4MWGA

Crystal structure of burkholderia xenovorans dmrb apo form: a cubic protein cage for redox transfer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
180
structure length
174
Chain Sequence
FKPDARFAWCVTGSGHLLDESIALALELPRADLFLSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAKCAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVWVELRPRAIELDNVERLSRFEYTTLVRSLDELKAALGERLSTLDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydromethanopterin reductase (AfpA)
publication title Structure of dihydromethanopterin reductase, a cubic protein cage for redox transfer
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 64
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4mwgA00
4ZAYA 3LQKA 4ZAFA 1MVNA 4RHFA 3QJGA 1G63A 1G5QA 1SBZA 4RHEA 4ZALA 2EJBA 1E20A 4MWGA 1MVLA 1QZUA 4ZAXA 4ZAWA 3WISA 3MCUA 4ZAZA 3ZQUA 4ZAGA 4ZAVA 1P3Y1 4ZANA
chains in the Genus database with same CATH superfamily
1S1CA 2FEPA 3D4NA 3HKDA 3L04A 4ZCTA 4OMCA 1DZ3A 4ZQCB 2I2BA 5BN5A 2AGVA 2J0EA 3N8HA 3X1YA 1A8QA 1IYZA 3EODA 3C6YA 3H3XA 8AT1A 2C42A 3CYFA 2IJGX 1QK3A 4LJYA 4TS9A 4JLMA 4F1KA 3IEIA 4OQDA 2ET6A 2DUNA 2W43A 6LDHA 2F1RA 1JUDA 2E6KA 4I4IA 4G8BA 4CM8B 1GQOA 4CR7A 5JUWA 4L2IA 5D7NA 1PZNA 3RNOA 1MH9A 5TMEA 2Q4DA 2OECA 1JEAA 2Z56A 3FVVA 1QIMA 2AG0A 3KKPA 2YS7A 3DDUA 1ORRA 4LPKA 2PZGA 3AZOA 1HQCA 1SC9A 2EFGA 2G8LA 4KXUA 4QIHA 4RHXA 4AZ3A 1SVWA 2ONCA 3BDVA 5JJIA 2OXEA 3HJHA 4EUSA 3CWZA 3GJXC 4G5OA 4YB8A 1XU9A 3HEMA 3OFND 3GDOA 1TJ4A 4TLCA 5LQUA 4QRHA 1T5DX 1G5QA 1DOAA 3O0DA 4RUKA 4ENTA 2I8AA 4F2DA 1J1IA 1LF5A 1PKEA 1I7PA 3GCWA 4HNVA 1FNMA 5AMXA 2YCBA 5FT9A 1V1MB 1GCIA 3OO1A 3PWZA 4MWGA 4CMIB 3ZE8A 2GCOB 4FGLA 4ZWNA 4URFA 1MMFB 3RSFA 4ZD6A 5B3LA 3PZRA 1MO6A 5LQCA 4G0VA 3BT7A 3X2FA 1G7SA 1UBHS 4L78A 2I91A 3RVRA 1GYQA 4KE8A 5BUQA 3VPGA 3U5ZB 3A9TA 4X7BA 1IZYA 3RC9A 1VGVA 3ZUPA 5C8ZA 1NFQA 3SD7A 2XTJA 4OBXA 2PAFA 3CVUA 1TAUA 2VKQA 1XZQA 2HQBA 4L8GA 1BXZA 1JA1A 1UP6A 5GONF 4WESB 4HX2A 3ICPA 1J2YA 4ETMA 3PQ7A 4TMKA 5BSWA 2VO1A 2UV8A 1U0LA 4QBFA 2VWHA 4HAWA 3IVGA 1CJBA 1XZCA 1E64A 4O59O 3QGMA 3GOQA 1TT5A 5B2EA 1QB7A 2CD7A 3AVQA 2JDIA 3BWBA 2HV8A 1KYTA 3FZEA 3JATB 4PR0A 1Q1BA 2VAMA 5DP1A 2BKEA 2Q3CA 1YFZA 3AUXA 4MGIR 4XVCA 3KVRA 4E13A 3K0AB 3SQXA 1H2BA 3GP8A 1ZK0A 1UPTA 3BFXA 4WKNA 2FQ1A 4ZYLA 1USWA 3TN7A 2CNBA 5EE9A 1J8YF 2OD9A 3LY9A 1Y3HA 4OAQA 3DZJA 1E3QA 1F8UA 1M1NA 2V98A 1WXIA 2ATIA 3DM9B 3HVJA 3MJTA 3ZXIA 2F3PA 2V59A 3RC1A 3VBEA 4D26A 2BCJQ 4F4HA 5B58C 2GMWA 4YJ3F 4AMVA 3OX3A 3HY6A 3UC9A 3R8XA 4QODA 1HTTA 4MW6A 4K9NA 5LNK1 2K4MA 1FP1D 1RAIA 2ZFUA 4P7GA 1K9VF 3FWYA 1WW8A 1WUTA 4H7JA 5KVQA 1PGJA 3LBFA 1NLYA 1VIVA 4O2BB 1ADGA 2XNCA 5DOVA 1K68A 4CM9D 3OT4A 3NDRA 1IC6A 4NV3A 1LJ8A 3TRDA 3WGGA 1LLDA 3LG2A 4B3JA 3HR4A 4OLFA 2WWVD 2FRXA 4QEDA 1RCFA 3ZXYA 3RYHB 2ZRCA 1GWNA 5TPWB 1XTZA 2ORVA 3H8SA 1FTYA 1M66A 1SCDA 3EUWA 2A1TS 3LGAA 3LM8A 3SMVA 3U4GA 2H1IA 1OVGA 4GBJA 3HVRA 4MLCA 1NVXQ 2GA8A 2B34A 2QSUA 2V7QD 1B76A 2FG5A 2WWWA 3W9YA 3U7EB 1TZKA 2V54A 3VPDA 4DV5B 4M1SA 3GJZA 3D8UA 4H4EA 3WRYA 4W5TA 3U7GA 1ZEJA 3S2SA 4I4TB 4QNRA 3RC3A 3QYJA 4IS2A 1E79A 2B82A 2GPWA 3G0CA 1D2GA 1Z18A 3DZCA 4N1AA 5FUQA 2AYYA 1J0AA 4O8ZA 5LC1A 3HCWA 5CXXA 3ZQUA 5ICFA 1P2DA 5G41A 5AVQA 1R66A 2PZKA 4DA7A 2A4MA 5KMGB 4LZNA 4FM9A 1XVIA 1VE1A 2VN8A 3HMKA 1RWXA 3U26A 3UK0A 4BN0A 3QG5A 2YV3A 4RPLA 5JS2A 3OLWA 3M9XA 3G5LA 1EGVB 3TLKA 3AESB 4OH7A 2J48A 2FSHA 3F8WA 3QVLA 2RARA 4Q6WA 1SWVA 1B0PA 1CEQA 2XGJA 1Z83A 5AVSA 5IHPA 1GRVA 1DWPA 3SJCA 5HA5A 2PUBA 3GJ3A 3V1LA 4UUAA 4M22A 2HU5A 3OQIB 1IN7A 4HQ6A 4R1TA 4ATNA 4F9TA 4BLVA 3H8VA 4KUGA 4DPKA 2JFVA 3OH8A 4Q24A 4WLEA 2BI4A 3AP2A 1CTQA 3CH6A 2FG6C 3CCCA 2E4ZA 2BBSA 2F8LA 2WHXA 3P4YA 5FOWA 2J7PD 1GO2A 3A37A 5B12A 3GRVA 4X94A 4JL5A 3DTVA 4I1OA 3HCPA 3KTOA 4MWBA 3BN3A 1CR6A 3L0IB 3K0BA 2ZYDA 3N53A 4R84A 2B4KA 3OJEA 1NG9A 2IKSA 2PMWB 4QBHA 1KI7A 2ZRKA 2NIPA 2ZLBA 4XJXA 3OMWA 4PIMA 3PL1A 2W48A 4NECA 3LW7A 4BCDA 4OJKA 5BRJA 5AVTA 2QVLA 3B7GA 3GLSA 2PGLA 4OY3A 3VU3A 3ZEIA 1XLWA 2CE7A 1KMIY 2Z1NA 1JP7A 3I32A 1Y0BA 1AHPA 3NKLA 3BUSA 4O4HB 4DCVA 3HNPA 4GWGA 2CMFA 2QD3A 5K3DA 4CCSA 1PJSA 1PGQA 1A77A 1QKJA 1QRAA 2B8NA 1CHDA 3SE0A 4LF8B 2DHDA 4GKKB 2OTCA 4R81A 1SB8A 3F67A 1Z0UA 4DDMA 2Y1DA 4I9GA 4LJKA 2NQTA 2ONJA 5I7RA 7AT1A 4OHOA 1NHGA 2JHCA 3SXUA 2PPLA 1PKXA 1K6IA 2BKAA 2YVAA 5FUXA 4YMTA 3NAQA 2R6R1 2H85A 3WXMA 7REQB 5C1IA 1Q12A 4MUGA 1CIVA 1WDWB 3KR2A 3EC1A 4TLBA 3P20A 1X7HA 4P33A 4EUHA 2VSYA 1QMGA 2AOUB 1YZQA 4L50A 2NUPA 3ESAA 4OU4A 3O1JC 1OAOA 4IIDA 4RQTA 2WF6A 1PZGA 3TB4A 4GR9A 1CY1A 3JD1A 5BV7A 5FPYA 4QVIA 2D5IA 3A1NA 2PE5A 1JTEA 4E5UA 1C41A 3TLCA 2XWQA 3EHDA 3CKKA 2BDTA 5T57A 1MDBA 3Q40A 5AKHA 4JB0A 3T0IA 4R2IA 3THWB 3RS3A 2BEWA 4KACA 3OBIA 5T4BA 1SBTA 1J7KA 3TKAA 3AUTA 3EVGA 4GYJA 4BAUA 2I4IA 1JHXA 2BGKA 2HIGA 3D3JA 4GOMD 1U6KA 1QYVA 1KPIA 3W2HA 5FH9A 2H0RA 2WUGA 4D9MA 3KB8A 1U9IC 5ALZA 4YI3A 2ZTVA 4TUYF 1N2BA 2YNMD 3AWDA 1A8HA 3DE1X 1QQ7A 3H6KA 3LYHA 3LX4A 2H4ZA 2YX1A 1TZCA 2GR9A 3L7DA 4PZDA 3LWZA 5JSZB 3K70B 3N86A 5JCJD 2XOKD 4FLFA 5AHXA 4Q9HA 3UMJA 5DYNA 3WL8A 3O9VA 1Z74A 2IXFA 4YBRA 5YASA 3RWOA 1D0VA 1FUEA 2ZI6A 3SZOA 1FTSA 1ZJ5A 1IJFA 3OTIA 3W5DA 1QBGA 3QXJA 4DDTA 3ZZMA 1H6DA 3KYCA 4IF6A 1A1SA 3VPCA 2A57A 2VK8A 4OTZA 1QU2A 3H17A 3KVVA 5HRAA 3BE6A 3EVAA 3PC8A 1P4HA 5BQ3A 4BP1A 3ZR4B 2QNBA 1MC4A 1J56A 2WZDA 2RIPA 5EHQA 1B6SA 1Q20A 2DCMA 3K72B 2JLWA 2XYRA 4QUDA 4EI8A 5HK9A 4PG8A 3R9XB 2BTEA 4K9DA 1MT3A 4DLZA 1KH1A 2OR3A 4J0QA 3SM9A 3OZEA 1E4OA 2AI1A 4R69A 2JFFA 1GITA 4F11A 2CLEB 2RHDA 4WA7A 1IULA 3BIFA 2KBFA 3FPBA 5BSRA 5CITA 4RDCA 1J5EB 3EZ2A 3NONA 2TS1A 3SHQA 2D06A 4HDKA 4NZNA 2Q1YA 2X0FA 2PUTA 5K6AA 1DQNA 1E69A 5EE0A 5CUQA 5CCBA 1WBBA 3CX4A 4B76A 5KJ1A 1E3SA 1SG0A 5DF1A 3HN7A 3GNLA 1Q17A 4BC1A 4ZJYA 3KALA 1VL5A 1CR0A 2XITA 2W8BB 2Q6IA 4FK8A 3LRXA 4R5MA 1YIAA 4KLZA 1YJXA 2O2SA 1C1HA 2I8CA 1OI4A 3DL7A 1E3IA 4IDPA 3FMPB 4AJPA 4EGSA 1GCGA 1N1DA 1K08A 3OQVA 1J6UA 2LZ0A 2X9LA 3L8DA 3ZDDA 2DQ4A 4CBVA 1I7LA 1B3RA 1KVRA 2DC1A 4HFNA 4RMNA 2FFBA 3VBCA 3BZBA 3FOWA 4MR7A 1PJAA 1G8GA 2OBXA 3DZDA 3MMSA 4MYRA 2Q5JA 4CIVA 3N8GA 1JS1X 3UG6A 5KSOA 3UMMA 4UDXX 2HCJB 2BGGA 3V3KA 4MAMA 1Y98A 3EZYA 3UY4A 4RMIA 3SX2A 3TW6A 2FZWA 4NNPA 4KL8S 5FCDA 1OI3A 4W5WA 2BSXA 2ZYUX 3HPQA 2ANBA 1ZL0A 1IB0A 1Y6JA 2QTGA 1WDLA 5EQFA 5F23A 3ENWA 3OF5A 1DKOA 3DOOA 5F3RA 5AXDA 7ABPA 5AR1A 5T3YA 4IOLA 1J0BA 4J76A 1V95A 2J3IA 4MQ6A 2QSYA 2J9XB 3SVZA 1KOFA 3EAFA 9ABPA 2F3UA 1QVWA 1R50A 3FAKA 1EVLA 1YT5A 2OGZA 3E7XA 4JQYA 5ALXA 3GZJA 5EWLA 4DIOA 1ISGA 1QO9A 3NIFB 1R3UA 4HDMB 4LBVA 4YJGA 3TKLA 3RFVA 1KKUA 2GZ3A 3T1OA 1W7AA 2Z2JA 3DZ8A 1ZD5A 6YASA 1Y42X 4KW7A 1R8XA 4HEA1 4RZHA 1AZTA 3D8SA 4PLCA 1SM4A 3BB3A 4A92A 1U8TA 2GTPA 4YH1A 4BMCA 1Z0JA 2G9UA 2XGMA 3HCNA 3IA7A 5ICGA 4B7CA 3ZWNA 4NK4A 1NVBA 5LA6A 2HDNB 5CDFA 3SYRA 5JISA 1DPFA 3EXG2 3H2JA 3QPAA 2HMTA 1IN8A 1ORIA 4BBZA 1ID8A 1S1MA 3N0RA 2AQ8A 2HA0A 1TMYA 2X3FA 1Z4JA 1DTWA 1U81A 2Q62A 3PX2A 3QW2A 4WCFB 5FOUA 3CLUD 4YAWA 4GKVA 4X1KB 5E4FA 4PC1A 3PPVA 2H51A 2GERA 4RIGA 5FUYA 2IWHA 4B3BA 4ENSA 1BJKA 1LK0A 4G0PA 1C3XA 3O82A 4K9KA 5DX1A 1GTSA 1G7RA 3K1JA 4TL7A 1JMKC 1OIXA 2A0WA 1KIMA 1TQ2A 1QVAA 5EJ4A 3DDSA 4TSRA 2ZKIA 4ZGGA 1LC3A 2UKDA 2AC4A 2V0CA 4Z2AA 2RIRA 2C9DA 2QZ9A 1VKRA 3EVCA 4UCWA 5BY2A 4YMLA 4WGGA 4WN3A 4A0HA 3PICA 4J2OA 1A9RA 3IUSA 4RHUA 4ESEA 3A2LA 1ZOSA 5DSTA 4ABYA 2IYYA 3H2IA 4WRRA 1P3Y1 3EC2A 4PX5A 2JFHA 5FNVA 4P2BA 4YMGA 1DJLA 3MJVA 2C82A 2G17A 1EHCA 4C0JA 5JADA 5LQKA 1DGQA 4NZOA 1VCNA 5F1OA 1DV2A 4ZRDA 2JIDA 4AX4A 1UMCA 5MN4A 1YJAA 4J9UE 3H6HA 1DUVG 1P1CA 2O52A 1PFVA 2B8WA 4MYCA 1YE8A 3AW8A 1MENA 2P8SA 2W2PA 4HS9A 4UEJA 4FB4A 2OK8A 3REGA 5BR8B 3CT4A 2P8JA 3EH2A 5AIAA 4KPUB 1EX6A 5TC4A 3BSYA 1ONBA 3W5HA 4WCVA 3L6DA 3ZJTA 4QXMA 2DKFA 3HR8A 4NAVA 1I2ZA 4NABA 4ZEMA 2ODPA 3KJQA 4Q3EA 1VCOA 2B25A 2M1ZA 3ZWQA 5JAOA 3FYCA 4YR7A 2GCNA 2X3UA 3ON5A 4IEEA 1VSTA 2AWOA 2VJAA 4WFKA 3TVYA 3WRYC 4NENB 5IUKC 1HNWB 1Z0KA 2G28A 3N7TA 3N2GB 3FTDA 4GEGA 1ULUA 3HEAA 1UDWA 3GLTA 4P5PA 4ZVKA 4BECA 2WA2A 5DNDA 2WZCA 1NVVR 4PRYA 3LBIA 2BEUB 3EEIA 4DTIA 1FDSA 2PQ2A 3IERA 2IUTA 1DWQA 3B1ZA 4BB0A 5AKZA 3L0BA 3I1JA 3K0FA 4QU0A 1Q6YA 2REBA 4OCZA 1G0NA 3IFSA 3U40A 1HZZC 1RSZA 1NNUA 1GFIA 4ZANA 4MS4A 2BFCB 2VDPB 4OYLA 3E9MA 1FX0B 3L2OB 4R4JA 3TBFA 2B4QA 2GUGA 3TZKA 1UK7A 3JWIA 3V2UA 1MAUA 2XD9A 2I67A 3KXDA 2GZ2A 3L05A 2I6TA 2IT1A 3ZK9A 3U4QB 1GXSB 2PRYA 3OE7D 5EKSA 3T7CA 4RY0A 1XD9A 2B78A 4XM0A 1S8AA 2ZUTA 3TQRA 4PGMA 3SQLA 3OPQA 3UMGA 3FTQA 5BV2P 4HADA 4UCFA 2HK9A 4XIGS 2OSBA 5CIWA 1Y6ZA 3HB1A 1Z2NX 1N0VC 1JMVA 2VJMB 2PUWA 3X1JA 1JBEA 1NVKA 2VP4A 4B4UA 4BB9A 2G83A 1QQBA 1Y9JA 1A3CA 4GU5A 2F8MA 4G0QA 1CF2O 3U3MA 3KOMA 3LVFO 3ESXA 3I34X 3A6EA 4TN5A 1UC4B 5K7SA 3E2IA 1BRMA 1WXGA 3P5BA 4GXRA 4JLUA 5AM1A 3S2IA 3ZKWA 3LPCA 3ZTTA 3CW9A 4BZXA 2RHGB 4BFVA 3CJTA 4ARSA 4C0LA 5J23A 3PI6A 1DBRA 3RS5A 5T6MA 1OD6A 3SBXA 4BNGA 4YRLA 4K6KA 1EVYA 2Q45A 4AS2A 4Z9FA 1TKAA 2RBGA 3ISVA 3G9TA 1TMGE 1GQQA 2BKVA 4PLVA 5F78A 1KYIA 3ICEA 1F0YA 5AJZA 1S3FA 2FWRA 4ADSG 1FJGB 1QRTA 5THKA 3H5LA 3KETA 3BD9A 1IG0A 2TMGA 1K88A 1LWOA 1M0TA 4X3OA 3JWHA 1E77A 2Q7XA 1I1HA 2V7PA 3TBKA 2YC4C 4ARUA 1QFJA 1KMQA 5L95A 2W98A 4YRTA 1K8YB 1L7QA 4QG3A 1KFEB 3T7EA 1Y3IA 1JA9A 3K1YA 3T5MA 4K8RB 1GZHB 1NJ1A 1O6ZA 3PYXA 5E4YA 4J94A 4JJ6A 4V0OA 1GPNA 3SR3A 1OWPA 1P9WA 2F67A 5BRNA 3RYFA 3L6EA 1B0UA 4IUBS 2QPOA 1WCXA 2AR9A 1T29A 4HDQB 1UFKA 1MKYA 3FMFA 4P6VF 2OCKA 2WP8J 1UXOA 3PENA 3PFNA 1OAOC 2YOGA 4B35A 3SYMA 4NU8X 3V8QA 4ZJZA 2R7KA 2NOAA 1Z4OA 2D00A 2A59A 2UZAA 1VBKA 4KAJA 1K92A 2HSGA 1Z13A 1SB9A 3VHRA 4E33A 2LCFA 3LU1A 4PHCA 4Q05A 5KI6A 5B1YA 5LQAA 1U7XA 2QQFA 1G6OA 4EQ6B 1SMKA 4D92A 4QQNA 2Y2VA 5AQ1A 3EDQA 4A5OA 3KLBA 2JA1A 1WEKA 3FJYA 4R2LA 2VT3A 3Q0EA 2H0AA 2QJWA 3SQMA 4EKDA 1C8BA 4HDRA 1ESEA 2ZP1A 3GK3A 4B2IA 1GL6A 4B33A 2N42A 2QE7D 3V00A 1W29A 3LHSA 2Y67A 3I0NA 2ZI4A 3KOWA 1VSBA 2ADOA 3U44A 1ST2A 4S0XA 1OXMA 4NFLA 2V8OA 2I9KA 4RYDA 4EHIA 2P6OA 5U1PA 2GEUA 1N0HA 2AXQA 3ER6A 3ZD6A 1NR5A 3FWZA 4WVFA 3F7OA 1I6MA 3EQZA 2VJCA 2VXCA 2ZIWB 2RGAA 1E1DA 3WHKA 4LAFA 3THXB 1H5NA 2WSIA 4PPGA 4GRDA 3T6KA 2C4WA 4Y2YA 5EXSA 3WAKA 1UMDA 1MOSA 4D5GA 1AHIA 4HX9A 2WQ6A 5KOIA 1W5TA 4JLAA 4NE9A 4NJMB 2KYRA 2H1OA 4N7RA 1VI6A 4BFXA 3PQCA 4CKBB 4UVDA 5E2IA 1J9ZA 2YHBA 4K6FA 1YVEI 3PC8C 1VPTA 1Y5IA 2J7PA 3V42A 1PJLA 2B1RA 1A9TA 1K7EB 2V7UA 3PUJA 4E2XA 3NDBB 4CLXA 3GLUA 4FT4A 4F5WA 3OZFA 1XD8A 4W9RA 2VJDA 3FETA 1BFDA 3QHAA 2P40A 2QOEA 4PYIA 1MU0A 4IHKA 4JI4B 5C5IA 2JKZA 2VAVA 1OX6A 3C1UA 1CJSA 1KPGA 3DE2X 4GSYA 2PO7A 4BNLA 2ZTSA 3O0TA 4YUYA 4HUTA 1SC4A 2FPIA 1FNCA 4D3DA 4LYFA 4IGKA 5K6AC 2DBVO 3B5EA 3GAZA 4E5DA 5KX5A 4AJEA 1SVSA 1YI0A 3U7QA 4C29A 4Q3LA 5JSZA 3M5WA 4C1BA 3F7MA 2IP2A 1F20A 2NNLD 4M99A 3VO1A 4FQ7A 4CM3A 2JJ1D 3BBPA 3M82A 2AKYA 4O2RA 3R24A 4ARVA 3W3ZB 1E96A 3MCWA 4BAZA 1U3UA 3K0EA 2H3EA 2A0UA 4HFJA 1ORVA 5AQEA 4ZC8A 2FH5B 2FETA 2YV2A 3A1WA 1EZ4A 5IEBA 4QXPA 1HLPA 3U4AA 3V48A 4DKXA 5HE8A 1OGIA 3PU6A 1EUCB 1ICEA 3G59A 2E4XA 1XVUA 5CDUA 1QC5A 1XEAA 3NGXA 3MRTA 5JD6A 5F98A 3DBVO 4CIDA 3IBFA 4UMDA 1RMTA 3QUCA 1O95D 1Z4QA 2HJGA 5JAIA 1ADFA 3CLTC 4KLCA 4JUBA 4TSKA 3RC8A 4G1BA 5AJWA 3UUGA 3Q6MA 1XZHA 2AJ8A 4CF4A 3D4PA 4DMMA 6ADHA 1Z6XA 1IIRA 1E2QA 1ZCFA 1NMSA 4JX8A 4R9VA 2AA3A 4HWOA 3NC0C 4KVAA 2PKQO 1ULHA 1SUAA 3FROA 1E58A 2B1IA 2CCJA 2A14A 2C9ZA 2DPXA 2ZIGA 3EXIB 4MGKR 5E7QA 4LSWA 4F5ZA 5A5GA 4C0WA 1B26A 3KAQA 4Z4FA 3FKSD 2VHQA 2G88A 3KUUA 4O1IA 4BUJA 3COWA 4QOIA 5I7AA 1IY8A 4FFSA 1LA2A 2QQ0A 4QUIA 4TKUA 5CT6A 3CPJB 4Q82A 4DQKA 2R6FA 1QG6A 3E03A 4TGLA 5SY9A 3UA3A 3QXCA 1ZOOA 5D3QA 4ZT6A 4G5GA 3TECE 2GJSA 3EISA 3FMOB 5LSAA 1GKKA 1W49A 4BDTA 4JLPA 3QH4A 1II8A 3RBVA 1FDTA 2IUFA 2P9ZA 2GAJA 2HXYA 3BWXA 4RVCA 2PLRA 2X9NA 3J81A 1T9GR 3LMKA 4IMRA 4YK7A 1IB6A 1A82A 3E9QA 5KYWA 1TAGA 4CEJA 1R0KA 1BCRA 1RI4A 2VZEA 3AETA 4XVUA 4X91A 5AXBA 2XOKA 2CEAA 3GLIB 1J00A 1O8CA 3EPPA 3DOFA 3L8ZA 2ZG6A 2ZK7A 4LSMA 2C5GA 5F73A 4DL9A 1VLQA 5FNVF 5BYBA 2Q3MA 3CH7A 1I5OA 2BJWA 3H75A 1J5XA 2Q3FA 3Q9LA 1ZOIA 1YR9A 4IIXA 2I4LA 2CNLA 1TFUA 2N9UA 3ECCA 4JP5A 4DGQA 4OYRA 5BMVA 1KYXA 4ZMSA 3LCJA 4FE4A 3S7ZA 1HBJA 2DFVA 4F2WA 3Q1KA 4FS8A 4DUPA 4DLLA 4ZXFA 1OW3B 2NZ8A 4WASA 5COQA 1Z0AA 5B7QA 1T5SA 2I7TA 4ER7A 3SJZA 4XVQA 1ZD4A 2OY0A 3HCBA 5FORA 1X94A 4BAGA 2MSDB 3DPIA 3W3AH 2VRCD 5AVRA 4JC0A 1NW8A 4GXQA 4HWSA 3RABA 1YC5A 3U16A 3PJRA 3EW9A 1QTQA 1UXJA 3O3NB 4D56A 3UWMA 2JLZA 4QX6A 1XGKA 4NCKA 1JDJA 3OHSX 5ALPA 4D44A 3OLXA 3IEVA 4WXRA 1K3UB 2YHUA 2D5LA 4XDZA 2VPQA 3IVRA 4EL5A 5IN4A 1WTAA 5B2ZA 3PXDA 1CY4A 4D9HA 1XU7A 3ENNA 4U1RA 4IVQA 4X8OA 5LQNA 3B1YA 4X3PA 2WFMA 3E0XA 1JYSA 3S29A 3SQWA 1AMNA 2W6ZA 5BOVA 3H65A 4HFMA 4LJAA 5FIUA 3SZUA 3TCNA 1Z5PA 2VVTA 2G07A 1J0XO 3ZU2A 4LJRA 3I64A 3L9WA 4GXTA 4HKTA 3PNOA 5AESA 1P3DA 3IKJA 4J4HA 1RPZA 1R10A 2FX5A 4G01B 1J1UA 2Y1FA 2QVGA 4EPTA 1IQ0A 2B37A 2JLVA 2O3UA 1YGPA 2HZ7A 4K05A 2BV3A 3T9BA 2P3OA 4M1TA 3WJ2A 3WP0A 3TLBA 4C5BA 5GV8A 4WX2B 3QF7A 3U19A 4KIUA 2FHSA 2F90A 4U6SA 3O84A 4IHJF 4Q7JB 3ZCXA 4B2YA 2KSQA 3I42A 5IARA 3ADPA 2F8SA 3PDIA 3LUAA 2TYSB 3MERA 4QGFA 4ZVSA 3MT8A 3PGKA 3D8RA 5ALTA 2J9GA 4QOFA 4RL4A 3F46A 3ZBPA 4FZ3A 4K8OA 1LDYA 1XIVA 3PUHA 2Q1TA 5CK4A 5DRTA 3ZHCA 3ZCRA 2HA5A 3H9BA 3UHJA 4FDTA 3V1TC 1EAMA 4MV4A 4M1KA 4LWQA 1UBGA 3P0EA 5ESDA 4HBZA 5DXAA 5DBEX 4CCWA 4UM8B 3D7LA 5CLIA 4L3WA 3AX6A 3D6AA 4X60A 3TX6A 3G85A 3ZWOA 4B6PA 5CFMA 3RTGA 4G24A 3TD2A 1JHUA 1NJGA 4CE6A 2J67A 2QMUA 3BGIA 1RC0A 3BCRA 2UVPB 1JJAA 4JXZA 2GVNA 2OD2A 3AF0A 3HI6A 2XNHA 1S2GA 4HH4A 1WJGA 2Z1MA 3F3MA 4TQUS 3WRVA 2EW1A 3C3AA 5I7VA 1SIOA 1ECCA 2ZB4A 1FA9A 5AM0A 1J24A 1L4UA 2IODA 5ECGC 1A0OA 4M0EA 2W2TA 1WAMA 3O26A 1HYEA 3EK2A 4TSFA 1VPDA 1UZNA 2YFKA 1S2LA 3QVGB 5JH7B 1IK4A 1HDEA 2XZPA 5EP1A 1ODSA 3K31A 2IPOA 2Z58A 1ADYA 3OTGA 3PNMA 4KDEA 1XHLA 4LMAA 1YOBA 4R0VA 3VVMA 3HY3A 1Z6GA 3AWIA 1H8EA 3NC1C 3DW3X 3EJ6A 1W2WB 3DTTA 1T26A 3HNOA 3PFBA 4YMUA 1T9KA 1LEHA 2XCQA 3A70A 4LZLA 4MQ4A 1GTVA 4R40A 4LF9B 3IO3A 2ZULA 3ZDZB 3IIEA 4QE3A 5JMOA 4KU4A 1AC5A 2XA9A 5KOYA 1L6RA 3OCCA 3AL2A 5JQGB 2BW0A 2ZXFA 4UE2A 4XGQA 3R7DA 4RD2A 3RC2A 4DM4A 1BHSA 1OX5A 2BZ1A 5M29A 1ZL2A 1FE8A 1XDGA 4ZQFA 1BFKA 3ROGA 1E9CA 1YS4A 3GZNB 1OX4A 2MYUA 2DLNA 3DHWC 4FFPA 4QJ3A 1I1QB 2IDZA 4UMEA 4MVJH 3OUUA 5AI5A 4FKBA 3VAZA 4BXOB 4PX3A 4IIYA 3MT9A 4AUKA 4J8PA 4BUCA 3QMWA 1QIIA 3OHMA 3EYWA 2ZQZA 2PT5A 2PRIA 3KZOA 3GYBA 1R8QA 1T1IA 5U9CA 3MMZA 1UQUA 4Q4DA 3U0BA 3DLIA 4URZR 4Q1VA 2D0DA 4A0SA 3ZLJA 1ZH4A 2OP1A 1NYTA 3L0PA 4J7AA 4R51A 3P9QA 3ITKA 4P7BA 5C8XA 3ZDAA 3QW4B 4JDUA 1VE7A 4LY3A 4A1OA 1BHJA 1NBMD 2MMGA 3IQHX 3NRBA 3SKVA 1FSSA 2G09A 5BSFA 1PR2A 4WFIA 2QTCA 4D9JA 4RGVA 3GUHA 4D02A 3PLRA 1BYIA 3RBAA 4RKWA 3ETEA 4AS3A 3IAAA 1GQRA 5KCMA 5LOVF 1U0SY 4PLHA 2IPNA 5H8WA 2IHBA 1XUOA 1KI6A 5KYTA 3QEBZ 2N1BA 4TVSA 1YR1A 4GM1A 1HT3A 4PFSA 1MEEA 3BVPA 5IRCD 1Z4IA 1C1XB 1OFVA 1RYHA 3WWZA 1YF3A 1JFSA 2WF8A 3LOPA 4NJOA 3ESQA 1L3CA 3U4IA 4LJ5A 3DCNA 2D59A 4N4AA 3RT9A 1KMHB 3ZZ1A 1CX9B 4NOKA 4BRWA 5B36A 3K4QA 5REQA 1J99A 3FYUB 3N8NA 3L0SA 4P1ZA 3O95A 4Z3OA 3CEMA 4E5KA 1QTIA 2MINB 1DS6A 4IOKA 3E5HA 5JQGA 2F64A 4AYWA 2GEVA 3ENQA 2HBQA 2IV3A 1BE0A 2V6GA 3VO9A 3G2MA 3RS0A 4BIMA 2I1LA 3KV1A 1NR1A 2DWQA 3C2QA 3ZU4A 2X1VA 3WXBA 4DXAA 5DYTA 4V0LA 3H0KA 1NC1A 3IBCA 3PNYA 1KVSA 4TMZA 2HX1A 5ERYA 4CTKA 5K0SA 4ENVA 3RVSA 4BXOA 1R0YA 1M2KA 2OFXA 1Y8AA 3V34A 5BW8A 3GT3A 3KFVA 4IG9A 1WUYA 1XBTA 2UYGA 3U7JA 3UZUA 4AKSA 4W5HA 2W6QA 3W77A 1DAOA 1OFUA 4LUCA 1QSGA 1RQXA 2IIQA 3EOZA 3IS3A 4JLDA 1EGHA 2VZ0A 3P9XA 4P38A 3DT6A 3NWBA 5FUMA 1WA5A 3Q5DA 3Q5EA 3FM9A 4NYMR 1F51E 1L5ZA 3WRXC 3ZE1B 2PANA 2FR8A 2PHZA 3VHQA 4X1YA 3GPDG 4HL6A 5TMDA 1GG5A 2C3YA 3BB4A 3UAOA 6GPBA 5CCDA 5JYDA 1N77A 1DAMA 2HADA 3IESA 3QPUA 3D81A 5GGXA 1M8FA 2WWTA 1E89A 3I6IA 1WABA 4CLOB 1D0SA 5CDYA 1K9SA 2QUHA 1X9HA 3T3EA 4IHAA 4RPGA 5FI5A 5H82A 1NUHA 3IQWA 3R4CA 1DVRA 1D5CA 1SOWA 3CXRA 1DC3A 1LSOA 2PZ8A 1BDBA 1IXSB 1USUA 2I3BA 1CE8B 4F3CA 2IYVA 4DLPA 4NZMA 1YDEA 3WWDA 4JR2A 4IMIB 2VKTA 3PPWA 4I36A 3TZ6A 2HJSA 3HRIA 3E22B 3AY0A 3KDSE 4IY1A 5LZ5A 3SF8B 2R8EA 3OEEA 3DEIA 1H5QA 4XRRA 3F5FA 3LP8A 4TVBA 2IXDA 1XF9A 2XYHA 3EZ9A 1A96A 3QVTA 2NMVA 2A84A 4ZAGA 2PCLA 2WIDA 4KAXA 4QYMA 4DW8A 5CX1A 1AKQA 5EESA 3KP1A 1FJ2A 3RIMA 5DM1A 1ZIYA 1SVKA 2D5AA 4PZAA 4D9KA 4DCPA 5HDQA 1FYDA 1XMPA 4AN4A 1ESCA 2NG1A 3G8CA 4PXYA 3EIEA 4D0LB 4ZVPA 1GYRA 2OGWA 3BS4A 1HXHA 1J0DA 4NRDA 2I3GA 3GEBA 4WXHA 2XE4A 5JSHA 1Z4KA 4KVGA 3AVXA 4UM9D 2FWIA 2QE7A 3HUFA 4LXYA 2EL9A 3QFSA 2FPGB 1OPXA 2JJ8A 5LBUA 3A1VA 4F4DA 4E5YA 2PLWA 3K0CA 5A0VA 1PTJA 2C7GA 3A9WA 4L9AA 2PNFA 1B7GO 4CQMB 1GN9A 3T3NA 3DUFB 5BPHA 3OC6A 1G5HA 1X7YA 2E7ZA 1H2RS 2Y3IA 1JEQB 2ZPTX 2PVCA 5EJIA 3TZHA 1G16A 4EJMA 9MHTA 4B6JA 2QV7A 1FQJA 4G1UC 5T4FA 1E18A 1HKUA 2OCYC 1YK0A 2VQDA 4GVLA 2OV6A 4I14A 2IHYA 4JSYA 4BGEA 1WDKA 1GCOA 2V97A 2AB0A 2VYVD 2IYEA 2KW5A 4AULA 1EFVA 5JAPA 1P17A 5EEGA 4O4IA 4CM1A 2BFWA 1Z7EA 2WRZA 2ZJYA 3KE9A 3PXAA 5LJLA 5F5LA 1Z8HA 1GPDG 3G8AA 2CJWA 1RJFA 5JEEA 5CJPA 3AEQA 2QG9A 1CE8A 1NNLA 1TF5A 4MH0R 4UBIA 5JVDB 2CLMB 1KL7A 3LYLA 4LVNA 4F71A 3CINA 4F84A 4I5GA 2YZKA 4G4SO 1AGNA 1XRPA 3DZKA 1ODCA 4BJ1A 4EFLA 1CV2A 1ML3A 2FJPA 1IM2A 2ZB3A 4F72A 4IRUB 2EFCB 2ZT6A 3GUYA 3V8VA 3EULA 4JI2B 4C2UA 3NWOA 2ZDGA 3DSRA 2HM7A 3ODGA 2DF8A 1NTRA 1JDTA 2IYFA 4JJZA 3UAXA 1CF9A 4C7BA 1WLYA 3OU7A 4L08A 1YB6A 4K1LA 4TV8A 1RPNA 2ZBUA 3RT1A 4B4OA 1PHRA 2Q0SA 1EBUA 2VPZA 3D64A 5BT8A 3KZVA 1F38A 2QENA 1N34B 1N2CE 2AZDA 1DHTA 2AFIA 2JJ1A 4DR6B 2PYIA 1T0BA 2WHPA 3N3BC 4BIIA 1IN1A 3U6KA 5FPQA 2ZIEA 1FTQA 1L4HA 2PWZA 3HHPA 1IK6A 3DKPA 2J59A 3ZVNA 4XD7A 5EHIA 2R8PA 2YDXA 3LDHA 2FDCA 3OE1A 3B2QA 1AZWA 2DKNA 2FOIA 2W2LD 3QLUA 2CXXA 4XCQA 5TVGA 1NJ6A 1YASA 1N2EA 2V45A 3SPXA 1SG9A 3ZLTA 3AF3A 4ROSA 1CZKA 4PAQA 1QHHB 4RW0A 3AHJA 2ID9A 3CEPB 4BO3A 1HI9A 3HA7A 1F8XA 3JAWB 4OHZA 1CJUC 4PS1A 4DMKA 4OAOA 3H83A 4WEQA 2CYAA 2HO4A 1TF2A 4J07A 2DLCX 2M1XA 3AR3A 3GLGB 3KWJA 2JATA 1EE1A 1EVKA 1KVQA 3L8HA 1TUGA 1JKIA 1C9JA 1I2BA 1NRJB 4L8VA 4PPFA 4R2JA 4AMYA 2H9YA 4P31A 4BMSA 1XDDA 4WNCA 4TWBA 2DQYA 3MS2A 5DCYA 3ASZA 2E4YA 1ACMA 3DH0A 5HFJA 1ZCAA 1DRUA 3IDQA 3SZRA 3VAYA 8LDHA 5JY1A 3OY2A 4BFTA 2BBOA 1QORA 1U0FA 3DW1X 3KXIA 3IHKA 2GSWA 4H7PA 3WHIA 5EZQA 2PUDA 4P81A 4DBLE 3NAMA 4EATA 1DX4A 3LQYA 5I9BA 1L4KA 1Z16A 3U3DA 2FZ5A 4E09A 521PA 4R8MA 1R6UA 2HDOA 3GH1A 3EUAA 1Z26A 2YCLA 3NHFA 2VSQA 4G89A 3GA5A 2Y71A 1B00A 2JI4A 3H1PA 2CXTA 5F3DA 2VATA 2Q7DA 1MRZA 4GLJA 2IW1A 5T4HA 1I4LD 2WMYA 2HJHA 2M6KA 2IEAA 3ZWCA 3BSSA 3TPCA 2HIAA 4ETNA 1GZ4A 1KK0A 4XARA 1G3IA 1M8PA 3CLUC 2F1JA 5JNWA 2R8RA 3OX2A 3RIYA 2VHJA 1G21E 2W7TA 4WZBE 5IF9A 4Q7EA 1YDFA 3SKXA 4DNFA 4LHEA 4HAIA 3UQZA 4KKVA 4AKIA 1UXGA 2PKCA 1FUIA 3GCGA 2W11A 2IYZA 1FW6A 1DAGA 1Q1NA 2ZSHA 3TRFA 1QHHA 1TYZA 1EESA 5LWQA 1QHEA 4YJDA 4DVGA 1PK7A 2I5PO 5G02A 1DIOB 1EP1B 1P60A 3V7NA 1WF3A 2ODWA 2WAMA 3FNRA 2D0IA 2DWCA 4DMLA 3U7HB 3THSA 4PIVA 5BR4A 1BO6A 3K0KA 2CHVA 1M7GA 1BDHA 1DO2A 3M89A 1DXHA 3QBDA 5DN6D 4Q4HB 1X1EA 3KSDO 5EXTA 2FA9A 4INAA 3EASA 2ZBDA 3OIFA 2G4VA 2Q5IA 1KU0A 5K3SA 4ENUA 1FS4A 1T9BA 3WYAA 2KWIA 5JMWA 4BFUA 5T8KA 4F7DA 1XOIA 3TTWA 1VB3A 1QHXA 1XAIA 3A6KA 3MWEB 4RK5A 5HMLA 4R98A 4ASUD 2A9JA 4ZA2A 1SU6A 1YB5A 2H18A 3HYLA 5JSKA 1J42A 3GN1A 4G37A 1GPMA 4DMUB 4Z9XA 3BK7A 1NOJA 4KXLA 2XQJA 2LXNA 3DQQA 1B8OA 4LRXA 4ZI2A 5A2GA 2W0MA 2FFJA 2HQSA 3IOMA 4JFRA 2XMCA 3CMCO 4L5IA 3A1DA 3WE7A 5ICMA 1ABEA 5FTMA 3R7WB 2ZSAA 3ZDBA 4LTNA 1M7HA 1TX4B 2O4CA 2AMYA 4O3FA 1LDGA 2PKWA 1QIKA 1N4AA 1CERA 1YBMA 5L7YA 4M88A 3SU8A 2WNSA 4E08A 4CEIB 5GINE 3TZEA 1TYBE 3Q2KA 4OXNA 3NHLA 1FJHA 4L73A 4G9GA 1EQ2A 3G9ZA 3MWKA 1IHXA 1HL3A 5B64A 2FW9A 1PNRA 4FDAA 3BZWA 1KEEA 1BMTA 1P1BA 1LPOA 2JI7A 3K8OE 3Q9UA 3M6WA 1U6IA 3QTTA 2E89A 1AMOA 3ITDA 1UAAA 1SUWA 3AUKA 3RUAA 4FFNA 2O2YA 4XYBA 1JHPA 4L9WA 4E70A 4YAGA 3S1AB 1BIFA 1HDYA 3EQ2A 3BMNA 1K7XB 2NSJA 2YY7A 1OFGA 1QFXA 1F2VA 1K7FB 2G77B 2RAFA 2Y0PA 1GFZA 2ZJ0A 4HB0A 2CMGA 5FI1B 4F8EA 4DC1A 1TK2A 5K0TA 1WM1A 2DFPA 1B23P 1JT9A 3STHA 4YCMA 1W0CA 3H0CA 3JV7A 5KYKA 1KI9A 1L5FA 4ZEWA 2RDMA 1TJYA 3LUKA 3IKLA 4BNDB 1LPBB 4HYEA 4ISBA 1MB9A 5ADWA 5ICEA 4E5SA 4KJZA 5BWNA 3DXZA 5FOSA 1IZ8A 1CUJA 4FD3A 1GY8A 1KMNA 2QLBA 3ROZA 4BNUA 4ARZB 3T5PA 1I2CA 4DDHA 3GGJA 3OUZA 3PFFA 4Q7LA 4WL0A 3S2GA 5AW1A 3IUBA 1AKNA 3O94A 4CKYA 4UUOA 1PLLA 4F38A 2XDYA 4C3OB 3AHGA 3EQ6A 5KOJB 1XRNA 4TZTA 3D1LA 4UZFA 4HFRA 4L95C 1A71A 2I29A 3I23A 4XPIA 2H11A 2AFHB 2P2GA 3L9XA 1MUUA 2CDBA 2A9KA 4B79A 1JWLA 1XZPA 2BMEA 2ACVA 1Z6AA 3CVVA 4L0CA 5K0CA 4EMTA 3T9DA 1DRWA 4QUKA 2FSGA 4GI2A 3QOWA 1QLJA 3K8YA 5KDLA 5JPDA 1I3KA 2ZDHA 1A95A 3JR7A 1XN1A 4RKEA 4KWTA 1GDHA 1PW5A 1M2WA 3I04M 2PD3A 2ZJ7A 1EUDA 2PXXA 5DM60 4KSYA 3AYZB 3C7AA 3EBLA 1HL7A 4HPWA 2WD7B 2DFKB 2GK7A 2IUEA 5A9SA 4EJ6A 5CA1A 1ORDA 4RVFA 1K8XB 1QX3A 3OLCX 1Z25A 3HO8A 3F4KA 3LO8A 3LQ1A 4I9NA 4YR9A 1OYYA 4WBSA 2XAUA 3KVYA 1RPTA 3QNUA 4DG8A 3THWA 5B1IA 1ZK2A 3PWKA 5K3CA 3TMAA 2EX4A 2JFNA 4ZTBA 4B7AA 5E1MA 2X8WA 4YAIA 5CNIA 1ODTC 2YICA 1U9YA 3R74A 1BKYA 2BGLA 3K73O 5TLSA 4QSHA 1CYEA 1E1RA 5LZ8A 4EPVA 5KO2A 3I53A 2IDJA 1SVLA 4HLQB 3DHVA 4O5AA 4X41A 3U37A 5AM4A 5K0EA 2WQ7A 3N76A 2EGGA 3H97A 4FLEA 4BQNA 1GA6A 4JITA 3U3KA 3K9FC 4O4LA 2Q1WA 5H1YA 5AVZA 1W4CA 3ZXSA 4I0WB 3Q8XB 5CVCA 2X9GA 3SS8A 1K66A 4XFDA 5JNUA 4FQ5A 2RKBA 1C7JA 5I7UA 1Y9DA 2FNAA 4HG2A 5JJCA 4ZQHA 5CDGA 3CRZA 2ZUCA 3OLVA 3GVIA 4IUDS 4KQ2A 5EY5B 1GPUA 2VXYA 1E94E 1I0ZA 1RT9A 1IHUA 1SUCA 1KGSA 2HUPA 1GTL1 2OK7A 2QTLA 1I4DD 1NI3A 2QUAA 5ESXA 3TSOA 1YIOA 3KR1A 2R0QC 2I7CA 4BO7A 1H4SA 4JYAB 1KZHA 3O2SB 3CCBA 2YINC 4QRDA 4MVWA 5LL6P 3K0CC 1PTJC 1Z6PA 2EJBA 2A9OA 2X1MA 5HWSA 2NO7A 4HF7A 2P68A 4TQGA 1U9ZA 3C5HA 3F6BX 3MLEA 1NXXA 3R2JA 1KS2A 5BVGB 1L4NA 4Q02A 5CDHA 4CG2A 1L7NA 1HTWA 1SVIA 4XGNA 1KPHA 3V4FA 1ZY2A 1TMKA 4EVSA 1JLSA 3ISTA 4J6EA 1AHHA 3UO8B 1ZN9A 3IR7A 3D8TA 3OIYA 1O0CA 4QZVA 2AYZA 3L1HA 4IWYA 4LMBA 5A4IS 1WXDA 1U7UA 1DUSA 1GG2A 2NTYC 2ZT5A 4TV8F 4V3BA 1JA0A 1JDZA 4MW5A 2PCJA 3AM5A 5L8VA 2BN4A 4JB2A 1LNQA 1CU1A 3A6JA 3N2ZB 5JPIA 3O2QB 1B8NA 2FLVA 1YWGO 2QMHA 4YRSA 1YZ3A 2HHAA 4OQQA 5AVJA 1YMVA 2GILA 5ER6A 1NN5A 4AM8A 1S7CA 3IT0A 1I3CA 1JDBB 4K87A 3VGPA 4RJTA 4UM9B 2WICA 2GN9A 2AQKA 3AF2A 3H04A 3MVEA 4H6PA 1QYCA 3NC4A 3USCS 4DBVO 3RNLA 1YUNA 2QNRA 2NYVA 1IATA 1Q6ZA 3RYIB 3WNDA 4UVEA 5JQWA 4OXYA 4WOCA 4B1FA 4Y0NA 3EZ6A 5I7FA 1YTLA 2WIGA 3RUCA 2H1HA 1V43A 2O2CA 3H84A 4D2IA 4NU0A 3PQ2A 5AD1A 1T2EA 3CB2A 3PDUA 4JCCA 4CIBA 1BEEA 1LBSA 4CLEA 3O8OA 5MGBA 4UJ5A 3B82A 3PXUA 1T2VA 3CH4B 2G1PA 2HNBA 1INLA 2QRVA 3GVPA 4PZ0A 3PJDA 4BQFA 3QE0A 4YASA 3V9AA 4CKCA 2J30A 4OSOA 4RO0A 3MXOA 3QLUC 4FYVA 4EEXA 1OBHA 2AEMA 1K3FA 2CLFB 4NOJA 3VV2A 8ATCA 4X90A 2XQGA 4BB5A 1ODFA 2EGHA 4DCJA 3Q9NA 4TLAA 1X7WB 3QPCA 4N01A 3ESDA 3JXEA 2ECPA 4IFBA 4OKSA 3AJAA 3ONEA 4YRBA 1NVFA 3O8LA 3WK4A 4DR7B 1MEOA 3AL0C 3FSGD 1FFCA 2GA9A 3U80A 2XT0A 3CPEA 5GPBA 4AZWA 1THGA 2K2WA 3PP8A 2YXNA 3FNFA 3HH8A 4YUVA 4H08A 1DAHA 2RAUA 2DFNA 3DL0A 3L8YA 4INJA 3DVRX 4JEHA 4P0TA 1UT8A 4P3XA 4AUNA 4CFZA 4YROA 4R8LA 1QVVA 3JWPA 3Q11A 5H3HA 3IT3A 3DWEX 3WKBA 4AMBA 5L6LB 4X0EA 4ZJPA 4DKJA 1VPLA 4EYQA 1WMDA 1PR9A 1N1MA 2WTNA 3ROKA 2H92A 1K2VN 3PTZA 4KQWA 3TSYA 4C9BA 1DL5A 4AI6A 1LRLA 2BEKA 1XWIA 3E6AA 3F2VA 2O2IA 3LXRA 3QG1A 2WINI 1VJGA 1JEDA 3GD5A 3PUZA 2EV9A 4FSDA 5CG2A 1VLHA 2ZCUA 4FHZA 2M32A 2QBYA 1K7SN 1H0RA 1ZEMA 5J9FA 3IVAA 3AP1A 3ZW9A 5B53A 3HKBB 3OIGA 3VSCA 3I4LA 2BGNA 1FOEB 2OXIA 1GA4A 4M0FA 1M9NA 5EWMB 1CZOA 2V5AA 1GTMA 3EFBA 4IGEA 1VMAA 2ID8A 5CVVA 1WXEA 4CODB 3TOSA 4NG4A 4S24A 5TS2A 1FFEA 4AY6A 2AUMA 4RIEA 3T38A 3F97A 2K7FA 4IZOA 2Q9UA 2DLDA 1N9GA 3KKQA 2ZSUA 5EFZA 4IGAA 4Z9BA 1ISPA 2KLHA 5TGTA 3TJZA 1XEXA 2WTMA 4E21A 1MJ5A 4KV7A 4RQBA 4CUKA 6REQB 3MIZA 1NSFA 3ND9A 4UHJA 2IZ5A 2OHIA 3RD5A 3ORFA 1X8XA 1A9OA 3DFFA 4MKXA 2O4UX 1R9GA 3QEAZ 3COJA 1X7WA 1QYIA 3R3VA 3WGTA 4MNTA 3FJ1A 2RHCA 3IPCA 2H6EA 1TQ8A 2VF2A 3OZGA 4FNOA 1QIDA 1XJQA 2R47A 2R751 1NGSA 2QN3A 2QZPA 5CD1A 1VKHA 2EEPA 1U8CB 2LTAA 2QMYA 3OPVA 3RTEA 2B6NA 2JGRA 3A58B 4ZOLA 1EG7A 3GRFA 4NU5A 3O3CA 4H16A 5DLQC 5IT0A 4P0PB 4ETWA 4DMCA 4MKHA 3UFXB 4TM7A 2LCIA 2VF8A 3FWHA 1XZEA 1WV1A 2Y1EA 3GLRA 3VH2A 3ZG6A 4Y2JA 3ZY4A 4C2AA 1I9GA 3KJEA 5T8KC 4RDXA 4LSZA 3OJ0A 1XI2A 4MI3A 3E5RA 4WK2B 3C8UA 5FFMA 1VG1A 2WKPA 2ZRBA 3HJRA 3A36A 1JIVA 3LGSA 1XQXA 2JFGA 2H1VA 2VSXA 2W2LA 1OLUA 4ZIRB 1O6FA 3WGOA 2I34A 2X7XA 3GN2A 1ZINA 4DIUA 2B94A 2NO5A 4RDIA 3D7MA 3B1WA 4DDVA 5CP8A 1LPAB 2OSVA 3TG2A 4M1QA 2HSZA 1ANKA 4XYGA 2WT8A 1NOKA 1X6VA 3KEFA 2W6OA 1XTJA 1NQXA 2RG7A 1MX9A 3F6EX 5KTOA 3WGUA 3Q12A 4NVRA 3QVVA 4NV0A 1FNBA 1T2UA 4TYYA 3BX1A 1QP4A 2NSDA 1Y1RA 3GNTA 1NP7A 3CC8A 1K6XA 1P5RA 1SXHA 3NANA 3R0JA 1AKYA 4GFDA 4YWJA 1OYOA 2O9JA 4MQMA 1JR2A 4QULA 1PL6A 4O0MA 1MHTA 2Z4TA 3ZDYB 1ISRA 1C29B 4YX9A 2JEYA 2NYRA 3PYLA 3ONVA 2OO7A 2PLNA 3G0HA 5IHXA 2EX1A 2NXNA 3DBRB 5BOSB 4LDPA 4BU0A 3RVLA 3UYKA 3WZ2A 4TLMB 1UBEA 1FDIA 5EJFA 2X4DA 3FWPA 4OBBA 3BE4A 3P9CA 2NZYA 2Z6AA 3GVCA 3JZFA 4K86A 4XOUA 4F4JA 2O1WA 3MD0A 1T6BY 2NLOA 3CGWA 3VZQA 3C8MA 5C1DA 4UNQA 4A0RA 3W4KA 1SKAA 3DOCA 4IJ6A 4N5LA 1W1IA 3I37X 4TKVB 2RI1A 1JLRA 1UM9A 2J5XA 1EB8A 1N7JA 5DEOA 3L6CA 1PDWA 3SJBA 4B7XA 2ZCVA 1FP2A 5EIAA 4ZQGA 3CIFA 4BGDA 3MPUA 1OZAA 4OL0A 1IFXA 4UPDA 4DC0A 3UMRA 1RZUA 5CTAA 5LDGA 2MDTA 3DHEA 4ZTUB 2FW7A 4JP8A 2NXCA 2NADA 4N5HX 4ZICA 4ZIRA 2F8TA 3A6FA 1X1QA 2Z83A 3D4OA 4BVGA 3OTWA 4HZUA 2X2EA 3PD7A 1HDGO 2QRKA 3ABOB 4PQRA 4NR0A 1UPXA 3CCFA 3KXKA 2DHQA 2ZIXA 4ZYUA 3SX0A 8OHMA 1LRKA 1S4QA 4O4LF 3I2IA 3KAJA 5CGZA 5JD5A 5IJ9A 1RTKA 5EJAA 3THRA 3DULA 3OOWA 4Q9NA 3BCSA 3KQYA 4V02A 2A4KA 4LJ4A 2OB1A 4M9XA 5EUQB 3KSBC 3HJBA 2RCNA 5DSZA 4EELA 1Z2AA 3HRHA 1M6VA 1WZ2A 1L1EA 4CQJA 3PNPA 3TD6A 4G4IA 1X7DA 1WP4A 4DQXA 3EGXB 3WGYA 2O6LA 1ZMXA 3C6BA 4GZ5A 4R2MA 3ZZ0A 1M8GA 4DWWA 4QTYA 3A1SA 1JECA 1X70A 3E27A 4RS4A 1RE1A 4D8WA 4FS3A 2GETA 3B5JA 4QYXA 2ZAGA 2L0XA 3NBZC 5DFAA 4Y2QA 3WWYA 5C4IA 5JFGA 2GFHA 1LDNA 3M2TA 2RGCA 4C6RA 2VH2A 4E4RA 2H07A 4KXXA 2DXIA 3ZWYA 4G0XA 4MV0A 5CVEA 1I2DA 1TFRA 2ZIUB 2XYGA 1Z5VA 2Q1SA 2C1ZA 1UDCA 4O4JA 3ZDRA 5AOCA 1ICIA 4PCUA 4UQPA 3S8YA 5J43A 4JOQA 4YUXA 4MVJF 2A9QA 2ZUFA 3M4YA 1WUKS 3HA3A 5EE3A 4FC7A 4WI1A 1XCMA 3UK2A 1EG2A 2EKDA 3ORSA 3WLJA 3RRMA 3E61A 4CQLA 1QKIA 4BDSA 4YCNA 4D4MA 2O0MA 1SWWA 1G5FA 5CEFA 1YFLA 2A9RA 1NMEA 2JFZA 2VF7A 3KDPA 5H68A 1WETA 4BVHA 2AJTA 1GGKA 1M10A 5DK6A 1IN5A 1L5YA 2WM2A 3FTNA 2G5TA 1NDQA 1SBYA 2AN5A 3ULKA 1N8SA 2YMPA 4NIMA 1L7AA 1YZYA 3TIXB 5BW4A 2HZBA 1M2OB 2NVOA 2PTHA 3T3HA 4HQ0A 4C4ZA 1BVHA 1EZZA 1P33A 4KXWA 1GVNB 4WHMA 4BQRA 4F1WA 4J1NA 1D7OA 2FP4A 3I9MA 3M4XA 3OOJA 3WGZA 4BP8A 2W2OA 2BGIA 1X13A 3JQEA 4FMCB 4EJSB 5IKMA 2VEDA 2REOA 5SV2A 3PQDA 1Z7WA 1AVTA 3M6LA 1NJ8A 3NTVA 2XWSA 1XTVA 4LGMA 4WKBA 4Y9SA 5EKTA 2OBYA 1OGYA 4HPXB 3TZLA 2PZJA 1ZWKA 3ACDA 5HE9A 1YB4A 2OHFA 3USZA 5JNTA 1WHSA 4QARA 1D09A 3QU4A 2CBXA 4URHA 1K5GA 5IWAB 3SQDA 1F9EA 1VYHA 4RVSA 1C9KA 1ZJZA 3CRNA 3R5JA 4FYWA 3IKVA 5C8YA 4CTOA 3L49A 2CGEA 1VZ3A 3NOVA 2QK4A 4IH1A 2PSEA 4Q1DA 4QOEA 3ZH9B 2PUHA 3AI7A 3E23A 4M37A 3AZPA 4D80A 1NM5C 5AUPB 1P74A 2ARKA 1LQ2A 2QX6A 2W2KA 5JY6A 4P54A 1W5FA 1D8TA 4B5KA 4I4CA 3ZCQA 2VK2A 4WQMA 4ETIA 3FDXA 1C9YA 1G55A 4KI0A 5J2UA 1WDMA 1NRXA 2G67A 3NT4A 2ZU0C 1KK1A 3OQ1A 4NESA 4OFZA 4YO8A 4ZO9A 1TLFA 2HA3A 2PVPA 2IFTA 4K2AA 3NV7A 2E4WA 5I3ZA 3HXOA 1ZZEA 2EF1A 3W6ZA 1KY3A 4LFAB 4A73A 1BFUA 2XXAA 4OA5A 2QL9A 3NM4A 5FUVA 1E2FA 1JDNA 4WD3A 5EWJA 2HWKA 4WPGA 1GAJA 1FMJA 1GKUB 2DHCA 1KR5A 2VRWA 3N6VA 4WDQA 4XQEA 5FTJA 2LBPA 3S8MA 5L40A 3KS9A 2Q5QA 1EDEA 1QV6A 4MRRA 1MIOA 2GT1A 1IUNA 4RD1A 4JI6B 4J16A 1V1JA 1DJQA 1V25A 1AV7A 3EWIA 2X86A 4OL9A 1IM8A 4QGAA 4CI9A 2IHNA 4PHTA 1XZ8A 3P9NA 4U6NA 4YHBA 1Z0FA 2OE2A 1C3LA 4QFBA 4Z0TA 2J6HA 1L5KA 1GQSA 2J09A 3C3JA 1B43A 2XUDA 4C4TA 4BGUA 3PJEA 4BEJA 3A05A 4JYZA 3AEUB 1SBHA 4RE5A 4K9RA 1G1MA 2R7AA 3K94A 1YFKA 1DADA 5AOAA 4DIBA 2AOXA 2JD0A 1ZHHA 3KV3O 1Z5WA 4MYHA 5MN5A 1RI1A 4Q39A 1VKOA 5JZVA 1QZTA 1VCIA 2HSDA 2ERYA 2GF2A 1R6TA 2AXNA 2J31A 3MCUA 4HAVA 5E4JA 3MMNA 5ENVA 4I1PA 1Y4DE 5EMKA 1KWGA 4IR7A 4BO6A 3OJFA 1IBKB 1W4BA 3IAHA 2LGJA 5G3YA 2ZPUA 2QM7A 4I50B 4K46A 4GICA 5TARA 2COUA 1TQDA 2XMZA 1UBUS 1ZU5A 2VJBA 4LRUA 1SA0B 2P11A 2VOEA 3WMFA 3ZE2B 4JT9A 1JBQA 1I7NA 1ZM4A 2FGJA 1OXVA 1T4CA 3UCEA 2JEOA 4REQA 1CG6A 3R9WA 1SOMA 3CRMA 4REMA 2BSQA 4OOEA 4CV1A 1SXJA 1NL3A 1OF1A 5LXTA 2DFLA 2SCUA 3GQBA 3MWGA 4GZMA 4WAUA 4X97A 3N70A 3VI4B 3EZGA 3GQVA 3KJHA 3BGDA 1GKLA 3L7CA 4J75A 3GRPA 3EXFA 4Q4AB 4B83A 1ZGAA 2Q4TA 4F3KA 9LDTA 2ACKA 5AWFC 1SZCA 1IQUA 4M53A 3KSRA 4IDDA 3PDHA 1Q7GA 3O8QB 3H5NA 4NNJA 4V2IA 3M1LA 1O89A 3NU1A 1VG9B 4HEQA 1JDUA 1YCDA 2MSKA 4IXNA 2HRDA 4EPYA 2RGXA 2ID7A 1ZH8A 4Q15A 2BFDB 4MJ3A 2JAUA 4ZREA 4EG5A 5B7PA 3QITA 2D0PB 3MIIA 4GMFA 4OATA 2QJTA 3NEYA 1GARA 4P3KA 1SD5A 3AM4A 4U0JA 4F3TA 2XIQA 4ZN6A 3W2IA 4YJ2A 1PP4A 3FFBA 3CF6R 1PDOA 3WNCA 2QTAA 4LHXA 1KP3A 1UKAA 2RHOA 1DV1A 3N0XA 5D1HA 3SZLA 2GESA 1T8RA 1IEWA 3K1ZA 4O4HF 4RGYA 4TT8A 4IAOA 3ABQB 2HNKA 1FL9A 4I9UA 1BJTA 1P45A 3HKEA 4HWTA 4XWAA 4B17A 2X9QA 3ZV7A 3WFJA 1HLDA 1IY1A 1IJBA 1JMYA 2CK3A 3AUFA 2GNAA 3GWGA 1I3NA 2BBWA 3PA6A 3RRXA 1I33A 4LY0A 4Q9DA 2Z9CA 3QOFA 2CZCA 3EJWA 4DLXA 1AQLA 2D2VA 2JJ2A 1EUYA 5JAMA 2C04A 5B4TA 4UM5A 3O03A 3FTFA 2WT4A 3BAZA 3UWSA 3VXKA 1JPUA 1V45E 2DBZA 3IVMA 4NBNA 2NPFA 1AGPA 1YKSA 3PVCA 3Q1LA 4G8CA 5TQJA 1JFTA 3K9CA 1TD1A 4R54A 3CR7A 4YCBA 1CEYA 4X64B 3KT6A 4CGZA 3MWLA 3FOAA 1EM6A 2J0UB 4P0QB 2FP3A 2KE5A 4EI7A 2Z2XA 4PLWA 3RAJA 3S2ZA 4GKAA 2IOHA 1THTA 1N3LA 1T8YA 2BRUA 2DPYA 5G2OA 4B8ZA 3WKAA 6AT1A 5KNDH 3ROEA 2WIAA 4ZOQI 1XZLA 3W5SA 3KVOA 3E3NA 4LJ6A 1PO7A 5FD8A 3CEAA 3WK7A 3GYGA 3VKHA 4J1SA 1MD9A 1THMA 1XRJA 4RCVA 1DJNA 3DM5A 4BMDA 1KI2A 2I8LA 2F2TA 3AGQA 2OZKA 2PS1A 1P0IA 4UUBA 4MWCA 3M70A 4QJ5A 4OHWA 4H3KB 1TM7E 1W85B 3A9UA 4U8HA 4Q4JA 4Y2PA 3NPAA 4HC4A 3TOCA 1CIJA 4Z4IA 1OILA 4MCAA 1PSWA 4OQEA 3VV3A 2SKCA 3THYA 4TKMA 1DIGA 2V03A 5FHRA 2Q3HA 3TNJA 1VLJA 4M1MA 2V5VA 5HG0A 3CONA 4ZAYA 1AA9A 1G3RA 2NP6A 3CEJA 1BXRB 1O08A 2QQGA 2PAAA 3DDOA 3PC3A 2ORWA 2GHRA 3D02A 3LUJA 4XVHA 4YNBA 4MQEA 4EJFA 1J49A 1OWLA 1P6UA 3FNHA 3OEHA 2DSNA 4XWWA 4E5PA 1OU0A 4JD5A 1ZJ4A 4UXIA 3SNKA 1JFRA 3IEKA 3IT1A 5FO0A 2QIPA 1I4OA 2FMHA 2GHIA 3CF4A 4U9IS 3T3MB 3ZHVA 4ON9A 1R5OA 2XDAA 4LX0A 4RMHA 4RVOA 4KIGA 2J3EA 4YJKA 2HO5A 4HMOA 1XCLA 3RVOA 4PBRA 2D8MA 4H15A 2OZEA 2WOJA 3CA8A 2B5WA 4XFJA 3LAWA 3F49S 4Z9AA 1C4XA 1B16A 3TTVA 5A4DA 3HXQA 2G25A 2YXEA 2PGJA 2GBIA 3Q10A 4O4JF 4TT3A 1I1NA 4EPXA 5FBRB 1EXNA 2GRUA 4CF7A 2WIBA 3DT8A 4OD0A 4C08A 3KL2A 1JT2A 1JU9A 5CT8A 4IBOA 4Q12A 2G71A 5E9WA 2PS9A 4AF8A 1OXTA 4N18A 1NDHA 1VA5A 2O8NA 4FCCA 4QOJA 1GCAA 5AHRA 4L72A 3NGMA 3EDRA 3TDMA 2PT6A 3OZIA 3WTBA 3A1FA 3KLMX 1E4EB 2WAXA 4JZKA 2E1RA 5GIPE 4A03A 1NSYA 3PDCA 1PK9A 3I1YA 5AUNB 4MW1A 1CJTC 4JAVC 1KEUA 4BQIA 2QZZA 3UK6A 2YJ4A 4YIKA 3PHHA 1WVIA 3RRBA 1TYAE 2OCGA 4MUEA 3RSZA 1G41A 2RAVA 3ZW8A 1QWOA 3JQRA 4E15A 1QOZA 5JNLA 4KYUA 5E8JA 5JHHB 1Y4SA 1UC8A 3KQTA 4BMPB 5F9MA 2GAOA 1W5AA 1UJCA 4JYCA 4GI1A 4C7MA 4Z49A 3H18A 4QBKA 5LYJA 3X1KA 1Y33E 2J0SA 2YVKA 3I05A 3MSCA 4U0KA 2FWAA 3KUKA 4UULA 2ILTA 1ZR2A 1V0JA 3EA4A 5I7HA 3TQFA 3NTOA 4GT1A 5F5XA 1HE4A 4JHXA 2BL4A 3JQ8B 3LHDA 3WKDA 5A5FA 2XVXA 1NLZA 4C6SA 1E9RA 1XR3A 1Q91A 3K20A 4YCAA 3VZCA 2WM3A 4URVR 4P53A 1F4LA 1N33B 4MS3A 4HNTA 4BZPA 4G09A 5BWOA 2R5FA 3MJDA 5CFQA 3B53X 3W6UA 4DSOA 4NCXA 1E2MA 4CUZA 1C0IA 1P5FA 1BS2A 2P4HX 3AHEA 2Y68A 4KV9A 1WB4A 3JWJA 1IY0A 1IWPB 1F2UB 2WD9A 3R41A 4XLTA 4DF3A 5E2AA 1YCHA 1LDEA 1J25A 3CX7A 4JUDX 2IYRA 2PWBA 2X5OA 4RJIA 1AD2A 3QLEA 2VPTA 2XMGA 5EQJB 4YXFA 5JCPA 4QU8A 1Z7YA 1ZRMA 1VLVA 4UDOA 4C4SA 3HV0A 4HRAA 1W8DA 2ID4A 3G0GA 4AW9A 1ZXBA 3RK1A 5I5EA 1ODLA 3KQLA 1YRYE 1OI2A 3U6BA 1EEHA 3AJEA 4V0QA 2WYIA 4FR0A 4WNAA 2FMUA 2OD7A 5HIJA 3NHYA 5TR9A 4E5NA 1JQLB 5J3JA 2I4TA 1DG3A 2YY5A 4YS6A 1QRRA 1H1LB 3PXCX 3OFVA 4XD2A 1M54A 1OUMA 1ZN7A 4AO8A 4COKA 2WT9A 1GQYA 3Q7PA 4A0QA 3QNMA 4M9CA 1KVTA 3DLAA 3ANTA 3K1TA 3EVBA 3OIUA 3OZ7A 4JBLA 4MKRA 3IODA 4PVCA 4Y6PA 1OXUA 2ZUVA 5ANRB 5LBTA 4OXIA 5JYBA 3EIQA 4J29A 4OQYA 3I2YX 5G40A 3BRSA 3PNLA 3TLMA 2OHXA 3HFGA 2UAGA 3HLTA 4MV8A 3QENA 2WJIA 3D9QX 4H4DA 4KQ9A 4NJEB 3UB4A 4NHEA 1R4MB 3V6MA 1JDSA 1XT6A 4QLAA 2PZLA 1NBHA 2Q2VA 3KNZA 4JMLA 1ZN2A 1NLMA 3DHNA 4GX5A 4BASA 2BFBA 4JGBA 4M98A 6Q21A 5I8PA 1IEQA 5JC1A 2ZRPA 1M6WA 3EMVA 4GPEA 1XZBA 1CULC 1YA6A 1T10A 3T8YA 4KFTA 3U9LA 1HT2E 3SAJA 2WY2D 1QQ6A 3M9WA 1RVDA 4A36A 3N5KA 4R3UC 4QVKA 3M3DA 3HA2A 4KXNA 4LYYA 4JLBA 1KY2A 5KQPA 4S2EA 3VC1A 5JSQA 2OMEA 4QL3A 3O5AA 3RS7A 3QWAA 4N0EA 1H6BA 2PD6A 2XMBA 2ETVA 3G7SA 1AK1A 2VLIA 3T7KA 3VMFA 4AMUA 5AVVA 1MABA 3DS8A 4XGIA 3OPYB 3DVQX 1HRDA 3OP4A 1NV9A 5H9WA 3BFPA 5IJ0B 3R5XA 1MVOA 5GIOE 3VYTB 1SCNE 4LYJA 1DAIA 3OE5A 1KQ3A 4QUJA 4A9AA 5GJBA 1HQKA 2P67A 3LPNA 2QMOA 2Q7OE 4CRWB 3FWNA 2CY0A 3QU9A 2B0JA 4RZ2A 2F00A 1K5HA 2IIVA 1YQXA 1A76A 2C95A 4RD0A 4U7WA 5H02A 4DIEA 2VTBB 3GRKA 3ETLA 1X39A 1IAVA 4FIZA 4JSTA 5KAMA 3DXFA 3I45A 3RS2A 4DXHA 4YMHA 1T0PA 1LD3A 3I09A 3D6UA 3K32A 3S68A 4IDOA 1HF3A 2NT4A 4I1RA 2GARA 4U9UA 4S35A 1QM5A 1H5UA 2FJ0A 2L69A 4PE5B 3CT6A 3V4VB 1D4FA 1SCJA 2QL7A 3DVAA 2BMDA 1HT1E 1NF3A 3C6MA 3LZCA 4G1VA 2OENG 4D9GA 3DEAA 1QIEA 3A6PC 4X20A 1U65A 3PBKA 4QVGA 4ZO8A 4EKNB 3ORRA 5LB2A 1AT1A 1UEXC 2A5LA 3EXEB 3WI7A 5KYYA 1PV4A 4JBIA 3ZYZA 1YVPA 4OUDB 4J7CA 5C7IO 4IKOA 4IIJB 3B3JA 4M7PA 2BYTA 1ZQ1A 3KQHA 3QHQA 3A0RB 4N6OA 1SHLA 3RARA 1P2FA 4AKEA 3VA7A 5TF4A 1SXJC 1XD2B 1ABFA 1CVIA 3GFVA 2HHLA 4REOA 2RBEA 2NU6B 5F21A 2PUVA 4J3NA 4C5AA 2A0FA 1E5XA 1JG1A 3KB2A 1JLLB 3RWMB 1P7PA 1BG6A 2GPJA 4DQVA 2QAGB 2X5NA 2PVSA 4RADA 5B37A 3FY4A 3CF0A 1I14A 1U7PA 1HEIA 1T5LA 4DR1B 2LE0A 2C2WA 4GOND 3OPYA 2NXJA 1IZ9A 3FPEA 3IQXA 3VKWA 3WLFA 4BMYA 1U7TA 1KY5A 3PRJA 4I8DA 1GM5A 4HWGA 3AQIA 5FR2A 1P5HA 2ZYIA 3OG9A 5EJGA 1U0NA 1M7BA 2HUNA 4M6WA 3G9XA 3H9QA 4M9QA 1DWUA 1MW8X 1USKA 5EJEA 1XXLA 3TEJA 3B9PA 2VBFA 3DKKA 3L8FA 4GGPA 3TUZC 2RC6A 3GO4A 1OOEA 3VR0A 3CIOA 4HBGA 1UWCA 4FP9A 1NN3A 3W1VA 2ZRAA 4K6OA 4Y0AA 3SYNA 1RJWA 1KDPA 4I3FA 1XYVA 1GGEA 4Y2VA 3TLJA 5EMHA 4YT4A 1TZ2A 5CFNA 5DNCA 1UH5A 1AB6A 1R37A 4V1CA 1KO7A 2IUSA 2CHUA 4TV9A 3DWIA 3EZLA 4AZTA 4ENRA 1PS9A 2J5BA 3F8TA 5F3WB 1X74A 3OA0A 2BEVA 1UC9A 2Q2QA 2ZJBA 3BFVA 4MLZA 1IPHA 4DN6A 2V9PA 2CVFA 4FNGA 4E12A 4EK9A 3GUCA 1HY3A 2UVQA 4N41A 3MLBA 5H5JA 2ZYSA 4D79A 4DT1A 3HDVA 3HYRA 4HUQB 4UASA 1KE2A 2EP7A 2WSSA 2K7ZA 2OVBA 2CFOA 2JVJA 1CUGA 1ILEA 4KX5A 4G1CA 4R1QA 2QPTA 1YKGA 2C07A 4R6WA 4MHTA 1VPVA 3NEJA 2XVMA 4BYMA 2BRUC 1JQBA 1II9A 1PCXA 4TWRA 3IH5A 1YFJA 3AVUA 5H9VA 1FLVA 4S04A 4ZV9A 3O9ZA 1JDPA 1TXGA 4GVPA 1E61A 3UEOA 1MO3A 3ZDEA 4BJHB 4JVMA 4AJIA 5D7BA 5KKCA 1N8TA 4GZLA 4PV7A 1Y1PA 1Y8QA 3DV0A 3EA0A 3QF4A 1BOOA 1NNSA 4ZQBA 5IBPA 3HBNA 5KIAA 2D7DA 1S01A 4JUAA 3C7DB 3EE6A 1RW4A 7YASA 1KF0A 2Q6OA 3KLNA 3QK7A 4B3IA 3N07A 1O96A 3MB8A 2QW1A 4GX0A 1QG4A 3B2NA 3C98A 1YB7A 3LGXA 5EP2A 4A23A 2R1UA 4F93B 1V16A 4WDRA 5HS6A 5TT0A 5C52B 2D2EA 3HCFA 4OV6B 3EIXA 3ZQ6A 1OFIA 1R12A 2NQ2C 4QAQA 5BNWA 5KU1A 2WG2A 4XM2A 2C77A 2WWGA 3L0ZA 1XMXA 1OLXB 2B4RO 3KG2A 4E22A 2AN3A 1C14A 1GPKA 3QYPA 4B71A 1NZJA 1MV5A 4MRMB 3UWKA 2P7IA 3EUEA 1EB9A 1JKXA 5GMOA 1NNEA 4Q1CA 4D57A 4DDKA 4LXGA 5HHTA 1HETA 4JVOA 2HPHA 3L8CA 3BL8A 1CLEA 4TTJA 1OKKD 1E1QA 4IO0A 5DOZA 4BNZA 5HOEA 4D25A 3RUHA 3GGDA 2ZYRA 3SR0A 4OHFA 2R5WA 3EAGA 3EPRA 2RHBA 2EERA 5EQDA 1O4VA 2BHSA 2II6A 1LQTA 3HBJA 3MJRA 4H0CA 4IKPA 4J7UA 5LYJF 2JLXA 3WHLA 3N6RA 3J81k 3H5OA 5BWCA 5JNRA 2QG4A 5CVDA 4RNCA 2J6IA 3W78A 2IX3A 2O07A 3DD5A 3GRYA 4HQRA 4PRKA 1AO0A 1PT7A 1FIUA 2PJUA 4HYQA 5TV2A 1N2IA 1P7ZA 3K9QO 1RHMA 3PB3A 4D3FA 2XCSB 1XRSB 1SKBA 1YZHA 2VQSA 4BPBA 3CTMA 4GYWA 2GPNA 5L6MB 3ETHA 2PO5A 4C3UA 1T35A 4EFDA 5BSVA 3I9V6 3CV3A 1JIXA 1PZFA 1DLIA 2W71A 4H7FA 1WWKA 3KJIA 4PYOA 5TGDA 4DM3A 3A3YA 1X0XA 5ECYA 3QPWA 1R4NB 4RF5A 5TEWA 4IJ5A 2R6AA 3OZRA 2CXSA 2ZYWX 1QR2A 3BHNA 1X92A 4YGXB 1UK8A 2IV7A 2BGRA 3WNBA 1WUJS 4IQFA 1H2XA 3I12A 4D98A 2R84A 1U1IA 1RKUA 4QNMA 1JIUA 1LLFA 3PNSA 5CG1A 1M33A 3IP7A 3TDKA 4AP5A 4B87A 1PUIA 4CIAA 2G9RA 4JQOA 2BE9A 3O38A 4LK2A 3C5EA 5FTWA 4AY5A 4OP2A 4ZRMA 3LK7A 4PXAA 4QQFA 3P9SA 1P75A 3EHEA 4X63A 4YN3A 1AK2A 3RSSA 1V11A 3M3HA 1TYCA 2GI4A 5ALUA 2PNJA 3OZBA 3THOA 1NBIA 1M1YA 2J0QA 4L4XA 3RQIA 4EY5A 3S8EA 1DDOA 3G0DA 1GGNA 3AP3A 1U1EA 1LV8A 3EEYA 5L3ZA 4CL3A 2KPOA 1UEIA 2IE8A 4JLVA 2ZITA 4L22A 3EVZA 2JBWA 4C4YA 4AN0A 3LC7O 2JIOA 1HORA 4IZHA 3N5CA 2B5VA 3DMDA 4FZRA 2O8CA 5U4XA 2POQX 5JBIA 4HGRA 4OHMA 5AKJA 2YV4A 4EJ2A 3N59A 1ECLA 4LSGA 2QN7A 2EKZA 4G5QA 2WNIA 3VVCA 4A6EA 4GOOD 2B20A 1KY4A 3ZLUA 1QZZA 4RYLA 3BBLA 3IALA 2Q5LA 2WWFA 1RBQA 1P1RA 3UCFA 4OHBA 2Q4EA 3QVSA 2XEXA 1RLMA 4N0DA 2Z2IA 2JG3A 2P65A 3BQNB 3LT0A 5F33A 4C7JA 3C8DA 4KFRA 4B3XA 4EARA 5LYYA 3ZQJA 3NHBA 4JH0A 1PR5A 3WGMA 2YIJA 3COYA 3ZD7A 3C7KA 2C1XA 5EGNA 5EHNA 2G80A 1FMFA 1UWVA 3QVJA 4FMDF 4IV8A 4KDFA 4F6LA 1CY2A 1AX9A 5IAKA 1EVQA 1WZIA 3BMXA 5G1PA 2OM6A 3TBHA 2QTVA 2WAYA 4OJYA 5JDCA 2G7ZA 1UDRA 4JJKA 1GILA 5CBPA 3STWA 4CM5A 3V4RA 4AX8A 1DQSA 3RGWS 2OV4A 2P9GA 2FPWA 3VO8A 4MMZB 1JQEA 2EJVA 5FLEX 4BVKA 1PWHA 1RP1A 4CLDA 5KTMA 2I99A 2GVZC 1PEKE 5JS8A 1D2NA 1SXGA 1H9AA 4TS4A 1BKDR 3OQMA 1A8PA 1G5TA 1I01A 2OWEA 4Q3OA 1TTPB 4CGYA 2WVAA 1OHHA 3L46A 2QL5A 3I9OA 5KNDA 3R5HA 5IMSA 4IIVA 4M1YA 1CUYA 4Y2RA 2OB2A 2DHEA 2Q99A 4RKQA 4XX1A 4Y1EA 4YRAA 1TRHA 3BWDD 3DWFA 2UZ0A 2BISA 3UMVA 4NOLA 4CDMA 2D6FA 1XZJA 3GZTB 2B8EA 2CJYA 3ME5A 2VI5A 3N87A 5KINB 1T1JA 4HDNB 4IYJA 2A1TR 4FE7A 4G1FA 4LY9A 1JI3A 3VR2A 4K6CA 4B43A 4CG0A 4EB0A 2DUWA 2EKQA 3DOUA 3R76A 1T1RA 4KVZA 4AQDA 2CV2A 4IMJB 3TMKA 4KO4S 1ONSA 3IR5A 3VI3B 4B4VA 3HV2A 1WB9A 5EXEA 3VYSB 2J3DA 4QXQA 4ZI7A 3GEDA 1RBYA 1UZLA 3GLFA 4UU8A 1WPXA 1UP7A 2F3QA 4Y2GA 2TRSB 3HZHA 3DB1A 4ZI3A 2VS1A 4EY7A 2FPRA 1Q0ZA 5C3UA 4EX7A 4PGFA 3IVCA 5JJLA 2PZFA 4FFBB 5GQSA 3EPHA 4EY8A 5TF0A 3CPHA 3DBLA 2YYSA 3HADA 3MQ2A 4YC7A 4DCTA 1NVVQ 1MZPA 1IN4A 1AQNA 1OH8A 1CPYA 3PE4A 1Z3CA 4NYIR 3N7AA 1WU8A 4I2VA 4DADA 5T67A 2P9QA 4YPOA 2MT9A 3A26A 4QPCA 2GN8A 3GAAA 2UYCA 4MB6A 1VC2A 4WKGA 3MTQA 1UJ2A 2OQ2A 3VJKA 1QH8B 5ALNA 3WRWA 1PX2A 3M6MD 4BJ6A 3QJ5A 1YR2A 1TMOA 3BIJA 4JLJA 4W1RA 3GROA 5KPJA 3T5DA 1SIWA 2ATVA 5D86A 2XODA 2Y6UA 1U2DC 1QE0A 3HEBA 2AOTA 2NU9B 5ALMA 3WGLA 1V4VA 1R6DA 1DKMA 2FUNB 2XMRA 5D87A 1U7WA 2O7NA 4TTAA 4XB2A 5E6SA 2D7JA 3ZHOA 2QYTA 1QG2A 4BNVA 1VJDA 3AEXA 2GPTA 1HSOA 1UMKA 2AQIA 2VF5X 4M0PA 4OJTA 1O1YA 5HUJA 1TU4A 1WXWA 3TXYA 4DA8A 3K9HA 1H3FA 4FHDA 5LDHA 4BOYA 1QQ5A 3H0EA 3OQ6A 1QUFA 2QN2A 2WJWA 3PFHA 3HVUA 1QZXA 2DR3A 2ZBEA 5ALSA 2VUTA 4FN5A 1IDOA 3E53A 4HDNA 4KFCA 1XRRA 2IOQA 1DKPA 2XQVA 2HFJA 3UMSA 1XKQA 5I4BA 3VR1A 4L4YA 1M74A 4RM2A 4LKRA 2NTEA 4HN2A 4B31A 1MAVA 3AERA 5HJ5A 5ELMA 1RCTE 2EKPA 1O94A 1AB5A 1N2CB 2P5TB 3L1KA 2XA1A 4F96A 5KWSA 1GTG1 2WG0A 1BMFD 1CQWA 1YKFA 2ECQA 2IYNA 2OKCA 2GUWA 3ELUA 4Q3CA 4FEGA 4TQ9A 4YQZA 3ZOKA 4UNNA 2BZ0A 2HXGA 2XZTA 3D3WB 3OLYA 1Z2DA 1JR3A 3NCHA 3N0VA 4IW3B 4HXYA 2C00A 3FZYA 3F1LA 4FFOA 4GR5A 4KMSA 4M7WA 4ACBA 4R2WA 3AQ4A 3AF4A 3RVMA 5EXDA 2DZDA 2QTFA 4C2TA 2P9FA 2PL1A 4Y2SA 4Y1RB 2GZHA 4DJEC 2NZWA 3C3MA 4U4AA 3QWIA 4JP3A 3OIVA 4XW2A 4IFTA 3WDSA 1C3VA 3RSGA 2IU4A 1G17A 1NUUA 1AQYA 5ISMA 4MIOA 2NPOA 4ZEOA 3OCYA 1J07A 1L5MA 1OPRA 1L1FA 1KZ4A 1R88A 3ZVRA 1C0PA 1QH1A 3CSUA 4CF6A 3ET4A 1NONA 3H2YA 4JJAA 4P2GA 4EKGA 2CW5A 1E9AA 2VAWA 2NU9A 2JLUA 4PAMA 2WWHA 1WW3A 1TO1E 2O8FA 1D9XA 1LTQA 1SK9A 1T43A 1DBIA 2EDCA 3FPCA 3P2OA 4J4TA 3ZI0A 4IM7A 3ZHTA 4BTEA 5B57C 4OGFA 4DA6A 2GXAA 1EFRD 2RAPA 3V7WA 1HFKA 1XA4A 4BBJA 3OMXA 4EEZA 1OREA 1E5VA 1W9HA 1Z5UA 2VZ8A 2WU4A 1AGYA 1RQNA 1KERA 1U2SA 4OFBA 3QVMA 3IJEB 2A94A 4EF4A 4YACA 1LXCA 2WMOB 2FZEA 3LUPA 3NS7A 4BVJA 4PIPA 3RTBA 2VBIA 2XLBA 4ZZ1A 3K6KA 2CBGA 4PF1A 3WYCA 2GOYA 3RLFA 3HP1A 1XNHA 5DU2A 4CMBA 2FMTA 2Y0DA 4L51A 1A2QA 4RJ2A 1CS0A 2ZROA 1QHNA 1RXIA 4B80A 4WBNA 5FAKA 1JH8A 4B46A 1WMEA 1FSZA 1RAGA 2G7MC 5AXCA 4BZZA 1DMSA 3V4LA 1FXWF 3U31A 1A9SA 2Z5VA 4EG1A 3MFQA 2CDAA 4GGMX 1ISFA 2L82A 3K71B 2ZSDA 1QE5A 2V58A 1WW2A 2GH1A 1VJ5A 1HE2A 1OFUX 1Q3KA 4HNSA 5T3UA 3RASA 4A26A 2JHGA 1ONOA 1O77A 3MHTA 1G21B 4WZBB 4PFJA 4AECA 3A3KA 2C61A 3OKCA 1LLCA 4NZPA 4R1LA 4DLTA 1U8ZA 3E48A 4QGSA 4KB5A 3IILA 3SHWA 4U3JB 2ZWMA 1TU0A 2QTWB 1N5DA 3FPHA 3AOEA 4F6RA 5KNBD 5B6IA 1Y48E 4BNHA 2XCUA 2H2WA 1TAQA 4Y1GA 2FVYA 3IEPA 3HA5A 4II3A 5K3FA 3F3KA 4RZSA 1KZ6A 4A8JB 2HYDA 3OCWA 4B3FX 1SBIA 3T7JA 3C1TA 3VR4D 1MNAA 3KU1A 1QWSA 3KQWA 4B84A 5J5AA 2WOOA 5D1NA 1SZDA 4QECA 4EI2A 2MR6A 3PVZA 4KQXA 3F47A 4DVJA 3HVHA 4LBYA 4WZ6A 1W52X 3LFTA 1I2MA 2P77A 4UE6A 2RJ3A 10MHA 1BE6A 2GPSA 5LQJA 2Y1CA 3JAKA 2HOQA 3EDOA 3GRZA 5AW7A 4U2EA 3GEHA 2FSVA 5BQOA 1P0MA 1Z7GA 3AT1A 3K0SA 3EZNA 1J8QA 1UBFA 2PUGA 1ORWA 5FO1A 3GA7A 5IAJA 4UTNA 1JHQA 5LIPA 1E3MA 1BHO1 2VHUA 2HPZA 3UJDA 2JIQA 3I72A 1DQPA 1IRXA 3I5XA 4DNQA 1XDBA 3SBDA 4JLSA 5KQLA 1UF9A 1VE5A 1Q50A