4O08A

Crystal structure of bacillus megaterium epoxide hydrolase in complex with an inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
287
structure length
287
Chain Sequence
MSKQYINVNGVNLHYISKGQGELMLFLHGFPDFSHIWRHQIDEFSNDFHTVALDLRGYNLSEKPSGLESYEIDVLVEDIRQVIEGLGYSSCTLVVHDWGAGIGWTFAYRYPEYVQKLIAFNGPHPYTFMRELRTNKNQQKASEYMKWFQKQEVQDYMERDNFSGLRKLVIDPGVKKGYLTADDVQAYMNSWENGSVLSMLSYYRNLKIFTEEDLRRKSLFPLEEEVLNIPVQIIWGNQDPTFMPENLDGIEEYVPNISVHRLAEASHAPQHEKPQEVNNVMWNFLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Soluble epoxide hydrolase
publication title Engineering of an epoxide hydrolase for efficient bioresolution of bulky pharmaco substrates.
pubmed doi rcsb
source organism Bacillus megaterium
total genus 111
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 3.2.2.10: Pyrimidine-5'-nucleotide nucleosidase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4o08A00
2WIGA 4QA9A 2VQ6A 1JJFA 4JNCA 4CG3A 5LKAA 1AUOA 2VT7A 2ES4A 3BE8A 5JZSA 5JZ9A 5C8ZA 3ZV7A 4KAAA 4ZREA 1BROA 3N0TA 2GYWA 2DHDA 1TCBA 2XE4A 4J0KA 3WKBA 1OXMA 3IIIA 5ALUA 5I9IA 1WB5A 4EA6A 5T4FA 1QTIA 1FFDA 3TEJA 1MO2A 1TQHA 5LZ2A 1XRLA 2BJHA 3C5VA 3WIOA 3R3ZA 1O6FA 4P08A 1T2NA 1ZIYA 3FYUC 3I2IA 2CUTA 4GECA 4M0MA 1DT3A 1VXRA 1W76A 5HF8A 3BF7A 2BGRA 2CMFA 2R11A 4B80A 1YS2X 1XRPA 1AMNA 2UZ0A 4B82A 5T4HA 4BVKA 1U2EA 3R3XA 3HABA 3F98A 1H22A 3HLKA 3GA7A 1ORVA 2HA2A 3R3WA 5HKAA 2HM7A 3DJYA 4KE8A 3WLAA 1KU6A 4UHBA 3ICVA 4Q05A 3RARA 3S8YA 5D3ZA 1N1MA 4DSZA 1P0IA 1GPNA 5H3HA 2RIPA 5CXUA 4LIPD 4A16A 4UFNA 5BOVA 1XZCA 5DJ5A 3I6MA 1ZOIA 3UUFA 4WFJA 3P2MA 2VTVA 1BU8A 1XQXA 2BGNA 1E8MA 1XZKA 5BWBA 5CRIA 5JATA 5AOAA 2QXUA 3IA2A 4IO0A 1ZD5A 5AOCA 5C8VA 3KOOA 5ALHA 1XLVA 2E3JA 4DGQA 1XZLA 1GT6A 1VZ2A 2ZYHA 3O9VA 2DQYA 2ECFA 1XZDA 4ZWNA 4UHHA 4AO6A 3FLEA 3PI6A 3KWFA 2G5PA 4K6GA 1Z68A 3MVEA 5CT6A 4J0CA 2OCLA 5IVKA 3EQ8A 1U8EA 3IUMA 5LZ4A 1LPNA 4G5XA 1P0QA 3ANSA 5LZ8A 2HFJA 2JGFA 3STXA 2HU8A 4WCVA 3W04A 2OAEA 1JU3A 4FKBA 3V1LA 5K3FB 5I8PA 5AKLA 3B5EA 5IH7A 1LBSA 4HXEB 1ZICA 2Q0XA 3KD2A 5AK5A 5EIHA 3OURA 2G4LA 4QZVA 1HDEA 4IQ4A 2B4KA 3DKRA 3BJMA 5A62A 3A2LA 4H7HA 2PKYX 4H7JA 4P9NA 3O4HA 5JADA 3DCNA 4BVLA 1G4HA 1XRNA 5EHZA 1WHTA 2OGSA 4ARBA 4MEAA 4B0OA 2GZRA 4PF1A 1N5RA 5CT4A 4C89A 5HF6A 1UOQA 2B61A 4PV7A 5YASA 5CH3A 3D0KA 3JWEA 1CUHA 1ZD3A 2QZPA 4ZRDA 2B20A 4UHEA 3ZI7A 3PE6A 4AMYA 4AMZA 4WDQA 4X6YA 1DQZA 1K4YA 3FOBA 2QT9A 1BEZA 3WK5A 3ZPXA 2JGMA 4BATA 4J0JA 1QIHA 1GPLA 2WIKA 1JI3A 1CUWA 5DYTA 5ALNA 3VVLA 4OYLA 3B3QA 4GEGA 4E46A 1NU6A 4C87A 4W1SA 5K5EA 3M3DA 4X6UA 4X6XA 4W63A 3HXKA 3KDAA 5KREA 4B7ZA 4OYYA 3C43A 4FLMA 1SFRA 1QZ3A 1N8SA 4YX9A 2OLEA 5AKJA 1MX1A 2C5GA 5CT9A 4X91A 3WA7A 2YH2A 4FBLA 1VA5A 4J0HA 5ESRA 3AIOA 3KXPA 2XUFA 2R8BA 1CV2A 3KWJA 5T4BA 2X8BA 2DFPA 3E3AA 2PSJA 1Q0ZA 5CT5A 5AK4A 5J3JA 2GBFA 3R40A 2WTNA 1ACLA 5JAPA 2PX6A 2CJPA 1UOPA 1DWQA 4U2EA 1K5PA 4L0CA 2XMDA 2WU4A 4XVCA 1MNAA 4HRYA 1H23A 4Y7DA 1LPPA 1CUVA 4CG1A 4DMKA 2VEOA 1HLGA 1W75A 5A7FA 3JYHA 1UXOA 5DTIA 4BC1A 3L1JA 1QJ4A 1E89A 4QE3A 3K6KA 2BUAA 2JBWA 4BDTA 4E15A 4XX1A 4DSAA 1FJ2A 1WHSA 4BB0A 3K2IA 3IBTA 4PSDA 5JAUA 1FFCA 5HF9A 4BC0A 2XQFA 3C6ZA 1NU8A 1A7UA 2WFMA 1SC9A 5AK3A 5T4EA 3NUZA 4F60A 1UOOA 4H7FA 4X94A 1SOMA 1H2XA 1XKLA 1PV1A 2OXEA 1SCQA 3H2HA 4AN1A 4C4XA 3IVMA 3WZMA 3QVMA 4EY5A 5ALWA 1UZAA 3IULA 4E11A 3PF8A 4DNPA 3E1GA 3EQ7A 5A2GA 5FV4A 4FOLA 5K3BA 3WQHA 2H9YA 1MN6A 3RM3A 2PU5A 5ALZA 2XQJA 2XUDA 1WM1A 4HVTA 4AO7A 5E2IA 1W1IA 2I3DA 1QIJA 3UUEA 3STWA 4MYDA 1G5FA 3O4IA 2XMQA 2PSDA 4LXIA 3IURA 3RKSA 4XIIA 5D6OA 4MEBA 4G9GA 1LPSA 4MJ3A 3H2KA 3WYDA 3ZLTA 3A2MA 4EY6A 5AICA 1UK8A 1EVEA 2JGLA 1ORWA 1YA4A 3MGAA 5E4TA 2CBGA 2QVBA 3AIKA 3G9TA 5ISMA 5DWDA 4YK7A 4Y2SA 2WSLA 3D59A 1GQRA 4KAJA 2OCGA 2OAGA 4CG2A 2WU3A 1LPMA 1E8NA 1EI9A 3G02A 5EIAA 4IH1A 2VF2A 4EZIA 2RI6A 4AZ0A 2OCIA 1GGVA 3AUKA 2HU7A 3OPMA 1BN6A 4Y2YA 4K2AA 1XROA 1VZ3A 5JYCA 2WJ4A 1BCSA 4FMPA 1RWQA 1U4NA 3H18A 3DYIA 4Q82A 3HSSA 3S2ZA 1E8DA 3WYNA 3O9MA 4PW0A 2EEPA 1RP1A 2LIPA 1CUBA 4FTWA 5AI0A 5CBKA 4PO3X 2HDWA 4X71A 1CUYA 1XZBA 4BRSA 2XUHA 2DR0A 3O4GA 3HZOA 2HU5A 4Y2XA 3DD5A 4Q34A 5CTAA 4Y2RA 5DNWA 3SC2A 5IKXA 3OG9A 1JU4A 5A7GA 1J1IA 4OB8A 1ACJA 5AJHA 1CUZA 2O2HA 2C5FA 2AJLI 1XRMA 3CCBA 2Z5GA 1PFQA 4TVKA 1M33A 2H1IA 1BE0A 5ALFA 3WKDA 4DIUA 2QXTA 1AZWA 3I2GA 3IUQA 1LZKA 5JIBA 2ZJFA 1AKNA 5LKRA 3RK4A 3VKFA 5LZ5A 2PVSA 5AP9A 5EGNA 4D9JA 1CUEA 1XZMA 4W1RA 2XMCA 4KYVA 4EBBA 5HK9A 4G4JA 3HC7A 4UUQA 1X2BA 1LZLA 1H2YA 2HIHA 5FRDA 2WQZA 5LLSA 5JZBA 2ZYIA 1CUXA 5DNUA 4I3FA 3NGMA 4DNOA 1C7JA 4HAIA 4NMWA 4Z49A 5CW2A 5JAHA 3BXPA 1FSSA 3F97A 3HJUA 1AX9A 5C8XA 1ODCA 3W9UA 5EIEA 4OB7A 2HA6A 5ALEA 4MYSA 3AINA 4EY4A 4G4IA 4ZV9A 4X3CA 4L3WA 5JD4A 1CUJA 4QWMA 3VISA 3WK7A 1YSCA 2V97A 1GKLA 1AURA 2BCEA 4KE9A 2WFLA 2WILA 5LYYA 3AZQA 4ETWA 3G9XA 3PF9A 1MPXA 3KSRA 1K63A 3CXUA 3DYVA 3BF8A 4CCYA 1QE3A 5JD5A 4B81A 2XUQA 5FXMA 5AKHA 1UK7A 1ETHA 2ZVDA 5E4YA 4ITVA 3V1MA 1HKHA 5CT8A 1TK3A 1F0PA 5DLPA 3SWWA 2HA4A 4QDUA 1X70A 4DYHA 1J06A 4B83A 2QUBA 2XUOA 3EBLA 3WI7A 3EF3A 4CFSA 1QO7A 2J3DA 2RAUA 2OGTA 4BCCA 4AQDA 5E4JA 3G8YA 4AO8A 3A2NA 4QEKA 1CUDA 4A5SA 2XUIA 5AKXA 2HA7A 5DYYA 4UHCA 3DQZA 1ZI9A 3TGLA 4UFOA 2WHQA 2DHEA 2OG1A 4AB1A 4BP9A 1DQYA 1GZ7A 4AX4A 4BAZA 1XZFA 5EHNA 2ACEA 5ALXA 4N5HX 1CUIA 1XZHA 2RHWA 3A6ZA 3CN9A 2P8SA 2XT0A 4KAFA 4Y2VA 1FFBA 1WPXA 4K5QA 5KWJA 5AI4A 1VJ5A 4LXHA 1GQSA 1MJ5A 2VATA 1VA4A 3Q0TA 5ALOA 1H2ZA 4P92A 4ZI5A 4AN0A 2D0DA 3WA6A 1QIGA 1XRRA 1LBTA 1IUNA 3W06A 3GELA 4W1QA 2PSFA 4DLNA 1QIMA 1TKRA 2DHCA 2XMZA 4CI9A 1B6GA 3HYSA 4MWTA 3FBWA 4MQMA 1XRQA 3G0BA 3GROA 3PUHA 4I19A 4FNGA 1VLQA 4PSCA 4DNFA 4OPMA 1QIFA 2OPHA 2GBIA 4OCZA 3QPAA 3SX4A 1MAHA 3I1YA 2C7BA 4U2BA 2PL5A 1I6WA 1XZGA 1BEEA 1W6RA 1AQLA 3WKCA 1THTA 3DS8A 3FYTA 1TCCA 2JGIA 2ACKA 1DT5A 5CXXA 5HZGA 5K3DA 2PU7A 1ZI8A 4GI1A 2IITA 1UK6A 5K3CA 3LS2A 3DL7A 4INZA 5SYNA 4BDSA 3WJ1A 1WB6A 4EY7A 4B0PA 3FWHA 2HFKA 3L1HA 2PBLA 2QJRA 1XQYA 4AXBA 4GW3A 4DMCA 3BIWA 5AH0A 4IH9A 3STVA 2XUKA 1TCAA 2XLBA 3WL7A 1GPKA 2DSNA 3DDUA 2PSHA 3WK6A 3VJMA 2J4CA 4AZ3A 5I7UA 4F21A 4LXGA 5IVIA 4W1PA 1EH5A 4QDTA 3UMJA 4BVJA 2RONA 4RGYA 5IVHA 1Y7HA 4C88A 3PFCA 1QGED 5ALQA 4MWSA 5AM4A 1QONA 4UBOA 4LHEA 3I6ZA 3BJRA 3WWPA 1ZJ5A 1CVLA 1F8UA 3PFBA 1F0NA 1LPBB 5A7HA 4BCBA 4B85A 5DYWA 1R50A 1TRHA 1P0PA 2Y2UA 4BE4A 1FFEA 4N8SA 1JMYA 2XUJA 4G8BA 3VJKA 2WIJA 3HACA 2VJAA 2WIFA 3IUJA 4K6HA 4BAUA 4N8DA 4GLBA 1L7QA 3H04A 5FLKA 4ZV7A 4JH0A 3R0VA 3AFIA 2B9VA 2WHRA 3EIOA 4JYMA 3V9AA 2XQIA 3FCYA 4M0EA 3IB3A 5CMLA 3IDAA 4GDMA 5AKIA 1A8UA 4KACA 4G8DA 4OUKX 1CPYA 3ICWA 1QTRA 1JJBA 2C0PA 4C6HA 1SCIA 2O7RA 4X90A 4FBMA 1MNQA 5JASA 4C4YA 3CN7A 2JIDA 5JD6A 2YXPX 2Z8ZA 1E3QA 2V9ZA 2BAGA 1J07A 5HK8A 4RE5A 3YASA 1MTZA 2I78A 1E66A 1UKBA 1XZEA 3OTQA 1VE6A 4UPDA 2BUBA 3ZWQA 4ZGBA 4LYDA 5F4ZA 2FUKA 2DCMA 1R9MA 4QLAA 3WWEA 3D2CA 3VVMA 5ALGA 4Y2JA 1R88A 4A23A 4WDRA 4Y2QA 4L9AA 2FJ0A 2G5TA 1DWPA 2C4HA 3H19A 4WFKA 4Y2TA 5C7YA 2QM0A 3HEAA 5ALDA 2HL6A 4Q3KA 1CUFA 7YASA 3BIXA 2ZSHA 2PUJA 3FAKA 5LP1A 1JFRA 5FP0A 1WPRA 1PJAA 2JGEA 4YASA 2OCKA 4X7BA 1ZD4A 1LNSA 2QMQA 5AHXA 1YB6A 3C6YA 1LGYA 2V98A 1EDBA 4CIBA 1ZGBA 2XUAA 5DNVA 1CR6A 4H18A 4H77A 3HRHA 4HRXA 5FOQA 4V2IA 5ALIA 3LP5A 4FLFA 4QDXA 4H7KA 5AI6A 5CH5A 2WKWA 1NX9A 1XKTA 5HQ3A 3H17A 4Y9SA 5ALMA 2CEKA 1B41A 4B9EA 5FDFA 1EDEA 4FWBA 4L72A 5HF5A 2ROQA 2YYSA 3C6BA 1N5MA 4IH4A 4WFIA 3G0IA 4ZXFA 4BTVA 1JMKC 2QUAA 4G9EA 3QZUA 5AKKA 3QYJA 5AI8A 3H1BA 1SCKA 3ESBA 4FDMA 2I3ZA 3OOSA 4KRYA 4C01A 4BE9A 3AZOA 2K2QB 2RGUA 3ESCA 1X2EA 1R3DA 2XDWA 1OCEA 2XI4A 3E0XA 3WJ2A 1W4LA 1UT6A 3C8HA 3WMRA 4BZZA 1IVYA 3F9CA 2WHPA 2CZQA 1AC5A 2WLSA 3BDIA 5AKZA 5ALTA 4F5ZA 1D07A 4X97A 3CCCA 2AJBA 4KRXA 3H1AA 4BCDA 1YB7A 3VJLA 5JAOA 2O2IA 2PSEA 1K6EA 1KU0A 3F96A 2VSQA 4S0XA 4GXNA 3WWCA 1C7IA 4UBIA 4B84A 4QLOA 3FYUB 3PUIA 1AGYA 3WKEA 5AOBA 3WIBA 1YAJA 3V48A 4FNMA 3WK4A 3W05A 4J0GA 2JGJA 3G0CA 2Z3WA 2ZYRA 4ARAA 4TPKA 1DINA 1VOTA 4KR0A 4J0IA 2H7CA 4OD0A 1QOZA 4H7EA 1HBJA 2AJ8A 4OSEA 2XB6A 1ODTC 5AM1A 3H2JA 3MUOA 1E5TA 3OM8A 4EUSA 4K6KA 3I28A 1L7RA 4KE7A 4XJVA 2WUFA 3HI4A 3WZLA 1Q84A 1UKAA 1YASA 4Q3LA 3D2BA 4CCWA 1VKHA 3C45A 4MQLA 3I2KA 2W6CX 1CUAA 3I2JA 1HQDA 5CH8A 4UFPA 2XLCA 1IUOA 1OILA 4UHDA 1S8OA 1BCRA 2J3QA 4QDOA 3ZLUA 1G42A 4UBMA 1XQVA 3G7NA 2WG1A 2WUEA 2PPLA 4Y2PA 5ALJA 1EINA 1EXWA 1JT2A 5D3KA 1CIJA 3B12A 3C70A 2QS9A 2QKYA 3DLTA 4I4CA 3M82A 3C87A 1ISPA 5AM5A 4X93A 2AXEA 1CEXA 6YASA 1T4MA 1YR2A 3T52A 1UWCA 5HFNA 1HL7A 2NW6A 5JALA 3H2IA 3V1KA 1Q83A 5ALVA 4OU4A 2WFLB 2GZSA 1CQWA 1ZJ4A 5FKJA 1USWA 3VDXA 2XMRA 4CCYB 4P93A 2HA0A 5A6VA 1IZ7A 3FVTA 5KWIA 4H35A 2HRQA 3WKAA 1UFOA 4EB0A 2X5XA 2AJDA 3WL5A 1MU0A 2HA5A 4RNCA 3F67A 1BS9A 3FLBA 5AKGA 3TRDA 1R1DA 1XLUA 4JUIA 1VXOA 1DU4A 4CIAA 5EFZA 1BRTA 2QOEA 3G0GA 5HCUA 4UBNA 1QO9A 3F8SA 3BWXA 4DMFA 1Y7IA 1XZJA 1LLFA 1P0MA 5K3FA 2QTBA 3ANTA 3IUNA 2XQGA 3R41A 5K3EA 1VE7A 3DOHA 4UBKA 1XQWA 5D7BA 4O08A 2JGKA 1CUSA 4PNZA 1KEZA 4DTCA 3DEAA 5AIBA 1EK2A 3G9UA 4U2FA 4NVRA 1XLWA 4W9RA 1EVQA 3T4UA 4QDZA 4LYEA 3QPDA 2Y1KA 2GBGA 4BP8A 1EB8A 2EDAA 4Q3OA 1CQZA 4DMHA 2IX9A 4C4ZA 1CUUA 2ZJ6A 1A88A 3NWOA 1LPAB 2WJ3A 3WK8A 1G66A 3FVRA 1QFMA 5HFAA 4WJLA 4XWGA 3STYA 5JANA 1WOMA 3K9BA 3ZLVA 3ESAA 4X00A 3U0VA 1F6WA 2CKMA 2HADA 2IIVA 3MUNA 1CUGA 3R3UA 4RPCA 3WWDA 1DX4A 1R9NA 1EB9A 4EY8A 4HXFB 3G9ZA 2VJBA 3I2FA 3WL6A 5AKYA 3C6XA 5AI5A 2FJPA 4MXDA 4FFVA 2V96A 5BWCA 3BDVA 5EHQA 3QBJA 4NZZA 5BV7A 3D7RA 4B6GA 4WY8A 1QIEA 3AIMA 1DTEA 2WFZA 4OB6A 4BTLA 4GWLA 2Z3ZA 4X85A 5LIPA 2X76A 2Y2VA 1EA5A 2ZYSA 3STTA 4N8EA 1GXSA 1O6GA 5EHXA 1WCYA 2G63A 4H0CA 4PSUA 3QMWA 1EHYA 3FSGD 4QWWA 1ZGCA 2HA3A 3I6YA 4HS9A 3C8DA 5ALLA 4BYMA 4X95A 3TJMA 3WL8A 3O95A 5FUMA 5KBYA 1R4ZA 2WG2A 3A70A 5IVDA 4RE6A 4UBLA 2HHAA 2QJWA 2FX5A 4BZWA 2OQIA 4G8CA 2OQVA 1QIDA 3ED1A 1UKCA 1IUPA 2VAVA 2QR5A 5ALYA 3RLIA 1W52X 3WK9A 2BUCA 1Q0RA 4HXGA 3QPCA 5AI9A 1UK9A 4X92A 2VJCA 1EX9A 5LZ9A 4J0DA 4ROTA 2Y6UA 5AM2A 3STUA 3AILA 5LZ7A 2I03A 3M81A 5ALPA 5AIAA 1MX5A 5FPPA 4GHWA 2BFNA 5A71A 4JYPA 3DOIA 4BBZA 2XQKA 4H7IA 4DNQA 2VJDA 4N5IX 2GYUA 1ZIXA 2EDCA 2ONCA 2VT6A 3QITA 5AKEA 1EK1A 4FLEA 3FLAA 2YASA 4TGLA 1THGA 4E14A 3QM1A 5FPQA 3EQ9A 3QMVA 1QFSA 4H7DA 3NOXA 4IHAA 2QRUA 3O0DA 5AO9A 1QIIA 3PICA 3VXKA 2WUGA 4B9AA 3R3VA 1YCDA 4KJXA 2JEZA 1A8SA 3ILSA 1IZ8A 5EI5A 3W2TA 2ZSIA 3H0CA 1L7AA 1MX9A 2CB9A 4OU5A 1QIKA 4YPVA 2XMGA 5AK6A 1H2WA 3WWOA 4PQEA 4U2GA 1GKKA 2WJ6A 1ZI6A 1K8QA 1IMJA 1YS1X 2OGZA 2WG0A 1BN7A 3I2HA 1FFAA 3DL4A 2XMSA 1CFJA 4UBJA 5JARA 4DM7A 2D5LA 4F0JA 1WB4A 2ORYA 3E4DA 4Y2UA 3N2ZB 5AM0A 3LLCA 3DKKA 1A8QA 3G0DA 2BKLA 2J4FA 2AJCA 3JW8A 3U1TA 1JKMA 3GUUA 1J2EA 4FHZA 4GBGA 1ZD2P 2Y6VA 4U2DA 2PUHA 1XZIA 3M83A 1CRLA 5DTJA 2JEYA 3BL8A 4BRZA 1MT3A 3R3YA 3DNMA 1QLWA 1YAHA 2O2GA 2WM2A 4Q1VA 5ALKA 2XUPA 2RHTA 4FFWA 2H7YA 4QNNA 4EHBA 1HPLA 5HKBA 1Y37A 1EDDA 3H2GA 1DX6A 1XZAA 3GFFA 4KE6A 5ALRA 3LCRA 3D4LA 3D5EA 1C4XA 5HQ3B 2HRRA 2Z8XA 2GBCA 3ESDA 1DWOA 1MAAA 2W22A 3FSGA 2XUGA 1TAHA 1XFDA 2XMBA 1RYYA 3LIPA 2WUDA 2JF0A 4M0FA 3D3NA 5C81A 1LPOA 2O7VA 3FYUA 2C0QA 3I1IA 3GZJA 4G1FA 4BAGA 3O4JA 4HTAA 2GYVA 2C58A 5CURA 3FCXA 5ALSA 5SYMA 4G4GA 1CUCA 4WY5A 3GBSA 3C5WP 3OC0A 3AJAA 2H7XA 3LIIA 3SK0A 2PM8A 1CLEA 1ODSA 3FNBA 4J7AA 2WHPB 2WIDA 1U65A 2ZJ7A 3W9BA 1YA8A 4NS4A 3QMMA 3V1NA 4KEAA 5K3AA 4JEIA 3Q8WA 3QH4A 4J3JA 5AM3A 4HZGA 1JJIA 2VAXA 2WTMA 4LKOA 4UHFA 4U2CA 4J03A 3AZPA 1TIBA 3D2AA 3L1IA 2DQZA 2VA9A 3X3HA 3PDCA
chains in the Genus database with same CATH superfamily
2FVXA 1V3TA 1XMSA 1PJRA 1FNSA 5MN5A 1KYVA 1X38A 3CRRA 1T9GS 1OLSB 2VQ6A 3ZX4A 4DWWA 1N8KA 3KEGA 3GRVA 3I72A 1YQDA 2IOYA 4G89A 3FPBA 4TV8A 2WD7B 5BN5B 4DIDA 2PWYA 2WUWE 5BNWA 1HRKA 3X1ZA 3L02A 3ZNQA 5LKAA 2R8PA 2O8BB 2UZ1B 5C18A 1EVZA 2W98A 2D8AA 1SQSA 2P6UA 3TLGB 2ES4A 4JT9A 1MLDA 1VB3A 3VDNB 1GSAA 4CTOA 3HWRA 4HX9A 2BEKA 1U99A 3A6KA 4LSMA 3M6AA 4FGJA 1SC1A 4WY2A 4DB4A 1VJ0A 1Z88A 4KAAA 4ZREA 1KMHA 1RXEA 1Z6QA 1G21A 2HWKA 1BROA 2IXAA 3GFPA 3DB2A 3NVDA 2FRVA 2YXNA 3N0TA 2W2XA 2A57A 5ARBA 1DVRA 5G1PA 1N78A 4CM1A 2DHDA 2JG3A 5DCLA 1MDBA 3DMHA 1IPEA 5EJGA 4CJXA 1XCMA 3A4MA 3E61A 3NYIA 4TTSA 3WKBA 1TKBA 3RYHA 4EO9A 2RE8A 2V1XA 3FMPB 3IIIA 4NCJA 4LJ5A 4C2AA 3W2GA 1VJTA 5I9IA 1IPHA 3JAMA 2PRYA 3N8NA 3PC3A 1JIVA 3VGPA 1KHTA 1PR6A 2OSVA 2C96A 4NG4A 3TEJA 4Q4JB 2IJGX 1HUQA 4IIJA 3VC7A 1XRLA 2BJHA 4MVJA 1NVUQ 2OHVA 3A1FA 4KMRA 4ZZ0A 4PZCA 1PL6A 5KJFA 1BNCA 4CEHB 3GLHE 2H6EA 2I9PA 4IDFA 4YC7A 1T2NA 3WDSA 1V1MA 1GTMA 3E35A 1Q7RA 3R3HA 1KOFA 3E6AA 4JFRA 5IW8A 1PFGA 2HNKA 4HNHA 3FPLA 4HN2A 4F7WA 4F4CA 2H92A 2QMYA 4M0MA 4E4RA 4GXQA 2O50A 3GP3A 4DUPA 2W8BA 4MIEA 1UBFA 4OF4A 2WMOB 1PJSA 1QQAA 2WMDA 3JD3A 3EAQA 5LD2C 3QA9A 3ZKAA 1SQ0A 4UJ3A 4B80A 2HSDA 4LGYA 1W5TA 1GQ2A 1XRPA 1EAMA 1VCHA 3PDIB 1K97A 4NJMB 5HS4A 5EMKA 4FI3C 4A4DA 3BOSA 4ED9A 2PEYA 4B82A 3KZ1E 3VR3A 1QRDA 3VMMA 5ED4A 5T4HA 3L2OB 2BI7A 5P8WA 1U2EA 1I36A 3EFBA 2JFPA 3K5WA 1DXHA 5DP2A 4DCVA 5GIPE 1Q1QA 3AR7A 4V0KA 4HTFA 1IHYA 1NVBA 5TNXA 4B40A 4C0LA 1XMQB 2HU2A 2D1RA 5CJJA 5EZSA 2Y1DA 3DAOA 3I58A 4QXMA 2GARA 1AMUA 4MUMA 2I80A 2K6GA 2WD9A 2GSDA 1ODFA 3DMTA 1P1BA 1J0CA 1IHDA 2HM7A 2FFQA 2ZTHA 4RU1A 4V38A 1I3CA 5KHOC 1NP6A 1OWLA 2UVQA 2WWHA 2XKJE 1A5AB 1KJ9A 3VHXB 4ZHSA 3HVRA 2ANBA 2PDAA 4GBJA 3ZY6A 4XD7A 3WGQA 2QQ5A 4N0DA 1M1NB 1PWXA 2IXDA 2OL4A 1A5SB 5J4HA 2AMJA 1RU3A 3EVTA 2DUUA 4HEA1 1BE6A 2IKQA 2QWXA 1JXAA 4YJ2A 5J43A 1H8HD 3JCZA 5C37A 3AT1A 3RLFA 3HVUA 3FTFA 1AK1A 1NL3A 2NU7A 2RIPA 1HE5A 1TYBE 5H3HA 3PZBA 1AV7A 1PT5A 1T3GA 4OSOA 2ZM5A 3VMFA 4KO4S 5ES3A 4HPWA 5CG1A 3RCBA 1DBVO 1C7QA 2F1HA 2G9RA 3RNLA 4CQJA 4ZMRA 3C48A 4S05A 1Q6YA 4EJFA 1CZRA 4HAUA 2GN2A 4BLUA 5C4MA 1A7KA 2JNWA 1NF9A 1E3SA 5EZ6B 2I1VB 4ND3A 1Z5VA 3P2MA 1YDEA 2FMKA 3UNXA 1HTTA 5L51A 3Q3IA 1EFPA 5BVGA 1DJMA 3I9V6 2GPTA 2QVZX 4CZ2A 1XQXA 4ZT4A 2BGNA 3BX1A 1X13A 3I76A 4OBEA 3P71T 5CAEB 5IPFA 3G5AA 5CRIA 4CM3A 4R7GA 5DP1A 5AOAA 4PXAA 1XN4A 5FA5A 1UXJA 3HY6A 2INGX 5IM5A 1AN9A 1ZD5A 1A4RA 2DPGA 3EIXA 3PC6A 4IO0A 2BGUA 2CEAA 3PU6A 1VG8A 2C1EA 5B1DA 621PA 1CK4A 1PZXA 3TQTA 2E3JA 2ZR9A 1XN1A 3EXEB 5JLAA 4YR9A 3D3KA 4IF4A 1H5UA 2IP4A 5BSKA 1VZ2A 2CXHA 2QROA 2YVAA 3O9VA 4RKWA 3EWSA 2CHQA 3B1ZA 5L6LB 2WP0A 5B1HA 1SURA 4F4FA 1U6JA 4JLAA 1MCZA 1DEHA 1XTQA 4FCCA 4DLXA 4S0ZA 4EA9A 3AO0B 3LWBA 1XZDA 1V5EA 2JGDB 2QJOA 3HCRA 4MITA 1YBFA 1JDNA 1YZKA 2YIVX 4ZWNA 4UHHA 5IBQA 4AO6A 3I3OA 3RVQA 4BZQA 1V7PC 2LCFA 3K8QA 3A28A 1CP3A 4FR5A 4NFHA 1KY5A 3SNHA 4XTRA 2C78A 4O2BB 1U0LA 1PEAA 4QJ4A 5A5DA 1LX7A 2JI7A 2ALJA 3H8JA 3EFHA 1RYMA 3PQ2A 4IFBA 2ATEA 4Q4LA 1T25A 3A4YA 9LDBA 3WB2A 3WFIA 1LDMA 2A5FA 1L4HA 2EJTA 3EQ8A 3WGYA 1O4WA 5CB4B 1U8EA 1L9KA 3M2PA 1ZCZA 4I0WB 2VDKB 2LBPA 2QL7A 3B9RA 1UMBA 3I04A 4IIGA 1LPNA 3DDCA 5LZ4A 2VUSA 2YN0A 1RBMA 1RJDA 2UYQA 3PXGA 2F3SA 1QMPA 1UFQA 2QN6A 2HFJA 5J4YA 1DIRA 2B94A 2JAXA 2PXCA 3W04A 2OORA 3DBRA 1M1YE 2Z6VA 3EG5A 2OAEA 4EYGA 2G77B 2PMWB 3MTJA 3OX4A 4OLBA 1PLKA 2GNPA 3LPCA 3FKSD 1E4VA 3ZDCA 3NHJA 4FKBA 4UU7A 1JTEA 1KFJB 2Q4RA 5K3FB 4LDAA 1ZYUA 4KQ9A 1M66A 2AEJA 4Z8YA 3SNKA 2EZTA 4M8LA 2RAPA 1E20A 4RK4A 4A82A 3DKIA 5AUNB 3GH3A 3R5HA 4X54A 3ABSB 2IBMA 4CTNA 1XALA 1CDZA 4QGAA 1KJNA 1XF1A 2PLFA 4EUEA 3E3MA 4C7MA 4OREX 2AR0A 1YVPA 1Z38A 2VPWA 3OURA 4WX2B 1UAAA 1HDEA 3W7BA 1NMYA 1QK5A 4IQ4A 2Q1TA 2ZUVA 4CQMA 4Q66C 3U9TA 3H16A 4C03A 3FWYA 3BJMA 3WQSB 2BEJA 3K70B 2ECPA 5A62A 1UDCA 1DO0A 2Y1OA 4H7JA 1QRRA 1NUPA 2O2EA 3FGZA 2BFFB 3H5RA 2RGAA 2YIMA 2OCPA 4V0MA 5GGXA 4BMNA 5JADA 1XRNA 2OHHA 3TD2A 2FWAA 5EHZA 1QNFA 4I1VA 4GGPA 3VZQA 2NO0A 4EEXA 5JMPA 4KLAA 4ARBA 4M8SA 2J0QA 5CIQA 1SCJA 2VTKA 1Z0KA 4J94A 4PF1A 2QG9A 5AVUA 5LQUA 2NM0A 1A9TA 2QAGB 4RK7A 4IJMA 4WK4B 4BO3A 1ULZA 1XCGB 1X77A 3C1OA 3NUQA 3QXSA 1MXHA 4M1WA 5CT4A 4BJ3A 3LWNA 1VE5A 2PPVA 2GXSA 2I6UA 3UKOA 1J2JA 5YASA 4ND1A 5FWNA 1N0VC 4KB5A 3JXEA 2OT3B 2UXDB 1J9EA 4OH1A 1S3FA 3NBUA 5E7MA 1CUHA 1ZD3A 3R77A 4OQXA 5DN6A 3BTVA 5EZ5A 4ZRDA 1JJ7A 1P9NA 4E3WA 2IKSA 3WLTA 4UHEA 1XVIA 3ZI7A 4WOJA 2WJWA 3DBIA 1SCAA 4OQZA 2FI1A 5BQFA 4MSUA 3IH5A 3GQBA 4AMZA 4BL5A 1Z08A 3G2LA 4OLHA 4NLLA 4QUDA 1OI7A 4YYEA 5HZMA 2GEFA 3URMA 4OXYA 1M7GA 4OO3A 5TMEA 3ICPA 2GD1O 1BEZA 2VWGA 3ZPXA 1E77A 4BATA 1FDOA 3RU9A 2AI1A 3KKEA 4MK4A 3JSAA 1G3MA 4ZI7F 4JASB 2HBRA 2KM1A 2JAUA 1IXKA 4YBZA 3MZ0A 5FT9A 1GPLA 2YY5A 4NYIQ 4MPDA 3M34A 1CUWA 2H5JA 1K0UA 1YRQA 1W93A 5DYTA 3S1LA 3S81A 3Q7IA 5ALNA 3OZ7A 4M54A 2BGWA 1TU3A 4Q7JB 5FWYA 3HVJA 1GYPA 2VP3A 3CMCO 1K27A 3GGOA 2BEVA 1NU6A 1C1DB 1I7LA 1N5KA 2NZXA 2O0KA 3DV0B 4FDLA 2CL6X 2G6BA 1E0SA 2BVNA 4NARA 1VFPA 3M3DA 4X6XA 4QYMA 2PZFA 4P0PB 2RKOA 5KREA 4B7ZA 3MJEA 4INOA 3ZOKA 3FX2A 4II7A 3CEHA 3SMVA 3C43A 3V2GA 2EYQA 1VPWA 3D0QA 4MW6A 2ASEA 1E9SA 1AK9A 1T2DA 5J2TA 2A35A 3IILA 1XT6A 4H15A 1MX1A 4EM6A 1YB2A 1ZISA 4Q5IA 2YYZA 4E03A 4EY3A 2C5GA 2OORC 3IAAA 4F1WA 1WD7A 4NZ9A 2YH2A 3BGWA 2N1BA 4DABA 5KQLA 3H5OA 1J99A 3KLBA 5ESRA 1MGOA 3CKYA 1GPUA 3KXPA 2R8BA 3W5DA 3DFZA 4LY0A 2C00A 4XCQA 2KLBA 4KVFA 4UREA 3FTPA 2HCBA 1PQWA 3ODPA 3CZCA 2DFPA 3F2VA 3IAM1 4Q1BA 4R2JA 5EE0A 3CWZA 3NHLA 2VDWB 4RLFA 4Z0TA 4MQ5A 5CT5A 1RPAA 3A1SA 1V5FA 2F7SA 1T1RA 2EWVA 2GBFA 2OP0A 4JMLA 4RSMA 4MIYA 3FDZB 5EJ5A 3R40A 4CDRA 1ACLA 1U2DA 2GD6A 1YI8A 5B12A 4B75A 5JAPA 1XZNA 5MGBA 3AX6A 2PX6A 1IXRC 2CJPA 3LKZA 4XUEA 3NG1A 1MEEA 1PUXA 2JD1A 4G1EB 3MWJA 4U2EA 3ZYCA 2VR1A 3GCWA 4JLSA 2HV9A 1LBQA 4C6SA 2WU4A 2WSSA 2V7UA 2GM9A 1BOFA 1VGVA 1MJGA 1Z75A 1TM5E 3ANMA 1H23A 4Y7DA 3ZWAA 4ZK6A 2HNBA 1SIOA 4CMAA 5C1BA 3CRW1 3O6VA 2EYUA 1HQCA 4DMKA 5LQJA 3GLUA 5FBKA 1HLGA 1TYAE 4W82A 5HHTA 2G5GX 3FYCA 3JYHA 2D4AA 1UBKS 2Q4EA 3L1JA 3KYIB 1E1QA 2BR3A 4OFZA 5F1YA 2BUAA 2CYAA 2EFCB 1M1ZA 1PBTA 2FEMA 4UE6A 3OCJA 4PR3A 5EWJA 1T2FA 1TIPA 2FPMA 4XX1A 2VLBA 2YBDA 4DSAA 1TE2A 1OTHA 3DKVA 4WQMA 3G2NA 3DPSA 3A1DA 2GR9A 2FHSA 4A2QA 2VP5A 1X8JA 1Z37A 1A8HA 1AQYA 2QTVA 1P44A 4K05A 4E1VA 4Y18A 1DRUA 1NN3A 4PSDA 5JAUA 4RWZA 1FFCA 1BC5A 1L1RA 2VP0A 2XQFA 4D9GA 3LUFA 4RVOA 1LJUA 2AVNA 1A7UA 1H42A 2IYUA 2KI5A 5B30A 3TCKA 5JFTA 1JAYA 3M4NA 5DGTA 4C4SA 4DBVO 4HUQA 4Y6QA 3VHLB 4F60A 3G8AA 3W8FA 2YOFA 4F6RA 1QRAA 2D7DA 3L0OA 4PINA 4XB2A 4X94A 1JV2B 2QLNA 3GMIA 5HTKA 3PWTA 1I10A 4WXPA 4B4KA 4DKXA 4R1OA 2AN9A 4N0MA 3T41A 3PIRA 1J39A 5FI5A 2HREA 1TJ5A 3O9ZA 2TMKA 5LYJA 1VJDA 4N47A 3UOAB 3QG5A 2HMYB 3DV9A 4EY5A 4OHWA 1L8LA 1ECGA 2AZTA 2C84A 3NHMA 3IRUA 1G19A 1KIAA 3BAFA 1W8IA 2IZ6A 2IOFK 2PQ2A 4EKGA 1E2UA 1Z0DA 1ZGAA 1DAHA 1Z26A 3OZCA 4XQEA 1L5MA 5FA8A 5K0SA 3RV4A 1ZL0A 3C1TA 3J7TA 2DEUA 4G9BA 1YD7A 2AMFA 2EG5A 3L8MA 3WQHA 4GRIA 3B6EA 4C08A 1OHHD 1ZRSA 2PH5A 2OC4A 4HADA 3A9SA 4MRMB 1TJYA 4KWIA 4QXOA 1C14A 1N75A 2XUDA 2DE0X 2WTUA 1IVNA 3GDOA 4BVAA 4URVR 2C9DA 4L8LA 1RMQA 3AR8A 4HVTA 2H1VA 4AO7A 4BASA 3Q1LA 4KQFA 1PJLA 4KHZA 4JR0A 1NXTA 1W1IA 3OPVA 1QIJA 3Q6IA 4QU8A 3UATA 1LD3A 4HAXA 1YJXA 4MHOA 3O7WA 1U7TA 2C3YA 1IQPA 1SQ6A 1YVDA 1X7DA 4MQEB 3FPKA 2IS1A 4UAUA 4TVSA 1II8B 3P2OA 4ZYWA 1GKYA 3TX2A 3A6GA 3WRWA 4BJHB 2MHCA 2LCQA 1PS9A 1YS6A 4IM7A 3TPCA 2FW1A 1K6XA 2H4YA 3RKSA 4Q03A 1EIZA 4TRNA 2PA0A 5HRCA 4MAAA 1Y6FA 5EVJA 1VSQA 4OHKA 4HGZA 1ISFA 1KJQA 1N3BA 2MOKA 2QN7A 3CLTC 4RYLA 4AKTA 1XEXB 4Z5XA 1M6NA 4A8TA 4UPEA 3PPYA 4CODB 2GNOA 3A06A 3SDBA 3LHKA 1YUBA 4A8PA 2J3EA 4FIDA 3R5FA 4PZ0A 2X41A 3AK4A 5H4HA 3I53A 3BFKA 1DEXA 2GZ2A 2FP4A 3PJRA 4C5AA 4D9MA 2NVUB 1D1PA 2H57A 4LXQA 3ZLBA 1KIMA 2BEUB 3MS4A 3RTCA 1ORWA 5K3SA 1Q0SA 1YA4A 3MGAA 3H6GA 4PLYA 3C6KA 3TE6A 2I9KA 4JKYA 2Q21A 2Z43A 3L6OO 3MWEB 3TTVA 1QFYA 4PNEA 4HPXB 1OMOA 2DMRA 2RCNA 3K0KA 1ZCBA 4HJRA 5K8TA 5L40A 5DWDA 2FSUA 5ISMA 3DVLA 4IDOA 4ISBA 3I8XA 1KP9A 1K92A 1M9NA 1QUEA 1E2EA 2AOWA 2V3WA 2EU8A 2ZRMA 1QO0A 3PVCA 3GBVA 3OCZA 3MXTA 1OAKA 1X6VA 3D59A 4PO1A 1OXVA 5DHRA 4QX6A 4CMEA 1E0AA 1QPBA 3AEUA 3JQBA 4WZAA 2EGHA 1I3LA 3KQHA 2IUEA 4DDMA 3SSOA 1PGNA 2QRMA 1E60A 2P5YA 1TFRA 1HEYA 4TTVA 3G02A 3LC7O 3QY0A 1TLLA 4OXQA 4MROA 5HKKD 2R1UA 4PX3A 4XSHA 1CZOA 1JDBB 2LKCA 4D4JA 5MFZA 5JC8A 1NY6A 4EZIA 1GM5A 2O2SA 1AKMA 1D1SA 4M1ZA 4RKYA 3ZE7A 1UM9B 4CMKA 5E6UA 2NTYC 3PSHA 5BYAA 1O0BA 3ZHSA 5JHHB 3H1TA 3CNOA 4E7OA 3DLIA 2Q2QA 4OHCA 3TXAA 1GWNA 3A26A 1H1DA 4PYJA 5KOJA 4MS1B 1XROA 1KRHA 1VZ3A 3CTMA 3D8UA 3L8FA 3R76A 4YRBA 1PAUA 4C2UA 4BGDA 2NU8B 2J3MA 2XWBF 3KHUA 4UVHA 5JYCA 4YT2A 5KC8A 3K6SA 2QUHA 4QXPA 4OIMA 5B7QA 3A6PC 3RC3A 2HCFA 3AJRA 1RWQA 3BBPA 3EGOA 2I66A 2G70A 4IHJA 5JNSA 4C43A 4UVDA 1SHTX 2AIRA 4BFZA 3N70A 4URHA 2C2GA 2FZ5A 3BB1A 2ONYA 3KD3A 3OCUA 4PYLA 2NOAA 4Y6RA 4YUXA 3HSSA 2ZI3A 3OA0A 4KIJA 1E8DA 4NYJR 2PANA 3WYNA 5LQNA 1UJCA 4TMFA 5B7PA 1QS0B 1VYVA 5EP3A 2V1UA 4OFXA 1KZ1A 1HSZA 5H16A 3HL0A 4BGEA 1GV0A 4LJ7A 1FDIA 2YXLA 2PIDA 4E2ZA 5IXSA 1Q5PA 3BA1A 2UUOA 4H6PA 2DQSA 1XJ5A 2HDWA 4PO3X 4X71A 4CDMA 5CA0F 5CM8B 3L4SO 2AD1A 4D0SA 2Z1MA 3ICEA 2BZ0A 5C53B 4L5BA 1Z8FA 3BHNA 4QTXA 1J23A 2ZPTX 4AZTA 4DIMA 3SS9X 4X60A 2HU5A 4QOEA 3TNJA 3V8PA 4CF5A 1FXWF 3MAAC 4INAA 4LQLA 3B2EA 4QIHA 4YRDA 2P5SA 4Y2XA 3DD5A 5D1NA 3R9XA 4FNOA 1QC5B 5CTAA 1SQ5A 1A9YA 3BYZA 1O89A 1O58A 2BFBA 4IX1A 1KTIA 3COWA 1OIVA 3LQ4A 4DC9A 4MGZR 5HMLA 2ORVA 5BR1A 3LPNA 1PT9A 1JU4A 4G67A 3CPJB 4OB8A 1U9IC 3CSSA 1SA0A 2FPRA 1GPBA 2IE8A 1CUZA 1Q7GA 2PS9A 2SHKA 2WE8A 3OEWA 4L27A 4UULA 3V33A 3ZOZA 3THXB 2NN3C 1L3IA 3AQIA 5EC8A 2VK2A 4PICA 1RHMA 3ZE9A 1GQOA 4I2VA 3B7WA 1XRMA 4YUAA 1XXLA 1FY2A 5CP8A 1XPUA 2OYRA 1EDZA 2Z08A 3UBMA 1V47A 3T3DA 2J41A 4KVZA 3K70D 1WCIA 5F64A 3ZS8A 3B7GA 4TV8F 1CR2A 4Y3UA 2UZ3A 4D3DA 1TOAA 2P65A 3DFUA 1ADFA 3B38A 1E63A 1DO8A 4DA0A 4GPAA 1XMIA 4F04A 3AF6A 3OT1A 3DFFA 2QXTA 4TZ6A 4K9MA 1XLTA 5AK0A 3BD6A 3DZDA 2W2NA 3MN1A 2FOIA 3HCAA 2V03A 4L0MA 2QYSA 3CWCA 2XNDA 1WKVA 1G2QA 1JEJA 2VRNA 1P2TA 3WGHA 1E6EA 2QLBA 4CLEA 1E9BA 3PQCA 3FB4A 2RK6A 3OQ1A 4FZ5A 2HF2A 2QNRA 3P9ZA 3SX2A 3TQCA 5LKRA 2OXCA 2VZLA 3JQBC 3NOOA 4EECA 4XYLA 1BGWA 1RBQA 5LZ5A 3UB3A 3KUCA 1HDGO 1PE0A 5AVKA 1CUEA 1WUTA 2J9XB 4GQIA 3EC1A 1XZMA 4HO1X 1U98A 4PIPA 2ZM6B 1NNUA 2GAIA 4KH1A 1ISMA 4QYIB 3ZHXA 4YRIA 3OHMA 3T99A 3IKLA 4CMCA 2MSKA 1YH3A 2FPUA 2ZRFA 1KH1A 1R6TA 3G13A 4AG5A 4DQVA 3IA7A 5ADWA 5JQWA 4LVUA 5LMCA 3F5DA 1P60A 2WHYA 1TXGA 4QAQA 3L8GA 1KNXA 3MHPA 4BNFA 4UUQA 4MVJF 1L3BA 1SMKA 4MYTA 4XGKA 2HGSA 3MUEA 3ZVMA 1BFUA 3F6EX 2QAIA 4EMUA 3JAKB 4B4UA 2PD4A 2X3YA 1NQTA 1HNXB 1K98A 2LVBA 3JSXA 3C3EA 4DLYA 3HH8A 4BFUA 4ON9A 1LRLA 1CUXA 1M6EX 2Q5EA 2W83A 4WESB 3DONA 4K9OA 2GM3A 1W94A 2J0UA 3EZ9A 3PLAE 4BEWA 1NLUA 1C7JA 1C4WA 1DTWA 2VG8A 2C9MA 2VJYA 3CLSC 3ANYB 3WY9A 1YZNA 1YHZA 1NQUA 2X4DA 3BMNB 4NMWA 1R6UA 2YV3A 3PQ8A 4NCNA 4B8ZA 3OHSX 1P2FA 4HKTA 4I6GA 1UOEA 5CW2A 3U37A 4F2PA 5JAHA 2CVQA 3NBKA 1MDFA 1KAMA 4LQDA 3EMVA 3KYDA 3LGSA 5J4VA 1G98A 1CY4A 2A9FA 2IYAA 2JL1A 5P21A 2ZYVX 5BN4A 3CH6A 2GZHA 1KXJA 1M2NA 4XCXA 5LQSA 1SGWA 3HJAA 4OB7A 4X8MA 5EIEA 2Q3FA 1NBME 1PGOA 3DVRX 1AUQA 1RRVA 2A0FA 1K7SN 3N8HA 3QLVA 1Z0ZA 3AINA 1GOTA 1LTQA 2GA9A 4MYSA 5CR9A 2F8SA 1D7AA 3W6PA 1G3UA 1H3FA 1LF5A 4JVOA 2BR4A 3B1XA 3IHLA 2CHUA 4D74A 4BQFA 4X1KB 1SOAA 1PLLA 4JLKA 5EIOA 1AURA 5CEJA 1VBKA 4KE9A 4L9RA 3RD5A 4DJFC 3ZDDA 2FPXA 2LKDA 3QF4B 4CKWB 5LU9A 3IAS1 5AUQA 4DDWA 1US8B 2WBLC 1FU7A 3FCOA 4JA0A 4RLQA 3GPIA 3R6DA 121PA 1P18A 1PUIA 5FADA 4KQIA 4K2HA 3JV7A 3VU3A 2BFCB 4ANFA 1KERA 4LZJA 4CN8A 1WV1A 1TKCA 3DYVA 1Q91A 2N0SA 3DSRA 5DOZA 4CCYA 5KCMA 1FUYB 2QK4A 1O6BA 1JHUA 2WJYA 5JD5A 1BXRB 3EXIA 1J33A 2OMKA 1BWSA 1T34A 4E7PA 3HUDA 1GSOA 3GLIE 2E5LB 2J5XA 3UMFA 4RHEA 1UK7A 1B7GO 1ETHA 4RPGA 2Q27A 2VT3A 1S5PA 2PS1A 2ZVDA 4PONA 3VR5D 2O8EB 4I99A 2PHZA 3GZNB 4OH7A 5M29A 2BMAA 1XXHB 1HOXA 2MYTA 1T35A 1HKHA 2QENA 4ALIA 1ZR4A 4POOA 4F3CA 3IVGA 3D54D 2FK7A 2BFPA 3SWWA 4OAOA 3WLNA 2GTPA 4GWKA 4MRSA 4ABYA 3V6LA 1KY3A 3AL2A 4Q0MA 1CY7A 3KXKA 1DXYA 1XQ1A 4QQNA 4DYHA 4F45A 1J06A 2QXYA 5JE8A 2WRZA 4UUAA 2FPSA 1GCGA 2YCBA 2CFOA 2HAEA 4TVOA 5ITVA 1NI3A 1PU2A 2KBFA 2PS0A 2FEPA 2GASA 2YTZA 2FLVA 1QCZA 2NU6B 3HVHA 3P45A 4HZUA 4QU5A 1L4MA 5K51A 4BMCA 4CFSA 5LXTA 4B3MB 4JI6B 3AM1A 2OD9A 3M9XA 2RAUA 1GFWA 2DLDA 2Z6AA 3GP8A 3ZLJA 4XJXA 4O63O 1K7CA 3HBAA 1C5KA 3CRZA 1E1KA 1RRFA 1FOEB 3F7MA 2XXJA 3FHLA 4RW0A 2J9YB 5J59A 4AKSA 2HCTA 2WJZB 3F7TA 3MA0A 1XL1A 2EXXA 2GEKA 3K8ZA 1JG1A 3T9FA 1Z6ZA 2XUIA 2HA7A 3HUFA 2CMKA 1YDFA 1ZDMA 3D3EA 3PNPA 3N7UA 4RGVA 1KC1A 2GAFA 5DM1A 2H29A 1IWPB 3B3JA 5CCDA 2Q6IA 4UFOA 1W46A 4OOEA 2J6BA 1RWVA 2NPFA 1X0XA 5TEVA 4AB1A 3L8CA 3QEMA 1SG0A 3DP9A 4IDGA 4JGIA 3W2HA 4CIWA 4URWR 1BKDR 4HZIA 2GDJA 4OA5A 2XT6A 1Y5LA 3TNFA 4CMJA 1X1DA 1FDVA 5F9MA 4IWXA 3UPDA 1SBNE 4IWNA 1T5BA 4CI0B 2IELA 3OUUA 1XZFA 3GMTA 4FBGA 2ZR7A 3H9UA 5AHRA 4N5HX 4F9TA 5JW6A 1Y6GA 3X44A 1FMFA 2XA9A 4Y2VA 1ZGHA 3FOZA 2WM3A 4TM8A 1TUGA 1W8DA 1TYEB 4YV2A 3QFRA 1BU5A 2Q2NA 1GZHB 1MJ5A 2ZI5A 1UZMA 1IJKA 3ON5A 2ZYUX 3JWGA 3RYCA 2BGGA 2XE7A 1XJWA 2FOLA 4PWZA 1MIOB 4NAVA 3HZRA 2EW8A 4ZC1A 4P2BA 3D9QX 4PPGA 5FF9A 4L57A 3NVKI 1QIGA 4GMFA 5K0EA 1BKSB 5JHGB 3GL9A 4BGUA 1TMYA 3NBAA 1IUNA 3W06A 3AVUA 1J49A 1PEYA 5JS6A 1VSVA 1EDOA 1RCFA 4HDNA 2X3FA 4L4RA 1L7MA 1QXSA 3DA8A 4N5LA 1LI4A 5EUBA 4BFWA 4DCUA 3MOIA 5LVAA 2JEOA 4DRXB 2WHXA 4RY2A 4D7AA 1QIMA 5ILOA 2ZIUB 4MWOA 3DQPA 4M7WA 1TKRA 1X42A 2DHCA 4DIFA 1V8ZA 4CI9A 3IVXA 3HXMA 3FTCA 4GC9A 1B6GA 5FAXA 3HYSA 4FHDA 1UFKA 3NJRA 2GTIA 1P0CA 4I19A 5I01A 2DSTA 2ZW9A 4U2KA 4FFBA 4UMDA 3KQLA 3OUZA 3QBVA 4U00A 4D9HA 3I5UA 2OPHA 4EUFA 2GBIA 1X9IA 3H2BA 4JXKA 1T3ZA 2OQ2A 1NUSA 2OOSA 1YKFA 2JIZD 4N12A 4JQOA 5LB2A 4O4LA 2C7BA 1I6WA 3Q3CA 3KV3O 4I2NA 3P9QA 3UPUA 1NXXA 1JPUA 2ZETA 3G9QA 2P3QA 4NP6A 1N2JA 3H7IA 1NPDA 1AQLA 3BICA 3JALA 2H65A 3KJIA 2PKQP 1C7FA 3CURA 3NYWA 5TRTA 3KETA 2WQ7A 3DE1X 2EBWA 2WT8A 1THTA 2GPSA 3INTA 2AOTB 2FNAA 2JGIA 5JCXA 1YQXA 3KQUA 1JA9A 2B82A 1RMYA 3GT3A 4G56A 2QVGA 3ROEA 5KYXB 2NMVA 3AQ4A 3BSFA 2B92A 4D80A 2RC5A 2HD4A 1KHHA 4Y30A 1X8KA 2XEDA 3E9MA 4GICA 4ER7A 1JBKA 4Z9YA 3L43A 1UXHA 2X23A 5LQMA 3EQ6A 5ESWA 1EXDA 1U6IA 5I7FA 3H1EA 4MWDA 3QE9Y 1QP0A 3F4BA 4QYWA 1JTVA 1S3GA 1VYHA 4JX8A 1I9CA 1RABA 5DEOA 4Q7MB 3L1HA 1TEHA 3L7JA 1SUBA 2B3DA 2NAFA 2QJRA 3K4PA 1XQYA 2H4HA 4YJHA 4GW3A 3IQEA 4S1NA 3X1XA 1R4MA 2XT9A 5CVVA 2AOVA 3IJPA 1Q2UA 3BREA 2ZANA 3SOZA 2P2DA 3DT8A 4KZKA 5ARDA 1OI4A 4AS1A 1V8PA 3KSAC 1P0FA 5EXSA 3USES 4DRYA 1ZBDA 2A9QA 3PR1A 2JBHA 1H6DA 2XUKA 3G79A 4U7FA 1UPFA 4V1CA 1ZPDA 5I5EA 1U7HA 3S55A 3FCSB 1YVUA 4F46A 1L5SA 5J2TF 2CD7A 3QI2A 4L85A 3WL7A 4R8RA 1U3FA 1GPKA 4E1BA 1K8XB 1ZVJA 3DDUA 2PSHA 4IDQA 2AZXA 4BY9E 1IOVA 5IC6A 1P2DA 3PQ7A 2YWJA 2NYUA 2F3TA 3DMNA 2FUG6 2Q0SA 2QA5A 3L46A 3V55A 2C2ZA 4C7BA 4XB6B 5I7UA 2P9CA 1Z34A 2E89A 4ZTZB 4X6LA 3K9GA 3VR4D 3RF7A 1UM8A 4WEQA 1ECCA 1EH5A 1UMCB 3DEKA 4PZAA 1GY8A 4QDTA 7GPBA 4MW4A 4BVJA 3PPIA 2P2LA 1KIFA 4E2YA 4EYQA 4KK3A 4CUKA 3NWEA 4OL9A 4TTQA 3PJFA 4YJGB 1CF9A 1GPYA 3DD1A 3ORSA 3DZGA 3PFCA 4GKAA 4Q12A 3PD7A 3L84A 3OCCA 4IGKA 1UFRA 2IIBA 3RS2A 3U26A 5L4LA 1VHDA 2B8NA 5IG2A 1OIWA 3DWFA 3GNTA 3FPEA 3CC8A 3VH3A 3CLSD 4ECEA 4B3CA 2YDXA 3UYKA 3H3FA 3X1DA 4RQBA 3ZH2A 1WP9A 2Y05A 3ANXA 3LXUX 3SI7A 1FFHA 1Y81A 3DAYA 3F6RA 3NHWA 1F8UA 3WHKA 4BNIA 4MV4A 3L8DA 4DIOA 4U8GA 2ZRAA 2R65A 1OW3B 4ZFNA 4X44A 1KMMA 3OPYB 3CX6A 2FEXA 3TX6A 4ZDIA 5CGQB 4ZAXA 2JBAA 1NXVA 2VZEA 1T29A 4R5MA 4XRRA 4KPGA 5FFNA 4C14A 1KOGA 2EGUA 3MQFA 5CFOA 1XTUA 1R50A 1TRHA 3GNSA 4B45A 1P0PA 2Y2UA 4D99A 2ATVA 1ADGA 2HJHA 1RXYA 1TQ2A 2QQGA 3LBNA 3OMLA 1JMYA 4WW0A 1LK7A 2EHJA 2I7CA 3M3PA 3SBOA 3JQ8B 3WGNA 4G8BA 2O8VA 4MW1A 2GUGA 5SYAA 3HACA 2CLEB 1T10A 3REQA 2QN1A 1M3SA 4QOIA 5H68A 4N8DA 1FNNA 4FQ8A 3ZBQA 3UBTA 3E2MA 3H04A 2A0KA 1E4EA 5FLKA 3UMMA 4Q00A 3HB9A 2X4IA 5KSWB 3SEQA 4IY1A 1U81A 2ZYWX 4JH0A 4ZI7B 2H06A 2I4NA 5BMVA 2JKVA 2F1KA 1P4GA 2B9VA 2WHRA 5JEDA 1DC5A 7ADHA 2EFGA 4PYIA 1YMUA 3VR2A 3VKUA 2ZZMA 5KHAA 1F14A 4DC1A 4S3MA 5IAKA 5JXWA 3FR7A 4RVHA 4CL8A 5FJIA 5LYJF 3ZCVA 1QDLB 2QM7A 3Q8LA 3ULKA 4RIIA 3PFIA 2H11A 2I8LA 4M0EA 1OB5A 5JJIA 5I4CA 3IB3A 1ZOLA 2ASVA 3GT4A 3HEMA 4O2AA 2EP7A 1GQQA 2VYVA 3REOA 1MT0A 4MICA 1I6LA 4PCVA 3GFVA 4G8DA 4OUKX 1HE3A 4F2WA 2CXTA 3S2FA 4UW9A 4TMTA 4G25A 4YQEA 3SY8A 3TQIA 4O0MA 1SD2A 1LDNA 2UZIR 4RADA 2PUGA 5A9RA 4C6HA 1QK3A 3C3KA 3RANA 4JKIA 2QORA 4KI0A 1VPLA 2B21A 2X9GA 4R8MA 3HP1A 3PDWA 3DT6A 1PP4A 2HRZA 3RVNA 4C3VA 3CN7A 1NQ5A 1C30A 2QNIA 2YXPX 3DUFB 3JQQA 4RK5A 3HBLA 3RBZA 1L7BA 2GEVA 3JQDA 2V9ZA 4J2OA 1J07A 4IIUA 4HS4A 3UHOA 2XKKA 4RE5A 2AJTA 2CJXA 2O57A 3BXHA 4IKPA 2A7QA 4S2EA 3AM5A 2B2CA 2CHVA 4Z7OB 5BRAA 5BV0A 3Q9NA 4GE0A 1OY1A 1ZMOA 1MTZA 1H66A 3KXIA 4FZRA 5AW6A 1R4NA 2I78A 2YX1A 4ZVTA 4CUJA 4JC5A 4RFVA 4OHUA 1AXGA 4KQWA 4AJOA 4UTXA 2V9CA 2BTQB 2XTNA 4PC6A 2C8VA 2WYIA 3C7AA 1T5DX 2W70A 4DREA 4CMHA 1QGOA 4N3AA 5CVDA 2GHIA 4ZODA 4LECA 4MUEA 3Q8KA 4FHFA 2V74B 3JQCA 4WRRA 4AKEA 1YJ8A 1GQYA 2BBSA 3C24A 3T7CA 4FJ0A 5K2MA 4K6CA 2WICA 5LL6P 1AH2A 3I09A 1G3QA 3GFQA 4XE5A 5GINE 2BLLA 1R9MA 4XDGA 3VC2A 3UO8B 3ZHZA 2XITA 1Z3CA 1P2UA 5GZ1A 1TUBA 4MOWA 4QRIA 1ISRA 3UAWA 5GVSA 5IK2D 4TWAA 1C9YA 1FMTA 1QLHA 3A31A 4Q9IA 4HLCA 3NV7A 1TW2A 1TZKA 3ET5A 3V7NA 2XTZA 1GNTA 4F4DA 4IVQA 5L6MB 3W3AA 4JP8A 2EERA 2FDCA 1ZO8A 3V2IA 3GOQA 1V4VA 3LGAA 4Y6SA 3EPLA 1RD4A 3K5IA 1GRNA 4X1IB 2IBTA 3E1KA 2FJ0A 3T5CA 2C4HA 3O5AA 5T57A 4G0VA 1XCJA 5C7YA 2WNIA 1RPTA 4UXHA 3WGIA 3FDJA 1AN0A 1JPNA 3OF2A 3CB2A 1T3HA 5ARCA 4CR7A 3S0JA 1QB8A 1QHSA 4G26A 4EQ6A 2C94A 2HYDA 3ZR4B 2EF1A 3DHWC 1XK6A 2PX8A 3RVRA 2HL6A 1EWVA 2PRZA 4JP5A 7YASA 4TLDA 1I4OA 3BIXA 2ZSHA 3EUWA 3QSGA 4LDQA 1JDZA 3L06A 2PUJA 4LW8A 4E07A 1RE1A 5I7HA 4AF7A 5LP1A 2FFJA 5KTRA 4YS6A 5FP0A 3NB0A 1QV7A 5T8KC 5JXIA 4MJLA 1NE7A 1NW3A 4HK4A 3SZLA 4JGBA 3KPJA 3CLKA 1RIFA 4EJ2A 1T1IA 2D1TA 4DUYB 4OQEA 3RJTA 4R1TA 2V55B 1V48A 3B6JA 4A5OA 1J20A 1J9ZA 3KB1A 5FI1B 2ZIAA 4JSYA 2OFFA 3S6JA 1XKXA 4CQNA 1HO3A 1EQUA 2Z4TA 4PXSA 1NYQA 2QSYA 4CIBA 2ODBA 3MM4A 1AKTA 4IHJF 4NYMQ 1NNEA 3BCRA 4F8EA 1EX1A 1X1SA 1HC7A 3EA4A 3E7XA 5I7SA 1KI4A 3GRAA 4HRXA 3NW9A 2QN3A 3MSXA 4IO1A 3UMSA 1ZNXA 3AERB 2BTOA 3N07A 4DZTA 3LCUA 4ZOLF 1VMDA 5DNCA 3ZJYA 3LKBA 3VDQA 3LP5A 3CO5A 4C7JA 3MS7A 4XWWA 2MSLA 2FWIA 3BMQB 3N3AC 1K75A 1S2LA 2DFKB 2O06A 2RHDA 1RJEA 1XKTA 3FLMA 3LHSA 3OFJA 4PPQA 2C4VA 1JFFB 4UEQA 3GJTA 2CEKA 2JJ2D 3H13A 4UUOA 4KPFC 4B9EA 3JU3A 4FWBA 4EBFA 1UDBA 5HF5A 3A1CA 5DK4A 4HN4B 3ZWKA 3M5CA 2XYGA 1OAOA 2YYSA 3C6BA 1RKBA 5KSOA 4IH4A 4LNHA 1CDEA 2XYVA 4DHEA 5K8LA 2ZBEA 2CNNA 3V7FA 4B73A 1EG7A 4WFIA 4MDYA 1MFPA 4D6XA 4ZXFA 4EUHA 1WX1A 3TS1A 3CH4B 1EUDB 2QUAA 1Z7EA 3NBMA 1Z47A 4G9EA 2AC4A 2EBUA 3D8RA 3R7WA 3PTZA 3JTEA 4MA4A 3TW6A 3PQEA 3ELDA 4QJIA 3HRIA 2B6NA 4UASA 3EGDA 3L82B 2GXQA 1D9ZA 1RYNA 3I8SA 5AI8A 3OQIB 4ZT3A 5K8CA 1W36B 3DZIA 2C7OA 2C8JA 2ZJ5A 3EXG2 3R24A 1HSOA 1T1GA 2ZUUA 4RTJA 4RESA 3UM9A 3AHIA 1DC6A 4FDMA 4UOEA 2E7ZA 1IG0A 1ZUNA 1GNPA 4U1RA 4PR0A 4C30A 1RZRA 3UGKA 2R2AA 2UXCB 2BFDB 4DEVA 2H1CA 4B46A 1U4SA 2WU1A 5DOVA 1GPAA 4NOKA 5ERYA 1LRJA 1PVDA 2XDWA 3F78A 4UTPA 1MORA 1JHZA 1ECJA 1GL7A 5NLLA 4CDGA 3SGLA 4BNDA 3E0XA 1I14A 1W4LA 4DBLE 3NPAA 1ZMXA 2WJPA 3C8HA 4OL0A 1XP8A 4JYBA 2ZULA 3TLMA 3ZV4A 4ONEA 2O3QA 3GLHB 4K26A 4BZZA 3T7JA 2V54A 1Z9BA 2DUMA 3AMVA 4D9KA 5BVHA 1ZN7A 3JYPA 1FU4A 2AG8A 2QQFA 1XTPA 3LQQA 4QPZA 4JP2A 5BQOA 3AP1A 3PX7A 1AC5A 1XUOA 2OV1A 2WLSA 3EEBA 3HYTA 2SNIE 4TXLA 3SR3A 3AI1A 5LIRA 4FWTA 1OH5A 2ZWVA 2VDNB 3PYLA 2I7XA 4X97A 2B5WA 4WMLA 3V4SA 1ML4A 3AY0A 4PLVA 4F3TA 1QE0A 2G4VA 4DS3A 3LX6A 2VDJA 4LAFA 2E55A 3AM4A 1U1EA 3NRCA 4BCDA 2VEDA 3PUWA 4B3JA 3ID6C 1P73A 4P35A 3URKA 2DWUA 5JAOA 2AFHB 2Z2ZA 3KZNA 3ENNA 4QUBA 2ZCJA 2GCOA 1XDGA 1P5RA 2G9NA 1KZ9A 2XAUA 5F5XA 3ZKWB 1V1RA 4IDCA 1BIFA 2IXBA 3RFVA 1SCUA 1UBUS 4UBIA 5G2OA 1GPH1 4E5VA 1I32A 2ZWOA 3SOPA 4ER3A 2I76A 2RH8A 3WMGA 3BJEA 3PE3A 3FSJX 4UDNA 1N0UA 3TUZC 4GH5A 1TGVA 1E7QA 2MYPA 3HKDA 2WM8A 4RXMA 2YOHA 1PEDA 4PLWA 3WIBA 2IUYA 2QRVA 3FH0A 1MR3F 1P81A 1KJWA 2Y1XA 4UATA 2YR0A 3N2IA 2W4IA 3W05A 1RJ9A 2DAPA 1XDWA 1G4UR 2XW6A 4F9EA 4DT1A 1RI1A 1W48A 3CT6A 3AHDA 1DXQA 1W85A 2I22A 2QZJA 2W6QA 1Y6QA 1QGAA 3K73O 5HEKA 4CM7A 3DEFA 2DULA 1P4HA 1RXCA 3MGGA 1VOTA 2F4NA 1DG1G 4LBZA 3F7NA 3IR7A 3CO0S 4DA4A 2AXPA 1QOZA 4H7EA 1HBJA 2AJ8A 4JODA 4UDXX 3VI3B 3WLQA 4RHTA 4GZ5A 1U0FA 2DBQA 3WLLA 1T9GR 1AK2A 4RH0A 5TF0A 4ZYUA 1B6SA 4KXVA 2Q6VA 3TSZA 4R1UA 4ZEVA 1KVTA 1ONOA 3B8HA 3SYMA 2H0QA 3CGWA 2ISCA 5G0TA 2PRIA 4AI6A 3HB5X 1I3OA 3BPSA 5DKFA 1VCOA 1L7RA 3HJTA 2HJWA 1RAAA 1L1QA 4HDOB 1UQRA 3RC8A 5G0WA 1OZ0A 4CTKA 3V97A 5DHAA 1V0JA 5IJXA 5LMUB 5JCPA 3BM5A 1XYVA 3OOJA 2GVZC 1R6DA 1UKAA 5K8UA 3EEQA 3T94A 1NVDA 1QH8A 1WAMA 2W6ID 1VIDA 4P1ZA 1BMFA 4L5CA 1NSTA 3VPAA 1U7WA 4E5PA 1BTOA 4DILA 1Z12A 3DMGA 2VP4A 3DCYA 1M1YA 4HDMA 1FJHA 2IF0A 2BZSA 4KXUA 2O4UX 2YZGA 4BVFA 3I2KA 3MQ2A 4I4TA 3Q8MA 4KQCA 3THRA 4GO1A 4ZAYA 1RXVA 3EMBA 5EXDA 2B25A 5L7TA 4TV8B 2WF8A 1S8AA 5KCZA 4FEEA 4LI0A 3I2JA 1C4KA 1FYEA 4QFMA 5CH8A 1C3XA 1C9NA 4BTEA 1T8RA 2QMUA 4W5TA 4DR1B 1E6WA 3L7DA 5E1BA 5F1PA 3K05A 1GTG1 3E9YA 4KQKA 5IAAA 4UHDA 1J0BA 3N2GA 4MYRA 4FW9A 1G6HA 1RACA 1GZ6A 2JAOA 1CT9A 4GXTA 4ZEWA 1Q3KA 3E0QA 2X8AA 3TQRA 1FSZA 1KPGA 3ACCA 4YUWA 1KMHB 4HQFA 1YIOA 3EGXB 3VNSA 2XSZD 4OXXA 2PPLA 5EWMA 5A4DA 3QVVA 1NG9A 1AT1A 3AFMA 2FZEA 4XQ0A 1WXQA 1G9XA 3C3MA 1JT2A 2AC2A 3NYQA 3WL3A 4QU9A 2EARA 1CIJA 3B12A 1A96A 4MMZB 2YJ6A 3RYHB 2GN4A 1JIQA 1R12A 5E3JA 3T8YA 2B8EA 6LDHA 3LCVB 1BGVA 3LZDA 3FMOB 5LXTF 1P33A 3U62A 2B0CA 4Q24A 1VIVA 3Q7TA 4TRJA 4F96A 3HQ4O 2YRWA 3M82A 4B48A 3O1LA 1J21A 2K5UA 2MINA 3DB1A 4JP3A 1CEXA 1EGHA 1ONPA 2HV8A 5GIOE 1T4MA 2XE8A 1YR2A 3TCNA 3AUTA 4TYMA 1UPTA 2HOQA 4UXJA 7REQA 4ZVOA 1G8PA 1V1MB 4IDNA 2JH9A 4QPPA 4DCSA 1DUVG 2OBFA 3OJLA 4HY3A 1V4BA 5DGDA 1APBA 4WOPA 4UNRA 2NW6A 2BMJA 1PFKA 4G0PA 2CBZA 3H2IA 3SAJA 3IIMA 5HGJA 3COSA 5ERXA 4Y0AA 4HYEA 2W8BB 2ZTVA 4A0QA 4D4KA 1MG0A 3D7LA 2WFLB 1CQIB 3KAJA 3RGWS 1GCOA 4LHYA 3O4VA 1OH8A 1ZJ4A 3TLBA 3F0TA 3THSA 1XNRB 2BDEA 1JKJA 3WISA 2YWXA 2ZTSA 1DRVA 1LY1A 4HNVA 2XMRA 4A9AA 4BRWA 1GR0A 4L8WB 5BSVA 2JFXA 4I9NA 2BYTA 3WYEA 4J6FA 3DDHA 4O1MA 1YA6A 1YIAA 4NQZA 3ZZNA 3LVFO 2RDMA 4F1KA 2HA0A 4WCDA 4K6FA 4YAKA 1AKVA 4OMCA 5DGCA 3K94A 4HTFB 3D8BA 1E98A 3M6IA 4L73A 3T1TA 4G0WA 2WT9A 2RBGA 1WS6A 3E2PA 3AVQA 4ITRC 1WY7A 5IAEA 3R8XA 3NHAA 3GLFE 1J25A 1PI3A 4EA8A 3K8YA 2XWQA 3FD8A 1TAQA 4X1OA 5EY5B 2H4XA 3L6EA 2YW9A 3CUTA 1Z5WA 4TTIA 4M1OA 3TWOA 1RRMA 3ZD8A 5H81A 1Z73A 2X0FA 2XX3A 1E1RD 4Z6KA 3IE0A 3NXKA 4PZDA 2HA5A 4PZ9A 4EHNA 2GKSA 3JVEA 1W7AA 4L50A 4UTOA 1ARZA 1CRWG 5FTKA 3T1HB 1BS9A 2MTBA 3FLBA 3DH0A 3PPWA 4KQHA 1U0NA 4FYVA 5AR1A 4YGYA 3COYA 1XJQA 2DECA 3IOCA 4DZZA 3NXSA 4PFSA 3RC1A 1BRMA 1R1DA 1SUSA 3ZD7A 1KFKB 4GOXA 2NU7B 3CZQA 1R16A 2IUUA 1U1IA 1XLUA 4LF5B 1VXOA 1SHJA 1MABA 4MI1A 1DU4A 1TM2A 3G0GA 2GRJA 2IPOA 1B8OA 1RW4A 3DMDA 1L6IA 1H4QA 1OV4A 3LVBA 2EKQA 1ST2A 5DHTA 1A4IA 3HPQA 2IZ5A 3NOVA 4DCPA 3NMUF 5A0VA 1EFPB 3AVXA 4PS0A 1NUQA 1DJNA 2JCBA 4FD3A 1EZZA 4O4LF 1Y7IA 1NRIA 2WTXA 3H65A 1O08A 2M1ZA 4DMFA 5K6TA 4OTZA 1ENPA 2ZR8A 1WDLA 4AYWA 3KVNA 1G2OA 5GQSA 5TC4A 1P2VA 3VYWA 1KO1A 2VVTA 3ANTA 3TLXA 2IPLA 1Y6ZA 2V7XA 5J2UF 4DA8A 2IU4A 4EMSA 1OWPA 1Y4AE 4TSFD 3H84A 3TAHA 2PZJA 2VCEA 3O82A 3N39C 3IO3A 4ER5A 1FP6A 1N0HA 4G0OA 2OO5A 1PJ3A 5AIBA 4GSYA 5JRDS 2O8DB 3G9UA 3FNQA 4RY9A 1T8PA 4NCIA 1OYVA 2FFAA 1OBVA 2VOJA 3RSFA 5TIIA 1EVQA 1W96A 2BH9A 1K66A 2G36A 3BQ9A 3AHFA 2IHKA 3G49A 2IQIA 4LUCA 1SQFA 5ECGC 3UK7A 3H2ZA 1YZUA 2P3LA 3ZD9A 2EIXA 4CKEA 3O21A 1N3IA 2LTAA 3HV0A 4YXFA 5DCWA 1G0NA 3KFVA 4RM2A 1W5EA 2Q50A 4IGEA 3RVKA 4Q3OA 1CQZA 4FE4A 2IX9A 2IW3A 1R74A 1KEUA 1CUUA 3TIFA 2Z09A 4B3IA 5D84A 1RHUA 1A88A 1U2RA 2NSYA 2YNMA 3HMKA 3OT5A 3VPHA 4LDZA 4AUEA 4EI8A 4MNTA 3EOBI 4IV0A 2NO6A 4EZBA 3R4VA 3IVAA 4OLJA 4TS9A 3WYBA 1TM4E 2HIGA 3DBRB 1G64A 3VZPA 5F5LA 3LDGA 1RQ7A 3E9EA 3LAWA 1Q0LA 3TTSA 4RPJA 2I91A 2WJIA 2A86A 1J9GA 1UEJA 1RNLA 1F6WA 1UJ4A 4U6SA 2CFCA 3SSAA 1CJBA 3U0VA 1R0CA 3M5PA 4Y9UA 3V4VB 1DKLA 2O05A 1V37A 4OXKA 4HLQB 4IDEA 3R3UA 4RA9A 5CEEA 3JVVA 1DBQA 1TZJA 2G3YA 1L7OA 5JEEA 4OI0A 2G4CA 3U31A 3ZV6A 4ETIA 1C7RA 1EB9A 3NEYA 4GVPA 1DBRA 3TOVA 3OLCX 4GKJB 4JLPA 4HXFB 1EMDA 4B32A 5J1SB 1G9TA 4BKQA 4MQUA 1XZPA 5EIFA 3PNBA 2QLFA 4ENTA 1FPMA 2XRZA 1W36D 4Z0NA 4BNUA 5BY2A 3VH1A 2B0JA 3VU8A 2C97A 3E23A 1XSEA 5ER9A 5JLJA 1BWQA 4NENB 2NUPA 4GMDA 4GR5A 1ZIOA 1AA9A 1ND5A 3L4BC 4FEYA 2PX5A 3ECCA 5BRNA 2WA1A 1ZINA 4FYHA 2Y77A 5BWCA 4DC0A 5IZ4A 5KX5A 2V3VA 2WAOA 3JD1A 3KL4A 1W1WA 5FWXB 4HAOA 4EA7A 1PN3A 3V4PB 4H1WA 3P2KA 1NQWA 1TT5A 4WY8A 1U02A 1WEHA 3OECA 2VL7A 4KFRA 3TBFA 2EWMA 3V1UA 1NE2A 4O2RA 4YCAA 4CMIB 2WFZA 4AWAA 3MGCA 5AJUA 4BTLA 5CDGA 2H0AA 4Q19A 4MI6A 1VHQA 1RAGA 2VBGA 2KLHA 2Z3ZA 1E61A 3K1YA 4MR7B 4BO6A 5LIPA 5EKUA 2ODEA 2FETA 3WIVA 5CYPA 1L5GB 1CJUC 4ZYYA 3COJA 5HP4A 3OP4A 1UQUA 2HI0A 5EJIA 3GQBB 3RSQA 1N32B 5JXJA 3TI9A 3OLQA 2JHPA 3PGLA 3SYRA 5FBRB 1WCYA 4U6NA 4PGMA 1P7CA 4EFKA 3QMWA 4KLRA 2E21A 1KYTA 4NE7A 4C0KA 1UEXC 1XHLA 2OO5C 5FPYA 2YJ3A 1NN1A 1WXIA 3HJGA 2GJ8A 4GOJA 2ECQA 4I4IA 2VYQA 3WGKA 3HJCA 3W5AA 1NQAO 4I5EA 4HS9A 1JPJA 3BXGA 3QBDA 5BMVF 5C1DA 4DV0B 1RBZA 4R8VA 4E6PA 4LFAB 2VPTA 2YVLA 4IFEA 5DHUA 5DSTA 4ADSG 4X95A 4BNVA 3O95A 2L0XA 1R4ZA 1SB8A 4A7PA 2WG2A 4IUYA 1P7YA 1QYWA 4QECA 1M1UA 1W49A 2ZDQA 1J6UA 2IHJA 2BEVB 2J32A 3G7SA 5CFNA 5HDQA 4O2AF 1JBQA 2QJWA 1AO0A 1MQ9A 2ZBDA 4G8CA 2PUVA 1QIDA 2Q3CA 2I4LA 4R3WA 1Z6PA 3ED1A 3GFOA 4Y1EA 2YNMC 3V1YA 5CVTA 1HTBA 2RGCA 2IU6A 1BW9A 1KZHA 3ZZMA 2ADMA 3G2JA 1JKIA 1M7HA 4ZQGA 5J2TB 1SXJB 3MPOA 3ONNA 1K6MA 1T43A 5BSMA 1V5IA 2RHGB 4YRRA 2TYSB 3VO8A 4QBGB 4DSOA 4EAAA 3DZBA 4L74A 1E62A 1YNSA 4BS9A 1KAQA 2CSXA 1UBRS 1F38A 1OJ7A 3HE3A 4H27A 3DBVO 1KXZA 1KQPA 1KDPA 1ZUIA 3QPCA 5F7XA 4LXTA 1UK9A 2PMBA 3IDFA 1DCFA 4ZHQA 4QOSA 1NYRA 2BKEA 2VK4A 2N47A 3AKCA 4LCBA 1I3NA 3MBIA 4J0DA 4PQYA 2PRJA 3EIHA 4W5JA 3SX0A 1SG9A 4TN1A 2Y6UA 2Z8YA 2VRCD 4RJLA 5PGMA 1KDRA 2HJVA 2MYNA 4RABA 2DUWA 4R84A 1R2QA 3DC7A 3E9QA 3SR4A 1PZHA 1Y6RA 5LZ7A 4CLXA 3C3WA 5ALPA 4E5NA 3G8DA 4NECA 3T7SA 3MJFA 4UEWA 4HDQB 1R18A 1VGQA 3A0UA 3DOIA 4UE3S 4IOJA 4TLEA 3RSZA 4BBZA 1EVYA 1STOA 3GEEA 5DYIA 4KGDA 2PAFA 1Y7PA 2XGOA 2ZS7A 4N5IX 3QE3A 2BFMA 2BOVA 2F1OA 1T3LA 3BB3A 1UDAA 5LN1A 4OK3A 2P91A 1ULAA 4JGGA 1ZH8A 4XB1A 421PA 3ST7A 3DCJA 2FU5C 4K6MA 3FIJA 2OKCA 4FLEA 4RJJA 5AQEA 1R10A 1O95A 1P6QA 1YRAA 2FG5A 2IW1A 3QFFA 2Q5FA 3HWWA 2IOFA 5CNMA 3UCXA 3AEYA 4OUDA 1RQLA 3L7MA 2BMEA 3QUBA 3ILYA 2CXOA 2FFHA 2WKPA 3QMVA 4YLGA 2JVIA 5EWJB 5CB8A 4LMBA 3K31A 1R5NA 1TEZA 1AS2A 2DY1A 1SVUA 3O83A 4BLTA 3BCHA 4DDKA 5HM8A 3DO5A 1AOXA 2GZ1A 1VECA 3NOXA 4XLZA 4ENUA 4TTTS 2QTVB 4M1YA 1Z5PA 3MEQA 5D00A 4AIIA 3IE1A 2AQIA 3RPEA 4NZMA 3PICA 4TQAA 1MVOA 2LUOA 1Z29A 3OKCA 4KL8S 1DO2A 3AEXA 4N03A 5LDGA 3GZ4A 1URPA 2C83A 2G71A 2WUGA 1UC5B 3OLWA 1Z2DA 4K6OA 1YB5A 2O3JA 4PRZA 3P0HA 2IS2A 5EP2A 1CRPA 1ZFNA 2XY4A 1N2GA 1Z5NA 2ATXA 3MWLA 3ILSA 1J0DA 3NP7A 4BPBA 5DNYB 5BWLA 3H1PA 4FQ5A 3CUYA 2Q0QA 2VKQA 3GR6A 3H0CA 5ER6A 4X3OA 2V7GA 4UAVA 2XOKD 3HR4A 3VOAA 1W4CA 1JB1A 2WB4A 1EE2A 4R7ZA 2H16A 4OU5A 1BZYA 8ATCA 4MYHA 4ZCQA 4DLSA 5LYJB 3N53A 4MVJD 1JEAA 4OBBA 5KSZA 2FOXA 4E32A 4QNRA 4XR9A 2BH2A 5CVCA 2TECE 4MH0R 5COAA 3T7IA 2FZGA 2WQ6A 3HYRA 3D02A 4BO0A 3ZDBA 3WV5A 4AG3A 2N1MA 3DW3X 1H2WA 4ZVUA 3GVIA 3AGQA 4HNTA 3T1NA 2WJ6A 1WP4A 3DF7A 3R23A 5IWAB 1PQPA 4KXMA 5CITA 4N41A 4K87A 5ELLA 1SUWA 1YS1X 2OGZA 2ZKLA 3JZAA 1RP7A 3CPHA 1JHDA 4LV5B 3Q11A 1J56A 3RADC 1EM8A 1BN7A 2VJPA 4H60A 3ROQA 1QE5A 5TE9A 4L7VA 1T4CA 2XMSA 1T5IA 2XECA 1NBEA 2Q7OE 3HJFA 3GIDA 4YP6A 1LVGA 5LBIA 4UBJA 2FGKA 1JR4A 4G37A 2CNLA 1KZ6A 1C1XA 4HEHA 4DM7A 1MJHA 1WB4A 1ZH4A 2NXCA 4PGFA 3VPFA 2ORYA 5BOSA 4I6JA 1I94B 1UC9A 2V0NA 4Y2UA 2ZATA 3VOTA 2B98A 2KBEA 3LLCA 3LLUA 5KC9A 3G1UA 4ALJA 5I9BA 3ZQKA 3DDSA 5ITZA 1GGJA 5IBRA 2ZJ8A 1P3Y1 3I05A 5KTKA 4K0KB 1JKXA 2ZB7A 3TECE 1W5BA 2IU3A 2J4FA 1AGXA 3MJHA 4RS3A 3ZWCA 2ZSDA 3G2KA 2PYIA 2B99A 2OO3A 4RVFA 3ZTYA 2VXBA 4CM4B 1A95A 3KWLA 5EVCA 1MRZA 1L1FA 3VBCA 3GUUA 5KNCA 2NO5A 3UH1A 4IWYA 1ZD2P 1P8AA 2VO1A 2Y6VA 3KR0A 3IMEA 3WOHA 4Q1EA 1B8PA 3NM4A 2ZIEA 2MDTA 2FP4B 1BJKA 5JOQA 4TTPA 1ISGA 1TTQB 3M83A 2BI8A 1M8KA 2HK6A 4H7PA 3SJZA 4JLBA 1HR0B 3U19A 2IYEA 4F6LA 5J4KA 2IF2A 3VC1A 1OZAA 1JWBB 3ONDA 3AUXA 1Z6GA 3CNBA 3HNPA 1U8UA 2QGFA 2O2GA 2WM2A 1HH4A 3BD7A 3D1LA 3QW4B 5DWVA 3R7AA 5AW8A 4FFWA 4CR6A 4REOA 2W90A 4WCFB 2H7YA 1N9GA 2QD1A 4QYXA 4JB2A 5BN3B 1DS6A 4IIYA 3WMXA 4C22A 1QGZA 2D5IA 1ZC4A 4WZAB 2J09A 1RRCA 5DBEX 2Q6TA 5KQGA 1F9AA 4MZDA 3H2GA 1KO5A 3HR8A 4QKQA 5I7VA 3D8NA 2OUIA 3PKIA 1QCCA 1ZC3A 4RA6A 4H1UA 5EQFA 4B8WA 3I9MA 1QQ6A 1IN4A 1M2HA 2GYYA 3DLPX 3TNYA 4BIIA 3U0BA 3M9WA 1XD2A 5CXQA 2UYOA 5DX8A 2GK6A 5E4FA 1L5WA 1I3MA 3ASVA 3D5EA 5KQPA 5LU8A 2HEIA 5BV2P 1C4XA 4R1PA 5E6UB 3I64A 2QR3A 3IQZA 2DYKA 4CGZA 3G0OA 1U04A 1K06A 3R0XA 4N5NA 2HRRA 4GR9A 1GIAA 5AT1A 1CF4A 4EVQA 1ABFA 4ZOQI 2IFTA 1KSGA 4EG1A 1DWOA 2Q8PA 4F5EA 3R9KA 5KOJB 3BMCA 2W22A 3FSGA 2NUBA 2QPTA 2XGMA 1T1EA 1E7YA 2XKAA 4MV8A 1ZG3A 4YA6A 1L1EA 3HCOA 3OE7A 3NQ41 4WOKA 3ZK7A 4IHJB 1HQYE 4R2WA 2IYTA 1SPBS 2WUDA 3L18A 4W7IA 3TDKA 2FZ4A 8MHTA 2Q4OA 1FJXA 3QNMA 5BSWA 3D3NA 5LQDA 2NZ2A 4PAWA 1M76A 3UFXA 4RHYA 4L8YA 1OUMA 3D43A 4AURA 1LPOA 3ZDAA 4ZOLB 4BWGA 3LA6A 3L0YA 2Z2XA 1A9XB 4YRGA 1Q6ZA 1USUA 3E9CA 3T3PB 1AF4A 2CMGA