4MWGA

Crystal structure of burkholderia xenovorans dmrb apo form: a cubic protein cage for redox transfer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
180
structure length
174
Chain Sequence
b'FKPDARFAWCVTGSGHLLDESIALALELPRADLFLSAAAEEVLPLYGWALPRLRKHFRVFRDNSASGVPVGMLYHGMYHTVVIAPATSNTVAKCAFGISDTLPTNMYAQAGKQCIPGIVFACDTEPTVVWVELRPRAIELDNVERLSRFEYTTLVRSLDELKAALGERLSTLDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative dihydromethanopterin reductase (AfpA)
molecule tags Oxidoreductase
source organism Burkholderia xenovorans
publication title Structure of dihydromethanopterin reductase, a cubic protein cage for redox transfer
pubmed doi rcsb
total genus 64
structure length 174
sequence length 180
ec nomenclature
pdb deposition date 2013-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02441 Flavoprotein Flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Flavin prenyltransferase-like 4mwgA00
1QZUA 1E20A 3QJGA 1SBZA 2EJBA 3WISA 4RHFA 3ZQUA 4ZAVA 1MVNA 1G5QA 4ZAZA 1MVLA 1G63A 4ZANA 4RHEA 4ZAXA 4ZAGA 1P3Y1 4ZALA 3LQKA 4MWGA 3MCUA 4ZAFA 4ZAWA 4ZAYA
chains in the Genus database with same CATH superfamily
1QZUA 1P39A 2BONA 4AF6A 4B7ZA 5JLAA 4RCZA 1K7EB 1IBMB 2I2AA 2OPHA 3K15A 4XB1A 1C9KA 1GTVA 1EDOA 1GN9A 2H1IA 3TI7A 3WP0A 3X44A 2IL1A 3PJDA 5LZ7A 4EIWA 3X2EA 3T3GA 2VQEB 3JZFA 4G9BA 3FIJA 3X43A 3EZXA 4DLLA 4KPUA 3FTFA 5EN4A 5FULA 4P7BA 1C80A 4HUTA 2FR8A 1KNXA 2CWDA 1LX6A 1SBQA 2H92A 4GF5A 1IHDA 5BSVA 2XE6A 2X23A 3KYCB 3TMKA 1X1BA 3S3TA 1CWUA 1WZEA 3L0SA 3EXHA 3NTUA 5CLIA 1IY0A 3SQMA 2PJDA 1ONPA 2XB8A 1BE8A 1NZFA 2YDXA 3IXLA 4BP3A 3W7AA 4FE3A 5DFAA 5SICE 2P6RA 2Z04A 5DI9A 2VSFA 4RTOA 2FQXA 4IIXA 3FB4A 4U7HA 3K31A 2O5RA 1AQ6A 3O1HB 3RS5A 2GUWA 1PTJC 3DKPA 3KFXA 4FYMA 3WX0A 4F45A 1VP3A 5HEKA 3RHSA 4D9IA 4OQMA 4OO3A 4C21A 5CBPB 2DP4E 1W0JA 2WDPA 2Q2WA 4EB3A 2E48A 2OM2A 2ZB8A 3QEMB 1DWOA 5E2IA 1JJAA 4KPFC 2HU8A 3EIOA 3GT4A 4PQYA 4D0LB 2X58A 1XHEA 1Z2AA 5EINA 2PYIA 2BP7A 1SOAA 2GDJA 2H7YA 3JPYA 3KHUA 2ZCJA 3DV0A 4KGZA 1E60A 1DDIA 3Q11A 4YPVA 3PVSA 4IKEA 4AQ7A 4B8ZA 3KBOA 4QVKA 1J0BA 5AHWA 4W7HA 4PS1A 4NCXA 2ZSUA 3N5KA 4QUAA 3K70C 3A7DA 1ZX1A 1K88A 2JFPA 3IEMA 4D41A 1GY8A 2XMBA 3D4BA 2AXPA 4IIJB 1Y9EA 2FGKA 1VZ2A 2DSNA 2Q99A 3CLUC 3FNIA 3UAVA 3DDUA 1WLYA 4HUJA 4R5HA 5CYFA 2GFQA 5LM3A 4WQMA 1ZNWA 4EJSC 5LU9A 5LZ5A 4BFSA 1KMMA 5I47A 3MD9A 2JGRA 1NOIA 4XQEA 1SZPA 2GDZA 2JGEA 2QY9A 3H5WA 5GGYA 1HDXA 3F7NA 3NBUA 1PLJA 3SZGA 3ZVMA 3EG9A 2II6A 3W04A 4ECAA 4ZKDA 1VRVA 4J1SA 4FOOA 4X84A 2LIPA 1OKKA 3TLXA 2CYCA 2R1TA 4PHTA 3UK0A 2WHQA 2PLAA 3KPJA 4IV8A 4WBXC 2DLCX 1S96A 2WI8A 2HHJA 2WZQA 4AZ0A 1BX3A 1SD2A 1NXPA 3QVGB 4G8JA 1PTJA 2ZI3A 3ESCA 3AJEA 4MIKA 5T6MA 1GZDA 4N9WA 4RK6A 2GRUA 3QPDA 4B46A 4LJKA 3OZGA 2ESRA 3C3CA 1DKPA 1RRVA 1EINA 1JJVA 1DRKA 2IF0A 1OXBB 3ZWVA 4QKQA 4JBGA 4P4SB 1JWLA 4NCKA 1RKUA 2OSVA 1D09A 2ZSFA 3ND6A 3DD5A 5F3DA 5TJ9A 2H5EA 4BKUA 4EFMA 4I6GA 3UHPA 3T4PA 1Z4PX 5EQJB 4I4IA 3TIIA 4FHCA 1AGPA 1JQLB 4I4TB 2Q62A 4JA0A 3ZZTA 4BCCA 1N2SA 3BERA 1YS4A 4X66B 2OORA 4RVOA 3VHLB 3V97A 1LBIA 1AKTA 1E0DA 4QUKA 2CEKA 1B8NA 3LXXA 4I7EA 2GB4A 1DC6A 5TVKA 1BWRA 1J8DA 2D0OB 2OZLA 2QQ5A 4XPIA 5DP2A 5FAXA 1YKSA 2J9FA 5IU6A 1FS5A 4ND4A 2QRHA 2DT8A 2V7XA 2I65A 1ZU5A 2PLWA 4FPXA 3GUYA 4ER6A 4TYYA 2LXNA 1VQ1A 3A2LA 2AG1A 3G9UA 3V48A 5B36A 1F12A 5JZVA 3EIQA 1NJ1A 4H3KB 3NBKA 4O2AF 3R7WB 4CTMA 3FFAA 4MW2A 1D6JA 3EEOA 3NOOA 4E5YA 4CUZA 1E79A 4RQBA 4G89A 1PEKE 5H16A 2AXQA 2V7UA 2GO7A 1W1IA 2XDYA 5KC8A 4XARA 1XNHA 5IASA 3IRVA 4K7JA 4N3CA 1A2OA 1H5UA 1QNLA 4LXYA 5KU1A 2AKEA 2D2IA 2GUGA 4QGSA 3MN1A 2MINB 3G17A 3HQ4O 4II3A 5JI2E 3E03A 5K4HA 2AUNA 4GM4A 1JFVA 3QUQA 1VLMA 1BGXT 1WF3A 1UQTA 1VPVA 2YV3A 3RJZA 3GVCA 4YS6A 2OVFA 3T5BA 3VTKA 1D1TA 3VOSA 3WB1A 4DANA 3CLRD 2A9PA 2IVFA 1AT1A 1D5CA 5ALIA 1L1RA 4RAQA 3UK2A 2FZCA 2IJGX 1D7OA 4OIMA 3IO3A 2MJLA 3M1IA 4FFDA 4ZYLA 3FD8A 3OQHA 1QMGA 2C5HA 4K9MA 1H1LB 4E08A 2WIKA 4WNCA 5G3ZA 4OHVA 4NBUA 4U0KA 3ZU3A 2Q1TA 3P0EA 4P80A 2GA8A 3K09C 5HF8A 1KI6A 2G88A 5DB4A 4D4GA 5A3JA 4WWHA 4JUDX 1DEOA 2OORC 5AJVB 5SZKB 1DARA 1LDYA 5DBHX 1H65A 1CRPA 1UANA 3OEYA 1J1ZA 3CKLA 4LY0A 2ZAIA 4WD3A 5HKKA 2X13A 2YWDA 3GFPA 5JH7A 4L7QA 3T7IA 5KJFA 1YMVA 5BWNA 2IEBA 2PGDA 1C3VA 2XRYA 3FPSA 3DONA 1FL9A 4BKMA 4KLNA 1PJZA 2CFRA 4RVUA 1CE8B 4AJEA 1Y6JA 3ZYCA 1C5KA 1QX4A 4YT8A 1CUXA 5B1DA 5J5CA 4R0VA 5A5GA 1J5EB 3UMRA 4GKBA 2FY8A 3PR1A 4RUKA 3GA5A 3BIJA 1Z4MA 1TEVA 3NBXX 3LRPA 2V8BA 3ADPA 1DE0A 1G60A 3C8MA 5ANRB 4ZMBA 5KJ1A 2HWKA 3PRYA 4RJTA 1M73E 4IVPA 5EHQA 5K3OA 1ZXXA 4NNJA 1G1MA 1IE3A 1NRIA 2JHFA 3D6UA 4MUYA 4NV1A 4DXHA 2YY5A 5AM1A 1PK9A 1CLUA 1FQWA 3ND8A 1UMKA 1Z5WA 1Q3TA 2EYQA 4MV1A 3EPPA 3JARB 3UJ7A 3WSTA 5J43A 4V0KA 3FX2A 4I19A 2WNHA 3EXG2 4PXSA 1EJBA 5F1OA 5EQDA 5HDBB 4PFJA 2HX1A 2VF5X 4KP7A 3DFFA 5AKEA 1FVXA 3TB6A 1LS1A 4X0EA 5C80A 5F2NA 5AVUA 5DGTA 3L7CA 2IOFA 3WZMA 3GFOA 5JE8A 1UBHS 1CJKC 3K4PA 2CUZA 3VUEA 3ZYZA 4KZPA 3ZKAA 4YJHA 2EDAA 1U04A 1MZVA 1BVHA 4J6EA 1YCFA 2Y2VA 5JRDS 1XXLA 4HRYA 1EUCB 2FZVA 2C2YA 2C82A 1USWA 2HPVA 3S1AB 3ND5A 2V7BA 1V5GA 4HNVA 2F64A 4IOKA 3BHNA 1HE1C 1YB4A 1E6UA 2W6JA 5F5LA 3I01A 3CH4B 1T3ZA 4ZOLF 2GN8A 2NAPA 3OJOA 2FPPA 1TGVA 5BN1A 3ZWMA 5EJ7A 4QSHA 1KQOA 4G67A 2VQFB 4REOA 4DV0B 1FJGB 1U5BA 2IA5A 2BKEA 4DNQA 5KNDD 2YYYA 1MJHA 1W35A 3C3MA 1NULA 2WD9A 3DULA 4KRXA 1J56A 5BNWA 4DUGD 5J23A 5E1DA 1IZ9A 2ET6A 1M1ZA 1PR2A 3EVZA 1NVBA 5IHPA 4F4UA 4PO9A 5HTKA 2O1SA 3B9PA 1AD2A 4TLDA 4V2UA 5AI9A 1CUCA 1XL0A 1T1GA 1GRCA 4NZ9A 1CHDA 1K4MA 2ZB7A 1IJBA 1NP7A 1QG6A 3D6MA 1B16A 3OIDA 3RVSA 3EJWA 1GTZA 1QVZA 1F38A 4XW2A 4GUAA 2QQEA 3OZRA 4KBGA 4NEGA 1DXYA 4FFBB 2MT9A 5BQPA 3AJ8A 2CJXA 1SQSA 3ZGOA 4BB6A 3SIWA 1XWWA 3VU8A 1E32A 1RQXA 2VH5R 3M9XA 2QTMA 3BILA 1GLGA 4MUIA 2VUIB 1EK1A 3CQ9A 3OCXA 1BEEA 4CKBA 1GTSA 4CLOA 1ACJA 3BRCA 3GP3A 7YASA 4MA4A 1KA9H 2Q0SA 2HMAA 3LL7A 3OT4A 2V65A 1DBWA 1H4QA 2P9JA 3UWSA 4KIJA 2E9SA 2I6SA 4JEIA 3RGWS 4Y6OA 4DIFA 1ULZA 1M2FA 1R4MB 5KYWA 2C2GA 1TC2A 2BKUA 2OFPA 1STOA 1ZIXA 1RYEA 2YRXA 3OO1A 4BNIA 2G3YA 5IG2A 1XJQA 2PUFA 1GYPA 1VKZA 3E9NA 3JXEA 3K2BA 2VFAA 4NBRA 4N8DA 1LSOA 1GTL1 3KVRA 2B20A 3U3KA 3V4VB 3MCAA 5E8JA 2N0SA 4KH1A 3TQOA 2PIAA 4DR1B 5LJIA 1EHIA 5GJCA 3GLTA 3HYTA 3AEUB 4EEZA 2QTVB 3C98A 4LZPA 2OM6A 3R7DA 5AJYA 2C9BA 1SUPA 5IJAA 2A6PA 3QG1A 4M55A 1WQ4A 2VWGA 1TAGA 1DINA 1CY0A 1N2CE 2C7PA 1FYDA 1O8BA 3W3AA 5AOCA 4EF4A 3N2GB 4IMIB 4HVTA 4LGCA 1HG1A 4OU4A 4GMDA 1REQA 3ZW7A 1YJCA 1UPTA 1NVVR 2AEJA 3VZCA 1VGVA 4AIRA 4YRFA 2PVCA 4JC0A 4L0MA 4AKIA 4LN1A 3LCCA 3H8JA 4LDRA 4D46A 3HCDA 5FO1A 4OV6B 3MS7A 4YT4A 4WZBB 3NBFA 1XZBA 3R76A 5DT9A 2XSZD 4BO7A 5DM0A 3EOBI 4IIGA 4EGFA 4AJ4A 4XB6B 2XUIA 5LLTA 3FVWA 2BISA 4RF2A 1F2UA 2VDMB 3M83A 5J5VA 1RACA 3PEUA 5ES4B 3OUZA 5EP1A 3I5YA 5CDFA 4F4HA 2NZ8A 2BFEA 2YUTA 2E4YA 5ELMA 2ODAA 2EIHA 1AN0A 1FYEA 5HX7A 3PHIA 4OAQA 3NBYC 4MRMA 1L7EA 1NC3A 4U2KA 1UXIA 1IN1A 5LOVF 2C9YA 4LYHA 3D54D 1J21A 1LJ8A 2D8AA 3W2TA 2EKLA 5EA2A 2FEPA 3EC7A 1Q1AA 2C59A 5DHUA 4ABYA 5CEFA 1ZVJA 4URUR 2FSIA 3BMXA 4K81B 4R8MA 1IU9A 1K6MA 3H11A 1ZY2A 4K9SA 4JUFA 3HMKA 4QLAA 3T15A 3T54A 3V55A 4HYQA 3HJTA 3NRBA 2O1WA 2VUTA 3U56A 1LD3A 4BV8A 2NXEA 2W8BB 3EXEA 2NU6A 2VT2A 3J7TA 3U62A 1X1QA 4BTEA 4YJFA 3I73A 1KJZA 1HWYA 3OIGA 1KAHA 3NANA 3H04A 1T0JB 1VG1A 3GZNB 4ENWA 2AG5A 1CB7A 1JR3E 1OLXA 1WZUA 2FWIA 4FLEA 3VPFA 4Z4CA 1I51A 3PFFA 3CVXA 3DMTA 1VJ5A 1ZLXA 2JARA 3QJ5A 1C8VB 1SQGA 3RYHB 4YQZA 1OLSA 4CQNA 4I1SA 3DBHA 2OV8A 2W4QA 5KVSA 3EAQA 5E0OA 3W6UA 1J23A 3GJ8A 2Z57A 2GEBA 4BEWA 2YJ5A 2WP0A 1RM3A 1QE0A 3L7AA 4TKMA 3D4LA 1EUCA 3RSHA 4BVFA 4PZYA 3EZ7A 4TQGA 1KYZA 5J40A 4ENUA 2GT1A 2IUEA 4BX0A 3EEFA 3C74A 1Y8AA 1ZK0A 3JPWA 1H94A 3QVUA 4TWAA 3RANA 1UKBA 4BO3A 3JASA 4PFSA 1Z17A 4BFWA 4ZGWA 2JVIA 2AQHA 3LUHA 2FPPB 2J6BA 3E7DA 4HS9A 3WIDA 4LYGA 5I4BA 4HWTA 2V7VA 1DAOA 2C04A 4I4LA 4L7VA 1NLYA 2FPWA 4YC7A 2EATA 1LSJA 1GPNA 2QTWB 2XNKA 1RXIA 4BVAA 2QUBA 1NN1A 1SWVA 4S2EA 5BRAA 1KEEA 5EKDA 2Q0HA 3VDRA 5KSWB 2XNHA 1RVV1 4F5EA 3WAGA 5C3MA 2CV0A 1C7IA 1GPDG 3K0EA 3W6OA 3R4VA 5BN4B 1EVEA 3N0XA 2QUKA 1JR3A 2W58A 1PWZA 1FUEA 1TPZA 2N9UA 1E6CA 4K6HA 1KJJA 1NLUA 3DJFA 3K0BA 3SBDA 2XKKA 3VR5A 3BYZA 2L18A 5ADUS 2J31A 1L3IA 1BMFD 4F4FA 2WD7A 1XQ6A 1Y7TA 3GJXC 3L6CA 4LYDA 5JZMA 5TF0A 2CF5A 5COAA 5FJJA 3KJXA 2DY1A 3UHFA 5BN3A 2H18A 3G59A 4TM8A 2EZTA 1JKIA 3DT8A 4GRAA 5I5EA 4W9MC 4DA6A 1KFCB 1CUFA 2DFPA 4RWEA 5JUWA 1ZH6A 3DTVA 3KTAA 4YV2A 1UBCA 4CMIB 1ZHOA 2QTBA 3THYB 4ZQBA 1M5RA 4PAOA 4TUYA 4BE9A 1DJMA 3EMBA 1S6YA 1UBNA 1ZNZA 1TQ8A 3IAHA 1VG0B 4FQ8A 4PZZA 4R8SA 1XDGA 4U1RA 4D3FA 1BX1A 3UPUA 4KX5A 2WLSA 2WVGA 4EJMA 4GKAA 3O84A 4HNHA 1VBNA 3U3XA 2D1TA 1UF9A 3ZU5A 3N8NA 4Z99A 4KPEC 1Y1KE 2VT3A 2VZ8A 2ZQZA 1JN0A 1UC9A 5KINB 4OBXA 2FF7A 4DPLA 5IANA 1Z7WA 5FOUA 1LSUA 4YWHA 1LGYA 2Y0BA 1IUOA 1NWCA 2Q1XA 2X9GA 1Q19A 5AKJA 2D06A 1MENA 3EGDA 1XYYA 4NENA 4QU9A 3WYNA 2XGJA 3JD4A 2GNAA 3KOOA 1IFXA 2RHJA 4HRVA 1TF5A 2GEUA 4B31A 4DXAA 3INTA 3SN6A 4EHFA 4JQYA 4B4VA 4D74A 4E3ZA 5EWJB 1YQ9A 1JLMA 4A6DA 4ARUA 3QPVA 1ZISA 1XTVA 3GJRA 1KJ9A 5LYJF 1KJNA 4EVQA 2DH5A 3VRHA 4CM3A 1U3VA 2HWXA 3FCEA 2AMYA 3D5TA 1Q0TA 3EG5A 5KTPA 4YRSA 3NCTA 3Q6NA 5K05A 2OB1A 3IUBA 5JS2A 4IAOA 4RPHA 1JMKC 3AQ4A 3BULA 3OU2A 5IK2A 1P3Y1 2Q0QA 1RYFA 1SB9A 5GONA 2DFDA 4M1OA 1E7QA 1ZN9A 3PFBA 3QWIA 1LS6A 3NXSA 3K1AB 1FF9A 4GLLA 3UGTA 2JIDA 4M8IA 4UHEA 3ZIAD 4AZ0B 1KDVA 4BS9A 1WOMA 4EJSA 2PBLA 1VMEA 3J81A 1CQZA 1ZM7A 1ZONA 4D57A 1I01A 4P22A 5CB8A 1HRDA 1XFDA 3K2QA 3AONB 2D5BA 2BM8A 3RD5A 1D1SA 5K45A 2JZOA 2FFAA 4OQEA 1J00A 2PQ6A 2FCRA 3EDMA 3RJMA 4ALMA 4CG3A 2ARKA 1H8HA 2VJKA 1W59A 1L1EA 1R9MA 1FP4A 1NSTA 2NXNA 4YDSA 4QRIA 2DCUA 5BYKA 1CFJA 1R15A 2D1SA 1KXZA 3HBNA 4TVBA 3BMOB 5NLLA 5JVDB 3V3KA 10MHA 3IP5A 3Q3JB 1MABB 2ZTVA 3DCJA 3IDQA 3KVYA 3PP8A 3N59A 3QOWA 4RV5A 3EW7A 3RC7A 3U26A 1G98A 1SKYB 1VHJA 1CUJA 4P3NA 1JSLA 2VJYA 2BEWA 2Q4RA 2IPXA 2ZP1A 1Y8RA 3CLSD 1JV2B 4KE9A 3S0JA 1TT7A 2QN6A 4ZTUB 2VYVD 4XD7D 1BKDR 1FMCA 2PQMA 1OLUA 2CXRA 3TAXA 2BKLA 4FGWA 3WRWA 4E51A 4GD3Q 4N01A 3VV3A 5MFZA 3UHOA 2PLNA 3SJUA 3RO7A 1GRVA 2EP8A 1GCIA 3HKBA 3PEYA 1P0FA 5HSGA 2IVZA 3D9QX 2VDPB 1PTKA 1SURA 1E2GA 2KI5A 3U3JA 4EFNA 2I1QA 4RGVA 4AROA 5LB4A 2F4NA 4S04A 3WGVA 1QYDA 3QFSA 4HDNB 4TRRA 1E63A 3BA1A 3DHVA 3QMVA 4LSWA 4C4AA 2J9XB 4KHPB 3FNBA 2F43A 4HOYA 1KETA 1BU8A 5E7QA 1F8XA 4Q1DA 3MPUA 1BCRB 4B3XA 3IT1A 3HUDA 4DV2B 1WHSA 4ALNA 1PEDA 4Z4GA 4C4ZA 1KJWA 3R3SA 3CSSA 3TQSA 3B53X 3G0OA 1B0PA 1QTNA 1V47A 3IR5A 5FT9A 1WKCA 3H5NA 3KQPA 3OOEA 4OATA 2QE7D 1R5BA 3M5WA 2QV0A 1DT5A 4NZMA 1W36B 4B9AA 5FFFA 1IXZA 4B6SA 1OUMA 2UXDB 2B7CA 1HG0A 1UZMA 2QAGB 3ZN2A 5BQFA 4RPGA 4R1SA 2VSQA 3ZBUA 1Z5GA 4JEMA 4ZT6A 4CTKA 5BQ5A 4XFDA 3ANXA 2HWUA 1K06A 4IJKA 2O7RA 2BDTA 3UT6A 3WBFA 2AX3A 4GOMD 2B3TA 4CNQA 2BTEA 1TLFA 3MQFA 4I5EA 3OJLA 2G1PA 1B23P 2R8BA 2HIMA 1RMTA 1UPUA 4PQEA 2Y93A 3ENKA 3DLTA 1CEYA 2P1ZA 4RZQA 4ZYVA 3L4SO 1DEKA 3OIVA 3D3EA 2B25A 4LDPA 2XT6A 3B3AA 3ZGLA 1QO0A 2ONYA 1BEZA 2WTBA 4ZHQF 1GSOA 2EJBA 1JJIA 2ZROA 3Q3IA 1E8MA 4IXWA 4MI6A 5IN4A 2O3SA 4KMMA 3FHTA 4K9LA 4V24A 2C7RA 1OFHA 3HZZA 2BELA 2G5CA 2CF6A 4DTCA 3D0KA 3QBVA 1Q77A 1MB4A 1IULA 3M33A 4TMVA 5JEDA 2OBXA 2AKYA 3GDFA 3H9BA 3M34A 1W76A 1BDBA 2IY7A 3KSRA 4J0IA 1G5IA 1RCTE 2C07A 3E53A 3KAQA 3PNMA 4IF6A 4OYHA 4ZVVA 3TTUA 4GX2A 1DQNA 4F84A 2IBMA 2PUJA 2X0IA 5EY5B 5EE1A 3DP9A 4JI4B 4YDRA 4X91A 2PGIA 1GKKA 1NWHA 4O1MA 4E7OA 2AYYA 4AY5A 2YZ2A 4XGQA 2I76A 5BSMA 4LNUA 1G38A 1S89A 1TIKA 4N39A 3UPDA 1PEAA 1KRXA 1HETA 2I8CA 1JFTA 1XMXA 5BVHA 2AOUA 1OGJA 5T8KC 2NXCA 4JB3A 1GGFA 3AEQA 3ZI4A 4XRGA 3AF5A 4MEBA 2XUOA 3MS4A 4AG5A 3CNBA 4K9DA 5HG0A 1EFAA 4BDSA 1UBEA 1XVAA 4EX6A 3H9QA 5BNFA 1MIOA 2FUCA 1S8OA 2GM3A 1P0PA 3SJZA 1DBVO 2ZIXB 3T7RA 3GF4A 4IZ6A 1JEJA 5DT2A 4B48A 5EUQB 2XX3A 2ZM5A 1NMXA 2VHXA 3CYFA 1E6WA 3VC7A 4ENTA 4JDPA 1L4UA 4J94A 3EEBA 4BGIA 2VPWA 2R7NA 4QM7A 2QM7A 3LI2A 3CZQA 5IAEA 2J87A 3RSQA 1YULA 3WWDA 2B1RA 4Q4JB 4OI1A 3E1KA 4GUDA 3HBAA 4JYAB 4YCNA 2OXIA 1E98A 1LVGA 1NATA 4DNOA 8GPBA 2OLEA 1JECA 4IIUA 1M8KA 2P6UA 5DHFA 1R6DA 3EF3A 3ENNA 5BR7A 5CBKA 5UKDA 3JTMA 5E1OA 2UXBB 2C8LA 2MDTA 3IT2A 4ZU1X 4EF5A 5FDFA 4O2RA 3K1AA 3NP9A 4BBZA 4XJTA 3BCSA 3NM5A 4EABA 4MYRA 1L5VA 3EHEA 1X94A 3FHCB 4EJSB 5JAUA 4FDMA 1M0TA 3KQNA 1USIA 1G8PA 2VJOA 3HS3A 3LHSA 5JS8A 2J0QA 1CZNA 3SR3A 3SR4A 1C1DA 4Y6RA 1YZQA 2VJMB 2I33A 3B89A 1Z0KA 4M54A 3AG5A 3RUPA 1T1SA 1FPQA 4BZZA 1B3RA 3AUYA 3GP8A 5A2QA 2H1CA 3GEPA 3F6SA 1QHGA 2BOVA 2B61A 4L28A 2FFBA 2WVJA 3I4LA 3KLNA 3LT1A 1U7TA 4X1YB 3RLIA 5M04A 1YQUA 2HPZA 3KAJA 3HB4X 4FYIA 1E18A 1N6PA 3A3KA 4H9GA 2IW1A 4MTLA 5CA1A 1AKYA 2I7DA 2I7VA 3OHSX 3ZY6A 1JB9A 2Q3FA 2ZJ0A 5JPDA 1N6IA 1P80A 2AEFA 1GILA 2OLJA 1PUIA 3E58A 4LSMA 5CHEA 5FBWB 3SEFA 3GL9A 3ITNA 4YMWA 4AULA 2FQQA 2QD1A 3DOUA 4Y98A 1JVNA 1DJPA 1Y8RB 2NGRA 3IUPA 3LGAA 2GN4A 5FPHA 3WJ1A 4D92A 5I6DA 2H4HA 3IHLA 4WL0A 1PZMA 1TZKA 2QUHA 3IMCA 3HJFA 3SF8A 5L3QB 5CW2A 2X6QA 2ZQYA 3SHWA 2QJFA 4GLJA 5FEMA 3BVPA 3WQBA 2HCJB 3I01M 3I37X 1VBKA 2Q5OA 2OWDA 4YCCA 4KFCA 1SK8A 3R0ZA 1ZZGA 2OWEA 1SHKA 3FCYA 3OIFA 1RP1A 2WTEA 4GMFA 4M7OA 4OX9Y 1N5DA 3LG2A 3TO5A 3H1FA 4HGZA 1OZGA 3PIDA 3A6FA 4KX3A 2XODA 1U0NA 5BURA 1NVMB 4WBNA 1NU8A 4S12A 1E3WA 1BZYA 2AR9A 4AZ3B 2MSWA 3PIRA 4TKLA 1J2RA 1FA9A 3NIFB 4C2UA 2XCRB 3OWHA 4IICA 2IHUA 1Z13A 2XIJA 5ITZB 2CE7A 4CM8A 1BDJA 3JQ9C 4RPJA 1P45A 1TW2A 2JVKA 4CN9A 3DO6A 5I4KA 1K3UB 1WJGA 3QSGA 4RELA 5JOQA 4DYDA 821PA 2ZTUA 4EGQA 5LZ9A 1GTRA 1G7TA 3SY8A 1R3DA 3EIXA 1R4NB 2VZ9A 1ZJ5A 4NESA 3RU9A 1Y3AA 2VXYA 2GZRA 2XQGA 4OJNA 5D01A 4WFKA 5HXAA 1QRRA 3DOEA 4P33A 5KNDA 2J9GA 4B4KA 3D8BA 2CL7X 1ZGGA 2JFUA 2X0NA 4PRZA 2ORYA 4XM2A 2OO5A 4E2FA 1OPXA 2R6CA 2RJNA 4JXXA 3FB1A 1XO1A 2BHTA 1PZGA 4B5KA 3NM4A 3RCBA 1V71A 2J3HA 2WF9A 1ZJWA 1B43A 1G8GA 3BJIC 3M9LA 4UDNA 5JYDA 4A8TA 1QOZA 1AKRA 2QTAA 1EAYA 2I3AA 3C5HA 2AYXA 3G5MA 3PRKE 5DNAA 4QLBA 4PCUA 4R8LA 2BI4A 4XOIA 5LD2B 3P19A 1CRWG 5KI6A 1Q1GA 4JI6B 4UVHA 1DGQA 3QWFA 4HD8A 4LMBA 3ANMA 4RVFA 3RTEA 2WF6A 1EA5A 3M2PA 3MVEA 4I4TA 4B80A 1RPNA 3EXEB 4OGGA 2F67A 1V5FA 3GCGA 5JAOA 2OOSA 1V1RA 4FN5A 3BCHA 5IKOA 2DBQA 4DR6B 1MW8X 2VYND 3IUQA 2XZPA 3P2OA 3OQPA 4BZWA 3SSMA 1O89A 3NHKA 1DMRA 2G4LA 5CEJA 1X1EA 1X1RA 3IB6A 3OESA 4KKXB 3PC7A 3DLIA 2ZIZA 3NW9A 2XCUA 4UAJA 4WERA 3TW8B 5EE0A 1MDFA 1GUZA 2O0KA 1O7JA 2RHGB 2XWQA 3O9ZA 2NO5A 1Y1LA 3JW8A 3P9RA 3UA4A 5C1PA 2K87A 4U00A 1SPXA 3A1VA 3ZZUA 3DEKA 1U8EA 3D64A 5BSEA 3MTIA 3U3MA 3M1YA 1IQUA 3TZ6A 3JQQA 3ADDA 4J4HA 3QU4A 4YREA 3X1DA 4PF1A 1DEXA 2DBYA 3HSSA 2FSUA 3V1KA 2XVYA 1NVAA 1Q57A 2P4HX 3GZJA 5SY9A 3U19A 4OKIA 4NK5A 3K9HA 3WJAA 5EXEA 1IN4A 2HLHA 1JSZA 1U7HA 1BGVA 2FN9A 3BHIA 3TRFA 3AC0A 2YVLA 1DNPA 3ENVA 2JIZD 1TECE 1YL5A 1GPWB 5EYPB 3GVIA 1MDBA 2PZMA 1EH5A 3BK1A 3RFTA 1OWOA 3T9FA 1VB3A 5G2OA 1QP8A 4TL6A 3ZXYA 5LQMA 4MUBA 3NIWA 3RKSA 3U2QA 5DNUA 2OAP1 2OUKA 3RC8A 2ZTSA 2G17A 2DJIA 2ETVA 3GJ5A 4JZKA 5U9CA 2JGLA 2O0JA 4Y1FA 2CDNA 2EFDB 2GJKA 3HBFA 2A5YB 4ZKEA 1V8DA 3QFTA 5HIMA 1UM9A 4B2IA 3C8HA 4QOEA 2P8SA 1M67A 3F3SA 1XAGA 2QJWA 4PYNA 2WBLC 4XIFA 4ZYZA 5JW6A 1GSAA 1TAQA 1IHUA 1X38A 1XHLA 1NQOA 2B69A 3H2YA 5CLLA 1WSBA 1C7ZA 5IT9A 4B3DA 3LD9A 4LUCA 2IH2A 4A36A 4D4JA 2QRGA 1K3FA 4Q9NA 4MEJA 2PX6A 3MCVA 2ZJ1A 2BKVA 2ZJAA 2PRSA 3E84A 4RGYA 4K9NA 3I58A 4AUEA 1T29A 5AW5A 3DLCA 2FW6A 4YV0A 4RHCA 1YE5A 3L6DA 3CUSA 3HCPA 2H0RA 1XTSA 1DAEA 3VNUA 1DAPA 3PVCA 3ENWA 3LMKA 3LP8A 2B8TA 2I71A 3DOHA 2B8JA 4OJQA 4A5OA 4CKEA 5AVSA 4ER5A 1QP4A 3UG6A 3NVKI 1SWWA 2R8YA 3I8SA 2C4MA 1ACLA 1P6UA 4FFNA 3LCVB 4HX5A 4RTMA 1Z0FA 1XVIA 3OPXA 3TXAA 1OJLA 2DGDA 2H48A 3PDIA 1KQ3A 3BAZA 4BNLA 5A5EA 1DCFA 3OU7A 2OQIA 4RK7A 1SG0A 5E9QA 4LHEA 3H5RA 1BC5A 3TVTA 3BFVA 2Z3ZA 1XKLA 3AR4A 5FR2A 5K2OA 4P93A 1A9QA 2NXJA 1S7GA 2FG5A 3HADA 5HWSA 2F3UA 1TJ3A 3ONVA 5KQLA 1NBWB 2R5NA 3DA8A 2AOTA 4IHJB 2HPHA 3QXSA 1NMEA 1SKQA 4B81A 2QVBA 3ML1A 1GD1O 2GILA 3IAEA 1R88A 3DBVO 3ONFA 1C0IA 3U3RA 1YZTA 5CFRA 1CNMA 1JQ5A 5FCDA 2PT9A 1VB5A 3MPOA 1E5XA 4HJXA 2WJ4A 1CUGA 5BWLA 3SEAA 1NW8A 1Z5ZA 3DYIA 1A4UA 4PGAA 5K09A 4ZVOA 1DJNA 2N1MA 4R1TA 4XIJA 1J8VA 3V2GA 5HPYB 2ZI6A 4FB5A 2VSNA 4ZOCA 3LLMA 2W2MA 1C81A 4W5RA 3HGMA 1JILA 4JT9A 4GPTA 5K6AC 2C7OA 3FFBA 3GX1A 3DPUA 3HUUA 5EUMA 3VR3A 5KZMB 4IIEA 3DCNA 4XUGB 1K7FB 2IEZA 3WNCA 5ALHA 3TEJA 3H5IA 1ZPDA 3IR7A 5ITWA 4WTOA 1LI7A 1OKKD 4UZSA 2C2BA 1EVLA 1MBZA 1PJSA 1Y4UA 2NWQA 1QR6A 3I53A 3SSNA 4OXRA 3N8KA 4MS4B 2BR4A 1FUUA 1NBIA 4Q21A 4TS9A 4QUEA 2IH4A 1VTKA 3OTIA 4YJHB 2V0GA 5H9VA 3IKLA 2L0XA 4BNDA 1GIAA 1I6LA 1OJ7A 1W88B 1AH2A 1OHHD 1VCIA 2OAQ1 3INGA 3U7GA 1B1CA 1NF8A 3PCXA 3FCUB 2UU9B 1IHPA 1NJ2A 3HV2A 4P98A 1YR9A 4DR3B 2GAIA 4HTFA 1U2QA 3ZHSA 4EYEA 1W5EA 4EYSA 4U7FA 4CT4B 5LL6P 1JHXA 5CDTA 3PQCA 2C1ZA 4XX1A 3CBQA 3LT2A 2Z4RA 5TE9A 5LQJA 5TQ2B 4MS3A 1FP6A 2KS6A 1BNCA 1AZWA 1HFEL 2HXSA 4CIAA 2GAFA 3NGMA 4CKBB 1AHNA 1SU6A 3T0FA 1SMKA 5FNZA 4YCSA 1JKJA 3U09A 4YMVA 4C4RA 2D6FA 3LW8A 4R2IA 5AW8A 5AW9A 4FW8A 3FTQA 3TMAA 5I8WA 4DILA 3PUVA 4BPBA 2SNIE 3OF2A 1KO7A 4JLPA 4DLYA 3Q6IA 4QQNA 4L4XA 3LY5A 1CUIA 1RXSA 3TQIA 3V8PA 5I51A 4ASUD 1KZ6A 3DDOA 2F00A 4OQLA 4WA7A 3ZX5A 4EKEA 4HBZA 4MUJA 5F1KA 3KL4A 1R66A 1TUBA 2A7QA 3SD7A 3NHUA 1SXQA 1U9JA 4RBNA 5K0LA 1W5FA 8ABPA 2Q0XA 5KPJA 1XV5A 1RYZA 1Q7RA 4HLQB 1FS6A 4QPDA 4RACA 5DMHA 1QRTA 1SVMA 2XD9A 3DMNA 1CPYA 4KC0A 1SC3A 5BORA 3FJ1A 3NHWA 1T5TA 5G1NA 2QUIA 4N5NA 4LK2A 2J45A 4ARIA 1L5YA 4TN1A 3AFNA 5HCNA 3UJAA 4L4RA 1YB5A 3G88A 5EMMA 2WYHA 4I6EA 2JLAA 1QJCA 3WZLA 4CG1A 1N77A 1J06A 1H0HA 4ZC1A 3GLIB 4KI0A 1V43A 3AI7A 2QRVA 3TLMA 5L7TA 4DWVA 2RAVA 1RCUA 5IEBA 3FWKA 4ZOLA 3S2ZA 2QAGA 3IT3A 4U2BA 2AOWA 1XYGA 1PSDA 1NXOA 2ZYVX 5E4YA 4LXXA 5KBYA 5AK3A 3P9SA 3AT1A 1L4MA 5DLQC 2E4ZA 2PZFA 1Z34A 3NT4A 3RHFA 3AUFA 3IV7A 2UYCA 4ND1A 2CK3D 3JVEA 5LA6B 4CM5A 1XZCA 3URMA 3KUKA 4H3SA 4P7KA 5JR3A 5MFPA 5LXTA 4A91A 2FSHA 3HACA 3O3MB 3QTTA 1IC6A 3X1YA 1P6XA 1JYSA 4YYEA 1VCHA 1NX9A 1XCMA 3X1ZA 1W29A 3GMDA 3TCNA 1LW6E 1VC2A 1BCRA 2P11A 4K8RB 3U61B 1NF3A 3VO1A 3PHHA 2MR5A 3L0ZA 1U8FO 4RZXA 3A05A 5AM0A 3WLRA 2O5VA 5HQ3A 4KR7A 4XIGS 4UTZA 4GG1A 1XPRA 1UUFA 2GWHA 2FUG6 3VH1A 5HRAA 4L1KA 2WWYA 3KQUA 1L8QA 2ZCUA 4MW4A 1CJTC 3HLTA 3BORA 1D07A 3G1TA 4EEXA 3BCUA 2IPNA 2J0EA 4WZBA 3JX9A 4BKRA 5DHTA 3F6BX 3E48A 4YMLA 5KWVA 2WJVA 4MQ6A 3UOAB 1PFWA 4IUYA 4U6NA 4WECA 2IDKA 1ZD1A 3IERA 1ICIA 2EKZA 4A0SA 4U8GA 1F0KA 5ALTA 1EFPB 3W5JA 5JCOC 3TAUA 4CDRA 2B82A 4EHAA 4PS0A 4R51A 1CY2A 1OR8A 3HVKA 2FPXA 1OASA 3IVXA 3RUHA 4CF6A 3E8MA 4I5DA 4L4SA 4NYJR 1W5SA 2JFVA 4AJ2A 1NVGA 1YB2A 3WYFA 4J91A 4AXXA 1DAKA 2H1LA 2O23A 3C2QA 3FAKA 3H5LA 4OY3A 3FPAA 4ESHA 3ZHTA 1B6GA 1J7JA 4H0NA 4KO2S 4ZDIA 5JNTA 1ABFA 1T9HA 1HQCA 2Z6UA 3SFVA 1KDRA 2QX9A 1UMDA 3TZLA 1SY7A 1KPGA 4RQAA 3DZJA 4B47A 1WDTA 3DZGA 3KSMA 4B3FX 3WYEA 4DC0A 1DUVG 4N3GA 4DVJA 4WGFA 2JLXA 4U7TB 4LS3A 3DFKA 5IVDA 4RZIA 2QT1A 3I12A 4Q4JA 4HCJA 3IPYA 1XEFA 3GH3A 4G9EA 4HMOA 4JV5B 4QHSA 1G2OA 4LJ6A 4LSGA 3RC1A 4H6VA 5TLSA 1QC5B 4UAUA 2IZZA 3CUVA 3REQA 3GIDA 4KACA 5SZIA 4QBFA 2I9KA 1YACA 2ZJ4A 1NNI1 4V0LA 1HQKA 4UNRA 2O3JA 3MINB 2JKVA 4IDQA 5FI3A 4B3JA 4ENQA 1L8AA 1FFCA 1LC0A 2D74A 3DUFB 5G0TA 1Q50A 3KDSE 3VAAA 4ASUA 3TXYA 4YAOA 3OM9A 1M2VA 3ZC3A 5C8ZA 3KCNA 5CJJA 1FY2A 3C4QA 1J97A 3OD5A 3B9QA 2V3WA 5LOVB 3HNOA 1XXHA 3NR2A 4GPIB 3URKA 2WWGA 2XUZA 1J2JA 4ZOQI 1RXYA 3ES9A 1LNQA 3ZLBA 4TXHA 5TXGA 1M2OB 1VSVA 1ZD2P 1IZYA 2AN3A 2O2YA 3GJYA 2JC3A 3O74A 3T12A 3V8RA 2X9LA 2A58A 4CF7A 1IN6A 3A6ZA 4NBTA 3RVQA 4D9EA 4F2WA 3OH8A 1LXCA 1A9OA 2P68A 4KAAA 3FMPB 4MB2A 3M1LA 3CUTA 3RC3A 1M1UA 5HRUA 4NICA 1U3TA 3KQTA 3JD2A 3OQIB 4IEFB 4MEAA 1GL6A 4Y3UA 3JWGA 2PR7A 1X0XA 3VYSB 1BOOA 2VWQA 1QGUB 1E5TA 1ZWKA 2XGSA 2YHAA 1XZHA 1RP7A 2R5FA 4Q3DA 1VRWA 5BN4A 1IOVA 1NTRA 2R68A 4BPRA 4MQMA 3JQPA 1PR6A 3LK7A 5KVVA 2ZBQA 4W9NA 2CMHA 2V6BA 3G0DA 1P73A 3PNKA 2WMDA 4GP9A 4HFRA 2WMOB 4YIHA 2R5WA 3FMOB 4G9GA 4MJXA 3I45A 2WWRA 3HA2A 4KO4S 4XIYA 3QKRB 3L1JA 2W7TA 3IAAA 4CRWB 4WJLA 4DE5A 2PX5A 4LBWA 4QODA 3LX5A 3CBGA 1Z08A 2ENWA 3TNDA 3JQRA 4KAXA 4CTJA 3WLQA 2CXPA 2WEKA 1W581 3KQQA 3ZE7A 5KX5A 4YRIA 2DLDA 1J39A 4B75A 4GBMA 1ORIA 3DB1A 4DRYA 4EDFA 1GZHB 3UJ3X 3FPEA 2L69A 1YKFA 1KK0A 2GEJA 3DAFA 4MNTA 3HKDB 4OB6A 2L19A 1RCFA 2Y05A 3FWZA 2AEMA 2ORED 1ZICA 4EBFA 1Y33E 1I0IA 3C7TA 1SUCA 4AJHA 1E66A 5DHSA 1QLHA 1P77A 3A3NA 1E99A 1FDRA 3CF0A 1KFKB 3KZCA 4FOPA 2ID9A 4DQVA 4QXOA 2Q07A 3PQ6A 4UREA 4TKUA 1E64A 4QPZA 2BSAA 4YDQA 1DDOA 5I7HA 2UDPA 3GRYA 1EXWA 2BEUB 2EYUA 1I10A 1UJBA 4MP8A 3S5UA 3M0EA 3N86A 5HIAA 4CEJB 3NIDB 3VSDA 2VTBA 1WMBA 4EA6A 4BO9A 5K0EA 2Q7OE 1IEWA 1V6AA 2CEAA 2FPSA 3I9LA 1U3GA 5K0CA 5BR8B 3ZD7A 3WGZA 3I0MA 1EGAA 3L6EA 1E3WB 3ICEA 4H1VA 4I8XA 1I7SB 2J7PD 1EBFA 3LQ4A 4MPDA 1QANA 5ARCA 2FSGA 1ETHA 2XUKA 3AETA 1IXKA 1KZ7B 3KVOA 4GQBA 4PRLA 3IA7A 4KKVA 4QNMA 4XGKA 3AF1A 1XI2A 1OXXK 2IYNA 3ZDFA 4ZP1A 5GPBA 1LDNA 5DYNA 2CCJA 1X1AA 3KOYA 3E9RA 3WK8A 3WFIA 2VK2A 4LRWA 3PKJA 2HMUA 3B78A 3BKXA 1RLJA 1T0IA 1E0SA 2BEWB 3M3HA 5FP0A 5TMDA 2Z5VA 3ZQUA 4CCSA 5EJ8A 1YC2A 1R8JA 1VLVA 5M3BA 2DETA 1FPMA 3F67A 3AHJA 4MIYA 4C5CA 5BUZA 2VF7A 2J3QA 3PEEA 1FTNA 1R18A 1NQWA 4I0WB 5KWIA 3JVIA 3QU5A 3A7EA 4LOIA 2BJHA 2IUUA 1X9IA 2NU8B 1F14A 1YUBA 4LVUA 2F8SA 4YT2A 4BC0A 4M0MA 4D4IA 4XUEA 3LQ2A 1YO6A 4HGNA 4F92B 3KELA 5E3IA 5C9ZA 1Y8ZA 2DG2A 3CX6A 3L7JA 5DP1A 1C30B 4IHQA 4WZAA 7AT1A 1N32B 4OJKA 1WS6A 1UKZA 2DUJA 5BW6B 4AP6A 5CG1A 4TLEA 5KTOA 1FMJA 1QLWA 3B7GA 3RJTA 3SVZA 2XH8A 3GPLA 4HDKB 1LVUA 1N8TA 1F6WA 3MSXA 5C37A 2XTJA 1JHZA 4DNXA 3L4BC 5EIWA 4G97A 3WRYA 4ZPJA 1ITZA 1ND5A 2RK6A 3H87A 2FRVA 5LN1A 2DWOA 1NUAA 2R4TA 3L8GA 2FZWA 4CLOB 2RE8A 1CLEA 3I4CA 1I14A 5H7XA 4PZ0A 5DX8A 4B44A 1NLMA 1MUUA 2E5FA 4FYKA 4KAFA 4WK2B 1ODFA 4AZSA 4B84A 4E30A 5H4GA 1XA3A 3IVRA 1JDBC 4AKHA 1ZESA 2Z5FA 2AZDA 2EQBA 1I2CA 2POQX 3BWDD 2ZIGA 4K6OA 4ZT4A 4ZAFA 1H1TA 2KSQA 2IPOA 1IJFA 4NFHA 1JHPA 4X1KB 1CVLA 4H1TA 3WY9A 5DLDA 4N03A 4GFDA 4N8EA 2VLBA 4I5GA 4TZKA 1EFVB 1UBUS 1KMQA 4M36A 4LDQA 3ADBA 3TQRA 5C81A 1Y48E 2NADA 2Z3WA 1VKOA 2PKCA 2WJAA 2O0LA 1MT3A 5DHPA 4KK3A 4L8FA 4MYSA 3VX3A 1IATA 1ZOOA 4NYMQ 5E2BA 4YCMA 3H7IA 1NQAO 3WK6A 3I76A 1T1IA 2VBFA 3DZFA 2MU1A 4PC2A 3ZWBA 3F6YA 4GAEA 5M5BA 4WOJA 4W1RA 4XLTA 1V8ZA 4RX1A 3LQYA 1AURA 2OOKA 2RH4A 3ZVRA 1PT7A 4QYSA 1NM5C 4BJ6A 2IZ6A 1J9GA 1GUBA 2P2ZA 1K9VF 2VPZA 1UDRA 2Q9AA 3GJ4A 3H5TA 2ZR7A 2Q4OA 4UUOA 1HT1E 1JDPA 5IC4A 5C8DA 4KMRA 1SU7A 5K0JA 2VHQA 4FGSA 3RRYA 2CWWA 2Q3BA 2YASA 1RZRA 4ZA2A 2VCYA 1OA0A 3CJQA 4FEYA 4II2A 3R3ZA 4BNGA 3H6KA 1Y1RA 3BKWA 3E27A 1K92A 4OL9A 1ADCA 1OW3B 1MTOA 1QYWA 3ZH9B 3C8DA 4FBMA 2B0JA 3Q9NA 3WL5A 3OP4A 4LNUB 1PYDA 2JCGA 4FD2A 1GGNA 2P4EA 2AL7A 5IJ9A 5FHRA 2ZAYA 3UFXB 1JBEA 1P9NA 1AKMA 2KJQA 2WWTA 1TOAA 4UQOA 4XWGA 4UUPA 1U0BB 2X3YA 2AXNA 4P5DA 3VH2A 3LC1O 4PIMA 4PG5A 1LF0A 3HEAA 1O5IA 3NFRA 4M1EA 1L7PA 5PGMA 1PDVA 4POOA 4QRDA 2FLKA 2PMKA 3NC0C 1NF2A 4E2YA 4PC6A 3OZXA 4K9QA 2H51A 1Q22A 2NV6A 2O2JA 3AYXB 3LVBA 4FWBA 1ISPA 3NONA 4F1KA 2YJ3A 3FFXA 3MCZA 5HUHA 3EJ6A 4KR0A 3AUUA 1PWXA 3GAZA 2A0YA 2J5XA 2PUHA 2YWHA 2QD2A 1OYOA 3NIBA 1JTFA 1YFZA 1QIIA 3NRCA 4U9IS 2WSLA 4AZVA 1K0FA 4G8DA 1FJHA 1E9BA 3A10A 2VAVA 4S1NA 1Q14A 1E4EB 2OK8A 1C4OA 2HCRA 2YJTD 3N8GA 3A25A 1KK1A 4ZI3A 5JXIA 1AQUA 4UOEA 1VLQA 4MS4A 1K8QA 2C5LA 1I33A 1ESDA 3CS3A 1NVXQ 1W93A 4HSEA 2CVPA 2O2SA 2NZVG 3LOPA 4HDRA 1QAQA 2R00C 4RLFA 3KSBC 3N7TA 4Z2YA 2JGAA 4RY8A 4OQZA 4ZVQA 1D4OA 1XD8A 4JP8A 5E0KB 3ZUPA 4F21A 1K75A 4JXZA 1XG5A 2IBSA 3IQGX 4NSNA 5E4TA 3PUJA 3UV3A 4IINA 3DOCA 2P41A 4HAUA 4BRUA 4Z3KA 4X20B 1OWPA 4MV6A 3LLCA 2F1KA 1MH1A 4C6TA 4NP6A 3BGOS 3HDVA 3C14C 3OMLA 3UAWA 3AGPA 4JVSB 3ZV5A 3CN7A 4ZFNA 3OQMA 2D0DA 3GGPA 3ZGYA 4JKIA 3LHKA 3OETA 4H0CA 4F1JA 2PEYA 3IBCA 1I9CA 1E2KA 3H5AA 1JAZA 1ORVA 4US1R 1TL7C 1YRYE 1PW7A 1YCDA 1GNSA 3CG4A 2JI7A 1Z2NX 4QG7A 1IQ0A 3SI7A 3S68A 2G9NA 1CQIA 1KI6B 2RGNA 4BVKA 1FX0A 3HFSA 1AN9A 4EMTA 3MWDB 5LQCA 1YFJA 4BQRA 4Z0HO 1H2FA 1PR9A 1TUBB 2MIIA 2O7SA 3GUZA 1GRQA 1M6YA 2PMDA 3ETNA 2W2TA 1F2TB 2P9EA 5LD2C 5FNVF 1UZNA 1YA6A 2QTZA 5EIEA 2AGVA 5C4IA 1MQAA 1GFZA 1N7JA 2WT9A 3IEUA 1M2WA 1Z0AA 3PXEA 5FTWA 5IJXA 3UATA 4YUVA 4Z4QA 3C4VA 1QHEA 1AUVA 2UZ0A 2C57A 2ZETA 3C3WA 5CXSA 3UUFA 1K5GA 1XU7A 3G0CA 4XGRA 3WL7A 5F7XA 3CHYA 4ND6A 3T7SA 1T36B 3EFEA 1V4BA 2H1SA 2W37A 3ORHA 4GW3A 4GSLA 1EG2A 2EWWA 2VHTA 3KFVA 4M8NE 4N5IX 3Q5EA 4PTYA 5AVJA 3ILHA 3RBZA 3AHCA 1QORA 1G21A 1X7ZB 2WHXA 4HY3A 4IIFA 4X63A 2PH3A 1CDOA 1M10A 1NJ6A 3F9CA 4UCQA 5H70A 2AR0A 4H77A 2Q4TA 2YZ7A 3K70B 3CRNA 4OH7A 2R6DA 3DDZX 4OSEA 4D82A 4REQA 3ASZA 3WRXA 1XCJA 3IIJA 1AGNA 3VPAA 3WDMA 3I6YA 1OVMA 2G0AA 1TD9A 1Q0SA 2CMKA 2OHIA 2X4LA 4GXNA 4YTEA 5HF9A 4C0LA 2HZ7A 1HKUA 4NQRA 3OZVA 2OV4A 1TRHA 3CUUA 2XYVA 3B1ZA 4JD5A 4IJMA 4NTZA 2H1OA 1T1RA 1T6BY 2C94A 3LA6A 4L3OA 1HI9A 1YI0A 1RLTA 1X7XA 1UK6A 3AUKA 3CZCA 1EUZA 1OTYA 3CTPA 5C31A 2VQSA 3N58A 1VYHA 3DW1X 3GGSA 4ZI7F 1EP2B 4W6ZA 1L3BA 2PBZA 1NBME 3IODA 4GI5A 5F73A 5AP9A 4CDNA 4EAQA 3R41A 2R6FA 5T5QA 1O08A 3LUBA 2XA2A 1OXUA 4PSCA 3S2IA 2VHJA 5L7WA 4G4IA 4V1CB 3E22A 3I9NA 2WKSA 3ADKA 3Q7SA 2GD2A 3OA0A 4EJFA 2IZOA 1YK1A 3G8DA 5KSOA 3TIXB 1LW7A 4DHEA 2R79A 4RHYA 1GAXA 3UVEA 4X93A 1IEXA 1ODKA 2PMCA 1R4NA 3OFVA 1LDBA 2JJQA 2PYZA 2X2OA 4RKWA 1G5FA 5JCJA 2QB5A 3EGOA 2W6QA 2FZEA 1MG0A 3KUUA 2M98A 3T5MA 1JBQA 1RHKA 1X86B 4D3SA 3BDIA 1ZSVA 1QPBA 4YJ3A 1O94C 2IY8A 4G0YA 4U02A 4MGYR 4QEKA 1CEXA 1YTLA 2ERXA 4JT8A 2QBYB 3LX8A 3Q7PA 2BPOA 2IP4A 4JUBA 5HDQA 3SQWA 2FFJA 1GUYA 4S3MA 3PC6A 1JSCA 1W5AA 3D4OA 3LUGA 4CG2A 2VDKB 3TLJA 4NZOA 3AESA 1YHNA 3EBLA 4KQGA 2F8TA 4QJ5A 4Y7CA 3VM6A 3MMPA 4RPKA 2IY9A 3ESDA 3L4EA 2VNJA 4JI7B 4UMFA 2FPGA 3HH8A 3PNBA 3CGWA 4DAEA 2PRKA 3QJGA 2DC1A 1U94A 3EC2A 2H1WA 1H0RA 2A9JA 5BV0A 4JL6A 9MHTA 3TD9A 1QIKA 3GLHB 2VAMA 3ANNA 2C03A 1C29B 5TJHA 3EK2A 1EE2A 3PHJA 3RBXA 3RG2A 2BGGA 2A0UA 1ZZEA 4ZV7A 1DL5A 1NVEA 4KYIB 3T7EA 4F97A 4DCGA 3OJXA 3O8RA 2GBIA 2YR0A 4IOLA 3GJ7A 1AK2A 3HKBB 3PHBE 1T2VA 3ZV4A 3FPGA 1DFGA 4JBXA 4XYEA 4G01B 4URWR 4V0QA 3FTDA 1GNPA 1G16A 2HRRA 1S2IA 1D2AA 1ODTC 2IOQA 3CZ5A 4PPFA 4RD1A 5A1JA 4PXAA 3TECE 1S9HA 1SVKA 4HXYA 5ADHA 3Q8MA 1NY5A 1FSSA 5CM9C 3UAXA 2AR7A 1RYMA 1SHJA 3VR6D 3EPRA 1SH7A 1PLLA 5H9WA 5I4CA 4CJXA 4J0DA 1XRRA 4E12A 4E5VA 5IUNC 1ZINA 4JOQA 1SBYA 1IIBA 2O1EA 1UMBA 1W85A 2IPMA 2EZ8A 4PLFA 5HQTA 1YRLA 3PLAE 3A37A 1ENPA 4NWIA 3ZI7A 1YONA 1SCKA 3FN4A 3NTXA 3A2MA 3ZCVA 1GP2A 1WUTA 4R0MA 5JALA 4NMXB 2XWPA 2ODTX 3KKEA 5IKPA 1MT0A 4QGBA 3ZLVA 3AP3A 3MMSA 2F3QA 2Q3HA 2Q5FA 4TVKA 5EIBC 2FN8A 5AVOA 3WGQA 2QW8A 4DLBA 4PZDA 1Q0QA 1R7RA 4M1SA 3PPXA 1N57A 1IBCA 2YHIB 3DQPA 4NU8X 3GJQA 4X45A 4UXJA 3TKYA 4WRRA 4Z0TA 1NQUA 1QHHB 2E4VA 1VM6A 4I1YA 4XQ0A 5TGZA 2PRYA 2BF7A 3VZDA 1QGOA 2ZS8A 3QVMA 5LKRA 4BO2A 2VNAA 3EZNA 1EQAA 3DCIA 1SCNE 1MVLA 3FNEA 4ZXFA 5CPBA 4N0QA 1WHTA 3OE7D 1EX6A 4ALLA 3C3XA 2GNPA 3NTVA 3T1VA 4O2AA 3O38A 3P9KA 1QVWA 2YC2C 2WG1A 1RJ9A 4RHXA 5ULLA 3WA6A 2PKEA 3USES 1MA3A 2J3IA 1OX4A 1QBKC 1T13A 4N3AA 1SBHA 4RDCA 2HFKA 3HA7A 4RMNA 2PWZA 2GZ2A 1YJQA 1NKVA 3RYFB 5IK2D 1YZGA 3TLKA 2C2WA 1GZ5A 1HURA 3R3YA 4MV3A 3G8BA 4RMHA 4I55F 3Q40A 2BZGA 5BV1A 4ZK2A 1F7UA 3DMFA 2A4KA 4GLFA 5A7GA 3OIUA 4FHDA 1K5PA 5CVTA 3NAQA 2GEFA 2DM6A 3IMKA 2MHCA 1V11B 1QB8A 2CKMA 2OMKA 1DZIA 2BEKA 3EB9A 3NCHA 4C0WA 1OLXB 5TF4A 4C6HA 2E2WA 5DRTA 1FXSA 1K63A 4DCCA 5K3DA 4FMPA 4EECA 3DZKA 4HEA6 3A9TA 2R6JA 3AR2A 3GQBB 2VYVA 2XZTA 3PUYA 1PHRA 4HQKA 3GGJA 4REQB 3ZWNA 4C0QC 3KJZA 2YZKA 2JFZA 3DNMA 3NYIA 1ZMXA 4IHJA 5AI8A 3TPCA 2FVXA 2PXHA 3K05A 2WINI 1HTBA 3LFTA 1DQRA 4AJPA 1AA9A 1RM4A 3GT7A 4JGIA 3OLWA 4LK3A 1LLUA 4O4JF 2NUTA 4C4SA 4WKOA 3NKFA 1OTHA 2VVTA 1BD3A 4L9WA 2F9FA 1RJGA 2VA8A 4GQAA 1LBHA 1SJ9A 2OCLA 1Y5LA 3ASVA 5E8RA 4NXMB 4OOEA 1KFBB 4Q19A 5ALEA 4MGKR 3WYBA 3QPAA 1FBTA 1KZYC 5ALKA 5LQSA 2G82A 1KYQA 3HCRA 1NW3A 4I14A 4RS3A 3D59A 3K6SA 1JDBB 4ZARA 1XNRB 4BX2A 1NJFA 3ZNQA 2FPMA 3MT9A 4TTTS 5A3RA 1CY1A 4EPWA 2JLWA 1C1YA 2KPOA 1PL6A 2CVZA 1P2SA 3RK1A 3TTYA 2R7AA 4B7CA 1FZQA 1GDHA 4BCBA 2HWYA 4HQNA 1MP0A 1FXWF 3O2QB 1XX6A 2H8KA 3T4UA 2FWMX 3IKJA 1CP2A 2RSLA 3NTOA 4A16A 2QZZA 2M32A 3U37A 4DMUB 1O77A 1DUIA 2GD0A 2DB3A 4KO8A 1G8JA 1XT6A 2HA5A 2YRWA 4BV9A 1INLA 3AB8A 1R9GA 2I8AA 2M6SA 3LCMA 2VDRB 5L7YA 5LKAA 3Q15C 1O57A 5ALWA 4RTNA 1ISFA 1ECJA 5J4LA 1N0IA 2WTAA 3VYRB 2QD3A 2XHEA 1VIMA 1RBYA 4J7XA 1YR8A 1CUWA 1U9IA 4F6RB 1F5NA 1VMIA 2P0AA 3ACCA 3PI6A 3S27A 4ZD6A 1ATZA 1S9DA 3RWBA 4GKKB 2Q5JA 3CZAA 4L27A 3M81A 5KX5B 5HQJA 4RANA 2PUEA 4AO8A 2PS1A 3M1AA 1GZUA 1Z38A 4DQLA 3MJRA 4R6WA 5CPFA 3RVKA 1QZTA 3WSWA 2GPYA 1L3CA 4IH1A 5DWDA 3GEMA 4ZMSA 3QKSB 1WNTA 3AB3A 3THYA 4PYRA 1U63A 2CD9A 3PG5A 3UG7A 2ZATA 2V0NA 2XMDA 1FDSA 5E1MA 1YZHA 2DKFA 2VJNA 2IPLA 4DDKA 3GAMA 5FI5A 1N33B 1TKBA 5JIBA 3EAFA 1POWA 1P9OA 4C5AA 1J8MF 2ALJA 1N2BA 4EUNA 3X1JA 2NO4A 3IDZA 1ABEA 5A4FS 2G4CA 4CL2A 1TVCA 3OQ6A 5AJZA 3Q8KA 4MUNA 1G55A 1AHPA 2YUIA 5CFQA 4LX0A 2OBBA 5CNJA 1Q6YA 1YVEI 2R84A 3DTVD 1QPGA 4KVZA 4M9RA 4RLQA 1CJSA 2H54A 1TF7A 1J1IA 2J4FA 4PWZA 4Y9TA 4TGLA 3D7KA 3IELA 2FRDA 4XGNA 5LXTB 1XN4A 2GN6A 4A03A 4IRMA 4QDZA 1E9DA 3DEJA 1F5SA 3HO8A 3I04A 1SQ6A 2FEMA 2HJGA 2HJRA 2DCMA 2XA1A 3AKYA 1BVRA 3OICA 4E5NA 2YFQA 4HNTA 3HJBA 3VU9A 4BFUA 4DUZB 4UVDA 1I5RA 1KU6A 2PXCA 3IHKA 3ZE0B 5ERXA 5I3CA 1NQXA 1QDUA 1ARZA 1OY1A 2EBFX 3IIKA 3EBPA 4G5FA 4J0EA 2FEOA 3ZS9A 3VZPA 2TS1A 3FGOA 3CLRC 1XZFA 2RDMA 3IFSA 3QLEA 1KO5A 1D2CA 3LW7A 4Z3OA 2XNSA 1UBRS 3ED1A 4ADSG 5A03A 2WAYA 4IDOA 2FAXA 4WV3A 3HA5A 4BNKA 3B12A 1ZOLA 3RFCA 4YRJA 5C52B 1K6EA 1PV1A 2MSNA 3KXIA 3WTBA 2H08A 2Q29A 3I9JA 4YR7A 4KRFA 3WRYC 1FQJA 4DLZA 3K0SA 3SQLA 5HZKA 1L5LA 4W99A 1Y9ZA 2RMKA 3GLRA 2JI4A 1ZI6A 4HUQA 1JLSA 1T34A 3TTTA 4BZPA 3K0AB 3NTQA 4Q3NA 2R8OA 1JJBA 1WL8A 2AN4A 4JJZA 3KD3A 2IUFA 4RFSA 4KQ1A 5GIPE 1WOYA 3DEHA 1DG3A 1EK0A 3H9UA 3G6KA 3K16A 2XCTB 2XV1A 3UJCA 4D43A 1JG3A 1PGQA 2AFIB 2XA9A 3B9BA 5EOVA 4KNWA 1Z25A 2XKJE 2OKCA 4OJTA 3PV0A 4BGUA 1RT9A 1H6AA 2NNLD 2RB5A 2OGWA 2BZ1A 3BMNA 2OCYC 3GMTA 1L1FA 2OMEA 3ZDEA 4DM3A 3W3AD 5AKXA 4ER3A 1P44A 2J46A 2BHLA 1O87A 1U2SA 4NARA 4FMDF 5IKXA 5HJ7A 3QMWA 4EG7A 3FWHA 1BVYF 3AF3A 3H7AA 5EHGA 3S70A 4QGFA 2O4UX 3KS9A 5D84A 1DBQA 3B6MA 2A30A 4A6EA 5HKAA 1SU4A 1FLVA 3GA0A 4GR9A 5DXFA 3GQBA 4JMPA 3DZBA 2XKAA 2EWMA 3G9TA 3TAHA 3QUBA 3ROXA 3QLUC 1L7RA 3MINA 4XDYA 3QOYA 3V1YA 3G5AA 4ZDWA 3UN1A 1KBQA 3KSZO 3PQFA 3VQTA 4CIBA 1DVRA 3HO6A 1Q0PA 2AMVA 3KSUA 1N8SA 1JP7A 4NU6A 2LVBA 2ZYTX 4BLSA 3SYMA 1NUPA 2G8NA 4JBHA 4JBYA 4UHFA 4D8XA 1U90A 1XRJA 2IU6A 3KC2A 2O8DB 3IUJA 3D1JA 3ISTA 4B3RB 1DRJA 5BV2P 2BMAA 2PUVA 4MVJD 3NBMA 2X0DA 5LJLA 5TIIA 4ND2A 4ZVTA 3AU9A 3P4UA 4W8OA 1E2UA 2P75A 4ZOEA 4ZQCB 3HHEA 4LSZA 5THXA 3TM5A 2QUJA 1UKYA 2Z98A 1S8FA 4IBOA 2VDNB 1DLIA 3R7NA 2WU8A 1GZVA 1H6CA 4J0JA 1A9PA 4MVJI 2NVUB 3GO4A 9LDTA 2JFNA 2IYZA 3EXIB 4RULA 4ARCA 2ZBUA 2FWNA 5ALRA 3ROZA 3WMGA 2O8FA 1LEHA 4MW6A 1I3CA 4Z8YA 1WQ1R 1FQOA 4GRIA 3F47A 2E3JA 1KO1A 3FSGD 1CRQA 3NLLA 3PL5A 5A7FA 3EEIA 2QUAA 5K0NA 3DOIA 1C3EA 4TUYF 2MYNA 2QN9A 2VHWA 4LF9B 1FNCA 3DE4X 1UM8A 4JJEA 5BW8A 4YK7A 3AK4A 1R1DA 3PSAA 2C0CA 3V4FA 4GYKA 3U4HA 4LGMA 1UJ4A 3VXKA 5JJ5A 2GK3A 4Y0AA 4UBJA 5J2UA 1Y3BE 2FMUA 1J0EA 3CT6A 3UAGA 4UTRA 2XB2A 3F90A 3K1YA 5C5CA 4LDNA 1N36B 1EE1A 1U9ZA 1EI9A 4KRGA 1WXWA 4ZK6A 1XZLA 2MSCB 1WDLA 3W77A 2E4AA 3LXRA 1EFDN 4S1TA 1A2KC 4AJKA 3AERB 4O4HA 3WYGA 4Z49A 2PA0A 2FEWB 2WJIA 4WGGA 3C41J 3GEBA 1NRXA 4B5LA 3I0NA 3AB7A 1JG7A 2ZT8A 3BWCA 3CA8A 1IB6A 4RK0A 3KU1A 5CX1B 5DBFA 5EJ2A 3MYRA 1YU9A 2RHTA 4XYMA 2UYYA 3RHZA 4ZO4A 4BNJA 2W42A 1G63A 1C0LA 3HCNA 5EXXA 4QGGA 4MAMA 1A27A 1D6NA 4ITUA 1E1DA 4FNOA 1MLDA 4KR2A 4J1NA 4X1IB 5B1YA 5F1PA 2X9NA 3UENA 4MPTA 1JX6A 4MUFA 1F9EA 1WIWA 5ALPA 3TSAA 1GKUB 2XNDD 4DCSA 3VVCA 4CU2A 5G40A 2VJBA 1WRBA 3G6WA 2FSVC 3PICA 3QVVA 2CKDA 1MRZA 3NORA 1YWGO 5JLJA 3ELUA 3TIVA 1KIAA 1L7AA 1UZUA 1T3LA 3D3JA 4G5GA 3PGJA 3UAOA 1RKQA 2XMQA 3OSZA 5K6RA 1R50A 3NUQA 1HSZA 2FHSA 3KB6A 4OHZA 3T61A 2AJBA 4ISBA 4V1CA 1LKZA 2FW7A 4UBLA 5CLQA 3RSLA 1H93A 3I2YX 2ZJZA 3WLIA 2WYIA 1Y3DE 1TMGE 1BMQA 1HGXA 4PG4A 2I62A 3CN9A 4JYBA 3RVNA 5JD3A 2CZGA 2WJGA 4AY4A 1QU2A 2X42A 4X61A 1B93A 4Q24A 5G0SA 2NO9A 3W6NA 1WCV1 3QW4B 4H16A 3HJRA 1Z9BA 3P2JA 1T6YA 4QOGA 2D0IA 4TRNA 4YPOA 3IQXA 1H2XA 3IQEA 1EWVA 4O2BB 1F4VA 3T4EA 3DYVA 2DUUA 1WABA 1CNFA 4J3JA 4RJLA 3W6ZA 2GXAA 2GYUA 2V9PA 2FUG1 4IFBA 2ZJYA 4L8WB 3UC5A 1JT9A 4C2TA 3AW9A 2OL4A 1MC5A 3HBJA 4HKTA 2I54A 1Y7HA 1QIHA 3KKQA 2FXVA 2QQ0A 4QTZA 1RQPA 1MA0A 3U4AA 1J20A 3OQ1A 3F97A 2FXIA 3R77A 2LDBA 4Q93A 1GJRA 3E81A 3KTOA 3SP1A 3W8EA 3OCCA 3H4TA 2ZBRA 3OM8A 1IZZA 3H11B 1GCGA 2FPGB 1ODLA 2HHHB 1CUBA 1PZFA 5JNSA 3N07A 3M6UA 3F6EX 4TLBA 2C4HA 2Z2ZA 3O8BA 3WKEA 4AN1A 5LIPA 3THXA 2RARA 3TIGA 1CHNA 3I83A 3TKLA 1JHMA 1GA1A 2VDWA 2UYQA 2BFNA 3W9UA 2GPSA 2O07A 5HGJA 4C7VA 1FJ2A 2Y66A 2KB0A 2CHEA 5LSAA 3L43A 3QVGA 4FWTA 1FDOA 2GTHA 1DJQA 3DEFA 1J49A 1E79D 2GS9A 2XMGA 4D9NA 1O2DA 2L2QA 4DEVA 3SIXA 5EJ4A 4Y1RB 3KO8A 2YJGA 1NXSA 2C2ZA 4GXQA 1UJ6A 2IITA 2IEDA 2Q5HA 3FCSB 4F8EA 4U39A 4J0FA 5KU7A 1M7BA 2D2EA 2D8MA 3FI0A 1SD5A 3UMCA 4Z51A 1MW9X 4GP7A 2Z0MA 4HLUA 4XPZA 5LPNA 4XWWA 4JI0B 5K0FA 4CEHA 1D6SA 1E9SA 1FYVA 4LWZA 4DEXA 4C4PA 4WCFC 1N5RA 1U1IA 4ND8B 1ZD9A 4PO3X 1Z6GA 1CQJA 1E2MA 4AZ3A 3CVUA 2FPIB 1AHHA 4AX8A 4COOA 1LK7A 1TLTA 3EGVA 2GLUA 4G0MA 4IX9A 3VR1A 2ZRLA 1E3SA 1ONSA 2J5BA 2JAWA 2G07A 4PCLA 3MWYW 2C1EA 2WT8A 4Z9BA 3PF8A 3TNLA 4AC9A 1M1NA 1RKVA 4MKRA 1RRMA 1TRKA 2BE9A 1I5EA 3D81A 5C5EA 5LQNA 1R4ZA 5FJIA 5K3BA 2HTEA 3TLZA 2GKOA 1NVTA 1MAWA 3ECSA 2XI4A 4FGJA 3NTLA 1QHHA 1B76A 2JIQA 2O8VA 2QE6A 1WA5A 4IX1A 2APJA 5A9TA 3EXIA 1KSHA 2ZT7A 3N0TA 4J29A 3FDJA 4YAWA 3CE6A 4C4YA 3KZNA 4ZMRA 1EJ6A 1G5TA 2ZJOA 5FPKA 1H4SA 2OGUA 1A9ZA 4P4UA 2J6IA 1GTJ1 5BW5A 4J4TA 3PGA1 4YQYA 1N6KA 3H3JA 2X5XA 4QYIA 4EY7A 2DWCA 2QRJA 5HE8A 2EKDA 2JVJA 1M1YA 2J8ZA 2JRCA 3WNZA 4Z9FA 2RHBA 1CVRA 5EKSA 5I7WA 1QKJA 3FFWA 1ECCA 2ZB4A 3KCQA 4I50B 3RYFA 3K0FB 4NQZA 4P4TA 4JLUA 1MX1A 2AFIE 4GC9A 1MB0A 2FW0A 3RQSA 2W11A 2FPKA 4YASA 4YA6A 1G19A 5IZCA 1XA0A 3GFTA 2ODEA 2NYUA 3Q8WA 1EVQA 2EOAA 4O4HF 2C98A 2JFQA 5DNWA 2X9VA 4RADA 3C3EA 1M1XB 2QX7A 2YJ6A 4ZHQB 5AVZA 3NDRA 3TX6A 1B73A 1Q1ZA 3HVHA 5LLSA 1WF6A 4EELA 4XYBA 3E61A 1XRSB 2E85A 4BKQA 3N2NA 2JFBA 5LP6A 1U98A 2CXNA 4WEOA 2M2IA 3ZJ5A 2WA1A 2NYAA 2JK0A 3HB5X 3VNAA 4A8HA 4DGSA 3QXXA 2QAGC 3G0HA 1BDHA 3EIFA 1BXRA 2W22A 3KPYA 4RD0A 3IP1A 1YOBA 3RFXA 1DWPA 3NDBB 3SX0A 2H2FA 1PR0A 1SBTA 3E4DA 1NNEA 1EGHA 1QK4A 3T41A 1V35A 4A92A 3SXUB 1VDZA 3HRKA 3SM3A 2Z6AA 2ZSDA 4D9KA 3M6XA 4GM1A 3GJSA 4IDGA 2MWMA 4W63A 1WXIA 4IYJA 2ZU6A 1PN3A 4E5SA 1SN7A 2JAXA 4YMTA 4X6YA 5JISA 3D31A 3ZDBA 4M9ZA 3H4IA 1PI3A 3H86A 5ES3A 4MLCA 1N3BA 1A50B 2TMYA 3WYAA 1HE8B 3OUTA 1W34A 2HDOA 2WHPB 4FGKA 3AV3A 1ULTA 4EKDA 3FNGA 2P2LA 5CR9A 3K35A 5D7NA 3TBFA 4WVFA 1K66A 1GN8A 4BLRA 2PM8A 3QY0A 3O91A 1QC5A 2BHSA 1ADFA 4R1NA 1Q2UA 1QG0A 2NO7A 2R48A 3UANA 3UIEA 1SA0B 2XCOA 1DI0A 5BW4A 5B6IA 2XY4A 1UWCA 1PZHA 1RDFA 1QVRA 2HK6A 4KQ9A 4O4LB 4OMFG 3F8TA 2XUFA 2HRQA 1O96A 4BFZA 2UV8A 3L7YA 1E58A 4BFXA 4R3WA 4QBTA 4WPGA 1XZ8A 5DVZA 4G0UA 5FF9A 4P3XA 4ZODA 2GQ0A 1VBFA 3H9EO 3LF1A 3W2EA 1FCJA 3RIMA 2I91A 3KLPX 2F1OA 4ZVSA 3A6PC 1AXRA 3DVSX 3H9GA 1DWUA 3LFHA 4RESA 3V4LA 3WFJA 3JS5A 3ZZ0A 3VH4A 3MTQA 2A1UA 5AW4A 3MHTA 1WCIB 2IXTA 4NPHA 4Y0VA 1M2GA 5EXTA 1SVWA 2P69A 1Z2OX 3LT5A 2IC5A 4RXTA 4BP9A 1S1MA 3BMOA 3IS3A 3RUIA 1HUQA 2OV1A 3P52A 2CBXA 2WE8A 3NATA 4N8SA 2FN7A 3LP6A 4W7SA 5AVKA 1P4AA 1VOTA 2PL9A 1E9AA 1A7JA 2EIXA 4GL2A 4ZDKA 2Q46A 3R7SA 2ZR8A 2QPTA 3BB1A 2XUQA 1KWKA 1HPLA 3F2IA 3M89A 4KOEC 2WSMA 3A4VA 4J76A 5FI0B 3AF0A 1UJ2A 4CWAA 1SUWA 3DEAA 1EIWA 1ZU4A 4UBIA 3OI7A 1CR4A 2ZRGA 1MOZA 1C50A 3LQ1A 2CHUA 3VGPA 1JQBA 4JA2A 1XNGA 3FKSD 4NRDA 1AHIA 3LOUA 4DSAA 3OMXA 3KYCA 1AGRA 1WXEA 4HLCA 3KL2A 4LVCA 4E1BA 1S7CA 2FG7C 1B6RA 3VH3A 1T3TA 3HWRA 3IMEA 3KB1A 4FC6A 5DHQA 1UDXA 1P9LA 3KYBA 5AK4A 3AJRA 3ILYA 3WK4A 3PHGA 3BFKA 4LRQA 4DIMA 4Q05A 4A73A 4YV7A 4NAUA 4D4HA 3WGOA 1Z36A 1JEAA 3WMWA 1DJOA 3FYSA 3W5VA 1WHSB 1EVJA 1T36A 2WM3A 1TCVA 2XWBF 3L07A 4COKA 4EA7A 1NSFA 4IYRA 1QQ6A 3T3MB 1BE1A 1RRCA 2YJ4A 3P0IA 4HS4A 2GXQA 4Q15A 2EZUA 4RQTA 1GUAA 4LGVA 4H1HA 8ADHA 3C6MA 2OC9A 1A2QA 4QPPA 4DLXA 1W96A 1ZG3A 3G85A 4NBNA 2RAUA 4H6XA 4HQ6A 1BYIA 1VKRA 1PT8A 1RPTA 1M1NB 4ZRNA 3C6BA 1L4YA 3FY4A 3AUTA 1XDWA 4OQDA 1ZA2A 4WDRA 4EGAA 4L4YA 3HP1A 1JLLB 1QFJA 3QI7A 4GWLA 2OY0A 2YVQA 4TKUB 5BVGB 3ZGVA 2FETA 4FYJA 1U2DC 3A06A 2NU7B 1JQKA 1OBVA 1ZRSA 4PQRA 4ACAA 3EDRA 4AJJA 1P3DA 3GA7A 1ZK4A 5A71A 4KSBA 3GUCA 2DE0X 1A3CA 2GYWA 3UQZA 4QOJA 4BVJA 5HNKA 3CT4A 1B2RA 3ZR4B 4M0LA 3QPCA 1OBOA 1WKVA 5CVCA 1KZHA 4BNMA 4E4RA 1E1KA 4JYCA 2A86A 4WN9A 1CVIA 3G7NA 5AM2A 3P4XA 2N3ZA 1G9XA 1N25A 4W5WA 2AG0A 1U8YA 4EZIA 4IIJA 4TL9A 3HSKA 4KREA 1WX1A 4FONA 1IYZA 3DAGA 3U1VA 3L8ZA 3QU7A 4I1OA 1IY9A 1GQRA 2GKSA 4E5UA 3SYRA 3HCBA 4LJRA 3FSGA 4RCYA 2Z1MA 4BJ5A 5CXUA 1XJ5A 2BGRA 3HJCA 5A4AA 1ESMA 6GPBA 5HUJA 2OV2A 1YDGA 1PVOA 3VU1A 1JXOA 1WPGA 4OB8A 3NAMA 2FEXA 2JFHA 4YYZA 1PGOA 2A8YA 2Q8PA 3IULA 4JLNA 4UXHA 2WMNB 3MTDA 5K6AA 3L0YA 1EQUA 4RAOA 3H4VA 2VWPA 4DMHA 2ZJBA 1Y4AE 4BFLA 1GNTA 5KC9A 4DARA 5ALSA 1FU7A 1CEEA 1I1HA 3DHWC 3OHMA 1YZKA 4WMLA 3G68A 1GT91 1D9ZA 1K6XA 4L15A 2O48X 1IHOA 3KR9A 3FWPA 2WLTA 3MQ4A 1T6XA 1XTRA 1YI1A 2DFKB 2XB6A 3FTPA 3QWAA 4JLJA 3S2GA 4YX9A 5AUNB 2X0JA 5INTA 1L7NA 1UEJA 2M6LA 1KQPA 1EUYA 3U7QA 1ZUNB 4DA7A 4KQIA 2I34A 5ADVA 3DAPA 1FFSA 1TT5B 4BMZA 5KNLA 1WB4A 2PFKA 2LNDA 2L42A 4KIWA 1ISSA 1QYXA 4NULA 4Y2JA 5CRIA 2G5GX 5FUBA 1PQPA 1W30A 2HA0A 2H3EA 3N2LA 1KAMA 4JOSA 4NMHA 1YZUA 4HLUC 1F6BA 1VI2A 2NQTA 2QKYA 3HHPA 2JHPA 1A9RA 1KI1A 1OQAA 1T2FA 4BGEA 2IU4A 3ETCA 4E1VA 1A96A 5EMKA 3ILXA 2VBIA 1A5BB 3B20A 2FP3A 2G0TA 1A9SA 2VRNA 1BX0A 1AK9A 3GNTA 4V0MA 3IUSA 5EHXA 3QFHA 4MIEA 5IHXA 4MYDA 2J67A 3T6KA 2I0FA 2OQRA 2WWFA 3QX7A 3ZHYA 1MEJA 3EEYA 8ATCA 3L6RA 4K2AA 2FDRA 2OYSA 2UYGA 1KF0A 3QX3A 5ECDA 5A4KA 4FHZA 1V7ZA 4LBZA 3THOA 3FJYA 4DDUA 1B15A 1WPXA 4PHGA 4WBNF 4O25A 2EGGA 2ONZA 4NBSA 4YAJA 1P4GA 1Y1SA 3IBYA 4PC1A 4CM4B 1IDOA 2YYZA 1WEKA 5JS1A 3CNQS 4EB6B 5KYNA 1B0AA 1GRRA 1UINA 2BW0A 2Q1SA 1RJ9B 3AFOA 1C9DB 1K0UA 1X8LA 4FZVA 4F6CA 5LZ4A 4F7DA 4GGMX 2QM3A 1Q11A 4GWKA 5L45A 5TPZD 3SWWA 4X1YA 1PR4A 3RT9A 3EPLA 3DL2A 4EA9A 2QN1A 1XQVA 2J5RA 2WJ6A 3FOBA 4Q16A 4MDEA 1NBAA 1R0ZA 4X44A 3AVWA 3DE3X 4Q3LA 3PKZA 2H0AA 3DYBA 4EX7A 1UBOS 2H52A 4EBBA 1TDJA 1UKAA 1IBKB 3ZJUA 4GI3A 3BH6A 2VZLA 3DTVB 4QXRA 3G5UA 2A5LA 3O8DA 5KYUA 3R4CA 1TGYA 3VYUB 4FZ5A 4Q7MB 1KEEB 1ZXBA 3HKCB 3RUEA 5IXSA 2O14A 5KYVA 3PRHA 3ZG6A 3WWPA 1SEVA 2VXBA 4JR0A 2X0RA 3DE5X 1EFPA 2HZBA 2E18A 3A58B 1DG9A 4L0DA 3DR5A 521PA 1ZM9A 1H85A 3HWX1 1N1DA 3Q5DA 4LJ9A 3KQOA 4UEWA 5D2CA 1Y6RA 2NSYA 2PX4A 3ELDA 4OGFA 1CSEE 2HF8A 3V1MA 4MHOA 2WB2A 3ZOKA 3MJCA 1MO4A 4QPJC 5DTMA 1DC3A 3EHDA 1ZDMA 5FFMA 3NDIA 3WI7A 5J4YA 4U7DA 3Q0TA 1XZEA 2FW1A 2YOHA 3NV7A 3P32A 3V7UA 3ONNA 1QIMA 5CA0A 1QSGA 3KUDA 5BQXA 1HO3A 2A0XA 1ZOPA 2IU3A 3RVBA 1N0WA 1D3AA 3EPHA 3EFBA 4JYPA 1NM5A 1NW9B 2C3MA 3B1WA 1A95A 3SKXA 3U39A 3P0FA 4TVOA 4CKZA 4DHWA 5CCBA 5CFZA 2JLVA 2E4WA 2MTBA 3LZCA 1ZCAA 1Q12A 1Q16A 1B8VA 5IDVA 2UUCB 3LV8A 1OI2A 4WT7A 2PKWA 4MR7A 2A78A 4NZZA 4C9BA 2SCUA 3PYXA 4M87A 2XBLA 3ZXXA 3LXUX 1O94D 4QRHA 3E7XA 3O92A 4KE7A 3HN7A 4D0NA 4HVLA 1A7KA 1UT6A 1XTZA 5SYAA 5MDHA 3RAFC 1HDOA 2WE7A 2Z95A 1JFRA 1VIYA 1R27A 3GJTA 3HRIA 1W8IA 4J3FA 4QTXA 2EARA 4YN3A 4BEVA 2P3QA 6REQA 1TYEB 3OZ7A 4OXYA 4IQ0A 1XNQB 4AL4A 1EZ1A 1KEPA 2NSJA 2MCFA 3IE2A 1Z68A 2ISSD 2V7TA 3AI3A 3K6KA 4HL6A 2X6RA 4FE4A 5B3JA 2XT0A 5JMPA 2G36A 5EJEA 5F23A 1AX9A 1QR2A 4MYCA 1U1CA 1E6EA 1SHTX 2XUHA 3MERA 4XX0A 1RWBA 4EPVA 1BE6A 3IRUA 1PP4A 2I4NA 3EARA 4P3YA 4AYTA 1UFOA 1KFEB 1TFRA 2I29A 3GAFA 3QHQA 4N5MA 1PDWA 1OWNA 4Y30A 1JJ7A 1N6RA 1B1AA 1ECGA 3PYLA 2ZUFA 1YQQA 1EFRA 4GI2A 5DGCA 5AXCA 5B7QA 4RM3A 2XGOA 4HEHA 2AX4A 2ACVA 3QE9Y 1TJPB 5GADl 2PH5A 1E2NA 3TOXA 4L57A 3D6TB 4M0CA 4LYFA 5CB4A 4HMPA 1VSBA 1QQBA 1MB9A 3IIMA 1RR6A 1R6TA 5HIJA 4C4XA 4DBZA 1PNTA 1X7YB 2O2GA 2A9VA 1IZ7A 3HL0A 4GXTA 3WK5A 4PYJA 2HHLA 4C3UA 1E1NA 4R3NA 3B1VA 3U44A 4M7WA 5C7IO 3QU2A 1XQWA 4L5JA 2P4UA 1L4KA 2ZSBA 3FUTA 1AV7A 1J6UA 3O73A 1T9BA 1JTVA 1V6SA 2GZSA 2H4XA 3H13A 1UODA 4OHCA 4RHFA 3RRXA 5IPFA 2P8JA 2Y27A 3NHPA 3B48A 1VE6A 4R5MA 1I24A 4ZJYA 1Z7GA 2D5IA 3VZSA 4YMIA 1M8GA 2PE5A 4GZ6A 3AUJB 1CDDA 2E0IA 1F9AA 4ER7A 4X3CA 4F91B 2PWYA 4QBKA 4URXR 2C4TA 4DG8A 4ZTBA 1U8ZA 3J7AC 3O83A 3QBTA 2W9XA 3QZUA 3A6GA 2W2PA 4RV9A 1VHDA 5EXDA 3RREA 4FHEA 1LY1A 3O75A 1P17A 3KXLA 4D0GA 3QXHA 2UUPA 4NX2A 1EHYA 4QU0A 1EB8A 4EPTA 1DHRA 2Z6VA 3WQQA 1YRBA 4U5QA 221PA 2H8GA 3L1KA 3M2TA 5IEJA 1F06A 2C7VA 1I94B 1VL5A 1A1SA 4ECEA 3RADC 1VIVA 2DVMA 1HLDA 1W8DA 1FMTA 2H9AA 2RHLA 3R24A 4PPNA 2I2CA 4UJ5A 3VMMA 3X3HA 4CEHB 2D3TA 2DPMA 1NNSA 2WTNA 1V3TA 3BXGA 2I2WA 3SJAA 2ADFA 1XK6A 1KRWA 4IXTA 5IWAB 4UCFA 3ZIAA 3QELB 3VNRA 4B4UA 1U2DA 2CDRA 3IAM6 3Q41A 4R2HA 4KW7A 2GF9A 2C5AA 2QENA 3P2EA 3N74A 4QYMA 4TTRA 3VU9B 3WYDA 3NHJA 4RFSB 3AETB 2BH2A 2CD7A 4TXNA 4U2FA 3RDPA 2IYLD 4CBVA 4LWQA 1RQ7A 4EG8A 5L4SA 1OTXA 1Z4KA 4JHXA 1M66A 3V8EA 1L4EA 3D8HA 3P0JA 4EI8A 1NMZA 1KH2A 1JZQA 1TA9A 4MKGA 2QTTA