PCAA 3ZV6A 1FMJA 2ID7A 2P69A 4Y1FA 5CEEA 4YA6A 4TKZA 5SZHB 1NFQA 2VZEA 2FXVA 4H7FA 4IX1A 4DR2B 2FWNA 4ZDWA 4Q1AA 5K4HA 2I6TA 5E95A 1DC4A 1U28A 1KRXA 3E3MA 1E0KA 4EVSA 5IBCA 3BBLA 4LVCA 4UOQA 3O9VA 4HDNB 1PLJA 2XUIA 3BSSA 5JCPA 4RTKA 4LFBB 4HN4B 4OL0A 2P3OA 2VDLB 3CZ9A 2OHHA 1J0AA 1QTIA 2QJOA 4BZZA 4QTYA 1N2ZA 5HA5A 1VL6A 1YZQA 3HRHA 1W4ZA 4U2GA 4JX8A 4Y1RB 4YWJA 3TKLA 2H59A 2GFQA 3LBYA 3U1VA 1EPUA 4KR0A 4R54A 2Z3ZA 4A4DA 2VSXA 1C2TA 2OCGA 1QPGA 2ZAYA 3LX4A 2H6EA 1YVPA 4B0PA 1RKVA 1KQGA 4RULA 1E9BA 4I81A 1IPFA 3N2KA 1IFXA 2WG1A 3HI6A 3OFSA 1K5PA 2AFHE 2XCLA 2ISQA 5AM0A 1JQ5A 1VXRA 4IPTA 2WDZA 4LXTA 3SEQA 5KNBA 1HMPA 4L8GA 3IUEA 4O02B 3O6VA 3PNQA 3I6MA 4RDCA 4IHJF 3VSDA 4D9CA 1VDZA 4YP5A 1QK4A 3GBSA 3KJEA 4G5RA 1Y9DA 2HMUA 3D8TA 3I8XA 1GO2A 4IIJB 3SY8A 1WB9A 4CEJA 1UJ6A 4XM2A 3MQFA 4P31A 3L0SA 4N8SA 2Z6QA 1HYGA 1JG2A 3ZI0A 4DMHA 1PW7A 3NHMA 4QRDA 1YC5A 2IYUA 2XE8A 3RUIA 1TLTA 3FMFA 2NP6A 4RWEA 1AKTA 2W0SA 2RGNC 2PIAA 1FYDA 5FYDA 4BFZA 1YRYE 1FW8A 4KHZA 4IXMA 4TTAA 4IGEA 4M7WA 3LRXA 4B4WA 1KO4A 5HKAA 4CQMD 3HEMA 5HILA 5JSFA 3UKDA 1TYAE 1R4AA 4FGSA 1P5JA 1JTVA 1U3CA 5ALYA 3C8UA 1X19A 5HMMA 2ZS7A 5L3QA 4BFUA 1WCIB 4DC0A 3FI9A 3DV0A 1K4YA 5JRJA 3C8HA 1HM5A 4LZAA 4C21A 5KOHA 1EJ0A 2QSUA 4RGQA 5CDFA 2PO5A 1ZAYA 3Q8LA 1K75A 2ORED 2QSZA 1JP7A 3M33A 1ACMA 4Y18A 5F5XA 4DOMA 5LQRA 3EXHB 1NYLA 4Z1MA 2FOIA 4EFLA 3H2BA 1K68A 3VTKA 1SUAA 2C0CA 1F8YA 2I4RA 4PSCA 1G42A 3BMNA 3HMQA 1PR4A 3Q3CA 3PDCA 1QNFA 3K5HA 3O4FA 1F38A 4NV0A 2XZLA 2A1UB 3BERA 1GKLA 3DGFC 4KMOA 4TLLB 5CUQA 5FORA 2ZB4A 3SE0A 4NATA 2X6QA 3OFKA 4YAIA 4I19A 4GQBA 4L08A 4OUDB 4R1LA 4ZVLA 3PQFA 2F3SA 2WJAA 3LH5A 3P5BA 4F72A 5HJ5A 1FF9A 1EVLA 3D3KA 3X1MA 1V1RA 3N0TA 1UQTA 4LZZA 3BJMA 4YJGB 2OAEA 1W5EA 3L7JA 1UQRA 4R1OA 1MRSA 2Q21A 1R8XA 1ZNYA 4M87A 1CUBA 1TM3E 3ECSA 1BFKA 3EODA 3ZBQA 2H85A 2X0DA 1IMJA 1N5IA 3HJUA 3TBKA 1EM8B 2P2LA 3GXOA 2PUWA 1MX5A 3U4QB 2VDWA 3NBKA 1O9BA 3MTDA 1NP7A 3FBWA 5JAQA 5DGDA 4PVCA 4DJJA 4QYIA 4CPDA 2ZLBA 3TAUA 3FMPB 5E1MA 3EIHA 5FTWA 1DDOA 3ADOA 1DKRA 2PZMA 1FSSA 1UIRA 3IO5A 1CQJA 3SKVA 5DIZA 1L7AA 4AJ2A 1KWKA 1UZAA 1JKIA 4ZTUB 3GF4A 4J1QA 2IK8A 2IEDA 1PWZA 5EMKA 3HFSA 5JAOA 1KEEB 8LDHA 1GU7A 3HTXA 3PA6A 3IV9A 2QLMA 1I36A 4UAVA 4RV5A 3AY3A 2R96A 5IJZA 2J4CA 2PX2A 3GN1A 1OI4A 4QUBA 3EVEA 4UMDA 3V1TC 3G3EA 3DUWA 1KY3A 2PX4A 1ZUWA 4GZ5A 3HVRA 1BJRE 3CUEF 1CCWA 1IB6A 1NJSA 1T1JA 1X1EA 2JIRA 5B7NA 2I55A 2J3QA 1L9XA 2V6JA 2KJQA 1R10A 2QF7A 2VP3A 3CEPB 3LHIA 5E1OA 3SOZA 5CG2A 5AUPB 3ITNA 2REBA 3RWOA 1R4MA 3O74A 1SIWA 2FW1A 2NUAB 2FMFA 4IH1A 3AKZA 3EW9A 1U8UA 4WUTA 3HVIA 3TGWA 5IH3A 1DC3A 1EP2B 2E4VA 1AGXA 3DR5A 3ORQA 1D2EA 3UK0A 4ZYZA 3R5SA 4LGMA 3DOCA 2AZXA 2BFPA 3FVWA 4P3PA 3BFJA 1V4BA 2G25A 1COWD 3LUAA 3CBGA 3OTQA 1XTQA 4P3XA 1QFJA 3MD0A 5BYJA 2QWXA 3RWBA 1GDTA 1UBOS 5BSUA 1PUXA 4FINA 2P5YA 3UV3A 4G01B 3U31A 3UMBA 4D4HA 4P2GA 1TEZA 1ESNA 2FWPA 1VKHA 3ICVA 1ZH2A 2PKQO 1J0XO 1D0VA 5B1IA 1E8DA 1OSNA 1PNVA 1UP6A 2MMCA 3MWYW 4GPBA 4KI7A 4IIYA 1U9YA 4Y6RA 5FFNA 4EVRA 4LZLA 2F43B 1FUYB 2MSCB 4XH9B 4JZYA 1U98A 2ID9A 1GQQA 3C5HA 3KPJA 5DK6A 4DSZA 4AN4A 4PGAA 4F9FA 4PBTA 2CVHA 6YASA 3IT1A 4MVJF 1Q20A 2QLJA 1SVOA 2WD7B 3MTBA 2B8JA 3MMXA 3Q9SA 4MCJA 4I50A 1ILWA 3H2JA 1R0BA 2FI1A 3N2GB 2GCEA 5TC4A 4QJ5A 3UMRA 3GNSA 3S81A 4P38A 2OMKA 1E7SA 4Q7EA 3UF0A 1E6WA 3F5SA 3I12A 2I6UA 3T7IA 3MTGA 5J4VA 3H7IA 3C3YA 4PIPA 1J39A 3KZNA 1PS0A 2B4AA 3E5RA 3S3TA 1UFKA 3F7MA 1I6KA 3EH1A 1UDCA 4OLFA 5U4XA 1M75A 1IXKA 1FDWA 1LV8A 2IYOA 3NKFA 4KXFB 1V6CA 5EZYF 1KH3A 4A92A 2II6A 1ZK3A 1CJCA 4HPJB 4EKNB 1CNMA 2QAGB 3WAGA 2Y1GA 1NI5A 3DT9A 4H6PA 4MGIR 1R1DA 2Q3DA 1RJFA 2J0EA 1Q0PA 4QPCA 2VP6A 3I9NA 1AUXA 4AZSA 4ZIRB 1DJOA 3G8YA 4EJFA 2PKWA 1DKUA 1KL7A 1O4WA 3SXUA 2BFMA 5K45A 2W37A 3AUSA 1XA4A 2Q41A 2CCJA 4GOJA 2WWTA 3W5IA 3I4CA 1ISPA 1L7XA 1JJIA 1XVAA 3OC6A 2RONA 3ZLVA 1U1EA 1XRPA 8MHTA 3T5AA 1ZJ4A 3DCJA 1M6HA 2Q5EA 1WXGA 4AUNA 5K0FA 1SR8A 3DD5A 5BV2P 4XB6B 3OE4A 1JDTA 1XCPA 5FWYA 4K9LA 3M9XA 3P0IA 4W8GA 4D5GA 1X74A 3H9CA 4P54A 3DR3A 3EQ7A 1A95A 3I9V6 3L40A 4QWMA 4E5PA 1JFSA 4DB2A 1N5JA 2IA5A 3P97A 2FSHA 3H5LA 5FUMA 3VSBA 4JGIA 3FCYA 5ALXA 1P1HA 1JT9A 4IIDA 4QYTA 4CWAA 4LMRA 1GL7A 4OQMA 4Z2YA 1WOMA 2QM8A 5CFOA 1ZL0A 1DEXA 1M9NA 2B35A 4GYYA 1NA5A 1TCBA 4HGPA 5AJTA 4BWGA 4PXSA 5TT1A 4CKBB 1IUKA 3GLIA 5ESWA 2FSFA 1SKYE 4ZT4A 4WOKA 3RHSA 4E3ZA 3PC3A 5LOVA 1R5JA 3C45A 4IHQA 4GSLA 2QPAA 5CCBA 2BH2A 4NJMB 2XRZA 4JT2A 2WT4A 4UUNA 4R8MA 4WXMA 1TLLA 5AHRA 4KAFA 2ONJA 3KSAC 1E7QA 1OWNA 1U28C 3L5OA 3HWWA 1FDSA 1EX6A 4O2AA 5DGCA 1OH7A 5C1DA 1D4ZA 3LC1O 3LKDA 1A7KA 1YR2A 3R0ZA 3ZU6A 4MR7A 2PUAA 3ZH9B 1EVKA 1GDDA 4IIVA 4LI0A 1Z3IX 1T91A 1EFCA 1Z12A 2P62A 2PXAA 2ZUSA 3GEPA 3AEKA 2O7NA 3ET5A 4L7VA 1STOA 4C0XA 1NMZA 3DYVA 4FDAA 1WQ4A 3ONFA 2DKOA 4K9NA 4UEJA 5T4HA 4AW9A 2EQAA 3PWSA 3K2EA 1S2IA 1QHXA 2X1MA 2AJTA 3G8CA 4L5BA 3ZBUA 5DTJA 4NECA 1Z5ZA 3LSTA 4Y2QA 1R0ZA 3TD2A 4CKCA 2RKOA 2OCDA 3BXXA 1WETA 4NBUA 5EP3A 5JC1A 4AF6A 4Z1MD 1WW2A 2YQ4A 3NPMA 4J1TA 1SXPA 1DG9A 2XI4A 1SU7A 1C3JA 1M10A 2BI7A 1I01A 1VG8A 3EGEA 4QC2A 4KSCA 3T5TA 5JEEA 1FFHA 5JATA 1SQ5A 1FZQA 4FYWA 3CIFA 1PL8A 4RQAA 4O63O 3EFEA 4E03A 3X3HA 1KVUA 4NZMA 4N7JA 4CL2A 3WMFA 3IQGX 5ADVA 5KNCH 4A0GA 1Z62A 4I14A 3I6YA 3MINB 3FLBA 3HCFA 1GNVA 2W6OA 3BB1A 1AHNA 5AKZA 1E7YA 4ZWNA 3QSYA 3QMMA 2H9IA 4IZIA 4G9BA 4DV0B 1HG0A 1B43A 3CBQA 1VCMA 1VKZA 2GN9A 3IXQA 3NX4A 1Q1EA 3PQ8A 5TQ0A 2WHYA 1NI3A 4C0AC 4DAOA 2FZKA 2J9ZB 1V37A 4MX8A 1O54A 3SI7A 3IKVA 2H2GA 1FX1A 1R00A 1WHTA 3AEXA 1XRJA 3AZQA 5DTMA 2O2IA 2QAJA 1SUBA 1B6RA 3F1LA 3GCXA 3QE2A 4JBLA 2VQSA 4QOGA 3RLFA 3U37A 2R1ZA 4YRCA 2H1HA 3PYMA 4C6HA 2G76A 2I7XA 1JDPA 4D0RA 1IZ0A 4P3KA 2PUVA 1ZH6A 1QHNA 1H4TA 2QQEA 1ST2A 2R79A 4BLSA 2BI4A 4HNQA 3DT6A 2IHZA 5BUCA 3REOA 4B7UA 4KX3A 3NFYA 1ICEA 2C4VA 3PC2A 3I01M 3O91A 2ZRDA 3RU9A 5E7QA 2VSQA 2ZKIA 3BVPA 2G40A 1BGWA 3E23A 4FHFA 1CF4A 1OLUA 3EXFA 1U4SA 3CLRD 5C80A 4MMXB 3OJFA 4J6FA 2W70A 2UVQA 2VP5A 1QIIA 4BGEA 1XF9A 2IXEA 2QKYA 4GICA 4PBSA 1BCSA 2PD6A 4V0QA 1QRSA 2A6PA 2AVNA 1T4DA 3KD2A 2AN9A 5M34A 4UD6A 3RVKA 1S02A 4R8LA 5TXGA 1J8MF 3DAFA 1TC1A 4LQDA 4FJ1A 3C85A 2JGDA 3Q7QA 4F2PA 3VSCA 2C3OA 4C3UA 1M34B 2W2PA 1S5PA 2WIKA 1Y1QA 1L5GB 1ZKMA 5IKOA 1R9GA 2W00A 3Q6NA 3V1KA 1NNEA 2ZYGA 2JD2A 2FPUA 5CVEA 3ZHOA 4AZTA 1EAMA 2FPGA 2QRJA 4M0UA 4XTRA 1E3WB 2FV8A 4DR1B 2IDKA 3KQWA 4QXAA 3RRJA 4IV8A 1DBIA 3BILA 3JZMA 1PQPA 3JAWA 2W9XA 3U17A 3WGNA 5IZCC 3FIJA 1T2EA 3M9WA 3MCAA 2D3WA 3QSGA 4BJ3A 4BUZA 2FLVA 4HDOB 4BJ5A 1Y5LA 3HJCA 3LCJA 4GYJA 3CX4A 1MG5A 1QFXA 2CL0X 2QBYB 3SLRA 3GHYA 3RCBA 1TAGA 2C9MA 3VYTB 2TMYA 3HH8A 1YZFA 3D6AA 4KWHA 3GN2A 1BG6A 4WZBA 3SEFA 3G5LA 2RK6A 4X1YA 4FW9A 1N4AA 2JG3A 1PUJA 5AOBA 2JAHA 4ZCQA 2HK7A 3KXKA 4ESEA 4RY8A 5A6SA 4XA8A 5FFMA 1ZGBA 1QC5B 3FE2A 4ZCTA 2Q4EA 1XGKA 2FSUA 1UQUA 4UHJA 1RHQA 4XQGA 1UZNA 3FPAA 2QW0X 2UUOA 4LECA 2HA5A 1P1KA 3A4TA 1GCGA 3RWMB 2B83A 3UJ9A 4MRSA 2FF5A 4MI3A 1YBMA 3HCNA 2FPRA 5CMLA 2IV7A 1RWKA 2A1TR 3R3YA 4RMIA 2JFFA 4NX2A 4YY3B 1QLWA 4AO8A 4KE9A 2YOGA 1EXVA 5BN4A 1U0JA 4B43A 3REGA 2EX0A 4CG1A 3QU5A 2ZJ2A 1ZGAA 4OQEA 4Q3OA 3L6BA 3WGJA 4OQXA 4WDQA 3A4VA 5AK6A 4IOJA 3BFKA 3FKSD 4I8DA 4E5NA 3CV3A 2OCBA 2WM2A 1XCOA 2W98A 3IAM1 4D2IA 2PANA 3SMVA 5ESRA 2XLCA 4OKSA 2W6QA 1YZTA 1H0RA 4RLHA 2R7KA 4PHHA 2FW8A 4IO1A 2Y1FA 3KOUA 3KJQA 1TZMA 4IINA 2FJ0A 2QLTA 3QW2A 4TUYF 3DZ8A 2IELA 1CNEA 3EZFA 1H1TA 1QKKA 4L0MA 4DY4A 3A2MA 2B9EA 2B99A 2QP4A 3ONWA 4NQZA 2R5NA 2QB5A 2Y99A 4OHKA 1BVYF 2RGXA 4R8VA 3SR3A 2WE7A 2O5VA 2PX5A 2QP3A 4EB8A 2YIDA 4BEVA 3L9XA 3BQ9A 2CMKA 4PZDA 2QZJA 4HAXA 2HCRA 3PF9A 3W04A 4EUSA 2BEJA 2XPCA 2JCVA 3A36A 4CDRA 1K3UB 4Y1EA 3EZXA 4KQCA 1ISGA 3RADC 4TS9A 3T4PA 1QWSA 2EERA 2QTWB 4JFRA 4M6WA 1UADA 1ZM3A 2QRNA 5BSMA 5A4FS 4KSBA 1TTTA 3LVFO 1M8KA 4LE0A 1E6MA 4IUCS 4PSDA 2AFHB 1YCGA 1H2FA 3CUSA 3L84A 2G0TA 3ICEA 3LHFA 1AU9A 1P61B 4WCVA 2ZDGA 3U9LA 4PLHA 2BIFA 3PUJA 3JARB 4GW3A 1CS4C 3TSAA 4LRSB 5EJ8A 2HT1A 2W0MA 5IDQA 4CM4A 3W79A 1UT5A 4PYJA 3X2FA 4HDMB 4XFKA 4GI5A 3GEIA 1PWYE 3ESYA 1U7PA 1PGQA 4O33A 2WNHA 3BRWA 4BE7B 1RZ3A 5AOAA 1Z7BA 1WTAA 4Q4LA 3RREA 2O23A 4YYEA 2FPSA 1WV0A 4UQPA 1SZDA 1OA0A 4DREA 5H68A 4GI2A 2PKXA 3C14C 1EWRA 2JFXA 1JE1A 1GZHB 5GV7A 1QAOA 1OAKA 1DPGA 2CB9A 2EP5A 2R1UA 3DB1A 4KDEA 4S04A 2DFVA 3EHDA 3WLFA 4DR3B 5DYIA 5A9TA 5LSAA 2A2ZA 5G0WA 1D0IA 1TJ5A 2RGCA 1FDRA 4YP0A 2R60A 3QUSA 1T5BA 1YRWA 2A33A 3FSEA 5AKKA 1PJ3A 4RMHA 2XBLA 2J9RA 5CBPB 2LVBA 2WB4A 4HNGA 5K2MA 3PSHA 4EKIA 4GPZA 1K3TA 4P98A 4RF2A 3U7HB 2OHOA 1H2HA 4O59O 4W5QA 4X6XA 1V8FA 2PX3A 4HG2A 4QXOA 4R2WA 1KI1A 4X8LA 5J59A 3DLPX 4XVQA 4RVCA 2JKYA 2Z4TA 2GN1A 4TV8A 1ZD5A 4C20A 4K2AA 3NP7A 5DM1A 5FO0A 1GN9A 1NAHA 4BGDA 1CR4A 5KINB 5KPDA 1F14A 4H1TA 2J85A 3N0WA 4YUVA 2W2KA 4PIMA 5BWOA 3GI1A 2ZBFA 4HI0E 2RIPA 3E3OA 5JDIA 2DPLA 2ZRFA 3A70A 1M8JA 1XCJA 2FH5B 2GYWA 1AGRA 2PAAA 2IEIA 1XD2A 2D0PB 3OZDA 4PSAA 2GTIA 2Q6IA 2CMFA 721PA 4GM4A 4KR9A 3QVMA 5JNUA 4H7KA 2FG5A 1Y34E 1RRPA 3N0VA 3NAGA 2HWUA 5AICA 1XRLA 3NO4A 5L3SB 2NN3C 3O4RA 5AUOB 1ODCA 2PPLA 4ENQA 4GECA 3SYRA 1FXWF 3O84A 1JHUA 4FD2A 5FI5A 3D5TA 1CF9A 3BMQA 2PG3A 4OGGA 3SIWA 3PKZA 4BRSA 1UKVY 1T0JB 3KLOA 2ZBQA 4M1WA 2Q1UA 3B3GA 1K4KA 3WP0A 3ROXA 2QVYX 2K4MA 2H8KA 4MZXA 1YOVB 3GEDA 1L5QA 1VZ3A 5LU9A 3CO5A 3Q3EA 3UICA 1Z6XA 1UBUS 4C01A 1HY3A 4WLOA 1M5TA 1W25A 4PR0A 4Q4JA 1PYOA 3LGAA 4RXMA 3OT5A 1C30A 1Q84A 2FNAA 1PGNA 4E12A 4G5YA 1PL6A 1KFBB 1QK5A 3UJHA 4O4LB 5BWMA 3KXLA 1DINA 1IJKA 2CL7X 3U13A 2AH5A 2GXQA 4ATNA 4PWZA 4MR8A 4ZI7B 1VGVA 1W88B 4UNQA 3A25A 4WRRA 2O7QA 1YE5A 2XUFA 3C97A 4IXTA 4M0PA 4JVNA 1TM2A 1D9ZA 2CDRA 3C3XA 4PAGA 4XB1A 4MULA 4RA9A 4RBNA 4B6JA 4CU5A 4ARIA 4TVSA 5LJIA 1VHLA 4ZN6A 2JFBA 3T3EA 1EQAA 1JU9A 1RXEA 2E5FA 3CVYA 3RIMA 5J5VA 1I1HA 2GF0A 1P6XA 1G3QA 3U62A 1NOIA 2ADOA 1SRQA 1ZEJA 2R00A 5EKXA 3RBXA 2J32A 1VJ1A 4KUEA 4ETMA 4YPVA 4W9MC 2P2GA 2FZLA 1RI1A 2VPIA 1QZUA 3R3VA 1NV8A 3DHVA 4AJIA 4F56A 5T4FA 3RS3A 2GWHA 3T9FA 3ZZUA 1OX5A 1JILA 1T8WA 4IY1A 4ECEA 4IR7A 3VUFA 4Q7JB 2VP4A 2FMHA 3KU1A 5B3KA 1OZFA 4ZV9A 4DCTA 1ZI8A 4RFSA 1GG2A 1FE8A 1Z6GA 1KZ1A 3OJ0A 4XW2A 5DNYB 1V47A 2EL7A 3SQNA 3KJIA 1VE7A 4MYTA 4QUEA 5CXSA 5F77A 3CZAA 4JMLA 4DLZA 4RL6A 1I4DD 1XZAA 2C2MA 1H5QA 4IG9A 3ZUPA 3CT4A 4M9QA 1RAFA 2GS9A 3R75A 3H2SA 1NBOA 2QLNA 4NY1A 5EJ2A 4DLPA 1A8IA 1QS0A 1R0WA 3BSFA 3GJTA 1SO8A 1ISRA 3FG9A 3GUCA 4N5MA 1EGVB 3AL0C 2VBCA 4ML3A 1K27A 3IAUA 3ZJ4A 4F9EA 3O75A 5FA5A 4MPPA 1F6DA 3T0IA 2OB2A 2OCPA 3U26A 3T9EA 4D3ZA 5DBHX 1BHSA 4FNOA 4NOJA 4XASA 3Q5EA 5T6BA 3IJEB 3ST7A 2DJ5A 2RHTA 4RZIA 2DHEA 1H6CA 1V7QA 5EAIA 3GAMA 1QGYA 3DEAA 1YU9A 2YHIB 2X4IA 3FROA 4V0NA 3ZQJA 4BV3A 4CDMA 5K6AA 4HB4A 3CGWA 3HWX1 1Y9ZA 3HDQA 3LVQE 2D1FA 3OMWA 1TZCA 3NUQA 4MV8A 3TLBA 2W6CX 3QUCA 1P75A 5JAIA 3RPEA 4XM1A 2IZ6A 2PNJA 1IJFA 4EQ6B 3NV9A 1UR5A 1BSVA 1F6WA 2FPMA 1M33A 1DAMA 2EFHB 1T9BA 3DKIA 5E9AA 1JFLA 3PXUA 1PFWA 2IUFA 2CLIB 3H5IA 1KAQA 1U2GA 4MVXA 2VRNA 3RTEA 4ECAA 1Y1PA 4YVFA 4ERNA 8AT1A 2HW8A 3SF0A 2G67A 1B0UA 5JJBA 1EH5A 3AVOA 2HK6A 5C35A 4BEBA 3ITKA 3LY7A 3PFKA 1G20A 1H8EA 1UDWA 2GK4A 2PSHA 4FC7A 4FZJA 4NS4A 4M9XA 1WU7A 4BBAA 4XJXA 3RRNA 1RKQA 2NU7A 3DW3X 4PFQA 5HQJA 2EEPA 1W47A 3EWNA 3OLVA 3FTFA 2QM3A 2XECA 2WZQA 2PS0A 2ZT6A 3AJDA 1PTJC 2TSYB 3JPWA 3MJTA 3JRNA 2GVDC 1O6CA 2FFQA 2XTAA 4ZVNA 4M1YA 1NG1A 2BUBA 5HZKA 1B4DA 3WKDA 2Q3EA 4FDMA 3TTTA 6Q21A 2X8WA 4D4JA 3D4OA 2UKDA 4XYEA 2NMVA 2G82A