4MWGA

Crystal structure of burkholderia xenovorans dmrb apo form: a cubic protein cage for redox transfer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
180
structure length
174
Chain Sequence
b'FKPDARFAWCVTGSGHLLDESIALALELPRADLFLSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAKCAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVWVELRPRAIELDNVERLSRFEYTTLVRSLDELKAALGERLSTLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydromethanopterin reductase (AfpA)
publication title Structure of dihydromethanopterin reductase, a cubic protein cage for redox transfer
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 64
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4mwgA00
1E20A 4RHEA 2EJBA 1MVLA 1G63A 1G5QA 1SBZA 4ZALA 4MWGA 4ZAXA 3QJGA 4RHFA 4ZAWA 3LQKA 4ZAGA 1P3Y1 4ZAFA 4ZAZA 3MCUA 4ZAVA 3WISA 4ZAYA 1MVNA 3ZQUA 4ZANA 1QZUA
chains in the Genus database with same CATH superfamily
1WMBA 3N2GA 4PPQA 1UXOA 4ZYTA 4BE7B 4ERXA 2PMBA 1LGYA 2I2WA 2R8XA 1ZHFA 1G5PA 5CURA 3S0JA 2ZK7A 3CLUD 3E9RA 2OOSA 5ESXA 1V1RB 5AESA 1NMSA 3UCFA 4IBOA 3GY0A 3ROXA 4DCTA 3LCUA 3SX2A 4ZO7A 1ZW1A 5LU9A 1AY0A 5F1PA 4R8MA 1P4HA 5BQPA 1CWUA 2PUFA 2A1TR 1AKNA 1DEHA 4GL4A 4YACA 3RVRA 4C4ZA 5BSTA 3MT9A 2C03A 3SHFA 4CQMA 4BEWA 4UNIA 3RYIA 1F3LA 2AG5A 4PSCA 1LJUA 1SQ6A 3WFZA 3IUYA 3M83A 3TSAA 3RJZA 3CBQA 4UMEA 2QAGB 5E9JA 2O2SA 2ZE5A 3VVBA 2ZYGA 3OD5A 1KQ3A 1G291 5CDFE 1N7HA 3VJMA 2LW7A 3UG7A 4HC4A 2I6TA 2Q1SA 3SYTA 3LRXA 2HJHA 3A10A 2QTMA 1SG0A 2DHEA 3REQB 3QVOA 4WVFA 5EIWA 1AO3A 2Q3EA 2EOAA 3L9WA 1I14A 1L5MA 1XD8A 2V1XA 3FNQA 1E1LA 1X6VA 2WTMA 4PG5A 4LJYA 5LQRA 1TCCA 2M6KA 1DKNA 1QHEA 5A6VA 4X20A 2GN1A 2VNAA 2PM8A 4N48A 2XWQA 2YNMD 2Q8PA 4Q4LA 2GUGA 1ZRMA 2JHFA 2ZYDA 1MF7A 1IYZA 2ZZKA 2NSHA 5ESWA 5GM1A 2DSTA 2GZDA 3HCWA 3FOAA 1PJ2A 5THQA 4Z4HA 3DMTC 1H2AS 1N5OX 4DMLA 3ZCRA 3GCXA 4IH4A 2QV0A 2FMFA 4CMIA 3I5YA 3ROTA 1GKLA 4EGCB 1PAUA 3P9KA 1J00A 4GLFA 4F5ZA 3MWJA 4FGSA 2XZPA 3AJDA 4O4HF 3H0CA 3U7RA 1AC5A 3FYUB 2F9LA 4JSRA 4LS3A 3V3KA 1GFIA 3ZJ5A 1LPNA 2DETA 3GNQA 1QVZA 2IDJA 3QNMA 4N47A 1KEUA 5DULA 2ZJ3A 4ARBA 5KB3A 2NT3A 1XWIA 4LHXA 4A0GA 3RC1A 3TMKA 4C06A 4CODB 4UTPA 3QE9Y 2H51A 4KNWA 1K7YA 4AJEA 2VDWA 4XTRA 1AXRA 1T1SA 3DCNA 2X6TA 5DTIA 2NO7A 1PBTA 1E6LA 2O6LA 4FQ8A 5F5LA 3X2FA 5CX1B 2YNMA 5CHYA 3KSAC 2AEFA 1ZH8A 5AIAA 2CLCX 4LDZA 4HATA 4KXMA 4OK5A 4NR0A 2I91A 1N8SA 5AP9A 2JVIA 4UE2A 1JDUA 2ZT5A 5DYTA 3E53A 3GLHE 3MMNA 1KO8A 1TQ6A 4M98A 4HDNB 4OI4A 3WGJA 2JI8A 4ZDIA 1C14A 4ZRDA 1VFNA 5MN5A 1H3NA 3ZWKA 3N7AA 3ZOZA 1G2PA 1O97D 4AY4A 2JH3A 5EWJA 3PPIA 1JN0A 3KTOA 2J1LA 3FGOA 4GSLA 4N5LA 1QBGA 1Q92A 3RIGA 3HCBA 3IVGA 4YRSA 2WMOB 1ZIDA 3BUSA 4EG6A 3T0FA 4BHTA 2FN8A 3MGGA 2QD5A 1H5UA 3JQ8A 3P0HA 3OEEA 1VIVA 1ZD2P 4FEAA 4MH0R 5DP2A 3TQRA 2LGJA 4D74A 1BROA 4NU5A 4RZUA 2ZROA 5FV4A 2N75A 4DRZA 1S01A 1AV7A 1RRGA 4KLNA 1GUYA 3A9UA 2H1LA 3RVPA 2VHWA 1KHTA 1ZMBA 3C85A 1IHXA 4DLWA 4QG3A 2B3TA 2O7NA 3KUKA 1L0BA 2QQGA 3IAM6 3PUXA 2ZSBA 1JFSA 3BIJA 1L4BA 1V3QE 4Z9AA 4ZYUA 2P2YA 4EGFA 4Y2PA 1RTTA 3NBAA 2YIDA 4NENB 4H7FA 2VQ3A 5MN6A 3IR7A 2YVLA 4P33A 1NFRA 3EOBI 4O4HB 3ONVA 4M76B 3D2BA 3WOVA 1Y9JA 2QX7A 3T52A 4X7PA 1G8AA 1T6YA 5GY7A 3V1TC 4LVCA 1ORVA 2QB5A 3LXXA 1HRKA 3FIJA 4F71A 4F7DA 2OHIA 1NQXA 3PUJA 2R00C 2GPYA 5IX8A 1TTPB 1YAHA 3I6IA 3Q3CA 3BSFA 1KMMA 5IM4A 4H1TA 4YCDA 3W2TA 1NJ6A 5FTWA 3R7SA 1MLDA 2JJYA 2YTZA 1T8YA 2JAQA 3FFXA 4GECA 5K0LA 1VKJA 2OXTA 4BZZA 5HJ5A 1YCFA 1PL8A 2PD3A 3QLEA 3WMFA 4RTRA 1M5UA 1OIXA 1TD9A 5EMKA 3AQ4A 3QSGA 1CF2O 4FR0A 2VWPA 3FBGA 4CEJA 5HS4A 1PG0A 2VWQA 2FMUA 3B6MA 2R4TA 4URFA 4BQEA 2CT8A 3CUUA 1MDFA 3JZMA 5AM5A 4EB8A 1WULS 3ZCPA 1M1YA 1W4BA 1YCHA 4C4XA 1KKMA 2KWIA 2PMDA 1FLDA 5C81A 3RH0A 3NM6B 3PTAA 1JNXX 2A9FA 2X15A 1OXBB 4ND2A 1RVDA 5HKLA 2W8ZA 4D1YA 1VDMA 4TYWA 3N07A 5ALOA 1I1HA 1N6HA 3BSYA 4HYYA 2QLTA 4RK7A 4C0KA 2G8LA 2IXTA 1K3TA 5GOTA 4ES6A 4A4DA 1HQKA 2VJLA 4BV2A 2BF4A 2H1OA 4KVZA 4LY3A 3BD9A 1OXUA 2CLMB 2ODNA 2RIRA 4MW1A 5JS7A 5E1OA 5G1PA 5TV2A 1UCFA 3IUSA 1ZEJA 3NHMA 2V7UA 4NHOA 1L5QA 1K63A 1Y37A 4QASA 5JPIA 1JE1A 1XSEA 3OQPA 4KREA 1HE8B 4IM7A 1BXRB 2HXSA 4EUSA 1OREA 1SOWA 1NJSA 1YZVA 2WPNA 2XI4A 3AGPA 4P0QB 2PWYA 4UM7A 2Q9UA 1Q7CA 2XUOA 4ZDJA 2V4ZA 1B6SA 5E2BA 4DIEA 5JVDF 4FB4A 3MJHA 4E32A 4HLQB 1SMKA 2V5AA 3NP7A 2Y71A 4EFDA 3E05A 2EWWA 1PS0A 2KE5A 3IIJA 3AIOA 4H7IA 4PN3A 5H16A 2OGZA 1C9DB 1GV0A 1YIAA 2H57A 5KCZA 2D2FA 4W7HA 2IKSA 1YDMA 1DQYA 1NRIA 2JCVA 2NUPA 3D3EA 3REOA 3HJNA 1FIUA 1RXIA 1B23P 1MZPA 1WAMA 1FFXB 4RZHA 9LDBA 2BFBB 1EP1B 2HAEA 2XCQA 4KQFA 1C2TA 3LHFA 4E03A 1GL9B 3T5PA 2Z8YA 4O02B 5IKPA 3ER6A 1R8SA 1JDSA 2OBMA 3H2KA 5AHRA 4NAVA 1JEYB 3BMNA 4BGUA 4IUCS 3UAGA 1MVOA 2JS7A 1Z6AA 1I0ZA 3F1KA 1C80A 3QPDA 6AT1A 3K32A 5EJ8A 2OUKA 2B7LA 4BAUA 3EBLA 2RC5A 1UQTA 3AFIA 2N1MA 4NBNA 1TT5A 3KLNA 4AJ9A 1K86A 5EXEA 4B6SA 2C2ZA 2E4AA 2NG1A 3D3QA 4JU9A 5EZYB 4EYKA 4ETNA 1Q0QA 5J2TB 3ZY5A 1ZOIA 3D3WB 4OB8A 1GGJA 1GKIA 2XUZA 3BA1A 3FF1A 3WLOA 4D4MA 3C98A 2QTTA 3H4IA 4ZQCB 3L7DA 2F7SA 2ID7A 3IT2A 4WBNB 2OFXA 3PQFA 2RK6A 2G6BA 3NHLA 4AS2A 2FW7A 4GM1A 4UTRA 5JD4A 2H1WA 4H6PA 4NBWA 1ZD1A 2DGDA 3AVXA 2JGIA 2FB9A 2ZXFA 2XPCA 1I6LA 3K1AA 3ZWNA 2P6UA 1SUIA 3I2JA 1CP2A 2C4HA 4I4TF 4C3OB 1AV6A 4EM6A 4IV5A 4GOLD 2O2CA 1DMSA 1G4AE 1N3IA 1YQXA 1EFUA 1ADFA 2HK7A 3CX7A 4MGEA 3KT0A 4XSGA 5TARA 4BNNA 1JUDA 3KTAA 2J4FA 3EUWA 4HGZA 5FOXA 2YMQA 4ZHQF 2JLWA 2OILA 2XIQA 1NOIA 4JS0A 1XJCA 2PVPA 4LYHA 4GO1A 1QO9A 1KWKA 1CY1A 3IULA 4UHBA 3LWDA 4AZ3A 1WHTB 3G2PA 1PW5A 4DS3A 3CF4G 3O4HA 1M0TA 1U28C 4LBVA 1XF9A 5D6OA 1ORIA 2RGWA 1M6VB 3DOOA 2NMVA 4O5AA 1E3IA 1GGHA 1JFFA 1YA4A 2QVGA 1D8TA 2QUAA 3AU9A 1JJVA 3DO5A 3I1YA 1CW2B 2ZIGA 4I1YA 4D9GA 1VM6A 2G5CA 4WW0A 2W2OA 1R12A 1RTKA 2EVWX 4YCAA 3ZQKA 1ZJ5A 3T41A 4NV0A 4LHWA 4U7TB 3IRUA 3PKIA 5T3YA 4JROA 4NZNA 4X65B 4LF4B 3L1IA 3ZDXB 1F51E 1VLVA 3X2EA 1SN7A 1QRTA 4UPDA 2J8ZA 3EMBA 3GBSA 4CG3A 1F2DA 1M8FA 1NP3A 2O7RA 4PC7A 1WPQA 4TSKA 4BATA 5K05A 4HLCA 4Q01A 3BORA 1TYAE 1VHDA 3W8EA 3K20A 4LJRA 2DR3A 4FYYA 4AN0A 3O31A 3C41J 4N0MA 2MWMA 2QKYA 3FKSD 4ZVRA 3WRVA 2VH5R 1N4DA 3OP1A 3M3DA 4BFZA 3F71A 3P5BA 1BX0A 4V39A 5E1BA 1JHDA 4H1WA 2A86A 4AJPA 2W8BA 1WKVA 2LKDA 1ESZA 2QN7A 3EG5A 1E2LA 2VYFA 4ZZ0A 1G3QA 1TZ2A 3K05A 4BGEA 4CQLA 4I4TB 4U2KA 4JJKA 5JARA 1II8A 3FDXA 5IYZF 5CFQA 3GLFB 2OKGA 2ES4A 1EUDA 1UBRS 4MR9A 4BNIA 2OHXA 4X1IA 1G7TA 2FRDA 1FW8A 1EVQA 4WV3A 4OXIA 3GG9A 3PQ6A 4Q24A 2ET6A 4D4JA 3ONWA 2VPZA 3U5TA 1G8SA 1RKXA 5E6RA 4GKKB 3RC7A 4ASUD 1M74A 2R8OA 3L6DA 3AFHA 3CNHA 1ESCA 1SC1A 4Y0NA 1VCIA 2A7QA 1QNLA 4NCKA 3JARA 1OAOA 3WKCA 4R7GA 5IT9A 1K6EA 3RRJA 2VHUA 4LMRA 1DBVO 3RHFA 1KY3A 1H3FA 1UM9A 2I4IA 1M2VB 3FKSA 4UUBA 5CA0B 1RI5A 1U2PA 3X2SA 3VOBA 3PVZA 4UZFA 2J41A 2XMPA 4BN0A 1ZL2A 2UDPA 4TV8B 5CK5A 3RRBA 4G0QA 5F7XA 1KRHA 1NRWA 1VCNA 1C1YA 3HBAA 4K88A 1JDTA 2PZBA 4U0JA 1H1TA 1MG0A 4BY9E 3CRMA 5TQ0A 4GUAA 5IVKA 2O5RA 3GP5A 4HAYA 4JVSB 4KMOA 5JFOA 2GPBA 3MPOA 3F7TA 5F73A 1V7CA 5BN5B 4WI1A 1G5HA 1O9BA 4PC6A 3AB8A 4GKVA 1OFIA 1ZVMA 2D5IA 3B38A 3QLUA 4UJ3A 2AMYA 1IE3A 3E82A 4ASUA 1U3WA 4MV9A 2O2JA 4ZQEA 3HYLA 1ECJA 1JKMA 2AJ8A 3AF5A 3CMCO 5A3JA 1XMOB 2C7PA 1TTQB 1ZHOA 3BJIC 1NATA 5ECWA 1Z6GA 4BFYA 3ORYA 1O94C 2ZWVA 3VSCA 5G0UA 4M1ZA 1B15A 1MENA 1FDOA 1ZYUA 1CR0A 2A57A 2BHRA 3HN2A 4NOLA 4S2EA 3SQOA 1MAHA 3JRNA 1AKMA 3SJAA 2WU0A 3W1VA 5TGTA 4OL0A 3VTAA 5C8YF 1M2EA 3VKFA 4JP1A 9ATCA 3EFOA 3EQ8A 1FNMA 2C94A 3D54D 3EXAA 2WI8A 1GNLA 4M22A 3ON5A 4KN5A 3KHSA 4NULA 5LZ9A 4N6NA 2C88A 2IA5A 5AVVA 3LI2A 2JFYA 4TT3D 5A0FA 2QMEA 3NS7A 3HYSA 5KPJA 2AOWA 3UANA 3GR6A 3ZDYB 4EW3A 4CM9D 4KQKA 3QXXA 3B5JA 1YOBA 2P11A 1I9GA 1CB0A 1REQB 2C77A 3CRRA 3FFAA 5LVAA 2FKAA 2I87A 2ZUSA 3PEYA 4L9SA 1FY2A 3MILA 5A7GA 5CDTA 3GA7A 3KQMA 2NV0A 1QYCA 2DWCA 4MQLA 2Z83A 3ZDZB 1J0DA 4MR8B 4C0SA 4ZMBA 2CLEB 3M2TA 4CWAA 1YUNA 2QJFA 4LZPA 1T3SA 4K2AA 1UFRA 2VP9A 5ITZA 2CHEA 1LNQA 2GAFA 2FPUA 2B21A 2G4CA 2VH1A 2X0NA 4KK4A 2PVCA 4KRYA 3KAJA 4M9SA 1SUWA 3K9FC 1A7KA 1DJLA 5AJTA 2R6DA 4NI5A 1BHSA 1J2YA 2FI1A 1BWPA 5K3CA 2F1OA 3QXJA 4MZXA 4ZI3A 5K4GA 3UHAA 1P7ZA 4B7XA 1THMA 4TT3A 4U7FA 2HBRA 4Q00A 4B9AA 3F2VA 3NH9A 1ZK3A 2CDBA 5CYFA 2QEQA 3SPXA 1DNPA 1Z37A 4QZVA 3VBEA 4C08A 1K97A 4BASA 4RTOA 2Y1FA 3V8MA 4CM9A 3BXGA 4FIZA 1EJBA 1X8LA 4RM2A 2A84A 2G72A 5AHXA 3ZGOA 1DJMA 1SUPA 3BH0A 3I32A 4I5DA 2VHXA 3OX4A 2CYBA 2PUEA 4R54A 4YXFA 4JBGA 2W6ZA 1PKXA 3TL6A 5JC8A 1UZMA 4TKUB 1V6AA 3WZLA 3K0KA 1U2SA 3LC2O 3Q9SA 3V4ZA 3P2OA 4M1OA 3L0ZA 3BXZA 1I10A 4IG4A 2Q8QA 1O6GA 4L5YA 5IHPA 2CMGA 3ZJVA 3GLGA 3ICVA 1DIBA 3I04A 3KYCA 1H1LB 3KZ1E 1X3LA 4Z0HO 1LQUA 5CCBA 3EWNA 3K96A 4MS4B 4TMWA 4F93B 2UZ4A 5FOVA 5G3YA 1GVHA 1X7ZA 4UAVA 1BDBA 2GILA 1Z3IX 3LY9A 1KH1A 2F3TA 3EA0A 3ZGXA 2YJGA 4GI7A 2GF2A 3E1KA 5LKAA 3CZRA 2QJOA 3LUBA 4D8XA 3RUFA 2QQ5A 1EK5A 4Y2TA 3TIXB 4CKBA 3C6ZA 1Y3FE 2CXXA 2VT3A 3GW8A 1ABBA 1HT2E 4YRNA 4XVHA 1WMAA 3GHYA 4TL9A 2F1HA 1TM1E 1SUFA 2WKRA 3PIDA 2NO6A 3KYDB 4OTZA 4W5HA 4WKCA 4MVJI 5T5QA 2O07A 3BAFA 1V8BA 3GRZA 1KY2A 2B7BA 4IVNA 1DV2A 2GAIA 4P0TA 3N8GA 3NIWA 1E66A 1H2WA 4B32A 4UFPA 3F5QA 3SC4A 4WDQA 3S40A 4N76A 4RD3A 3MQ4A 2C7OA 3I2GA 4MYTA 2PL3A 5IWAB 1SURA 3ESXA 3V97A 4BCDA 1U0EA 1NIJA 4RA9B 3LX4A 4JLAA 1QHNA 2P0AA 3GAAA 3PJEA 5DBFA 5JJCA 2NXNA 1RPZA 2IWHA 3C8DA 1Q16A 4HEA1 4FX5A 4EKNB 3LYHA 2F1RA 4IXDA 4B3SB 3ZEAA 1OKKD 3RFUA 2JAPA 2Y1WA 4OB6A 3RUCA 4OHYA 1N32B 2F3SA 5E38A 1GL3A 2A94A 2HCTA 2PCLA 2QAGA 3DMDA 3D6VA 4GLBA 4QVGA 2Y1XA 3WK6A 5K7SA 4R8LA 3ZHSA 5JASA 5LC1A 2H2WA 3PEEA 1K2VN 1N8KA 3JD1A 3JS5A 1JHXA 3REQA 3VDXA 1DIHA 2C5HA 1U9CA 4UTNA 1TLLA 2VHJA 5F98A 4GL2A 4BNHA 3ZE2B 2RI0A 3FCOA 1CE8A 3UQZA 4RKWA 1NNUA 1GRQA 1WCV1 1X86B 1FMJA 4LCEA 1R0CA 5E6UB 3V1YA 4ESEA 3L8GA 3QVGA 1D09A 2DFVA 3UO8B 3OWHA 3PV0A 4ABYA 4HWTA 1O03A 3KG2A 3LF2A 4F4CA 3Q11A 3PFBA 1T26A 2HK9A 4PZ9A 2ZI9A 3B82A 3IUBA 4HNVA 1OKKA 1XTKA 1W35A 1M2GA 2LBPA 4LUCA 4RY0A 3RVJA 2J6IA 3W78A 4LQ4A 5KYNA 1Q0TA 1T1JA 2HYIC 2HF8A 1TLTA 2XNKA 4CMHA 3Q9UA 2IH4A 5DWDA 4K3UA 3DSRA 4B3TB 4XGIA 1PX2A 2VJNA 2X0KA 3S81A 4I9NA 4MLZA 4CV1A 3NBMA 4LPSA 3FYUA 2VTBA 2C8VA 1I3MA 2Y68A 1S7GA 2JJMA 1K88A 1I36A 1TK9A 2VQDA 2X4IA 2BI7A 3MAGA 3NC4A 4LDRA 2R87A 3W3ZB 1CUVA 1C3LA 2D54A 2QZJA 2PZJA 2QTRA 2NGRA 4KQMA 1M7BA 2VBCA 1AA9A 4OXXA 3HL4A 4RH0A 3LDHA 5B1SA 4HUQB 4D4LA 3O92A 4L3VA 1H0SA 4IO1A 1GPUA 1T6NA 2D4AA 4IS3A 3T4UA 4CM1A 4V0KA 4MVJP 3KUCA 2D5CA 4LCBA 1FRNA 1G3UA 3BF7A 3WJ1A 4U02A 1Z5OA 4EYEA 1THGA 3EZLA 4GI5A 1NUSA 2VSFA 4NDZA 2DRIA 4JK3A 4MYSA 5KQLA 3LBYA 4H0CA 3LTNC 1H3EA 4BNGA 1SH7A 4G1BA 1DKQA 1EFVB 4HDNA 3Q5DA 3ICQB 5F1KA 4MQ4A 1Q83A 5JS8A 1J8DA 1IXSB 2ZQZA 3RIHA 2VXYA 3L49A 3G2KA 3ITKA 3OO0A 3QNWA 4KH0A 3A6ZA 4W5NA 4EF6A 3KKMA 4BFCA 1I4WA 1DC7A 2IHTA 4PF1A 4Q1EA 5ICEA 3O4VA 3OLWA 1HYQA 4FOSA 3I4FA 3G7SA 3RSGA 2B4QA 2F3QA 3ZU5A 1TM4E 3A14A 4BVJA 5AQ1A 5IAAA 1Y34E 4S1VA 1UC5B 4WK6A 2GZ2A 2KSQA 1GGKA 4UDXX 4DNXA 3CWQA 2IV2X 4CKWB 1TO6A 3UZUA 1XJWA 2FSSA 2VDLB 3G82C 1DARA 3L7AA 4REOA 5HZKA 5AT1A 2Y1DA 3KB8A 1E8NA 2HA3A 3A9RA 4H1VA 4QQNA 1W94A 2ZTHA 3DHYA 4NENA 5C7LO 2WIJA 4DG8A 5I9IA 3EHDA 3W6ZA 2TMYA 1RBMA 2XRMA 3X1DA 1SCJA 2X0RA 4O4HA 5TNXA 4CU2A 2VNJA 3GROA 1G2OA 1JMVA 1OTXA 2VXCA 1ZVQA 2BTQB 5TS3A 2NYUA 1ZI8A 2P62A 3SDSA 5IEBA 3FPEA 4GQBA 3CLSC 1UXJA 2YJTD 1AZLA 2R4QA 8ABPA 3G1WA 2JFOA 1QH0A 1P1BA 1SUEA 2C5FA 2Q27A 1DUSA 3M9WA 3FGZA 3W2HA 1B3BA 3MIIA 4F6RB 5SYNA 3H17A 1M6YA 1NOKA 2VSYA 3G02A 3KZVA 3C5WP 3FMFA 4MS3B 1QDEA 3NP9A 2C98A 2RBEA 3M5WA 5D3ZA 5LBTA 1AK9A 1PR2A 2J9XB 2PZMA 1EX9A 3DKPA 4X1YA 5DV9A 2DX7A 5JO0A 1VDZA 1GTRA 1IEQA 4IGEA 1XZAA 3C0KA 4IINA 4UEJA 5JD3A 2QT0A 3DYVA 3VZDA 2ABWA 3MTJA 3WI7A 4C0LA 1HBJA 1W29A 4ZU6X 4DY6A 1T4GA 4KN9S 3RKUA 2I54A 2O8VA 1E59A 4KAJA 3VPHA 3V2HA 2G76A 4DZTA 1R9MA 3D6JA 1JIXA 1Q5PA 1W46A 3EGDB 1EE1A 3I37X 4RMJA 3QRWA 4DZZA 1OD6A 1VP3A 2C1ZA 2HO4A 5ECDA 1HQCA 4IUYA 4IWXA 5KWVA 1E3MA 4JJ8A 1XZGA 1EESA 2HBYA 3PHIA 2I4OA 3PRJA 4KH1A 4LSMA 4PTYA 1E58A 1RD4A 3UKDA 3RTDA 1JKIA 1V7QA 2M1ZA 4P53A 5FPKA 2GCNA 2GN6A 4INZA 1T34A 3OPVA 2I1QA 3D4PA 3H3JA 2QY6A 3IP3A 1QX3A 5CIWA 3S2ZA 2DQSA 3ZUPA 2X5KO 1K5GA 1YZQA 5KDOA 1QIFA 3LUKA 2VPXA 4QOHA 1PJSA 2ZSIA 3G9TA 3G2HA 1DRUA 3IP5A 3K2EA 3FI9A 4EJSB 1F1JA 4HVLA 1PGJA 3CPHA 1BXRA 3K30A 1LJ8A 3EF1A 2H52A 3A27A 4WBXC 5CT9A 4RVSA 3ZLBA 4GYWA 4F4UA 4F21A 1E9VA 5EFOA 1L7NA 4NV1A 1RYNA 5B7PA 1EFHA 5LM3A 1A2OA 3LCRA 4HNRA 3AH8A 1GGMA 2BFOA 1NUHA 4ZVSA 1YZ3A 1Y8AA 1PYDA 1UKEA 2G8NA 3CGWA 3R20A 4PSDA 4RHFA 1Q2XA 3T95A 4O4IB 1YQEA 2CEAA 4TXNA 2BFFB 1RZRD 1GV1A 3BKXA 1KERA 1H1DA 3L8YA 4RV5A 3X44A 1P1RA 1FFXA 2GNAA 3F4LA 3TBFA 4DLBA 3UT0A 3IT1A 2ZAGA 3OZBA 5G0TA 5GTDA 2W83A 3S1LA 4MQEB 2PZ8A 1F6DA 4N7JA 4E5MA 2Z1NA 1AHIA 1N3LA 2H2AA 1IPEA 4FK8A 3NAQA 3ERCA 2PCJA 3JQ9A 1H2ZA 1NVAA 1PV2A 1X0XA 2Q5QA 3RVLA 3ZG6A 1RXSA 1TZBA 1V1JA 1YVEI 3FNFA 3SYRA 1V96A 1V4BA 1F8YA 2HT6A 1OWPA 5EJ7A 4FUQA 1ZCZA 1D7AA 3DBLB 1XDBA 1VKZA 2Q21A 3F8TA 4RD1A 2YOFA 5EZYA 4PBRA 1EK2A 4P4SA 4B80A 1WR8A 3IHKA 1U9IA 3CTPA 3D3WA 4HADA 4A0QA 4U7DA 4P0PB 4CGZA 2BC9A 2ZFUA 3ABSB 5HSGA 4MP3A 2ZT7A 2WHYA 2Z8ZA 1SC4A 2J5XA 3TOZA 2R751 4D79A 5JSUA 4FZVA 4WBNA 3VDQA 3LPAA 1U99A 1VPVA 3FHCB 2Q50A 4UD2A 2BDTA 2I22A 5DDIP 5FLKA 5ADVA 3WO1A 3T1YB 1WBDA 1UDXA 1GEGA 1U8FO 3VJKA 4A73A 4D02A 3L8ZA 3Q5GA 3P4XA 2HPVA 2PLNA 2ZWPA 3VU8A 1U7UA 1XA3A 2ZPAA 3MJSA 1UMBB 3FZYA 4JI3B 5J2UF 1TPYA 2HLHA 1E3SA 1C5KA 4YRIA 3DONA 1F06A 2RHHA 1RI3A 3HYCA 2Q3MA 1ZR4A 2ZG6A 3JQCA 1TJ4A 2QRVB 1UBKS 4WZBE 4NNJA 1AUXA 1US8A 5GM2A 3MPUA 2OLEA 4NKRA 4II7A 4MA4A 4AULA 3P9YA 2GHQA 1A5TA 3PDHA 3ZBPA 2IS6A 3C3WA 4IIGA 2DKOA 4QPNA 2HMSA 1GCGA 3I2HA 3L0BA 4IQGA 4DPLA 5TF0A 4LKRA 4IIVA 4RIHA 3IS3A 1M6VA 1EEHA 3NVAA 5K3BA 2JFGA 3COJA 3U7GA 3L0IB 2XT6A 4U0KA 3VVCA 3GFPA 3LWNA 4LOAA 1QF9A 2FG6C 5E7IA 2GPNA 3EZGA 4NF2A 5JSKA 3D81A 4FLEA 3ND5A 5TMEA 4UHJA 1NPYA 1ZA2A 4IH9A 1XZCA 5EHIA 1A72A 3VI4B 5DEIA 2XHZA 1ISGA 1U5BB 3FSRA 2QTCA 4RU1A 1GTL1 2Y4NA 3SR3A 3TMYA 2WV7A 3GRAA 3NM5A 3UFXA 4CF5A 1W36B 5LWHA 3OZRA 1V5EA 5EMLA 3DCYA 1ZN9A 2JIRA 5F1YA 3RFCA 1YFJA 3TQTA 3ADDA 1Z2PX 2G9UA 3H0EA 3KFLA 3MOGA 1DHTA 2EX1A 4OBWA 4DV7B 3U62A 1BYIA 1V41E 1W2WB 2WD9A 2QLJA 1M9NA 1N0WA 3OMXA 3SEAA 3LMKA 2FPPB 2WYUA 1FNSA 1P1CA 2G71A 3W7VA 3ZHVA 3TZBA 3G8CA 2J3LA 4ER6A 3GDOA 2WV9A 1UPXA 4D3SA 4A0FA 4A2QA 4ZVTA 4KN8A 3GUHA 3ZHYA 3ZE0B 4RVUA 4Y1GA 3BGWA 4I4TA 4CM5A 4BO2A 1Z38A 1OYOA 3GLFA 4EJMA 2YNMC 4FYIA 3ZH2A 5CVEA 2ODPA 3ORSA 2YS6A 3UJ8A 3EGXB 1JQJC 2A14A 2GWHA 4GBGA 5DGIA 3WLSA 1FMLA 2A9QA 2G0TA 2LCFA 5K51A 5JHGB 3BGOS 2V7GA 2WTBA 4K9LA 2L82A 2VUHB 1BXKA 4U6NA 4B4WA 2ERYA 1SCNE 4A15A 1UXIA 3TINA 4LYYA 3HUTA 2BFDB 3JD0A 2R8EA 2O6HA 3M7IA 2DJ5A 1W87A 1M2VA 3TMAA 1VPDA 2QXYA 1KVUA 2A0XA 2RGUA 2QU7A 4PS0A 3M49A 3P45A 2BFNA 2D13A 3R76A 5GIOE 1X1QA 1F48A 2OXEA 2WE8A 3FOCA 5HIJA 4LDQA 5TPWA 1BS9A 2FX3A 1UPUA 1TECE 1KBOA 1L9KA 1Y3CE 2XNHA 3GUYA 4HYTA 1UODA 1PT7A 2I7XA 4ND8B 2WIBA 3OSUA 5CM9C 3SI7A 3WGYA 1LC3A 1KOJA 2B61A 4BLVA 2F1JA 1ODJA 4WKOA 2XOXA 1G4HA 4G23A 5ARBA 5BN5A 3BE5A 5D7BA 4FT2A 3S55A 5ALLA 2C99A 2HA6A 2J5KA 4BMXA 3KCNA 4JD5A 1KRWA 3FYSA 1S8OA 3HUFA 4MHSA 1S2OA 3TG2A 1KDOA 1PHPA 4AX8A 4EPVA 1J9EA 4D26A 2X9VA 1EFCA 3UM9A 3H5IA 2BM1A 2VEDA 3KQVA 3M33A 3NTXA 3PVCA 4H0NA 4QGAA 4ZT2A 4F4DA 4ERNA 4FOOA 4AMYA 1I3KA 2SBTA 3O9VA 4PLPA 3FZGA 4KWHA 4YMTA 1FJ2A 3NV9A 4K1XA 1OZGA 1XZLA 3ZX4A 3HJRA 4YDHB 2XQGA 1UH5A 4OD0A 1QHGA 4CU5A 1K4MA 3KWLA 1F6WA 4O2AF 1LSSA 1G2IA 3QZUA 5DBOA 2IYQA 3ROEA 1HG1A 1WVMA 3OT1B 3L93A 4ITVA 5AM2A 5FBVB 3EPJA 1X8KA 5B36A 2IOHA 3JYPA 1JAYA 4JGIA 4LGMA 1ZCJA 3TAHA 3WJ7A 1WMEA 3P0JA 2G25A 3F78A 3H5VA 1F8XA 2WMYA 4PLVA 3HXOA 4XFDA 1K8RA 3KJZA 3QQPA 4CPDA 3PJRA 3BRSA 1U2ZA 3L8MA 3LFHA 4LOLA 1VLJA 3SVLA 2OYSA 3IEMA 4R84A 1IN4A 2VI5A 3BEOA 3JAWB 3KB1A 2CNWD 1YQWA 3IBYA 1REQA 3TQOA 2P1ZA 2P69A 5AK0A 3T4XA 4D96A 1DV1A 2XUDA 1Q12A 3SXUB 4HRXA 1GPH1 2JNWA 4L15A 4NBSA 4YREA 1KL7A 2H3HA 3CCCA 3K9QO 3ZIDA 2I03A 2C5BA 1FK8A 2ATIA 2CVHA 1I6MA 2GJ4A 3HUDA 3LS2A 4FPXA 1QAOA 2QX8A 4H7DA 4Z9XA 5B2EA 3K94A 4ZXPA 2MSLA 3ZNNA 4K9PA 3REGA 4NPCA 3ZNQA 1MIHA 1KOFA 2Y6VA 4ZV9A 1HMPA 3WGMA 2RHLA 1WB6A 3VFDA 1IPHA 4XJSA 2XRYA 4OATA 3ZW7A 3ASUA 4ARUA 1PDOA 2WR8A 2FFAA 1V48A 4FMDB 4BNUA 1NTRA 3W8DA 4NECA 1A8PA 2WJ3A 1BMDA 4HJRA 4RO0A 1EE2A 4DA9A 1J2TA 2GKGA 3ZU6A 4DBLE 2M6RA 2B4TO 2LVBA 4D2IA 3MLEA 2CL0X 4M49A 4PZZA 5TQVA 2CNWA 4MW7A 1YR9A 5K3FA 3RVDA 2AMVA 3SIWA 3U48A 2JFHA 1X7XB 4FC6A 3U3JA 4FWTA 1P0PA 1RHUA 1JKXA 1G21B 2XKJE 3N59A 3URMA 1ISIA 3EUEA 2G09A 4WZAE 4XYLA 2X0IA 4TYYA 3LOUA 3IPAA 5JJBA 1OX5A 4TKUA 5IP5A 1JEOA 4V03A 1XPUA 1GZ4A 1HMYA 4XAQA 3ZWQA 1N75A 3Q0TA 4HDRB 3R4VA 2IS1A 1JEDA 1ADCA 1T4MA 3DB2A 2CF6A 4KXVA 5IBCA 5HBGA 2RAFA 3H4TA 3HJUA 3L8FA 5TQJA 3TW8A 4MWSA 2D06A 2PS3A 3T35A 3TZHA 5CD1A 1H1LA 3CRQA 4JOQA 4E4RA 2A2ZA 1KOLA 2ILTA 5JCOA 4CQJA 2GT1A 2XX3A 4MS4A 5T4EA 1KAEA 4K81B 1ETUA 5CT5A 4BQFA 4G5YA 1N6KA 4QGGA 5ILOA 3PDJA 1BE6A 5CXUA 2NP6A 3JD3A 3K9GA 1I2MA 1KPHA 1OAAA 4P81A 4Z53A 3HS3A 3GGJA 1LBHA 4PLWA 3FUUA 4N3GA 4F2HA 1RHKA 2FSHA 2QOEA 4C89A 3R7LA 1TOAA 2CJYA 1ZXBA 5ESDA 3MWFA 5F12A 3GAMA 4QECA 1ONNA 3AB3A 2LIVA 4DRYA 3KYDA 3JQ6A 4R71A 4RKEA 4OJTA 1C9YA 3PDWA 5JAIA 5IJZA 4F11A 1H9CA 4RFSB 1TVCA 3EFEA 3VPCA 1COZA 1ND6A 4DUZB 1ZHHA 1P5RA 3CRVA 1VE9A 3ZTYA 1SRQA 4WCFA 5J4HA 4HX9A 3C3PA 4LIPD 3TEMA 2YHUA 2F64A 1Z2OX 4C4YA 3HKEB 1J0AA 4RA9A 3ZWVA 1KAMA 4C04A 3EXG2 4RL4A 2X9LA 4U5XA 4HFNA 2JRLA 3F0TA 3VX4A 4W6QA 3PQDA 4EKYA 4JXXA 1Z7BA 4EATA 1H5QA 4D8YA 3ZY2A 1LI4A 3I1IA 4XRGA 3BFXA 3EE6A 4NAHA 5TRTA 1E3DA 1XJ0A 3FLMA 3RHSA 1XC7A 1N1DA 1PR0A 1U2EA 3RQSA 4KPEC 3JX9A 2UVPA 3SYMA 3DMPA 1FDUA 4ME6A 1JJAA 4YRRA 2X6RA 4B47A 2OVFA 4C2AA 5CEEA 4CXMA 3PC6A 4I1RA 3UENA 4FMPA 5FEUA 3U4QB 1JLKA 2YZNA 1CK4A 1DAOA 5CM8B 3G9UA 1NXQA 1A5SB 3ODPA 1V5GA 2QPAA 3S2GA 4XXHA 3P26A 2UUBB 3IBFA 2XDYA 4R2KA 3CO5A 1CHNA 1GGNA 2AW3A 1ZA1A 1BJKA 1NOJA 1XP5A 2AE1A 2QUHA 3M4YA 4MWBA 2O52A 5K0SA 2IOQA 2QD3A 4MTCA 2RB4A 4U1RA 2P30A 4FYVA 3Q87B 4IOLA 5TQ2B 3VTFA 1EFRD 1XDUA 4HT3B 5L4LA 1QVRA 2ZI6A 1E2IA 4GW3A 4FYWA 2FE1A 2ZQ5A 4CM8B 3HH8A 1CUHA 1KJZA 2FRDC 2I4LA 4S05A 4EQZA 2RGAA 1M2WA 2PGIA 2H1VA 3HO8A 2WF9A 2Q2VA 3L4BA 4J1QA 1ZRSA 4RE5A 4CCWA 1Y4ZA 2MSDB 3A6JA 4LJ5A 1M7HA 4MPDA 3RT7A 4Y0AA 3OCCA 4LHYA 2C7VA 5ALEA 3D7KA 2Y1OA 5C0OE 4BDTA 3FVQA 2JKVA 4YJGB 4QDTA 3VMMA 3EYAA 5LSAA 1ZK1A 1DX9A 1OAOC 3I5XA 2F67A 2FW8A 2ORIA 3TTSA 3NPAA 5D3QA 4RHXA 2PUHA 4LDAA 4M54A 5J59A 1CPYA 1PL7A 1F2UA 4P98A 3P9CA 4XFJA 2HLPA 3RT9A 1GQYA 1FRQA 3BMOA 3CUKA 3NHPA 3O8QA 2FZEA 3ZPXA 1EFRA 1L5NA 2FTKE 3KKEA 3HSSA 5EWMB 1N5DA 3B12A 3HB1A 3WNCA 4UFNA 1G18A 1C81A 1XTUA 3CJTA 1L7BA 2EWMA 1J0XO 1DKOA 1CQPA 2NACA 2QQ0A 1D7OA 1Y80A 1UK8A 3C3DA 3EQ7A 3KZMA 5JLAA 3EW9A 5EIXA 3V8EA 4ZYXA 4JDPA 4HB2A 1KZ4A 3RAFC 3QLUC 3E9DA 3NRCA 4P3XA 4J3FA 4F3CA 4TVKA 5C7OO 2HU5A 3M6LA 1MUUA 5EUMA 1JLSA 3U80A 3K0CA 2RI6A 1Z28A 4N0EA 1E9CA 5I9MA 1E20A 1TPZA 3V1UA 3JQ7A 4ZFNA 1P1KA 3R3ZA 4R16A 4WD3A 1SZJG 5AICA 1WB9A 1X3SA 1M0EA 5JQGF 1H8HD 3H2HA 3LIIA 2PRZA 2GSDA 4U63A 4D3FA 2ZYRA 4MRMB 3SKXA 3VR3D 4A5SA 4BJ3A 1VLHA 4KE9A 4MKHA 1E4EB 4NZZA 3WB2A 5LU8A 1J90A 2WWGA 4CKWA 4DMRA 2QLNA 4BB6A 3BILA 3PRKE 1CETA 3LQYA 4OSOA 4JL8A 1HNXB 4YAKA 4DV6B 4FEGA 2Z4RA 2VIIA 5ALDA 3SGLA 2AC7A 3NR2A 3G1UA 4FHEA 4HVTA 4X85A 1TM5E 3GXBA 4L28A 4M99A 2PKRA 2R65A 3RU2A 4RTLA 1JMYA 2H1HA 4M0LA 4QQRA 4CT4B 5HHTA 2YASA 4P7JA 1BRTA 2HUNA 3T8YA 4JIMA 2GK7A 3C5HA 4PIMA 2GERA 5CVJA 1OE0A 4I5EA 1EQAA 4B3CA 5I7EA 4NC9A 3ZVLA 1ZH2A 2WJAA 4B6PA 1D03A 2I78A 5LDGA 1KYIA 3CONA 3KFXA 3KHUA 2ZUCA 3DP9A 3MTQA 4C4OA 3KKNA 5AW5A 4CLDA 1MW8X 3U3OA 3E9EA 1PTJA 4M36A 2AA3A 1B8NA 1NULA 3DBRB 1H8HA 2CXOA 3J7TA 3QENA 5CUQA 4E1AA 3WLRA 1HKHA 1ZGHA 3HLKA 3VR3A 4LJ8A 4J3NA 5AWFC 4AKTA 3R6GA 4OHZA 1BS2A 3ZZTA 2VJOA 1E5DA 4LE0A 4I1VA 5CBKA 4JLWA 1HT1E 4QLAA 3TI7A 1SKYE 3PX2A 1VB5A 4ZOEA 5FI1B 1QZTA 5EIAA 1ULUA 3EHEA 5K8LA 4AMVA 1SU8A 1FNCA 3L6OO 2GCIA 5AXCA 3KJHA 5MFPA 1E4YA 4ARCA 1TD1A 2DCMA 2GKSA 1VL1A 3EGDA 3M5PA 4BLTA 4ZJUA 1E1QD 4XASA 1AB6A 1Z62A 3QSYA 3HADA 1SWWA 2X1LA 3P2MA 1K66A 3VO9A 3TTWA 4U7WA 4PPNA 2HJSA 1W4AA 4UE6A 2AI3A 4DQXA 1GKKA 2A9RA 2OM2A 2QMZA 3M5CA 3PNSA 4IHKA 4O5OA 2VJYA 5GOZA 1LX7A 3UPDA 4OK6A 1JYSA 4QEZA 4OI2A 3TDNA 4P92A 3NEJA 4PE5B 1E1CB 5EQJB 5FA6A 4EJSA 4EKIA 2PT9A 2SCUA 4JX9A 4P82A 3TI9A 1S2NA 2EW8A 4QULA 3OECA 2ZWAA 1KETA 2VHYA 3OZIA 2XLBA 4KCGA 1OY1A 2FJUA 3ICCA 3LO5A 4N6GA 3SC2B 3WJAA 4OQZA 1YL5A 3JATA 3HFJA 4TTSA 1TGYA 3UCEA 3TJMA 1LNZA 3MWGA 4Y2QA 3CLRC 1VIMA 4Q21A 4IUBS 1KO7A 3UK0A 4X66B 4O4IA 1SEPA 2BFFA 1X7WA 1XFAA 2OD9A 4BGDA 1E1QA 3FZNA 3WLLA 4MOWA 3A05A 1WG8A 2Q5LA 3NHYA 3GRRA 4LV5B 4RK6A 3A7DA 3BIOA 3ROZA 1O58A 4H7KA 1M2HA 2DHQA 2I99A 2GPAA 2Q0SA 3N5KA 4YROA 1GCAA 4CN9A 4LYJA 4DABA 4DA8A 4E08A 5BWBA 1UBLS 2XQVA 1CVRA 3I9KA 3A6LA 5AVXA 2WB2A 1CQIB 2VXOA 2ZRQA 4PHHA 1ZNYA 4JLSA 1TEVA 2HHAA 2JAXA 4S1TA 4B81A 3ESCA 5AW6A 3P96A 3DBLA 4BEVA 5CVTA 5K09A 1W4LA 3Q15C 3RTAA 1DU4A 3LDFA 3TLMA 1U0BB 2DQ4A 1TYCA 2C2MA 1H6AA 4Z99A 1XZQA 4KXUA 1KFJB 5JEEA 5E7JA 1PK8A 2XTJA 1Y8CA 4FP9A 3RG8A 2GX6A 2ZDQA 3H6HA 4MYCA 2D2VA 3CZAA 4ZT5A 1SBIA 1ZXXA 3FNBA 4I55F 4A82A 4IOMA 4RW0A 3K5WA 1E6MA 2QPTA 4RXMA 3K31A 2XBUA 4MAMA 1PFUA 2YR0A 4DDTA 4YMHA 3AUJB 3DHEA 3IELA 1SZDA 3OE5A 5EINA 3UC9A 1GAQA 1DC3A 2IQIA 4LNAA 1ZVKA 1K4KA 1UMBA 3CUEF 1VJDA 3HA3A 3K9WA 3DUFB 1BVHA 1SCDA 1MB0A 2V96A 1D4OA 3I9MA 4L16A 4M8SA 4YT2A 1A5BB 1IB6A 1PJRA 2HQOA 2J9FB 1RM5A 2QRVA 1U80A 2XAAA 3KZOA 4KE8A 5ALRA 2QAGC 3KR0A 2FX5A 1A1SA 1NBEA 1V8OA 4KPUB 5DMXA 1MJHA 2BMEA 5LUBA 1RHQA 4CTMA 4G0PA 2WHRA 5EJ5A 2NSJA 3S8EA 1E3EA 4EBFA 1QUFA 4QUJA 2P2LA 5EA2A 2CUZA 2QNRA 5C5IA 1A2QA 5ES3A 2P40A 1HY3A 3PG5A 5WRFA 1HX7A 4Y30A 2IVFA 3DDWA 1Y6FA 3Q5EA 1BHJA 2ZVPX 2FZWA 1CQWA 1KH3A 1UWCA 1IEWA 3HC7A 3JU3A 3L6UA 4N5IX 1H0RA 4DRXB 5BQ3A 1YZYA 2HYDA 2XUIA 3BBLA 5FWAA 2H0AA 4HFJA 3CLKA 4YRTA 3WJ2A 3X1JA 3FWHA 2FN9A 1CF4A 1R4NB 1UBOS 4HTFB 1F5NA 3AM3A 4O25A 2HX1A 4YMIA 5B3JA 5ILQA 4BNLA 1G0OA 3V7YA 2CV2A 1J9ZA 1TT7A 4RK1A 5JAPA 4ZAWA 4LJ7A 4N65A 1TA0A 3W0LB 2IX3A 2CKMA 3E18A 3H0KA 3PHLA 4JBXA 3ZGYA 3FYUC 1SULA 1U3DA 3OC0A 4YJHB 4DJ5X 2Z2YA 1BMFD 2FPPA 1CRWG 4HXGA 4PCAA 1EDEA 1UMCB 4FFNA 2QRHA 3O91A 3USZA 4J16A 3ZV6A 5H9VA 4R9UC 2XMSA 1P73A 3BKWA 1CEXA 1X7DA 1NPDA 2EFDB 1LK0A 3AX6A 3JRXA 4PYLA 4RVGA 4X45A 2WMDA 4YMSA 2UZAA 4C5AA 4Q7KA 4DA7A 5BQFA 3L7KA 2QM3A 2CYCA 1PVOA 3EGXA 3OPYI 1TE2A 4XE5A 1G17A 3GDHA 2QYTA 5C3UA 5EP3A 4QNNA 1JHRA 3GOHA 1XNGA 3AERB 1Q14A 1YGYA 3O1LA 4UREA 3ZK9A 5I7SA 2C3YA 4IDFA 4MGHA 4F5DA 5JAUA 3K53A 3FHLA 4WXPA 2QUKA 3FETA 4QU0A 4B9EA 3E3LA 2J6HA 2BFDA 3WKBA 4WXMA 5D5PA 5TVKA 3DO8A 2OR3A 3O9ZA 4B33A 1BMFA 3G0GA 5CCXA 4JEIA 1LSJA 2J33A 1CY7A 1GHTA 2CMDA 4FI3F 2ZI5A 4IWNA 5FF9A 3FVVA 5BOVA 3R9IA 4S1NA 2B83A 1LA2A 3ABQB 1NUTA 2XLCA 3BE8A 2V03A 3GFVA 1JL3A 2WFLB 4X84A 1RHJA 5EOVA 3RR2A 1X1SA 3EVEA 4ND8A 3L06A 4JBIA 1CT9A 1N9KA 3HFGA 2V98A 4WT7A 4OI1A 4D9KA 3HJHA 2DUUA 2Z5LA 2X9QA 3S2UA 1X15A 4IRXA 2ZB4A 5G41A 5BNIA 2AGVA 4EENA 4Q6BA 3IC5A 4QXQA 4CKXA 1SQSA 2O3QA 3B9PA 3SBXA 4HDKA 4DIDA 2IVZA 2ZM6B 2YV5A 3C24A 1PFQA 3AEKB 2FEPA 3E70C 1FOEB 3FCXA 3D0RA 3ZLUA 3H04A 4I7EA 4WAUA 4X3PA 1DX4A 4NSNA 3TFQA 4B7AA 1V43A 1YFKA 2BEVB 3OJ0A 3MA0A 4MP6A 1FU7A 1K8QA 1WRBA 1XBTA 2RGXA 5BV2P 1F7VA 3WGHA 2ATEA 3VZCA 2YWBA 4EA9A 3AXTA 3GJQA 1RKBA 1ODSA 5DHTA 4NMLA 3HJAA 1LLCA 2I2BA 5C7YA 1ZMOA 4L76A 3AFGA 2E37A 1VE3A 3OFJA 2XUJA 2CVQA 1U02A 4JQYA 2OCDA 3KD2A 5A71A 3B1YA 3OT1A 3TD6A 2RH4A 3AUTA 4RVDA 3D5TA 5HTOA 2YHIA 4Z7OB 2UXCB 5JEDA 2ZCJA 3DH0A 1FVXA 2AFRA 1G8YA 1YDEA 4TLCA 2ZRHA 5KJ6A 1VBFA 2Y1CA 3A0UA 3CBGA 2G1UA 4ZCMA 3PNQA 4H35A 5GONB 1RM0A 1JQBA 3IILA 3R7DA 3W5HA 2PX8A 1P6XA 3DEYX 2EP7A 3NTUA 4R5MA 5GV7A 4AN1A 4H6VA 3SXUA 3CVOA 4MPRA 1IHPA 2X1HA 3FRJA 5HA5A 2V6GA 3TTXA 3VC1A 4ETIA 3U37A 2ORWA 4BE9A 3K71B 4NQZA 2O3SA 1DTWA 3B20A 3CF4A 1H4SA 3AUAA 4YJDA 5FPSA 4EMTA 2WHEA 2HQSA 5IDVA 1C9JA 2QK4A 3GK3A 2JHAA 2AYYA 3A1DA 4QUHA 5DX8A 2OECA 1SC6A 4PHFA 4EG8A 2AL7A 4FW8A 1EX1A 3DQZA 4J7CA 5FI0B 1N6PA 2ZJ5A 2XA9A 3B7GA 2YYZA 1N2EA 2B37A 4G4IA 2OHFA 2B4AA 5BN1A 5CNMA 3Q2OA 1KEEA 3WMRA 4Z86A 1BA2A 1OXXK 5JJIA 1G9SA 3DVRX 3OEYA 1RZVA 2JLQA 3E7WA 2VPWA 1E5LA 1L4KA 4LF5B 1P7PA 2LNDA 3FNIA 3QE4A 4F3TA 1MEEA 5DZSA 1IZZA 2RARA 1OI7A 2GJSA 3IH5A 3W5AA 2PKQP 2BP7A 2GZRA 1U2DA 1T1RA 2P4UA 3DKVA 4B8ZA 3IAUA 4RDIA 4OMDA 5A1TA 5IAEA 4OB7A 3GFRA 3IHWA 4IGAA 3IVAA 1KY5A 2XVMA 3GP8A 1PUJA 3AR5A 2ZT6A 5E2IA 4TMTA 4HDRA 3R9WA 1UPFA 4LY0A 4D9CA 4XFKA 3C4QA 3TPCA 4Q02A 1DADA 4XH9B 1G7SA 4O1IA 2JK0A 2I7VA 4J7XA 2AOVA 1CZKA 1U9IC 5KUTA 1RC0A 3EEYA 5HE8A 1Z4OA 2BF7A 1E5TA 4IF6A 3K8YA 1WLSA 4R1SA 3FVTA 4AZVA 4C3UA 2ZR9A 2BE9A 5DTRA 1JP7A 5L3QA 1NXTA 4OYRA 1E62A 3FCCA 1XQ9A 3EPHA 4QUAA 1AF7A 2W6ID 1C3XA 4RDHA 4CETA 4HJXA 3A9VA 1T8TA 3ESAA 3EZ7A 4L8YA 4UMVA 4ZVMA 3WGTA 4XWTA 3WL7A 2XT9A 3FB4A 1P18A 4DL9A 4IDCA 1SBNE 1O87A 4NFSA 1WB5A 1YRAA 3JR3A 3NHAA 3K0FB 3RAEC 4IDAA 2GN9A 2WAYA 1YFZA 2WWXA 3BA6A 4RFSA 1KH2A 1TYDE 2HF9A 2XDQA 1IRXA 3CF0A 2NSYA 3Q85A 3FJOA 4AO6A 2ZB2A 1NT4A 4DANA 1R0XA 2VF8A 2ECOA 2N0SA 5A9TA 4HGOA 2A58A 3GP3A 2AUTA 2ATVA 2QJRA 3SIPA 3L0PA 4GGPA 3WNDA 1N3BA 1SR8A 4LQCA 3GRFA 4BX8A 1B74A 4O8CA 3EC1A 3MMPA 3CUTA 2ISQA 4OAQA 3WL3A 3SU8A 3ZKWA 4J2TA 5TMPA 1WBJB 2W6IA 4W99A 5JZSA 3T1HB 1Z15A 3T3IA 3AFMA 2NYRA 5FUVA 3E35A 3T61A 5KO2A 3ZBQA 1HH4A 1ACLA 1I3OA 3AIIA 4XWGA 2ZITA 3OTQA 2Q1WA 1UMKA 4BLWA 2I0FA 4ZZ2A 4PRZA 4YO7A 3R0JA 3W04A 4HKTA 4NJEB 4QPPA 2A4KA 1IUKA 1E2DA 3ENWA 1GL6A 3FWKA 3HA5A 3NGLA 2BBSA 3EVBA 3PQCA 1SO8A 3R5HA 4U8GA 4WIAA 1YZNA 4Q4AB 3TOCA 3F3YA 4MIEA 3EUAA 5J2TF 1JZTA 2W00A 2O2DA 1XTBA 4OOEA 3TB4A 2ON6A 3MBKA 1JVSA 4K8OA 2O50A 1J0BA 4G5GA 4O33A 3JALA 1HA3A 4QSHA 3UTDA 1M2FA 2L17A 4RE6A 5TQ2A 1R6VA 1GGFA 4RPGA 5HIAA 2X13A 1GPNA 1UOPA 2BW0A 4G1UC 2FSIA 3CEHA 4JC5A 4JJ7A 2F3UA 4CM8A 2XUFA 2XUGA 3MMXA 1BEUB 1R4MB 3WWDA 4OXQA 2YMMA 3VNBA 1GZHB 1JRLA 4B84A 1UBCA 1WF6A 2OLKA 3FR8A 1UJMA 1KSGA 1F12A 2GEBA 2IGTA 3OE7D 3CHYA 3K09C 1VGRA 3CM0A 3ZIAD 4HVAA 4YJGA 2PY6A 1JYEA 3DXYA 3N7TA 3RRMA 3MAAC 3Q0IA 4D9JA 1S7CA 1X42A 4DXAA 2E6KA 3CW9A 2EKBA 3HDGA 4BVHA 2EJWA 2NO4A 5C4IA 1PGQA 1PNQA 3CS3A 1DAKA 1FRVA 4M1EA 4TXJA 2EATA 5E4JA 1UDAA 1O54A 1QGYA 3S2IA 5LMUB 1IOLA 4AJOA 1AURA 4FFPA 3J81A 4HZUB 2GCEA 1O6BA 1T4CB 3RABA 1HTBA 2OCLA 1WUTA 1DAEA 1HG0A 3LPCA 5C8DA 1GAXA 1U8UA 2RBGA 4ZP1A 2PD4A 3W2IA 2ONYA 2IOYA 4R9NA 4A8HA 3DVQX 5CG2A 2YZKA 5KC8A 4BFXA 1FP7A 5KJ1A 3VKGA 4K9DA 5ERXA 3K6SA 2J0QA 2PT7A 2C57A 2VUIB 5H70A 1JHZA 1SCIA 1RCFA 4WZZA 1GNRA 2AEJA 4KBFA 1P61B 3OE7A 4D3YA 4IILA 1W5FA 3W4JA 2N3ZA 4NBKA 2K2WA 4EHFA 1WV0A 2OCBA 5AK5A 1I94B 4A1FA 5FRDA 2BRUC 3NWOA 4Q3AA 3VDMA 1T9HA 2HBZA 2VPQA 4G81A 2PH7A 3I05A 1U4SA 1TAUA 5TC4A 4DJDC 1LY1A 2FHSA 4M83A 4AL4A 1YF3A 2QAIA 4MRMA 3TO5A 2OP0A 3WG9A 1XNRB 1Q74A 4TLDA 3FLEA 2HSZA 3FCSB 4PY2A 4YAWA 5ENVA 4BX9A 1D2RA 2BGTA 2EQ5A 2OT3B 1V1MB 4WTOA 4KDCA 1CD5A 3IBSA 4C6SA 3MCVA 1CUAA 2VF2A 2ATXA 3PNMA 5BW8A 2CVFA 4JQSA 2MR6A 4AQDA 4Y1FA 3JQGB 1M7GA 4UJ5A 5KTOA 4YRGA 2QXUA 3TS1A 4YAUA 1ZZEA 3QUTA 1OW3B 1YB5A 4MW5A 5K8JB 2G80A 1N5JA 1U0OC 2GASA 2V65A 5ARCA 5IFKA 2Y2VA 3IPLA 3ONNA 1VG0B 4R83A 1KXZA 3WISA 1GLGA 1SBHA 3C7DB 1EVEA 3GIDA 5BV7A 5CB0A 1KRXA 2FH5B 2VAPA 5IM5A 3RASA 1PJTA 3CJQA 5KNDD 1T9AA 3ZHUA 3DBRA 3RKRA 4L9AA 2XEDA 3KXLA 3P19A 1W0KD 3ESYA 2MCFA 2JFFA 1DDIA 4RIIA 2QROA 5CDYA 5LNK6 5KNBD 3GG2A 4F38A 4GVLA 2FDRA 4KQ2A 5T4BA 1ORDA 1Q2UA 3VYWA 3ZOKA 4EF5A 1W9HA 1Z39A 4RH1A 1IAQA 2CHQA 1KDYA 2ZWIA 5K8UA 1XQYA 4PFSA 4O4LB 4X41A 2EARA 1MBZA 5FDFA 2FAXA 3ZV5A 4XYMA 3E3OA 3TR0A 4URUR 2R2GA 3LPMA 1G1AA 1Z36A 4CYMA 3LUFA 3W2EA 3UB4A 1NP6A 1FTWA 5KYKA 1EXWA 4YNBA 5CTJA 3KWFA 4DR2B 2AV6A 3DEFA 3O2SB 3OOEA 3RYCA 3S8MA 1WX1A 1EHCA 2VJCA 2P35A 5FBQB 3T0IA 3BIXA 3EG9B 4NV3A 3VV2A 4JQZA 4MUHA 2IZ7A 2BI4A 2CUKA 3Q3VA 4A0HA 4WOBA 2MYTA 5LQKA 4YUYA 1E1CA 2C04A 2JI6A 1W0KA 1P0CA 2PX6A 1ZOLA 4N0QA 2VJBA 3DOJA 2FLVA 3Q1LA 4QDJA 2VPIA 4QIHA 3TSCA 3TZEA 1Z82A 3WLTA 1R8YA 4BDSA 5IZ4A 4RMHA 3QEMB 5KNBA 1C41A 1NQOA 1T91A 2PL5A 1NWHA 4XQCA 4B1FA 4DKXA 3IEPA 5J43A 2XQKA 1L5VA 2FSFA 4NXMB 1OA0A 2FUKA 3C1OA 3C3YA 3PKJA 3GBVA 4JI5B 2IU4A 1LPSA 4AP6A 5IAGA 1KGSA 3C6YA 4GKJB 2GEVA 3LYUA 1JIJA 3DDZX 1NN5A 3F98A 3G2OA 3LDAA 2VP3A 5JCOC 4DV1B 1QOPB 3ILYA 5D1HA 5EXPA 2CB0A 3NOOA 4I6GA 3U49A 3HWSA 2CFTA 4D9IA 2O54A 3D43A 1QVAA 4GMHA 4S04A 5EIBD 1IN7A 3UJ3X 4E2FA 1JILA 5JPCA 1OBCA 2NO5A 3HEBA 3SD7A 1TJ5A 1VLQA 2VT7A 3RB8A 1BKSB 3LUAA 5KYTA 1UBMS 1X14A 2VZ9A 1Q6ZA 3FFWA 3TRJA 1BEEA 4CW7A 5E95A 4NIMA 1B0PA 1Y42X 5I7UA 1E9BA 3UK2A 1Z2NX 1PZFA 3FOZA 1IY2A 1T4DA 3H1EA 1B8PA 3ISJA 2C82A 4RL6A 4DQLA 1X1TA 3W5VA 4BO8A 3E58A 4DOMA 5AUOB 5LD2B 2M32A 5ER6A 1NUPA 1KU6A 3E15A 3UMFA 3WGNA 1T6BY 5I4IA 3SMVA 1YZLA 4RCYA 5JZ9A 4JP2A 3UGQA 3IDOA 1H69A 1MTOA 1VMIA 3BFPA 3EH1A 4WCFC 1IM8A 2ZATA 2GO7A 1XN1A 1DT5A 4BBZA 2JFQA 5LYJF 2FP3A 4BEBA 3F74A 3CY6A 4QTXA 2W2LD 1K5PA 3VR5D 4B31A 4CIYA 1BJRE 2L42A 3T0GA 4WGGA 3ROKA 1RRKA 4MUBA 1ZD8A 1KC1A 1MOQA 3CMMA 3UICA 4BLRA 1DCFA 2WPDD 4K1LA 4XB1A 1H0HA 3PC7A 4YPOA 2R62A 5E8RA 5TR9A 3ZWYA 4QICA 3T3GA 1PT5A 2BHTA 2J9FA 1CERA 1SCKA 3EEIA 4HDSA 4HVCA 1KDPA 4ALNA 4JX8A 4N8DA 1M2OB 2HNBA 4KPUA 2HU8A 3KOZA 4URZR 5BT8A 3W06A 3GFTA 4PG4A 2YWHA 1ZCBA 2QTNA 2J31A 5A04A 3G13A 2OZLB 2K87A 1G5QA 3H6GA 1GSAA 1FTSA 3O03A 4BMSA 4YAFA 2IYYA 3VPSA 3AR3A 4GYYA 4N03A 3GHHA 3STWA 5AH0A 5AQEA 5HRUA 1L7RA 2QG6A 5K4HA 2ZJFA 2BDUA 1YACA 4M1YA 5LLSA 5JTUA 5GAJA 1M1UA 2W2LA 3H83A 1UDRA 2NW6A 1TK2A 1ZGAA 2RAUA 3K0HA 3X43A 2UZ1B 4J3JA 4DRXA 4EJ2A 4RS3A 2WPDA 2AX3A 4OQFA 3TVTA 3L4BC 3WP1B 1R37A 1DG3A 1ZO8A 1PJLA 2H1SA 3Q3IA 5AJWA 3TTYA 5CB6A 5ED4A 4W4TA 5CA1F 3LA6A 2P4HX 5ENDA 3TAUA 4EX7A 3W5DA 5BWOA 2O59A 5C34B 1JHUA 2DBYA 3T7AA 4BZWA 1UFKA 1E63A 2PUWA 3CPSA 1DHRA 3CZ5A 2GVNA 3A1NA 4JWTA 4KI7A 3SLKA 5BRAA 5D8DA 2J3JA 1A27A 3OZSA 1S9DA 5K0JA 4PZYA 2PH3A 4TL7A 2BZ1A 2XQFA 4U6QA 3VC7A 2BTEA 1UMCA 1PFVA 3OZWA 2ZWMA 1XJQA 1O0SA 1UFQA 2OO5A 4LRSB 2W0SA 5J9FA 4BMOB 4OQDA 4MUIA 4RJIA 2Z9CA 4B17A 3C4JA 3HVUA 3WK5A 4XQEA 1GRCA 3IR5A 3OM0A 1AKRA 1KAQA 4HWPA 4IMIB 4EB6B 3KXIA 3KOXA 4QYSA 3N2ZB 4YHHB 4P54A 4NX2A 5EZSA 3RUDA 3H9JA 5ICSA 4YQYA 1UBNA 3CZ9A 5K99A 1QNFA 1E0JA 3AERA 4A26A 2GWRA 1P3JA 2JD0A 4WHMA 1FYXA 1CY6A 4KGZA 1ODTC 2VATA 3BWCA 1H2RS 4FFVA 5AKZA 2IHZA 4TN1A 4AMGA 1RQ2A 4KQXA 3V1KA 2ZBUA 2XXJA 1F2TB 2HUPA 2ADMA 3HCCA 2FUCA 2NXJA 1NJGA 1UMDB 1BQ4A 1S3SA 3IJEB 3HV2A 4ITUA 2PEZA 1KDZA 4DDKA 5I7WA 1YKSA 3DEZA 3SF8B 1JYFA 4PGMA 3DFZA 3WWZA 2WFLA 1YS7A 3MD0A 3ZDEA 3SS7X 2C31A 1EDZA 1G3IA 4FWIB 3ELUA 3DUWA 2CXHA 4PCVA 5JI3E 4RD2A 3N75A 1XP8A 1FXSA 3HI4A 2YFKA 4IP0A 3QGMA 3ZH9B 1HC7A 1V9LA 2CHUA 2CL6X 5EXTA 3OOYA 1NNSA 3L41A 1MX5A 5C4GB 1G3MA 5JADA 3ILVA 2R7NA 2WFAA 2WJWA 3YASA 4W9MC 2WG2A 2HHHB 1VL2A 2E55A 3PX3A 3GXOA 2JH9A 4PG7A 5I9NA 3H6KA 4LFCB 2NPFA 4AJ4A 3CV3A 3KJFA 1RSZA 2PQ2A 2WDZA 4GPZA 1YXMA 1YQ9A 1M1XB 5B3KA 3P94A 4OUKX 3VAAA 1PTJC 4BJ5A 4ZOLB 3AEUA 2KX7A 3VKVA 2FEMA 1NJ8A 4C7XA 1JLLA 2VHZA 4BMYA 4NFHA 2X42A 3SFZA 5FBRB 4B85A 2Y0DA 4RHEA 1KOGA 2D5BA 1DC4A 4QJIA 5FR1A 1BS1A 4PFJA 1GGEA 4Q1AA 4BJHB 3A70A 3IA2A 4ISBA 4ANFA 3FM9A 2C9OA 1TKBA 2HOQA 3CJRA 3ESRA 3SEQA 1TUEA 3NWEA 1I3NA 4REMA 4G0UA 1Z8NA 4H6WA 1DIOB 1IATA 2BMFA 4O0LA 3A4TA 3NONA 4OHFA 1P2UA 2APJA 2P8SA 1MH1A 2IE0A 2JIDA 1R5OA 2X58A 1FTYA 2D7JA 4OYHA 4M8NE 2PGOA 2ZBEA 4NZ9A 3E1SA 4ZQFA 1K5DA 1ST2A 2V7QD 3DBVO 3KOUA 2EZ4A 3BHIA 1LW6E 1ZKDA 4GOKA 4AJIA 3SJZA 4AYWA 2AOUA 4DDUA 2P6MA 1H66A 2QNBA 4CT5A 3ESBA 2E21A 2XYPA 5J23A 3DZCA 4ZIRB 4EPYA 2IZ6A 3BDVA 1NVTA 4TVBA 3T3MB 1E2FA 1CF9A 4EJSC 5BMOA 1JQ3A 2XWPA 2FWIA 4TMXA 2IITA 4MUMA 1OXKB 4LTMA 4X7BA 1D5CA 2PXCA 3OHPA 4QUGA 4L5CA 3KLOA 4DQKA 5L51A 2V0GA 4FOPA 2Q5JA 1WXWA 2CFCA 1Z2AA 3CT4A 3QMMA 2FNAA 1KPIA 4F9TA 3FNGA 3RTEA 2CWWA 1VHLA 1WF3A 3NHKA 1E92A 4J0JA 3W9BA 4R8VA 2FW0A 1EFLA 2XJ4A 4LE1A 4PIVA 2XMGA 3VU0A 1K6IA 1KK0A 3FOEC 4KLAA 4WY5A 5JALA 5ISMA 5FUBA 2GD6A 4GOXA 1T9CA 1S02A 1VSUA 2GKOA 1CJCA 2PLFA 2V7QA 3DDNA 1I24A 1TCBA 1SU4A 3H1TA 1AX9A 3I6YA 4H77A 2I6SA 4IXTA 4K5QA 4B75A 4F96A 1LZLA 2HDNB 3UV7A 2UUCB 2O8EB 5KWSA 1WTCA 1VMEA 4TTTS 3VR1A 1E2KA 4MEBA 1ZL0A 4NFYA 1QVVA 4DWOA 5JIBA 1GT6A 4ZT4A 1QGOA 2PAAA 4AK9A 1L5OA 1WNTA 1KI1A 3GC6A 3R7FA 4PAMA 2JZOA 3MJEA 2P9QA 1APBA 2KW5A 2XGSA 4R31A 2P1RA 2ZTSA 2OGSA 1KJNA 4QRHA 2V4MA 1EJ2A 2RGBA 3CPEA 3QNUA 4KTTE 3UGJA 1MPTA 5SZHB 1HFKA 3AVOA 1GTG1 2O1SA 4LMBA 4WA8A 5K0BA 3NG1A 3W5SA 2UU9B 2Q3BA 1NQTA 3FNRA 3QBJA 2VQ6A 3R0VA 3VNRA 5ITVA 1PZNA 4GR9A 4FFWA 1EI9A 4OV6B 1KIFA 4ER7A 1LFAA 1YIOA 3C5EA 4J7UA 4DLXA 2C07A 1XK7A 1JKJB 1KAOA 4W8GA 5BT9A 4PZAA 4BKMA 4NEQA 2OQRA 1C0LA 1UEJA 4JGGA 1V4NA 3RAJA 3UUGA 1B76A 1YJBA 3QKWA 1A4RA 3ZZMA 1U1GA 2CNKA 1QHHB 2E2WA 4KWTA 4ZO4A 1Z3CA 4X1OA 1SUCA 3VH2A 1EBBA 2BSXA 5K0CA 1EP3B 2ZGVA 1FX0B 3KQKA 2AZXA 1R8QA 3ZQUA 4DQUA 1S3FA 5HNKA 5LOVB 1WXIA 1YJCA 5FYDA 4CEIB 3L1JA 3SQDA 1K6JA 1ENYA 3ONDA 2RKOA 3G9ZA 3IAAA 4HCJA 4RLSA 1VE6A 4JELA 2OCGA 1JFLA 3AOGA 4W8HA 2XVYA 1PV4A 4BZXA 3GVCA 5DHAA 2ZJ4A 2BMVA 4JITA 1JHOA 1UT5A 3LT5A 2Q4TA 4JT2A 3JYHA 2WJGA 4IYJA 1J2JA 4NYJR 1IWBB 2ZDHA 1MAWA 2ASVA 3PGKA 5HKBA 2EFCB 3C1UA 1BJTA 2FFQA 2QI9F 2Z8YM 5GWXA 1U0SY 1ZJ6A 3GMSA 5I7FA 1B0UA 1K3UB 5J5CA 2YXLA 3KX2A 3SIXA 1ES9A 2Y77A 2Q99A 2PT5A 2JA2A 4MITA 3VMFA 4CM3A 2A5DA 1N2HA 2NU9A 1D0VA 1FC0A 1CY4A 1LRJA 1SFRA 4J76A 3RT1A 3MWDB 3TZLA 1Z6QA 2VK8A 3MEQA 4LK3A 4I8DA 5B3JC 1BDIA 2Q6IA 3IO3A 2W2PA 4NJEA 4YJ2F 4TQGA 1ACMA 3KV3O 3DL2A 3P52A 2D2XA 4Q4AA 5HCNA 4DQDA 4AJJA 3CNQS 2CXPA 3T1NA 4WNIA 4MVJH 2W93A 2O7QA 1ILWA 5HM6A 1I2CA 3L7YA 2IXDA 2DAPA 1SQFA 3I3SR 4BNVA 3DLCA 1Z5UA 2H85A 2V0NA 3R74A 4J16C 1B0AA 1PEDA 3THWB 2JGLA 2SKCA 2QL9A 5E9AA 5IKEA 3ZGLA 1NBMA 2G1KA 3DB1A 3P9ZA 4GBJA 1OROA 1J97A 2OWEA 5AVYA 1DQPA 2EFGA 4LV8B 1TMGE 1R4MA 1QOQB 1QIHA 9MHTA 2CLOB 1OIVA 2M6LA 3THXB 5KQSA 2HA0A 5D3MB 1QYWA 1T9GS 1KF0A 3B78A 3NEYA 1N6IA 5TMBA 1OYYA 2PLRA 3D6FA 3GB9A 5KVAA 1Z5NA 3SM3A 2R0QC 1SWVA 4RPJA 4CMBA 2B5WA 1IUNA 1RMTA 1ZS9A 3I6MA 5IVIA 4ETWA 1XRQA 2FN7A 2FW9A 4NCJA 2W2VA 4TYNA 3QXHA 3RSLA 1QONA 2GYUA 2V58A 5KCMA 1QE5A 1E1DA 4HN4B 5L3SB 2ZYTX 3KQPA 3OT4A 4JB2A 1KQOA 3NJRA 4QA9A 1XXHE 1T4CA 5EL0A 1G20E 5FPTA 2OK7A 1DCMA 1R0YA 2W43A 1I2ZA 3O8NA 4L4SA 2GLXA 1W88B 5LB2A 1X7HA 2PTGA 5IFLA 2QY9A 1ULAA 4FCCA 1EVIA 1XLUA 3G8DA 4PNZA 2XWBF 4QEDA 1WIWA 5E9QA 1KIAA 2BFMA 2BKLA 3M1YA 4XIIA 3RREA 2Y8EA 3HKDB 1Q21A 4C5BA 4MQMA 1GG5A 2UVQA 3N76A 3BQNB 3BC1A 2VTEA 1I5EA 3HGQA 1ZCFA 3RWBA 1OJLA 3RFFA 1RLJA 4RBNA 2H65A 3BREA 1HSZA 2WU3A 5HUJA 1WSDA 5G3ZA 1KDVA 3SCZA 2VZLA 2IYFA 1R6TA 4KOAA 2GN4A 2B2XA 3NFYA 3MTGA 5J2TA 4JASB 2O06A 2AN1A 2CDRA 3DO6A 4CKEA 3LW8A 4GWKA 2V7TA 4BWFB 4OU4A 4O8ZA 1A97A 3GLUA 3IR6A 1ZK2A 2O7VA 1JDBB 1QYDA 1LC0A 4OGKA 1K98A 1N2OA 4R9RA 4U00A 2X77A 3TJRA 5LCXA 2ZBVA 1QQTA 4WDRA 2IHBA 4HH3C 1MO3A 1DBWA 1W30A 1CR4A 1T5LA 3AEYA 3RJMA 5ER9A 4B4KA 1IJKA 5F9HA 2J45A 2PXHA 3I0ZA 1SKAA 4CV3A 1JW9B 1NMYA 3H11B 3AM1A 1DC8A 2XOKD 1MVLA 2JLAA 3JQGA 6ADHA 4E51A 3A06A 4BX0A 3JSXA 3PC8A 5KYGA 5ALXA 2EAUA 4C01A 3CX6A 4OSPA 1GRVA 3VSAA 3G2QA 2FXVA 5DCLA 3PGVA 1CUSA 1BFUA 1I7LA 3B13B 4UBJA 3ZS8A 2DR2A 2NM0A 3C3CA 2FEOA 4Q9HA 4ZYVA 4Q9JA 5EKXA 1EFAA 3EGIA 1QC5A 1NVWQ 3M0EA 4KDRA 4LKOA 1Z7EA 1UP4A 2FLKA 3COZA 4ZAVA 1Z73A 4HTAA 2DBRA 4D81A 5A4DA 3WWPA 1PS9A 4HAWA 5FNVB 1JXMA 1Z6YA 5HJ2A 3K6SB 3MWLA 3BJRA 3FY4A 1MX9A 1ZICA 5EE5B 3RRYA 3W6OA 4AKSA 1MB3A 2IOFK 5CGQB 1Z0SA 1TCUA 4PYJA 2B6NA 2J32A 2WILA 1XVAA 2XOKA 3LQ4A 2DFDA 5AVZA 2VBGA 4BIMA 4DC1A 3PFFA 3U4HA 5BP7A 1OWMA 1JAXA 3ZJ4A 3K8OE 1ZUWA 4P2BA 2A9JA 4JMPA 4AN4A 5JJLA 3NHSA 2F59A 4UM9B 1RPNA 3D7LA 3PK0A 4BNWA 2IPOA 3AY6A 3RYHB 4XKJA 1PQ4A 3VSEA 2GRUA 3E3NA 5K2MA 5HUHA 3DVAB 4HNAA 5LUAA 1QCDA 4LRXA 3EG9A 4LY6A 4QARA 1HM5A 2XNCA 4FLFA 3FLAA 4D8WA 4A2CA 3LF1A 1IHUA 4TLEA 4HL6A 1U2DC 1BA3A 5AVJA 3C45A 1NV9A 3H2SA 1Q0ZA 1YTUA 1C9MA 3F6EX 1HQDA 3L8DA 5KAPA 1NXSA 2GK6A 1NVVQ 1NVMB 4YT8A 1C7RA 3A1WA 3JTEA 3QEMA 4PQEA 1JU9A 3RYFA 3X1YA 1FFEA 2GZHA 1ZDMA 5ULLA 1UBSB 4E30A 5FWXA 4N5HX 2UYOA 1F7UA 1UXHA 1VIYA 1W5SA 4JJFA 4Q18A 1K2WA 2ZKIA 2ENWA 1T5SA 2PZKA 2QTWB 3EEFA 3T7CA 1SXHA 5BV1A 3HVIA 3UWKA 5K6AA 1VRWA 3AUKA 4GRAA 1J56A 3WYDA 3ZN2A 2BLNA 2FMHA 2Z5VA 1OLOA 2PZLA 5LZ5A 1CU1A 3H75A 4AECA 2WLSA 2D7CA 2WG0A 2FPXA 2TECE 1YFLA 4J4HA 2IU0A 3IV7A 1C7JA 2OLJA 5CD9A 4ZV4A 2BSQA 1YA8A 1Y63A 2CEKA 4YRQA 3ETJA 3OM8A 1PN3A 2RHBA 4AXBA 2IZ1A 2GM4A 2YZMA 5HGJA 3VSDA 3ETGA 2H4JA 4RQAA 1XYGA 1A50B 3KBOA 121PA 4G4JA 3THYB 1JTFA 1WCXA 2VHEA 3GT4A 4IGIA 5A03A 2FSPA 3F5DA 3QWAA 2IEGA 4FQ7A 3F6YA 1YA6A 3R41A 2PWPA 4MV0A 4I5FA 2QN6A 4CF4A 3UFBA 4E5PA 4F56A 3Q41A 4GXNA 3FB1A 1YHZA 3TFOA 1GFZA 2VJMB 4IOKA 3R6LA 3RO7A 5C35A 1LBSA 1GGVA 2P2NA 3INNA 3ZWMA 2WWHA 3SHQA 3QOWA 1ZC4A 3W3AD 2KBEA 1SD5A 7ADHA 4R0VA 3F46A 3EIEA 4FDTA 2BEJA 1QP8A 1I51A 2X2FA 2PGLA 3WRXA 2Z30A 2YJ5A 2IY8A 3CEMA 1WUYA 3IUEA 2BMJA 3FPFA 3IOCA 1WDKA 3S70A 3KALA 4WLUA 5IJ9A 3QX9A 3V1LA 1IVYA 3V2GA 2W98A 2G08A 2V0CA 2G77B 1U4OA 1D4ZA 2GS9A 2PXAA 1ONOA 3C6BA 4I08A 1F0PA 2FLWA 3FDFA 5K20A 1QANA 3AHIA 3NJ8A 4D42A 1M2OA 1XROA 2NX2A 5DN9A 1U4NA 2A33A 4C4SA 4MYDA 1BKDR 4H3KB 2OZLA 3JPWA 3SXJA 4AUKA 2HRQA 1LF5A 1QZ3A 2B8EA 1HYHA 1T4BA 1Z5ZA 1V5FA 4ZDWA 2QYHA 3VDNB 3X0DA 1KFCB 4B76A 5HM8A 4C7KA 2W71A 3MRXA 3EDOA 3WQHA 3TR6A 3W3AA 4NH0A 4D8UA 2XB2A 4OHXA 4FHDA 2RIPA 5BVGA 2QA5A 3ZYCA 2UZ1A 1NYQA 1YT5A 2ECQA 3FOWA 4UM8B 5JZMA 4I1PA 1D2GA 1QV9A 1P3Y1 2HIAA 1SEVA 2ZT8A 2JBAB 2WAAA 3KQQA 4HRYA 1XI2A 1SBYA 1DCKA 1DO0A 3FBWA 3B6JA 2GCGA 3V8NA 2LV8A 2MYUA 2IW1A 3I8XA 4DR5B 1FNDA 3D7RA 1BYUA 1E0SA 1KMIY 3GLTA 4G89A 4EIWA 1UAYA 1A71A 1QR2A 2ZYSA 4ZGGA 5JR3A 1WCWA 4LWOA 5DI3A 5EJ4A 3OZDA 2JJ2D 4JKOA 1BWRA 5REQB 1KU0A 4E0BA 5KPDA 1EHYA 4M8LA 3QA9A 5DGCA 4KR0A 1GUBA 1K6MA 1NQWA 2I3ZA 4ZVNA 3OY2A 5LYJA 4CMAA 4DUYB 1OPRA 3WXBA 1PLKA 4FE4A 4Q5IA 3OCZA 4ODIA 3BXOA 4AWBA 1PWHA 2DBQA 5DNCA 4C7OB 1ZINA 2XRFA 2Q7XA 3QOXA 5FYQA 4FM9A 3KL2A 1FZQA 1XWWA 1JIQA 2GO1A 2XT0A 1PR9A 2NVUA 2WF8A 4W1PA 3ABRB 2ZBQA 4JLKA 5T6MA 5BWLA 4Z3KA 4EB6A 3M82A 2WJPA 2EL7A 3R24A 3QPWA 4R2HA 4CKCB 3UXMA 1CJBA 5EG5A 4D0GA 1J1UA 3VYUB 3GYBA 1XYYA 2R1VB 1BHO1 5HIIA 1NN1A 1KJYA 3PDIA 1IVSA 2P3LA 3L46A 4TMKA 2UUOA 3NVDA 3PDIB 2PZAA 2XBMA 2QSJA 2HM7A 2NO1A 3R3JA 2IDKA 4COKA 3CEPB 2QMHA 1WXFA 2XMQA 3E22B 4JNCA 4QTZA 3HJFA 3GPLA 3TOVA 2JJ2A 4TQAA 2QD4A 5H80A 5I9LA 3OTOB 4P84A 3SBDA 1G8JA 3T9DA 1ONSA 5J4KA 2HA4A 4LX8A 3N58A 4N4AA 4BLQA 2Q4BA 1IY0A 1PSDA 2D0IA 1UMDA 2F43A 3AVVA 1I2DA 1NC3A 3F67A 3KWMA 4LQLA 1YDGA 1P5ZB 2ISCA 4WADA 3SF8A 2WWFA 3DDCA 4Y1RB 1XRMA 2WP8J 4UHEA 1DQZA 3IOYA 2ZYUX 4HDOB 4R0MA 2G70A 1GXSB 3SN6A 1BN6A 4RVHA 1EXMA 3UOAB 1P33A 2ETVA 1MJGA 3R09A 3UT5A 4BMPB 5KTTA 3R8FA 3COPA 2UAGA 4CL8A 1N7GA 4NS1A 2BKEA 2R68A 4XYEA 2XDAA 5AXBA 2IEIA 2PSFA 4JVLA 4CMEC 3KHKA 3HWX1 1HDOA 2JH8A 5FEMA 4U2BA 3IQEA 2YX1A 4EHBA 4FUTA 1N78A 1R8XA 1A95A 1OZAA 4ENRA 2NUTB 3KVRA 5T7BA 4ZOLA 3V42A 5KS2A 2HXGA 2Z04A 3E8XA 5DX0A 4L22A 1QP0A 2PIAA 3BMQB 3V8RA 4KXYA 2OBBA 5KSOA 2G1JA 4X6LA 3I61A 2G04A 1QXSA 4ZMRA 3KSMA 4LGCA 4HNSA 3STVA 4XEHA 3I6ZA 3EF0A 4MPJA 4I2NA 4Q4DA 3WRWA 3KQHA 3EPKA 2PKYX 2RGDA 3BXEA 5FR2A 2B20A 4R5HA 2ESRA 4N54A 2FWRA 3Q8LA 3JYLA 1E0AA 3LKBA 3U5ZB 2BELA 1T8UA 4D99A 1H23A 1QWOA 2H4WA 2CL5A 4CI0B 4HFMA 2ZOSA 3DR5A 4EG5A 1DXOA 3E8SA 3F5MA 3AFNA 4PM4A 1E1NA 4CIVA 3RM3A 2B1QA 1LH0A 1Q0RA 2EQBA 4ISCA 1VI6A 1FW6A 1NR1A 3LUHA 2P0YA 1OGIA 3FDIA 4RMNA 5IASA 4AMBA 1UP7A 1J24A 2HQBA 3UMVA 3SY8A 2OZEA 4ZIRA 4NP6A 2C84A 4J0FA 2F2TA 2R4UA 3WQSB 1CFZA 4OJQA 3EXHA 2NXCA 2E4YA 4AIRA 2FVYA 2HW8A 2DTEA 2GM5A 4H7HA 2IUFA 1UBUS 2OXRA 2HADA 2VTDA 1UZLA 3E48A 3IUNA 3TUIC 5LJLA 2OV8A 1PNOA 2OD7A 4JCCA 4LVUA 2W37A 3OX3A 4L2IA 5K5EA 3LCJA 1OXSC 1RKQA 3NIBA 4TUYF 2DFPA 4KFCA 2IPLA 1CLEA 2JASA 3LT2A 4NAUA 1K7SN 1RHMA 1Z75A 1FVOA 1L5ZA 3KU4A 1QGUB 3M81A 3O6VA 5ALJA 1UPCA 2H59A 2FUEA 4ACBA 4R1OA 3OLQA 1YE8A 1UINA 1N7JA 3BRWD 4AVYA 2YVKA 1NW8A 1R88A 2P9CA 2G83A 3T3DA 3VKUA 1JG1A 4Y2XA 4JLMA 3D3KA 4I4LA 4UNSA 4QOSA 2WW8A 2LP4Y 3TUZC 2OZPA 1PV1A 3L1VA 1S1CA 3IEKA 4MRVA 4XVRA 3GGDA 4GKBA 1GU7A 4LC0A 4A23A 4W5QA 3M1AA 4C2UA 3LHDA 3ETEA 1STOA 3LOPA 4DSZA 4RULA 4WJKB 4I6EA 5AKEA 3VNAA 4EEKA 1LPMA 3I9LA 3IIKA 4ZAXA 4K03A 5DW3A 3DGEC 1SBTA 3RD5A 1R1DA 1ID1A 3QU7A 4Z54A 4G24A 1HE4A 1IY8A 1QM5A 5JAQA 4UMDA 3NM4A 3WHPA 4YV1A 2BV3A 4I0WB 4QHTA 1C50A 2XBLA 1QG4A 3QWBA 3WSWA 5LQMA 1XVLA 1IN5A 4Y9SA 3H8JA 1E0DA 3EFHA 2IU3A 1E7WA 1W8IA 2Q62A 4HP8A 3QKRA 1CEEA 5EIBC 4O1MA 1YZTA 3HPQA 4IYRA 5TPZD 4AWXA 3CN9A 3B9BA 1E6WA 5JT1A 3CUYA 3DZFA 2WU4A 1UPTA 3GI1A 4QYMA 1JKJA 3ZBTA 1F17A 3P32A 5D84A 2PUAA 2O8CB 3TCNA 5JMTA 1YQGA 4XYGA 3HACA 3WGUA 2YWDA 1QDLB 1YONA 3ZZNA 1R0LA 1IM5A 2X1MA 4RY8A 2EGGA 1QHHA 3DXXA 4ZKDA 2YWJA 4TUYB 1EX7A 1J7KA 1FFHA 3OTHA 3B3FA 3WLFA 3UBMA 3FYCA 3HVKA 1FX0A 2CUTA 2UV8A 3ZVRA 3KEQA 4OM7A 2J5RA 3N6RA