4G1UC

X-ray structure of the bacterial heme transporter hmuuv from yersinia pestis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
262
structure length
262
Chain Sequence
AVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/hydrolase
molecule keywords Hemin transport system permease protein hmuU
publication title X-ray structure of the Yersinia pestis heme transporter HmuUV.
pubmed doi rcsb
source organism Yersinia pestis
total genus 71
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g1uC00
4BFWA 2GRJA 4QL3A 1G291 5JRJA 4PPNA 3TBKA 3OIWA 1BMFD 4K81B 1CJVC 1W2HA 5FOXA 1G20E 1Q12A 2FFBA 1EWRA 1AZSC 3V9PA 4BLPA 4B35A 1T5IA 1KO8A 2AWOA 1OKKD 5JWHA 1N6RA 1PLLA 1YZUA 4QJ4A 1U9IC 4PZLA 1DAIA 3AVOA 1KIMA 1EESA 2CCJA 3ND8A 3TH5A 2YHSA 4PQFA 1JAIA 5FTMA 1G5RA 2VYFA 2ATVA 1X8LA 4FCVA 5EXXA 3H2YA 4C7OB 4A8JC 4L9SA 4ZCIA 2IYXA 1PLKA 4Q00A 3U60B 5DYIA 2GVDC 2BEKA 3LA6A 1W5SA 3ZVLA 4IVQA 4QGGA 3B1XA 1GRRA 3ETLA 4BECA 4HAYA 4A8JB 1II8A 1RC8A 2J7KA 3KXKA 1GAJA 4NU0A 2RMKA 2HLDD 4FIDA 4KFSA 3KUDA 4DSNA 5DLQC 1KI9A 3Q72A 1KI6A 3VR5A 2OV2A 2N46A 3GMTA 2PZGA 4Q4HA 3THXA 2O8FA 3Q9LA 4GI7A 1MV5A 2RGXA 1U90A 1W1WA 3K9LA 1ZUIA 4YDHB 4D81A 1G16A 1GOTA 2FZ4A 4TYYA 2VP9A 1XWIA 4PO1A 1BO6A 4CYMA 1UKEA 1P2UA 3QPVA 2IX3A 1MRNA 3QJYA 1ONBA 2J87A 4V0MA 4MYCA 3T35A 3C15C 1QHIA 3MLEA 3QKSB 5HCIA 1HH4A 3CH4B 4U00A 1E9DA 2AKYA 4UNNA 2NIPA 4RZ2A 2C04A 3ZD6A 2YOHA 3CX6A 3GJ8A 5LB2A 1XPOA 4MDEA 1W0JD 1KK2A 4C0HA 3AUYA 1NF3A 1ZCAA 2I1VB 2R6FA 2FX3A 1ANKA 2RAPA 3EZ2A 4M1OA 1II8B 3CF6R 1G64A 2FOLA 3IKJA 4Q4JA 4R71A 3S1AA 3A58B 3IPXA 2REOA 1HUQA 4B3FX 4TL7A 4BPBA 2Z4RA 3BH7A 2AK3A 2QT0A 5FUYA 2O8FB 2H16A 1YR9A 4IEIA 1SULA 4IFBA 4W7SA 1Q22A 3CNNA 1XRJA 3I8XA 1Z6YA 3VNVA 3VR4A 4ZCLA 1UKYA 2A5YB 4WVFA 3RDPA 1CR0A 1UADA 3X1YA 3PXGA 5TV2A 4WXRA 1PZNA 1RJ9A 1Q3HA 4OBEA 2I1QA 2AXNA 1P6XA 4Q21A 5C4GB 4PAQA 1GL9B 2EVWX 3GLFB 4IFEA 3K8YA 3AEZA 3OFND 2JA1A 4HAWA 2RH5A 1VMAA 3BE4A 1W36C 1G21E 5B57C 4V0NA 1OXXK 1FX0A 1IJFA 1KZ7B 2OLJA 3BS4A 3OIYA 1G7RA 4U7DA 2HF9A 4OQNA 1YRAA 2ODEA 3IIJA 4YMVA 4CW7A 4EKDA 2Q3MA 4OHXA 3ADKA 2X1VA 2ZTSA 2IHBA 5TXGA 4E5UA 4DLZA 1QHHA 1HQYE 2ZRFA 4NYMQ 5K8TA 1QG4A 3SC3A 3K70B 2WBLC 2ZANA 4QXAA 4G5OA 5JMTA 4LYAA 4JS0A 4UNPA 1ZC3A 2MSDB 4UJ5A 1X1RA 3ZH9B 3JZMA 3TUJC 4PX9A 1DOAA 2BOVA 3GEHA 4OK6A 2X19A 3TRFA 2WVJA 2R2AA 2WJHA 2LKCA 1Z6GA 2CNWA 1G1MA 2ZAOA 2GCOB 3B82A 3HR8A 4ACAA 3AVWA 1JAHA 4QGHA 3HPQA 4YMUA 2NZ8A 1HEIA 4OYHA 3QF7A 1BIFA 1S2MA 3PV0A 1ESNA 4F92B 3C14C 2WWFA 4UJ3A 2IYWA 4QJ5A 1LS1A 2GJ9A 1X1SA 4GDFA 1Y3AA 4DIDA 1US8B 4DUGD 4JVSB 1IN5A 3EIEA 4IHQA 2Q6TA 5TMPA 4KJZA 2O8EA 2XZLA 4KXFB 4NYIQ 1DELA 1IHUA 3KJEA 4TQAA 5LD2C 1M7HA 1HA3A 3PFIA 2FNAA 4M9SA 4Q4AA 4RFSB 3A1TA 4D0NA 1RRCA 4JT2A 3QKRA 2QPAA 3KJIA 4MYTA 4N0DA 3QF4B 1F3OA 3J81k 2N42A 3R20A 2QAGC 4QNMA 4OQXA 4P4TA 3X1DA 1S9DA 1X6VA 3A4LA 3K0AA 1NN1A 1PUIA 5E7MA 4F38A 1VPLA 2BJVA 1CTQA 2REBA 1ZNYA 3K1JA 4JLOA 4BRUA 5FUWA 5L3RA 1HT1E 2DPXA 5C2JB 4B48A 3WMGA 1E9BA 2IT1A 3GJ6A 1BKDR 5FOWA 2WWWA 4AYWA 1HQCA 1KAOA 1QVRA 4B76A 4LK2A 2OAQ1 4JYCA 3FMIA 3R8FA 2EFHB 3CF2A 3P1JA 4JKIA 3U5ZB 1IN6A 1G7SA 1R7RA 3LX8A 1UEJA 5TDHA 4DLVA 1PUJA 2VP0A 4MRPA 2IYTA 2CXXA 5DI3B 1ZMXA 2X77A 1TAGA 4JL8A 3RVBA 3D7MA 1E0SA 1GNPA 4P33A 2YC2C 5HKKD 5KDOA 2RGNC 2H17A 1EFCA 4PPGA 5EE5B 1GNRA 2BMDA 3AVPA 3FKSD 3GJ3A 2G83A 1YZTA 5ANRB 5FI0B 5JJLA 2QI9C 1U8AA 4ITRC 4TLDA 1RRFA 1FW6A 3LX5A 1GVNB 3ZZTA 1DTSA 5JHGB 3ZIAD 4Q02A 3EA0A 4B74A 1N25A 2AD5A 3A1UA 3KJHA 1KI3A 3W6NA 2KI5A 3H4MA 5FPKA 1ZYUA 1OJLA 1YRBA 2CL0X 5FPYA 1J8MF 3MG9A 3QPUA 3ADDA 1CS4C 4GT1A 2RGDA 1XMJA 4DSTA 3U4QA 1TX4B 2IK8A 1P60A 2GILA 1IOZA 1JXOA 2BKUA 4F4JA 1ZU5A 2VHCA 4GMDA 1BS1A 4BUJA 3KQUA 1UFQA 3B1VA 1EFUA 4LBYA 4D0GA 2GEVA 2IYUA 2QN6A 5CLQA 4KBFA 1Z0KA 2ORVA 1P4SA 2AX4A 4TMTA 4DXAA 4LSGA 4QHSA 3SS8A 3DOFA 4CEJA 3GLHE 5EE1A 2VF7A 3WXMA 1E98A 2OCAA 4MGYR 1NMZA 4LHWA 3AVQA 1DVRA 2AXPA 2ONKA 4D82A 1KO1A 4XH9B 1VG8A 1AN0A 1OH7A 4LYFA 2QBYA 1AS2A 3V4RA 2YNMA 1UF9A 1T6NA 5EJEA 1KDTA 4EPVA 2BKEA 2PT5A 3TSWA 1GL6A 1Q44A 4KFTA 1GZSA 3VHXA 5AUNB 3LQQA 5J4HA 3E1SA 4JLKA 4HAXA 5JJKA 2O8BA 3DEFA 2HYDA 2ONJA 3U4QB 1P9NA 4B2LA 1J99A 1TEVA 4LOAA 4IOLA 2UZ3A 2ZUBA 4YMTA 2VTKA 1W48A 1SXJE 4LJYA 1JQLB 2V7QD 3K9HA 1Z0IA 3T5DA 1E32A 2R6GA 4F91B 3OAAD 3CUEF 1M74A 3H1TA 1ZNXA 3U2QA 4US1R 3T15A 5F9FA 3ZD7A 4QM6A 2O0JA 2CHGA 3PCRB 4PFSA 5HPYB 2R6AA 2H1LA 4BLSA 4LGMA 3WY9A 3WYGA 2IWHA 2C98A 4TYQA 3QG5A 1I2MA 4D25A 2E87A 2FGJA 4EPXA 3D8BA 4HAZA 1G3QA 2A7QA 5L3QA 3FPAA 3T1TA 4IOKA 1ODFA 4PHGA 4Q4LA 2O8BB 2R65A 3CX8A 1D8TA 2G6BA 3UK6A 1KDRA 1W4BA 3QXXA 2VIIA 4NHOA 3UMRA 2ZYVX 4RZUA 3W9YA 1MH1A 1TUIA 2HV8A 3T61A 3IIMA 2BM1A 4FW9A 2YKGA 2D2EA 3LH5A 1F2UA 5F98A 5IRCD 1E2FA 4M22A 4A9AA 5BQ5A 1G8HA 4HSEA 4UNSA 1IXSB 4XWAA 1E9SA 1OF1A 2CJWA 1Q20A 4HATA 5FPSA 4QNRA 4WW0A 3RSLA 4F93B 2JJ2A 1IY0A 2CLCX 1GFIA 3GJ0A 3KX2A 1ZP6A 3PG5A 4P3YA 2ORIA 3EA5A 2BMFA 2FJUA 3CPJB 1T4GA 4ZO4A 3NIBA 2KWIA 5KSOA 2H8KA 4YXWA 4CVNA 2QRNA 4AI6A 2AL7A 1O87A 1ZUNB 2D3WA 4AYTA 4BZQA 4Q1EA 4TMZA 2J7PD 3WHKA 4GZMA 3TE6A 5L3QB 1WA5A 1ESMA 4B32A 3N2EA 5HZHA 4HZUA 2D2FA 3K09C 5FTLA 1E94E 4JYBA 3X1XA 2NTYC 2O8DA 2H18A 1OFUX 1CU1A 4NYJR 3W8RA 3F8TA 1GKUB 4ZCMA 3UWKA 2C9OA 5KNBA 1OH5A 1HYQA 1Q1QA 1N6OA 3RS2A 1AS0A 3IEVA 2IYRA 3R7WB 3WRYC 3X1WA 4URUR 3EG5A 4P4UA 2ZRBA 3C8UA 2FA9A 2AN9A 1SVIA 2BBSA 1HTWA 3O47A 4PAMA 4Q1CA 3REGA 3W6PA 1TQ6A 1IAQA 2WIAA 4ASUA 1D9ZA 2QEQA 1P9RA 1ZNWA 4OHWA 1XEWY 2GCPA 4BEJA 3A4NA 5LB4A 3AVUA 4FI3C 1F5NA 2OLKA 3GPLA 3W34A 3I92A 5EZ6B 3M4YA 4QC2A 3LO5A 1G9XA 1E9CA 1G3MA 4A6XA 2UKDA 1E4VA 2ZE8A 3T06B 3VU9A 5KU1A 4PHTA 1ZD8A 1D9XA 2WKRA 1G18A 2R9VA 2TMKA 1IJEA 1F60A 4M21A 5BXQC 1MABB 4GOXA 2O8DB 1ZNZA 3PEYA 3AVVA 1E2QA 2ZI3A 4AK9A 4EPRA 3UG6A 2CVFA 1P62B 4MKFA 4FINA 4MRVA 1E1RD 1IBRA 3ZGXA 1Q1BA 3DO6A 1K5DA 1OH6A 3HP1A 1KI7A 1G41A 1Z6XA 2JJ1A 2O0KA 2VSFA 3BBPA 5FBVB 2FSHA 1SKYB 3TK1A 4XWOA 3KKMA 4RD2A 3L8YA 2OG2A 1LNZA 2AK2A 2BMEA 1TNDA 3I3SR 5EXTA 4B3XA 1XJCA 5KOYA 2JASA 4FN5A 4MDFA 1NVVR 3IDQA 2FZLA 4LV5B 3I61A 2ORWA 2RCNA 4CEIA 5B64A 1E2NA 3GLHA 3JVUA 1MOZA 4MUBA 4P32A 4RCYA 2PCLA 4TMKA 3TUZC 2EW1A 1BYIA 1YKSA 3BK7A 4ON9A 4BFZA 3AVYA 2DWQA 1YQTA 2ZJBA 3LLUA 5CLLA 2DWOA 1LVGA 1SQ5A 1W7AA 4C0LA 5GJCA 2QSZA 4H9GA 4IVPA 3RRNA 2WPDA 3UIEA 3IHLA 4M1WA 2F9MA 2OM2A 1QHGA 3DVLA 2ZJAA 2P65A 2NOAA 1CLUA 4OI0A 4LZZA 4RD0A 1AM4D 4LHYA 5EXSA 1YR7A 3TUIC 2L0XA 1NN5A 2QP9X 4KFUA 1EFRA 1E2DA 5AJZA 2YWGA 2AR7A 2GXUA 5SZHB 5BYKA 4DWJA 1K6MA 1SXJA 2CHVA 3E70C 3W5JA 3BB3A 4KODA 5DIFA 3KFVA 3JVVA 4MRSA 4B71A 4D4LA 4C30A 4XTRA 3VMFA 1KAGA 3AP2A 1RE0A 4CEIB 3QBVA 4DLSA 2ZREA 1H8EA 1W36D 2CLSA 4ZDWA 4C2TA 1CJMA 3GLIE 1QRAA 2J9RA 4A2PA 1RPZA 3GJ7A 1AQYA 3RHFA 1EK0A 4AY2A 3VTKA 5HZKA 3CRVA 2AFIE 1G6HA 2WWHA 2JLXA 1JEEA 4KAXA 3O8RA 1BYUA 2XTZA 1S1CA 3HYRA 4EFMA 4LX0A 4LHXA 2CCGA 3ZVMA 1Q57A 4OJQA 4HYYA 1P2VA 3CR8A 4B6FA 4BQSA 621PA 4X8OA 1XEXA 2W6JA 1T3SA 2ZRIA 4DBLC 3CBQA 1N5JA 4A15A 2IUTA 2IXGA 1VHTA 3BXZA 1A5TA 2GEUA 1TU4A 3FHCB 5CYPA 4B44A 2GJAA 2ZRGA 4LWZA 3KXIA 3B7GA 1XTQA 1SXJB 3U3KA 4JLDA 3CWQA 2G0NA 3MWYW 3KXLA 5E7JA 2YZ2A 1OXSC 3ICEA 1U98A 4CF7A 121PA 3QVUA 3SQXA 1PJRA 4RFVA 3EX7C 4HB3A 821PA 5KDDA 4IXNA 1NL3A 4TLCA 4Q18A 4CT4B 4A2WA 4D6PA 5J47A 3A6PC 4TTRA 4C9BA 5L8VA 1E3MA 1JR3E 3GFTA 1TF5A 4TMVA 1KNQA 5D3MB 2JJ8A 2IEZA 3ND9A 4MRNA 1X8JA 4WZBE 3QBTA 4LPSA 4C3ZA 2NQ2C 4MRRA 1XEXB 3ZVNA 2PLFA 4Q9HA 1UBFA 3FYHA 4DLYA 3B8HA 5JSZB 1CF4A 2OILA 2ZVQX 3I4LA 3OHMA 5CB8A 3R9XA 4LJ9A 3O8DA 1ELOA 1Z0FA 1Z8FA 2WHXA 1E2EA 5UKDA 3B9PA 5IK2D 2ZJ5A 3IEUA 2PMKA 1XF9A 3AUXA 4JLVA 1RW4A 2XOKD 4C2UA 1ZAKA 3A8TA 4TSFA 3SEAA 5FBQB 2FSIA 2R44A 1CJKC 2YC4C 1T5LA 3OZXA 3MWJA 4K8OA 4Y0VA 1TMKA 4MGZR 3T5GA 1QHYA 2J45A 3WMFA 4IW3B 5E95A 1QHSA 3UMFA 2CHQA 1GRQA 1E99A 1XD8A 2BHRA 4MKHA 4TLEA 3QUSA 1SVSA 5C46F 1U9IA 2IBMA 3NXSA 2XNDA 1XJQA 4L8GA 2LKDA 3FWYA 3GJ5A 4OKSA 1A4RA 1C1YA 4BEBA 2A9KA 1G8FA 5KSYA 3UPUA 3QG1A 2VL7A 3IBGA 2JLUA 2IUUA 2JDID 1YR8A 1I2DA 2QQEA 2ZI7A 4JMPA 4TMWA 2C96A 4QFMA 4QBFA 2OZEA 3SHWA 1VIAA 4M1KA 3CNOA 4R7ZA 3SDZA 3DMDA 1SZPA 3AF4A 2ZR9A 2RHDA 1H8HD 3U7FB 2XEXA 4O25A 4S35A 2ZUDA 3CH5A 5SZIA 4R2IA 2VP4A 5JS7A 3CRQA 2XB4A 3MGCA 1XEWX 3N2IA 1MKYA 2WJIA 1G3RA 3U6BA 2WSSA 1RYFA 1W4RA 2P3SA 4TYNA 1R4AA 1IY2A 1XPUA 1KOFA 1KK0A 3B5JA 3KFXA 3FTQA 3WHLA 1W47A 1A2KC 1ZCBA 2E1RA 3SBDA 2KB0A 2WV9A 2ODWA 3CX7A 3WRXC 1OT3A 2B7CA 2HXSA 2W2VA 4ZPXA 4DT1A 1KY3A 2ZJYA 1D5CA 4PC7A 4AG6A 1IXZA 2OBMA 1E0KA 4P4SA 2J46A 4XIGS 3SU8A 3OEHD 1G7TA 5CM9C 1VIYA 4B6EA 2D06A 1M34E 2R62A 4B3GA 4LYJA 3MMPA 2DFKB 3CW2A 3EZ7A 2PH1A 5J4VA 5AJXA 1EGAA 1NKSA 4Z54A 2GF0A 1CR1A 4NP6A 3TMKA 2FPMA 3EPHA 5G53C 3HR7A 2ZQ5A 1CBUA 1KDPA 5D3QA 3KKPA 2GAAA 3C41J 2WKPA 3LRPA 4KBGA 1IN4A 4DSUA 2QMOA 3AKEA 4Z1MD 1KI6B 1YU9A 2G88A 4Q4HB 1ETUA 4KYUA 1KKMA 3GLIA 2GK6A 1Q0UA 3U3RA 4EPTA 3THXB 3IO3A 2XSZD 5HE9A 2GJKA 1CRPA 1NMXA 1XCPA 5BN3A 1OLOA 5CK4A 1N3BA 3EASA 1IM2A 3B85A 3EWAA 3KB2A 1OXVA 4LC0A 5FFMA 2BV3A 4URVR 4NTZA 1II0A 1FTNA 5FI1B 5DNYB 1FZQA 2B8WA 2PZFA 3THOA 3ICQB 2WMOB 2EWWA 2H92A 3AKCA 1R5NA 3KL4A 2IYVA 1GWNA 2RGCA 2WWIA 1E6CA 4LJ6A 2HJVA 4KSBA 1T0JB 1QVAA 5H70A 1VECA 1D2MA 1N0VC 3LVRE 1MO6A 3MFYA 1CJUC 1KZGB 1E1QA 3K70C 2ZRNA 2GESA 3BB1A 4CEHA 2V8OA 4Q4JB 3S1AB 4EPYA 3NC1C 4X8LA 5C1BA 2P2LA 2C99A 2WWGA 4JIMA 5KPJA 1TL7C 2CVHA 2Q9AA 5EP3A 2ZSBA 3L0SA 1NVXQ 3IO5A 4PZZA 1WBDA 3GEEA 4QM7A 4Q66C 2GXQA 1NBMD 1HURA 3NC0C 4C0SA 1T3LA 1Z0JA 3CZPA 3OEEA 1N6PA 4XD7D 2ATXA 1QHNA 2W6ID 4MYUA 2Q21A 1RJ9B 4G3XA 3EWSA 3GP8A 1JR3A 1OYWA 4B3BA 5G41A 1RVDA 2F43A 4V0OA 1OFHA 2ZUCA 3UANA 1LW7A 1A7JA 2B7BA 5FTNA 3NH6A 1FX0B 1IN7A 1KTVA 2RGGA 2JIZA 2BCJQ 1E69A 2I4IA 1DAFA 4FMDB 1ZM9A 1S8FA 4DDWA 4QGAA 2OCBA 1MO5A 2HT6A 2J5XA 2UVQA 4CEHB 4RSGA 1VHLA 4PTLA 3RC3A 4WXPA 4LPKA 4WIAA 1M7GA 2XXAA 1QHHB 3MRSA 5CYOA 1E2LA 1FQJA 4IDHA 1FMJA 4IRUB 4LRWA 3P4YA 3SYNA 2ZJ8A 4M9ZA 2F1HA 5SZKB 1W4CA 4D2IA 2XJ4A 3QQ5A 5JI2E 4PQRA 3TQFA 1JPJA 4KCGA 2QAGA 5FPHA 3DZDA 1KK1A 1L7VC 2XJ9A 2Z6VA 5J5CA 4I1UA 4D0LB 2ERYA 4YLGA 4QJ3A 4C0AC 1IONA 2EWVA 2V1XA 2VSOA 4FMBB 4MYHA 2FEMA 4M1TA 1BMFA 3SYLA 2GNOA 4EDHA 4Q48A 4L5BA 2RGAA 1ZVQA 4EIWA 1WCV1 1KJWA 1XCMA 1G6OA 3TVTA 4FMCB 2GJSA 1OKKA 3TQCA 2EYQA 3LVQE 2ZVPX 5B2ZA 1SHKA 3ZZ0A 2JLRA 2PLRA 4V03A 2O8EB 1UBEA 2KSQA 2XXAB 1E9FA 1HV8A 1UKVY 4HUQA 4WZ6A 1UBCA 4Q4AB 4HLUA 3ZJYA 2QSYA 2RGNA 1JNYA 1BOFA 1H65A 1XNJA 4Q9KA 1DO0A 2A5FA 4MH0R 2IA5A 3QKRB 1WRBA 2W58A 2IS2A 1TEXA 2JDIA 1Z07A 1S1MA 3RS3A 4HB4A 4OQLA 2ASEA 3FB4A 3D6TB 2CMKA 3D31A 3OE7D 1WE2A 4G5SA 4TL9A 4TWZA 5EZ5A 1XFAA 4B2IA 4WBSA 4BWYA 4B47A 2PCJA 3P20A 1W46A 4PC3A 2BDTA 3PQCA 1E79D 3K0AB 2IF0A 1E0JA 3BIFA 3ZQ6A 2QZ4A 2A2ZA 4E09A 3BD9A 1C9KA 4JJKA 2OAP1 4PPQA 4JKYA 2NO1A 3KQLA 4GP6A 2HLDA 4OHYA 2IF2A 3H84A 1TF7A 4Q9JA 5JRZA 3FDIA 1KI1A 2J1LA 2QM8A 3LY5A 3SBEA 2ECKA 1NIPA 3G0HA 4DCTA 3NHAA 2GVZC 4Q9IA 4NDZA 1L4UA 3LQRA 4TL8A 3WBKA 1VG0B 4BFYA 1D2NA 3TJZA 3G82C 4Q7JB 4PC1A 1CIPA 4TLAA 2E9SA 1KO7A 4LBWA 2JLYA 1XD9A 5A5GA 1R5OA 1ZC4A 2BBTA 5H68A 4M9XA 3QY0A 1E2MA 2A5GA 1YZLA 5AUPB 4K46A 2C95A 4JLPA 2GA8A 1G8YA 1YHNA 2QT1A 4HDQB 1E96A 5EXPA 3NG1A 1GILA 4YC7A 4IOMA 1G7CA 4UKDA 4MGIR 1W0JA 3C5CA 2DY1A 3M0EA 4JL6A 4PPFA 3I8SA 3RNLA 4QKQA 3OF5A 5J4LA 3MUFA 1OHHD 5GVRA 3U3JA 1WQ1R 1U0LA 221PA 2YWFA 1XX6A 1OFIA 3FFAA 4UQOA 3CZQA 3KQKA 4GRAA 4A36A 2HT1A 1N2CE 3HWSA 2P5TB 521PA 3KTAA 2ZYWX 1WB9A 2V1UA 2F3TA 3C5HA 2C9CA 1TQ2A 4POAA 4U02A 3VR3A 3W5IA 4EQ6A 4HUTA 3DL0A 4HLCA 2ZEJA 5J4KA 4CEJB 3LBNA 3R9IA 1UDWA 1KJYA 1ZIPA 5JZVA 4PC2A 5G40A 4DJTA 3AP3A 1FUKA 3QEJA 1N5KA 3OFNA 3TAUA 4KHZA 2QBYB 2H5EA 4I1SA 5KPDA 3LAWA 3C4JA 5KSPA 4L15A 1AIPA 5LPNA 1NLFA 3ADCA 2F1RA 3WP1B 2ZRMA 1JPNA 4B2PA 1MR3F 1CKEA 4RJLA 5BW8A 1NN3A 3SJCA 2QP4A 1NJFA 3AP1A 1XB2A 3QXJA 3RABA 5CITA 3AVXA 4DLRA 4RY2A 4C0JA 1S3SA 2GTPA 2QP3A 3MWKA 4LBVA 5K8IA 3KTAB 1R2QA 4M2LA 4XVQA 2JCSA 2WAXA 2WICA 2QRZA 2X2FA 4PR0A 3UKDA 2EFCB 2VSXA 1F6BA 2MSCB 4EQ6B 4C0KA 4J0QA 2XGJA 3QENA 4BFSA 1YR6A 2W6IA 5DE3A 5KTYA 1OH8A 3B9QA 2Z4SA 3THYA 1KHTA 5DHAA 1LTQA 1AK2A 1NG1A 2OXRA 4DHEA 4B3CA 1LF0A 1KI4A 1M2OB 2PX0A 3CONA 5J40A 4HEJA 4WAUA 5FBWB 4HDOB 4LCBA 4RKFA 1PLJA 2W2TA 1R0YA 1PV4A 5JCZA 3SNHA 4ZIRA 4PO9A 3HPRA 1VCIA 3PVSA 2A30A 4NCJA 5J4YA 4RKEA 1XDBA 3ZQJA 4DUGA 2ZE6A 2CL7X 2V3CC 3MAAC 2ZRDA 1M6NA 1P3JA 1R8QA 1TQDA 4BLTA 1X8KA 1WXQA 4NYMR 1E2GA 4TLBA 5HTKA 3RS5A 3SFVA 3QI2A 5JBQA 2DWPA 3SI7A 2FEOA 2FPKA 1M8PA 3MSXA 4IOJA 3IGFA 1GG2A 3U61B 1OB5A 4B34A 3L2OB 2XX3A 4A1FA 3L0PA 1Z22A 4AIIA 3RANA 1FNNA 1A82A 4JLNA 1F2UB 5GJBA 4B75A 1XD2A 4IDPA 5DISB 3QKTA 1E0AA 1Z2AA 2GHIA 2HCBA 3P26A 5DYGA 2CJWB 4YMWA 2JLZA 4XWKA 3PEWA 4DCVA 1S96A 2ZRJA 1NP6A 2AWNA 4DEXA 1CJTC 4R98A 4S2EA 1JJVA 1J8YF 1G5PA 1R10A 2IYLD 3DM9B 1B23P 2WJYA 4ZKEA 1W4AA 2OHFA 1II9A 1NLYA 2ZS8A 2ZS9A 4YQFA 1WDTA 1NNEA 1MO4A 2GWHA 2HYIC 2QPTA 1VKJA 2CCKA 5JWRA 1M7BA 3NTUA 3SJBA 2ZS7A 3UXMA 3U44A 2GBLC 1LY1A 1NVUQ 4HZUB 2O8CA 2FPLA 1ZINA 3X2SA 2WIBA 1DARA 3GFPA 4KVAA 4NYIR 4D4KA 2J0SA 1NLZA 4Q7KA 5C4MA 3DOEA 3BB4A 3UWOA 2XTNA 3QPWA 2WJJA 4BLQA 4ZI2A 5KUTA 2FDCA 1COWD 4MITA 5HKKA 3L0OA 1QBKC 3I73A 3CKLA 2OE2A 1ZM4A 4URYR 3LD9A 3FKSA 3KKNA 3OE7A 5KDLA 1Y63A 4EFLA 4TZ0A 3K0FA 2AFHE 4GL2A 2BWJA 2VF8A 3PJRA 1R0XA 4UNQA 2QORA 2Z5FA 2OT3B 4M1SA 2NO6A 3B1WA 5EE9A 3ZIAA 4EJSA 3QSYA 1CEEA 4JLJA 1VCOA 3I5YA 2ZR7A 2R6CA 1E4YA 2MMGA 4MQBA 3FVQA 1VG9B 2C78A 5CIQA 4PC6A 4GZLA 1Z83A 1W0KD 2NG1A 1R0WA 3WNBA 3UG7A 1FUUA 2GKSA 4LJAA 5AUOB 3VU9B 4QHTA 3SFZA 4KU4A 3MJRA 4Z8XA 4A2QA 1UEIA 2FFQA 1WF3A 4RZXA 2O8CB 3IIKA 5FR2A 2OEPA 3NHBA 1ZM7A 1SHZA 3W3ZB 1YZNA 2J41A 4KSCA 4RD4A 4G1UC 3EPJA 1JJ7A 4GPTA 4BFUA 3EPKA 5BN4A 1IQPA 1VCNA 4TTPA 5F3WB 1XTJA 4GNKA 4NCHA 2REXB 1XXHE 4R9UC 3EZ9A 4BFTA 1M1YE 1FOEB 2OUKA 2RB4A 3WBJA 3ASYA 4GSYA 2KE5A 3K0FB 4MUAA 4NBSA 1AZTA 4U5XA 3SHFA 1LFDB 2OFWA 1AGRA 4A0GA 1UJ2A 3GFOA 2QU8A 3JZAA 5FOVA 1EX7A 4IDQA 1AJEA 2C77A 4URWR 3RRMA 1RKBA 2J0UA 1KO5A 2QTHA 3QIAA 4FXPA 2ZRCA 4Q01A 3P32A 1C4OA 2A5JA 4LBZA 3GLFE 3BORA 3FE2A 3GLHB 1HY3A 4W5WA 1SVMA 4D4JA 3I72A 1BH2A 1S4QA 3NDPA 4H1VA 4D80A 3GLGA 4NONA 4LV8B 1GDDA 3U3MA 3K0CC 1N0UA 2ZR0A 3KJGA 2V7QA 2VA8A 3K70D 2JLQA 5LDDC 2BIFA 1VYVA 2QTFA 3OAAA 3MCAA 1DE0A 1QDEA 1RRPA 1FMLA 2Q3HA 1KMQA 3Q5DA 2QE7D 3QVVA 4TQUS 1TU3A 2EYUA 3KUCA 4B3DA 4OI2A 1SXJC 1KNXA 1XZPA 2QM7A 2ZRPA 3ASZA 4IJMA 2B21A 3RSOA 4A0FA 2XNSA 4E22A 2ANCA 2WTUA 5F9HA 5JHHB 5HCNA 1AS3A 1J2JA 1YZGA 2IXEA 2FU5C 3CPEA 2QG6A 4Q1FA 4X8HA 2IWRA 4DCUA 4DSOA 2VP2A 2PJRA 3U7EB 3L0IB 2QROA 2ZSDA 2CK3D 3B1YA 4OHZA 2GEDA 1GL7A 2RGEA 2J0UB 1Q1EA 1TPZA 5AK0A 1GSIA 2P0EA 4RD1A 2A5DA 2H7VA 5B30A 1PVOA 4PO8A 1EG7A 4LV6A 3FKQA 5EP4A 4B43A 3IPYA 2BBOA 2JGNA 3FMFA 1JALA 4QBHA 3RRYA 3TSZA 4NKRA 4O2LA 3DKVA 5GJWC 2D74A 2ZYTX 4LJ5A 2IW3A 3PUVA 4G5GA 1EFHA 2YYZA 4MA4A 1NY5A 3EXAA 3H0KA 1T8TA 5JLJA 2BCGY 3N5CA 2J3EA 3TR0A 2EFDB 1OE0A 3LXXA 3PUZA 3NDBB 2IXFA 3U3OA 2CNWD 2DYKA 2F6RA 3CIOA 4JLBA 5E4FA 5E3HA 4JBXA 2ZU0C 3LWNA 1KMHA 2PZEA 4DIEA 4V0KA 2YOFA 4M9QA 2W0SA 2YVUA 4AYXA 3U7HB 4CGZA 2A3RA 2FN4A 3RWOA 2J7PA 3RS0A 5E7IA 2VHQA 3VR1A 4BFXA 3QXHA 3PUXA 4TT3D 1MO3A 3Q7PA 3Q7QA 3TVDA 4AKIA 1P9WA 4O0MA 4YDSA 2P67A 2GXAA 3FGNA 4HLDA 4I1VA 1OFTA 4ZKDA 2V9PA 3B2EA 4YONB 2OCPA 5FUXA 3IUYA 4HB0A 1JEDA 2JEOA 3EAQA 3OIUA 1KI8A 2UZIR 1GKIA 1MRSA 2ZI9A 4OHVA 4JVNA 1P75A 2F3RA 1XCGB 1Q21A 3AGPA 4DLXA 4AKGA 4IXMA 1OSNA 3M6AA 3ONWA 2PBRA 3BWDD 4HAUA 2WSMA 4NMMA 4C7OA 2WWXA 2XITA 2HF8A 2QNRA 4IVRA 4QGFA 2XB2A 3D3QA 2ZSEA 1YE8A 2ZI5A 1CULC 4DB2A 5H1YA 3SQWA 1T9HA 8OHMA 1KMHB 1CXZA 1V43A 4M4SA 3O8CA 4WA7A 2AD1A 1FP7A 1ZD1A 4DLUA 1EX6A 2B92A 4IKEA 3ZYCA 3FMOB 1KSGA 1JECA 4A8JA 1GUAA 1ZIOA 2PEZA 3DHWC 1Z63A 2GAOA 3HU3A 3RLFA 1DAMA 2P6NA 4FCTA 5DH9A 3AF2A 3OIVA 3RRZA 1U0JA 4W5HA 3CO5A 1SVLA 1NJGA 1ZM3A 3F3YA 3HYTA 3B13B 4MGKR 1COWA 1G8PA 3NEYA 2FSFA 3CF0A 2QQ0A 2EFGA 3RWMB 3VFDA 2PL3A 1E1RA 3PR1A 5TVKA 2W83A 3TNFA 2J0QA 1TTTA 4XOIA 1A1VA 1DADA 4P31A 3TGPA 2QMHA 1B0UA 3QKSA 5GADl 4BGDA 2C9YA 4Q9LA 421PA 4PSAA 5FBLB 4ZDIA 4X8MA 3UATA 3M1IA 5K8UA 3GJ4A 5DO9A 1Z5ZA 3EARA 2QPOA 1W0KA 2QUZA 1N6LA 3KB1A 1WMSA 1D2EA 2R6DA 2AHOA 1CR4A 2Z83A 1U8YA 4EPWA 1XXHA 4ARZA 1L8QA 5JEDA 4A0HA 2D7DA 3MJHA 1F2TA 3QKUA 1CP2A 1QF9A 3T1OA 3BOSA 1IY1A 1KSFX 1GM5A 2IEYA 2ZRAA 2CLDX 2HXYA 2VLIA 3BFVA 1P61B 5C18A 1FQKA 4HDCA 3EC2A 4MKGA 1N0WA 1T3HA 5H8WA 4F4IA 1CRQA 5FL7D 2FSGA 2NO9A 4KFRA 3TW8B 1X3SA 4DLTA 3GLFA 1S9HA 2GDJA 2GETA 3R8CA 1AGPA 5BN5A 3GD7A 1FTSA 5BWMA 1DO2A 3K0SA 2RGBA 2JLWA 1K8RA 1SGWA 2GZAA 4AWXA 4DT1B 5DHFA 1P2SA 4FWIB 2ZXUA 1D6JA 1NRJB 3WMEA 4D4MA 1UM8A 4Z8YA 4P4SB 1XXHB 1G3IA 4ARZB 3IHWA 1JBKA 2J59A 1F2TB 2G3YA 3T12A 2CBZA 1DBSA 3K0EA 2RKOA 1P73A 3K53A 4G5RA 3PEVA 4NCKA 4DKXA 3VX4A 4DEYA 4E07A 3QXSA 1I4TD 4Q5IA 3REFA 2QE7A 1E9RA 1KK3A 1NY6A 2VBCA 3LXRA 3B78A 1E9AA 1JI0A 2ZRLA 2OXCA 2EU8A 2MMCA 1SVKA 3AQ4A 1ZRHA 3TW4A 2GCOA 1DPFA 2W0MA 1T91A 1N5IA 2VHUA 3PEUA 1SKQA 3CPHA 5JS8A 3GLIB 1N5LA 2NGRA 5GVSA 3QNUA 2CK3A 5DN6D 4V0LA 5JEEA 5FR1A 2X8AA 5FUVA 3EZFA 2IS4A 2GXSA 4JZKA 3EPLA 4DDTA 4JSYA 1JR6A 3NEJA 5TARA 2JLVA 1XTRA 3IQWA 1W36B 1US8A 1R0ZA 4OJKA 4DB4A 4LYHA 3VKGA 3LV8A 2P6RA 1N6NA 1NBME 1N6KA 4XJXA 1Z6AA 4M1MA 4PSVA 4RD3A 4KV9A 1OW3B 2YJTD 1FFHA 5FH9A 4RFSA 3L8ZA 4LC1A 3QE0A 5JWOA 4NYJQ 2YINC 3CRW1 2VH5R 2EFEB 3TIFA 5M04A 1GITA 1RIFA 1J7KA 1EFTA 2NO0A 3FMPB 2IL1A 2PX3A 4W9MC 2D62A 1NMYA 1P7CA 3AF3A 1NVWQ 4E03A 3CLVA 1RYHA 3QF4A 4IEEA 5K8LA 3NKVA 4I4LA 4A0RA 4YMSA 1QG2A 2HJGA 4LJ7A 4JLAA 4LJ4A 3WYAA 1HE8B 1VCMA 3HJNA 2JJ2D 1G8GA 5P21A 4BASA 2Q9BA 3MWLA 4TYWA 1DG3A 5AJWA 5JECA 5ELXA 4YXWD 1AQUA 3B6EA 5IK2A 3AH8A 1ZUHA 3A1VA 3RS7A 3PITA 5EE3A 4TT3A 2KJQA 1I4LD 1QHXA 3PUYA 3KDSE 2F43B 3UMSA 2XOKA 2VHJA 3KKQA 4C0BA 3SZRA 1SVWA 2ZRKA 3EIQA 3HU1A 3SJZA 4PHFA 1VYTA 4LUCA 2IS1A 4NE2A 1XP8A 1RZ3A 4L16A 4Q1AA 5HE8A 2ZE7A 3KQNA 4BZXA 4LJ8A 2P5SA 5DI3A 1FNMA 2JLSA 1E2PA 3A1SA 3CRRA 5EP2A 5AUQA 1E2IA 1G17A 2KBEA 1IN8A 3VX3A 1XEFA 2F1IA 3LFUA 4PXAA 3IBYA 1OB2A 5LD2B 1ZD9A 1RRGA 3LW8A 4G5QA 1ZJ6A 3VR6A 1KGDA 1GNQA 3MD0A 3FFBA 4ASUD 2WJGA 1G4UR 4UXJA 3RYTC 2WMNB 2O0HA 1TADA 3QOFA 2ERXA 2YWHA 3TLXA 5SZJA 2D7CA 3T1VA 3GCGA 1NVVQ 1Z0AA 2QAGB 2CL6X 2HDNB 2V4ZA 1Z6TA 4LY6A 1FP6A 3EZ6A 5CDFE 1SKYE 1VG1A 5KHOC 3HDTA 3P4XA 2V54A 4BZPA 1XU4A 4JSTA 2C03A 1XMVA 1TF2A 2WZQA 4TYPA 1KYIA 1H8HA 5HR5A 2ZSAA 3SJAA 2O52A 3VQTA 5KNCA 2IYYA 4G01B 2MSEB 5L3SA 1YZKA 2I3BA 5IF9A 4DCNA 1LB1B 1JXMA 1LS6A 1FL9A 1AKEA 4IDNA 4AKEA 4V02A 4CDGA 2BBWA 3LNCA 1OIWA 3EIHA 4PQYA 4HLUC 2ZI6A 2WM9B 3O8BA 4DLWA 4N1AA 2GJ8A 4DRZA 3NH9A 4BFVA 2ZJZA 4A92A 1HT2E 2G1KA 5BYJA 4GMXA 3U6KA 2FG5A 2W00A 5AR1A 2JJ1D 2ZETA 1E2HA 1Z3IX 2GZHA 4HUQB 2BJWA 3GJXC 2EQBA 4Z51A 1Z06A 2ZI4A 5JJIA 3QEOA 3F0TA 4FCWA 2QY9A 4A82A 1XTIA 4BLRA 2OSBA 2G0TA 4HAVA 2G9NA 1DG1G 3OEHA 1R8SA 1NG9A 3ZVRA 4TQ9A 4L4UA 3LDAA 1R5BA 1KY2A 2GCNA 4JLMA 4ZDKA 1JB1A 1O3YA 4B33A 4US2R 4Q7LA 3R9WA 1UAAA 2OBNA 1AKYA 1OIVA 2WWYA 4KLNA 5FBRB 3AVTA 5L3SB 3TR5A 3VAAA 2V6JA 1NSFA 2IYZA 2W2XA 5FL7A 4Z1MA 1W44A 2WPDD 2AKAB 1GKYA 2FWRA 1U2RA 2D4HA 721PA 2WJVA 2XSZA 6Q21A 2ZIAA 5FTKA 5A4JA 5KNDA 1SVOA 1J70A 4NH0A 3FOZA 3BGWA 2NPIA 2DR3A 4G0NA 1HE1C 3EW9A 1EFRD 3V4FA 1G3UA 4W5JA 3CWZA 3F5FA 5F2EA 1SXJD 5IT5A 2FFAA 4D26A 2Q3FA 2C5LA 3VR2A 1DS6A 3AGQA 2NO7A 2ZPTX 3BERA 5FTJA 3GLGE 4DC9A 1N6IA 2DHRA 2FFHA 2WKQA 3BH6A 3U7GA 3BC1A 4M53A 2GF9A 4Q47A 1H8ED 4TZ6A 1XMIA 2B6HA 2ODBA 4II7A 4O3MA 2Z0MA 1Z47A 2XTMA 3NWJA 4KYIB 3W90A 4CIDA 4LHVA 3WNCA 3NBXX 2IS6A 2P6UA 4KO8A 4F7WA 5TB5A 2VP6A 1OXTA 4HLQB 3PIRA 5FOTA 3KKOA 4UXIA 3CRMA 3NBZC 3NBYC 1P5ZB 3ZZUA 2B8TA 4KI0A 1Q1ZA 3ZDQA 3BAFA 2IHYA 2W6JD 1VTKA 1NSTA 1ZW6A 5KSZA 5DN6A 4CT5A 3A36A 2FV8A 1NBMA 3ADBA 5DI9A 4XD7A 3BRWD 4ESVA 2OFOA 5AJVB 3CM0A 4RCZA 5EUMA 1DAEA 4NCNA 2VHTA 2BM0A 3KZ1E 2HUPA 4JL5A 3AKDA 5CK5A 4LI0A 4DDVA 1GIAA 2ODNA 4F4CA 1YJ5A 4ABYA 2ZRHA 4PANA 4OI1A 2JATA 4A4DA 3Q85A 5IHPA 1V5WA 1G5TA 3TKLA 4QBGB 4XTCS 3SR0A 4XVUA 1OYYA 1K5GA 3K09A 3R7WA 1NN0A 3LBHA 4EAQA 1G19A 2ZITA 4ZI3A 3RAPR 1CR2A 3B60A 3V00A 3K9GA 4JJZA 2WAYA 4HZIA 2C8VA 3NBFA 3TAHA 2NMVA 1T8UA 1LF5A 1G4AE 1UDXA 1T0HB 4QG7A 3AF0A 2IUSA 1X86B 2VQSA 4PHHA 4Q19A 4AG5A 4C4PA 3I5XA 4LDJA 2F1JA 4OI4A 1XTKA 3W3AA 2OESA 1DAHA 4FMDF 3W6OA 4AC9A 3THYB 1JQJC 5B58C 5FL3A 2O5VA 4PZYA 1KSHA 4AKHA 3N70A 5G3YA 2ZJOA 3THWA 1E2JA 5IDVA 4EFNA 2ZJ2A 3EC1A 1ZM2A 2Y8EA 5KO2A 1OXUA 1Z28A 1KJZA 2OBLA 3AB3A 2WOOA 2QA5A 1OIXA 3LBIA 4Y0AA 3K9NA 1MABA 1DAKA 1AA9A 3X1ZA 4TSFD 2ZAMA 4XSGA 4I81A 2OO7A 3I62A 2QMUA 2GBLA 4ZIRB 2VPPA 1UBGA 5L3VA 4RZ3A 3WP0A 2CDNA 4DCSA 2OCYC 1NI3A 3PENA 1WBBA 3Q3JB 5EE0A 2IYSA 1EXMA 1I4DD 3C16C 3CNLA 4UXHA 5JCPA 5JFGA 5CDFA 2N1BA 1U99A 2F9LA 2CE2X 4TMXA 2XNDD 5EUQB 5DGXA 3BH0A 4Q1DA 4BLOA 4OL0A 2BMJA 4CRWB 1A2BA 1F48A 4N0EA 3DKPA 5FOUA 3FHOA 1XD2B 4FMCF 2DBYA 1GP2A 2YWEA 4WZAE 3SN6A 4ESHA 4PAOA 2YV5A 3THWB 4OQFA 1E79A 2A78A 4LHZA 1XBTA 4BE7B 2VRWA 2QL6A 3QXCA 4JT4A 4QHYA 4R2HA 4MKIA 3L82B 4FD2A 3RC8A 1L4YA 3E2IA 3AM1A 2V6IA 3LW7A 4URZR 2ANBA 2LCFA 3CR7A 1TUEA 1KSJA 2BVNA 3P27A 4GFDA 5EQTA 3U44B 4RD6A 4GOJA 3AF1A 3GQBA 3A37A 2WSSD 5LBIA 4HB2A 4XVRA 2H57A 2VO1A 4P0TA 5CM8B 1YZQA 3PUWA 1YVDA 1ZBDA 1R6BX 2ZSFA 1RFLA 4TTQA 4M8NE 5AWFC 4OQMA 2G77B 3SOPA 3NVAA 4EJSC 2QGNA 3VKWA 1Z0DA 2XAUA 2X2EA 1KDOA 2Q9CA 2VEDA 3G5UA 2ZU6A 3DM5A 4JVMA 3H86A 4FWTA 2K5UA 4DVGA 2DFLA 2PJZA 1TQ4A 1UKZA 2QTVB 4M1YA 3WNDA 3AKYA 4EJSB 3FHTA 5AJYA 2XZOA 1VDZA 2NPFA 2SHKA 5GJVC 1OHHA 4IDOA 5FPTA 4B73A 4JVLA 2QAJA 5FOSA 4V0ME 4ZV4A 3VNUA 1IXRC 4TL6A 4WOPA 3RS4A 3IILA 4DZZA 2DB3A 3ZLJA 3K0CA 4GBMA 1KI2A 2BC9A 4KLZA 3T34A 2ZE5A 4H1UA 3T1QA 4JBWA 1GTVA 2Q0HA 3BFKA 1GRNA 4A6PA 3KQHA 2HEIA 3DDCA 5CIWA 1E9EA 3IQXA 1XPRA 2QMEA 3A1WA 3TSOA 4URXR 1LV7A 2CEAA 1OPXA 4Q7MB 3GEIA 5EP1A 4DDUA 1U8ZA 4QOSA 1MT0A 5CJ2A 1ZU4A 2PEYA 3AV0B 2JAQA 2WOJA 4NL4H 4XSHA 1NIJA 2Z43A 4AD8A 1DAGA 5DSZA 3DPUA 1L2TA 1Q3TA 3E5HA 3ZS9A 1QZXA 3Q8XB 4GOKA 1EWQA 4JBYA 3VKHA 1XTSA 3L43A 1E1QD 2OFXA 4NZYA 1W49A 3SE0A 4M0LA 5D3MA 2DFNA 1P2TA 1Z2CA 1DEKA 4KITB 5TY0A 4Q03A 2DCUA 1NKTA 3GLGB 1E2KA 5JSZA 3BFXA 1U81A 2RHMA 4ACBA 2CE7A 2V55B 2F55A 2J0VA 2FE4A 2R8RA 2ZYUX 4I99A 4L9WA 4Q1BA 2BEJA 4GP7A 4N3NA 1Z08A 2NZJA 1N6HA 4OK5A 3OEED 3SYKA 1XZQA 1U0HC 1S3GA 2F7SA 1P72A 3DZ8A 3ECCA 4UNRA 4ILEA 3W8NA 2C2HA 1JR3D 1Z29A 4PSKA 4QBIA 1UPTA 2XZPA 4I1OA 2ZROA 4KVGA 2JIZD 4AURA 1S0UA 3B1ZA 3Q5EA 5JI3E 3LLMA 4CZ2A 2LWIA 1XJ0A 4NPHA 1J90A 1OV4A 4O2RA 3ZS8A 4US0R 2HCJB 2FGKA 2FMXA 3OESA 4OK3A 4TN1A 2FH5B 2GK7A 1W5TA 1KKLA 5CJPA 1FPMA 2PT7A 2IYQA 2QGZA 4ZDJA 3DMNA 4RVCA 3VHLB 2QENA 5KYKA 2IC5A 1XMSA 4C0QC 2FF7A 4QRHA 1W2GA 4NCIA 2GZDA 5CB6A 1U94A 2PMDA 2DFTA 2VP5A 3A4MA 3HU2A 3C7KA 3I1FA 3WYFA 4ERNA 2KBFA 3I32A 3CB4A 1KO4A 2YOGA 5G3ZA 5A0FA 1WP9A 4EUNA 2G1JA 2ZM5A 4BRWA 3BJIC 1VYUA 4HI0E
chains in the Genus database with same CATH superfamily
4YUWA 4BMZA 3UENA 1BKYA 3PNYA 5H9WA 2ZOSA 4PPNA 4PFJA 4RGVA 4E88A 5KZMB 1PK8A 4R1PA 4EHLA 1T9KA 4K6OA 4LXUA 4NXMB 1MAWA 1MF7A 3CVWA 1G20E 3FGZA 4ZI7B 3ZNPA 2AKEA 4J16A 1UM9A 1YDWA 2FSVC 4GOLD 4TSRA 2XVMA 1T5IA 1KO8A 2B37A 2XVYA 3NOVA 2DPHA 3I37X 2PFSA 2HU5A 4XYBA 1P7WA 5JWHA 1J2EA 2HGSA 1PLLA 4WZAA 1JFFB 4QQRA 1R66A 1DV2A 4V0QA 5CLGA 3WIOA 2X15A 3UMVA 2IJGX 1NP7A 2P9CA 3EF0A 3EUAA 3F6SA 3M81A 2CCJA 3Q3CA 4JUDX 2IW1A 3G88A 3ND8A 4E4YA 2PL5A 3H1AA 1YZHA 4PYRA 4DQXA 5AI9A 1JAIA 3L79A 3R5JA 5SY6A 1G5RA 3OBBA 1RQLA 2Y0EA 3UPTA 2W90A 1ORIA 3AHFA 3W5AA 2ZIXB 2R7NA 4K1LA 4MW1A 4TWIA 1GXSB 1Z88A 4F1WA 2YICA 2D1TA 4BGVA 1WHSB 2AH5A 4A8JC 1XEAA 4ZCIA 4FXOA 3CJRA 1WU7A 2R00A 5I51A 1EVYA 1NXTA 2PQMA 3TZCA 4IDEA 4KR6A 1W5SA 4MPPA 4WLVA 5H83A 4RKWA 5H59A 2C83A 1SPXA 3DT9A 1XHEA 2WB2A 4I3GA 1U2TA 3EZGA 5EYPA 3TRDA 4S05A 5LJIA 4BWFB 3ETLA 1SXPA 2HK6A 4NBRA 3DB1A 4PAGA 1RC8A 2J7KA 3KXKA 4KWEA 1SCKA 3ABSB 4ZTZB 2FQ1A 2YIDA 4IJWA 3KUDA 3GLVA 4MVXA 3VR5A 3FVWA 3DZIA 5H0IA 3T9CA 2FI1A 3A0UA 4WZAB 2O8FA 1O2DA 4BTVA 2QJOA 2RGXA 5AK3A 2OVBA 1Z8HA 5AK5A 1XMQB 1L4KA 4YDHB 3DDSA 4D81A 1GOTA 1TUGA 1XRSB 2FZ4A 1RWWA 4WBNF 4A03A 1O9BA 4TYYA 5AOCA 1XG5A 3ZCPA 4OXRA 1UKEA 3W1VA 1XZBA 3B9BA 1AG9A 2ZB4A 3HP7A 5DX0A 1MRNA 3VSCA 5D6NA 3AIKA 3PNOA 3QJYA 4DIKA 2J87A 3K4PA 1W30A 1F1BA 3FYTA 3ANMA 2PH7A 1M10A 3C43A 3QKSB 3MLEA 2FZWA 5CT8A 5ERXA 1BXKA 3ZOZA 4DPKA 4U00A 1E9DA 2AKYA 1UJMA 4UNNA 1LI4A 4XDYA 4ZCPA 4I4CA 4KKXB 1DRUA 3V6MA 2C04A 2FR1A 3CX6A 3H99A 1L7QA 4LRXA 4OGFA 3CVYA 5EUCA 1TEZA 1O95A 2OY0A 3C97A 3GJ8A 4ALJA 4H0CA 1H1LA 1W0JD 1C9DB 1KK2A 1QS0B 3R6TA 4H6PA 1W75A 4Y9UA 4GMKA 2HRRA 2Y05A 4JXXA 1O8BA 2OCKA 4AP9A 3Q8MA 2YZGA 4MAAA 4P9NA 1G64A 2FOLA 4Q4JA 2Y1CA 3A58B 2PPLA 1GGHA 1H66A 1JT2A 1PVDA 4GWGA 1HUQA 4B3FX 4RDHA 3D8HA 1T4CA 2OD9A 4WKNA 3BH7A 2AK3A 2QT0A 3LUKA 3ESRA 4D9FA 1SHUX 1TAUA 3JQCA 2JAUA 2O8FB 2VVTA 2FMKA 1XTVA 3T1NA 2JK0A 1PGJA 4ZCLA 3VR4A 5FNVA 3RDPA 4AY3A 5C3UA 5J43A 1N9GB 5JNLA 5C52B 3ZJUA 1OXKB 4TS9A 3URMA 3GVCA 5BNFA 3HCCA 2WKSA 1USUA 1NSYA 2CN1A 4OBEA 4FZ3A 1NYTA 4RIEA 1P6XA 4Q21A 2EZUA 1H2EA 1SBZA 2J5BA 5C4GB 2HSEA 3I6YA 4IFEA 3VYRB 5EJ5A 4MPJA 1CS0B 4IJKA 2WJ3A 4K9RA 2RH5A 3BE4A 4BVAA 1Q0QA 1LWOA 5JMWA 1EEXB 1A4UA 3JVDA 3BICA 4V0NA 1FX0A 2OR3A 3DOJA 2QV0A 4K6GA 2B2XA 5F1PA 4PRLA 3IP8A 3C4VA 2EDCA 4G86A 3HFJA 5JCJA 3A6KA 1ODSA 2Q50A 4OQNA 3MM4A 5HJ7A 1NUPA 3IT2A 4Q0MA 3WAJA 4YJHA 5JNSA 2I2WA 4BCBA 4EKDA 1PJ2A 4Y1RB 1TK2A 3G1UA 1A9OA 1NNSA 1TDJA 2X1VA 5DGDA 1DWQA 4XWYA 5TXGA 4DLZA 4I1IA 2R8BA 4ZYXA 2ZRFA 1WUTA 5ERYA 5JMPA 5IM4F 1O9GA 3E9YA 5AKGA 5TT0A 1V6AA 2V4MA 2CNDA 2WBLC 4LVOA 1O94A 4G9BA 1ZC3A 4YRLA 5J2TF 1PNQA 1NUHA 2O1EA 3OECA 1FRQA 3ZH9B 4D3YA 4ESOA 1O08A 5D01A 5JD6A 1U9YA 1DOAA 3L6BA 1TYCA 4DLBA 3ADOA 3GEHA 4OK6A 4L4RA 3JYPA 3IMFA 1MIHA 2WJHA 4ZJPA 4UW9A 3R5HA 2UYHA 3PNQA 1G1MA 3HR8A 1DDIA 4Z3OA 3WIUA 2XWPA 1JAHA 3QOWA 4Y3UA 4QGHA 2BKLA 7MDHA 5JARA 2EWMA 1TJPB 1GCOA 1J0EA 3OOWA 2BEWB 1FU7A 3Q3IA 4YDRA 3RIMA 1NV8A 3C6XA 3A3OA 4IF6A 3MWDA 3QF7A 2AC4A 2IX9A 3HSKA 1V1MB 3CCBA 3NHYA 4UCXA 4G0VA 4QODA 1KJQA 3V1MA 1QIFA 3I9MA 4EK9A 1YJQA 5A3QA 3FFWA 3R0XA 1EVIA 1T0BA 1Q77A 4NDAA 3OZSA 1Y3AA 5EWMB 3WBBA 4M8SA 4F3NA 4GDFA 4JVSB 4LF4B 3EIEA 4EHHA 5IVKA 4CTNA 1WX1A 3AZPA 5TMPA 3S8YA 1QP7A 5J1TB 6CHYA 3EEFA 1N75A 3L07A 4Z6KA 4TQAA 3KJEA 1XRRA 1Q7GA 2QZ9A 5TQ0A 4Y8VA 3UUGA 3ZGVA 2X4DA 1RIIA 1OQAA 3A1TA 3Q40A 2R2GA 3ZD6A 3WHPA 4FVTA 4MUIA 2YHAA 4N9WA 2OB1A 2HIGA 5ICCA 5CFMA 2XR1A 1OH5A 1G20A 1P0MA 3NHRA 2I9PA 3LOPA 2AS0A 1BFDA 1FFSA 3SZ3A 2DBRA 2GQ0A 3EVFA 2VBGA 3R4VA 2N42A 2V0NA 3R20A 1I2AA 1HXHA 2AN4A 4IHKA 5AVXA 4MS1B 4HWGA 4BJHB 5DWDA 1Z0ZA 4P4TA 3X1DA 3H3FA 1C1DA 1KZ9A 4HXEB 3SF8B 2X5XA 3E53A 3ICPA 5CG2A 1NQTA 4BO5A 1E2UA 3GA0A 2DPXA 4LSWA 1GPYA 5C2JB 1MG0A 5EXEA 1GPBA 2EQ5A 1E9BA 2IT1A 2Q46A 5FOWA 4N47A 2WWWA 2QUKA 4X84A 3W5HA 2HHCA 2RK6A 4JYCA 1I5EA 2ID4A 2CDAA 3W9BA 1PK7A 3P1JA 4JKIA 4MIKA 4IJ6A 2VAMA 3FUVA 1Z4JA 5FBKA 4EHJA 3HJBA 3UB3A 1CUXA 1IN6A 1NONA 5TQ0B 5TDHA 1PUJA 1G55A 2VP0A 2YW9A 4MRPA 1XYVA 2IYTA 3N2NA 4FNMA 3OIDA 5ALNA 4N48A 4Y2UA 1I4EB 1N5OX 2YHBA 3ZHTA 1PX2A 1E0SA 1P2DA 2Z2IA 1P2FA 5HKKD 3KYDA 1NU6A 2XNKA 3B1KA 1FFYA 1ISRA 4R1NA 3RKSA 3FKSD 1JILA 2IE0A 2O5EA 5ANRB 4PS1A 5JJLA 4ITRC 4TLDA 1RRFA 1S2OA 5FHRA 2W2KA 5I5GA 4EHAA 2B99A 2YV1A 2TMGA 3ZZTA 5JHGB 5C8DA 2HZ7A 1ZXBA 3K5HA 4UUOA 1YFJA 1H94A 1N25A 1OYVA 3MS4A 3A1UA 3PVZA 5FLYA 3OWXA 4RV5A 1QWSA 4LDPA 5DDIP 5ADWA 1ZMTA 4L7QA 3BGDA 3OX4A 2CNOA 2A57A 1O0BA 2XRFA 3OWHA 1HBJA 3M1YA 1Y3IA 2GILA 3R3ZA 3C7TA 4ENUA 1IOZA 1YJ8A 4MUGA 3HCOA 2VHCA 4ZN6A 2QRMA 4FGSA 3TKAA 1E5XA 2YRXA 5CLQA 4BO3A 4D6XA 1SR8A 1UFRA 1LVUA 2XYQA 1MCZA 2YWXA 2OZLA 1YZVA 1VKHA 2DLNA 4KDCA 2PWAA 4RJTA 1T9AA 1RCFA 4FFBB 4TXHA 2ORVA 3ENZA 2ZBDA 1NQAO 3MTGA 4JR0A 2NZWA 2G08A 1VRWA 2V6FA 2RCYA 4ZRDA 1SQSA 1NBAA 1QK5A 3CSSA 4E2ZA 1EGMB 2YVQA 4LHWA 2JGFA 1UXJA 1VSVA 1X7XA 5K0CA 1IOLA 2ZDQA 4XH9B 3K9WA 3HEMA 3VU1A 2QBYA 1UBTS 4QREA 1UMBB 1AS2A 3PQFA 1H4SA 1UF9A 2QYOA 2JGKA 2RDMA 1JHXA 1XCJA 1I9CA 3ACCA 1OJ7A 1EUDA 1T6NA 5B2FA 2WD8A 4J1TA 4EPVA 2BKEA 2EX4A 3TSWA 3U7RA 3OZFA 1GL6A 1ZK0A 3LUDA 4XCXA 3NT5A 1JFVA 2GZMA 4ZK2A 4CTJA 3EEIA 4Z1OA 4H60A 3UKJA 4O2BA 4JZYA 3RHZA 3FLEA 5BV8A 2I03A 3VJMA 4Z9XA 2PS1A 4B6QA 1VLZA 5B1IA 1T4DA 4DTIA 4YYEA 1JPVA 2UZ3A 3DAYA 4R2LA 5IU6A 3E6AA 1RU3A 2H9AA 2PX4A 5LA6B 4GP9A 5J9FA 1JQLB 3MTDA 5DASA 5JADA 2YV2A 4NFYA 4ZC8A 4WN9B 1SUAA 4F91B 1EIWA 3EIFA 4K28A 1EFAA 3SEZA 5EIBD 3S2FA 4US1R 3U2QA 2HMUA 1CFZA 3AFGA 1KAEA 3K1ZA 5M34A 1H4QA 4GUAA 4COKA 2O0JA 3PCRB 4PFSA 1E3WA 2E4WA 2Q3DA 2R6AA 3T52A 4B4UA 4BLSA 3UJPA 2N3ZA 4YAJA 1R12A 1JHYA 1GA1A 1X7WA 4D3DA 2A0XA 2C98A 3NDJA 2IBTA 4CG3A 1E59A 1XZEA 2W71A 3BCSA 1Z2OX 4OU5A 2E87A 2VZLA 4L8YA 1XLTA 3D8BA 2PLAA 3OE4A 2BJHA 4EJ2A 1FTYA 5JDIC 5CGQB 2A7QA 3GRPA 3FPAA 2ZM6B 1Y1KE 2BFPA 1ODFA 2BHTA 2QZZA 1K27A 3HZHA 4PHGA 2NZVG 3KHSA 2R65A 5SYAA 4NFLA 4OP2A 3RV4A 5ES3A 4MPRA 4ZMSA 1JH8A 3ZDAA 1J0AA 1P45A 3UMRA 2ZYVX 4KX3A 2JPDA 2DQYA 3GP5A 5EJ8A 4LCJA 1QTIA 4RFLA 1MH1A 1OBFO 1N9KA 3EWNA 3IIMA 4FIZA 4KPUA 3FETA 5HIAA 5AMXA 2J5RA 2I4TA 1F2UA 1JLMA 3H5VA 2Y71A 1E2FA 3NDIA 4GI5A 4YPVA 1KIFA 4NX2A 5BQ5A 1CQJA 3OKFA 4UNSA 1BX1A 4XWAA 5JSQA 4HATA 1Q20A 3B7WA 1W1UA 4DCOA 1IY0A 1BROA 3KX2A 1YA6A 1E3WB 1KVTA 1DRJA 2BMFA 3NUQA 1CHNA 4AM8A 4G26A 4C4OA 5D3KA 4GOOD 4YXWA 1NVDA 3V80A 1TRKA 2AL7A 2W6ZA 2HCRA 1O87A 4JUFA 3NAZA 3Q12A 2VK1A 3AZOA 4R41A 5GZ3A 4ND5A 4BZQA 5LQMA 4Q1EA 2BHNA 1FU8A 2J7PD 3EPPA 4EHDA 4GQIA 4GZMA 2R1VA 3AXSA 5KJCA 3GVXA 4NNPA 4JNCA 1UFKA 3COVA 1WA5A 3BXEA 4NXNB 5CX1A 1B8NA 1WR8A 2RFLA 4HZUA 5CB4F 3K09C 4XDZA 1NVTA 5FTLA 4G5YA 3IDFA 4CMAA 3OCJA 3A3PA 1E94E 4JYBA 3A7EA 1R6VA 3DOHA 2NTYC 2O8DA 2EGHA 1CWUA 3VPBA 5FJIA 4DEVA 1JDSA 3UWKA 1OZ0A 2FN9A 1FDRA 4X97A 3U7QA 4KPUB 1HYQA 4AN4A 1UP7A 1N6OA 4NCXA 4AZ0A 1AS0A 4AZVA 4DANA 3T5TA 4FOLA 1QYRA 5JAOA 2XCIA 3O74A 1ONOA 3OZUA 4BVKA 3EG5A 1S4MA 2H1SA 1CV2A 5THXA 3C8UA 3VR5H 2HA5A 2WHYA 5C5EA 1LDGA 4RK5A 5AD1A 1THZA 3ESDA 5I7AA 5A4AA 4BV8A 1T3ZA 1TQ6A 2ODTX 2WTXA 4OM8A 4PGGA 1D9ZA 1OTXA 2OD7A 3LKZA 5AHXA 4CKYA 4DYHA 1P9RA 4N6NA 1ZNWA 3ES9A 3OZBA 4OHWA 3A4NA 4BQEA 3G7UA 4B46A 2OLKA 1PG2A 4H4DA 4X6UA 1CUSA 1Z74A 3T9EA 3W34A 4WBNA 1ZR2A 1KFKB 3STXA 4C43A 1PZGA 4QC2A 5KBYA 1G9XA 1E9CA 3F90A 2UKDA 4A6XA 1B8OA 4FPXA 4HUJA 5LC1A 5B4UA 4N3AA 5KU1A 3DWFA 3JWGA 1ZD8A 4F5YA 3N3BC 2OC9A 4G1BA 1XHFA 4R2MA 5BW5A 2R9VA 1Y7LA 1GAXA 1QNFA 1M2JA 1YRHA 2BL4A 4M21A 5BXQC 4GOXA 2O8DB 3KUUA 3PEYA 3AVVA 3NHFA 3O8QB 4BJ1A 1JIXA 3KPJA 3OPMA 4EPRA 4ZI5A 4COOA 1PJLA 5BR8B 4Y2HA 3TUZC 2G8LA 4P3NA 4FJ1A 5LFAA 3TL6A 3DL7A 3ZGXA 3WVNA 1BQEA 3IKTA 1K5DA 2RIRA 1H9BA 2P1DA 4R9NA 2WZDA 2R96A 4Z3DA 5JATA 1KI7A 2JJ1A 1V4NA 1Z6XA 5CUQA 5JIBA 4TUYF 1TVMA 3CUTA 3KKMA 1H93A 4HFRA 4RD2A 3A31A 3WGQA 4WRRA 1MOPA 3GCZA 1CUUA 1MJFA 3BWBA 4XGRA 5D86A 2Q29A 1YKFA 5DYTA 5HG0A 9LDTA 1YGPA 5EXTA 4B3XA 1W93A 4MQFA 3KLPX 1H85A 4MDFA 4FN5A 1NVVR 3SVLA 1V6SA 3I61A 1AMNA 2EAUA 1P18A 1E2NA 4WBXC 3TZBA 2WVHA 1POWA 3ZWQA 1BYIA 3PDJA 1C0LA 4MK4A 1BX0A 3AVYA 3O92A 3PC2A 3OSUA 5EIOA 1Q1AA 4OSEA 3IPCA 3WWCA 1YQTA 3LRXA 3R0QA 5CHYA 1W8DA 1R8XA 2YQ4A 1ZD4A 2DWOA 4UQPA 4R3NA 3RGWS 1LVGA 1SQ5A 3U0VA 1W7AA 3ZCRA 3BILA 2UV8A 4RDIA 3GMIA 1QIMA 2WPDA 3UIEA 1A77A 4U7WA 1NRIA 1XYYA 3PKIA 4W8GA 1TIPA 2NOAA 3DZHA 3FOBA 4ANFA 4LZZA 1UIMA 3I04M 3UEOA 3MUNA 2I1WA 3ZXYA 3KVYA 3GI1A 3VAYA 4KFUA 2W2LD 4EUSA 3TE7A 4B5LA 3FLMA 1EFRA 3HB5X 5AJZA 3AEQA 2GKGA 1VKRA 3ZUGA 5JBNA 4RETA 1JZSA 4WX2B 3ZK7A 3E70C 3QWIA 4ARSA 4QG3A 4O4JA 4MQFB 2HLPA 1UJ4A 3WLKX 1XDDA 1ONSA 2WAAA 3C3WA 4LOHA 1ZH8A 4RSMA 5DB4A 2XMQA 1QFJA 4C30A 2IE8A 1TLFA 1H8EA 4NBVA 3MILA 4ZDWA 1W36D 3WK4A 2J9RA 1RPZA 2ZWMA 1HZZA 5K3DA 3LPDA 3LPCA 1H0SA 1OX4A 3O4VA 2IV3A 3K9CA 3VTKA 3CRVA 1YZ3A 3BJZA 3JARB 5I9BA 2G67A 3ND5A 4K03A 1MX1A 2WT4A 1GZ7A 1ZG3A 2YDYA 4S1WA 4X9XA 4Y6GB 1A98A 3C8HA 1DQRA 4BB9A 5BVGA 3JX9A 3MBOA 2BGGA 4BE4A 3UGJA 1G5HA 4L8LA 3GDOA 4LHXA 1U2ZA 4UM9B 3FGOA 4DYDA 3ON5A 5LL6P 1PFQA 2JH8A 1OA1A 2CZGA 4BX9A 4YV1A 4CL2A 4KVZA 3PS9A 4L5CA 1XEXA 4U5QA 2AW5A 1I36A 1V37A 2MSNA 4G0ZA 2B61A 5DRYA 4A15A 2IDKA 3TW6A 3BGIA 4O4HF 3H2BA 3TO5A 1TU4A 2JG3A 3UFXA 1UBJS 1YE5A 2GJAA 3UOAB 2Y27A 3PC8A 5E1DA 3U3KA 4EYEA 3DHNA 4O4JB 1V5IA 5E7JA 2YZ2A 1OXSC 1D6SA 1U98A 2PWYA 2PQ6A 1XZFA 4XX1A 1DIBA 4CF7A 2X9LA 2B5OA 2VOEA 2FW6A 3QVUA 5CYFA 3ONDA 1XIVA 4ARVA 2FWIA 2OYSA 4RFVA 1OX4B 2R79A 4HB3A 4CHTA 1V4VA 1IOWA 821PA 3OT1A 3EW7A 1CF2O 3PSHA 1OWLA 3U4GA 4C2AA 3DUFA 2OVFA 3A6PC 2AN5A 3HLKA 4QJIA 3FNRA 4C9BA 1KH2A 1LBTA 4INAA 3WQSB 1J9GA 1KQ3A 4DA7A 5U9CA 1E3MA 1E3JA 1L7PA 5G2OA 4KMSA 3I76A 4G56A 4FEEA 3UO8B 1KNQA 2HMYB 2WPNA 3ND9A 3BKWA 1FNSA 4FT2A 4MRRA 4C3ZA 1C1XA 2M9MA 1XEXB 1VLVA 2CJXA 2YIMA 3R24A 3RFCA 1SOMA 3CVUA 3NBQA 2OILA 3OM1A 3WLPA 1KEVA 4FYKA 4EITA 5ABPA 2Z2YA 5IJZA 3KCNA 4UOQA 1ELOA 1JDTA 3TFQA 4ZAGA 1Z8FA 1MNAA 3GW8A 3V1KA 4A10A 2NO4A 4RYDA 5K51A 3N2GA 5IKOA 2WC1A 3W6UA 3JQ7B 4MP6A 1SC6A 2PXHA 2WFMA 2ZJ5A 3ED1A 5L7WA 4QTUB 1ZVJA 4EVSA 1KFEB 1X42A 3D3WB 2AB0A 4L6CA 1Q7BA 4JLVA 2AE2A 2REQA 1DGQA 3GNQA 2Q0SA 4B3TB 2XOKD 4C2UA 4TSFA 1B73A 2XCRB 3TJRA 4RY0A 3MS2A 2C8KA 3D4NA 2QXTA 3DZFA 3OT1B 5BQXA 4E3WA 1T5LA 3EXEB 4K8OA 5ITZB 1YF3A 4ETNA 5L3ZA 2G07A 1QHYA 2J45A 4CNQA 3EWIA 2CMFA 4IW3B 4QUEA 2FQYA 2PZJA 5PGMA 1I7SB 3IXLA 3K8QA 2RBEA 3RIXA 2CXOA 3R5XA 2VUUA 1D0SA 2BHRA 2CFTA 3VV3A 4MKHA 2IV2X 1SVSA 1RBQA 2IBMA 3UW3A 1RM3A 4U2EA 1XJQA 2GHTA 1UXGA 2C4UA 1W2WB 3DNPA 4L8GA 1O77A 3ZGYA 4S1TA 2ILVA 2X0FA 4PWZA 1A4RA 2F17A 2HHLA 2FRVA 3OCCA 4OJMX 5ALFA 3O83A 1T5DX 2A9KA 2H2GA 3WA7A 4GL2A 3RPEA 2GEFA 5A2GA 3QG1A 5G02A 1VP3A 3JU3A 3BMNB 3PKZA 4OFXA 4YJFB 2GBFA 3BEDA 1LWNA 3RUPA 1FYWA 1Z36A 4R40A 3VPSA 2JDID 1GN8A 1YUNA 3N8IA 2QD2A 3GRAA 2YYSA 2VDUE 4JMPA 3IT0A 4TKUB 4EL5A 4HK4A 5AXDA 4QBFA 4C21A 2OZEA 3SS9X 2REQB 4R7ZA 5F2NA 3V4LA 2AFHA 3DMDA 2WUEA 2O48X 2RHDA 2R1TA 4RWZA 1JFLA 1ZWLA 3QYPA 4S35A 1T5OA 3CH5A 1YRQA 2B8NA 5THKA 1WBJB 2VP4A 1JHDA 2GNPA 2QRPA 3DBRA 4HRXA 4KEAA 4B4DA 4EB6A 3CRQA 3RT1A 2XB4A 1K7SN 4RPJA 4CV0A 4JI4B 5EMNA 2WSSA 4MV0A 2XGOA 1JVSA 1W4RA 4GVLA 4PNPA 4Q3OA 3K5PA 5DW0A 3DVAB 1UBMS 2CZCA 3L7BA 5TMBA 3PDCA 4L95C 2P30A 4RM2A 4FI3F 3AKZA 2G80A 5LP6F 3T3PB 4UHDA 4BU1A 3QHQA 4RZQA 4CCYB 1A2KC 3ZWXA 2E1RA 2R00C 4RH0A 2E5WA 1GNTA 2ODWA 1WEHA 2AVNA 4FZ5A 1OT3A 3L8HA 3A6ZA 4IGFA 5EJ4A 2E48A 2GUGA 1O4VA 3F7MA 1T6XA 3NGMA 1OI2A 4JBIA 3Q7RA 4H6WA 4ERXA 3OE5A 4G1EB 4OSOA 4P4SA 3P96A 5EKUA 4XIGS 3SU8A 1PFVA 4KSYA 2I91A 4IILA 2BKAA 2L42A 4ZJUA 2B8EA 3RW9A 4XWWA 1FDSA 2WF7A 3HB7A 3T3HA 4G2NA 1FW8A 3OZCA 4I8XA 1RI4A 4B3GA 5CA1B 3EZ7A 2PH1A 4AZ3A 2Y1EA 3JQ8B 4MYSA 2GF0A 4BO8A 1VKOA 4HNAA 3DBRB 2P9EA 1H6AA 2P78A 1CBUA 1UP6A 4G1VA 1K3FA 2IVZA 3KKPA 4RKYA 5DMXA 2OLEA 2YXNA 3VH1A 2QMOA 3A4TA 3FTNA 1KYWA 4KN8A 5ICMA 1DKMA 1KERA 1J4AA 4UMEA 3U3RA 5FAXA 3HQ4O 3V00A 2XSZD 1RXIA 1DJOA 2C9BA 5LIRA 1U3WA 2P5YA 3BQNB 1PKEA 5CK4A 1GSAA 4MI1A 1EEHA 1SCJA 1F9EA 5K3FB 4KQ1A 2ZQYA 1OXVA 4JP5A 1O95C 3ANXA 4TOIA 5FFMA 4R3WA 4URVR 1FTNA 2ADFA 3FWHA 3QMPA 1NVMB 2B8WA 1ZOSA 3O73A 1HQKA 1SA0B 2ZIFA 4W8HA 2H4WA 1Y1SA 3ETDA 1R5NA 1YH3A 3LUFA 2QUHA 3L0BA 4QLOA 4MUEA 5LN1A 1V0JA 3DBIA 3QITA 2OCLA 2XF8A 4KSBA 4L4SA 4HN9A 2YH2A 4BC1A 4M37A 2H0RA 3FJ1A 2MYPA 1NXOA 1M2NA 3RUEA 1E1QA 2JIOA 4JQOA 1Z18A 2Z1NA 3D5TA 4REMA 1NBEA 1I1NA 3NC1C 4EPYA 4EEZA 2P2LA 2V0GA 4JIMA 4KIWA 3WFJA 1Q7TA 2WQZA 2Y0BA 2B4YA 2VDPB 3N6XA 3BMQA 4O0LA 1PGOA 4CTKA 3GEEA 1QR2A 3ONFA 4ZAWA 1PZMA 1I2ZA 2P9FA 3OU7A 5DEOA 3PYLA 4U0JA 1XCLA 3F67A 4FBMA 1N6PA 2X3YA 3AJRA 1P77A 1UMDA 4LRSB 1XF1A 2WJ4A 4NK4A 1TUBA 3GXOA 1XRMA 3NNNA 1P39A 3O4GA 3G79A 2EGGA 3TSCA 1QSGA 1M0EA 3PFBA 3N8HA 5B12A 2ONYA 1ZA2A 2WG1A 4MRMA 5JV5A 2MR6A 2A0YA 2VDLB 2W42A 4GX5A 4OQPA 3UGKA 3C0KA 2ZGVA 2QYSA 1VI5A 5AW5A 3D6VA 2K87A 3NVKI 4K9NA 2IEDA 1FLDA 1F7UA 3DOOA 3NP9A 3TDNA 2BCJQ 1E69A 4HVAA 4J2OA 1ZM9A 5IX8A 5IDQA 2FPPA 5FWYB 1IXYA 1O94C 2J5XA 1TC2A 2ZAGA 2R68A 1HNXB 3HZOA 4TRMA 5NLLA 3RC3A 5KCMA 4YPOA 3E5MA 1WW2A 4LPKA 2V45A 2RAFA 3OVMA 4WIAA 4B1FA 2LNDA 4EGCB 5BSFA 5IXJA 3T9BA 1QHHB 4JB3A 4CM7A 2J3HA 3LG2A 2V7XA 1J0CA 1FQJA 1M54A 3AHIA 3GCWA 4OU4A 2Q2QA 1FMJA 1Y6QA 1YFZA 4UM7A 5BPHA 2P11A 3EJ6A 3LUPA 3MAJA 3P4YA 4LRWA 4PIMA 2HQ1A 4GPZA 3EK2A 4D2IA 5DLYA 4B80A 4IGIA 1OX6A 2G4CA 2OV6A 3L6UA 4LJRA 4DZTA 1JPJA 1XAGA 2AMFA 2JS7A 4KCGA 3T9AA 3COPA 3H5LA 3NPAA 5LKAA 3R3YA 4LKRA 4X90A 4ARBA 1RXWA 5DT9A 1E64A 1JQ5A 1DEXA 1MIOA 2ACVA 1X7DA 2JGAA 2Z6VA 3NM5A 2FZ5A 3AK4A 3HBLA 4TUYA 2X9NA 1P2BA 5CYGA 1JAZA 1XRNA 3S2EA 4MICA 1IZ8A 1YIOA 4ND2A 1QPGA 4MUXA 4QWWA 5HWSA 4MYHA 3N39C 4FFMA 5IZCC 1BMFA 1NJ5A 2CVPA 3S81A 1JYEA 2JARA 4JDPA 3GA7A 2X2OA 4EIWA 1AZLA 1G6OA 1V5GA 4YI3A 3TVTA 2H1VA 1HLGA 4IGEA 4U3JA 2HR1A 1QF7A 2AYYA 4DQ0A 2NNWB 3LVQE 3N8NA 4MYRA 1H2ZA 4RK6A 4RLSA 2B2CA 2JLRA 5CFPA 2JJMA 4EYOA 4IDAA 2O8EB 3FG9A 1Y81A 3LC2O 4Z86A 4DJJA 4LE1A 5AKIA 1E2BA 2VPYA 4LQCA 4Q4AB 5H5JA 4HLUA 4RQTA 2QSYA 3IAM1 4TV9B 4IH4A 3W5VA 1XRLA 2B7LA 1XNJA 4Q24A 4Q9KA 4MH0R 3U3ZA 2IA5A 1P4GA 3BXHA 3QKRB 3TKYA 2OPBA 4I5FA 3VSEA 2YRWA 5FAKA 2JDIA 1NR1A 1S1MA 5AW9A 3ROQA 3PF9A 1U3VA 1PNRA 2M6LA 3T61A 3GLSA 2CBXA 4MHTA 3VKVA 1CUJA 2HCTA 5F3DA 2WD9A 4WBSA 5DF1A 4B8YA 5ALWA 2BDTA 3QUCA 1JSCA 3PQCA 4IZHA 4PCLA 4R1QA 1Y4AE 1YVRA 3RVSA 4QUGA 4DLKA 4RMIA 2IF0A 3JQPA 2WJ6A 4GMHA 4AUNA 3N2KB 2BF4A 3BD9A 1C9KA 4R0MA 4PPQA 1XVTA 2ZBVA 3VSDA 4B0OA 1FXSA 2NO1A 3KQLA 4EA9A 1E1NA 3PJEA 3SQNA 4OHYA 2IF2A 3H84A 1TF7A 1SC4A 1U3FA 1U3GA 3JATB 4ATNA 1LFAA 3RI3A 1SOWA 4BYMA 4F86A 1SVUA 1KI1A 2J1LA 4BMDA 2BE9A 2WSBA 1NIPA 1ZJYA 4WA8A 5HUHA 3KZOA 4M83A 5IDXA 4FM9A 1IBMB 1IMJA 4TL8A 4BFYA 1ILEA 1J8FA 4IQFA 3RK0A 3TJZA 2DX7A 2UZ4A 3G82C 1C8BA 4Q7JB 5DHTA 3USCS 3UTDA 1VLJA 1K3UB 1S8AA 1PSDA 2C0PA 2HBRA 4PC1A 3S2YA 4C88A 4LBWA 1KO7A 3RCBA 3GNTA 1DKPA 1JEAA 1QUEA 2XDQA 2RAVA 3AI1A 3COSA 3GGPA 4O4LF 4H59A 4YRMA 2WE7A 2JLYA 3QYAA 2GX6A 4DCCA 3D2AA 4YQEA 1H6DA 3OOSA 1Z82A 2A5GA 4I55B 1YZLA 1EUZA 4BKRA 4K46A 1RC0A 4JLPA 3QUQA 4OM7A 3CLKA 4HDQB 3VVLA 1GILA 1IBCA 4IOMA 4O4HA 2VT3A 4XQ0A 4JL6A 2DY1A 4G85A 4KH0A 4EI2A 1OASA 3A6DA 4G8JA 4H4CA 3TLGB 3ROEA 5HYVA 1OZAA 5IAOA 3OF5A 5J4LA 5FQNA 2PUTA 4OB6A 1ISJA 1WQ1R 4DXDA 1H5QA 1CP3A 2P1ZA 1C14A 1I3LA 2WM8A 5AESA 5M5BA 2OK8A 4A36A 4E1AA 5EWJA 3U37A 2BFEA 5B1YA 2HT1A 521PA 1RRKA 2P5TB 3TLBA 5DHRA 2F3TA 4JJEA 1M5UA 2PFGA 4R1TA 2BUCA 1WULS 1NXSA 3AC0A 1ZH0A 4POAA 1U11A 4B6RA 4HLCA 2ZT8A 2ZEJA 1RQ2A 1SMKA 2PNFA 6NULA 2XDQB 5J4KA 5DBEX 2FP4B 2H1WA 3HL4A 1UDWA 1KJYA 1VE5A 2AMLA 3IAFA 4GF5A 4J1TC 1ZDMA 2ZBEA 3FI0A 4MWCA 2J5QA 1YI0A 3OJFA 1Y7TA 1QDUA 1NRXA 5CW1A 4Z7OB 1T8YA 1WVIA 4IUYA 5EIAA 3ZNOA 4ZHQB 3FMGA 1GTMA 3AJ8A 3QE3A 4JC0A 4CFZA 2QVYX 5KTPA 1VFNA 3MEQA 2BF7A 4GGPA 3I3OA 3NORA 1S2GA 1E5LA 4L51A 2ZDHA 5JJBA 1DFHA 4D9NA 4AS2A 1NN3A 4B84A 5E7QA 1RCUA 5AXBA 3I1YA 3N05A 1V39A 4EF6A 2Q0QA 1XJWA 1AKTA 1DBRA 3LHDA 1JHMA 4R5MA 5CITA 2IPOA 2W5UA 3DF9A 1S3SA 1LQTA 1LW6E 1XC7A 2GTPA 4LBVA 4TRJA 3SC2A 2WEKA 5FV4A 3EEOA 4J4TA 4M2LA 4XVQA 1F12A 2QJWA 4Y6QA 3UKDA 5JO9A 1G21B 1OFVA 2EFCB 1F6BA 2N9UA 4X20B 5I9MA 1KJ9A 2OA0A 3VA7A 1IDOA 4BFSA 5KTYA 1YS4A 3VXKA 2K2WA 2Z4SA 3THYA 2WM3A 5DHAA 3JAWA 1FDWA 4MARA 4NMWA 5K99A 1Z26A 2RK3A 1XLTC 1NJSA 2W6OA 1IZ0A 5HDQA 3BAZA 4HWOA 2VZ0A 1NT2A 4X93A 2ARKA 5EZYB 2FZKA 4HEJA 2JZNA 4WAUA 4B7ZA 3EVZA 2BHSA 3DOUA 4B85A 4HDOB 1MAUA 1O03A 2O3JA 1VE9A 2NVBA 2OV4A 2Q7OE 1IEVA 1MLDA 1FDOA 5JCZA 2QN3A 3F3MA 1V2GA 4ZIRA 1U1FA 2VRNA 3O7MA 1VCIA 4OD0A 2EKLA 2A30A 3P2MA 4GICA 4ODIA 5BR1A 1XDBA 3PJDA 5IKXA 2PUCA 1YFLA 3LCJA 3NYRA 2QLFA 1CUFA 4FEYA 2IDZA 3RS8A 4ZCRA 1OC2A 1YL7A 1X8KA 1WXQA 4NYMR 1WHTB 4ZEXA 1MX9A 3SFVA 3WGOA 3HA5A 3QI2A 4EELA 1XKTA 1N7HA 2DWPA 3PI7A 3SC2B 4RENA 5HRAA 3EBOA 1Y8RA 3MSXA 5D85A 4CKWB 3LIPA 3U61B 3L2OB 1Z15A 2ZYHA 3CXUA 1Y4SA 3L0PA 3VO1A 3M2TA 4W5TA 5JAZA 5GJBA 2QTAA 1E0AA 4RW0A 1DX4A 5LYJF 2I2BA 1Z2AA 4O1MA 1U2GA 1A7KA 5WRFA 3PEWA 5EJAA 2XZTA 1F5SA 1W4ZA 2JCBA 4RHFA 1AOXA 2AE1A 5A7HA 4DEXA 1SCBA 5LP6A 2B4QA 3L8EA 5ALHA 3FDFA 2IYLD 1QP0A 1JTVA 3HUDA 2OHFA 4UTZA 4UTXA 4E5PA 3L7JA 1FNDA 2ZS9A 3AOEA 4E5MA 2ZUTA 2B1GA 4PPYA 3ZHOA 5I5EA 1NNEA 4QU5A 1IHDA 1SN7A 2CCKA 1BXGB 1EVZA 3NTUA 4LNUA 3SJBA 2D0IA 1HEYA 4ND3A 4O63O 4MVCA 3UXMA 2P9GA 3RH0A 1IDN1 4WLFA 4K9QA 3TMAA 2VZ9A 3BL5A 4CE6A 2JAOA 2NVUA 4NYIR 1DARA 3GFPA 4D4KA 4NQZA 5I4CA 3JCZA 4DQLA 2QJRA 1VHWA 3QPWA 4Q6BA 3NIWA 4N0MA 3DLAA 5H02A 5AW8A 3FSEA 4WNIA 3GHYA 1Y8RB 4KTVE 4OLAA 1B0AA 3R3JA 4R68A 1YMUA 3L0OA 1VL5A 3WKDA 5JD3A 1LCIA 2IHJA 3BK2A 4HKTA 4E7OA 2W93A 3I73A 5TQ2A 4E5KA 2PN1A 2WWRA 3CKLA 4URYR 3LD9A 1B16A 2VXBA 3OC0A 1JKXA 1Y63A 2OK7A 2P9QA 2Q99A 5ITSA 1MV8A 1OFGA 1E8NA 3HGMA 4GC9A 1LEHA 1QG6A 3WYBA 4ZCQA 3N0WA 1N77A 3TRIA 2VF8A 1Q0TA </