4MWGA

Crystal structure of burkholderia xenovorans dmrb apo form: a cubic protein cage for redox transfer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
180
structure length
174
Chain Sequence
FKPDARFAWCVTGSGHLLDESIALALELPRADLFLSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAKCAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVWVELRPRAIELDNVERLSRFEYTTLVRSLDELKAALGERLSTLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative dihydromethanopterin reductase (AfpA)
publication title Structure of dihydromethanopterin reductase, a cubic protein cage for redox transfer
pubmed doi rcsb
source organism Burkholderia xenovorans
total genus 64
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4mwgA00
4ZANA 1E20A 4ZAYA 1SBZA 4ZAWA 4ZAVA 1QZUA 4RHFA 1MVLA 4RHEA 3MCUA 4ZAGA 4ZAZA 4ZAXA 1G63A 4ZALA 1MVNA 3LQKA 3ZQUA 2EJBA 4MWGA 3WISA 1G5QA 1P3Y1 3QJGA 4ZAFA
chains in the Genus database with same CATH superfamily
3PDHA 2YWGA 1SQSA 2H1CA 4PLWA 3PR1A 2JZOA 4YAOA 2IS2A 4XGNA 4X1YB 1TEZA 2VDOB 4P4UA 4J07A 4QJIA 2GEVA 4KQGA 3J80A 2H48A 1Z25A 3NT4A 1XAGA 3Q2IA 3QPVA 1YQXA 4QBIA 5AHXA 4BVHA 1LDNA 1SB8A 1FXUA 4OH7A 3RS5A 2HH9A 1U80A 1UFKA 2D1QA 2HUNA 4ND5A 5EJAA 3U1VA 4B2PA 4CKCA 1JMYA 5IHXA 3O93A 2QP4A 5HKKA 2RGNC 4YWJA 1T2VA 5TQJA 5KYYB 4YI3A 4LVOA 2J4FA 2P9BA 3SSOA 1KSJA 1QTNA 1ZGHA 2FV8A 1SVMA 4V0MA 1DFIA 1RWQA 1SVLA 3SIXA 3ZVRA 1QKJA 1FFDA 1VJDA 3EZ9A 1H8ED 3T1OA 3ZNOA 5LNK6 2VG8A 1CJBA 3T4XA 1JLLA 1NQOA 4YRRA 1BGWA 2X4LA 3NIDB 5CTAA 3U0VA 3X43A 5DNYB 1XFDA 2YRWA 1CF4A 3TNJA 3T06B 4TOIA 5MFZA 1DBSA 3MRVA 1XTQA 2JVJA 2XDYA 3MQ2A 1C30A 4G0XA 1FMFA 1YBMA 3PUXA 3PUVA 1LV8A 1QV6A 1QVRA 1N2SA 2WIAA 3EAGA 2VATA 3ME5A 2WHPA 1UFVA 1XHLA 3OD1A 1E96A 3UXEA 3O7MA 3TD2A 3IQDB 1Z07A 1QMPA 1Z0AA 4KR2A 3FW1A 2D54A 1ADGA 2O48X 3OM1A 4FK8A 3KDSE 4MYRA 4RY9A 5C8YB 3EH2A 3KKQA 5TMBA 5TPZD 1G2OA 2PKRA 4UMVA 3A6JA 1OPRA 5JW6A 3M3HA 3RAJA 2QTNA 1OREA 1PGNA 1RRMA 2P9GA 1Q1NA 4EUHA 2C5LA 3PFNA 2XWPA 1JIXA 4H77A 4N12A 1X38A 2GILA 2HL6A 4HGYA 2ZJ6A 1PJ4A 4K1XA 4IVPA 1RLIA 1MRSA 3GFRA 4I0WB 4WVFA 5KYVA 4A36A 3WK6A 1HUQA 4BMCA 5HK9A 1KAEA 1V16A 4M55A 4PXYA 5AI9A 3TW4A 1KIMA 3V8RA 4C78A 2L17A 2CVPA 1DBVO 1MO4A 1QH9A 1GUZA 4MP6A 2NSDA 4S24A 1WTCA 1RYHA 3PUIA 4PYOA 4XH9B 3WNZA 2WMDA 5I9SA 4CLRA 1D1PA 2OXRA 1S1CA 1Q7TA 3E27A 1TQHA 2AR0A 1KDPA 4P6VF 4UU8A 4F97A 1OF1A 5HXAA 1HQCA 4XR9A 5K0SA 3NORA 3RFFA 1G18A 3TEFA 1E3EA 1HT3A 1SQ5A 2V6IA 5JNTA 1HC7A 1UOEA 5DFAA 3F49S 4Z6KA 1RAHA 3EC1A 1Q44A 3DZHA 4N3BA 3STWA 4YMVA 1BS1A 2PJDA 3ZV4A 5K0ZA 1JYFA 1FNBA 2WP8J 3F6EX 1WZIA 4MW9A 4YUWA 1UFQA 1V8BA 1LD3A 4ZYVA 1NF2A 5BSRA 3UG6A 3WXBA 3RS2A 5IKOA 4P7KA 3RTAA 3MGBA 5IC4A 1WWKA 2QK4A 4P38A 4HP8A 3A9RA 3RT9A 1SKBA 1OAOC 3DEHA 4HWGA 5I6DA 1ISSA 2NQ2C 1E18A 1EX7A 1T9GR 1WSWA 2A14A 1R4NB 3OU2A 4MJLA 1JA1A 3REGA 2Z95A 2NVBA 1C3VA 2C1XA 2GCGA 2ZSIA 3DFMA 1ZNWA 3LJKA 4Z4IA 2FEXA 1JKIA 1XCGB 2A57A 1R0XA 3CO5A 2LUOA 4UDNA 1SQ6A 5EJ7A 3C5HA 3IR5A 3HLYA 3SX2A 3FR8A 3VR4H 1TUIA 4NU8X 5AVQA 1NC3A 1JAHA 2YMLA 5DTMA 2FY8A 2QF7A 3D31A 3DJFA 3AL3A 4PLYA 2XDQB 3URMA 5I3CA 5JY1A 2ET6A 2LVBA 1PT5A 4LXUA 1Z0JA 4URWR 4DB2A 5FWDA 3OBBA 1VKJA 1BGVA 1PZHA 4C4TA 2ZVQX 1CVIA 2OBYA 3BIFA 1KI6B 4P31A 4Q02A 1MPTA 3Q0TA 1ILWA 2BHLA 3FZQA 3NHYA 4TWRA 4NFLA 4UPVA 1IY8A 1QGUA 1RM5A 4QVKA 4MI1A 1NBAA 1A4UA 5IJXA 2UZ0A 4M8SA 1M6NA 4PONA 3OU6A 1NJ2A 3NG1A 1G5RA 1C9EA 4LBVA 2VZLA 4JB8A 4RMHA 1H2XA 1IN4A 4MEJA 3TQOA 3AETA 3LWDA 1NX6A 1V2GA 1YC2A 4JJAA 4MMYB 4ND8B 5CNIA 3WLFA 4PPNA 2NP7A 3CCFA 3PQ4A 2I3GA 3MJDA 3F67A 1R5OA 5DJ5A 1HMYA 2CXRA 3BH6A 1VLLA 3PDIA 5ITVA 1U90A 3JQGA 2EOAA 3C5VA 1ONOA 3EHEA 3QUCA 4HNRA 5EQJB 4DCOA 1X2EA 3SVLA 5JMTA 4ZI7A 4KXWA 1TEXA 3CLRC 2OQVA 1AMUA 2O2XA 5HCNA 4ND4A 1OFUA 5HDQA 3M0EA 1Z38A 2JDIA 5F78A 4QQ8A 2BISA 3OIUA 2ZRCA 1SUDA 3R0JA 1LWOA 1LF5A 3GB9A 1SD1A 1ND6A 121PA 3KKNA 4I9HA 2IXAA 1KNXA 3GJ4A 3QE4A 4O4JB 3GEMA 2UUBB 4JUDX 2Y8EA 1P1HA 4MVJE 3ZPXA 1EB8A 1YBHA 4FD3A 4V0OA 5EESA 4MITA 1N9GB 4YMSA 5G2OA 3P71T 1T1JA 3UWSA 1A82A 1YVEI 2Q1SA 3GLSA 1UPAA 3BJZA 5JRDS 1BQEA 1XALA 3ETDA 3VYSB 5A3QA 4R9SA 1M2NA 1VSUA 3T34A 4BIIA 5B1IA 1HDYA 3BSYA 5A3RA 2CCKA 1VL6A 1JQ3A 1U65A 2G1JA 2Q5JA 1M8GA 4WK6A 3SS9X 4AJNA 1IBMB 1C1HA 1YRQA 2W93A 3T15A 2EEPA 3AB8A 4TKVA 5J4HA 3I6YA 4ARCA 4KKXB 3RS3A 3T3MB 1EUCB 1A9XA 3JQ7B 1FFWA 4IIUA 1FP1D 3IS3A 3O8RA 3F6PA 4CCSA 2CDAA 1K86A 2A35A 2QSJA 3EGWA 1FYXA 3VNQA 4DDTA 1C1DA 3E7FA 2F1JA 1X15A 1M6EX 1GVNB 2CFIA 1WUKS 2X2PA 1G16A 4UUQA 3HB4X 4EVRA 3SJAA 3W5IA 3HWSA 4M6WB 1C4XA 2ZBQA 2I91A 1MHTA 2GOYA 3B2NA 3COYA 4ISBA 2NWQA 1TM1E 4TUYA 3RQSA 2H8GA 4B3RB 5T6BA 4RV5A 3ZQUA 2C5GA 2VJOA 4CKCB 4NOMA 1RZVA 1AK9A 3TR6A 4KREA 3WV5A 4MRAA 4B3DA 3M9LA 2QTVB 1QHSA 1TVCA 1V48A 3O4HA 4Z51A 4FFMA 3LHFA 2DBRA 2HQRA 2OV2A 1I0IA 1XZEA 2FRDC 2BEJA 2D2IA 2HWKA 2Y66A 3I1YA 4EFDA 3EULA 2BRUA 4KBGA 4C88A 1Z5PA 1JLLB 2VP0A 2P6RA 5CLHA 1TU0A 4QLBA 2HSZA 1N3BA 4LHZA 4C6RA 4EVSA 3KB6A 5IM4F 3EOAI 2QXYA 1K3UB 3I2YX 4M1KA 5BUZA 1C30B 2YRFA 3DYVA 3NHPA 5D5HA 1R16A 3L0ZA 4FS8A 2I55A 2WHPB 2PWBA 2VLBA 3NW9A 3OJEA 1CY0A 5BWCA 3QIAA 1M73E 1WE2A 1BMTA 5HKBA 3IP6A 5U4QA 1IVNA 1OKKD 4RF2A 3THXA 3BWMA 2H1LA 1FQOA 1CXZA 2HD4A 3JQAD 1QYWA 5J23A 4AJ9A 2R4QA 1HBJA 1J2EA 1SZPA 1I2BA 1X1AA 9LDBA 1VHQA 2Q3EA 1GLGA 4UBKA 1ECBA 2BFNA 2PD3A 4HH4A 1WD7A 4EPTA 3KHTA 3OY2A 4L2IA 4AQDA 3EWNA 3TSAA 1VYVA 3ZGZA 3ZDFA 2WV7A 3ANMA 1Z6YA 4B74A 3RVSA 4E07A 4NK4A 4J91A 4JJIA 4YWHA 2VRCA 4NFSA 4RM2A 3WWPA 4B7XA 1XJWA 5LSAA 1V16B 3G68A 2GMWA 3KZMA 2HK6A 1P2SA 3HWWA 4EI8A 2B9VA 5JBQA 4A1FA 1AGRA 1I4EB 4YFVA 3U09A 2P6OA 2CK3D 3U9LA 4QGGA 3L02A 4CLRB 4DMKA 1MB9A 3V8QA 4E4YA 3C97A 4JQCA 2QRZA 2FWPA 1EI9A 2TYSB 3PC7A 1IN1A 4PEVA 5F51A 2LKCA 4ZAFA 3W7VA 1T5DX 4BV3A 2EF1A 1ODCA 3ZLBA 5JDIA 3GDGA 3JASA 4PZCA 1B2RA 2J1LA 4U8GA 1R8SA 2CDBA 3IHWA 3OIDA 1QAMA 2D1SA 3VSDA 4C43A 1E2DA 1MB4A 3QU9A 3WHIA 5IBCA 5FTKA 2CC2A 3A1NA 4RJJA 1A2QA 3D7SA 3O4VA 1DBQA 3N86A 4PC7A 2DQZA 1DIAA 3OKPA 2A9OA 4Y2SA 1E2LA 4P5DA 3TSCA 3CLKA 4J8PA 3BCHA 1S2OA 1MN6A 2AQHA 1AHIA 1XT6A 1W5FA 3TLYA 3FMIA 3WLLA 3C3EA 4DIUA 4FC7A 1QPGA 2VF5X 4BXOB 1NJSA 1NLZA 3PNKA 3K9HA 2B21A 3RSQA 2I66A 1V3UA 1QYVA 2EU8A 3JU3A 4EMBA 2H2DA 3PYMA 4BLQA 4JKOA 4CQJA 2ADFA 4HDOB 4K40A 2D1YA 3LECA 4OHRA 4A92A 1VBMA 3JALA 4ZAVA 2IYSA 1IB0A 1XMPA 2ZXEA 1MVLA 4D0GA 3KQUA 1VP9A 4Z7JA 1Q1AA 2J45A 4JI1B 3QSGA 5G3ZA 3U4CA 3QFCA 4JELA 4L7QA 4F8JA 4X6UA 1KMHA 3G0BA 3OD5A 1JEYA 2PUBA 4P08A 3PK0A 2RHLA 1ZD5A 3ZDBA 5DX1A 2WIBA 1P5HA 5ICEA 3I2GA 2CNDA 1I9GA 4JI5B 1T0BA 2EKQA 4EGJA 4NENA 3AIOA 1OGJA 1Z56C 1T8UA 2ISCA 4FIZA 4DIBA 3L82B 1N6PA 1U0HC 3AETB 4IH1A 2FZVA 1U8CB 2V5UA 3BCSA 4CUKA 1YT5A 3OG9A 1OI3A 2K2WA 5J1SB 4YVFA 1FNNA 3CEAA 3FPFA 4M54A 1G6KA 1Q7GA 4AG5A 2D13A 3PHIA 4LSGA 3TK1A 1X9GA 3T1YB 3KJNA 2PN1A 1Q16A 1E1RD 1E5XA 1PCXA 1RQLA 1Y4UA 3JQGB 3PDIB 2ZBFA 2QD3A 5A7GA 3W4JA 1O6GA 1U28C 4A8JC 4EY8A 4WGGA 2G3YA 3HUUA 1P33A 2QW1A 3CH6A 2P27A 1Q0UA 3K0EA 3DZFA 2C4KA 3GLRA 4ROTA 1BH2A 3CUKA 1ZH4A 2J6HA 3IAM1 3N8HA 4TRMA 2BFBA 3AX6A 3FPGA 3TRIA 4B48A 2FX5A 4IG9A 3ZD6A 3ZVKA 1CVLA 1ELOA 4M3NA 1KJZA 4QTYA 3ZNPA 4RH3A 1ZVJA 1XDGA 2XMSA 2XXJA 1BVRA 2I4NA 3E1SA 5ERGB 3SAJA 3SDBA 3WFJA 4LSMA 4AYWA 2HSJA 4YRBA 4H1WA 2PL1A 5E2BA 1V47A 4Q7LA 1UMBA 3EZGA 1EDBA 2FN4A 1SVOA 2N3ZA 4KAJA 4I1IA 5BWLA 1O95C 3CG0A 2FU5C 3SHTA 2ECQA 3TIXB 1TJYA 3OY7A 4GM4A 2V45A 4ARSA 4CQMA 1OZ0A 2H57A 2WVGA 2RIPA 2WU8A 1RI3A 1CDDA 2HK7A 4H7FA 2WAXA 3NOVA 1SCIA 2C54A 2YMMA 5MFPA 3TZLA 4K28A 4F5DA 3ZI7A 1VPWA 2PUDA 2SBTA 5FOWA 4RXTA 3UEOA 2FSUA 3ZWVA 2IYEA 1CZNA 4Y2GA 2BELA 1VE6A 2D2XA 2W6JD 4XUGB 2CF6A 2OHIA 4D44A 2B1QA 4LZOA 3BT7A 4BLVA 1PT7A 1U7PA 2G6BA 2NO4A 3DO6A 4EUSA 1PBNA 2QGNA 4DV3B 1RXWA 1O95D 1E7MA 3AVQA 2VZ8A 5THKA 1C1DB 1OTHA 5DCYA 3LOQA 1ZBDA 2OWDA 4EYGA 1E4EB 4I1UA 2OZPA 2B98A 2VDNB 5EKTA 5EZSA 2ORWA 2WJ4A 3JRXA 7MDHA 5L6MB 3D6HA 4MGHA 1MJGM 5CM8B 4RHTA 2FRVA 4M98A 3ROTA 2F43A 1R6AA 4LJLA 2EARA 1T91A 1MVNA 1WA5A 2YV2A 2RK4A 1NUAA 3ILYA 3GEDA 1E1LA 1PJ2A 4M8KA 2X5OA 2FA9A 1S8OA 1OA0A 3W90A 3PTAA 2R6JA 1DBRA 1VIMA 1WMEA 3M6FA 4YGXB 5HUHA 1W47A 1U8TA 3LVFO 4IJWA 4UQPA 1YA8A 3PS9A 2JASA 1DLJA 3QOYA 4WKBA 1QIMA 1QMGA 3K6JA 1KZ6A 3MWDA 3NYIA 2QAGC 3HGMA 3S5JA 3WBJA 4TN1A 1MAAA 4XFDA 4F1WA 3K9FC 1KJ9A 3RUCA 3BQ9A 2F9LA 2XPCA 2G4LA 3H5AA 2YXEA 1P1KA 5AHOA 3AOEA 2BY4A 4IHAA 1FK8A 4M9SA 3RSLA 3F7OA 2H7CA 3RUFA 3RS0A 3EPKA 2GJ9A 3PVCA 3NTOA 3NALA 4K03A 4MKZA 3TKLA 2O5EA 3SYLA 4E4TA 3T9FA 1L4FA 1I7SB 3THXB 4KXUA 1JDPA 4JCCA 5AVSA 3G13A 3RYTC 4O02B 4IY1A 1XQXA 3ZYCA 4Q6BA 4PYIA 1SIWA 1CD5A 1SOAA 2XV1A 3H13A 3PC4A 3OZGA 1E61A 1AT1A 4GI1A 2FG5A 1LI4A 4GL4A 4L2IB 1D6SA 2O3UA 3KOUA 3U7RA 1UXHA 4EA9A 3ETLA 4Z3KA 1QF9A 3KOYA 4D46A 4EI2A 4QREA 1IN7A 2JAUA 1G8HA 1OXBB 2B4RO 4HB4A 1VL2A 2CN1A 4DBVO 1H6DA 1XVIA 4LN1A 2E6KA 1RE0A 5BN4A 4EAAA 3R09A 4GOND 2O20A 1SELA 3F90A 4RVOA 3CW9A 4L5JA 3KELA 4KJXA 5CLFA 3LUFA 4D9KA 1YR7A 2Z8YM 2A1TR 4Y0AA 3MCVA 3QLTA 4Q1DA 1J8QA 2VTVA 1OIVA 3H17A 3JZMA 3AJ8A 3SYTA 2X1MA 1BCRA 3OTWA 1SKAA 2PYDA 4HC4A 2WYHA 2I6FA 4UM5A 5BRNA 3ZYZA 5HWSA 1SEVA 4CCWA 3ZY3A 2UUCB 3JASB 1MT3A 2VT2A 1Z4JA 5DHUA 3PC2A 4OLHA 2QN6A 5IEJA 2KPOA 4OMCA 5BVHA 4FFDA 4NFYA 1ZMBA 1BKDR 2YQ5A 3HRHA 3HYRA 4DDWA 2JVKA 1OWMA 3IR7A 4FBLA 3TAUA 3VX3A 3P32A 1Z7GA 1W0KD 3TLMA 5CT8A 4YP1A 5LQNA 4Q15A 1FBNA 1IHUA 3D02A 4H7JA 5KSPA 4E6PA 2CLFB 1EWKA 4DR5B 3WAJA 3Q3GE 5DX8A 2Y1OA 4JL6A 3KHKA 1PUJA 3HVKA 3UHAA 4DVGA 3LC7O 1Y5LA 3JVVA 5K0TA 3VNVA 2OFOA 3EW7A 1HG1A 1IEXA 2IEGA 1ZHFA 2OORC 2WC1A 3FBGA 3M6WA 2QZJA 2GESA 2Q49A 1CUUA 3AEZA 3JALB 4ZP1A 2C9OA 4CQLA 4G5FA 3RRXA 4BZPA 3EUAA 3GI1A 1K75A 4IXWA 3ZH2A 3LP6A 1VIVA 4HAWA 3UA3A 1ECPA 1ECJA 1EK5A 1P19A 4NV1A 3IQHX 4KPUB 3BBPA 4UAJA 3O38A 3DE3X 1JEYB 2YR0A 1FY2A 1YULA 1ZQ1A 2AFIA 4CM6A 1C0KA 2GJAA 2IUUA 4KAXA 4BMYA 3H1FA 1YCDA 1WHTA 2PXXA 3SFTA 1CQIA 4NENB 1ISJA 1JMVA 1AUQA 1G5IA 2RAVA 4F38A 3CN9A 3MRXA 2H65A 1U3WA 4U02A 2W2XA 4L5BA 4LDZA 4PCLA 4YBZA 2NVWA 1OXTA 2ONCA 1NWHA 5LA6F 1XEXA 1G4UR 2YYZA 3F74A 2J9XB 2YW2A 3E0QA 2W2NA 1THTA 4ICIA 5K8VA 2G4CA 3EUFA 4ESEA 3GNQA 4EHDA 2UU9B 1FRVA 3K4PA 3QPCA 4QC2A 2GHQA 5D8DA 3M5CA 4QUGA 3V42A 3ZJ4A 1JE1A 2WZDA 3LQ4A 1URPA 3PQ3A 1JXMA 3CSSA 5BXQC 4EY6A 1VG8A 2AXNA 1ORTA 5HM6A 1T3HA 4H7IA 3IEKA 4HQLA 3O95A 2CLDX 4H1TA 3A37A 4JAVC 3C8UA 2QD5A 1C81A 2BFBB 1UFRA 1RTTA 2ZK7A 4P36A 1JHAA 3ULKA 3MQFA 3TZHA 3AILA 3RWMB 2P2CA 1FFYA 1Z0IA 2H5JA 3AHIA 4XX0A 4BQQA 2WAMA 1J56A 1GZ3A 2AV6A 2WHEA 5KYUA 5ALXA 2OGSA 3KV3O 4LJYA 3O4GA 4UD2A 3WGMA 1UMBB 4GUDA 3S55A 3WWYA 4DJ5X 2IOQA 1ZI6A 1YONA 1JNYA 5GZ3A 2GPNA 1UC8A 2WWXA 4CQMB 3OLQA 4C0KA 1JAZA 3QPAA 3CX6A 2BL4A 4TTRA 4GKAA 2JFBA 1TJNA 2AB0A 2CD9A 2W7TA 3Q9NA 3GNLA 1JEDA 1C3LA 1ZCJA 4JQSA 4MWDA 1CE8A 1HQKA 4KC0A 1O5IA 1R64A 1Z0DA 1UMDA 4YP9A 4FX5A 2HDWA 4DDKA 3VYRB 5LKAA 4HGNA 2DQYA 4YIHA 1L3IA 2HCFA 4ZT5A 2H1FA 3CISA 4RSMA 1T9BA 3QA3E 4LUCA 5E2IA 2PMBA 4O2AF 2YXPX 2XOXA 3AV0B 4A0HA 3QE9Y 1J07A 2XCIA 3S2UA 5AOVA 1ECFA 4WUVA 3C41J 3GT3A 4HSGA 5FRDA 1IHYA 2AC7A 2M9MA 2V1XA 2WQZA 2CXXA 3DMRA 1RYZA 1GPJA 3DZGA 1WF3A 3JYPA 4UE6A 5JALA 1P9WA 1EPUA 5JD6A 4P92A 3W78A 2F43B 4RTRA 4JYAB 1B76A 1CDEA 2H0RA 5FD8A 1K7SN 1U04A 1NU8A 3Q5DA 4ZQFA 2DQ4A 5HF8A 4Q4AB 3T6KA 1ADBA 1UJMA 2DWCA 2PTGA 3D54D 2CGEA 4I99A 5FPPA 2WNHA 2AXPA 5FWAA 4YHHB 1VMKA 1VBFA 3QPBA 1YFLA 3AR2A 3D6FA 3HM2A 4X6LA 2Z3WA 1MQAA 1R8XA 5ICGA 2P79A 1YE5A 3OT1A 3QE2A 4Z0HO 2P7HA 2QLBA 1RQ7A 5IM5A 5LQRA 3NUZA 1VGRA 3NHZA 3OQPA 2PBLA 2RB5A 4CM1A 2BJHA 4H4CA 2X5XA 1S4QA 2BCEA 4FQ7A 3MWDB 2J4CA 1RP7A 1IXSB 1VCIA 2IYTA 1ZO8A 2BD0A 2OHFA 4XXHA 1EH5A 2ZBUA 3A9UA 4Z8YA 5TEWA 3M6VA 1NBHA 2HDHA 3R6LA 5K3DA 3RI3A 3RSOA 1F60A 3PNPA 4GNRA 2FFHA 3CWQA 4XJTA 4K87A 4G1MB 5FQNA 3RKSA 1CY7A 3UMVA 1GCGA 4WXHA 4K3VA 3PUHA 3ZZ0A 4R0MA 4YV2A 2F8SA 1OBHA 5ESRA 3KSZO 4O6VA 4XLLA 1GSIA 2WF5A 2WDZA 1J99A 1BA3A 4EBBA 1MHPA 1T3ZA 3DTYA 1KEWA 3NHBA 3VHRA 4D3SA 1R10A 2QPAA 4HH0A 3D8SA 3E9RA 5DBEX 4B5LA 1UDBA 2QW8A 4KE6A 1F20A 3OZCA 5J63A 1P4AA 2GBCA 4ZVRA 2PJUA 2YH2A 1JTVA 5BO5A 3RVRA 4CMAA 2JJ1A 1D8TA 1TZ2A 1X86B 2IZ5A 4I4LA 1DAFA 2FPMA 3HUDA 4IGAA 4PXAA 5JSYA 1YZKA 4G4JA 1OB2A 2AMFA 1NVAA 2SNIE 2XKAA 3AB3A 2YN0A 3ZD8A 2WJHA 5F9HA 2NU6A 4LOAA 1YUNA 5GADl 1BVHA 3GRKA 3N8GA 4BFXA 1BCRB 4I4CA 2AZXA 1B14A 4EW1A 4IDEA 3HXTA 1MB0A 2ICAA 3LG2A 4R9NA 4HMPA 4KO2S 4CF6A 4WLUA 5B12A 1APBA 3Q9SA 1G98A 3C5WP 4GDMA 4PG8A 4BO9A 1DTWA 1QWSA 3OJOA 2ZUEA 1US8B 2AD1A 4HY3A 1Y8ZA 1W35A 2Q2WA 4K8OA 5BVHB 4LYFA 3IV6A 8OHMA 1I1OA 1N7IA 2XDWA 2Q6TA 5DOVA 4DLKA 2BEKA 3LDHA 3THOA 1KQ3A 2YOFA 2BKXA 4LGVA 4N4AA 4D5GA 1JQ5A 1DEXA 1LBQA 4J1TA 4EX7A 3AOGA 2QN9A 1NVBA 2O2IA 1P4SA 2V7XA 2QUBA 1L5VA 1DJNA 1JHVA 5A02A 2DKNA 4U6NA 3IMFA 1YA4A 2ZIXA 4LOJA 1B8PA 1R4MA 1UBSB 3GGJA 4D74A 2H0AA 3L7IA 2PZGA 5F12A 1EAYA 3MD0A 1FDUA 4MQEA 3LK7A 3HJRA 4B6JA 1EVIA 4J0JA 3F1LA 1GNQA 1JIQA 2EJVA 4PYQA 4YHBA 4CQLB 1EGMB 4L22A 3DV9A 1YBAA 4MR8B 3V4VB 3EA4A 3H65A 1PGJA 1IHXA 2Q5IA 4DLLA 3AUYA 4WSOA 3W3AH 5CVJA 1FYVA 5FPQA 1QPZA 1Q3KA 2WB4A 4B7AA 3PJRA 3M4YA 1Q74A 1RI5A 2YJ3A 3CN7A 4X41A 1ZMTA 2AFIB 4GPZA 2Q4TA 1F0KA 4WFKA 4LK3A 4A1OA 1WHTB 1PI3A 1SRQA 2CSUA 9GPBA 5LD2B 1CQIB 3P2KA 2GA9A 4FWTA 1LJUA 1IK4A 1E1QD 4QYMA 1I01A 3UWDA 4JVOA 2Y1LA 4UULA 5AVTA 3C16C 4HQ6A 3T8YA 4MYUA 2YOHA 1OY1A 2O7VA 1JQJC 1NYQA 4PAWA 4QQFA 1XZDA 1D09A 1XEXB 1M66A 1V3TA 2YVAA 5I8PA 1UL1X 2G28A 3NRCA 3CX3A 4OMFG 3U3RA 3ZQJA 3O5AA 1QZUA 2Q07A 2PWYA 3CKKA 4FFRA 1PT9A 5SICE 5FIUA 5DHFA 5LB4A 1ADCA 2G63A 2PVCA 1HDIA 3M3DA 1FSFA 4A6DA 2J6CA 2AFRA 1CUAA 1Q12A 4C76A 4CKEA 1D4OA 3OA2A 2QA5A 2J9GA 4MKRA 2F1HA 1Z17A 2BZ1A 1NG9A 4B76A 2AH5A 2CMHA 1ZESA 3CZQA 2O07A 2LCIA 4XX0B 4MH0R 1CRZA 1ODJA 1U6JA 1YCFA 2O0JA 3F5DA 4N0MA 4XPIA 3MMXA 5CVDA 2BSXA 5KYUB 1YL6A 1GT6A 4PAMA 5CFZA 5JZSA 1OAAA 4URYR 3RU7A 1XAHA 2FYTA 2XYVA 3QF4B 4QDJA 4X0EA 1F2TA 5H9VA 2B5OA 2UUOA 2I2WA 3ESCA 2AMYA 3X1DA 1FFBA 4JWTA 4KXQA 5DASA 1XC7A 1PJCA 4YXWD 4F60A 4ISCA 1Y89A 2Y1DA 3UPUA 4QLOA 1L5YA 2DQSA 2NO7A 2EG9A 2X5JO 2QRQA 1JZQA 3AO0B 1CKEA 3ML1A 4I50A 4DM7A 1XLWA 1ZLYA 1CE8B 1WEKA 3JD4A 4GRAA 4MV3A 1DJPA 4MX8A 4Q47A 1CQZA 2SECE 1XI2A 4TVOA 3ZEAA 1QHFA 4BX2A 1OI7A 1W4AA 2ERXA 2PBRA 2WD8A 1KDOA 3FWYA 3KQMA 1YHZA 4K1LA 4TZTA 3TQHA 4NZNA 4EARA 5LMNB 5L51A 5J2TF 1SG9A 4P53A 2FEPA 3MYRA 1OILA 1K8ZB 3MWGA 4DMMA 3K53A 2ODQA 4DLZA 4Y9SA 2UDPA 4YMWA 4CTOA 1QE3A 4BKUA 1CY4A 5G1OA 5M5BA 1JB1A 1YUMA 2C7PA 1ES9A 4ENSA 3IELA 3OQMA 3OOEA 4MCAA 4TTPA 4D97A 1NBWB 1N6LA 4FFNA 4UQOA 2PHZA 3GARA 3T1HB 3HP4A 4EIWA 1NTOA 1XO1A 1SC6A 2CD7A 1W85A 4FFOA 2F3PA 2YYAA 3FVWA 5GMOA 5CM9C 4RBNA 4F3CA 3WFZA 3T3OA 3KUDA 1FEZA 4BJ1A 1G21A 3I9NA 4UUBA 1GL3A 4XZ3A 2QT1A 3S29A 5KYXA 2VJCA 3DOEA 4KEAA 3LXMA 5EJEA 2D62A 4WEOA 3KLOA 4ITUA 4KO8A 3OT1B 1H8EA 2JFZA 5HFJA 3O74A 3O91A 3VKGA 4HDSA 4OHWA 3MTDA 3BUSA 1R9MA 1ZCBA 4JR1A 4R2LA 4XQGA 4YCAA 2Y0CA 2JIRA 4XASA 4UU0A 1R9JA 3EE6A 3K5IA 1EJ0A 3X1ZA 4WMLA 3V46A 5K4GA 5KOJB 1OI4A 1QJCA 5MN6A 4CGZA 2ETVA 1OFGA 1EXDA 3PXDA 1FZQA 1JKMA 2OBXA 2QX6A 4ZOQI 3HBNA 4WDQA 3PFIA 1E3LA 1KJ8A 1JE0A 1KFJB 5TSDA 5KI6A 2PS1A 1ULBA 4B71A 1XPOA 4BNXA 1Z62A 1UT5A 2X8JA 4N0QA 1Y63A 2ZAYA 2DR2A 1ONPA 1A9TA 1FDVA 1FYDA 3GFTA 4XCXA 2BAGA 1VDZA 5JT1A 3H1GA 1ID8A 3EA0A 4J76A 2VBFA 2ZWVA 1CZKA 4HB2A 3QLVA 4R8RA 5DDIP 4PIPA 2AIRA 2IZ0A 4UHFA 3QJ5A 4JQYA 3ENWA 5BORA 4KZPA 3DT8A 1TVKB 2BM9A 1ZIYA 2C9BA 2Q0QA 2Y1WA 3LPCA 4P3OA 4KUHA 4AUKA 2AG6A 3Q3VA 5E0KB 1L5WA 1V5IA 1YKFA 2PL5A 3Q7QA 1YIDA 2NN3C 4JU8A 4FKBA 2IY9A 1VHDA 2XUHA 1GDTA 1UAYA 1A9SA 3BWEA 2P77A 3KLMX 3ZY5A 3LPAA 3IAS6 4XD7D 4MYCA 1ZLXA 3ITNA 3N0VA 3HLTA 4HLUC 2DBYA 2FDRA 4WACA 2FP3A 3TZKA 3TTWA 2QMOA 3DA8A 3NHUA 1SG6A 3L6EA 4TVSA 3HVUA 5BRJA 4M7WA 1FFAA 4DXHA 4FINA 2VXYA 1A0OA 1XQYA 2A5GA 3DOOA 5TGDA 4XJSA 1LW7A 2AYXA 4XQEA 3F7MA 4CIDA 1JEEA 2EJTA 3IE0A 1DTWB 1GKUB 2IUSA 4NDAA 1XRRA 1HTTA 3L7OA 2PK3A 3IAXA 4GC9A 4MUHA 4GW3A 2WJWA 2JZNA 3V32A 2JAWA 1JPNA 1ODSA 3ED5A 4M37A 3BXHA 3BDVA 1I3NA 4PWZA 3IJEB 3RABA 3U39A 3I23A 4P93A 2XNDD 4L75A 3W8EA 1Q3HA 1TGVA 4MPDA 3CLHA 4R5MA 5BN1A 5GJWC 1JDSA 3LDFA 3BRQA 2XUIA 2NNWB 2VO1A 1PDWA 3QMMA 2CY0A 2V6MA 4FHZA 4V39A 1LBEA 2G82A 1DCMA 5TGZA 4YQFA 4U2FA 2YNMD 4FLEA 5C4GB 1PG5A 1PR0A 2X0RA 2ZIXB 1R4MB 1W5TA 1DNPA 2WVAA 3D5TA 2LKDA 4N39A 3RT1A 4CG2A 2GA8A 1EUDA 3G6KA 2GN9A 1SCQA 1W2GA 2LCQA 1EYZA 2ZIFA 1TJ3A 1JRLA 3ONNA 1EGQA 3AR9A 4CETA 2ZSFA 3ORFA 1MJGA 1PBTA 3DAFA 2JGKA 4MRSA 5E9WA 1SBTA 4OQYA 1SWWA 3MTIA 1PS8A 4B4VA 3LF2A 4EFMA 3R0QA 2GZAA 1RJFA 2ZWOA 5FP0A 3ROEA 4LQDA 2QPTA 3E5NA 1GQOA 5EKXA 4DJDC 1H2RS 5C52B 5M04A 4GPEA 4GVLA 1SBIA 4CL2A 1NFFA 2FKNA 3JAWA 2HM7A 4KYVA 3B6ZA 3U7HB 1TQDA 2HYDA 2P40A 4C3ZA 1NBEA 2PH1A 4MARA 4E11A 1Q6YA 3NPAA 2F1RA 4QGSA 3DAOA 2E5FA 3MMNA 4NYMR 1F8UA 5CJ2A 1X9HA 5F7XA 2R44A 1NN3A 1UQRA 2YW9A 1QVAA 4PR0A 4MVJD 4N3GA 2WFLB 2O8FA 2IOFA 3RFTA 3UCFA 2O8VA 3ZHSA 3KUXA 2AC2A 1AC5A 2ZI6A 2DWUA 4JVNA 1TIBA 1WVMA 1KJYA 4NZPA 3COPA 4RIGA 4TTJA 4A8TA 4ABTA 3TZQA 4A10A 4BFWA 3ENKA 4EOGA 2EYUA 4MZDA 4U0KA 1OXXK 2V7QD 3V1LA 3W34A 4AF8A 4BLOA 4TMVA 3AF3A 3A58B 5LD2C 2QV0A 4CKEB 2O4UX 2A78A 2B0JA 4C0WA 2VEDA 2R6AA 1U3VA 2XY4A 1U8FO 4FCCA 5F3RA 4BNFA 2ZP1A 4OXQA 5E7IA 5FFMA 1WXFA 1X92A 4JOQA 3SI7A 4EPYA 1NJ5A 3ZUGA 4BYGA 1MDFA 3DR3A 4GLFA 1XXHE 2QWXA 4NBLA 2DJIA 3BJMA 3N58A 1KARA 1SK9A 1R1DA 3SHOA 1MC8A 1T29A 3KEGA 4DSTA 5KYNA 2JRCA 4C5CA 2JFXA 1GO2A 1PGPA 2P69A 1ZOIA 1UBHS 1GZ7A 1HTBA 4I50B 4FONA 1W0JD 1U8XX 3RPEA 5M2QA 3SD7A 3K1JA 4R51A 3DPUA 3WRXA 3KAJA 4C89A 1HE8B 3IYLW 2WT4A 4XVUA 1Z39A 2WMNB 3RJ9A 5LNK1 3HGTA 2ZQZA 2R6GA 1P62B 4JBLA 2RHJA 3CRQA 3P2OA 5K01A 2FW7A 3ZWPA 2I6UA 3RRBA 1P72A 4YLYA 2GBLC 1HF3A 1EWYA 2WZCA 3W9BA 4EEKA 4YRAA 4ZN6A 1JKFA 2VUUA 1UC9A 1KXZA 1E3TA 1DFGA 2CLOB 3F5FA 4PVDA 5KVQA 1IPHA 4JI6B 5C1OA 1SPXA 2ZJ7A 3S81A 4N40A 2AYZA 1Y42X 2GZMA 2GYUA 2DWPA 2GYYA 1XZMA 3E15A 4MUAA 3RRMA 4EA6A 1W85B 3ESAA 4Q05A 1BN7A 1P9RA 2GJ8A 3OJ0A 5BV0A 5KQRA 2VNHA 2D5BA 1VFPA 2RIRA 1G21B 4OHVA 3AWIA 3P1JA 1J8DA 4G0VA 3WQBA 2DT5A 2YFQA 2ZRGA 3D4PA 1RFLA 4AY3A 4ZT4A 3U1BA 1FDRA 2NV6A 2X1LA 2XCUA 1UJ5A 1SXHA 1E2UA 5EE3A 3M83A 4HDSB 3A4VA 1IY9A 1I3OA 2DH6A 2R84A 2HJSA 1XWIA 2XRFA 3JV7A 5CDSA 3JYQA 1KTVA 1CW2B 3DZ8A 1B73A 3U3JA 4AMVA 1XTRA 1KF0A 4V24A 3MQ4A 1Y80A 3HQ4O 2BBWA 4OVKA 2YFKA 4US0R 2R8RA 5DLQC 2CBZA 3HXPA 1NVGA 3QVMA 1WF6A 1I0LA 2IP4A 3CLUC 3MWJA 1STOA 5G1NA 1OKKA 3F6CA 3ETNA 1EZ4A 2I3BA 2FDXA 2X8JB 3R20A 3JQAA 4HGRA 1O96B 1XDBA 5HA5A 2G71A 2P41A 1HDEA 3G1UA 5ADWA 4EY4A 4URFA 6ADHA 2FUKA 3HCWA 3HKBA 1JDUA 3AZPA 3GBVA 3LBIA 5GVSA 2WWRA 1AQJA 1BHO1 3MCZA 1W87A 5KKCA 3JD2A 4I55F 4YRFA 4D5EA 1H0HA 4MW0A 4ZJUA 4C14A 2JEYA 3EWSA 3K94A 4MJ7A 1U1CA 3LTNC 3LKDA 1JEAA 1D5CA 1TJPB 2Y99A 4JHXA 2HQSA 3LCCA 3HACA 4HADA 1U2GA 5L53A 5CDUA 4GXNA 3UICA 1Z13A 2E4WA 3B9PA 3W1WA 1W6UA 4YP0A 3ILHA 1LPBB 4G23A 1K88A 3EMBA 1Y9EA 2CK3A 4L4RA 4EZEA 1DBIA 4FP9A 1QVVA 3E5HA 1L7RA 1JSLA 3DDNA 4WWHA 4C7XA 5CVVA 4AS1A 3EJ6A 4WQMA 2QI9F 1W73A 3T7IA 2F1OA 4JUFA 3R4CA 4HDCA 2RGUA 1T3LA 4IIVA 3O75A 5GM2A 2P2SA 1M2OA 2VHQA 3D7RA 4LMBA 1F1JA 5JXIA 4TLCA 2ZJFA 4XIIA 1ORVA 4GL2A 1W59A 2NPOA 5JC8A 1D1TA 5DN6D 2QR3A 3DOHA 3QHQA 3L0OA 3VOTA 1PHPA 5AUOB 4MQ6A 1ZVVA 5F21A 3WYNA 1VKOA 4TS3A 3KD2A 3NM6B 3F5MA 3BHJA 1KNQA 4NL4H 3TRHA 4KI0A 4X44A 4KPYA 1SBHA 3IUBA 1I4OA 3QVXA 5JSFA 3I61A 3OQVA 2QDXA 4TKUA 2D8MA 3KTOA 3AVWA 3HV0A 4HI0E 1JT2A 4HF7A 3BTVA 3K09C 3LRPA 5A5FA 3ZU5A 2QRMA 3VO8A 3ZU6A 4Y9RA 421PA 4MV0A 5A4JA 4QU0A 3PGXA 1JDBB 3QW2A 1EUDB 1EAMA 4GOOD 4RPGA 2QJTA 5DNEA 5T4EA 5K8JB 1V4BA 2IOFK 3ABRB 1IZ0A 2GZSA 5ILQA 2V1UA 1KGDA 3PLAE 4XSVA 4MLPA 1XTZA 2J5QA 1NR5A 3LBYA 3A1CA 4NE9A 2A84A 1N2XA 4ES6A 1WCWA 1TUEA 3C1AA 1KJJA 4IUDS 1M74A 1P5JA 3VR3D 3PC3A 3OTOB 4ZODA 1TT5A 1Y3CE 4FMPA 3UW1A 2VDJA 2XEXA 1P2VA 5FUBA 3VOBA 1HZJA 1MXHA 1OFUX 4EVQA 4ZT7A 4PX2A 3DD5A 1KEEA 4BUZA 1ZS9A 1T0UA 1J21A 1EQAA 1PNVA 1NT4A 1X77A 2P9TA 3A1EA 3N87A 4O2BF 2Z2KA 5DGHA 3R3HA 1Y82A 4Z9YA 3T3NA 1IPEA 1GL6A 3SLKA 3ND5A 3DMPA 4FI3C 5B4VA 3AI2A 3P2IA 1E9EA 4RKEA 4DR6B 1RWVA 4GMXA 1E1RA 3G89A 3L4EA 3GAZA 3ZK9A 2PLNA 3EIQA 1AK1A 3QUAA 3RUAA 1C4WA 1J49A 1PTKA 4AF7A 1QIDA 3KAKA 1SJ9A 4KXMA 3GR6A 3X1KA 4B6RA 2QVBA 1A3CA 1K4YA 2RBGA 1VHWA 4OI1A 3OPVA 3V7WA 3WNDA 1CYEA 2C8KA 1Y7TA 1DEHA 2QTMA 1N0WA 4KIUA 2GRAA 3UNXA 2GEBA 1QHHA 2FWMX 2JLQA 5EKUA 2FEOA 3HJTA 5IDQA 4B84A 1WIWA 1ZU4A 2ZTUA 3BMCA 5EP1A 3IRUA 4Z0TA 5GIOE 1N1DA 3D8BA 1MX3A 3T12A 4L16A 3ZS8A 1X42A 3I72A 4A7PA 2AG1A 4TRNA 3EEYA 1EJBA 1FIUA 4II2A 4RCYA 5ULLA 4RFVA 3QOWA 4GOLD 3UH1A 1TEVA 1W75A 3FLEA 3WAKA 4EW6A 3BEDA 3BJIC 4C29A 3R3UA 2PZJA 2NO0A 3EEFA 5K6RA 2QVYX 5ICFA 3CR3C 4QYSA 4JOCA 1DELA 1YHNA 3Q8LA 2W6JA 3TKYA 1FE8A 4AQYB 2ZJOA 2GEFA 4OU4A 5IKMA 2WJIA 2FCAA 3VPBA 4E1BA 2QU8A 5ALKA 1HA3A 2CCGA 3KQSA 2R7LA 4CDRA 2CNNA 4GOJA 4G0QA 4YAIA 1O95A 3GGOA 5EWMA 1INLA 1NOIA 1KR2A 2XTZA 3GLUA 2DSNA 1VRWA 3R0XA 1KZHA 2VA9A 3K30A 3MPOA 3S5UA 3SJBA 2OOSA 2FEWB 1R0LA 3KQQA 4DV0B 1C7EA 2Z4RA 2OT3B 4HFMA 1NXVA 1TW3A 4HLQB 2WUGA 3INNA 4QUKA 6REQB 2PZAA 2W00A 3EIEA 1AIPA 4WKGA 3ZWOA 1LUAA 1X94A 4YAUA 4KQJA 2Q3MA 2ID4A 4UDYX 1B0PA 1N6HA 4FZJA 4L95C 2GTPA 2AUMA 2N42A 3E7XA 3U56A 1QQ5A 3GMDA 4KQ1A 4NULA 1KAQA 3G9QA 2NPFA 1DKPA 1LBIA 1YNSA 4B40A 4M86A 4W1QA 2WOOA 4OXYA 4OJYA 2AA3A 1JIIA 1S3IA 1YZLA 4FYYA 5FNVF 5AJZA 1SHTX 3VH2A 1W5SA 1B23P 3GDHA 3O9MA 2IIBA 3A9SA 4UDXX 3EAQA 4ZO4A 2VP9A 4D9CA 5BR1A 1J2RA 3EIXA 4PANA 1NF9A 1ZH8A 1CUIA 3GJQA 3L43A 3LY9A 4FZRA 2Y1FA 4HYQA 1NW3A 2XBUA 2HJRA 2FSHA 3M4ZA 4J0EA 1SCBA 2BFFA 1AUVA 3MJSA 1T8SA 2CLSA 3CW8X 5HS6A 1G3RA 1J0CA 3L77A 4JP5A 2W48A 1UMCB 4LS3A 2QKYA 1V4NA 2XDAA 5AI6A 1PUXA 4GQAA 4MVJM 1F6DA 1R6DA 2C5AA 3HSSA 2HJVA 2IP2A 4I36A 2MIIA 1N8KA 1Z47A 4NEHB 2UZ1A 5CW1A 4HLNA 4EZBA 1XNJA 4LV8B 5LYJA 2C03A 1G1MA 2DOKA 2HOQA 2YUIA 1OV4A 3TQFA 1F6BA 1NU6A 3JQAB 1OC4A 4J75A 4LXGA 1XKXA 1RRKA 3SR0A 3VR1A 1IBKB 1DAHA 3PUYA 3RYFA 3HKBB 3RGGA 4I1RA 3MT7A 5FI3A 1Y9JA 2X77A 3FE2A 2V7PA 1IM2A 1WP4A 2RHCA 3LBNA 1HFJA 2CSXA 1ZI9A 1FTNA 5E95A 2RBKA 2CZQA 3VNRA 1QZZA 3IBCA 3JWIA 5WRFA 3DFFA 2VJBA 5B1DA 2OECA 2PR7A 3G9XA 2C29D 1IQRA 1C14A 3AMVA 3BXZA 5DMXA 1XD2A 1R3UA 1UDRA 1ULAA 2VP5A 3SNKA 3TQQA 2PX2A 3HCEA 4DSAA 2H3EA 4XWOA 4MHTA 1NNI1 1Z6QA 3Q10A 4NBRA 4E1VA 2WUWE 2IPMA 5B4TA 2FW6A 2EBHX 1YJBA 3HC7A 5KVSA 4IHJF 4ZVLA 1NM5C 2MYPA 4LX8A 3AVXA 4A0QA 2C5FA 2FSFA 1GXSA 1JZSA 3JY6A 4ZKDA 1E3DA 2ZVPX 4LYAA 5FORA 3TGPA 2WUEA 1M2OB 2J30A 1GCUA 4AC9A 2LV8A 4UCQA 1JIUA 1H2HA 1UT6A 4ZOLF 4TPKA 4LX0A 2HEGA 5A6SA 4FN4A 2PZFA 4BLWA 2WQ7A 2VP6A 4GS5A 4MUJA 1EU1A 2NQ8A 1J1IA 1ABEA 3RYIA 3OQOA 4AAYA 5KQMA 3E84A 4JK3A 5JJ5A 3H9UA 4HVTA 4XFKA 1LK7A 3AH8A 4AO8A 4D45A 1W0KA 1ITZA 2YUTA 4JBWA 5KQGA 2MOKA 1VIAA 1GQYA 2I2CA 1ZJWA 3HR8A 3RIEA 4Q9KA 4LRYA 1SULA 4A0RA 3M1AA 5CCEA 3OLYA 4TKUB 2CYCA 3ZTYA 4EB3A 3HBMA 1DKUA 3HY4A 2D06A 1PKXA 4MAFA 5LIRA 3EVZA 2RJ3A 2HU8A 1UBCA 2C7VA 3ZX4A 1AU9A 2HSWA 3AUFA 3NB0A 1QK4A 4G37A 1V9LA 3Q2OA 3V7YA 4YT4A 1N77A 4U7GA 2PSDA 2J85A 1PP4A 1G6HA 2A4MA 4WNCA 5H3LA 5JV5A 4LRWA 4RD3A 3DGFC 1VSBA 5CHYA 3SJ7A 3NWOA 1FYFA 4REOA 4BP1A 1MUUA 3LUCA 5LU9A 1TT5B 5IC5A 5CPFA 2C2BA 2X0JA 3AUSA 2ZYHA 3H5WA 3GOHA 3KB1A 1Y37A 2II6A 5BSWA 2XRYA 1KEEB 4OXXA 1NUPA 4NJMA 3L01A 3OCZA 2AZTA 5GTDA 5LQCA 4ZO9A 2Q7OE 2VSOA 2ZRNA 1NXTA 2TMYA 4OHXA 3SC3A 1H42A 1OT5A 1RU3A 3IOEA 3EF0A 4MWEA 3I8OA 5IZ4A 3H87A 4GMFA 3RV4A 4B0OA 2CJYA 4DDHA 3NC0C 3ORRA 2ZIAA 2ZUBA 2QRNA 3RVLA 2WKPA 3F7NA 3GJ0A 1YS4A 2XGOA 1MH9A 3MWLA 4EG8A 3E1KA 4KSBA 1USVA 5I7UA 4G97A 4YN3A 3V4PB 4XARA 2HSEA 5C1BA 2DPHA 5JQWA 1Y1QA 5CNKA 2H4ZA 1QP7A 4FZVA 3F9CA 5JYEA 5AH0A 4WESA 4AN0A 3AR3A 3AGQA 3K6SA 5LXTF 1YDMA 4JP8A 4AJKA 5KINB 3U4IA 3HO8A 3Q8MA 1TYAE 4D41A 1GTVA 4QA9A 1ZK0A 3IT3A 1ZKMA 4BJ3A 1FPMA 1ZW6A 3GRAA 2AHRA 5CG1A 2Y67A 1QHHB 3H1EA 5ENVA 5HTKA 4NXMB 1EZ1A 3E82A 3BMCB 5DCLA 2VJYA 3HDJA 4W9NC 2VCYA 1P39A 4MV5A 2R5WA 3UGTA 3L1IA 3Q85A 5C81A 4BKMA 3GLFA 4IJVA 5GINE 2QM0A 2QVCA 1Y8RA 2CXQA 2ZFUA 1XVLA 2E48A 2JAQA 3IB6A 3I1JA 3R44A 1XZNA 4GSLA 2JD1A 5KNBH 1YQQA 1BYIA 1O54A 1IXKA 1NF8A 2G5TA 2OAQ1 3KTAA 3OZXA 1JSXA 1UBUS 5T4FA 3W4IA 5JPDA 2ECOA 4P1ZA 2JLCA 2XXAA 2PUEA 2PUFA 4UNPA 3GJ7A 2GTIA 1T5BA 3RSGA 2BOVA 1QGOA 3HHPA 1L1RA 2GK7A 2HF9A 3GMTA 4OFBA 5F3DA 3WYBA 4BQFA 3T5AA 4MS3A 3BDAA 4NIMA 4DJFC 3PXBA 3C3WA 5ED0A 5EWMB 3AVVA 1MAVA 2GK6A 2GCIA 2J0VA 4HNVA 3TX6A 3GCWA 2HSDA 1GYQA 5LOVB 1B8NA 1LRKA 2YWDA 4H3HB 4BVKA 1I24A 1N1EA 4JEUA 4GQBA 4QFCA 1NJ1A 3DKIA 4R2HA 1OBVA 2QQFA 1OBOA 2ODWA 1QLWA 1V1RA 3DBRA 4NMHA 3NC1C 3R9WA 5TF4A 1FDOA 1RYYA 4PZAA 5JLAA 1GAQA 2PT6A 2CLLB 4JC0A 4U4AA 4XYBA 2WLSA 4DARA 3KT0A 1SUEA 4PQGA 3MUFA 3H5TA 2VHCA 4DR4B 4N6GA 4MIKA 2FPGA 2QMHA 2ZYWX 5I7EA 3V6MA 1C0EA 2IDKA 1N2EA 3THSA 4FHEA 4NYJQ 4FW8A 5BNFA 1YRYE 5SZIA 3JX9A 1WPGA 2AXQA 5TB5A 3UKJA 2PKQO 1E6KA 2BFFB 4P86A 4GPBA 1K6IA 3KJHA 1H94A 3G7NA 2VAVA 1SXJD 2G09A 2V0GA 2C96A 3FX2A 3LVQE 3PQCA 2ZJ4A 1SMKA 5F4BA 2PKQP 2X7XA 4ZVMA 4EYSA 5CG2A 3AVYA 4LQ4A 1K89A 3QVSA 5HKLA 1FUKA 4B3FX 3UJBA 5A1TA 2NT3A 2UZ1B 2IV7A 1MOZA 5FEMA 3IO5A 4UNIA 4EHBA 1YNOA 1ZH6A 2WEKA 1U7ZA 4CMGA 5LYJB 3B6IA 4RWZA 1WXGA 1SBCA 2OAGA 4BYMA 2H5LA 4KR3A 1R6XA 5GONF 1PJBA 3ZZUA 2ZI9A 1UBNA 3ECSA 1F8YA 3GRCA 4ZA2A 3RYFB 2VSXA 2G36A 5BQ3A 1NTRA 3C4VA 3FSEA 4B6PA 5B1EA 9LDTA 4INAA 1KAMA 4RA6A 1SEPA 3VTKA 2GEUA 4YJ2A 1VSTA 2DHCA 1C9YA 2OK7A 3KKOA 5D3KA 3CVOA 5E38A 3UMCA 5F98A 1CUHA 2FHPA 1FFCA 3LUDA 3EIUA 4OQFA 1JG4A 3WNVA 1QH0A 1CUEA 1YDHA 4EG7A 5JNWA 4YJGB 1XD2B 2PLAA 1L7VC 4KK4A 2VP4A 4M9RA 1E6WA 1G55A 2SKDA 3BD8A 2V5AA 3DQPA 3PENA 4LTMA 3QG1A 3C7TA 4RC9A 4YP6A 4HYTA 3TIGA 3QTLA 2V3VA 1L4GA 7YASA 4UMDA 3PJFA 4ZYYA 5F4ZA 2NW6A 3DKVA 1IHOA 1II0A 1G7CA 4MW2A 1IXRC 2BMVA 2FSGA 3L7JA 4GXRA 5EE0A 2GUWA 4JMPA 4QDKA 2Y2UA 3I73A 4O4LB 3L0PA 3BORA 1IOLA 2O0HA 3FMGA 3I2IA 4GX2A 5BOVA 4UTRA 1W36C 2QX4A 3AYXB 3SZ3A 1N57A 3GZTB 3K3PA 2IFTA 2Z5FA 1YR8A 3GEBA 4ND6A 4DSZA 4CXMA 1OLOA 3VKVA 2VQEB 1Q57A 2MSNA 3HLKA 3WGJA 1T9HA 1L3CA 1USGA 1NQ5A 3LC0A 4IUCS 5CVEA 4ADSG 2A59A 4DMHA 4TN5A 4DF3A 2V4MA 4ALIA 3ELWA 2IHYA 1DTSA 1GAJA 3PEFA 2YCBA 3EASA 4ETIA 4XDGA 4F9EA 4C3VA 5AW8A 5JNLA 1I4LD 1Q14A 1QS0A 1Q1ZA 2EBUA 3BZBA 3HB1A 3JRNA 3R7BA 3AG5A 1C3OA 3ZXIA 2OCLA 3OLVA 2GZHA 4G5XA 5CM2Z 1NVXQ 3G5TA 3K0AB 1MA0A 4LIPD 3CU5A 4OHPA 1G63A 3T7DA 5A7FA 1QF6A 3PIDA 3FWKA 2HIGA 4PC2A 4RSRA 2JJYA 4C1NA 1KRWA 3OHPA 1VA5A 1SRRA 1YVRA 4EKEA 2R1VA 5K3AA 2KBFA 3GEGA 1QIIA 3QV2A 4YJKA 1OTXA 4N01A 3ITKA 1GGNA 2M2IA 1OU0A 2ORVA 2NXJA 4KXVA 3HVIA 3QELA 4JUAA 3ENNA 4ER3A 4GGMX 521PA 2H59A 5JARA 1NULA 1QR6A 4NJMB 1RWOA 1E1QA 1WMFA 3IERA 2OC9A 3KXDA 5FLEX 4OREX 3VJLA 2OHJA 1HETA 3WGVA 5HKAA 5JASA 4HEA6 5LBIA 5TS2A 1UXGA 1WUTA 2EQBA 2FH5B 4BVLA 3ZLJA 5KBYA 1KE1A 1XF1A 2QUHA 4RS3A 2ATIA 1HV8A 3IKVA 4Q18A 5GVRA 3R74A 1TQ4A 5LWHA 1XMSA 3CLTC 2I4OA 3C6ZA 4QT0A 1Y4SA 4FZ3A 4ITVA 4QAJA 1FUYB 2DBQA 4PFQA 4ZCMA 4OG2A 6REQA 3AB7A 4RYLA 1Y4DE 4JVMA 1E4VA 4L8WB 3P7MA 1RKVA 4PRLA 4BCDA 1IY0A 4NECA 5KTMA 1V9CA 1L4LA 3K6SB 2HU7A 3TBKA 3ZWKA 1MR3F 4ML3A 5IDVA 3OEWA 5CLJA 5K2OA 2P2NA 4LXHA 5I9MA 3FTFA 2YVLA 2IXBA 3LK6A 1GAWA 5JPCA 3FWHA 2O50A 3VSEA 4JHLA 3DOIA 3IUYA 4DQDA 4PX5A 4MR7A 4NMXB 2IX9A 3O3CA 4OATA 2JVIA 3QXSA 1GARA 3GEHA 2W6PA 3CLTD 1X7ZA 1B74A 1D07A 4G01B 1S4MA 3OH8A 3OE5A 1WEHA 2X1HA 5AKEA 1KY5A 3VISA 3GLFB 1GAXA 3QENA 4ZYWA 1DQSA 4YXWA 3OETA 3HCAA 3OX2A 2C3MA 3TXXA 5JS1A 2P0EA 4BP3A 4NHOA 1DX9A 3BFKA 3KTAB 3QP9A 5FI0B 4DG9A 2XXAB 4HS9A 1DHTA 4BMSA 1C0LA 4NY1A 3RCBA 3V3KA 1T6ZA 4HNQA 1WCYA 1XZBA 1DL5A 2PT9A 3N2KB 4JFAA 1N36B 1XA3A 2EX0A 3W5AA 1BZYA 4L0MA 4QNRA 5AVJA 3V5NA 1YQWA 3EBLA 1RRCA 3OZ7A 4RVGA 4X84A 3MVEA 3ROPA 1F2UA 3PGVA 1FX1A 1ULSA 3ELDA 4RJ2A 5M3BA 2OXIA 1V1RB 3DBRB 1TMYA 1GGJA 4CEJA 2C31A 1R50A 1MQSA 3TH5A 1V45E 1U2EA 5I4BA 1IOZA 3B82A 3WFIA 1IZ8A 4NCIA 3CEMA 4QFBA 5DTJA 2EP7A 3LL4A 3ZNNA 1QRRA 2PG3A 3R3WA 5ALOA 1IG3A 2FPGB 4YQEA 3BFXA 1Y5MA 4IIJF 4C2UA 4EPWA 5ALJA 1F8XA 1WUIS 2BHRA 1P77A 1KEZA 2FR0A 2NAFA 2YJGA 1FTSA 4I6JA 2FE4A 4J29A 3FCCA 4J6FA 4L9RA 4ZJPA 3Q12A 2RAPA 5CA1B 4ZVVA 3TW8B 4GQIA 4KE7A 3CTPA 1V0JA 2HCRA 2AL7A 5B2ZA 4DOMA 1AMOA 4ZTZB 5B57C 5CBPA 1Z6ZA 1ZRSA 5HNKA 2UXCB 3U4QA 2NTNA 1T5OA 3D3NA 3OC0A 4WECA 5TF0A 1DCTA 1H4SA 1BN6A 3MUEA 4YRTA 2Q1WA 1R3DA 5IDWA 3G8DA 3NQ41 3QEMA 1FX0A 3F47A 3OQBA 4ZT2A 2HT1A 3HR4A 5KS2A 1YZNA 4G5GA 4CF7A 1SU4A 2QQ5A 1XLTA 2OFXA 3GLHA 4G6ZA 1U0FA 5FOQA 5IVPA 2C97A 4NABA 4GPIB 2JHAA 4EVIA 4IRUB 2UUAB 3LYUA 4XWYA 4DPKA 1YA6A 1RJWA 4RA6B 4YJ2B 1SVKA 3FOZA 2QYTA 3D4OA 4JLMA 4J0IA 3RTCA 4B3JA 5DWDA 3SZUA 2FMTA 1QHYA 4J0FA 2BGLA 1GKIA 1SFRA 1EGHA 1QIHA 3KQYA 3KL4A 5K0CA 4F3TA 2R96A 1QO0D 1DLIA 3LBHA 3DZBA 3OF5A 4M0UA 2HJWA 2R11A 4XD7A 3SEAA 1LW6E 4YR7A 1VJTA 3WLPA 5ANRB 2VZ9A 4OIMA 1GITA 2GUGA 1HXHA 4POOA 3GLKA 2D2EA 2B69A 2YHIA 3BHMA 3WKAA 3ONWA 2V7UA 3IDQA 4C4AA 5EZYF 5FCDA 1ADFA 4FWBA 2BGNA 5HZGA 1Z4PX 3OAAD 2JB9A 1ZGAA 3QBJA 4Y1RA 1AVTA 3I45A 4UU1A 1MW8X 5H81A 5K3CA 2WTAA 4LCBA 1FXWA 4DLNA 4C2TA 3ECAA 3X3HA 3N1UA 1UDXA 3RJZA 2O8BB 3VPCA 3U40A 3GIDA 1FSGA 4URZR 1JG7A 4W5JA 3DT9A 4N9QA 2XNDA 4WEQA 1O8CA 1AN9A 2VFAA 5BN5B 3UJ3X 3OFND 1P74A 5TVKA 3KYDA 4EEZA 2PXAA 4R3UC 1SCUA 2NZVG 2REBA 2ZB3A 1B0AA 1DFHA 1VYTA 2PL3A 2ZREA 3DMTA 3NJRA 4WINA 4EUNA 1RIFA 2QIOA 3T3EA 5ALFA 1QS0B 3GYBA 2YNMA 5BP7A 1NKTA 1P18A 4B7ZA 5LVAA 1F0NA 1UOQA 1XWWA 2Z43A 3FSJX 3IQFA 5LN1A 4L6CA 2WKSA 4FDTA 2H8KA 1AOXA 2EW1A 5AI4A 3VUFA 1RIIA 5EYPB 1RW4A 4B3BA 4BB5A 1N5MA 1XTUA 2JGDA 3RK0A 5KJFA 5ED4A 4KNVA 5A1JA 1GM5A 1J9EA 3R23A 3I2KA 4J90A 5EXDA 4H1UA 1EX9A 1Y1RA 1QHGA 3GMSA 4C6HA 1BG6A 3NVDA 2R1VB 4KV9A 3TLBA 1SCKA 1Y1PA 2XVXA 4XDHA 8GPBA 2IDZA 1OZFA 2FWRA 2YXLA 3KLPX 1BE6A 4N48A 3IMEA 3LWZA 4QPCA 3QELB 5JD5A 4JLUA 2XB4A 4BGDA 3WIBA 4BO1A 1U2PA 4C4OA 3A6EA 3TPZA 2CLCX 2Q21A 3B3JA 4S12A 1KRXA 3TQRA 2FWIA 3TFWA 4MPRA 5BWOA 1BA2A 1GLVA 2I1VB 3DLCA 3H86A 1BJTA 3EEOA 2H29A 2P11A 2FPXA 5ALPA 5KJEA 3OZDA 5JS6A 3I5YA 2EKZA 1C7JA 1JDTA 1U7WA 3WK5A 2ERCA 5BVGB 3FBWA 2YY7A 2YDXA 1OB5A 3PT9A 3BXPA 1DV2A 3KPVA 4MVJA 4BN0A 5EHXA 5K45A 1NW6A 5HTOA 3HFRA 3T3GA 621PA 1R66A 2D74A 1WB9A 3SG0A 5B3KA 1IZ9A 3W9UA 1QYXA 3VVLA 1EBBA 4WKOA 1EUZA 4B79A 4D82A 4ZVNA 2V7QA 1H2ZA 4XB2A 1TW2A 1R4AA 1JR3D 1I7LA 2OQ2A 4HFJA 1SU7A 4WLVA 5E9JA 5PNTA 3IDZA 3USZA 4E2FA 1C8VB 4E7OA 1KYIA 1M83A 4LHWA 2EC5A 3VPSA 2ZSUA 2QJOA 1YS7A 3CEPB 2H5EA 2C7GA 4MR7B 4AG6A 1GSAA 2VCHA 2Z3ZA 3QKIA 1UDAA 1X7ZB 2CXPA 1C0PA 1BHSA 4IOKA 3ZCPA 4NDZA 3FF4A 3GPIA 3OZTA 2NZUG 3T7RA 1Y5NA 1VE1A 3LAWA 5IX8A 4L78A 3DTVD 3JAKA 1ABFA 1ZD3A 3Q41A 4MIEA 2RHBA 3KR9A 3TTXA 4DQVA 1PNOA 2Y4OA 2O54A 1TA0A 1RQPA 3G9ZA 2R8EA 5GOTA 3T99A 1VPDA 3E2PA 1ZGBA 1W0JA 3IAEA 4BNVA 1FMCA 1ETHA 1M34E 3LT0A 2PBZA 2PRJA 3BGSA 3PR2B 4H7HA 4NBWA 1UWCA 3HB0A 1GIAA 4BNTA 2A9QA 5FUMA 1AF7A 2CW5A 1JJAA 5C0OE 5K6AC 1LDGA 4JYPA 4UFOA 5K3BA 4LBYA 1N3LA 3WIEA 8MHTA 5CP8A 3UATA 3B7PA 1RQNA 1B93A 3EUWA 1XELA 4ND3A 1JSCA 1F2UB 5FBWB 3R7SA 3L5KA 5K3FA 5GPBA 2YJ4A 3EK2A 3N9IA 5A62A 4L3WA 4CEJB 2WT9A 2Y05A 5T6MA 1V35A 4E1AA 3SKYA 2WWYA 3COZA 3G3EA 4DIOA 1X7YB 3UHOA 4DLBA 1RJEA 1CPYA 4ALLA 4BNHA 5A03A 2BLLA 2NZ8A 5K2MA 2GSWA 2R00C 4Y6RA 4GR5A 2NUAA 3CJRA 5DHRA 2JG3A 1IJBA 4G89A 3UWPA 1Z0UA 2G80A 5MN4A 1GCAA 1SUSA 1FVXA 2V4UA 4HAIA 4W6ZA 3VSAA 2FMIA 3GGSA 2FK7A 2X22A 3VYUB 3BTUA 3F3SA 2X9LA 4HZIA 5KHAA 3SMQA 2AGVA 4DA8A 4Z99A 1I1NA 1M2EA 2QR2A 4MW1A 4R6WA 3KT6A 4YJ3F 4CU2A 1WB4A 2XQKA 2PAFA 4B75A 2C7RA 2H1VA 3DKKA 2GZDA 4LFAB 3DPIA 1Y9DA 3VJRA 5IBQA 3RYHA 4KLRA 1S6YA 5FTJA 3R3XA 1FX0B 3EDOA 1XRJA 4PFJA 1Q0ZA 3SLRA 4HEHA 5CGZA 2GBPA 2W2MA 4NVRA 4CUJA 4KDCA 3OQ6A 2DPYA 2NVOA 1ZM9A 3T5MA 5DTIA 4JYZA 2H9YA 3W2IA 3FVRA 3HABA 4O1MA 2Q4EA 5CK4A 2HMWA 5DYIA 5KKAA 3WK7A 4XRGA 2WBLC 3R7AA 3RTBA 5AW4A 3ZDQA 4RTJA 3ZCRA 3UBMA 4EATA 3EPPA 3FRHA 4MKIA 2HQBA 2IY7A 4TMXA 4D98A 4UOEA 3NHRA 4A8PA 1X8XA 3ID6C 1ST3A 4HMOA 3JWJA 1F6WA 3W04A 2GLTA 5C51B 4Y6PA 1K4MA 2FX2A 2OZKA 3FAKA 3EODA 3PPWA 1M3SA 1X19A 4LJ7A 1HYEA 4FW9A 3U81A 1H4TA 2HCBA 4F45A 1J23A 3FOAA 3ZWXA 3HZRA 4W63A 2Q3JA 2YHIB 2IH5A 4HDAA 4EHIA 1J1UA 3CNQS 3LDGA 3OZEA 4Q66C 1MVOA 1XZCA 2C95A 1YQUA 1NFQA 2O6HA 4OK6A 2RGDA 4RD6A 4DRXA 3IVGA 2IL1A 4K9PA 1R0CA 4U2DA 4ZO7A 4ZRNA 3ZH9B 1CY8A 5KSZA 1MU0A 4X20B 5DN6A 2FJ0A 3H0KA 1PVDA 2VWGA 4RLSA 1NW9B 1UH5A 4RVCA 1G0NA 3H5RA 1VOTA 4QU5A 1DAMA 3IEPA 1CZOA 4IGKA 1DJLA 2JIBA 3WL7A 3P9PA 4MGZR 3KYDB 3WMXA 2WV9A 3M81A 4I6EA 1SCUB 4WFIA 1YI8A 3ZDEA 4DXDA 1PKEA 1DXYA 4FVTA 1BVUA 1U63A 4U2EA 3RFCA 2ZYDA 3LPNA 2W58A 4I6GA 1OH8A 1R7RA 4CIWA 4BQEA 3ZZTA 2QMQA 1RXYA 1YRBA 3ZHQA 1U8EA 5K09A 4XM0A 4F12A 4C2BA 2XNHA 1E8NA 3B3QA 1LS1A 3MGAA 4F04A 2JGDB 2YWFA 4BPBA 1V5FA 4ESHA 3WVNA 4DYVA 1HNWB 1CJVC 2F6RA 3M1IA 4TL8A 5AFSA 1VB5A 2AKEA 1T3GA 2G72A 4NEQA 2H2AA 4YS6A 5EIOA 4M0EA 2JGAA 4K9KA 3W8DA 3NOQA 1BS9A 3Q88A 4BATA 3VR3A 3KQNA 2AG5A 3GQBB 4WBNB 1B26A 1DADA 2ROQA 2C04A 4A82A 2IF0A 3HVJA 3L8CA 3EXIA 3E5MA 5L3RA 4EDHA 3AEQA 2PZMA 4KGVA 4LDJA 1BWRA 1D6MA 1F4LA 1EQ2A 1YB1A 3TO5A 1TD1A 2ORED 1PV2A 4MDHA 3WQSB 1X14A 1SC9A 1JJVA 2W22A 3AINA 3OCJA 3PQ5A 3TAHA 3UT0A 2V0NA 4EUEA 2O2CA 1VFNA 2KSQA 4DNFA 3IXMA 4L08A 3H1AA 4RD2A 4N8EA 5CDFA 4I2VA 4YLGA 4ZCLA 4M9UA 2DPXA 2ECKA 5L6LB 3ZN2A 2O8NA 3OM8A 1ZAYA 1I14A 2WU0A 2XA2A 3BIJA 4BRSA 2O8CA 4P83A 2ZUUA 3N6RA 4K9DA 4M1QA 2C59A 2JA1A 2ZE8A 3EZXA 1N2ZA 1TE2A 2BFAA 4KU4A 3S68A 4YXFA 1L7BA 5FX2A 3VUEA 1U2DC 2EX1A 2RHHA 4B87A 4R2KA 3N0WA 1N9ZA 3KKMA 1XGKA 4AO6A 1T9KA 2WG2A 2J3JA 1QIKA 3ET5A 3PHJA 4OY3A 4RPKA 4XM2A 4YUVA 5CIYA 4IRMA 4LZZA 3AI1A 4W5HA 1CUJA 3NDRA 4TT3D 4LV5B 2X0IA 2EZ9A 4D1YA 3GRZA 4PYRA 3LT5A 2Q4DA 3WNCA 1DKLA 3JAKB 2NV0A 3PRHA 3V4ZA 2JS7A 4EG5A 4B3IA 5ALVA 2O1EA 4MWGA 4NFHA 2J3LA 2XMDA 4RK0A 1KBZA 5CGQB 2Y1GA 4CV0A 4CTNA 3CC8A 5FPYA 4KRGA 5H5JA 5FI1B 4Q4CA 3KXIA 1B8UA 5KOHA 2V3CC 1TYDE 1I3MA 4TYQA 1YZYA 1S8NA 1HYGA 4JXJA 4BFZA 1JIVA 3S7ZA 1NAIA 4RZ2A 5HJ7A 2IC5A 3ETEA 5ICSA 3ABZA 3SC6A 1Z82A 2Z6QA 3GJ3A 2O3RA 2X15A 1OXVA 3JQFA 4OGFA 3VR6H 1RQGA 4AN1A 2UXDB 4UHKA 4UXHA 5K3FB 4N5LA 3WA7A 1JL3A 3WAGA 1L4UA 3HXOA 5TARA 3LWBA 5KKNB 4QQKA 3MLBA 5KHOC 1BDIA 1LEHA 3M8KA 5HE8A 3RTGA 4P22A 1P9LA 3T94A 4H7KA 4AJLA 3OPYI 5HRCA 2QMEA 1AHPA 1NN5A 2NUAB 1MZPA 5TDHA 4BLRA 3I6QA 3WGLA 2ZYVX 4Z9BA 1YJQA 4UARA 1VMIA 4AP9A 1YDWA 3IMGA 2YBEA 4NF2A 3V80A 3MRSA 5EVCA 2E82A 3DZDA 1D7AA 2IWRA 1AXEA 5T4HA 4ZDKA 4YO8A 3EY4A 5A71A 1WQ1R 4N7MA 2QYHA 3RT7A 1SVUA 1NJGA 3PWZA 1KEPA 5C8YF 3RYHB 1I36A 2HA0A 2WWHA 3FWNA 3JPYA 1KXJA 4IG4A 4U2GA 2VYQA 2J7KA 2Z0MA 1WZEA 2BFDA 1N4AA 3BHIA 1E2FA 2RHMA 3CZAA 3S4YA 3ZC3A 1FTYA 2G1AA 4FHFA 4ENWA 1BS2A 2G6TA 5GP1A 1CIJA 1AA9A 1JHPA 1KERA 4NPHA 4QELA 4F46A 2Q6IA 2ZEJA 2W0MA 4MQFA 3SMVA 2JW5A 1EWVA 3PD7A 3ITEA 1KVQA 1QR2A 2C0CA 3OQIA 2AQ8A 1U5BA 5LLSA 1P2FA 5J47A 3A11A 4M4SA 3OX4A 1LPOA 2R7NA 3VVCA 2FUEA 2ILTA 2Y71A 3BCUA 4M1OA 1WNTA 3WMRA 1TAQA 1PNRA 2B2NA 4PZ0A 5DYNA 1Z9BA 1MDBA 4EENA 2DHEA 4D4HA 5EL0A 1GNTA 3AF2A 1QTIA 1TC2A 3C1TA 4EG3A 2GAOA 2O8EA 2C3OA 4RIIA 1KQFA 4DLWA 2QY6A 1XRQA 1R6UA 4JX9A 3D59A 3ASVA 3WG9A 1FW6A 4GT1A 4YECA 5BSGA 2NTEA 2IP1A 3I9FA 4L9AA 4W5NA 1U3GA 3CZ9A 1J8MF 1RMTA 4KPGA 1KA9H 1LZKA 1UM8A 1BCSA 2BGMA 2XAAA 3BGOS 4DRXB 4DZTA 5FWNA 4MDFA 4MMZB 3DCJA 4C5BA 2XH8A 1I33A 2G07A 1FMTA 4PGHA 1MP0A 1TM7E 2H1SA 3G82C 3O2NA 1N9KA 4ASUD 2NO9A 4KWHA 5I7WA 2FFRA 1UBJS 2BGKA 2GGSA 5E1OA 3AUAA 1Q84A 4CMIA 1XMJA 2C5EA 2DFNA 2XLCA 3DL7A 1SCAA 3A6DA 1JFVA 1LPSA 2IKQA 2Y0EA 5AK6A 2BMJA 5FNZA 3R7FA 1B16A 3KKPA 3IMCA 4K6OA 4I9GA 4I9UA 4RVHA 4CCAA 4X9XA 1W2WB 4CZ2A 4GWLA 2L19A 4P3NA 3K5PA 3IHTA 5LB2A 3L4BC 2DP4E 3BXXA 1U31A 2EHJA 1QCYA 4JGGA 1BXRA 3ECCA 4H1HA 3TGWA 1G5HA 3OCCA 1XEFA 4JBYA 4EQ6B 5C4MA 1ZK1A 2FF7A 1LK0A 3M5WA 4WV3A 4B8WA 5BSFA 1GPKA 1YZUA 3U19A 1R5BA 2H16A 1MF7A 3TIIA 3Q87B 1O5TA 1OYVA 1ZVMA 4GUAA 2QZSA 2TRSB 4OQPA 2HGSA 3GDWA 3MFYA 5FNVA 2JLXA 1KMCA 4TWIA 3WLRA 2IYXA 1W9HA 1KHHA 4RW0A 5EQDA 3D6JA 1UODA 2H54A 3K96A 3EIHA 4L7VA 5DE3A 4EQZA 2RH8A 3RUHA 5I9BA 1RXIA 3LUJA 3W2TA 3QRWA 1MOSA 2PX8A 2VJNA 1VG1A 2A86A 2W2OA 2WNIA 5AI8A 1AO0A 1WQ3A 3HG7A 1JJ7A 3HN7A 2CCJA 3AEQB 4G07A 3A7DA 4OFZA 3TAXA 1CUSA 2YJ5A 1Q1BA 1LXCA 3QUSA 3D5QA 3JVIA 1M7BA 1A9ZA 1U81A 4XQ0A 4UU7A 3MTEA 5IVDA 2PKWA 4IRXA 3IIIA 3TE7A 1U1FA 1LRLA 3THWA 2QP3A 1Y7LA 4CIAA 1NASA 3O8DA 1QYCA 1RBMA 1COZA 4RHUA 3IL2A 4C4PA 1GA4A 4RY8A 1OCEA 4RH1A 3A4TA 2D3TA 1MIOA 3A6KA 2GYWA 4I3GA 721PA 3TGLA 2O8CB 3DHVA 1W29A 4KHZA 5K99A 4KQIA 5JJCA 1SZCA 3H84A 3TUZC 2QRHA 3VKUA 4D9MA 3KDAA 1UK7A 3ZU4A 2FG7C 3RSHA 1B3BA 3C5EA 3M6AA 4IMRA 2GT1A 3MERA 2NO6A 4KYUA 4KK3A 3AR6A 3STTA 3KX2A 1OX5A 1UBEA 2SICE 2NUPA 2PGAA 1JFTA 2X42A 4G63A 4RDIA 2X0DA 3E9YA 3GZJA 1R9GA 1K8XB 4PCAA 3E7DA 4DLTA 1D04A 1K5HA 4O4IA 2ZIVB 5ADVA 3NOOA 2NQTA 1YAHA 2PKEA 4RNDB 3W6ZA 3EFEA 5JDCC 5BYAA 4F5YA 1THGA 1DV1A 1RWKA 3DKRA 1S2NA 4IJQA 4QQRA 5AKJA 1FP4A 1XKTA 1PQWA 1REQB 1CUYA 1WMDA 2H92A 1S2LA 2AG8A 1FTWA 2J46A 3PC8A 3AT1A 2LR0A 5DNDA 1FDTA 2W2KA 3WP0A 1YAJA 3RWBA 4FMCB 3T7SA 4ENPA 5IWCA 5KOHB 3AQ4A 2YJNA 3HI4A 1NSTA 2F1KA 3I83A 1FS4A 4M22A 2NLOA 4BX3A 4C06A 4LVNA 1VE3A 1LPAB 3BE6A 3W6PA 3OP4A 1TAGA 4PM4A 3N8IA 5B53A 1TO6A 1HRDA 1LH0A 2H17A 3IP8A 4GP6A 4IJ6A 1X8JA 2QUAA 1L8OA 4JLDA 3MFQA 4R1SA 3P4UA 1GRRA 2X6TA 2XUKA 3AW9A 3O0DA 2A0KA 1L9KA 3K31A 4Q3CA 3CT6A 4TXJA 3PXCX 5C8VA 3UMMA 4U3JA 4OM8A 3IKJA 4V3BA 2X2FA 2WTUA 4QPJC 4A2QA 1U9CA 4IDPA 3QU4A 5CH3A 1L5GB 5BQOA 1RC0A 1K2WA 3REOA 5KJ6A 3GFQA 1R12A 1E7QA 1XTBA 4S0XA 3BXFA 1WZ2A 1Z08A 1XRMA 2R6CA 2C77A 3PEYA 4NS1A 3I62A 3IAHA 3B70A 3QVWA 4K9OA 3CONA 3G23A 3DOUA 3EGOA 3FVQA 3GFFA 2CJXA 4QGFA 3HNRA 4R1QA 3ESBA 2QVLA 1RM0A 4DHEA 1E2BA 4CKWA 3EW9A 1ESZA 3HCCA 2Q50A 1H0RA 1LLCA 5HP4A 1A7UA 1II9A 3EVNA 1SXJA 4DT1A 1A27A 2FSSA 5BT8A 4DSUA 4UPEA 3QF7A 3UTCA 2K2QB 2QG6A 4KIFA 2YRXA 1C7IA 1A8QA 5AM0A 4OBBA 4NBNA 5CURA 2HK9A 1L5OA 4DYHA 4EKGA 3EXHC 4RVNA 2QQ0A 3F6YA 4WFQA 2BFDB 1PWHA 3GJ6A 1FP7A 1RRGA 3EGVA 5LQMA 1RRFA 2AR9A 2O8DA 4GGPA 7ABPA 4MQFB 4E46A 5CCBA 2Q8PA 1RRPA 1E5QA 1EX1A 1J09A 1T5IA 4HQOA 4Q7KA 3OTIA 4TGLA 4TTTS 4HFRA 3ZBTA 4I5FA 2ZB4A 3TSZA 1DINA 3TEMA 4B31A 1U5BB 5IG2A 4BB0A 2IXEA 2A6PA 4MO9A 1A5ZA 2PT7A 2X0KA 3RC9A 3L6RA 4JI0B 1JLKA 4ZICA 1XOIA 4Q37A 4C7JA 2X8LA 3W1VA 2A9PA 3KC2A 3PQ8A 3UYKA 4D8TA 2K7ZA 3EZ2A 3ZU3A 1PJAA 2P9QA 3V7NA 4TROA 4D02A 1OBCA 4OLAA 2O8EB 1DKMA 3WKEA 1N34B 4MVCA 3TVYA 3FHOA 2Y0BA 5AKZA 1BX0A 1PNTA 1G0OA 3LQRA 5BR7A 3SC4A 1QO7A 2ID9A 4MR9A 4QAQA 4D9EA 2ZS9A 5JZMA 1ZI8A 3PUWA 4BFLA 3W6OA 2VSFA 1BCSB 2ZAMA 1N33B 1QGZA 3FCXA 4TZ0A 2W2QA 1ZOLA 5IPFA 1EE1A 1FDWA 1SXGA 2FN3A 1VXRA 5ITWA 1CNFA 2IU6A 1Q19A 2VAWA 4XA8A 5KSOA 1N75A 4FNMA 4ZVPA 1FNDA 2ZTSA 3C8DA 4A2WA 3R2JA 2Y1EA 1MC5A 4BNYA 2REQA 2NTYC 2Y4NA 3TRDA 2W70A 2DE0X 4RKFA 2HKIA 3DVLA 4A0FA 4CT5A 3PYLA 3LUGA 1QH8A 4YNBA 1EWQA 1GUDA 3RODA 3GZ4A 4D3ZA 3CKLA 3Q98A 2NGRA 2JIZA 1G8YA 1E7YA 2BSQA 3TG8A 3UC5A 1BXRB 5I8WA 5IT4A 1IFXA 2ZI7A 1NY5A 4YDRA 3SJCA 2A0FA 2R8OA 5FA8A 4DIFA 1GL9B 1TTTA 5CPBA 4P4GA 1T1RA 4H31A 4AP6A 2PT5A 5CT6A 5E6UA 2IV3A 1O6ZA 4PS1A 3WMWA 3VTAA 2OCIA 2JFNA 3B60A 3PE6A 1IMJA 3PUKA 5HIKA 1A2KC 4IILA 2R7MA 3LOPA 3MAGA 2Z2XA 4OAPA 4Q9HA 5E3IA 3C6YA 3E81A 3RE1A 2FQYA 4PRZA 3R8CA 5CEEA 2QD4A 3W5CA 1A98A 2EZUA 2HRBA 4Q3AA 3LTEA 4Y2UA 4BO8A 1RZ3A 2DLCX 3PSHA 4KN8A 2A67A 1K63A 1YB5A 2A3NA 2C57A 3FFTA 4IX1A 3VC3A 2CUNA 2E87A 4BC1A 2GM4A 4BJHB 2PGLA 5JSHA 2JBAA 4E5YA 3FPCA 5DHTA 3FTQA 3RQIA 3THWB 3G0IA 3EBPA 1A4IA 3WDKA 5ERYA 3V7FA 4ALMA 4N5DA 1D4FA 4CLOA 4GMDA 4AI6A 5GONA 2HAEA 1MIOB 4Q01A 2RHOA 4NRDA 3ZDYB 3U44A 3BAZA 1BQ4A 2ZULA 3GROA 2JLAA 3VV2A 4BQRA 4BTLA 3QFTA 5A2GA 3GEEA 2X8WA 3GCXA 2V5VA 1U0OC 5FBLB 4RQTA 4WCFC 4HSEA 2V6BA 5EOVA 3TFQA 1VPLA 2LDBA 2XWQA 2MHCA 3OWHA 2WTBA 3N2LA 1UPFA 1NC1A 3QFSA 3QVOA 4M1ZA 3UGJA 1CRPA 3E4CA 4TM7A 3WJ2A 5JXHA 5KVAA 2NUPB 3K0KA 1R4ZA 4D0RA 1K5PA 1MEJA 4PGMA 3DNFA 3ZJUA 1EK0A 2H1HA 2QE7D 3F0TA 3WBFA 4Z7NB 3BILA 8AT1A 4H17A 4WOPA 3FCSB 5KREA 3L6DA 3B53X 2B6HA 2HPVA 4O4IB 5JJKA 3SF0A 1PFGA 2C20A 1ESNA 1SXIA 5SZKB 5C5IA 5FR2A 5EUQB 2IOHA 1VG0B 1GSOA 3ESQA 3M33A 5AK4A 1FP4B 4YB8A 3W9SA 2PUTA 2XVMA 3WGNA 2F00A 4PFKA 4BWFB 1NBME 2VA8A 4TMTA 1Z35A 2O2SA 5KTSA 1ZKDA 1RAGA 1SBQA 4WLFA 1RHKA 1SUFA 2RJOA 2W2KB 1CJSA 3I34X 2Z5GA 4FPXA 3ANTA 4G5OA 3WISA 2Q3FA 1G8KA 1U5AA 3FZGA 4KCGA 3C1OA 4XCVA 2EJCA 1OWNA 2DLDA 4IJUA 4PXSA 5KQSA 1HDZA 3VA7A 3HDHA 1O87A 4WN9A 5DM70 2VBCA 4ZYTA 1OFIA 1BVYF 1TKAA 2IXTA 4G85A 4KQKA 1GZHB 2GN1A 4C3OB 2P6PA 5ALRA 4BO3A 3AFIA 1XZHA 4EP1A 5I4IA 2OTCA 1U0LA 3F8WA 4L3OA 1Z15A 5KB3A 5A9TA 5BSHA 2ZT8A 5JWRA 3C7CB 1C7RA 2XB6A 5BW5A 5J43A 3GFGA 4S1PA 4B3SB 4MQBA 2QTRA 4IIGA 5EPOA 2X0EA 3TLGA 1UUFA 2M1XA 4IV8A 3Q11A 4R2XA 5JCXA 2XIJA 4N41A 4D9IA 4Q7MB 1JV2B 1BMQA 1GGMA 2I71A 3H2HA 2DR0A 1KQOA 3VMFA 1UJCA 4UAUA 1E1YA 1N5LA 3EXG1 2KJQA 1W5EA 1ZRHA 2XZDA 1ZA2A 1QXSA 4BFCA 3YASA 1JA9A 4MVYA 1RHUA 2C07A 3WL3A 2IY8A 2EXXA 4F6RA 2O2GA 5B6JA 4G0UA 3O6VA 2JARA 3WIDA 2IEZA 3G0GA 2QUKA 4R8SA 4CKWB <