4G1UC

X-ray structure of the bacterial heme transporter hmuuv from yersinia pestis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
262
structure length
262
Chain Sequence
b'AVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemin transport system permease protein hmuU
publication title X-ray structure of the Yersinia pestis heme transporter HmuUV.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein/hydrolase
total genus 71
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g1uC00
5JRZA 3QY0A 1N6NA 4X8HA 1RRCA 2QN6A 4LHXA 2V8OA 3RRNA 4OHZA 4LHYA 1IONA 1R5BA 1IN6A 3F8TA 3PEYA 2BWJA 2A5GA 3CIOA 4IFEA 2J7KA 2H7VA 1FP6A 4IVPA 1JEDA 4LV6A 2QBYA 1EFRA 2W0MA 1FFHA 2GEUA 2E1RA 3LX5A 5IRCD 1KK3A 3UMSA 2E9SA 2VP2A 2LKDA 3LX8A 4PPQA 5KO2A 2OCPA 4LJ7A 5FUVA 2WOJA 1KMHA 3RDPA 2C77A 1IY0A 1TQ6A 4DLTA 1OYYA 1X8KA 4RFVA 2DYKA 3RLFA 5FPTA 5C18A 1QG2A 4G1UC 1OIVA 1GRNA 3T1TA 5HKKA 1Q57A 2BVNA 1E9AA 2ZRFA 3WMFA 3H84A 3NVAA 1GWNA 2PJRA 5DSZA 1V43A 2O8EB 1OH8A 4D25A 2O8BA 4OKSA 1UFQA 3EX7C 3AP2A 2VH5R 4OHXA 4YQFA 4DKXA 5AR1A 4QM6A 4MRSA 3EWSA 4IDPA 2GXUA 2QM8A 2CDNA 5F98A 1EX6A 5DO9A 4RFSB 1N6KA 2IYTA 1FX0A 2F43A 4Q4HB 4TT3D 2QGNA 1KKLA 5FI0B 2G9NA 4A8JB 4TYYA 2IUSA 1E1QA 1MRSA 4AYWA 2QZ4A 3QPWA 2RGBA 2WMNB 2GXAA 3KB1A 1N5KA 3Q8XB 5DHFA 5ELXA 3EZ6A 4HLDA 1QVAA 4DDWA 2XSZD 4OYHA 1UAAA 1AZTA 4WAUA 2BMFA 3L82B 5CB6A 2YWGA 4GSYA 4WIAA 3NIBA 2XTNA 4FXPA 2IXEA 1XNJA 3HP1A 1YRBA 2RGCA 3SFVA 3VKGA 4FN5A 3TSOA 2I3BA 3A4LA 2ZQ5A 5DGXA 5SZHB 2C99A 2C5LA 5CIWA 2FSHA 1H8ED 2F3TA 4RD0A 2VP5A 1UBEA 4JYCA 1YZGA 1CP2A 1G4AE 4IHQA 2UZ3A 4BASA 3IUYA 2A2ZA 2I1VB 3GLFE 1Q1QA 3F3YA 2J7PD 2IS1A 1NLZA 2HCBA 3FKQA 4YMSA 4KVGA 4JBWA 2ZUCA 1SHKA 1XD8A 2QU8A 5FPKA 1EFCA 5D3MB 4CEHB 1II0A 3CONA 4DLWA 2ZSDA 5TARA 4EPVA 2H92A 1YZQA 1ZUNB 1D5CA 2FFBA 5AUNB 5GVSA 2FWRA 3Q85A 3ZQ6A 4HLUA 4BRWA 4D0LB 3DZ8A 1BIFA 5FBLB 4B76A 4JLMA 1NVVR 3JZAA 1IN8A 2YHSA 2HT6A 2BMEA 4FMDF 1CBUA 5JWHA 3U3RA 2WAXA 4PSAA 1G5TA 4CZ2A 3MJRA 1G7CA 2ZRBA 4RZXA 1XTRA 1JNYA 5IDVA 1U94A 5FI1B 3AP1A 2Q0HA 4GOJA 4JLVA 1NSTA 2C8VA 4LYFA 4ZI2A 1DG3A 4JL6A 5F2EA 1DELA 4FW9A 3V4FA 1NN3A 5G53C 4GL2A 2ANCA 1N6PA 3GJ4A 3QI2A 4M1WA 2ZJYA 5DN6D 3LWNA 5JS7A 1DOAA 1HE8B 3PEUA 5DISB 4AK9A 1OB2A 3LLUA 3DDCA 3KL4A 1HTWA 2NPIA 1KJZA 5IK2A 2R6CA 2VIIA 2ZS8A 3K0AB 3KFXA 5J4KA 3T1VA 2HF8A 4IDQA 5FL7A 4XVUA 4IVRA 3KTAB 1KZGB 4Q21A 4PX9A 2QMHA 2GNOA 4Q4LA 1OFUX 1QRAA 2ZANA 3AEZA 4I1OA 3TIFA 4IDHA 3CNLA 2UZIR 3Q72A 1SKYE 1JQJC 1Z22A 4CIDA 1EFUA 1RZ3A 3B2EA 4W5HA 2O52A 3FHTA 1NN1A 1M8PA 2OCAA 1XD2A 1KGDA 1M6NA 2G0NA 4MUAA 4NTZA 3K70B 2VP4A 4Q7LA 1KDRA 5G40A 4F7WA 1EFHA 2ATXA 3RABA 5FOSA 1E2MA 4URUR 1JXOA 2X19A 2BBWA 5AJXA 1CS4C 2A5DA 1KI3A 4LYHA 4RZ3A 1Z0AA 2W2XA 3REGA 1R4AA 2NO9A 2OEPA 1KK0A 1XEXA 1K5DA 4CF7A 3PUVA 2ZSFA 1MABB 1TF5A 4B71A 1NKSA 2OM2A 1W49A 3OIWA 1X1RA 5ANRB 3OHMA 3DMNA 5EP2A 1DARA 1UKEA 3I32A 3OAAD 3PXGA 4I4LA 4WOPA 4POAA 2J46A 1P2SA 2RGNC 4C7OB 2JEOA 3NBFA 3PITA 2JDIA 4TTQA 4PR0A 3PCRB 3SNHA 3UKDA 4AY2A 3JVUA 4PHFA 2NPFA 5JJLA 4QBFA 4TQUS 3ZZTA 2EWWA 2ZU0C 3GLHB 5EUMA 2VL7A 4A2QA 5EQTA 1LS6A 1BYIA 2JLSA 3B1YA 2HYIC 1YJ5A 2DHRA 4H9GA 2O0KA 3GLGA 2QMUA 4NP6A 3HPQA 4V03A 2A5YB 2ECKA 1BMFA 1G7TA 1TQDA 2O8CA 4GDFA 2BM0A 3I5XA 2ZAMA 3BORA 1BOFA 1K5GA 1GL6A 2P5TB 2WAYA 2X77A 4TMZA 4CRWB 4DXAA 4ZI3A 3LBIA 3P32A 2WJHA 1XWIA 2IW3A 1KY2A 3MMPA 2SHKA 4RSGA 2WICA 1KK1A 5TY0A 1E2PA 2WKQA 4HUQA 3MG9A 3THWB 2Z5FA 1PLKA 2RGNA 1GITA 2GZAA 3HR8A 1UKYA 1RJ9A 1LVGA 5EXSA 1KI7A 4F92B 1S4QA 2NOAA 1P9NA 2D2FA 4LSGA 4IXNA 2JJ8A 4BFSA 2AK2A 5HCNA 1AM4D 5DE3A 3MFYA 4DIDA 2Q21A 4FINA 3RS4A 4DC9A 1W0KA 3VNVA 4ASUA 4IOJA 4Q1AA 3GLIB 4NU0A 4C3ZA 3EXAA 1MT0A 2GBLC 4QGHA 521PA 1E94E 2G6BA 1FUUA 1U0HC 2AKYA 3WY9A 4DRZA 3PJRA 4D2IA 3C15C 3A8TA 3AUYA 3EIHA 2FSIA 1EFRD 4TZ6A 2J1LA 1TQ2A 2V6JA 4JKIA 2ZJ2A 1GNPA 3SZRA 5JBQA 5EE9A 4WXPA 1QZXA 2QP9X 1GNQA 2FSGA 3UATA 1W48A 2GILA 2H16A 3ECCA 4P0TA 5AJZA 2EFCB 4HB3A 1ZYUA 2QUZA 3BC1A 4K8OA 5GADl 4LWZA 5E7MA 1DS6A 2A5JA 2ZRGA 1NIJA 5AJWA 5IF9A 2IWRA 1M34E 4G01B 4U7DA 1W0JA 1GTVA 5LPNA 2XTMA 1D2MA 2ZI6A 3BXZA 3DPUA 4PO1A 4LX0A 2FU5C 4PPFA 4BLTA 1DAFA 5JCPA 1YZKA 2IEYA 3CNNA 4JLDA 1P2VA 4A9AA 1MO3A 3U5ZB 4HDQB 2EU8A 1XCPA 2J0UA 3TSZA 1Z2AA 1CF4A 1E1QD 4HAWA 4GZMA 4KXFB 4PZLA 4X8OA 4BRUA 2NZ8A 3QPUA 3FTQA 1UJ2A 3FKSA 1R5NA 1VCNA 1Z0DA 3BFKA 4LJ8A 4RFSA 5BWMA 2O8BB 3B1XA 5KNDA 3C5CA 5FTKA 5B2ZA 4DCUA 4LZZA 3T5GA 2FV8A 3BB3A 4Q4HA 4UXIA 2J3EA 4LJ5A 4M9SA 2IYLD 3IGFA 3VNUA 1OSNA 1E2NA 1ZUIA 5FFMA 1BKDR 3NG1A 3QE0A 1XXHA 5B30A 1J70A 1FX0B 3VR4A 4W7SA 2PZFA 2Q9AA 1FNMA 2QORA 5G3ZA 1QBKC 4AYXA 2F43B 5JECA 1JB1A 2AD1A 4FCVA 4A2WA 3IQWA 2GJAA 4G0NA 4JVMA 4Q9KA 4YC7A 1PUIA 4C0SA 1S1CA 4RZUA 1NF3A 4NCHA 3THOA 4BEJA 3MWLA 1J7KA 1Z83A 4XJXA 1W46A 1T91A 3I3SR 1JPNA 4LC0A 1EESA 4BLOA 3WYAA 4QRHA 5J4HA 2IYYA 1N5JA 4OI0A 4B47A 4DIEA 2QT0A 5JRJA 2WM9B 3FFAA 1U81A 2PCJA 1T5IA 4KFRA 1LF5A 4Q1BA 5FR1A 2QRZA 4R7ZA 4RZ2A 2JIZD 5JI3E 2BMDA 2P6NA 2A9KA 4AKIA 4GT1A 4PHHA 5G3YA 1W44A 1ZM4A 1IM2A 3FMIA 2A30A 2GEDA 1J2JA 4Z1MA 3AVUA 4GPTA 2ORVA 3W6NA 1TU3A 5CB8A 2QENA 2F55A 1E98A 2F6RA 2IHYA 4K81B 3R8CA 3E5HA 1R6BX 4II7A 2CNWA 5D3MA 1VCIA 1AK2A 1T9HA 1MH1A 5FOTA 4CT4B 5BXQC 3ZVNA 2GKSA 4ACBA 1ZBDA 3THXB 1GL7A 3MGCA 3QKSA 4IDOA 4LHWA 1JR3A 2WHXA 4B6FA 1NJGA 1XEWY 4U02A 2GTPA 4TLEA 4MH0R 1E2KA 3MCAA 4XTCS 1KY3A 2CJWA 1KI1A 2GK6A 3TUJC 5IHPA 5DNYB 4Z54A 1Q20A 4EFMA 3KQLA 3QKRA 4R98A 5JFGA 1AQYA 3WP1B 3CBQA 1WA5A 2OBLA 3A1SA 2BEJA 4KFUA 1KI9A 3U7FB 4DUGD 1B0UA 4KU4A 1JQLB 4E09A 2FFQA 1T3LA 1WBBA 3L0IB 1AQUA 2ZRNA 4Q7MB 3RSOA 4DLYA 1KI2A 1NN5A 4AKGA 1CXZA 5IK2D 1XJ0A 1TEVA 3K70C 5FL7D 4JLNA 4DCNA 2ZYVX 2IUTA 3GJXC 3VHXA 2D3WA 4AC9A 1E4VA 2QSZA 1R0XA 3ZIAD 2PMDA 4QXAA 2PMKA 3CNOA 3O8CA 3RAPR 2PX3A 2RHDA 4D81A 3NH6A 5JS8A 3K0CC 1ESMA 2D4HA 2N42A 3SHFA 4OQMA 1OE0A 1JR3E 2BMJA 4KYUA 3DZDA 4I81A 2Z83A 3CW2A 4LPKA 3ADCA 4AG6A 1G17A 1MO4A 2EFDB 1IY2A 1NLYA 2VPPA 4HZUA 4Q9LA 3GFTA 3W5JA 4DZZA 4M4SA 5JZVA 3CH4B 4IKEA 4NPHA 1FP7A 5HPYB 5FTMA 4OHWA 2QGZA 2WBLC 5SZIA 3DM9B 1XEWX 4JLJA 4A92A 1UBGA 2YZ2A 2QG6A 2V6IA 1JAHA 3EC2A 4CDGA 3DO6A 2EW1A 4DDVA 3PEWA 4Q1FA 1OKKD 2ZSEA 2FEMA 2ZRIA 1X8JA 1NY6A 2J45A 3AKYA 1IJEA 1CLUA 2W00A 3LVQE 3OEHA 4M8NE 4B2LA 5JLJA 4A15A 1KO8A 3FMPB 3TRFA 4D6PA 3C5HA 3R20A 3D6TB 1DPFA 3I61A 1R5OA 3FPAA 1HUQA 1OW3B 4GP7A 1R10A 1TUEA 1GM5A 1CJTC 3Q9LA 3EA5A 3M4YA 4Q4JA 4BLPA 1G291 4BLRA 4L9SA 3KJGA 1XEXB 2IUUA 2RMKA 5KSZA 4C7OA 2H5EA 1NJFA 2R6DA 2XAUA 3H86A 3K8YA 2WWYA 1BMFD 2EYQA 3D7MA 2JJ1D 1G8FA 1WF3A 2VRWA 1VECA 4JLAA 4URXR 4LBWA 2NMVA 3HPRA 1YR8A 1E2FA 1N5LA 1Q1ZA 2BIFA 1VYVA 1HA3A 3MWYW 3OFNA 2ZR7A 3RRMA 5FUYA 5FBQB 3SR0A 1NBMA 1WBDA 1OJLA 2TMKA 3L43A 2CE7A 3B85A 4NE2A 5EXXA 1SQ5A 2VP9A 1ZCAA 2R6GA 4M1MA 3BRWD 5CLLA 3SHWA 5K8UA 2CLSA 4D4KA 2AX4A 2Q9BA 1GNRA 1D6JA 2A78A 3GLGB 2MMGA 1NMYA 2VHTA 1GOTA 1F2TA 3BD9A 1G3IA 4QJ5A 1D8TA 4Q9HA 1KDPA 4C0AC 3EA0A 4HAYA 4HSEA 2O8CB 3PFIA 1DTSA 1WP9A 4ON9A 3LFUA 3PUWA 4BFYA 3LRPA 3THWA 2GJ9A 3ZZUA 1PLJA 4O2RA 3IEUA 3RWOA 4ASUD 4Y0AA 4DT1B 5SZJA 2HCJB 4FMCB 1E6CA 2A7QA 2O8FB 2OXRA 2WIAA 4HUQB 4YMUA 1P4SA 3CR7A 2CK3A 4PQYA 3U3OA 3AKCA 4ZO4A 1G7RA 1Q0UA 1CJMA 1L4UA 3A1VA 5KDLA 5LD2C 2OFOA 4Q1EA 3GLHE 5DH9A 4EUNA 3BOSA 3TUZC 2IHBA 1GKIA 2DPXA 1NSFA 3RRZA 2WKRA 2C03A 3GLIA 2AFIE 1OXUA 1RKBA 2QPTA 3GEHA 4LBZA 2XGJA 4MGKR 4X8LA 5TB5A 4N3NA 4LCBA 3FMOB 1HY3A 4MKFA 4DSTA 2HF9A 3TBKA 2RGAA 1R0WA 2G88A 3Q5EA 5CYPA 2BM1A 2WIBA 4NCJA 4F4CA 1EG7A 4UJ5A 2VYFA 3LA6A 1SXJB 4MKHA 1EFTA 2OCYC 3HJNA 4R2HA 1XDBA 3AVXA 2FG5A 1ONBA 2V3CC 3SOPA 1II8B 1U98A 4GZLA 3LAWA 1EX7A 3B6EA 3MRSA 1U8ZA 1D9XA 3HR7A 4DB2A 2JLUA 4Q00A 3U61B 1AS2A 2AD5A 1LS1A 2FH5B 3X1ZA 1E0JA 2FGJA 1M7GA 4N0EA 3MAAC 221PA 1XCGB 2AK3A 1GKUB 5HR5A 3AVPA 3FHOA 3O8BA 4RCZA 5EZ5A 1W36B 4DLRA 5FL3A 2YWFA 1I2DA 4DSNA 1OF1A 1L8QA 3VR1A 1P9RA 2OV2A 4YDHB 4YDSA 3NHAA 4BWYA 1IHUA 3AP3A 5CM8B 3QF7A 1VHLA 2P3SA 2EFHB 1BYUA 3ETLA 4C30A 721PA 2RB4A 4JLBA 3E2IA 3EASA 4FWIB 4D80A 4Q66C 1A82A 4NL4H 5GJBA 4Q4AA 1FTNA 3L8ZA 1FUKA 4TTPA 4BFXA 3C14C 1JBKA 1E4YA 2BBOA 1Z8FA 3UG6A 1U90A 2J0UB 2GJSA 3DM5A 3ZVLA 3WNCA 2IYRA 1G21E 1ZUHA 5E7JA 4M1KA 4MYTA 2BCJQ 1HT1E 2ERXA 1VG9B 2ZS7A 4WXRA 2KJQA 2F7SA 3LBHA 1R0YA 4BPBA 3BB1A 5E95A 5GJCA 1RVDA 2YOGA 1P60A 3WNBA 2OHFA 1KDTA 2PX0A 1YVDA 4KCGA 1XXHB 5CJPA 3L2OB 1P3JA 3CPJB 3UG7A 3A6PC 1ZNZA 3OIYA 4O3MA 3T5DA 3BK7A 1ZP6A 1SVLA 3BWDD 121PA 4JLPA 4OJKA 4Z51A 2F9MA 1UBCA 1E9RA 5K8IA 3AF3A 3PV0A 4HDOB 1BO6A 1P7CA 1I2MA 1E9EA 1S9HA 1Q22A 4HLUC 4LGMA 4HEJA 5DYGA 3A1WA 5FTNA 1YZNA 4HDCA 1G5RA 1JR3D 1HURA 3B8HA 5JEDA 1UM8A 2PT5A 1Y63A 3CRQA 4CEIA 2V54A 4M0LA 2QRNA 4UXJA 1CULC 2KBEA 1IBRA 1ZU5A 2RGXA 3THXA 3LO5A 5EE0A 4TLAA 1DAIA 4O25A 2GJ8A 3EAQA 1P73A 4TWZA 2I4IA 4ZKEA 4BFVA 4DVGA 3QG1A 5LDDC 4G5SA 4W9MC 4MRNA 2CCGA 3QKSB 1XTQA 1Z07A 4RVCA 1E2EA 2QP3A 2ZRMA 4JSYA 2J0SA 4GRAA 2R6AA 4JIMA 1G3MA 1AS3A 4J0QA 2H57A 1PVOA 2Q9CA 2CJWB 2WWWA 2IBMA 1COWA 3SYLA 3GJ5A 3N5CA 3RS5A 1P5ZB 3ZZ0A 3QKRB 3ADDA 3F0TA 4MDFA 2Z4SA 4C0KA 3SE0A 3ZH9B 4BEBA 4ZIRA 2HLDA 4ZCMA 1OB5A 4JVNA 3S1AA 1XMSA 4IW3B 2G0TA 1W5SA 2QTVB 2VF8A 3QIAA 3SJAA 3T1QA 5A5GA 2YYZA 4DLXA 1AN0A 3QEJA 5FOWA 1ZCBA 2RHMA 3SDZA 4TQAA 1KAGA 3NWJA 3BERA 1ZJ6A 1Q44A 1ZD1A 3SEAA 3TR0A 1IAQA 4BUJA 1IXSB 5KDOA 2B7BA 4ZDIA 4UJ3A 3CF0A 4LV5B 3RS0A 3QOFA 3SC3A 4B43A 1PV4A 2FPLA 2IEZA 1A2KC 3QUSA 3EPLA 4IVQA 6Q21A 3AF1A 1TEXA 1C1YA 1KAOA 1ZINA 5KSOA 2X2FA 3QEOA 2I1QA 2AKAB 1ZMXA 3K70D 3K0SA 2CBZA 4NYIQ 3TW8B 3BIFA 2OUKA 1CU1A 3EPHA 1W2GA 3B1WA 1WQ1R 5B58C 2YOHA 3IHWA 1E69A 5AUQA 4OI1A 3OEHD 2ZSAA 4I1UA 4D82A 3NBYC 4RD3A 2DCUA 2NG1A 2VF7A 4P31A 1JR6A 4QOSA 2XNDA 1OFHA 4MRVA 2ONJA 4TL6A 1S2MA 3GFPA 4HZUB 4B48A 3THYA 2QMOA 1DAGA 2ZETA 3NXSA 2G1KA 4ACAA 1H8HA 2YOFA 3DOFA 3U6KA 2HUPA 2O0HA 2O5VA 2B6HA 1TU4A 3GJ3A 4AWXA 3CH5A 1AA9A 2F1JA 3AKDA 3AV0B 3D8BA 1ZNXA 2IXGA 4KLZA 3P4YA 1ZNYA 5KUTA 2VP0A 1M74A 2ZI5A 2ZAOA 3OE7A 4OJQA 1A1VA 4TL8A 5TMPA 2DFTA 3KB2A 3EZ9A 3OESA 1Z2CA 1II9A 2BKUA 3B9QA 1G8GA 3JZMA 3P4XA 821PA 2NGRA 2R6FA 1GRRA 4LPSA 1YQTA 3OFND 3RS7A 1KIMA 5JEEA 1NBMD 1NG1A 2PH1A 1AZSC 4LJ4A 4X8MA 4Q4JB 3CR8A 5E4FA 2FFHA 1NVUQ 3LW8A 4QKQA 3QSYA 2FA9A 1CKEA 4LYJA 4U00A 4TQ9A 1W7AA 3TH5A 1KSGA 1ANKA 2HJGA 2FZ4A 3AVQA 3GFOA 3NHBA 4MYCA 5CDFA 2KI5A 5P21A 4LHVA 1KO5A 2JGNA 1G64A 3TAHA 2ZRAA 3WMGA 3A58B 2OBMA 3CX8A 5TXGA 2QNRA 2P6UA 4YXWD 3L0SA 4OI4A 5EE1A 3SN6A 4A4DA 5KOYA 3QXXA 1E79A 2QMEA 4V0KA 3ZVMA 4OHVA 2CK3D 2XJ4A 2IYSA 5A0FA 1XD9A 2GCNA 3QBVA 1F2TB 3PENA 1A5TA 3OF5A 2A3RA 4KITB 1US8B 4DT1A 3FVQA 1SXJC 4TSFD 1KI6B 2W6IA 2XB2A 5D3QA 4D0GA 4B34A 2NIPA 2O8FA 4A0GA 1CEEA 3LXRA 3H4MA 3PQCA 4Q7JB 3O8DA 2Z0MA 3OIUA 4WVFA 3AGPA 4EPRA 4JJKA 3ZLJA 3ZD7A 2GAOA 3OEEA 5TVKA 4A1FA 2MMCA 4FI3C 4KFTA 3REFA 1VPLA 1HEIA 1J90A 2IT1A 2KSQA 4IRUB 3FOZA 1W36C 2EWVA 3GPLA 3EARA 3CKLA 5LB2A 1U0JA 2CLDX 2OFWA 3AQ4A 4WBSA 2ZRHA 4PQFA 4R71A 1YZUA 2DFLA 3IPXA 5KNBA 4E22A 1EWRA 1JECA 3GEEA 3QPVA 5JHGB 4A0RA 3GLGE 4WZBE 5FR2A 4Z8YA 2BKEA 3BE4A 1F2UB 4TTRA 2F1IA 1G9XA 621PA 3X1XA 2VSFA 1TAGA 1SXJA 2C78A 5C46F 5F3WB 1Z0JA 3E70C 1W4CA 2PEYA 5KSPA 1II8A 4P4UA 1R0ZA 4KODA 2R65A 4NYJQ 4RD2A 3AVYA 4CVNA 2WJIA 1JI0A 2QEQA 3B5JA 1Q21A 4XD7A 4U5XA 4MQBA 3A1TA 3AF4A 4JJZA 4Q01A 3UANA 4G3XA 2G1JA 4JBYA 4QJ3A 3PVSA 1OXXK 2YINC 2OILA 5AUPB 1QHNA 2WJVA 3P26A 4HAUA 5HKKD 5LD2B 1OIXA 4LI0A 5CIQA 1HT2E 5DLQC 2CMKA 3QXCA 2IYZA 4LJ6A 1ESNA 3CRW1 1XTIA 3AVWA 1X8LA 4PHTA 1AJEA 2GA8A 4PPNA 4B3BA 2Q6TA 3U3JA 2OZEA 3SJCA 1E32A 2FDCA 2QPOA 1VIAA 3T34A 2C2HA 1V5WA 2CL6X 5G41A 1G7SA 1T6NA 1RYHA 1LNZA 4N1AA 2OCBA 3WRYC 4B74A 1GL9B 1ZC4A 3AVTA 3HU2A 1Z0FA 4QGAA 1KSJA 1X86B 3KQUA 2CL7X 5H8WA 3ICEA 1SXJE 1GKYA 2PBRA 4DLVA 3ZGXA 4DCTA 5KHOC 5E7IA 4PO9A 4Q4AB 1HQYE 3W90A 4HLCA 2IS4A 4AIIA 3TQFA 3UMFA 1GG2A 2VBCA 3RC8A 4BE7B 2ZRDA 4KSBA 2FMXA 2BBSA 4DCSA 2EFEB 4AYTA 3QKTA 2UKDA 3AF0A 2V7QA 4PC6A 2XB4A 2YC2C 2VTKA 1YE8A 1KO1A 3HDTA 1JAIA 1LF0A 2OBNA 1E2IA 3R9WA 4OK6A 3AKEA 4B33A 4B3CA 1Z6TA 4NYMQ 1J8MF 1QHXA 2WWIA 2F9LA 2EQBA 2QQEA 5H1YA 4B75A 4P4SB 3IEVA 2GHIA 4LJYA 4DHEA 4JYBA 1QHHB 3O8RA 4XWKA 2BC9A 4HAZA 1EGAA 2ZPTX 2WSSA 1KYIA 1OLOA 4LHZA 4Q18A 3RHFA 2GF9A 4KBGA 3KXKA 4M1YA 1GP2A 2GETA 1OHHA 1X3SA 2J9RA 3SJBA 1AS0A 1Z08A 1CR1A 4QC2A 4HAVA 2RGGA 3LNCA 5DHAA 4KBFA 5C2JB 2ZYTX 4YMTA 1KI8A 1KTVA 4OQNA 1S0UA 5KPDA 4RD6A 2ZIAA 3QENA 4EPYA 1MRNA 4AKHA 3ASYA 1ZU4A 4OI2A 1E9CA 3JVVA 2QPAA 5C1BA 3PUYA 1D2NA 4M9QA 4QGGA 3CB4A 4HB0A 4A0HA 2XEXA 1T0JB 4CEIB 1XXHE 2ZEJA 4EPXA 1WMSA 2W0SA 2XJ9A 1COWD 3TW4A 4BZPA 2Y8EA 3HU1A 2QY9A 1CJVC 3BJIC 1UEIA 1N0WA 2HLDD 4TMKA 1ELOA 3N2IA 1XMIA 3U7HB 1NKTA 2ZE8A 3IIJA 1TX4B 2XZOA 1Z29A 1NY5A 1W5TA 1CRQA 1QF9A 1S3GA 4OQFA 1IY1A 5EP4A 5UKDA 4DBLC 3MJHA 2J87A 1N0UA 2YJTD 3ZJYA 2XTZA 1IXRC 1P2UA 3ADBA 2IXFA 1FOEB 3RNLA 2ZJZA 4DEXA 1VTKA 1ZC3A 3IDQA 1VMAA 2OLJA 1Z3IX 2ZRLA 1OXTA 1FTSA 2P65A 2XNSA 4KFSA 3GJ8A 4LOAA 2DBYA 1J99A 1RIFA 3CRRA 5KNCA 2IL1A 2ZRKA 1Z0KA 2RGEA 4ZIRB 4QHTA 1UPTA 3KJIA 4TYPA 3S1AB 2ZXUA 1RRFA 1EWQA 1DO0A 1M7BA 3EZFA 3I1FA 2F1HA 5FH9A 4MGZR 2B92A 5JWRA 2DWOA 2WPDA 3DEFA 4L15A 1LV7A 2N46A 1OV4A 2QP4A 4NBSA 3ICQB 2J7PA 2O8DB 1ZVQA 2XNDD 4I1SA 4F4IA 5CK4A 3AF2A 1JALA 1GILA 3SQWA 1WB9A 4PTLA 1H8HD 1HQCA 1OXVA 3KKMA 1NMXA 4UNPA 3K0FA 3TUIC 2QTFA 5CJ2A 3GD7A 4HZIA 3K0EA 1Z0IA 4MYHA 3RRYA 2AWOA 4V0MA 5L8VA 4JS0A 1PJRA 2BEKA 3RWMB 4LBVA 1MO5A 1NP6A 4Q48A 1G8PA 1E0SA 4DLUA 4M53A 2MSEB 3BGWA 4RKEA 2R9VA 3OE7D 2KE5A 1FQJA 3WYFA 1KJWA 4O2LA 3VR3A 4MA4A 3BS4A 4L8GA 1OFIA 5K8TA 3ZDQA 4F4JA 1SGWA 2G83A 5BW8A 1N2CE 2CHGA 4L4UA 2R44A 1G3RA 1PUJA 4GFDA 2X1VA 2ZYWX 3AUXA 3EC1A 3Q5DA 2WWGA 1F5NA 2AWNA 2OSBA 3THYB 1KOFA 1S96A 3A4NA 1NL3A 4LK2A 1VKJA 2UVQA 4TN1A 1RFLA 3VAAA 3B1VA 3QF4A 4FMBB 5KPJA 3I8XA 1T8UA 1GDDA 2NTYC 4TYWA 1SVOA 1HH4A 3LY5A 3RANA 4Q9JA 3IHLA 2PL3A 2XXAB 4IDNA 3LDAA 3CO5A 4LY6A 1C9KA 3TK1A 3FB4A 3TMKA 421PA 2JDID 3CWZA 4BZXA 1QDEA 2OESA 2ZTSA 4D26A 2ASEA 2VQSA 3N2EA 3WBKA 1KO7A 3Q7QA 3ONWA 2JATA 3A37A 3D3QA 2IC5A 1NVVQ 1G8YA 4XTRA 3VKHA 1SVSA 2LKCA 1XMVA 1U8YA 1E79D 1L4YA 2D74A 2ZJOA 1FPMA 3NKVA 4UNNA 3CUEF 4A6PA 4BFTA 4ESHA 1P6XA 3TKLA 3KKNA 4MRRA 3MSXA 3VHLB 4BLSA 5KSYA 4L16A 4PQRA 2AL7A 2BDTA 1IQPA 3N70A 3QXSA 1IJFA 4D4LA 4PAMA 4B3GA 1WE2A 2N1BA 4GNKA 5FOXA 3IIKA 1P61B 3TVDA 2ODNA 2ZU6A 3M6AA 1E2LA 4QJ4A 5KU1A 2CLCX 5M04A 1X6VA 1Z47A 1P9WA 1E9DA 3MWJA 4NHOA 1ZM2A 3OEED 3FE2A 4XSHA 5FBRB 3DKVA 4MKGA 1XJQA 1US8A 5BN5A 4V0NA 3RS2A 1KI6A 2C95A 2OO7A 2WOOA 3WBJA 1ETUA 2HDNB 3FGNA 3QBTA 1SKQA 4TMXA 5HE8A 5BQ5A 1DVRA 2CXXA 4CYMA 4LC1A 5H70A 5H68A 2IX3A 1W0KD 1Z6XA 1G4UR 1QVRA 1G3QA 3CF6R 5FPSA 1T5LA 4V0OA 1YZLA 3WXMA 2WJYA 2B8TA 2D7CA 3OAAA 1E2QA 2VHUA 3KX2A 2REBA 4JL8A 5JHHB 3LQRA 1SXJD 4MUBA 1UF9A 2QAGB 3GCGA 4B32A 1XRJA 2C96A 3T12A 1CTQA 3GEIA 3WNDA 2EYUA 4QM7A 1S3SA 3QVUA 2CL0X 4Z8XA 3VMFA 1VG0B 1QHGA 2AFHE 2WMOB 4GOXA 1FL9A 1IN7A 1NBME 4PAOA 4XD7D 2DY1A 1F2UA 3CX7A 4DLSA 3KFVA 4EIWA 4TLBA 2GRJA 2BCGY 2VSOA 1FW6A 5FBWB 4UXHA 5BYKA 1W36D 3R9IA 2JLYA 2V4ZA 4XIGS 1YR6A 4MGYR 1Q1BA 2BV3A 3B78A 4BFZA 1QHSA 2GCPA 3K09A 5J4VA 3IPYA 5JJIA 3R7WB 1WDTA 3OZXA 4FCWA 3IQXA 2QM7A 1KSHA 2ZJ5A 1UDWA 2FX3A 1W0JD 2Z6VA 2GJKA 2BJVA 3A4MA 3GP8A 2JA1A 1Q1EA 1MV5A 1U9IC 2Q3HA 2XZLA 2IF0A 3IBGA 4FD2A 2O0JA 2B7CA 1YRAA 2JLQA 3ND8A 3V4RA 2D7DA 2ZI9A 1UEJA 1XMJA 4D4JA 1R8QA 4OQLA 1KO4A 4PZYA 2GAAA 4JZKA 4CGZA 4NCKA 4JT4A 1OT3A 4NDZA 2VHCA 3U3MA 1OIWA 2QT1A 2WJJA 3GLIE 4YMVA 2D2EA 3FKSD 3WHKA 1VG1A 3UIEA 5EUQB 1S9DA 4BFWA 4IOKA 3SJZA 4HYYA 2ZITA 2GZHA 2V7QD 4ITRC 4Q03A 4ESVA 5L3RA 2IWHA 1NVWQ 3A36A 3HYRA 4ZDKA 4KLNA 3BH7A 4FWTA 2ATVA 3K9LA 4ARZA 1OYWA 4EJSA 4C9BA 5IT5A 1U9IA 4C0BA 1PLLA 1UADA 2RGDA 4LDJA 4D0NA 3FYHA 1JPJA 1P2TA 3L8YA 1TMKA 4IOLA 1OH7A 2JLVA 5J4LA 1A7JA 3UWKA 3L0OA 4M1TA 4HLQB 2CEAA 3UMRA 5J4YA 2XX3A 1XX6A 2QL6A 5L3QB 2WSSD 1G1MA 4QL3A 3W8NA 4LUCA 1XP8A 3IBYA 4MGIR 4XWAA 1OHHD 1JXMA 1W4RA 2FF7A 4GBMA 2ZUBA 3UXMA 3I92A 4JVLA 4P4SA 2PJZA 4LJAA 5FPYA 1NIPA 2BBTA 3EIQA 1N25A 1XTJA 3U60B 1QHHA 1HE1C 4ZDJA 1KHTA 3Q3JB 1KNQA 4G5RA 4M9ZA 3U7EB 1U2RA 1M1YE 3ZD6A 1UDXA 3MWKA 2FOLA 1KSFX 4LJ9A 4Z1MD 2W2VA 3I8SA 1MO6A 1XF9A 4M9XA 5DI3B 1DO2A 3GQBA 3W6OA 3GLFA 1P72A 4KHZA 2JCSA 3W34A 3RVBA 2GCOA 1LW7A 2HXYA 2CNWD 1Z6AA 4RKFA 4IEEA 3EWAA 2Z4RA 2CHVA 1W47A 2OFXA 4NCNA 2PCLA 2KWIA 3AH8A 2ZI3A 2ZROA 4MITA 4PFSA 1I4TD 4PZZA 3U2QA 4C0QC 1XPOA 2CE2X 3SQXA 2ODBA 2J0QA 2EVWX 2RKOA 3WMEA 2NO0A 3TJZA 1S8FA 1KNXA 2AN9A 3K1JA 3VR5A 2VSXA 3NC0C 1WCV1 4DWJA 1C4OA 4PSKA 3LH5A 1R2QA 1Z5ZA 4B2IA 1LY1A 4H1UA 1U0LA 2LCFA 1K6MA 3DVLA 4TZ0A 4HUTA 4CEJB 4BLQA 3MLEA 4JT2A 5LB4A 1HV8A 2FJUA 1XZQA 1M2OB 1RE0A 2H17A 4DDUA 4OK3A 1T3HA 4NMMA 4KSCA 5JCZA 1LFDB 2CCJA 2JLXA 4PHGA 4RD1A 1DE0A 1W4BA 2PZEA 2WZQA 3BFXA 3SI7A 2WPDD 2JLRA 4JBXA 1FMJA 4C2TA 2ODEA 5E3HA 5C4MA 4PXAA 2JLZA 1XTSA 3PUZA 4QGFA 3QXJA 1ZW6A 1Q3TA 1T0HB 2H1LA 2ZI7A 1GSIA 2JIZA 1E2HA 3FMFA 2FSFA 3NBXX 5B64A 4L9WA 3SU8A 3NBZC 2QE7A 1VYUA 1GAJA 1SVIA 2FE4A 4EDHA 3V9PA 5FBVB 2DR3A 1D9ZA 2FGKA 2YWEA 2VEDA 2OXCA 2O8DA 3GJ6A 3LLMA 5EXTA 1IN4A 4B6EA 1D2EA 4QBGB 1LTQA 1X1SA 4AG5A 3KQNA 2E87A 2R8RA 2VO1A 5L3SA 2EFGA 4LBYA 2W6JA 3CM0A 4Q02A 1KZ7B 1KMQA 4UKDA 4KAXA 5AK0A 4TMVA 1Z63A 3T15A 3K0FB 1XBTA 3QXHA 4P32A 5DI9A 3J81k 4A6XA 1G41A 1VDZA 3D31A 1SULA 1TF7A 1UKZA 2P5SA 3LV8A 4OQXA 4RCYA 5EP1A 3SBEA 3KZ1E 4F91B 4S2EA 3C4JA 2ERYA 4NCIA 4KVAA 1DBSA 2GF0A 4JMPA 3EIEA 1XB2A 4JLKA 3CZQA 5EP3A 2AXNA 1NLFA 2P0EA 1FQKA 2JJ2A 5GVRA 4ZDWA 1ZD9A 3VFDA 4DUGA 4EFLA 4F93B 2OAQ1 3LQQA 1TTTA 1LB1B 1SVMA 4PC3A 4QBHA 2W58A 1A2BA 2OE2A 3ADKA 1DEKA 1E9FA 4Q7KA 1TF2A 2XXAA 5LBIA 2HV8A 2QAJA 3CF2A 3E1SA 3QF4B 4GOKA 4IEIA 3V00A 3VX4A 3WHLA 4URVR 2KBFA 3U4QA 1N0VC 4C0JA 1AIPA 2H18A 2VA8A 3ZIAA 1W4AA 3ZQJA 1VHTA 4PPGA 2XOKA 4V0LA 1CIPA 1NMZA 2Q3FA 4RY2A 3VR2A 1Q12A 3TNFA 1TUIA 1IXZA 1DAMA 3QNUA 1E3MA 2WWXA 1AGPA 3KJHA 2Q3MA 4PC2A 3EZ7A 4C0HA 3G5UA 3SS8A 2ODWA 2NO7A 4FMCF 3W3AA 3L0PA 2ZJ8A 2BHRA 3DMDA 5A4JA 2J0VA 1B23P 2IA5A 3TAUA 3MUFA 2D62A 3A1UA 2ZVPX 3UK6A 2X8AA 2QQ0A 2QAGC 2V9PA 3NDPA 4MDEA 2GDJA 4JL5A 4HB2A 2CVFA 2LWIA 4UQOA 2IK8A 3NEJA 1W1WA 4JVSB 5FOUA 4GMXA 4TMWA 1TADA 1OKKA 5HCIA 2PEZA 4Q47A 1MR3F 1XJCA 4C2UA 2VHJA 4AD8A 2YV5A 5J47A 1G5PA 3VU9B 1E1RA 3NC1C 4YLGA 1UBFA 3C8UA 2X2EA 4OBEA 5KTYA 2FN4A 3TE6A 1E2JA 3FFBA 3H1TA 4GI7A 3UWOA 1O87A 2HYDA 2VP6A 4ERNA 2Z43A 4G5QA 1RW4A 4B2PA 5F9HA 1E9SA 1JJVA 1KDOA 4BZQA 3NDBB 3U44A 1KJYA 3ASZA 5TV2A 3TGPA 5CK5A 2ZUDA 2PZGA 1WXQA 3G82C 4K46A 2YWHA 5EJEA 3EPKA 3G0HA 1P62B 2QAGA 3TR5A 2V55B 2JJ1A 4PSVA 2P6RA 2AXPA 1CR4A 1E2GA 4EPTA 2IF2A 2CCKA 1ZNWA 2K5UA 4E5UA 5CLQA 5CDFE 2ZE7A 1RPZA 1I4DD 2VLIA 4NKRA 3ND9A 2KB0A 1WRBA 2P67A 5BYJA 4EQ6A 3KUCA 2C04A 1ZM7A 5SZKB 5JSZA 4DSOA 1G6OA 4H1VA 1XZPA 4URZR 4YMWA 1N6RA 1HYQA 3VKWA 1DAEA 1GRQA 2IYXA 5KYKA 4BGDA 3HYTA 3R7WA 1ZIPA 1F60A 3LW7A 3CRMA 1FMLA 2FPKA 2R2AA 4M22A 3C41J 3F5FA 4Y0VA 2BOVA 3FHCB 4XSGA 2FPMA 4FIDA 2IYQA 4IOMA 3BBPA 3RC3A 1YKSA 1NRJB 3B60A 4S35A 3FWYA 1OXSC 3KDSE 5J5CA 3CWQA 4DEYA 2J59A 3CPHA 4OL0A 4WA7A 2L0XA 4IJMA 4R9UC 2PT7A 3PEVA 2IYVA 1AKYA 4JKYA 3WP0A 3QVVA 4EPWA 1A4RA 3P27A 3RYTC 5BN3A 2GWHA 2XITA 4QFMA 2C9OA 2WWHA 3W5IA 3IILA 5EE5B 1N5IA 5B57C 4CW7A 3SYNA 1Z6GA 1DAKA 3K9GA 1GUAA 5AUOB 3AB3A 5JMTA 1VCOA 3C16C 5CYOA 5HTKA 2JAQA 4HB4A 4B3FX 1E0KA 1T3SA 3CX6A 3M1IA 3NH9A 2GZDA 2DB3A 4TLDA 4ZV4A 4A8JC 1EXMA 4A0FA 1Z06A 2QBYB 2ZRCA 2J41A 2WKPA 3PIRA 3QKUA 4ARZB 1GZSA 2WVJA 4EJSB 1XEFA 2GBLA 5L3QA 4ZPXA 5FUXA 2ZE5A 3PG5A 4A2PA 4M1OA 4G5OA 3TLXA 1KMHB 4MRPA 1W2HA 3I72A 5FOVA 4Q5IA 3SFZA 4HI0E 2ZJBA 4XVRA 3ZYCA 3R9XA 2O8EA 2W2TA 2CVHA 3X2SA 3KQHA 2WSMA 3EZ2A 3QG5A 1DG1G 2QSYA 4UNSA 5GJVC 4W5WA 3GJ7A 1UKVY 1Y3AA 5GJWC 5DIFA 5BN4A 1XFAA 4I99A 1XTKA 3W9YA 2G3YA 1G6HA 2NO6A 4P3YA 3SYKA 4EFNA 2OAP1 1RYFA 2NO1A 3R8FA 5DI3A 2NQ2C 5K8LA 4QNRA 1QHYA 3BH0A 3ZS9A 2HT1A 4F38A 2F3RA 3K9NA 4A8JA 4E07A 1CRPA 1E0AA 2FZLA 4B73A 2QI9C 3M0EA 3VR6A 4BQSA 1NI3A 2NZJA 2PLFA 2ZR0A 3QQ5A 3GLFB 1GVNB 1KKMA 1RRPA 4XH9B 2REXB 2GCOB 1RC8A 1H65A 4KYIB 3EPJA 1ZM9A 4PO8A 1Q3HA 3SBDA 3W3ZB 2HEIA 1VG8A 5EXPA 1U8AA 3NEYA 1Z6YA 4QHYA 1BH2A 5FPHA 3VQTA 4B44A 1E2DA 4HATA 4A82A 5EE3A 4TT3A 4O0MA 2C98A 2R62A 4QHSA 4W5JA 3WYGA 4NYIR 4CEJA 1MOZA 1T4GA 2BJWA 3FDIA 1YR7A 4JLOA 3OIVA 2IYWA 1JEEA 1KK2A 3UPUA 2YVUA 3IKJA 2RCNA 1E96A 3LVRE 3VX3A 4TYQA 4B35A 2QE7D 2GESA 3KKPA 2XSZA 3BAFA 4PAQA 2J5XA 4RD4A 4TMTA 1NNEA 2ZI4A 4V02A 2G77B 3KKQA 1AGRA 2WTUA 2GEVA 4DSUA 4QBIA 3KQKA 1R7RA 1KI4A 4KJZA 5DYIA 1T8TA 2GK7A 4KV9A 3TQCA 1FNNA 4ZCLA 4BECA 4CEHA 3ZS8A 2QA5A 3T61A 4B3DA 1NVXQ 3IO5A 4GP6A 1H8EA 3AVOA 2W6JD 4AURA 3AM1A 1G19A 3QJYA 2ZREA 4LV8B 5J40A 2IYUA 2W83A 2V1UA 2AHOA 3CRVA 1M7HA 4QG7A 3WRXC 1CR0A 4US1R 3B1ZA 4M1SA 1G8HA 5TDHA 1L7VC 4DJTA 3CPEA 1XPRA 4XWOA 1CR2A 5FTLA 2QROA 3MD0A 1SZPA 2JJ2D 3LD9A 1SVWA 4ILEA 4MYUA 1SKYB 5L3SB 1FZQA 1G18A 2HJVA 3X1DA 2A5FA 1QG4A 1TNDA 4IFBA 3PUXA 4P33A 3HU3A 2ZYUX 2ZR9A 4IXMA 1RRGA 3BFVA 5L3VA 3HWSA 3NTUA 4URYR 1JJ7A 4ZKDA 3I73A 2YKGA 1GIAA 2ZSBA 4EAQA 4EKDA 1YZTA 2GXSA 2ANBA 1QHIA 2HXSA 2WV9A 4US2R 3W8RA 2C9CA 3B7GA 2XOKD 4WZAE 3KXIA 5EZ6B 3DHWC 1DAHA 3K0AA 4PC7A 2ZVQX 4WZ6A 4DB4A 2ONKA 2ZRPA 3P20A 4RJLA 1BS1A 1VIYA 4C0LA 2CHQA 2GXQA 3KTAA 1ZAKA 1XPUA 4M2LA 1G20E 3CLVA 2MSDB 4BFUA 2F1RA 2GVZC 4FMDB 3RSLA 4Q1DA 1O3YA 4M21A 3U4QB 4LRWA 4Q19A 1F6BA 1VCMA 2QTHA 5DN6A 2ORIA 1OFTA 2YC4C 1E99A 4GMDA 4OK5A 4ZCIA 5JJKA 3T1OA 5HZKA 1VYTA 3BH6A 3LBNA 4HAXA 5FTJA 4A36A 4V0ME 4WW0A 1YU9A 3KJEA 4XVQA 3K53A 4L5BA 3B13B 4TLCA 5KDDA 3I5YA 1EK0A 1P75A 3I4LA 1ODFA 4PC1A 3KKOA 3AVVA 2DFNA 1XD2B 2FEOA 2JASA 3B82A 5HE9A 3ZVRA 2JLWA 1K8RA 4CT5A 2IS6A 3IIMA 1E1RD 3K0CA 3O47A 4Q1CA 4TL7A 2FFAA 4YONB 1E9BA 3BB4A 4MKIA 3KUDA 4R2IA 3P1JA 4JSTA 4N0DA 1NG9A 2W6ID 3W6PA 4XOIA 1G16A 3I62A 1F3OA 1MABA 3X1WA 3GJ0A 3B9PA 4OHYA 3DKPA 8OHMA 3H0KA 5CM9C 3VU9A 5CITA 1XCMA 4NYJR 2ORWA 1TL7C 2ZJAA 4Q9IA 4I1VA 2V1XA 1OH6A 1SVKA 2WJGA 1TQ4A 1Z28A 4QNMA 1YHNA 3GLHA 4DLZA 2B8WA 3PR1A 2ZM5A 3AGQA 2B21A 5JI2E 3TVTA 3U6BA 5AJYA 3K09C 1TPZA 4B3XA 3H2YA 1PZNA 1S1MA 2P2LA 1R8SA 3U7GA 2DWQA 2YNMA 3U44B 2GVDC 3DOEA 1G3UA 3X1YA 1N6IA 1ZD8A 1N6HA 3Q7PA 2PLRA 2OG2A 4LYAA 3KXLA 5HZHA 1CJKC 4URWR 1MKYA 2FNAA 1GFIA 1L2TA 5FUWA 4NZYA 3K9HA 4DCVA 2D06A 4UNRA 1ZIOA 4TL9A 1DADA 2DWPA 2OT3B 1N3BA 3C7KA 4US0R 5AJVB 5C4GB 3T06B 4ABYA 4YXWA 3LXXA 1F48A 1NN0A 2MSCB 4KI0A 4EQ6B 4KO8A 4PANA 3TSWA 5JSZB 2C9YA 1IOZA 2AR7A 1OH5A 2RAPA 3DL0A 1RJ9B 3EW9A 2ZRJA 1CJUC 3RS3A 4TYNA 1SHZA 3U3KA 2XZPA 4C4PA 1OPXA 4AI6A 5JWOA 4G5GA 2OLKA 4NH0A 4TSFA 3VTKA 2DFKB 1N6LA 2VHQA 5F9FA 4EJSC 1ZRHA 4E03A 1N6OA 1J8YF 2ZE6A 4UNQA 1IN5A 4AKEA 1I4LD 4DDTA 4NYMR 4FCTA 1U99A 1YR9A 1XU4A 2IS2A 3IO3A 1ZM3A 2H8KA 2WWFA 3T35A 4D4MA 3EG5A 1AKEA 2REOA 2ZS9A 2RH5A 3CZPA 3GMTA 4NONA 4P4TA 5AWFC
chains in the Genus database with same CATH superfamily
2FPUA 3L7KA 5JRZA 4J0HA 2WVHA 4O33A 2WF7A 1Q2UA 5CDSA 2A59A 1PL6A 4LHXA 4MWTA 4C1BA 1HNXB 1P44A 3TI7A 1J8VA 3TFWA 2GUGA 2G63A 2CBGA 4IQFA 4BFTA 4I9HA 1B76A 3IV9A 3F8TA 3TTYA 3OIDA 2FFRA 3PC6A 4Y9UA 4OLAA 3ROZA 4IFEA 3ANLA 3CIOA 2IGTA 2H7VA 3JQFC 4GWKA 5F4ZA 1JEDA 4LV6A 1IVYA 2IHZA 1RWVA 3MCTA 1ZKMA 5IRCD 5KMGA 1KK3A 3UMSA 2E9SA 5BW5A 3G6WA 1IPFA 1E7YA 1LQ2A 1P1IA 1UBSB 2AFVA 3EVZA 1RTTA 5JU6A 3FWHA 1ILWA 3CG0A 3C85A 4BNTA 1KVUA 1FXWA 4NS4A 3AEQB 4GVLA 1TQ6A 2PZLA 1OYYA 3ZLTA 2JCBA 4HN2A 3WTCA 2DYKA 2I8AA 4HJXA 4WK4B 2PZAA 3GYGA 1HT0A 1QOQB 3PNYA 3FDZA 4G1UC 3DL2A 1GUFA 1XG5A 4RH3A 3RJTA 4OBBA 1AKMA 3WMFA 3GUYA 1PYGA 3FTNA 3H84A 1FUEA 4B4UA 6REQA 4IS2A 2X40A 1RBQA 1QV7A 1V43A 1T36B 5EEHA 5MN4A 4AMUA 4U7HA 1ZR2A 1PX2A 1PWYE 1UFQA 4F3KA 2DCMA 2VH5R 5F78A 2W48A 3C87A 1HNNA 3VZCA 5K7SA 2PYIA 3C3KA 5AR1A 2FAXA 2UZ0A 2E4WA 2QL5A 3EWSA 4MRSA 4QM6A 5KNCH 4C6HA 1SHTX 3ISJA 1EX6A 5DO9A 2GD1O 2JNWA 3NEPX 4EHFA 3HY6A 3ABSB 1F14A 3N75A 4HTAA 5BWBA 3UENA 2XA1A 3NIFB 2F43A 4P86A 1A7UA 4OPMA 4A8JB 5FPQA 2G9NA 1IZZA 1JSCA 3WC4A 4HQKA 3ETDA 4NX2A 5B55A 2HMUA 1Y9DA 3SQDA 1AH2A 3ZXXA 4GF5A 5D6NA 3EGDA 4NMWA 4JFRA 3ULKA 5CA1F 1W52X 2VTBB 4MV3A 4RWZA 2ACVA 3RT9A 4RVSA 1RHUA 2Q2NA 4R8KA 5ELXA 3GAZA 3WIBA 2R0QC 2FDRA 3M1AA 3M9WA 2BF7A 1ZOPA 2JD0A 7GPBA 4FXPA 1PDOA 1BXGB 1E3LA 3N3AC 3LLVA 3U3DA 2ZJ4A 1Y7TA 2H0QA 4WE3A 3P9KA 3HP1A 2RHJA 4UU0A 2I3BA 1YR2A 5SY9A 3GD5A 4AECA 5SZHB 2NWQA 2Y1FA 2QMQA 1ZK1A 3NHLA 3R09A 1ZK3A 3G8DA 3PHIA 4QPJC 5CIWA 3ABIA 2F3TA 2VP5A 1UBEA 2A4KA 3OPNA 3AK4A 4P5DA 3H13A 1D1SA 1U0FA 3T5TA 3UB4A 3R0JA 5CA0F 1AXRA 2VDKB 3PRJA 4RORA 1CP2A 3C6BA 1G4AE 4IHQA 2UZ3A 3F6YA 4DMCA 3WA7A 1IOVA 4KO4S 4YUVA 1TFUA 3HBMA 3HCOA 4FPXA 5HF5A 5ITZB 2NACA 1VGQA 2EJCA 2VT2A 1BAPA 1EG2A 2BGMA 1DDOA 2EGUA 3EFOA 1AKQA 4LISA 4U3JB 4XYBA 2IS1A 4JBWA 1U3DA 1FNCA 3C3PA 3F3MA 1S7GA 3HFJA 3HXKA 3PNQA 1SHJA 4U9HS 1SHUX 3DE0X 3SNKA 2B0CA 2ZATA 1UDAA 2Y1LA 2ZSDA 5DIZA 2H92A 1YZQA 1PT6A 3VPHA 3WLRA 1INLA 4DYVA 5GVSA 2J3MA 3VVLA 3ZQ6A 3M3DA 4KN9S 3DZ8A 3WYNA 4B1FA 1TYZA 4C06A 1NVVR 2XMSA 5CEFA 4MPDA 3TLGB 1HG1A 1EE9A 4XDGA 4LX8A 3MJRA 2JAWA 4GVPA 1RIIA 2YR0A 2H1HA 3RG2A 1AKRA 2BZ0A 3EMDA 3BTOA 3K1TA 3STUA 4LOIA 5IDVA 4O4HA 5BN1A 1HQKA 5JUWA 4HCJA 4DNPA 1H2FA 4UATA 1WEKA 3BCSA 4QARA 1NSTA 3V7UA 5F2EA 2AOVA 2HQBA 2QTBA 2A4MA 5G53C 3TXXA 4GL2A 2QVZX 4KC0A 3N7UA 5K51A 3SF0A 3RI3A 3QI2A 2ZJYA 3L8CA 1HE2A 1LW6E 1OA1A 1V5FA 3BIWA 2I99A 3DW3X 4A5OA 3T5MA 5KNLA 2CV2A 5DISB 3O0TA 3HJGA 2YRFA 4QE3A 5JFTA 3PGLA 3DHNA 3LLUA 1C30B 1HTWA 2OV4A 3A4VA 4Y2GA 1CQWA 3PB3A 1GHTA 4MLCA 3K0AB 5IK2A 2VDUE 2NN3C 2VUIB 4JR0A 3ORHA 4JIGA 4IHJB 3T1VA 1J42A 1QF6A 4OYRA 4RY8A 2IZZA 1VHWA 2Y1XA 2V58A 1KZGB 4I5GA 4Q21A 5AOAA 2F90A 2WKWA 2SCUA 3NGLA 3JSXA 2HNAA 4Q4LA 2Q1UA 1QRAA 2VDLB 1XZEA 3HCDA 4MCJA 3AWDA 2AC2A 3TZEA 4UHCA 1PZHA 2IOQA 4H1HA 4MV6A 3I30X 2QW1A 1SKYE 1Z22A 4CIDA 1C1DB 1RZ3A 2O52A 1M3SA 4ZAYA 3DZGA 4MARA 3FHTA 1ZH8A 5JJCA 2PTHA 2HMYB 1AQIA 3BSWA 2AN5A 3V8MA 1KGDA 1M6NA 4J0IA 1KQ3A 4L2IA 5LYYA 1M2KA 4XDYA 3L8MA 4C7KA 1MOPA 1RQ7A 3K15A 5KTRA 1USVA 3NJ4A 4MINA 5G40A 3SVZA 2B30A 2ZUTA 1W88A 4F7WA 4AY5A 3RABA 2SBTA 2ZP1A 3OZSA 4M8IA 4URUR 1JXOA 1NHWA 1G5QA 1M72A 3OPXA 1PNQA 3PHBE 1RYDA 1GU7A 1NQTA 2BPOA 3PQFA 4JJAA 4MCIA 4XGRA 3RVDA 5H9WA 1C50A 1KI3A 3ETHA 4LMPA 1XZAA 1E1LA 2H29A 5CVUA 4UPVA 3MHTA 1R4AA 3ZDEA 2NO9A 4P92A 4A0QA 1NJ1A 2XHEA 4CF7A 1WHSA 3E0QA 2FSUA 2QTMA 1V96A 4F3CA 4ZV9A 2ZCJA 4HXYA 3PUVA 3L7MA 5IKOA 5KX5F 2OM2A 3G5TA 4NMHA 3KV3O 5EP2A 3HYSA 3DMNA 4BZZA 3B6MA 1UKEA 3D8TA 1I94B 1YFJA 3ESXA 4ZODA 5IAOA 2J46A 1Z38A 3ICCA 1Q6YA 2QJWA 2DPHA 2V7VA 1QM5A 2NU7A 2YN0A 3DEYX 1YQDA 3PCRB 1TM2A 3JVUA 2NPFA 2GCGA 2W42A 5DBIA 2R6JA 2WU0A 1Z5NA 2EWWA 3GLHB 5EUMA 2VL7A 4YI5A 5EQTA 1X7ZA 4R16A 2QUKA 1VDMA 3B1YA 4D99A 1W4ZA 4OQEA 5TQ2B 1FU4A 2DHRA 1ZI8A 1CFZA 1X1EA 4Y0NA 3HPQA 3MCVA 4MIKA 2A5LA 1WCIA 1TQDA 3V46A 3ZWCA 2BM0A 3I5XA 3BORA 3DDOA 4NAHA 1BOFA 1K5GA 1GL6A 2X77A 1MJ5A 2RIPA 3AEUB 3LRTA 2E2WA 4LZAA 5CCBA 1X8XA 4O1HA 3O4JA 4LWOA 1XWIA 2X7JA 2WMYA 3ST7A 4HQFA 2VDPB 4AZSA 2SHKA 4KDCA 5EPEA 5L51A 3ELYA 5H3HA 2P7HA 1E2PA 3F9IA 4KAFA 4LKOA 3MG9A 4F6LA 3C3AA 5KCZA 1NNLA 2BLNA 3U37A 2RBGA 4PSDA 3ND6A 4BVLA 4Y2QA 2H52A 3NLLA 2C9ZA 1RJ9A 1UFKA 2G1AA 3C5EA 4TVBA 3WL8A 4NCBA 3KQTA 4XI9A 3Q87B 2NOAA 3ZCQA 5JQWA 1QIIA 4LSGA 3PUHA 4ZGWA 5KTTA 2BN4A 1UT6A 2CXPA 5EHGA 5TGTA 3NDRA 5BUQA 5K4AA 2NUPB 3DDZX 3FZGA 3A1CA 4XUGB 3WWEA 2XECA 1KF0A 4OB8A 1BFKA 3M89A 3SSOA 4ASUA 2PMCA 3WRVA 2Z5GA 4M54A 1AUPA 3VC1A 1J24A 4C3ZA 3EXAA 4R8SA 1ODJA 4IMIB 1ZL2A 3F8WA 2ICAA 2QJTA 5BOSA 1CHDA 1P3Y1 3H18A 2FF5A 4OQYA 3DV9A 3HO1A 1YIOA 1RMTA 4CIXA 1LH0A 3AUTA 4LZJA 3NVMB 2OYRA 1EFRD 3WZLA 2C7QA 1UXKA 1FLVA 2V6JA 3VDRA 1Z2NX 2I54A 1NI4A 3H9GA 3H9JA 1CUUA 3SD7A 4DF3A 2ZJ2A 1GNPA 1AQJA 1EGMB 4UNIA 3GOQA 4C20A 3AR2A 2JC3A 5T64A 3GROA 2FSGA 5FORA 5K0CA 1SXHA 3V42A 1TOAA 1JILA 2GILA 2XODA 5DF1A 2H16A 3ECCA 4OLFA 4MUIA 1CUCA 2IU0A 1ULSA 4HD8A 2JFVA 2EFCB 4RDCA 2FWBA 2D8MA 4HTFA 3FUCA 4R05A 1FRZA 4FZ5A 4OLBA 3FTPA 2JHPA 4UW9A 5BUZA 1YZFA 4YROA 5GADl 3AEKB 5E7MA 1BX3A 1P4RA 3O83A 5AJWA 4MVJH 4Y2HA 3WWZA 5HIKA 1T10A 3C24A 1QSGA 1MX5A 1WZIA 1LI5A 4U7DA 3BKXA 3HLKA 4JXJA 4UTPA 2FZWA 2VH2A 4CCYB 2FX2A 5DNUA 3RO7A 5C7IO 1E61A 4PWYA 3BXZA 5DHUA 1PR4A 2EKQA 3G9ZA 3SQMA 3ZWNA 4BJHB 1DAFA 5CT9A 3FLEA 2HMSA 2IEYA 1C7JA 3U4IA 2N47A 3PPYA 3K16A 2ZW9A 4A9AA 1FRVA 1MO3A 4DR7B 1S2IA 4HDQB 4D8YA 1QP4A 1EHCA 1YCHA 1XCPA 5EEGA 3TSZA 3HI6A 1Z2AA 3PLAE 1WAMA 1FYWA 4HAWA 1M2VB 4GZMA 2XVAA 4KXFB 4FLFA 3ROFA 4NLLA 4EBBA 2XUAA 2GEBA 1U7HA 3QV1A 3AWIA 2NZ8A 5CX4A 1PF7E 3QA3E 3FSEA 5HNKA 4DJDC 1Z0DA 4Z3OA 2O8BB 2J3KA 4KAAA 3KEFA 3O90A 2E5WA 4UMEA 1GUYA 2YVLA 2EBHX 5C1DA 3P2MA 1JFLA 4ME6A 5B2ZA 1N33B 3T5GA 5KWSA 3F9RA 1KMNA 4N7BA 4MI3A 4L0MA 1OZGA 3RAGA 1T1EA 1OSNA 1WP4A 4AIRA 3NG1A 5CJJA 1XXHA 2AG1A 5AK6A 4EI9A 1REQB 4J91A 1AQLA 3F90A 1KEEA 2VHWA 5CRIA 2LCIA 2VYVD 1I2ZA 2FN7A 2FPOA 4QTXA 5CG2A 1G9TA 1N0HA 2X0EA 2Q2VA 1PUIA 1PN3A 2I65A 2AMVA 4XIIA 5TQJA 3RYIA 3VAZA 3LNTA 4C0SA 4KFCA 1W46A 2J4DA 1T91A 3ZXYA 2AN3A 3I3SR 4KTVE 4OYLA 2PKYX 4H3KB 4HEHA 1YS2X 2OZKA 5E38A 2BEVB 2IYYA 1PJAA 3VNUA 1OMOA 2KLBA 2GD2A 1A8PA 4NULA 5J59A 1LC0A 2CLOB 3U56A 3FOFC 2GM4A 3LFHA 1E60A 1N7HA 2GS9A 4K2HA 4O08A 3TKAA 2CWDA 4KFRA 5LR6A 4ED9A 1GGMA 4LHEA 5FR1A 2QRZA 3I1JA 5K3CA 5K3BA 2HWUA 4F6RA 3OM9A 2QL7A 2WWRA 4B6GA 2BHLA 5JH7F 2B3DA 2P6NA 2O4UX 4GT1A 4WN3A 1W44A 1ZM4A 3EDMA 4RIIA 3FMIA 3IODA 3L7IA 2A30A 1ZIXA 3BQNB 3AO0B 3HGQA 1J2JA 1MB3A 4N49A 4GPTA 5EZSA 4Z1MA 2WUWE 4X1IA 1U9CA 4QREA 1W73A 3FYUA 1DXQA 1O8BA 1VE9A 4B79A 5LQCA 3KOOA 2WDZA 2RBEA 3LHDA 4J3FA 4KQJA 4LDQA 4RSRA 4KDFA 4WFKA 2VFAA 3V3KA 4MB0A 5BY2A 5D3MA 1K7FB 1C4KA 1T9HA 1MH1A 4CT4B 1ECCA 4CQMA 2FFJA 4Y1EA 3MWGA 2R8BA 4AJKA 2BGJA 1GL7A 1UIMA 2YYYA 3LHIA 3DD5A 3PC3A 1ZUNA 4DA4A 3GRCA 3BICA 4ZVUA 4EY6A 1A9OA 4CFZA 2YIDA 4GL4A 2ARKA 4YIKA 3TJMA 3NDIA 4H7JA 5DHRA 3IV6A 3DDHA 5F21A 3AJ9A 3CT6A 4G25A 1I1HA 4J7XA 2RG1A 4JUBA 3RK1A 1QCDA 3MCAA 3UJHA 1ICIA 4FWBA 4IFIA 1Z2PX 4MKRA 3TUJC 1PJQA 3EGXA 4NARA 3WL4A 4Z54A 5DCWA 4DSZA 3QTLA 1SVNA 2R25B 3E9EA 5JFGA 1B00A 5IZ4A 3WP1B 4NNPA 3UK0A 4CETA 1N2CA 3SDBA 2V4MA 3A1SA 1HDZA 3ZBQA 2AYYA 1ULAA 2R751 3BGOS 3HKEA 2QTVA 5JSUA 2O3UA 1PI3A 1TJ5A 3LOPA 2QTWB 4B83A 4R0MA 5JROA 1JG7A 3DE4X 1WBBA 3L0IB 5B1IA 1AQUA 1KVQA 1PR1A 4MS1B 1HFEL 4P83A 4Q7MB 3RSOA 1KI2A 3NKFA 4QDJA 1CXZA 1C9JA 4YP9A 4G0QA 1EDEA 2NUBA 2XR1A 4MQLA 1O6ZA 4U7JA 2FG6C 5JZSA 5DSXA 3DKIA 4ZU1X 4DCNA 2A9PA 1K5PA 2D3WA 3CUWA 1GD1O 2QSZA 5IAKA 2ZBVA 4YV7A 2GZMA 1KJ8A 4QXAA 4QQ8A 4DG9A 3CNOA 3DF7A 4NFSA 3O8CA 3GARA 1ZAYA 2P5YA 1R15A 4MW2A 3G2NA 4AUKA 2XMPA 1H0HA 3ABOB 4WACA 4KYUA 2OG1A 4X93A 4B4DA 2CZCA 2Z83A 1NRIA 4TKVB 1VB5A 2GAIA 2WUEA 3V7YA 1T26A 4UEKA 1MO4A 3CBGA 3RD5A 2VPPA 2APJA 1KRWA 1JEOA 1MEOA 3I1YA 3W5JA 4M98A 1XZDA 4HN9A 5CLIA 3CH4B 5JZVA 1WMDA 1RWMA 1FP7A 4QECA 4CR6A 5HPYB 1O97C 1JHUA 2RI1A 4RVFA 4ZZ2A 4JI5B 2V5AA 3A6LA 3TCXB 4N7RA 3DM9B 3AMVA 3QBEA 2WUDA 3QU2A 1SIWA 2V6IA 1SKBA 1J9EA 2I4RA 4IF6A 4O2BF 3EQ2A 3DO6A 4DDVA 3PEWA 4Q1FA 5DBGA 5CFRA 1EE1A 2ZSEA 3GUVA 3WGYA 3SBOA 2FEMA 1X8JA 5TC4A 1NI5A 3TRIA 1UFOA 2W00A 1P8JA 3UICA 1ZS9A 3P5BA 1V16A 5JJ5A 4CWAA 1GVHA 2I7XA 4HRAA 3RFVA 4X7BA 5KC9A 4A15A 2R3SA 3D6TB 1JDZA 3A32A 3FVWA 4I55B 3FPAA 1HUQA 4GP7A 3A1FA 3BE5A 3IEIA 1LUAA 4CKEA 3OX3A 4LSWA 1CJTC 4MMZB 5T7BA 2VJQA 3DEJA 4FUQA 3MCZA 2H2AA 3V4SA 1E4EB 1Q1AA 2OO3A 1G291 3DCIA 5ECWA 1UJCA 3N6VA 4BLRA 5LXTA 4PRYA 1XEXB 3JQQA 2RMKA 4RGBA 2XNHA 4G0XA 3DTVD 1TRHA 2GZ1A 5U4QA 1WZEA 4DIUA 4CXMA 3K8YA 2X1MA 2WWYA 1RRMA 1ZMRA 2RJNA 4B6QA 3AKZA 2O19A 1G8FA 1QVVA 3EA4A 4KXQA 4EHHA 3AFIA 1S7CA 1Z16A 1QNLA 3WLLA 2BFEA 1S2GA 4MUXA 4ZAXA 4ZT3A 2X9NA 2J6BA 4JFAA 5GONF 5A9SB 2H9YA 3LUCA 4PZ0A 5CLJA 4J9UE 4RBNA 2B99A 1D0IA 1SFRA 5ES4B 1XUOA 2AFHA 4YJHB 5FUYA 3I76A 4R1SA 1NBMA 4U2DA 1OJLA 1OZ0A 4O4LA 5EIFA 4NE2A 1TVKB 2FMHA 1Q2XA 2R6GA 8ABPA 4OKIA 4B8WA 3P94A 5DJ5A 3ZHYA 3HUFA 3JXEA 3ACBA 4D9IA 1D6JA 1DQZA 1XK7A 2WILA 4GKKB 1NMYA 2QN9A 1NJ8A 1F2TA 1OX6A 4DPKA 4IIJF 4DLPA 5F7OA 1I4WA 4DJEC 2QTZA 1Z5VA 1D8TA 2X8JA 4Q9HA 4D8VA 2RH4A 4ZVVA 4C0AC 4HSEA 4RIFA 3E84A 1XZKA 3OZCA 1T5DX 1YULA 5KU7A 1XMQB 1OC2A 5G0UA 5ESDA 3RIGA 4BFYA 5B4VA 2J4FA 3THWA 4UHBA 3LX6A 2CYBA 5H4GA 1PLJA 3CZCA 5CBKA 5HOEA 1NMSA 2POQX 3R3XA 3UTCA 2HHHB 3NOQA 1Q3KA 5JFOA 3QLJA 1E6CA 2A7QA 1ZICA 2OXRA 4H1TA 2Q0SA 2YBEA 4HUQB 3IEPA 4YMUA 3F6PA 4AU1A 2HX1A 1YXMA 3CR7A 4NZNA 4PQYA 3AKCA 4ZO4A 1L4UA 3RSQA 4R7GA 5AOVA 2YZGA 1A9ZA 2RONA 2WF8A 3A3OA 3GLHE 3IP7A 3BOSA 3NIWA 1JFFA 4M0DA 5LP6B 3V4LA 3TUZC 2IHBA 2DAPA 4RQAA 3BBLA 3K5WA 3WG9A 2WKRA 2C03A 4H2DA 2O1XA 4EP1A 1X7WA 2PUDA 1QB8A 4D3DA 1QYIA 3HA5A 2ONCA 2WHYA 4MGKR 4BBPA 4OX9B 5JARA 1PD0A 2PUEA 1SWWA 2V6MA 2L82A 2GN2A 3ZDAA 4X20B 1M8FA 5GZ6A 1A8IA 5A62A 2OZPA 5DCYA 1YDMA 4TKLA 5ECDA 1HY3A 4DSTA 1FXWF 3EFBA 2HF9A 1NE2A 1A77A 1Z7WA 3BZBA 3N07A 4HMQA 3Q7TA 5AT1A 2BM1A 4MV5A 4NCJA 1Z35A 4UJ5A 1QIEA 3GCDA 3LA6A 2PX6A 1WW2A 3U7RA 3SS7X 2LD4A 5SICE 4J9VA 1V8PA 2FG5A 1ONBA 1QNFA 3KJXA 4NH4A 1U98A 5D1HA 3SOPA 1BVHA 1YZVA 1EX7A 1QV9A 3MRSA 1LA2A 3PUJA 3TIGA 1M6WA 4B3HA 2ZULA 1ECJA 2JLUA 1TCCA 2FH5B 4H7HA 5HZMA 1E0JA 4N0EA 3LUDA 1E5VA 221PA 3QX8A 4PS0A 1IHOA 1WUJS 4QYIA 2Z9BA 3ND7A 5EZ5A 3VH3A 1T9CA 2QYSA 4YI3A 3A6KA 4IJQA 3R5JA 5FL3A 2P30A 3IA2A 4PNZA 3NT5A 2C4NA 1N4DA 1OF1A 1L8QA 1QYRA 2E49A 3OJ0A 3EXEB 4HFRA 4YDSA 5T6BA 1KY5A 1BRTA 1FP1D 1YQUA 2RKWA 4N5MA 4MR8A 4R1UA 4U7WA 5DULA 4BWYA 5KNDD 3LECA 4L3VA 3DYIA 1M9NA 3E2IA 4FWIB 1A82A 1H2WA 1GZ5A 2BHSA 4RA6A 5FO1A 5GJBA 1MC4A 3EZGA 4Q4AA 2HGZA 2FZ5A 3L8ZA 5ESWA 5EJ4A 4TTPA 2VPWA 3DBOB 3TOSA 2DLCX 4XYLA 4POOA 1J25A 1TFRA 1L5KA 5ALWA 5JAZA 4KX3A 1WSAA 2BBOA 1Z8FA 2A1UB 3PSHA 4IWNA 1F9AA 4HWOA 5D86A 2J0UB 2GJSA 5C7YA 3COVA 2CLFB 2EOAA 2HKIA 4C14A 2NVUB 1EGVB 3IPLA 1MQ8B 4OSPA 4RC9A 2IYRA 3V48A 5JZMA 1ZUHA 1CQIA 2BCJQ 2VZ0A 1VG9B 3FZYA 4WXRA 3BQMB 4YCBA 1DEOA 1R6VA 4RPKA 3E23A 3FKJA 4DAOA 5EY5B 4K9QA 4EZBA 2HSGA 1QQ7A 3VNAA 2PUCA 1RVDA 2V7EA 1A9YA 3D1LA 3QRWA 5TMDA 2PX0A 3WKAA 1XYGA 1YVDA 1ND5A 4KCGA 4QPNA 5FADA 4ZJZA 2CYCA 5CJPA 1DKMA 4WGFA 3ZV7A 5AW3A 1A9TA 4QYWA 4EI7A 3CPJB 1JFSA 2WG2A 3EGIA 3H2BA 3CZ5A 1I0ZA 3D0QA 4JU8A 1JTVA 1DLJA 3T5DA 5ELLA 4RTLA 1I7QB 3B5EA 1GPKA 3VSAA 5LP6C 3V80A 4K40A 5IJ0A 3NPAA 3QHPA 4GE0A 4NBKA 4JLPA 4UDNA 3LUKA 4RPGA 3SSAA 3UXYA 1UBCA 1G4HA 2CLIB 5FRDA 4RHXA 3S3TA 2JGEA 4FFSA 4HDOB 4A6EA 4BV8A 1KQFA 4D9KA 2COEA 2VAMA 2O2EA 1PR0A 1S9HA 4HLUC 2O3RA 3ZW8A 4F12A 4O8CA 5DYGA 1HGXA 3IAXA 3QLTA 4ML3A 1ST3A 3ZGYA 1YZNA 4X90A 1HEUA 3H5OA 1O54A 3KPYA 4QUKA 4YRQA 2I55A 5EKTA 2MSLA 3Q7SA 1PJSA 1UM8A 2HU7A 2OR3A 3FFXA 3OTQA 2V98A 4X6YA 2VHEA 5IBRA 1QYXA 3QOYA 4ARSA 2QL9A 2NQ8A 3RJ5A 1TZBA 3UAVA 3ILVA 4H0NA 4ZQEA 3BWXA 3TO5A 1ZU5A 1HZZA 4RGQA 4ZYUA 2O7VA 5E0KB 3ON5A 4CDMA 2DETA 2NU9A 3I5MA 2YN2A 4LCEA 3HVJA 4O4HF 3T7JA 4INZA 1L5YA 2ZG6A 4F4FA 4MR7B 3EAQA 1SPXA 4Q9NA 4HDKB 1P73A 2GASA 4ZKEA 3CSDA 2VJLA 1QCZA 1W76A 3FSGD 1IL0A 4NIMA 1NNSA 1U5CA 1IHPA 2CEKA 4MRNA 5CT5A 2CCGA 1TLLA 5D3KA 2PUFA 3GP5A 3RADC 4ROTA 4RVCA 3BHIA 1PEDA 4MVWA 2ZRMA 4W1SA 5E1DA 5I4BA 2IBSA 4GRAA 2QX8A 2R6AA 2P11A 4KIGA 4P4LA 5GIOE 1KEUA 1RKUA 3JWPA 1UAGA 2QRUA 1PVOA 4J6FA 3OU6A 1DIBA 2WWWA 3IEKA 4ZI5A 1ZCJA 2OLEA 3RS5A 1P5ZB 1YC5A 4Y8VA 2VCYA 4TOIA 2JJMA 3DCYA 4GGOA 4Z9XA 3H5RA 4BNUA 4C0KA 3KETA 2DG2A 1A5AB 4JVNA 2G5TA 4IW3B 5I5GA 1O5TA 2PR2A 3ZOKA 3HKCB 3ZK8A 3SJAA 3QIAA 5DTQA 4G97A 3RAFC 1T4CB 2YFHA 1J0DA 5KKCA 4B3TB 2CJPA 2R5WA 2QN7A 4TQAA 4GOOD 2MYNA 3H3XA 3BERA 1Q44A 1QH9A 4G67A 4MV1A 3I6IA 3DBLB 2YW9A 1IXSB 4PG8A 3ICOA 4HXGA 3WGMA 4BNWA 1UKCA 4LV5B 3QOFA 2QJRA 1P7VA 1PV4A 2FPLA 4EI2A 3EPLA 2CSUA 3K3PA 5DP1A 1TEXA 1C1YA 1CUBA 2NZ2A 1USWA 3ISVA 2X4DA 3T41A 3QEOA 3K0SA 4L76A 5BURA 2IYNA 1TRKA 1H0KA 2OUKA 1CU1A 5B36A 1HFJA 1WQ1R 3ZHVA 1FDWA 2Q9UA 5AUQA 2OV8A 2ZSAA 2QUBA 2FKAA 1WV1A 3OEHD 4I1UA 2NG1A 4P31A 1N9ZA 4RD3A 4TROA 1FDOA 1XP5A 2ONJA 4DIFA 1IUOA 2AQHA 2B6NA 4HZUB 4RPHA 2PD3A 3B38A 3MSCA 2ZETA 1DX6A 4UUAA 1H8HA 2YOFA 1BN6A 2O0HA 2H4WA 2JGFA 4J7UA 3B6ZA 3GJ3A 2H31A 3LX4A 3S0JA 1JE1A 1WG8A 4QDZA 3AV0B 1YDFA 4CF4A 1U0BB 1EDOA 2M2IA 3L02A 3IUJA 4OSEA 5FULA 5KUTA 1Z12A 3E05A 2VP0A 3ENKA 5K0LA 1DT3A 4OMDA 1M74A 1RBYA 2CHEA 4UAUA 5C5IA 4EJFA 1OLXA 1CUAA 3JV7A 1ZVVA 5FBZA 4UREA 1C0LA 4R41A 1Z2CA 1TAHA 1JSXA 3MTGA 2BR3A 5JXGA 3C74A 4BXOB 3AG6A 3TCNA 1GTZA 4FFMA 1G8GA 5ULLA 3JZMA 3P4XA 3GIWA 16PKA 3QVXA 2AN4A 2E7ZA 2WYWA 2D3TA 3FGPA 2G28A 3OFND 1SBQA 3KK0A 4IH4A 5G02A 1KIMA 1C0PA 4DY6A 2JLBA 5JEEA 3IPRA 1UXGA 2ZTLA 4ETWA 3LSTA 3FUUA 4LJ4A 4X8MA 4Q4JB 5TPZA 4BQRA 4J0KA 4O2AB 1JJFA 3CV3A 3QHAA 1ONPA 3G68A 3LW8A 4QKQA 1CUWA 4YH1A 1JLLB 1S5PA 2GEFA 3MMZA 2JBWA 3TH5A 3I6MA 3O3OB 1S8NA 1JHXA 2HJGA 2WZCA 2FZ4A 3H1FA 3VJKA 1D07A 1JIKA 2AVNA 2Q27A 3AVQA 2KI5A 2XYVA 5CDFA 2VXBA 3U7IA 3YASA 3QEBZ 4R8RA 4Y6RA 4TXHA 4D4IA 1LK5A 1YRQA 4ER5A 4OV6B 3A58B 2O6LA 2OBMA 3C3CA 3CX8A 3ZD9A 3R5XA 1NXTA 5HZGA 4YDRA 3A05A 5LQDA 2P9QA 4IIFA 2DTXA 4CF6A 9ATCA 1JP7A 4MUFA 2O2GA 1UOOA 3IT2A 4FJ1A 3TG2A 2QSUA 4OHVA 2CK3D 2Y6VA 3OLXA 1XYYA 2IYSA 4WVLA 5A0FA 4MO2A 4AJ9A 5C8YB 4EUEA 2X7XA 3GQVA 4RIEA 1HLGA 4MP3A 4V0RA 2A14A 3D0OA 3PD7A 4CG2A 1KWKA 3HB7A 4FDVA 3OF5A 2A3RA 3L4JA 2R7MA 4DT1A 2QZZA 2XYHA 3ESQA 3VYUB 4F0JA 2XB2A 3PJFA 4D0GA 1P80A 1U8CB 4A0GA 5DWQA 1VL0A 4M76B 4Q7JB 4QZVA 3BTVA 1G2QA 2GYUA 3FTEA 1T9GS 2CUNA 3TLMA 1SEVA 1QFZA 2GMWA 4JJKA 4EPRA 3I12A 3WGOA 4RJJA 2O54A 3HS3A 3OEEA 5HIAA 1H1LA 3S8YA 1SC9A 1Y1TA 2P75A 1XVAA 4C04A 1TO2E 4FI3C 2IPOA 5TQ0A 4HVCA 3FOZA 1UBTS 5JR3A 2EWVA 2A92A 2IIPA 3AU9A 3CLKA 3EARA 3KWJA 3PDHA 1YJBA 4IKPA 2QKYA 1NJ2A 2OGUA 3M5WA 4YRLA 3UKOA 4CMJA 6YASA 4GBED 4K9SA 4KUHA 4S12A 5DNDA 3QE9Y 3OQIA 4R71A 1DAOA 2G1UA 3O26A 1EWRA 1P3DA 1QHFA 4U9UA 4A0RA 4ARIA 4WZBE 3TEJA 4MZDA 3BE4A 1TDJA 2F1IA 3Q2IA 621PA 2PWAA 2VNIA 2VT3A 3FVTA 4AZTA 2VSFA 4TLLB 4CU2A 5KQGA 5F3WB 5CNKA 1Y1SA 4QODA 1ZGCA 2HU5A 2PEYA 1C0KA 4D8WA 3AFMA 1II8A 2NP7A 2O2DA 4CQNA 3BD8A 3G2PA 4YRBA 4MXDA 2QEQA 3R5KA 4MA5A 4FGLA 4K6GA 3AF4A 3NC4A 4Q01A 3ZHBA 2FLWA 5G4KA 5H80A 3OLZA 4G3XA 4EGJA 4EECA 3OZFA 4D0SA 3DC2A 1GA1A 4BN4A 4J49A 2YINC 2OILA 3RROA 1WSDA 1RVV1 4FR5A 4A73A 3OCUA 2Q6IA 1RXEA 4LI0A 4TVOA 3K1AB 3A6EA 4WCVA 5ED4A 3CT4A 3HB0A 2IYZA 4L6IA 1PK8A 1VKZA 2ZBEA 4MUHA 3HP4A 4LSZA 4XQEA 1XTIA 4BBZA 1CUXA 4PHTA 1YHYA 1AJEA 2VTVA 4QOJA 3ZIDA 5EQFA 3VR0A 2OZEA 3QK7A 2PUBA 3LUHA 2FDCA 2LR0A 1M1YB 2C2HA 3JASA 1QS0B 4HAIA 4NOJA 5G41A 1M66A 2XAAA 3HLTA 4XCQA 2C83A 3FFTA 1MORA 3DV0A 4QDOA 3AVTA 4MX8A 2HRCA 2O3JA 4EX6A 3W5AA 1FVXA 5KQSA 1VJDA 2XRYA 4LZLA 3KQUA 2FZVA 2CL7X 2VJNA 5DV9A 5HFAA 5I9SA 3ICEA 5BV1A 1CEEA 1PQYA 1U2DA 2PH7A 4RF2A 1DKUA 1M6VA 4YJ3A 3RC8A 4A8HA 4E11A 3F5MA 3EAGA 1Z75A 4R68A 2FR0A 1IZ7A 3OJLA 4DCSA 3PXAA 3QKTA 2VBIA 1PSDA 4FT4A 1QOPB 3JRXA 4PLVA 3AF0A 3C98A 4XWYA 2NV6A 5G1PA 2P3LA 4CTOA 5CLFA 2NU6B 3HN7A 4CM6A 3A25A 1KO1A 2V59A 1JAIA 3HGMA 3CVYA 1WMAA 2GBFA 3FCYA 3LVFO 3D3WA 1U6JA 2Z5VA 3U9SA 3IE0A 1K7CA 4OBWA 4B3CA 1EM8B 1Z6TA 2WP0A 4NYMQ 3RYCA 1PEKE 2Z1NA 2DGDA 1E3QA 1WB5A 3IL2A 3FW1A 4G56A 4P4SB 2H54A 1D7OA 4MDHA 4QX6A 5T4HA 4BMPB 4OHMA 1JWAB 2D1TA 2XDQA 3BMOA 4AB1A 3O8RA 2OWEA 3KT8A 2JFXA 1EGAA 3QFSA 3WICA 3GWGA 2WSSA 2JGLA 2ADFA 1U65A 3RHFA 3WZMA 3ZDCA 1DEXA 1PQPA 4QUBA 4F46A 4KBGA 4OJMX 3LSYA 1COZA 1X3SA 3HA3A 4CM3A 2Y6UA 4N9WA 2AOUA 3DEHA 2VTEA 4C0XA 2EDAA 3SHOA 4L4ZA 1CR1A 5LIPA 4HAVA 4UQPA 2C3UA 2ZB7A 3CLTD 1ISIA 4KBFA 4QOEA 5JXJA 3TW6A 4OQNA 4FFPA 4HGYA 3HVRA 4M1EA 4RD6A 4XZ3A 4EPYA 1JHZA 1P6UA 2Q6KA 4MJXA 4OI2A 4RV9A 2M6LA 5I9BA 4BJ1A 4AKHA 2PY6A 1LBEA 4I3GA 4M1QA 5C1BA 4IJUA 3R6DA 1L5GB 4BNFA 3CB4A 4HB0A 4OXNA 1JQBA 4TZKA 1YIAA 1VPWA 5CR9A 1AKNA 2IPMA 2X13A 3D6MA 1R4NA 2XJ9A 3I9NA 1VB3A 2I7VA 2HI0A 3QA9A 4K9OA 5EWLB 1Z8DA 4O29A 1UEIA 2PKRA 2R79A 2FTKE 4N5HX 3L7DA 1ELOA 1U5BB 2V7XA 4TMKA 1DC7A 1XMIA 1M2GA 3JQAB 3R2JA 1N5DA 3U7HB 3UOWA 4BNDB 4M0KA 1SBIA 1BTOA 2ZB2A 5EFOA 1NY5A 1S3GA 4OQFA 1XQ9A 3ILYA 1WY5A 2H65A 3ZJYA 1P9LA 3I52A 2OPHA 2G40A 5JAIA 1E1KA 1FOEB 1UC4B 5CA1B 2ZJZA 2C8JA 1VTKA 1ZC3A 3IDQA 3H9QA 1XNQB 2ZRLA 4E33A 1FTSA 3W7VA 4I8IA 4QTZA 3VV3A 2DBYA 4UVDA 3PHGA 4U5QA 1R6DA 1AHIA 3CRRA 4URFA 2QLFA 2ZRKA 3UMMA 3CEMA 1NXPA 4NXMB 2I3DA 2JHFA 3KXDA 2J5BA 4WCFC 4BVGA 5ADUS 3K32A 1YZ3A 4QHTA 3KJIA 3S1AB 3FY4A 1T0PA 4GU5A 2RD2A 1RRFA 4UBMA 1EWQA 1A8UA 1WF6A 3KJQA 1LRLA 3EZFA 1H0SA 3I1FA 4RKQA 3SSNA 4EDFA 1LKZA 1U7OA 3B6IA 4CE6A 5FH9A 3FCEA 1RXVA 2N46A 3I64A 3EVEA 4V0QA 1V48A 2QP4A 4EJ6A 2NADA 5IBPA 2WZDA 3S2ZA 2VYND 1GPDG 3HN2A 3HDGA 3AEXA 4DXHA 2XNDD 3PUKA 4JJFA 1BHO1 1R8YA 5CK4A 2VHVA 3FGZA 4ZK2A 3TN7A 4NU5A 3EBPA 1TUBB 2IPNA 1HQCA 2A9VA 2YXEA 2C9MA 3JQPA 3UHAA 5CA0B 2X6QA 3OKCA 1W2WB