4O08A

Crystal structure of bacillus megaterium epoxide hydrolase in complex with an inhibitor
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
287
structure length
287
Chain Sequence
MSKQYINVNGVNLHYISKGQGELMLFLHGFPDFSHIWRHQIDEFSNDFHTVALDLRGYNLSEKPSGLESYEIDVLVEDIRQVIEGLGYSSCTLVVHDWGAGIGWTFAYRYPEYVQKLIAFNGPHPYTFMRELRTNKNQQKASEYMKWFQKQEVQDYMERDNFSGLRKLVIDPGVKKGYLTADDVQAYMNSWENGSVLSMLSYYRNLKIFTEEDLRRKSLFPLEEEVLNIPVQIIWGNQDPTFMPENLDGIEEYVPNISVHRLAEASHAPQHEKPQEVNNVMWNFLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering of an epoxide hydrolase for efficient bioresolution of bulky pharmaco substrates.
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Soluble epoxide hydrolase
total genus 111
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 3.2.2.10: Pyrimidine-5'-nucleotide nucleosidase.
pdb deposition date 2013-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4o08A00
1CUWA 4G8DA 3K6KA 3V1KA 3M82A 5IVHA 4OU4A 2ONCA 1MX1A 5DTJA 3OG9A 1E8MA 4GI1A 1IVYA 3DYVA 3U0VA 2OQIA 5JD4A 4EZIA 3ZI7A 3PICA 3HRHA 4B82A 3WKAA 1JJIA 3I6ZA 3F96A 2HRQA 2IITA 4ZI5A 3Q8WA 1B6GA 5AKYA 3A6ZA 2O7RA 3BDVA 2WHQA 2WUFA 4HRYA 5A2GA 4B7ZA 5FV4A 5HF9A 4EHBA 2HA0A 3C87A 1P0MA 4EUSA 4DMKA 5JALA 2XLCA 1UWCA 4CI9A 4S0XA 1SCKA 4GWLA 1YASA 3F8SA 2RAUA 2VT6A 4X93A 3I1YA 1CFJA 1HQDA 2C5GA 5HK8A 2G5PA 2RI6A 4AN1A 4UHBA 2PUJA 3DOHA 3CCBA 3IURA 4EY5A 1AUOA 4XVCA 5JANA 1O6FA 1ZI6A 4DM7A 1U65A 2DCMA 4GW3A 2JEZA 3NWOA 1QONA 5AP9A 5AM1A 4H0CA 2GBIA 1YR2A 2HIHA 4X00A 5KWJA 5HQ3A 2XUIA 4KE6A 2QXTA 3G9XA 5ALDA 1A8SA 1QO9A 3WQHA 1W6RA 1IUOA 4DMFA 4C88A 2PSEA 4W1QA 5K3EA 5K5EA 1LBSA 2XMGA 1SCIA 3WIOA 1QZ3A 3H2GA 5LZ2A 5ALVA 4C89A 4IQ4A 2OCKA 1GKLA 2FX5A 3FSGA 1N5RA 4Q1VA 4OPMA 3D5EA 1EDDA 1C4XA 3G0CA 2WHPA 5IKXA 4MYSA 2JGMA 4BAUA 4ETWA 5D7BA 5DNVA 5ALNA 3DYIA 1EA5A 4TPKA 2CJPA 5CRIA 4LYDA 1DTEA 2WUDA 3B12A 2JGJA 1J06A 1GXSA 5ALXA 5AIAA 5ALHA 1A7UA 4DYHA 2WU4A 3I6YA 4OB7A 1YCDA 3KD2A 3BIWA 1RP1A 4J7AA 5AM3A 4FNGA 3ANSA 2WQZA 3EIOA 3STXA 5E2IA 2H9YA 1QIMA 3ZLTA 2ES4A 5C8ZA 4UFNA 3FCXA 1CUIA 3PF8A 1GQSA 1IUPA 3WL5A 5KWIA 2JIDA 1OCEA 4W1RA 3VJMA 1G42A 3IIIA 4BE9A 2AXEA 2PKYX 3HACA 3WWCA 5AM0A 1VZ3A 4OYYA 1W4LA 1EVQA 3H2HA 4UBJA 4H7HA 4XJVA 3KOOA 1YS1X 4Y2JA 2GYVA 2Z3WA 7YASA 1E8NA 3FCYA 3EF3A 1WB5A 2VJDA 2JGEA 3DL4A 3JWEA 2VJAA 4H35A 3FYUA 1XZGA 1RWQA 1JKMA 1G66A 1X70A 1MT3A 4UHDA 4BC0A 3BWXA 5AK5A 4X6YA 4K5QA 4CIBA 1P0QA 4W9RA 1CPYA 4QDZA 1MX5A 5EIEA 3M81A 3FBWA 4BCBA 2CBGA 2WFMA 1Q83A 3WKCA 1YA4A 3HYSA 4X94A 1EB9A 1YAHA 3WMRA 1XRRA 1RYYA 5AKHA 1ZD4A 4OB8A 3TGLA 3IDAA 1XRNA 4G4IA 2WG2A 3Q0TA 2OGZA 3C6ZA 2Y2VA 2QUBA 3PFCA 5ESRA 5A71A 2OCGA 3BF7A 3EQ9A 3ZPXA 5LIPA 3G9UA 3G0GA 2FJ0A 1GKKA 2OCIA 1MTZA 5CH8A 2BUAA 2W6CX 3DKKA 5AI6A 1J2EA 1YSCA 3RK4A 2DQZA 4B84A 1XZCA 5AI8A 2XUGA 2XDWA 5EFZA 1ZIYA 1UOPA 5JZSA 4B6GA 5EI5A 4RGYA 3QPCA 3R3YA 1DU4A 3IUMA 1OXMA 3WJ1A 2AJBA 1LPSA 2JGKA 4IH4A 2WG0A 3AFIA 4IO0A 3STWA 1UKBA 4WDQA 4X91A 1XZKA 1AX9A 2XMZA 5DYTA 4BDTA 4H77A 4H7FA 3RARA 2PVSA 1VA5A 2G5TA 4NS4A 5SYMA 3A2MA 2H1IA 5FPPA 3H0CA 4O08A 1JJBA 3I2JA 2PU7A 4AQDA 4X95A 4X90A 4H7DA 2XMCA 4X92A 4UFOA 5AI4A 4ZV7A 1SFRA 2HA6A 5AM5A 1XQYA 4K2AA 3HZOA 5FUMA 3ESCA 2C0QA 3P2MA 4UFPA 1E5TA 3WIBA 3GROA 1HL7A 3C6XA 1DT3A 4XWGA 4DMHA 3O4GA 3S8YA 2YYSA 1C7JA 3FAKA 4G8CA 1K4YA 1VZ2A 3B5EA 1U2EA 2ORYA 2XB6A 1H23A 3O4HA 1P0IA 1MNAA 1LNSA 3DL7A 4H7JA 1AZWA 4XX1A 1TK3A 1JI3A 2JF0A 4X3CA 3CN9A 5BWCA 2XMSA 2HA2A 3WWOA 3V1LA 4GHWA 1DQZA 3E3AA 1UK7A 1PV1A 1S8OA 4U2GA 3AIMA 5ALUA 1QLWA 2PSDA 1ZJ5A 5AKIA 5EHNA 3SK0A 3ZLUA 1THTA 4D9JA 5HF8A 2XUFA 4X71A 2V97A 2XQFA 3KWFA 1ZD5A 2G4LA 4NZZA 2B9VA 3JW8A 1BN6A 4ARAA 5AK3A 1QO7A 3WK6A 1WPRA 5FDFA 5JZBA 3T4UA 5E4YA 4FBLA 2HA7A 4UHEA 4WY8A 1A8UA 1R9MA 3V1MA 1TCBA 1TKRA 3C43A 1IMJA 3R3WA 3SX4A 3G9ZA 2ZJ6A 3A70A 5ALQA 4YPVA 4I4CA 1OILA 3I2FA 1EX9A 3G0BA 3RKSA 3IVMA 3L1IA 1LPMA 1WCYA 2WUGA 5T4BA 1KU6A 3G0IA 4P93A 5CTAA 2DQYA 4FKBA 2PPLA 4XIIA 2QKYA 3WKEA 5DWDA 2ZYRA 1DWPA 1LZKA 1XZBA 5FOQA 4AO8A 2QTBA 4K6HA 3FYUB 3WL7A 1CUHA 4RPCA 3WJ2A 3LLCA 5AOAA 1WHTA 3VJLA 5AHXA 3FNBA 3EQ8A 4QWWA 2QMQA 1FFEA 1BEZA 2VTVA 1ZI9A 2QOEA 4Q82A 3VDXA 3GBSA 2HFKA 3OC0A 4AXBA 4J0KA 5AK4A 4G9EA 4QDUA 4N5IX 1XZMA 1R1DA 5EIAA 1UOQA 3OURA 3OTQA 1B41A 4EY8A 1HKHA 1MU0A 1U8EA 4Q3KA 4C01A 3S2ZA 4Y2YA 5I9IA 5DYYA 2CUTA 2XUOA 1MAHA 3KWJA 1UZAA 2OQVA 4CG3A 1WB6A 2Y6UA 1W76A 4BTLA 2DFPA 2WILA 4HRXA 4CG1A 3DS8A 4FMPA 3F67A 5AM2A 2VSQA 2J3QA 4UUQA 3LS2A 3H18A 4QWMA 5BWBA 1T4MA 4GXNA 3QZUA 3IBTA 1CUBA 1F8UA 1GPKA 1QIIA 4AN0A 3G7NA 5EGNA 4FFVA 1ZICA 3WKBA 2ACEA 5K3CA 1JMKC 2WIDA 5LKAA 4ZXFA 3MUNA 2CKMA 5ALLA 3WL6A 4KRYA 5ALKA 3D2AA 2H7XA 4CCYB 1CUEA 1VXOA 4FFWA 4MEAA 5AH0A 1XZFA 4LXIA 3FOBA 5EHXA 2EDAA 2Y1KA 1SCQA 2WIKA 4W1PA 5KBYA 3BE8A 5CH5A 1QGED 3FYTA 5AO9A 3WL8A 2BGRA 5LZ7A 1XZEA 1W52X 2GBFA 2WJ3A 1WM1A 1JT2A 2BUBA 1QIEA 4KAAA 2YXPX 4BRSA 5YASA 1GPNA 5ALIA 2DHDA 1C7IA 2Z8XA 1YAJA 2ACKA 1E3QA 4IH9A 1LGYA 3AZOA 1VKHA 5FPQA 5AOBA 2VJBA 2XUJA 3H2IA 5JAHA 3AIKA 3FVTA 4V2IA 5LLSA 4BCCA 1E89A 3C6YA 3IUJA 2WHPB 4HXFB 3FWHA 2CB9A 2WFLA 3H17A 4UPDA 5HFNA 1CRLA 2ZSIA 3E4DA 4QDTA 4PV7A 4ARBA 1FFCA 4U2CA 4GBGA 4GLBA 3MGAA 4KACA 4WFKA 4PF1A 1XZDA 2VA9A 4Y2SA 1ZJ4A 2HA3A 3HEAA 1XZHA 1SOMA 4BTVA 2WHRA 3I28A 4Q3OA 3K9BA 2WM2A 2ZSHA 5BOVA 4OCZA 1UKAA 3BL8A 2ZYHA 1TCAA 4BB0A 1CUYA 1QIHA 4KYVA 2QJRA 4M0EA 2W22A 3QPDA 4KE7A 1R9NA 4HXEB 5DLPA 3R3ZA 3L1HA 1UT6A 3FLEA 4B81A 5T4EA 2V96A 1WPXA 2C0PA 4BP8A 3F97A 3WK8A 2OPHA 4EY7A 2QT9A 3GELA 1JU4A 1BCRA 1EDBA 3IUNA 1XQXA 3A2NA 3KDAA 3RLIA 2WIFA 3D59A 1CUSA 2QM0A 2X8BA 2YASA 4Y2PA 3N2ZB 3PF9A 5ALGA 5HF6A 2GYWA 4JYPA 4DIUA 1TRHA 4I3FA 3W05A 2WFZA 3MVEA 4FBMA 2V98A 2VQ6A 2HA4A 5AKJA 2AJDA 4A5SA 1CUFA 4X97A 3CCCA 1JMYA 5A7FA 2XMDA 3NUZA 4AO7A 3LP5A 4GECA 2VAVA 3SC2A 5AJHA 3EBLA 4UBKA 5LP1A 3STYA 1THGA 5AKLA 4BZWA 4L72A 3PDCA 3NOXA 2J4FA 1Q84A 1Y37A 4J0HA 4P08A 4EY4A 5FRDA 1CUVA 4KAJA 2BFNA 5AIBA 4OUKX 1XZAA 4KAFA 3ICVA 4QDOA 2K2QB 2GZRA 2PM8A 5K3FB 1H2XA 3ZWQA 2ZVDA 1W75A 1AC5A 1KEZA 1J07A 3HC7A 4CG2A 3WYNA 1XZJA 4N5HX 4YASA 2HU8A 4AB1A 5CT4A 3WA7A 2RHWA 1ZD3A 4PSDA 5ALFA 1USWA 1UK8A 2XUPA 2B4KA 5JZ9A 2C58A 3WWDA 1EK1A 3G8YA 2G63A 1CLEA 5A6VA 4DNFA 4GDMA 5CT6A 1R88A 3QITA 2PU5A 5DNWA 4CIAA 1AURA 4Y2UA 4UHFA 1IZ7A 1MX9A 5ALPA 4ZREA 1CUDA 4J0IA 3ILSA 3QH4A 5CT9A 2VF2A 2AJCA 1AQLA 1XZLA 2EEPA 1LZLA 1DX6A 5ALRA 2QZPA 3H2JA 3DCNA 3D4LA 2O2IA 4J0GA 4WJLA 3STVA 1BROA 2XMRA 3C8DA 3H2KA 5H3HA 2ZYIA 5ISMA 5IVKA 1KU0A 2HU7A 4GEGA 4H18A 2JGFA 4BVJA 2CEKA 1EB8A 4NMWA 5E4TA 4FLFA 1UK9A 4DTCA 5EHQA 3KXPA 4JYMA 4WFIA 5HK9A 2JGIA 1UKCA 1EH5A 1NU6A 1ZIXA 1VE6A 1PFQA 3WK4A 1GQRA 2PL5A 5C8XA 3IUQA 2QUAA 2H7CA 4I19A 3D3NA 4UBMA 3STTA 1MAAA 2JGLA 1LPPA 4BE4A 3K2IA 2Z8ZA 1QTRA 4H7KA 1DINA 2WG1A 1G5FA 5K3FA 2WUEA 2I3DA 4CCWA 2HHAA 2OG1A 5LZ5A 4BRZA 3C8HA 1BCSA 3DJYA 3BF8A 4DGQA 3WLAA 1R50A 5SYNA 1BU8A 4A16A 4H7IA 4FLEA 1QIFA 1NU8A 1JFRA 4MJ3A 3O4IA 1F0NA 1JJFA 3AUKA 2D5LA 5HFAA 4OB6A 4CFSA 6YASA 1ZGCA 5DJ5A 2RHTA 4FLMA 3I2KA 4X7BA 3AINA 4ZGBA 1Q0RA 3C45A 1ISPA 4E46A 2XE4A 1MJ5A 4X6UA 5DYWA 4U2DA 3YASA 3DD5A 2HM7A 3C6BA 5A7GA 2BGNA 5D3ZA 1MO2A 1ORWA 2GBGA 2C7BA 3DLTA 1L7RA 3WKDA 3HXKA 2HFJA 2ZJ7A 3GA7A 4ITVA 2LIPA 3FLAA 1R4ZA 1UOOA 3TJMA 4L3WA 3PUHA 5AM4A 4Q34A 3O0DA 5J3JA 4BZZA 2H7YA 4DLNA 4DNQA 2WIGA 3QBJA 4BYMA 3KSRA 2HA5A 2V9ZA 1FJ2A 1BN7A 5LZ4A 3QYJA 5JD5A 2WJ6A 5C81A 1PJAA 3WK7A 1JU3A 3R40A 2XUAA 1TQHA 3G9TA 4PQEA 4PNZA 4RE6A 1XQWA 1ACJA 2QS9A 4KEAA 3F98A 4W63A 5K3BA 1QIGA 4BATA 3H19A 2FJPA 4ROTA 3ICWA 2WU3A 3STUA 1F0PA 1XRPA 5JYCA 5AKKA 4FWBA 2ECFA 2O2HA 2QVBA 1QIKA 5JADA 3V1NA 1XRMA 4JUIA 1MN6A 2RIPA 3ANTA 3PI6A 3ESAA 3UMJA 4RNCA 1UXOA 5JAOA 3QVMA 5ALSA 1SC9A 2WLSA 4B83A 4U2EA 2WSLA 5D6OA 4ZV9A 5HF5A 1EINA 4Y2XA 1FSSA 2BCEA 1I6WA 2HL6A 1WB4A 5ALZA 2D0DA 4WY5A 1QIDA 2I3ZA 3QM1A 3W2TA 4LXHA 2DR0A 2FUKA 4AO6A 2QXUA 4E11A 2AJ8A 4BC1A 3D7RA 1ETHA 3ZV7A 2AJLI 2EDCA 1HDEA 2WTMA 4B0OA 4MWSA 4NVRA 5AOCA 1CUZA 1QE3A 3TEJA 2PX6A 4UHHA 3O9VA 4EBBA 5JATA 3VISA 3C5WP 4B0PA 4C6HA 1L7QA 2I78A 1WHSA 1YA8A 4X85A 2WJ4A 5HKBA 4HS9A 4DNPA 4KR0A 3G02A 3UUEA 4AMZA 3IA2A 4INZA 1CUCA 4LXGA 3HLKA 1Z68A 5JD6A 4F21A 1CV2A 4JEIA 4PO3X 4OYLA 2NW6A 3GFFA 2HADA 2XQJA 5CBKA 1E8DA 3DQZA 4B9AA 1HLGA 1HPLA 1IUNA 2PSJA 1XKTA 5HQ3B 3O9MA 5CURA 3LCRA 3GZJA 1GZ7A 2XQKA 4KE9A 2R8BA 1TAHA 4F0JA 1XRLA 3W9UA 1DX4A 5JAPA 4Q3LA 2OLEA 2RONA 5K3AA 3R41A 4QE3A 2PSHA 3NGMA 3QMWA 2Q0XA 2VATA 4JH0A 1BS9A 4Y2VA 2BUCA 3C70A 4HZGA 3OOSA 2GZSA 4ZWNA 4UHCA 4X6XA 1TCCA 2J3DA 4KRXA 1IZ8A 1H22A 1WOMA 1YB7A 2RGUA 1E66A 2WKWA 1ACLA 3HSSA 3R0VA 2P8SA 1P0PA 5E4JA 1Y7IA 2OAEA 5IVDA 3X3HA 1K8QA 1VXRA 4WFJA 3H1BA 2OAGA 5DNUA 1ORVA 1VJ5A 3T52A 1X2BA 3FYUC 4K6GA 4PSCA 4TVKA 4J0JA 5K3DA 3WYDA 1VA4A 3FLBA 1FFBA 3WZLA 4DSAA 5HCUA 2QJWA 3AZPA 4LYEA 1CEXA 3E0XA 4W1SA 5AK6A 5CT8A 4FHZA 4KJXA 3D2BA 4B9EA 4OD0A 1AMNA 1CIJA 5CW2A 1LPBB 4G4GA 5FP0A 4BBZA 2BAGA 3DOIA 5JARA 1LBTA 4J0CA 2BJHA 1GT6A 1EVEA 3BXPA 3OM8A 5AI5A 3VVLA 2CMFA 4QNNA 4WCVA 1O6GA 4DSZA 4PSUA 4G8BA 2XMQA 1L7AA 1CVLA 4J03A 3IB3A 3ZLVA 4Y2RA 1Y7HA 4C4ZA 1NX9A 1R3DA 2R11A 4AZ3A 3WI7A 2X5XA 3CXUA 2OXEA 1LPAB 3U1TA 3W9BA 2Z3ZA 2WIJA 1ZD2P 4AX4A 5ALOA 4AZ0A 2GBCA 2DHEA 3PFBA 2CZQA 2QRUA 3IULA 5ALWA 4B85A 5I7UA 4G5XA 1DT5A 3D2CA 5FKJA 4LIPD 2XMBA 2GYUA 1AGYA 3RM3A 3R3VA 5T4HA 4N8EA 4MWTA 3DDUA 4Q05A 3FSGD 3HABA 4U2FA 2Y6VA 3SWWA 5CT5A 4EA6A 1CUXA 4MXDA 1F6WA 5ALEA 4OSEA 1CQZA 3AILA 4OU5A 4FOLA 4G4JA 1J1IA 2Y2UA 4MQMA 5ALJA 1UK6A 1EDEA 1HBJA 4L0CA 1BRTA 2IIVA 1VOTA 3QPAA 1XZIA 5DTIA 5AI9A 4BAGA 1XLVA 4YX9A 1YB6A 1A8QA 4MEBA 1N5MA 3N0TA 2VT7A 1EI9A 1H2WA 4FNMA 5AKZA 1DQYA 4F5ZA 4QA9A 2I03A 1GPLA 5LZ9A 5EIHA 4QDXA 1YS2X 1FFDA 2VEOA 2XUQA 1AKNA 2HRRA 3V48A 1CUJA 2YH2A 3LIIA 4F60A 2DSNA 5AKGA 2Z5GA 1XFDA 2WTNA 1CUGA 5CH3A 4HVTA 3R3XA 1QTIA 1ODCA 1G4HA 2VAXA 4A23A 2ROQA 1ZGBA 5ALMA 4DNOA 3R3UA 1CUAA 1XRQA 1EHYA 3I2IA 3O4JA 3TRDA 1XQVA 3WWEA 4QEKA 5IH7A 1ODSA 2PBLA 4N8SA 5JAUA 1H2ZA 1XLUA 4L9AA 4KE8A 5AKEA 2ZYSA 4QLOA 4PW0A 4UBNA 2HU5A 5I8PA 5A62A 1EK2A 1XLWA 1EXWA 2JBWA 1X2EA 4YK7A 4HTAA 4DMCA 2ZJFA 3BJMA 5HKAA 1ZOIA 5T4FA 1VLQA 1FFAA 1N8SA 4LHEA 3HI4A 4N8DA 1BEEA 3ESBA 5CXXA 3UUFA 2HDWA 3H04A 4C4YA 2C4HA 3HJUA 3D0KA 3B3QA 5AICA 4JNCA 5HZGA 4TGLA 3VXKA 3WA6A 3H1AA 1DWQA 4BVKA 3M3DA 1T2NA 4MYDA 4Z49A 3JYHA 1CQWA 3VKFA 5ALYA 1BE0A 4AMYA 5FLKA 4Y9SA 5JIBA 3BDIA 4M0FA 3DEAA 3I1IA 4FDMA 3EQ7A 3WK9A 4EY6A 4ZRDA 3BIXA 3W04A 3VJKA 5EHZA 3MUOA 3WWPA 3AZQA 1MNQA 4UBIA 2WFLB 5BV7A 4QZVA 3WZMA 5A7HA 1XROA 4H7EA 3L1JA 1LLFA 4EB0A 4BVLA 3QMMA 1QJ4A 4Y2TA 4CCYA 4BP9A 3DKRA 2E3JA 2X76A 1K5PA 4UBLA 3CN7A 5AKXA 1W1IA 4IH1A 5C8VA 1ODTC 4J0DA 5AI0A 1QOZA 4QLAA 1QFMA 3I2HA 1N1MA 1GGVA 4E14A 3E1GA 3V9AA 2PUHA 2XT0A 3F9CA 1TIBA 3M83A 1K63A 4HXGA 2DHCA 1Q0ZA 2XQIA 1QIJA 3ED1A 3FVRA 1K6EA 4BDSA 3PE6A 4LKOA 2J4CA 1VE7A 3WK5A 5CMLA 1XKLA 2OGSA 1D07A 3ESDA 3GUUA 5ALTA 5JASA 2O2GA 4K6KA 3AJAA 4BAZA 1A88A 5F4ZA 4WDRA 4P92A 5IVIA 4C4XA 3PUIA 1QFSA 1CUUA 2XLBA 3I6MA 1LPOA 4BCDA 2OGTA 4UBOA 3DNMA 2QR5A 4J3JA 4FTWA 2JEYA 4U2BA 3QMVA 2O7VA 4G1FA 4MQLA 4M0MA 2UZ0A 4C87A 2IX9A 3OPMA 5C7YA 4G9GA 1ZI8A 2PSFA 5LZ8A 5D3KA 5LKRA 2BKLA 1MPXA 5FXMA 4RE5A 1H2YA 5CXUA 4Y2QA 3W06A 4P9NA 2B20A 4B80A 2XUHA 5LYYA 2XQGA 2VJCA 5KREA 1DWOA 3BJRA 1M33A 3C5VA 3VVMA 2XUDA 3A2LA 1CR6A 3I2GA 3O95A 2XUKA 4E15A 1UFOA 3LIPA 1LPNA 2B61A 4Y7DA 1U4NA 2XI4A 3AIOA 2C5FA 4HAIA 4IHAA 3G0DA 2OCLA
chains in the Genus database with same CATH superfamily
3QHQA 4RADA 3RVNA 1XD2A 3IR5A 3A2KA 1XU7A 2YS7A 4BPBA 2CEAA 3EZ2A 4R40A 1W0JD 2RGEA 3JQDA 3UB3A 2JI4A 3DEZA 4BECA 4EI2A 4BLRA 5FTLA 5EJFA 1LX7A 1BDJA 4OH1A 4OU4A 2ZRHA 4D74A 3H4IA 3LUGA 4UPVA 4OSPA 3PU6A 3PQEA 1OWLA 5KVCA 3OG9A 4LGYA 3GGGA 1QRTA 1ZL0A 4J2TA 4TXHA 3AF5A 4Y6RA 3M1AA 3D7SA 3A6EA 3KYDA 5K0GA 4ZQBA 3NT5A 2MYNA 2OQIA 3FJOA 4IIYA 5MFZA 4IIUA 1N6HA 3H4MA 1DWUA 1XVLA 3MWEB 4F3RA 2D4AA 1N5IA 3B20A 3NTXA 1N2XA 2P7HA 1JTFA 3ADOA 3W6UA 2FG5A 4X64B 1FA9A 3L18A 2VA8A 2FE1A 2GBLA 3OA0A 3QXJA 2E37A 1B15A 3JQ8B 4RGBA 7REQA 3BHNA 1E9AA 1QH1B 3D7MA 2I99A 4I8IA 5AKYA 3J7AC 5B5SA 1O0BA 4I9HA 3R9WA 1SXJB 3UFXB 1CERA 1WW3A 2BEWB 2VNSA 2I2XB 1OUMA 4BBPA 4G97A 1M2OA 1JSXA 4L4RA 1XF1A 1YC5A 2I8LA 1RHMA 3U48A 4XRGA 1VSUA 1ESEA 1KS2A 1RC0A 2VFAA 3I32A 5HF9A 3C7AA 4EHBA 3OY7A 4N3BA 2XE7A 4ROSA 2AF4C 1HE3A 1QOPB 2X19A 4GGPA 1AF4A 3T5GA 1XXHB 5D86A 3L6OO 3F1KA 2IYWA 4QUHA 4CL3A 4XYLA 1Y8ZA 3ZGOA 4X9XA 1PEYA 4M2LA 3KSAC 5K8CA 1QB8A 1P33A 4G4SP 3VX4A 3SICE 1CNMA 2FPGB 4RHEA 2XVZA 4LPSA 4MS3B 1SK8A 4XA8A 5GM1A 2XLCA 3U4QA 4S0XA 3EZYA 4G5OA 3KOYA 4FGSA 3PKIA 3S44A 3SJ7A 1A77A 2I67A 3ZHBA 5I48A 3JQBC 4UC0A 1DQPA 4GWLA 1T6NA 4E32A 1W5EA 4ZVUA 2ZIEA 1IB0A 1UC4B 3FFAA 3I1YA 4LG1A 1RZ3A 1H93A 1HQDA 2QZ9A 1ZSYA 1LDGA 2ZWIA 1U6JA 3GLHE 4L27A 3RS0A 3IAFA 4MYCA 2G5PA 4II7A 4MV9A 3ZEIA 5IAAA 1R6BX 4RW0A 1P4GA 2GN8A 4AN1A 4F9TA 3HDJA 2O48X 4MV7A 4YXWA 1M73E 3IURA 2H4JA 2EWWA 3G79A 2ZTMA 3OZTA 4RKWA 1T8UA 3JTMA 4YDHB 1PT9A 1AUOA 4RU1A 4P7FA 5EZ6B 4EK9A 2OM2A 4ENPA 2J7PD 2X77A 2C3OA 4C1NA 1TCVA 1YONA 1YJXA 1U65A 2ZDHA 1RI2A 2RKOA 1SXIA 4MTCA 4D8UA 4MWZA 2DJ5A 1RXUA 4GW3A 2ZWOA 3NWOA 5JD3A 4IY1A 3ZNPA 4IDBA 3LG2A 3LQ1A 4M7PA 4BFTA 2YN2A 1QONA 4E4YA 1SHZA 5AM1A 4M55A 2GBIA 1YR2A 1AKWA 2HIHA 2YHAA 4X00A 5JLAA 4L9WA 4F71A 1DRVA 1XEWY 2XUIA 3K9QO 5FWNA 3NBXX 3NM4A 1AVTA 4K05A 4GOXA 4V0KA 3KSZO 2EJVA 4ZQFA 3IPYA 4Q4JB 1UMBB 2XXJA 4ZJPA 1IUOA 1S3IA 1P77A 5EKTA 1FXUA 4BB5A 2AI2A 2I4NA 2BFCA 4PC3A 4W1QA 4E5YA 4OQEA 4ENVA 3DOFA 4BQSA 1VL2A 2QQGA 2GN2A 1E77A 1MPTA 2WSMA 4KV7A 4MDYA 4KGZA 1S96A 2OLKA 4L2IB 2W2KB 3JD2A 3M6IA 1HDXA 2FZGA 3ICCA 3HFRA 1SCIA 3OFNA 3FDIA 2AQIA 2J4DA 2IQIA 3PQCA 5ALVA 5CITA 1PGPA 4C89A 1QQ7A 3O26A 3W7AA 3ST7A 3GQBB 2HJWA 2OCKA 5AVSA 3KQKA 4D26A 1GKLA 4Q93A 3W5DA 3KJZA 4BFWA 3BFJA 1A9XA 4JBXA 3UENA 2FX5A 1KI8A 3HE3A 2QENA 3E9DA 4HL6A 1F0KA 1FNBA 3QX9A 5HEKA 1P17A 5BMVF 4Y2HA 4C7OB 3LQFA 2WNIA 3KEFA 1YVEI 3ABIA 4BHTA 1P1BA 5KOHB 4LF8B 1FUYB 3ILYA 4AYTA 1C4XA 1R0ZA 3G0CA 3KJGA 1K8YB 4TV9F 4TV8F 1J25A 2WHPA 1FDOA 4NFHA 2JLBA 3CONA 1XTSA 3T5BA 2XKAA 3NNDA 2B92A 4JB0A 1L7EA 3VHLB 2PRIA 1P5FA 1B93A 4AF7A 4HYYA 1EA5A 2RGNA 1S89A 2FFRA 1JRLA 4DC9A 2CFRA 1F8GA 2B30A 2JA2A 4D1YA 4HJRA 3HBJA 4QXRA 1A76A 2I4IA 4UHKA 3PC8C 3GT3A 2WB4A 3PGMA 1S8NA 2NU8B 1T26A 4MV6A 3TSYA 2WUDA 3SG0A 1WQ3A 4GE0A 3BD9A 4LGCA 2NIPA 4GE3A 3HGQA 4YNBA 1JLRA 4DANA 1PR9A 3ZXSA 1GZUA 2QBYB 4ZKDA 1X14A 4KMOA 1DBWA 2CF5A 3VKWA 5CA0B 4AT1A 1OU4A 1TO1E 2KQUA 3U4IA 4U9IS 3JAKB 3HTXA 2OHVA 1FTYA 1N2CA 1U7OA 4WN9A 3SKYA 1VMKA 1FQOA 3MZ0A 3UM9A 3SZUA 1RP1A 1QHHB 3E18A 5LNK6 2VPZA 1IHUA 2WJGA 3LFTA 4J7AA 1VLMA 1C3LA 1IY2A 1NZJA 4FNGA 1Y5RA 2XCIA 1OT5A 7MHTA 3DAGA 3PNBA 4M1SA 3SQDA 2XUZA 4MUAA 2ODAA 4POAA 4GX0A 2RI0A 3JR7A 1KEPA 1JZSA 1O95C 1OTHA 1VI2A 3H8WA 3MM4A 3IP7A 4TMWA 4Q00A 1R4AA 4JJEA 3I9LA 2G4CA 1WDLA 2Q6LA 3O8QA 3REGA 2YNMA 4RTLA 1ZS9A 3WL5A 2J32A 1E6MA 1UDWA 2JIDA 1OXTA 4NI5A 5CU7A 2BSQA 4E1AA 1UBLS 3EVDA 2FQYA 3VJMA 1QZUA 5L8VA 1QTQA 4JR0A 3V4OA 1BFKA 4RK0A 1X1EA 5BNWA 9GPBA 4ZI7B 1J21A 1VZ3A 4OYYA 1S2MA 4BEVA 1AN9A 4GYKA 1JDPA 4F04A 3P9NA 4UE3S 3OHPA 3RV3A 2I6SA 3EDMA 2POCA 1X9IA 2JFYA 4ASUA 1AK9A 2GYVA 5FTNA 1EFRA 3C8UA 2BEKA 3W2IA 4EHLA 7YASA 1H2FA 3FCYA 4NJMB 3EF3A 3UWSA 3H1GA 2IYFA 3MNFA 2BI4A 3QI2A 1WB5A 2RGBA 3RFFA 3TH5A 3LNTA 3WLQA 3VI3B 1OC4A 4A8PA 2GNOA 3NJRA 3PFKA 5UKDA 3FYUA 3OOWA 1ZQ1A 4OHPA 4QEDA 3LBNA 2CDNA 2XZPA 3K6JA 4H4EA 4ENQA 5K8LA 1RWQA 3KUDA 1JKMA 3N0WA 4QNRA 1NDQA 1G66A 3DZCA 1BXRB 2QD5A 2O06A 2PBZA 1MT3A 3K20A 4Y6SA 2M1ZA 4MA4A 5CLGA 2YTZA 4ESVA 3GUVA 5B6JA 5CG2A 2VK1A 3T0FA 1UJMA 3BWXA 3N2LA 3MG9A 4CNBA 5EXPA 1I3CA 4YHHB 1A50B 2DB3A 2GQ0A 3ZEAA 3S0JA 3DA8A 1RBZA 1XMOB 1CPYA 4DCTA 1UKYA 4IWNA 5E7JA 4YONB 3VX3A 5GTDA 3D8UA 1KDRA 1L5VA 1ZMXA 4TZKA 3KOWA 4ZALA 1G8HA 2Z3VA 3DGEC 4GH5A 3SJUA 3CVOA 4UJ5A 2WFMA 2QMOA 1E7QA 3GI1A 1Q83A 1RXEA 3NNNA 3WKCA 3H5LA 3QEMB 1L7MA 3LW8A 1YVPA 1CEEA 2CCKA 1KYZA 4ZPJA 2GERA 1SQ6A 3RVDA 4QXPA 4P86A 3TGLA 4BNJA 1B16A 3AETB 1NN1A 3VNBA 1Q7GA 1NSYA 1K7YA 1NI5A 3BX1A 5D84A 4XLTA 5IAKA 3TNJA 2BKVA 2ADFA 3KQQA 4LWOA 4P2GA 3NBKA 1RQPA 5EFOA 5K0FA 4D4JA 1TQDA 2Y2VA 3PFCA 2ZQ5A 3WLOA 1C9EA 5ESRA 2OCGA 2PZEA 5A71A 3FOCA 4EB6A 2YWGA 3C8ZA 3JZAA 3S99A 1DBVO 2QAGA 4DBLC 5LD2C 4ZJYA 4BWYA 1V8PA 1Y5LA 5IANA 4NDZA 4H16A 1XTRA 1SELA 2FJ0A 3OU7A 4GXQA 2HWWA 2OYRA 2OCIA 1MTZA 5CH8A 3PDUA 4HLCA 2XA1A 4RIFA 4ACAA 2QLLA 5LU9A 1N2GA 5EQDA 3C5HA 1JKJA 1QRAA 5BW8A 3PLAE 1HTTA 2Z08A 2P4QA 5P8WA 2XYQA 1PZNA 2WYVA 1N3LA 4MV3A 3KKLA 5BORA 2W4IA 1GY8A 4NZMA 4BX9A 4BNIA 4R84A 3RTDA 2EKBA 2CXTA 1QC5A 3X1XA 1PYDA 1TKAA 3KQTA 1IFXA 1IK4A 4D42A 1TGYA 4B84A 4BXOB 5JI2E 4OXNA 1UXHA 2GCIA 2XUGA 3BMOA 1NPYA 3W8FA 5AJZA 1T9HA 2AFVA 1ZDMA 1Q3HA 2B2CA 2JD0A 4L3OA 1DPFA 1TZ2A 4WNIA 3PYXA 5TPZA 3PXCX 2OWDA 2IEGA 1KVRA 1U6KA 2O0LA 4G0YA 1M8FA 4CR6A 1E2NA 4O2LA 2P2YA 2Q9CA 4BKQA 4C2TA 4WN3A 4L95C 3T9FA 2B4AA 1FS4A 4AJOA 2NYAA 1ZK2A 2GILA 3DB1A 2ZIVB 3GMIA 4MGHA 1A8IA 1AGPA 2HK7A 3KVRA 3L5KA 4P32A 5D5PA 4CKCA 4XW2A 2CD7A 1G9SA 1C3JA 2YN0A 1FQJA 2D6FA 2PA0A 4O29A 5JTTA 1CD5A 1XGKA 3FMVA 2CK3A 1M1YB 2XB4A 2JGKA 2WT4A 1XB2A 1OASA 1TK2A 4YCJA 4MITA 2Q5QA 1WTCA 1UKBA 5SZIA 1M1YE 1P2UA 4GKJB 3C97A 3HUFA 3ZZUA 1AX9A 5LB2A 1ILWA 5DYTA 4WRRA 4BDTA 4ZIRA 3RAGA 3OZRA 2HQ1A 4TV9B 1TTPB 1CY4A 2DVMA 1KGSA 2GM9A 3G59A 3L7OA 2FMKA 3U6BA 4R2XA 3VR6D 4AZWA 5KNDA 1VA5A 5EJ4A 4J6FA 1R74A 4D44A 1NWCA 1W48A 3FCCA 4ZGGA 4UCFA 3ZDDA 5KVQA 5COQA 2H1IA 1TW3A 5EESA 1NW4A 2ZRMA 1W29A 5AXBA 5JSYA 4YYEA 3K6RA 3ABZA 3EPJA 2PKEA 4O08A 4X1IB 3FTQA 1UJ2A 4C29A 2KBEA 1E6LA 3EQ2A 2IV3A 4FXOA 5LQMA 4B44A 1WUTA 1I36A 1JEQB 4QBFA 1XOIA 5IMBA 3RS4A 2FP3A 3V2IA 1E1CA 3ICPA 2ISSD 3PKJA 1MABA 1K86A 4CMEA 2OFWA 4IILA 3HJCA 3U3XA 4ZV7A 3HLYA 1T0PA 3P9XA 5LBTA 3X2EA 3BERA 4K2AA 4RA6B 3NRBA 3F47A 3HZOA 4Z6KA 2JIQA 4AKSA 2O2EA 3V8BA 1KHHA 1I4WA 2C0QA 3GFGA 1KMQA 1I5RA 1Z4IA 4IIJA 2BEUB 4ND8B 3JASB 1NJSA 4Q18A 5JSHA 3TFOA 5F9MA 1JVSA 3QWIA 4IUCS 1KOLA 3ZXYA 4C04A 1TK9A 3FF4A 3FBGA 3O73A 4MVJE 2JFGA 3U4HA 1V5IA 1ZK1A 1HL7A 1A9QA 2WSIA 3I0MA 4OAPA 3QTTA 1DUVG 5FI0B 3DEYX 3QKUA 4NULA 3HWSA 5CEFA 1I33A 3MB8A 5ECWA 1NTRA 3JAMA 4LC9A 2DUWA 3OLQA 3LUHA 4XVRA 5AT1A 5B7GA 1ADBA 4P3KA 5F5LA 3NCHA 4TS4A 1T1SA 2NV0A 1WY7A 1YT5A 3AUXA 2SECE 4UAJA 3H5AA 2EATA 3A9SA 3CHYA 2VYFA 3EPRA 1HF3A 1K4YA 3CEAA 1ORTA 3PSAA 4WH0A 1CHNA 5AVKA 3EDYA 3VQTA 1P9LA 3R5SA 4MKXA 1WQ4A 3IKJA 1V4NA 1P0IA 3GJZA 5IUKC 3ER9A 3P8ZA 3VUFA 1GZ6A 4JLDA 2C9BA 2NPIA 1NVGA 5CM2Z 1JI3A 2JF0A 2PUWA 4Q01A 3RIMA 3FPHA 1ISJA 3TMKA 2YWFA 3GGDA 4KYTA 3ZOZA 1E7MA 3WWOA 2C5SA 2IDKA 3VVCA 1P45A 1AT1A 2IHUA 4M53A 3FRHA 1J8QA 1CY8A 4I36A 2JBAA 3KKPA 4R41A 3NC4A 2IHZA 4U2GA 4ZRNA 3A6GA 1NHGA 3IVCA 3LTEA 2QW8A 5JNUA 3MCZA 4RTKA 1U63A 3D7LA 4P98A 1KI2A 4LW8A 1P75A 1QLWA 4ZAWA 5GPBA 3ABOB 3GUCA 4L9SA 3VU9A 1GR0A 2V6GA 1K7CA 3OTGA 4G63A 1TPYA 3EAQA 1THTA 2O8NA 4D9JA 3TLBA 1JEEA 3FPEA 4JOSA 5IXJA 4IGEA 3KWFA 3UJ8A 2DEUA 1KL7A 2IXBA 1KH2A 4M1ZA 2G4LA 4NZZA 2QTNA 2B9VA 1X1QA 3CINA 3LH5A 5BR1A 1BN6A 1RLIA 1T1RA 2YFYA 1SKAA 2C7VA 3KFXA 2HEGA 3FM9A 3I76A 1N6NA 2MT9A 2AD1A 2EBUA 1PZXA 2QTLA 2WKPA 4OFBA 2OKGA 2JKZA 5DU2A 5KKAA 2BEWA 2JLYA 3G2NA 1ONSA 3BYZA 4B71A 4FYMA 5E95A 4JXJA 1GNVA 3T4UA 3CRQA 4A26A 5K9ZA 2UYQA 1E9BA 2W2KA 4PINA 2CCJA 1MVOA 1ZX1A 2VPTA 3C8MA 4MB0A 4BJ3A 4KXVA 5BW5A 2JASA 1Q0UA 1KZGB 2WIBA 1QQAA 4F6RA 1HLDA 2QIPA 1WDWB 2GCGA 1FFHA 2KBFA 3RVQA 3I5UA 4EX7A 3VR4D 5ICMA 4RZ2A 3K0EA 2EX1A 3MCAA 2Q4TA 1IMJA 3O75A 3P19A 1SQ5A 1ABBA 1K2WA 4GM0A 4GR4A 3HHPA 1HE2A 1GQQA 3ELBA 5AW4A 1WE2A 3BQMB 3EN0A 4AY3A 3A4LA 1LTKA 1HURA 4IJMA 2REXB 4R2KA 4RZSA 4I4CA 4ZYUA 2XVXA 2C78A 1IOZA 2VDRB 2RC5A 1UFVA 1KK0A 1UQRA 2BFAA 2Y92A 4L6IA 3RRYA 3STHA 3TTWA 5JYBA 3PP8A 3DXZA 3KYJB 3DR5A 3ETJA 3WGZA 3THRA 2W43A 2JFZA 3IVMA 3RS5A 3TTXA 2AOTA 3EWIA 4F5EA 5K3OA 2PZJA 4OQQA 1ZIOA 3Q0EA 3L8YA 5T4BA 3TNDA 4BKUA 4GL2A 3X1WA 4F86A 1HG0A 1HNNA 1REQB 4P93A 1E2GA 1QS0A 2W0SA 1G3RA 4JQSA 1IHOA 1OH5A 2OCAA 3DF7A 1A82A 1Z16A 4GWGA 1K6XA 4FKBA 4JCOA 1ISMA 1OZHA 4KXXA 1DAGA 4ZO4A 1YS4A 4DV5B 3CUYA 1V11A 2QKYA 1VCNA 4LNHA 4REQB 5DGHA 1H4TA 5DWDA 4B43A 2ZYRA 2IFTA 4E3ZA 2X41A 5H02A 1UMCB 5BNTA 2ZRGA 3FX2A 2R1TB 4DUGD 1IYZA 2YXDA 3GRKA 4JELA 1EWQA 4NZNA 2ZYUX 1VMAA 3NX4A 4V02A 3VR5A 1Q44A 4KIGA 5CJJA 4QTYA 2WSSD 1IIRA 2EL9A 3ZBTA 3LDFA 4RPCA 4GFDA 1MUUA 3WLPA 1D6JA 3B6IA 3BE4A 1NSFA 2BMJA 2FF7A 3LLCA 1WHTA 3H42B 5AOAA 4CLRB 5ANRB 3VJLA 3OFKA 4ZT5A 2HIAA 3E27A 2R0QC 5K0LA 3LSYA 3HA2A 2DQSA 4EUNA 2XHZA 2EV9A 3BBPA 3DSRA 3V97A 4D6XA 2WD7A 2H9AA 2LR0A 2P27A 3PHJA 4AMBA 1P7ZA 2QMQA 3K0AB 3B7WA 4FE3A 2BFWA 1BEZA 1PYOA 3K0KA 1ZI9A 3O38A 3QF7A 2A1UB 4J3NA 3ME5A 2RGCA 1RCFA 3R0QA 3R77A 1SXGA 3TE7A 5H0IA 2C2YA 4AXBA 4DQUA 1Q7RA 4J0KA 5BRJA 2DERA 1YR9A 1Y8QB 4BGVA 1ECGA 4LXUA 4Q7EA 5AK4A 1H2AS 1Z5WA 3K9GA 5G0UA 3T3NA 2Y0DA 1NLMA 2OBLA 4UNNA 5DV9A 3U3OA 5EWMB 2ZIXB 3KLPX 3OURA 5DF1A 1RJGA 1W0KD 1IRXA 1EX6A 2Q3LA 3BVPA 3RF6A 2ZR0A 1M2VB 3AEQA 4ZAFA 3PNVA 2R4UA 2AUNA 1C3OA 1ULBA 3COZA 3GFQA 4TWRA 1BKDR 5EWLA 4ZT6A 5CIQA 2IHVA 3DVAA 3S2ZA 4BVFA 4C01A 4NR0A 3VYSB 2IYZA 4NYMQ 5FWDA 1MAHA 2ZVPX 4L6CA 4XIFA 4DV4B 5LLDA 3HXPA 4HRVA 1YCHA 2YJ6A 3MQ4A 3E9NA 1CJUC 5DNEA 5EJMA 3DO5A 1WB6A 8GPBA 3UJNA 2E1RA 3N0RA 4MKGA 3OAAA 1OH8A 1JVNA 3CX4A 1SBCA 4L76A 5K0BA 4BTLA 4RK4A 4IS3A 1T24A 2WILA 4HQ0A 4U7WA 2XGMA 3ANXA 4HRXA 4FMPA 3F67A 5H59A 5DM1A 3OZ7A 1IQ0A 3WTBA 1KC1A 2BJWA 2WB2A 2FX2A 1QRDA 2GJ8A 5C35A 2AR7A 3LS2A 4B75A 1LA2A 3B38A 1JF8A 1CF9A 1DLIA 4GXNA 3WNBA 4N40A 3NU1A 1JQAA 3UHFA 4COOA 3FMPB 1F8UA 3WOHA 3FHLA 2H8KA 2F00A 2XDYA 2ZXFA 3PITA 4AN0A 2DPGA 4B35A 1WXEA 3IEKA 4GOMD 1X92A 4DA0A 4Z7OB 4Y1RB 2ZJBA 3WGGA 4BV3A 1KYQA 1STOA 2GJAA 2QD3A 4I5FA 5GQSA 3M6MD 4OMDA 1H85A 4UD2A 1MRSA 3IUEA 3JVEA 5AW7A 5JNVA 1O8CA 4PIVA 1SVWA 4PZEA 4KBFA 2BT4A 3GDWA 1FU4A 4EJSB 2HK8A 1MJNA 3JQFC 2GKOA 3W1VA 3HLTA 2ZJAA 1D5CA 1UJ5A 4PYQA 2XR1A 4FGZA 2M6KA 1A7KA 1AGXA 1Y33E 3SOZA 4RSGA 1CY6A 5JSZA 1D03A 3KSBC 2IV7A 2FEXA 3TINA 1YKFA 2WTAA 3EIUA 3UA4A 2O1XA 4OLAA 1NM5C 1I3OA 2PGAA 3OF5A 4UASA 2CY0A 1QYRA 1G1MA 1JFLA 4MVJG 3UJCA 3QX3A 3Q85A 1I5EA 2EDAA 4QAQA 2GCNA 4W7IA 3A6PC 2WIKA 4UKDA 4GZ5A 1Z29A 5FHQA 3VH1A 5IZ4A 4W1PA 1U8CB 2Q1UA 1ELOA 3JD0A 3EEYA 1U02A 3F4BA 4B3XA 4FDUA 1W9HA 1J0EA 4QQFA 2QLTA 3FYTA 4CMHA 4TMYA 1H65A 4W5QA 3WL8A 2BGRA 2CXPA 4B6EA 5HOQA 4RMJA 1W52X 1Y81A 2GBFA 4L5BA 4OYHA 4ZCIA 3BE6A 4BWGA 4URWR 5KNCA 2PD3A 3PHGA 5HM6A 4U7FA 2FZ4A 5JNWA 1JDVA 2PXAA 4BLOA 3KWMA 4GNRA 3KQWA 3R7LA 4IWXA 5K0ZA 1KRXA 3IUPA 1MAUA 2WHXA 2VHTA 2ZWMA 2OZKA 4Q7LA 3DC7A 1W8IA 2JAUA 2FEWB 5C37A 1DZIA 1XA3A 1ZIDA 2DHDA 5IPFA 2Y67A 1B3BA 3O3CA 1GCGA 2Q5LA 4OA5A 4YMIA 3RREA 3T4XA 4NG5A 5JNRA 4DJJA 1CQJB 3FBTA 4GP6A 1NW3A 4I55A 5L3QA 1GTG1 1VKHA 4X20A 4QLBA 3NT2A 3H05A 5FPQA 4M0PA 4EI8A 2DT8A 1U8FO 3E9ZA 2YYAA 5JAHA 1N78A 1U1IA 3T7JA 1QF9A 4G65A 1MLDA 3PR3A 3QUCA 3CF4G 1D2RA 1K88A 1UQUA 3Q40A 3FNRA 4J1TC 1E89A 2DFLA 3C6YA 3FF1A 3OZEA 1MIOB 1T25A 1WF6A 2R9VA 4M37A 4QC2A 3NWPA 5HPYB 2FPWA 3GJ8A 2ZK7A 3LT4A 4KX3A 2XD9A 4NMXB 3ZHYA 4H4CA 1W0KA 3IGFA 1W93A 2ZXUA 4Z4EA 3I12A 1G7TA 3MTQA 4B79A 4Z53A 3W78A 4YEDA 4PWYA 4DZZA 1QYCA 3PWSA 1YS7A 4L4ZA 4BMYA 3GMDA 2X7JA 1RJEA 4NAHA 1FFCA 1N92A 5BYAA 1DKOA 4HLUC 2Q62A 4DIDA 4FOSA 4QUIA 2CJWB 1YTLA 1VRVA 4YAJA 4BQRA 4CPDA 5E7MA 1LJUA 2WF8A 2OHIA 3C3CA 2X40A 4KACA 1WJGA 1WU7A 2GPNA 2O3QA 2PZKA 4INJA 2PKRA 2QTHA 3MMPA 3DZGA 2FPGA 2DF8A 3G13A 2Q41A 3I30X 3KHKA 4C05A 4C0AC 4CV2A 1D2CA 4HCJA 1KQ3A 1O58A 1KBQA 1SO8A 4J6EA 3RS2A 4BB6A 4Q3OA 3A9CA 3X2SA 4DBVO 1TO6A 4QOJA 1SJ9A 3K96A 4CKYA 1QGDA 4OJQA 4LF7B 4KUGA 2G8NA 1NYQA 1B42A 5KAMA 2QRNA 4KZKA 1Y9JA 4BEBA 1V3QE 4I2NA 3GLKA 1AZTA 1XL1A 3FJ1A 3IDZA 4KX5A 3RTEA 2EAUA 2YBDA 4F4HA 5CUQA 3QTLA 3NM5A 1WNFA 2P65A 3OM1A 3BL8A 4P81A 2ZYHA 1R0YA 4QOGA 3SXPA 4E7PA 3ITDA 5AD1A 4D0SA 2WWWA 4M0EA 5IJXA 3GNTA 3FUCA 5BNIA 3P0RA 4U6NA 1R6UA 1RHQA 2AVNA 3HV0A 2IEYA 3R3ZA 1Z17A 3W8NA 1NN0A 3GLHB 4N12A 1SCUA 4CEJA 2HDOA 4O6VA 1PBNA 1N7IA 3L6CA 3P0IA 1M8GA 3HY3A 4PR3A 2D5CA 2Q3FA 3AR7A 5GONF 4QGBA 4QXOA 5B3JA 2ZVJA 3PNKA 1UP4A 1X3SA 2XYVA 5BVHB 2C0PA 2CUZA 3WHIA 2HWXA 4BP8A 3NDBB 3L9XA 1X74A 1T8PA 4Q9AA 5CDFA 2VJPA 3UAVA 3WL3A 3WK8A 1C8BA 1M34E 1NMYA 3AW8A 1FZTA 3LOUA 3C0KA 3GELA 4U5XA 3T1NA 4TXMA 1GQYA 4O4LA 3R8XA 3GOQA 2J3IA 1C8VB 4HNSA 4CQLB 5F3WB 1BCRA 4RPLA 4JEHA 3U80A 4F96A 2EFCB 1XQXA 4MV8A 4UCQA 4CDMA 2E4XA 3L7JA 1GSOA 1E1QD 3CWZA 3U56A 3SXJA 1EUYA 4FYIA 1EFTA 5BPFA 3AT1A 4F8YA 2BPOA 1CUSA 1C9KA 2BFCB 3NAGA 1GFZA 1CB7A 3GVXA 3I83A 4K28A 3KC2A 3USES 5JJKA 4EF6A 3TPZA 3GBPA 2AT1A 2P6MA 1BX0A 4NH0A 4IMJB 3QK7A 5HF6A 1WZEA 1JG3A 2W71A 1NG1A 4HAZA 3KU4A 5K1ZA 4A82A 4I3FA 4RA9B 3W05A 2P9CA 5TLSA 3VJRA 1ISHA 3T3PB 2P40A 1MJHA 3AHCA 2NNLD 4PYKA 4DPMA 2IX3A 4JZYA 3PWKA 4KK3A 2HHJA 2B94A 1DAOA 1S9HA 4Y98A 2VZEA 4TMVA 5IARA 1SG0A 2DUJA 4FMDF 5F2KA 4MRVA 3CCCA 3SYRA 3WY9A 4AKEA 3Q8LA 5BRAA 4RJIA 3JWHA 1JMYA 2YCLA 4MVJF 2WWYA 1ABFA 1RBMA 5J4LA 4JGBA 2QRJA 1NFRA 4OQLA 1DL5A 1KFCB 2YFQA 3G5MA 4JVSB 4LPKA 4LRXA 2RIRA 2VAVA 4FWIB 4NBWA 4B3HA 1B8PA 1MOPA 1PR3A 4Z9BA 5AW2A 4JFAA 1N3BA 1R2QA 1X7HA 2BHNA 2WWXA 3NP7A 1ZSVA 4KDRA 5CFLA 1L4NA 1QK3A 4U3JB 2E4VA 2J4FA 3E9EA 5EKDA 1C29B 3TQQA 4ESHA 5F35A 5LXTB 3VO9A 1YQUA 5T6MA 1ZCJA 2F3QA 4NSNA 2ZJ5A 2BJVA 2JL1A 5HCNA 4DG5A 1NDUA 3LY8A 2B21A 5FRDA 5KEIA 3FGNA 5DLYA 2EJBA 1YB1A 1B26A 3DZ8A 1U0GA 1VBNA 1XEAA 3IBSA 3T38A 3OKAA 4F8EA 4NBSA 1UAAA 4EEKA 2WDPA 2QW1A 1XCLA 2O2JA 4JSRA 4S1NA 4KAFA 4CL2A 1B2LA 2R8OA 1H4SA 3M4ZA 1V43A 5ARBA 5F2NA 4V24A 1G21E 2GZRA 4ZYLA 4NS1A 2OE2A 1CF4A 4GBMA 3QWAA 5K3FB 3AY6A 1T6ZA 3UIEA 2FGJA 3FNIA 1EWKA 2C0CA 4QTTB 4EMTA 1W75A 3EA5A 4R51A 5E1MA 3C3WA 1M2KA 1XFAA 4M1OA 2F48A 2OHOA 4NWIA 4U39A 4YV0A 2GB4A 2NTJA 1XU9A 2IY8A 2WHEA 4NK4A 4CG2A 2VDUE 4EELA 5EPOA 2DPMA 1DEXA 3FOWA 4N65A 4RHTA 3RVPA 2PMWB 4WLNA 3TMYA 3OTOB 1PHPA 4IEEA 4N5HX 4OMUA 2GEJA 4YASA 4IXWA 1XHEA 3RYTC 1XN4A 4F2HA 1UBJS 3QLEA 3FOEC 5TR9A 3EGEA 5ALFA 1USWA 1UK8A 3AETA 4LDNA 1EJBA 3LPMA 3OD5A 2XUPA 4BFUA 1GTRA 1OTXA 3O2NA 1L7NA 3G1TA 4AIRA 4EMSA 1ZINA 1AUQA 5JZ9A 3HKEB 5B1DA 4D96A 2YOHA 3BOSA 3CA8A 4V1CB 2FWIA 3EMKA 4CR7A 2Q0QA 3C3PA 1KJ8A 3G8YA 3ZZNA 5IWAB 5F76A 4PHHA 4TKZA 3GZ4A 4DIMA 4DQLA 2VYCA 3BZWA 4M22A 4Y9DA 4EF4A 3THYA 2JZCA 2I3BA 1OZ0A 1J99A 1JB9A 2PU5A 2J5RA 4L0MA 3HCFA 4MVYA 2P7IA 4NJMA 4CIAA 3BA1A 4OQ4A 3RHZA 2WAMA 3LT5A 2Q6KA 4B4WA 2QU7A 1GSAA 4ZOLF 1Y63A 2QK4A 4Y2UA 4FFRA 2FY8A 4KQ2A 4LX8A 3ZZ0A 1OI7A 4OUDB 2HRZA 2QPAA 3MMNA 2JH8A 1PGOA 1JHVA 4J0IA 1T34A 2ZLBA 2CLSA 3IC5A 4NRDA 5C32A 4RVNA 5CT9A 4A2PA 5IC4A 2PAFA 2PKQO 1QKIA 3W3AA 4O4HF 1O96A 1AS0A 1JQBA 2IF2A 2OD2A 2AS0A 2R84A 4PIPA 4UNIA 3SX2A 3TPCA 5G41A 3OT5A 3ZWMA 3R74A 3U62A 1XZLA 1YNSA 1LZLA 3PRKE 4XD7D 4ICIA 5TRTA 5LQJA 1VHDA 4RTNA 2PTGA 5K6AA 1NXOA 4GQAA 5IAJA 2H57A 1YI0A 3DV9A 1ECJA 2O2IA 3JSAA 1H3EA 2PLNA 2QGZA 4C0QC 4WJLA 2XA9A 2ZJYA 3KKZA 2NU9A 4BNLA 3ROQA 5B3LA 1JR6A 3HM2A 2YICA 1JYFA 1ST2A 1G5RA 1V5EA 3INGA 4KLZA 3Q5GA 3ZVLA 3ZW8A 1JHRA 4KJZA 1OPRA 1P4SA 3KKKA 2C9YA 2HU7A 1I1QB 3U37A 4HYQA 4MULA 2GH1A 4RV9A 2PDAA 4H18A 2JGFA 4RK5A 2JRLA 4FOOA 5TJHA 3LZCA 2CEKA 3QOWA 2OESA 3K72B 1KH3A 4XGNA 4HN4B 5MN6A 5ELXA 2H65A 4HB2A 3N8DA 1OIXA 5EHQA 4J7XA 3UMFA 1I7SB 3UAWA 2ZU0C 4YMWA 1ZJJA 3RC3A 5IK2A 1SC1A 2ZB3A 4J4HA 1Z5NA 4C0JA 4A2QA 3K09C 4WFIA 4AIIA 3T54A 5HK9A 3WNQA 1A97A 4AFNA 3TW0A 1V11B 3B8HA 5GONB 2AQHA 3EGDB 2CZCA 1COZA 5AW0A 4NHEA 1EU1A 4LTMA 1VE6A 2QL6A 3PPWA 4TLBA 4LDRA 5IF9A 3GO4A 4G37A 5EYPB 3RIYA 3E1SA 3L8HA 3PGLA 4WFQA 4CMJA 2B2XA 1X1SA 4MZDA 3WK4A 2GZ2A 2NT4A 5BYBA 1D0VA 4GYJA 5BV0A 4PCLA 1MC8A 1HQCA 5C8XA 1YVUA 2GKGA 2QUAA 3WYCA 4XSGA 2BGWA 3D3NA 2QQEA 1D6MA 3L07A 1R0CA 4HADA 4DTIA 1JKJB 1O57A 1Y3DE 4IEFB 4PGMA 4LK3A 4PCUA 5E9WA 2ZIWB 5ENDA 5SZHB 1N6PA 3NXSA 2CL0X 5G1OA 2GRJA 3LY9A 4GC5A 4XAQA 1E2FA 4CGYA 4ND1A 5AVWA 1WKCA 1E1KA 1T2AA 1YRBA 3T3IA 5I7RA 5KSYA 2D0PB 2C1ZA 4D3SA 1Q0QA 4RPIA 3U5ZB 1HETA 1ESMA 3EZ6A 4FFMA 1DV2A 1QGAA 5DLQC 2ONZA 3DDHA 3GEDA 3JYPA 3K2IA 2VHWA 2Z8ZA 4XUGB 1Z39A 3EG5A 1BDHA 4H7KA 4TYQA 2OV6A 1DINA 4K3UA 2Q5OA 4C6SA 4B6PA 5KYWA 2PWZA 1SUEA 3A1EA 2WG1A 2H5LA 1X1CA 2V6FA 2WP0A 3BIJA 3CLTC 4HX5A 1SUSA 1KVTA 2A8YA 1C50A 2C99A 2X8WA 4U8GA 2VPWA 4LJ6A 4YRNA 4DOMA 2QP3A 2I4RA 3I9NA 1GTMA 5HQJA 2C3PA 2ILTA 3C8HA 5H3CA 2HWUA 1CP2A 2QNIA 3BF8A 3DFFA 1HDIA 3EULA 3MS2A 4L7VA 4OKIA 4DGQA 2FMXA 2UYCA 4HWTA 3J80A 4DWJA 1HZZC 4WXYB 4J9UE 5EP3A 3BXXA 1NRWA 4HH0A 3K70D 1IB6A 4KXYA 4TUYB 2QI9C 5G3ZA 1EVYA 1F0NA 4GBJA 3TKLA 3RTCA 3ELUA 1HL3A 1N7HA 4FE7A 2QR2A 4OB6A 4CFSA 1RVV1 3ASYA 5GVRA 2CGEA 3IAM1 5TS3A 5EJEA 1KEWA 1DO0A 1NQUA 1ZGCA 3QLVC 2G5GX 3I0ZA 4Z51A 1NAIA 3FWKA 2X0DA 2Z5LA 2PG3A 3R5TA 4X1IA 4FLMA 3EGOA 1M2OB 3SBDA 3C1OA 4V2UA 4MI9A 1DE0A 1RBYA 3MJRA 1QXSA 4AJKA 2R7KA 1J09A 2YWRA 3B13B 3SHOA 5K6AC 2ZUEA 5GVSA 2J8ZA 1Z07A 3GFPA 2VBFA 4IG9A 1E1CB 4KVFA 1ISPA 2ZIZA 1PJLA 1SXJE 4QUGA 4UU8A 2MU1A 3WNCA 3SKVA 4X6UA 5DYWA 2FZCA 4QHTA 3AHEA 4ZO6A 4C0XA 3H5WA 5FBHA 3BB3A 3C6BA 5A7GA 4TRNA 5A0FA 1MO2A 1L2TA 2VNKA 2WD8A 3EA4A 2C7BA 1I10A 3ANNA 4FINA 1L7RA 3WKDA 4BXOA 3HXKA 3AI3A 2ZJ7A 1PSDA 3L8ZA 4QULA 2BEUA 1TI7A 3G1WA 3WLEA 3IHTA 3K2BA 3RFXA 1HH4A 1XHFA 1M6YA 4C1BA 4S04A 3KPUA 1TKCA 3ZVMA 3TJMA 3W9SA 1HDYA 3CVWA 4NC9A 1GWNA 3I1FA 3PUHA 4BMCA 1I24A 4FR2A 1CR4A 3HRKA 3K09A 3Q3GE 4Q34A 1W7AA 2B4TO 4ILKA 4CN8A 4B3MB 1S1MA 3D2LA 3C4VA 4NU8X 2B2NA 2XNHA 4OOFA 1E1QA 2HCTA 1YE8A 3SEFA 4I55F 2DH6A 1CE8B 2NZVG 5THKA 3VR6H 3Q41A 1W85A 4LDZA 1F4VA 4BYMA 4WESB 5EWJA 3WDLA 3ZXUB 4IWYA 5PGMA 1BN7A 3ULKA 1ZC4A 3QYJA 2GAFA 4C6RA 5JPIA 1OV6A 2C5HA 3ZCPA 5BT8A 3R9XA 1ZKMA 2IQ5A 5H4GA 1CZKA 2GK6A 4ZVRA 4F3YA 5C46F 4K1LA 4Q03A 3BXOA 2IP1A 3E15A 3M9LA 3O74A 1BFDA 3R40A 1GAWA 1P73A 1Q1EA 4CTMA 1HK7A 1G9TA 1GQFA 2B7LA 2JI9A 2VSNA 1SNYA 1U3CA 4P4SB 3G9TA 1TAQA 3CSDA 4YP0A 3RGGA 5BRNA 4R71A 2WQ6A 4K9LA 4PNZA 1TF5A 1V41E 1DAIA 2EQAA 2Q1XA 3CZ9A 4RE6A 1JAHA 3TUIC 3WDMA 1LRKA 3D54D 4QM6A 2BFEB 2BDTA 4NV0A 1R5NA 3MJ4A 4ATNA 5SICE 1CDZA 1XQWA 1MQAA 4IFIA 5KTRA 1AF7A 4ZEOA 4O5OA 1T9AA 4XPZA 2R1VB 4RF3A 1TT5A 5ARCA 4OFWA 2CJXA 3TOXA 5B4VA 4QREA 1RC1A 2Q5JA 1ESCA 4UEWA 1SUWA 3JAWB 4I8DA 2BR5A 1GUYA 4N01A 5K8UA 2IPXA 3DTTA 2XCRB 1QKJA 1XCOA 3H19A 4CKEA 1UMCA 5J2TB 1YB2A 3G8DA 4HEA1 4WSOA 3CE6A 1OVMA 2VHYA 4MH0R 3QYPA 4ROTA 1NBME 2ABWA 5KTKA 1SXPA 3O9ZA 1OGYA 3ZHUA 2VBCA 1ZGGA 1ZL2A 2XGOA 3ZIUA 2AYXA 3O82A 5HDQA 5AKKA 4FWBA 1OSNA 4EFDA 1AUVA 2ECFA 5C4IA 1RWKA 2QVBA 5G02A 5HUQA 1YA6A 1HRKA 4GPZA 1XZ8A 1USUA 4OXRA 1SPBS 5IJZA 4AJ9A 1NBMD 5EVJA 1MB0A 1CHDA 1MN6A 3ANTA 3QFTA 4BMVA 3ESAA 4B17A 3A0RB 1SOAA 3NHKA 2AE1A 3S2YA 3CC8A 3ANLA 1QGYA 4G0ZA 3DW1X 4ER3A 2WUVA 4L0QA 3WLIA 4BPRA 3JARB 4ZHSA 3VSCA 2WYHA 2WLSA 3AO0B 1K8RA 1RWMA 4B83A 1KFBB 2NVUA 2WSLA 4Z0PA 3WMWA 5IUJC 4HC4A 4FGWA 2BH2A 3W1WA 1ZVKA 5CPBA 5HF5A 5KYKA 1GPJA 2ZYWX 1EINA 1IM2A 2W2TA 3COPA 4Y2XA 3UKOA 1U9ZA 1J5XA 1QG6A 2B6NA 1ULHA 3AEUA 5IKPA 3UXEA 2TSYB 1QUEA 1Z8DA 1JG7A 4I3GA 1WB4A 2PH1A 2VTBA 2O8CA 4BX8A 2IH4A 5CJPA 2X9GA 1OJ7A 1Z5ZA 4WY5A 4YQZA 4CKBB 1O6CA 1QIDA 2H59A 1I6MA 2PX0A 5DHFA 2IBSA 7MDHA 3TKYA 4F3NA 5AK0A 2P6PA 2HF8A 1ZISA 1HZZA 3DPIA 3TECE 4LXTA 4RCVA 4K40A 2FMUA 3K0FA 5I7OA 3LTNC 2PR7A 1TA9A 2E5FA 13PKA 4Q1BA 1RI4A 3SU8A 2HH9A 3OQMA 3QJYA 2IUFA 2YHBA 4JR2A 4KZPA 3U7RA 2EDCA 3GCDA 4AKTA 1HDEA 2PK3A 4B0OA 3CCFA 5HMLA 1XDDA 4UNSA 1CUZA 1E3SA 1QE3A 2HRDA 1I3KA 3JD3A 4NEHB 4UHHA 1ZSNA 2VXCA 3L93A 5JATA 3SFVA 3THWB 3VKUA 1EJ0A 4ZJUA 1L7QA 1KQNA 1J97A 5IC5A 4QU8A 1SUIA 3AEYA 1UDXA 2I33A 1YA8A 1G20A 2QN1A 1PJ8A 1EAMA 1VFNA 3OE7A 4NOMA 5HKBA 1RW4A 3FR8A 1WQ1R 4DNPA 2PV0A 3G02A 3UT5B 1RABA 3VR4H 5JO9A 3T15A 4CT5A 3BRWD 3IAXA 3K4HA 2ODNA 5LCXA 1TM7E 1WR8A 1ZUNA 2BZSA 2F67A 3THXB 3M6UA 2GUGA 3FXAA 1RTTA 4GWKA 5BOSB 3DLHA 3EVAA 4R5HA 4LJ9A 1QHXA 4F21A 1KORA 3DO8A 4CDRA 4O4JB 3ADDA 2BBOA 2NW6A 3GFFA 4OFZA 4G0WA 3ETEA 3HV2A 4KFSA 5EIWA 5LUBA 4DMMA 2IY9A 3NBUA 2I2BA 4EGFA 3A3YA 2IV2X 5DWVA 1JVBA 4JITA 3ZIAA 3G5LA 10MHA 2O20A 1NLFA 1M2VA 3AEQB 1C1XB 1QZXA 3DQZA 3L40A 3G6KA 4DV1B 4YMGA 1HLGA 3GJ5A 2GO7A 4H1VA 4UM5A 3HMQA 1XKTA 2OO7A 4BMXA 4MKHA 2IY7A 3T3MB 4R0VA 2B4RO 2JJMA 4PG4A 3GZJA 4TKMA 1BQ4A 4V0LA 2C8JA 1J2RA 4NATA 3E3MA 4HBZA 1GHTA 1BJTA 1TFUA 2PMCA 3CH5A 3TGWA 4ABYA 3PE3A 1TGVA 2YRWA 1P5RA 2AFIA 1NVXQ 1EEHA 3G2OA 3HB1A 4MS1B 3OD1A 4AY2A 1GPH1 4N3GA 3W9UA 3R0XA 3BRQA 4C7VA 1JJVA 4TLLB 4GXRA 5LQDA 3SMQA 3G5TA 3NEYA 3V4RA 1FSFA 4RJJA 1Z25A 2HBQA 5ITSA 2PSHA 4MGKR 3W2HA 1N6OA 3FUUA 3T41A 8ABPA 4JH0A 4YA6A 1BS9A 1C1HA 1Z0AA 3AY7A 4O3FA 2OK7A 4YJ2A 2XRZA 2CE7A 4MR8A 4TQAA 3C70A 4G1CA 4MUMA 1JNXX 3MMSA 2C4WA 4YUZA 2E5LB 2C97A 2IHTA 2IZ0A 3OOSA 4KNWA 5CVTA 4LJ8A 4ZWNA 4RVGA 3ZE7A 2FWAA 1UDRA 1TLLA 3P2IA 2OFOA 4UHCA 4KRXA 4X6XA 1UKVY 3WAKA 4X60A 3A6HA 2EYUA 4I55B 2ADOA 3GCXA 4X1OA 2BMEA 1V5FA 1U4OA 2CMHA 1RYMA 1YB7A 2RGUA 1JSLA 1KMNA 1CRQA 1KY4A 1PG5A 2V0NA 5E9JA 2HTEA 3S8MA 4CKWB 3E6AA 4DCVA 4EPWA 4B3RB 1X9HA 2HU2A 4W5HA 3Q6IA 1YACA 4DC1A 1CZNA 1TA0A 5F9HA 1NZDA 2RFLA 5IVDA 3HJFA 3B3FA 4HVCA 3OT1B 4FHFA 3WNVA 1X7YA 1H9CA 4HDNA 5JJCA 4XR9A 1XP8A 1K8QA 1VXRA 3GGOA 4Z5XA 1XF9A 1M2JA 3SLRA 2CXHA 1PDVA 4XXHA 2JA1A 3CLKA 2ZYAA 2BGUA 4AROA 2DKOA 2NYVA 2QN7A 5DGXA 5FPSA 1BHQ1 2C20A 1MOZA 3DB2A 2VDOB 2W8ZA 5GV8A 1M34A 5JRJA 1A98A 1GFIA 1ZUWA 3LVFO 5IULC 1JH9A 1EP9A 4NOJA 1GRRA 3W8DA 3I5XA 4YS6A 1TQ2A 2VRCA 3HB4X 3BMQB 2ID7A 2QJWA 3AZPA 5HCUA 1VL5A 5JDIA 2DJIA 3GLSA 2VQFB 4G2TA 4RQTA 4IGAA 4LV5B 1G59A 4KRFA 3VR0A 1IJKA 3IRUA 3PL1A 4DA6A 5BSMA 1M6EX 1T9ZA 2I3GA 2QUIA 3DAFA 3ZY6A 2HV8A 5JH7A 1CVIA 1USVA 1CIJA 2UUBB 2NVWA 3QI7A 5CDUA 5JZOA 2O2CA 3E5NA 3IAHA 4NJEA 5FP0A 1G5HA 1FUEA 1UWLA 2ZAMA 2CHGA 2W4QA 3SF8B 2AC4A 2XTAA 3PB3A 4UUBA 5JARA 1QHGA 5EP2A 3S2FA 3LKVA 4MP8A 4W5TA 2XODA 1EVEA 4OUDA 3H5IA 4NYJR 1EE2A 1SXJC 1M0SA 3WICA 4JX8A 4XWAA 3DHEA 3OM8A 2YBEA 3LRPA 4JU8A 1W4BA 4GSKA 3DQQA 5DP1A 5HR5A 1MB9A 3U3DA 1TEZA 1QAOA 2VPIA 4B7AA 4CMAA 2D0OB 3S1AB 5L4LA 1O6GA 4PO9A 2Y9PB 2XMQA 3S40A 1DAHA 2VP3A 5A5EA 4DPLA 1T4GA 1COWA 2W58A 3KRTA 2ODBA 3AI1A 5FNZA 1JIUA 1EE1A 1NXQA 2PL1A 3AK4A 3P5SA 3QPUA 4J03A 4DLLA 1YNOA 2NVOA 4C4ZA 3NAQA 1J2JA 1T1GA 2CHFA 4YROA 5C3UA 3NMUF 1K97A 4LCEA 2V6JA 5ARDA 1T15A 2VAWA 3GVPA 4J07A 3WIUA 4C0WA 2X5XA 4CODB 3B1KA 5FEUA 1A5AB 3I9JA 4QUJA 5EJ6A 2E18A 2FPLA 2ATIA 2IOHA 3GJRA 3WXMA 1XAHA 2FETA 2RJOA 3JY6A 2NP7A 2WK1A 1X7WA 3FDJA 3L82B 3TAUA 3W9BA 2EJTA 2R85A 2FMFA 3F71A 3GT4A 4H1UA 4S0ZA 3TEFA 3IXQA 3AY3A 1H2RS 2G71A 1H0RA 3GZNB 1ZCZA 1GRCA 2GBCA 3N8GA 3VV2A 4E09A 2CZQA 3SSMA 5B1SA 1RRVA 4CE6A 3N70A 2AEJA 2GXUA 1P7CA 2H85A 1M1XB 2QRUA 3N05A 3Q7EA 3QUSA 4HHEA 1DIRA 3E7FA 4EF5A 4GKKB 5CBPB 5LVAA 1NYRA 2CFCA 2XYHA 2O59A 1PNOA 1WXHA 2AQKA 4LSZA 2P6UA 3PZBA 1Y4AE 621PA 5HZHA 1YCGA 4FU0A 1AUXA 1PHRA 3HO8A 4POOA 1ZR2A 4CKZA 2JBHA 3GUYA 1C8LA 3BS4A 3D2CA 3N5KA 4KQCA 5FKJA 1G5IA 3FSEA 4F4UA 2FP4B 5JHHB 2XMBA 2MHCA 3MFQA 1QRUA 1GM5A 1G3QA 3K9LA 1AGYA 1ID1A 5T4HA 1YK0A 2YVKA 1H8EA 3F2VA 4N8EA 2VYQA 5INTA 5LWQA 1SK9A 3A6FA 3AP3A 3LLMA 2EP7A 4Q05A 4QKQA 3U7HB 3U5TA 1B00A 1YJCA 2HO4A 3FSGD 3HFJA 4IOMA 4ABTA 2AR9A 3DFUA 3TCXB 2WJWA 9LDBA 1Z12A 1U7ZA 3E9MA 1PAUA 3HABA 4LOIA 1LEHA 1RS0A 2Y6VA 4OQDA 3PUKA 1KI7A 1ZUD1 2HD4A 3ENVA 1F6WA 1VG9B 5U1PA 2OVBA 3V4FA 3HJAA 3UMCA 1PZFA 1Q91A 1SBNE 1NJ8A 1PD0A 4EDHA 4LXYA 2IH5A 2QPLA 3K35A 1CIVA 4DY6A 4MLPA 4FDVA 2Z2YA 3DMYA 4DCOA 3JQQA 1JZQA 3E22B 4R0MA 5JV5A 1J0AA 1D04A 2J45A 4IO1A 3CUKA 4LZAA 3UPTA 2QJFA 2I7XA 1QG4A 2V7XA 3MCUA 4D4GA 5A4FS 1NIPA 4B87A 1YL5A 3D8RA 4DJEC 3JALA 5EJ2A 1PGJA 1EFKA 5AVTA 1GSIA 2CFIA 5D87A 1NFFA 2BMDA 5JTUA 1N6LA 4KWTA 2VH1A 5EWJB 1UK6A 4CEJB 1ATZA 2XV1A 1YHNA 1BRTA 1EZ1A 1VOTA 2IIVA 2ZJOA 1O5IA 4R5MA 4M9ZA 4UULA 3T7IA 3OCJA 4Q21A 3ZWNA 5MN4A 2BMVA 4U7GA 4MRPA 4Q9HA 3LWBA 4GP9A 3TXYA 5LU8A 3GRYA 2GJ4A 2PBFA 2X8LA 4K6OA 3WGNA 4BAGA 5I3ZA 1XLVA 2FVYA 4YX9A 1ZCBA 2VQDA 3SQOA 1APBA 1C7FA 1U7UA 4C03A 2AZDA 2F43A 1NUSA 4FX5A 1A8QA 4MEBA 3RQIA 1G6HA 1N5MA 3IVRA 5IM4F 1DCFA 4YUAA 3IDQA 2YN4A 3CLRC 3DUFA 5I51A 4HY3A 4R81A 1MOQA 2HXYA 2PX4A 3MAJA 2IYNA 2ZYVX 4E5DA 1THMA 2CL6X 2POQX 2I03A 2WFAA 5LZ9A 2P8JA 4R4JA 3SBXA 4CT4B 2RHJA 1YZNA 4XGIA 4QDXA 5J59A 1YS2X 1FFDA 2HSJA 2QN3A 4K7JA 4MWCA 4TYYA 3ABQB 3KL4A 4YCBA 4R6XA 1X15A 4H1HA 4OHYA 3O83A 4CBVA 4F6RB 1WCWA 2Q49A 1CQPA 1PWEA 4WERA 3V8NA 1E62A 4FJ0A 4F60A 2CD9A 4EAAA 1NGSA 3MGKA 3EAFA 4TWZA 4QFMA 4C3UA 1QP7A 5DPMA 4QDKA 2WWRA 1GV0A 3F0TA 3NOOA 5KWEA 1O77A 5IVPA 4QXAA 5TGDA 1BHO1 3GUHA 3AVPA 3HP4A 4MO9A 5FL7A 3HFSA 3RRJA 3DBVO 3R3XA 4UNQA 4DM4A 4QUBA 3W77A 4A10A 3DV2A 1ZVMA 3NHZA 4CMKA 2JATA 1FTWA 3PA6A 3DAOA 4HGZA 4JJGA 4FX2A 2N42A 4CV3A 4DNOA 4DR2B 1PJZA 2GZDA 2AXNA 3JRNA 3GRVA 3KQOA 1CUAA 4IJKA 3V6LA 3BK2A 4DJTA 1J23A 4WZBB 1EHYA 5K2OA 3O4JA 1KYVA 3TRDA 1XQVA 1JQEA 1PUJA 5IFLA 3VA7A 4QEKA 4LJ4A 2A86A 3E35A 3E9QA 3Q6NA 2NZ2A 1IEWA 4OXXA 5DSXA 5JAUA 4DLPA 2XTZA 2VH2A 3HU1A 4PNEA 1PD1A 4IGFA 3GW8A 1J0XO 4W82A 1FYFA 4WESA 3SNHA 1KQPA 1JHXA 4H27A 4JWTA 5EMJA 3RYHA 5BQPA 2J85A 4E94A 5CDGA 3K2QA 4BFLA 1SHUX 5A62A 3H83A 2LKDA 1IHYA 2VKQA 5AESA 2OXRA 1JA0A 3OLVA 4YK7A 4IIBA 3TK1A 2Q4BA 5A02A 1TAUA 2EKLA 2QEQA 2VRBA 4AJ4A 1PW7A 5CDTA 1I9CA 3QX7A 3UZUA 4BJHB 3EX7C 1C7ZA 2IWRA 3ZTYA 4C30A 4ZI7F 3H87A 5T4FA 1VLQA 3HB0A 3P5BA 1RZRA 2OT3B 1N8SA 4OAOA 3W34A 4TWJA 3SYMA 2J0UA 1DCKA 4JBIA 3BIOA 5K8VA 1QVZA 2CYBA 1R8SA 2HDWA 4PG7A 2EF1A 2WAOA 3FNGA 4QATA 5DK4A 2C4HA 3RC2A 3TLEA 4OP2A 3DMRA 1Z82A 3GLFB 4ALMA 1L8XA 4K9KA 3O3MB 1GIAA 1U2SA 1S2GA 1TEVA 5L7YA 1KYYA 5FWYA 1GN8A 1N8NA 4K3VA 1NZFA 3KQYA 5JAQA 3L4EA 5HZGA 4JR1A 5K3SA 1SVLA 3ZS8A 1TJPB 2XJ4A 1ML4A 2CNWD 1KBOA 1W2HA 3MEQA 1JYSA 3M34A 4H3HB 4IXDA 4L51A 4ZOBA 5EYPA 4EEXA 1EK0A 3H1AA 5IT5A 2RARA 5BW4A 1G0NA 1NM5A 1UP7A 2VF8A 3MC1A 4YJ2F 4PYMA 3T95A 5KVVA 3CMCO 4D82A 4HV4A 2Q1TA 1O6ZA 4JSTA 4ID3A 2IYQA 4EJ6A 1EWYA 2X2PA 4M1KA 2Z4RA 3TRHA 3OEED 4Z49A 2EBWA 3IOCA 1DEAA 4E5UA 1GVNB 4HBGA 2FEAA 2QF7A 4Z8XA 4WKCA 5A4DA 2FPIA 4PEVA 5J1SB 5C51B 1NUTA 2FJUA 4IVPA 5EJ9A 3OQIB 4KQ1A 5GJBA 1P1FA 4PPGA 221PA 3PUVA 4JJKA 3RBAA 2HPZA 3ADPA 4I5GA 3RH0A 3OX3A 4LFAB 2HLDD 2WTBA 4ZQCB 5DTRA 4OBXA 5A9RA 2WSSA 3DEAA 4UDXX 2OL4A 1E2UA 3I1IA 3GGSA 1A71A 1DEHA 3EQ7A 4NAVA 2CFSA 3O92A 4WADA 1KYIA 1TJYA 1PTJC 2G6TA 2XF8A 4IXMA 4AJ1A 3LHSA 5REQA 4K8RB 1Z83A 4RPGA 4KN8A 5EHZA 2AK2A 3AB3A 1EP1B 1ZJ6A 4LHVA 2R8XA 2QTAA 1GNQA 5AUNB 1R0XA 1GAEO 1G19A 1R0SA 1T2UA 2VQ3A 3O8OA 4ALNA 2VC2B 1KK2A 5BV7A 3WZMA 5A7HA 4H15A 3RROA 3WZ2A 4GZ6A 5JEDA 1LI5A 1BHSA 2F1RA 3HKCA 3NGLA 4RF2A 3DV0B 3K6SB 1HORA 1Z5OA 4H7EA 3RVMA 3ZGLA 4D46A 4DBLE 3ZU2A 4UZFA 4EB0A 3L3BA 2B3DA 4HDMB 3DMDA 3QMMA 1PGNA 1Z0UA 5KDOA 1JIXA 2XADA 2VJYA 2PVPA 5CDSA 1ZA2A 3N39C 5LP6C 3VZRA 1YRYE 4MQ5A 2AX3A 5EZ5A 2JI8A 1KEVA 5FBKA 4LWZA 3CQ9A 1UF9A 4Y0NA 2NPFA 2EW1A 2LDXA 2O7QA 2XQVA 3AP1A 3GEIA 4TVBA 1C7RA 1DZ3A 1JUDA 1X1AA 2OENG 4DDHA 4EW6A 5C8VA 1UP6A 5ES3A 1EIZA 4K26A 2DWQA 2WU8A 5JCJD 3I4LA 4KBYA 4ECEA 4GVLA 4N7JA 4CM8A 2C8LA 4G25A 2UUPA 2PWYA 2BMAA 2C8VA 4JI1B 2HQBA 3L8CA 4KR9A 1QQ5A 1NWHA 3UHOA 3CVYA 1FPQA 3ECCA 2BCGY 3JVVA 1W8DA 2VF4X 3U60B 1VYVA 4G24A 1IXSB 4MCJA 3U4DA 1BZYA 2JZOA 3S2SA 2IJGX 2BRUC 4EKDA 1LLUA 3VNVA 2VLBA 1P7WA 2PXXA 1WZNA 4MQFA 2HT6A 4HXGA 1W44A 2ETXA 1QP4A 2XQIA 3FTPA 3ZY2A 1QRSA 1D6NA 1WABA 5FOWA 4C14A 3ZJUA 1PDOA 2D1TA 1JA1A 4RWZA 4DHEA 4MQEA 4RVHA 2K87A 4RCZA 5HOEA 3PE6A 2OXFA 3SJBA 1LBIA 4MSUA 4B3CA 4WBNB 1RJDA 2BBWA 3G2PA 1CQJA 3CG0A 3L0SA 4S3MA 2OGSA 4XUCA 5DKFA 2PNJA 2F64A 1A2BA 3R7BA 3BDAA 2BW0A 3ZUPA 5BWNA 3L8GA 2ZRLA 4L9RA 1OQAA 1NF8A 3ZTTA 3GJQA 5B2EA 4K6KA 2X1HA 5HNKA 4ZK6A 3SM3A 1FNNA 3QVKA 4BAZA 4AQ7A 1N9KA 4JSYA 1FS5A 2FPPB 1YH3A 3GA0A 3RRBA 1OA1A 1UZNA 2MINA 4BFYA 4D9EA 1BOFA 3OUTA 5KTOA 3QVVA 4RZUA 4AMGA 1YRWA 1XD2B 4PHCA 5JJ5A 4EJ2A 3GP8A 5J47A 1O97C 2OHGA 5K4GA 3LNCA 5CFRA 3GG2A 2M32A 4BCDA 5F7OA 3HDGA 5JMTA 3OIVA 3THOA 4YGYA 4NYIR 4AJJA 1MH9A 3K1JA 3VR2A 2LDBA 4KO3S 5ADUS 3WGOA 4II2A 1NG9A 2Q3CA 3FUWA 4C2AA 5TSDA 5HMMA 4D43A 3FI0A 3EXFB 4MR8B 2JEYA 2BP7B 2JARA 4DJ5X 2FFJA 4L6AA 2W83A 1X1BA 3R0ZA 3ZV6A 2WYUA 1IE3A 1SMKA 4B7CA 4Q9KA 5K45A 1BWRA 1DBSA 3F5FA 1JMVA 1S5PA 2HMAA 3DP7A 4WXMA 1XTBA 3W7BA 4M0MA 4OHMA 5I9BA 2BGMA 3I04M 3EISA 3Q9UA 5IAOA 2EGHA 1F4PA 1AQNA 4L4UA 3B1ZA 3SF0A 3BK7A 1J00A 2Z95A 1X7WB 5C7YA 1KDYA 3LDUA 3QU9A 3PWZA 2MR5A 3JQ8A 3P2KA 2PSFA 5CM8B 5FO1A 2R00C 5FTWA 3MS7A 2ZEJA 2YYYA 1ZA1A 1H2BA 3AH8A 5D5HA 5HA5A 4M1TA 2FA9A 4ES6A 1UBHS 4OO3A 4EPTA 3AV0B 2P9QA 5MFPA 4FR5A 4CWAA 3FOZA 1V1RB 1WDTA 2VDWA 1ADFA 4H08A 4E33A 4JT4A 3UCEA 3D4PA 4X5OA 2DPHA 5M5BA 3DO6A 3PQ5A 2JCGA 3V5NA 3EZ7A 4K6MA 5EKXA 1LS1A 4X6LA 5LYJA 2Q5FA 4B2YA 2GEDA 2NG1A 4OOEA 2A84A 3LT2A 1PI3A 1AQJA 3EC7A 4NAUA 1S3FA 3K5PA 5BP7A 2XAUA 2XUHA 2CVZA 2IXTA 3AWDA 4CHGA 1A4XA 2BHLA 2QVYX 3OFSA 3C74A 1VM6A 1TTHA 3L9WA 3G2IA 4KL8S 5EZYF 3R9XB 4R8MA 3INTA 3LXRA 3GBVA 3DYBA 3LBHA 3L0IB 2NVUB 1FF9A 2DUUA 3CEMA 3N7AA 1E1YA 1GDDA 1QX3A 4BQFA 2OZPA 3GFVA 5FWXA 2NO4A 1JEDA 3O95A 4MWGA 4ESEA 1W19A 3UB2A 5KJEA