1LY1A

Structure and mechanism of t4 polynucleotide kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
152
Chain Sequence
b'MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polynucleotide kinase
molecule tags Transferase
source organism Enterobacteria phage t4
publication title Structure and mechanism of T4 polynucleotide kinase: an RNA repair enzyme.
pubmed doi rcsb
total genus 53
structure length 152
sequence length 152
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2002-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ly1A00
2IEZA 1B0UA 2R6GA 1ZNYA 1VKJA 2W83A 3QKSA 3AP2A 4NYIR 1Q3TA 5AUQA 1FPMA 2L0XA 2OAP1 5GVRA 1MO4A 4U02A 4R2HA 4Z54A 4JLBA 3W6OA 4B43A 3GLGA 3WP1B 3GEIA 3RVBA 3FVQA 4D0LB 3KUCA 2EVWX 3GLFB 1NBMA 5EXSA 3QXCA 5CK4A 5LDDC 1SZPA 1U99A 2ONKA 4TTQA 3BFXA 4IKEA 5K8UA 2R65A 4Q1CA 1H65A 1RPZA 4IOLA 1SULA 3JZMA 3DZDA 2WWWA 2ZVPX 4DCTA 5FTMA 1E2MA 1KI4A 4XVQA 2WKPA 5F2EA 1OXUA 5J4YA 3SYLA 2GZHA 3RNLA 4DZZA 2O8CB 5L3SB 4JIMA 3EC2A 5FI1B 2WJYA 1A7JA 2RGDA 4M1TA 1BO6A 3OEHD 5EXPA 4YONB 3WP0A 4BLOA 3ZDQA 1GL6A 1FQKA 1KJWA 3VR3A 3TUZC 1LTQA 2O8BB 4LYHA 1YZLA 2WWGA 1I4LD 4IVRA 2GVZC 4Q7JB 4NU0A 1T3LA 3MWYW 1N6NA 2R6CA 5DSZA 3HP1A 4B33A 1P72A 1DG1G 1NN1A 4LPKA 4JKIA 4BFSA 5KNDA 3J81k 4EQ6B 1J90A 1XTSA 2B6HA 1P6XA 2ZE5A 3THWB 2QPTA 5ANRB 2ONJA 1RFLA 2YYZA 5L3VA 2QAJA 2W6JD 3GLIE 4WXRA 3TKLA 3TR5A 1OFUX 1RKBA 4MQBA 4XD7A 4D4KA 2D4HA 2FGJA 1G7RA 2GILA 3Q5DA 2QZ4A 1QHGA 2XSZA 2AK2A 2DCUA 4KYUA 4WZBE 3ZIAD 2ZRKA 4A36A 2JDIA 2PMDA 4LJ5A 1P9NA 2ZYUX 1JR6A 1DAHA 2ZM5A 4HEJA 1H8ED 1U0JA 1S4QA 1P3JA 1X8JA 4IVPA 4YMUA 4Q18A 1KDTA 2ZSAA 4Q4JB 1AKEA 3DKVA 3K09C 3SJBA 5JJLA 1XEWX 4LJ7A 1QZXA 1P4SA 1ZRHA 1EFRA 2NO7A 4QGGA 5G41A 1G5PA 3I62A 2Q3HA 3UPUA 3TJZA 2EFCB 2IYRA 4RD6A 1E1RA 3FHTA 1LVGA 5EXTA 2JLVA 4G5GA 4AI6A 2QQ0A 4U00A 4DLSA 4PTLA 3ADCA 1R5BA 3TRFA 1QVAA 5FTLA 2C9CA 1XXHA 5D3MA 4ARZA 3A6PC 1ODFA 3CO5A 4QJ5A 3X1WA 1NVVQ 4ERNA 2C77A 4HLQB 1COWD 1BKDR 2RHDA 1G8FA 3LBHA 3N70A 3VR5A 4JZKA 4A82A 2CNWD 4B3XA 2FFBA 4XJXA 4EPVA 2F3TA 1VG8A 1KIMA 1H8HD 2IF0A 4EJSC 1XJCA 5IK2D 1E3MA 4I1VA 4ZKDA 3GEHA 2ZS9A 1QVRA 4PSKA 3QIAA 2ZUDA 2DWQA 2VHCA 3CRVA 3KTAB 4XTRA 1EK0A 1R4AA 1IONA 1TF2A 1IM2A 3BFKA 3AM1A 4MDEA 1FFHA 4B3DA 2JJ8A 2HYIC 1QHSA 2OCPA 4B6EA 4QXAA 1NG1A 2C9YA 3T34A 1E0AA 3T12A 3GP8A 3SR0A 4OHZA 3B9PA 4IDQA 3OF5A 2REOA 4PC1A 4HATA 4B76A 2AKYA 4F93B 3EA0A 1UEJA 2KE5A 5FI0B 2IYQA 1R0WA 1XCMA 2I4IA 2IYSA 5FR2A 1E98A 4HAVA 1DAMA 3W8RA 1WP9A 1E2FA 4Z8YA 2QM8A 5HKKD 1PUIA 3M0EA 1E9CA 3G82C 3SJAA 3NKVA 3ADKA 2FH5B 1UKVY 2GXUA 2PLFA 3DL0A 2GJAA 2AHOA 2PCLA 2K5UA 1XD8A 2VRWA 3MG9A 2REXB 2A5DA 2ZRGA 3OFND 1ZNWA 2JLXA 4A92A 1YZNA 1MKYA 2HEIA 4BZXA 1IN4A 1Q22A 2E9SA 3KFXA 2YHSA 4C9BA 1LY1A 3DMNA 4BLRA 2IS2A 1BH2A 2R6DA 2JGNA 4M1KA 2J46A 5KPDA 3NC1C 1NMZA 4D4MA 1YE8A 2GWHA 2OCYC 3SYNA 4TT3A 3MLEA 4Z1MD 3R8FA 4PO9A 1Z0IA 3PUZA 3TUJC 1ZMXA 2ZS8A 4RD2A 4URYR 5D3QA 4AYWA 1GNPA 1JPNA 2PH1A 1ZYUA 2WKQA 1GAJA 3ICQB 4CEJB 5KNCA 4Q48A 3GLHA 4N1AA 3P1JA 3NBFA 2NO1A 3THYB 3W8NA 4NPHA 3CX8A 4TTRA 3EPJA 4CVNA 1U0HC 1Z6TA 2J7PD 2GCPA 1OHHD 3K9LA 3L0OA 2WSSA 3GPLA 1AA9A 3ZQJA 2V7QD 3M6AA 2FPLA 1Z0DA 2F9MA 2O8CA 1TQDA 2R9VA 1DS6A 4AYTA 1DAGA 2BHRA 2VO1A 1XEWY 1E99A 3VHLB 2HT1A 3K0AA 1E9FA 4LWZA 2CLDX 3WMGA 4JL6A 3U6KA 2GTPA 1J7KA 4PX9A 2PLRA 3UKDA 2H57A 4D25A 3C4JA 3WY9A 3I92A 2XNDA 2ZE8A 1JB1A 1TEXA 5FOSA 3ZVRA 2QPAA 1KI1A 3U7FB 3C5CA 4PO1A 3V00A 1G8HA 2WWXA 5JBQA 3UATA 1XNJA 4KBGA 3SQWA 4Z51A 3TSZA 1ZNXA 1R0XA 3CR7A 2BCJQ 1S3SA 4FWIB 5AJZA 5KU1A 1Q1QA 3EAQA 2VA8A 3PUVA 1KSJA 4LBWA 3WRXC 1C4OA 1SKQA 1KJZA 2BBTA 2AWNA 3QEOA 4PAOA 3VQTA 4DBLC 3BOSA 4TYQA 1YRBA 3LVRE 3VNVA 1RRPA 2JEOA 1ZW6A 2F1HA 1EG7A 3ND9A 5DH9A 3HYRA 3UANA 3AVTA 1W4RA 4UXHA 3ZYCA 2J59A 2R8RA 3HJNA 4M21A 1P60A 5J5CA 3TAHA 3QF4B 5FUXA 3S1AB 1KHTA 1OLOA 1L4UA 3WNCA 4KBFA 3W9YA 1DOAA 2G3YA 1X86B 3Q9LA 3LW7A 5SZHB 1XCGB 2A7QA 5BN5A 3EIEA 4P3YA 3B85A 3U60B 1XZPA 2ODWA 4M22A 1SVWA 2NZJA 3RSOA 1IXSB 3A1WA 1E4VA 4GI7A 4Q4AB 2CBZA 4NE2A 2QGNA 3BD9A 3LH5A 2NMVA 1OE0A 1T5LA 1GSIA 1CF4A 1II8A 3RRNA 3I32A 3KZ1E 2GJ8A 3OHMA 3B1YA 2DHRA 1KSHA 4PPFA 1W4AA 2NPFA 3VR1A 4DLVA 2OEPA 2WVJA 4FIDA 2YKGA 1GNQA 1S9DA 3A1VA 1Z2AA 4HDOB 1SVOA 3IQXA 3HU3A 1J8YF 1CBUA 2A5GA 4NDZA 1OXXK 3LXXA 1ZC3A 2FFQA 2RGGA 5D3MB 1ETUA 1P73A 2J41A 3AKDA 4O3MA 1JR3A 3PFIA 5KSYA 3C14C 3LBNA 3P20A 2WWYA 1KAGA 3QVVA 1TQ6A 3BXZA 4H1UA 1W36B 2ZU6A 2A9KA 5DI9A 2NO6A 2QTHA 1C9KA 1R7RA 3CRW1 3I8XA 2A5YB 4BRWA 1JR3E 2TMKA 1N25A 2ATXA 3GFTA 4ACAA 2O0JA 5H8WA 2WICA 4HYYA 2BJVA 2WZQA 4GZLA 2DFTA 2IYVA 1ZCAA 2FSGA 2WOOA 2ZJOA 3LNCA 1MH1A 4OQNA 4LX0A 2HUPA 2VBCA 3MWKA 2WBLC 2W6IA 3L8YA 3GLFE 2EFGA 2V4ZA 1KI6B 4KI0A 1UBFA 1CJKC 1KMHB 2IUTA 1NF3A 2XJ9A 4GP6A 1OB5A 4EKDA 3QJYA 5C4MA 5J4HA 1TQ2A 4D0NA 3PCRB 4HZIA 4DUGD 1YR8A 2Q21A 5KDLA 3VTKA 4OI4A 3QNUA 4MRVA 3I5XA 1A4RA 2F43A 3BORA 2GCOB 4QNRA 1E9BA 5TARA 4A2WA 2ORIA 2DB3A 3RWOA 5FPHA 4XVUA 4C0AC 4TLEA 3L43A 3H86A 1VIAA 4IDHA 1BOFA 4JLKA 2D62A 1PJRA 1DAKA 1N6RA 1CULC 1UPTA 3LO5A 4QFMA 5JEEA 4E22A 3ZH9B 1OFIA 2HJGA 2CHVA 2NPIA 2JLWA 1XTQA 1W49A 2OSBA 4UKDA 1ZM7A 1FP6A 2KSQA 2IXFA 4CZ2A 1IBRA 4M53A 3RWMB 1AZTA 3REFA 1YKSA 5M04A 1M7BA 4TQUS 2QSZA 3B5JA 2QTVB 5H70A 1CS4C 2ORWA 3CPJB 2Z83A 1VCMA 1ZU4A 2V55B 4MYCA 2JJ2D 2C9OA 2ZSFA 1KI3A 2QEQA 2RGNA 1OFTA 3F8TA 2GXQA 2AD1A 2QM7A 2VP4A 3WYFA 4D4LA 1A82A 3OE7D 2ZR9A 4AY2A 1F48A 4QGAA 5CB6A 4GOJA 3KXLA 2R6FA 1SHZA 4HSEA 1HA3A 2DR3A 1EFHA 2B8WA 1E2NA 2IK8A 4HZUA 5FTKA 3F0TA 3RLFA 3FDIA 3CUEF 3CNNA 4B3FX 3B13B 3EIQA 4LUCA 2J1LA 3SZRA 4FWTA 2SHKA 2BC9A 4TMTA 4BFZA 4TL9A 5KUTA 3BK7A 1D9ZA 5E7IA 1N6KA 2IF2A 4L16A 2GA8A 4LJ4A 4JLVA 1N0WA 2OBNA 2ZS7A 3SHFA 3SNHA 4ACBA 3WRYC 1DO2A 1OKKD 2IUSA 2N46A 3V4FA 5IF9A 3NBZC 4FMDB 5FTNA 1FMJA 1T5IA 2YNMA 1L2TA 4Q47A 1Z6AA 4D0GA 2QNRA 1TMKA 2QAGA 1W44A 4QL3A 1DAIA 2XITA 1GVNB 5EE1A 1XXHB 3QBTA 4Q66C 2ZXUA 4GT1A 5F9FA 3HR8A 3KKPA 1ZIPA 4G5SA 4GDFA 4C0HA 2OFWA 2VP6A 1ZD9A 1CIPA 4C7OB 4TMVA 2O8FA 4WAUA 4YQFA 1UKYA 4JLDA 4NP6A 3SDZA 2O8EA 4BEBA 1D9XA 4QOSA 3NC0C 1Y63A 5C2JB 3OE7A 4IFBA 4LHVA 1EGAA 4MGIR 4RSGA 3GLIB 2NO0A 2YINC 3GJ6A 2WAYA 3FMOB 1IXZA 1NIJA 2IHYA 2RHMA 3U3RA 2WWIA 3LA6A 4DLYA 4OI0A 4CEJA 5JSZB 3G0HA 4NCNA 2GZAA 1BS1A 2G83A 4B47A 3NBYC 2ZR7A 5TY0A 1YHNA 1EFTA 3RDPA 2QMOA 4WXPA 1SVSA 2A5JA 1DE0A 2AFIE 2C96A 1PLJA 4EAQA 3MD0A 3NTUA 3TGPA 3R7WB 1VDZA 4NYMQ 5GJCA 5AR1A 2ZROA 3KJGA 3QUSA 4A15A 4R7ZA 4B35A 4OI2A 1I2MA 3DM9B 1E2JA 4LOAA 2YZ2A 3MFYA 2W2TA 3BFVA 3DPUA 2JA1A 2A3RA 1K6MA 5KSPA 4C4PA 4GPTA 3VKWA 5EP1A 5G3YA 1KZ7B 4PPNA 4DUGA 4LBYA 1P62B 1YZQA 2J0QA 1QDEA 1Z0JA 2GBLA 1U9IA 2OV2A 2ZRNA 3QXJA 1G1MA 5AJYA 4BQSA 2X19A 1P2SA 3BC1A 2W6ID 5AUPB 1MT0A 3N5CA 4Q4LA 4YC7A 3AKYA 4L4UA 1GRNA 4AKGA 2X1VA 3K0FA 1NBME 1YR6A 4ON9A 1W5TA 4OL0A 1XXHE 1DAEA 3QPWA 4LC0A 1US8A 4NYMR 4Q1DA 4QRHA 4RCZA 4QJ3A 1Q1ZA 3VNUA 4RKEA 4OKSA 4V0LA 4DSTA 4J0QA 3D7MA 3RRMA 3HU1A 1TUEA 4Q4HA 1FTNA 3CF0A 4EJSA 1Z0AA 2IEYA 2IT1A 3AB3A 1MOZA 3KQKA 5IHPA 4E03A 1XU4A 4BZQA 3O8DA 1JR3D 1F2TB 2HLDA 4JVLA 3THYA 4TYYA 3LBIA 2LCFA 3CH5A 2NZ8A 4IFEA 4Q9KA 4DB2A 2FFHA 3PUWA 3VU9B 2UKDA 5HE8A 4II7A 1XTKA 3P26A 3GJ3A 4BFXA 1R10A 4I4LA 1BMFD 1GRRA 4OQXA 4KLNA 2PJRA 1SXJB 5JHHB 3N2EA 1NLYA 1XFAA 4P0TA 2CCGA 2O8DB 1MRNA 2EU8A 4LSGA 3EA5A 1J99A 4XIGS 4HUQB 2R62A 3DHWC 5FPSA 1E0KA 3IBYA 1P75A 2MSEB 4Q7MB 4C30A 5BW8A 3AF1A 2CL7X 4C0JA 1TADA 5EUQB 4EPWA 3IIKA 3WBJA 4TQAA 3KJEA 1YVDA 3L2OB 2RMKA 4L5BA 5TV2A 3K09A 1OIVA 2AD5A 3SC3A 3OZXA 1S0UA 2C04A 3LLUA 2FOLA 2XOKD 1Z3IX 3WYAA 4RD4A 4X8MA 4JJKA 4L8GA 4R2IA 4W5JA 4DVGA 1E94E 4OQMA 1UDWA 3ND8A 4JBWA 3TSWA 3AVOA 5HTKA 5CM8B 4QM7A 1LV7A 2J0UA 2VP9A 1KOFA 4HB4A 1DVRA 1VCIA 1P2TA 2ZRLA 4RZ2A 4CIDA 2Y8EA 1Z2CA 4MRPA 3RHFA 1DBSA 4JBYA 4Q1AA 3ZZTA 1W4CA 4IVQA 5L3QA 3EIHA 3W3AA 2C78A 3SOPA 1D2MA 4M8NE 4A4DA 1NL3A 1E69A 2O5VA 3U44B 1KMHA 4DIDA 3IBGA 5DIFA 1QF9A 4UJ5A 1HT2E 4EPTA 1ESMA 1KO5A 1SHKA 2XNDD 1LFDB 1M74A 1TU4A 3MAAC 1KTVA 221PA 3EZFA 4KAXA 4BRUA 1GIAA 5E7MA 2WV9A 4MKHA 3RAPR 4LV6A 4XH9B 4LHYA 3O47A 4DC9A 2ZIAA 1CJTC 1AM4D 1US8B 1KY2A 2YOHA 4UXIA 4B3GA 2EFEB 3BBPA 2VTKA 2E1RA 2QMHA 1NN3A 4CEIB 1KDOA 5CLLA 1F3OA 4TZ0A 4A6XA 3RANA 2WJGA 3B2EA 1T6NA 2V7QA 3ZVNA 2VF7A 1ZVQA 4V0MA 3D3QA 5J4LA 2O8FB 5FL7D 2WSSD 2AFHE 2ZETA 2O8EB 4HDCA 1XTIA 1OHHA 2IW3A 4M9XA 2J7PA 1D5CA 1XRJA 2VSFA 4QHTA 2CHQA 2LKDA 3A1UA 3PR1A 4F91B 2QBYA 1CJUC 5DGXA 4M9ZA 1A2KC 4DCUA 1G4UR 3QENA 2RGBA 3QY0A 1UKEA 3AGPA 1U2RA 2QSYA 3AH8A 1N6LA 4Q1BA 5E4FA 2JLYA 4A8JC 3QXXA 4DLXA 3U61B 1IOZA 1GZSA 5E7JA 2ZRIA 1NMYA 2GAAA 4MGKR 5JWHA 2H8KA 3KDSE 4R98A 3CX7A 2Z0MA 2FX3A 4Q9JA 4MRSA 2QE7D 2G1JA 4H1VA 3EXAA 5HCIA 2IWHA 1OH7A 1E2QA 2DFKB 4KFTA 1TF5A 4ZIRA 3R7WA 3U6BA 1X1SA 1N6PA 4H9GA 3KQUA 4NYIQ 4HLDA 3FE2A 2YWFA 4ESVA 1SVKA 2ZE7A 1QHYA 5B30A 3PG5A 3GJ0A 4DLWA 721PA 4F4CA 3AQ4A 5GJVC 4M2LA 4S2EA 4TMKA 1G7TA 5EZ5A 3WXMA 1NJFA 4W5WA 3KFVA 2VP0A 4YLGA 3ZD6A 3QEJA 4TYNA 2LKCA 5E95A 4NH0A 1OT3A 2OFXA 3EWSA 2B7BA 3IQWA 4MKIA 4HB0A 4LJYA 5FBLB 4DLZA 4TN1A 1Z63A 4NMMA 4QHYA 3IUYA 4HLCA 4QHSA 3OIVA 4DT1A 1NIPA 1J2JA 3OIWA 1XD9A 4E09A 4WIAA 4K46A 1R8QA 2X8AA 5DLQC 4OK6A 5FH9A 5EQTA 2ZJBA 2OLKA 4ZKEA 5JHGB 4AG6A 3LD9A 2OG2A 3C15C 1RC8A 4FMCF 3CZPA 4B34A 4CEHA 3AV0B 1R5NA 4I1SA 1YZUA 4IOKA 1G20E 4IDPA 1NSTA 5KDDA 2ZRJA 2ZJ8A 1ZD8A 1JJVA 4DCNA 5K8LA 1NLZA 3GFPA 4DCVA 2PZGA 4G5OA 4C0SA 4E5UA 1JQLB 2C8VA 5IK2A 2P65A 4PHGA 2GEDA 3B60A 1XZQA 3C16C 3HPQA 4JL5A 4NONA 3UK6A 5EZ6B 4ZI3A 4OBEA 1VYVA 4GRAA 1R5OA 3GLFA 5F98A 3KJHA 2WM9B 2JLZA 2RB4A 1G7SA 1GKIA 2YOFA 3I73A 4LHWA 4BLSA 4CF7A 1COWA 2ZRBA 1T0HB 4ABYA 3EPLA 1G3QA 3GJ7A 1CR1A 3QXSA 2CLSA 2GVDC 1AQUA 2Z4RA 3KXIA 1JAIA 3R9IA 1BYUA 1MO3A 4Y0AA 3VU9A 2QI9C 4DLUA 4HUQA 3I3SR 3TLXA 2JATA 4S35A 1JI0A 2ANCA 1UF9A 1NKSA 4TMZA 1SQ5A 2AX4A 3TBKA 3RS5A 2B92A 3LY5A 3VAAA 3TW8B 1U8ZA 3ASZA 2JIZD 3WHLA 3NWJA 4ASUD 3K70D 3KJIA 2G77B 2H16A 3UWOA 1OXVA 1S96A 1RE0A 3QXHA 4GBMA 4OYHA 3TVDA 3K1JA 4CT5A 3X1ZA 2EQBA 3VR2A 4C2TA 3MCAA 4R71A 5KPJA 4OHXA 1TPZA 1GL9B 2DFLA 1NN0A 5C18A 1CJMA 1H8EA 1AS0A 1X8LA 4HZUB 3AVWA 1KDRA 4A0HA 4AG5A 4OQFA 4D80A 2JDID 3QBVA 1OIXA 4RZ3A 5J40A 5SZJA 3ZIAA 3SQXA 3W90A 2EWVA 3MUFA 4RZUA 4NBSA 4OJKA 1G16A 2AK3A 4PAMA 5J4KA 3RS2A 2W6JA 4UNPA 3IHLA 3HR7A 4ASUA 4DEXA 1ZUIA 2JIZA 4JLPA 2FEOA 3C5HA 4B3CA 4URUR 1IN7A 4A0RA 4M1MA 1XWIA 1UBEA 1WA5A 4KO8A 2HJVA 4JMPA 4P4TA 3VR4A 3BB4A 2HXYA 2VQSA 2AWOA 2BVNA 2OBMA 4PHHA 2J7KA 4N3NA 3ADBA 5JMTA 3TW4A 1RRGA 1AN0A 2QAGB 3RRZA 5KSZA 1NMXA 1LF5A 5EJEA 1E9AA 3RABA 1NI3A 1TAGA 3IPYA 2CCKA 2FPMA 4XOIA 1YZTA 1ZM4A 1Z5ZA 4CEIA 2CMKA 4G1UC 2PX3A 1IXRC 1QHXA 1WRBA 2QU8A 1M6NA 3GLHB 3NH6A 1HUQA 2KJQA 3TVTA 3TSOA 4B32A 1KK2A 5AUNB 2OILA 4O25A 2D3WA 2KBFA 3K0EA 4RD1A 1I4DD 1UAAA 1P9WA 3LQRA 2BKUA 4KODA 4EPRA 5FOUA 2CL0X 1HT1E 4YMSA 3BJIC 2YWGA 4IRUB 3T15A 1E9EA 3U3JA 3IEUA 3C41J 1NBMD 4Y0VA 3G5UA 1LNZA 3IIJA 3TMKA 3FHOA 3R9WA 4MITA 3LDAA 5SZIA 1Q3HA 2VLIA 3RS4A 3R9XA 3VHXA 4C3ZA 4AD8A 2GF0A 1S8FA 4NCKA 1T4GA 1P7CA 3KKMA 1FW6A 1M7GA 5C4GB 1FTSA 4PC6A 3DEFA 4KSBA 1M2OB 4KU4A 5JI2E 3BGWA 4C2UA 4ZIRB 4LGMA 4LPSA 5CDFE 4TL8A 2LWIA 1VG0B 4LI0A 4DB4A 3CPEA 3NG1A 3QSYA 4V0OA 1E2LA 2GETA 3IGFA 4MKGA 4PQFA 4YDHB 1Q12A 1ELOA 1Z07A 2QRNA 1AGRA 1AGPA 5TVKA 4PSVA 4AK9A 1XDBA 4OHWA 3KQLA 4B2PA 1E2EA 3KKNA 3T1VA 4PC2A 2CXXA 2WOJA 3B1VA 4JLOA 4UXJA 1KI9A 2OM2A 4QBIA 4D2IA 1XD2B 4PR0A 5AJWA 1G21E 1XTJA 2GKSA 3WNBA 3KQHA 1PLKA 4AKHA 3GCGA 1GM5A 2FEMA 1U98A 1W47A 2BWJA 4K8OA 3VKGA 4DHEA 2QE7A 1N5JA 5AJVB 4TZ6A 3FMIA 1R8SA 4KJZA 3FFBA 4LJ9A 3KQNA 2VEDA 3MGCA 2XZLA 2V1UA 1FUKA 2O8DA 4LYFA 1T8TA 3LVQE 1W36D 3QI2A 4KXFB 3B8HA 4I81A 2F9LA 2YJTD 1HV8A 2Z4SA 4KFRA 2HV8A 1M8PA 5CYPA 1A2BA 4KV9A 4A8JA 2QN6A 3OIUA 3KL4A 5FL7A 4A1FA 4ZCIA 3O8CA 1KGDA 1NSFA 4P4SB 3TIFA 1OV4A 1XF9A 2ZJYA 4CYMA 3KKOA 3LX5A 4NCHA 4I1OA 1W0KD 1SXJC 1OYYA 3ZLJA 1YU9A 4DDTA 4QJ4A 5DYGA 4CW7A 1CRQA 3RC8A 2ZRFA 2ZJ5A 4D6PA 3BAFA 3A36A 2RKOA 5DYIA 3ZVMA 3EPKA 2FJUA 5SZKB 1ANKA 5KHOC 1HE1C 4JS0A 2D2EA 1SXJD 1KI8A 4UQOA 4IXMA 2FA9A 4US0R 1Z6GA 1U94A 1GRQA 4NZYA 2OXCA 2PZFA 3L82B 2RGCA 1BYIA 4EUNA 2UZ3A 5FUYA 2FSIA 2XTMA 5CM9C 4ZDWA 2CK3D 1X8KA 2DYKA 4JYBA 1HQCA 1SVLA 2JJ1A 1W0JD 2IS4A 5B64A 1UADA 2AKAB 2WTUA 4I1UA 1FX0A 4CDGA 1JXMA 4TYWA 2ZEJA 2I1QA 4KCGA 2XTNA 4Q03A 2P6UA 1IAQA 3SHWA 2ANBA 4HLUA 4LRWA 3X1YA 4C0KA 2ZI3A 3VMFA 3GJ8A 2ZU0C 2ZI6A 4IJMA 4RFSB 3C8UA 1G41A 2XB2A 3ZD7A 2F43B 2ZYVX 3EW9A 5L3QB 3EASA 2XOKA 2WJJA 1KO7A 1W1WA 2H92A 4MRRA 3ZZUA 3HYTA 2IXEA 3L0IB 2J0VA 2ZITA 4WA7A 3ZJYA 5F9HA 1G8PA 4TWZA 2GF9A 2RH5A 3PUYA 3ZS9A 4DDVA 5KO2A 2QP9X 4D4JA 4L9SA 5HR5A 3U7HB 4P33A 4US2R 2ZRHA 1J8MF 8OHMA 1OW3B 1Z47A 1CR2A 2P5TB 2D2FA 5K8TA 3DM5A 1CR0A 1ONBA 3GFOA 1CEEA 4ITRC 2EW1A 2OUKA 4PC7A 1U90A 1VMAA 3LAWA 4ZO4A 1S3GA 5EP2A 1IN5A 3TAUA 1LS1A 1BMFA 2CLCX 5FTJA 3X2SA 2YOGA 1WCV1 3CRMA 1XMSA 3QKTA 5BN4A 5FPYA 4RJLA 3QKRB 1RVDA 3BB1A 3PEVA 4LBVA 1IHUA 3A4NA 5A4JA 3R20A 3GEEA 2HLDD 2J9RA 3Q72A 3IKJA 1UEIA 4TLCA 4YDSA 4YMVA 2G6BA 2R6AA 1E32A 3ONWA 4TLBA 5KYKA 3NVAA 4FD2A 2WKRA 2QP3A 4Z8XA 5JECA 4UNRA 2F7SA 3OEED 3B7GA 1NP6A 2QMUA 1F60A 3FKQA 3TQFA 1KAOA 1MO6A 1RYFA 1LW7A 4HB2A 521PA 2ZANA 2AN9A 3TQCA 3BS4A 1T9HA 2R44A 4FMCB 4TL6A 1A1VA 3ICEA 3CNOA 1AIPA 2QORA 2W2VA 3AF4A 1CTQA 1GKYA 2GXSA 2D7CA 4XTCS 2WIBA 1AQYA 1I2DA 1XD2A 3QPVA 4GMXA 4OK5A 2EFHB 3IILA 2KI5A 4XVRA 3TNFA 4MH0R 5DISB 4BFWA 4DSOA 2XZPA 4LDJA 1X3SA 1ZAKA 5TMPA 2P3SA 3AP1A 1Z8FA 2GBLC 3IPXA 1JEDA 4GZMA 2W00A 4KITB 2W2XA 2ZQ5A 4URXR 1PLLA 1QHIA 2CE7A 2XX3A 3AVPA 1VCNA 1XMIA 4UJ3A 3MMPA 3MRSA 2QY9A 1F6BA 2Q3FA 1PVOA 4Q9IA 1U81A 4ESHA 2H5EA 1N5LA 4JBXA 2QT1A 1LS6A 3VKHA 1QHNA 1D6JA 2VSOA 4RZXA 1FMLA 1JXOA 1KJYA 3UIEA 4QM6A 2QL6A 2FZ4A 4B44A 4DCSA 3ZGXA 3L0PA 1GFIA 1ZNZA 4B75A 1XJ0A 2CVHA 3B9QA 4Q4AA 1GITA 5EXXA 4NKRA 3H2YA 4RY2A 3OESA 3RC3A 4C0BA 2CCJA 1VPLA 3K9NA 4GMDA 2F55A 5EE0A 4KLZA 4POAA 1VYTA 2OAQ1 2CE2X 2ODEA 4PANA 2IYTA 3ECCA 3H0KA 2H1LA 3K53A 5IDVA 1KSFX 2GJSA 2C2HA 1K8RA 2IHBA 4A8JB 2HYDA 5C46F 4M1OA 1CLUA 3QG5A 3AVUA 4JVMA 3VFDA 1N0UA 4GOXA 1XX6A 5JJIA 4FINA 3A1SA 4MYTA 1JQJC 2BJWA 3FKSA 2GK7A 4WZ6A 3A1TA 4NCIA 4Q19A 1M7HA 3T1OA 5KDOA 3EZ7A 5BYJA 2IA5A 2FNAA 5DHAA 3FMPB 5JRJA 1XPRA 3UMSA 1GNRA 2F3RA 3EZ2A 2FZLA 4EPXA 4PXAA 5ELXA 2FMXA 5KOYA 4QC2A 5HPYB 1U8AA 2ZI9A 2NIPA 2EWWA 2IXGA 3B6EA 2HXSA 3LXRA 5FBQB 4BFVA 1TNDA 5LBIA 1OKKA 4WBSA 4G3XA 1P2UA 4DLRA 4GL2A 1G3RA 4PQYA 4PO8A 3NHAA 4D82A 2A5FA 2GCNA 3FOZA 1Q44A 2OT3B 1GUAA 2FG5A 2ZJ2A 1ZP6A 3HU2A 2O0KA 2FE4A 4WVFA 2QA5A 3SN6A 3U5ZB 1HTWA 4PZLA 4TQ9A 5HCNA 3P32A 1ESNA 5EP4A 2WMNB 3AF0A 1JECA 1E2GA 5DHFA 3WNDA 4AC9A 2G1KA 1OB2A 3I1FA 3CH4B 4PC3A 4UNSA 1AKYA 3AEZA 4AWXA 4BFTA 3Q85A 4JVNA 3QKSB 3LQQA 2QT0A 4NHOA 3KB1A 2D7DA 2O52A 2ZRAA 2JJ2A 4M1YA 1TX4B 2QTFA 3L8ZA 5FBRB 1NVUQ 3BRWD 2F1RA 1D8TA 3K0CC 1E1QA 3AVQA 2N1BA 4RD0A 5FFMA 1D2NA 3GLHE 2YC2C 1OH5A 4A0GA 3O8RA 4XSGA 4X8HA 3UG6A 1AS3A 3ZQ6A 3JVUA 1NVWQ 1YR7A 1YZGA 2GAOA 2XGJA 1ZM2A 2PJZA 2WMOB 3M4YA 3P27A 1Q1EA 4MUAA 4O0MA 3F5FA 4F4JA 2VHTA 3TH5A 2WAXA 4RFVA 4Q4HB 4XWKA 2JASA 3DKPA 3SBDA 5JWOA 2HDNB 5L3SA 2IYUA 2IYWA 2YC4C 4FCWA 1XCPA 2JLSA 3PUXA 1U8YA 4FMDF 3HWSA 4A6PA 2RGXA 1UFQA 1XEXA 2F1IA 4Q7LA 2RAPA 4D81A 2YWEA 2J0SA 4PHTA 4BE7B 3E70C 3LW8A 4PPGA 3RRYA 4DWJA 1IN8A 4LC1A 3A4LA 1DEKA 5JFGA 5J47A 1TQ4A 1KY3A 2FSFA 3PENA 4MKFA 4IOMA 2FU5C 4GSYA 4KSCA 5CK5A 4IOJA 1PUJA 5BN3A 2XAUA 4BPBA 3A37A 1YRAA 1EWQA 3CONA 4YMTA 4IXNA 1G6HA 2NGRA 2WPDA 3ASYA 4OK3A 4HAWA 4B48A 4DEYA 3SYKA 3IO5A 1J70A 3ADDA 1YR9A 1OH6A 3I8SA 2QQEA 4QGHA 5DN6A 4ZCLA 5LB2A 2DFNA 4HDQB 2JLQA 4ZPXA 1SGWA 4EFMA 2QPOA 5FR1A 5G3ZA 2BMDA 1KI2A 2BBOA 3N2IA 2J5XA 4LHXA 4ILEA 1LB1B 2ZYWX 3QG1A 4DDWA 4RVCA 4YXWA 1NLFA 1E4YA 5K8IA 3U4QB 5TB5A 4Q00A 2GESA 2NQ2C 4JLNA 4TL7A 5E3HA 4X8LA 3F3YA 2VH5R 4YMWA 3I5YA 2DPXA 4CGZA 2FN4A 1UBCA 3E5HA 4JLAA 2HCBA 4Q1EA 3DMDA 4HAUA 3SEAA 3W5JA 2AXPA 5GADl 2NOAA 1U0LA 1EX6A 1ZD1A 2IYYA 2G0NA 3HDTA 4ZDJA 3T1QA 4JSTA 2B21A 2HCJB 2J45A 3CRRA 3K70B 1Z6YA 5H1YA 5B58C 3CRQA 3KKQA 4HAXA 1E96A 1KDPA 2MMCA 1YQTA 2BBSA 4M1WA 3REGA 4W5HA 1E0JA 5CITA 2ATVA 1W4BA 3PEYA 1E9RA 1OXSC 1AS2A 1ZM3A 1XEFA 4HI0E 3WMFA 5F3WB 1KK0A 1NVVR 2G9NA 1T3HA 3B78A 3FB4A 3DVLA 5TXGA 1KSGA 2ZRDA 4HAZA 4Q02A 4BLQA 1NKTA 4P4SA 4G5QA 2IWRA 3WBKA 121PA 4V0NA 1EWRA 3PJRA 5C1BA 2ORVA 2VF8A 4TLAA 5A5GA 5IT5A 4OHVA 4F7WA 1TL7C 2AR7A 1NN5A 1P61B 2OZEA 3THXB 3ZVLA 3CX6A 3DOEA 3EC1A 2Q9AA 4Q01A 1YZKA 3K0CA 2W0SA 2Q6TA 2F1JA 4IW3B 4JL8A 5JRZA 4NYJQ 2A78A 3KTAA 5A0FA 2V8OA 1G5RA 1OIWA 1GILA 1F5NA 3D6TB 2I3BA 5AUOB 1E9SA 5FOXA 3CWQA 4OQLA 5KSOA 3LFUA 1L4YA 3O8BA 4BGDA 3U3OA 3Q7PA 1FOEB 2KB0A 4KHZA 1JNYA 4M9SA 3QOFA 3FGNA 1RYHA 3BERA 1G4AE 1E2KA 2AXNA 4QBHA 2IUUA 3B1WA 3W6NA 1KKMA 5FBWB 2EYUA 1W46A 2OFOA 1G64A 3QE0A 2P67A 4RCYA 4LZZA 3U3MA 4EJSB 1ZM9A 1E2DA 2CVFA 1VTKA 1KK3A 1O87A 1V5WA 2ZI5A 5EE3A 2OBLA 1F2TA 1YJ5A 2QP4A 2QG6A 2YVUA 4URWR 2IS6A 2HF9A 3ZS8A 2BEKA 1L8QA 2Z43A 3QF7A 4TYPA 3PXGA 2IL1A 3PQCA 3GLGE 4GOKA 1XB2A 2QROA 1MR3F 3X1XA 1XP8A 4C7OA 1HQYE 3PV0A 4GNKA 3RSLA 4BLTA 2D74A 5P21A 2XNSA 1B23P 4JVSB 4CEHB 1QHHA 4D26A 2WIAA 5KNBA 1BIFA 3KX2A 4PZYA 3A4MA 2OLJA 1HEIA 5CB8A 3LX8A 3AVYA 2PBRA 1OPXA 3QKRA 5B57C 3L0SA 3GJ4A 5JI3E 4R9UC 1W48A 1QG4A 2CJWB 4TT3D 4Z1MA 4FCTA 3IDQA 1WBDA 1Z08A 5CYOA 2DWOA 2RCNA 3H4MA 1W2HA 4QBFA 4Q9LA 5DNYB 2VL7A 3VX4A 3Q3JB 4HUTA 1IY0A 1JJ7A 2ASEA 2WJVA 3FWYA 3CPHA 4PFSA 3AVXA 1FNMA 3T35A 4A2QA 2FFAA 4LHZA 3OFNA 2WHXA 3I61A 1FQJA 2VIIA 4BZPA 5JCZA 1CJVC 2RGAA 1NNEA 2BV3A 3FYHA 1UKZA 2C98A 4PAQA 3CZQA 3K9HA 1P2VA 1Q0UA 4AURA 2HT6A 5UKDA 3CNLA 1G6OA 2MMGA 1K5GA 5HKKA 1RIFA 1FNNA 1RZ3A 1CRPA 5HZKA 3TR0A 4ZV4A 4URZR 3NH9A 3Q5EA 1Q57A 4EQ6A 1FL9A 4UNNA 1W7AA 3C7KA 1T91A 1RRFA 1ZCBA 3CM0A 2C95A 1WQ1R 1DO0A 1S1CA 3AF3A 1ZINA 3KXKA 4BUJA 4KVAA 5LB4A 2BMJA 4BFYA 1IN6A 2VHUA 1ZBDA 4M1SA 1A5TA 4AKIA 2ZUCA 2Z5FA 4V0ME 2QRZA 4MUBA 2V54A 3V9PA 1IQPA 4YXWD 1F2UA 4PZZA 2XTZA 1TUIA 3GQBA 4B2LA 2C5LA 3FMFA 5FPTA 5LD2C 2OO7A 3NEJA 1G8GA 1KKLA 5EUMA 1G18A 4DIEA 3U7GA 3B1ZA 4B73A 3SS8A 4LJAA 2ZE6A 5DO9A 2ZRCA 1MABA 2FPKA 3BH0A 2C99A 3NHBA 4HAYA 4EFNA 1NG9A 3T06B 3IEVA 4MYHA 1N6IA 5DN6D 1H8HA 1W36C 1D2EA 2Q3MA 3AKCA 3SJZA 1HE8B 1K5DA 2QBYB 3MWJA 4OJQA 1N6HA 2CNWA 2GCOA 3AUXA 3Q8XB 2WPDD 1WF3A 5FOWA 2EFDB 1Y3AA 1ZUHA 2XJ4A 5JS8A 2VPPA 3K0SA 4W7SA 3FHCB 3U2QA 1IY2A 1EXMA 5AK0A 2P5SA 1S9HA 3CIOA 2WSMA 1OXTA 1EFCA 1W2GA 2BCGY 2P0EA 1UM8A 4FW9A 4QNMA 5BQ5A 4I99A 3LRPA 2VP5A 2GEUA 2AL7A 3EZ6A 5JSZA 2FDCA 2ECKA 1JBKA 1OF1A 1E1RD 1Z6XA 3AF2A 4KYIB 1SKYE 1GTVA 4LV8B 4Q7KA 4V0KA 1RJ9B 2GJKA 3NIBA 5FL3A 1GWNA 1WMSA 5B2ZA 4BECA 1RRCA 3THXA 4KFSA 1L7VC 3CF2A 4B6FA 1EFRD 1CKEA 4OI1A 2ZAOA 3UWKA 3I72A 1SVMA 4KFUA 3K70C 3U4QA 4G01B 3H84A 4G0NA 4Q1FA 1P5ZB 4UNQA 1Q20A 2ODBA 3LV8A 1MRSA 3AVVA 4MDFA 1GP2A 3SI7A 3UG7A 1NY5A 4JJZA 1XPOA 2E87A 2D06A 2XSZD 3A8TA 1PZNA 4M4SA 4U5XA 3EZ9A 2GEVA 4MYUA 2Q0HA 2ZSDA 2IYZA 1DARA 1R0ZA 2BOVA 3BB3A 1FUUA 3BWDD 4XD7D 4GP7A 3GJ5A 2GXAA 2CDNA 3WYGA 4O2LA 4A0FA 2JAQA 1XPUA 3P4XA 1E1QD 2PEZA 1N6OA 4DJTA 3FPAA 5GJBA 3QQ5A 1Z06A 1MO5A 3H1TA 5G40A 4Q5IA 1E6CA 2QGZA 1M34E 3SFVA 1CR4A 3MWLA 1G9XA 3QVUA 5IRCD 4DRZA 3VX3A 3MJHA 3WMEA 2YWHA 3CB4A 4MGZR 3PEWA 1N2CE 2PX0A 3T5GA 2VYFA 2Z6VA 4B71A 1WB9A 3NDPA 2GHIA 1XMVA 4LV5B 1AK2A 4HLUC 5AWFC 4BFUA 1GL7A 2ZSBA 4M0LA 5AJXA 4FI3C 3VR6A 5CJPA 1KI6A 2OCAA 3OEHA 2OESA 2UVQA 2P6RA 3MJRA 5G53C 1HY3A 3FTQA 5EP3A 3EX7C 621PA 2JCSA 3SJCA 2QMEA 4P31A 2BM0A 4IHQA 1HH4A 4BASA 3MSXA 1Z29A 3NXSA 4CRWB 1G17A 2ZYTX 4AYXA 3W5IA 3U3KA 1OFHA 1G7CA 3SU8A 4N0DA 3AUYA 4NL4H 5FUWA 2CJWA 2NO9A 4LJ6A 2BBWA 2ZSEA 2GNOA 3U7EB 1DADA 3GD7A 1CU1A 3NBXX 5EE5B 1ZJ6A 3PEUA 3B82A 3Q7QA 3IHWA 1IJFA 1ZU5A 2IS1A 2R2AA 5JJKA 4ARZB 3SFZA 2FV8A 4IDOA 2V6JA 3T5DA 2NTYC 1UJ2A 2XEXA 1KO1A 3AP3A 3CW2A 5L8VA 1G5TA 2BDTA 4P32A 5CIWA 1MV5A 3FKSD 1G8YA 3OIYA 3R8CA 2ZVQX 4F4IA 1EX7A 3LWNA 4PPQA 2IBMA 3EG5A 5FOVA 4ZDIA 2PMKA 4NCJA 1XMJA 4X8OA 2P6NA 2FF7A 5FBVB 1GDDA 1XEXB 4JSYA 5HZHA 2NG1A 1ZC4A 2FWRA 1G3UA 4IEEA 1O3YA 4JT2A 4TLDA 1R2QA 1N5KA 2A30A 4LCBA 3WHKA 2GK6A 4MA4A 3W6PA 2IYLD 3CKLA 3GJXC 5JWRA 1Z0FA 2V1XA 4W9MC 3NDBB 4MRNA 1N5IA 1Z0KA 1FP7A 1KO8A 1TF7A 3BH6A 1OJLA 3CBQA 3D8BA 4FN5A 2W58A 2ZRPA 4F92B 2ZTSA 3SBEA 1SVIA 4DT1B 4MGYR 1DTSA 4XWOA 4LK2A 1Q1BA 4A9AA 1JAHA 2BKEA 1AZSC 2PEYA 4URVR 3U44A 1T8UA 2C03A 5BWMA 3B1XA 3GMTA 2ZUBA 2IX3A 1GG2A 2XXAA 4RFSA 1FZQA 2JLRA 3CF6R 2KWIA 3OAAA 4DLTA 1JPJA 2J87A 5LD2B 1SXJE 2ZJAA 2IYXA 1Z22A 1G291 2B7CA 3TE6A 4EFLA 2ZR0A 2BIFA 1KK1A 1QG2A 2FGKA 1VIYA 1XBTA 2J0UB 1QBKC 1MABB 1GKUB 5DI3B 1AJEA 821PA 5L3RA 5TDHA 3DO6A 1U9IC 4M9QA 4LJ8A 4QBGB 1IY1A 2PT5A 1EFUA 4IEIA 1M1YE 1G3IA 5CIQA 1R0YA 2Q9BA 2QENA 2VSXA 2DWPA 3W3ZB 2RGEA 4QGFA 2FSHA 1N3BA 1VHLA 4LY6A 4PQRA 3UMFA 2BMFA 4NYJR 5LPNA 1E79A 3HPRA 4F38A 1II8B 2ZI7A 4XWAA 1G3MA 1VHTA 1S1MA 3OEEA 2OCBA 3KB2A 2CL6X 5EE9A 3UMRA 4EDHA 1XTRA 2X2FA 4B2IA 4DDUA 1NVXQ 2BEJA 3UXMA 3EPHA 1T3SA 2QAGC 5CDFA 1NJGA 2V6IA 3BIFA 3TUIC 2ZPTX 3GLGB 1LF0A 3AGQA 2Q9CA 3NEYA 4RD3A 4RKFA 3I4LA 4TSFD 1RW4A 4KVGA 4O2RA 2ZREA 2EYQA 1IJEA 2X77A 4FMBB 4DKXA 2XZOA 2REBA 3DDCA 4CT4B 2OE2A 3QKUA 2ZRMA 1TEVA 1ZUNB 1KMQA 3THWA 2B8TA 2O0HA 4JKYA 3A58B 5JCPA 5JS7A 4IDNA 1WBBA 5JEDA 3EARA 4TMWA 5CJ2A 3E1SA 3IIMA 5GVSA 4LYJA 1E0SA 2DBYA 4L15A 2ERXA 3K0FB 1OYWA 3T61A 4AIIA 4BLPA 1OSNA 3PIRA 4Q9HA 1GOTA 3ZZ0A 2ZAMA 1VECA 2KBEA 1F2UB 1TU3A 4US1R 4TTPA 3D31A 1T0JB 3V4RA 1WXQA 2H7VA 3QPUA 4Q4JA 5FPKA 2RGNC 1P9RA 4U7DA 2VHJA 3CR8A 1X6VA 3DZ8A 4JT4A 5FOTA 4E07A 1E2PA 3SE0A 3BH7A 3K0AB 3JZAA 1OH8A 4OHYA 3X1DA 3PITA 1VCOA 1E2HA 1ZIOA 3BE4A 4BWYA 2MSCB 1QHHB 1JALA 4V03A 1KZGB 1W5SA 4TSFA 1CXZA 3DOFA 1DPFA 4K81B 1W0JA 2J3EA 2JJ1D 2PCJA 2XB4A 2VHQA 2ZJZA 3CLVA 4P4UA 5DI3A 1II0A 2GDJA 2CK3A 4EPYA 1DELA 3KUDA 3RYTC 4LYAA 4JLMA 5CLQA 4EIWA 1DG3A 4PHFA 4HB3A 4V02A 3P4YA 3K8YA 1KYIA 2OHFA 5J4VA 5HE9A 4PSAA 2BMEA 3EWAA 1E79D 2WWHA 4QG7A 3K9GA 1C1YA 2QUZA 4JYCA 2N42A 1SXJA 1NRJB 2V3CC 1V43A 2YV5A 2MSDB 1R6BX 2JLUA 3THOA 2WJIA 4B74A 2PT7A 2WWFA 2X2EA 1SKYB 1UDXA 1FX0B 1HYQA 1Q21A 1W0KA 3QF4A 3S1AA 2GJ9A 4DSNA 3M1IA 1G19A 1WE2A 2OXRA 1QRAA 5BYKA 1E2IA 2ERYA 3AKEA 1VG1A 1HURA 4FCVA 2O8BA 4ZDKA 1XJQA 2WJHA 3LLMA 2I1VB 4FXPA 4C0QC 1TTTA 5BXQC 4JLJA 4WOPA 2PL3A 1KNXA 4G5RA 5DE3A 2H17A 2G88A 3FFAA 4TMXA 3OAAD 2P2LA 2PZEA 2IC5A 3E2IA 4Q21A 4NTZA 3T1TA 2W0MA 1VYUA 5FUVA 4N0EA 4DSUA 1PV4A 5JLJA 4B3BA 1Z83A 3RS0A 421PA 1DAFA 4ZI2A 2F6RA 1NY6A 2UZIR 2VP2A 4BEJA 4ZCMA 1II9A 4C0LA 2DY1A 5GJWC 2ODNA 3CWZA 3IO3A 2GZDA 1CP2A 1KNQA 4L9WA 3W34A 4A2PA 5H68A 1EESA 1WDTA 4WZAE 1N0VC 1VG9B 1JEEA 1E9DA 1UBGA 2H18A 3TK1A 2CEAA 2ZI4A 4WW0A 2HF8A 5JZVA 1I4TD 1KI7A 1X1RA 3RS3A 1Z28A 2A2ZA 2GRJA 4QKQA 5KTYA 3RS7A 2V9PA 4DXAA 1RJ9A 3JVVA 3PVSA 2XXAB 4AKEA 4XSHA 6Q21A 3ETLA 2BM1A 2CHGA 3GLIA 2G0TA 4GFDA 1KO4A 1S2MA 4LBZA
chains in the Genus database with same CATH superfamily
3AFNA 1UBLS 1YB1A 1EPUA 5LA6B 1GJRA 1GKKA 1VKJA 1ZNYA 2W83A 3QKSA 4QFDA 5E0OA 5EQJB 5AUQA 4FDVA 1FPMA 2SICE 2ZBUA 3DD1A 2XIJA 3KAPA 1SHTX 1BHO1 3LUDA 1MO4A 4Y2SA 1TZKA 4JLBA 4JV5B 3PVZA 1NXPA 3FFWA 1SU4A 3N76A 3C6YA 3GLGA 2YQ4A 1MNQA 3FY4A 2EVWX 4YWJA 3LT5A 4CETA 4V38A 4DL9A 5LDDC 1U99A 1AKTA 4C4AA 4HDKA 4EUSA 5I8PA 2YDXA 5K8UA 1N2CB 2R65A 1H65A 3KC2A 1YHYA 1ULZA 4IOLA 1LSOA 4MV4A 2AE1A 3EVGA 2WWWA 2ZVPX 5JIBA 5CD1A 4UVHA 2W8ZA 1E6LA 1E2MA 2B7LA 4HQ6A 1V8BA 4J1SA 3L4JA 4XVQA 4X6YA 4YRFA 4NCXA 3O9VA 2UVPB 4Y67A 3SYLA 1RKQA 1HKHA 2G80A 3ZEAA 1G60A 5L3SB 1YCFA 2CHEA 2A9PA 4M1TA 3OEHD 4ND7A 4L0CA 3ZDQA 1RJWA 3VR3A 4QAJA 1LTQA 3WGZA 1YZLA 3WA7A 2JIMA 4Z2YA 3SEFA 1E18A 4IVRA 1RXSA 3EZYA 2Z2IA 4CHTA 3BJRA 2OGTA 1ENYA 1AKUA 1QLWA 3MWYW 3KQVA 4Q7JB 4RF3A 1J1IA 2C2GA 2R6CA 1CE8B 3QFRA 3T9FA 2J8ZA 4B33A 3X2FA 4HWSA 1ZN9A 1BA2A 1DG1G 1GY8A 1H2AS 5G0WA 2RHHA 1NN1A 3DFUA 3OU2A 3P0HA 2QUJA 5AW1A 1K8YB 3IL2A 3SPXA 2P0YA 4MVJI 4MW7A 5ANRB 1NVFA 1QYIA 3E3MA 4Y2JA 2OV3A 1EUQA 1V4BA 2VT6A 4I4NA 2TMYA 2OKCA 2QAJA 1FP1D 2W6JD 3LCCA 3NRCA 3I64A 4WXRA 3W1WA 4MQBA 4OGKA 2HMWA 2FGJA 3ESZA 5JCOA 3ZJTA 1SBQA 1K97A 2QZ4A 3ZIAD 4DDHA 5B3KA 4NWIA 1GFWA 2O6HA 2APJA 2JDIA 3IC5A 4LJ5A 3LGAA 5NLLA 1P9NA 1RHMA 1JZQA 2FUCA 1HG1A 2ZM5A 4F5ZA 3ANNA 4CMHA 4HEJA 1H8ED 4IVPA 1S4QA 5ILGA 3O9ZA 3HI6A 1C3LA 3AIMA 5AHRA 2ZSAA 3DLAA 4Q4JB 1AKEA 1O54A 3TKYA 1W85A 3CB2A 4HTFB 1R5JA 4TXLA 1ZRHA 4KDFA 5GAJA 2NO7A 3DWGA 4JB2A 1UP7A 1G5PA 3HZZA 4QARA 3S40A 3I62A 2Y4OA 4RTLA 1Y1TA 4LZNA 2NU6B 3T54A 4WOKA 2UYCA 1YJ8A 2BM8A 3OBBA 4P1ZA 3TEFA 1XFDA 3FHTA 5EXTA 3ICCA 4G5GA 2H0RA 3AF5A 4K9NA 4C4YA 4DLSA 1D6NA 1YF3A 3NM6B 3TLYA 1KIFA 2R4UA 3RR2A 4IIVA 3MS4A 3VMMA 1QVAA 3II6X 2EL9A 1XXHA 3Q0IA 4Y1FA 3A6PC 1GCGA 2RIRA 4Z9BA 4DABA 4DWOA 2DUNA 2RDMA 3L49A 3HM9A 4OB7A 1NVVQ 3X1WA 1QQTA 4YEDA 3TIGA 4HLQB 1VE6A 3CZAA 2EGHA 3KXPA 3L77A 4KQ1A 5CU7A 5GV7A 5C37A 3G59A 5K8CA 3ETJA 3HA5A 1PEDA 1S8AA 2P3OA 4ENSA 3RIYA 4RHCA 1CUYA 1DCFA 1VLZA 4K5QA 2HPAA 1GXSA 2IF0A 1NOIA 3TRIA 2EG9A 4UC0A 3QX7A 4EJSC 2E6UX 4WSOA 1NUSA 2Q5IA 1KBZA 1YB4A 4D5GA 3M1LA 1V9LA 4QUIA 2X4DA 4HJXA 3SC2A 2LVBA 2PXCA 2EZ8A 1EK0A 4RLFA 5KOIA 3IOMA 3CCCA 4MQEA 1IONA 1WLSA 1TF2A 3BFKA 1B7GO 5B6JA 4RSMA 3WYBA 3UMVA 2Z57A 4B3DA 3IXMA 3QU9A 4LZLA 1FC0A 5C4IA 2DFDA 2ZYSA 4E08A 4AMZA 1VL0A 2BEVA 4XOUA 1SUPA 1ENOA 1ONNA 1YKGA 1T5HX 2P4UA 1NG1A 4PF1A 1BFUA 3PHBE 1WG8A 3T12A 4B6EA 1E0AA 5DRYA 1ORTA 4INJA 2O7NA 1USVA 4OBWA 1SEVA 3E8XA 3RD5A 1DQSA 2NU7B 4PC1A 1ZH0A 3K9QO 2QN9A 4OGGA 2WTXA 2IYQA 1DQPA 4RA6A 3VVLA 3OZDA 4V1CA 2QV0A 4HAVA 3DOHA 3ZDFA 4IUBS 4AJJA 3AX6A 3ZWDA 4F9FA 4HZGA 3VYRB 5LQDA 4JBHA 5HKKD 1EFAA 3G82C 3P9XA 2VYVA 3D7RA 4W5RA 3ADKA 1B8VA 2GXUA 2PLFA 3DL0A 2GJAA 4LX8A 3HB7A 1NR5A 3A9SA 1XZ8A 5TPWA 3MG9A 3KYJB 1Q0ZA 3OFND 1FDUA 5KQLA 1JVNA 4BZXA 1MKYA 2YY7A 1Z35A 3PKZA 1IN4A 3R5SA 2E9SA 3KFXA 5A5VA 1J0EA 4TLMB 2NZVG 3H65A 3X1KA 2H3EA 2IS2A 1BH2A 2JGNA 4UULA 2RAUA 4M1KA 4MQLA 5LA6A 3O4VA 4OXRA 4EKEA 3NC1C 1ZJWA 1NMZA 1UOEA 2E21A 4M0MA 4TKUA 4PN7A 2X1LA 4I66A 3SYNA 1W1IA 1ZJYA 4S24A 5K5EA 4DNPA 4RVHA 1ZMXA 2A9OA 4IQ4A 1K6EA 2O2XA 1RLOA 2PS3A 3OG9A 2PH1A 3LF2A 4N3CA 4UE6A 1IUNA 1E7MA 4AZSA 4L5AA 3A9VA 1JG4A 2OO5C 1ZGBA 1ZYUA 8ADHA 1T6ZA 3RYIA 4BE9A 1OWLA 4CEJB 1KYQA 3MB8A 5BURA 1J5XA 5TGZA 1PL0A 3ENNA 5KNBD 4MUEA 3QU7A 4FS3A 3LQ1A 2H2DA 4BX2A 3AL3A 3EZLA 1U2DC 5C81A 4BP9A 1PWEA 5F1PA 1N2EA 3QEAZ 3EPJA 1ZR2A 2G1UA 4CVNA 2J7PD 1F4PA 1MH9A 2ONCA 2WSSA 5DBOA 2OPHA 1E60A 2FX5A 1Z0DA 2F9MA 2GKOA 1Z62A 4BBAA 1DS6A 3AL2A 2UZAA 5KYYA 3BWBA 4X20B 3VHLB 5TX7A 3VPHA 3M3HA 3QVGA 1FDOA 3HCFA 5I9NA 2GTPA 2UZ1B 1J7KA 4DWWA 1KQNA 4MV0A 2I4TA 1BVYF 3T7AA 3H7AA 2NYVA 3R0XA 3OVMA 5JTTA 3N0TA 3R6GA 4PNHA 2FW9A 4D25A 3WY9A 3L0DA 2B1QA 2QPAA 3QFTA 4PO1A 2QZSA 3PHCA 1R50A 2HBZA 2VZEA 2WWXA 5JUWA 3B5EA 1ABFA 3JS5A 3K6JA 1TZJA 3L1VA 3OO1A 4XQ9A 5I45A 2BCJQ 2PWBA 1PQUA 2VA8A 4JC0A 4RTOA 1KSJA 3E0XA 3S8YA 2WI8A 1DT5A 1C4OA 2X7HA 2QJOA 4JJAA 4ZANA 1TM3E 3PPXA 1UKAA 2BBTA 3R0ZA 2AWNA 4KUEA 5FWYB 3U37A 3U4AA 4DBLC 3GHYA 3BOSA 4HFJA 4W5TA 1HRKA 1N2ZA 4E5PA 3JQAA 5BUQA 4OREX 1I7PA 1Y1QA 1YQEA 2K4MA 1O5TA 1UXGA 1PZEA 4LWPA 4UXHA 1TM5E 4EMUA 2R8RA 1GA4A 4UTOA 2RC6A 3K31A 3E3AA 3TAHA 3S1AB 3W3AH 3RBXA 2OVBA 4MV3A 4WI1A 3BF7A 2Y92A 3TEJA 3OJFA 3WMXA 1V7PC 2XVMA 4A8PA 5I7HA 1YC2A 4GGPA 3WGJA 2RONA 3ASUA 4L5CA 1ISMA 1DOAA 1RKUA 1RXYA 3P2OA 5DU2A 1X86B 3RF7A 3LW7A 5LYJF 1JMKC 1XCGB 2A7QA 4MQFB 5SYNA 5MFPA 5AQEA 3ME5A 1C0PA 1P74A 2JHPA 2VUIB 4UM9D 5A05A 4Q9DA 2D1RA 3A3KA 2IV2X 2ODWA 3EISA 4M22A 4MCJA 3SR3A 3E7XA 5AXDA 2OQVA 2X0JA 5FTWA 2CYAA 1OROA 3D6VA 2EW2A 1GXSB 1VOTA 3F6PA 4BNGA 2QGNA 4U7FA 4R5MA 3R3VA 4BC1A 4L9AA 4OPMA 3FZGA 1P0QA 5GM1A 5BMVF 1NBEA 3I9FA 3IMGA 4KYTA 3M1YA 1LBQA 3OHMA 4HMPA 1WXFA 4P2GA 3ZOZA 2DHRA 4F1WA 4PPFA 1W4AA 4TS1A 4J3JA 2NPFA 1H0RA 5KOHA 3VR1A 4CKXA 5HF9A 1N33B 3WGNA 2HF7A 3JV7A 1QE3A 4WNAB 1JVSA 1OXXK 1DDOA 3LXXA 2IZ1A 3PJEA 4G25A 7AT1A 1ETUA 1P73A 4UE3S 1QIMA 3VBCA 5IVDA 1T2UA 5KSYA 3C14C 1ZVKA 3P20A 5F4ZA 4B5KA 1VJ5A 3MUNA 2E85A 5CJJA 2CN1A 3HNOA 5HS4A 3BXZA 5EYPA 1K5HA 2ZU6A 2A9KA 5DI9A 2NO6A 1O6ZA 1R7RA 1N9ZA 1P1JA 4MVJD 1YS9A 4CM8B 4FJ2A 5K8JB 1JR3E 2IYFA 5ALRA 1N25A 1TW2A 2ATXA 3QVGB 5LQNA 4R1UA 1XQ6A 3Q6MA 2O0JA 4J2OA 4XPIA 2CLHB 1YRWA 2WICA 3D0KA 3CNQS 3PEEA 2DX7A 1L9XA 2JBAB 4R8KA 2WOOA 1W87A 2VDKB 5BR8B 5IYZF 1XPJA 4LX0A 3RAFC 1UDBA 4LF9B 4QNNA 1FXWF 4IGFA 4CKWA 4MQ6A 5T5QA 2VBCA 1C3OB 3MWKA 2WBLC 5BSFA 3NBAA 5CHYA 2EFGA 2V4ZA 3GLFE 1R4NA 1CJKC 3AESA 5D1NA 1PWHA 1PZXA 2XJ9A 1BS9A 3JW8A 2YXEA 3QJYA 1TIBA 1T3TA 5FLKA 4DUGD 5HFAA 3OM1A 4MRVA 1A4RA 4UCQA 1W6RA 4LRXA 3T1HB 1E9BA 1F9EA 3E8SA 3GLVA 5EHZA 5IT4A 4IJKA 5JALA 4HNAB 1O08A 4MX8A 2PLWA 5ALNA 2H51A 3QH4A 4K9SA 5FPHA 3VA7A 3QRWA 3RNOA 4NULA 1BQ4A 4IDHA 1JLHA 4KPUA 1WW8A 2WM8A 4ZGBA 1OU4A 3MMXA 4KV7A 3LX4A 3F73A 4PYIA 4ND8A 1ODKA 3GVPA 2C4KA 4HFMA 5BYAA 1OFIA 5AP9A 4F3TA 2GWRA 1M2HA 2ZOSA 2JL1A 2JLWA 4K9PA 2OSBA 4E5SA 4ENUA 1UJNA 2HRQA 3Q9UA 1ZM7A 1FP6A 2KSQA 3ADPA 1IBRA 3I2HA 1TFUA 1GZ6A 2XV1A 3W5SA 1WL8A 2GSDA 3L6EA 3DWEX 3H9JA 3BAZA 1HKUA 1QKIA 1OTHA 2BMWA 2B83A 5M29A 2DWCA 2RSLA 1EVEA 1N1DA 5KOJB 2UUCB 1CS4C 2ORWA 3CPJB 3OFSA 1Y3IA 4DMFA 2Z83A 3OLWA 3I2IA 2QSUA 4L4YA 4Y7DA 2JJ2D 1Q95A 4W9RA 4AO8A 2ZSFA 1KI3A 3F8TA 3D4OA 5FAKA 2VP4A 3SQOA 3WYFA 3M70A 1K3FA 3OH8A 5E3IA 1K6JA 2NT3A 3EYAA 5C34B 4QGAA 2JNWA 4GWLA 1XMPA 4FFRA 1O6GA 3RKRA 1C4XA 2R6FA 3V42A 5JSHA 1SHZA 4HSEA 5JAIA 4G4SP 5EEGA 5F35A 2J4DA 4YRQA 2B2XA 2XH8A 5CB0A 2C7RA 3KQQA 3ZXSA 2G09A 4H2DA 2E7ZA 3F0TA 5E1MA 3WFJA 1SKBA 1BW9B 4NZ9A 1SU6A 1EMDA 4WKGA 4OHFA 2FW1A 3M4ZA 4NPAA 5EGNA 5F3DA 3IT2A 1CT9A 1NAIA 4AWBA 4ER7A 3SZRA 3ZD8A 2GN8A 2YNMD 2SHKA 1SCUB 3F4LA 2W71A 4TMTA 5AVKA 4BFZA 3PTAA 4HXYA 1ESDA 4FGLA 4TL9A 5H82A 5G0UA 1WVIA 1SOVA 1N6KA 3FZQA 2GA8A 1ZLXA 4MI9A 4ZVUA 1FS4A 1PNTA 4LJ4A 1N0WA 4X1IB 1NNI1 3SHFA 5HEKA 4ACBA 4TXNA 3WRYC 4NJOA 2GAIA 3TNYA 4HNSA 3PSHA 3PCXA 4ZMBA 2NZWA 4PLYA 5BQOA 4GI2A 1T5IA 3PYXA 1L2TA 2W6ZA 4G37A 3ZKWB 1CIVA 1Z6AA 5L53A 2VQEB 2A57A 1QK5A 5DF1A 3DA8A 1DXOA 4QL3A 3ZDXB 1GVNB 1K27A 1YSCA 5DTJA 5ICSA 1XXHB 3ND5A 4ND1A 3Q2IA 4YAOA 2FHPA 2ZXUA 2CZQA 3G88A 1DHRA 2PTGA 3G9UA 1ZIPA 1OOEA 5E9AA 5LQUA 3R6WA 9GPBA 1WDWB 1Z6ZA 4IQFA 4RK0A 4YREA 3W8EA 5JFTA 4UHBA 2VP6A 4XX0A 4RIEA 1SO8A 4R83A 1UBHS 4I9UA 1CS0A 2XODA 1UKYA 3KZCA 3TXAA 4BEBA 1U0BB 2E1PA 1Y63A 1PJ2A 4E2YA 5H4HA 4MGIR 3GLIB 3PXBA 3L8DA 5EIBD 3WQQA 1LI5A 1QE5A 2Y1WA 1SN7A 1Z8NA 2YINC 4MR8B 1MVOA 5FLEX 4YR7A 3DVQX 2QL7A 3RAGA 1RD4A 2Q8NA 4CLDA 3EMDA 4OI0A 3LHKA 3HY4A 3UXEA 2GZAA 2E48A 2B4YA 5JYDA 2F64A 3GRRA 3NBYC 3ZK8A 3Q41A 5TY0A 1FTQA 1AK9A 1EFTA 4RPJA 1E6UA 1Y8CA 4RTQA 4JI7B 1Y1RA 5BN5B 3F71A 4RIGA 5DNCA 3NTUA 4HXEB 2PMEA 3WLSA 2XZTA 3RO7A 3R7WB 4WZAB 1VDZA 2P8SA 5ETJA 2ZSUA 2OA0A 4NMHA 4P5DA 1TLLA 2R68A 4WLVA 4POOA 3E2MA 4XFJA 3KJGA 1FDVA 2P9FA 3GVHA 4FKMA 2HXGA 5KPJA 4ZTZB 1F3LA 1MB9A 3ELYA 2O5EA 3SYRA 3AEKA 5CEJA 3OMXA 4FFBB 3VH4A 1P5FA 3L0ZA 1Y9DA 5J2TF 5LYJA 1QIKA 4CLOA 2W2TA 4YK7A 2O59A 3BFVA 1C29B 1YONA 2A3RA 3WAKA 3Q4GA 3LTEA 1DIHA 3UMCA 3DOUA 1L7MA 1G20B 1R0KA 4WGFA 5G3YA 3STYA 2IXTA 2W9XA 3R0VA 1T8SA 3E81A 1QDUA 4MDYA 3IDZA 3MJ4A 1GGHA 3AJ8A 2FPOA 4UFNA 3IVGA 4JI0B 5CH8A 3F97A 1G21B 1U9IA 1N8SA 2GN9A 2ZRNA 1G1MA 3JQQA 4MB0A 4PLHA 4UEQA 5AJYA 5JZMA 3JARA 3K5PA 3UBTA 2CBXA 2W6ID 1QFSA 5E2BA 1UL1X 1EK5A 4YC7A 5IWCA 3AKYA 2HLHA 4KTVE 2HQOA 2I0FA 3D2CA 3B53X 3WQHA 4D4HA 2KLBA 2X1VA 3K0FA 4C21A 1O95D 1E0DA 1W5TA 2VJBA 2Y0BA 4IJ5A 5KYUA 4JQOA 4KXWA 2CNBA 4D6XA 5LIRA 1MAWA 3KJZA 3EB9A 3MJFA 2XMBA 1CQIB 4RH3A 1EJBA 3HCBA 3VNUA 3CUTA 1Q1ZA 3L07A 4OKSA 2E5WA 3WO1A 3D7SA 1GG9A 3BRCA 4J0QA 2CBGA 4QUEA 3L6UA 1QAMA 1BQ3A 3PHLA 3CF0A 3GZTB 4EJSA 3W4KA 1HNWB 1VKOA 5JSQA 2GZ3A 2RH8A 3UJDA 4BNLA 3JQFC 4JVLA 2HLDA 4L08A 2OV1A 5E1DA 4C22A 4TYYA 2LCFA 4PSDA 3A4YA 4IFEA 3KWLA 1U7DA 3MOIA 5CUQA 3YASA 4DB2A 3V8NA 3CN9A 4II7A 4HX2A 3RYIB 4BFXA 1R10A 1PR3A 5AI8A 3SKXA 3PRJA 4I4LA 4IV8A 2PJRA 1JT9A 1VLMA 4M3NA 3BTUA 3JQCA 4OQXA 1JWLA 1NLYA 1SOUA 4PYRA 4DJAA 3OU7A 1AC5A 1L4KA 4KX3A 1STOA 3EA5A 3FTPA 4IHJB 1J99A 3RVDA 1H2FA 2R62A 3DHWC 2LCQA 2B9VA 3IBYA 5T4BA 3GRAA 2I6SA 4C30A 1U3VA 5CBKA 3K2BA 5KOJA 5EUQB 1XOIA 3IIKA 3M9LA 4R84A 1N7IA 3K1YA 4WVLA 5CNIA 1KVQA 2FLKA 4L5BA 1A76A 4AS2A 1EWYA 3M6IA 2C3YA 4EM6A 4YCDA 4KWHA 1TU0A 1BD3A 2ZQZA 3LLUA 4FYKA 4R7GA 2WZBA 5FWNA 1Z3IX 4HP8A 3N6XA 5CLJA 4P81A 1HK7A 4JJKA 3V8VA 1FU7A 1E94E 5HYVA 2UUBB 1DJQA 1TA0A 2D0IA 2ZULA 1P4HA 3AVOA 5CM8B 4PCUA 2CFCA 4MUGA 5BWOA 5JJ5A 1VCIA 4ROTA 1P2TA 4JDPA 4CPDA 5JFOA 4M49A 4NFLA 1CUGA 4MRPA 2Q5EA 1DBSA 1Z8DA 4Q1AA 3ZGNA 4H4EA 5GP1A 1GTRA 2O3SA 4IVQA 4XJTA 1QKKA 4Z4GA 4WESA 3D3EA 1LA2A 2IPLA 2WVGA 4MS4B 5A3VA 4M8NE 2GZ1A 3AINA 2JHAA 4IHJF 2FN3A 2YWXA 3WLHA 3U44B 4BNDB 1QIHA 2YBEA 3IBGA 3IS3A 3BFPA 2Y9MB 5DIFA 2IY9A 2PMCA 2DG2A 1V4VA 2QD3A 1KO5A 1SHKA 3IHKA 4QSMA 3MAAC 4OHMA 4BRUA 2PFSA 4E70A 5E7MA 3PWTA 1YC5A 3WIEA 2HTEA 1MJNA 2Q0SA 4DC9A 2NUAB 4EWLA 1AM4D 4JA2A 2OMKA 4YA6A 2BGTA 1VLJA 2YOHA 1FU4A 1RCUA 1OA0A 1HLFA 2AR9A 4MUJA 1MHPA 4WJZA 3VHQA 1HPLA 2E4XA 2YUIA 3ZE8A 2E1RA 1NN3A 4CEIB 1KDOA 1SC4A 3UFXA 4C78A 2QN1A 3WG9A 4RBNA 2DUMA 3G2LA 4XXHA 2P79A 4Q9AA 1T6NA 3FWZA 3I04M 4XEHA 3WB0A 1ZVQA 3ZVNA 1V3VA 3TWOA 4I9FA 1EA7A 4ND5A 4V0MA 4WOCA 3WWZA 1SIWA 5J4LA 2WSSD 3DZFA 4BO4A 2AH5A 2I7CA 4HFNA 1D5CA 1JKFA 4XIYA 2E0IA 2CHQA 2I78A 3A1UA 3F1KA 1I6KA 1KS9A 4PBTA 3J7TA 4GAEA 5BSGA 2RGBA 2FE1A 1M75A 1H2XA 1F8FA 5AHWA 3SICE 5KOHB 3RBZA 4Q1BA 4YI3A 5E4FA 2Q4TA 1IOZA 2JZOA 5E7JA 1YE3A 4TTAA 3ZBQA 5ICGA 1DIAA 3CSUA 4RF4A 5ALGA 4FE4A 1T0UA 1LBIA 4R98A 1VM6A 3T38A 4NMXB 3OIDA 4Q9JA 2QMZA 4QREA 1YQUA 4U6NA 2HA3A 2IWHA 1OH7A 2DFKB 3EH1A 2QVCA 4BNWA 1TF5A 1X1EA 3N8IA 4ZVSA 3R7WA 3M6VA 3U4GA 1DRUA 5GINE 3IV7A 3L7AA 1TYZA 1MC4A 5F33A 3JD3A 5KTNA 2CNOA 2JEZA 2YWFA 3C4VA 4AU1A 4Z4CA 5EFZA 3EOBI 1HETA 5B30A 3GJ0A 2P3LA 4R2LA 1XZLA 4F11A 4FFOA 4F4CA 5GJVC 1L6RA 4S2EA 4TMKA 1G7TA 2XUJA 3EXEB 1NF2A 2J9ZB 3LBAA 4KK3A 3PF8A 3UC5A 2PGNA 5H9WA 3T4PA 1OX6A 1HGXA 3ZD6A 1L8LA 1JR4A 2A8YA 4NH0A 1GLVA 1L3IA 1RJGA 4MB6A 1AUVA 3Q1LA 2P2NA 4HB0A 1RXIA 3L7IA 4LJYA 4PFKA 3DMTA 2B4TO 4YAUA 1SG6A 5F52A 2DE0X 1GPH1 5E4JA 1KFCB 2VZ8A 2VLBA 1LBSA 1QIGA 2WP8J 4UUNA 3TE7A 4YR9A 4DT1A 3PI7A 2XUGA 4DANA 3HGTA 4MS3A 3MZ0A 4RTPA 1XD9A 3GYGA 4I08A 5AVQA 3UOAB 1NVDA 4F46A 1R8QA 2X8AA 3CC8A 4MXDA 4WN9B 5DLQC 4A27A 4DSZA 1VE5A 4NZZA 3IDFA 5H7XA 3Q11A 2D0OB 1KPHA 4JN6B 5G4KA 1AVTA 4DR1B 4AG6A 1EZ4A 2HNAA 3ZHQA 1CUAA 2DQZA 3VDXA 2RHRA 2MR6A 4FMCF 3CZPA 2OHVA 1YR1A 3CZ4A 3AV0B 1QO0D 1R5NA 1SU7A 1YZUA 4I1SA 4ETIA 3O26A 1QP4A 1JW9B 1G20E 1YNSA 4P38A 1NSTA 4JOCA 1WXHA 3VVMA 2XI4A 2ZRJA 3CVJA 1EFLA 3PGJA 1DWUA 1ZD8A 1P9LA 3H8JA 4DCNA 4YJ3B 5L51A 1P6QA 3UJAA 5K8LA 4B3MB 2EG5A 2HU8A 4QFCA 2PZLA 4YI5A 1IK6A 1G8SA 4W9NA 4C0SA 5EMJA 3MTJA 1M1YA 3TIIA 4ALLA 2C8VA 1BE6A 2AW3A 1OC4A 3A4TA 5IK2A 2GEDA 5J63A 4JL5A 4YLYA 3C16C 5IHXA 2GN6A 2V98A 3ZE6A 4OBEA 4BMCA 3KJHA 1M10A 1U9JA 5I6DA 1ZCZA 2PV0A 2RB4A 3B3GA 3EVZA 1G7SA 2FWNA 1W34A 3OPYI 4BYGA 1JEYB 4B4KA 4MR7B 3E7WA 3QXSA 2CLSA 2Z4RA 5D2CA 2X0KA 2F9FA 1SK8A 3A1FA 3K8OE 1BYUA 3LCRA 3H99A 3ZJUA 1NC1A 1WSWA 3OHPA 4TV9F 1QWSA 4Y0AA 3WLFA 4Z4IA 2JATA 2E5LB 4J90A 1WP4A 2IOFK 4TMZA 2ZAGA 3DL7A 3MJDA 4TXHA 4AAYA 1TCBA 3RS5A 5D5PA 4PIMA 4H3HB 4DZTA 1KP3A 3ASZA 3BGDA 2BI7A 4LSMA 2X2PA 4XUDA 4IDDA 4X24A 4FDUA 3GA5A 1NXSA 2G77B 3IAUA 3H5WA 3IAM6 1O9BA 1S96A 1RE0A 1SM4A 3QXHA 4GBMA 3OQBA 4XYLA 5HJEA 3WGOA 3K96A 1AE1A 2CV0A 2ZT6A 2FUG6 2DH6A 2AJCA 3OP1A 3QW2A 1NBIA 1TPZA 1GL9B 1XA3A 1NN0A 1QLJA 2WYWA 3NRJA 4HZUB 4KAJA 1ZXLA 3HKEB 1GEEA 3MWGA 4R1MA 2C2WA 4AG5A 5GOZA 4RV4A 3W05A 1WTAA 2A0YA 3QBVA 4EY8A 1UMDA 3NNNA 1IYZA 1ECBA 5EMMA 5E1OA 4ZEWA 1E5TA 4O8ZA 5J40A 3K71B 4Q3LA 2E37A 3PQ4A 5AIAA 2E55A 4YVFA 4F7DA 1GV0A 3DXXA 3MCUA 2NSYA 3QWAA 4PAMA 3TRHA 3RGGA 3IR6A 1JIKA 3QVJA 1GPKA 4TTIA 3RS2A 2NU8A 4FGJA 1Z5NA 4ASUA 1IN1A 3FUVA 4J0FA 4QE3A 4QYSA 5G4LA 3ZCRA 4B3CA 2VWQA 5AQ1A 2Y1XA 2XKAA 3WWYA 4M1MA 2C4VA 1C7QA 1PVDA 2ZB7A 4MUMA 4QDKA 2R86A 4HT3B 3ADBA 2CF6A 2J7KA 1T5OA 3KFLA 5FT9A 5DHRA 4BMOB 2Y6VA 3QPCA 1ORRA 1AN0A 1BWRA 2QAGB 2X5KO 3PC8A 1NYTA 1LF5A 1E9AA 1A8PA 4OMFG 3LUPA 1G9SA 1TAGA 4OB8A 4CMIA 1EQ2A 3MJVA 1GTL1 1UXIA 4AX4A 3ILVA 3AM5A 3RJZA 5J58A 2JHFA 4Z99A 1ZGAA 2WYVA 2Y0DA 1UBUS 3GR6A 3NTXA 2CMKA 3ZG6A 1Y1LA 1ZHHA 2PX3A 3D1JA 2PTHA 4K03A 4JJ6A 1EM8B 1TRKA 1GGVA 1WEHA 2AFRA 4RMHA 1XQ9A 2PVCA 2O14A 3DOOA 4M88A 3LUHA 3LJKA 4L07A 5G1PA 4GX0A 5L7YA 3ER8A 3ESBA 4F3RA 1QRRA 4GC5A 5LMZA 2D3WA 4BGEA 5F2NA 3ITEA 4L51A 3HCNA 4AS1A 1P9WA 4ZO6A 1TZBA 2WJAA 3ELWA 4LDZA 3VZPA 5K0ZA 1HT1E 3G5MA 4YMSA 1K4MA 5L8VA 1ISRA 4IRUB 4DV5B 1E9EA 1N8KA 1QO0A 3U3JA 3IEUA 4CTMA 1NXWA 3C4QA 2CT8A 3BXPA 1G8KA 3FHOA 4ZZ1A 4MMYB 1KJQA 3FA2A 3X44A 2PKCA 4G63A 4M87A 2EJBA 2BCEA 2AQIA 3VHXA 1DQRA 2WSYB 1ID8A 1KH2A 1S8FA 3PRHA 4H0NA 1P7CA 2R8PA 3B2QA 3KKMA 3N2GB 4QEDA 3ECAA 3WB2A 4A1OA 1W4ZA 2Q07A 2EKLA 1O0BA 3BZBA 1EGVB 3CYFA 4PINA 1WJGA 1M2OB 3LPNA 4JI4B 1NF9A 3BGWA 3IMEA 3N2LA 2IOHA 2WAAA 3OM8A 2C5SA 1RPJA 1DJNA 1QB8A 2BGUA 3G3EA 4WVFA 4TL8A 2LWIA 3VPAA 5CDFE 1M5RA 1VG0B 1NLUA 2WYUA 4Y1RB 4OX9B 1PDVA 3WKEA 4DB4A 1BA3A 2QN2A 3AG6A 5GPBA 1USWA 2Q45A 3IGFA 5KYUB 2GOYA 4YDHB 4Q3KA 4X1OA 3CEPB 5DWVA 3ZV7A 4W5NA 1JLRA 4IHAA 2ZAIA 3FX2A 1TM2A 2WAMA 3OQ1A 2B30A 2PQ6A 3HSYA 1G5QA 4OHWA 2I22A 2PSDA 1L1QA 4B2PA 3VO2A 2QVZX 3MJTA 3ZNNA 5F5LA 4GI3A 1JGTA 2FQXA 1RAIA 2A1TR 4UXJA 1RQPA 5IASA 2VPZA 5JSFA 4QBIA 4W5OA 4PR0A 1G55A 3BCSA 4MVYA 5AJWA 2DETA 1XTJA 3KQHA 1PLKA 3GCGA 1U4SA 4HS9A 2PFKA 1GM5A 1U98A 2BWJA 3F5DA 4K8OA 4P5EA 2K7FA 3LFTA 1N5JA 5ITZB 3IQHX 3OZFA 4LZWA 4WCDA 4KJZA 1A0OA 5CA0B 3FFBA 4EENA 3COPA 4Y2VA 3L8CA 5LXTF 2XZLA 5ARDA 1U2TA 1BS2A 5SYAA 2O8DA 1T8TA 5F23A 1Y80A 1SURA 4LXUA 3E9ZA 1XJWA 3D0QA 4I81A 5FNVB 5IJXA 3LKBA 1PK9A 4JNCA 3BYZA 1HV8A 4Z3OA 1M8PA 1A2BA 1V1RA 2X4GA 4H7HA 2C7BA 1XK7A 3KAJA 4LNAA 3PFCA 4XAQA 3UMJA 5I7UA 4FONA 1XQXA 5BWLA 1OI4A 2WVAA 1KYZA 1OBOA 3JASA 3NU1A 3OIUA 4OD0A 5ALZA 3VPXA 3EXFA 3N28A 4QUJA 4Y9DA 5FL7A 2DQ4A 4ZCIA 2H31A 4C5BA 4ARCA 4CYMA 1R0SA 2IDMA 3LX5A 4NCHA 1KDZA 1OYYA 3FXAA 4WACA 1Z4KA 1Z6QA 2VWGA 1R6XA 3JD4A 1CRQA 2YXBA 4BN0A 2ZTMA 3UHAA 3ILSA 1QRSA 1SCQA 5BQXA 4GHWA 3BAFA 3FSJX 3RC8A 3ZVMA 3EPKA 2FJUA 6REQA 3WRXA 4ML3A 1ANKA 2F48A 1KQPA 1YAHA 2BH9A 1XTTA 3CTPA 3PICA 4WK6A 1TIKA 3EMVA 2F3QA 4OU5A 4G23A 1ZL0A 4PG4A 4HGPA 2XF2A 4OM7A 5CVDA 1K4YA 3A11A 3DEKA 4XGIA 1P2FA 2C1ZA 5EYPB 5JG7A 4EI2A 1SB9A 4NZYA 4ETMA 2HTFA 1ECLA 1LBHA 3IP7A 2PZFA 3L82B 2RGCA 4OJMX 2QG4A 2B5OA 4QYIB 2PDAA 4EUNA 1SXPA 5CM9C 2XTMA 3LT4A 3HBLA 2C5BA 4R9VA 4YO8A 2CK3D 1ZGCA 2DYKA 3PE4A 4JYBA 2OD9A 1N1MA 4LVNA 3GJRA 3GNQA 3GELA 5DFAA 4YIKA 3DONA 3V3TA 3LTNC 3ZC3A 4TYWA 1E89A 2P9BA 2ZEJA 1DBPA 1JDBB 3KPUA 2I1QA 4KCGA 4OIMA 3HLYA 1T0PA 4JB0A 3SHWA 2IFTA 4K6FA 4HLUA 3X1YA 1WCIB 2JFYA 4C0KA 3UM9A 2QRVA 4HOYA 4DILA 4ZZIA 3QEBZ 4HBGA 4EVSA 2VRCA 1X1QA 3E22B 1CFZA 1V96A 2AYXA 2NMVA 1W76A 4P2BA 2QAIA 3FRHA 4V0SA 4RZQA 3T0GA 4AJ1A 5K3OA 1BMQA 2BFBA 2GLUA 5L3QB 1GPAA 1P44A 2H92A 2WJJA 2XOKA 3C3EA 4MRRA 3ZZUA 1Z75A 2IXEA 3PQFA 4DUPA 5CCEA 4JB3A 3QP9A 4WFKA 2G1PA 3FNFA 1BXKA 2GM5A 1WMDA 4TWZA 3DOJA 1XGKA 3PUYA 1NNUA 3PT5A 3ZS9A 1F17A 4NH4A 3A28A 4X54A 2ZRHA 1OW3B 1GGEA 1Z47A 4LWOA 2HN9A 3HWRA 4NPCA 3G8CA 3KCQA 1ONBA 5I7VA 4C6TA 1GUDA 3KUUA 3EEYA 2PSHA 3S4YA 2P75A 1P3DA 2OPBA 4BKRA 3KVRA 3RTAA 3V55A 3RADC 2IVZA 5F77A 1U90A 3OQOA 3Q98A 5CAEB 1WV0A 2Q1UA 5EP2A 3M34A 5K3FA 1BMFA 3L4BA 4OOFA 1DDIA 1GPJA 2BFMA 2WLSA 2XNHA 2JH3A 5AVSA 2YW9A 1UEXC 1UZLA 3A7DA 1KZHA 1NONA 2HK7A 1LPSA 3Q7EA 4JJGA 3PEVA 4LBVA 4RULA 2YV3A 3DR3A 3A31A 1WZIA 2N47A 3EAFA 5E1BA 2ZYHA 5JAZA 3EGEA 1UJ6A 3CTMA 3DFFA 2HLDD 5ALUA 2WMDA 3AHIA 4QLOA 4RHFA 4TLCA 5DM70 4YDSA 3C7TA 3ZHUA 4BB0A 5I7OA 2HA4A 3AEXA 4TLBA 3WWCA 3K73O 2DJIA 2BRUA 2OQIA 1Z68A 3NTLA 1XYYA 2E3JA 4H31A 4H27A 1L5QA 3L93A 5AFSA 3L7DA 4Z8XA 1JIXA 2FLWA 2PAAA 2ZSIA 2F7SA 1MGOA 3B7GA 5CB4A 3W7BA 1F60A 3TQFA 1KAOA 1JHMA 1Y1SA 3O9MA 4I55F 1Y0BA 1M0WA 3EK2A 4HB2A 4XUEA 5CLHA 3FLAA 3PQ2A 1E6WA 4KKXB 3EE6A 3S7TA 2QX9A 3TD9A 1Y48E 3WB1A 1VJDA 2OVFA 5C8DA 5LDHA 3BS4A 1T9HA 1U28C 3ICEA 4HGQA 4XFDA 1XN4A 1OFVA 2UV8A 1EUDB 2E2WA 2W2VA 2DFVA 4G8DA 4O4HB 4WBXC 3V1KA 3WISA 4BB9A 2IDJA 3EFOA 5FJJA 3WK5A 1V5EA 2WG1A 1LRJA 1OI3A 3NTQA 4XTCS 2WIBA 3PT9A 1I2DA 5BPHA 1WPXA 2EFHB 5IEJA 4XVRA 1Z2NX 3GRZA 1G2QA 2C54A 4JX8A 4MH0R 3TNFA 3B8EA 3VR0A 2XZPA 4LDJA 1H6BA 4DSOA 1LLDA 1U28A 1PJ8A 2P3SA 3AP1A 4K9OA 3IPXA 2FWPA 1RHKA 3PFWO 2D8AA 1NC3A 3OJCA 5JBQA 4KKVA 3HJGA 4CHGA 5AOCA 4EEZA 1PLLA 1QHIA 1VB5A 2CE7A 2XX3A 4M99A 5L4SA 2VWPA 4GUDA 2OZKA 2HIMA 2FMKA 2R751 5AI9A 1SCAA 4Q9IA 4TM8A 4ESHA 4OLBA 2H5EA 2XWQA 3BEDA 1RP1A 1IB0A 2BRUC 4HDNA 4K9MA 2HMYB