1G6HA

Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
TMEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANSPORT ATP-BINDIN
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
total genus 92
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g6hA00
2GK6A 2OLJA 4HLDA 4V0OA 1L4YA 2FZ4A 4ILEA 1E79A 1RJ9A 2RHMA 3D7MA 4MKFA 5FL7D 3VNVA 4TZ0A 4RD0A 1OHHA 1N0UA 2JJ2A 2QP3A 2V9PA 3HP1A 1HT1E 4R71A 4H9GA 3SZRA 3GJ0A 4DSUA 1V5WA 3C4JA 1CRPA 4JMPA 1KO1A 3K0FB 3CKLA 4EQ6B 3V4FA 5SZIA 2AD1A 1ZM2A 2D2EA 4RZUA 1OJLA 4XVRA 2QP9X 1YR7A 3G82C 4YMWA 5F98A 2WMNB 1MT0A 5EZ5A 1HUQA 1S2MA 2H57A 3NC1C 2H17A 5KHOC 3WXMA 4PQRA 5EP1A 3B13B 4LJYA 2NTYC 4MYHA 5FR1A 3NG1A 3PUWA 3SS8A 3GJ7A 1XEXA 2OFXA 3ZIAA 3K70B 1FX0A 3BFVA 1NY5A 2MSCB 4R9UC 3VR4A 4NZYA 1M34E 1M8PA 1CKEA 1SVMA 4EPYA 1P62B 3LW8A 1A82A 3P4YA 2ZYTX 4KI0A 5A0FA 4LBYA 3QF4A 2P65A 1G8FA 4AC9A 5B57C 2BIFA 5AJXA 1OYYA 1Q0UA 3F5FA 4TTPA 2VYFA 3VX3A 4CVNA 5KOYA 5B30A 3I32A 3DPUA 5P21A 3FKSD 2PZGA 4XJXA 1FZQA 1U90A 3CM0A 1Q1BA 5BQ5A 5EQTA 2PCJA 3RS4A 1AJEA 2IYLD 3MLEA 2ZJ8A 4ACBA 2YVUA 2J41A 4S2EA 3OHMA 3A58B 4IHQA 3VMFA 3Q5EA 2RCNA 3LVQE 2QAGA 3CZPA 3VR1A 4PAOA 2NPIA 4DB2A 1SHZA 3GFPA 1WMSA 1COWA 1JAHA 1YVDA 1UFQA 2CVFA 5EUMA 3IDQA 1E1RA 3QKTA 5FOSA 1A2KC 2GVZC 3LX8A 5C4MA 2GEVA 2BVNA 3CONA 3FGNA 3IEUA 4QBIA 4DRZA 3ZVNA 2CCGA 2GZHA 2W6IA 4I81A 3SYLA 5FOVA 1Z8FA 3ECCA 1E0SA 3QG5A 4POAA 2DCUA 4ZIRA 1E1QA 1IJFA 1ZCBA 5FFMA 1DAFA 2ZE7A 2QPOA 3SU8A 2WKRA 1F60A 2XTMA 4UQOA 4X8MA 3UMSA 4B2LA 4BWYA 3W3AA 2PEZA 2QP4A 4RKFA 3KTAA 2VQSA 4NYJR 3NBZC 4DLWA 1W36C 4PC3A 3IHLA 1WP9A 4RD3A 1P60A 3PITA 4BFUA 2ODEA 2LCFA 1C9KA 1JNYA 2F9LA 4TLEA 1ONBA 1XPRA 2ZYWX 4CGZA 2ODNA 4UXJA 5FR2A 2GTPA 5LBIA 1KI6A 4A2QA 2BKEA 1UBCA 4TTRA 1II9A 1G21E 2V6IA 4GZLA 2QBYB 4F92B 3TAUA 2B6HA 2Q6TA 3EX7C 4RFVA 3T12A 5B58C 1PVOA 1OIXA 2F1JA 2P6NA 2JCSA 2ATXA 4BLQA 3PUYA 4A0RA 2QA5A 2C95A 1KDOA 2R65A 5FBLB 4YMTA 4Q01A 3KKNA 2VO1A 2BBOA 3IO3A 3MSXA 4KCGA 2DBYA 2FX3A 1YR6A 2WJVA 1EFRA 3GLGB 2Z4RA 2C99A 3AF4A 1JQLB 1TF7A 1TPZA 3E70C 1JR3D 3AVXA 1G7SA 2WJHA 1BOFA 1NVXQ 2XNSA 2EFCB 2YOGA 1VYTA 1WF3A 5DI3A 2OCPA 4DWJA 3C14C 4D4MA 1XMJA 4LX0A 1VKJA 2ONKA 5LPNA 2PMKA 3X2SA 2OFOA 2JEOA 2KE5A 4U00A 5C46F 3NH9A 3X1DA 4LYHA 2OAQ1 2WIBA 2F1HA 2F9MA 2QZ4A 2O8BB 4DCUA 2DHRA 1MABA 4EAQA 3SOPA 3IPYA 3M4YA 4CW7A 2GXQA 5UKDA 2VHTA 4RJLA 4A92A 4Z54A 1NRJB 4A4DA 4NCIA 1TX4B 4LPKA 4ZDJA 5FI1B 3NBYC 5JI2E 2F1RA 4FI3C 4ZDIA 1HA3A 3QOFA 4PC1A 2N46A 1GNPA 3I92A 3U3JA 4RD1A 5CLLA 4LJAA 4LGMA 3RANA 1NN1A 1NJGA 3RVBA 4P4SB 3ZZUA 3QIAA 4Q7KA 1OH6A 4JZKA 1G5RA 1GOTA 4DCNA 3CRRA 4NKRA 2CE2X 4NYJQ 5J40A 4X8LA 5HKKD 3DDCA 5F9FA 3OIWA 2XJ4A 4GP6A 4LYAA 1QG4A 1II8A 2OUKA 1SGWA 4FMDF 3OIYA 2WHXA 4XD7A 4URZR 4K81B 1KK0A 2Z5FA 4B48A 1SKYB 1D2NA 4RKEA 4U5XA 1JJ7A 1W2GA 4OK5A 4TYPA 2FEOA 3L0IB 2ODWA 4D4LA 4GPTA 2WBLC 4UJ5A 3TSOA 1CJMA 2O8DA 1ZUHA 2OILA 1U0LA 2FSHA 2O8FB 1PZNA 1IJEA 5DO9A 3SFVA 5J4VA 3FHTA 2F43B 2A3RA 3LAWA 1LNZA 1Z63A 2IXEA 5KTYA 4CZ2A 4B6EA 1VMAA 3CW2A 3AF2A 1TADA 1P9NA 2C98A 3B60A 4CT4B 1FQJA 5JZVA 4CF7A 3DMDA 2CNWA 4MUBA 3EIEA 3TE6A 2ZREA 3K0SA 3Q3JB 1KI4A 3GEEA 1E98A 1G5TA 1F2UB 3E2IA 5B64A 5BN4A 5EJEA 5FBVB 4EFMA 3VR5A 1Z83A 4KAXA 4QL3A 4ZV4A 5FTNA 1LY1A 2W6JA 1H8HD 1KI3A 3C8UA 4Z8XA 4LHWA 5AJYA 4OHWA 3LXRA 3U3OA 4HAXA 1IHUA 4KVAA 5TY0A 5JHGB 1Z22A 3DOEA 4ITRC 2KSQA 4A0FA 4PHHA 1EG7A 3GLFB 1EK0A 3TVDA 4ARZB 1CEEA 2YZ2A 3SDZA 3NKVA 1UDXA 2BEJA 3J81k 1E99A 1O3YA 1N5JA 2C2HA 3BS4A 1XPOA 4O3MA 1KDRA 3PVSA 1P73A 1W5TA 3D31A 1QF9A 3EZ2A 2GZAA 3VKHA 1FTSA 2UZIR 1E3MA 1R0WA 5CB6A 2ORWA 2QM8A 2WWWA 1GDDA 5JI3E 1J8MF 4PZLA 3GPLA 1W36B 1SXJD 4IVPA 1ZNYA 2J45A 1FW6A 2WJIA 1ZVQA 2ZRGA 1VIYA 4D2IA 4LJ9A 1GP2A 3PEWA 2XXAB 3VKWA 1NVUQ 1F2TA 1DPFA 4B3GA 3IIMA 3C5CA 2XSZA 4QGGA 3GLHE 4M9ZA 3WYFA 3CB4A 1CP2A 1Z6AA 1N6LA 1JJVA 2FOLA 1KYIA 2BCJQ 3IBYA 2VHUA 4B75A 3GLIE 4M4SA 3T06B 3TUIC 1MOZA 1UAAA 2NOAA 4ON9A 5HCNA 1JPNA 2Y8EA 2YINC 1DELA 1UKEA 5JEDA 1A1VA 3QENA 4TN1A 1XCPA 3K53A 1W5SA 3PEUA 5CB8A 3T5GA 5FOXA 5GVRA 4AG6A 3KQKA 3NVAA 1XTKA 4NMMA 4B3XA 1EFUA 1CJVC 1ZIOA 1I4DD 5JHHB 3G5UA 4BLSA 1T9HA 1E9BA 2OHFA 2DFKB 2BEKA 2ZTSA 3FOZA 1E9EA 4ZKEA 5KYKA 3TR0A 1G4AE 2QSZA 5DI9A 1EGAA 3OEED 5HE8A 4DLTA 1E2NA 4PSVA 2QGZA 2X8AA 3CPHA 1OXVA 1XXHA 4HLUA 2A5JA 1KSGA 1AM4D 4GP7A 1TL7C 2GJ9A 5G40A 4URXR 2FG5A 4K46A 3ND9A 4QGFA 5DNYB 2WVJA 4DDWA 4C2UA 3EPHA 1P7CA 1ZUIA 3KJEA 4II7A 4DCSA 2CHQA 5IK2A 1UDWA 1Z47A 2CVHA 3EIQA 4PZZA 3R9XA 2W83A 4E07A 4PHGA 2KBFA 1E9CA 2V1UA 2GVDC 3ZD7A 2GZDA 4C4PA 1S3GA 5DISB 3ZD6A 2QTVB 4G01B 3K70D 1P72A 5DN6A 2OT3B 4OHVA 1VIAA 2X77A 4HB4A 1S9DA 4B71A 3P1JA 4FXPA 5L3RA 2DFNA 2J87A 2ZEJA 1AQUA 5FTKA 2G3YA 2OXRA 1E6CA 3GFTA 4WW0A 2D4HA 1T8UA 4TT3A 1G7RA 3UMFA 5AWFC 1AS2A 2ZRAA 4YXWD 3R7WA 2O8EA 3AF0A 3KB2A 4RSGA 3PR1A 4PO9A 4I1VA 3U5ZB 1T3LA 3DZ8A 4PC7A 1TUIA 3EWAA 1QZXA 1Q20A 3PV0A 4HEJA 4F93B 4JKYA 1Q3HA 5J4KA 3AB3A 3MJRA 4WOPA 1OB2A 3KDSE 2V3CC 4JJKA 2ZXUA 3I1FA 4TL7A 3Q7PA 5KU1A 1EX6A 4R2HA 3R8CA 1Q12A 4M53A 1WB9A 2ZRNA 5KNDA 2W0SA 2DFTA 3U4QA 2GJ8A 2IUTA 4C3ZA 3GCGA 5CJPA 3UXMA 3BOSA 4B74A 1ESMA 3OAAD 2CHGA 4I1SA 5FL7A 2NPFA 1ESNA 5JBQA 3R9WA 3U7FB 2PCLA 2R2AA 2H5EA 1OFUX 1G16A 2GCOB 2QY9A 5CIQA 1JR3E 5FBQB 3EZ7A 1K8RA 2CK3D 5JJLA 4OHZA 5KDDA 3CBQA 2GBLA 3IQWA 2DWQA 2A5FA 3NEYA 1W49A 3THYB 3CR7A 2IT1A 3AKYA 4MH0R 4C7OB 4MDFA 1NLYA 4JLAA 2BMDA 5FPSA 3RDPA 2ZANA 5DHAA 4US1R 1W0KD 2Z83A 1QHYA 3THWB 5ELXA 2CL7X 1VCOA 1J90A 3GLHA 1UADA 4EJSA 2O5VA 3SQXA 3LBNA 2GJAA 2ZRMA 5CK5A 4HAYA 3BAFA 1GIAA 2J9RA 3FE2A 4S35A 1NY6A 4DLVA 3GLIA 2H7VA 5KPJA 2FU5C 2ZJ5A 1XTJA 1GL9B 1XPUA 1ZIPA 5LD2C 5DIFA 2CL6X 2QAGC 3LD9A 1L4UA 2ORIA 2RB4A 1GNQA 1WCV1 2YOFA 1ZRHA 3HU2A 1RRGA 3LDAA 1N6IA 3EASA 3UG6A 1ZUNB 4YDHB 4DLSA 1SVKA 2RMKA 4PTLA 1U8AA 1KMHB 5AJZA 4BZXA 4XWOA 2FH5B 3QXSA 2OZEA 1E2DA 2ZI9A 4HDCA 4QC2A 1GRRA 2QE7D 4MRNA 3V00A 5L3QA 2IYTA 2J59A 5JEEA 3IQXA 3FKSA 2QORA 3HPRA 3T1TA 2ANCA 4KV9A 2PJZA 2ZRPA 3ZQJA 3LBHA 4EFLA 2R6AA 1IN7A 4LK2A 4CIDA 2O0JA 2FFBA 2IYWA 1LVGA 4L5BA 1UBEA 5AK0A 3CLVA 3C15C 4V0NA 4C0LA 2ANBA 2QPAA 4UNQA 3Q5DA 4AYXA 3FHCB 4D80A 2QTHA 1TEXA 2JJ1D 1SVIA 4D81A 2QNRA 1QHHB 3SEAA 1JEDA 4I1UA 4O25A 2WWGA 4RVCA 5BWMA 1Z08A 2FMXA 3DM9B 3LX5A 2V6JA 2ZUDA 5DSZA 4PAQA 3QBVA 4RD2A 4WVFA 1E2MA 2YV5A 4Q7JB 4KLZA 2B8WA 4IVRA 1N6NA 4PO1A 1GG2A 4BUJA 2NO7A 3NH6A 4I1OA 4LSGA 2PMDA 1FFHA 2WOOA 2GESA 3AF3A 3BC1A 4L4UA 3B78A 3QBTA 3HU1A 4L8GA 3TMKA 2CL0X 2VPPA 4IFBA 4MRRA 1DTSA 4QFMA 1CJTC 3RRZA 3OEHD 4HUTA 2YWEA 1Z29A 1HTWA 2JLRA 4XOIA 2FNAA 2HUPA 5E4FA 4LJ6A 4DDTA 1MO3A 1BMFD 1M7HA 3AM1A 2BJVA 1UJ2A 4NYIR 2D74A 3ZS8A 1YZTA 4LV8B 2EWWA 4TQUS 3SBEA 3TVTA 1P3JA 2ZYVX 2DWOA 2DPXA 3KXIA 2J0UA 2EU8A 3ZH9B 4AIIA 2WAXA 3K09A 1K6MA 3LXXA 3H1TA 2YWFA 1IY2A 1RJ9B 4X8OA 1SXJE 2ZAMA 2AKAB 4DC9A 4DDVA 4BRUA 4DSOA 2OAP1 3LVRE 3VR2A 1LW7A 4NDZA 3IIKA 2B7BA 4FMCF 4XTCS 2WJGA 1E0AA 1NIJA 1FP6A 2IYZA 3GJ4A 4LBZA 4TMKA 1XTQA 2KB0A 5CK4A 5CLQA 1XTSA 3PG5A 1N0VC 4YMVA 4JIMA 3VU9A 4LOAA 4D0LB 4IEEA 3DZDA 3W5IA 4ERNA 4X8HA 2IXFA 2HJGA 2ZE8A 2ZRCA 1LB1B 5FUWA 3SBDA 2O8CA 1EESA 3I5XA 3BH7A 1Z07A 4C9BA 3KB1A 1RIFA 4NYMQ 2OEPA 1RZ3A 721PA 4V0KA 2F3RA 2P6UA 5FPTA 3SE0A 4QJ3A 8OHMA 3GEIA 4M1KA 1XEXB 4Z8YA 1FX0B 4Q21A 4LJ7A 3ASZA 1CIPA 3QNUA 3BFKA 1I4TD 1ZU4A 2XITA 4A2PA 4HSEA 5HZHA 4KSBA 3HJNA 1W36D 1ZM7A 2WMOB 1HE1C 3BJIC 4A8JA 4ZCLA 4BFYA 2J1LA 1W1WA 2WAYA 1ODFA 3DMNA 5KNBA 1HQCA 2QRZA 4M1WA 5FH9A 1Z0KA 4AKGA 1US8A 2ZROA 5HKKA 1II0A 4JSYA 1IXSB 1N6OA 3GMTA 1JR6A 2JLQA 3FB4A 4LHYA 1WBDA 2LWIA 4NYIQ 3ZJYA 521PA 1CF4A 1PLLA 3QKRA 1FNMA 2QUZA 3LQRA 3QKUA 4CEJA 3BGWA 1YZQA 2G1KA 2Z6VA 5LD2B 4FWIB 2P5SA 3BD9A 4EDHA 2QAGB 1E96A 4LI0A 4MRPA 3AKCA 4TTQA 4G5SA 1DG1G 2GAOA 4LUCA 3W3ZB 4C0AC 5LB4A 2F1IA 3DKPA 1HEIA 5JS8A 4A15A 1TQDA 1Z6XA 2ZJZA 2Z0MA 2HT1A 3DM5A 3H4MA 3MAAC 1NSFA 1A7JA 3NDPA 3VAAA 4JL6A 4LBWA 4Q47A 1KO7A 3AGPA 5J4HA 2QMOA 5L8VA 2XB2A 3V9PA 1D2EA 2R9VA 4DLYA 1OH5A 4D4JA 1EXMA 4M8NE 4DIDA 1VG1A 2HV8A 3RSLA 3FMFA 4GOKA 4JLJA 4JLDA 4LRWA 5EE1A 4YMUA 4TQAA 2L0XA 3NXSA 4G5RA 4V03A 2XTZA 1AQYA 1NBME 1XEWX 2DYKA 3KTAB 2QN6A 1NG1A 2JLSA 2REXB 5FOWA 2WM9B 4PSKA 1XTRA 1ZNZA 3U6BA 3K9HA 1H8HA 3QEJA 4LV5B 5FL3A 1MRSA 4QKQA 3W6NA 5E7JA 4ABYA 1DEKA 2CDNA 1ZYUA 4GNKA 1KI6B 4IFEA 3WP1B 2PZEA 1H8ED 3ZLJA 3DEFA 1SVWA 3CNNA 4QOSA 3FWYA 2JJ8A 1E4VA 3BK7A 3PQCA 5D3MB 4W9MC 1XD2B 1EFTA 1N6HA 2QTFA 4HZUB 4TLAA 2XGJA 4CEIB 1IOZA 2C04A 2RGNA 1DO0A 1QHSA 3BB4A 1Q21A 1FUUA 4EPRA 2AL7A 2F6RA 1NSTA 1SXJA 4MKIA 1XWIA 5HPYB 3A6PC 2LKDA 3A37A 3PEYA 1CJUC 2WWYA 2J5XA 3HU3A 2GNOA 1J99A 2J0VA 1E2IA 1XP8A 3TIFA 1IXRC 1IAQA 2RH5A 4A82A 2YC2C 4UKDA 2GEDA 4RZ2A 2YC4C 3R9IA 2Q0HA 5K8UA 1CR4A 4P31A 2PZFA 3IGFA 4HLUC 2IL1A 5FPYA 1NMZA 2W58A 3CIOA 3UPUA 4HYYA 1EX7A 4G5GA 5FOUA 4N3NA 2Q3FA 3SC3A 4JYBA 4MGIR 2WJJA 2VRWA 4IDPA 2V7QD 4C0QC 3NDBB 3TH5A 1GL7A 1M7BA 6Q21A 2PX0A 2BM0A 1LF0A 4O0MA 3MFYA 2BMJA 5K8LA 3GLGE 2D7DA 2D7CA 4BZQA 2B92A 3LRPA 1WXQA 1Z3IX 1G20E 2FSIA 4DHEA 1PUJA 1XEFA 5FTMA 1W2HA 4LJ5A 3OEEA 5FTJA 1OV4A 2G83A 3VHXA 4MGYR 3TRFA 1KY2A 1AIPA 2R62A 4G5QA 4R7ZA 3K0AA 4JBWA 4DCTA 2GDJA 4Q4LA 1CJKC 1BYIA 2P5TB 2CBZA 4EQ6A 1Z2AA 2XZPA 3SJCA 4M9QA 4BQSA 1GNRA 2GJSA 1N25A 3CF2A 1X86B 2BJWA 3M0EA 4IDOA 4LHZA 4MKHA 5GJCA 5BN5A 3RNLA 2JLYA 4LZZA 1M2OB 5G53C 3IBGA 3B5JA 4CEHA 3OF5A 2FFHA 1D9ZA 3ASYA 1NLZA 2O8DB 2CLSA 4QHTA 1MKYA 3W5JA 5BXQC 3LY5A 4KO8A 2J0SA 2WZQA 3W6OA 4PPNA 3JZMA 4MRVA 1FP7A 5H70A 4DDUA 4Z1MD 2QMUA 5AUPB 1I2DA 2J46A 1DADA 4OHXA 5HCIA 2CCKA 4U7DA 3BIFA 1AZTA 3QKSB 4WAUA 4YMSA 1TF5A 3L2OB 2EFDB 4JYCA 1JXMA 2ZS7A 3OE7D 2XOKD 2BM1A 1W0JD 4MYUA 4YXWA 4Q4AB 3SJZA 5DYIA 1XX6A 3KQLA 1G1MA 1TMKA 3TQFA 1SKYE 2QT1A 2E9SA 2GBLC 5KSPA 3EC2A 3EPJA 1N5LA 1OPXA 1M7GA 1E0KA 3A4MA 4LCBA 3AP1A 4XSHA 3HDTA 5K8TA 3UMRA 1E2KA 2GCPA 2UKDA 3PJRA 2RGCA 2XB4A 2ZJ2A 3HR7A 1E2LA 1GZSA 1KI2A 1R8SA 3K8YA 5B2ZA 2RGDA 4XSGA 4QJ4A 2RGBA 4V0LA 4ZDKA 4EJSC 3OAAA 4OJQA 2OCAA 2IS4A 1HURA 2VP0A 5L3SA 1VHLA 1XF9A 2ZITA 121PA 3LQQA 4PXAA 4HLQB 3N5CA 4RY2A 4DLRA 3T1OA 1GKYA 1U0JA 2RGGA 3QXJA 4QJ5A 2CK3A 1XBTA 3WP0A 4US0R 3T15A 4LHVA 2KJQA 3S1AA 5KDLA 4DUGD 421PA 3VX4A 2FFQA 1XJQA 3B1VA 1QHGA 1UEIA 2IA5A 3WNDA 2B21A 2R6DA 4DCVA 5A4JA 3GLFE 1ZM9A 2XAUA 3FTQA 4AI6A 1G8GA 2OXCA 1G5PA 2R6GA 1W0KA 3BWDD 3DO6A 3EZFA 1RRFA 1E2EA 2W00A 4FIDA 3WHLA 5E3HA 1QVRA 2RGXA 4QG7A 1KI9A 1E32A 3B9QA 4HAWA 2VHJA 2FJUA 3MWKA 4PO8A 2QBYA 5EE3A 2OESA 4NCKA 3K9NA 3QI2A 5EXPA 3B6EA 2VP2A 2ZRBA 5C2JB 2ZE5A 1Q1ZA 4TMVA 2MMGA 5EXXA 4V0ME 1LV7A 1NNEA 5AUNB 3K9LA 3WNCA 4JT4A 1XXHB 3K0CA 1W4CA 4M1MA 2W2TA 3QPUA 4IVQA 4G1UC 1SKQA 1X8LA 2H16A 1U99A 2QE7A 3QQ5A 4Q7MB 4V02A 1IN4A 3VNUA 1T8TA 2HLDD 2AXPA 4LBVA 2C77A 2EFHB 5CM9C 4Q4HB 1AS0A 3TAHA 2A5GA 3BRWD 4IOMA 4L16A 2IYVA 1W4BA 1S3SA 1JXOA 1XRJA 1G3MA 2AKYA 2VSFA 3EIHA 4OK3A 1KIMA 2BV3A 1Q22A 2ZS9A 3I8SA 1A4RA 2P6RA 4FN5A 3I3SR 2O8BA 4HAVA 2JJ1A 1YRAA 2I1QA 4HUQA 4PANA 1J70A 3TNFA 3HYRA 3QPWA 5D3QA 4F91B 4Q9JA 2ZE6A 5DE3A 1ELOA 1YZGA 4BE7B 2GXSA 1C1YA 3MMPA 4JT2A 1AGRA 4KJZA 3WRXC 4F4JA 1KI8A 4P4SA 5FI0B 3AVVA 2O8EB 3MD0A 3U6KA 2O0KA 3T34A 1TU3A 4QXAA 1GWNA 3U3KA 1U98A 3VQTA 4AKHA 4W5HA 5EP3A 1NI3A 3OEHA 4CT5A 3ETLA 5JSZB 3B85A 4PPFA 1OXSC 4M1TA 4YLGA 1BMFA 1G8YA 2P0EA 4HAUA 2GJKA 1GL6A 4Q66C 3U4QB 3B1YA 4OI4A 3DHWC 1F5NA 1ZP6A 2GF9A 2PT7A 2R44A 4EIWA 4GT1A 2ZUCA 1XTIA 1Z6GA 2IK8A 2QQ0A 2GAAA 3LBIA 1IBRA 3AVPA 4UXHA 3RS2A 5CDFE 1E2GA 2A78A 2WIAA 1Z0AA 3W8RA 1IQPA 1R0ZA 2OE2A 3KJIA 2H92A 2QRNA 3SYKA 1QHNA 4JLMA 4YQFA 2O0HA 4NPHA 1QG2A 4NP6A 2IF2A 4BASA 2KBEA 2BHRA 1KDPA 1XMIA 1F2UA 1E94E 4IXMA 3VR3A 4OYHA 3PENA 4PX9A 2GCNA 4JVNA 2F3TA 3ZYCA 2VSXA 2G9NA 1KNQA 1SZPA 2EWVA 3A8TA 3L0SA 3ZDQA 4A8JC 1SVSA 1RKBA 5J4LA 1UPTA 2SHKA 1OFHA 4KLNA 3TJZA 3NIBA 4RCYA 4BFXA 1X1SA 3ADCA 4Q9HA 4N0DA 1E9AA 2R8RA 1XD8A 4M9SA 3QJYA 4IDNA 4ZI2A 1NKTA 3CNLA 4JLVA 4J0QA 1G7TA 2PEYA 1JEEA 2PL3A 3SN6A 4C2TA 3I8XA 3SHFA 4DZZA 3B2EA 4O2RA 2ZJAA 5HZKA 3D3QA 1E9SA 1Z5ZA 3WMFA 1N6KA 2D06A 2FE4A 2Z4SA 3FVQA 5HTKA 1X8JA 3GJ6A 3QE0A 3RHFA 3GJ3A 5BYJA 3PXGA 4O2LA 3KQHA 2J3EA 4KYIB 1E4YA 1W48A 4D0NA 2J0QA 5CM8B 5F9HA 1L8QA 4PC2A 5EP2A 4BEJA 1HQYE 4OI0A 1NBMD 5L3QB 4DBLC 3IEVA 3W8NA 4EFNA 3O47A 4AD8A 2GETA 2XXAA 4V0MA 4LJ8A 2QG6A 2ZJOA 4RCZA 3KXLA 3L8YA 4OBEA 3UATA 2WWHA 1ZNWA 2BC9A 2H1LA 4JLBA 3QSYA 4TMWA 4Q1BA 4HB2A 1WE2A 4GSYA 3U61B 2EVWX 4NU0A 3VFDA 1U8YA 1IN5A 3NWJA 1G8HA 1O87A 4Y0AA 3RS3A 3DOFA 2OFWA 1GITA 1N6RA 2AN9A 3NHAA 3B1ZA 1OH7A 5DH9A 3U44B 5FUXA 2XX3A 1T4GA 2MSEB 2FZLA 3CH5A 3LFUA 2HJVA 2VHQA 3EZ9A 1W7AA 2EYUA 1IXZA 4URVR 2V55B 1YJ5A 2WPDD 4PPQA 4IJMA 4KXFB 5J4YA 3ZQ6A 2FEMA 4NBSA 2WWFA 1P61B 3LNCA 4OJKA 1VYUA 3HWSA 1CR1A 4OQNA 4Q5IA 4A36A 1S4QA 1U9IA 3N2IA 1C4OA 2IS1A 1G3IA 4M2LA 2RGNC 2CXXA 4NL4H 2GKSA 1DO2A 2EYQA 4JVLA 4FCVA 4B3CA 2BBWA 3EZ6A 1X6VA 3T61A 3MWYW 4TLCA 3TSWA 4HB0A 5KNCA 4DT1B 1ANKA 1GSIA 1SVLA 1G9XA 2IXGA 4NCJA 5M04A 5GVSA 2IUSA 2V54A 4TSFD 3CRW1 1H8EA 3O8DA 4YC7A 3KUDA 3F0TA 2A30A 2PJRA 3BFXA 3BORA 3QF7A 4OQMA 2W0MA 5JWHA 2KI5A 3ADDA 5JJIA 3CF6R 4A2WA 1QHIA 1OFIA 2CMKA 4TYQA 4RFSA 2G77B 4AYWA 4M9XA 2VP4A 1RE0A 2BBSA 1ZJ6A 2N42A 3A1TA 3U3RA 4JL5A 1DAEA 4KODA 4B2IA 5CDFA 3CF0A 4NHOA 1DAMA 4OQFA 1NMYA 2Z43A 5DGXA 3PEVA 4GOXA 4ZPXA 1LTQA 4JBXA 4ZKDA 4GRAA 2NO1A 4D26A 2O8CB 5BN3A 3RC3A 3W34A 4E5UA 4NYMR 4P32A 3GFOA 1OW3B 4Q19A 2ZETA 3TW4A 1OSNA 1GAJA 4B35A 3I4LA 1MH1A 3NTUA 2OSBA 2XJ9A 2QMEA 4MRSA 5AJVB 3A1SA 2ONJA 1KOFA 1YU9A 1KHTA 1P5ZB 3KJGA 1DARA 4IOLA 1AA9A 3CH4B 2PLRA 3A36A 5LDDC 2BKUA 4B73A 2C5LA 3SHWA 2GHIA 1G64A 4HDOB 2V7QA 2ASEA 4QGAA 4C0HA 4LY6A 4HDQB 2ZRKA 3CNOA 3KZ1E 4ASUD 1EFHA 4XVUA 1YZLA 3KQNA 1KMQA 1VECA 5A5GA 4QBGB 1KO8A 5KO2A 2XZOA 1AK2A 2ZYUX 1KI7A 2V1XA 5EP4A 1GILA 2GCOA 2X2FA 1WDTA 5AUQA 1UBGA 4URWR 2R6FA 1M6NA 2CJWB 1S96A 4IDQA 1US8B 2WJYA 2GA8A 3AVOA 1Q1QA 3THYA 3WY9A 4C7OA 1XD9A 3X1XA 4Q1EA 4Q00A 4DEYA 3BBPA 4KSCA 1TQ6A 1R7RA 3CPEA 1SQ5A 1YQTA 3IPXA 5LB2A 1OLOA 5KPDA 1T5LA 3ZZ0A 5H68A 2Q3HA 1OXTA 1RRPA 4QNRA 3BXZA 1KAGA 4GBMA 2FF7A 1A5TA 1Q44A 2ZM5A 1NF3A 2VP9A 5TMPA 3A4LA 2ZRDA 3AVYA 4DKXA 4EPWA 1SVOA 2ATVA 4N0EA 4Z1MA 1E9DA 1OYWA 3L0PA 2F7SA 1UKYA 1JR3A 1W4AA 2QU8A 1XNJA 2RGAA 1LS6A 1G6HA 5IF9A 3FFBA 5IT5A 1T0HB 2GK7A 2IWRA 4ACAA 2GILA 3OE7A 1JAIA 2REOA 2XOKA 4TYWA 1G8PA 4XIGS 4PPGA 1D9XA 1W0JA 1KMHA 3H86A 3ZZTA 4K8OA 1TTTA 2RAPA 1RVDA 3M6AA 4B3DA 1DAHA 4E09A 3N2EA 4PAMA 4TLDA 1Z0IA 4QNMA 4B34A 5F3WB 5E7IA 3BERA 4FCTA 2NGRA 1ZU5A 2J7PD 1ZD9A 3NC0C 1VDZA 4HB3A 4L9WA 3UWOA 5JCPA 2JASA 1Z28A 3EARA 5KUTA 1N3BA 2G1JA 1ZAKA 4C0KA 2XNDD 1G3RA 2ZSDA 3F3YA 4AKEA 3QF4B 2YNMA 3AUYA 2C03A 3SJAA 1FUKA 2A2ZA 1JBKA 3OESA 5TDHA 3Q7QA 1L2TA 2Q21A 4M1SA 1YE8A 3REFA 4KITB 1PLJA 2YYZA 1KZ7B 3BB1A 3KKOA 3U3MA 3CZQA 4HATA 3KXKA 4D6PA 1QRAA 5SZJA 1MV5A 1KZGB 4DLZA 2IHYA 2C96A 4P0TA 4AURA 4GDFA 2IEZA 2WICA 3KUCA 3OFND 3EPLA 1FTNA 2AFHE 3CWQA 4AWXA 4DUGA 2P3SA 2ERYA 1TUEA 2RHDA 3BH0A 3C41J 2E87A 4H1UA 4C0JA 1ZBDA 2WKPA 4BZPA 2IYSA 1I4LD 5DYGA 3P27A 2WSSD 2C78A 1QDEA 2A9KA 1P2SA 1TU4A 3UG7A 4DSTA 4AK9A 5J5CA 2OCYC 2ZS8A 4OL0A 4HAZA 1P4SA 4ZCIA 4P3YA 2FPMA 5JWOA 1YZNA 4ZIRB 1Y3AA 4B43A 1E69A 3P4XA 3THXA 2AWNA 1OE0A 4GOJA 4Q1AA 4DIEA 1RYFA 5FBRB 1X1RA 5C18A 4WXPA 3CUEF 2ZI4A 3MG9A 2AD5A 4FMDB 2WSMA 3K0AB 5KDOA 3HR8A 3IILA 2HF9A 2IW3A 4NTZA 2JAQA 1KSHA 3LLMA 4US2R 2IF0A 2UZ3A 1XJCA 3E5HA 5H1YA 1RRCA 3O8CA 1KY3A 3ICQB 3NBFA 2HLDA 4BFZA 1NVWQ 4ZCMA 2BMFA 3TUZC 3TGPA 2QROA 2O8FA 1G3UA 2FV8A 1YKSA 4IXNA 4CEHB 4JSTA 3CRQA 4JLPA 2C9CA 1XJ0A 4MQBA 1AGPA 1JQJC 2YHSA 4PHFA 1NN5A 1E0JA 4I4LA 1D5CA 1FMJA 4Q4JA 2UVQA 1G3QA 2R6CA 3K9GA 3M1IA 1D6JA 2NZJA 3AVUA 1KJWA 5TB5A 4C0BA 3QPVA 3A1VA 3LH5A 3EAQA 2QI9C 3KFVA 2VEDA 4IRUB 2ZI5A 2ZU6A 1KGDA 2ZJYA 2AK2A 1EFCA 5DI3B 4B47A 4TMXA 4Q1DA 3X1ZA 1R6BX 3KKMA 1LFDB 2DY1A 2PLFA 1P9WA 2ZIAA 1P2UA 1IONA 4BFVA 1R4AA 1J8YF 4I99A 1R0XA 2QGNA 4TL8A 3RS0A 3VTKA 3IKJA 3R8FA 1MO6A 3JVUA 5JWRA 2P2LA 2D62A 4WIAA 3SI7A 1MABB 4JLNA 4BLOA 1UBFA 1DVRA 5ANRB 3X1WA 2WTUA 1BO6A 2B7CA 1TF2A 1U8ZA 3UWKA 2EW1A 4Q9KA 3PIRA 5KSOA 3IIJA 5HR5A 1D2MA 1P6XA 1CR0A 2OLKA 1R10A 3Q72A 3PUVA 2GRJA 1E2PA 2FFAA 1P2VA 3HPQA 5E7MA 3WYAA 3UANA 1Z0FA 5C1BA 1M1YE 2BCGY 5L3SB 3ICEA 3HYTA 1E2HA 4JJZA 4B32A 2ZRFA 1FNNA 2EQBA 2XZLA 1N0WA 2G0NA 3TR5A 3WNBA 4UNNA 4A9AA 4OI1A 2PX3A 1II8B 1XCGB 4U02A 1NJFA 1G6OA 3IUYA 1KNXA 3K0FA 3PUZA 1SHKA 3A4NA 1UM8A 1HE8B 2Q9AA 3S1AB 1P75A 1U81A 1TEVA 3K1JA 4H1VA 4N1AA 3RC8A 2FPKA 2JDID 4PZYA 2WWIA 4YONB 3ZVRA 2ZRIA 1XCMA 2W2VA 1HYQA 3D6TB 3ONWA 3RLFA 1AZSC 1NN3A 1K5GA 2KWIA 2FSFA 3MWLA 3QG1A 2MSDB 1BKDR 2VF7A 1XU4A 5G3ZA 1HV8A 2ODBA 3AEZA 4OHYA 4DB4A 1KK3A 4L9SA 5DLQC 1ZC4A 1ZW6A 1KJYA 3AQ4A 2ZSAA 1XFAA 1XEWY 4QRHA 3FDIA 2YJTD 1K5DA 2NO0A 3SYNA 1U94A 5FOTA 4IOKA 2YKGA 5BYKA 5CITA 5D3MA 1YR9A 1XD2A 1OKKD 2BDTA 4P4TA 3B9PA 3CRVA 1IN8A 5CIWA 1CS4C 3RABA 4HZUA 4PSAA 3U7GA 1NLFA 4HZIA 1BIFA 5G41A 2ZRHA 4CEIA 621PA 2VHCA 2ZVQX 3RYTC 4EPVA 1GRQA 1Y63A 5EUQB 4MYCA 4UXIA 4DVGA 2DB3A 4A0HA 2FN4A 5KSZA 4OK6A 5JFGA 2IYXA 5AJWA 1NBMA 1E2QA 3AVQA 1DOAA 3I73A 4MDEA 2AWOA 4EPTA 2PH1A 3AH8A 1PJRA 2XEXA 3KX2A 1VYVA 1HT2E 3QUSA 4URUR 3UKDA 2VP5A 5KSYA 4W5WA 3E1SA 3VKGA 3B82A 1U9IC 4P33A 3THOA 3PFIA 1YRBA 1B23P 3B1XA 1VG0B 1PUIA 3GD7A 3P26A 1Q57A 4PQFA 4WZAE 3I61A 221PA 4EPXA 4DLUA 3L0OA 3FMIA 2NZ8A 3EXAA 1NMXA 5E95A 5JECA 1G7CA 4CYMA 2AXNA 1R5OA 4OQLA 4WBSA 1OIVA 4A0GA 4HUQB 5FUVA 2IBMA 4M21A 5JJKA 1RW4A 3AKDA 3TUJC 1AN0A 1F2TB 4F4IA 2REBA 2JIZD 3CPJB 1XXHE 3Q85A 4G0NA 2WPDA 3C7KA 3LA6A 1VG9B 2AX4A 4R2IA 1J2JA 4IEIA 1W46A 1Z6TA 3H2YA 3DVLA 2NQ2C 4A1FA 1S0UA 1KO5A 3TSZA 2ZUBA 4Q18A 5FPHA 4IW3B 2VH5R 4P4UA 3OIUA 4BEBA 3WYGA 2V8OA 4EKDA 4JVMA 2H8KA 3MCAA 4AG5A 4B76A 1NIPA 2Q9BA 1OT3A 2YWHA 4IKEA 2JGNA 1UEJA 4OI2A 3OIVA 1IN6A 2PBRA 2C9OA 2JATA 3QVVA 4HI0E 4PR0A 4LWZA 1E79D 821PA 1T91A 1CLUA 1DAKA 4TSFA 2ZSFA 2XTNA 1QBKC 2D2FA 2VSOA 3EA5A 4ZI3A 2HT6A 1OHHD 3W9YA 2JJ2D 3U7HB 4WXRA 4G3XA 2ZVPX 1F6BA 3AGQA 1VTKA 1S8FA 1NP6A 3DKVA 3GQBA 1OH8A 3GLGA 1QVAA 1KK2A 3LW7A 3KQUA 2YOHA 1TQ4A 3F8TA 1GTVA 4DLXA 1N2CE 4M1YA 4BFWA 1EWRA 1A2BA 1MR3F 1G17A 2VL7A 1DAIA 4QM7A 1CTQA 3AF1A 4B3BA 3JZAA 3QKSA 3FKQA 3RSOA 1N5KA 3KFXA 2WWXA 1Z2CA 1ZMXA 1V43A 1R5NA 2EFEB 2ZQ5A 4B33A 3T1VA 4NONA 4W7SA 2QSYA 3BE4A 3IO5A 4MA4A 4Q4AA 3AUXA 4RZXA 4UNSA 3REGA 5FTLA 5TVKA 4BLTA 1NKSA 3CWZA 3RRMA 4JLOA 3LLUA 3ZIAD 2HCJB 4HLCA 1T5IA 2OBLA 3O8BA 1CULC 2DWPA 2ZRLA 1HH4A 4KVGA 4DJTA 2OO7A 3FYHA 1N6PA 1Q1EA 2BWJA 2HDNB 1EWQA 1CU1A 1BYUA 1CBUA 4UJ3A 2FDCA 3K09C 1OIWA 1UKZA 5CYOA 2P67A 5IHPA 2X1VA 1VCNA 2QEQA 3TKLA 3R7WB 4GI7A 4ASUA 2QPTA 3BB3A 1VCIA 4B3FX 1AKYA 1D8TA 3C5HA 1KDTA 2QAJA 1KO4A 1OXXK 3CX6A 3IHWA 5JMTA 4BFSA 1KKMA 3MGCA 2AHOA 4CRWB 2A7QA 2K5UA 4A6XA 4MGZR 1DS6A 1WA5A 2E1RA 1IM2A 3TLXA 1NG9A 4JS0A 2TMKA 4TMTA 3Q9LA 3MUFA 1W44A 1ZC3A 2IS2A 3SJBA 2FWRA 4G5OA 3GEHA 2IUUA 1COWD 2RGEA 3U2QA 2BBTA 3QEOA 1WQ1R 1E1RD 2X19A 1T3SA 1RFLA 3LO5A 2F43A 2RKOA 4RD6A 4TMZA 4XH9B 5CYPA 4Q7LA 4D0GA 2QENA 2W6ID 4LHXA 4XWKA 3I5YA 4D82A 3QXHA 3FHOA 5BW8A 1E1QD 1ZD8A 1Z06A 2IEYA 2IX3A 4C0SA 1W47A 2QL6A 3RS7A 1CXZA 4MKGA 5K8IA 4TYNA 2G6BA 3OZXA 2J7KA 4LJ4A 4OQXA 2Q9CA 2IYQA 4BLPA 1ETUA 2HYDA 2ERXA 3GLHB 4TYYA 4EJSB 1RC8A 3GJ5A 3UIEA 2YWGA 4QHSA 1ZNXA 2I3BA 2N1BA 3GLFA 4ARZA 4B2PA 2IYYA 1VCMA 3GLIB 2JLUA 4ZDWA 5TARA 4XTRA 1FL9A 3QVUA 2J7PA 4QBFA 4B6FA 2GXAA 1FPMA 4Q4HA 2G0TA 2QT0A 2ZR0A 2JLWA 1XMVA 2XNDA 1TAGA 2CLDX 2CE7A 2ZR9A 4FMCB 1G4UR 2HEIA 2LKCA 4QBHA 1KK1A 1S9HA 2NO6A 2ZR7A 4Z51A 1Z6YA 1EFRD 1U2RA 5EZ6B 5JRZA 1PV4A 1NN0A 2AK3A 4RFSB 3T5DA 4AYTA 2IYRA 1ZINA 1X8KA 2GXUA 4AY2A 3MWJA 1R5BA 1Z0JA 2OG2A 4LC0A 4LPSA 2ECKA 4FWTA 1P9RA 4UNRA 3P32A 5H8WA 3SQWA 4FW9A 3OFNA 5FPKA 5JRJA 3EPKA 3EC1A 3KL4A 2VF8A 3FPAA 5GJWC 4MITA 1L7VC 4KFTA 3P20A 4TLBA 2WSSA 3KJHA 3C16C 1MO5A 1OF1A 4Q9IA 1FQKA 2CCJA 1Q3TA 5JSZA 4CDGA 4URYR 4BLRA 2AFIE 3GJ8A 1YHNA 3L8ZA 3Q8XB 1ZD1A 4YDSA 2I4IA 1CRQA 4WZBE 1UKVY 1QHXA 3A1WA 1W4RA 4MGKR 1MRNA 1RPZA 5G3YA 1NVVR 4JVSB 4R98A 2C9YA 5SZKB 1YZUA 4DXAA 5EE9A 4LYJA 3EG5A 2OBMA 3ADKA 4LC1A 2VP6A 1HY3A 3NEJA 1BH2A 1R8QA 2WOJA 2HF8A 4MYTA 4IDHA 3WHKA 2ZSEA 1XZQA 3ND8A 3N70A 2GEUA 4F4CA 2X2EA 4BRWA 1XDBA 3O8RA 3PUXA 2OCBA 5SZHB 4XWAA 1SXJC 4E03A 1OB5A 3G0HA 2MMCA 3ZGXA 2WKQA 5L3VA 2BMEA 4TL6A 2I1VB 4LYFA 4XD7D 3RRNA 4GMXA 3L43A 2GWHA 2VLIA 2J0UB 1H65A 4XVQA 5JS7A 1M74A 1P2TA 4LV6A 5HE9A 1U0HC 2PT5A 1X3SA 2JA1A 1GVNB 2ORVA 1DE0A 1ZM3A 3R20A 2WV9A 1R2QA 4Q02A 1G19A 1T0JB 2W2XA 5IRCD 5JCZA 4BFTA 2VTKA 2OV2A 4JKIA 4GL2A 2CNWD 2ZJBA 3VU9B 2G88A 3QY0A 4KFSA 1XZPA 4WA7A 4TQ9A 1KSFX 2IS6A 5F2EA 3U7EB 4QHYA 1NL3A 3ADBA 1KJZA 4NH0A 2FGKA 3CX7A 4Q48A 4FD2A 4F7WA 4PFSA 1T3HA 4M0LA 1CR2A 2VBCA 1AKEA 2W6JD 3EA0A 1GFIA 4KBGA 4Q1CA 4PC6A 3PCRB 1E2JA 1IY0A 5DHFA 1LF5A 3CR8A 2VA8A 3LWNA 3L82B 3MRSA 1GKUB 2CHVA 4B44A 3H84A 4EUNA 4KBFA 4Q03A 4D4KA 3RRYA 1MO4A 5FUYA 4KFRA 1ZCAA 3LV8A 2V4ZA 3QXCA 4OKSA 3T35A 1G18A 3BH6A 1GRNA 1NVVQ 3JVVA 3CO5A 4FCWA 4LDJA 4DEXA 3B8HA 3WBJA 4JLKA 4F38A 3AVWA 1E9RA 1JECA 2ZU0C 5GJVC 2GF0A 1DBSA 2IC5A 2FGJA 5TXGA 3D8BA 2BOVA 4A8JB 5AUOB 1GM5A 3U44A 2DFLA 1TQ2A 4UNPA 4KU4A 3NHBA 1E2FA 3CX8A 3K70C 3AVTA 4QM6A 4FMBB 1B0UA 2A5DA 1ZM4A 2XSZD 3VHLB 1OFTA 4M22A 2A5YB 1S1CA 1FMLA 2ZI6A 3RS5A 1YZKA 1GUAA 4NCNA 3QKRB 2IWHA 4CEJB 1KTVA 3DL0A 3ZVMA 1G41A 1FOEB 2FPLA 2HCBA 2JDIA 4TL9A 1F3OA 2H18A 4BECA 2JLXA 3K0EA 4AKIA 3FMOB 3THWA 5EE5B 2D3WA 5J47A 1KAOA 1UF9A 4L15A 1J7KA 1AS3A 1DAGA 3UK6A 2JLVA 5C4GB 4BPBA 4JBYA 1PLKA 4RZ3A 1DG3A 1IY1A 3SFZA 3TW8B 4DT1A 4ESHA 4NCHA 5GJBA 1E9FA 3RAPR 3AP2A 3H0KA 4KYUA 2C8VA 2QM7A 1RYHA 2ZAOA 2IYUA 3V4RA 2CLCX 2EFGA 2HXSA 3MJHA 2QQEA 1XMSA 1WRBA 4PQYA 4GZMA 3THXB 2HYIC 1GKIA 1OKKA 4PHTA 2NIPA 3U60B 3B7GA 4IOJA 1I2MA 3TQCA 2Q3MA 3AP3A 2ZI7A 2FSGA 4W5JA 2O52A 1R0YA 1JI0A 2ZI3A 1VG8A 2ZPTX 4M1OA 3RWOA 1LS1A 5IDVA 4GFDA 1JALA 2NO9A 4Y0VA 3W90A 4TZ6A 3SNHA 2OBNA 2QMHA 3NBXX 1G291 3WRYC 3FFAA 5IK2D 4TWZA 2CEAA 1KSJA 3TBKA 1KI1A 2JLZA 2AR7A 5EXTA 3ZS9A 1VHTA 3EWSA 3W6PA 1YR8A 1OXUA 3AV0B 2DR3A 5TV2A 2IHBA 3GP8A 1Z0DA 4Q1FA 5DN6D 1BS1A 2FA9A 3T1QA 4ZO4A 1QHHA 4C30A 4Q4JB 4KFUA 1SXJB 3QXXA 1VPLA 2B8TA 4A6PA 4E22A 4BGDA 3VR6A 2VIIA 1JPJA 1SULA 3EW9A 3KKPA 1XB2A 4TT3D 2OM2A 4DSNA 5JLJA 2ZRJA 3SR0A 3WMEA 5AR1A 1WBBA 4Q9LA 4ESVA 2JIZA 2NMVA 3CRMA 5FBWB 3WBKA 3WMGA 3I62A 5EE0A 3I72A 5EXSA 1N5IA 1S1MA 1KKLA 3AKEA 3RWMB 2F55A 3FMPB 2NG1A 3A1UA 3GJXC 3K0CC 4QGHA 3ZVLA 2ZSBA 4GMDA 5GADl 2CJWA 3KKQA 4D25A 4KHZA 3X1YA 3TK1A 4NE2A 1JB1A 2HXYA 4JL8A 5CJ2A 4MUAA 4FINA 4WZ6A 1F48A 1TNDA 3B1WA 4RD4A 1T6NA
chains in the Genus database with same CATH superfamily
1CB7A 1CE8A 3C8MA 4MJLA 4N47A 1E63A 2FZ4A 5EJEA 2OFFA 4I50A 1TZJA 2Q5LA 1YQQA 2R5WA 4E1VA 3GO4A 4ZVPA 5ALZA 4CG3A 5A4KA 2JJ2A 4I6GA 1WMEA 1EJ6A 4FYHA 1FFSA 1HT1E 3B9RA 3R41A 4NU5A 2GLTA 2PH5A 1JNXX 1FFBA 1RMTA 1Y3HA 3GJ0A 5EWJA 3V4VB 3GLGE 4I2NA 2VJMB 2HR1A 4MUMA 3C4JA 3L6BA 5EHXA 5L4LA 2IZZA 2AW5A 1O9HA 3CKLA 1B2RA 4AJOA 2DZDA 4WY2A 3ISTA 3ESDA 1FFAA 3WSWA 4NJMB 2VTEA 3C70A 3WL3A 4YCLA 3K05A 1VI2A 2E1PA 1YR7A 4GNRA 3WTBA 1MT0A 5KS2A 1HUQA 1S2MA 3GMSA 5KHOC 3WXMA 4PQRA 2H54A 3ETHA 3MWDA 5IVKA 4GLOA 1B8VA 1GU1A 2RH8A 1QNLA 3NG1A 1W59A 1JTFA 3TIIA 4B31A 4XB1A 2E4XA 1MLDA 1XEXA 1Q16A 3VDMA 3A26A 3ZIAA 3BFVA 1MMFB 1P0QA 4R9UC 3NBAA 3VR4A 5B3JC 2VUIB 5A2QA 3W05A 2CUTA 4OREX 4EPYA 4M87A 4HGOA 3LW8A 4OOFA 1N8KA 2ZYTX 2DWUA 1V3UA 2I99A 3ND6A 4OB7A 1JDUA 4V39A 1KZ6A 3MYYA 3K94A 3PB3A 2AHRA 1J5PA 4MQUA 1G8MA 4ARBA 2VXOA 1G8FA 4MUKA 2C5HA 2D2VA 1K5HA 4TTPA 4WA8A 3VX3A 4CVNA 5T7BA 4KX3A 1JGTA 3SC2A 1SBHA 5P21A 4DIFA 2B83A 4HF7A 4RUKA 3FKSD 1I5EA 3GLTA 1XVUA 4GR4A 3F6CA 1WTAA 5FADA 2K2WA 3DL4A 1FZQA 4H4EA 3PE3A 2ZYRA 4EMUA 5JROA 4L0MA 2DH5A 5FYQA 2QYHA 3RS4A 2DTDA 1AJEA 3DO8A 4PXYA 4LISA 2JKZA 2OCKA 3ZCRA 2R1UA 3AEQA 4S2EA 3CUUA 1NW5A 4TV9F 2NU8B 2VWQA 5NLLA 1F2DA 2M9MA 2RCNA 1UZUA 3MBOA 5DK4A 5JASA 3AUTA 3CLUC 3IVMA 4BXOA 1UK6A 3CZPA 1AMNA 1XA0A 4J8PA 2NXCA 4DB2A 2NZ2A 1COWA 4FX5A 1U28A 4U2FA 4OQDA 4N5LA 3I6YA 2QL5A 4YBZA 1NP3A 2L69A 4QLBA 1I30A 3V1UA 3C3KA 5DCUA 1CB0A 4PO3X 3WJ7A 5C4MA 1LI4A 2BVNA 1CP3A 1YDHA 4JJEA 5EGNA 3ZVNA 3AETB 2GZHA 2IRWA 3I9JA 3ML1A 3JVEA 2HSDA 2IGBA 1XEAA 1E0SA 2LCIA 4OX9Y 1Y9ZA 2QK4A 2HLNA 3STWA 1IJFA 1XP5A 2PYZA 5G1PA 3G85A 2IV7A 1IN1A 1QM5A 2JFYA 1YJBA 3QUQA 2NW6A 4KXUA 1U5CA 1DQRA 5JYDA 2VQSA 1W36C 4UBKA 4DLWA 3BEOA 4XSVA 4NV3A 1SUEA 4BP1A 4KE7A 3STHA 3A1FA 2FOIA 3HXMA 2ODEA 3CKYA 1C9KA 3LQFA 3RW9A 1NKVA 2ZYWX 3H0CA 1C9YA 1FLAA 1ZEJA 1WXIA 4X1YB 2X5JO 1M0EA 1YNOA 5KJEA 4TTRA 1D2HA 4ZYZA 4YHHB 2I6FA 4RIHA 4YP0A 2V6IA 4GZLA 4MWBA 3M9WA 1A76A 2B6HA 3T12A 1U6KA 4OAQA 1OIXA 4I55F 4AZ3B 3LTEA 1CDDA 2UYHA 2Z2IA 5IJ0A 3VNBA 3WGGA 3O73A 2CNKA 2O57A 4A0RA 2C95A 3GFSA 4KN9S 3VR2D 2C3OA 1JEQA 2R65A 3OWXA 4HL6A 4Q01A 3WLOA 3DHNA 5DW0A 5K3CA 3AEUA 1XG5A 4IXWA 1DNPA 1ZESA 3LRTA 3UMYA 1TLLA 1W8DA 2DBYA 2FX3A 4IR7A 2Z9BA 3RJMA 1QP7A 1MPXA 1TF7A 2AOWA 3KPUA 1JJFA 1P3Y1 4ANFA 1ECPA 2RG1A 3RU3A 4G8BA 1G7SA 2WJHA 2XNSA 1EBFA 1H1TA 2QMYA 3HR4A 1DC8A 1KEPA 3JWEA 4RM2A 2OCPA 3TNDA 4YCCA 1Y6QA 3K1TA 1K3UB 1XMJA 4OHCA 2XE6A 3X2SA 1BWPA 4KDEA 4BNYA 5C46F 1RM4A 2Q6KA 3NH9A 4MCJA 2OAQ1 4M6WB 2F1HA 3QU2A 1YJAA 3PXCX 4WY8A 3ZHVA 1Z7YA 2G5CA 1NW4A 1BXRB 4H3VA 2PSFA 2ZTLA 2GXQA 5UKDA 4MCHA 2IEDA 4NCIA 5FI1B 5JI2E 2ABWA 2YUTA 3PFCA 5JTTA 1XN1A 2F1RA 3F5QA 4ZFNA 4P0PB 3QOFA 4PC1A 2N46A 3QYPA 3B52X 3U3JA 2VAVA 4LJAA 1NN1A 1T13A 5E6UA 3GLRA 5KQGA 2O19A 5ES3A 1X7GA 3LQ2A 1GQQA 4Q7KA 4KMMA 1M34A 5JZOA 5LQJA 1NXXA 1OH6A 3WNQA 2VYND 1G5RA 2G28A 1GOTA 2VA9A 4DCNA 4NKRA 4X84A 4L5CA 1BVYF 3BJMA 3OIWA 4RGVA 3S5UA 4C4XA 1HO3A 5F35A 1S8AA 4KLRA 3TZBA 3UT5B 4J2TA 2HC9A 1Q0ZA 4CQLA 5I47A 1Z4QA 1U0EA 1SGWA 3FUVA 3IT3A 4W8HA 4URZR 4K81B 4OBBA 1DMSA 1KK0A 4XD7A 3UK1A 3ANNA 4GVXA 4E4YA 1UOQA 1YAJA 4QYTA 1Y4SA 1G2PA 2YFHA 1JJ7A 3L0IB 2NVWA 5AW3A 1E4EB 1EAYA 2PZ8A 3OIFA 2C4TA 3HO6A 1P4RA 1U0LA 1Z5GA 1E1NA 1GR0A 3D3KA 1PZNA 4UHEA 4DFDA 2O8FB 4IHAA 5DO9A 4CIXA 4Y9TA 2MTBA 4B1FA 4RY8A 4JENA 2D2XA 3FHTA 1L7QA 4O02B 1OXBB 4WASA 2FRXA 3HN2A 5KTYA 4PNZA 2VBFA 4CZ2A 3IQEA 4DV1B 3CW2A 3R0QA 1A7KA 3PQ8A 4WV3A 1Z4KA 3BA1A 4NLLA 3B60A 1B0PA 5JZVA 4CF7A 4D9GA 5EA2A 4KZKA 1NDQA 3TE6A 4DIKA 1ECCA 3Q3JB 2N47A 5JNLA 3NUQA 1G5TA 4NDNE 1F2UB 4R51A 3WFJA 5FBVB 1AQNA 1ISSA 4W63A 3QELB 2H4JA 1Z83A 3HJUA 4S0ZA 4I5IA 4UDYX 4ZV4A 1QQBA 3IEPA 3DA8A 3MQFA 3JAKB 5K05A 2W6JA 5FORA 1H8HD 1KI3A 5LNK1 2QVLA 1HYBA 4UUPA 1HDGO 3D6FA 1BW9B 5AJYA 1J00A 1Q91A 4C78A 3U3OA 4HAXA 1X0XA 3T3MB 4ITRC 5JFOA 3RARA 5FQNA 2N75A 2OD2A 2HDOA 2CUNA 3NPAA 4JQZA 2X8WA 2GCEA 3SDZA 3UAWA 1XCOA 1UDXA 4CMGA 1WHSB 2BEJA 2XPCA 2PL1A 4P08A 3NPMA 2QRJA 4XX0A 1N5JA 4MQEB 2FR1A 3H1FA 5I9BA 4AZ0B 4HGZA 1XPOA 1A7AA 3BMQA 3PVSA 1ZHHA 4UAGA 5H9VA 1QF9A 5AKXA 3T38A 1ZRMA 2UZIR 3IEIA 4MR7A 4ZT4A 5J59A 1XXLA 4JFRA 3G2IA 1CNFA 4NICA 5CB6A 2F90A 1A8SA 2QM8A 4H77A 2VPZA 2WWWA 3JR7A 3QNMA 4MI9A 3W4JA 3TPCA 2HU5A 1GPUA 1W36B 3MS4A 2ICAA 3V4OA 1UT6A 1VJ5A 3AILA 3R24A 2WJIA 3JQFC 1U8UA 5ES4B 5ECWA 1J1ZA 4ZVUA 1PVDA 3MWFA 1AHPA 3OP4A 3BQNB 1Q83A 1UBLS 2D5LA 3LPNA 3OI7A 4GKAA 2IE8A 2XXAB 4B4VA 1AO3A 1ENZA 5K8JB 3CXUA 2OYSA 5EI5A 3WL4A 2UVPB 4M9ZA 5CT9A 3AL0C 3RREA 3D0KA 1LTHR 2FOLA 3R5KA 3UCXA 3ZU2A 2XOXA 4RAOA 2CLMB 1XQVA 3EDCA 2VHUA 3GLIE 4M4SA 5K4GA 3FNRA 1AU9A 3TUIC 3WE7A 1O95A 2QLBA 1U0FA 2Y8EA 2YINC 3PC6A 5ESDA 3TTXA 3LUBA 1AQLA 2IU3A 4KPYA 1T4CA 3PEUA 1DWPA 1OGIA 4R8MA 3QV2A 4M55A 3HK2A 3MBKA 1TT5B 5ALNA 3FOEC 4KQ6A 1FP4A 4AG6A 1PGOA 4IV0A 4NMMA 4B3XA 1EFUA 4Z4HA 4E33A 1CJVC 4HBGA 1I4DD 2HRCA 4C6TA 8ABPA 4BLSA 5K0GA 3VVBA 1L5HB 2I76A 2DFKB 3C8DA 4TX1A 1LA2A 4B5KA 2ZTSA 1E9EA 5KWJA 3BSFA 1G4AE 4MW4A 5JS6A 3RVPA 3FKJA 3VPAA 1I1OA 2JZOA 4JIGA 2X9GA 2SKDA 1E2NA 4PSVA 3DMFA 1J09A 3CPHA 1K1EA 1OXVA 4LCEA 4Q3OA 3V6MA 4C14A 4J1QA 1KSGA 4N5IX 1NR7A 1XOIA 4RPCA 1KOLA 1UCFA 3QH4A 4K46A 4CUKA 4KDCA 4CMJA 3PI7A 2DECA 3T7DA 3DLBA 3TECE 2WLSA 4DR3B 3A9UA 3AI2A 3V42A 2QJOA 4ZC1A 3D81A 5TMEA 4EFDA 3F4KA 1SUSA 3P2EA 2H0QA 1NRXA 4WXYB 5DNCA 3DMGA 3EQ9A 4PZZA 3EIQA 1KYZA 3I04M 3R9XA 1KFBB 1OASA 1UJ5A 2FRVA 5LYJF 5FYDA 3K32A 4UCXA 4BO0A 4BKPA 2V1UA 4DGSA 3E2MA 5JQWA 5MFZA 4C4PA 2BHNA 5DNUA 1JIKA 2QTVB 3K70D 4FJ0A 1EQ2A 2ISCA 4OHVA 2NUBA 1MNQA 2NNWB 5KTNA 1POXA 2CDRA 2B7LA 4B71A 4MO9A 2DFNA 3K2EA 2WZCA 5KQMA 2DT8A 4ER3A 4Y9RA 1OAKA 1CC1S 2BZSA 1KORA 4INJA 2HSZA 4MLPA 3RJZA 3UMFA 2YQ4A 4HDRB 5IC4A 2J0SA 2DUNA 4MQFA 1HF3A 2RHBA 2ZRAA 1EX1A 3HFGA 2O8EA 4QVGA 4CQMD 2TSYB 4PO9A 1SZJG 4E51A 1JEOA 3DZ8A 2LDBA 1QZXA 3FGZA 2MR6A 2XMSA 3TL2A 3WI7A 3LZCA 2XH8A 4JJKA 3ESBA 2ZXUA 3ST7A 4TSKA 1M8JA 1E0DA 4MV3A 2OORC 1YB7A 1V1RB 3PD1A 4X6XA 4D8YA 4HNAA 3ZQ4A 1PHRA 2V45A 5K8VA 1P0PA 4M53A 5KNDA 2H2GA 1A98A 2X8JB 2DFTA 4NIMA 1PGJA 4CM4A 2ZJFA 3U4QA 1W581 1EYZA 1BHQ1 5LMZA 2W2PA 3UBMA 6AT1A 3BOSA 5FL7A 1FBTA 2BGKA 2WPNA 4DWWA 4UTRA 5LL6P 5EMLA 2ZVJA 2Q9UA 3I9V6 1G16A 1JPUA 3CZ5A 2JHCA 3DXZA 4H6XA 4IIJB 3HWWA 3PD0A 2BM8A 1DIRA 1K8RA 3C0KA 3EXFA 1F38A 4EJ0A 2P1ZA 2ZWAA 2DWQA 2FPGA 1DQPA 1W4ZA 2A5FA 2R84A 3NEYA 4K7JA 1YO6A 1L5GB 1QR6A 2IT1A 4I5GA 3RRBA 3UHJA 3AHGA 2QU7A 4M1QA 1BE0A 5J2TB 2E7ZA 1KEZA 2JFUA 3IELA 3KKEA 2L2QA 2DVMA 3DLAA 2PRJA 1HFKA 1Z45A 1CNEA 1E1CB 1SBYA 2BMDA 2R1TA 2X7XA 4MV6A 4V0RA 5FPSA 3RBVA 2ZANA 2KX7A 3E9NA 4KR0A 3IUMA 4QDOA 3JCZA 1W0KD 2WM3A 1PHPA 3THWB 2NUAB 1J90A 1I3CA 4BNMA 4EJSA 3U1BA 5HA5A 3Q5GA 3SQXA 3LBNA 2BE7A 4H6VA 2JB9A 4BO2A 1UAYA 1FDRA 4S35A 3QOYA 3BTVA 1H66A 2GD1O 5B4TA 4J6FA 1SQSA 5JNRA 1LDBA 3USZA 2FU5C 1YVPA 3EXHC 4O1HA 4Z3DA 4YCJA 5JH7F 2P78A 5J2UA 4WKPA 2XMRA 5GPBA 1RYZA 4ETMA 1YRWA 2B5WA 2MSKA 3R7NA 3LD9A 1ADYA 2ORIA 2VZ0A 2F59A 1ZRHA 3UHAA 4OXIA 1U28C 3EASA 1P7PA 3EH2A 1ABBA 1UBKS 2XCOA 3T0FA 1SVKA 1Y1QA 2QUAA 1U8AA 1KMHB 4PTLA 4YQYA 1NP7A 4Q3BA 3KOUA 4K26A 2OWDA 5IKEA 3LSTA 4LYGA 5L3QA 1DIGA 2J59A 4WFKA 1EWVA 1QF7A 1QS0B 1XA3A 1MB0A 1YS1X 3DLPX 3EBPA 3F67A 1KA9H 3HPRA 4W6QA 1LK0A 1PQWA 2PJZA 5DDIP 2Q2QA 3M2TA 1NGSA 4IQFA 3LBHA 1PL6A 4JB8A 3T4UA 3UUEA 2R6AA 1YFKA 1Z4OA 3DWGA 3AKZA 1T5BA 1ZH0A 1D6NA 2FUKA 1YB5A 3CF4G 2ZIVB 1LVGA 4Z1OA 1GQYA 1Z2EA 2Q0XA 2XKJE 4KH0A 4ZYVA 3W9UA 1OLXA 1VLJA 2IDZA 4IX1A 4ZVOA 1I5OA 4WN9B 1N1GA 1KPHA 1UXOA 3C15C 1MPTA 3CLVA 3DEHA 3EJWA 3RNOA 3ZHYA 1LDMA 4AYXA 3DDHA 4PG6A 4LXUA 1OAOC 1E1MA 1YIOA 2GAIA 4IYJA 1SCNE 3FBTA 3URKA 4IO1A 1PAUA 1KR5A 1QU2A 4D81A 2FFRA 4G4GA 3R3HA 4RVCA 5F77A 3EXG2 1IM8A 3WKDA 3LX5A 2FMXA 4G5YA 1WKBA 3TD6A 3VKVA 4WVFA 3IPLA 4RD2A 4D5GA 1ILWA 4CR6A 1NQOA 4Q7JB 1U7DA 3ZE6A 4RTMA 4BUJA 2NO7A 1NRIA 2WUGA 2WOOA 3BMCA 3IVGA 3QFTA 3DS8A 4PXSA 3BC1A 5IJAA 5LJLA 3QBTA 2HIAA 3RYFA 4D41A 4IFBA 2VPPA 2ZIEA 4QFMA 1DTSA 3B3QA 3CEPB 2YY7A 4CNQA 1M2WA 5D3ZA 2JLRA 3LPCA 2FNAA 4X45A 1WU7A 4AN4A 5IWCA 4PX2A 2NAFA 4DDTA 3UMMA 2X5NA 4I9GA 1YR1A 1BMFD 1M7HA 2O0MA 2WR8A 3A06A 4DQVA 3ZS8A 5LP1A 1NPDA 2P9FA 4WDRA 1NUTA 3AJEA 4MVJG 2CLKB 1TTHA 2DWOA 2PFSA 2Y9MB 3RWBA 3CGWA 5DBEX 2F8LA 4BO4A 1YB6A 3BXOA 1CE8B 1RWBA 1XHEA 2FJ0A 3H8SA 1PL8A 4HX2A 3EXG1 4I50B 1T5SA 3ONFA 3WL8A 4UPVA 2X14A 2XDAA 5B5SA 4J3JA 1P81A 2ZT8A 4RPLA 2A94A 4DSOA 5GTDA 1RBYA 4A91A 5JW6A 2XVMA 3E3NA 4UBOA 4GE3A 3EQZA 2WJGA 5A5VA 1A95A 5EWJB 4Y2RA 4QSHA 2QT9A 1N2ZA 3GJ4A 4LBZA 2ENWA 4ZK6A 1XTQA 2KB0A 3M82A 1CY4A 3DT9A 4YJHB 2Y1KA 3IUNA 4LOAA 4D44A 4YP6A 2A0WA 3D9QX 3VR3D 3KIPA 3I9LA 2OPHA 4DLPA 4ETWA 1LEHA 5KYTA 1DUVG 4ZAVA 1U3WA 2PQ2A 5IAGA 5IDYA 4R6XA 3KB1A 3TZCA 721PA 3PC8A 2F3RA 2P6MA 1F8YA 3HHEA 3AHCA 3RV3A 4KIJA 1PRYA 3PFNA 1QTRA 4GC9A 4Y9DA 4QJ3A 1IIRA 3VSCA 1QGDA 1X7XA 4LNUA 3PXXA 3GEIA 3MAGA 1V7QA 4ZYXA 4EMTA 1SY7A 3UO8B 1XEXB 5JAMA 3IAXA 3KWMA 1TI7A 4Q21A 1LLDA 1NXPA 3OCVA 2B6NA 2WD9A 3G1TA 4RY9A 1GPWB 4XB6B 4L78A 1MXFA 4YYEA 4ND2A 2PGDA 3NALA 2I4LA 2OHXA 3O1JC 4HSEA 1SVUA 4RV5A 4KSBA 5EKDA 1Y6ZA 3HJNA 3TZQA 1AVTA 1NUUA 4J7UA 1K98A 1HE1C 1BC5A 1UQUA 3BJIC 2AA3A 2D1RA 2G8NA 1OTXA 4BFYA 4CLDA 2J1LA 2IYEA 3BQ9A 2W42A 3NATA 3L7OA 2JI4A 2WAYA 3IP5A 4R8RA 3SC2B 2NYUA 3CH6A 4RKWA 3JWHA 2VK8A 2QTMA 4JSYA 1N6OA 2AEJA 7ADHA 1ZIDA 4IIJF 5AW1A 2FPPA 5K0SA 5ARDA 3FB4A 5HDBB 2C3PA 4LHYA 4UHBA 3WFZA 2BFNA 3ZWKA 4NYIQ 2GFQA 1QYRA 3KR1A 3EXHB 521PA 1I3NA 3AEQB 3ROGA 3HDVA 4KWEA 3VPBA 2FPWA 1ORDA 3BGWA 3QFCA 3HCOA 2NYVA 3LYAA 4J16C 2VOJA 3LOQA 4NEQA 4XYMA 4S12A 5JYCA 1W85B 1V5FA 1Y9DA 2WTEA 1R64A 4G5SA 1U2ZA 1YQWA 3CA8A 3OZTA 4C0AC 3E0QA 3EIXA 2NN3C 2QZZA 1VHJA 3KDPA 4FMPA 5JS8A 1Z6XA 4OD0A 2K7FA 3NHLA 1IVYA 4GOND 3DM5A 4FE7A 3H4MA 5AQEA 3R7FA 5JSUA 2HT1A 2QGFA 1JH8A 1A7JA 1V8BA 3PPXA 4MR8A 1Y4ZA 3BSSA 4OSEA 1HE5A 1KO7A 4FDVA 3OURA 2QD4A 1JHMA 3H8WA 3JZDA 3LVBA 5FWYB 3QOXA 3RT9A 3PQEA 3BDVA 3QYAA 3STXA 4FQ8A 4UMFA 3UHFA 4D4JA 1JQBA 4M8NE 1U7ZA 1VG1A 1PGPA 5BW4A 3USES 1EA5A 2IVFA 3PJGA 4H3SA 5ER6A 4RTLA 5DW3A 5HEKA 3QU9A 5CA1A 2QW1A 4G5RA 5ALRA 3HZRA 1AQYA 1XEWX 3EH1A 3PGXA 4OH7A 1BGVA 1Q5PA 3MS7A 4J0EA 1QTNA 4P34A 4J76A 1ZNZA 4C5BA 1NYLA 1T8SA 1Q1GA 4HOYA 2BHTA 1EK6A 5FL3A 2ID4A 1G1AA 3FZQA 4O4IB 2ZTVA 2JHPA 2Y76A 3L7AA 1EP3B 1HKHA 3M49A 4GBGA 3DBVO 3CC8A 1SUDA 3R7SA 1BDMA 3HUFA 3UT0A 4B85A 1MHTA 4RTPA 1ULTA 3M4XA 3DEFA 3QWFA 2JJQA 4XWWA 5AVKA 3FWYA 2B69A 2JJ8A 1VKHA 2PKXA 2WT4A 1Y5RA 2YYSA 4OGWA 4Y9UA 1U3FA 1EFTA 3F3SA 3VAZA 3CEAA 4R40A 1R6UA 4CQNA 2II6A 2RHLA 2BEWB 2MINA 4TLAA 5IJ0B 5L95A 1PBTA 4ZYYA 5F5XA 1O95C 2VHXA 4RENA 3N2LA 2HD4A 1IOZA 1JEQB 3NB0A 4ZO9A 2H59A 4P3XA 3S2FA 1QHSA 4JB3A 1QHEA 2X3YA 2NUTA 5KYXB 1ZGGA 4O2AF 2BEVA 4L7VA 1A9QA 3UXHA 2F6RA 2POCA 3OKFA 2A9OA 5TMDA 3MPOA 3D4PA 3OTIA 2O7NA 1LRKA 1RYBA 1VP3A 4L9AA 1GCAA 4ITUA 4Z2AA 2WWYA 3SDSA 2RDMA 3AO0B 5A6SB 4ML3A 1KDVA 4PYKA 4EMBA 1L3IA 1YKGA 3LUFA 1XP8A 3EXIA 4G0XA 2AF4C 4GEKA 4CG1A 2B61A 2RH5A 4KACA 4QRIA 5D7NA 4A82A 5BV1A 1LTKA 4UKDA 3OEYA 4EHBA 3T3OA 2YC4C 4BJ1A 2JGMA 1V0JA 3R9IA 5IBCA 2O2GA 2CMFA 1QCZA 5HW0A 4CKEA 3LJKA 1U7UA 2PZFA 4U2CA 2I03A 4UMVA 4DS3A 1Y8QB 4JEIA 4GLBA 1OZ0A 3EOZA 3PGVA 1MF7A 2CV1A 1VLHA 3QNWA 4NG4A 4QYXA 4NECA 2D5AA 1ENOA 3DYIA 1SN7A 1SA0A 4DIBA 1I7NA 1LC3A 3HCEA 1ML3A 1GL7A 3OZUA 4RMNA 1M7BA 4UDXX 5KHAA 5GMOA 5DTEA 2BM0A 4RW0A 1I7QB 4LGYA 1QJ4A 1SBNE 2FE1A 4MMYB 3RYHA 2P9TA 2D7DA 3H2ZA 4BZQA 1K3FA 1K7FB 5DT9A 1K6EA 1L4KA 1W2WB 2FSIA 1PUJA 1XEFA 2UUPA 1KAEA 1W2HA 1ESEA 1XR3A 2OB1A 5K0LA 5FTJA 3OZFA 2Q62A 5E9QA 2NZXA 5MN6A 3QHQA 3H04A 1V7CA 2P11A 2CN1A 2Q50A 3U40A 2VJYA 2XQGA 4WLNA 5FLEX 3WL5A 1DIBA 2GDJA 2YJZA 1R8YA 1FU8A 2WJ4A 3QIVA 3Q10A 3EEOA 4DMMA 1LSOA 2D2IA 2HBQA 5JYBA 2DHEA 3EJ6A 3BT7A 3C8HA 4M9QA 4BQSA 1DFGA 3IT2A 1N25A 2X5OA 3CF2A 4MKHA 4ESEA 1K06A 1L4FA 4P7JA 3WK5A 3RNLA 1M2OB 4INOA 4RVGA 4U6NA 3IBGA 2J32A 1MQ9A 3BGSA 3RCBA 3B5JA 3FMGA 3H7AA 1T0UA 2QZSA 2FWNA 1D1PA 2FVYA 2UVDA 3HUUA 3CEJA 2A9FA 1AK1A 1ZL2A 4KN8A 4QHTA 2A9QA 4MTLA 1TA4A 2DQKA 4KO8A 4MEJA 3W5JA 5BXQC 4Q9AA 3HLTA 1CUHA 3MM4A 4QPZA 3K20A 1I6KA 2C5EA 4S2UA 3S7ZA 3TZHA 4JP2A 4BVJA 3GQBB 1F1JA 2QX4A 2WFZA 1S2DA 3JZMA 1MB3A 3Q1KA 5EC8A 1FFXB 4YV2A 4RWZA 1FP7A 3OZSA 1N5OX 1Q17A 1NW9B 1VJGA 2QMUA 4OMUA 2HPVA 4TOIA 1KZHA 4C4OA 4DDUA 4YI5A 3B2NA 3NAGA 3RIGA 2AZMA 1XKXA 2CCKA 2Y1OA 4M9CA 5HCIA 4U7DA 4FR5A 4EK9A 5T57A 2ZWOA 3DEAA 4CIYA 4QTZA 2ZS7A 3WHIA 3N1UA 4OQQA 5INTA 5J43A 4MYUA 4OQEA 4EA9A 1USKA 1XZ8A 1ZICA 3IUPA 4L8FA 1GU0A 1Y8AA 3CV3A 5DYIA 3SJZA 1LD3A 3H99A 4ZZ1A 5IN4A 5AVYA 2P69A 2BSXA 1TMKA 3ACDA 5ALKA 2E9SA 3NTRA 3IODA 2UYOA 1CUJA 1TTPB 1VSQA 2C5GA 3EC2A 4IHKA 4JC5A 2PZMA 4NARA 4F6RA 1N5LA 1I8TA 2IHVA 4UOEA 2PKRA 5FBKA 2JVIA 3R0ZA 1E0KA 2WSBA 4WCDA 3H97A 3SHQA 3AP1A 2CLEB 4MJ3A 1DIOB 2VZEA 3H9EO 2LZ0A 1UMDB 4BNJA 1Z35A 2D1QA 1IOLA 3M1YA 3EBOA 3STUA 2GCPA 2I66A 2UKDA 4JI6B 3PJRA 2XB4A 1KS9A 2XEDA 4WZZA 1REQB 1TM2A 1ZHFA 4QJIA 3E61A 5B2ZA 4QJ4A 1T9CA 4TM7A 2RGBA 1RQLA 1USWA 2VNSA 4G0PA 4V0LA 4MA0A 5FNVB 3RVKA 1A9XB 3GNTA 4YJDA 4EJSC 2HRQA 4KE8A 1RP1A 2GFIA 2HSGA 3H6HA 1RWXA 1X15A 2GTHA 2HSWA 3SSNA 2IZ0A 3TOSA 3ZX5A 4B6OA 1Y5IA 1MX9A 2G5GX 2FEKA 4HLQB 4RY2A 3PE4A 5IM4A 3HM9A 3QXJA 4P98A 4QJ5A 4CHGA 1GZVA 1N8TA 4FHFA 3WP0A 4M7OA 1H22A 3NXKA 1BJRE 5BNFA 4DIMA 1FJXA 2EEZA 2IZ6A 1B0AA 1EZZA 3S1AA 5KDLA 1V2GA 4WJLA 1E7QA 1P1KA 2B99A 3QBEA 2WG2A 1L8LA 4LQCA 2LGJA 3JQ8A 4MUYA 2GNAA 3VX4A 3OT5A 4I3GA 3B1VA 1YJ8A 3L1JA 1UWCA 3PRHA 4LE0A 1UJCA 1Z4NA 2R6DA 4N5DA 2HUNA 5EXDA 3UJ8A 2CXTA 2IH5A 4AWBA 2UYQA 3FTQA 1T8YA 4IIUA 2IEAA 5ADUS 2OXCA 1G5PA 3BWDD 3MUEA 4WXHA 4L8WB 1HNZB 1EUDB 1RI1A 3D8RA 3N2KA 3OJOA 5EJ8A 3WHLA 2EDCA 4ND8B 2IP4A 3F7OA 2VDNB 1Y7HA 1VA5A 3KCQA 1NNI1 5LA6F 5CBKA 1E32A 1FXUA 1RJDA 2QDXA 1CY8A 1H9BA 3FZYA 1MTZA 4LQLA 4FK8A 3T3DA 1RDFA 1FP4B 3ITKA 1DXYA 2Q4TA 3K92A 4LJLA 1SU7A 1S3FA 2YWXA 5AK5A 5U1PA 1JMKC 2HWWA 2PKCA 3UC5A 2QBYA 1XYGA 4C6TB 2CVZA 1YFZA 2APJA 2H4ZA 4QWWA 1CUXA 2XLCA 4QATA 3AR7A 2NUPB 3B6EA 3MPUA 1E5XA 1UK8A 2P79A 1RWNA 1XYYA 2C94A 5C2JB 3I5MA 4BJ5A 4DBVO 5EKXA 5AIBA 5GIPE 5ALDA 4LFBB 1D04A 3F46A 5AUNB 1ABEA 4C89A 3WNCA 1L3CA 4JT4A 3C7TA 4PHCA 2EF0A 4EA7A 4M1MA 5IDQA 5JNTA 2YBEA 4P4LA 1NJ5A 1UR5A 4V02A 1IDN1 4DSZA 3MB8A 1T8TA 2IOFK 3LKBA 1Q7TA 2EX1A 1N7GA 2CNOA 3ETEA 3IR7A 2WJZB 2XQVA 4M49A 3OTOB 2EFHB 3K4QA 2PKYX 5A5EA 4NOKA 3USCS 4GI1A 4JR1A 3GYBA 3HBLA 1AS0A 5T67A 2NX2A 3HCPA 2A5GA 3BRWD 1R8JA 4TKVA 1H4SA 3R9XB 1FVXA 1H6AA 3LK6A 2IYVA 1YUMA 3EIHA 3DDOA 5FT9A 1ZZGA 1X7WA 2AB0A 2BR4A 1U7WA 3HDGA 1X38A 1ZDMA 5TQ0B 2P6RA 1BGWA 5ARCA 2OHJA 4KB5A 1C0IA 2O8BA 5DHRA 3WYBA 3ZDXB 5FXMA 1O0SA 2RHJA 1YRAA 1H94A 3V4SA 1ISFA 1JKJA 1UKBA 5CDHA 1L4LA 1B76A 1O2DA 4KXVA 4DJFC 3KP1A 3HYRA 5AVTA 1FYWA 5D3QA 4IHJA 3GOHA 2ZE6A 1VFPA 4BE7B 1MAUA 2AQ8A 2GXSA 3FNGA 4JT2A 4KJZA 5D51S 4F4JA 4S1OA 1QQ5A 1KI8A 3CLTD 2O8EB 3HKDA 4Y2YA 1GUYA 2Q1WA 2W37A 5DTJA 2O0KA 4HFJA 4P7FA 1TU3A 3NWBA 1KE2A 2A1TR 4R1LA 1O4WA 1ZGCA 1V1MA 1FF9A 4QPNA 1UBRS 3A1EA 1M83A 3B20A 3K0BA 2L42A 2ZBVA 4I5EA 1DDOA 4P3KA 3WRVA 4O4HB 3G2KA 4H0FA 1RKUA 1R0KA 2J9GA 3AW9A 2XV1A 5JSZB 2VJCA 2I2FA 2I6SA 4J75A 2D0IA 3TFOA 1NNLA 1N4DA 3L7JA 4YLGA 3DOUA 4HNAB 2MYPA 4RMJA 4N41A 1XNHA 2EBFX 1YFLA 3CNQS 1GL6A 1Y7TA 3U4QB 4OI4A 4RNCA 3DHWC 5ENVA 4AVYA 4BP3A 3ZI4A 4DGQA 3C7AA 4EIWA 3I9MA 3N0XA 4JI3B 4P6VF 2ZYIA 1XTIA 4H6PA 3RS2A 1JHZA 2GAAA 2CLHB 4HJXA 4I6EA 4KRYA 4AMYA 4KR6A 1YA4A 1DUSA 2PANA 2WIAA 4LXQA 3TQQA 3S8YA 5LOVA 2QRHA 4UREA 5EPEA 1JS1X 3EXFB 5A0VA 4KAFA 4MW2A 4R9VA 5T41A 3CEHA 3FR8A 3FOCA 2FPGB 1C7RA 1QHNA 2I7VA 2O14A 1QORA 4JLMA 3IIEA 4UVGA 3WLSA 1WPXA 2FSSA 1Z39A 4QNNA 1M5RA 1QG2A 1L5OA 4RZSA 3V8QA 4DYHA 4EITA 3BWBA 1KDPA 3DTVA 3A9VA 3TTWA 4MJ7A 4D3YA 1E94E 1PFVA 1SCKA 3E1GA 4PX9A 5GOZA 2F3TA 1S8NA 2RI1A 3S29A 3UZUA 2BAGA 1NBAA 1VMDA 3EVBA 1ACLA 3GT3A 3GJSA 2JA2A 2Y99A 3H7IA 1G6Q1 2SHKA 4E30A 1OFHA 5AW4A 3GCZA 1WU8A 4MB6A 2ZTHA 1KH3A 1B3BA 3ADCA 1X1SA 2P62A 4MWGA 4N0DA 1E9AA 4Q9HA 4G56A 1XD8A 5CCDA 4F8EA 1GCOA 3Q15C 4IDNA 2FLWA 4ZI2A 4P80A 4B4WA 1JYEA 2B30A 2DU8A 4J0QA 4OX9B 3FI0A 3PHLA 5G1NA 1JEEA 4KGXA 2Q5HA 1LJ8A 1KR2A 3ISVA 2CYAA 5M34A 1BMTA 5HZKA 1D1QA 1V4BA 3V2GA 1Z5ZA 5IJXA 1N6KA 4GWKA 4KWIA 4WEQA 3RUIA 1MU0A 1NXOA 2G7MC 3KQHA 4F96A 2J9ZB 4ZZ2A 4E46A 1X7YA 4D0NA 4YAGA 5BYAA 1GTSA 2PD6A 1JU9A 3NQ41 1L0BA 4P8RA 2HF2A 5CM8B 5EP2A 1Z13A 1HQYE 1V9LA 4BEJA 1WM1A 5L3QB 2BGLA 4XRGA 3R7BA 2INGX 3RTDA 4DBLC 5JZBA 2FW9A 3RKRA 2EZTA 4OM7A 2QUJA 2P27A 3IQZA 3N75A 4DY4A 4LJ8A 3QVGB 3KXLA 3LYLA 4IIVA 2EZ4A 2WWHA 1TIBA 5EKSA 1K8YB 1RC0A 3KLOA 4QU8A 3V3TA 2M1ZA 3TS1A 3ZXYA 4BOYA 4DQKA 1WE2A 1X9HA 4UPEA 2PUTA 1OLXB 4QYSA 1KHHA 3NWJA 5I9IA 3DOFA 5LZ5A 2I8AA 2I78A 3U44B 4EB6A 3NONA 5KJ1A 2Q7XA 5HGJA 2PJDA 1EM8B 1FE8A 4UVHA 4KWCA 2NYAA 2OB2A 3QU4A 3MAJA 3K3PA 3VOBA 3PFKA 2VYVD 3VZDA 4URVR 5MF6A 3WLQA 2WK1A 2WTXA 4P53A 4Z9AA 1DKRA 4KGZA 4IJMA 2FW8A 2OHOA 1TEHA 4DSAA 2W43A 3HJRA 2O2SA 1BEEA 4FONA 2WVHA 2ZK7A 1SC9A 5LP6C 4BQOA 2H5IA 1Q0PA 1S4QA 1U9IA 5G0VA 4GRDA 4ZGBA 1G3IA 1PR6A 1LFAA 5EVCA 3WDMA 10MHA 3ZNOA 4DA4A 3WNVA 1ZVVA 1KBOA 2CXXA 1WSBA 1D5WA 2HAEA 1TVMA 1MORA 2Z3VA 3DL7A 4HNSA 3RG8A 1RWVA 5B7GA 3EZ6A 2H4WA 1XZIA 4L4RA 4HQOA 5KYYB 2IXGA 5CH5A 3R0IA 5GVSA 5A3JA 4DV3B 4LF9B 2GQ0A 1OWLA 2ECFA 3UN1A 4HNVA 2I22A 3DLIA 2QQGA 3PNOA 3WYNA 1H8EA 2WYHA 4EVSA 3O8DA 4H1TA 1RWKA 1JDNA 3F0TA 4ZHQF 1UJNA 1PD0A 5IVDA 4BNXA 4G25A 3BFXA 4WZBB 3Q7TA 2XGSA 3BORA 1W94A 2C92A 3D64A 3QF7A 4GSKA 1PJCA 1GFZA 5CX1B 2FP4A 3ZWAA 4ZGGA 3DYVA 4MGEA 3CF6R 4OBXA 2H2IA 3GCDA 4AS1A 2CXQA 4YS6A 3SDBA 3QA9A 3VKFA 3WJ2A 3JPWA 3R3YA 1P0CA 4JQOA 2BBSA 3C74A 3A1TA 4ND5A 3U3RA 2Y71A 3SSOA 3GGSA 5HMLA 2BL4A 1QAOA 2XWQA 1SXPA 1ZRSA 4IYRA 5CDFA 4NHOA 2X42A 3EIFA 4EEKA 2Z43A 3GPIA 1PWHA