4G1UC

X-ray structure of the bacterial heme transporter hmuuv from yersinia pestis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
262
structure length
262
Chain Sequence
AVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemin transport system permease protein hmuU
publication title X-ray structure of the Yersinia pestis heme transporter HmuUV.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein/hydrolase
total genus 71
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g1uC00
1Q57A 1FOEB 2IS1A 2ZM5A 5F98A 3X1YA 4CGZA 2ZR7A 2W6JA 3AB3A 3AKEA 1T5LA 4DT1B 1RRPA 5FOUA 1P4SA 2AX4A 3BFVA 3K09A 2XZLA 4TMVA 1UBFA 3BERA 4EQ6A 3D7MA 5G3YA 5HCNA 2PL3A 5H8WA 4JLAA 2D74A 2F43A 4PR0A 1ESNA 2ZSDA 2AWNA 3CB4A 3Q85A 3DZDA 2WSSA 4IXMA 2WWWA 4NONA 2NIPA 4P31A 3W6PA 1RW4A 4DDWA 1DAEA 4A92A 2OBMA 4PAOA 1XMVA 3CRMA 3T1OA 5DH9A 3VR2A 2WPDA 3ADKA 3WHKA 3FYHA 1QZXA 2EWVA 5KU1A 1PLJA 4XTCS 1E79D 4CEHA 2C04A 4IKEA 3NC1C 5FBWB 4URWR 5AUQA 4EQ6B 5CK4A 4K46A 4A2QA 5EE9A 2C98A 2ZE6A 2FFHA 4UNQA 4Z1MD 1TAGA 1TADA 5L3QB 4PQYA 3TMKA 1M2OB 1W4AA 2ZRBA 4L9WA 4B6FA 2V55B 1UEJA 2WKRA 1FPMA 3GJ8A 4UQOA 3WP0A 1DS6A 1HE1C 5CM9C 2HXSA 4DUGA 1LY1A 4A0FA 2G9NA 1NP6A 5TY0A 4R2IA 3VX4A 4S2EA 4CVNA 1HT1E 4RZ3A 2P6NA 4B47A 4ZDIA 2VO1A 4BQSA 4I1OA 2FJUA 4F4IA 5BW8A 1PUIA 2I4IA 4P0TA 2KJQA 3QE0A 2VH5R 2ZRDA 3QKUA 4LJ9A 3U5ZB 5GVSA 1NG1A 3QOFA 821PA 4B74A 4A8JC 2ZEJA 1W36C 2V7QD 2BDTA 4ZPXA 4B2IA 3IKJA 1G41A 3G5UA 5CYPA 1P2VA 3AUXA 1GKIA 3UXMA 1NJGA 3CLVA 3CUEF 4V0MA 2G0NA 2GF0A 3B1VA 3BH6A 2ZR9A 1KAOA 1A5TA 3NBYC 1TEXA 3QVVA 2ONKA 2J7PA 3FKSA 4YC7A 2BBTA 2XGJA 2KE5A 5IDVA 1Z0JA 1XB2A 2ZVQX 3DOFA 3GJ3A 3MSXA 3E70C 1MOZA 1E9AA 1N0VC 5C2JB 4KSBA 1KI2A 4UXIA 1RKBA 1EFTA 1Z6TA 3Q7QA 1U90A 2FV8A 2N42A 2OCAA 1O87A 4HAYA 5DHAA 5C18A 1JXOA 1Q1EA 1Q12A 1Z8FA 1NBMD 3C4JA 4TYQA 4DJTA 1E3MA 2RMKA 2JGNA 1G3MA 5GVRA 4Q7MB 1R0XA 5CDFA 4TTPA 3B1YA 2O8DA 2QE7D 2FSIA 4TLAA 2JLRA 4NCKA 4M9XA 1K8RA 3OIWA 4WZBE 3QEOA 5KNCA 5FTMA 4HUTA 3K0FA 3QF4B 4P4TA 3VMFA 2BEKA 3ZLJA 4QHTA 4O3MA 1DAGA 5G3ZA 3ZGXA 3JVVA 1Q1QA 4MUAA 1SVWA 4A6XA 3AKYA 3RAPR 1JQJC 2ZQ5A 1WRBA 2IYUA 4Q4HA 3W3ZB 1N6LA 3QKRB 5BQ5A 3CRQA 2BM1A 3OFND 3ADCA 5KPJA 2J5XA 1TU3A 3EPKA 1CIPA 3PUWA 3KJGA 5FOTA 2GHIA 1XD9A 4G5OA 4WZ6A 1GG2A 1SGWA 1HH4A 5E7MA 4EDHA 3FE2A 4LHZA 1IN5A 2C9OA 2BOVA 2BJWA 2W0SA 3THXA 2ONJA 1D2NA 4HAVA 2GEUA 1E2MA 4A8JB 1E94E 1OYYA 1ZAKA 3ZQJA 1NLYA 3P26A 3P20A 3A36A 2OFWA 2H92A 4AKEA 1E9SA 3GMTA 2UZ3A 1NN0A 1OLOA 4KXFB 5H1YA 2PT5A 1Z29A 4C3ZA 2A2ZA 1E2QA 4W5JA 4R2HA 1ZCBA 5EE3A 2FEMA 2XNSA 1RRFA 1G64A 2CXXA 4A0HA 5EE5B 5BN5A 4BFUA 4HZIA 4BEJA 1CP2A 1RFLA 5KSYA 3LAWA 1R8QA 1L2TA 1W48A 1NN1A 4MYTA 5BXQC 3DVLA 2OFXA 5AJWA 3H2YA 1KTVA 221PA 2ZE7A 1SXJD 2JASA 4ZCMA 2G6BA 3ADBA 3BBPA 3L0SA 4JYBA 3FB4A 4M22A 2VBCA 1KMHA 3DKPA 3GFTA 4B44A 4MKGA 2FA9A 2UZIR 2YHSA 5JSZA 4K8OA 1A4RA 3QXJA 3KKNA 3W3AA 3WP1B 4E07A 2QROA 2B21A 2B6HA 1NN5A 3CPHA 5DI9A 4C2UA 1MH1A 3SZRA 1V5WA 4PO8A 4BWYA 1NKTA 2HF8A 4CEJA 4OL0A 3EWAA 4JS0A 1WCV1 4KLZA 1OFIA 2PLFA 1G8FA 1OPXA 3PIRA 5EP2A 3V4FA 3A58B 3ONWA 1ZNZA 2BKEA 2GKSA 4TMKA 3T1TA 3ICQB 3AP1A 5K8UA 2D2EA 3RDPA 3NDBB 4Z8XA 3EPLA 1KKLA 3RVBA 2GVDC 2EFHB 2W2VA 1FUKA 1G6HA 5J4KA 2IYSA 5A5GA 1SQ5A 1YR7A 3R20A 2HV8A 4IDHA 3KX2A 4N0EA 2ZRPA 3PG5A 1XEWX 1GVNB 2A7QA 2ATXA 1R0WA 2O8EA 4BFVA 4CW7A 1NN3A 2XEXA 1GSIA 4RD3A 3SYKA 4QGAA 3OAAD 3GLGB 1XJ0A 4RD0A 4JBYA 2FWRA 4S35A 5G41A 4EFLA 3CWQA 3B85A 1ZD1A 3L8YA 2YKGA 3NH6A 1XTRA 1FZQA 1SHKA 2R6CA 3IHWA 5TMPA 4I99A 1GKUB 3NKVA 3OEED 5HE8A 4JLNA 2ZREA 1C1YA 1YZQA 3KKPA 4F4JA 1H8HD 4JKIA 3TVTA 4BRWA 1DG3A 3HR7A 1TEVA 3AVUA 4DC9A 1W7AA 2KBEA 3BGWA 3TW8B 1J70A 2YVUA 1SVLA 3BB1A 3N2IA 3T1VA 2OZEA 1AK2A 4WVFA 2GNOA 2P65A 1X6VA 3A1SA 3TKLA 4RCZA 2ZRCA 1XBTA 4US0R 3QPWA 1YHNA 4JBWA 1KI3A 3RRNA 1Z6GA 1I2MA 1M34E 1KZGB 5AUNB 2IWRA 4IJMA 1SKYE 1E6CA 2A5YB 2OAQ1 2MMCA 1RVDA 5BYJA 2BJVA 5DYGA 3VTKA 1XPOA 4ZKEA 1AKYA 1M1YE 3Q9LA 3ZZTA 1JR6A 1NVWQ 4MYHA 4DDTA 1W44A 2EU8A 2F7SA 2AK3A 1E2LA 1M74A 3I3SR 5DN6A 4DLWA 1H8ED 1OHHA 4LWZA 1Z07A 4MRPA 3KUCA 5FTKA 5JCPA 2QP3A 5JFGA 4AYXA 1DAHA 4RZ2A 2H16A 2SHKA 3G82C 4Z8YA 3AEZA 3EA0A 4IDQA 1XJQA 3N70A 521PA 4Q21A 1VCMA 2FPKA 3SQWA 2DY1A 5EXXA 2XTMA 2A5DA 2EFEB 2YWFA 1VDZA 2OEPA 2OCBA 5HZHA 4URXR 1WF3A 2BHRA 2G3YA 5JBQA 5G53C 1IQPA 4DLSA 3KTAA 3P4XA 1D9XA 4G01B 3P1JA 2EYQA 3IQWA 2J87A 3U44A 1D8TA 1S1MA 1KI6B 1IY2A 3MMPA 4YMTA 3VR5A 1ZM3A 3CRW1 1P2TA 4RFSA 4UXJA 4B3XA 1KO1A 2PX0A 2DPXA 2YNMA 2G88A 5JJKA 4EAQA 1RJ9B 1WDTA 2YJTD 3U7FB 1CS4C 1RC8A 4B3FX 2WMOB 4BEBA 3TR0A 4V0LA 4B3BA 1D2EA 3QJYA 1UKVY 4GBMA 1MABA 2LKCA 4BFSA 4O2LA 3U44B 3NEJA 4P4SA 1E96A 2O8BB 4ZCLA 4FMBB 4Q5IA 3F3YA 3DZ8A 3LX5A 1AJEA 1N0UA 4HLDA 2I3BA 4NYJR 4OHVA 1KGDA 2QMUA 3EZ7A 3MWLA 4HI0E 1UBEA 1G7TA 1JNYA 2IXGA 1E2EA 4B6EA 3OESA 4A1FA 4BZPA 2VHJA 3EASA 4OHYA 3HJNA 1OB2A 4C4PA 1KY3A 1MABB 2J7KA 3WMGA 4NL4H 2GWHA 2Q3HA 1LB1B 4DSUA 4BLSA 1YR9A 4ZO4A 2JLUA 1NG9A 3WYGA 3GJXC 4IVPA 4UNRA 4MDFA 1G3IA 3SU8A 1U0JA 4M2LA 3AH8A 3M4YA 4E09A 2GZDA 3PITA 4NBSA 3H1TA 3P32A 1BS1A 4D4KA 5JS8A 4OHXA 1NVUQ 2NO6A 3I4LA 3SYLA 4DSOA 3QXSA 1NSTA 1EG7A 5TVKA 5D3QA 4YDHB 4DZZA 3ZS9A 1XPRA 3K8YA 4CT4B 1XD2B 2D62A 3QF7A 2FNAA 4LHVA 1M7BA 1CLUA 5FUWA 1A82A 2HT1A 2WJJA 5JRJA 2FPMA 4LC1A 1EFUA 5SZJA 4MRRA 2XZPA 1L4YA 1YJ5A 3W6OA 1VCNA 2ZJZA 3MJHA 4BUJA 4G5RA 4DLUA 2QRZA 2QAJA 4Q7JB 4B2PA 5JHHB 4E22A 1CR1A 3FMFA 1CJUC 1Z0DA 3WBKA 3HPQA 1TTTA 2CLCX 2ZAOA 1E2IA 4PZZA 3RRYA 4KBFA 3OIUA 2ZUCA 1Z08A 2F1RA 4AG6A 2QAGB 2VL7A 5FUVA 4XD7A 2BEJA 3B82A 4Q19A 2WSMA 1MO5A 1W4BA 4FMDB 2CCKA 2D06A 2O0KA 5J4LA 2BVNA 3VQTA 2ZRKA 421PA 3GLFB 2HJVA 4QM6A 2J46A 2XXAA 5HTKA 1VCOA 1QHGA 4UNPA 1KKMA 1C4OA 1YU9A 4LJ6A 2UVQA 1PV4A 1KO7A 1KDPA 4FWTA 3X1DA 3WYAA 1YZGA 1L7VC 4Q1CA 3L0PA 1PLLA 3WYFA 1HUQA 4C0JA 3DKVA 1JI0A 3NHAA 4Q48A 4XVQA 1ZC4A 3VNUA 2HEIA 2GBLC 3PEWA 3QPVA 3UK6A 1LV7A 1P9NA 1X8LA 4Q18A 3ETLA 2CJWA 2PEYA 3D8BA 4R98A 1OB5A 4CEIB 1SKYB 3EPHA 1T8TA 4CF7A 1XTJA 3W8NA 1KDRA 3Q7PA 4ZCIA 2YC4C 4JLMA 4MGKR 1KNQA 1Z0AA 1ZIPA 4CYMA 5IK2D 2V1XA 1R5OA 4Q9IA 3D6TB 2OCPA 3LXXA 2A5GA 1AZSC 5A0FA 3HYRA 4XVUA 3QIAA 1ZIOA 3TLXA 4M1SA 4PHGA 5HR5A 4E5UA 5HCIA 1Z6YA 2AKAB 2CLSA 1DG1G 4ESVA 2WJHA 4Q00A 3SOPA 5AUPB 2ZS9A 2ZETA 1QHHB 4LSGA 3WMEA 2OBLA 3X2SA 3AVWA 1GL7A 1PZNA 4HAXA 4LYHA 1VG8A 1WBBA 4WZAE 5DSZA 3B1XA 4ACAA 4GOXA 4DSTA 4RCYA 1EESA 3SBDA 1CR4A 1GTVA 3WRYC 3DEFA 4IFEA 3RS4A 5EXPA 3VHXA 3OE7A 4M9ZA 3VFDA 1G7CA 1LW7A 4Q7KA 1P6XA 4GNKA 1DAMA 2QSYA 3LV8A 5AJYA 2X8AA 3N5CA 3BRWD 1G9XA 3CH4B 3GD7A 3CNNA 4FN5A 4IVQA 4URVR 2BMFA 3CZQA 2IS6A 4AI6A 8OHMA 1YR6A 4CZ2A 2CDNA 2GBLA 5SZIA 2YV5A 3VR4A 2FFBA 2D7CA 2ZSEA 4BLQA 4Q4AA 2DB3A 1AKEA 2DWOA 2D3WA 2ODBA 3FDIA 4II7A 4TSFA 3K70C 5FL7D 1LFDB 1CU1A 2QTHA 1FNNA 2X2FA 1EGAA 4PC7A 5FBVB 3I8SA 4TL7A 1VHTA 3MWKA 1E98A 4HAUA 5FBRB 2YOHA 1E0AA 3VR1A 4KYUA 4OHWA 3L0IB 5KYKA 4LDJA 5KSOA 1TQDA 2W2TA 4PQRA 3GLHE 4PHTA 1ANKA 3C5HA 2OT3B 2IHBA 4Q4AB 3OEHD 4AD8A 4F93B 3LBIA 2IYWA 5FPSA 5IRCD 1VHLA 3FKQA 3PUVA 1LVGA 3MWJA 1G6OA 4RFVA 1XX6A 1W5SA 3CX7A 1KO8A 3NH9A 3B9QA 2C78A 1S3GA 1U81A 4BGDA 3VAAA 4TLEA 1BMFA 2GZAA 1X86B 2EVWX 1JR3E 2W6IA 4AG5A 1WBDA 3MRSA 2I1VB 6Q21A 3AM1A 4EPXA 4DCVA 2HCJB 5B58C 1AS0A 5FPKA 4HB0A 4TMWA 2FG5A 2OBNA 3AGPA 5EP3A 4DLYA 4BFWA 3IIKA 4QGGA 1T5IA 2CL0X 1E0JA 3TGPA 4Z54A 3P27A 4BLOA 3ZH9B 2JJ1D 4JSYA 2PZFA 2QEQA 4FW9A 4C0QC 5HPYB 3FMIA 4B3DA 3W8RA 1ZNXA 1SZPA 2ZRNA 5AJZA 2CK3D 2HYDA 3MCAA 1TQ6A 3DMDA 3GPLA 1OH5A 4DXAA 3LXRA 2IS2A 3CWZA 5H70A 4LYJA 2F55A 2FN4A 3PV0A 4BECA 1KDOA 3KXLA 3EZ2A 3EC1A 1US8A 1CJMA 2F9LA 2IYYA 1KSGA 4XTRA 1UKZA 4NZYA 4Q9LA 4L15A 4C0BA 1CEEA 2XSZA 3A8TA 4HAZA 3E5HA 1BO6A 3NWJA 4X8OA 2P6RA 2F1HA 2ZU0C 3K70B 5LB2A 1QG4A 4B75A 5BYKA 3TBKA 1CBUA 2OLKA 1DBSA 1G8HA 4QGHA 5M04A 5CK5A 1Z0FA 3QXCA 3LH5A 2BBSA 2XZOA 1DADA 2ZJYA 1N6OA 3CF0A 3GFOA 3AV0B 4LV6A 3LX8A 5HKKA 1US8B 1ZM9A 5BWMA 4QHSA 1XXHE 3VU9A 2JJ8A 4JLPA 5CLLA 3IQXA 1L4UA 2NO1A 3KKOA 1Z63A 3V00A 3ASYA 1T6NA 3X1ZA 3DM5A 2ZXUA 2RHDA 3QXXA 1NMYA 2R8RA 5CB6A 2FFAA 2QY9A 4FWIB 3QBVA 1Z0KA 1QHXA 2CCGA 1VG9B 2CMKA 3THOA 2QP4A 2GA8A 3QUSA 3T12A 1W4CA 1KY2A 2WV9A 5KUTA 4X8LA 5FTNA 3MFYA 4BZXA 1AA9A 2FFQA 3GFPA 4RSGA 4IXNA 4Q9KA 3CM0A 2WAYA 1XTIA 4PPGA 4M1MA 4RZUA 2F43B 4WXRA 3FMOB 3GEIA 3LRPA 4B3GA 3VU9B 4DIEA 1W0KA 1CKEA 2ZYWX 4JBXA 2NPFA 1UAAA 4TQ9A 2REXB 2RB4A 4GMXA 3BE4A 5JRZA 2FZ4A 1IAQA 2B7BA 1BOFA 2XOKD 5LDDC 4MUBA 2VP5A 3A1UA 3VKGA 1T91A 3GJ6A 2QORA 4QGFA 4NCIA 4HZUA 2ZRJA 2XITA 3QBTA 4CEHB 3C41J 2VSXA 3FTQA 4DDUA 2IUUA 3IO3A 4EJSC 2BMDA 4PHFA 2WMNB 1ZNYA 1E2GA 1XF9A 4DDVA 1VPLA 4US1R 4PAQA 5EXTA 1VTKA 4KCGA 1GOTA 2IA5A 1HY3A 4OI2A 1VYVA 2KB0A 1R0YA 3EAQA 4YONB 1EFRA 3GLHA 3IEVA 2HLDA 4CRWB 2XNDD 2LKDA 4NYMR 4J0QA 3DOEA 2LWIA 1R10A 2F3RA 4TMXA 3K9LA 1XCGB 4I81A 2PCJA 2QM7A 4QBGB 4F91B 1OKKA 4LK2A 5DGXA 4OKSA 2X1VA 5B2ZA 1F2UA 2FSHA 2L0XA 4HUQA 5JLJA 4CIDA 4JLBA 3ZIAA 3EX7C 1MO6A 1IY1A 3AVTA 3ZJYA 2ZE8A 5DI3A 3VKHA 3NIBA 2R44A 3BFKA 3SE0A 1JR3A 4BZQA 1E4VA 2ANBA 2O0JA 4KFRA 4OQXA 3ZZ0A 4ESHA 1J8YF 5DHFA 3KB2A 1IN6A 4LJ7A 2PZGA 1OIWA 4OYHA 2ZJ8A 4MRSA 1YVDA 2AD5A 4CT5A 4LPKA 1HQYE 2CNWD 2FH5B 1RPZA 1GDDA 4BFTA 3K9HA 1W1WA 4EPYA 1GWNA 2CHVA 1F2UB 3QXHA 4HUQB 4TMTA 1EWRA 4HLQB 2N46A 1XU4A 3RS2A 2BBWA 3HWSA 3I92A 2IX3A 3K9NA 1G20E 4BFYA 1G4AE 2VTKA 1P5ZB 2PJRA 4AC9A 5K8IA 3A1WA 1N6PA 2O5VA 4EFMA 4EJSA 4XVRA 1FMJA 1HEIA 4D25A 4ZIRA 5TV2A 4C7OA 2Q9BA 3I32A 2Z6VA 3M6AA 4M8NE 5EE1A 1E2NA 1U8AA 3U7HB 2MMGA 4AY2A 2JDIA 3EWSA 1FTNA 4XWAA 3FWYA 2REOA 2O8DB 3QENA 1COWD 3LO5A 1NLFA 2YWHA 5KDLA 5LPNA 4A15A 4M53A 1BH2A 1ZP6A 2IYTA 4XJXA 1U2RA 4A36A 4JT4A 3CBQA 2OE2A 1E1RD 3K0FB 1QRAA 1OF1A 1Z83A 4ON9A 1GL9B 4TLDA 4EJSB 2BIFA 4IEIA 2JLVA 2O8CA 3TJZA 4DB4A 1P2UA 1P2SA 1QDEA 2YZ2A 4P4UA 2BCGY 4QBFA 3K0AA 2ZRHA 3BC1A 3WNBA 1VG1A 3BOSA 4DLVA 3I61A 1Q44A 4Q4HB 4PC6A 4ASUA 1W0JD 4QJ3A 4PAMA 1XXHA 1W36B 3PFIA 1W47A 1OIVA 4WAUA 4TL6A 2CVFA 4JIMA 1U8ZA 4GZMA 4EFNA 1E9EA 5CITA 1P9WA 2VPPA 3OZXA 5H68A 3RRMA 3HYTA 5L3VA 1Y63A 4A9AA 3NBXX 3UWOA 1S0UA 1GNRA 1HYQA 1OFHA 1BYUA 2VSFA 3SS8A 1UFQA 2QBYA 1NRJB 2FE4A 1XEFA 4Y0VA 1GNPA 5JI3E 1F5NA 3K0AB 3LY5A 1WB9A 4B33A 2J41A 3BAFA 2C03A 3THXB 2R6DA 3A6PC 4LPSA 2JIZD 3AVYA 3MAAC 1XXHB 5L8VA 4D0GA 1CRPA 1JJ7A 3U6BA 4GOKA 1GRRA 1BKDR 1VECA 2R6GA 3C14C 2GAAA 3C16C 4NCHA 1N6NA 3SR0A 1EXMA 1N6RA 1FQJA 1KK2A 2DFNA 1NBME 1Q1ZA 4NE2A 1D2MA 1OXTA 4H9GA 2C96A 3NBZC 4HYYA 4QJ4A 3UG6A 1XEWY 3SFZA 4Z51A 3KQLA 2IBMA 4FMCB 3IDQA 1KDTA 2KBFA 2Z43A 3SYNA 5DYIA 3NG1A 2ZANA 1JECA 2IF2A 4YLGA 2H8KA 1AS2A 2WWHA 1ZC3A 4DEYA 2WJIA 4TTQA 2ZI3A 2DFLA 1KMHB 1NI3A 4EUNA 3FFBA 2EQBA 2CHQA 5JHGB 1E1QD 2TMKA 3ZD7A 3LLMA 5FR1A 3FHOA 1DAIA 5JSZB 1ZUNB 1CRQA 3M0EA 4QNMA 4BFXA 2XJ4A 1OW3B 4D82A 3LW8A 4KV9A 2ZU6A 5B30A 3RWMB 2V6JA 4JJKA 1WA5A 4PO1A 2BKUA 2ORVA 4CEJB 2A3RA 2GILA 2VF8A 4ZV4A 2J1LA 1Q1BA 2PCLA 3R9XA 5BN3A 2KI5A 4N0DA 1N0WA 2X77A 4WIAA 1TNDA 3TNFA 2JLZA 2JLYA 1X8KA 3CO5A 1GNQA 5KO2A 4MRVA 4M1KA 5GJVC 3REGA 1XZQA 4D4JA 5J47A 2NQ2C 3EIHA 5FR2A 4WOPA 4B2LA 4LHYA 2Z5FA 3U3KA 3VR3A 2O8EB 3B13B 5KDDA 3U3RA 1HT2E 2NG1A 2IEYA 2W00A 1O3YA 4WXPA 3C5CA 3MLEA 4Q01A 4QJ5A 5FOVA 2GJKA 4OI1A 3B60A 1ZUIA 1ZM2A 1ZJ6A 1XMSA 1MV5A 2NO0A 4JL8A 1ETUA 4DIDA 4GOJA 4RKEA 5C4GB 1OJLA 4ACBA 2GCOA 4MKHA 4C2TA 1JEDA 1E79A 4UKDA 4LY6A 1SXJE 2Q0HA 4QC2A 3ZYCA 3K0SA 3SN6A 1NVXQ 3X1XA 4M4SA 4Z1MA 4HLUC 3K0CC 4QL3A 2EFDB 2EFGA 2G1JA 2FSGA 2JJ2D 4NYJQ 5DIFA 1DEKA 2YINC 1LNZA 1KK1A 3TSWA 1I4LD 5LD2C 1SVSA 1TPZA 1I4TD 4MDEA 1PVOA 1RE0A 1GL6A 2QMOA 2QPAA 3JZMA 4MKIA 2RGNC 5F3WB 4XWKA 3TRFA 3THWA 3OF5A 2PZEA 4M21A 4F38A 4DLZA 1P9RA 3AF0A 1KSJA 4PANA 4NYIR 3CZPA 4AKIA 4P32A 2HXYA 1GRQA 1J7KA 2W2XA 2CEAA 2ORIA 1NL3A 1NY5A 4LCBA 5TXGA 1EFHA 3L2OB 4TQAA 3FOZA 2IL1A 2V7QA 3KQNA 3F5FA 1U0LA 3G0HA 4LJ8A 3CH5A 2P67A 4TMZA 3TSZA 2B8WA 3CPJB 2EWWA 3RYTC 4NMMA 3TUJC 4DHEA 5J5CA 3THWB 1E2KA 4B35A 1OH6A 5EQTA 4LBYA 4HAWA 4AK9A 1TX4B 3CKLA 1JALA 2AKYA 3EA5A 4IDOA 4R9UC 4TT3D 5FFMA 4BFZA 2RHMA 1RRCA 3NDPA 3ND8A 3GJ7A 3TW4A 2WWGA 2PBRA 2JCSA 5LBIA 3BH0A 5EUMA 2NO9A 1X1SA 2FU5C 2H17A 4MGIR 1UF9A 3O8RA 1MO4A 2FEOA 4DKXA 4OHZA 1GITA 1UBCA 2W6ID 1NBMA 2R6AA 4HLUA 3K0CA 5DE3A 1MT0A 3KTAB 1L8QA 4GT1A 3EXAA 1Q20A 1DVRA 3IPYA 4HLCA 2QE7A 1YR8A 4TYYA 4O2RA 2N1BA 3L82B 1DO2A 1QHYA 1SXJC 3AF3A 1KZ7B 1TU4A 4RFSB 3RC3A 2BMEA 1F3OA 1IY0A 4WA7A 1S8FA 2C9CA 1CF4A 4JLDA 4CDGA 3KKMA 2F9MA 4Q03A 2RGNA 1CJKC 3MD0A 5IT5A 4DCNA 4KBGA 5J4HA 1JBKA 3EZ6A 2FSFA 4A0RA 1HURA 3BWDD 3RC8A 3R9IA 4OQFA 4TN1A 4NU0A 2A78A 4DEXA 3K70D 5FTJA 4OQMA 2JA1A 1IN7A 3TH5A 2QGZA 4OK6A 3GLIE 4P4SB 4DLRA 3OFNA 3E2IA 1TQ4A 2JAQA 1GZSA 1OH8A 3GP8A 4C0HA 1J8MF 5LD2B 4UNNA 3U60B 3CW2A 3NHBA 5KTYA 2OLJA 5CJPA 4L16A 1WMSA 1JAIA 2AHOA 1LTQA 3L8ZA 4RD6A 1ZRHA 1AN0A 1ZVQA 3ND9A 3BIFA 3RS7A 5K8TA 2WWFA 4A0GA 2OO7A 4C0KA 3A1TA 4LZZA 4K81B 3T06B 1W5TA 3EG5A 2R2AA 3Q5DA 4KSCA 1F60A 4MKFA 4H1VA 3B2EA 2W6JD 1Z0IA 1ZW6A 4KVAA 5D3MA 2QU8A 1NLZA 1OFTA 3THYA 1NKSA 4LHWA 4W7SA 3AF2A 4M0LA 3U61B 3I5YA 2WHXA 3EW9A 1S9DA 2GXQA 2WVJA 4MYUA 3TUIC 4X8HA 3TK1A 4NPHA 2WSSD 4IOKA 2WWXA 3U3JA 3U3MA 4TZ6A 1KI9A 4PSKA 5FI0B 4Q1AA 1SXJA 1N5KA 2WPDD 3W5IA 1X8JA 3ZVMA 1G8GA 3LVQE 4GL2A 2HYIC 1YQTA 2WWIA 5D3MB 2IWHA 3O8DA 3TQCA 4KAXA 4LJ4A 4MGZR 621PA 1EWQA 1II8A 1K5DA 1KI4A 3HU1A 4A82A 4B32A 2HCBA 1VYTA 2CVHA 3IHLA 4JLOA 5JEDA 2QMHA 4FCTA 1EX7A 4POAA 3T35A 5CIWA 2REBA 1SXJB 3L43A 4TLBA 5C1BA 4DUGD 3JZAA 1I2DA 5P21A 4W5HA 1KI8A 2QA5A 1NVVQ 3AQ4A 3QPUA 3LWNA 1NJFA 3T5DA 2C5LA 3T61A 5JMTA 1XZPA 1RRGA 4IEEA 2XXAB 3DL0A 4QG7A 2RGEA 1JQLB 3BXZA 4PQFA 2FZLA 4OJQA 1II8B 1N5LA 5ELXA 4F92B 2GJAA 1TUEA 1XTKA 1FP6A 3PUXA 1G17A 2QTVB 1LF5A 1HA3A 2D7DA 2VP4A 3LBNA 4GP6A 1D9ZA 4TQUS 4GI7A 5EUQB 3RS3A 4B76A 2IC5A 1IXSB 1F6BA 2O52A 2GJ9A 2ZI4A 2ZVPX 2CJWB 3OAAA 3T1QA 2ZJOA 3K1JA 4A2WA 1XJCA 2AWOA 4BRUA 5KOYA 4QKQA 3L0OA 4LJ5A 1XWIA 1LS1A 2KWIA 2J7PD 3FKSD 1WXQA 2ZYTX 1AZTA 1E2FA 1U99A 1DTSA 1AGRA 3SJCA 4DVGA 4BE7B 3AKDA 3DPUA 2P6UA 3FPAA 1VIAA 2FDCA 5KNBA 2FOLA 2XTZA 1NNEA 1H8HA 2ZSBA 4BLRA 5A4JA 5FBQB 4Q1BA 4GFDA 4GZLA 3SJBA 1W2GA 3AKCA 1E2HA 3UWKA 3FMPB 1G7RA 1UJ2A 3ZVLA 1DAFA 2HDNB 2AL7A 2GCPA 4LOAA 4LYAA 2WTUA 1G16A 4IFBA 3KUDA 2ZJ5A 1DE0A 5KSPA 2ZS8A 3Q8XB 2W58A 1CTQA 3LA6A 3PEUA 5FOWA 3QVUA 1N25A 3X1WA 1S1CA 3GLIA 2WOOA 2ZI9A 4D2IA 4Q47A 1PUJA 3RRZA 1KMQA 2EYUA 1ZCAA 2GAOA 2HUPA 3GJ0A 1OXVA 2ZI5A 2OXCA 3DO6A 2C95A 1M8PA 3SHWA 2XX3A 3IUYA 3TQFA 3IBGA 1W36D 1W46A 3JVUA 4IRUB 3RSLA 3U7EB 1H8EA 1SVOA 4V0OA 1E9RA 4TLCA 3VR6A 4I1UA 2YOFA 2ZYVX 4EPTA 1QG2A 4HB2A 1XMJA 2H18A 1ZU4A 1KK3A 2E1RA 3D3QA 4QXAA 3GLIB 3QKSA 3CPEA 1W49A 4M9SA 4RD4A 2Q9CA 1T3SA 1OH7A 4V0NA 4C9BA 1QVRA 3TIFA 2WM9B 1DPFA 4BASA 4QNRA 1VCIA 4L4UA 5TDHA 4JL6A 4ERNA 5CYOA 4AIIA 1AGPA 3RSOA 1IONA 2QG6A 1BIFA 4AYTA 5F9HA 4PTLA 1P61B 1OV4A 5EZ5A 4LJYA 4ZDJA 3A37A 1FQKA 4NH0A 5C4MA 3GEEA 4V03A 4KITB 4R7ZA 2QPTA 4N3NA 2VHTA 2Q9AA 4BLTA 3TAUA 1G3QA 1WE2A 3QY0A 5AJXA 3BORA 4EKDA 3AF1A 4PX9A 5B57C 4IVRA 4US2R 2ZI7A 3SJAA 1YZTA 1FL9A 2VHUA 1FUUA 4RVCA 2IYZA 2YC2C 4NP6A 1N2CE 3I62A 1VIYA 5JI2E 1N6HA 3IIJA 1KJWA 4I4LA 1XFAA 5LB4A 2IW3A 4JLVA 2J45A 4A6PA 1SVMA 4JMPA 2GXSA 5TARA 3QKTA 3CF2A 1WP9A 1MKYA 4ILEA 4QOSA 4W9MC 2IS4A 4NYMQ 2WJVA 2RGCA 3H0KA 3IPXA 4H1UA 4DT1A 4G1UC 2H1LA 2WOJA 2HF9A 2QSZA 4U00A 1E9BA 1ZMXA 4I1SA 4KO8A 2R6FA 3UANA 1FX0A 3UIEA 4IOLA 2VQSA 3EPJA 5JWHA 3H86A 1R0ZA 5DLQC 5AUOB 1MRSA 3VHLB 1SKQA 5E7IA 2AXPA 2GRJA 1IXZA 1Q3TA 1K5GA 2E87A 3KJIA 3WRXC 1QHIA 2JLQA 2WBLC 4MITA 4KU4A 4URYR 2P0EA 1UBGA 4QBIA 1KNXA 1UM8A 1FX0B 1KJYA 2ZI6A 2ZRFA 4LJAA 3ZS8A 1Q3HA 5FUYA 1QBKC 5L3QA 3QEJA 4ITRC 1G18A 1NIPA 1ONBA 1XCPA 2PT7A 1G5TA 4LV5B 3RWOA 4AKGA 2OESA 2ERXA 2JATA 1W2HA 3TVDA 2WZQA 3F8TA 3FHTA 1XCMA 1DARA 4QHYA 1NY6A 1ZUHA 4LYFA 1NSFA 2QENA 1VKJA 3VNVA 1IN8A 3PVSA 2A5FA 4IW3B 4OK3A 1E32A 2GJ8A 2FMXA 2IUSA 4UXHA 4D4LA 4NTZA 3O8CA 3ZZUA 2QI9C 4JT2A 4YMUA 3ZVNA 4OI4A 5J40A 1IXRC 2Z4SA 3AVPA 2NGRA 2GXUA 2BM0A 2VP9A 2ZE5A 2RGAA 4R71A 1T3LA 3PEVA 4LUCA 1A2BA 4HZUB 5FPYA 2ERYA 3C8UA 3H4MA 4MGYR 4YXWA 3KDSE 5DN6D 2WAXA 1OHHD 2QUZA 3CR7A 1II0A 4IDNA 3ZVRA 2GCNA 4ZI3A 3GLGE 5IK2A 2CE2X 1MO3A 5GJWC 4DBLC 1JJVA 2ZRIA 4RZXA 4G5GA 1OXXK 4FI3C 3LDAA 1G1MA 2XTNA 4B71A 1A1VA 2VYFA 2W83A 3WNCA 1KSHA 4LI0A 5E7JA 3CNLA 4UJ3A 1NF3A 2QTFA 3GLHB 5JEEA 3ADDA 5EP4A 2QQ0A 3KQHA 1OT3A 1GM5A 5IF9A 5JZVA 3K53A 1T9HA 4RY2A 1J90A 3UMFA 1R5NA 4Q9JA 1M6NA 1EX6A 1FNMA 3O8BA 4ZDKA 1QVAA 1KSFX 3TAHA 2P5SA 1E2DA 3LLUA 2IT1A 3S1AA 4NCNA 5E95A 2GTPA 5F2EA 3SJZA 5DI3B 3T15A 4DLXA 2ZRAA 4GRAA 4PSVA 2ZITA 3QF4A 4RKFA 4WBSA 2ZAMA 5EP1A 3T34A 3I5XA 1ZU5A 4PC1A 4HDOB 3LNCA 2GDJA 2NZJA 2VEDA 3NBFA 4MH0R 1OSNA 5J4VA 4KHZA 1M7HA 2ODEA 2J3EA 3WY9A 5E3HA 2FF7A 4UNSA 5ANRB 4LBWA 2JLWA 1KO4A 3MJRA 3B9PA 4JSTA 3QKRA 3AUYA 3SDZA 5GADl 4LC0A 2IUTA 3FVQA 2ZJBA 4O25A 4PZLA 1E9FA 3W34A 2IHYA 3S1AB 2ORWA 3QI2A 1GP2A 1R4AA 2DHRA 4OQLA 1C9KA 4XOIA 3IO5A 3U4QA 2GZHA 4GPTA 1UDXA 4ZIRB 2RGDA 2ODWA 5GJBA 2IYQA 5FL7A 4C7OB 4LBZA 2GF9A 1R7RA 1PJRA 2Y8EA 5FBLB 4IOJA 3W90A 2ATVA 4PFSA 1K6MA 2IXEA 1IOZA 1XEXA 1QHNA 5JJIA 3J81k 2IXFA 5UKDA 3TSOA 4A8JA 2E9SA 3B5JA 3MG9A 3TE6A 1TF2A 1N3BA 2IYRA 4M9QA 3OEHA 1UPTA 1G3RA 4PC2A 2CL7X 4ABYA 3U4QB 2IYLD 2O8CB 5F9FA 3LD9A 1B0UA 5EJEA 4L9SA 3AF4A 2DYKA 1KOFA 1NMXA 4MYCA 5K8LA 4D0NA 1XEXB 2PMDA 1OXSC 3CR8A 1KIMA 4QBHA 2J9RA 2PLRA 1Y3AA 4HSEA 1G291 1S3SA 4ZKDA 1CULC 4UJ5A 4PPFA 3WNDA 1Z47A 1G4UR 2GK7A 3DDCA 2OILA 2CE7A 1TF5A 2CCJA 2RCNA 4OQNA 2R62A 4JZKA 4C30A 2C9YA 4EPRA 4DB2A 4FCWA 1JPNA 2D2FA 2QGNA 1OYWA 2QBYB 5AK0A 3UG7A 2ECKA 2ZPTX 4D80A 1W4RA 3TUZC 5CM8B 4BPBA 3LFUA 2IEZA 4XD7D 1LS6A 2A9KA 1DO0A 1ODFA 2JJ1A 2GK6A 1Z22A 2IF0A 3I72A 2ZJ2A 3AP2A 3GEHA 4JLJA 4RD2A 5AR1A 3SFVA 1G7SA 2NMVA 2DCUA 2PEZA 2X2EA 3AVVA 2QZ4A 4PSAA 3QG1A 2ZUDA 2GETA 2CK3A 1BYIA 4HDCA 2CHGA 5EXSA 3A4NA 1R6BX 1XTQA 4XIGS 2NOAA 2Z83A 3NEYA 1KI7A 1S4QA 2VSOA 4NYIQ 2F3TA 4O0MA 1DAKA 1F48A 1KI1A 1Q22A 4JKYA 4U5XA 2H5EA 3A1VA 3PXGA 2G0TA 3CF6R 5DNYB 4HDQB 4QRHA 2VLIA 3LVRE 3GLGA 5FTLA 1IJFA 3BFXA 1S96A 2ZRLA 2D4HA 3WBJA 2VP6A 1IBRA 3ECCA 2ZR0A 2Z4RA 3IEUA 5FH9A 2QNRA 2H7VA 4QM7A 4RJLA 4JVSB 1AQYA 4Q66C 1G3UA 3NC0C 4AKHA 4P33A 1VMAA 3EZ9A 5C46F 1XNJA 4DRZA 1DELA 2BBOA 4M1TA 1SVIA 2V54A 2YWEA 4GMDA 2JLXA 4URUR 3PUZA 3FHCB 3MGCA 4URZR 4KVGA 4MQBA 3GQBA 3P4YA 4D4MA 3B1WA 1OE0A 4TL9A 1I4DD 4ZDWA 1II9A 3REFA 1E4YA 2DWPA 5E4FA 4OI0A 3DMNA 2B92A 1OFUX 4PC3A 5FOSA 2Q21A 1G8YA 2PMKA 2AN9A 1G19A 3OE7D 2B7CA 2PH1A 1T0HB 4OK5A 3GLFE 4Q1EA 5IHPA 4D26A 2XOKA 1XPUA 2WJGA 3U3OA 1QHSA 4MA4A 5JS7A 1TMKA 5FPHA 1YZNA 4DCTA 3T5GA 1U9IC 3PQCA 2AD1A 1ZM7A 2WWYA 2Q3MA 3V9PA 1FW6A 2GCOB 4N1AA 3SHFA 5EE0A 4JLKA 5KDOA 5CLQA 4B43A 2VHQA 1IJEA 4KFUA 2P3SA 1ZNWA 2V9PA 2P2LA 4JVNA 1XP8A 1IM2A 3DHWC 3CX8A 4TSFD 3CRRA 1HQCA 1F2TA 3OIVA 4OBEA 2ZYUX 4MRNA 4D6PA 5HZKA 1IHUA 1T3HA 4PPQA 2J0QA 3C15C 4YMWA 4XWOA 2XNDA 3BK7A 5G40A 1JXMA 4B73A 4FMCF 4GP7A 1Z3IX 1P62B 2WKPA 1P75A 3ASZA 1N6KA 4W5WA 4YMSA 2BCJQ 2V6IA 1KI6A 2XAUA 4C0LA 4I1VA 4PZYA 1UEIA 2Q6TA 1Z06A 2VP0A 3MUFA 2RKOA 2Z0MA 2BC9A 4LV8B 1TUIA 1JPJA 1F2TB 2ZJAA 4KODA 1RJ9A 4DLTA 2RGGA 1BMFD 2QRNA 2G1KA 1YE8A 2IK8A 1CR0A 1R8SA 1GFIA 2AFHE 2ZRGA 1GKYA 2ASEA 1MR3F 2CNWA 3BJIC 2MSCB 1LF0A 1Q0UA 4PO9A 1KK0A 2OHFA 3DM9B 4DCUA 4TZ0A 2O8BA 1U9IA 4V0KA 4IHQA 5JJLA 1AQUA 2QAGC 1J99A 4LGMA 4P3YA 3BD9A 4C0SA 1P60A 3SBEA 4L5BA 3W9YA 5JECA 2QN6A 4YMVA 5KHOC 3KQUA 1ZYUA 2X19A 3K0EA 4TL8A 2P5TB 2ZS7A 3C7KA 2VIIA 4D0LB 2ODNA 5HE9A 4FXPA 2K5UA 1P3JA 1EK0A 1KHTA 3D31A 5J4YA 4EPWA 3RHFA 5L3SA 2I1QA 4Q4JA 4XSGA 5SZHB 3KFXA 1J2JA 1E99A 4KFTA 1CJVC 1D5CA 1N5IA 2YYZA 4ARZA 1COWA 4HB3A 5DISB 3BS4A 3K9GA 4JJZA 2V1UA 3O47A 1OIXA 2FPLA 2GJSA 2PJZA 1E1RA 3AVXA 5AWFC 2GXAA 2QL6A 2A30A 1R2QA 4G5QA 5GJCA 3IIMA 3QSYA 5KSZA 2RGBA 1XD8A 1YZUA 2XSZD 3B7GA 3CONA 2GVZC 3GJ5A 3LQQA 1M7GA 2QM8A 4LRWA 3GCGA 1XD2A 5L3SB 2EW1A 1NIJA 4Q4JB 4QFMA 1W0JA 3E1SA 2AXNA 3B8HA 4ARZB 1HV8A 3ZD6A 2MSDB 3HPRA 4JL5A 4XSHA 1KAGA 4EPVA 2OCYC 1G5PA 1YZKA 5HKKD 3PENA 2WICA 1Z6AA 4M1YA 5JWRA 1X3SA 1EFCA 3H84A 5FOXA 2GEDA 1GRNA 2GESA 3Q3JB 4X8MA 3RS5A 2MSEB 5AJVB 4YQFA 3KZ1E 2QAGA 4JVLA 1JB1A 1UKEA 1KYIA 3PCRB 4YDSA 2JIZA 3RS0A 2WJYA 4C0AC 4NHOA 1GAJA 3THYB 1YRBA 1U94A 2AR7A 1S9HA 3GLFA 2C99A 3UMRA 2OUKA 2W0MA 3IBYA 5L3RA 3QG5A 3I73A 1W0KD 3PR1A 3U2QA 3EARA 3KL4A 4KLNA 2ANCA 4Q4LA 3FFAA 1WQ1R 3NTUA 1NMZA 5DO9A 3RLFA 1G21E 3B78A 1E0KA 2JLSA 3AP3A 3HR8A 5BN4A 3EIQA 4B34A 4PHHA 2DR3A 4TYNA 2OM2A 4LX0A 4CEIA 3HU3A 2KSQA 1X1RA 2XB2A 2QT0A 1Z2CA 3R8CA 2F1JA 2VHCA 1E1QA 3R8FA 2O8FA 3WXMA 2NTYC 2FGKA 1DOAA 3SEAA 4B48A 4L8GA 1TL7C 2QT1A 1E0SA 3IILA 2V8OA 1U0HC 4WW0A 4G0NA 4JVMA 2QQEA 1EFRD 3SNHA 5JWOA 2OXRA 5FUXA 1R5BA 2HLDD 3KJHA 2NPIA 4DWJA 2Q3FA 1ZD8A 5KNDA 1GILA 1SHZA 3NVAA 4NCJA 2R9VA 4YXWD 3ICEA 2BV3A 1RYHA 1YKSA 1E9DA 3KJEA 5FI1B 1QHHA 4ZI2A 1OKKD 1H65A 2O8FB 3A4MA 2CBZA 1XMIA 4FCVA 4RD1A 3ZIAD 1RIFA 4M1OA 2ZSFA 3LBHA 1OXUA 4E03A 2BWJA 2H57A 4AURA 2ZIAA 2RGXA 2VP2A 2XB4A 3OEEA 3TR5A 1JR3D 1ZM4A 1MRNA 2WIAA 3HP1A 3RNLA 4FIDA 3KB1A 4Q1FA 3OIYA 4DSNA 3GJ4A 2ZROA 3PUYA 1S2MA 4AYWA 3KQKA 3RABA 1T0JB 2J0SA 3EC2A 3UMSA 1AIPA 4Q02A 1ZINA 4LBVA 4G3XA 2R65A 1PLKA 1V43A 3F0TA 2J0VA 1CXZA 4M1WA 4XH9B 1E2PA 2WKQA 1AS3A 3BH7A 3BB3A 3B6EA 3QNUA 1N6IA 4NKRA 3CNOA 2J0UA 2J59A 3NXSA 1Z28A 2C2HA 3I8XA 3OHMA 3PJRA 1FTSA 2DFKB 3MWYW 2DWQA 3Q72A 5CIQA 1FFHA 1Z6XA 1ELOA 2RAPA 121PA 1UKYA 1TF7A 1Q21A 2JJ2A 3ZQ6A 2VF7A 1N5JA 3R7WA 4EIWA 2JDID 3AGQA 2GEVA 4TTRA 5TB5A 1SVKA 1YRAA 2G83A 1Z5ZA 1XDBA 4DCSA 4F4CA 1A7JA 1A2KC 2HT6A 5FL3A 1P72A 1HTWA 3HDTA 3W6NA 2IYXA 1Z2AA 2J0UB 3VX3A 2V4ZA 1JAHA 3CRVA 2G77B 4G5SA 4FMDF 721PA 2IYVA 4Q7LA 1RZ3A 1ESMA 3QQ5A 1ZD9A 4KJZA 3UPUA 3VKWA 1HE8B 4Q9HA 2ZSAA 1CJTC 3LW7A 1E9CA 1NVVR 4TWZA 3R7WB 3UKDA 4GDFA 2VRWA 2JEOA 3V4RA 5CB8A 3AVQA 2C8VA 4ASUD 2UKDA 3U6KA 2F6RA 2NO7A 4Q1DA 1U98A 2NZ8A 3A4LA 3WMFA 4KYIB 3RANA 1KO5A 2OV2A 5CJ2A 4A2PA 2DBYA 3U7GA 4AWXA 2O0HA 4NDZA 3AVOA 4IOMA 1ZBDA 5JCZA 4A4DA 4TYWA 2LCFA 3ZDQA 3N2EA 3EZFA 4TT3A 3QKSB 4V0ME 4U7DA 2EFCB 2OAP1 4PPNA 4FD2A 2C77A 2PX3A 1XTSA 3K09C 2AFIE 5B64A 1JEEA 1UADA 3Q5EA 4B3CA 4HEJA 3BB4A 4KI0A 2CL6X 2YOGA 4FINA 4GSYA 1QF9A 1IN4A 4LHXA 4BLPA 2DFTA 3HU2A 5KPDA 3LQRA 2WIBA 1GIAA 3UATA 1G8PA 1VYUA 3I1FA 1E69A 4JYCA 2F1IA 3PEYA 1FMLA 3CIOA 4TYPA 5CDFE 2QMEA 3SC3A 3KXIA 1UDWA 2YWGA 1B23P 2OFOA 1P7CA 1XRJA 3B1ZA 3SQXA 2CLDX 2ZUBA 4KFSA 5FPTA 4Y0AA 3EIEA 4F7WA 2V3CC 1YZLA 2ZRMA 1T4GA 2FX3A 3KKQA 2ZTSA 3M1IA 3R9WA 2FGJA 2QPOA 1E2JA 1AM4D 1P73A 2QP9X 3KFVA 5SZKB 1SULA 2AK2A 2VA8A 2XJ9A 1T8UA 4U02A 3WHLA 2OSBA 3CX6A 1VG0B 4D81A 4V02A 4HB4A 4PXAA 1GUAA 2B8TA 1FP7A 1RYFA 2OG2A 4IDPA 1KJZA 5EZ6B 3W5JA 2BMJA 1TQ2A 3KXKA 2RH5A 2A5JA 1G5RA 1U8YA 1D6JA 3IGFA 1CR2A 3FGNA 4OJKA 2HJGA 3SI7A 4HATA
chains in the Genus database with same CATH superfamily
1JFFB 1Q57A 1FOEB 1I33A 4WOJA 2ZM5A 1F5SA 2ID8A 4CGZA 1NW3A 1HSZA 2PGXA 3MB8A 4EEKA 3AKEA 4JC0A 4EKYA 3O03A 3PHHA 2XZLA 1E7RA 4RPCA 2RARA 3GJQA 2YIJA 3PHGA 4E3ZA 5IZCC 1TCCA 2B4YA 2H7CA 1CD5A 1QYRA 1JLMA 2P2ZA 4F21A 3RTAA 1DRVA 4WNAB 6REQA 1PWYE 1ESNA 1YJQA 5BSMA 3KSAC 1JLHA 5K6RA 3DZDA 2R48A 4ESEA 4MIYA 5IABA 2A92A 2DTXA 2GPSA 4DDWA 4I08A 4BXOA 5AJUA 1P5HA 4HN9A 3ZY5A 3SVTA 4KQFA 1XMVA 2O07A 2QV0A 4C08A 1N2EA 4C6SA 1NKVA 2EWVA 1PLJA 2GKGA 5JSKA 4LHSA 4EWLA 1E79D 3DJYA 3F6PA 2C04A 1IRXA 1Q1NA 3FLMA 1NTRA 1X80A 5FBWB 1WZ2A 4U0JA 3EJ6A 2HZBA 3JPWA 1D2HA 4K46A 1QK4A 1WO8A 1UBLS 3HY3A 4I46A 2C98A 4K5QA 1YQXA 3TGWA 1M2OB 1W4AA 2ZRBA 1YKGA 4B6FA 3KYCA 5J58A 1UEJA 2UUPA 1A3CA 4PS0A 3D1JA 4TRRA 3FPSA 5AVJA 3TIGA 1DS6A 2PMFA 4WKBA 5CM9C 5BSVA 4BKPA 5L9AA 2OGSA 1WXFA 1LY1A 3HVIA 3G49A 4J94A 3NCHA 1DOZA 4MJ7A 2G9NA 1NMEA 3VPCA 1NP6A 4MGHA 5TY0A 2Q50A 2VRCD 4RZ3A 5FT9A 4I2VA 4UE3S 1RMQA 4M37A 2XXBA 4I1OA 3L79A 5J1TB 4F4IA 4XM1A 2I4IA 1T15A 3C3EA 4N5NA 4BNUA 2KJQA 3QE0A 3ZCQA 4Z1OA 2ZRDA 1R8JA 2WABA 2OK8A 4MUMA 4PGAA 4JDUA 1FXUA 1NG1A 1SOMA 1UANA 5FJIA 2ZEJA 2CXQA 2J6IA 2F90A 5BOVA 5LP6A 4CE6A 2OHXA 4ZPXA 1JEYB 3SQDA 2HMYB 3IKJA 2RK6A 4MW5A 1YK0A 2C2GA 3AEQA 5LQJA 3EDMA 5CCBA 1R15A 2GBFA 1AUOA 1WDKA 3Q2OA 1Z74A 4GAEA 2X0IA 2IDZA 2ZR9A 5THXA 3L05A 4FLMA 2AFIA 4LN1A 2OOSA 3FKSA 5G1NA 2BBTA 2KE5A 2ZVQX 5B3KA 4O4JA 2W37A 4UXIA 4KN9S 4LG1A 1EFTA 1Z6TA 3EIXA 4JGGA 1IPFA 5C18A 1Q1EA 1OLSA 3VZPA 4PCUA 4UU1A 3INNA 1Z9BA 4Q7MB 4LXUA 3EXFA 4YNBA 3B1YA 2VZ8A 3DUFB 4FLEA 2O8DA 1UJNA 2TMGA 3LKZA 4G1FA 2FSIA 1I7LA 1JR4A 3TTSA 3VH4A 2JLRA 1A69A 3JQBA 1X0VA 4IO1A 1W1UA 2FEPA 4RLSA 3G9UA 3TCXB 2I3ZA 4IWXA 3GF4A 4D9HA 4Q3KA 4GL4A 4WUVA 4P4TA 3DZFA 3G2LA 3FUVA 2WDZA 3TOXA 2IPNA 3VMFA 2QVCA 1EFVB 4QICA 2O7VA 1SVWA 3BRSA 3A4IA 2W2LA 4N7RA 3TEMA 4C4XA 4EKEA 2VUSA 3FWZA 4UAJA 1JKJA 1CK4A 2E4VA 4DCOA 5B3JC 2NAFA 3G8YA 5MF6A 3BMNB 3HEAA 1UMBA 1FU8A 3GRPA 1QIGA 2W6NA 1EVZA 3QKRB 3UEOA 3CRQA 4BWGA 4L4XA 2M32A 3N76A 4BC1A 5HBGA 3N2YA 3O7MA 3K0HA 1IE3A 1HFJA 2ZJFA 3DZIA 4WY5A 3EPKA 1CIPA 4D3DA 2ZFUA 4NJEA 2Z8YA 3NBMA 2VPTA 3WSVA 3P9ZA 1GXSA 5ER9A 1D09A 1PZHA 4H6VA 3ACCA 1K3TA 3E5NA 5EOVA 3KDAA 1HH4A 2X9GA 4YAJA 2R751 5E7MA 5JYDA 1Y9EA 3FE2A 4LHZA 1H1DA 1UC4B 6LDHA 3D6AA 3F7TA 4D98A 2XUZA 3W8RA 5DTRA 5EZYA 4BQRA 2FY8A 2ONJA 3PD7A 4K9SA 3RE1A 5B6JA 3NKFA 5FB3A 4HAVA 1TQHA 1OYYA 2OORA 3ZQJA 1NLYA 3JWIA 4JEHA 3WOVA 2C2BA 3P0JA 5C8DA 2BJHA 4G6ZA 4AKEA 4KMSA 2XWSA 1E9SA 5EI5A 3GMTA 3ZJUA 4IIGA 5ADUS 5H1YA 3MTQA 2PT5A 1Z29A 4AXBA 2A2ZA 1E2QA 2EZ8A 5EE3A 2VFAA 3RJ9A 3FRHA 2XNSA 3U4AA 5BN5A 2CXXA 4A0HA 5EE5B 4WBNB 5D5QA 1RFLA 4IJWA 2M6SA 3RBAA 1KYXA 2I6FA 3LAWA 1SBCA 4MYTA 1Q0SA 1S8NA 1YI0A 5BXQC 1G5IA 4C87A 4WCDA 3H2YA 4OB6A 4Z3KA 3VSDA 3HN7A 2BF4A 4HQ0A 2CFTA 5E9JA 2E1PA 2G63A 5GQSA 2AR9A 3CZ9A 2OMEA 1XDSA 2YFYA 3ILHA 3MVEA 1DC4A 2GEKA 1MX5A 3L0SA 4M22A 5K2MA 3QWFA 5JSFA 2VBCA 4DRXB 3GFTA 3KSZO 5DTEA 1QIJA 4X24A 1U8XX 3LFTA 1ZH4A 4DF3A 1SQ6A 2WSBA 2WWRA 3LT1A 4NENB 1KWGA 5F12A 1T36A 2CMGA 4OMCA 3QXJA 1MHPA 4OUKX 1XN4A 4IJUA 1V1RB 4KE8A 3DMGA 2F59A 4C2UA 3RK1A 1EFPA 1RI3A 3ABIA 5ALLA 3V1KA 1V5WA 2ZUSA 2HTFA 4UDNA 1FXWF 1NKTA 4HXFB 4WINA 4CEJA 3EWAA 4C2AA 4CM1A 1WSAA 4PQEA 1U7OA 2QK4A 3GCXA 1JEAA 1MFPA 1OY1A 1TTQB 1WSWA 1VJDA 1V8PA 2PJUA 2GKSA 3LJKA 1B1CA 1ZD4A 2IOFA 1PU2A 2GS9A 2RI6A 3HA3A 3KVYA 4XXHA 4ZT7A 4EBBA 4UU8A 2B82A 2HRBA 1FNCA 2FWNA 5K8UA 1ZGAA 4WLEA 2XCSB 3HEBA 2FUG1 4UVGA 5FQOA 3RDPA 3WGZA 5CB0A 1KKLA 3RVBA 3DPSA 4BJ3A 1ZMRA 1GPAA 3U3ZA 2HV8A 2ZRPA 1YZVA 1XEWX 1GVNB 2C5FA 3I9FA 3TB6A 2O8EA 1HDIA 2HL6A 2B20A 2IVFA 1NN3A 5H02A 5CB4F 4OFZA 3INTA 4YFVA 2B2CA 1C7IA 4X64B 2A9VA 2JAPA 4O1HA 2JFUA 3OAAD 4C22A 3A10A 2EQ5A 2P5UA 3D2CA 4S35A 1BFKA 2FLKA 1IZ9A 1R66A 1SBHA 2WTBA 1NC3A 3BM5A 3WQQA 1YBHA 3RJMA 2PX8A 2L82A 2XUJA 2HQRA 3NH6A 4J8PA 4PYMA 4HQFA 1IHOA 2EJCA 4P08A 4ZTUB 4CFSA 2GN0A 5SYMA 1FTGA 4I99A 4F86A 1GKUB 3WKAA 5ALKA 1YFJA 1R3UA 4B3JA 3EXIB 3GEMA 4JLNA 4KC0A 4CI0B 2F9FA 3GJSA 3KKPA 1PGOA 3ROQA 4OXXA 4BRWA 3N2NA 3O3CA 1WXWA 2CHFA 2JKVA 3H2HA 4DC9A 5JD6A 1U3DA 2BGJA 5BMVF 1LW6E 2OWEA 3QYAA 3BB1A 1TA0A 3PZRA 4JX8A 4RJ2A 2IZ5A 4DVJA 1I3OA 2AG5A 3X2EA 1SU4A 3HGMA 4PZ9A 1A04A 4O6VA 4WVFA 5REQA 1T4DA 3UJNA 1RYEA 3PYXA 2G09A 4HDRA 4TTJA 2NVOA 4R4JA 4ER3A 4Z6KA 4H2DA 1XBTA 1XJ5A 4E13A 4EZEA 1B15A 5BOSB 1BD3A 1YHNA 4BZZA 4BNGA 1W73A 1Z6GA 4W7IA 1MOQA 1CB0A 4IJMA 4RE5A 4KUHA 1POWA 1RVDA 3VTKA 1C0EA 5DYGA 4LJRA 1ZZGA 4YRCA 4ZKEA 1AKYA 5JNUA 1A9QA 3Q9LA 4IKPA 1YU6A 4PWZA 4IRMA 4MYHA 1SOWA 1W44A 5AP9A 4DDTA 2F7SA 1LUAA 2AK3A 3CW9A 1E2LA 3WSTA 1H5UA 1OA1A 1QLWA 4CMIA 1J8FA 1SUDA 4JZYA 2WP0A 4PLGA 3DHNA 5TNXA 1WHTA 1TZBA 3P2EA 4KQGA 4QODA 1IXYA 5FTKA 5AW0A 1KRHA 1OC2A 1NX9A 2SHKA 3G82C 3KRTA 3HKEB 3CV3A 2JF0A 1DX9A 3N70A 2O5CA 1NC1A 2AI1A 2YUIA 4DIUA 3IBSA 4Q21A 4M0PA 4LECA 1VLMA 3G8DA 4AWBA 2XTMA 4IF4A 2YWFA 3FTPA 4L72A 2OCBA 5DYWA 2N3ZA 5HZHA 1XL1A 1AK9A 2C2YA 3WWYA 3DAPA 4FNGA 2C0CA 3IAS6 5ERGB 4BTEA 5LP1A 4KLRA 2GERA 2IEAA 3V5NA 4MUGA 4PX5A 6AT1A 2QLMA 1Y6FA 2JGDB 5TT0A 3IP7A 1KDVA 4C3VA 2YRWA 1IIRA 3IVMA 3JVIA 4L5AA 4Q1VA 4MVJD 3BWVA 1K98A 4RBNA 4F5DA 4N7JA 3MMPA 1N3LA 1P2TA 5EQFA 1Y6QA 1XJWA 2JI6A 3OPXA 3RF6A 3ENNA 4UXJA 4B3XA 3AFGA 3MHPA 4RJJA 2PUGA 2BGKA 4OAPA 1J9GA 3CJRA 5ALQA 1Y4ZA 5BUSA 4NNJA 4EAQA 2I6UA 1WV0A 4JUBA 1QX4A 3BHJA 3FIJA 3HU5A 2YJTD 3VC3A 5JO0A 3P9XA 4MV4A 1CUZA 5E2AA 4EB3A 3U7FB 4B3FX 3AZOA 1GQQA 3HN2A 3HRIA 4FSDA 3TX6A 1DQYA 4OXIA 3SHVA 3FTEA 2WR8A 3H2GA 3NT5A 1MABA 2JAWA 2GBCA 2I9PA 3UJ9A 4B5LA 4JUAA 5T4BA 4E31A 3HVRA 1NW9B 1XI2A 3LUDA 2YJ4A 3LX5A 2CLHB 4F8EA 3C1TA 4B7AA 2ZR8A 5HSGA 5DMXA 1U1GA 2NU9A 2QMUA 3EZ7A 5CH8A 3R6LA 1THMA 5IU6A 5K6TA 4FWBA 1E2EA 2A1UB 3ZHSA 2QKYA 1JSXA 4B6EA 2V4UA 4QDUA 2EBUA 5DHSA 2YJ6A 3PUKA 4Y2VA 1FZTA 3EASA 3O74A 2ECPA 3KT3A 3RBXA 1ENPA 2CDAA 4TZTA 5I8PA 5K01A 4ZV9A 4JR1A 4BV3A 1FDSA 4NL4H 1PYGA 2GWHA 1D0VA 4DSUA 2E37A 4RA9A 3ABZA 1SCBA 2DFPA 3OM1A 4LF7B 1ESEA 1ZQ1A 3KZMA 1E4EA 3DV0A 5ALSA 3GJXC 4IVPA 1GFZA 4CHTA 4COKA 4MDFA 1G3IA 2AZMA 2H0AA 4M2LA 1XYGA 3AH8A 4B4OA 1J2UA 4QTXA 3UA3A 4EHBA 5LQKA 1ZH6A 3ELYA 1PJBA 1BS1A 3PGA1 4D4KA 3ZE6A 2OHHA 1JDVA 3EW7A 4YP1A 1EG7A 2Q1UA 4IZ6A 1CFZA 3IJ5A 3KEMA 3PNBA 1IJBA 3PNOA 4M7PA 1XPRA 3K8YA 2J3MA 2V4MA 3BXXA 1XD2B 1S02A 1C0LA 2D62A 4TXMA 1QRSA 1JG7A 1Z5PA 2AQHA 2FNAA 2ZWOA 4ISBA 1TUGA 4BVBA 5K0SA 1HR0B 1A82A 5A9SA 5JRJA 1J49A 5SZJA 3TW0A 3W9SA 5KCZA 2HWWA 1F0YA 3W6OA 4C29A 2HREA 1ST2A 3UKOA 4G5RA 4DLUA 1SCUA 2VDKB 1P1IA 3X43A 3E5MA 4D6XA 5JHHB 3OG9A 3M6XA 1CR1A 5TJ9A 2Q9UA 5EJMA 4KO4S 3A4TA 3H11A 1HYHA 4P35A 4PQGA 4AZ3B 1E2IA 1V9LA 1UZUA 1NT2A 4Y1FA 4CT0A 1PGNA 4DC0A 4JQZA 1DMSA 1VHQA 1Z08A 1Z25A 4C5BA 1YJBA 4QLBA 4BBJA 1C30A 2QAGB 2VL7A 4KMRA 2E21A 5FUVA 3EXG2 3KYIB 3NNSA 1WMEA 4A5SA 5EWJB 3EEIA 4RXUA 4F4HA 1OILA 1W4BA 1M34A 3PPVA 4RQBA 5ELLA 3GRUA 5J4LA 3VQTA 3IJRA 2XA1A 4QM6A 1AD2A 2WWVD 4OUDA 1M1YA 1UC5B 3LUCA 4GZ6A 1KDPA 4H16A 2H2AA 4RLHA 5KVSA 3HI6A 4PIMA 1L7VC 3R5HA 3WLRA 2O1SA 3SY8A 4J7CA 3Q8LA 2O20A 2SCUA 4C0JA 3DKVA 1R9JA 3UB2A 2WNHA 3CUWA 2HEIA 3PEWA 4MR7A 4Y7DA 4DLRA 4EUSA 3SVLA 2OZVA 4Q18A 3O5AA 4F8JA 3JTMA 4G8DA 4LC9A 2XCUA 1SKYB 3F4LA 2C4HA 3UFXB 4FYPA 1ML3A 4C0XA 4CF7A 4W5TA 2Y99A 1XTJA 2AF3C 3GNSA 5G0TA 4BDTA 4YK7A 2Q45A 2YC4C 2VDRB 3OU6A 4JLMA 5C8YA 2XE8A 1N2BA 4CYMA 3AOEA 4FK8A 5IK2D 1IBMB 5HQTA 2QN9A 3LXXA 5BV2P 4NU5A 5A0FA 4JI3B 2EWMA 3ZU2A 5FKJA 2HY7A 4R1NA 2X6RA 1RXVA 4X93A 1OGIA 1VKHA 1WXEA 2Y1FA 1W93A 5I9BA 3HKDB 4XVUA 3AJDA 1NJ6A 3GGOA 1ECFA 5GV7A 3TLXA 3UXEA 4ED9A 5L4SA 4TUYB 3T5BA 4E5UA 4DTIA 4FB4A 3BMQB 3LRTA 3GMDA 4L02A 4LISA 4HVCA 2RGYA 3DW1X 5J2TF 2PWPA 4PBSA 5HKOA 5H9WA 1GL3A 5I7WA 3HDJA 5AUPB 3RVNA 4Q9AA 5KTRA 4EF4A 4QXOA 5PGMA 5G0VA 3AVWA 2F4NA 3CCBA 4LYHA 3A2LA 3AR5A 4ND8A 1OWMA 4ID9A 5DSZA 5TMDA 4FX5A 4U7JA 3SEFA 1Y5LA 1LK0A 1EB9A 4RS3A 3RYIA 2LNDA 3PJFA 2XB8A 4HP8A 2GD2A 4RCYA 1Y8RB 4UUMA 1CR4A 3SBDA 2UUAB 5KQRA 1T2NA 3DEFA 4IFEA 4N47A 1RCTE 4E21A 3RS4A 3ZXSA 5A2QA 4MP8A 4R8MA 2J48A 1A5ZA 3IV6A 3VFDA 4PRZA 1VJGA 4LY0A 2WA1A 4E88A 2GYVA 3HYNA 3IR6A 1ADFA 2QD3A 2V0CA 3UJ8A 3NRJA 3ZE0B 3CH4B 3GD7A 5IBRA 1FDWA 4KAAA 5A05A 5JFOA 4ZV7A 4IVQA 3R24A 2BMFA 5JY1A 1IHYA 8OHMA 1L3IA 1U1FA 1YR6A 4CZ2A 2GBLA 3HO1A 3LMKA 1Z7YA 2UZ0A 1LBHA 1GCOA 2D7CA 5ALRA 2W8BB 4REOA 4Q4AA 3AQIA 3LYHA 1E1CB 3AI7A 1ZA1A 5JBIA 2VDWA 1T8SA 3DKRA 2EL7A 4B80A 3K70C 2I22A 5FL7D 1V2HE 4F96A 1NW8A 2QTHA 2X2FA 5FBVB 3T3OA 4GGOA 4YP5A 2O54A 3REOA 1FFAA 3MWKA 3N05A 3WS7A 2YOHA 3FZGA 3E7DA 5DCYA 4BNVA 3LCJA 4AJOA 2B0JA 1FYXA 1TQDA 3RT9A 4I55A 3LQ4A 3GLHE 4PHTA 1ANKA 1EH5A 1VQ1A 3PICA 4YJ2F 4HN4B 3L93A 3PHLA 2QU7A 3DMTA 3DCNA 3KIPA 2IYWA 1QZ3A 1GCUA 3ENKA 4XFDA 3PUVA 2O3JA 3HNRA 3PVZA 3PNKA 2HUNA 2PKQO 1JSRA 2FSUA 1ZEJA 4RFVA 3VPSA 3OZIA 1C5KA 1QIEA 3MT9A 2O2XA 3QIVA 3QFTA 1IEQA 2IFTA 2I3GA 3SXJA 1CQZA 4ER7A 2Q7OE 1RZRA 1AGNA 2QUAA 1NVDA 3R1IA 2EKPA 3EIFA 1MVLA 3F7NA 3PRYA 6Q21A 3ANXA 3JX9A 4G4GA 1A2QA 3DO5A 4DCVA 5DXJA 2XUGA 1Z4OA 1JP7A 2QRVA 1QIDA 5LKAA 1YA6A 3QVWA 3EUEA 2GO1A 1S2DA 2WF6A 3EQ2A 4XA8A 2XDQB 4QT4A 2OBNA 5EP3A 4DLYA 4BFWA 3RIMA 1J5EB 2FI1A 2ZT7A 4QGGA 5ADWA 2W6QA 3DBIA 1N7IA 4UHFA 3NJ8A 4TS4A 1HI9A 3UOGA 4Z54A 1DBRA 3P27A 3SYRA 1L5HA 3U7RA 1FFXA 5LVAA 4D9CA 3W5SA 1UQTA 5HPYB 4INAA 5CYGA 2IHTA 5JXWA 2DJIA 1S2NA 4IQFA 3LM8A 1UZMA 2BMVA 2IOHA 1SZPA 3L8GA 5H0IA 3ZNNA 3LC0A 2HSEA 2HYDA 3ERCA 2Q3EA 1FXSA 1J1IA 2JS7A 3MCAA 4LX8A 3A9CA 1M54A 2J85A 1AG9A 1G21B 4IHKA 3I5AA 3ONVA 3WWZA 2C2XA 1TYZA 1KDOA 3W78A 3UPDA 3VV3A 1OH5A 1WB4A 3EC1A 3ZW8A 5K1ZA 1CC1S 1H0RA 3MWDA 4Q9LA 4EFKA 3V8RA 2ZBQA 5EGNA 2XRMA 4TKZA 4EG4A 5C8VA 3O82A 4C6RA 4RADA 3NNNA 2HR1A 3PL5A 3M9WA 2NT3A 3NWJA 1FVHA 3O8RA 2YXPX 2ZU0C 4F9EA 2V6BA 4DBVO 1JTVA 2POCA 5BYKA 2FP3A 2H1HA 2ODTX 1DBSA 3DZKA 2DR2A 5M04A 2BFBB 1RKUA 5CK5A 3CF0A 3STTA 1HKUA 4BRZA 3HXOA 3IDSA 3K94A 3T4UA 4X54A 3URMA 2FR8A 5HKKA 1KEWA 4ARVA 1US8B 1VSUA 2QHXA 4QHSA 1I24A 1RABA 2G40A 3ICCA 4JLPA 4ZXFA 1L5LA 4KR3A 2XYQA 2NO1A 1Q7TA 2P4HX 1CYDA 1SWWA 1T6NA 2OFFA 3QXXA 2R8RA 1M1NA 5ALXA 4U6SA 4DL9A 2FFAA 4HVLA 2NSHA 3OCJA 4GLBA 4FWIB 3QBVA 4BJ6A 2BGNA 4BP3A 2Z6AA 1EA7A 3F71A 2QP4A 3GJZA 2GA8A 3GVPA 4NG4A 1BA3A 3M5CA 5CLHA 3C6YA 4X8LA 3MFYA 4PIPA 3HA5A 4A03A 3OFKA 1M6VB 1OZHA 3AW8A 3QUCA 3CM0A 2PYZA 4IXNA 4QT0A 4Q9KA 3WIDA 4YRKA 2XKAA 3GCDA 5JPCA 4NBVA 3GJRA 4RELA 2BR4A 5D7BA 3ZWMA 4PGGA 1GD1O 3VU9B 4ZHQA 5JCXA 3UCXA 2PO5A 1PIWA 3DBRB 4UBIA 1UAAA 5JRZA 4ETIA 3AILA 2I2CA 2XOKD 3AF5A 4OIMA 4N0PA 3A1UA 5C1IA 3ZWYA 5AFSA 3ABQB 5GGXA 5TF0A 4MCAA 5U4XA 5JYCA 2PX6A 2PSDA 3DULA 4NCIA 4OYRA 3ZJ5A 2NW6A 4GMFA 1FC0A 2UDPA 2E0IA 3PDJA 1NM5C 5CFMA 2D5LA 3I3OA 4ZI7F 1LSUA 1AV7A 5CG2A 3TOSA 1F51E 1GGNA 3O2QB 3T9CA 3CPSA 3IO3A 4OA8A 1CIVA 2I87A 1FVXA 3MMNA 1XF9A 1L7BA 2JGEA 3B6MA 5ETJA 5EXTA 3KT8A 5AVRA 2WFZA 1QH9A 4QUKA 1IZ8A 2TYSB 4RGBA 1R0YA 1JYEA 5GM1A 3V2GA 3A11A 1EFRA 2DERA 4GPAA 5DRYA 3G2JA 4CRWB 3GFQA 1B6GA 2IYEA 2XMZA 1R10A 1ZI8A 1X19A 2PCJA 3ILSA 2E18A 3H4IA 4W99A 4Z4IA 1RD4A 2R7KA 1P81A 2FEWB 3P2MA 4LK2A 5DGXA 1FSZA 1KEEB 3SYTA 4EHFA 2D1TA 3TZQA 4C04A 1MO6A 5L7WA 5AXBA 2ZE8A 3VKHA 1QQBA 4O4HA 1V1JA 3WGVA 4ZQCB 2VHVA 3BFKA 3SE0A 1OV6A 5KVAA 4WKCA 4C21A 3UJ6A 2HBQA 4E7OA 2OO5A 2ANBA 2O0JA 3N8KA 2BSQA 2EF1A 3JQAD 4K6HA 5C32A 4OHKA 1JJAA 2PZGA 4LWQA 1M1UA 2QGFA 4HNGA 5E0KB 3BXFA 3P52A 1UXIA 4OYHA 1C2TA 4EHHA 3L5OA 4CT5A 2AD5A 2RGWA 3VU1A 3LT4A 5DBHX 1VE6A 4EVRA 3WIOA 1MZPA 1JHDA 1ORDA 4HUQB 4NCAA 3O7WA 3IRUA 4FFOA 3IDFA 3FUXA 1X7XA 3Q40A 5TGTA 3PIDA 4RW0A 5AM1A 3K9NA 3B7PA 1G4AE 5M29A 5ECWA 3PLNA 3OOJA 5BUCA 3AWDA 2VOJA 1N6PA 1L1FA 1FMJA 2WT8A 3IAFA 1LKZA 2HDWA 4X9XA 1ZFNA 1ZPDA 4D25A 1J39A 2Z6VA 5EIEA 2C3OA 2IY8A 3M6AA 1VE9A 4LF8B 3EWSA 3PQDA 5IKMA 3BK1A 4XWAA 2ZOSA 1Z82A 2REOA 3V7NA 1FFDA 4X65B 1V7PC 2DGDA 3WI7A 1E2UA 1COWD 2DSTA 2P9EA 1X74A 2IUYA 2YWHA 3K8ZA 3NPMA 1BH2A 2I2WA 4A36A 1Z34A 2FZVA 5CVCA 3TL6A 1LDNA 1QRAA 1CFJA 1WHSA 2QJTA 4TLDA 1Y5NA 2BIFA 3A6DA 4GRIA 4DNFA 3TTTA 2O4UX 5A4IS 3OZFA 2C88A 1RHJA 2DCMA 3TOZA 1CRLA 2AG0A 5D51S 3LQYA 3OLVA 3K0AA 1VC2A 1XZ8A 1HF3A 2P6OA 3BC1A 4WEOA 1WU8A 3PI6A 2DBQA 4UM8B 4DXDA 1U2EA 2QWXA 4Q4HB 1KZHA 5KKCA 4PC6A 1OXMA 5JAHA 4B79A 4PAMA 2M6KA 2C5EA 4H18A 4QLOA 3SP1A 5CRIA 4X6UA 5A6SA 2O8NA 1TT5B 5LOVF 2LTAA 1JFLA 4P84A 4EFNA 4Y2SA 3EIOA 1WLYA 5F7ZA 4F97A 4EJ6A 1P9WA 5CITA 3OZUA 3L7LA 3MJVA 2O05A 1PZEA 1Y63A 3F6CA 3NBQA 1HMYA 1S0UA 1L3CA 4L6IA 4R3WA 3SS8A 5CAEA 3WK6A 1UFQA 4AECA 1Y1RA 2BI8A 1JHOA 2JFBA 1GNLA 1LLFA 4HFNA 1F5NA 2BFEA 3TDMA 4RZHA 5L51A 1WB9A 4KFCA 2HJ9A 2I62A 2FHSA 1Q19A 4K9LA 4B33A 1H4QA 3OT1B 4D5GA 2I78A 1YF3A 2AT1A 4GM1A 5L3ZA 2CXSA 3AVYA 3JR3A 1XXHB 5LMZA 2VQDA 1CRPA 3U6BA 4EGAA 2DH6A 1WPGA 1LRKA 5WRFA 5CX1B 2GAAA 4G5HA 2PQMA 2HLNA 3TTYA 2OAGA 2YY5A 2B8NA 1N6RA 1X7WB 1KK2A 1W88B 2BGIA 1LSJA 2IIBA 2C96A 4QJ4A 4HYYA 4TKVB 3UG6A 1XEWY 4DR6B 3USZA 3DGEC 5EC8A 3VBCA 4KMMA 1A72A 2IBMA 4L4RA 5FWAA 5KYGA 1KDTA 2HA7A 2KBFA 1HFEL 3SYNA 1AKVA 2QM0A 1SCIA 2QF7A 5KOJA 4YCMA 2OV6A 1JECA 2IF2A 1B26A 3ECSA 3GLRA 4YAKA 4GZ3A 5HOEA 1QANA 1R16A 3A1NA 4NQZA 1SCJA 1PR4A 1RLUA 5FWYA 4KWCA 1NI3A 4B4VA 3GUUA 3VO8A 3KSBC 3IVRA 4I2NA 5F9MA 2TMKA 4UTOA 3ZLTA 3OKPA 1SKMA 1DAIA 4BU0A 5L4LA 3M0EA 4BFXA 1GGJA 2IELA 4LRUA 4XDYA 4BTLA 1YMQA 1LDGA 1NQTA 1VP9A 2ECFA 3E8SA 2VXOA 2BKUA 3AIMA 3IUBA 1TLLA 1LDEA 5H81A 3TMYA 1PJQA 3ZWCA 4EX6A 1Q1BA 2PSJA 4V39A 4IICA 3NM4A 2KI5A 4ZMSA 5BN3A 3LI2A 1ID8A 3BXOA 3TNFA 2XWPA 4CV0A 2JLZA 2WHYA 2JLYA 4E4YA 2P2NA 1GNQA 3FUUA 1Y1SA 5TMBA 5DNCA 3W05A 4D4JA 1XZQA 4A8HA 4RF4A 4B2LA 2FMHA 5HK9A 1J5PA 2V7TA 3F2VA 1RMYA 5KWVA 4AB1A 4OATA 5LYYA 2P2SA 1IM5A 5K99A 4DAEA 1XEAA 2X9VA 4YO8A 4Q7QA 1M8KA 3B13B 5JE8A 4KGVA 1QIMA 4HMQA 4INOA 3U3RA 4KK3A 4PXSA 1E2BA 5FOVA 1WETA 5SY9A 1CUFA 4OI1A 1NXWA 5C7IO 2NU6A 1ZM2A 2DWUA 3T52A 3FNIA 5E6RA 2JLVA 2HU7A 1NBEA 4GOJA 1IRIA 3HZOA 4X00A 5C4GB 4C2TA 1KEPA 1LPMA 1JEDA 2VDQB 2H65A 1MMFB 3KKKA 5FLXA 2QG4A 3OZTA 4RTPA 4O3FA 3SN6A 1NVXQ 1IIBA 4M4SA 4KPYA 3SIWA 3UQZA 2GKOA 2P0YA 1B3BA 1I4EB 1KP3A 1Y1KE 2Q5CA 3IODA 1YQ9A 2FSGA 3K0CC 5DIFA 1K0UA 1DWOA 4TTIA 3B3GA 1A9XA 4YGXB 2NYRA 1Y7IA 1KK1A 3DBLA 5KIAA 2PKRA 3DCJA 1G20B 1I4LD 2MINA 5LD2C 1T4MA 1YR3A 1DXHA 2AZ4A 1FPQA 3CZ5A 3CNEA 3NCTA 3OECA 4OHMA 5KAPA 3RQSA 1LPAB 3CFYA 3TZBA 3JZMA 4AU1A 4DWWA 1PVOA 3UT5A 1CY8A 5A06A 3TRFA 1X92A 1E1NA 4YUXA 3V48A 4P2BA 2V5UA 3AF0A 3GEDA 4EW2A 1BS2A 1ZONA 3FWPA 4H7PA 4NYIR 4J3NA 2BAGA 3BIOA 3CXUA 3D0QA 4NJOA 4O4LF 4TPKA 4DMLA 1VHWA 2W2XA 1F12A 2CEAA 1DAOA 4LCBA 1NY5A 5TXGA 3I6YA 1EFHA 1KF0A 2J6HA 1IDN1 2BFAA 1GFWA 4NR0A 5JSUA 1GSAA 5IEBA 1U0LA 3G0HA 1PEAA 4NWIA 5ENDA 2BW0A 3C7TA 3ADOA 3ZDFA 4I5GA 2B8WA 4MI6A 4F72A 1KEKA 3EY4A 3RYTC 3W9UA 3TUJC 1RM4A 3THWB 2Q41A 3GBVA 3UAOA 1VA4A 1YFLA 3QFCA 4HAWA 3BHNA 3RBVA 4PZAA 3B1JA 1QR6A 3BSFA 1YB2A 3CKLA 4TKUA 1JALA 2AKYA 1QYWA 4AP9A 3Q3EA 2CUTA 2CD7A 2CW5A 2H1CA 2VDMB 1I0LA 4TV8A 5JYBA 3S8EA 4LF6B 1KAHA 1U3WA 1Z0ZA 2X0JA 2IHJA 3MRXA 2WWGA 3PNMA 2Q2VA 2JCSA 3ES9A 4N6NA 4UBOA 2D3TA 3EXEA 2CB0A 5LBIA 3V32A 2CV2A 4ZD6A 2OBXA 3A25A 2NO9A 2Y05A 2FU5C 1IHXA 2FSVA 3DTYA 3DYBA 1MO4A 2FEOA 2YR0A 1SG6A 3OBBA 1Y5IA 3TOVA 1B73A 4F60A 1BU8A 2R6AA 4HLUA 1DWPA 1V26A 2B8JA 4YMGA 5ALWA 2O2IA 3I2JA 1NT4A 4GX5A 4FE3A 4HLCA 1PD1A 2QE7A 1I5EA 4OQDA 5E8JA 2OTCA 3L8CA 3OPMA 5FTWA 1L7QA 4LGYA 3I42A 3IT1A 4EGCB 2FWPA 1SN7A 2BMEA 4J0GA 1IY0A 2C94A 1S8FA 1PNTA 4JELA 3IFSA 3LQFA 4ZQFA 4CDGA 4BGIA 3VAZA 1NZFA 2OSVA 2RGNA 5FWXB 1O0SA 3AHJA 1KC1A 3X0DA 1K7XB 4DCNA 3E58A 3A4YA 2R84A 5J4HA 3QX3A 3O1JC 7REQA 5JNTA 2RHHA 2DAPA 2W2MA 3EWIA 2C3PA 5JCOA 1HURA 3RC8A 5KEIA 1GPMA 3DE5X 4O08A 4X3CA 3ASVA 1RWMA 1QS0B 4HPXB 1SUFA 2XCLA 3AR4A 4NU0A 3KELA 3HGQA 3W5UA 4BLWA 4DA7A 5K3FA 1QIIA 1NVMB 1Q83A 5D3ZA 3TD9A 2FUNB 2QGZA 1TJ4A 2ZZKA 3CY6A 3DKKA 2GNAA 5FADA 3WO0A 5H9VA 5A5FA 2X23A 3OFNA 5LQDA 1H1LA 1XNRB 4RL6A 2I91A 3N0XA 5CVDA 3I9JA 2LCIA 5C5DA 1BX3A 4UPVA 4UNNA 4EITA 3U60B 1UBNA 2V6FA 3NHBA 5LA6A 1ORWA 3EXHC 1PVVA 4WKNA 2V03A 3RS7A 3L8ZA 3ND9A 2O1EA 2HAEA 3FUWA 1BXGB 1W5EA 3N87A 1CQJB 1VA5A 2VBIA 4Q6WA 4C5CA 2XQKA 2Q5LA 4DXHA 5AW7A 4QOGA 3PNQA 2R2AA 4FW8A 3B2EA 1FY2A 3EGDA 2YN2A 4KQ1A 2Q8NA 5AKHA 1NMSA 5D3MA 1MZVA 2QMZA 2QU8A 3HH8A 3K9WA 4LJKA 5JNRA 1CDOA 3U61B 3AUJB 3EHEA 3I5YA 3RFXA 3E9YA 4CLRB 1AZLA 1DU4A 3HBMA 3O38A 5JAMA 2QLBA 1F9AA 4IGFA 4MYUA 3HY4A 3MTIA 2OXEA 1EUQA 5LQRA 4OB7A 4GVXA 1DBVO 4DCPA 4TZ6A 2YCLA 4MVJE 1KH2A 2VK8A 4FB5A 2NZUG 4FYHA 4Q1AA 1X14A 2I4MA 1N5KA 1J33A 3OLZA 1OT5A 2W98A 1B41A 1G8GA 3DDNA 3LVQE 1TO2E 3ZVMA 4GL2A 1MD9A 3OCUA 2HYIC 1TCVA 2WWIA 2IWHA 3O8DA 3TQCA 4IL5A 4KAXA 4XIYA 4BMOB 2ZTMA 1MIHA 4HH3C 3VC2A 1FRVA 3JATB 4YTEA 4PZ0A 1GGEA 2JFOA 5H4GA 1KI4A 5A9RA 3V42A 2G4LA 3IAM1 2ZT6A 2H2WA 4QUHA 4CG2A 4Q3LA 2ZLBA 2AOTA 2QMHA 2KLBA 3HLTA 3K1TA 5CIWA 5D00A 2VXYA 5FV4A 3E53A 3B9RA 1QOZA 3LBYA 4W5HA 2GT1A 4BMVA 2QA5A 1AGYA 3T7SA 4DSZA 1Z0SA 2H85A 3KWFA 2HDOA 5DK6A 1XLUA 2C5LA 2CJXA 3OQJA 4J1NA 4HDSB 4MEJA 2A35A 5JMTA 4CF4A 2XXAB 3DL0A 3LCMA 4NSNA 3BXZA 1ZJJA 5DLEA 3DLHA 1V5GA 3HB9A 4OJQA 4CNQA 1II8B 3CH7A 2WM3A 4BFCA 5CXQA 3OJOA 5IS2A 1GPBA 4GMGA 1NHWA 1SUPA 2GJAA 4P82A 1TUEA 3D64A 1BDBA 1VL2A 4DKJA 1YRHA 2L69A 1JIIA 3D8UA 3ZCPA 3ENQA 2IP2A 1L9KA 3NKLA 4TWRA 1I2ZA 3WJ1A 4BQPA 5ECDA 4P38A 3WMXA 3GU3A 1IXSB 1F6BA 1NJ5A 4QOJA 1L7XA 5DVZA 1YBVA 3LSYA 4PX2A 4A7PA 3UMYA 1IZ7A 3GLQA 1XCJA 2DM6A 2AG1A 1XJCA 3FSJX 4JODA 3TTUA 4E0BA 4U3JA 3TJRA 3U4DA 5TQ0A 3QKWA 5I7HA 4BKRA 3OY7A 2F00A 1XWIA 1DUVG 2O0MA 1T25A 2KWIA 3H9EO 3PR2B 4HGOA 3FKSD 4RMNA 4XB6B 3ZGVA 3PX3A 1FLNA 2ZYTX 2HD4A 3F6BX 2V9ZA 1XAJA 3RAFC 1E3EA 1XQ6A 4YWJA 3SJCA 1AGRA 4DVGA 3EQ7A 4EB6A 2GRAA 2K4MA 4NXNB 3UZUA 5KNBA 3H5WA 1H8HA 2ZSBA 2IVZA 2WG2A 4H7EA 4H35A 2G72A 4DHWA 4YJ3F 2HB6A 4GFDA 3WX0A 3RVPA 3H8SA