1G6HA

Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
TMEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANSPORT ATP-BINDIN
total genus 92
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g6hA00
5EJEA 3TE6A 2VP9A 4JT2A 5FBLB 4U7DA 4UQOA 2IW3A 5CYOA 2QNRA 2ZJOA 2ZTSA 4P33A 4C2TA 4IOLA 4BFTA 1E9CA 4ON9A 2IS1A 3QBVA 5LDDC 2HCBA 2XB4A 3C15C 3L0PA 4RD1A 2WAXA 3V00A 4DRZA 1GWNA 4HAVA 1ZP6A 3QVUA 2YINC 3KKPA 2N42A 3REFA 3Q7PA 4D4LA 3IQWA 1KMHB 4O25A 2JIZD 3PVSA 3GJ8A 5H8WA 3WHLA 4TT3D 4B3CA 1R8QA 4NKRA 3K0AA 4Q7KA 2WM9B 2CCJA 3AVPA 4NL4H 4I4LA 2H5EA 4EPXA 1VCNA 2IYYA 1S8FA 1OXXK 1II8A 1D2EA 3BWDD 3CRW1 1FL9A 2ZIAA 2XTNA 2OT3B 3CBQA 3NC0C 3FYHA 1KI3A 3VQTA 5H68A 3EWAA 3CIOA 1JXMA 4QHTA 3L8ZA 5DYIA 3J81k 3GJ4A 1U8AA 1OFUX 2ATVA 3WMGA 4I1UA 4QGHA 4DXAA 4OHYA 2C5LA 3GLHE 2CVHA 1SQ5A 2QP9X 2OZEA 3IQXA 5ANRB 4NCNA 2JJ2D 2OSBA 1TAGA 5JCPA 2D7DA 3BRWD 4DIEA 1NY5A 4DSUA 3GLGE 1ZUNB 2P5SA 3IDQA 3MAAC 3KX2A 2P67A 2XNDD 1CRPA 1U0LA 3AVVA 1K6MA 4LGMA 2OCAA 4IDNA 3QUSA 2CLSA 3HYRA 3OZXA 2C9YA 2DR3A 3OEED 4KVGA 2G83A 4EPRA 4NCHA 1Z6TA 2GESA 2XEXA 2KSQA 4KVAA 1CBUA 2IYXA 2QSZA 1YZLA 5L3RA 3QG1A 4FIDA 3I72A 1LY1A 3RS2A 2I1VB 1KJYA 5IDVA 1E9BA 3WP1B 2O0KA 2EWWA 1E69A 4GI7A 4ZDIA 2BJVA 3UPUA 1RZ3A 1OYWA 1VG9B 2VA8A 1V43A 2ZSDA 3N2IA 2O8BB 4HUQA 2QP3A 4IXNA 1UADA 2QQ0A 3A1UA 1W0JA 4V0NA 1FX0A 5L8VA 3T5DA 1MABA 1S1CA 2PT5A 1P75A 2G1JA 5DHAA 1GIAA 2NPFA 1AQUA 1R7RA 2G3YA 3QQ5A 4H1UA 1S2MA 1Z6AA 3H0KA 4UXJA 4Q19A 4BLTA 4EUNA 1WF3A 2ZE7A 3SYKA 4TLAA 2JJ1A 4NMMA 4ZIRA 1JQJC 2KI5A 4BFWA 4YMVA 1G8GA 1EFRD 1NBMA 2GDJA 1BH2A 3E1SA 1COWA 1US8A 2LKCA 3T34A 2J0UB 4Q9LA 2FSHA 3KXKA 4QNMA 3DM9B 2Q6TA 3K0FB 1P62B 3W5JA 4DDTA 3NG1A 4LJ8A 1E1QA 2XX3A 1GNQA 2B92A 3FKSD 4JL5A 1YE8A 1PJRA 1DG3A 1E2JA 3R20A 1WXQA 3FKSA 2IYSA 2GXUA 2GWHA 1XJQA 1LW7A 1QHYA 3ICQB 1NP6A 1OFHA 3KJGA 1XCMA 1OT3A 4GZLA 2DBYA 1UEIA 3IPYA 1W44A 4LV5B 4DSOA 3CR8A 5FL7D 5B64A 2YOGA 4G01B 2CHVA 3NBXX 4QFMA 4Z8XA 4DLTA 1D2MA 4XVRA 4Q5IA 2XZOA 4KITB 2OBLA 3UG6A 5BYKA 1AKYA 4JLDA 2ZI5A 4L4UA 2NTYC 2ZRBA 3KQHA 3DZDA 2SHKA 4I1VA 1T5IA 1B23P 3VNUA 4RZ3A 4YMTA 3FPAA 3MJRA 3SNHA 2HDNB 2MSDB 2FDCA 3AP3A 2QPAA 4FCVA 2E9SA 2GNOA 1XWIA 3PR1A 1ELOA 2PX3A 4OI1A 1A82A 4ARZB 3CW2A 1KI4A 2XJ4A 4BFZA 1DG1G 4JL6A 1DVRA 3DMDA 4JYBA 2W6JA 4MKHA 2BMDA 1EFRA 4C9BA 2GAOA 2IXFA 4XSHA 5GJCA 4DT1B 3SQWA 2GCPA 5HE8A 5DNYB 2YC2C 3NH6A 4IOMA 2IWRA 4TYPA 3SJAA 1VYVA 1U94A 3KJEA 1DPFA 3B82A 4W7SA 1F60A 4ZKDA 2QY9A 3LFUA 1XCGB 4JYCA 1E2LA 4EPTA 5GADl 4A6PA 2J0SA 4C2UA 2H92A 3NHBA 3SEAA 4AYTA 1NKTA 2RHDA 1NKSA 5CJ2A 4NU0A 3GLHA 1U9IA 2OEPA 1YU9A 2GZHA 2JJ8A 4LJ6A 4N1AA 3TMKA 5LD2C 1ZD9A 2WWHA 5EE0A 1XTSA 3KFXA 3SI7A 2ZSBA 3JZAA 3AVQA 3BK7A 3WRYC 3SS8A 4PPFA 5TXGA 4B47A 1SVSA 3WP0A 3B85A 3KQKA 1Q3TA 3U6BA 2XXAA 3CRMA 1AZTA 3ZLJA 1N0VC 3QEOA 2PMKA 4PTLA 3PCRB 4FD2A 1DADA 3FHCB 1JXOA 1J70A 3MSXA 1ZINA 4A92A 1W2GA 1Z0FA 3ADKA 1HUQA 3BORA 3TRFA 1KY2A 4W9MC 3JZMA 3TLXA 2C98A 3EPJA 2IYZA 5TDHA 1GAJA 5L3SB 2QAGC 1T8UA 1OXTA 5EP4A 4RD2A 3RHFA 3B78A 1DBSA 1BIFA 2RGCA 1TU3A 1W5TA 3P4XA 4BE7B 4AIIA 3LX5A 1Q22A 3NTUA 2ODEA 2CHQA 4TYWA 4MYTA 3F8TA 3B9QA 4HB0A 2F6RA 4IFBA 1UEJA 1W0JD 2DFLA 3IBGA 3HU1A 4IW3B 4R2IA 1WBBA 3LQRA 4PSVA 3SBDA 4MRRA 1T3LA 2ZEJA 4UNSA 4MDFA 4GMXA 5JMTA 4KJZA 2XITA 2ZJ8A 4TYNA 2WWGA 4B3XA 4B75A 5E3HA 2VSOA 2QN6A 2DWPA 1NL3A 4FXPA 1LS6A 4ABYA 3GLFB 5DYGA 421PA 3THWB 4Q9KA 3IIKA 1XRJA 4ESHA 1A4RA 5AUQA 1DAFA 4LYAA 1Z5ZA 5EXSA 4JLPA 4XVUA 2QT1A 4ZV4A 1R5OA 4BFUA 4RFSA 2OHFA 1ETUA 2FH5B 4NYMR 3QF7A 1W36D 5FL3A 3A36A 3U3KA 2J3EA 4P4SB 4PHTA 4LHXA 4YLGA 4ZIRB 1E0JA 1CS4C 3ZH9B 3ZZTA 4KODA 1F2UB 2ORVA 2Z4RA 1JAHA 4WXPA 2CVFA 1NJGA 1OYYA 1SZPA 4HLCA 1GITA 1GL6A 4NCKA 4H9GA 1ZNYA 3O8RA 2L0XA 1FW6A 4LOAA 1CEEA 3R9IA 4UNQA 2GJAA 2WJYA 5DI9A 1MABB 4B3GA 1G19A 2AWOA 4BGDA 1G41A 1M74A 2ZRKA 1RYFA 4KFUA 2ZRDA 1MT0A 1GL7A 2HEIA 2OCBA 3SYLA 1GKYA 1GP2A 1AK2A 3K8YA 3KUDA 4JBYA 5FTKA 4AKEA 1NBME 2G0NA 1G64A 3DZ8A 4H1VA 3SR0A 5BN4A 3EZ7A 1RIFA 4DEYA 3LVRE 3PQCA 3KZ1E 4A2WA 3KXIA 5EXXA 3FMOB 1OKKA 2Z43A 3AQ4A 4MH0R 3LLUA 1JBKA 2VP5A 1D5CA 3OAAD 1IN5A 1LV7A 3PXGA 4POAA 4G5OA 4RD6A 2JJ2A 1Z83A 3QVVA 4US0R 1E1RD 1IY0A 4HB3A 3AVUA 3G0HA 1F5NA 4Q9JA 3TH5A 1QVAA 4MGIR 1Z22A 3GEEA 1KO8A 3NHAA 3PITA 4TL7A 3RC3A 1P2SA 4KBGA 4CEJB 1F2UA 2RGAA 4KFRA 2V3CC 1LTQA 4HUTA 4C7OA 5CM9C 2OFWA 1U98A 4PO1A 3TJZA 3C5CA 2H7VA 1Z0IA 2ODWA 3P20A 3AVWA 2O8EA 2QROA 1EFUA 2QRNA 3OFND 4GNKA 4MDEA 4JVSB 1OH8A 4MGKR 3DO6A 4RZUA 1U0HC 2YC4C 3ND8A 2GRJA 5FUXA 2NGRA 2RKOA 4QG7A 5FL7A 4IFEA 1VG0B 3ONWA 4CEIB 1MR3F 3GLGB 5EUQB 5C18A 2QEQA 4M2LA 2UZIR 1KK0A 4UJ3A 3ZVLA 5KPJA 1UBEA 4Q7LA 3RS4A 4BFVA 4TSFD 2OAP1 5FOSA 3GLFE 4JLMA 4LJ5A 4FW9A 2ERXA 1CR4A 1WMSA 4TSFA 5KNDA 5SZIA 2C8VA 2ZE5A 2FWRA 4G3XA 4D4KA 4ERNA 2RMKA 3P4YA 2RAPA 2N1BA 1DAIA 1X8LA 2HT6A 4LUCA 3F0TA 3RS3A 1FTNA 3D3QA 1RYHA 2FV8A 621PA 2G9NA 3T35A 3MJHA 2IF2A 3ZVMA 3RS0A 2C77A 2PCJA 4ACAA 4QNRA 3NXSA 3UWKA 2JJ1D 1TMKA 1JPJA 2IF0A 1JECA 4IVRA 2WAYA 4BFYA 1FUUA 4DCUA 3TSZA 3OE7A 1BO6A 2A3RA 4JSTA 2REOA 2PEZA 4O2RA 5IT5A 2F43A 1GKIA 5L3SA 1CP2A 2XJ9A 4WXRA 1YR8A 1JB1A 2R6DA 1IJFA 1LVGA 1A7JA 2AHOA 1CJUC 3U61B 5HZHA 4QGFA 5H70A 4M1WA 5KHOC 4PHFA 3CH5A 1FFHA 1V5WA 2GJ9A 2J0UA 3O47A 2IYRA 1DAGA 4KLZA 2FG5A 1XJCA 1ZM9A 3TBKA 2FGJA 5FR2A 1ZUHA 1VG8A 1T0JB 3THYA 5FBVB 2PL3A 1QHHA 2F43B 5KDDA 2ZRNA 1XD9A 1XBTA 2ZE6A 4PQFA 1E2HA 2FPKA 4I1SA 3SZRA 1E9SA 4B3BA 2P5TB 1CTQA 5DH9A 5JZVA 1VDZA 2ZJ2A 2KB0A 2DFNA 4JJKA 5EP2A 3MWLA 2R44A 1H8HD 2JLZA 2VL7A 1K8RA 3OAAA 3ND9A 4OQNA 1YQTA 3THOA 1EG7A 1S0UA 3K09C 4LC1A 4A82A 5CDFA 4C0AC 4YQFA 3I92A 4PR0A 4TT3A 4C0SA 1UBGA 4DDWA 2RGNC 2XNSA 4G5QA 2Z0MA 5CK5A 1GDDA 3A1TA 3QNUA 4HATA 2ZI6A 4LDJA 2AN9A 2BBSA 2J45A 4ZCMA 4Y0VA 4BFXA 3K9LA 4NCJA 3U4QA 1PZNA 1F6BA 1TNDA 2O8BA 3EASA 2FNAA 4TL6A 2AK2A 4PSAA 1DE0A 1X8JA 4FCTA 5HE9A 3PUVA 3GP8A 4W5HA 2HCJB 3CKLA 2FFBA 5JLJA 2IUUA 1VMAA 1H65A 2O8DA 2QPOA 4Q4HB 2G1KA 1W4BA 5BYJA 1WA5A 1BMFD 4YMWA 4DLUA 1IN6A 3Q7QA 1G3QA 4QGGA 1VCIA 2PZEA 4HYYA 4KYUA 3DOEA 4HLUC 1MH1A 3TSWA 5FBQB 4G0NA 3BXZA 3KQNA 2A5DA 4WW0A 1JALA 1UJ2A 2EFGA 3AEZA 5FPHA 1TPZA 2CE2X 2VHQA 3LQQA 1E98A 1KI9A 3MFYA 1WDTA 2VHUA 2DCUA 2J9RA 2FSFA 2QAGB 2HF8A 4LBVA 4NTZA 5P21A 5J4KA 1XTQA 1Z0KA 3OEHA 1ZAKA 2WWFA 2YWGA 3X1DA 4GPTA 3TR5A 2FOLA 2R65A 4TMKA 4Z1MD 5FTLA 3R9XA 3MCAA 2FE4A 1S1MA 1XCPA 5FTJA 3EARA 4HLQB 2QU8A 3AP1A 4GP6A 5G40A 3CPEA 3FTQA 3NVAA 1M6NA 2CK3A 3REGA 3SFZA 2ZS7A 3MWJA 2WJVA 2X1VA 1E9RA 3K09A 1WRBA 1RRCA 2WSSD 1W4CA 5AK0A 2HUPA 4NCIA 4EPYA 1NLYA 3ADCA 1UBFA 2KBEA 3AVXA 2QGNA 2JLVA 4Q1DA 3VR2A 1SHKA 4XWOA 4WA7A 1GRRA 2WSSA 2EYUA 2O8FB 3BBPA 1W47A 2QAJA 2AR7A 1UPTA 3C7KA 2OXRA 3BB1A 4ILEA 3B2EA 3H4MA 2W2VA 3ASYA 1CULC 2NG1A 1QHXA 2ZRFA 3D7MA 1GILA 3QKTA 4HI0E 3HU2A 2Z6VA 3K0CA 4LHWA 5JI2E 4N0DA 1VCOA 2JLYA 5CM8B 4Q7JB 5BWMA 1ZYUA 1OB5A 2NO6A 4E22A 1CJVC 1OXUA 1FMJA 4GFDA 5EQTA 1AIPA 5FUWA 3RWMB 4URZR 4LHZA 4URYR 2AD1A 2OESA 3ZVNA 2J0QA 2A5JA 3GFTA 4QRHA 5F98A 2CE7A 3AB3A 3TW8B 3IO5A 4IDOA 4QBIA 4TTQA 1E94E 1C1YA 3B60A 4JLKA 4HZUA 1GVNB 3BH6A 4Q21A 3GLFA 1G291 4HUQB 4Q7MB 4Q47A 3EC2A 2WOOA 3FHOA 3L43A 1ZC4A 4JBWA 2BV3A 2N46A 4L9WA 4DKXA 3U7GA 4K46A 4LX0A 1EFCA 2I3BA 2VYFA 1U8YA 4LBZA 4QXAA 4OQLA 2QMUA 4AG5A 1DOAA 5C1BA 5K8TA 3EIEA 2W83A 1U8ZA 2X77A 3UMRA 1X1RA 1T3HA 2V1XA 1E2FA 2GCOA 1JPNA 1W2HA 2WICA 2CNWD 1KJWA 2D2FA 1UKVY 2OBNA 1E9DA 1KSJA 1A2KC 4V0MA 3DDCA 1E6CA 5JFGA 1FQKA 4L8GA 2VLIA 2JLRA 4XD7D 2CL6X 3TQFA 1XD2A 4Z8YA 2IS2A 3LVQE 3D8BA 1OJLA 2VHJA 5E4FA 4V0KA 1N5IA 3OESA 4IOJA 4DIDA 4PZLA 3DOFA 2XNDA 4BLOA 1L2TA 2RB4A 4K8OA 3RRZA 2ANCA 3CX6A 3GCGA 5LB4A 1EFTA 2D3WA 2JLUA 2DWQA 521PA 1E1RA 1UF9A 3NH9A 1I4TD 1US8B 3CM0A 3AUXA 2UVQA 4TLCA 1N6LA 4CYMA 2QMOA 4M8NE 1SVOA 3R9WA 4OK5A 4R2HA 1P7CA 4KXFB 2BCGY 1KAGA 1AS3A 3T12A 3HYTA 1G7CA 2DFTA 2YKGA 1AGPA 2BMFA 3RC8A 2QTVB 4DLSA 5JI3E 5KOYA 2VTKA 3VU9B 1TX4B 3SQXA 4NYJQ 4TYYA 5J4LA 2FFHA 2GJ8A 1BMFA 2ZI3A 1LF0A 1YZKA 1GTVA 4K81B 3QF4A 4M1OA 3RAPR 1IONA 3I61A 3G5UA 1W49A 4TL9A 1IOZA 2VHTA 4Q1BA 1G8PA 2H17A 5TB5A 1XTKA 4O0MA 4WAUA 2PJZA 1W46A 5EP3A 2QM7A 4DB4A 1SVWA 2GBLA 4IVQA 3CWZA 3RSLA 4BEBA 221PA 2V9PA 3EG5A 3K9GA 2VEDA 1G7RA 1EWRA 5CJPA 1XNJA 4UNNA 2CJWB 4DCSA 4A15A 2IWHA 5DLQC 1QG4A 5G53C 1NBMD 2DYKA 2V4ZA 2W6JD 3F5FA 2BDTA 4B32A 1HT2E 1XXHB 3AKCA 5A4JA 2OLKA 1D8TA 2XOKD 3AKDA 3TVDA 1W36C 3LWNA 4IEIA 2B8WA 3UK6A 4LHVA 3L8YA 3TAHA 5BW8A 3THXA 5KUTA 1YKSA 3BIFA 1J8MF 1RJ9B 4HLDA 5AJYA 1Q0UA 2V7QD 3TR0A 3QOFA 3EAQA 3FWYA 1MO3A 4Q4LA 2W0SA 5B58C 2ZI4A 2EFCB 3RABA 3KKNA 1WQ1R 1X8KA 4OKSA 3VMFA 3HPQA 4NYMQ 5DHFA 1ZBDA 5FTMA 2PCLA 2QORA 4DT1A 4US2R 2AD5A 4JSYA 4X8LA 4BECA 3EIQA 4EFNA 1Q44A 1Z29A 2CBZA 3C41J 5FBRB 2OLJA 2QRZA 3EZ2A 1CKEA 1W48A 1E32A 3QE0A 4Q4HA 2PZGA 1JAIA 5JRZA 2GEUA 2YOFA 3UKDA 4QBHA 3SDZA 1S9DA 4HZIA 4Q1EA 4YDSA 3UIEA 2ZRIA 3B5JA 1DAKA 1QHIA 2WSMA 3W5IA 3B13B 3RS5A 4RD0A 2JLSA 3Q5DA 1XMIA 4A8JA 3L82B 4C0KA 3UMSA 3ZD7A 1CF4A 2NQ2C 4P3YA 1JEDA 4B2IA 3CF0A 2ZR7A 4HDQB 4G5GA 4CW7A 2OXCA 3FDIA 3CR7A 3I3SR 1KGDA 2HLDA 3I32A 4IVPA 4S35A 2AFIE 4BFSA 1E99A 1FUKA 3K9NA 3AP2A 3R8FA 4M1MA 1IY2A 2WWXA 4OHWA 5DN6A 5EE1A 1IN4A 5F2EA 2FEOA 1RC8A 1F2TB 2ZANA 1RE0A 2QQEA 1FX0B 1Z06A 2ORWA 2JATA 3PUXA 3K70C 2RH5A 1NJFA 5DN6D 2NOAA 2DY1A 1AS2A 1RW4A 4NYJR 2QZ4A 1II0A 2K5UA 4QHSA 1MV5A 2XOKA 1T5LA 4DCVA 3THWA 1NLFA 2FN4A 4B34A 2AKYA 3KQLA 3RSOA 3MMPA 2C9OA 4JKYA 1TUIA 4MRSA 1T4GA 1OPXA 3TIFA 1SGWA 5EZ6B 4LYFA 4DC9A 5IF9A 3WXMA 1J90A 1LNZA 3R8CA 4PPGA 2GJKA 4E03A 5UKDA 3I4LA 1HQCA 4C4PA 3A4MA 1YR7A 2ZUCA 3PEUA 5AJWA 5J4HA 2WWWA 2Y8EA 3THXB 1HY3A 4MYCA 4DLXA 1XMJA 3IHLA 2ZRGA 3K53A 4ASUA 5KSOA 2ZR9A 1MOZA 1UKZA 3BH7A 4B76A 2BHRA 2V6JA 5J47A 2YYZA 3PEWA 1WBDA 1OF1A 3NWJA 4JLNA 2GZAA 1G18A 3LXRA 1CR2A 3CNLA 2GF9A 4MYUA 5DE3A 1AN0A 3LDAA 1ZM4A 2QMEA 2NO0A 3KTAB 3QKUA 4TMZA 5FOVA 4URXR 4QJ5A 4AI6A 2VF7A 2PBRA 4DUGD 1VCMA 1KMHA 3U4QB 2ZJ5A 2O0HA 2IUTA 1L4UA 4QOSA 1XU4A 3N70A 1VYUA 1G5RA 1YZGA 2ZYTX 821PA 2GJSA 2C2HA 1KSGA 4ZDWA 3PFIA 3RRMA 4MGZR 5D3MB 1T91A 3TQCA 1OE0A 4DJTA 4JLJA 1EX6A 2HXSA 5DGXA 3NBZC 4PZZA 3OIVA 1YZTA 4CVNA 5CDFE 4NONA 3H2YA 5C46F 5M04A 5L3QA 1FNMA 4JVLA 3GLIA 5FUVA 1D9XA 4FI3C 2IC5A 3A58B 4M9SA 3KJIA 3WYAA 2WBLC 4UXHA 3Q8XB 2P0EA 2R6GA 3W3ZB 5C4MA 3SHWA 4WZBE 4FMCB 2IUSA 3NBYC 3KKMA 4C0BA 2QAGA 1XEWX 1E9AA 3CRVA 1E2EA 2GXSA 3TW4A 3VTKA 5KSYA 2GXQA 4RCYA 3KKOA 2WKQA 2CL7X 1VHLA 1P2TA 3DKPA 3TUIC 2E1RA 2FJUA 3T1VA 3W8RA 3LXXA 3BERA 2OE2A 3Q9LA 2CMKA 4I81A 3LX8A 3RVBA 3RANA 1QF9A 1YHNA 3E5HA 1FPMA 2ANBA 2FSIA 3NDPA 4KHZA 1XEXB 3CLVA 5GJWC 2RGNA 2A9KA 2VP6A 5EE9A 4M9XA 2J5XA 5JHHB 2EVWX 2ASEA 3M6AA 1QDEA 1M2OB 4IHQA 4KU4A 3B1WA 4C0JA 1U9IC 3GJ7A 2RGXA 2CL0X 4LYJA 1Z6YA 3NC1C 4LYHA 3A37A 1MO4A 4X8MA 5EXTA 4B3DA 4CEIA 2ZREA 3EIHA 1KKLA 2D74A 3EPHA 1E3MA 2CCKA 1GUAA 2GILA 2GTPA 3FKQA 2ZU0C 3KB1A 1YR9A 2QBYB 1ZU4A 1P73A 2IHBA 1P60A 4AD8A 4KSBA 2WWYA 1W7AA 1NG9A 2F3RA 4Q02A 3ZGXA 2BMJA 1RVDA 5SZKB 2QA5A 1U90A 2F7SA 1RJ9A 1G8HA 2C95A 1ZMXA 1YZNA 4EIWA 2XSZA 4TMWA 5JSZA 3SHFA 2Q3HA 2R9VA 1ZW6A 1I2MA 1T3SA 3IPXA 1Z47A 4A1FA 3QXJA 1GL9B 3AF0A 3LV8A 1DARA 2EQBA 3MWYW 3OEEA 4BWYA 5SZJA 5FUYA 3FMPB 1ONBA 3P26A 2GEDA 1VIAA 2OO7A 3RYTC 1CXZA 2W2TA 4PC3A 5FBWB 1M7BA 1KTVA 4BRWA 2GXAA 1MO6A 2VH5R 1NVVR 1U0JA 3LAWA 3M0EA 3P32A 2BBOA 5FTNA 4D26A 4JZKA 1M7HA 3QENA 5KYKA 2A30A 2FPMA 4LY6A 1OXSC 1E79A 3H86A 4M9ZA 5KDOA 2A5FA 3CWQA 1QRAA 1P9RA 5JCZA 5J40A 5KU1A 2C03A 3DKVA 1T9HA 4L16A 3CZPA 4MUBA 3ZQJA 2R62A 2RGBA 3BD9A 1GG2A 4AYWA 1ZC3A 3W8NA 1IN8A 4PC2A 4W5JA 2DWOA 2Q9BA 2V55B 3AKEA 1E2DA 4PQYA 4P4UA 3X1XA 1KDOA 1H8EA 1G20E 2HT1A 1ZNXA 4PFSA 5AUPB 5FR1A 1S4QA 3W3AA 3T61A 2AWNA 4QGAA 1W4RA 1HQYE 5B30A 3FMIA 1II8B 3IILA 4DCNA 2BVNA 4URWR 1NN0A 1NNEA 3GD7A 4U5XA 4B3FX 3VX4A 1ZD1A 1WE2A 3EXAA 4MGYR 1U2RA 2HLDD 2F55A 2QMHA 2GKSA 4GRAA 2J59A 5HPYB 4TMVA 4V0ME 4LJ9A 5HKKA 1ZCBA 2OAQ1 6Q21A 1R8SA 3VFDA 3OE7D 4KI0A 1JJVA 1FMLA 3G82C 3I73A 5K8UA 1GSIA 1DTSA 1XFAA 1TF7A 4OYHA 721PA 1PLKA 4PPQA 2ERYA 4DLRA 4PHGA 2ONKA 3VR3A 1R5NA 1W0KD 1GNRA 3HWSA 3CUEF 2Q0HA 1FP6A 3FFAA 1EWQA 4NE2A 3LW8A 4N3NA 4MRNA 4URUR 4EFMA 1ESMA 5KNCA 2WMNB 5EZ5A 1VHTA 1KY3A 5TV2A 2JLWA 4EDHA 1HE8B 3EW9A 4L5BA 4PAQA 5DI3B 3SBEA 3NEYA 1IJEA 4JKIA 8OHMA 4LPKA 3ZYCA 3TNFA 1CR1A 4AURA 3L2OB 3LBNA 4P4TA 4I1OA 2UZ3A 1TEVA 1N0WA 1ZM7A 4QJ4A 3SU8A 4HB2A 2ZYWX 4C0LA 1FP7A 3HR8A 1DELA 2PLRA 2JDIA 1M1YE 2A2ZA 3GJXC 1HA3A 2IL1A 1NF3A 4X8OA 4BLQA 5CB6A 4RKFA 1Z6GA 4D82A 1R6BX 5AR1A 4EJSC 4B73A 4QC2A 3QY0A 1RKBA 3ZZ0A 4F4JA 3WMFA 4TQAA 2OILA 3U44A 3Q85A 3LBHA 3GLIE 3OEHD 2HYDA 3WNCA 1IBRA 1R0XA 3VR5A 4EFLA 3TKLA 2JLXA 1G6HA 1QZXA 2OM2A 1NIJA 3B1XA 3IO3A 5GJVC 1KSFX 1SKQA 4P4SA 4F4IA 2AX4A 1SULA 3LD9A 4R9UC 5HKKD 4WZ6A 2XGJA 4EPVA 2H8KA 1VIYA 2KWIA 1YZUA 5CK4A 4EAQA 2P6RA 1Z8FA 4QBFA 5E7IA 4PC1A 4MRPA 4GP7A 1GNPA 2XTMA 5JWHA 5DO9A 4F4CA 1UDWA 2NO7A 3ZVRA 4KLNA 3VKWA 2GVZC 1SXJC 1A1VA 1CIPA 4A8JB 1IN7A 4FMDF 4ITRC 1G3RA 1AKEA 2HXYA 2XSZD 3DPUA 1CR0A 3LW7A 4TWZA 3BH0A 4E07A 1KK2A 2ZS9A 4WBSA 3VR1A 3D6TB 3QEJA 4DLWA 4LPSA 3O8DA 4GSYA 3W6PA 3ADBA 4Q03A 4R71A 1SVKA 1TQ2A 2ZRHA 1G4UR 2KJQA 2P6UA 4RY2A 3T1TA 4LJAA 4OJKA 4PXAA 4XJXA 5H1YA 2P3SA 4LJYA 2C04A 3KQUA 4JVMA 1OH5A 2J1LA 5JJIA 1PVOA 1WB9A 1QBKC 4KAXA 1Z08A 4F93B 3WBJA 1XEFA 4L15A 4ZCIA 5HR5A 1OIXA 4M1YA 3U6KA 2E87A 3QPUA 3BFXA 4JLAA 1KI2A 3PG5A 2G6BA 4TLEA 1P2UA 2NO9A 3GLHB 1PUJA 1KO5A 5ELXA 5IHPA 1F48A 1NN1A 4PX9A 4LZZA 4OQFA 3QIAA 1KDRA 4HDCA 3I5YA 1VG1A 3UXMA 1KNQA 4Q18A 3L0IB 4CEHB 2QE7A 1I2DA 1Z3IX 3LY5A 4L9SA 3SJZA 1P3JA 1E2MA 3PJRA 1N6HA 4QBGB 4RKEA 4BZPA 4OQMA 2ODBA 3QKSA 3DMNA 4RZ2A 2JAQA 4AKIA 1KI7A 1G6OA 1IQPA 1TQDA 4TTPA 5CYPA 4PHHA 5GVRA 2ZVPX 5IRCD 1DO2A 1KAOA 3LA6A 2CDNA 3KKQA 1FQJA 2KE5A 3CO5A 5DIFA 5JHGB 2B8TA 2BJWA 3I8SA 3GQBA 3U2QA 2F1HA 4P31A 1PLJA 3WBKA 4YC7A 4M1KA 1U99A 4D0LB 4JLOA 1T6NA 3VR6A 1COWD 2IT1A 2ZAMA 2F1IA 5KDLA 5FOXA 1HH4A 3GLIB 3U60B 3GJ5A 1E1QD 2B7BA 4S2EA 1XX6A 2O5VA 2D4HA 4B2LA 2GZDA 1W4AA 4NH0A 1R0ZA 1XJ0A 2O8EB 1P5ZB 4XVQA 1HE1C 1W0KA 2RGGA 1MO5A 4MITA 3PUWA 1AM4D 1ZIOA 2QTHA 2OG2A 5FI1B 3VU9A 2NMVA 1O87A 4JVNA 2WKRA 4YXWA 2A7QA 3RRYA 4ZDJA 1R0WA 1KNXA 1II9A 1EGAA 4GBMA 3AVOA 4YXWD 2JCSA 3P27A 4B44A 4QKQA 2H16A 4M53A 1CRQA 1GFIA 4E09A 1X6VA 5AUNB 3B1VA 1J99A 4WIAA 4A8JC 2G88A 4Q1AA 1TU4A 4AK9A 5J4VA 4UXIA 2WIBA 2FX3A 3I1FA 2QT0A 1MRNA 1Z0DA 2Q3MA 3MG9A 3RWOA 3SN6A 2YOHA 3ZJYA 4LI0A 5KSPA 3U3MA 4LHYA 2X2EA 5TVKA 1Q3HA 1XTJA 4TQUS 3N5CA 4Z54A 1DS6A 1LFDB 3ZS9A 1OHHD 5KTYA 2WV9A 3IUYA 3IIMA 1KDPA 4ACBA 4I99A 1GKUB 2H1LA 3EZFA 3BE4A 2B21A 3T15A 1QHNA 2ZJYA 3CF6R 1KJZA 4ARZA 4A0RA 3DVLA 3MD0A 2ZU6A 4ZO4A 4LJ4A 3CB4A 4JT4A 5CLLA 1KDTA 3K0CC 2Q9CA 2J7PD 2WHXA 5DISB 2BBTA 3A1WA 1GRQA 3UG7A 1KZGB 3CX7A 4US1R 4GDFA 1KK1A 2J7PA 2NZJA 2GETA 3H84A 4M21A 3IIJA 4LBWA 2Q3FA 4OQXA 1N6RA 3X1ZA 3FB4A 3QI2A 4TZ0A 2DFKB 2IYQA 3DEFA 3QKRB 5LBIA 1E4YA 5LB2A 4A6XA 4B43A 4JL8A 1N6KA 4TLDA 3IEUA 4HAZA 4TTRA 3QSYA 4IDPA 2FFAA 1KHTA 1OFTA 2IBMA 4UJ5A 2P65A 2Z4SA 4BZQA 4FWIB 4PANA 4FINA 4HAXA 3VNVA 2X2FA 1M7GA 1NMYA 1SXJE 2WOJA 3QXHA 1KSHA 2JGNA 4HDOB 3X1YA 1OW3B 1XPRA 5JSZB 1D2NA 1SVLA 3CZQA 1S96A 3K0SA 1KI8A 1OXVA 1YZQA 4U00A 4D0GA 1L8QA 4A36A 1BYIA 4XH9B 2O8CA 1VYTA 3IBYA 2OCPA 1J2JA 2ATXA 4PO9A 1OSNA 2YV5A 3FOZA 4LV8B 2G77B 4V0LA 2I4IA 2CCGA 3CNNA 3IKJA 1GRNA 1TTTA 1OHHA 3IGFA 2DB3A 2GVDC 1N0UA 2RGEA 2ZYVX 4TMTA 2HF9A 3K0AB 4ESVA 1S3GA 2GHIA 1BS1A 4HAWA 3K0EA 2J0VA 1GZSA 1P9WA 1XMVA 3EC1A 3OIWA 2WPDD 3EA5A 4DBLC 5KNBA 1E2IA 1R0YA 2EFEB 2VBCA 2JEOA 1QHSA 4AC9A 2CXXA 3B6EA 2Z5FA 4C30A 1WP9A 4YONB 1NSTA 4Q4AB 4ZPXA 2B6HA 4P0TA 3P1JA 3GPLA 1NMZA 3W6OA 2JASA 5FOUA 2MSEB 4OK3A 3GFOA 4OHZA 1NN3A 5JWOA 4KSCA 1RRGA 2XXAB 2ZAOA 3A8TA 1NVXQ 3WYFA 1SHZA 1Z0JA 2C78A 1E0KA 2XZPA 1M34E 3PENA 3QBTA 1F3OA 3QKSB 4FWTA 2WVJA 2ZVQX 4M9QA 3T1OA 4DCTA 2MMCA 4KV9A 4BLRA 3T1QA 1ZIPA 3D31A 1UAAA 2FU5C 2W6IA 3ZIAD 4R98A 5F3WB 2H57A 3KUCA 3U3JA 3KTAA 4AG6A 1AQYA 4KCGA 4Q9IA 2ZUBA 4YMUA 1Q57A 4BASA 4B6EA 1QVRA 2ZITA 1DAHA 1L7VC 5FOTA 3R7WA 1O3YA 3JVVA 1L4YA 1S9HA 2GBLC 2YHSA 1E96A 1XPUA 1IHUA 2IS6A 4QM7A 2OFOA 1CU1A 4D81A 2GEVA 2QPTA 1J8YF 1XTRA 1ZVQA 4ZKEA 4FCWA 4RD3A 3KDSE 2F1RA 1Z6XA 3BFVA 4G5SA 3VHLB 1OKKD 1NIPA 3UANA 5FOWA 4CEJA 2O8FA 4Q4AA 2YWHA 3BFKA 1N6NA 2GA8A 2ZS8A 1KO4A 3QPWA 4QHYA 4DHEA 1XMSA 1AJEA 2BEJA 2BKUA 5BXQC 1D9ZA 5B57C 5GJBA 2X19A 4JLVA 1UFQA 2YVUA 1Z2AA 3AF2A 3RS7A 3K70B 1C4OA 1YJ5A 5G3ZA 2QSYA 2J7KA 4N0EA 3NEJA 2ZR0A 1E9FA 4C0QC 2EFDB 5EE3A 1XEXA 4KBFA 1P6XA 1EXMA 1CLUA 4WVFA 1GM5A 3T5GA 4LC0A 5DI3A 1XXHE 4GZMA 4BZXA 4AWXA 4MYHA 2ECKA 1CJKC 1AGRA 4NZYA 4UNRA 2AXNA 2TMKA 5J4YA 5F9HA 2RGDA 3OFNA 1E2PA 1Q20A 1ZJ6A 2ZI7A 3QXSA 3SOPA 4BUJA 4A2PA 1G7TA 2ODNA 2ZI9A 3X1WA 2WMOB 4JIMA 2VSXA 1BYUA 5CIWA 1W1WA 2AK3A 4PSKA 2F1JA 3SJBA 1E79D 1IAQA 5BN3A 1VPLA 1FOEB 1E0AA 2QGZA 1N6OA 3U7FB 4PAMA 4PZYA 1RRFA 3KB2A 1JNYA 4EJSA 3U7HB 2ZQ5A 2C99A 4LK2A 2PT7A 1KZ7B 2BBWA 1SKYB 2FPLA 1I4DD 4B71A 1KOFA 4OK6A 2H18A 4TZ6A 2QBYA 1X1SA 2LCFA 1LB1B 4LWZA 3K70D 1B0UA 2VIIA 4RJLA 4D4JA 1SXJB 3WMEA 2ZJZA 4B74A 5FPSA 4YDHB 1Z0AA 3CRQA 4MA4A 4OBEA 3FGNA 4R7ZA 2ZJAA 3AGQA 4NP6A 1LS1A 1KKMA 1JR3D 1XDBA 4C7OB 3C4JA 1NG1A 4YMSA 1XP8A 5JJKA 3BAFA 3A4LA 2A5YB 3TVTA 1XTIA 1HYQA 1RRPA 5JS8A 4F91B 2F3TA 4ASUD 1X3SA 2AXPA 3HJNA 2NPIA 1G5PA 3SYNA 5SZHB 1M8PA 2CLCX 1G3UA 2FMXA 2WTUA 4FMDB 1G17A 1XZPA 2CJWA 4RVCA 4Q4JA 1SVIA 4G1UC 4HLUA 2WWIA 4MKFA 1N6IA 4URVR 5K8LA 3FHTA 3LO5A 4LJ7A 1TQ4A 1Q12A 1XZQA 3AF1A 4HSEA 1Z2CA 1JJ7A 1P61B 4Q00A 5FPKA 4KFSA 4IDHA 3MGCA 4PO8A 1Q1QA 1G8YA 1NY6A 3TSOA 5BN5A 4OL0A 4CT4B 3OHMA 5DSZA 3U5ZB 1SKYE 5EE5B 1SXJD 1OIWA 4LSGA 4XIGS 4A0GA 4QM6A 4GT1A 1N25A 2R6AA 2QM8A 5CIQA 1SXJA 3GMTA 4PAOA 4UNPA 3AF4A 3AM1A 3CX8A 1UKYA 3U7EB 4DB2A 5JECA 3ZZUA 1H8ED 5F9FA 4EQ6A 4JJZA 1ESNA 1XEWY 5GVSA 2RCNA 1QG2A 3QPVA 5D3QA 4GL2A 2IS4A 4LCBA 1BOFA 4IKEA 4MUAA 1KO1A 2HV8A 1XPOA 1NRJB 3S1AA 3AF3A 1UM8A 3F3YA 1X86B 2WZQA 5AJZA 3SFVA 5CITA 2W58A 1ZU5A 4OI4A 2BC9A 4D0NA 3B7GA 4XWAA 4ZDKA 4CGZA 2O8DB 2IXEA 4G5RA 4CT5A 3QXCA 4RFSB 5B2ZA 2WJIA 1DAEA 2GCOB 3CH4B 4QL3A 2W2XA 1JR3A 2V7QA 2CK3D 4M0LA 1ZM3A 4P32A 2PLFA 4DVGA 3QJYA 4DZZA 1OB2A 1KI6B 2NO1A 3CPHA 3K1JA 4FN5A 1A5TA 1E2NA 1N5LA 1P4SA 2FFQA 2PJRA 1DO0A 1OH6A 3EPKA 3NKVA 4KYIB 3KL4A 1U81A 5TY0A 3EZ6A 5LD2B 1ZNWA 3BGWA 2G0TA 3AUYA 1T0HB 3B1YA 2FA9A 2VO1A 2WJGA 5BQ5A 3THYB 1EFHA 3BS4A 5E7MA 5EP1A 2Q9AA 1P72A 2OUKA 2VF8A 3FFBA 3LLMA 2V8OA 4OI0A 1Z28A 5JS7A 1HV8A 4HZUB 1VKJA 3CONA 2VHCA 3FE2A 1Q21A 3ETLA 2GCNA 3BB3A 1KYIA 5TMPA 2ZRMA 3GFPA 4TL8A 5J5CA 4JLBA 4GOJA 3TUJC 2V54A 4BEJA 3PEYA 1E0SA 4QJ3A 2WJHA 3LH5A 3K9HA 2R8RA 3OIUA 3B8HA 1IXSB 4HAUA 4ZCLA 4DDVA 3I8XA 2IHYA 2YJTD 4IJMA 1NLZA 5TARA 1QHGA 3ZS8A 2FEMA 4NPHA 4XD7A 1IM2A 3C14C 2IEYA 2ZSEA 4WOPA 4M1SA 2XTZA 1TF2A 2AFHE 1OH7A 1T8TA 2BIFA 2ZROA 3W34A 4EKDA 4XTCS 3U44B 2BOVA 4X8HA 1S3SA 3ZDQA 2WPDA 3VKGA 2OFXA 2ZE8A 1Q1BA 2UKDA 2F9MA 2V1UA 3WRXC 1CJMA 1OLOA 4J0QA 4IOKA 4PC6A 1G1MA 2D06A 4OHVA 1KMQA 4FMCF 5FFMA 4CIDA 2EW1A 3EX7C 3RDPA 3PIRA 2B7CA 4B33A 2IYUA 4PPNA 1KK3A 5JEEA 2RHMA 4Q1FA 1VTKA 3L0SA 2VP4A 1XXHA 3A1VA 1Z07A 2ORIA 5L3VA 2JA1A 1OIVA 2W00A 4C3ZA 4ZI2A 4E5UA 5HCNA 2ZYUX 1ZRHA 2IYVA 1W36B 4NBSA 4IDQA 3GJ3A 4D80A 1E9EA 3QG5A 4RD4A 2D62A 2W6ID 3OF5A 3ZIAA 2R6CA 3O8BA 2ONJA 4WZAE 2EU8A 2YWEA 2JDID 2QP4A 2ZJBA 4Q66C 1TUEA 4XWKA 5EUMA 2Q21A 3I5XA 3KFVA 1PV4A 2FZ4A 2ZRJA 3TAUA 2BEKA 2WIAA 3KXLA 5AUOB 1PUIA 2QUZA 2ZETA 1NN5A 5JEDA 1ZM2A 3DL0A 4U02A 2EWVA 2OBMA 4JS0A 2OCYC 1Y63A 1ODFA 3TK1A 3VR4A 2VQSA 3CF2A 5IK2A 1P2VA 3AKYA 3HP1A 3AVTA 3EA0A 3CNOA 4DSNA 2ZRAA 2QI9C 4NYIR 4RSGA 5CLQA 2O8CB 4V0OA 3QKRA 4DDUA 1TQ6A 2QE7D 4C0HA 4EJSB 4DLZA 1Y3AA 1JR3E 2HJVA 3MRSA 2VSFA 3W9YA 2JLQA 3UWOA 3T06B 2J46A 3QXXA 5G3YA 1R5BA 2ZRPA 1UKEA 3W6NA 3IHWA 2BCJQ 1FNNA 3MWKA 4OHXA 1CJTC 4OI2A 1IY1A 2PH1A 2O0JA 3A1SA 2CEAA 4DWJA 2GK7A 3VAAA 1OFIA 4M22A 3MLEA 2EYQA 4LBYA 4RZXA 3RLFA 3EPLA 1Z63A 4EPWA 3U3RA 2J87A 3Q3JB 4GOXA 4FMBB 4PC7A 1MKYA 1YR6A 1NI3A 2QG6A 2ZRLA 4JBXA 4BPBA 1N5JA 3NIBA 1G16A 1XD2B 1I4LD 4Q1CA 4JMPA 4A4DA 1RFLA 1ZCAA 1HURA 2XAUA 5K8IA 2GF0A 4ZI3A 1TF5A 2VP0A 2CHGA 1NMXA 2REBA 4D25A 1KI1A 4TYQA 2CLDX 3C5HA 3BB4A 4NHOA 2PZFA 4KO8A 4NDZA 2P2LA 1BKDR 1G3IA 2NZ8A 4NYIQ 1UBCA 1R2QA 4AKGA 4LV6A 5AJXA 1NVWQ 1NVUQ 3AH8A 4BLSA 2R2AA 3DHWC 5CB8A 4Z1MA 4DLYA 4MQBA 2REXB 2FGKA 1J7KA 1XB2A 5JWRA 4BQSA 4D6PA 3PUYA 1W5SA 5A0FA 5FH9A 4AKHA 1E2QA 1HEIA 1JQLB 2XZLA 2IEZA 1G21E 4HB4A 5FPTA 1R10A 3A4NA 4Y0AA 4W5WA 1IXRC 4BLPA 4GMDA 5C4GB 4A9AA 2XB2A 2C9CA 5JJLA 3H1TA 4IXMA 4TMXA 1H8HA 2C96A 4EQ6B 4O3MA 1KI6A 1YVDA 1FTSA 5AJVB 3PV0A 2X8AA 2VRWA 4V02A 2DHRA 121PA 1YRAA 2BWJA 1DAMA 3R7WB 4A0FA 2PMDA 3CPJB 3Q5EA 4Q48A 5L3QB 2VPPA 3SC3A 3FVQA 1NSFA 4CF7A 3ICEA 4TLBA 2O52A 3WNDA 5FPYA 1AA9A 1DEKA 2BM0A 3M4YA 3LNCA 3X2SA 3HU3A 3GLGA 3L0OA 5D3MA 3HPRA 2KBFA 4B35A 1FZQA 3GEHA 3WHKA 3VX3A 4TN1A 3V4RA 2MMGA 4MKGA 4HAYA 4DLVA 3VHXA 1KO7A 3C16C 3ASZA 5LPNA 1K5GA 3V9PA 1ANKA 4IEEA 2YZ2A 2IYLD 5AWFC 3CRRA 3VKHA 3QF4B 2IX3A 4LRWA 4CDGA 1TL7C 4A2QA 1E4VA 1SVMA 4GOKA 3B1ZA 1G5TA 3M1IA 3AV0B 3AGPA 2ZSFA 4B6FA 5EXPA 1HT1E 2IXGA 1G8FA 2D2EA 3HR7A 3AVYA 3A6PC 2FZLA 2QL6A 4CZ2A 3JVUA 5G41A 3O8CA 3I62A 4M4SA 3ECCA 3BOSA 1G4AE 5C2JB 2ZUDA 2D7CA 2AKAB 2YNMA 1WCV1 2PX0A 2J41A 2FF7A 1IXZA 4Q01A 2ZM5A 2QENA 3MUFA 4Q4JB 1GOTA 3NBFA 3GJ6A 1E2KA 2IYWA 1E2GA 2I1QA 4Q9HA 3WY9A 1Q1ZA 3TUZC 2R6FA 4M1TA 4CEHA 2WJJA 1JI0A 2QTFA 1G9XA 1VECA 1ZNZA 3E70C 3EWSA 5HZKA 4KFTA 2AL7A 3WYGA 1G7SA 3PUZA 4F7WA 3TGPA 3N2EA 3BC1A 4O2LA 1K5DA 3DM5A 3K0FA 2ZXUA 3V4FA 3GJ0A 4B2PA 2IK8A 1N3BA 4DEXA 1JR6A 1P9NA 1N6PA 3NDBB 4OJQA 2EFHB 4XOIA 4AY2A 1R4AA 4MRVA 1LF5A 4HEJA 1TADA 1ZD8A 2GAAA 2VP2A 2YWFA 1OV4A 5FI0B 1AS0A 1MRSA 3B9PA 1XD8A 2MSCB 4RCZA 3ZQ6A 1ZUIA 2Z83A 1YRBA 3IEVA 3BJIC 4B48A 4D4MA 4UKDA 3LRPA 3LBIA 2ZPTX 1G3MA 1N2CE 3SE0A 2IA5A 5JBQA 2NIPA 1A2BA 5KPDA 3E2IA 5A5GA 3PEVA 1PLLA 1JEEA 3C8UA 2HJGA 4DUGA 1AZSC 4TQ9A 3ADDA 1KIMA 2GK6A 2WKPA 3U3OA 5IK2D 5JRJA 4IRUB 1F2TA 4Z51A 3GEIA 3RNLA 2DPXA 5HCIA 5E95A 4DSTA 3FMFA 1XF9A 1EESA 1QHHB 5E7JA 2ZSAA 2BKEA 2W0MA 1RPZA 3S1AB 2JIZA 2FSGA 1EK0A 1N5KA 4D2IA 2ZRCA 4CRWB 2LWIA 3SJCA 2OV2A 2PEYA 3OIYA 2BM1A 4PQRA 3Q72A 2V6IA 5HTKA 4II7A 1NVVQ 5KSZA 2CNWA 1C9KA 5KO2A 4AYXA 2BMEA 3RRNA 3ZD6A 3UATA 3EZ9A 4V03A 1D6JA 1UDXA 1TEXA 3UMFA 4XTRA 2A78A 1EX7A 3WNBA 3KJHA 2LKDA 4F92B 4RFVA 3HDTA 4MKIA 4A0HA 2IYTA 4BRUA 4F38A 3W90A 2A5GA 2HYIC 1HTWA 1Q1EA 4XSGA 2F9LA 2P6NA
chains in the Genus database with same CATH superfamily
3PIIA 3TMAA 2VATA 3QE2A 4IO0A 3O95A 4UM7A 3VGJA 5COQA 2XCOA 5EFZA 3RC2A 4WGFA 3ZXXA 3CW9A 2IPOA 1U5CA 2J9FA 2PMCA 4C2TA 2P79A 4IOLA 1XZFA 4DUZB 2RI0A 4YRKA 5IMBA 3IR7A 3GFBA 4K3UA 3HKBB 3U17A 4CDMA 3C15C 3L0PA 4GPD1 5TJHA 1MV8A 1DZ3A 2WAXA 3UCFA 4DRZA 3GDHA 5ITSA 1A77A 5JQGA 4HAVA 5A5VA 3AR7A 3QVUA 4ETMA 3SIRA 4DARA 1QONA 3GJTA 1KH2A 4O25A 2YQ4A 1QIKA 3GROA 1FLDA 2YHAA 3T9CA 1M6EX 4CKXA 4XPZA 5ADUS 3AVVA 1E7WA 2W48A 3LYUA 5JH7B 1PYGA 4I3FA 1CNFA 1MTOA 1W85B 2VYND 3BEOA 4B09A 2H5EA 2IYYA 3E18A 2P77A 1S8FA 5JO0A 2M2IA 1I01A 1SUIA 3PD7A 4JOCA 4W8GA 4IIJA 2YVQA 1FL9A 1LQ2A 2ZIAA 2OT3B 4YP1A 1KE2A 5K99A 3H17A 4D9EA 5G1OA 4CLEA 4FHGA 2E4AA 2ZWIA 4IS2A 5LOVA 3DPSA 3WNVA 3GJ4A 4ZYTA 2UZ4A 4MIKA 1OFUX 1KY4A 3UXYA 1XNGA 2WUGA 3WMGA 4DXAA 1W5FA 4QGHA 1PAUA 2C5LA 2YWDA 3FW1A 3GLHE 5JATA 2LPMA 4AT1A 2CVHA 2BE9A 4FQ7A 2QP9X 3IQXA 5ANRB 2BEVB 1FUEA 3H4TA 1GAXA 2I54A 2EKBA 3M5WA 4B6QA 3NWEA 4DSUA 4JJ7A 5FUQA 3IAFA 4LNUA 4UBMA 1PP4A 2P5SA 1ZH6A 3LGXA 2OUIA 4RAQA 3TLBA 4ALJA 3DBOB 1AKRA 1U0LA 4L50A 3CTPA 3ET4A 1K6MA 4NDAA 4XDYA 2PRSA 2Z2IA 2XMZA 3QUSA 2CLSA 1TJ3A 3KV1A 4WWHA 4WSOA 1N1MA 1L3BA 4R1NA 1OBOA 4X1IB 4KVGA 4QJIA 4EPRA 3OOSA 4KBYA 1XMOB 4GD3Q 2VBFA 2XEXA 4EDFA 4YT8A 3TOCA 2HHJA 1RWKA 1UQUA 5BWNA 1ZVVA 1L5HB 2IYXA 3DCJA 1PZHA 3GR6A 3QFRA 1QRUA 3IQHX 3BCSA 4NECA 3RS2A 4BATA 7MDHA 3ICVA 4CIYA 5KNBH 1Y34E 3L7JA 5IC5A 4L73A 3WP1B 1FB5A 1QYIA 2EWWA 4ZOQI 4GI7A 1AX9A 2BJVA 3D9QX 2WIKA 4V2UA 4Z4IA 1BXGB 2BI4A 1S7CA 3EVBA 3OSUA 3CISA 4UC0A 2O8BB 3TS1A 2VEOA 2QP3A 1JEYA 5G0SA 2QQ0A 2QVLA 1BJKA 1W0JA 3EF3A 5L8VA 3EC7A 4RUKA 2EATA 4Z4CA 3CGGA 3N6XA 4KGXA 4QLAA 1P75A 2DULA 3ZW8A 2NPFA 2FLKA 3HV0A 4H1UA 2VQ3A 2DWUA 1S3IA 4CFYA 4A7PA 2FK8A 5JSHA 5KB3A 2WNIA 4A27A 4BKPA 2R8YA 1A9ZA 1IDN1 4NMMA 1HFJA 3K4HA 4BFWA 2ZK7A 4YMVA 3HLKA 4EHHA 1TYAE 5ECDA 4KDEA 1EFRD 3VPFA 1C9DB 3OUTA 4EKIA 2GDJA 3WLIA 2XBLA 1BE1A 1U5BB 4NXMB 2B1QA 2J0UB 2FSHA 3AHCA 3K1AB 4G0PA 4X3PA 5EINA 3G68A 4XW2A 5U4QA 4CL8A 4KACA 2XGSA 1E59A 1IG0A 2XX3A 3IAHA 3OMXA 5CX1A 1KOLA 3IOEA 1T0PA 5BW4A 3FNGA 2QI9F 3SEFA 3EXHA 3K2QA 2EW8A 1C3VA 4HR7A 1M1ZA 2GXUA 2RJNA 4ARUA 2C92A 1LW7A 4DGSA 3R23A 4XQEA 2H7XA 3G0GA 5TQ0A 4NWIA 1C0IA 1XCMA 4M7RA 3S4YA 4GZLA 5IAOA 2DBYA 4EB6B 1SIBE 4FBMA 1W44A 3H2SA 5CD1A 5D51S 4MUJA 5A9RA 1ZR2A 3EMVA 4YJHA 3OG9A 3KPWA 1DUIA 4G01B 9ABPA 1EUYA 5CXQA 4LJRA 1IY9A 4QFMA 1Y7IA 1YS6A 3OIFA 4XIJA 5U1PA 2Q5JA 1EX1A 1RIIA 2GHQA 4TVBA 5IXSA 2ZI5A 1CETA 1Y8QB 3DDWA 2ZRBA 3KQHA 2EERA 3TQIA 2EIHA 2OL4A 3ZNNA 4EY8A 2WQ7A 4F3TA 4Z9FA 2WV7A 3EIUA 3KG2A 2HDNB 1HYBA 1YAJA 4KYVA 5KVQA 3SNHA 3AP3A 3UK0A 2QPAA 2FDCA 3DT9A 2E9SA 2GNOA 1XWIA 2PANA 3ZDXB 4OI1A 2FWMX 2XY4A 1RYZA 1OXMA 3AFHA 4ARZB 4RK1A 2E4WA 1G8SA 3QNWA 1CVLA 1KI4A 3DUFB 4JL6A 4JYBA 2ZATA 1HLPA 5L53A 1SN7A 4M7PA 4GGMX 1HYEA 4Q05A 4GKVA 1Q7TA 3U4AA 2IXFA 3FVVA 3H11B 3ZD7A 4OGKA 1ZFNA 1RNLA 2GCPA 2NVUB 5HE8A 5D85A 3FIUA 3CC8A 4CM8B 1IVSA 3CMMA 4AWBA 2ZYGA 1S2NA 4NCBA 4LXYA 2ZR8A 4ENTA 3DO5A 3AM3A 3N58A 4Y2VA 2F59A 2NV6A 3H13A 4OTZA 5KIAA 2YX1A 4FFVA 1XTTA 1XCGB 1L4MA 1A04A 2H9IA 1E2LA 3V2IA 3AFIA 1YDWA 5BRJA 5GADl 3AIIA 3NHBA 5A3SA 4OGFA 2RHDA 4NU0A 4QPJC 4H6VA 1WCIA 2GZHA 4Z3OA 1AKWA 2ZTMA 3KZCA 4CQMB 1WDMA 1CLEA 2JEZA 3BIOA 2GTIA 4Y8VA 1R15A 5ALTA 2ZSBA 1KVTA 2Q2QA 4JENA 1STOA 3AVQA 3SI7A 3TI7A 2WZCA 2PS0A 3NT5A 4BGIA 2GPNA 4FYVA 4PPFA 5TXGA 3T3NA 5MGNA 1Q3TA 2Z09A 3U6BA 3A3PA 4IIJB 1AZTA 5BW6B 2BEUB 1PWXA 4MV7A 3VDQA 5E0KB 3PCRB 1BDJA 4FD2A 4G4IA 5LIPA 2C1EA 1JXOA 3QHPA 1ZIDA 2DPHA 1ZINA 1HPLA 1Z0FA 1G20A 2JB9A 1JB9A 3IUQA 4EG4A 5BSWA 4JT9A 3TRFA 1KY2A 1LV8A 3PFNA 1VP9A 3PICA 4KRYA 5J59A 1AQJA 3FJOA 2PKQO 2IYZA 1LNSA 1TZCA 3RU2A 4YCCA 5TDHA 3LPDA 4NAVA 2FUG1 2VNKA 3C7CB 5A4IS 1BVYF 3E4DA 2IPNA 4O5AA 3LT5A 5IM4A 4RM3A 3G6WA 1QVWA 3SICE 1M0TA 2CB0A 3RHFA 5GGYA 1T9AA 1KEWA 4F2PA 4Q7EA 2RGCA 2J4DA 4YCDA 5K45A 3P4XA 2QRKA 1E6LA 3VR5D 1ADJA 4AIIA 2P2SA 4DDMA 1H2ZA 5H0IA 1G2IA 2ODEA 3L5KA 2CVQA 1AOXA 1S2GA 2OZPA 3F8TA 4ES6A 3B9QA 3KSRA 2OD7A 1CQZA 4HB0A 4F8YA 3IA2A 4IFBA 1UEJA 3FVTA 5DP2A 2DR0A 1AGXA 1W0JD 3BUSA 3IBGA 4IW3B 3GQVA 2G06A 1IHPA 5HMMA 4CM4B 5JS6A 4DZTA 1RLIA 3OCUA 4P98A 2R68A 4UHDA 4JX8A 3VPDA 4ZAGA 1T3LA 3N2YA 4BVGA 2OYCA 4ZCTA 1VXRA 1OBHA 2JNWA 3VRHA 4CKBB 3EDCA 4KJZA 1A76A 4B2YA 2IEAA 3MS2A 2EJVA 3GI1A 4ZYYA 4GXQA 1ZGCA 4D42A 4MI9A 4B75A 4KQKA 3STUA 1JZTA 2QN6A 4LY9A 2DWPA 4PFQA 4HWRA 2QTBA 4GSKA 3JQAA 3GLFB 2OM6A 3NVDA 5C8YA 3SOZA 5JMWA 3IIKA 3SS7X 2W9XA 1T4DA 2DZDA 1B26A 3K2IA 1DAFA 1R74A 5DW0A 2C9ZA 4PZCA 4XVUA 4R31A 1NJ6A 2C3UA 2AQ8A 3FKJA 3GNLA 2DWCA 4BFUA 3T99A 1YZVA 3TSAA 3UXEA 4DQDA 2DH6A 2OHFA 4YP0A 1L5FA 3T3DA 4X54A 2Y1XA 3QF7A 3EJWA 3ZBUA 4WBNA 1B4DA 4MS4A 4BKUA 2J3EA 4LHXA 4H4EA 2O5RA 1UZUA 1GARA 1BWRA 2J07A 2ORVA 2RGUA 2Z4RA 1JAHA 1ACJA 4GX2A 2CVFA 1SZPA 1OYYA 1JLMA 2ZBUA 1L5ZA 1ZK4A 1GITA 1GL6A 2HRZA 4QODA 3DBVO 1R6AA 1R0BA 2L0XA 3QVKA 4XQCA 2YH2A 4DLLA 5JD5A 1RQLA 1KQ3A 1ESEA 2W6OA 1CEEA 3REQB 2WTEA 3GMSA 5BN3B 2WJYA 1MABB 2H7CA 3HVUA 4BGDA 2AWOA 5BV1A 1G41A 1M74A 5M34A 3R9XB 2IHTA 3K71B 2ODPA 1Y1QA 1D6SA 4ZVNA 3ZHCA 3KUXA 1GKYA 1MFPA 1OTHA 1GP2A 2ISCA 2Q9UA 1IEVA 2ZBPA 3IQFA 3K8YA 5FWXA 4LF8B 1P7YA 2Y76A 2PS1A 6PFKA 2FN7A 3L9XA 4H1VA 4KIUA 4QLBA 5BN4A 1T25A 5JAMA 2FR8A 4FIZA 2V96A 2RBKA 2BAGA 2XQFA 4YRAA 3KZ1E 4ZI5A 4X1KA 1E8MA 3QKIA 3IV7A 2EV9A 4IH9A 2Z43A 3SS9X 3S2GA 1P39A 3LLUA 2E4YA 3G88A 2WD7B 1Z2DA 1JBKA 3TL2A 5CFRA 1QS0A 1ES9A 2WM2A 3O74A 4TQGA 4FBLA 4ZEVA 2I4LA 4HFMA 3ZUPA 3SHTA 3V8EA 1H2AS 5ICGA 4RXTA 4KO3S 3QVVA 1C3OA 1MDFA 4US0R 4NMHA 1E1RD 4DJAA 4N5LA 2WTNA 5FV7A 4BO2A 3PITA 3ZBTA 4TL7A 3D2LA 3JALA 4MUFA 3RC3A 2BUBA 2QX7A 2QT9A 2RGAA 4GLOA 4KFRA 4CEJB 4HUTA 1AO3A 2OFWA 4IHAA 1U98A 5I9IA 4PV7A 3TJZA 3C5CA 2H7VA 2J31A 2ODWA 2YNMC 4GH5A 3AVWA 2KQUA 3RU9A 1EFUA 2MR5A 3ZWXA 3OFND 4GNKA 2Q4OA 1PHPA 3BX1A 2H00A 1E3TA 4RK4A 4MGKR 4YP5A 3THRA 1DI0A 3S40A 1OH8A 2YC4C 3ND8A 5CFNA 4BBJA 3CPSA 4M87A 2J4FA 2AUNA 4AF6A 2PVSA 2RARA 2O2GA 4OQDA 1NM5A 5C18A 1EDEA 1JHMA 1UXJA 1RM5A 5KPJA 5K1ZA 5BR8B 4Q7LA 4TSFD 1ZICA 5FOSA 4ZTBA 1C7QA 1RYYA 4FW9A 4TSFA 4JI0B 3D3KA 2ZE5A 3AY7A 2RSLA 3CSSA 4LUCA 2RAPA 1EDBA 1X8LA 4QUGA 4P8RA 3F0TA 1KAEA 2A14A 1P4JA 1FTNA 3D3QA 1IPHA 1NE7A 2C5AA 1ECGA 5HF6A 3DDUA 4BB0A 4HP8A 1EVJA 1ORRA 5F5XA 3TLZA 3ZZMA 2IF2A 3CTMA 1WJGA 3C7DB 4A5SA 4CIAA 2C77A 2BF7A 3EZGA 3C8ZA 4BKMA 4F9FA 3LOQA 4LG1A 1ODTC 4FT2A 1JECA 1PT7A 4IVRA 4ZAWA 4AF7A 4QXOA 1FUUA 1ORVA 2PRJA 1O94D 1DU4A 2ZUWA 1NWCA 1BFKA 1BO6A 3WAGA 4W9NC 3I5MA 3F4LA 3X2EA 5LA6A 5G0UA 3WIBA 3DC2A 2PEZA 1DC3A 3NUZA 2F43A 4C7BA 4EGCB 1MQ8B 3TX6A 5L40A 4L8VA 2Q1YA 3C1OA 4BZZA 4Y6PA 1AO0A 3GT4A 5C1OA 2ATIA 5AVYA 2ZCJA 5DOVA 2XJ9A 4WXRA 5AW5A 1LI7A 4B45A 2H0AA 3NWOA 1PR3A 3FFXA 1A7JA 1XRLA 2EGHA 4ENUA 4JEHA 1ZL0A 3F3MA 4QGFA 4RY0A 3C1TA 2Y1OA 5H70A 5ELXA 1NVKA 3UJBA 1EFKA 3CIFA 3SGLA 3CH5A 1FFHA 4TV9A 4KRFA 3T7RA 1URPA 4QA9A 2NU6A 1PEKE 3OOHA 1J21A 1ZOPA 1DAGA 4KLZA 5TEVA 1ZM9A 1Z68A 3GRVA 2VJQA 3JATA 3KAKA 2E89A 3HA3A 2CLLB 3TJMA 2AUMA 1T0JB 2Q8PA 4QO7A 1ZY2A 1WQ4A 1JKMA 4MHOA 1QHHA 2F43B 4DMMA 1T13A 1EYZA 2ZWVA 1XD9A 4Q9AA 4PQFA 2FPKA 4V0QA 1TK3A 1KQFA 1MOPA 3ILHA 1KXJA 1Z13A 2P5TB 1YVUA 3GFVA 3C3EA 4OP3A 5F12A 1CTQA 5DH9A 1I5EA 1VDZA 4YH1A 2KB0A 4A2CA 5JZVA 2DFNA 3DJFA 1QRDA 2AQIA 2GA9A 4I6GA 4YGYA 3EEYA 4BNVA 1U2EA 3ZNPA 2UVPA 2P9HA 1OWPA 2G6TA 4QFBA 3VNBA 2VL7A 1B16A 2GOYA 2JLZA 2JVKA 4R9NA 5BOSA 4GWGA 2BM9A 1S2DA 2R96A 2XYGA 4HFJA 1V7PC 1ILEA 3D64A 3K09C 4LC1A 1T2EA 4LWPA 5T4HA 3I92A 1YR1A 4TT3A 2WSYB 5TT1A 3SK0A 3RSGA 4RIFA 4RIIA 2C7BA 1TMYA 2Z0MA 1S2LA 3A05A 1KA9H 2HIGA 3S5JA 1LBEA 1NM5C 2QJTA 4HATA 4MKXA 3NI2A 3VKFA 4PN7A 4ZCMA 4Y0VA 4BFXA 4H77A 4JODA 4K0RA 1GNTA 3SYTA 4NCJA 1A8SA 5BVGA 2O8BA 3EASA 3QLTA 2FNAA 2QVGA 4TL6A 4CKWA 4XUGB 1X8JA 3O4JA 1M3SA 4QEDA 4OHZA 3KNZA 2RK6A 1MX5A 2IELA 4FYXA 3BTVA 4W5HA 2HCJB 3OZRA 3UV3A 3CKLA 3TN7A 5JLJA 4DF3A 2BM8A 5ITZA 5LOVF 4HAOA 1V4VA 5BYJA 1LCIA 1XAHA 3OO0A 2HGSA 3R3VA 4RKQA 2EX1A 5HK8A 1M34B 3KVRA 1TM2A 2RBGA 3DOEA 5DBIA 4HLUC 4KVFA 3TSWA 2E4ZA 2BI7A 4MEAA 3QIVA 3WS7A 5A3VA 1UJ2A 1TXGA 2EFGA 2B7LA 2H6EA 5FPHA 4L4ZA 1GQQA 2P62A 3CLKA 2XHEA 3A6LA 3GW8A 4N7RA 1U8EA 1KVQA 1WDTA 1JG1A 4N5MA 2GN0A 5AW0A 4GDMA 2FSFA 3C7AA 1AG9A 1AK1A 2QAGB 4JQOA 3PNBA 5ALDA 1G5QA 1R6UA 2PUTA 2HF8A 3TLCA 2VKTA 2PX2A 3HCEA 4B7XA 4NTZA 1HXHA 2XIQA 3DF9A 1XTQA 4MWGA 3V3KA 3ZDRA 4AZSA 4MHTA 3I0NA 4HDMA 5JCJA 5IH3A 3PT5A 3AIMA 2WKWA 2AN4A 2FOLA 3E9CA 2VPXA 5C34B 2Z3WA 4XVCA 1EHCA 3DMRA 1W5EA 4CKYA 3RVJA 2BZ1A 1E6EA 1V8FA 3GJSA 2B82A 2E48A 2QU8A 3AP1A 2NU8A 5KZMB 2LD4A 4NC9A 3A1NA 4OAPA 1L1EA 1PVDA 3L1UA 1RQ2A 1H94A 1XCLA 3QHQA 2Q5IA 3SFZA 2VAWA 1QZZA 1RRCA 5IT0A 4V0SA 1W4CA 2PWPA 3FPBA 1SBIA 2XZDA 4ZRDA 3MJDA 1DZIA 4NCIA 3SX4A 1T5SA 3WLAA 1WXIA 2QGNA 5T4FA 3ZXYA 2NPOA 3ZJ4A 5AM2A 1FVOA 2UYOA 3RAEC 4XWOA 4WA7A 1TEZA 2Z6UA 1RTTA 3H0EA 3BBPA 5IG2A 2WF7A 5EESA 4ILEA 3CUTA 2N75A 3B2EA 4IJVA 4HX9A 1KR2A 3ASYA 4F6RB 3WZMA 1HL3A 2NG1A 2Q50A 3D7MA 2DGDA 3QKTA 3EWIA 1SPBS 4I7EA 1QTIA 3KEMA 2X0FA 3AEQA 4N47A 5JI2E 1VCOA 2PMWB 1IC6A 4KXYA 3MUNA 1RCUA 1SXGA 1QAQA 1ZYUA 2ZDGA 5I7WA 2W2MA 1OB5A 4GFDA 1OXUA 5FUWA 2BFBB 3MELA 5E4JA 2GN2A 4X00A 1T3TA 2WR8A 5ESWA 2AD1A 1XTVA 2OESA 3DMFA 3ZVNA 2GYYA 2IEIA 4QRHA 2CE7A 3IP9A 1RAHA 1V1RB 3V2GA 3KZXA 1GR1A 2LVBA 4KWEA 3JQAB 4RMGA 1G291 3GLFA 2A1UA 1K3TA 4C7JA 3EC2A 2APJA 3JY6A 3AUAA 2WOOA 3L43A 3ID6C 1ZC4A 4NSNA 5HKAA 2BV3A 2N46A 1JEQB 4C4SA 2P40A 1L5KA 4DKXA 3GARA 2KLHA 3X44A 3SSNA 2XRZA 1DRVA 3NBKA 4HGYA 1EFCA 1GGFA 1OAOC 2EBWA 3O38A 4LBZA 3AEQB 3NOOA 4QQKA 4C1BA 3HVRA 1EUQA 1Q0SA 3DL2A 4RCVA 1Z8DA 4BC0A 4KHPB 2QMUA 5JPIA 3A06A 4AG5A 4BVEA 1HNZB 4ZOLA 5GWXA 4XGQA 1V37A 2X77A 4ZRMA 2CJFA 1T3HA 4QXQA 4Y2RA 3FOFC 3FGOA 2NVOA 2CNWD 1PJ2A 1E1MA 1LK5A 1QYXA 4WFKA 4CMGA 1A2KC 1BW9B 1YGPA 2FPPB 2HN9A 5LM3A 1QIIA 3UY4A 4XB6B 1PD1A 1YI0A 3T3EA 1DQSA 2OORC 2ZJ4A 3MRVA 3DV0A 3ZG6A 5BWLA 5EJ6A 4QAJA 2VHWA 3QELA 1ISGA 2QUIA 1HDXA 3C8DA 1XD2A 2IS2A 1X7GA 2XF8A 3H1PA 3LVQE 5E4FA 5AW4A 3R0IA 4MW5A 1J0DA 1E4EB 3CN7A 2A3NA 3DOFA 4A0SA 1OI3A 2Z9DA 4OD0A 5AVOA 3BMNB 3OQIB 3OVMA 3C70A 2PV7A 5HUJA 1NW4A 4DG9A 1ZJWA 1EQAA 1FNDA 1I0ZA 3MPUA 1VE5A 2CLEB 3WBFA 1JW9B 1US8B 2DLCX 3EY9A 2L18A 3AUXA 4IUDS 1S2IA 3FLEA 2QVYX 3TTTA 3SXUB 1YRYE 3BQNB 3R9WA 2ZAYA 4OK5A 4YIHA 3EPRA 4Q12A 3T12A 3E1GA 2IOYA 2JFFA 3DLTA 3N86A 5FBKA 3RC8A 4XJSA 1KZHA 1Z4PX 2XTJA 4DLSA 5KOYA 3VU9B 1WZ2A 2UZ1A 3SQXA 5DGCA 2XI4A 4NYJQ 3IPLA 1CFZA 2ZIXA 2I9KA 1UC9A 2GJ8A 1BMFA 3V55A 2ZI3A 1ORTA 2HK6A 2JHAA 2JFUA 1TW2A 1JHQA 2YRWA 3FYCA 4M1OA 1LWNA 1PW7A 2HWYA 4AJ9A 1W49A 4M83A 3VO8A 3WQSB 2FW6A 2V45A 4BX3A 1JHYA 5TB5A 1NQWA 4O0MA 3RTBA 1YJCA 2PJZA 3D4NA 4JC8A 2PH3A 5CLHA 5EP3A 3AOEA 1SVWA 2P9YA 3OOYA 3UAGA 1IQ0A 1W5AA 2OBBA 3O4VA 4HDRA 4AULA 3KSZO 1U1EA 221PA 2P1RA 2R8EA 3JQ8B 2ZSJA 4DIBA 4KOAA 4WJZA 3ZWMA 1NV8A 3FZEA 4C1NA 4DS3A 2I2AA 2W6CX 5KX5A 2A0FA 2JFBA 1ZSVA 4QTZA 4UBNA 2FF5A 4DCSA 4A15A 4PGAA 1X9HA 2OXTA 4ZHSA 4G9GA 5G53C 2V4ZA 4EHAA 1TCAA 4DLBA 2BDTA 4D9NA 1HT2E 1XXHB 4D5GA 4YB8A 5DFAA 4G1BA 5DULA 4ZVSA 2VG8A 5SYMA 4CLOB 5JVDA 3DZJA 2YYSA 3DTVB 4DJ5X 3HCWA 2OLKA 4IEIA 4S05A 3NP7A 3TQQA 4LHVA 2A0UA 2IS1A 3TXXA 4MQUA 5HDQA 5AJYA 2I2XB 1IN1A 3HB9A 1E89A 2WFMA 1OWNA 4NZMA 3QOFA 4AQYB 4OHCA 3JATB 4QICA 4OGWA 1KZ1A 1RKXA 2Q28A 4MGHA 2R1VB 4Q4LA 5B58C 4I5EA 3T7CA 5IX8A 4AJHA 4PG5A 3TWOA 4CIBA 1UANA 3H05A 3O92A 1WQ1R 2EHDA 1XVTA 1JIKA 2B6NA 5DHFA 1ZBDA 3ELBA 4PGFA 4K03A 5FTMA 4EY6A 4WZAA 4E31A 4I8XA 4US2R 2OWEA 3Q8LA 1TB4A 1Z38A 4MPTA 4X8LA 3ZE9A 5CCBA 3AJ9A 3AR4A 5K09A 1XGKA 3EIQA 4CCSA 1Z29A 2G4VA 1A72A 2OLJA 4QT0A 2HSEA 3KJNA 3RO7A 1CKEA 4J49A 5FO0A 3OM1A 4CCYA 3TG8A 1RJGA 2PZGA 3V9AA 1GQYA 1TDJA 4IUBS 3PF9A 3Q9NA 4NRDA 5AVVA 2DBZA 1P7ZA 2WVGA 1R64A 2OOKA 3OKAA 4YA6A 4YDSA 3K32A 5ALKA 3B5JA 4XDGA 3L4EA 1QHIA 3MM4A 3SLRA 1IZZA 3PDIB 1U0EA 3B13B 4GL4A 3Q5DA 4A8JA 1DHTA 1AKNA 3Q0IA 3K20A 3L82B 2D1SA 1P81A 4OH1A 2A84A 4P3YA 1JEDA 2CD9A 5AOCA 2FP4A 4QRDA 4UHCA 2I99A 2OXCA 3FDIA 3FTCA 3WLHA 5AFSA 3A7EA 1SU7A 1ZAYA 1ECJA 1YRWA 4EKGA 5LA6B 4S35A 2ES4A 4K0KB 1VJDA 3MCTA 4JUCA 3AP2A 1U3UA 1D8AA 2EEPA 2WTBA 1YB5A 4HBZA 2ZQZA 1NJ2A 3ABIA 4M1MA 2WWXA 1YKGA 4QPDA 4C6TA 4CTMA 4DWOA 5LMUB 2ZANA 3CUSA 4K87A 3PS9A 2ORWA 2DB3A 2RH5A 1CEYA 2Q41A 2ID7A 4DUYB 3W2GA 1AS2A 1RW4A 1ZRMA 3VI3B 1UQRA 1II0A 4IH1A 4ZYXA 5BUCA 1MV5A 4D9GA 1T5LA 2UVDA 4B34A 1XLWA 2JIPA 1F5SA 4JKYA 3H1BA 1T4GA 1OPXA 4ROSA 5ADWA 5B7NA 3I39X 5BQXA 5C8YF 4JBHA 3DVAB 3LOPA 4M0DA 4OGLA 1LNZA 3R8CA 1HFEL 5ESDA 3LXMA 4P81A 4ZXPA 1E20A 4HVLA 2VA9A 3OPVA 1Z26A 3B51X 1NVGA 2CHEA 2W90A 3FPFA 3WLNA 4C4PA 3A4MA 1YR7A 2QX9A 5AJWA 1PN3A 4YUZA 5I8PA 1C29B 2Y8EA 1SUEA 1HY3A 4KUEA 4ENRA 4MYCA 1XDSA 4DLXA 2I66A 4N5DA 4MUHA 5KNCD 3VA7A 2A5LA 4GEGA 4ASUA 3GGJA 4A8HA 1MOZA 1UM9A 3G89A 1UKZA 3UB4A 4ZU1X 1JQBA 3BH7A 4RPLA 1DP4A 2BHRA 3ZHTA 4Z9YA 3EFHA 3LXRA 4XYEA 2W6ZA 4D9FA 2B4AA 2GN1A 3LDAA 3TE7A 5JCJD 4LTNA 4MO9A 1R9GA 2DTEA 2Y1CA 2G63A 1Z4NA 2PGJA 2ZWMA 5FWAA 1BX3A 2IXTA 3B6MA 5JC8A 3KTAB 3TDKA 4TMZA 1K68A 5FOVA 4URXR 1DEOA 4BWGA 2R1TA 2UXCB 4UUMA 2VJPA 3U4QB 1KMHA 4RQAA 2ZJ5A 2IUTA 1Q2XA 5IMSA 1VHDA 4QOSA 5TPZD 821PA 1YZGA 2ZYTX 1C8LA 1EUZA 1Y1LA 5K3FB 3K0BA 2I6XA 3PFIA 4P3XA 2H4JA 1T91A 2BDEA 1UP7A 2FWPA 3NALA 5EHGA 3DE1X 4CPDA 1L4EA 1YZTA 4IDAA 3NU1A 4IG4A 2WYIA 4HJRA 1DWQA 4NONA 2QL7A 1SHTX 2CNLA 2UZ1B 5ICEA 5L3QA 1DBQA 1M2FA 1MZVA 3VHQA 5FUVA 4MZDA 1D9XA 4K9SA 2V0CA 4XR9A 4ZVPA 5LYJF 4M9SA 3WLQA 1MN6A 3UV7A 4QQRA 5I8ZA 1DRJA 2ZJ6A 2P0EA 2R6GA 1NFRA 3JASB 3PF8A 4IGAA 4IIBA 4PBSA 3W3ZB 3L41A 4FMCB 1W85A 4WZBE 4F1JA 2IUSA 5C4MA 4HCJA 4LVCA 1H4SA 1JN0A 1MJFA 2XECA 3WWEA 3IEMA 2PUAA 3C4VA 4Z5XA 1EM8B 4J76A 1E9AA 1MMFB 1DRKA 1E2EA 4ZPJA 4O2BA 4ZQBA 3KAJA 1E5TA 1E7RA 3VKUA 3WQRA 4KTVE 2Z8YA 2R1ZA 3BIWA 1DKQA 1JR4A 3MIIA 1KH1A 2E49A 3O2NA 4M0KA 5NULA 4ZI7B 2CL7X 3FRIA 5JAHA 3OQNA 1VHLA 2F4VB 3TRHA 3GOQA 5IP5A 1ISJA 3NNSA 4P5EA 3DE7X 3WGNA 2Z1NA 4EF6A 3LXXA 1H2XA 1UPBA 2OE2A 2BKVA 3BERA 3IV6A 3RBAA 3P0JA 2AF4C 3G02A 1KXZA 3IT2A 2ZSUA 4RVNA 5E2AA 3RVBA 2RJOA 5A02A 1P4GA 4WLUA 3E5HA 4XGIA 3UNXA 2FSIA 2XE7A 3NDPA 1B23P 1XEXB 1XZIA 5GJWC 5TQJA 3ZHSA 3D8RA 3RFTA 2IGTA 1B6GA 2A9KA 1N2BA 4R1OA 4FEYA 1N1GA 3AXTA 1NKVA 4IGFA 2EVWX 3MJ4A 1DTWA 1DCTA 1NYQA 2C54A 4NOJA 3UWPA 1NBWB 3PTAA 2AH5A 3NVMB 5IEJA 3GJ7A 1U7DA 2CL0X 4LYJA 4BNDB 2QRPA 2WUEA 3IUEA 4HGZA 4R9RA 4B3DA 4ICIA 4JXZA 3AYXB 2VJNA 2D5BA 2BZGA 3OQ6A 4EI9A 4V2IA 2CCKA 4XWKA 1GUAA 5HFNA 3EPHA 1J49A 5EMJA 4DJEC 3KB1A 3TCKA 1YR9A 5REQA 2H0QA 3GJZA 1PWZA 1E64A 3PLRA 4HGNA 4LVUA 3UMBA 1P73A 2IHBA 2WWYA 1UQTA 2CDRA 3ETDA 3ORHA 1NG9A 2W93A 3ZGXA 1QPBA 1IRIA 1RVDA 1ISSA 2H2GA 2WJAA 5JDIA 5SZKB 3B3AA 1U90A 3Q2KA 1YBFA 2F7SA 2C95A 1G8HA 3SSOA 5JCXA 3S2FA 3QMWA 4UVGA 3SC4A 3JWGA 1DTWB 3PNYA 3WRXA 3ZD9A 5JTUA 4TMWA 5LYJB 1JV2B 3VZDA 4MVYA 4L7QA 4U6NA 1ZW6A 4C6HA 2VDWA 4PNPA 1QH0A 1SD1A 4X64B 1QIGA 5F64A 3QUQA 4HDSA 5FORA 2JAWA 4AJJA 5I7UA 3JPWA 1DARA 1NR7A 4YV0A 3UEOA 2UUBB 1NXPA 1FF9A 2HTEA 5FHQA 1ONBA 4DEVA 4Y9UA 3AFNA 1U0RA 2OCDA 1P0PA 1CXZA 5FBWB 4ZZIA 1KTVA 4L4RA 4RL4A 5HNKA 3P32A 1U0JA 4ZU6X 2BBOA 3GRZA 3IKVA 3PTLA 3F6EX 4BZWA 4N7MA 1LXCA 1V9SA 2HA6A 2YICA 4BLUA 2DUWA 4M9ZA 4ERXA 4ECEA 3CWQA 1B8OA 1T2DA 2EJBA 5JCZA 4O4IB 4YFYA 4JMLA 2FN8A 2O2HA 4KE7A 4M3NA 3DKVA 4MWZA 2JHPA 1YL6A 2JRCA 2XA9A 3SWWA 3CZPA 2BTQB 3UOWA 3BMOB 4NEQA 1NW3A 1QYDA 1ZMOA 2V0NA 4AYWA 5IU6A 4MI3A 2WT4A 1AKQA 4H59A 1MZPA 4DG5A 3D1LA 4PC2A 5AKIA 3S70A 1XRMA 2ECQA 2MIIA 2DWOA 1ORIA 2QG4A 2X4DA 3AKEA 4O4JB 4LQDA 5EFOA 2Q7XA 1L8AA 1WLYA 4M8LA 1VIMA 2WQZA 4WZBB 1N4AA 4PRKA 3VYRB 1VQ1A 1T1IA 1HQYE 1OLXB 2NU9A 3D81A 5B30A 5MFPA 3T5TA 1JDJA 3CA8A 3AETB 1II8B 2JI9A 3K5HA 5SICE 3A2KA 3EGDB 3HXLA 1NN0A 2RGRA 3VSCA 1NNEA 2F00A 3MD9A 3VX4A 3AWDA 4MGYR 7REQA 3EXAA 4UMVA 1JA0A 4HMQA 1CYDA 1V4BA 3H2ZA 3ER8A 3WMXA 1WLSA 2QS9A 1AUXA 4P54A 2I2CA 3MCWA 4LJ9A 4MV6A 4DCJA 3FOEC 2D0OB 1EDZA 1K7CA 3RK4A 2AG5A 3M5PA 3WLEA 2IYOA 3VFDA 4CIWA 1TEHA 2UUAB 4KEAA 4LOIA 4QUAA 2X4GA 1Y3HA 2VJOA 4KI0A 3PGVA 1JJVA 1Z35A 1FMLA 4PPYA 1IVNA 4WHMA 5EKSA 1P2BA 4BTEA 4Z7NB 2G5CA 5A1JA 1Y5NA 3F67A 3LT1A 5AK6A 3F8SA 2WU4A 4G5XA 3R6TA 4PPQA 5ALIA 4RTNA 3L8MA 1GG8A 3FNHA 3HBFA 3KLBA 2C2YA 2J33A 4PY2A 2B1IA 1MJHA 4YCNA 3HWSA 1H2RS 5KWIA 1GPWB 2BFMA 1AVTA 6LDHA 1J6UA 1KYTA 1EUDB 2XW6A 2I2FA 3RQIA 1FLNA 4EFMA 2FAXA 1XWFA 2WMNB 5EZ5A 1HYGA 1KY3A 3LX4A 1UXKA 2JLWA 4EDHA 1Z4LA 3DWGA 3N75A 4ZANA 1YBHA 1JRLA 1J42A 3DOUA 1IJEA 1ONOA 3NHFA 4Y1EA 1T43A 1JLRA 2VDUE 5HMLA 4CKEA 8OHMA 2F64A 3GEMA 1R3DA 4AURA 1IMOA 3PXBA 1SCBA 1FQWA 2W43A 4P4TA 2UZ3A 3E2PA 2B30A 2HZ7A 4ER6A 1L7PA 1FP7A 2PLRA 5IWCA 4HEQA 3F6PA 2H2IA 3P0EA 4X8OA 3ANYB 5DLDA 5CW1A 5TGZA 5JDCC 3MGBA 4NZOA 5A5DA 2B8EA 3K4QA 3QI7A 1WAMA 5AR1A 1HNNA 4LKRA 3W6UA 2NSHA 4XYGA 2XHZA 1L3IA 3SMVA 1M1YA 3TPCA 2XOEA 3LHIA 1I32A 3ZU3A 3ZZ0A 3LBHA 5F73A 2GPSA 2HYDA 4LHSA 2B4YA 1ZNQO 1RXCA 2R7NA 3AF5A 1LLDA 1OGYA 1SFRA 1W34A 1N2CB 3CT4A 4II2A 4EFLA 2JLXA 1Y9ZA 1A8PA 3I2KA 1D2HA 1NW8A 5KREA 4O8ZA 4R2XA 1MIOA 3TRDA 4ZVOA 4AMGA 1E3LA 5GJVC 5EHNA 3BMCB 2AA3A 2OO5A 4QUBA 4G86A 4R9UC 2QQFA 3L7OA 4WZ6A 4R1LA 1F4VA 2ABWA 4R41A 3WRWA 1O8CA 3PGA1 3ZK9A 4EPVA 1QPGA 2XGJA 3UUEA 1NRWA 2C57A 5AQ1A 5C35A 3CWCA 3P52A 3EQ7A 3U3MA 3G8AA 5E7IA 2MHCA 5F76A 4DYDA 2JK1A 4MRPA 4GP7A 3OPYA 1VRWA 4HNTA 3UMMA 2XTMA 3V7YA 2EEZA 4B7AA 4EHLA 1XQ6A 2PS3A 3IJEB 3K92A 4F4CA 3QWIA 5G2OA 2JD2A 3EEOA 1GY8A 2AE2A 2XMGA 1JT2A 2DM6A 4UUQA 4PQEA 4XDHA 1PNTA 4FX5A 2QTAA 3JZFA 4D45A 1A1VA 3W5UA 4EW3A 5AIBA 1T4CA 1AKEA 4O1MA 2JLCA 2ZLBA 2HXYA 2XSZD 1N5MA 4I1IA 4QIHA 1KK2A 4AB1A 2WUFA 1W96A 2DVMA 1UJMA 1O0BA 4C06A 4X7RA 4HJXA 4DLWA 1A9QA 4LPSA 4BVKA 2OFPA 3O8DA 5F4BA 3LPNA 4A1OA 3W6PA 3ADBA 1Q1AA 5IXYA 4Q03A 4RMIA 1GUYA 1VMIA 2WFLA 3WK6A 2ZRHA 2KJQA 3OM8A 3HU5A 3NAGA 2QPLA