4G1UC

X-ray structure of the bacterial heme transporter hmuuv from yersinia pestis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
262
structure length
262
Chain Sequence
AVTPVALLEASHLHYHVQQQALINDVSLHIASGEMVAIIGPNGAGKSTLLRLLTGYLSPSHGECHLLGQNLNSWQPKALARTRAVMRQYSELAFPFSVSEVIQMGRAPYGGSQDRQALQQVMAQTDCLALAQRDYRVLSGGEQQRVQLARVLAQLWQPQPTPRWLFLDEPTSALDLYHQQHTLRLLRQLTRQEPLAVCCVLHDLNLAALYADRIMLLAQGKLVACGTPEEVLNAETLTQWYQADLGVSRHPESALPQIYLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemin transport system permease protein hmuU
publication title X-ray structure of the Yersinia pestis heme transporter HmuUV.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein/hydrolase
total genus 71
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature ec 3.6.3.-:
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4g1uC00
1G17A 4IEIA 3FOZA 3HR7A 5B2ZA 4BWYA 5M04A 1ZIOA 3SBEA 3AF3A 1IBRA 3PFIA 2QMHA 2C8VA 3KXLA 5BW8A 4B2PA 2EFDB 4LRWA 1OFHA 5DH9A 3EPKA 3VKWA 3SN6A 3U7FB 1U8ZA 1VKJA 2QRNA 3PQCA 2ZI7A 1SZPA 1QHYA 4HAZA 2YOHA 2XNDA 3MWLA 1HH4A 1G20E 4HZUB 3SHWA 5DN6D 5JSZA 4U7DA 5L3QB 1NN1A 3OIWA 3B9PA 4C2TA 1H8HD 2MSEB 2WAYA 4Z8XA 4ZDWA 2YKGA 4PQRA 4HZIA 2FJUA 4BFVA 5AJXA 1AS0A 2MSDB 2IYXA 2WPDD 1P9WA 5DI3B 3HDTA 3X1ZA 1QVRA 2NO1A 2XX3A 4A82A 2GRJA 4JLMA 4YMVA 3KQNA 3VHXA 4P32A 4D4MA 4OQXA 4QJ3A 4BZXA 1AQYA 1D2MA 4DEYA 1F5NA 3AF4A 2CK3D 3GLIA 4I4LA 4P4SB 4F92B 2GJAA 4URXR 4LJAA 4A0GA 3TJZA 1NBMA 1KKLA 4E07A 221PA 4GT1A 1U90A 2GBLC 2QSYA 3LBIA 2BBSA 4IFEA 2IXGA 2IUSA 3T06B 1G6HA 4ARZB 4TQAA 2O52A 4DSNA 3IEUA 2I3BA 1M7HA 2F9MA 2VP2A 2BBTA 5SZKB 2FFAA 1SVSA 3IQWA 4LWZA 2W0SA 3T1OA 1QHHA 3I72A 3ZVMA 1OHHA 4AD8A 4RCYA 1NY5A 2BBWA 1VDZA 2AWNA 2G83A 2NTYC 3ZZTA 3P4XA 1D6JA 4RZ3A 3K70B 2GZHA 3U3KA 1KI3A 1XEWX 4LYFA 2FA9A 3A1SA 1OH5A 4L9WA 1W5TA 3I5YA 4V0NA 4Q9LA 1YKSA 2D7DA 2ZJYA 4JLAA 3LX5A 3GD7A 4HEJA 4PAQA 4QC2A 4EPRA 1XEWY 1OYYA 2GJSA 3QKRA 2YC4C 1TQDA 4DCVA 4N0EA 1E9RA 4KBGA 1TUIA 4LYAA 4IEEA 1ONBA 3TH5A 3W90A 2ORIA 4A8JC 1TX4B 1HUQA 5K8TA 3AVXA 3K9LA 1OXVA 3QXXA 4OK3A 3K09A 4G0NA 4TLEA 3TGPA 4PAMA 3ZGXA 8OHMA 4B3GA 4ZPXA 2BM0A 1TL7C 1ZAKA 2NIPA 1Q1ZA 4QBHA 4DSUA 1Z5ZA 3BRWD 2V4ZA 4E09A 4D4LA 1RRPA 1VCNA 1Q57A 4O3MA 3BS4A 1ZW6A 4AK9A 1H65A 1N6NA 2WOOA 3RLFA 3SYNA 3EG5A 3P1JA 2OG2A 4TQUS 3T1VA 2KB0A 5KNDA 4IDPA 2H7VA 1R0ZA 1KI2A 3AVPA 5IHPA 1LS6A 4MDEA 2NMVA 3IHLA 2QE7D 3I92A 3LX8A 4DDVA 1W36D 3F0TA 1GRNA 3AKEA 4QGGA 4RD2A 2YHSA 4OKSA 1KI6B 2CBZA 3ASZA 3IBYA 4RJLA 1NLYA 2HXSA 4TLBA 2YV5A 5AUPB 2WMOB 1HURA 1E2KA 2FZLA 2KSQA 2ZJAA 3FWYA 3O47A 1H8ED 1E2IA 4LYHA 3EZFA 3B8HA 1YJ5A 2O0KA 4G5SA 4QNRA 4BZQA 3VKHA 1PZNA 1E79A 5B57C 2QZ4A 4B2LA 4WW0A 2F1IA 3MGCA 3RAPR 1N6IA 2GVDC 4GOXA 1KNQA 1KHTA 4TL9A 4C0LA 1Z6AA 1RC8A 4PPQA 3SFZA 3HYTA 4RVCA 1KMHB 1N6OA 1BMFA 1MRSA 3KUCA 2ORVA 4CEIB 2XAUA 1W4AA 1KJZA 4DHEA 1E99A 3RS3A 2JJ1A 1YHNA 5KNBA 3TK1A 3U5ZB 1HYQA 5A4JA 2VL7A 3RVBA 2ZE5A 2IX3A 2ZRAA 4PXAA 1VYTA 3I4LA 3VMFA 1IN6A 2V9PA 3LBNA 3ZH9B 3TKLA 1JB1A 3QE0A 2R44A 4Q4LA 3NBZC 3ZIAA 4LK2A 2ZETA 4NCNA 1EWRA 1OJLA 4RD3A 3FMPB 5KYKA 3KUDA 1UKZA 4IJMA 4MYTA 1R8SA 1COWD 3RRMA 4GRAA 3SI7A 3DZDA 2AN9A 1G7RA 1E96A 3GLFA 3LV8A 1Z0JA 1A4RA 2BDTA 3EZ6A 1R8QA 3CRW1 3TE6A 3NHBA 3Q9LA 1W4BA 4U02A 2X8AA 3GEIA 1NN3A 5HE9A 5FR1A 1AGRA 1CIPA 4MQBA 5GJCA 3QKUA 1W0JD 1WE2A 3W3AA 2ZS9A 1ZM9A 1YR6A 3JVUA 4XSGA 3E70C 1VG9B 3QKSB 4IVPA 3HU2A 1II8A 1P2TA 1R2QA 3CRQA 5AK0A 4F7WA 1DE0A 5AJWA 4OI2A 1E9FA 3OE7A 4Q1AA 1AQUA 1XZQA 1Q44A 3T5GA 3I73A 3I61A 1IN7A 1E0JA 1JBKA 1GNPA 2NO0A 2QT1A 4URWR 4Q4AB 5D3MB 4Q21A 1GITA 2Q6TA 2XTNA 4MGYR 1ZU5A 2CHVA 3FHOA 4LJ8A 1ZYUA 2QA5A 3FVQA 2A30A 4FMDF 3Q85A 2D2FA 1D2NA 2IYWA 3GFTA 3DMNA 3L2OB 3CPEA 1KOFA 1RRGA 1UKVY 1JR3E 2ODNA 4B44A 1W4RA 1EESA 3GLHE 3KKOA 1Z0DA 4KFRA 2F1RA 3R9WA 1SVWA 1T3LA 4P33A 1M34E 3H86A 1G8HA 2VO1A 3AVWA 4URVR 2VBCA 2ZXUA 1TMKA 3HU1A 4PANA 1JJ7A 4QL3A 5EE5B 2VH5R 1QG2A 5G53C 3K70C 1OW3B 2G77B 1MO6A 1RYHA 1DAFA 2ORWA 2IYTA 4A36A 1NKSA 2BJVA 2D3WA 4C2UA 1O87A 1KSHA 1FOEB 2FH5B 2HLDA 2C9YA 3K0CC 4OQLA 2HT1A 4OI0A 1W2GA 3DOEA 3VR5A 3NVAA 4AKGA 1XTKA 1UAAA 3AVTA 4Q03A 3VU9B 3M6AA 4R9UC 5DN6A 1Z29A 1XF9A 3N70A 1H8HA 3NTUA 4BLRA 1PJRA 3THYA 1VCMA 1DPFA 4QGAA 4D25A 1KZ7B 2N46A 3SOPA 2WPDA 1FFHA 2X19A 4JVMA 2QMUA 4KVAA 3EWAA 2P6RA 2ZS7A 2RGEA 1RPZA 5H70A 2XSZD 4TMXA 5KSYA 1N0UA 2XJ9A 1OE0A 4GZLA 4DXAA 1E9AA 2QSZA 1T0HB 3U61B 4PC3A 3BH6A 4TL6A 1N2CE 5CDFE 3D7MA 3R8FA 1I2MA 5SZJA 1G7CA 4M2LA 1XX6A 4M22A 2DHRA 5E4FA 4P4TA 2OFXA 2G1KA 2CK3A 1E4VA 5F2EA 4DLWA 2J0UB 1RIFA 5JMTA 3KQHA 5CDFA 4C7OA 2GXUA 4MKGA 2GK7A 1E0KA 2HUPA 1KO4A 1FP7A 3KTAB 2P2LA 2YOGA 2V1UA 1ZNXA 2J41A 3TW8B 2PZGA 2QNRA 1GL6A 2KWIA 3P26A 3V4FA 3WP1B 4CRWB 1E2JA 3QEJA 4CDGA 2QPOA 3ZD6A 621PA 5BWMA 3BH7A 2IYYA 1NJGA 1L8QA 1RE0A 4H9GA 5JWRA 3IQXA 2VF8A 2QT0A 3CPHA 4PPGA 3U3MA 4B3CA 3JZMA 5TB5A 2RKOA 5FOVA 5KDDA 1VTKA 1NIJA 1ZUIA 2GCOB 1GRRA 3MJHA 3PIRA 2Q21A 3TIFA 1CF4A 3MJRA 4M53A 3OF5A 3QPWA 1HQCA 3W5JA 1SVOA 2QAGA 1ESNA 3THOA 2O5VA 3REGA 5FI1B 2P0EA 3KKPA 3ADDA 1R5OA 1RZ3A 4DLXA 1U99A 2WJJA 5EJEA 5FL7D 1QVAA 4P3YA 2DWOA 1DAGA 2OCYC 5FTJA 1ZNWA 1NL3A 4LJ7A 2Z4RA 4PO1A 1PLJA 4HB2A 2ERYA 4U5XA 2OLKA 3S1AB 4DJTA 4US2R 1UKEA 3CONA 2WV9A 3I3SR 3GMTA 4YQFA 3BORA 3G0HA 1RJ9A 3ECCA 4D4KA 1SXJB 1Z2CA 4R7ZA 4B3FX 4Q1FA 1JAHA 4PC7A 3SYKA 4G01B 2C96A 4IRUB 3BD9A 1AK2A 1JXMA 2OV2A 1Q1BA 3HPQA 1YZUA 2HCJB 2AK2A 1NG9A 2IT1A 1OIWA 3DPUA 2QE7A 1DG1G 3VX3A 4DB4A 2GILA 2QEQA 2W2XA 3VHLB 2MMGA 2ZYVX 5AUNB 1KI4A 4Q00A 1UDXA 3MD0A 4HDQB 4V03A 4LJ4A 2ECKA 4ASUA 3B1WA 3T15A 4M1YA 1H8EA 1UBEA 3LWNA 4C0AC 2FX3A 2HXYA 1EX7A 4HAXA 1VHLA 4PO8A 4D2IA 1GKUB 2IWRA 2HV8A 3L0IB 2XTZA 4NCHA 4F4JA 1B23P 2HF9A 1E2NA 3GCGA 3LD9A 4HYYA 5K8LA 1ZU4A 3M0EA 1JALA 3NDBB 3ADBA 2ZYTX 4EPYA 2IYZA 3KB2A 2QAJA 4QBIA 4NE2A 3AGQA 3N2EA 3SBDA 3GLGB 3R9XA 4P0TA 5K8UA 2IXEA 3SNHA 1GKIA 1T6NA 3BK7A 4PTLA 5KPJA 2ZRFA 3LW8A 4M1MA 4Q66C 2A5DA 4Q9JA 2QI9C 2BHRA 1HE8B 2LKDA 4OHXA 2J5XA 2H1LA 4YMTA 4MGZR 2GEDA 3MG9A 3T1QA 2AK3A 2ZJ5A 1P2UA 3TRFA 3FYHA 3Q8XB 3U7EB 4DBLC 1KO8A 1G8GA 4PHFA 4JL6A 2GEVA 3MSXA 2WJGA 4II7A 3DM9B 1YRAA 3PG5A 4JLBA 4EFMA 1COWA 2A5FA 4TMVA 5LPNA 2O8EA 2J7PD 2WIAA 1U94A 4HUQB 2FSHA 4GP6A 3TW4A 5JS7A 4TMWA 3VR4A 1ZC3A 4JBWA 3QXJA 5DLQC 4GL2A 1XXHB 4GPTA 4GFDA 4Z51A 1ZMXA 2F1JA 3WMFA 3O8CA 4XWKA 2FPKA 4AIIA 4I1VA 4RKEA 4QBGB 5TARA 4W5HA 3OAAD 4NCIA 4C0BA 5H1YA 3RS2A 2CNWD 5JLJA 1W0JA 1MABB 4D4JA 1J8YF 4QJ4A 2W0MA 4DDWA 2F43A 2JJ8A 3CZPA 4LUCA 3W34A 2IW3A 1KDOA 2MSCB 3SJCA 1IN8A 1Q22A 1ZUHA 5BQ5A 1XD2A 2YVUA 1KO1A 2XEXA 1G5PA 2XJ4A 2FFBA 4ZIRA 1D9XA 5BXQC 2B8TA 1KI9A 2C9CA 5CK4A 4XVUA 4BFUA 3HP1A 4JSTA 4JLJA 3KDSE 4MUBA 2ZUCA 1P4SA 5AR1A 4TWZA 1TEVA 1ZVQA 3PENA 3F8TA 5LB4A 2ATVA 1ZNYA 2WVJA 3QF4A 3EZ9A 1S2MA 1QHNA 4M1SA 3QJYA 4R2HA 4M0LA 5BYKA 1DARA 3A1TA 1DO0A 1XTRA 3NC1C 3WYGA 2EYQA 1WBBA 1LB1B 3MFYA 1XJ0A 4JBXA 1EXMA 2V1XA 1GWNA 5FPYA 1R6BX 4BFTA 1SXJE 1E2FA 3IIKA 4DLRA 4JVSB 3MUFA 2A78A 3EZ2A 2JDID 4Q4JB 2IL1A 2JASA 1QHXA 4A0RA 2BC9A 1DAHA 4LHZA 1KO5A 4MH0R 4L5BA 4KFTA 4OQNA 1UBFA 2X2EA 3TR5A 2MMCA 3KB1A 2F55A 3ZS8A 1FUKA 3AQ4A 1ZP6A 2ZRDA 5JCZA 2IF0A 2GTPA 2G1JA 1G16A 3SZRA 3GLIB 2O8BA 3BFVA 2CE2X 1AJEA 3U4QB 2ZEJA 1PVOA 5HZHA 3X2SA 2OSBA 2RGGA 121PA 2VHUA 4TMKA 2ZITA 2AX4A 4WVFA 4FMCF 3AF2A 3CUEF 2QTHA 3ICEA 2REOA 5FBVB 3PEYA 5BYJA 3FMFA 2OBLA 4KV9A 2J1LA 4DEXA 2JLYA 4TZ6A 1G6OA 3T61A 2WWHA 4U00A 3MAAC 4EJSB 5IT5A 2BEKA 2EWWA 2VEDA 3NKVA 2VQSA 2UVQA 1QHGA 4GNKA 4NP6A 3SU8A 4CIDA 2RGBA 3B1ZA 4TTPA 4OHZA 2WSMA 2XSZA 1ZRHA 3CLVA 1U98A 2BBOA 3THXB 2PCLA 2EFHB 2ZANA 4MRRA 1FQJA 4RY2A 4TTQA 5HTKA 4AI6A 1Z22A 1Q21A 3TSZA 3K70D 3PITA 1US8A 721PA 1SXJC 3QQ5A 1B0UA 1OFUX 2QP4A 4ZCLA 2VP6A 4M4SA 1FX0B 4CT5A 5B58C 3QKRB 3GJ4A 4IKEA 4JYBA 1IQPA 1OF1A 2ZRKA 4C30A 4CYMA 1UF9A 3U44B 3EC1A 1R7RA 5K8IA 1T91A 1AIPA 4G1UC 3EPLA 1W2HA 3I32A 1G18A 1X86B 3BB1A 4B74A 4F93B 3BB3A 1G64A 2PX3A 2GXSA 1P2SA 4H1UA 1Z6TA 4PX9A 4RZXA 2QU8A 4XD7D 3AVOA 2FPLA 2NO6A 3MCAA 1E0SA 1M7GA 3VKGA 5FTNA 4L16A 3KXKA 3C16C 4HLUA 1LY1A 2RGAA 1TQ2A 2OBNA 3E5HA 4MYCA 3GJ7A 4DT1B 3CRRA 4YLGA 3BOSA 5HKKD 4NL4H 2BMEA 1KK1A 1P73A 4RFVA 3SS8A 3WNDA 4URZR 1GFIA 1G9XA 3A4MA 3AP3A 4CEHB 4LJ6A 1EK0A 4L15A 4YONB 2ZSFA 4L4UA 2GBLA 4PQYA 5H8WA 3QXCA 3CRMA 3K0AB 3N5CA 5BN3A 2OHFA 3L82B 2DBYA 3BERA 2LWIA 1EG7A 2B92A 2ZI9A 3UG6A 5A5GA 4HB0A 3RRNA 5DSZA 1YR7A 2WJYA 4B3BA 1CR4A 4HDOB 1G4UR 1M74A 2XB4A 5KHOC 1IY2A 3GFOA 1RFLA 4AKIA 1X3SA 2FU5C 4KSBA 5J40A 1UEJA 4A6XA 4KU4A 3ADCA 2UZ3A 4F38A 5BN5A 4HATA 2BIFA 3TQFA 3FMOB 2IUTA 1BYUA 1XNJA 3FE2A 2N1BA 1Q1EA 1S1MA 5FPHA 3SJBA 1XD9A 2RHDA 1A82A 1N0WA 3QUSA 4MA4A 4ZI3A 3VNVA 4B35A 4DWJA 4DCNA 1Y63A 5AJYA 4EFLA 1NVVR 2CVHA 2GVZC 3ZVRA 2K5UA 2P65A 4CGZA 3HPRA 1WRBA 1XJQA 3IIMA 4KXFB 1SULA 4BASA 5GVSA 1S96A 2YJTD 1YU9A 3UG7A 3R20A 2FN4A 3R8CA 5KSZA 1M2OB 4ABYA 4QKQA 1FZQA 3B82A 4A0HA 1W1WA 4V02A 1LS1A 3VQTA 3IGFA 5IK2A 1OYWA 1KO7A 3PUXA 2CMKA 3GLFB 4I1OA 3IUYA 2KJQA 4UKDA 1EFRD 1M6NA 2WWIA 1CU1A 5JI3E 1P60A 3SJAA 3Q5DA 4FWIB 4UXIA 3R7WA 1T4GA 4EPWA 2DYKA 1SHZA 4E22A 5B64A 1JPJA 2QENA 1E98A 4Q1EA 4DKXA 1XZPA 3AGPA 4AURA 3EPJA 4PHGA 4YDSA 4WZAE 1E1RD 1YZQA 3TSWA 1II8B 4D81A 2V54A 2GZDA 2XOKD 3H1TA 2Z4SA 2KBEA 3NBXX 1MT0A 1IOZA 4O25A 4TLDA 4JYCA 5FTKA 4ESHA 2GK6A 4L8GA 1DADA 1ZCBA 1AZTA 3GJXC 4I1SA 1E9BA 4PPNA 3UATA 4Q9IA 2HF8A 5GVRA 3ZD7A 2J7PA 3UK6A 2QQEA 3EIEA 2IBMA 2JAQA 1CRQA 4LV8B 3B1XA 3ADKA 1FMJA 2B7BA 5EUMA 2Q9BA 3BGWA 4O0MA 4XH9B 1E9EA 2BCJQ 2ZI6A 1G8FA 1S0UA 3A37A 3EA0A 4LC0A 4P4UA 3VR2A 2IA5A 2ZRJA 4WA7A 2ZM5A 2D62A 3QXHA 2OFWA 1E2HA 1N0VC 4G5GA 1TF5A 3W9YA 2BMFA 3OFNA 4DVGA 5FR2A 4XWAA 3A1UA 1WDTA 3FDIA 5C18A 3AP2A 4G3XA 1OXXK 4TLAA 2C99A 4DDTA 1LV7A 2UZIR 4LJ5A 3REFA 4ZDIA 3B1YA 1GNRA 3V4RA 5FBLB 4EJSC 4QRHA 2ZE6A 4URUR 5EUQB 2VHTA 2VRWA 1MR3F 5JHGB 1GKYA 4OJQA 3C14C 3VR1A 5JFGA 4QJ5A 3ZVLA 4OK6A 2R6CA 5J5CA 4AKEA 1UPTA 1MOZA 4V0OA 1MKYA 2EQBA 5FUVA 4R2IA 2FSFA 3VNUA 1AKYA 1XTJA 3X1WA 2OXRA 3C5CA 2IS4A 1N3BA 2WSSD 1VMAA 4RZUA 1NMXA 5EZ5A 2BOVA 2DY1A 3QENA 3HR8A 1GZSA 4KVGA 5D3QA 2IEYA 1T3HA 2GXAA 2HYIC 4HZUA 4MUAA 1CJUC 1HT2E 5L3QA 1DAMA 1KDPA 3KQLA 4XTCS 4W7SA 2F6RA 2ODWA 1RRCA 2JDIA 3G82C 1KGDA 3WY9A 2XZLA 4PQFA 2PX0A 4PZYA 3RHFA 3LLMA 4ILEA 3EW9A 3W6OA 3KQUA 3WMGA 4YC7A 1M7BA 4M9ZA 4KYIB 3W8NA 4URYR 4OL0A 4LPSA 4C0JA 4ZCIA 4X8MA 5SZIA 4NH0A 3N2IA 5G3YA 4FD2A 1I4LD 3BH0A 4P4SA 4PZLA 4WZ6A 4AYXA 4HAYA 5HR5A 2CL7X 2B8WA 4M21A 2R6AA 2WWWA 1N25A 3GEEA 3QNUA 4PC2A 5C4MA 1CEEA 3U7GA 5FUYA 3LVQE 5G40A 3VR3A 5IF9A 4PPFA 3K0FB 5EP4A 2O8CB 1OXTA 1OXUA 5E3HA 2REBA 4IW3B 3O8RA 4ZKDA 1OH6A 1CRPA 4Q02A 2D2EA 1F60A 3BB4A 1NNEA 3I5XA 3U6BA 1XB2A 4JSYA 4MGKR 5LB2A 3FTQA 4RD4A 1G21E 3AV0B 3LY5A 2CJWA 2VP9A 4US1R 421PA 3NC0C 1OB2A 1AZSC 4RKFA 4V0ME 3EXAA 4QXAA 4AG6A 5KNCA 1Z2AA 2RCNA 5CIQA 4BPBA 1S8FA 4DRZA 2ZYWX 1G3QA 4XWOA 3WMEA 4NPHA 2PCJA 4WBSA 4QGHA 4ERNA 2CEAA 3M4YA 1E1QD 4FCVA 4LJYA 1E2DA 1DELA 1WQ1R 4V0MA 5C2JB 5FOUA 2IYLD 3LDAA 3V00A 4LI0A 1G7TA 4K81B 4BLQA 2ONKA 5EP2A 1JR6A 2OM2A 4RFSB 2NZJA 3IO5A 3CKLA 3Q3JB 1VECA 2FNAA 3HJNA 4F4CA 2PEZA 4JT4A 4Q9HA 5ELXA 3QKTA 4IVRA 1UEIA 2EVWX 4NYJQ 4BFYA 2J45A 4E03A 2X2FA 5JI2E 2VTKA 2FPMA 2RGNC 1DBSA 1E94E 1Q1QA 2IYRA 2G3YA 2J59A 5CB6A 2WTUA 2UKDA 2YYZA 2ZSBA 3KKQA 4F4IA 1JR3A 2FEOA 3UPUA 2RMKA 3QPUA 3GLHA 1G3RA 5HKKA 1SXJD 3HYRA 4LBVA 2JLZA 4IHQA 2QM8A 4C0SA 2QP3A 3EA5A 2ZS8A 4F91B 4WXPA 4NCJA 1XCGB 3LFUA 2RGDA 4IDHA 1J8MF 2X1VA 4P31A 3T1TA 3CPJB 3VAAA 1VG1A 2XXAA 1XJCA 3TMKA 2GF9A 3Q7PA 2ZRMA 2ZRHA 2OILA 1E2MA 4EQ6A 3EC2A 1KI6A 1E9DA 4D0NA 1ZD9A 3W6PA 5TDHA 4NCKA 3IIJA 4QOSA 1CKEA 3SR0A 3TUIC 3AF0A 5FUXA 4LDJA 1Y3AA 5KO2A 4DZZA 2C98A 4WXRA 1GP2A 1JQJC 1AS2A 2ZTSA 4DIEA 2IYVA 1A5TA 4A2WA 1VYVA 1SKQA 4DIDA 4A2PA 3CM0A 1K5GA 2V55B 4Q4HB 5DHAA 5GADl 1LF0A 3C7KA 1HTWA 2R9VA 5KSPA 2C77A 1KMHA 1FNNA 2CDNA 2JLVA 1L4YA 4C0KA 2PMDA 2ZVPX 3NXSA 4LBYA 1P7CA 3CR7A 4TTRA 3NHAA 3WRXC 2JLUA 3GQBA 2QGZA 3CZQA 2WWXA 3UMSA 1G291 4YMWA 1U9IC 5CLQA 5L3SA 5JWOA 1QBKC 1N5LA 2WAXA 2HJVA 2C95A 4EPVA 4DB2A 1KKMA 3LW7A 3PVSA 1S3GA 3RSLA 2PBRA 3U3JA 1PV4A 2GCNA 2W6ID 2DB3A 1D5CA 3K9GA 1FL9A 1G3UA 1PLKA 2PT7A 2F7SA 3IDQA 3BAFA 3OESA 2AKAB 4LJ9A 2YWHA 2ZJ8A 4EFNA 1F3OA 1F48A 3L8YA 3PUZA 3SJZA 3ETLA 2J0VA 2QMOA 1Z3IX 1EFRA 4I99A 4WIAA 4DCUA 1OKKD 2P5TB 5EZ6B 4TL8A 1XRJA 2WJHA 4IXNA 2V6IA 1U8AA 3C5HA 3LXXA 1QZXA 2WICA 3PJRA 4D0LB 3TUZC 4LHXA 4CT4B 5JRJA 1EWQA 3EIHA 4NU0A 2QBYA 2O8DA 4A0FA 5DYIA 1E1RA 2FDCA 2PZFA 2W6JD 2ZJ2A 1XEXA 5KTYA 4S2EA 2XOKA 1KDRA 1GM5A 2JIZD 4LPKA 4JT2A 5JRZA 3P20A 4NHOA 1JNYA 4DLZA 2GA8A 4RD1A 2YWEA 3Q7QA 3W5IA 4R71A 1L4UA 1NLFA 1OV4A 2HCBA 1KY2A 1ZM2A 3OEHD 1G8YA 2EYUA 4DUGD 3CF0A 3EIQA 1J2JA 1YZKA 3EX7C 4Q4AA 5D3MA 4N0DA 2YINC 3W3ZB 1F2UB 2GDJA 3QF4B 4KI0A 3I62A 4LHVA 3A8TA 3D6TB 3DM5A 2ZRIA 4IXMA 1I4DD 4HAUA 4TMZA 4RCZA 3B78A 3D31A 1M8PA 3KJEA 3FHTA 3AVQA 4FN5A 2AD1A 1V5WA 4M9SA 4KFUA 1VG0B 4D26A 3SC3A 2E87A 1W48A 3IO3A 3GJ8A 3R9IA 3K9NA 4Z1MD 3IILA 5J4LA 4MRNA 2H18A 3P4YA 1AKEA 1I2DA 5DISB 5HCNA 2ZR7A 1JQLB 2ZR0A 1DVRA 1QHSA 1OFIA 1RW4A 2QROA 4TYYA 2CHGA 3AEZA 4M1KA 5F98A 2Q9AA 3KX2A 4GSYA 4KITB 4PZZA 2TMKA 3K53A 1RYFA 1U0JA 5J4KA 3C41J 2RGXA 4TYNA 1JECA 1J7KA 2ASEA 2WSSA 2FFQA 2ODEA 4PHHA 4KLZA 3C4JA 4BECA 2H17A 4UNNA 1WMSA 2P3SA 2QPAA 3GJ3A 4LZZA 4Q1CA 1JAIA 4MDFA 4JVNA 4B34A 2J7KA 1X8KA 3VU9A 3NEJA 3X1XA 1UM8A 1T0JB 1NG1A 1KK3A 4LCBA 5FOXA 4CVNA 1N5JA 2H92A 3CO5A 1R5BA 5KSOA 4QM6A 4Q01A 2ZRLA 2O8FB 3U3RA 1RVDA 4BFWA 4M1OA 4HLDA 2GKSA 1S9HA 2EFEB 3WHKA 4AY2A 4NMMA 4HI0E 1JI0A 1KMQA 2NG1A 4D80A 1KYIA 2RGCA 4IDQA 4JMPA 1E2QA 1DEKA 1US8B 5FOWA 4Q9KA 2REXB 1E2LA 5FPTA 2QL6A 4CW7A 1T3SA 5B30A 1HY3A 1ZJ6A 2C9OA 2J0UA 3B7GA 4OQFA 4KSCA 3GP8A 3IHWA 4GDFA 2WJVA 3EAQA 2IC5A 1Z08A 3A4LA 4IVQA 2GJ9A 2AWOA 2H5EA 3UMRA 4BGDA 3IBGA 2ZVQX 3LH5A 4FIDA 4LYJA 5ANRB 3AUXA 1KSGA 5L3VA 4Q7LA 4XVRA 4QBFA 2HDNB 3KTAA 1OXSC 1N6KA 3T5DA 2NO7A 2KI5A 4KCGA 1IM2A 2Q9CA 3I1FA 3PR1A 1TQ4A 2IXFA 3BBPA 2GCPA 1CLUA 1FW6A 3ZZ0A 5IRCD 2AFHE 3QXSA 4NYMQ 2GCOA 3THWA 2ZI4A 2BJWA 4HSEA 1BS1A 1VCOA 1N5IA 2Z5FA 1E1QA 4PSKA 4CF7A 1KK0A 1Z47A 1F2TA 1NIPA 1SGWA 3EARA 5C1BA 1TU3A 2Y8EA 5DYGA 2JLXA 2P67A 1JEEA 4TSFD 2QP9X 5JSZB 4UJ3A 1XTQA 2OLJA 3BFKA 1XMSA 1WP9A 5JHHB 2QUZA 3QF7A 3GPLA 4B2IA 5HE8A 1NVXQ 4X8HA 4LGMA 3TSOA 2FEMA 2ZAMA 3S1AA 5FBWB 4NDZA 1KY3A 3NG1A 2XGJA 3RABA 4O2LA 2J46A 4QFMA 5EXSA 1XWIA 4FXPA 2FFHA 3L0SA 4N1AA 1SXJA 3KL4A 1E32A 1KTVA 2BEJA 2WWYA 1ZM7A 3OIYA 2C5LA 4CZ2A 2CXXA 3QG5A 2WKRA 4YXWD 2JJ1D 2J0SA 2NO9A 3C8UA 4IOLA 1BYIA 3K0EA 4C3ZA 2FG5A 4OBEA 4JBYA 5H68A 5FFMA 5EP1A 3DKPA 4XIGS 2VPPA 4BRWA 4JKYA 5FI0B 2B7CA 2H57A 4DCTA 1Z63A 5JWHA 3HWSA 2DCUA 3H84A 3A6PC 2GXQA 4B33A 1G5RA 1IXSB 4RD6A 6Q21A 1X8JA 1AS3A 1OLOA 1SVLA 1BH2A 4NKRA 3SQWA 2VP4A 1D9ZA 1QHHB 2QQ0A 2ZJOA 3GLGE 3B2EA 4DCSA 3DEFA 1CTQA 4Q1BA 3QY0A 2OBMA 2AD5A 2ZR9A 3TVTA 1SQ5A 3ONWA 2C04A 1RKBA 2IS2A 2WMNB 3CNLA 3QSYA 1XP8A 2LCFA 5J4YA 3D8BA 4LSGA 2ANBA 4BZPA 3LQRA 4QHTA 1NJFA 4EPXA 5KPDA 1GVNB 3MWYW 4UXHA 1WA5A 3GLGA 1LNZA 2PJZA 4DLTA 4ZV4A 1IHUA 4FMDB 4B76A 3I8XA 1MO4A 5TV2A 4ZDJA 2ZUBA 4KYUA 2ZRGA 1ZD8A 2EFCB 4B71A 1OIXA 1O3YA 3AF1A 1K8RA 4LHYA 3AB3A 4W5JA 4HUTA 1XXHE 3K1JA 3CWZA 2OCBA 3GJ6A 4BQSA 4X8OA 4XOIA 4H1VA 1R0WA 1SHKA 3AVVA 2IS1A 5TMPA 2SHKA 2CCKA 2DWQA 4HUQA 1XPUA 4C0QC 1G4AE 3A4NA 3KZ1E 1MO5A 4QGFA 3ZQ6A 5LD2B 1OKKA 1XFAA 2E1RA 1KJWA 1VCIA 2OZEA 4W5WA 4TL7A 5DGXA 2GAOA 2DFTA 1XXHA 4Q1DA 1NI3A 1HA3A 4PR0A 1YE8A 1CR0A 3B1VA 1UBCA 2EU8A 5DI9A 2IUUA 2DR3A 4M1TA 4DSOA 2FV8A 2PLFA 5FUWA 4G5RA 3MMPA 3K9HA 1CJVC 1MABA 3QVUA 2ONJA 3PCRB 4A1FA 2JIZA 3SYLA 3RDPA 3UANA 4B3XA 1NP6A 1P9NA 3AM1A 5FL7A 3L8ZA 4JJKA 1DAKA 3SQXA 1KAGA 3WYAA 1ELOA 1NMZA 1ODFA 3I8SA 4JZKA 4NONA 2XZOA 1IJFA 2DWPA 1GILA 5JEEA 1W46A 5KU1A 1LF5A 4JKIA 4DUGA 4FMBB 5HCIA 1QRAA 1Z28A 4BEBA 2OUKA 2GAAA 2QN6A 5EE1A 1G19A 521PA 2WWGA 4PAOA 1UFQA 2HLDD 2PH1A 4YDHB 3EWSA 5FL3A 4TT3D 5FBQB 4EIWA 2JLRA 3T34A 1XMJA 3EPHA 4MGIR 1HQYE 1S1CA 1XTIA 1C9KA 4B32A 4Q48A 4KJZA 1DAEA 3CIOA 2IS6A 2GETA 3CX7A 1KAOA 2B6HA 2PT5A 5GJVC 3VTKA 3U3OA 1OPXA 3WYFA 4OI4A 4Q7JB 2Q3FA 3QOFA 4Z1MA 5SZHB 3RS4A 2R62A 4XSHA 4OHWA 3BE4A 3BIFA 3GLIE 1A1VA 4A8JA 4ZI2A 4Q4JA 4ZKEA 1NBME 3TAUA 2IYUA 4KFSA 3OHMA 4HLUC 3NWJA 3LAWA 4JIMA 2OCPA 4HDCA 3Q72A 4NZYA 2JCSA 3VR6A 2D7CA 2G6BA 3QVVA 3FHCB 3W8RA 4RZ2A 3TQCA 2OEPA 2V3CC 3LA6A 1U8YA 3ND9A 5FPKA 3AP1A 3JVVA 3U4QA 3NH6A 1OIVA 3RS7A 2QPTA 2Q0HA 4BLOA 4NYMR 1KNXA 1UADA 4ITRC 2B21A 2Z83A 4L9SA 3FKSD 2QG6A 2HJGA 3KJGA 1E4YA 1XPOA 4UNPA 1S3SA 3AVUA 1ZCAA 4EJSA 2EWVA 2ZREA 5L3RA 2KE5A 4KO8A 4GP7A 2GNOA 2CJWB 1V43A 3DDCA 1AM4D 3AUYA 3THXA 2ERXA 4B75A 1NSTA 3TAHA 4HLCA 2QMEA 3Q5EA 2CL6X 2WKPA 4GMXA 2JEOA 1KK2A 2QY9A 2P5SA 3J81k 3DO6A 1P9RA 5CITA 1JPNA 1KSJA 3LNCA 4FI3C 4QNMA 2QTVB 4TYQA 1FX0A 2IYSA 1LW7A 2W58A 3PUVA 4S35A 1NRJB 2NPIA 3KXIA 3AVYA 4OQMA 4B43A 2AXNA 3DVLA 4PC6A 4XTRA 3CF2A 2KBFA 3U44A 4E5UA 1GL7A 1X1SA 2CLSA 4V0KA 3OAAA 4CEJA 2A3RA 1IAQA 1EFCA 4DLUA 4A2QA 5CB8A 2CNWA 2W2TA 4BRUA 3BFXA 4B6EA 2D74A 3KKNA 4UQOA 3MRSA 3TNFA 1ZUNB 2JLQA 2XB2A 4M9XA 4MRSA 4RSGA 3TUJC 4G5QA 3GFPA 2LKCA 2J0QA 3GLHB 2WHXA 3FKQA 4DT1A 1S9DA 1CJMA 2WBLC 3DKVA 2IWHA 3IPYA 3BJIC 3LQQA 1TUEA 2PEYA 4LC1A 4UNRA 3RYTC 4AWXA 2IEZA 5JCPA 4LX0A 3FMIA 1IJEA 2I1VB 2J87A 4JVLA 3B60A 1W4CA 4EKDA 4CEHA 2XXAB 2FSIA 5G3ZA 4EPTA 1NVWQ 2V6JA 5AWFC 5KDLA 5JEDA 1P6XA 4TSFA 821PA 4EQ6B 3K0AA 1OH8A 4QM7A 4PSAA 2PL3A 1FQKA 1YRBA 2AXPA 4ASUD 4N3NA 4HB4A 3THYB 1Z83A 1KSFX 2IYQA 5FH9A 4EUNA 3LRPA 2A9KA 1DO2A 3K09C 4PSVA 5GJWC 4ZO4A 1NF3A 1UDWA 3X1DA 2ZROA 5DI3A 4HLQB 2F1HA 1Z0IA 1G1MA 1W44A 3QG1A 4LV6A 3SDZA 4PFSA 3AKCA 3A1VA 1NN0A 4GI7A 5LD2C 4MRPA 5C4GB 4OHYA 1K5DA 1YZNA 1WCV1 3F5FA 2OAQ1 4Q47A 3TVDA 1XBTA 1N5KA 3WNCA 2I1QA 2OAP1 3RANA 4KBFA 5HPYB 3MWKA 4C9BA 4YXWA 2DFKB 2FE4A 5L8VA 4DC9A 3TLXA 5E7MA 2WOJA 2CLDX 2VF7A 4PC1A 2ANCA 4LOAA 1EFHA 2ZU6A 3NIBA 5L3SB 2C03A 3E1SA 4JL5A 4C7OB 5DIFA 3EASA 2Z0MA 2BMJA 3GLFE 1W0KD 4W9MC 4BLTA 4ARZA 5CM9C 2FF7A 1CR1A 1P2VA 2Q3HA 1QHIA 2ZPTX 3AKDA 3ASYA 3LO5A 1XDBA 2VHCA 5J4VA 2G88A 1N6RA 1Z07A 2RGNA 4MKHA 4OK5A 1J70A 1CJTC 4JLPA 4JLNA 4M1WA 3K8YA 3T35A 2C2HA 1JXOA 3CB4A 3GJ5A 4ZCMA 3BC1A 4BUJA 4M8NE 2GJKA 5EXXA 1J90A 3WBJA 2HYDA 3NH9A 3O8DA 3P27A 3SHFA 1RRFA 2GJ8A 2QBYB 2O8DB 3KJHA 3OIVA 1XEXB 2FGKA 2VP5A 1IN4A 3K0CA 3RNLA 4B48A 2QAGB 2V7QD 1T5LA 5CJPA 3CNOA 4DDUA 3FPAA 1W7AA 1KIMA 4LV5B 5JECA 1XCPA 5DO9A 4BLSA 5C46F 1YVDA 4J0QA 5EXPA 1SKYB 4EAQA 1A2KC 1E9CA 1FPMA 3OEED 4AKHA 1XD8A 1T9HA 5EXTA 1IY0A 1WF3A 4R98A 3WHLA 4KLNA 4QHSA 2BKEA 3W6NA 5J4HA 3KFVA 1E2PA 1Q3TA 1PLLA 3B13B 5FPSA 3G5UA 2JGNA 4XD7A 3RSOA 1Z0FA 4GOJA 4MITA 4KODA 5JZVA 1RJ9B 1UBGA 1J99A 1YZLA 5JJKA 4IFBA 4OJKA 4WAUA 2VSXA 2GF0A 2CHQA 2AHOA 2VSOA 2CCGA 4KHZA 1TEXA 1CR2A 1N6HA 3JZAA 3KKMA 1U81A 2AFIE 1G8PA 4WOPA 1TAGA 1HV8A 2F9LA 1W36B 2GWHA 3QPVA 1OH7A 1XTSA 4NTZA 3P32A 4FMCB 5DHFA 5JBQA 3E2IA 2DPXA 2ZSEA 1N6PA 4A9AA 1U9IA 1FUUA 3FFAA 3U7HB 3DZ8A 1Z0AA 1D8TA 4LY6A 3TR0A 2QM7A 5FBRB 1IONA 1S4QA 3NBFA 4C0HA 1DTSA 1C4OA 2YWGA 1G3IA 2VYFA 3ZDQA 4EDHA 2OXCA 3RWMB 3PUYA 3CWQA 3TBKA 3DHWC 3RRZA 1EX6A 2A5JA 4PHTA 5E7JA 2H8KA 4TT3A 3AH8A 4Z8YA 2YZ2A 5FOTA 3ICQB 3WRYC 4JLVA 1EFTA 5CJ2A 4HAVA 5CK5A 2OE2A 4AG5A 1DAIA 4XVQA 2FGJA 4Y0VA 1SVKA 4CEIA 2XTMA 4POAA 3CX6A 1DS6A 5GJBA 3ZVNA 3IEVA 2X77A 1NLZA 3X1YA 2RB4A 4D0GA 5P21A 5AJVB 1OB5A 1QF9A 4JLKA 5AUQA 2HEIA 2ZU0C 4ACBA 2CVFA 3B5JA 1ZINA 2I4IA 3FB4A 2JJ2D 2OFOA 1CP2A 1BKDR 2O8EB 2WM9B 4RD0A 5F9FA 2ZRBA 2BV3A 3QEOA 2FSGA 1P72A 1XCMA 3SFVA 4B73A 4JJZA 2QTFA 4Y0AA 1G7SA 1HEIA 1X6VA 2BMDA 3HU3A 3ZS9A 4Z54A 5CYPA 1IN5A 1LVGA 1GL9B 4QHYA 1TF2A 2Z43A 3FKSA 2BKUA 4OYHA 3L0PA 3OIUA 3QBVA 1T5IA 1ZM3A 2F43B 3K0FA 2F3RA 2ODBA 4XJXA 1ZD1A 4FCTA 2Z6VA 2O8CA 2CL0X 5BN4A 1CULC 1EGAA 3B9QA 1XD2B 1ZBDA 3QKSA 1YZTA 5CLLA 1ANKA 1HT1E 3M1IA 4ZIRB 1R4AA 5HZKA 3A58B 5JS8A 3IKJA 3C15C 3NBYC 5DE3A 2J3EA 1UKYA 3THWB 4B47A 2ZRCA 1G5TA 2RHMA 1K6MA 1G41A 1SKYE 1JEDA 2D4HA 4IOMA 4IDNA 3PEVA 5UKDA 1F2TB 1E2GA 3KJIA 1HE1C 2ZYUX 4IDOA 2AL7A 3QI2A 4Q18A 1CS4C 5JJIA 2RAPA 5DNYB 1E0AA 1TTTA 4JS0A 2RH5A 3SE0A 2XNDD 2ZJZA 3FGNA 1U0HC 2ZRPA 3CW2A 2GHIA 5TXGA 1X1RA 3B6EA 4RFSA 2A2ZA 4JLOA 4B6FA 4DLSA 1QG4A 1X8LA 2ZJBA 5CYOA 1Q0UA 3RC3A 4IOJA 1W49A 1GDDA 2HT6A 2ZIAA 2JLSA 1YR8A 2L0XA 3QBTA 3VFDA 1P61B 3H0KA 2D06A 1I4TD 3CRVA 4Q7KA 1MV5A 5EP3A 1VPLA 4HAWA 3ZZUA 5CIWA 4X8LA 2CLCX 3LLUA 4BFSA 4FWTA 2O8BB 1W5SA 5AJZA 2ZQ5A 2NOAA 4BEJA 1A7JA 5AUOB 4A15A 2CCJA 2ZE7A 4US0R 1NBMD 4PO9A 1UJ2A 2ZI3A 2QAGC 3CF6R 4NYIQ 2JLWA 1OT3A 2GEUA 2N42A 4V0LA 1GIAA 3PXGA 4AC9A 3LVRE 3ZQJA 5KDOA 1WB9A 4NBSA 1FNMA 2R6FA 3RRYA 4FW9A 4TZ0A 4BLPA 1R0YA 4D82A 5LDDC 4I1UA 3PEWA 1GTVA 4I81A 4IOKA 1TNDA 3RS5A 3SEAA 1WBDA 5IK2D 2PMKA 1OHHD 1E2EA 2ZI5A 4MKFA 4UJ5A 3L43A 2BWJA 1A2BA 4ESVA 1D2EA 2EFGA 3CBQA 1F6BA 5E7IA 4Q4HA 1CJKC 2WIBA 1P5ZB 3CX8A 2VHQA 1Z06A 5CM8B 1XPRA 3UXMA 3WP0A 1E69A 2IF2A 4NYJR 4C4PA 5J47A 1E9SA 1II0A 4KAXA 3BXZA 2WWFA 3T12A 1TPZA 3AKYA 1P62B 3UWKA 1W36C 1Q12A 2NGRA 4M9QA 1W0KA 1SVIA 4GZMA 4QG7A 1LFDB 3K0SA 1T8TA 4WZBE 1AGPA 1QDEA 1FTSA 1VIYA 1Z0KA 1PUJA 2VA8A 2YWFA 1CXZA 4LBWA 4TYPA 1T8UA 1TQ6A 3OZXA 5TVKA 1NKTA 1NVVQ 3PUWA 1VHTA 2BM1A 2ZAOA 1KZGB 1GNQA 2P6UA 2FOLA 1N6LA 1MRNA 4TQ9A 1ZIPA 1OFTA 1MO3A 4GBMA 2YNMA 3CNNA 1Z6YA 1Z8FA 3H4MA 4A4DA 2F3TA 1IXZA 2DFNA 2A5GA 4K8OA 1VYUA 4MYUA 2VP0A 1GG2A 2G0TA 1L2TA 2FMXA 2VSFA 4O2RA 1FP6A 3CR8A 1C1YA 2W2VA 1TU4A 1OSNA 2O0HA 3OFND 2YOFA 3EZ7A 3UMFA 4A6PA 2V7QA 2PJRA 5F9HA 1YR9A 1G3MA 1AA9A 5FTMA 1ZM4A 1VG8A 2OO7A 2JA1A 5A0FA 2J9RA 4G5OA 3LBHA 4AYWA 2G0NA 2R6DA 3NEYA 3OEEA 2R2AA 4MRVA 3MWJA 1WXQA 5JJLA 4LBZA 5FTLA 2E9SA 1BO6A 5E95A 3CH5A 2NZ8A 1W47A 2QGNA 2O0JA 1E79D 1BIFA 1XMVA 2DFLA 3V9PA 2IHYA 3A1WA 1YZGA 4TMTA 1F2UA 2VHJA 1BOFA 1R10A 3DMDA 3VX4A 1P3JA 5G41A 2ZE8A 4AYTA 2ZSAA 2BCGY 2XITA 3D3QA 4YMSA 3B85A 4JLDA 5TY0A 3QIAA 1E6CA 1BMFD 5EE9A 3L0OA 3WXMA 1SVMA 4TYWA 2WKQA 2ZRNA 3O8BA 1M1YE 1XMIA 2W83A 4D6PA 3KFXA 1Z6GA 3PV0A 1TADA 3UIEA 4BFZA 3GEHA 4B3DA 1DG3A 2BVNA 4A8JB 4JL8A 3BWDD 4DLVA 4GMDA 2VIIA 1ZNZA 3DOFA 2GESA 4DLYA 4ON9A 5IDVA 3F3YA 3ND8A 4FINA 5FOSA 4BFXA 3ZIAD 1Q20A 2JATA 1IY1A 3RWOA 2ZUDA 2FWRA 5LBIA 2C78A 3U2QA 4MKIA 3PEUA 3A36A 4UNSA 1L7VC 1NY6A 1NVUQ 1ZC4A 2PLRA 2VLIA 5EE3A 5KUTA 1PUIA 3R7WB 3H2YA 4MYHA 2W00A 1KJYA 2R6GA 1EFUA 1XU4A 2CE7A 4Q7MB 4TLCA 3KQKA 2AKYA 3ZJYA 2GZAA 1Z6XA 3LXRA 1IXRC 5KOYA 2YC2C 4OHVA 1U2RA 2XZPA 2OT3B 2PZEA 3WNBA 3CH4B 4UXJA 4TN1A 4GOKA 2G9NA 3U6KA 2NPFA 4ZDKA 4YMUA 1NSFA 2O8FA 3DL0A 1GRQA 1P75A 2NQ2C 3NDPA 1GSIA 3OE7D 2OCAA 2Q3MA 4K46A 2A5YB 2H16A 3WBKA 2W6IA 1FTNA 1NN5A 2JJ2A 1DOAA 1ETUA 1JJVA 2FZ4A 2IK8A 2QORA 2P6NA 4Q5IA 3UWOA 4ACAA 2XNSA 1LTQA 1CBUA 1GOTA 3MLEA 1GUAA 2EW1A 1AN0A 1GAJA 4HB3A 3U60B 1FMLA 1KDTA 2QRZA 4LHWA 1R0XA 5EQTA 4CEJB 2WZQA 1II9A 3GJ0A 4A92A 3ZLJA 4BE7B 5F3WB 1NMYA 3UKDA 3RC8A 4UNQA 2ATXA 3FFBA 2W6JA 1KI1A 2R65A 3IPXA 2ZSDA 2IHBA 1KI7A 4Q19A 1YQTA 1E3MA 1MH1A 1TF7A 2OESA 1XEFA 2R8RA 3RS0A 4NYIR 4DSTA 4OI1A 1KI8A 5EE0A 2AR7A 2WJIA 2V8OA 4FCWA 3ZYCA 1JR3D 1VIAA 1Q3HA 1U0LA 3OEHA 1ESMA 2A7QA 1R5NA
chains in the Genus database with same CATH superfamily
4L8LA 4L0DA 5B2ZA 1YS6A 9MHTA 1ZIOA 1RC1A 2P3OA 4GWLA 4RSRA 5ES3A 2EARA 3NV9A 1K7XB 2OOKA 2X22A 1A69A 5BV2P 3HB4X 4DM7A 1P1KA 4UDXX 1S6YA 3KYBA 5JJ5A 1EX1A 4CLOA 4M9CA 4RTNA 2R8ZA 3G7NA 1PEYA 3NM6B 3OM8A 1QHFA 1QHYA 1EYZA 2CLLB 2R4TA 1TFUA 4HAZA 2YOHA 5I4IA 3BJMA 1VKHA 3MWLA 4QQKA 2D54A 2H9IA 5JSZA 4U7DA 4PLVA 5DWQA 2OB2A 3B9PA 4CMAA 4QWWA 2MSEB 1PL7A 5JY6A 1J21A 1RMQA 2FPWA 3HSKA 5AJXA 2G82A 2C4KA 1D8AA 3EGDB 3HYLA 3MUNA 4OLBA 1F20A 4OFZA 1P9WA 3GT3A 4RLHA 5DI3B 3X1ZA 2W9XA 1PBTA 1YQ9A 1V71A 1YWGO 2XX3A 3HCCA 5FWNA 4HMOA 4P32A 3VISA 4F5DA 3KQSA 2ZT6A 1TD1A 5FF9A 4IF6A 3F78A 1I2AA 1VE5A 3RVDA 1AQYA 3C6BA 4JB3A 2YHUA 1CZNA 2O2XA 2EX0A 4B82A 1Q1GA 4ZTZB 2YMQA 2I2CA 3OPYA 4P4SB 2Z9DA 1QDUA 2JCBA 4LJAA 5E6RA 4A0GA 1EB9A 1KKLA 2I7VA 1ODKA 1OI3A 4DJEC 221PA 4JC8A 1U90A 4QXOA 5JATA 5KOJA 5L4NA 2QSYA 3LBIA 3W5AA 2IXGA 3G2IA 3DDOA 4TQAA 1DCMA 2POQX 3JPWA 3MW8A 5C8ZA 1PDWA 3SNKA 2B35A 1O95D 3RUAA 3ANSA 2BBTA 4KIWA 4ZAFA 4DY4A 3RK1A 2V5AA 4MWGA 2FFAA 2WU3A 1DIBA 3IQWA 3ZE9A 1JHZA 4PG8A 5IVHA 1XF1A 1S2OA 3S3TA 4AD8A 5JT1A 1H6BA 1NE7A 3E05A 5K20A 1C7ZA 4ITUA 4RCYA 2BBWA 1JMYA 2J6BA 3OCJA 2HPVA 2FSUA 3FR7A 4FX5A 3P4XA 1D6JA 1Z0ZA 2C7BA 4F9GA 1JT2A 4LHSA 2FA9A 5YASA 5BWBA 1E3TA 3NATA 4EMBA 1OH5A 1FDIA 1QR6A 2V4MA 4L9WA 3DFZA 1T36B 2ZUUA 3H5NA 4V0NA 2Q6VA 2A9RA 3SAJA 4DJFC 3T9BA 3AZOA 2BUAA 3RRJA 2ZJYA 3SZOA 2RG1A 3JR7A 3LX5A 4IJUA 4EPRA 3DMRA 5JIBA 1ZR4A 3N05A 3O4HA 3C3PA 4OHRA 3DTVB 5EWJB 3DJFA 3PUKA 4C4SA 2GJSA 3E61A 5CG1A 2RAFA 2YC4C 2QE6A 3ZCUA 4LSWA 4X6YA 3F4KA 4WCVA 4G2TA 3M2TA 1U5CA 1Z4QA 1Q7CA 3SC2A 1TX4B 2LV8A 2D1QA 3BXFA 4J7AA 5K8TA 3AVXA 4PN7A 2EZ9A 5M5BA 3BCUA 2C42A 1SA0A 3WGKA 2UXBB 1FDRA 2DFVA 3HCDA 2IZ6A 4DMFA 1WY7A 3K09A 3W5CA 1KFEB 3ILXA 5IMSA 4MJ3A 3TGPA 2GPSA 4PAMA 4QU8A 2FX2A 2I54A 2P9CA 4LFCB 3WK5A 4B3GA 3EC7A 4C43A 1NPYA 3WWDA 3GP5A 1ZAKA 2IYAA 3M5WA 1Q1ZA 4BU0A 3BRWD 5BSKA 1VSBA 3S5JA 3V7FA 4TRMA 3R6DA 2H1CA 1KJ9A 2Q4EA 2QZSA 2YHAA 5DYTA 4O3MA 4DRXB 2H5LA 3DLIA 1GAEO 2RC5A 4INPA 4FD3A 1H65A 2PX5A 2AJBA 2WOOA 4MA5A 4RO0A 3T7KA 2PG3A 3EG5A 4ZQCB 3P1JA 2X6RA 1PDOA 3T1VA 5KNDA 4IDPA 1YFLA 1D4FA 3NRBA 3DO8A 2NMVA 2PSEA 4DDVA 3OZRA 1BNCA 3JQFA 4N03A 3F0TA 5E8JA 5IMBA 3VOBA 1JFFB 2AIRA 3GGCA 4QGGA 4ZT3A 5K2MA 4I50F 3BXOA 3ASZA 3BEDA 3VO9A 4EITA 4TLBA 2HXSA 2J8ZA 2YV5A 3AFHA 5JCOA 2WMOB 1HURA 1E2KA 2KSQA 3KLPX 4AJ9A 1XRRA 2FRDA 5LLTA 3C6MA 9GPBA 3GRCA 3PXXA 1HI9A 5FHRA 3EZFA 3IAAA 4JB2A 1YJ5A 3UF0A 3CNHA 2H7XA 4BZQA 2NUPA 2I1LA 4I55B 4AJLA 4D8YA 2AUTA 4MTLA 4X97A 2K6GA 7REQA 3GG9A 3RU7A 4OM8A 3S7TA 2JIMA 1EM8A 2QTRA 3FPHA 4WW0A 4IMIB 4K6FA 4KQFA 3V6MA 2QTGA 2F1IA 1TT7A 4R4JA 3RAPR 4ENTA 2PAAA 3ELDA 3HL0A 2EC5A 1WEKA 4GOXA 5C81A 1ZAYA 1NJ8A 1U1IA 4TL9A 2VYND 4XEUA 4MYRA 3RSSA 3TZHA 1KMHB 2O6HA 4HYEA 2J3JA 1E5DA 5K9ZA 1K27A 5H9WA 1PG2A 3DYVA 1KJZA 4PWZA 1PJLA 1E99A 4FHFA 3ZZNA 3RF7A 1GR0A 3L1UA 3TK1A 1AC5A 2ST1A 1Y89A 2ETXA 4FYJA 3DSRA 2ZE5A 2AN4A 2ZRAA 3F4LA 3WIDA 1AKQA 3I4LA 1IN6A 5WRFA 2MSKA 4ENPA 1HG1A 3HS3A 2RFLA 3DTTA 1J0AA 2Y71A 4AO7A 4E2WA 5A5DA 4Q4LA 4Z9YA 3UAYA 1W8DA 2WEKA 5K0TA 2ZETA 1OJLA 4ZGBA 1M2OA 5KYKA 1KAQA 1UKZA 4IJMA 2Z8ZA 5CT4A 2ZJ1A 3LCUA 4U8HA 4O8ZA 1R9JA 1JQ5A 1J6UA 4IQ0A 1NI4A 4RNCA 2HA0A 4RPIA 3DC2A 1LQTA 3HB0A 4KX3A 3GLFA 3W2HA 3I39X 3AHFA 1H2WA 4Z2YA 1NW9B 3WL8A 2BDTA 3D7SA 4BCDA 1Y6GA 4RHYA 3CRW1 3GVPA 3TE6A 1RWNA 1RAIA 3U0BA 4UHJA 3U39A 3DF7A 3DAYA 4X3CA 4XB2A 5HRAA 4U02A 4MWTA 1HQKA 4KQEA 1RRVA 3GEIA 4L6IA 5D5PA 3MT9A 2G08A 2GX6A 3OA2A 1JILA 3TBHA 4UTPA 2KYRA 1D2HA 1I6WA 2DY0A 1CIPA 3KT3A 3O93A 3OF2A 4MQBA 1B8VA 1W0JD 3UHAA 3WTBA 5IXJA 1ZWKA 2G4CA 3JVUA 4NZ9A 3EEFA 2BGTA 1VG9B 3G2JA 2CN1A 3QKSB 4IVPA 5K0GA 4Z0PA 4BO5A 1GU1A 1P2TA 3CRQA 1DE0A 1RI1A 5HKLA 4C1BA 3EY4A 4XW2A 3W4JA 4QLOA 3GLQA 2ZBVA 3MA0A 1SKBA 1U63A 5BPHA 2FEAA 1IHXA 4NS4A 3ON5A 4FBLA 2N3ZA 2QJFA 4GW3A 4TXNA 2VTDA 5CD1A 3HGQA 1DQYA 2R66A 2FR0A 3LFTA 3W1EA 2OGSA 3N75A 4OJTA 4PZUA 2C5BA 4MGYR 3MJTA 2YMLA 1ZYUA 2JA2A 4LJ8A 3R7DA 3DD5A 4LGCA 3OI7A 5ELMA 1NOKA 2D2FA 4B84A 1D2NA 3AIKA 5CD9A 1XVTA 5D1NA 3CPEA 3UFXA 1UKVY 2HQRA 1L4NA 5HGXA 4N18A 4BB0A 1T6BY 2ORYA 4X60A 1MB9A 1RSZA 1AHPA 4BGIA 1L1QA 1I3MA 5KTOA 1VSVA 3LHFA 5I6DA 1BVRA 5FO0A 3U80A 5J59A 1T3LA 4P33A 1M34E 3AVWA 3LUKA 2Q50A 2VBCA 2WI8A 2XQKA 3K8OE 4XDGA 3DAGA 1NMQA 3K20A 1U2DC 4PANA 1JJ7A 3GEDA 5AW5A 2OO5C 2YH2A 3EXEA 4GS5A 4EKYA 3TO5A 3QE3A 1QG2A 3PPWA 2QL5A 3A2LA 4IJVA 2WD7A 1MO6A 4F6LA 3L6RA 1P2FA 4ZOBA 4BNLA 4NBTA 1FOEB 2HLDA 4GC9A 4HX5A 1VMIA 2H85A 2YDYA 1L3CA 2CNOA 3CZ5A 3DULA 5IHXA 4AKGA 3EGCA 1Y80A 3N3AC 1JNXX 2HLPA 4TVBA 1T8PA 3VU9B 4LEIA 1ICEA 2BFMA 5DN6A 2ZYDA 3ZCPA 3I09A 1XF9A 3RC2A 3NTUA 2VNHA 1PJRA 5A4DA 1VCMA 4UM5A 4QGAA 1KZ7B 4ER5A 1NONA 5DX1A 1O6GA 4DQLA 2C3UA 1CRLA 3DA8A 1H2ZA 2EOAA 1GQQA 2KQUA 3QA3E 2P6RA 1RPZA 2XSZD 1WUTA 3JWJA 3W5DA 2XJ9A 1U0GA 1IRXA 5JH7F 4PS0A 1AQ6A 4B8ZA 3QH4A 1H1LB 1H1TA 3BH6A 4TL6A 5CDFE 2Z5GA 5DZSA 3RF6A 3TBFA 1I2MA 5EUCA 3WL7A 2CNBA 3N8HA 4N49A 2I03A 2HW8A 4FVTA 4EA9A 4M22A 4NMXB 4P4TA 3ZU6A 2OFXA 2G1KA 1RNLA 4QUAA 5CH8A 5FFFA 4IICA 4FFBB 4DQVA 4UC0A 4NH4A 4EG8A 1U28C 3CLHA 2AEFA 4K87A 4LRSB 4FT2A 5H83A 5JMTA 2EZUA 5CDFA 1D6NA 4E5MA 5KX5F 1RYNA 4AJIA 2PUTA 2J31A 5L40A 3T3EA 4KG7A 1EFPA 5FBHA 4QZVA 3KTAB 2ZWOA 2Z8YM 3SS7X 3TW8B 2PZGA 3W2FA 2AS0A 4G63A 3SDBA 2B37A 3VU0A 5KZMB 2G25A 2HJRA 1NJGA 4H9GA 5JWRA 5EGNA 3CPHA 3NHMA 5K4GA 1U3CA 2QVZX 1YQQA 3G7UA 1NDHA 4PPGA 3LM8A 5B5SA 1HDXA 1KS9A 1P1BA 2RKOA 5DHQA 4BKRA 1MMFB 3GF4A 2R68A 1ZUIA 3NHFA 3ANLA 4AICA 3MJHA 3OFSA 1KS2A 5I3ZA 4AKSA 4QQNA 1QUEA 3C3DA 1CF4A 2NM0A 3B1KA 1JE1A 3OEWA 4M53A 1HZJA 1M5UA 4BCCA 1U3GA 3ZNPA 1UMBB 1UP7A 5D85A 1HQCA 3W5JA 1SVOA 4JLUA 1SJ9A 2B8EA 5CNIA 1MA0A 3D1LA 3QWHA 3WYCA 4ZVOA 4E0BA 3OWXA 5IANA 3H8VA 5EJEA 2BHNA 2Y0PA 3H0EA 3UCFA 5BR4A 1SUPA 3PRJA 1D6SA 5C32A 3TLCA 4G9EA 4CGYA 5FTJA 4OUDA 1ZNWA 2D6FA 1NL3A 2WP8J 1RXVA 2PRYA 4PO1A 1U6IA 4HB2A 2QRVA 2D0DA 3FSJX 1V96A 4J6EA 4QEKA 5JFOA 4MHTA 1DWPA 3O4JA 1UOEA 3TXYA 3EAFA 5FA8A 2O1XA 2XMGA 1GFWA 1POWA 1QQ6A 3HUFA 4V0RA 1RJ9A 2HIAA 1JKJB 4D4KA 2JG3A 4YIKA 3WADA 4R7ZA 3GNQA 1MF7A 4C4RA 1A9YA 3OETA 4G01B 5AI4A 1U2GA 2Y2VA 3NJ4A 5BURA 3AEUB 1OA1A 3FVWA 1AK2A 1AUOA 1SUFA 1Z25A 3JWPA 4KQXA 1MB3A 4RV5A 3URMA 4LNUA 2PHZA 1F0PA 2AK2A 1ADGA 3DZIA 3IAXA 1C7RA 1MXHA 4ALLA 2IT1A 2PWZA 1OIWA 1Y6ZA 2XECA 2QE7A 1DG1G 3BD8A 1MQ8B 3KKLA 1JHUA 3FX2A 4RF5A 2GILA 2Y0EA 4X6LA 5G02A 4CXMA 2QEQA 1XRSB 2IP2A 5AXBA 1YF3A 2MMGA 2ZYVX 4AF7A 3NVKI 1MGPA 2JGRA 1UDXA 3MD0A 5F5NA 4WKNA 1OWNA 1YT5A 1Q16A 4ASUA 3DEIA 4M1YA 4NFYA 4EY8A 1XRNA 2BFPA 1Y4ZA 4C0AC 4JXKA 2HXYA 3TPCA 1CS0B 5J1SB 3HHPA 1CERA 4PO8A 4RK6A 3TIGA 3TXAA 1GKUB 2P2DA 2REQB 2CJYA 1B1AA 2ZSKA 4PG4A 2JD0A 3JTEA 3Q0TA 3MHTA 5LZ9A 3C3MA 2OGWA 1V3QE 2WTBA 3AR9A 1ZU4A 2RBKA 4DXHA 3PE3A 2EG9A 2I7DA 4BL5A 4G81A 4ZO9A 3WLJA 3ADBA 3ZWMA 2WSIA 2QAJA 4QBIA 4K5QA 4NE2A 3AGQA 1Z5WA 5FV4A 4L78A 4EYGA 1N8NA 4ZD6A 1NXSA 1IWOA 2B0CA 2H08A 4WN3A 4TKVB 2W90A 2ZRFA 1B8PA 1L4MA 3FCUB 4K6CA 1BW9B 4YNBA 1P2DA 3BWBA 3ERCA 2BHRA 1UPXA 4WV3A 4CM6A 4QUGA 3Q8MA 3EODA 1I6LA 5EIWA 1PYGA 3HBJA 5AQ1A 4KQMA 2OLEA 4Q7QA 1DNPA 1U31A 2PL5A 4E7PA 4D96A 2NUAB 1CHDA 1OXBB 1USKA 3PR3A 1JFSA 3U7EB 3ZHSA 3LZDA 1NJ5A 1BHQ1 1SCAA 3SR4A 3C8HA 1YB6A 1V25A 3MSXA 3OT1A 1JIXA 1SEPA 2BFWA 5ICEA 2R8OA 1U94A 2GFIA 4HEA6 1WJGA 4XIIA 3ZWNA 2BFAA 1WUJS 2EEPA 2VWPA 4FYIA 3P2IA 4HVAA 1XZAA 3FMVA 4GL2A 1XXHB 4GFDA 2W43A 2F1JA 2E7ZA 1P5HA 2PSFA 4RH3A 3OFVA 5IAGA 3JWEA 1JRLA 1PJ2A 5ERYA 4AIIA 4RKEA 4ECAA 3LTNC 1E18A 3OZGA 5H1YA 2R6HA 1L7XA 2YIDA 2FXIA 1QLHA 1WEHA 3U4CA 1WO8A 1YGPA 1TI7A 1TVCA 1ZI6A 3VJKA 1NZDA 2EF0A 3DE0X 3OCXA 4LUCA 3RFTA 4DLSA 2OKCA 3EUWA 3KEOA 4OSEA 4ZTUB 3NEAA 3K1ZA 4WNYA 1XPJA 1ZS9A 3ZXSA 3BDAA 2FFBA 3EQZA 3CU5A 4ZIRA 1GU7A 3FWNA 1AB5A 5BXQC 4OMFG 3HEBA 3UMMA 2C9CA 1IBKB 3R76A 4NCBA 1MTOA 3OX4A 5D6NA 4L74A 3Q0EA 4XVUA 1NNSA 1T35A 1JHVA 2JNWA 3G6KA 3PDUA 2BFDA 1ISRA 1TEVA 3O95A 1XK6A 2EWMA 1XKTA 1E3WA 1TB4A 1IJKA 3F8TA 4GPEA 2WVJA 5IC4A 4QPPA 4LF7B 4G1CA 1LK0A 4F3YA 4XIYA 4M1SA 3K9BA 3I1YA 3QJYA 4RWZA 5TQVA 3OF3A 2RSLA 4DPKA 5BYKA 5LOVB 4CFYA 1T0PA 3N2YA 3PR2B 1GPYA 1I3NA 1LB1B 2B4AA 2GWRA 4E2YA 2EFYA 1H23A 3EMKA 3BD6A 1QGUA 2ZTVA 1ZXXA 5FPYA 1T29A 1BD4A 2QNBA 2XI4A 1VJ0A 4BFTA 1SZDA 1E59A 3GP3A 4XGRA 1RM5A 1XU9A 5A7FA 3VV3A 4H6XA 3EHDA 1VKOA 1Z75A 5JLAA 4BNIA 4C7XA 4I9UA 4PX5A 1QHXA 4TWIA 3Q7SA 2BC9A 3UWPA 1WXEA 1DKUA 3ER8A 2ZUEA 1HZZA 3OOWA 2YNMC 2OA0A 3RYCA 3RNOA 1UBFA 2HIMA 2OBFA 3RBAA 2MMCA 3PFNA 1RXSA 2PSSA 2ZRDA 2XWPA 3O90A 3R7FA 5JCZA 4AP5A 3FDFA 4C14A 4CUKA 3GLIB 4C01A 1EH5A 1FQOA 3U4QB 3GX1A 1T8SA 4ZMRA 3X2SA 3FYCA 2NQ8A 2OSBA 2RGGA 2RJ3A 2VHUA 2PK3A 3E18A 3L79A 4Y1RB 3S44A 2BR4A 2FQWA 3U56A 4FMCF 4UDYX 2ZXEA 1ZKDA 1WMBA 3AF2A 3FPSA 4ESOA 3HXPA 3FMFA 4WSOA 3OZEA 2I8LA 1A9TA 2HO4A 3PDIB 5HJEA 1PWZA 3IQDB 4KNWA 3B7PA 1G6OA 1CZLA 2GYYA 4U00A 2FZ5A 1N3IA 1CF2O 4JHXA 3L1JA 4NE9A 1P5FA 1PJ4A 1QHGA 2CJFA 2VSNA 5JS6A 4RE5A 4IYRA 1K8YB 1ZRHA 3SG0A 4BNUA 4NEHB 3SF8A 5HOEA 2OK7A 4AMUA 4MRRA 5HTKA 4BRZA 1FQJA 4ME6A 1RMTA 1Y81A 2GVNA 4N54A 3TRJA 4CQMA 5KNCD 4NU8X 1KEZA 1US8A 721PA 4PYRA 4EJ2A 3M4ZA 1SKMA 2WR8A 2QP4A 4FBGA 1UZUA 5IUKC 4F5YA 3EFEA 1UJNA 1NBOA 4UHBA 1MPXA 4Y1EA 4X45A 2XYHA 5BWLA 4GRIA 1RJEA 1EP2B 3IP9A 4IMPA 3GR6A 3HE3A 3FRHA 4JJIA 1GPWB 4CYMA 3DTVD 1UF9A 4DMLA 4ZV7A 2AC2A 3GJRA 1GHTA 4PCAA 2RK6A 3ZHVA 2Y9MB 1DKPA 1OBOA 1L4BA 3I32A 4KQKA 5EZQA 1G18A 2IU6A 3ZUPA 5P8WA 1IPHA 5K8UA 1NXPA 3DBRB 1SBNE 2HTFA 4Z7JA 2OZKA 5ECYA 2MSLA 5C0OE 2YJ6A 2GXSA 3L93A 4UHEA 4RZXA 4F7DA 4KR7A 3F6RA 5HPYB 2PGNA 3PYXA 4I14A 4RJIA 2PH7A 3DGEC 1BCRA 1XROA 4R8SA 5JSHA 1JA1A 5KYGA 1W5AA 3E5HA 3VNRA 3GJ7A 3JD2A 3ZTWA 4GBED 1K3FA 1P0CA 4YLGA 4RQUA 4ZI7F 4QEDA 1FZTA 5HKKD 5EWMA 1KK1A 3DOCA 3KSBC 1ADYA 4KP7A 1GFIA 2XDQA 5C5CA 4QTXA 1ZJ5A 2BGKA 2WFLB 3E9QA 4P0PB 4Y2RA 4CEHB 3OPVA 3F6BX 2VAXA 2GBLA 5CJJA 1XTVA 5H8WA 4Y6SA 3QXCA 3HKBB 3UJBA 1FMTA 2RHTA 4A1OA 3K0AB 1ONPA 4AU1A 4EELA 3WQBA 3WKAA 3WLSA 4OHOA 4DNFA 1ZK3A 3S8MA 3E9ZA 1NW3A 3K4HA 4MVYA 2X15A 2Y1GA 2W2KB 2DHCA 1R4ZA 2FAXA 5TVGA 2A7XA 3WMRA 2R8XA 4JOQA 2DWCA 4B3BA 1PWHA 4PLYA 1IY2A 3L4SO 1RFLA 4D02A 2FU5C 1M0SA 1PR0A 1XTZA 1UEJA 5J40A 3N7AA 4KU4A 4MHOA 4ZCTA 5BN5A 4HATA 5COAA 1AGYA 3FW1A 1CY7A 3FE2A 1XNJA 4AUEA 3OVMA 2N1BA 1XD9A 1TECE 2PYIA 4GLOA 3VDMA 4EKIA 2AOVA 2IBSA 4MA4A 3WJ2A 4KVFA 1D04A 4DCCA 4ZI3A 4OU4A 3VNVA 2NZXA 5AJYA 4EFLA 1NVVR 1HORA 3DR5A 1DIOB 1K0UA 2MR5A 3ZVRA 5L95A 4ALNA 3IAS1 3OCCA 3RLIA 4KR2A 1DGQA 1L9KA 4KDEA 2A0UA 3UT5A 3G0GA 4FR0A 2Y1KA 3KQWA 4EYQA 1NKVA 3I9V6 3PPIA 4X94A 2H07A 1YZ3A 3R0JA 5GVSA 5FI5A 4DCMA 2C5FA 1S02A 2HDHA 3QKIA 1ZOLA 2PL9A 3EVDA 4MUYA 4BNNA 3S27A 4Q4CA 2G5PA 3S28A 3UT0A 3G8DA 4GR5A 3EQ7A 3WLNA 5IAAA 1KKUA 4UTXA 1QGAA 1LXCA 1W1WA 3VQTA 4RUKA 1HDGO 3T4XA 2ZVJA 3GD5A 5CFQA 1HRKA 3QFCA 4GLFA 4I1OA 3KQTA 3QNWA 4EB8A 4FYXA 2M2IA 2WDZA 2I2WA 2CVOA 4FDTA 3F9RA 3IVMA 3SJAA 3QMMA 3Q5DA 3BGVA 4UXIA 1AHHA 2PRJA 4EAAA 5B64A 3PWSA 1PK7A 4BP3A 2VATA 1XJ5A 4J2TA 4M88A 2ROQA 3SWWA 4Q1EA 3AEYA 2R48A 3ZE8A 3ZJ4A 4COOA 4PHGA 4YDSA 1G21B 2OYRA 3EPJA 3HXOA 4LJRA 2R7MA 2PJDA 1O03A 1II8B 4NFHA 4ERXA 2VK2A 4OBBA 2JGFA 1SCBA 4Q7EA 2C84A 4NDAA 4V2UA 4LJLA 3BA6A 3VYTB 4OGFA 3WLMA 3VOSA 4JYCA 3DC7A 1LJ8A 4RK5A 4L8GA 3U17A 3U48A 4QVGA 1ZCBA 2R1VB 2YJ3A 2IY9A 3E2MA 3K0KA 4B85A 3UATA 3LCRA 2HF8A 1B8UA 2CHEA 4U2KA 2BZGA 3K6JA 4MDYA 2JAQA 2B20A 3ENQA 1WZ2A 4PZEA 3KCQA 2BFBA 2JARA 3B1XA 2B7BA 3DPSA 4GZ6A 4AZSA 4B2YA 3TTXA 4F3NA 2Q9BA 4XH9B 2ZI6A 4L4YA 1A4XA 3LCMA 1E6EA 4DQ0A 4YAGA 2HEGA 2IA5A 2ZB2A 3V46A 2IEAA 2ZM5A 2R1TB 3JWHA 1O0SA 2ZSUA 2A9PA 3CSUA 1SG9A 3LUCA 3QXHA 1N0VC 4RQBA 1TF5A 3W9YA 2BMFA 4NCXA 3CVYA 1QIIA 1Y5NA 2AG1A 4N9WA 5C18A 3AP2A 5LYJA 3AJ9A 4G3XA 2CJXA 5HUQA 1LV7A 1XZHA 3REFA 5CLIA 5JV5A 3HDQA 2DAPA 4ZXFA 2LPMA 4CU2A 4CMHA 3R4VA 3NNNA 2LVBA 4DCGA 3QJ5A 4ISCA 1SD5A 3HJRA 3PXCX 2X5OA 3FTCA 4MS1B 5JHGB 3JQGA 3LX6A 3UJAA 2B3DA 4D99A 2JI6A 2WA2A 3E3LA 3ZK8A 1EHYA 2GZRA 3ZVLA 3OU2A 4OK6A 4CKBA 3UK1A 1TZCA 1JJFA 4ZZ2A 3V7YA 4B9AA 3ABIA 5A4KA 1MKYA 5ECWA 1IFXA 1UPFA 5TQ2B 2WU4A 2FSFA 1B8OA 1AKYA 2YFKA 5CTJA 3IUBA 4G4JA 1E66A 3C5CA 4HZGA 3DXYA 5H02A 3X1WA 2F8SA 5GIPE 2IS4A 1ENZA 4UEWA 2IHTA 1TQHA 10MHA 1Z74A 2YV3A 3AY0A 4IV5A 2XBLA 4WK0B 2XCQA 2PUBA 1WXWA 4BJ3A 2IX9A 2VCYA 3FDJA 3GB9A 1QO0D 1X2BA 2DY1A 3VTZA 4XR4A 3SZ3A 3GNSA 4CTOA 5TIIA 3EXFA 3NOVA 4TRJA 1D2AA 4RKRA 1XQYA 3ELWA 5ALPA 3QUCA 1EI9A 4WNIA 4MS4A 4HZUA 5HK8A 4OJMX 5CFPA 3ZV3A 1HT2E 1R00A 1DAMA 1KDPA 3FROA 4XTCS 4CIAA 5GV8A 5L3QA 4W7SA 4RPLA 2F6RA 2ODWA 3DVAB 3I0NA 4BE9A 5AW4A 1YOBA 1DV2A 1H0HA 1R4MA 1P9LA 2WC1A 5CVJA 3WSTA 3MBIA 4PZYA 5JASA 3KCNA 2D8AA 1CIVA 1DEOA 2ARKA 2PKQP 3JYPA 3SXUB 1ZEMA 4IGEA 4ILEA 2P75A 4BXOB 3P9KA 3MILA 2G7MC 4UAVA 1KQ3A 4ML3A 3CSSA 4HQLA 1ZJWA 1F7UA 4NI5A 3WGLA 3M7IA 4WLVA 3IQHX 4QPJC 1EB8A 5B3JA 4KYIB 5BYBA 3FAZA 5IJXA 4OQDA 3LLSA 1TO2E 2Q4DA 4ZCIA 1CEYA 5SZIA 4OF4A 2IHUA 3LPLA 4JOSA 1I4LD 1X74A 3BH0A 3R3VA 4WZ6A 2BTQA 1JS1X 1M2KA 1MG5A 1OBFO 2ZJ0A 3FSRA 4BMCA 3JRNA 1MP0A 4FFDA 3ZJVA 5JVDF 3GEEA 1EUZA 4GR4A 1DHRA 3U7GA 1A7UA 2AJCA 1FU8A 3I2GA 3A4YA 4FE3A 5EIHA 5G40A 3K4QA 5IF9A 2WQZA 1UWVA 3GEPA 5EZSA 2O8CB 1Y1TA 2GN8A 1JPUA 1KMNA 4RVNA 1G5HA 5E3HA 1CVLA 4L1KA 3K71B 1K2WA 1E5LA 1L5NA 5BY2A 3RODA 1RVV1 4Q02A 3WDLA 2WG0A 2D2EA 1F60A 2EJCA 2ZIXB 5FYQA 4F60A 1NNEA 2PUEA 3MWDB 4GRDA 4MW0A 3FTQA 4RD4A 5EHIA 3KDPA 4D5EA 2CJWA 1RPAA 1SELA 1TJPB 4LOJA 2YNMD 3SFTA 3EPRA 3HXQA 4G0QA 4AG6A 2PVSA 4A5OA 2RCNA 1KRWA 4RVOA 1SR8A 3RQIA 3NM5A 3ZI7A 4ZHQF 1ULZA 2X41A 4DRZA 4GX2A 5AM5A 4XWOA 4KPUB 4M0PA 3WMEA 2O4CA 3AC0A 4WXHA 4I5EA 4CUZA 1I9GA 2WYVA 4Q37A 5I9MA 1DELA 4YAJA 1EK5A 3WRYA 4F3TA 5MDHA 3PC8C 4NV1A 1M0TA 4TTJA 3CVJA 1ODLA 4LI0A 4BV9A 3PVCA 4L4SA 2IGTA 4K81B 1A72A 3BMCB 3USES 4E1BA 3PC7A 1C8LA 2ONKA 1GXSB 3HR4A 1E64A 1Z4JA 2NZJA 2Y4OA 1VECA 2FNAA 3CKLA 3EG9A 3IO5A 4MUFA 1IXKA 2H0RA 2BGIA 4F6RA 2ACKA 4IVRA 2MIIA 5AW0A 3I6YA 4E03A 4G5FA 3DXFA 4G0MA 5G4KA 5IBRA 2IVFA 4J07A 1E94E 1Q1QA 2J59A 2G3YA 3FNRA 2WTUA 2II6A 4AY5A 3CF4A 4Q16A 2AMFA 2WAMA 1JG3A 1XTTA 2CLFB 3HSYA 3WWCA 3DDNA 1CX9B 1JR3A 3SIRA 3UPUA 4B3SB 2RMKA 2DULA 4C7VA 1FFSA 4HBZA 2YY7A 4JJ8A 3CLKA 2V97A 4MV9A 4XLTA 4IHQA 1RXWA 4QULA 5AKGA 2ADOA 1VGVA 2QM8A 2WHPA 2QP3A 3C7CB 3HWX1 3ZGZA 4BJ1A 3CUUA 2VJQA 4IIBA 3AFNA 4F86A 1T25A 2RGDA 3G9XA 1J8MF 2YYAA 4P31A 3JQAA 1GAXA 4N76A 1VG1A 5FORA 2GF9A 3UAOA 3V8NA 3V8BA 2ZRMA 3KYDA 3EY9A 4HNAA 4RTPA 1E2MA 3PXEA 4XJVA 1E9DA 4D0NA 3A4IA 4XFDA 1Z7GA 1M6VA 1W1UA 5I8PA 1GPH1 4E5DA 2YFYA 3NDRA 5CT6A 1GP2A 2ZTSA 1TEHA 3GQVA 3ZWBA 4WQMA 2WYOA 5THXA 3UWMA 3SGLA 4BNKA 1QOZA 1SBTA 1SKQA 2GARA 1XQ1A 2O8VA 3F3MA 1CJBA 3UQZA 4FGSA 3LGXA 3NLLA 2PTHA 4Q4HB 5E3JA 3WGYA 5JBIA 1NI5A 2H48A 3MGGA 1HYHA 4ZFNA 3C7KA 3I5AA 2WYWA 1P8AA 1HTWA 3V2IA 1FNNA 2H0AA 3TNDA 2JLVA 1L4YA 2BTOA 2DFPA 2C9ZA 4LBYA 3CR7A 3ZLVA 3NHAA 1A9RA 3WRXC 3H8SA 4ZOEA 1Z82A 5FAKA 3IUMA 2WWXA 5HCUA 1QH1B 3I58A 5A06A 5JSYA 3WGTA 1FTQA 5AO9A 3J7AC 5L3SA 3L9WA 1QBKC 2VS1A 4ZWNA 2FK8A 3GA0A 2FW7A 3LW7A 3RSLA 4EPVA 2AV6A 2AOXA 1FVOA 3F98A 2R751 4WESB 5DP1A 1FL9A 1G3UA 1E7SA 2BFEB 3MT0A 5KNBH 5DDIP 4EFNA 1YHZA 3R0XA 1F3OA 3TZ6A 1YDGA 2KS6A 5EJMA 3UMVA 1XNGA 4JY7A 4DCUA 4HL6A 5KQSA 4XWGA 4CV3A 4ARIA 1NBEA 1UXHA 2X7HA 4W7IA 4CKYA 4D3XA 4DR2B 4WLFA 5I9SA 3PQ4A 3LXXA 3Q7IA 3TUZC 1C9NA 3Q2KA 4LHXA 4CT4B 2A8YA 4DJAA 3CNQS 1AF4A 3RUHA 4NU0A 2HMUA 4DMCA 4V1CB 1IOLA 2GZ2A 2VDJA 1E1RA 1RZRD 1JIVA 2PZFA 4C0WA 5C8VA 1XEXA 1D0IA 5KTYA 3F5SA 4KWTA 2W2MA 2COEA 2FI1A 5D5QA 2XOKA 1KDRA 1ZK4A 3W6ZA 4RBNA 1BEEA 5BR1A 4JT2A 2Q7DA 3MMSA 2Q07A 2IU3A 1JNYA 2C83A 3ZWCA 4ZVRA 3H1GA 1HBJA 4Z6KA 2VJYA 3W5IA 3MTDA 4RTQA 3D59A 3FFWA 3AM3A 3G2MA 4HGOA 1NATA 2JF0A 4HNSA 2I2FA 3TPFA 5ADVA 2HCBA 1JU9A 4HHEA 1TM4E 2EYUA 5CB4F 2AI3A 1BD3A 5CDGA 5EMNA 4HYQA 4ZVUA 2B83A 1YZKA 1ISFA 2DFDA 2H1IA 3AV3A 1HPLA 3W3ZB 5K0CA 1F2UB 1I4WA 1R6UA 3N59A 2RI6A 4LHVA 4X92A 4HPWA 3A8TA 2HRRA 2XUAA 2ZRIA 3D6TB 2ADMA 2NU6A 5D8DA 1UC8A 1VMKA 1K8ZB 3PU6A 4TMZA 4RCZA 4QSHA 4C0XA 3FHTA 4UUQA 2XUFA 3FTEA 1MJGA 4JSRA 5C37A 2DUUA 2E87A 2FZCA 5BQXA 3IT0A 1U1FA 3GFGA 5DBEX 3RSCA 2WHRA 4HVCA 2BKAA 3AHIA 3K9NA 3IILA 2CXQA 2J5RA 2Z6QA 2XGGA 4FFSA 4XFKA 3T9EA 5ESRA 3WWOA 2XGSA 5DISB 1PR2A 2E4AA 2I5PO 1RPTA 5F4ZA 1YMVA 4MUEA 5IM4A 1QHSA 2XLCA 4AFNA 4TYYA 5J2UB 1WXGA 4M1KA 2X9QA 1UQUA 2X5JO 2Q1WA 3KLOA 4Q6BA 4UU0A 4GSYA 5K45A 1ZR2A 2WB4A 2FFRA 4IJWA 4JDUA 3MSCA 4K26A 3PX7A 1U0JA 5IFKA 3C41J 2RGXA 3GDGA 1JECA 2ASEA 2C2YA 1T34A 4AZ3A 2F00A 4RA6B 4EMTA 1XNHA 4FM9A 1PGPA 2DUWA 2Z56A 4IWNA 4MV7A 3L01A 4BECA 1I7LA 5EAIA 2Y6VA 3MJSA 4UNNA 1SB9A 4PYQA 2B0JA 2YIVX 3KO8A 2XUQA 3L4BC 2QL9A 3IE0A 4JVNA 2JK1A 5THKA 2I78A 1I9CA 1XSEA 3I9NA 4B34A 2WFAA 4E21A 2O2IA 4BP1A 3L8MA 4DBVO 5DT9A 3EGEA 5ER6A 1FBNA 1QZ3A 3X1XA 2B1IA 1T0JB 2XUGA 4GGOA 4QT4A 4C6TA 1N5JA 2H92A 3LC0A 4CHTA 4CFSA 5DNAA 4MEBA 2YHIB 2NO4A 2O8FB 4I55F 4N5MA 2VEOA 4RTKA 1MQ9A 4MWZA 2AXQA 2EFEB 4YRTA 1WG8A 2XD9A 3PHCA 2R5FA 4N7RA 4HI0E 4PGMA 1JI0A 2NG1A 1WTCA 4FZ5A 5CVVA 1LFAA 2I66A 4IDQA 1N9KA 4EW3A 1DEKA 2AVDA 2OK8A 4H60A 2FPPB 4Q9KA 4E08A 1NW8A 2HRBA 2QL6A 4CW7A 1W5BA 3B2QA 2QTTA 3BXHA 3HFRA 5B30A 5I01A 4PEVA 1VJ1A 3D6AA 1ZJ6A 3QPCA 4KSCA 1C4WA 3IHWA 1G60A 4G0OA 3PFKA 2CYBA 3AI1A 2IC5A 2WSYB 1NUHA 1Z08A 1DDOA 3DBHA 3E15A 2P2ZA 4N40A 1N4AA 3SQLA 4AS3A 1KPIA 2GJ9A 4WERA 1DIAA 4Z4QA 3NYIA 3RYFB 3P9ZA 1KSGA 2O2ZA 3HDYA 3PYLA 2ID9A 2HDNB 4ZPJA 3IB6A 3PKZA 2I6QA 3R4CA 4EG7A 5ES4B 4F85A 1Y3BE 3F8SA 3NT4A 3LE8A 5D84A 2E48A 2QGFA 4KCGA 1KOGA 4BN5A 1B42A 2CFOA 1GT6A 1OTHA 3CVVA 4EF4A 3NBKA 3L84A 5C8XA 4RSMA 1YZFA 2VFAA 2ZI4A 4QNNA 1E1KA 1OGJA 3S2FA 3GDWA 4YRFA 4L6AA 1K9VF 1HKUA 2Y2UA 1N5IA 1X7GA 4YT5A 3D5TA 5IC6A 3EARA 4Q1VA 3N8NA 2ZK7A 4FYKA 2CGEA 3HRIA 4J0EA