1G6HA

Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
TMEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANSPORT ATP-BINDIN
total genus 92
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g6hA00
3QQ5A 1TQ6A 2QAJA 3CWQA 1IM2A 2O8FB 1J99A 2RMKA 1TQDA 4MGYR 2ORWA 2WWIA 4JYBA 1JEEA 2BVNA 4Q1AA 4Q02A 4IOMA 1ELOA 1F48A 4C0SA 4JL8A 4ARZB 3WMEA 1GL6A 3K9NA 3SJBA 3GLIB 1ZM7A 4LRWA 1ZM3A 1MO5A 4PAOA 3EZ6A 3N2EA 1XNJA 4XOIA 4EJSC 1E2NA 2XOKD 5DE3A 1SVMA 4RKEA 1PLKA 3AVOA 3FE2A 1LY1A 2W58A 2RGAA 3K9HA 3BH0A 4R9UC 3QF4A 4Q4JA 2V55B 3OFNA 5AJVB 1DE0A 3LW8A 1NIJA 4TZ0A 4AG5A 1BO6A 1GP2A 5A0FA 2OE2A 3OE7D 3B1XA 1MO3A 1GKYA 2QZ4A 4KJZA 4F4CA 5JBQA 3QJYA 5JJIA 1T6NA 1KJYA 1H65A 1Z07A 4N0EA 3AF3A 1A2BA 3BRWD 4Q21A 2ZUDA 1N6IA 2DFNA 3L8YA 4Q9HA 1CJVC 1W4BA 2ZROA 1S8FA 4OI1A 3JZAA 3WRYC 1E94E 2XITA 3RS7A 3MJRA 3QBTA 4DLZA 3E1SA 1T8UA 3UG7A 1VCNA 4G5OA 1QHSA 1LS1A 3KKQA 3VR2A 2ZI4A 1KAOA 1Z06A 2BEJA 4DUGA 3DKVA 2CLDX 3WNCA 4B6FA 2YWEA 2Z6VA 5KOYA 4LHWA 1NI3A 3THWB 4Q01A 3WYAA 1WE2A 2D7DA 2WJHA 3GP8A 2R62A 2GK6A 1E9RA 3M0EA 1UDWA 3KFXA 3MCAA 4FW9A 4IEEA 1KGDA 2NG1A 4IXMA 1S1MA 2ZJZA 4LSGA 4OI2A 4QOSA 1O87A 3EASA 4JZKA 1BH2A 1D2EA 1OXSC 4AIIA 5BWMA 2NZ8A 5BXQC 1KI7A 3PR1A 3TAUA 1KZGB 2WWWA 4FCTA 3ZGXA 3VKGA 1EFRA 3LAWA 1UEJA 3GJ6A 3MMPA 4KSCA 3SHFA 5FPHA 3U4QB 2ZSFA 2EFGA 1II0A 2J1LA 2UKDA 3IUYA 3NIBA 5GVRA 1US8B 1OKKD 1AA9A 1JEDA 2N46A 3NEJA 4AWXA 4C3ZA 4B71A 3EIEA 4W7SA 2QG6A 1M6NA 3CPHA 1ZD1A 3F5FA 1G3IA 4Q03A 4HUTA 4R7ZA 1H8ED 1QVAA 4QXAA 1IN6A 2OXCA 3OHMA 4OJQA 3WHLA 4HB4A 1VYTA 4BFSA 2OXRA 3FYHA 3SR0A 2V3CC 1B23P 3H4MA 4XVQA 1J8MF 1Z6TA 4WVFA 1DAGA 1NF3A 3CX6A 4Q1EA 4TTPA 3ASZA 4HI0E 4NYJR 3VHLB 3WHKA 4IVQA 4FCWA 3VU9B 4A2QA 4Q19A 1HH4A 4DB4A 1V43A 3U7GA 4LBWA 1N5KA 3K70C 2IEZA 2JLSA 2XEXA 2AXNA 2OILA 5DISB 5P21A 4D80A 1UFQA 2G77B 4JLOA 3SZRA 3PXGA 1U94A 4B75A 3D7MA 1OIWA 5H68A 2O8CB 1XTKA 1E69A 1NVVR 2OLKA 5KPJA 1SVOA 4O2LA 1RRGA 1IXZA 3TVDA 1VG1A 5FUWA 1E0SA 1N6OA 2GF0A 4ITRC 1KK0A 1Q1ZA 3J81k 5JI3E 3NDBB 2W00A 1GFIA 1AK2A 4ZPXA 3ZLJA 1Z0DA 1N6NA 2J7PD 1KSJA 1YU9A 4IJMA 1M7GA 1XXHE 1G41A 3U3KA 3U44B 1U0HC 1E2KA 3SE0A 2ZR0A 3PEVA 2IS2A 1Q0UA 2C77A 1BYIA 1NMZA 1XF9A 2Y8EA 3GEIA 2BJWA 4MKIA 4B2LA 3C7KA 4HUQB 2ZETA 5F9FA 3R9IA 3PEWA 4LJ9A 1MO4A 1N6HA 1Q1EA 1RYFA 2CL6X 2RCNA 1RRFA 1XP8A 2ZRKA 5KNBA 5EP3A 3NG1A 3W6OA 1KI3A 4IW3B 3QXHA 4DCUA 4YXWA 2QQ0A 3CRVA 4HAUA 2JLXA 1YR6A 2BIFA 3GLGB 4EFLA 1OV4A 4QM6A 1CTQA 1LFDB 1VPLA 5JFGA 3W3ZB 3FHOA 5CJ2A 3QPUA 3NBXX 3FFAA 4AYWA 1Q1BA 2D74A 2RGNA 1XRJA 4PFSA 1D5CA 3SN6A 1ZIPA 5B30A 2HLDA 1E2EA 3TMKA 1JR3A 3U2QA 5FBLB 4B74A 2O8BA 2PL3A 3I5YA 1R6BX 3CZPA 1ZBDA 3OIYA 2UVQA 2DPXA 4WXRA 3U3JA 3K1JA 4F4JA 5LDDC 4XIGS 3QVUA 4Q1DA 2JJ8A 4D0GA 2GCNA 1SVSA 4QRHA 5AUNB 2KBFA 2BWJA 3I4LA 3E2IA 5EE9A 4KSBA 3KQKA 3NC1C 1P2VA 1NP6A 4IVRA 1ZJ6A 3IEVA 5AUOB 4ABYA 3B1WA 3L0OA 3RVBA 3OIVA 1NSTA 2J0VA 2YOGA 2Z83A 4IDQA 4RSGA 1CF4A 2R6GA 1NMXA 4OQMA 3OFND 2ZS7A 5BQ5A 4ZCIA 4D0LB 4QKQA 1DAIA 4C2UA 1EFUA 1JNYA 4IEIA 4DWJA 1E2JA 1G16A 2IUTA 1CKEA 2CDNA 4DDTA 3THYA 2OLJA 1VG0B 4MRPA 4I1UA 3IO3A 3AUYA 1N2CE 1D9ZA 2HF9A 4DCVA 4AY2A 1UKYA 2JLRA 1L8QA 3O8DA 2QA5A 1K6MA 2W0SA 2V7QA 4Q1BA 4YDHB 4OHYA 4V02A 1LB1B 3QBVA 4KYUA 2OBNA 3V9PA 3U44A 2IYQA 1TTTA 2IUUA 2VP6A 2A7QA 3FGNA 5J4YA 5KNDA 2CLCX 4O0MA 1XZQA 4AG6A 1XTQA 3PUVA 5FPSA 4PC3A 4P33A 1T3LA 3ZH9B 1MH1A 3BFXA 2QTFA 3TSOA 4IXNA 2G0TA 3L0SA 2GZDA 2IF0A 1ESNA 4X8OA 4P4TA 3FMOB 5FI0B 1IY0A 3LQQA 4BEJA 1QHYA 1CJMA 5CDFA 1XD2A 3RS2A 2EYQA 3GLFA 1KNXA 2ZU0C 1A2KC 2H17A 4YDSA 3O8RA 1GL7A 3MAAC 2V8OA 2DWOA 4W9MC 1XD8A 3QKUA 1NIPA 3R7WA 1QVRA 1FMJA 2O8FA 4WXPA 3EA5A 1OKKA 4LV6A 3TR0A 3W9YA 2L0XA 4RD3A 3NHAA 1YR9A 3ZIAD 4B76A 5EZ6B 2BBOA 2VSOA 4W5HA 2VHCA 3I62A 1FL9A 3EARA 2CCJA 2XZOA 3TIFA 3AP2A 4JKYA 1N0UA 3R9WA 2H7VA 5DH9A 3LWNA 2NQ2C 2QGNA 2XNDD 4TSFD 4UNSA 4URXR 1VYVA 2E9SA 3W90A 1Z0JA 3IQXA 4EUNA 3SQWA 4Z1MD 4CDGA 4TYYA 2FEMA 2ZSEA 2K5UA 2J0UB 1D9XA 3C15C 1IY2A 4I81A 4DDUA 5EJEA 1KHTA 1YZTA 2FGKA 1G3UA 1KI1A 4NZYA 4LPKA 2G88A 4FMBB 4TN1A 5H8WA 1W4RA 3R20A 2ZRJA 1CBUA 1F5NA 1ZNWA 4IDPA 1W4AA 4R2IA 1M7HA 2WPDA 5L3SA 2OESA 5EXSA 1KY3A 4QBHA 4JLAA 3H2YA 4A0FA 3BH7A 1IXSB 1NMYA 1LVGA 3VR1A 2MSDB 3RHFA 1UADA 1VECA 3ZJYA 1GRNA 3HDTA 2VP9A 4TL6A 1JQJC 3ZQJA 3KX2A 3THXA 2IA5A 2E1RA 5AUQA 1YE8A 1E98A 1Z6GA 3C4JA 4TYNA 3BB1A 5HE9A 2GJ9A 4WBSA 1VTKA 2O0HA 1OFUX 3FKSA 1W44A 1G4UR 2GJSA 2I4IA 4ZV4A 5C2JB 2Q3MA 1OYYA 2IW3A 1ZNZA 3GLHB 4BQSA 3ZVNA 2IL1A 2REXB 3CIOA 2GF9A 4BZPA 3KKOA 1FOEB 5JCZA 3BXZA 1SXJC 4M22A 4A1FA 4IFEA 2HUPA 5FBRB 2ZI7A 2GETA 3CKLA 3E70C 4CZ2A 1G7CA 3T1OA 2ZVQX 4TMXA 5J5CA 1L2TA 2R6DA 3B9PA 2PZFA 3SBEA 1NLZA 3OZXA 1LF0A 1XMIA 4ZCLA 3GLFB 4BFWA 1FNNA 3AUXA 1BKDR 5DYIA 3TQCA 2ERYA 5AK0A 2GDJA 1DBSA 5HPYB 2HJGA 4LBVA 3QF4B 1Q3TA 3EPJA 4DB2A 4KFUA 2QMUA 2CXXA 3NH6A 3OEED 4FMCB 1ZNYA 4CGZA 4FN5A 4Q48A 3X2SA 2IUSA 3F8TA 4QBFA 2JJ1D 3PIRA 3CX7A 1Z0FA 2G1KA 1KDRA 2AWOA 2ZJBA 3OIUA 4IDNA 2IYUA 3GEHA 1RRCA 2I3BA 1KO4A 5AUPB 1W47A 3K0CC 2ZRGA 2P65A 4HLQB 4I1SA 4V0LA 4B2IA 1GKUB 1WMSA 1AS3A 1G8YA 3NVAA 2BHRA 4GBMA 1XMSA 1CULC 1Z47A 2FZ4A 4HAYA 2AD1A 2XJ9A 3Q72A 4YMSA 2AK2A 3GFTA 4UNNA 1E3MA 2VEDA 1KDOA 3I5XA 3LVQE 3SU8A 1NN3A 2NTYC 4BRWA 3I32A 3SNHA 2FFAA 2Z0MA 2O0JA 4EPWA 2G3YA 1JR3D 2F1RA 2C96A 2PBRA 3CR8A 4XD7D 5KSYA 4LHYA 1LTQA 1GITA 4W5WA 1OT3A 1KYIA 1RW4A 5FOXA 1JQLB 3WP1B 1JXMA 2RGXA 2Q6TA 3NBZC 1ZYUA 1SXJD 1GZSA 3KUCA 4GPTA 2X19A 3O8CA 2BMFA 5EUQB 1OH8A 1S4QA 1SQ5A 4LJAA 4XSGA 3VAAA 3CR7A 1NKTA 3FOZA 1KJWA 2RGNC 4B35A 1Z83A 2YKGA 3M1IA 1NBMA 1P72A 1E32A 2C03A 3DMDA 3DEFA 3NXSA 2OV2A 3LNCA 2ERXA 4MRRA 5GJCA 2KSQA 1E79D 2GESA 3CUEF 3DOFA 3UWKA 2ZRAA 2ODEA 4EPRA 2PX3A 2ZI5A 4ZDWA 2VL7A 5TY0A 5LD2C 1MR3F 3AV0B 4HZUA 2ZRIA 4M1MA 3GJ4A 3U5ZB 5FL3A 1R5NA 4H9GA 4BWYA 2REOA 2XZPA 3GMTA 1M74A 1I4TD 1DOAA 1AKEA 3KJEA 2GEVA 4US0R 4GP7A 2QE7A 3AF0A 4RVCA 1X6VA 4U00A 5CYPA 4X8HA 5KPDA 1N5IA 5EP4A 1W0JA 2OM2A 2DFLA 2ZRPA 4DBLC 4G3XA 2ZYTX 2VYFA 3H86A 1B0UA 1GL9B 4LZZA 1Z6XA 1MABB 4L5BA 5J4HA 1XJ0A 2F1HA 4HB0A 1U98A 4GDFA 3LQRA 1OIVA 2G1JA 1BMFD 3CLVA 4LDJA 1IXRC 4EQ6A 4MKFA 4PR0A 2IF2A 5DHFA 2HYIC 5DIFA 4A2WA 1E96A 1FX0A 2FZLA 2FSIA 1OLOA 3C16C 2J0QA 4NL4H 3SYNA 3CRQA 3LBHA 4PZZA 3MD0A 3TLXA 4KU4A 3QVVA 3LV8A 3IDQA 2H16A 5G41A 4Q4AB 1Z63A 2RB4A 4YONB 3TJZA 1E9CA 5J4VA 4RCYA 4IOKA 2ZRFA 5K8IA 3U3OA 1LV7A 1L7VC 1Y63A 2ZRCA 4OQFA 2D4HA 2O5VA 3RS4A 2QBYB 4NONA 3VX4A 1IAQA 3DL0A 2RAPA 1GILA 5FFMA 3LO5A 5SZJA 3W6PA 4EFMA 1S9HA 1X86B 3TVTA 5IF9A 3TNFA 4DXAA 4F38A 4B73A 1G1MA 1IONA 1JJVA 1XX6A 2P6UA 3DDCA 4Q4JB 3O47A 1KY2A 1EGAA 4NMMA 4M1WA 4B3XA 3PV0A 3AKCA 2ZAOA 1AZTA 2RGGA 5JWHA 3UMFA 5CDFE 3TSZA 4A36A 2PZEA 4MUBA 3MSXA 3L43A 4PZLA 2DB3A 3JVUA 3REFA 1T3HA 1NN0A 1ZC3A 3MFYA 5H70A 2F55A 1T4GA 1XJCA 4Z8YA 1G18A 2V1XA 4MRSA 2H18A 2NPIA 1OXVA 2BCGY 3EPKA 2IK8A 4DLUA 5CIWA 3C5HA 4NYMR 2J0SA 3KKPA 3GLIA 1XEWX 1DS6A 2IYWA 3FKSD 4PHHA 2DFTA 2VA8A 3KJIA 5FOTA 1UKEA 3QEOA 4TL7A 4LC0A 5JI2E 4Q1FA 2GJKA 3KQHA 4Q4HB 1T8TA 3T34A 4C7OB 3LH5A 5DSZA 3SI7A 1HT2E 4AURA 2ODWA 4RZ3A 2OO7A 4FINA 2J7KA 3UG6A 4YMUA 4E22A 2W6ID 4DEYA 1DAEA 4EDHA 1O3YA 4BFXA 4GRAA 2IS6A 5FTLA 5KNCA 2CK3A 1EFTA 4NE2A 4NYMQ 1G17A 1UJ2A 1XEXA 3OF5A 4DVGA 1R0ZA 1EG7A 4DLXA 4GOJA 1PZNA 4PQYA 1YKSA 4TLBA 3SJCA 5JWRA 2JLVA 1KSGA 4N0DA 2GXQA 3T15A 1OHHD 1VDZA 2VQSA 3BJIC 1E1QA 4FMDB 3CF2A 5JEEA 2ZTSA 2YC4C 3K0AA 1E2IA 4A0RA 4BFZA 4E09A 2QBYA 4KBGA 2QM8A 4V0MA 2H57A 2F9LA 1SGWA 2W2TA 1OFHA 3SJZA 4OI0A 3NC0C 3GFOA 4ZDIA 4ON9A 4IRUB 1OW3B 2FPMA 4Q9JA 3U6BA 3SQXA 3B1YA 5DNYB 3UANA 1KI4A 2RHMA 2ZREA 1AKYA 4N3NA 2W6IA 1MV5A 2NO7A 2Z4SA 4PQFA 2GA8A 2XNSA 3CH5A 3PUXA 4QBGB 4QBIA 5SZKB 2WJJA 4C0QC 4DLVA 4ESVA 2P6RA 2P67A 1NVWQ 1OIXA 4JLKA 3WP0A 4Q4LA 1R5BA 4DDWA 1GRQA 1JPNA 2C9OA 5GVSA 2VLIA 3EPLA 3VR6A 1UDXA 3HR7A 4MDFA 1G291 3EZ9A 3NKVA 4M1SA 5JJLA 1D8TA 3SFVA 1U99A 2QM7A 4LUCA 1OH5A 2JLUA 2YC2C 4B2PA 1FQJA 1R7RA 4DCNA 2WZQA 3T1VA 4RCZA 2MMCA 2ZXUA 4P4SB 2DWQA 2ZJOA 4NBSA 1W36C 5GJBA 3CB4A 3KXLA 3Q9LA 3VX3A 1MT0A 2C98A 4M1YA 4ZIRA 2FF7A 4PQRA 3AP3A 3BFKA 2C9CA 1G3RA 4HDQB 2F6RA 1W0KD 2GTPA 3PCRB 2JJ1A 3QY0A 1XCGB 3HYTA 1YZQA 3QXXA 4ILEA 4M2LA 3EIHA 1HTWA 3OESA 3C14C 2ZAMA 1JXOA 3KDSE 3MG9A 4HAVA 5E7JA 3U6KA 3QPWA 1L4YA 3PUYA 4X8LA 4P3YA 3ZS8A 3KJHA 4LJ7A 4UNPA 2NPFA 2IWHA 2WSSA 2H8KA 2WJGA 1I4DD 4OHXA 2IEYA 3BORA 4JKIA 1FZQA 3C5CA 2ECKA 3K0CA 3K0FB 4KAXA 4LPSA 2XOKA 3GLHE 3RANA 3Q8XB 5CM8B 3SJAA 2HDNB 2IT1A 4C9BA 1C4OA 1PLLA 4NH0A 4FXPA 1T5IA 1NLYA 1AZSC 4Q4AA 5F2EA 4G0NA 3TW8B 5ELXA 4B3GA 4A15A 1Z8FA 4JBYA 5AJXA 1ZC4A 4NCNA 4FD2A 1G6OA 2GHIA 4UJ5A 4KFRA 3MWYW 3NBYC 3Q5EA 2OT3B 3DOEA 3SOPA 1CJKC 4BASA 3FHCB 2VHQA 2ZANA 4JYCA 3CRRA 1TF7A 3N5CA 5KU1A 3FB4A 1E9FA 4LWZA 1A82A 2D7CA 4KFTA 1CR1A 1Q12A 4DLRA 4YMVA 4DCTA 2ZQ5A 2VHJA 1Z22A 1OFTA 4OQLA 2ZRDA 4KVGA 1S0UA 4DT1B 4P0TA 5HKKA 4HDOB 1JR3E 5D3MA 1P75A 3PUZA 2FNAA 2P0EA 1MO6A 3A8TA 2RHDA 1MRNA 3P4YA 2CVHA 2GCPA 3QG1A 1R8QA 3CWZA 2AXPA 1G8GA 1OJLA 2NOAA 3DPUA 4TWZA 1KO1A 1KK1A 3CX8A 4DRZA 1W2GA 1OH7A 1COWD 2ZRNA 3H84A 3I61A 3OE7A 2CCGA 1G7RA 2A5FA 3LLUA 4PX9A 1W0JD 3S1AB 3T5GA 3F3YA 1AQYA 1XU4A 2PMKA 2Q9BA 3JVVA 3UIEA 4P4SA 1X8JA 4GZLA 1T91A 4IKEA 2X8AA 2C78A 3U60B 4EJSB 3I72A 4AYXA 2Q9CA 3NBFA 1E2DA 1QBKC 3LRPA 5EXTA 4RFSB 1BMFA 3HP1A 2CNWA 1ZMXA 4TYQA 3GJ0A 1G8FA 4KYIB 3SEAA 2W6JA 2W2VA 3K70D 4KBFA 1E79A 4OL0A 4ZI3A 4Q9IA 4JMPA 4W5JA 1XMJA 4TYPA 4CEJA 1DG1G 1YJ5A 3T06B 1T3SA 1S1CA 3R7WB 4MKHA 4UNRA 1U0LA 2QRNA 3BERA 4JLJA 2QY9A 4PAQA 1ZP6A 1E4VA 1WBDA 1CJUC 1GDDA 4PAMA 4QNRA 2DBYA 2HXSA 2D3WA 3H1TA 2CLSA 3WNDA 2OHFA 1F2UA 3CF6R 5CLLA 1SVWA 3IPXA 3QXCA 3GLHA 1YZKA 5L3VA 1FP6A 5JS7A 2MSCB 1UF9A 1E2LA 3RS3A 1LS6A 2YWGA 4QJ4A 2P5TB 1QG4A 2FMXA 1TL7C 4Q66C 4YLGA 5JHHB 1RJ9B 4OK6A 3QG5A 4NCHA 3AVXA 4B3CA 5B58C 4M53A 4RKFA 4KCGA 4DLTA 4Q47A 3BH6A 1UBFA 2PEYA 3U3RA 5BYKA 5KUTA 2ORIA 1NL3A 4FI3C 2XX3A 3HU1A 5E7MA 1SXJA 2QTVB 1C1YA 5EE1A 3IQWA 1U9IA 4US1R 5EXXA 4U5XA 5FOUA 1TUIA 1LF5A 4HLCA 1U2RA 2FPKA 2AN9A 4PPGA 1G21E 2WAYA 1T0JB 4LJYA 2A5JA 5UKDA 1MRSA 3GLFE 1WCV1 5EUMA 3AF1A 2X2EA 4IDOA 2QPOA 2FE4A 5FTNA 1ZW6A 3IKJA 2EFCB 2W0MA 5DHAA 5LB4A 5EE5B 1Z6AA 2V6JA 4DHEA 1D2NA 3DZDA 3FMIA 1OXUA 4MUAA 2EVWX 3QF7A 3SBDA 1IOZA 1X3SA 1JBKA 3I3SR 2R65A 4EQ6B 1N0VC 4TZ6A 1XPRA 2F1IA 4A9AA 1COWA 4B47A 3HU3A 5BN3A 2QQEA 5LD2B 3THWA 4UNQA 3EZ2A 1MKYA 2ZEJA 3K09C 4UXJA 4OHWA 2ZRHA 5SZHB 1DEKA 3CO5A 2EFDB 2YZ2A 4RD4A 2QI9C 4F91B 1OE0A 1N3BA 4B32A 2GBLC 1FX0B 2QSZA 1DARA 1OF1A 3LA6A 4H1UA 3QKRA 2GBLA 2RKOA 2AHOA 4CEJB 1DO0A 2F3RA 1P2TA 5KYKA 1E0JA 4XWOA 4ZDKA 5FBQB 4C4PA 2IS4A 1HQCA 3B2EA 4MGIR 2CCKA 3THXB 3W8RA 1E9BA 3PENA 1WF3A 4S2EA 5C46F 1UKVY 2EW1A 8OHMA 2R6AA 1W48A 2QAGC 2E87A 2FFQA 2WWXA 4D4KA 1ZINA 2FH5B 1KSFX 4QFMA 2A2ZA 4TMKA 4A0HA 2GXSA 1GNPA 2IYYA 4LJ8A 3EC2A 2B8TA 3VKHA 1SKYB 1P9WA 3B82A 3W34A 4LGMA 3KB1A 1IN5A 1M2OB 3QKSA 2BKEA 4LX0A 4NYIQ 1DVRA 4LBZA 1W36B 2FFHA 3LBNA 4HDCA 2IHBA 1XWIA 1EWRA 2A3RA 1CS4C 3UMRA 3DVLA 4KVAA 3H0KA 3IBGA 2QMEA 2OCYC 1G3MA 5L8VA 2GVZC 4TMTA 1R4AA 3HR8A 3T5DA 4CEIB 4A8JB 2NO9A 1W4CA 4PSKA 4ASUA 1TEVA 4HLDA 3CRMA 5G3YA 4GMXA 4JVSB 1E2FA 3GJ3A 2FDCA 2WJVA 2BM1A 2FOLA 1P60A 2JEOA 1RZ3A 4IOLA 3ZDQA 1U8AA 2JJ2D 3ZD7A 1GOTA 5IHPA 2PEZA 2IYSA 3FWYA 3P1JA 4XWKA 4TLCA 4ESHA 1FW6A 3I73A 4CIDA 4GOKA 5FOWA 1WP9A 4WZAE 3RC3A 2ZM5A 3RWOA 2Q3FA 4XTCS 2O8EA 3AVYA 4V0OA 4OQXA 1CEEA 1W36D 4G1UC 3K0AB 3EAQA 3GD7A 5IDVA 4EJSA 1XEFA 1E2MA 3LY5A 3GLGA 1P9RA 3X1ZA 1QHNA 3MUFA 2ZS9A 1PUIA 5EQTA 3TRFA 3ZD6A 2IS1A 3NDPA 3ZZUA 1E6CA 5G3ZA 4F93B 2BMJA 2OFWA 3LX5A 3EC1A 4C0JA 5JWOA 3A1SA 2WAXA 4C0AC 1L4UA 5H1YA 1Z0KA 5BN5A 4JVNA 1G64A 2LWIA 4LI0A 3BIFA 4XSHA 1SZPA 1JAIA 3EXAA 5FI1B 1YR8A 2WKRA 3K9GA 4WOPA 3A4NA 3HPQA 1W46A 4TLAA 2CL7X 2FSFA 4OK3A 4LHVA 5FH9A 5K8UA 2PT7A 3BB3A 1E0KA 2GEDA 3ZQ6A 2ZIAA 3DO6A 2QPTA 4GI7A 3QOFA 1N6RA 4JL5A 3G0HA 2NZJA 2RGDA 2XSZD 4I4LA 3VHXA 2AL7A 2WHXA 2UZ3A 2KJQA 421PA 2GZHA 2J9RA 1CXZA 3MWKA 1II8B 3IIMA 2IHYA 4LV5B 4P32A 4LOAA 1KDPA 2BOVA 2G9NA 4A8JC 1OYWA 5IK2A 4BFTA 1ODFA 1W5TA 3LXXA 4Q7MB 1XTRA 2NO6A 1H8HA 5BW8A 1G9XA 2GRJA 5TDHA 1G19A 2QENA 2F7SA 1AQUA 2O8BB 2XZLA 4NTZA 1U0JA 4V0KA 5AJYA 5FPYA 4FWTA 5E4FA 2XGJA 1DAFA 3IIKA 2OBLA 2PZGA 4PPQA 3EPHA 4M1KA 2IYVA 5G40A 5IT5A 4HEJA 4J0QA 1U9IC 4LYJA 1G5PA 1KMQA 3QE0A 4GMDA 5FOSA 4BFYA 4D82A 1XTSA 1A4RA 4Q7JB 2ZU6A 1F6BA 5CB8A 2ZR7A 4EPTA 2ZI6A 1RKBA 1NY6A 2HLDD 4URZR 4EPXA 5HR5A 1CRPA 2QMHA 2G6BA 1XZPA 4A0GA 1VKJA 1I2MA 5AJWA 3UATA 4C0KA 4FMCF 1X8LA 1S96A 2BM0A 4N1AA 2DWPA 3RC8A 1AS2A 2JDID 4LJ6A 1RRPA 2EWWA 2JLYA 4OHZA 1UKZA 4V0ME 2ATVA 2B6HA 2AFIE 3Q7PA 4UKDA 3TQFA 4DCSA 3N2IA 1JB1A 2RGBA 2RGEA 5J47A 2PT5A 3QPVA 4KI0A 1J7KA 3AH8A 1R5OA 3ZYCA 3AKDA 4QJ3A 3GLIE 4M9XA 1G7SA 2DFKB 2KWIA 4D4LA 4YQFA 5JECA 5JRZA 4DSUA 1NG9A 1YHNA 3A6PC 5B2ZA 2KI5A 3B8HA 3K0FA 2AKAB 1KMHB 3KFVA 3PVSA 4BLQA 4BLTA 4R71A 1GG2A 2HXYA 4BFUA 4ZCMA 3B1VA 4HB3A 2BV3A 4E5UA 2QSYA 1WQ1R 1NBME 4AC9A 2CJWA 1E99A 2IXGA 2D2EA 1II8A 1HUQA 1HV8A 3K9LA 5DLQC 3TE6A 4PZYA 3ADCA 2LCFA 4S35A 4RD6A 3ZVMA 3FPAA 4C0LA 3QUSA 4OHVA 2BCJQ 2CL0X 1AGPA 4V03A 2ZSAA 1N5JA 1Z0IA 5KDLA 3LVRE 3QNUA 4D2IA 3A1VA 1ZIOA 1UBGA 1DAKA 1KKMA 3GFPA 3L8ZA 4AKGA 2OUKA 1EWQA 4JLNA 5D3QA 2D62A 2AKYA 4ERNA 5E7IA 2WWGA 1P5ZB 5CB6A 3MRSA 2WMOB 3GJ8A 5A5GA 2O8DA 4PSAA 1VIAA 3E5HA 1E9SA 1SULA 2OEPA 3CBQA 1T9HA 2J3EA 4M1TA 4TQ9A 4F4IA 3B5JA 4TTQA 1H8HD 2ZRLA 2J5XA 3W8NA 3VKWA 5IK2D 3OAAA 1ESMA 3QKSB 3SHWA 1TUEA 5B57C 1AJEA 4EFNA 2BKUA 1ZD8A 1TPZA 4PPFA 4L9WA 4D0NA 2XXAA 3A1TA 3KKMA 5J4LA 3I92A 1F2UB 1E1RD 1M1YE 4LHXA 3ZVLA 3AB3A 2R9VA 2A5DA 2ZPTX 1N6PA 3T61A 3VNVA 3L2OB 2LKCA 3UMSA 3KB2A 2KE5A 2CE2X 1Z29A 5L3RA 3SYLA 1ZU4A 1RJ9A 3R8FA 1IJFA 3ADKA 5JSZB 3DMNA 4ZDJA 1SHZA 4PPNA 1KI6A 2VSFA 1F2TA 4OQNA 2QN6A 4DKXA 1BIFA 1A5TA 5DGXA 4KLNA 1TADA 3QKRB 4TMWA 4TLDA 2KBEA 1N6KA 3AP1A 1P62B 3U7FB 5TV2A 2AWNA 2PH1A 3MGCA 1VIYA 1QHXA 3A36A 2AK3A 2AX4A 4BLSA 1KDTA 3U7HB 3RLFA 3LDAA 4UXIA 1E0AA 1TEXA 1GRRA 2RH5A 3AM1A 1EFCA 2JGNA 4JLVA 4M4SA 2KB0A 3TK1A 3AVWA 3AKEA 3B13B 2IYZA 1KAGA 2A5YB 2EWVA 3X1XA 1N0WA 2PJRA 3SS8A 2WICA 3KTAA 3IILA 4ZI2A 3K53A 1G7TA 1SXJB 2J46A 2ZYUX 2C9YA 4MYHA 2C5LA 4XD7A 2Q3HA 3NEYA 2BJVA 4URUR 4AKIA 4CEHA 1R0YA 1E1RA 1WRBA 3KXKA 3RYTC 3LLMA 4LYHA 4TMZA 1M8PA 2OCBA 3GJXC 3LXRA 1W5SA 4GOXA 4BECA 2GAAA 1PLJA 3UWOA 2JDIA 3FTQA 2VHTA 4PXAA 4GZMA 2VIIA 1OB5A 4A6XA 1OXXK 4OBEA 4JSTA 2J0UA 4Q1CA 4DIEA 5EXPA 3I8SA 1VG9B 3FFBA 4M1OA 4Z51A 4DSOA 4BGDA 3K0SA 4NYJQ 3THYB 4I99A 2QUZA 2WMNB 1T0HB 2CHVA 2JCSA 4QNMA 2V6IA 2OAQ1 2WJIA 1UM8A 2QU8A 2JJ2A 4BEBA 4QHTA 3MWLA 4ZKEA 5JSZA 2O8CA 4U02A 5CLQA 5GJWC 3AVPA 3Q3JB 4NPHA 3BBPA 2B21A 1ANKA 4Q5IA 1KO5A 3AF4A 3SC3A 4URVR 5AJZA 2FU5C 4GL2A 2IYTA 4JLMA 5E95A 2GK7A 3WBJA 2VF7A 3KXIA 5M04A 1XB2A 3IGFA 4MYUA 3FMPB 4GNKA 2H1LA 4FCVA 4DEXA 2JLZA 1QHGA 1YQTA 1KKLA 5KTYA 1SHKA 4JJKA 1TF5A 5FUVA 1NG1A 5IRCD 3ICEA 1TQ4A 4LBYA 4B44A 1VCIA 4HAZA 4YXWD 2A78A 4KV9A 5HZKA 4L16A 4PHTA 2XSZA 1XEXB 1W49A 3GJ7A 2ZSBA 4MKGA 2WKQA 3WRXC 3KTAB 2QPAA 1TX4B 2JAQA 1R10A 4PTLA 3UXMA 1W0KA 2B8WA 1RFLA 5CITA 5CYOA 3IO5A 1NBMD 1PUJA 3IHWA 3ND8A 2QGZA 5G53C 3DZ8A 1ETUA 5JHGB 2FWRA 3CNNA 3TAHA 4KODA 4JT2A 3NTUA 2I1VB 4D6PA 3DKPA 5L3QB 5SZIA 1Q20A 1G8HA 4DUGD 2BMEA 1KI2A 4MDEA 1DAMA 1Q3HA 2D2FA 1E9AA 2ZRBA 4Z54A 2GXUA 4O2RA 1GM5A 3LW7A 3CRW1 3ZS9A 1TU4A 3B6EA 3JZMA 4KHZA 1FFHA 3RS0A 1PVOA 3CPEA 2CHGA 4TL8A 4NCKA 4D81A 1SXJE 3P27A 4L15A 1GVNB 2OFXA 1YRAA 2EFEB 4JLBA 1KMHA 5JJKA 2CK3D 2B92A 4PANA 2J45A 1DPFA 4A8JA 2YWFA 2X77A 1XCMA 4QHYA 3X1WA 4XJXA 5B64A 3HU2A 1GUAA 1QHIA 4M9SA 1Q57A 4TT3D 4CW7A 4V0NA 1TF2A 4URYR 4AD8A 4WAUA 3KZ1E 4TL9A 1XTIA 3WYGA 4B34A 1SVIA 3SFZA 3I8XA 4M9QA 2H92A 1YZUA 3KQUA 3HWSA 1T5LA 2R2AA 4K46A 3HYRA 1E9DA 1H8EA 4MGZR 1FNMA 2ONJA 1P61B 1UBEA 4GT1A 2REBA 3EW9A 1DG3A 1NVVQ 1UPTA 5DI3B 1QG2A 4WW0A 1Q21A 2GJAA 2EFHB 3CONA 2Q9AA 2O8EB 5F3WB 4Q18A 2N42A 4B3BA 3FDIA 3TKLA 3K70B 1VHLA 2F43B 2OAP1 1FTSA 2YYZA 4KFSA 1NVXQ 1CR2A 3W6NA 5EZ5A 4MITA 3DHWC 5LPNA 5HCNA 1EK0A 3VR5A 4POAA 1P7CA 1P4SA 1KOFA 5F98A 1TMKA 3EX7C 3CW2A 2Z5FA 4ARZA 3HJNA 1HA3A 1R0WA 1XTJA 5CIQA 1P3JA 3NWJA 2IX3A 1QDEA 1JI0A 1IJEA 2OFOA 3W5IA 3T35A 3MLEA 2VH5R 3WXMA 1KIMA 3KQNA 2ZJ2A 4X8MA 4NP6A 3U3MA 1J2JA 1DADA 2P6NA 5KDOA 2JIZA 4HAXA 5FL7D 3ONWA 1CJTC 1Z0AA 1IN7A 4DLSA 2F3TA 3TUZC 4H1VA 1GAJA 1NJFA 2GCOB 2CBZA 2V7QD 3A37A 5JRJA 2AD5A 1P73A 2WV9A 4TTRA 2P5SA 4QC2A 5JZVA 3B7GA 5JS8A 1XBTA 2JA1A 3ASYA 4R98A 2FN4A 2NO0A 2DHRA 4TLEA 1ZM2A 1OFIA 2OG2A 1ONBA 1P9NA 1Z3IX 1XMVA 2WBLC 2F1JA 2XTNA 4NU0A 2WWYA 3LD9A 2HEIA 4LYFA 3IHLA 2IC5A 4CF7A 3NHBA 1NN5A 4RFSA 2P3SA 4B43A 1E2QA 2IXEA 4JBWA 1QHHB 1EXMA 4BFVA 2FSHA 5JCPA 4PO9A 2FV8A 2QT0A 1XXHA 1Z2AA 2QRZA 1JECA 2VP4A 2H5EA 3HPRA 1JJ7A 2R6CA 4RD0A 2DYKA 2YHSA 4RZXA 2HT1A 2VPPA 1HY3A 3VMFA 5DI3A 2W83A 3TH5A 4CRWB 2WOJA 1ZCAA 1HE1C 1NKSA 1Z6YA 3LBIA 2ZUBA 1QRAA 4P31A 2QP9X 4BE7B 2YNMA 2JLWA 3DM9B 2O52A 2ZSDA 1U90A 4DC9A 4D26A 4PC6A 3PQCA 2QMOA 2ZE8A 5LBIA 2V4ZA 1XFAA 2YV5A 3A4MA 1EFHA 4JBXA 1AM4D 2CMKA 3K8YA 1N5LA 1KSHA 2OBMA 4L9SA 4LCBA 1XJQA 5DO9A 4CT4B 4GP6A 1BYUA 1RVDA 1ZVQA 3PEUA 4AKEA 1I4LD 5C18A 1KZ7B 4G5SA 4ACBA 1ZM4A 3TUJC 5J4KA 5KO2A 3VU9A 2LKDA 1OHHA 2F9MA 4TQAA 4QG7A 1P2UA 4TMVA 3K09A 2WSSD 3CM0A 4DSTA 821PA 4NHOA 4URWR 1GNRA 2QAGA 5K8TA 3MWJA 2WWHA 2ODNA 4IFBA 4TT3A 1NJGA 2XTZA 5KSZA 5FPTA 1X1RA 4BLPA 1IHUA 1GIAA 1SKYE 4M21A 2OZEA 3L82B 3M6AA 1KK2A 1YRBA 2FJUA 2ZYVX 5CK4A 4KLZA 121PA 3ND9A 1KK3A 2O8DB 2ZE7A 1NLFA 2PLRA 1TU3A 5FOVA 5JMTA 4CYMA 4UJ3A 1G20E 2DR3A 3BWDD 4AYTA 1D2MA 4IDHA 2OSBA 1DAHA 4EPVA 1N25A 1S3GA 3QIAA 5GADl 4US2R 2I1QA 4D25A 4I1VA 1TNDA 4RD1A 2C95A 2BC9A 2GKSA 4LHZA 4ZIRB 2HV8A 4IVPA 3GEEA 2QORA 2Q0HA 3QKTA 1G6HA 4C0HA 3P26A 4EPYA 4TSFA 2ANBA 4Q00A 1M7BA 2FSGA 4CT5A 3TSWA 1QHHA 3QEJA 4XWAA 1Y3AA 3QSYA 5DYGA 2WIBA 3Q85A 5HKKD 1E9EA 4JLDA 2X1VA 3C8UA 1Z08A 2N1BA 2MSEB 4WA7A 3C41J 5CJPA 5LB2A 221PA 2YVUA 5DN6A 1XCPA 1IY1A 1LW7A 4HATA 1W1WA 2WVJA 2ZS8A 1OB2A 2EYUA 2OCAA 2PLFA 2JASA 2ZJ8A 4WIAA 2ONKA 2VP5A 2DCUA 5JEDA 1FUUA 4NYIR 2CE7A 5GJVC 2R8RA 5AWFC 3AGQA 4KO8A 4B6EA 2GVDC 2BDTA 3TGPA 2QROA 2GEUA 2VF8A 1VYUA 3TR5A 1J8YF 1KI6B 2R44A 4HB2A 3QXJA 4D4JA 1N6LA 2GZAA 1IQPA 4QGHA 1E2HA 2JATA 2NGRA 5C1BA 3WY9A 1X8KA 3AVQA 4G5GA 4CVNA 2QP4A 4I1OA 4B48A 2VHUA 2SHKA 4B3FX 2MMGA 1UBCA 1VCOA 3RRNA 3ETLA 4XVUA 5CM9C 4KITB 4OYHA 4DZZA 4C2TA 3UPUA 2WKPA 3PFIA 1MABA 3THOA 2W6JD 5HTKA 4G5RA 1SKQA 4DJTA 3CZQA 2ZJYA 5CK5A 2ORVA 2HT6A 1OH6A 2DY1A 1XD9A 3X1DA 4E07A 4UQOA 2QAGB 3B9QA 2GXAA 1K8RA 4O25A 3OEEA 1CR0A 1RYHA 4JIMA 4OKSA 4CEHB 2YOFA 1AS0A 4XTRA 4JSYA 3Q5DA 3P32A 3V00A 4HZUB 4IOJA 3U7EB 1TAGA 4DT1A 2ZVPX 2FA9A 4NKRA 1Q1QA 4JS0A 1F60A 5FPKA 2QEQA 4HYYA 3RSOA 2VP2A 5C4MA 4BZXA 3PEYA 2G0NA 2O0KA 4RD2A 1YVDA 2Q21A 1SVKA 4OJKA 3KL4A 1GTVA 2VSXA 4Z8XA 2PJZA 3W5JA 3WNBA 5TARA 1A1VA 2NIPA 2ATXA 3IIJA 2C99A 1VMAA 2WPDD 4M9ZA 1E4YA 3ZZ0A 5FR2A 2GJ8A 4Q4HA 5FBWB 3BK7A 2B7BA 1QZXA 2BBTA 1GSIA 1X1SA 2WOOA 5KDDA 3BS4A 2JLQA 1KNQA 2UZIR 4QL3A 4IHQA 5ANRB 4LYAA 1NNEA 3ADDA 1KTVA 1PJRA 2BBWA 1AGRA 1OXTA 2Z43A 3M4YA 1XXHB 4K81B 3WMFA 3OIWA 3RAPR 2XB2A 1GWNA 2XNDA 2YINC 2HCJB 3SDZA 2VBCA 3CPJB 3Q7QA 4A2PA 1WB9A 3P4XA 1NSFA 2A5GA 1WBBA 2VO1A 2EQBA 3NH9A 3MJHA 2F43A 4FMDF 4QHSA 3D8BA 4LC1A 4MQBA 3BE4A 5L3QA 4BUJA 2XJ4A 3U61B 4WZ6A 1GKIA 1A7JA 1Z28A 1U81A 2GAOA 1R8SA 2GILA 4DSNA 1V5WA 2XAUA 1VG8A 4MGKR 1S9DA 3RABA 1WA5A 2R6FA 1ZUHA 3TBKA 3L0IB 3L0PA 3R8CA 1EESA 1YZGA 2P2LA 2W2XA 5DI9A 5J40A 4P4UA 1PV4A 1U8ZA 2C8VA 4C0BA 3N70A 3OEHA 2HCBA 2CJWB 2ANCA 4C7OA 3U4QA 5A4JA 1I2DA 4JVLA 4A6PA 1RIFA 1IN8A 1ZAKA 2FEOA 3AVUA 3ICQB 4JT4A 2FG5A 2V54A 3DM5A 1G5RA 4MRNA 1SVLA 2PCLA 4DIDA 4E03A 5TB5A 3FMFA 5F9HA 2IXFA 2YOHA 2HF8A 2QP3A 4BRUA 2B7CA 3A4LA 4DLWA 3X1YA 3R9XA 1NRJB 2ZITA 3RDPA 1F2TB 2CVFA 3UKDA 5HCIA 3PUWA 3T1TA 4Q7LA 3REGA 4UXHA 4WZBE 5EP2A 4LY6A 3CF0A 1HEIA 4GFDA 4PSVA 2ZR9A 1G3QA 1XEWY 4Z1MA 2QL6A 2AR7A 2VP0A 4EAQA 5K8LA 3EWAA 4NDZA 5EE3A 1XDBA 5FTJA 3TW4A 1FP7A 1FQKA 2FGJA 4U7DA 1R2QA 2IYRA 3AF2A 2XTMA 3BB4A 3S1AA 1AN0A 2WSMA 3RRZA 3EZ7A 1K5GA 1E2PA 3AGPA 1Q22A 3SYKA 1C9KA 4RJLA 3BC1A 4JLPA 2ZYWX 4KXFB 2PMDA 1ZCBA 1ZU5A 4JL6A 2ZI3A 3BGWA 5FUXA 3BFVA 2Z4RA 3T1QA 4G01B 4RFVA 1MOZA 1ZUNB 4FWIB 2WM9B 2WTUA 3B85A 1W2HA 4Q9LA 1J90A 4QGFA 3V4FA 3A1WA 4HUQA 3D31A 3RRYA 5BN4A 3T12A 1OSNA 3G82C 1FMLA 1P2SA 1R0XA 3AEZA 1KI9A 2PX0A 2C04A 4RY2A 4AK9A 2IWRA 2YWHA 3WBKA 3B78A 2CNWD 1J70A 4K8OA 4HZIA 3AQ4A 5DN6D 5FBVB 1RPZA 1YZLA 4LJ5A 1W7AA 1HYQA 1JPJA 3P20A 4QM7A 1YR7A 2ASEA 3QENA 4RZUA 4R2HA 4YC7A 3EIQA 4PC2A 4OI4A 4MRVA 3PJRA 4YMWA 1S2MA 2VTKA 2D06A 2WWFA 2ZUCA 4LV8B 5HE8A 1JAHA 2PCJA 3LFUA 4MYCA 3B1ZA 3I1FA 3AVTA 2QTHA 1D6JA 3EWSA 1NY5A 2GCOA 3ADBA 1RC8A 3K0EA 2J59A 1FUKA 2X2FA 4A4DA 3GLGE 5FTMA 4BZQA 2ZE5A 3QXSA 1HURA 5KSOA 2A30A 3OAAD 3A1UA 4HLUA 1K5DA 1DELA 4QGAA 3RRMA 1BOFA 5KSPA 4C30A 4F92B 3F0TA 1II9A 5FTKA 1CP2A 2VRWA 5BYJA 3EG5A 5TVKA 1JR6A 3KQLA 3WMGA 1ZD9A 4B33A 3BD9A 1EX7A 4QGGA 3ECCA 5AR1A 1RE0A 3GJ5A 4PC1A 3RSLA 1TQ2A 3CNOA 5KHOC 4ACAA 3UK6A 4L4UA 3EA0A 4BPBA 3O8BA 1IN4A 1EX6A 1G5TA 1HQYE 2QNRA 1Z5ZA 4PHFA 4F7WA 1S3SA 1WXQA 3RWMB 2XXAB 1KO8A 3GPLA 2ZE6A 2RGCA 2ZJAA 5TMPA 3GCGA 1KO7A 1G8PA 3W3AA 1ZRHA 4MYTA 4DDVA 4GSYA 4MH0R 2JIZD 1US8A 3ZZTA 5HZHA 2CEAA 1F3OA 3A58B 2J41A 2AFHE 2V9PA 2A9KA 4LJ4A 1DTSA 3PITA 4BLRA 4TYWA 1ZNXA 3RS5A 4QJ5A 4EIWA 1KJZA 1CU1A 1E2GA 3PG5A 2HJVA 3CNLA 1ZM9A 3FHTA 4PHGA 3GQBA 1KI8A 3FVQA 2GWHA 1UAAA 4CEIA 1XD2B 3D3QA 4NCJA 4PO1A 4BLOA 1XPUA 3VTKA 1WDTA 2C2HA 4XH9B 1U8YA 4M8NE 2J7PA 4JJZA 1OPXA 1UEIA 3KJGA 1P6XA 1VCMA 3D6TB 2FFBA 2XB4A 1ZUIA 3QI2A 1QF9A 3RNLA 3VR4A 1BS1A 2EU8A 1CLUA 4HAWA 4JVMA 2ZRMA 3TUIC 1NVUQ 2G83A 4AI6A 3KKNA 3FKQA 3AKYA 4RZ2A 1E1QD 4ZO4A 4M0LA 1M34E 4OK5A 2FPLA 4L8GA 3G5UA 4LK2A 1LNZA 4II7A 5FUYA 4A82A 1G4AE 2NO1A 2ZJ5A 2IYXA 2HYDA 3ZVRA 5EP1A 2V1UA 3VNUA 4AKHA 4HLUC 3OEHD 4FIDA 1DO2A 2YJTD 1JALA 1CR4A 4O3MA 4D4MA 3BOSA 6Q21A 1Z2CA 3VR3A 4XVRA 2BEKA 2IBMA 5D3MB 3IPYA 3AVVA 5C4GB 2IYLD 5FL7A 3VQTA 4G5QA 2QE7D 1VHTA 2ZI9A 2WIAA 3KUDA 3WYFA 3ZIAA 1XPOA 4Q9KA 1GNQA 2QT1A 3EZFA 3IBYA 2GNOA 4Y0AA 5E3HA 2WJYA 1FTNA 3CH4B 4YMTA 5L3SB 1AIPA 1HT1E 5JLJA 4PO8A 721PA 2FX3A 2BBSA 3BAFA 3V4RA 1CRQA 1EFRD 4NCIA 3LX8A 521PA 4Q7KA 5FR1A 4EKDA 4ZKDA 4B3DA 3B60A 5TXGA 2CHQA 2OCPA 2J87A 2BMDA 2NMVA 1YZNA 1CIPA 3VFDA 1Q44A 4ASUD 1FPMA 1IBRA 4HSEA 621PA 3IEUA 4PC7A 4DLYA 4Y0VA 4TQUS 5EE0A 2ODBA 2TMKA 1NN1A 4A92A 4MA4A 1HE8B
chains in the Genus database with same CATH superfamily
1U8XX 3QQ5A 3P94A 4BUCA 2RHCA 3GFGA 1TQDA 4MB2A 2ORWA 4JYBA 1JEEA 3ESDA 5IUNC 5H4GA 1EWTA 1MCZA 3I3OA 4LRXA 4PSDA 5IKPA 2NYUA 5P8WA 3R5JA 3VPSA 1GZ4A 1XFDA 3WMEA 4IMIB 2NZUG 3K9NA 3F1KA 3B1FA 1NQOA 3KE8A 4PQGA 3GLIB 2HQBA 4GKBA 2PD6A 2RKBA 4PAOA 4EA7A 3EZ6A 3KVYA 3N2EA 4RAOA 4C7MA 5CG1A 2XVMA 4D3XA 4MRAA 2XOKD 1NW5A 2WT8A 1CEYA 1NJ6A 2V5UA 3CUKA 4AMGA 1QZ3A 1SVMA 3RU7A 3ZE6A 3AVOA 4AJIA 2J08A 3AJDA 1LY1A 1U1GA 1P4AA 5CH3A 1H0HA 3VSAA 4CF5A 1I3NA 2P9FA 3A0RB 3QF4A 4CKEA 2BFBB 3ABSB 3OFNA 1DE0A 3HYLA 3NIGB 2IHZA 1AUOA 2PKCA 1D6SA 3MCTA 2VKQA 4X7RA 1BO6A 1CZKA 1GP2A 1RPNA 2JFBA 3OE7D 1J0EA 1XRNA 2F3UA 2EX4A 2QZ4A 2YV2A 4IMJB 5LBUA 5BV0A 5LU8A 2BH9A 3OIDA 5ERYA 4F4CA 5JBQA 3QJYA 5JJIA 1KJYA 1AKRA 4EJSB 1H65A 2ZSHA 4N0EA 2QOEA 3B2NA 1K0FA 1N6IA 4MS1B 3VNRA 1CJVC 1V8PA 2ZROA 2GKOA 2ZWMA 4NZMA 1X1EA 2GB4A 1D0VA 5AW4A 2IY9A 3VGPA 4YB8A 3CFYA 4BIMA 4DLZA 2Z2XA 1J7JA 4ID3A 3I9MA 4U2CA 2D3TA 1SOWA 1KH3A 1QWOA 2J8ZA 4MHOA 1MAWA 3D81A 5EI5A 3T41A 1PL8A 1Z06A 2IYAA 1RP7A 2I6UA 2BEJA 3BXXA 2F64A 4OLHA 1SHLA 3DKVA 4A5SA 4YXFA 4CIBA 2YWEA 1JHXA 4IZIA 1V8FA 2QVBA 1XTBA 1BD3A 2ZTLA 1UZMA 4Q01A 3THWB 1H9BA 1NA5A 2WJHA 2BF4A 3D2CA 4HMOA 2QL7A 4DJAA 5IVIA 4LVNA 3MCAA 5DT2A 3TLMA 5CBPB 3KQOA 3E48A 1KGDA 2BMAA 1UC5B 4LSGA 1I5EA 2JIMA 3EASA 3OPYB 1NUPA 4M60A 4W63A 1F9EA 4LF4B 2J6IA 4AJPA 3I12A 3V97A 2DBVO 5HOEA 2WWWA 3ZGXA 1QRUA 3VKGA 1H2HA 3U49A 1TAUA 3U4QB 4C88A 1RZRD 1NW4A 5ICGA 5HTOA 2O2HA 2ZSFA 5CW1A 2D2IA 1II0A 2EFGA 2J1LA 2WAMA 4Q15A 1BSVA 5BQ3A 1ZO8A 1SUCA 1US8B 4LIPD 1GDTA 3PXAA 1T2DA 1UT6A 4BN5A 1YAJA 2UUOA 3EIEA 4R1NA 5LN1A 1Y1PA 3IE1A 2C58A 2H1FA 1PQ4A 3N9IA 3RYFA 4Q03A 4BVLA 1KTIA 1IY8A 2X23A 1KU0A 4HF7A 2GI4A 2YFYA 3WHLA 4HB4A 3E9EA 4MWDA 3SX4A 4N6OA 2B69A 4LDZA 3ZHCA 4F4FA 1VKRA 3KLPX 3H4MA 1D07A 1J8MF 4EY5A 2E48A 1SUSA 3Q9NA 1T8RA 4FE3A 4L8LA 2VT3A 2Z98A 3V1MA 2Z08A 2IH4A 1KVQA 4X6YA 4E5MA 4TTPA 2HDOA 3HSKA 1JNXX 3EDCA 1WM1A 1IQUA 3OLWA 1WL8A 3WHKA 5G0UA 1KZ6A 4A2QA 4K6KA 5FIUA 1USGA 3PHIA 1E7YA 1JMVA 2VSNA 4ADSG 1WR8A 3EPRA 1DL5A 4AJNA 4AX4A 2HRDA 4KQIA 1V9CA 3EEFA 4XRRA 2QTGA 3G13A 1SCQA 3SBXA 4M7RA 4LGYA 3SXJA 5TQ2A 2XIJA 2GYWA 5DISB 1ZBQA 3PRYA 4D80A 3VH3A 2XXAA 2H9IA 2AQ8A 4JLOA 2CXNA 2EIXA 2QWXA 2ETXA 1H0KA 1QTNA 3PXGA 4CLOB 5K3DA 5I4IA 4DKJA 2VQ6A 1OIWA 1XTKA 2OLKA 1RHKA 1JT2A 2LIPA 2A88A 4HFRA 2EZTA 1Z7GA 4BNFA 3B70A 5DNAA 2O9JA 3VH1A 1N6OA 1P0FA 2JGLA 1KK0A 3J81k 2D5BA 4MVJH 2W00A 3GFBA 4KQ1A 3JWGA 1GFIA 4O63O 4PYNA 3D4OA 4IDGA 2IIBA 4WKNA 1Z0DA 3OTQA 4NCBA 1YQXA 1NJ8A 2AXQA 3HL4A 1Y3DE 2X0FA 3U31A 4ZARA 1M7GA 4JODA 1XXHE 4KXXA 4LSZA 4QAQA 3V1YA 2ZR0A 3PEVA 2C77A 3ILVA 2BJWA 1Q91A 1JG1A 2XE7A 4B2LA 5F9FA 2YV3A 1OMOA 4JP1A 3R9IA 1R6AA 4LJ9A 1MO4A 1PNTA 4LQDA 4O2BF 2AZ4A 5DNWA 2WWVD 4AKTA 4IIXA 3WB1A 2VPWA 1Q7EA 4F5WA 3KJZA 5H02A 4LDNA 3UKJA 3TMYA 1EH5A 1ESDA 1FUIA 4LJSA 4ZT7A 3ZWXA 3GLGB 1THTA 3ZX4A 1RYNA 2IDJA 3NT4A 1Q92A 1L7PA 3NBXX 4BO8A 3FFAA 2AF3C 3ZNNA 4KO4S 2RGNA 3RYIB 3GT4A 4HDRA 4R8KA 1SUBA 1ZIPA 3SN6A 1UXIA 4MQLA 2EXXA 1IXKA 1E2EA 1RBYA 4FDLA 4N8DA 3WGVA 3U2QA 1IWBB 4DSZA 3MGGA 4OQYA 1HYHA 3WFZA 4JUDX 2O8BA 1CE8B 5EFZA 3A1EA 1R6BX 2Q27A 1CB7A 1QQ7A 1JS1X 4X3OA 1ZBDA 4OBWA 4RTQA 4WXRA 3V8RA 3QKIA 5E2BA 4E2ZA 1QGDA 2YFHA 4QRHA 1JZTA 5GOZA 3HJTA 3E2IA 1XMXA 1MPTA 1SQ6A 1WLYA 1D2GA 4MICA 3I1JA 3AR3A 1XCOA 3LL4A 4ZJZA 3IEVA 5AUOB 1OI7A 4HNSA 3LHKA 1H85A 3MINA 4FDTA 3TQOA 2EJBA 3F6BX 3I6YA 3L0OA 4HQFA 3I1IA 1AVTA 1T10A 2Q5OA 2YOGA 3K9QO 6REQA 1PS0A 2ZVDA 4IDQA 1CF4A 3WGHA 1P0MA 3AY3A 2JGJA 3RVQA 1XTUA 2ZS7A 3T3PB 3GWGA 5DWQA 4D0LB 1TRKA 5G2OA 4QKQA 1H5QA 4IEIA 1E2JA 3K5IA 1CKEA 2CDNA 3KOUA 5ALGA 5DX1A 5TQ0B 1SD2A 3THYA 5G4KA 2IY8A 1I7DA 1B43A 3LSYA 3V3TA 1KE1A 1PFKA 4MRPA 4I1UA 3ETGA 3R7NA 3IO3A 3AUYA 2WI8A 1D9ZA 5LYJB 5ELLA 5J5AA 3TSYA 4R1QA 1EHYA 1GTSA 4EYKA 3KPYA 2HOQA 4NFHA 3FWZA 1CY0A 1T9ZA 1XAHA 3W1VA 4MEJA 4LOJA 2P9GA 4GEKA 2C2OA 4D1YA 3V33A 1FP4A 1K6XA 2OBNA 3CBGA 4G8DA 2VP6A 2A7QA 3FGNA 1XK7A 4O0MA 2F67A 5I7SA 5B7GA 3GNLA 3PUVA 5B5SA 2WVHA 2Z5VA 2WUGA 3SXUA 1SIWA 3J7TA 1HI9A 2Q4BA 1JKFA 1T3LA 2DM6A 3O4IA 4IYRA 5BMVB 4B4WA 1XDWA 3E84A 3ZE1B 4S0XA 1FXUA 2DC1A 1V1RA 2OV6A 2WY2D 2HX1A 4G84A 1F1JA 4WBXC 3QVOA 5HCUA 1IY0A 4HNRA 4JYPA 4MQ4A 4RFLA 1W4ZA 2O2IA 3CZMA 3GLFA 1PF7E 4XR4A 4RY8A 1F8UA 2TS1A 5TJ9A 4OBXA 1OOEA 3CSSA 3V4ZA 4CI0B 5KYXB 1U4OA 2RAFA 1GA6A 3QKUA 4DR5B 3E9MA 1TIPA 3GVXA 2AMFA 5FBHA 4LV6A 3W9YA 3WNZA 5FLXA 4JI8B 2V7VA 1NW8A 2RG7A 3LCVB 1FDSA 1GD1O 1WPGA 1ZN9A 3NHAA 5EERA 3KT6A 2PV0A 1V47A 3N76A 5EZ6B 4B76A 4F06A 2VHCA 2E7ZA 3C85A 3TIFA 1L5YA 3PKIA 1GZ5A 5T7BA 2VRCA 1G20B 2H7VA 2WMDA 4XE5A 4XGIA 2QGNA 3NRBA 4TSFD 4URXR 1EVEA 3U4DA 4MMXB 2WFLB 1ACLA 2IGTA 4EUNA 5CGQB 1FU7A 4CDGA 1TCBA 2R3SA 2V6BA 3LPMA 3VR0A 4BTLA 3KQMA 3M4XA 2JW5A 2K5UA 3C15C 4DDUA 4ZZ3A 1LRKA 4YRSA 3B3JA 3FOWA 5EJ5A 2X3UA 2FGKA 3QVGA 1MJGM 2I7VA 4HMPA 2ZQYA 2G88A 4V1CB 5EZSA 1QP0A 2IP1A 2FAXA 2R7NA 4FMBB 4UMEA 1AQ6A 1AKUA 4Y1RB 5JTTA 4DIKA 1OBOA 2R68A 3M5DA 3WL5A 4CMEA 2GMWA 2WUEA 1KY3A 2WZDA 2QK4A 2EJCA 4A0FA 1PT6A 1A88A 4PWYA 2IVFA 1IXSB 2HLPA 2VTDA 1LVGA 3E0XA 3N0TA 2RJ3A 3LCJA 3L9XA 4IXTA 4Y67A 3RK0A 4A91A 1R37A 1SNYA 2VP9A 1I8TA 1U0RA 4JR1A 3TLYA 1WZEA 3G2LA 5C81A 2BTQA 4D3ZA 3THXA 4ERNA 3AO0B 4ARVA 1TVKB 4FFVA 4EP1A 1E98A 4S05A 2R4QA 1D2AA 3P96A 3ROEA 2YRWA 3R7BA 2H1WA 1T2NA 2B35A 1E1CA 3HRHA 5H3LA 4MV3A 2GJ9A 4WBSA 3W9BA 3GEMA 8LDHA 1GZHB 2O0HA 1OFUX 3IHTA 3MERA 1H2ZA 1QO0D 1EVZA 4H27A 5EGSA 2ZTVA 4I9HA 4AMVA 1IULA 2I4IA 3BL6A 3ET4A 1PJSA 1TZJA 2YV1A 3H7IA 4IPTA 3E82A 4D9JA 2H1IA 4Q12A 4G1VA 4D79A 4XYMA 1FOEB 2AQHA 1OUMA 2J3QA 1YDEA 3G3EA 5JDIA 4H6WA 1B6GA 3MJSA 1B3RA 4M22A 1AZWA 1IN1A 1W8IA 4TTAA 3SF8B 3A1FA 3KZNA 2PNJA 2KMLA 4V39A 1CEQA 2LDXA 2PWBA 3FPJA 3VKFA 4E51A 3QELB 3OCZA 1FQOA 2IOQA 2ZVQX 4RU1A 1C8VB 3B9PA 2PZFA 4G89A 5TPWB 4D98A 3U9SA 3BAZA 4QUEA 1UKBA 4YWHA 3U0VA 1MJGA 1S8OA 1XMIA 3BUSA 4DQLA 1TJ5A 2XWBF 3L1KA 4EL0A 4S2UA 3EIOA 5DYIA 3TQCA 2AJCA 2XUZA 5IBQA 4JR2A 4BJHB 3OCWA 1USUA 3EEYA 3EPJA 4DB2A 2YS7A 4KFUA 2CXXA 3OEED 4O4LF 4F3TA 5BMVF 3S2YA 3F8TA 4CM3A 2VK8A 2M6SA 3G8AA 4GI1A 4UCXA 1CUJA 4QQNA 3CX7A 1YS6A 1GLGA 1Q19A 2W9XA 3EC7A 3EJWA 3OIUA 3SIPA 5A5EA 3HA5A 3GEHA 4BP1A 4G4SP 3N07A 3OPYA 3P9RA 4OA5A 3VYTB 3MTBA 4HPWA 3PNKA 3E81A 1RRCA 4A8TA 4M9RA 3UC5A 2I3BA 4DQDA 1W47A 4ZYVA 2AUMA 4V0LA 4I1SA 2ZIUB 3AWIA 1GKUB 2G1AA 4WACA 1AS3A 4D3DA 1R18A 2BHRA 1NAHA 2FZ4A 3L3BA 2VYVD 3D3JA 2CD7A 4F7DA 1FY2A 1VJ1A 2HIGA 1J9ZA 2JH8A 3H2JA 5GONB 2ZSIA 4EGCB 3SSOA 1ZQ9A 3GCDA 3LHIA 3JYNA 4XD2A 3DMPA 1ZI9A 1IWPB 1M6YA 2IIPA 3LVQE 3I32A 4EPWA 2QUKA 3USZA 5BT9A 3DV0B 2PBRA 1I10A 1J8DA 1KYZA 4F11A 1CUSA 4LYYA 4RK0A 1Q95A 1OT3A 1QYCA 3QGMA 2UAGA 2Y6UA 1JHZA 3EHDA 1C8LA 1A69A 3R0ZA 4CPDA 1HMPA 2Q6TA 2AV6A 4GUAA 1EI9A 1EKXA 1ZKDA 3KUCA 4G5FA 6NULA 3JV7A 4C21A 3TIVA 4BGIA 1QIMA 2DPMA 3CR7A 1NKTA 4AN4A 5A0TA 1KP9A 4B35A 3CLUD 3QJGA 5DM4A 5AFSA 3VM6A 1NBMA 1QIJA 1Z74A 5ED0A 1STOA 1K08A 4OHOA 4BX0A 5AESA 3X2FA 1QIEA 4L0MA 2YJGA 4XA8A 3TTTA 1EQAA 3DOFA 1V7CA 4ZCQA 1UAYA 4CIXA 2ZRAA 1HBJA 2IZ7A 3NEPX 2VP3A 4YP9A 1H4SA 1MR3F 4MJ7A 3AHIA 1EG2A 5FL3A 3CIFA 3B89A 3VVBA 4JB0A 1CNFA 4H9GA 4MV5A 4FFLA 2XZPA 2GK4A 2IPNA 4E0BA 1M74A 1IVNA 1DOAA 1I4TD 1HNWB 1AKEA 4HWPA 4IHKA 2GEVA 3HKEA 1L7MA 4PCAA 1R88A 4UEKA 1X94A 3DMHA 1DJOA 5K4GA 5ETJA 5KWSA 4B6RA 2OV8A 3IS3A 2JFVA 2CXQA 3DUWA 4OB8A 1EYZA 2VXBA 3M3PA 4C4AA 4IGAA 1MX9A 5KPDA 3RHZA 4XQCA 4DUYB 1E1LA 1FXWF 2DFLA 1RWBA 2I67A 3MIZA 4OHPA 5T41A 5EHZA 1FJGB 1FDTA 1LBIA 3D4IA 1B0UA 5J4HA 4Y2UA 5ITZB 4FN4A 5K3OA 3Q3IA 3DMRA 4XXHA 4G8JA 4ZOAA 3G23A 4CL8A 1DRWA 1Y48E 2FY8A 1KP2A 1U98A 2PKEA 4N5NA 2G1JA 4DCOA 1JAYA 5KYGA 4FFWA 1BMFD 3CSUA 4CCSA 2IF2A 1NV9A 3PA6A 5K0TA 4Z9FA 3HI6A 4A2WA 3AESB 3AG6A 2J4DA 3FCUB 5DSXA 2H4HA 2H08A 1E3JA 3OCJA 3U16A 1N3IA 1Y5MA 2FI1A 3SYNA 4EG3A 3LBHA 3RJTA 5F1YA 1I94B 4FNGA 5LQDA 4MWSA 2DR2A 2YICA 1ENYA 2PKXA 3FF4A 3SQOA 1WZCA 2Q5FA 3AERA 4X62B 2JC3A 3ID6C 3V6MA 3ZU4A 1N7IA 4YONB 5L45A 1E9VA 1E9CA 1DKNA 3A6ZA 2ZRFA 1FDUA 4OQFA 1AHHA 2GBIA 4O29A 5AH0A 3RTGA 2CNLA 2ZT7A 4NONA 5BN5B 3VX4A 3WAGA 1D4ZA 1IAQA 3SY8A 3DZJA 3H5OA 2RAPA 1GILA 2WU0A 3RGGA 3V4SA 1IB6A 1SUIA 1X86B 3TVTA 3GRAA 2H0AA 1JA0A 4JDUA 1YB2A 1ADJA 4KQ6A 1PI3A 1ML4A 2P6UA 3EN0A 1JU9A 1MOQA 4EGAA 3WLKX 3FHLA 5AKIA 2DPYA 1KY2A 4NMMA 4M1WA 2EBHX 2ZAOA 1IU9A 3PQ5A 5AMXA 2IYNA 1AZTA 2RGGA 2VPXA 3LUJA 3HP4A 3T7RA 4LXXA 3DAPA 3CINA 4RTRA 2YUIA 2GOYA 3JVUA 3OMLA 1NN0A 3HUDA 3MFYA 3VMMA 1ILEA 2F55A 1YVUA 1XJCA 3FRIA 1RTTA 1G18A 3PYLA 4H3SA 1RHUA 2V1XA 3E5RA 3IALA 3JALB 1ISMA 4TUYF 2E4UA 2F8LA 5E9QA 4YAKA 4PQEA 4MUYA 2IK8A 4DLUA 1XTTA 4I8XA 1EB9A 3KKPA 5A3RA 1XEWX 1DS6A 4OB6A 5U4XA 3OOJA 5H9WA 3FSJX 1ORWA 1ID1A 5KVAA 5E1DA 1V71A 3LO8A 5KOJB 3HCCA 4F2HA 3UF0A 3ND5A 2AW5A 1CVLA 2XMRA 5K0JA 5KQGA 5B6JA 3G8YA 3HA3A 4BAZA 1XV5A 1OTHA 4WNAB 2PKWA 3RU3A 3EVBA 3PE6A 4FB4A 4AM8A 2ZDQA 1WXGA 2PSEA 3MCVA 3FPSA 1YACA 2G06A 2BGTA 1DEAA 3EYWA 3QA3E 3WMWA 2N75A 2DRIA 1IZ8A 4MVXA 3D8NA 1S2IA 2A0YA 5KU7A 2JD1A 2Z2YA 1QK5A 4F2GA 2DTEA 1ZK1A 2I0FA 2W6ID 1VMKA 5U1PA 3M6WA 1TT5B 3SQDA 1BGVA 1GZVA 4UTOA 1C9JA 3Q3CA 3KKEA 4HDMA 4RTNA 1C7ZA 2BN4A 3JQFA 5HHTA 4BQNA 2GWRA 1CC1S 2IS6A 2OORA 4FJ1A 2CK3A 1EFTA 1NOJA 2YWCA 4OYYA 5KYYB 5KOHA 3QPBA 1K06A 2JIPA 1C41A 2RG1A 4D45A 3PWKA 2YJ3A 4W8HA 4BTEA 3LHFA 3GVPA 1NJ5A 4DLXA 1T29A 4PQYA 2QYTA 3DXFA 1YKSA 5BRNA 1USVA 3JASA 1JHYA 2GXQA 5IMSA 4QPJC 3ROMA 3HM9A 4PYQA 4QYIA 3TL2A 5ALOA 4G0ZA 3ENKA 4FMDB 4OB7A 4Q39A 1APBA 4CLXA 3AFNA 2ZTSA 2XCIA 2R8XA 2VHVA 5JZOA 2CYCA 3CZ9A 3NV7A 2C54A 4I4TB 1E1YA 2MSKA 4BFZA 2ZPUA 1WSBA 1Y8RA 3WDSA 3ZNQA 4BEWA 2QBYA 4MB6A 3VH2A 4A6EA 3QEAZ 1HE4A 4JN6B 2H57A 1AT1A 1SGWA 2W2TA 1OFHA 5I45A 4OI0A 2HTFA 5CEFA 5IFLA 3TAXA 2O50A 1TKCA 5F7ZA 4ON9A 4IRUB 3ETDA 2FPMA 3ESRA 4KGXA 5NLLA 3AHGA 4IJWA 2IDZA 3UANA 1KI4A 2RHMA 2DWUA 3LUDA 3OBIA 2NO7A 5HCNA 3GAFA 2GA8A 3CH5A 4QTUB 3L05A 2P6RA 4ESVA 1UOEA 1ZEJA 2J6HA 1NVWQ 2YHIA 4JLKA 2X22A 4NNPA 5IP5A 1SC3A 3AOGA 1N8TA 4D8VA 1BHQ1 2BI4A 2R5WA 3IR7A 1PYDA 1DIBA 4F2WA 1KQFA 3EWNA 4JUBA 3G5LA 2RBEA 1I33A 3RPEA 3VR6A 4EHBA 4JJAA 3NBMA 2I62A 4OXRA 5EJIA 1BJKA 1G291 2F1OA 4M1SA 3OM0A 4MV8A 1N78A 1D8TA 1YO6A 5CVUA 3SFVA 1R4NA 2D7JA 1W1IA 4IBOA 2YC2C 1VL0A 4RGVA 4BNDA 3PWZA 4B2PA 5BSWA 4CIWA 2WZQA 4WRRA 4CMEC 1P2GA 3SX0A 4CTMA 1VCHA 1TDJA 2HPZA 4BJ6A 1DKQA 3M5PA 2XE4A 2EBUA 4NBSA 5EHIA 1LDYA 1W0CA 2DH6A 4YQEA 3MWDA 4D8UA 4F9EA 4ZICA 2VFAA 4FOSA 1TT5A 1O0CA 2VJKA 3OURA 5HJEA 1Y1LA 3AP3A 3KV1A 1D6NA 2IU3A 1NP7A 1W0KD 2O7RA 4Y1RA 2ZIXB 1QP4A 4L7VA 1A04A 3W06A 2JJ1A 4RIGA 1BWRA 3ZE0B 2PS3A 4HFNA 3TTSA 2YVQA 3QXXA 2XMSA 3O38A 3SEQA 5BWNA 1HTWA 2AJLI 2FPIB 3CUVA 3ABQB 2P3LA 2ZAMA 2IEDA 3LX4A 5E7JA 2FDRA 2P9BA 2J31A 4QUJA 2FPXA 2BT4A 1JILA 4U5QA 2BGIA 1IEWA 4P3YA 3IQHX 3D2AA 2NXCA 2XTJA 3H0EA 3C1OA 4NMLA 4UNPA 4J3NA 3IAM1 3O4GA 5I5GA 3BORA 4YBRA 1QG0A 1MENA 3KPUA 4NZOA 1FZQA 3C5CA 3LLVA 3QNWA 4GUDA 3K0FB 1N2JA 1ZNQO 4KAXA 4YRKA 3PTLA 1GUFA 3G9QA 3ICPA 1W25A 4RYDA 2XDAA 2GD1O 3ZK7A 4C9BA 1PLLA 2Y1DA 1AZSC 4QXQA 3TW8B 4G0NA 4B17A 2OLEA 3WIEA 4LMRA 4A15A 4JBYA 3FYUB 2ZXFA 4DNPA 4QWMA 3MJVA 3O73A 5EJMA 5KYWB 1G6OA 3EGWA 5A62A 4UJ5A 4F86A 4K2HA 4KFRA 3ZHTA 2QN2A 1L5RA 5CCXA 4H08A 1CJKC 4IX1A 4PICA 4TKUA 5HZMA 4QVKA 2WE7A 4MWCA 3ZE7A 2XYPA 1E9FA 4LWZA 3B1JA 4C04A 3H5RA 3HVJA 4DA0A 3WZLA 4YMVA 3R6DA 3S4YA 1UUFA 3ETHA 4O1IA 2VHJA 1Z22A 4OQLA 4N40A 4FVTA 3VJMA 1R3DA 4DV0B 4ZEWA 3VZRA 2NTNA 3VU0A 4GI3A 1YBMA 3L4BC 2FP4B 4IY1A 1U5AA 5E6SA 3RKSA 1NRWA 3JQ9C 2C92A 2FNAA 1Z7WA 2R8OA 1OJ7A 2OBFA 3GA0A 2X9LA 4K6HA 4Q0MA 2ZPAA 3KTOA 3DVAB 1R8QA 3CWZA 1VL6A 2AXPA 1CETA 1G5HA 1NFRA 3GDGA 4YAOA 1G8GA 3GN1A 2IPXA 3WQSB 2FCRA 1OH7A 4DIFA 2GM4A 4JSRA 5FOQA 3A3PA 3H84A 1AUXA 3ORHA 4GXRA 3OE7A 5BQOA 3DP9A 1EFLA 3S1AB 2DPHA 3F4KA 1DKUA 3RV4A 2HMVA 2Q9BA 4JJIA 3TXXA 1X8JA 4GZLA 2X8AA 4UEJA 1BS9A 2CXOA 1CF2O 3QLJA 4P3XA 4W5QA 5CP8A 1FSGA 3N8NA 4BMYA 2C78A 2BHTA 2Q9CA 2QB5A 4PLVA 3X1JA 3G0CA 2O54A 1O6BA 4NBRA 2IP2A 1Q0TA 3IURA 4RF5A 4R8RA 1GZ3A 1C9YA 2QU7A 5LQUA 1D2RA 1TD9A 3GJ0A 3JQ7A 1P91A 2CKMA 4M86A 5K05A 4TXJA 2I7CA 2ZWIA 4AL4A 3K70D 3OT1B 1MIOB 4BAUA 2A58A 3CCFA 4EHJA 1V5FA 2J3LA 1R8YA 1WKBA 2D5IA 2IZ5A 5B3LA 5JXHA 4ZI3A 3EXHC 5ECGC 4RCVA 4S1PA 4CEJA 2B6NA 4BNMA 1YJ5A 2RHWA 1T3SA 4R6XA 3BQMB 2JZCA 4Q3KA 2OGSA 3R7WB 4CODB 1SUDA 5IAKA 2H85A 2Y05A 3DO8A 4P9NA 2QRNA 1IOLA 3CLHA 1ZITA 2BF7A 2QY9A 2V6MA 2W98A 5ALWA 1E4VA 1Y4ZA 4QIHA 4QNRA 5C0OE 1U2GC 3GAMA 3CMMA 1AG9A 2DBYA 3H1TA 3A9WA 5TLSA 2OHFA 2BL4A 1U3UA 3ETJA 5JAHA 5JXIA 5CLLA 2QZSA 3GLHA 2GPTA 5JPIA 1LWOA 4RHYA 2MHCA 1E2LA 3RS3A 2YWGA 4ZMSA 4BC0A 2P5TB 1CUAA 5DXJA 3GV0A 1LJLA 2FMXA 2PANA 4G6ZA 3U4HA 5JHHB 2QVLA 1VKNA 3BIXA 3QG5A 4J7CA 4B3CA 4UPEA 4KCGA 3E58A 2AXEA 4GC9A 1QTIA 1PW5A 1UBFA 3E3NA 5COQA 3B2QA 4E5PA 3OBBA 3S7TA 3HU1A 3PCTA 3JYOA 3PL5A 5E7MA 1SXJA 2YY6A 4LHSA 1K9SA 3IQWA 5TPZA 3SHTA 3GUHA 4US1R 3MW8A 1P1CA 1U7WA 2P41A 1ZGGA 3K2EA 2J9GA 4U5XA 2B36A 3EH1A 5F5LA 1TUIA 2H2FA 2WHYA 3LUAA 2HN9A 5DTQA 1U28C 2YYAA 1YDWA 5I7OA 5ADWA 3SNKA 2QTBA 5IG2A 4EUSA 4Y9RA 4N3GA 5EUMA 2XZDA 2FE4A 5FTNA 5LZ5A 5HUHA 1F06A 1G8MA 3LECA 3NOVA 3PFFA 2W0MA 5DHAA 4MDHA 1Z6AA 3RR2A 4RZHA 1D2NA 2WUDA 3FMIA 1YK1A 4AZWA 4HMQA 5KPJA 1NF9A 1M1XB 3I3SR 4RJ2A 3SBDA 3TZ6A 5IARA 4U6NA 3N39C 1UT5A 4MIOA 1P9OA 4HWKA 1XPRA 1K63A 1J0CA 3ZZ1A 4BDTA 5BN3A 2QQEA 2NUPB 1ZGAA 2L2QA 3BFJA 2ZUUA 4K2AA 1MKYA 2ZEJA 4UNQA 3BRSA 5D1HA 3GRCA 4ZI7F 4UXJA 3NJ4A 1ZZEA 5U9CA 4DQKA 5FADA 2OBYA 3EEBA 4C29A 1N1DA 4MS4A 2YZ2A 1J56A 2PU7A 3IA2A 1OE0A 3U1TA 4BZZA 5BSTA 3RK4A 1JEQB 1NBIA 2JI7A 2WU4A 2ONCA 4JASB 3KOYA 2GBLA 2R6ZA 2VG8A 3PJEA 2RKOA 1NVMB 1MJNA 1RXCA 1DO0A 2VBIA 4OXIA 3K72B 4UUBA 5ALLA 5BSUA 5I9TA 3Q8WA 1IM8A 3BGVA 1ZFNA 3LP8A 4MAFA 5AKZA 4BO1A 1E0JA 5KYKA 3QE2A 5FBQB 1H4VB 1Y8AA 4LY3A 3D3WB 2IS4A 3B2EA 3WDMA 1OBCA 1YNSA 2QRPA 1Z4NA 3EUFA 1Z36A 4N5HX 3W8RA 3PENA 4YI5A 5C46F 4MW1A 1P9LA 2R6AA 2YXNA 2QAGC 2WWXA 4AN1A 1YVEI 2YVAA 4MVJM 3SQNA 4D4KA 2G67A 2WYOA 4QT4A 3DTYA 1FS4A 3R7LA 2GXSA 5BN4B 3VKHA 2EATA 1D1SA 4Z7QB 2ID9A 1ITZA 4LE2A 1KC1A 4MV7A 3W34A 2G6TA 2I4MA 3KB6A 5IS2A 1IN5A 1M2OB 1Q17A 3KK0A 4JQSA 3I2YX 1SXPA 4FYPA 3OM9A 2G07A 4HDCA 1UMCA 1XRPA 3LPAA 1W5AA 4WLOA 3ONFA 4L3WA 4KAFA 4D9KA 3H0KA 2F1KA 4D96A 2QMEA 2XBLA 2CZQA 1K6JA 2QF7A 2XZTA 4RMIA 5IC6A 3TE7A 4F3YA 2X0JA 2OWEA 3HR8A 4H18A 3T5DA 3ONEA 4X94A 3D0OA 4XOUA 1U80A 1UFVA 4PSKA 1Z2OX 4OIFA 1DHRA 1FTWA 1A4UA 1AK9A 3LK6A 3T7IA 1THMA 1R8JA 1YKFA 3CRMA 2A59A 1VLJA 4KE6A 4GMXA 4RNDB 5AM0A 1ZWLA 2GZ1A 2EP8A 2JCVA 3GELA 2BM1A 3SYMA 2BGGA 2FOLA 3I6QA 4Q7EA 1TECE 4HWOA 4BLVA 2A4KA 3ZD7A 1GOTA 3KU1A 4HZGA 1RQ7A 4ANFA 4QDJA 1BHSA 2PEZA 4JCOA 2M32A 3P4UA 5BXYA 3H65A 3NTVA 3SDBA 2EP7A 5ESXA 2DEUA 3P1JA 5JAPA 1V5GA 3PIIA 1MXFA 3BK2A 3EGIA 4ESHA 2H8GA 2HWWA 3LC0A 4UAUA 3TWOA 1M6VB 1E6EA 1JIVA 1YHZA 2L69A 2QX9A 3FHJA 3N2NA 3FY4A 4LYGA 3PPXA 2C4UA 4I1RA 3I45A 2O8EA 2IYEA 3ZXIA 3T5PA 1K5HA 3HCEA 4I4TA 2Q8NA 4HH3C 5IDVA 2IV7A 3V4VB 3P5BA 4EJSA 2OGTA 2BFEA 1JSXA 4H7KA 4E7PA 1C3JA 3GZNB 4WZAB 1PHPA 1DSSG 1QHNA 2FQ1A 1QTQA 3MUFA 4WNYA 4DUZB 1QZTA 3HE3A 1PUIA 1R4MB 5EQTA 3C24A 3QMVA 3RFUA 3TRFA 2VJNA 2IS1A 1P1HA 3NDPA 5AICA 5DULA 3ZZUA 6LDHA 4F93B 4DNQA 3U1BA 2COEA 3LX5A 3EC1A 5CVDA 1L3BA 2Q5EA 5JWOA 1NBOA 2GM5A 4B09A 4R1PA 5HQ3B 2VK4A 4JVNA 3MYRA 2LWIA 4LI0A 4TXMA 5FKJA 2GQ0A 1SZPA 1JAIA 3MT0A 1B76A 5FI1B 2WKRA 4R2XA 4WOPA 3A4NA 2ZJ3A 2FETA 3RB8A 1LSOA 1AB6A 1W46A 3AF5A 3S1LA 1BKSB 2FKAA 2QJRA 2PN1A 4OK3A 1SBQA 2I2BA 3PSHA 4BMNA 3K9WA 2GEDA 5KWIA 3HDVA 1JKXA 1ZX1A 3HJGA 2YNMD 3GJRA 2QPTA 3QU5A 4GI7A 4RDCA 4HBZA 2WJ6A 3BZBA 3NFYA 4Z3KA 3HXKA 2R7LA 2WQZA 5ALIA 5B1DA 3WWEA 3EZGA 4RVNA 1PJQA 2UZ3A 3CLTD 2KJQA 4H3HB 2BFFA 2GZHA 1VBMA 2YHAA 3MWKA 4M0CA 1GGHA 1L5MA 2IP4A 5JSQA 1FFBA 2SCUB 2V8BA 5AJUA 2FZVA 3GGCA 5IK2A 1X7HA 4NFSA 3EIWA 3RJZA 4BFTA 4NNOA 4DARA 3CG4A 1H8HA 2R11A 1KQOA 2P6PA 3KJNA 5K0LA 2GRJA 3IIIA 3JVEA 4NAHA 1C4KA 5TDHA 3FCXA 4QRIA 1GCAA 2DKFA 3H9UA 2O8BB 1VJCA 4G0VA 4NTZA 1T5OA 5E4FA 2ACWA 2GRUA 4N4AA 1KPIA 3MTQA 2VTVA 1R9JA 1SJ9A 2HSWA 4AVYA 1JAXA 1NT4A 4KE8A 3PGXA 2NN3C 2FQWA 4YQYA 1WMAA 1Y1QA 2CLMB 1CJCA 3ENVA 3K1AA 5KTRA 4J0QA 3F4BA 3A9CA 1K7CA 4XWWA 1G5PA 1N9KA 4D4HA 5FOSA 2QYOA 1A8IA 3O4VA 1XTSA 1A4RA 3GLRA 1XR3A 1F6BA 1GU7A 4DA6A 5CB8A 1VPDA 3O3NB 2IITA 1RKBA 2CNOA 1SO8A 2PQ2A 3IKLA 3V9AA 1NTRA 3PRKE 2QMHA 4B4DA 3RYCA 3GMDA 2G6BA 1S4MA 1B6TA 1XZPA 3HBFA 5G1PA 1VKJA 1I2MA 3G2OA 4OBBA 5AJWA 1TLLA 1M34A 5K8VA 5DX8A 1X8LA 2BM0A 3ZDRA 4FHDA 1LSSA 4LTDA 2DWPA 4XDYA 2IU6A 2JDID 2QV0A 1RRPA 2AZMA 4XGRA 5IASA 5JYBA 2D1TA 1QYDA 2ATVA 2XUIA 1WMDA 4JX8A 2AFIE 3TQFA 4BL5A 1KU6A 3Q7IA 2R84A 3HB0A 1KAHA 3DONA 4AU1A 4KI0A 4X7BA 1J7KA 1ENZA 1WDLA 2HRBA 1E5VA 3AH8A 2P4QA 1E92A 3ANSA 1Z3CA 3MTJA 4ZO9A 5D01A 3ZYCA 4BMCA 7REQB 5IYZA 2PUEA 4G25A 3ZY4A 1JX6A 2DFKB 4XB1A 3W6ZA 3L8DA 4D4LA 5KWJA 3T1HB 1KPHA 3A6PC 1KMIY 3KFVA 3RIHA 4BLTA 1KMHB 4RZSA 5IU6A 4HRVA 4MQUA 4KUEA 4BLQA 4KJXA 4NXMB 4CMBA 4E5UA 1Z73A 1RZUA 2BV3A 5JARA 4D0NA 4FHZA 1NBME 1JG3A 2X0IA 4QXOA 3W3AD 4R0NA 3WOVA 3P9PA 5LLSA 1HUQA 3ZHRA 1ZUWA 4CN8A 5HF5A 2HLHA 1ZCFA 3DYVA 1Z4KA 3TE6A 1N7JA 2X76A 2LCFA 3WZMA 5AQEA 3OJEA 4Z53A 2C59A 3FPAA 3JSXA 1JPUA 5GV7A 5IBRA 1AGPA 2ZSAA 1WHSA 1IFXA 5C1IA 3CNHA 2QXTA 3LX6A 3L8FA 4B4OA 1DCKA 2BKXA 2V6GA 3H1FA 4AKGA 1U8EA 2OUKA 1W75A 3N3AC 4E5YA 5CBKA 1EWQA 5KNBH 1VFPA 1O7JA 1R27A 5HIJA 4UAGA 3CG0A 4OPMA 4OOFA 2JFYA 1QUFA 3MRSA 4I66A 5D85A 4YUZA 1H1DA 2A6PA 5LQRA 4PSAA 3IEKA 1RI2A 4PX3A 1AURA 2OEPA 5LL6P 3CBQA 4TQ9A 3C7AA 3M1LA 4TTQA 2ZRLA 3B5EA 1YE5A 1ORTA 3LPCA 2ZTMA 3AXTA 5F4BA 1JFVA 3OAAA 3PXCX 3QKSB 4MHTA 4EFNA 3MRXA 3IV7A 1E3DA 1ZS9A 5HMLA 2EHDA 3KKMA 3P19A 4OHFA 1PJ3A 5J4LA 5K45A 1T8YA 1E1RD 3BVPA 3ZVLA 3IBSA 1HFWA 2PGNA 4BNIA 1RHMA 2R9VA 1J24A 4JUAA 1N6PA 4NV0A