1G6HA

Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
254
structure length
254
Chain Sequence
TMEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEIYIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANSPORT ATP-BINDIN
publication title Crystal structures of the MJ1267 ATP binding cassette reveal an induced-fit effect at the ATPase active site of an ABC transporter.
pubmed doi rcsb
molecule tags Transport protein
total genus 92
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g6hA00
4Q03A 1HQYE 1E9DA 1OHHD 2D4HA 5E7MA 3GFPA 4UXHA 3TR5A 2NOAA 2MMGA 3MAAC 3MWLA 4NCIA 3RDPA 2MSDB 5JRZA 1Q12A 1Q3HA 2ODWA 3QOFA 4GP7A 2H92A 1I2DA 4BLRA 3V9PA 4HAZA 4G5OA 2FN4A 1XDBA 1YZKA 3MWJA 2VYFA 5K8UA 3P32A 4RZUA 3OIYA 4BFXA 3K8YA 5EP2A 2FSGA 1OKKA 4NHOA 5E95A 4PQYA 4ZIRA 1KY2A 3WNBA 2XB4A 1YR8A 3MWYW 4RD3A 4Q7MB 3W3ZB 1XX6A 2B7BA 3GFTA 4FINA 4BZQA 1IN5A 2ZRAA 2CEAA 1VHTA 4G0NA 1RRPA 3I3SR 4ILEA 4E5UA 4JLOA 3TVTA 5KSYA 2EU8A 2RGDA 2WKPA 1M1YE 5FUYA 5AJWA 4HZUB 4V0LA 1E2JA 4Z1MA 2XX3A 1ZM7A 4RKFA 4UJ3A 4CW7A 3T1VA 2VH5R 2ZR7A 2Z4RA 2IS4A 2WM9B 4JLNA 2REXB 1QHNA 4RVCA 1XU4A 2O8BB 3JZMA 2ZUCA 1DG1G 2WSSD 3OIUA 4AD8A 4LRWA 1HQCA 4LJ5A 5H70A 4DT1B 2MSEB 3IBGA 3W6NA 5HTKA 1G4UR 1UKVY 1Q1ZA 2JLRA 2HXYA 2ZYUX 3P4XA 4Q5IA 4EAQA 1CR1A 1Z06A 1XZPA 4MRPA 4M1SA 1GSIA 5H68A 4K46A 4A6PA 2YC4C 1N6PA 1RRGA 3NHAA 4Y0VA 2W00A 2ZU6A 2IYSA 1TU4A 4G3XA 4P32A 3WP1B 5AJXA 2A7QA 4WZBE 1F2TA 1CIPA 2GILA 1CR2A 3I73A 3VR4A 2YINC 1FTSA 4XVRA 1WF3A 4MKFA 2O0JA 1II8A 3KDSE 3NEYA 4A0FA 3LFUA 2C2HA 1FTNA 1F5NA 4FMBB 4BASA 1NKSA 2NO1A 3TAUA 1IXZA 1Z0DA 3X1WA 4JYBA 1R0WA 4KFTA 1MOZA 1Q0UA 2GAAA 1YR9A 3AUXA 2ZJ5A 2OESA 3QVVA 4KJZA 4Q4JA 1QG2A 2AKAB 1KI6B 3VQTA 3HU1A 2ZU0C 4M1WA 2O8EA 1YZQA 2ZJ2A 1F2UA 5FOXA 1L7VC 2BCGY 1N6RA 1XTQA 2W58A 1HV8A 5P21A 4PC2A 4V0ME 5FL3A 1FZQA 1ZD9A 3IDQA 4NPHA 3WYGA 3IO3A 2QUZA 1T3HA 3QNUA 5JSZB 2XB2A 3X1DA 3IUYA 4KBFA 5EP4A 2WKQA 4NU0A 2GNOA 3O8DA 2FFHA 1G16A 2OSBA 1GAJA 3EZ2A 3RS4A 1ZNWA 1Z8FA 2ZJZA 4I1UA 1CEEA 3CZPA 5TDHA 1OH7A 2XJ4A 4GZLA 2G77B 1PLLA 1SHZA 1UKZA 4HDQB 2G3YA 4K8OA 3AF3A 4YMWA 4OI1A 4CGZA 4OK6A 1TQDA 1KDTA 4OQMA 4B3FX 2QT0A 1SVSA 2GCOB 3THWA 2EFHB 1E9CA 2XOKA 3TSWA 3ZYCA 3ZZTA 2GHIA 4YDSA 4DEYA 1E9SA 2QSZA 2QORA 2WOJA 3B78A 5JBQA 3KUCA 4KSCA 1HT1E 3K53A 2YHSA 4A0HA 1FFHA 2EVWX 4DRZA 4DLRA 1VIAA 1G7CA 2EW1A 5FUWA 2BDTA 5AJYA 3AH8A 1Z29A 3R20A 2GZAA 5FI1B 1GKIA 5FUVA 1U99A 4GMXA 4POAA 4EKDA 2MSCB 5TVKA 2VTKA 521PA 1W48A 4NZYA 1CRQA 4AG6A 4B2LA 2ZRPA 1A4RA 1JB1A 4V02A 4QGFA 5IDVA 2V55B 3MJRA 1FOEB 1SXJE 1XBTA 3F3YA 3KL4A 5FUXA 4AYTA 3NTUA 4P4TA 1T0JB 3SFZA 3U6BA 4Q48A 4QHTA 4CEIB 1ETUA 4R2IA 4B6FA 3QIAA 3ZLJA 5EE3A 2OXRA 3OIWA 1G21E 3K0FB 4M4SA 5FBWB 4RFSA 4DCUA 1Y63A 1ZD8A 3NC1C 3KFVA 2NO7A 3GFOA 4LI0A 2QRZA 2ZYWX 2ZRMA 4GRAA 1OH5A 5AK0A 2JLZA 4TMKA 1XTRA 4LGMA 1CR0A 3GLHE 2HYDA 2B7CA 1TF7A 2FJUA 5BXQC 5L3RA 2FA9A 2BMFA 4RD1A 3TH5A 2HLDA 4W7SA 1VYVA 1G18A 3LX5A 1G3IA 2D2EA 3GCGA 3W34A 2GKSA 1GRNA 4XSHA 1Z6XA 2OE2A 4KCGA 5FTKA 4NCJA 4RCZA 4KFSA 3AM1A 3QF4B 5FL7D 1MV5A 1Z0JA 3M0EA 1EFHA 2OBNA 1K5GA 4NONA 1OXUA 621PA 4Q1FA 1P4SA 2CXXA 3RSOA 2GJAA 2VP0A 4DLTA 1TL7C 3ECCA 1UBEA 3QG1A 1HY3A 4N1AA 4BFSA 1CR4A 3CF2A 2JATA 3EIHA 2HUPA 3IPYA 4W5WA 2CNWD 3SDZA 5KDOA 3KQHA 3EXAA 1MO3A 4WXRA 4EPWA 5J4HA 2QU8A 1E79D 2CBZA 4X8LA 1NY6A 2NO6A 3OESA 2AKYA 5AUQA 2QAGC 4BFZA 3ZVRA 3N2IA 5SZIA 3EZ9A 1OFUX 4OQFA 4D0LB 3WHKA 3QKSB 2G1JA 1OT3A 2Q9BA 4MKIA 2WHXA 1FQKA 3GLGE 2ZIAA 1R10A 1YZLA 1D5CA 1I4LD 1JR3D 1E3MA 4XWOA 1GP2A 4OHWA 5SZHB 2NGRA 3U4QB 1GL9B 2IYZA 3EA5A 3K9NA 3PR1A 3UPUA 4HB0A 3RS5A 4KXFB 4Q66C 4FXPA 1P9WA 4KYUA 4TLEA 3VTKA 2XZPA 4UJ5A 1G6OA 2W6IA 2ZJOA 5KSPA 3VR1A 2VBCA 1A2KC 2ZJ8A 3ZGXA 4K81B 3THYB 3MFYA 3KJGA 2JLQA 2QP4A 2F43A 1N6IA 5LDDC 5EP1A 4TZ6A 4JVSB 1ZVQA 4C0SA 2JJ2D 1N6KA 4NYJQ 4CEHB 5CLQA 1GL6A 1T3SA 4NMMA 4JVLA 4C2UA 2QPAA 2HF8A 1ZC3A 3AVQA 1LV7A 1RW4A 4XH9B 4URYR 3RC3A 1TAGA 3UKDA 5IK2A 1N5LA 4B2IA 4XWAA 5DHFA 2FU5C 2BKEA 4V0MA 3P4YA 1N0VC 1E2EA 3B1WA 5JECA 2VSXA 3ADDA 2N46A 4Q4HA 2VP4A 1TUEA 2CK3D 3ZD6A 1TEXA 4M21A 1N25A 2E87A 1AKEA 2R6CA 2RHDA 3OHMA 3BERA 1EGAA 2XEXA 2OAQ1 5CDFE 4HUQB 1R0XA 1NL3A 4TTQA 4JSTA 1II0A 5EUQB 1H8EA 4DLVA 1CJUC 5FR2A 3CRMA 2WV9A 2IYRA 2CHGA 4DCTA 4Q1DA 4RD4A 2RGBA 1SULA 5EXSA 5JEEA 4J0QA 2AWNA 1G20E 1VCNA 3C16C 3CBQA 4PC7A 4CRWB 3KKMA 1ELOA 3OEHA 2BJWA 1S1MA 3TJZA 1RPZA 4GL2A 1MRSA 4PAMA 3SJAA 4DCVA 4EJSB 3GJ6A 3K70B 5A0FA 2GK6A 5LBIA 2B8TA 3A37A 1VG8A 5FOSA 3LVRE 3U3KA 4B73A 3AP2A 5GJBA 1U0HC 5JLJA 1E4VA 3CX6A 1JPNA 4E07A 5FFMA 4HB2A 4ZDJA 3KKOA 1U8ZA 2P6UA 2NPIA 3CR8A 3PQCA 2CL7X 3AVUA 2ZJYA 1VG0B 5DH9A 2IWHA 2K5UA 3O8RA 4LJAA 4KSBA 4KFRA 1MABB 1IOZA 4M1KA 2W0MA 1SXJA 2R62A 1UBGA 2RCNA 4M22A 1AM4D 4JKIA 4RY2A 4D2IA 4OI4A 1OH8A 1X8KA 4E03A 4D80A 3BOSA 3SFVA 5KTYA 4D4LA 2OCYC 4B3DA 1EFRA 2BCJQ 4A92A 2OEPA 3AKDA 2IBMA 2TMKA 4BPBA 3SBEA 4AC9A 3OAAA 2ZRJA 1GILA 4M9SA 4TT3D 2H1LA 1IY1A 2F7SA 1W36C 4CEJB 1E2GA 3A1UA 4LYJA 2JIZA 3OFND 2QMUA 2A3RA 5DE3A 4BGDA 4OBEA 2LWIA 3CIOA 1GL7A 2CHVA 1J70A 3B9PA 2JLWA 4NDZA 2YOHA 2VHTA 3BORA 2IF0A 4AURA 4FMCB 4GOKA 4EIWA 3GLHA 3L43A 3TNFA 1RRCA 2ZAOA 3NIBA 3ZZUA 1R6BX 3F0TA 4OHZA 5JWOA 1SQ5A 2OHFA 3FE2A 4IRUB 3T15A 1GFIA 2OBMA 1OPXA 3K09A 2F9LA 1FP6A 3W8RA 4EPRA 1EFUA 1E9AA 2QY9A 2IF2A 2ZRKA 4NYMR 3TUIC 5BN4A 3FTQA 1NKTA 3T1TA 3PXGA 1JNYA 2FFBA 5L3SA 2ZS7A 2JDIA 2XXAB 3U3OA 3CB4A 3LQQA 4YDHB 1KK3A 4R98A 4US2R 1G4AE 5HKKA 4L5BA 3UIEA 4O3MA 1W44A 2BWJA 4OHYA 4TL9A 3CRVA 3I8XA 1ZUNB 2VRWA 3ETLA 4RKEA 4OHXA 2R8RA 2HCBA 3KQNA 1MO5A 2FEOA 4TWZA 3LH5A 1YE8A 1CF4A 3RAPR 3L0IB 4Q7LA 3A1SA 3I4LA 1NN1A 1E69A 3DHWC 1XCMA 2C8VA 4OI2A 2PH1A 3LDAA 4TSFA 5UKDA 2GEVA 2FGKA 1JBKA 1ODFA 3ZQJA 2WJIA 1PUIA 1ZM9A 2R65A 4YXWA 3SU8A 3EIEA 5BN3A 2A30A 3FYHA 1T3LA 1P2UA 2OT3B 3GLGA 4IXNA 3KJHA 2J5XA 4AWXA 2IXEA 3R8FA 2GJ9A 3SN6A 3WMEA 1II9A 1GNRA 1W0JD 1Z07A 3EZFA 3ZS9A 5FH9A 3LQRA 1OE0A 3TGPA 5DN6D 5FBVB 3V4RA 1OFHA 1S2MA 1ZU4A 3GMTA 4LYAA 2ODBA 4A36A 1COWD 2I3BA 2J0VA 4G5RA 2F55A 1WBDA 1E2DA 3IO5A 3KXIA 1SXJC 3FWYA 4QOSA 4HLUA 4TTRA 3ZVMA 1US8B 2D74A 2F1IA 5JJLA 1KKLA 4LYHA 4C2TA 2ERXA 3WRYC 1T5LA 2ZS8A 4M2LA 1C1YA 1EFTA 2ZI6A 3GLFE 4ZKEA 1PV4A 2O8CA 2GESA 4Q7KA 3K0SA 3LX8A 2CVFA 4DSNA 4Q9LA 5B30A 3PG5A 3TMKA 5JZVA 4GZMA 3B1VA 1YRBA 2RMKA 2GXSA 1DOAA 1FQJA 3EZ6A 3HPQA 4P31A 4Q4AB 4G5SA 3EPKA 1WB9A 3S1AA 2F1HA 1XD9A 3FHOA 1EFCA 4JL8A 2AL7A 2J9RA 2V1XA 3MRSA 1CJVC 1QHYA 1JAHA 2IEZA 2ZVPX 3TK1A 2KBEA 4GBMA 3DMDA 2A5YB 3RC8A 1G291 1G5PA 3L0OA 3K09C 5FTLA 2DPXA 2WWXA 3TIFA 2VLIA 2VSOA 3MUFA 4QJ3A 4LBVA 2Y8EA 2B92A 1E94E 3K0AB 1NLZA 2PLRA 2Q21A 3CONA 1TNDA 2WIAA 3F8TA 4LBYA 4PHTA 1IN6A 3G82C 4O0MA 1A2BA 3Q5EA 3UATA 5CDFA 4Q9HA 4L9WA 4LUCA 2GJKA 1W36D 4NH0A 4Q01A 1P61B 4LWZA 3P26A 1ZD1A 4R71A 1ZRHA 3M6AA 4MITA 3SBDA 4URUR 2H16A 2VEDA 3EC2A 1L8QA 4AK9A 5HR5A 3NBZC 1SVMA 3KB1A 3QVUA 3VKHA 3GJXC 2HDNB 2G1KA 2UVQA 4C0KA 1NVVQ 2PZGA 1DVRA 4XJXA 5JI3E 1DARA 4EFLA 4D0NA 2IXGA 2YOGA 1KZ7B 1U81A 3AVTA 2RH5A 1H65A 1D2MA 2H18A 2OM2A 2CL6X 3PVSA 5F2EA 4D82A 1ZM2A 3CRRA 4DUGD 3ZIAD 1KHTA 4M1YA 1KO5A 2ZRCA 2PBRA 1MRNA 1XTKA 4B43A 3CRW1 2KI5A 5LB4A 3SHFA 4WAUA 3U44B 3CWZA 4IDHA 3AVVA 3GEEA 3TSOA 2H8KA 1PLKA 1W4RA 2EFGA 2JA1A 4LHXA 5BW8A 2EYQA 2R6AA 2VPPA 1YRAA 4DLZA 3IIKA 1OIWA 4GDFA 1NBME 5JRJA 3VHLB 1NLYA 1FMLA 4ASUA 4Z51A 1R5NA 1SKYE 1XNJA 2GZHA 4C9BA 5AUNB 2IT1A 3QKRB 2DY1A 3C41J 2DYKA 2VHCA 4OQNA 3TR0A 3IQXA 2ZI3A 3U7FB 1U0LA 3PUZA 1G3QA 1N5IA 4P0TA 2G0NA 1F60A 2IXFA 1ZMXA 4ZI2A 1QHGA 2XZOA 2QM8A 1SVKA 3P27A 1KSFX 3QSYA 1M2OB 3NH9A 1E1RD 5DI3B 1MO4A 3K70D 4PANA 1WA5A 4V0OA 2YYZA 2ZI9A 4MQBA 2BBWA 2Z6VA 1K5DA 1XFAA 4PO8A 3LY5A 2Q3HA 4N3NA 1X6VA 2A5DA 2OV2A 1U98A 2QL6A 4MDFA 4LJ4A 1LW7A 2I4IA 4DSTA 3VKWA 2J0UB 3VU9B 1Z3IX 4DDVA 3HYTA 1Z22A 1TMKA 4C3ZA 4IVPA 1E2NA 2XSZD 1ONBA 1P2VA 5GVSA 4GNKA 4KHZA 2EFDB 2YWFA 4G01B 4MUBA 4EQ6A 1UEJA 2QI9C 4TZ0A 1E79A 4QGHA 3FVQA 1RFLA 3SC3A 2ZPTX 2OLKA 4AKEA 1XMJA 5JHGB 3MJHA 2ZRBA 1ZCAA 2QN6A 1E32A 4W5JA 4ZIRB 5GJCA 1BH2A 1LF5A 2H17A 1BIFA 3QEOA 4PO1A 5F9HA 4TMTA 2FSHA 4Q1CA 3WMFA 2GF9A 5C1BA 2NMVA 1G3UA 3ND9A 2E1RA 1NJGA 2P6RA 4MA4A 4KITB 3CUEF 3LLMA 2KBFA 2GJ8A 3LWNA 5K8LA 2ZREA 1GITA 2G0TA 3QENA 3ZDQA 3QY0A 4TYPA 3BGWA 1KAOA 5CB6A 4LY6A 1NF3A 2BMDA 3GLFA 1J8YF 1G6HA 1X8JA 1XPOA 4R2HA 2C03A 4TLDA 4BE7B 1W2GA 4FMDB 4I99A 1FL9A 5KYKA 3BH6A 3ONWA 5CYPA 5FBLB 3A4LA 4JBXA 2FE4A 5TARA 2ZRLA 1KDPA 4FW9A 1TX4B 1I4TD 2W2VA 2CHQA 121PA 1VDZA 3HP1A 4X8OA 4A8JA 2P2LA 1L4YA 2C5LA 4XD7D 4BFYA 1WP9A 5CB8A 2HT6A 3X1XA 5EQTA 1G64A 2BMEA 1KJYA 6Q21A 3OEED 2ZSFA 4XTCS 5HCIA 5HE8A 3JVVA 2ECKA 1W47A 1OF1A 1II8B 1M6NA 1UJ2A 1FX0A 3FFBA 2IHYA 2KJQA 4HZUA 2BBOA 4FCVA 3IBYA 1S3GA 1DEKA 3LA6A 4KO8A 5FOUA 1GOTA 2QE7D 4WVFA 4B34A 2IL1A 3KTAB 2QM7A 1MH1A 3UXMA 5JFGA 2NZJA 4L16A 2QENA 3G0HA 2CCJA 4D4JA 3AF2A 1S4QA 4OK3A 4DLUA 3Q7QA 4JBYA 4G5GA 4O2RA 4B3XA 1VIYA 4RFVA 3Q3JB 1W2HA 4FMCF 3KQKA 2Z0MA 4LHYA 2PX0A 5FPSA 4Q9JA 1Q3TA 1J7KA 4M1MA 2IC5A 5CYOA 3R7WB 5A4JA 1AZTA 1TQ6A 3THXB 4KYIB 2C77A 2ZYVX 4AKGA 2WSMA 2V7QA 1W46A 5EUMA 1T0HB 3M4YA 2D3WA 1GNQA 1P73A 2G88A 3CPEA 2JJ8A 2QZ4A 3I1FA 1NN5A 2CL0X 1UF9A 2V4ZA 3AKEA 3IHLA 3QI2A 3DPUA 3SJCA 1N6HA 1RC8A 4TYNA 4PPQA 1A5TA 1T8TA 2W6JA 2PCLA 2GDJA 1CRPA 1G41A 3LLUA 4MGIR 3W9YA 4EUNA 1WDTA 3REFA 5DNYB 3PEWA 3CNOA 3SEAA 2IWRA 1OIXA 4AYXA 2QAGB 1X1RA 1QHHA 1G17A 1RJ9B 1UKYA 1OYWA 2AWOA 3IILA 4IVRA 4IOKA 1E2IA 3LW7A 4ARZB 4B6EA 1NBMA 3KFXA 3E70C 4GSYA 4L8GA 1A7JA 1XMSA 5CIQA 5JS8A 1KY3A 3ZQ6A 2OG2A 2C95A 5JSZA 3TSZA 4LOAA 5FOWA 1XXHE 3DZ8A 2BM0A 3MWKA 1CU1A 1E0KA 2RKOA 2ZR9A 4DIDA 3TUJC 1XB2A 1OB2A 3PUXA 4I4LA 1A82A 1S1CA 2QMEA 2WWGA 1VG1A 1FPMA 4QFMA 3WBKA 2DBYA 3CPJB 2HF9A 2R9VA 4KFUA 4A8JC 4MGYR 1AN0A 2GZDA 2HYIC 1NVWQ 2OILA 2C78A 4F4CA 5DSZA 1WQ1R 1T8UA 2F6RA 4BFVA 4ABYA 1EX6A 2H57A 2IYUA 4DXAA 2NIPA 3BB4A 2R6FA 4U5XA 1QHXA 3WHLA 2RAPA 1AKYA 1EESA 1VMAA 4XIGS 2V9PA 5IF9A 1NSTA 5KNDA 1AS2A 4PHHA 2BBTA 2QTFA 4Q9KA 1XPUA 2CVHA 1G8HA 1RYFA 4BEJA 1VCOA 3UMRA 4RD0A 5JI2E 3NKVA 2ZJBA 3N70A 1W0KA 2O8FB 2DWOA 1O3YA 3DM9B 1P9RA 4OQLA 3SNHA 5KPJA 4B71A 5KO2A 5ELXA 4LZZA 3I61A 1U8AA 5AUOB 3WYAA 2J45A 1G9XA 2WPDD 4LC1A 1EWQA 4P33A 3EIQA 1G1MA 2CJWA 3CM0A 1DO0A 1KI4A 1J90A 2A78A 1N5JA 4DWJA 3DDCA 5C18A 1KZGB 2XNDD 1NP6A 4UNNA 3GQBA 1DS6A 1X3SA 1DPFA 1Z0KA 5KDDA 2ZYTX 4UKDA 4HI0E 5DGXA 1LB1B 3Q85A 3RANA 5G41A 4ON9A 1R8SA 2ATXA 4ACAA 4A0RA 3QEJA 2QTHA 4OYHA 1JAIA 1XD2A 3BFKA 3OIVA 2GBLA 4WIAA 2G83A 3E5HA 3D8BA 1E4YA 8OHMA 5J4VA 5KSZA 4LBWA 5J5CA 4YMVA 2WIBA 3PEUA 3FKSD 1Z08A 3QKTA 1QRAA 2F1RA 4JLAA 2FPLA 2AXNA 4QJ5A 4TMVA 1UM8A 2HT1A 5DLQC 1VECA 3QF4A 3OE7D 821PA 2Q0HA 2J1LA 4NBSA 4JS0A 1PLJA 2J7PA 1EWRA 2O0KA 3QXCA 3R9IA 1TU3A 3SQWA 1IXRC 1S3SA 1T91A 1IJEA 3FHCB 3FHTA 2G9NA 3ADKA 2CE2X 3NVAA 4JLBA 3AF0A 3WY9A 2JJ1A 5HZHA 2GCPA 4B33A 2WWWA 2WJVA 1W36B 4ERNA 1FNNA 3SYKA 4C0QC 3C15C 3OF5A 4ZDKA 1D6JA 4I1VA 4C7OB 1OKKD 2CLDX 1BMFA 3VMFA 1XJCA 1YR6A 3RS0A 3T12A 3QKSA 2QEQA 1JALA 1JXOA 3QG5A 1OIVA 1AIPA 3AEZA 3KUDA 1Q1BA 3ZD7A 4GT1A 2IS1A 1TQ2A 1N2CE 2GJSA 2PEZA 1G3MA 3A1VA 2PMDA 2PJRA 3BH0A 4QL3A 5HZKA 4Z1MD 3L0SA 3KXLA 4HAWA 5J47A 4US0R 1IHUA 4QGAA 1TPZA 1TF5A 3EG5A 1OXXK 1QVRA 2OBLA 2ZVQX 4PC3A 2QMOA 2IW3A 1R5OA 3A36A 2BJVA 4B3GA 3Q7PA 5CIWA 4YC7A 3V4FA 5JEDA 4II7A 5BWMA 1JEDA 1YVDA 4DHEA 3CX8A 2OZEA 1GZSA 3IQWA 2P5TB 4B76A 2FPKA 2AK3A 1HA3A 4P3YA 1VKJA 2RHMA 3ZH9B 1CLUA 3RHFA 3THYA 1GKYA 3I92A 4XSGA 4AYWA 3ICQB 4Z54A 1SHKA 2J46A 1OH6A 4PX9A 2FOLA 4H1UA 1G3RA 1LNZA 1NMXA 2AX4A 2FH5B 3UWOA 2IA5A 1QHIA 2AD1A 4BZXA 4CEHA 3K0CA 3AKYA 2Z83A 3SS8A 4BLSA 2QTVB 1BOFA 3HWSA 3GLIB 4DB4A 2O8DA 1Q57A 1Q21A 2YNMA 4IFBA 3LBIA 4B2PA 2GBLC 1Z2AA 3BE4A 1MT0A 3PITA 3QXSA 3I72A 4JT2A 2DWQA 3QPVA 2HV8A 4Q21A 1ZM4A 1JI0A 2W2XA 2X19A 4O2LA 4NYIQ 3W90A 3U5ZB 5TB5A 5B58C 3RRNA 2YVUA 4A6XA 1GRQA 4S2EA 1AS0A 1XXHA 3B1YA 3SYNA 4C4PA 4JZKA 1RIFA 3RABA 1XJQA 3ZVNA 4KBGA 1GNPA 4CZ2A 5M04A 1SXJB 4QJ4A 1LFDB 1R4AA 1R8QA 1TEVA 4UXIA 4PR0A 3DOFA 1J2JA 2IYWA 3GP8A 1JJVA 3BC1A 3IHWA 2A5FA 4JVMA 2GF0A 3I32A 4CIDA 1FMJA 3U3RA 4NKRA 4HUTA 5EP3A 1Z6GA 1Z83A 4Q19A 2ZJAA 3FMFA 3C14C 1K6MA 5C4MA 1CJMA 1E1QA 5JWRA 1ESMA 4B3CA 1XMIA 3E2IA 4DDWA 3LV8A 3AP3A 3ADBA 1PVOA 3K9HA 4TMXA 2XOKD 5E4FA 5HCNA 2RGEA 5FPYA 4OJQA 4JJKA 2QGNA 3FOZA 3TW4A 2IUTA 1Q44A 1KSJA 1XTSA 3F5FA 4BEBA 2F3RA 1MO6A 1GRRA 1H8HA 1W49A 1VCIA 2WWHA 3VKGA 1RYHA 2WOOA 4WOPA 4GFDA 1HE8B 2VF7A 4A2WA 2WZQA 1X86B 1UBFA 3ZS8A 4LHVA 3U6KA 4DJTA 1WXQA 1DBSA 2VF8A 5LD2C 3PENA 1Z0IA 2EFEB 3EZ7A 4LJ6A 4BFTA 1XJ0A 3HYRA 5K8IA 4IFEA 2D7DA 3B9QA 1YJ5A 5EE0A 1B23P 2X8AA 3KJEA 4CEJA 1P9NA 3B5JA 4FIDA 2JLYA 3DKVA 2EYUA 1ZU5A 1DADA 5K8TA 1OHHA 2XTNA 2IYLD 5DYIA 2C98A 1QBKC 1YR7A 2FSIA 3BK7A 4LV8B 1QZXA 3N2EA 4M0LA 1R5BA 4V03A 2WJJA 2QRNA 5FTNA 1KSGA 3K0CC 1IONA 4U02A 2CCGA 1DAGA 1QF9A 5LB2A 1HE1C 4WA7A 2ZI7A 1IY0A 1XTIA 2ZR0A 4I1SA 5CM9C 1YKSA 1LTQA 2G6BA 2GTPA 3B60A 3B1ZA 1CBUA 1TQ4A 1PJRA 4QKQA 1R0ZA 3VNUA 3D7MA 1KIMA 2NO0A 4QM7A 2KWIA 2DB3A 3MG9A 4Y0AA 1U9IA 2EQBA 4RZ3A 4LPKA 2HLDD 3X1ZA 2ZRFA 1AK2A 1BKDR 3AB3A 5KNBA 4GMDA 3NC0C 4I1OA 4HATA 2XXAA 1NI3A 3IPXA 5F98A 1OW3B 4Q02A 1DE0A 2VO1A 1TTTA 5L3QB 4TYYA 1IM2A 1S0UA 2QPTA 3TRFA 2GWHA 2DWPA 2QP9X 5CLLA 1P2TA 2W83A 3T5GA 2F3TA 4EFMA 1KI2A 1PZNA 2WSSA 5KHOC 1W7AA 2BC9A 1JR3E 4OK5A 4PSKA 1FUUA 3SOPA 1N0UA 3MD0A 5JJIA 2GCNA 3LXRA 4HAXA 4PSAA 4F4IA 4H1VA 3AVXA 5KU1A 5TY0A 3CWQA 1E0AA 4AKHA 3N5CA 2C9OA 4PQFA 4DZZA 4A15A 4RZ2A 1RZ3A 3LW8A 3S1AB 1KO8A 2VP5A 4CVNA 5C46F 3HR7A 2BEKA 1M7GA 1RE0A 4RSGA 2YWEA 4US1R 1UDXA 4QBFA 1G7TA 2CCKA 3EA0A 2WMNB 5GJWC 3A1TA 5B57C 5EJEA 1QG4A 2GXQA 2QBYA 2ZSBA 4KV9A 1KI9A 1E96A 2UZ3A 2X2FA 4R7ZA 1Z28A 4PO9A 3A1WA 3EX7C 1P75A 1XEWX 4RD6A 1CULC 1G8FA 1US8A 4ZCMA 3SJBA 5JWHA 3SI7A 2GK7A 1E98A 3DVLA 4OI0A 2E9SA 2ZS9A 1YU9A 4C30A 1XMVA 4CF7A 1IN8A 1XEFA 1DELA 5AJVB 1E0JA 1NG9A 1Q22A 3EWSA 1U0JA 1VYTA 2XNSA 5E7JA 3AP1A 2W6ID 4CYMA 2OCAA 4OJKA 5AJZA 4MGZR 5FTMA 3L8ZA 5D3MA 4EPTA 3GJ0A 1B0UA 4YONB 4LHZA 2ZQ5A 3U7EB 5E3HA 5CM8B 2IX3A 1LF0A 1CTQA 4Q47A 4DCSA 3CH4B 1NY5A 5EXTA 4BFUA 3UK6A 4XVUA 3REGA 3D31A 2PCJA 3CF0A 1KJZA 5F9FA 1KO7A 2D06A 4DSOA 2GEUA 3KJIA 1BS1A 2PT5A 2O5VA 3MGCA 1OFTA 1U9IC 3K0AA 1CP2A 4D0GA 5IK2D 3DO6A 2YV5A 2FEMA 5DISB 1Z0AA 2RGNA 3PUYA 1IY2A 4D81A 4ZKDA 1P7CA 1N6NA 3PV0A 4URZR 4CDGA 2CDNA 3P20A 2QPOA 5KUTA 1N5KA 2OFOA 4ZDWA 3RSLA 2FZLA 4BUJA 5BYKA 2JLVA 3BFVA 1XP8A 4KI0A 2C99A 2XJ9A 3AGPA 1XCGB 1YZUA 3W8NA 2AN9A 1UAAA 3GPLA 4HLUC 4R9UC 5DO9A 3B13B 3IKJA 4TYQA 1H8ED 3P1JA 3RRYA 1DAEA 1SVLA 4JVNA 5G40A 3K1JA 4QRHA 4JLDA 4BFWA 2OAP1 4LK2A 4BLOA 2WMOB 5J4LA 3FB4A 2RGGA 4NYJR 1HYQA 1XEXA 4GP6A 3OEHD 4ZCLA 2DR3A 1KDOA 1KNQA 2WAXA 1Z0FA 2ONJA 1IN4A 1X8LA 5FTJA 1LVGA 2ZITA 1ZIPA 2BBSA 2YJTD 2ZE7A 4X8HA 1U8YA 4DBLC 4EPVA 1CXZA 3EW9A 2SHKA 2XITA 3CNNA 2WAYA 3GJ4A 5JCPA 1HURA 1NVUQ 2HXSA 3HDTA 2Q6TA 3LRPA 4MYUA 2ANBA 4MUAA 5H1YA 5FOVA 4BQSA 1KO4A 2ZRHA 4LSGA 1SXJD 1V5WA 4P4SB 3FKQA 3LAWA 3QKRA 2FZ4A 3SZRA 1EFRD 2B21A 1YQTA 5FL7A 2GXAA 3BFXA 3OAAD 3WYFA 2X1VA 1HUQA 3CR7A 2GAOA 2QG6A 4PXAA 3O8CA 1QDEA 4KU4A 1CS4C 2JIZD 2VHUA 4EQ6B 3U3JA 4TLAA 4URWR 3K0EA 2UKDA 2YOFA 4UNQA 2UZIR 3U61B 2QQ0A 4Z8XA 1Z63A 1KJWA 1M8PA 2CNWA 2OCPA 2ODEA 1YZTA 2I1QA 3W3AA 1CKEA 2D2FA 3AF1A 2QROA 2ZTSA 3GJ3A 3PUVA 1O87A 5SZJA 2PX3A 3DOEA 3M1IA 2HCJB 5LPNA 2RGNC 5CK4A 1KMHA 4M9ZA 1NVXQ 3T35A 4JYCA 1XF9A 3VR5A 5CITA 2ZRNA 2JEOA 3RRZA 1T4GA 4QNRA 2J0UA 4G1UC 4PQRA 3BXZA 4JMPA 2BEJA 3VU9A 2VP2A 4LDJA 1G7RA 4YQFA 3B8HA 4LX0A 2JDID 3CO5A 1DAKA 1G8PA 1OV4A 2X77A 3GLFB 1JR3A 2ORWA 4QXAA 5HKKD 3HJNA 2R6DA 2AD5A 2ERYA 3DEFA 1XD8A 3PIRA 4GOXA 3U2QA 1BO6A 2VP9A 3MSXA 1OXSC 4W5HA 5FPTA 1ZNXA 3QJYA 1YZGA 1EX7A 2D62A 3U60B 4XWKA 1NG1A 1AQYA 4A8JB 4QG7A 3TAHA 2GA8A 3EPJA 5G3YA 4Q00A 4TSFD 2XZLA 2PMKA 1VG9B 2IYYA 1KSHA 2OUKA 3DZDA 2PT7A 3W6PA 4JSYA 4YXWD 3SHWA 2C9CA 4YMTA 1GG2A 1FX0B 1ZNYA 2JJ2A 3RS7A 2YWGA 3RWOA 4PHFA 1Y3AA 4QBHA 4IDOA 1F2TB 1GUAA 2FG5A 1E9FA 2D7CA 5BYJA 2VSFA 1KK0A 1TUIA 4LJ8A 3ZZ0A 4BLPA 4C0HA 1N6OA 3BJIC 4V0KA 5FPKA 1IN7A 1KI1A 4IEEA 2DFLA 3IEUA 1ZYUA 3W5JA 4KVGA 1R0YA 4UXJA 2BV3A 3BH7A 3RS3A 3DMNA 2JASA 4IOJA 3VFDA 2O8BA 1BYIA 4F4JA 2Z5FA 5JJKA 2OCBA 4AIIA 2IHBA 4A2PA 4MKHA 4Q4JB 2ZUBA 1EK0A 1IQPA 2O8EB 1T9HA 1NMZA 2IUUA 1OB5A 1F2UB 2CK3A 4AI6A 4B74A 2V6JA 3D3QA 4LV6A 1U90A 4DT1A 4Q7JB 1KDRA 2AK2A 1ZIOA 3WXMA 4NE2A 1Z2CA 3NHBA 4OKSA 4GOJA 2OFWA 2REBA 3NDPA 2N42A 4IOMA 3CKLA 4C0BA 1HTWA 3ND8A 2WICA 3CRQA 1LY1A 1T5IA 1W4AA 2ZE6A 3L2OB 5JCZA 4A1FA 3RRMA 3KTAA 3QF7A 5EXPA 2IS6A 4JT4A 1CJKC 2ZXUA 3THWB 4A0GA 1V43A 1M34E 3DM5A 4HB4A 4PC1A 1QHHB 1G5TA 4N0EA 1DO2A 5AUPB 3FMPB 1KO1A 3WRXC 1KKMA 4B48A 2ZE5A 2QNRA 2QT1A 1W5SA 2CLSA 4KODA 3R9XA 1NIPA 3LVQE 3THXA 1N6LA 3QXXA 3R7WA 3I5YA 1KI6A 2IK8A 1SKYB 1RRFA 2KE5A 3VAAA 1NIJA 4NYMQ 2ZSEA 2CE7A 3CX7A 3BBPA 2IUSA 3NBYC 1GWNA 1JJ7A 1NMYA 1W4BA 3CH5A 4Q1BA 1KI3A 3IIJA 4Q1AA 1XWIA 3FGNA 4KLZA 3LD9A 3RYTC 2Q3FA 3TLXA 421PA 3AKCA 3T5DA 2L0XA 3QE0A 1E2KA 1T6NA 2F9MA 3A4NA 4TT3A 1JEEA 5TXGA 1D8TA 1E2LA 4JLPA 3OFNA 2JLSA 2GRJA 2N1BA 1OFIA 4F91B 1FUKA 5L8VA 3GLIE 4HEJA 4TN1A 2GCOA 4RFSB 2QAGA 3JVUA 3L82B 2OLJA 1RJ9A 5FI0B 2GVZC 3TW8B 2FFAA 1UBCA 1HEIA 4ARZA 4B35A 2V3CC 3A4MA 1KYIA 1M74A 2P67A 2ODNA 2ZAMA 4MRRA 5J4KA 1R2QA 3SE0A 3GJ5A 4TL7A 2J0SA 2J87A 3X1YA 3C4JA 3T61A 5EXXA 1I2MA 2ZEJA 5E7IA 3A6PC 2J0QA 3UMSA 221PA 2WVJA 2YC2C 3HU2A 4ASUD 4HAVA 2QSYA 3BS4A 3CLVA 2WBLC 2ZRGA 1NN0A 1KNXA 2VHQA 4TL6A 4D4KA 2CJWB 2EWWA 2ZSDA 2Z43A 3AQ4A 2RGAA 3B7GA 4EFNA 4M1TA 3Q8XB 2O52A 3ICEA 1Z6YA 3LNCA 1IXSB 1NVVR 5DYGA 2BKUA 1ANKA 1W4CA 4CEIA 4GI7A 3T06B 2IYTA 3KXKA 3K0FA 4ESVA 3HU3A 4FWIB 1JXMA 2OO7A 2P6NA 4A2QA 3A8TA 3MCAA 3T1QA 5KOYA 3L8YA 1S96A 3C5HA 1OXTA 1ZCBA 3NWJA 5KDLA 5G3ZA 4OQXA 4DB2A 3AF4A 4HZIA 2ZRIA 4LJ7A 1XD2B 2WKRA 4M9XA 3QUSA 3SYLA 5GJVC 2O8FA 4QNMA 3G5UA 4QGGA 2ASEA 1QVAA 1JR6A 4LJYA 4LYFA 3LBHA 1N3BA 2IS2A 1W0JA 2O0HA 2C04A 4XVQA 1G7SA 5DN6A 1ZAKA 3GEHA 1P60A 1COWA 2PEYA 5TV2A 3T34A 1UPTA 3FMOB 1NN3A 2FFQA 3PUWA 4IJMA 4NTZA 4NCNA 4Q4LA 1EG7A 4IXMA 1E0SA 1ZP6A 4B32A 4LHWA 3THOA 3MLEA 4U7DA 1J8MF 4HB3A 2BIFA 1R7RA 3WNDA 2YZ2A 2NPFA 4A4DA 3AVPA 3AV0B 4U00A 5H8WA 4PPFA 4Z8YA 1E6CA 2AFHE 2OFXA 2QMHA 3I8SA 4M9QA 2ZSAA 3FMIA 1FNMA 3BAFA 4DLXA 4A82A 3DKPA 4NP6A 1OXVA 2F43B 3CNLA 1VPLA 2PJZA 4BLTA 3EPLA 2VL7A 3H1TA 1NRJB 4HDOB 3JZAA 4LPSA 4DC9A 1VHLA 3Q5DA 5CJPA 5EE1A 4PPNA 3Q72A 3WP0A 3B1XA 3ASYA 2LKCA 4HLQB 4PZZA 3WNCA 5LD2B 2WWFA 4EPYA 3SR0A 3U4QA 4F7WA 4D6PA 2V8OA 4LBZA 4BRUA 4L4UA 4PSVA 1D2EA 4A9AA 4MKGA 4Q4HB 3GEIA 2ANCA 4BRWA 3UG6A 1M7BA 4JBWA 3EC1A 4KVAA 1E2HA 2AFIE 5AR1A 4C7OA 3PCRB 4MH0R 1M7HA 4F38A 2R6GA 2XGJA 3BB1A 4JLKA 2V54A 5EE5B 1RVDA 2RGCA 2HEIA 2J3EA 1WE2A 4JLJA 5BN5A 1SKQA 1KI7A 2O8DB 2QP3A 2LKDA 4PPGA 3ADCA 3NDBB 4LV5B 2W0SA 2XAUA 5IT5A 4C0JA 4JIMA 4DUGA 3ZIAA 3V00A 2ZANA 2BHRA 1PUJA 2AXPA 2DCUA 2ZE8A 3CW2A 1XXHB 3BB3A 4JLVA 4X8MA 1Q20A 2BVNA 4TL8A 3SJZA 3KQLA 3UMFA 1P5ZB 3J81k 4QM6A 1P62B 4QBGB 4IDNA 3TQCA 2OXCA 3DL0A 1ZNZA 2BM1A 2ONKA 4B75A 2V7QD 5FBRB 3NXSA 3QKUA 1LS6A 1P6XA 2CMKA 3UG7A 2V6IA 2FX3A 4DLWA 4TYWA 2VA8A 2VP6A 4HUQA 2R2AA 1KOFA 1OJLA 4XTRA 4DIEA 1DTSA 2GETA 1I4DD 2W6JD 4ZDIA 4BWYA 2XTZA 4QBIA 4DVGA 3A58B 3GLIA 3QPUA 1X1SA 4F93B 4IVQA 4EPXA 1MKYA 4MRVA 3Q9LA 2B8WA 1DAMA 1NSFA 1SZPA 3W6OA 4MDEA 4WZ6A 1XEWY 2FDCA 3BIFA 2VQSA 4LJ9A 4MRNA 4FMDF 5KPDA 1UEIA 5SZKB 3IEVA 5JMTA 4EJSA 1GM5A 1E1RA 2BMJA 3GLHB 3FDIA 3FFAA 3L0PA 3TQFA 3W5IA 4W9MC 5J4YA 4PZYA 1SVWA 3U7HB 1NBMD 2W2TA 1EXMA 1G5RA 1LS1A 4LC0A 1IBRA 1TADA 5C2JB 5FBQB 3H2YA 1E9EA 3ZVLA 1MABA 3BRWD 4FN5A 1N0WA 5DHAA 4PAQA 3E1SA 3QBVA 4NCKA 1OYYA 2H5EA 1UFQA 5A5GA 5L3SB 2Q9CA 4DDTA 4F92B 2C96A 2P5SA 2NTYC 1GVNB 3B6EA 2VHJA 2XSZA 3HR8A 3EWAA 2XTMA 3ASZA 4O25A 4M53A 3C8UA 4NCHA 3RVBA 4DSUA 5AWFC 1WMSA 1HT2E 2JGNA 3QXHA 4MYCA 2FGJA 3BWDD 5FR1A 4CT5A 2JCSA 2NQ2C 4TQUS 4ZO4A 2IYQA 4L9SA 4IHQA 3T1OA 3AVWA 1VTKA 3K9LA 1AGRA 4TTPA 5IRCD 4NL4H 4URVR 2B6HA 2RGXA 4UNRA 4AY2A 2RB4A 3H4MA 3U7GA 1OLOA 4B47A 4BECA 1GIAA 1P3JA 1W0KD 3HPRA 1G8GA 4IW3B 1MR3F 3FPAA 1DAFA 3GLGB 2Q3MA 4HDCA 1W5TA 3NBXX 4CT4B 1F48A 3LO5A 3GJ7A 2WJHA 4HSEA 5B64A 1FP7A 1JPJA 4WZAE 5DI9A 3TVDA 4PHGA 4DCNA 4BZPA 4QHYA 1ZC4A 5D3QA 5IHPA 3TUZC 2ZROA 1KK2A 1WRBA 1ZINA 2NO9A 1E2PA 1VCMA 1XPRA 2VIIA 5EZ5A 2ZI4A 4XOIA 1GDDA 3VHXA 3B82A 4M1OA 4WXPA 5HPYB 1DAIA 2DFTA 5B2ZA 3KKPA 2EWVA 1JECA 3X2SA 4JKYA 4N0DA 1XCPA 4ITRC 4IEIA 2O8CB 1P2SA 4RCYA 1E2FA 4URXR 2GEDA 5J40A 5FPHA 5BQ5A 4FD2A 2P0EA 4XD7A 3GJ8A 4Q1EA 4RZXA 4FI3C 3OEEA 4B44A 1UADA 2JAQA 4MYTA 4EJSC 1Q1QA 3K70C 1VYUA 4UNSA 1S8FA 2QBYB 3TKLA 1K8RA 4TQ9A 2AR7A 2F1JA 4LCBA 2QE7A 5L3QA 2PLFA 2DHRA 2HJVA 1KAGA 2PZEA 3AVYA 3VNVA 4JJZA 1OSNA 3WMGA 4KLNA 3R8CA 3R9WA 3AGQA 2J7PD 2X2EA 4IDPA 4YMUA 2WWYA 4Q18A 4E22A 2NZ8A 2ZUDA 2H7VA 5HE9A 1Z5ZA 2HJGA 4DDUA 4MRSA 4AG5A 1AA9A 1E99A 3BD9A 2QQEA 4G5QA 3NBFA 3TE6A 2JJ1D 1D9XA 3C7KA 4PTLA 2Z4SA 1IJFA 4PZLA 1BYUA 2A9KA 4HYYA 4JL6A 1TF2A 3MMPA 4ESHA 3I62A 2CLCX 5EE9A 4HAUA 1RKBA 1S9DA 2FPMA 5D3MB 2KB0A 1KK1A 5ANRB 1L2TA 2I1VB 4WW0A 1BMFD 1WBBA 2ZM5A 1YHNA 4Q4AA 2FNAA 4YLGA 4D26A 4H9GA 4OL0A 3KKNA 2WTUA 3EAQA 4TLCA 3IGFA 4EDHA 1HH4A 4DEXA 4DKXA 3RNLA 1KTVA 2IEYA 2NG1A 2P3SA 3D6TB 2LCFA 4P4UA 2IYVA 4JLMA 2KSQA 3QPWA 3SQXA 4D25A 1DAHA 1E9BA 3H86A 1QHSA 2Q9AA 5GADl 2PZFA 1SGWA 3VX3A 4UQOA 3KB2A 1ZM3A 4TMZA 1ESNA 4B3BA 1KMQA 3OZXA 4RD2A 3O8BA 5JS7A 2MMCA 1UKEA 4KAXA 4E09A 4TLBA 1YZNA 1U2RA 2GXUA 3RLFA 5KNCA 1ZW6A 1E2QA 2ORVA 3NG1A 1XRJA 4HLDA 3TBKA 2ZI5A 1F6BA 3PEVA 2ZETA 4HAYA 2DFKB 4L15A 1AQUA 4FCTA 3CZQA 2V1UA 3H0KA 3IIMA 1W1WA 4PAOA 2R44A 5F3WB 1JQLB 3LXXA 3QXJA 4C0LA 1CJTC 1AJEA 2QGZA 3UWKA 3ZJYA 1XEXB 3C5CA 4DLYA 1SVOA 5GVRA 3EPHA 4MGKR 3I5XA 2A2ZA 2REOA 2J41A 2A5JA 2J59A 4UNPA 5CJ2A 1G8YA 1Q1EA 1ZJ6A 4V0NA 1ZUIA 3KX2A 2EFCB 3O47A 2BOVA 4JL5A 4IOLA 4C0AC 4FCWA 3VX4A 4ZI3A 1ZUHA 3U44A 3RWMB 1NLFA 4PC6A 2YWHA 1F3OA 4ACBA 1P72A 1L4UA 3B2EA 3QBTA 4IKEA 2ORIA 4YMSA 1J99A 1GTVA 3B85A 4HLCA 1Z6AA 4OHVA 4ZPXA 1NNEA 2FMXA 1FW6A 3VR6A 1A1VA 3LBNA 2WPDA 3NH6A 1NJFA 4RJLA 2FV8A 3PFIA 4QHSA 3RS2A 2YKGA 1KI8A 5FOTA 5G53C 4DLSA 5KSOA 1UDWA 2DFNA 2JLXA 1XTJA 2QAJA 2XNDA 3UANA 2ATVA 3KKQA 1E1QD 3KZ1E 2WJYA 1D2NA 3K9GA 721PA 2ZRDA 4AKIA 2AHOA 2FWRA 4M8NE 3NEJA 4TQAA 4Q9IA 2IYXA 3CPHA 4TMWA 5CK5A 1Z47A 4GPTA 3PJRA 4I81A 3PEYA 1JQJC 1D9ZA 1AS3A 1E2MA 2WWIA 3AVOA 1DG3A 3U3MA 4IDQA 1WCV1 3VR3A 4ZCIA 1U94A 4PFSA 1H8HD 4NYIR 1GKUB 1C9KA 1SVIA 5DI3A 5C4GB 2JLUA 4ZV4A 1Z6TA 1S9HA 4D4MA 1KMHB 4QC2A 2J7KA 5DIFA 2GVDC 5JHHB 2P65A 4WBSA 2WJGA 1ZBDA 3FKSA 2C9YA 5EZ6B 3WBJA 2FF7A 1KGDA 4P4SA 4FWTA 1C4OA 2QA5A 1IAQA 3CF6R 2A5GA 3QQ5A 4S35A 4BLQA 3OE7A 1AGPA 3KQUA 1E9RA 1G19A 3EARA 3GD7A 2PL3A 3VR2A 3AUYA 4MYHA 5L3VA 1XZQA 3EASA 2FSFA 5TMPA 3H84A 1AZSC
chains in the Genus database with same CATH superfamily
4Q03A 1O0SA 5KKAA 2H7XA 1O9GA 3WNQA 1Z0UA 4Q6BA 3GFPA 5IFLA 3DVRX 5CFLA 1IBSA 1IATA 2NOAA 1CY2A 2IZ7A 1ZEJA 3C1OA 3GMSA 2OLEA 3MAAC 3PT5A 2GEKA 4E4RA 3GV0A 2QXUA 3QOFA 2ODWA 3FWKA 3H8JA 4GL4A 4OXXA 2H92A 4UHFA 4BLRA 4OSEA 1UOOA 2NTVA 5FYQA 1JHZA 4JJGA 1PR0A 2FN4A 3MWJA 5K8UA 2I7XA 3P32A 2BH9A 4CKBA 2HSWA 4UD6A 4DMFA 5KOYA 4MO9A 1SOAA 1XLWA 2O2CA 2FSGA 4H3SA 5EY5B 5E95A 4ZIRA 2I7VA 4KQ6A 3WNBA 3K31A 4RORA 5IM4A 3A0RB 1YR8A 3B38A 2P0AA 2VR1A 3BKWA 2FW8A 3D3JA 2B1JA 3KWJA 3LT0A 4L4RA 5FWDA 3IHKA 4P22A 1XX6A 4NJMA 2MSKA 4FINA 3MJVA 5CT4A 5HILA 5K0LA 5JXWA 5T6BA 3EGVA 3ELBA 1JXQA 2W11A 1N3LA 2YN0A 5KSYA 2EU8A 3WIEA 1G2PA 3HWX1 5FUYA 3AETB 2QX8A 3IE2A 1XNRB 4NCXA 4UJ3A 3FUWA 1E3WA 2B5WA 3RRFA 1S5PA 1OZAA 2PRJA 1V11B 3QIVA 1QHNA 4RVCA 1ISRA 3B6IA 1ZA1A 3NTRA 1W30A 1SC3A 3NEAA 4GU5A 1EU1A 3LC2O 3IJPA 2JFWA 4MGEA 3OIUA 4WESA 4RGQA 3L0BA 4EI7A 3BKXA 1HQCA 1IBCA 4HBZA 4TUYA 2GLTA 1EK2A 1TK9A 1YQWA 3T99A 4JGIA 2ONCA 4E6PA 4DT1B 1MEOA 1V6SA 2MSEB 2GH1A 1BXRA 4JC0A 1Q1ZA 3H1GA 1YE5A 2JF0A 3GMIA 1AZLA 3L02A 4HXGA 1CR1A 1BXZA 1GSIA 4A1OA 5AQEA 1MD9A 2AVNA 1SXPA 1RRGA 2AMVA 3HVUA 1C3OB 2OORA 1X2BA 4BP1A 2EF1A 3QEBZ 1G55A 4G3XA 2WVGA 3I42A 2XY4A 1TECE 1Z18A 4NR0A 5AKYA 4WZBE 1KXZA 1CR2A 2GILA 4JZYA 5DZSA 1J22A 1X1DA 1FTSA 1YB5A 3E22A 4HEQA 4MKFA 4YS6A 1ZHHA 1HTTA 2O0JA 2NYVA 3G3EA 3KDSE 3KWFA 4GC9A 2WFZA 5FI3A 2C3PA 1FTNA 1F5NA 3O90A 4HH1A 3G13A 3NONA 4ME6A 3S2EA 2W6NA 4KQJA 4FBMA 4I55B 4RK6A 5SYAA 1LNQA 1R0WA 4REMA 3GP5A 3ZHZA 5HKLA 3RYCA 5AXAA 4N0MA 5HNKA 3VQTA 1J2UA 2OESA 3EDRA 3LE8A 1KI6B 2O8EA 3JQCA 1Z5PA 5NLLA 2B82A 4LSWA 1YUBA 1FJHA 5ALHA 3M6MD 4KYVA 4JB3A 2W58A 1HV8A 5P21A 1T10A 1FNBA 1XCBA 2HHCA 1K4KA 2XKBA 1FYEA 3DZGA 4UBNA 4Z3KA 3DFKA 2D5AA 3EUEA 3IAHA 3HBJA 5JSZB 2C94A 4XEHA 1RQ7A 2I55A 1YBHA 4NU0A 4OBWA 2GNOA 5DBEX 2DEUA 2FFHA 2ACWA 4YHBA 1G16A 1N8NA 4FOSA 4P3KA 1A8SA 4QO7A 3RS4A 1ZITA 1Z8FA 2ZPUA 4I1UA 4XIYA 1IHOA 4GX0A 3ZE1B 2G77B 3ZKAA 3RFVA 2UYCA 5U9CA 5FA8A 1BMTA 4V3CA 5ALMA 1H69A 1VGRA 2QNBA 4AU1A 4GXRA 4L1KA 1AHHA 3PKJA 4K3VA 4YMWA 4CGZA 2YS6A 3KEGA 1ECPA 5J63A 3M4XA 3GPBA 5FD8A 2J3QA 1SVSA 2GCOB 4OM8A 3R2JA 3A3KA 3TSWA 2P9TA 2GHIA 1BCRB 3BA6A 4YDSA 4ZRMA 4DEYA 3PXUA 1E9SA 2EP8A 1A77A 4QSHA 5EZQA 1PNRA 1DB3A 2QQFA 5JBQA 3N8HA 2E89A 2C7GA 1FUIA 2WSBA 3IA2A 1HT1E 3K53A 1J8FA 1N8SA 4PYLA 4YJ2A 4PYQA 2WE7A 1DFIA 5E4JA 1VIAA 5H3HA 4DLRA 4DRZA 4RHUA 2BDTA 4MV0A 4U7WA 2H7CA 4G9EA 3KQTA 4PSUA 4BAZA 3EXIB 1L5MA 1GPUA 4N48A 4FGSA 1EXWA 4POAA 4GMXA 1VZ2A 1QX3A 9MHTA 2VUIB 4DRYA 3VYRB 2VTKA 1DBVO 1C3LA 3IAS1 4NZYA 4C0XA 3OTWA 3J80A 1E7SA 1FS5A 1A4RA 1JB1A 1N3IA 1QRDA 1RKUA 4R3NA 3HS3A 3LLCA 1VL8A 1O8BA 2PUTA 4QGFA 2X22A 4ZQIA 3MJRA 4BQPA 1GDHA 1SXJE 2D2XA 2UUCB 4PLVA 2Z95A 3RBXA 4HH3C 1T0JB 4CF3A 4BC0A 3ZLJA 2OXRA 3W2IA 5D6OA 4RFSA 5BSFA 4C7JA 1SG6A 1KYYA 3AHHA 3SPXA 5EHNA 9LDTA 3GFOA 2ZYWX 1XKQA 1OAOC 3KK0A 3A9WA 4ZVUA 3Q8MA 3ZE0B 1OH5A 3PNVA 3NYQA 5FLEX 1ZJ4A 5DLPA 2PZJA 2AZMA 1Z5GA 4CDGA 1FRNA 2Y92A 3H5NA 4GOND 1RM5A 4H3KB 4OMUA 1UJMA 3ZQUA 2JLUA 3FOEC 1E62A 5L3RA 3WGKA 2GPAA 2IHUA 3K2IA 1M6VA 2BMFA 4QGBA 4RD1A 3TH5A 2G08A 3QEAZ 2G5CA 3DVQX 5ED0A 2DHEA 4CMAA 4Q0MA 4MZXA 5FP0A 4YH1A 1R00A 2GKSA 3MMXA 3W34A 2OE2A 4QYIA 2OOKA 3NMUF 2YN2A 1R3UA 2FWAA 2DRIA 3CUSA 4HDSA 4ZEOA 3AM1A 3QF4B 2CDRA 4UHHA 2Y4NA 1XXLA 3H8SA 4PFJA 5B37A 1XQ9A 1I5EA 2NTEA 3UJNA 3Q7EA 3NHFA 3DD1A 5EJFA 4YUWA 1M8JA 2FMHA 1ZK0A 4WN9B 1L4LA 1UC9A 3K9QO 2GJAA 5F4ZA 4EKDA 1QQ6A 2V4UA 5U4XA 2BDEA 1F17A 1HLFA 1NJ6A 2HDHA 1CR4A 3G2LA 2ZZNA 1YUMA 3NFYA 2CNWD 4IGIA 3EXAA 3ZHRA 3BJMA 5ULLA 3N59A 5J4HA 1A04A 1UOPA 2NTNA 3AB7A 4EH1A 5F7ZA 1B41A 1IY8A 4X62B 4RY9A 1T9AA 3B1FA 4M1EA 4X8LA 2R0QC 2HNBA 3WKBA 5J59A 2W2OA 1QONA 1Z62A 2NQTA 3MWGA 1Z17A 5K6RA 2Q5EA 5SZIA 3GJTA 4CR6A 4HRXA 4NZZA 2G1JA 4O4JB 1OT3A 2Z5GA 4RPHA 4OIFA 1SCKA 2NAPA 1XQWA 2WHXA 3NVMB 3KAQA 1GA4A 2FPRA 2C57A 3GT3A 3P0EA 5DCYA 1VHQA 3B53X 3ROGA 2ZJ6A 1TTHA 3H7AA 1DZIA 3H3JA 3IBSA 3O2JA 1S4MA 4M6WB 4OXRA 2E21A 1HE5A 1GP2A 2MINB 1OI7A 5SZHB 1F0YA 3V48A 4ZGWA 4LF6B 1K5HA 4G2TA 2CDBA 2UU9B 4FLMA 4O29A 2Q8PA 3HCPA 4GS5A 4HDAA 3RS5A 4AJ4A 1V9SA 4EAAA 4NQRA 1P9WA 4KYUA 3VTKA 2UV8A 3LHKA 3C1AA 1G6OA 5CM2Z 3AG5A 2PZMA 2W6IA 2P9ZA 4WE3A 5KSPA 2NWQA 2O3QA 2VBCA 1QE5A 1RYYA 1FDWA 1MENA 1YCFA 3F3SA 2C2KA 2CJPA 4WZBA 2XUGA 4X92A 5C0OE 2P2ZA 2FN9A 2JLQA 4X91A 1C1XA 2F4NA 3MN1A 4J9VA 4C4OA 3B7WA 1T2DA 3MGKA 1OASA 5KCZA 1ZVQA 1CVIA 3QA9A 5CDGA 1TQ8A 4RPKA 4QRIA 2RJOA 3GMDA 5FBHA 2GN8A 1BHO1 1E1YA 5CLQA 5JNSA 2O3UA 5BNFA 2MJLA 2OO3A 5EMMA 4JVLA 5INTA 2O2XA 2XLBA 3FUXA 4OEHA 2J4CA 4BTVA 1SQSA 1P7WA 1ZC3A 4I5IA 1D1QA 4JEMA 4Z3OA 2A0KA 2FPOA 5IK2A 1C8BA 2HOQA 2WZCA 1P8AA 1PGNA 2EW8A 1UP6A 4QULA 3GF4A 1XCLA 1RWKA 1JZSA 1N0VC 4GQAA 1FCJA 1E2EA 1QGYA 1XN1A 2VSXA 3ADDA 3C4QA 2ZYAA 2YQZA 3JQBA 3OECA 1N25A 3LF2A 1TPYA 1NHWA 3BERA 2XEXA 2OAQ1 1E3JA 3RC2A 3R5TA 1R0XA 1RC0A 4LTNA 2G17A 1FB5A 5CPBA 3NRCA 4BVJA 1ZVKA 4JSTA 1DC8A 1II0A 3ET5A 1H8EA 4CQLA 3UOWA 4O2AB 1QF6A 2M2IA 4PZ9A 1PJQA 1TLFA 4XUGB 1B8VA 2BFBB 2IIBA 2GKGA 2WV9A 3TRKA 4DCTA 5KTMA 4QAQA 4CT0A 1P80A 3U39A 1OWOA 2AWNA 3DZFA 1C1DB 1HRKA 2WDZA 3E8XA 1UPCA 4DMUB 4QUEA 2NU8A 3DEJA 1ELOA 4J0EA 4EHAA 1S1MA 3TJZA 3VDQA 3A9CA 3F6EX 3ZI0A 3HUEA 4DCVA 4CMKA 3IRUA 1I2AA 5EKUA 1SC6A 3GJ6A 3HP7A 3AWIA 2O7RA 1IZ0A 1UMDB 1WHSA 4R3WA 1TW2A 1N5MA 5FOSA 1RCUA 4DL9A 2AJTA 3LVRE 2Z2JA 4EUHA 1BXGA 1THMA 5L7WA 1E4VA 2JI9A 1JPNA 1NXOA 3OQVA 4XLZA 4DYDA 1VPWA 3CR8A 2NU9B 3CJTA 2CL7X 3CZMA 3AVUA 4UUPA 4IX9A 3W2TA 3FSJX 2K5UA 4A7PA 5JPCA 1Z82A 1IOZA 1U3TA 4CM5A 4DN6A 1SXJA 6AT1A 4YBZA 2FE1A 1DKLA 2P7IA 4JX8A 4E03A 5DDIP 4D80A 3BOSA 3SFVA 5KTYA 1VMIA 1ABEA 3S2UA 3SBEA 1XRRA 4K6KA 2ZRJA 1GILA 4RCVA 3C5VA 2FQWA 1J00A 2XYGA 5KWIA 1XP5A 1FP1D 3A1UA 2JIZA 3D1JA 1A7UA 3OFND 1PGJA 1QGDA 5DE3A 1GEEA 4TTVA 3CIOA 1SOUA 4Q9AA 5H9WA 4IMJB 3HXPA 3ECSA 1BHSA 2XUFA 4NDZA 1WUHS 2YOHA 3QUCA 4H7JA 3SZOA 4D7AA 4MUXA 2YW9A 2H52A 3DE5X 4HQFA 2Y1DA 3A26A 5IK2D 4XLLA 5CX1B 4G8DA 4ARUA 4OJMX 1F8FA 4R51A 1I5OA 3ZZUA 5BMVB 5JWOA 1OFVA 4IRUB 3ADOA 3A32A 3R77A 2I9PA 1WCIB 3PHBE 4GKJB 5M2QA 3WGJA 2JVKA 4X41A 5C51B 4X6LA 4EY4A 4N76A 2PT6A 5DGDA 3OQ6A 3RSCA 3ZJ4A 1L5OA 1E9AA 2ZRKA 1BC5A 5BN4A 4DV0B 3SHVA 1THGA 3AFMA 4OB8A 3UXHA 4E5SA 5JAPA 3T1TA 2JFHA 3ABIA 3JCZA 3AONB 1IIRA 4GI5A 1ND6A 3QLEA 4HTAA 5HKBA 5JFOA 2AMLA 3MTIA 3BL8A 4BC1A 2JBAB 1ECJA 5LQDA 2XXAB 3DDHA 1RZRA 4CN8A 1RI5A 1G4AE 4RELA 4L5BA 5IP5A 2QLTA 4JR0A 3DQPA 1U80A 1L4BA 4Y1FA 5DJ5A 2AQHA 4EECA 3IPLA 1I4WA 1V8OA 3I01M 4YA6A 5FDFA 4HMQA 5IBQA 3KSDO 4AJ2A 1NTOA 2R8RA 5LQRA 1ZHOA 1Q7CA 3LH5A 2XMRA 3FF1A 4DJDC 1RQLA 2CNDA 2WQZA 4MMYB 4AT1A 2ODQA 1XOIA 3HBFA 1GU1A 1T26A 1YCDA 1W1IA 3GJSA 3K2EA 2VWQA 4JCCA 2FGKA 1ODFA 1E59A 1MN6A 4DLAA 1BDBA 1G5HA 3GRAA 2R65A 3SU8A 2A30A 3FYHA 4Y30A 2P2CA 1GQSA 1C3JA 2WU0A 2QLJA 2Y71A 3KKZA 1I7NA 2QDXA 4AWXA 1SUBA 1Y1TA 3NHRA 3SN6A 3BG5A 3TG2A 4L8VA 3O4FA 3LQRA 1TYEB 4TXLA 1P7VA 1OFHA 3GMTA 4LYAA 5BP7A 5EHGA 6ADHA 2O3TA 3SX2A 3UPDA 1E89A 3WK4A 1TJYA 2J0VA 4G5RA 4H6WA 2C2XA 3IO5A 3KXIA 3RGGA 3FWYA 4QOSA 4IICA 1US8B 4N6GA 3NO4A 4AF7A 4BCBA 2CY0A 4C2TA 2AFIB 4GQIA 4IHAA 4ND8A 5C1DA 3QU2A 2VPTA 1PV4A 1B00A 5JDCC 1WNTA 2UUPA 4ZQCB 2GA9A 1Z34A 1N2EA 3BWMA 2VYNA 3RH0A 1U28A 4HMPA 3ROXA 3F9CA 4BNGA 1CUSA 4FFRA 3LX8A 5IARA 1JDSA 4NX2A 5DVZA 5A7HA 5JFTA 3PG5A 3P2EA 4UARA 2AEEA 3KR2A 4WCFC 3B1VA 5G0WA 1ZPDA 2FN7A 2GXSA 2I99A 4P31A 3W4IA 4DKJA 1U0FA 4MAFA 4JHLA 2F1HA 1D09A 4JL8A 2Y1OA 5CB4F 2IIQA 3PICA 2F1KA 2WI8A 3NAZA 3CNBA 4MJ7A 3QVOA 2IEZA 4MK4A 1I94B 1U1DA 2KBEA 5SV2A 4NBTA 4AVYA 4DJ5X 3NYRA 4XDYA 3WWOA 5AVZA 1NOKA 1PJ8A 5EMKA 1MQ8B 1I33A 2VLIA 3KPUA 4C06A 4QJ3A 4LBVA 2Y8EA 1R50A 1E94E 1RKQA 1GGVA 2PLRA 4PHCA 2R3SA 2WIAA 2HA5A 3I39X 4ZQFA 5JH7F 3K05A 2CKMA 4PHTA 2JHAA 2A0WA 1CQWA 1HL3A 2PVSA 4MARA 3CZAA 3ZV4A 1HGXA 2R8OA 2YUTA 3FY4A 4CUZA 1FFXA 5ALRA 4L9WA 4LUCA 1EFAA 2X0IA 1N2OA 3PBKA 5IC6A 4NH0A 4Q01A 1UZUA 1P5RA 1WQ4A 4EO7A 1Z25A 3EXG2 4OQ4A 4ZVRA 1BRTA 4MP3A 3NORA 3P26A 3SHTA 1ZD1A 1ZRHA 5CT5A 1Y6ZA 1YGPA 3H87A 2RK3A 5LLTA 2H16A 1TA0A 2OHGA 2P3QA 3EC2A 4AK9A 3NBZC 3VKHA 2PSHA 3HBAA 4J0IA 2HDNB 2JD2A 4MWOA 2KQUA 1GQ2A 4DYVA 1DARA 4D74A 2OC4A 1EYZA 4EB6A 1AD2A 2YOGA 3HRIA 3OOSA 3R6WA 4LHEA 5EFOA 3ZCVA 5A1TA 4YT8A 1AGYA 2G7ZA 4A73A 4R81A 5E6UA 2CJFA 2CL6X 1USKA 1SIWA 5F2EA 4O63O 5FAXA 4I1IA 2FQXA 2O23A 5CDHA 4DUGD 4M1YA 1KO5A 4JV5B 5EOVA 5KTTA 2ZRCA 1RJEA 1MRNA 4OHRA 3CRW1 3D1LA 3EG9A 5LB4A 3HV0A 4WAUA 2HSGA 1P44A 4IDHA 3MTJA 4UULA 2JAWA 3HDGA 2H8KA 4ZVPA 2MOKA 3TSOA 1M72A 3W5BA 5KNLA 6LDHA 1REQB 5I7SA 3QV2A 3SP1A 4PYIA 2DTEA 1TGYA 1NUUA 2AI3A 3C98A 2HRCA 3CZ5A 3DXXA 2JGMA 3S4YA 4QLAA 2P0YA 1FMLA 2M98A 4FT4A 3RS9A 1X3LA 4JBHA 2VZ8A 1Y9EA 5AKIA 3PDIA 2XWPA 2GZHA 2W6OA 1KZ6A 3BMCB 1SB8A 1PEDA 1DWQA 1U6KA 1LJ8A 5CCBA 4X71A 1U2DA 3ILXA 3WTCA 1VKHA 1WV0A 2IT1A 1SXQA 4KQCA 1ZN9A 3VO2A 1OWLA 2C5FA 3ANYB 3IQXA 4NNJA 1U0LA 2DTXA 2GBGA 3PUZA 4FNMA 3QUAA 3EQ9A 2JHPA 1GTMA 5B53A 3GVHA 1C9EA 2IXFA 4BJ6A 1A9SA 5MHTA 2X5JO 4ZI2A 2W2QA 3K4PA 3W2GA 2PQMA 1SVKA 2X9GA 3KD3A 2VWHA 1KSFX 3ZTYA 2DFVA 4MS3B 1KWKA 3O9ZA 3R24A 3K70D 3HL0A 3CT4A 1EJ0A 1QZ3A 3R3YA 2HU7A 1O2DA 4CQMB 3IMEA 1URPA 1VDMA 4B9EA 2DSTA 4LJKA 1DINA 4HG2A 2ZI9A 4MQBA 3FIUA 4H0NA 2DKNA 4YRLA 5TQVA 5H9VA 3TLMA 4WZAB 4OPMA 2GYWA 3VZRA 3ZDZB 3LY5A 4ZWNA 2A5DA 1TM3E 2OV2A 3FCAA 1I0LA 3RK0A 3ZDYB 5EWLB 5CFQA 3ZV5A 3KPVA 4N3CA 4LJ4A 2C3OA 4DSTA 2NSDA 4ZGGA 5IJ0A 1K5PA 3W7BA 1CNFA 1MU0A 1U9JA 1NTRA 2YMQA 5KC8A 3FWPA 5CPFA 2WIJA 4HWGA 1LSUA 1TMKA 3ECAA 1ECLA 4H08A 4CMEC 1V2GA 3OICA 1HZZC 1ONBA 4GKVA 5CT9A 5C8XA 4GNKA 4PU0A 2J31A 2EFDB 5CRIA 4DLLA 4DUYB 4MUBA 3OE1A 4G01B 4YMIA 2FJ0A 2QI9C 3H6HA 4UZFA 4YJDA 1U6JA 4KMMA 3O5AA 4QGHA 5FJIA 4EY6A 1V41E 2EJBA 2GYVA 3GUUA 3KQVA 4AKEA 2IYFA 4V2IA 5JHGB 1MXFA 2BFCB 2LBPA 4W9NA 1ZCAA 2BJHA 2QN6A 4WK6A 3PLNA 5C80A 1PFUA 3UJAA 5FCDA 1JQ3A 2PGAA 2R1TA 3PXCX 4H15A 2NXWA 3WLLA 1QPGA 1BIFA 3QEOA 1ODKA 1ACLA 3QHPA 3N7UA 4Q1CA 2X8JB 3BTOA 2GTHA 3WMFA 1N0IA 5BNIA 3HKEB 1H2YA 1H4TA 3KE9A 4KIGA 4NNPA 4MA4A 4L73A 4KITB 1WZUA 3LLMA 1A69A 4G8BA 2ZREA 1WJGA 2YWRA 2J3MA 4FEGA 3GA0A 5KNBD 2V03A 2X5KO 1NF3A 2BMDA 1T3GA 5E9AA 1J8YF 4UM9D 3W8DA 4D9CA 3SM3A 5KNDH 1NE7A 2O54A 3N39C 4BE7B 4FMDB 3A6GA 4I50A 5IABA 3BH6A 3N0VA 16PKA 2WD9A 3KR1A 5MDHA 4YJHB 3UMMA 1FPQA 4H7PA 1T2AA 3CZ9A 3KVRA 4DNFA 4E4TA 3OSZA 5LQCA 4DJFC 2W2VA 4F1WA 3L8DA 1GTRA 2X2PA 2BE7A 3T38A 1UOQA 2XECA 4RVNA 3UHFA 3PXEA 1L4YA 1YR1A 1PKEA 4CI9A 2L69A 4JWKA 1XVLA 3LVBA 5EQTA 1G64A 2BMEA 4DUPA 6Q21A 2FPSA 5FULA 3CVWA 2PL5A 5LBTA 4E08A 5TPZA 1IVNA 3QK7A 5HE8A 4BLVA 4HH4A 2IHJA 3HKBB 3SHWA 1FX0A 3AETA 5KHLB 3GEDA 4RV4A 3PQ7A 4KWCA 3AXSA 5HTOA 1DEKA 3AHJA 2AC4A 4KO8A 1GOTA 4R7GA 3S2FA 5LUBA 4B34A 3KTAB 1WSBA 3MNFA 1N9ZA 1FFEA 4XZ3A 2DPYA 2NZJA 2R7MA 4JC8A 3WLQA 1GTZA 1XTBA 4AZTA 4OK3A 4JLSA 3Q7QA 4UFPA 5J4KA 1RXSA 2W6ZA 4WNAB 4RFVA 3QFHA 3N2KB 3UAXA 4LHYA 1NQAO 1IULA 3DL7A 1QFZA 1WPGA 1Z7YA 1ZW1A 3P0FA 1N1DA 3PE4A 5FUMA 3R9XB 1JDZA 3THXB 1XCOA 2BLLA 1LPNA 1TQ6A 2AZTA 3TTTA 1T0IA 2YZKA 1BXKA 2XUJA 2ZQYA 2WSMA 3C6KA 1Q7GA 1KBQA 1LPAB 2Q50A 3CPEA 1MW9X 2BFEA 1LX7A 2R6R1 1C3OA 3GLSA 3I1FA 4GO1A 3WK5A 5JRJA 1YA6A 3E84A 2PUFA 4PS0A 4WNYA 1ZI9A 1HDEA 1N6HA 4JROA 3JQGB 4FB5A 4PPQA 3KSUA 4IX1A 4QATA 2PH5A 4C3UA 3R44A 1G63A 4ALIA 3GZ4A 2GDJA 1CRPA 3H19A 4Y3UA 1G41A 1NUAA 4MGIR 3PQFA 3U4HA 2Q5OA 3W9YA 3QW4B 3G1WA 1BCSA 5CA0B 1KKUA 3HLKA 3UENA 1V4VA 3H6KA 1EX1A 3E15A 5A9SA 2DQZA 2QN3A 1I1QB 3PEWA 1EVEA 3SEAA 3Q98A 4MHOA 2IWRA 4IHKA 2G9QA 5COBA 4KGVA 4TZTA 1NXVA 3EVTA 1X1RA 1Q0TA 4TKZA 2Z98A 1QHHA 3DE0X 3FWHA 5EIAA 4D44A 1C0IA 1RJ9B 5JIBA 2ZM6B 2QJRA 3VYWA 1PFQA 1OYWA 2AWOA 1KEPA 2QM0A 4IVRA 5EJ2A 5I01A 1E2IA 2LXNA 4J49A 3QV1A 5I9IA 1MQSA 3KWLA 4L8GA 4GSYA 4PW0A 2OV3A 3O38A 3H97A 4IH9A 1XMSA 4JY7A 4UEKA 4WY5A 2DECA 1CJBA 1KY3A 4UASA 5CIQA 3UWMA 4F84A 4FLFA 5JSZA 3TSZA 3NU1A 1XXHE 2ZG6A 2BM0A 4I8DA 4KXWA 1KQGA 2HAEA 4ZHQF 2ZJ0A 1XB2A 1NF9A 4OMFG 2BI4A 1NPYA 3BRWA 1IIBA 3PUXA 4I4LA 4ZYTA 1S1CA 5L7TA 3GGDA 3A31A 4U3JA 3WBKA 1YBMA 1FA9A 1D1SA 2NUPB 5TLSA 4MLPA 5DYWA 1ENPA 2R9VA 3I01A 3D0KA 4ICIA 4NE9A 3ZWCA 4DTCA 4RTLA 4AJHA 4KWEA 1AN0A 1FXSA 2CNOA 3RT1A 5K6TA 1VXRA 4B79A 1ZGCA 2V74B 3OQJA 4FHGA 1WQ1R 1V25A 2HSDA 2PMBA 1EX6A 3NHZA 1JZTA 2JJQA 1D0IA 2NIPA 3I53A 5IAJA 1AF7A 1AZWA 4MWTA 5HFNA 3WHLA 2L2QA 1EG2A 3QWFA 1JTVA 3SS7X 4D0SA 1NSTA 1CQJB 1AS2A 3L1JA 4MVJI 3EHDA 3OP1A 3TTSA 1XPUA 5KSWB 4XEUA 4I1PA 1MFPA 2GOYA 2VN8A 3RROA 1ENYA 2H1SA 3AI2A 2WHPA 3EXIA 2Q3BA 4XGRA 4GF5A 3UK7A 1HMPA 3PGVA 3ZD8A 1ORIA 3RJMA 3HN7A 5G1PA 1W0KA 5E2BA 4H17A 3UMBA 1O95C 3SNHA 3BGIA 3WL7A 2PPVA 3L40A 4D41A 1T8PA 2H59A 4IP0A 4LZZA 3ROQA 3UAGA 1M2KA 3RSHA 2J45A 3TPZA 2X4LA 2B7LA 1EWQA 2IP4A 2PU5A 3EIQA 3JASA 1QVWA 4DMHA 3ZR4B 3DSRA 5K8CA 2F67A 3H11B 5J2TA 2A78A 3JX9A 4F9TA 3D7RA 5DFAA 3U26A 2CNNA 4G1CA 1BS2A 3VV3A 1HEUA 1X3SA 1PVDA 2HRDA 4CG1A 5JOQA 3OM8A 4LMBA 1BWQA 1NOJA 1Z0KA 3LPLA 4M76B 2BTQB 2QT9A 1ZGZA 2WP0A 2ZYTX 3QVGB 3NPMA 3OH8A 3ZK7A 2ZIXB 3CNEA 3G89A 3MEQA 4S1WA 4U2KA 1YAHA 5DGXA 2UUBB 1S8NA 1RLUA 1PJ2A 2PX6A 4RMNA 2Y93A 3VR3D 3OX3A 5TMBA 2VJKA 1R8SA 4JN6B 3DZIA 4S24A 2FZCA 3G8BA 4CV0A 2AG0A 1NW5A 2EL9A 3FGPA 3JYLA 1LLDA 1XD2A 5FBKA 5HDBB 3S68A 1D1TA 3OIVA 1QO0A 1WULS 3E5HA 4BNMA 3D8BA 4YRNA 5KSZA 2AJ8A 4RLHA 2HUNA 4J03A 4YMVA 3SVZA 2FSVC 4JJ4A 1QRAA 2F1RA 3D7KA 4WHMA 4HGRA 2XOXA 1UXJA 3VZBA 4CUKA 4FW8A 4TMVA 3UCFA 1EM6A 3NFRA 4GG1A 3GJQA 1AUPA 3IVCA 5TT1A 3QF4A 4OIMA 4I66A 1DQRA 1Q3KA 3PVCA 5AVOA 2A9QA 4MV1A 6REQB 3M9XA 1YC2A 5KYGA 2QTZA 1G6Q1 2J7PA 5DHRA 2NW6A 3QXCA 3SQWA 3FUVA 1Q16A 3DDZX 5IVIA 2AEMA 2ALJA 3UOAB 1T91A 2AJCA 2XV1A 5JZOA 3FHCB 1L5SA 2LIVA 5C81A 1SURA 3CX4A 4NQZA 3W4KA 1UWVA 1CCWA 1YVUA 3FLMA 5ALVA 3GUYA 1Z7EA 2MT9A 4EG3A 2QMZA 5TX7A 1CS0A 4LZNA 3SYKA 4C0QC 2DFPA 3C15C 1WWKA 3FXAA 4XVHA 3SMQA 2I6SA 4IXWA 5DBOA 3FM9A 2CFTA 1YDFA 3UHJA 2RAFA 1KMIY 1Y8RB 4NFLA 1BMFA 5AKXA 4MWEA 4PLGA 4E46A 1XZDA 1SUAA 5C9ZA 1X1CA 1YIAA 3T12A 3LVFO 2QEQA 3U62A 1C9DB 3ETDA 3DG9A 1ZY2A 3UGQA 2YMLA 2NPOA 4RA6B 5C37A 1QTQA 2J30A 1LRJA 2ODAA 2JEZA 3C6QA 3BH0A 2ZKLA 4YHHB 5TQJA 3L0SA 4A6DA 5I6DA 2ERCA 2VLBA 4UMEA 3JQ6A 1TPZA 3FNBA 1ZONA 3GG2A 2OBLA 2ZVQX 1ARZA 4OGWA 4PC3A 2XCTB 2IZ1A 3QJ5A 2GBPA 4K03A 4JMLA 1HDRA 4NOMA 1R5OA 2IYPA 4D9NA 2VJOA 3A36A 3KYDA 3V46A 3FTPA 4R31A 5BWMA 5CLJA 1JEDA 3SF0A 1KYZA 4DHEA 2OZEA 3B6ZA 4XCQA 5ERYA 2P5TB 1V45E 3RVNA 3IERA 1NMEA 2EBUA 2R7NA 1HA3A 1JU3A 4JA2A 3ZH9B 4LKRA 3THYA 4XSGA 3PQ2A 5AK6A 3H16A 5E2AA 2VC2B 3ICQB 4V2UA 1OH6A 4PX9A 2FOLA 4ZARA 2UUAB 4L74A 4EHFA 4C7VA 1NMXA 1U1GA 3ONDA 4OAOA 3FBTA 2QOEA 3UMGA 4EHBA 2AD1A 1YOVB 3V32A 1XHEA 3MMZA 4IXDA 3RVMA 3K0CA 2MR6A 3MHTA 1TKBA 1GJRA 1MAUA 4BLSA 3KOMA 3GLIB 3LQYA 2O8DA 2LDXA 1KJQA 2YNMA 2QZZA 3TG8A 2QDKA 3B3QA 4TSRA 3QXSA 3MCTA 4EWLA 2Y76A 3DMHA 4GMFA 2R00C 1ULTA 3E53A 2WKWA 2O2EA 1S2IA 4P4NA 2JGIA 4A27A 1ZMOA 2XVMA 2XT6A 4FGKA 1AXRA 4J16A 5CFRA 2YVUA 2X0DA 3PPYA 3EH1A 4KQ1A 3CW8X 5K8VA 1XXHA 3B1YA 2A9VA 2FAXA 3BQMB 4PXSA 4LY3A 3KYJB 2AS0A 4JZKA 4FM9A 3HZOA 2Q5QA 5HKAA 3HB4X 4YP5A 1AQIA 4ZAVA 4CKCB 2ZUTA 1W9MA 2B1IA 1GNPA 3RJ9A 1AMUA 1QKIA 4Z4FA 1H66A 4QJ4A 1CE8B 1R4AA 1OT5A 1NNUA 1SY7A 3K1TA 3DONA 1SQFA 5KYTA 2BFOA 2IYWA 2A5FA 1RVV1 1NYRA 3GNSA 2GF0A 4U7TB 4CIDA 5EJIA 3EIOA 3U3RA 3ZNPA 4NKRA 1SBHA 3H3FA 4LVUA 5EP3A 1Z6GA 2ZJAA 5IZCC 1RXCA 1T2CA 2BSAA 1K6MA 1Q1NA 1CJMA 2IKQA 4MLZA 7ABPA 4B3CA 3CMCO 5DK6A 3E2IA 4DDWA 2I62A 4HYTA 4HRVA 4YT2A 5IDWA 1RJDA 3ADBA 1O77A 4TMXA 1PI3A 1ISPA 1GPJA 3EBLA 2Y2VA 4DIFA 1I1NA 2Y1KA 4RS4A 4X1KB 1WXXA 3ZH2A 4DGSA 4D57A 1Q44A 1KSJA 2A0XA 1XTSA 3IV6A 1EHIA 4TXNA 1O9HA 1MO6A 1GRRA 2A94A 2F3RA 1H8HA 1VCIA 2WWHA 3KTDA 5CCDA 2PKWA 3NGLA 5C5IA 1JFLA 4GFDA 5FWXB 1A27A 4YRIA 4ZOQI 4A2WA 3KYCB 3ZW7A 1MNQA 4ZAGA 3KHSA 3PUJA 4L08A 4NWIA 4OBBA 4DJTA 4P7BA 4MR9B 3TS1A 1UC4B 4TWBA 3VISA 1C7RA 2KM1A 3BZBA 2EFEB 2FHSA 5AVTA 3PF9A 4Q3OA 1UBUS 4I46A 1PFWA 4IFEA 3WIVA 2D7DA 3L7BA 1YJ5A 5EE0A 3K1YA 2EZ4A 4DCOA 1E64A 2X8AA 4H3VA 4OHBA 2C82A 1UJCA 1BDIA 5LLSA 5HXAA 3O7WA 3G7UA 3DKVA 1DUIA 4U7HA 2EYUA 1XRNA 5FFNA 3OLYA 3IKMB 5DW0A 4EOGA 5K8TA 1OHHA 2Y1GA 4OQQA 5DYIA 2VJPA 2C98A 2FSIA 3BK7A 4FOLA 4LV8B 4I55F 1Z6ZA 3N2EA 3NT2A 3KXDA 4ES6A 4MX8A 5HUQA 1SNYA 1DRKA 1KJIA 1ESEA 1NP7A 5K0GA 2Q7XA 3EQ7A 2ZYIA 2UYOA 5CX1A 4CR8A 3TFOA 3IUJA 1DAGA 1QF9A 3R6LA 1ML4A 2BF4A 3OLZA 3I2IA 3BIJA 4DDHA 1IY0A 2ZR0A 3H5LA 3PPXA 3HJTA 2P5YA 4MVYA 4N6OA 3K9BA 1RXWA 3GT0A 4AZWA 1TQ4A 4C4SA 5EZYA 4ENSA 1ZD5A 4X44A 1P1KA 2FSUA 2NO0A 4QM7A 1Y1SA 1RQXA 1QIMA 4RESA 1U9IA 1FFYA 4OSOA 4LPKA 1ODTC 2H00A 3MW8A 2XTJA 3BXXA 4FP9A 4NHEA 4AMYA 3HGTA 3V6MA 3IOCA 1BKDR 3I45A 5G1OA 5IBPA 2VHXA 3NC0C 1TCUA 3U1TA 1QR6A 4B7AA 4BS9A 2XXAA 5F98A 3WGOA 1TTTA 1T4MA 3V8RA 3FG9A 2VJDA 2BZ1A 2P62A 3KOWA 4LXHA 4EELA 2Y77A 5KAMA 5K20A 2DWPA 1OJ7A 1TB4A 1KYXA 1WF6A 2F3TA 5KHOC 2WSSA 3U1VA 1JR3E 4PSKA 3MD0A 2BKLA 4F4IA 1W87A 4RIFA 4YCMA 1PBNA 5TY0A 1B1CA 2RBEA 5LQJA 1JDNA 1SIOA 3A9SA 3BGDA 4PQFA 3ZGZA 1QFXA 4A15A 2B98A 1U0RA 5DM1A 2ACEA 1WZIA 3I34X 4UTNA 1KO8A 1E0DA 2C58A 3GVIA 1R6XA 1K6XA 3FSRA 2PH7A 3ZV3A 5H80A 3HUTA 2X42A 3QPAA 1O1YA 4CM9A 3CLRD 1JG4A 1XLTC 2CJXA 4G84A 1Q0HA 4V0RA 5JPDA 3KT8A 2EEPA 2EZUA 1UAYA 2JAUA 2ZIUB 3PQ5A 1NFRA 1WB5A 4UVIA 5GJWC 3DWGA 5EJEA 4FGLA 4CV3A 1QG4A 5JC1A 4UHEA 1CF2O 1KYQA 4R7ZA 4NE7A 3CE9A 3F8SA 5JSYA 4K9PA 3OJEA 1Z5OA 1GRCA 1XEWX 5EIBC 2EDCA 1Y81A 1H2HA 3OF2A 1US8A 4ZCMA 2K7FA 3H5VA 3AIOA 1V5IA 3W3AH 2BZGA 4FOPA 1Z9BA 2AFIA 1ZO8A 2GK7A 3NETA 4IMPA 4MEBA 2E9SA 3BWEA 4OP3A 4RPCA 1QIHA 3LY7A 3WLIA 1KC3A 3ITKA 4ENUA 4P7KA 5LZ5A 1GGMA 4KO4S 9ATCA 1DELA 1GXSA 1KC1A 2L42A 5AJVB 3ZQ4A 5GP1A 5G0SA 1KWGA 1JLKA 1Q22A 3PEFA 4RPGA 1AX9A 4PLPA 3AP1A 4TTSA 2W6ID 4NEQA 2P30A 3KEOA 4OJKA 2CNKA 3RVQA 2FN3A 3UAVA 1CZLA 3K5PA 2XGMA 4X61