1LY1A

Structure and mechanism of t4 polynucleotide kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
152
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polynucleotide kinase
publication title Structure and mechanism of T4 polynucleotide kinase: an RNA repair enzyme.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
total genus 53
structure length 152
sequence length 152
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2002-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ly1A00
4V0LA 2QG6A 5KSZA 1HV8A 3VQTA 3K0CA 4Q7JB 1OHHA 1ZUHA 5CK4A 2GXQA 2ORWA 1CLUA 2GK6A 2YJTD 2WWFA 2GCNA 3QE0A 3QIAA 4B3BA 1YZUA 3SJAA 1NY6A 4V0ME 2QL6A 5FL7D 5JMTA 1M7HA 1ZCBA 3LW7A 3U4QA 2XNDD 1GRNA 2FOLA 1SXJB 2QA5A 4IEIA 4WZAE 3VKHA 4PO8A 1Q12A 4R2HA 1CULC 1ZP6A 5EE3A 4NCNA 4OHWA 1KO7A 3B13B 2ZRKA 4C0QC 2D2EA 1DAKA 4A8JB 1MO4A 3V9PA 3ECCA 2IYSA 3PEVA 1M2OB 4QHTA 4WXPA 3UANA 2OCPA 5HZKA 2PT5A 1P73A 1RRCA 1WXQA 4DSTA 4Z1MA 1UBCA 1TU4A 4E5UA 1EESA 2P6NA 3FDIA 1KJWA 1M34E 3CF6R 2MSDB 1KSJA 2IEYA 5FTKA 5KSOA 1ZD9A 1ZINA 1TQ4A 2G0NA 4URVR 2G3YA 1TUIA 2Z4SA 2CL6X 4PC7A 4JBYA 3GFTA 2IHYA 2WBLC 1E0SA 3R8FA 2V4ZA 1BS1A 3EIHA 2GA8A 2OM2A 4AKIA 1KO8A 3FVQA 5IF9A 1RRFA 2B8TA 4PZLA 3BOSA 4Q9KA 4E03A 4I99A 3P27A 4AWXA 4OHVA 2CVHA 2D2FA 4DCTA 4DSUA 5FOWA 2XB2A 1RZ3A 2XJ4A 2JLRA 2YWGA 1XEXB 1US8A 4HAUA 2P5SA 2O8FA 1CRQA 5IRCD 1OLOA 4RCYA 1A2BA 1X1RA 2Q0HA 5KNDA 4Q4LA 4DLSA 4YMTA 3GLGE 2YOGA 3AVWA 2D7CA 1C4OA 3HU3A 4D4LA 1TMKA 1P6XA 2FU5C 1YVDA 4LJYA 5KPJA 4KJZA 2GVDC 1XDBA 1Y3AA 4C0SA 3DOFA 4GOXA 4DDUA 5KSYA 4RFSB 3QKRB 3MGCA 2ZI6A 3S1AB 2QGZA 2L0XA 4BEBA 2UZIR 1P4SA 2CE7A 2GKSA 3EWSA 1XD9A 2QE7D 3K9NA 3EXAA 4BECA 1JXOA 2BCGY 2G77B 3W6PA 3MG9A 4LX0A 2NPFA 2QI9C 2D06A 3C16C 4R2IA 5KOYA 2VHUA 1LV7A 4TMXA 1KIMA 1TAGA 3LA6A 1AZSC 4Z8XA 1Z6YA 3EZFA 4M1TA 2HCBA 3FE2A 1UBEA 2QP9X 3ZD6A 4D81A 5DNYB 2D7DA 3GJ8A 1D2MA 5FOXA 1D8TA 3UG7A 2KJQA 4YMVA 2H8KA 2FPMA 4Q01A 1MO5A 5A4JA 1IN4A 1UADA 1VG1A 4GNKA 1U0HC 2FH5B 1MH1A 3EZ2A 4LRWA 5CJ2A 1W36B 2WWHA 3SJZA 3BJIC 5KO2A 1XCMA 4TSFD 3P1JA 4HUQA 3LFUA 5TMPA 4NYMR 4GOJA 4G01B 5DGXA 4ZPXA 3IBYA 2H17A 3WP0A 2XITA 1Y63A 4CEJA 3UIEA 1U90A 2DB3A 1XTQA 2CHGA 2XJ9A 3WNBA 4XSHA 1FMLA 3T1OA 1II0A 1IY1A 1E1QA 2ZE8A 1YKSA 3EIEA 5EE0A 2FEMA 3KZ1E 4TYQA 1D6JA 3CX7A 4LJ8A 3RRYA 1HYQA 1Q1QA 1GNPA 1QBKC 3WNDA 4D2IA 4JL8A 3CWZA 2JDID 3VHLB 4LDJA 2QP3A 4QGHA 3EPJA 1U8AA 1KK1A 4ZDJA 2BBSA 2DCUA 1FUKA 2IUTA 2R9VA 1E6CA 3B1XA 4HATA 4LYFA 3RRMA 3ZIAA 1A82A 2ZVQX 3KKPA 2WM9B 2G9NA 1JJVA 3ND9A 3ZS8A 5EJEA 3FB4A 5JS8A 2PBRA 2A5YB 3A4LA 2J7PD 4B6FA 1QZXA 4M9ZA 4TQ9A 5H68A 4IOJA 4KYUA 3GQBA 3HU2A 2IT1A 3AKEA 1CP2A 3VR3A 2V6IA 2YV5A 4B44A 2VYFA 3AKDA 2O8DA 2ZIAA 5DHFA 1SVMA 5JEDA 3K0AA 3QG1A 2C5LA 2HDNB 3M1IA 3PXGA 1YJ5A 4HAWA 2GF0A 4LV8B 3OFND 3GJXC 1G19A 3A6PC 3KDSE 1XB2A 3N2EA 5EXTA 2C03A 3GJ0A 3CONA 3QNUA 4ZKEA 4D82A 4XWKA 4L15A 2X1VA 2V7QA 4EFNA 4DC9A 3GLGB 1A2KC 3I1FA 3OEEA 3F3YA 1KI1A 1LS6A 3H4MA 1MV5A 1ZUNB 4F7WA 4HDCA 1COWD 4ZV4A 1N0WA 1R8SA 1N0VC 2OE2A 4ZDKA 3BH7A 1OH7A 3UPUA 4GT1A 2I4IA 1IY2A 4QGAA 2IS1A 3LBHA 4TQAA 1D9ZA 4TZ0A 3FMIA 4E07A 4D25A 2WWGA 5JWOA 4B48A 3TGPA 1JAHA 2DBYA 3AF4A 3CRRA 3Q5DA 5FBWB 2HUPA 3DHWC 4D0LB 1H8ED 1SVIA 2BKEA 5FPYA 3SNHA 1YZLA 1NBMA 1K8RA 2P67A 1IQPA 4D4MA 1NLFA 4PAQA 3F0TA 1EX6A 1NN1A 1QHSA 2GNOA 1UM8A 4JIMA 3GLFB 4FMDB 5AJZA 4ILEA 5DN6A 2JLWA 2QPOA 2VQSA 3EC1A 4HZUB 2O0HA 2OBNA 3QXJA 4ZI2A 2XOKA 3T1QA 2ZEJA 1O87A 1CJTC 3BFXA 4FMCB 1VCMA 1ZRHA 1ZMXA 1XEWX 2J45A 4LSGA 1WP9A 2WAXA 3EPKA 3K0FB 1QVRA 4LV5B 3GLHE 4IFBA 3MWJA 2O52A 2R62A 2ZSAA 4YONB 1FQKA 1GSIA 3EWAA 1LW7A 4ZIRB 1CKEA 1J2JA 4U02A 2V55B 2NO1A 4B32A 5CITA 3QXSA 2O0JA 3GJ7A 4IVRA 1OPXA 4IDHA 1G8HA 1GRRA 3IHLA 4NONA 5FPSA 3WRXC 4JZKA 1RC8A 1O3YA 2IYUA 4CYMA 3KJIA 2B21A 3PUWA 3K9HA 3AQ4A 1S9HA 3K09C 1OFUX 1RYFA 2FGKA 4EJSB 3HYTA 1Z0JA 2EYQA 4MQBA 4WA7A 1VG0B 3OHMA 1YR6A 2R6CA 3C15C 3OEHD 1Z6XA 3VKGA 2XTZA 5SZIA 1NN5A 2R6AA 1ZW6A 4HZUA 3REFA 5JJLA 3AH8A 2CJWB 4LHWA 3BB4A 2WJHA 3SZRA 1Z07A 1Q22A 2HYDA 3GJ5A 3SJBA 2GEVA 5J47A 4A2WA 4B3DA 4MDFA 4LJ5A 4JS0A 4MRSA 4YDHB 2R44A 1VIAA 4X8LA 4ACAA 3LLUA 1N6OA 4M21A 1KSFX 5CM9C 4A6XA 1II9A 3CUEF 2ZE7A 3CW2A 4EPWA 2WTUA 1T0HB 2PLFA 4KFSA 2OAQ1 3GD7A 2AWNA 2N42A 1XXHE 3WNCA 2WPDA 2AHOA 3AP3A 4N0DA 5BQ5A 1QHHB 2J5XA 4LK2A 1E98A 3IDQA 4M9SA 4NCJA 3KL4A 3NHBA 4NYIR 4PFSA 3SOPA 2ZJ2A 3FMFA 3Q72A 2YC4C 3ZQJA 3M4YA 2Q9CA 1EFRA 3EARA 5CLLA 4CRWB 1UEJA 2ERYA 1AM4D 2HYIC 4FN5A 5FOSA 4MYUA 4E09A 1NKTA 3U3RA 3QEJA 4HB2A 5LPNA 4V0OA 4BZQA 5HR5A 5DLQC 2WWXA 5LB4A 1TUEA 5IK2D 2VPPA 3KB2A 4S35A 5AR1A 2QEQA 3LWNA 1FPMA 1OSNA 2GHIA 2VA8A 2AR7A 1OB2A 4KXFB 5KDLA 3WY9A 4TYWA 4RKEA 1X86B 4QFMA 4NZYA 4Q21A 3BIFA 3U7EB 4HSEA 1SVSA 3PCRB 2WVJA 3RSOA 3R20A 3TNFA 1E2HA 1N5IA 2NMVA 2LKCA 2GJSA 1KOFA 2WJGA 4O3MA 5AJVB 3WRYC 2ZR9A 2HLDD 5K8LA 1XF9A 4MGZR 4N1AA 1BH2A 1I4LD 4Q9IA 4V0KA 2ZI7A 3AEZA 1E79A 1DAMA 2F3RA 1T91A 3ICQB 3NBFA 4KVGA 4RCZA 1TF7A 4Q03A 3SI7A 4G5RA 1E1RD 1ESMA 4TYYA 3DKVA 4B6EA 4A36A 4WZBE 2CMKA 4Q02A 4ZCLA 4B75A 1R0ZA 4H1VA 1DBSA 1ESNA 3AP2A 5EUMA 1KK3A 3Q85A 4DZZA 1YHNA 2YC2C 3V4RA 3AF1A 4QBHA 2REXB 2HT1A 2UVQA 4JBXA 5FBQB 1YR9A 2RAPA 2XEXA 4D6PA 2GCPA 3A1UA 3CO5A 5JSZA 1KSHA 4FI3C 1Q1ZA 4OJQA 4M53A 1Z5ZA 2DFNA 2P65A 4BUJA 1T9HA 1IHUA 2W6ID 2PCJA 2JLVA 2ZJAA 3OIUA 2E87A 1KHTA 1E9CA 1WBBA 3CH5A 3NDPA 3EA5A 5DI9A 3VNVA 1AQUA 2I1QA 1BYIA 4KI0A 1KDRA 1JQJC 3CBQA 4LCBA 2YINC 4BRWA 3QKSA 3KTAB 2JJ1A 4XTCS 2IYWA 2PJZA 5FBVB 4YXWD 3L8YA 2GJ9A 2G88A 3QI2A 4QHYA 1Z29A 4UNNA 4AI6A 2EFEB 4M2LA 3VFDA 1J90A 4PHHA 4PAMA 4EFMA 3X1ZA 3OF5A 3N2IA 5FTLA 1IXRC 1DE0A 1XXHB 2ERXA 3PV0A 2PX3A 3TW4A 4JLAA 3DM9B 3MJRA 3ZVLA 3D8BA 4X8MA 5LDDC 2PEZA 3CZQA 1KO4A 3JVVA 4WIAA 3QF7A 1KI4A 3GFOA 4JVSB 4EQ6B 5E95A 3RSLA 1R5OA 1OH5A 4MRRA 3QKUA 3TUJC 1GRQA 3C5HA 4IW3B 3J81k 5J40A 1DG1G 1QHIA 2ZUCA 1YU9A 3KTAA 1MABA 4OL0A 3ZJYA 5JJIA 2OSBA 5TXGA 4BFUA 4G5QA 5M04A 1E2QA 1M1YE 3EIQA 3D6TB 2BM0A 2IYTA 4BWYA 2J87A 1KK2A 1IN6A 4TQUS 1ZJ6A 3KKOA 5AUNB 4HZIA 4C0LA 1G6HA 4RD4A 3KKNA 3PVSA 2ZYUX 5IDVA 2LWIA 1FUUA 2EFDB 1IAQA 1S3SA 2ANBA 4EKDA 3KUCA 1VHLA 2GESA 1QRAA 2VP9A 3GJ6A 3BBPA 4DLYA 4JKIA 4FW9A 1Z2CA 3F5FA 2GBLC 1ZNWA 4TTRA 2WWIA 4PXAA 1VHTA 4TN1A 1JQLB 1E1QD 1Q20A 1GNRA 3FTQA 2REBA 2JA1A 3ZZ0A 1GFIA 3BERA 3FKQA 1AK2A 2G6BA 4Z8YA 2NQ2C 3NVAA 3X1DA 4DT1A 4QRHA 1DAEA 4ARZB 1S4QA 4EPTA 5FPKA 1ZUIA 2IWHA 2F1IA 2WSSA 2A5JA 1G3MA 5D3QA 5G40A 4Y0AA 2HCJB 4C0KA 2GXAA 4BFWA 2GRJA 5FPHA 3PQCA 1LS1A 4MRVA 1W36D 2A2ZA 1RVDA 4QJ4A 2BBTA 1E2LA 2GK7A 4U5XA 2ZITA 1TQ6A 2J0UB 1FTNA 3KXLA 3ZIAD 3BAFA 1SXJC 4C3ZA 5JS7A 5G53C 2IS4A 3QF4B 5JJKA 3FMPB 2W0SA 4BLQA 1S0UA 1JPNA 3TKLA 5DYIA 2XAUA 1NLYA 1PLJA 3EC2A 5GJCA 1H8HA 3WHLA 2G83A 1I2DA 1W4BA 5DI3B 2GVZC 2HXSA 2ZU6A 1XX6A 1TEXA 4Q4JB 4GZMA 4ABYA 2FFBA 2H1LA 4D0GA 2YWFA 5FI0B 2H18A 3HR7A 5H8WA 4HEJA 2A7QA 3A1TA 1XMIA 4YDSA 2ASEA 2SHKA 1E2KA 3ADKA 4ZKDA 2V7QD 3AVUA 2ZJBA 2DWOA 2O0KA 3PUYA 1PV4A 3OEED 1SKQA 3LBNA 2TMKA 5IT5A 2JLUA 1KI7A 2DHRA 1V43A 1NVWQ 2YVUA 4LJAA 1OF1A 2W58A 4IRUB 3EZ7A 4OHZA 4BASA 2GEDA 2V6JA 1NNEA 3K70D 2YZ2A 3A1WA 1AKYA 121PA 4CDGA 3I73A 1NN3A 4R98A 3T5GA 2AK2A 3QXCA 3I62A 5F3WB 1G18A 4BLPA 1NIPA 2ZAOA 2IHBA 2J0VA 4NMMA 5DI3A 1HA3A 1KO1A 2J3EA 5FOVA 3UK6A 2BWJA 2XXAB 1NY5A 1W2HA 1G7SA 3TR5A 2ZJ8A 4QL3A 2FSHA 2OCYC 2ZRDA 4OK5A 2D4HA 1NKSA 2FSFA 3MRSA 4Z51A 1ZU5A 2RGEA 1BMFD 2P6RA 3U4QB 4OBEA 1U9IC 3TRFA 4AURA 2P5TB 1L4YA 3X2SA 4XVRA 4KBFA 5GJVC 2XOKD 2XSZA 1RFLA 1WF3A 2WIAA 4V02A 4NDZA 5JRZA 4YMWA 4LV6A 1CEEA 5CYPA 1G8GA 1XMJA 3BE4A 2FEOA 4JLJA 1E96A 1HY3A 2J7KA 2OESA 2GCOA 1LF5A 1FTSA 3TMKA 3EG5A 1AZTA 2PMKA 3IPYA 4HLCA 4HLQB 1X8JA 4QC2A 4Z54A 1WB9A 1DTSA 4GI7A 2VEDA 4DLUA 4HI0E 2FMXA 1CR2A 2JLSA 3U61B 3EPHA 4ITRC 5LD2B 2GXUA 1XD2A 1Z0AA 1WCV1 4AC9A 4FCTA 4LY6A 1P9RA 2C98A 1X3SA 2DY1A 2OBLA 4NHOA 5SZHB 3VR4A 5FR1A 4G5OA 3B82A 3LXXA 3B85A 1BIFA 3TE6A 3BRWD 5TV2A 1NG1A 2VP6A 2ZQ5A 5L3SA 4BRUA 5FR2A 1QHYA 3OIWA 1KSGA 3UATA 1ZCAA 2GEUA 5UKDA 5L8VA 3ICEA 4KFUA 3FYHA 3D3QA 3RS7A 3TAHA 5KU1A 3IIKA 4ZCMA 1Z2AA 5EXPA 5C46F 5BN3A 1ZVQA 2BKUA 3DZ8A 2ZI3A 3FKSA 1G16A 3CX8A 3ZGXA 3BFVA 1Z6AA 4R7ZA 1US8B 2QAJA 4K46A 1N6LA 2O8FB 1G41A 2ODEA 1P62B 3SYNA 2QMOA 4WBSA 1Q44A 1DO2A 1M8PA 2ZRJA 5F2EA 3REGA 4NPHA 2IUUA 4MA4A 1GWNA 2FE4A 1GITA 1U8YA 2GZHA 3EA0A 2BJWA 2KBFA 2WICA 3A1VA 4F92B 1CU1A 4Q1BA 1Z47A 3U2QA 1P7CA 2CK3A 2GBLA 2OBMA 4LBZA 4MITA 4WOPA 1ZM3A 4NYMQ 3GLIA 4MYHA 3QJYA 2C9CA 2JJ2A 3PG5A 1P60A 1R2QA 1T5LA 4I1OA 3RWOA 1T3LA 4CZ2A 2CNWA 1IN8A 1ZC3A 4PO1A 5A5GA 1JALA 1TPZA 3RRNA 4CT4B 4DUGD 2PL3A 1BO6A 4L9WA 2GTPA 3W3AA 1G8FA 4C0BA 3VMFA 1DEKA 1XTSA 1GIAA 3F8TA 2CHQA 4L8GA 1RPZA 4PZZA 2RB4A 3WYGA 4LJ6A 4C30A 4QXAA 2EWVA 4CEHB 2VP5A 3VR5A 2W0MA 5DSZA 1NG9A 4QJ3A 1KMQA 4ESVA 3CF2A 4U00A 4HUQB 2YKGA 5KYKA 1XFAA 1VPLA 4PC2A 4AD8A 1G20E 1JPJA 4IJMA 2AL7A 2C95A 4PPFA 1L7VC 1E79D 4CEJB 4B3GA 2O8BA 3Q7PA 3RS5A 4O0MA 2XB4A 2QRZA 2AD5A 1IXZA 4B47A 4LHVA 1DS6A 1IONA 3A36A 3T34A 1IOZA 1W1WA 1Z28A 2Q9BA 3DEFA 4KAXA 4QBIA 1E2FA 2RH5A 4QM6A 1FNMA 1N0UA 4DXAA 3PR1A 1F2TA 1VYVA 1E69A 3PIRA 1GKUB 4EAQA 4P0TA 1UKEA 4AKGA 5TDHA 3AVVA 3GLFE 4QNMA 2OXCA 3WBKA 4Q1FA 4HAZA 3GCGA 1F60A 2P2LA 5P21A 1G3UA 1EFTA 1ZAKA 4WZ6A 4WXRA 4OHYA 2X2FA 4B71A 1AS3A 4M1OA 2ZRIA 3TJZA 2JATA 1JR3A 4Q9LA 2AX4A 1XNJA 4URYR 1KZ7B 5HKKA 3THWA 2ZSBA 3DZDA 4P33A 4NE2A 4OQNA 4TLCA 2O8DB 2Z0MA 1N6KA 2XZLA 3R9XA 3K0AB 4LJ4A 5C1BA 2B6HA 4QGGA 1W47A 1I4DD 3O8DA 1CR4A 1IJFA 2JJ1D 4OK6A 4UXJA 5AJYA 1CJVC 3X1XA 3B60A 4BLSA 4TMWA 5KUTA 1EFCA 1VYTA 3EPLA 1KY3A 2C2HA 4BFZA 4BFSA 4DLWA 3PEWA 2W2TA 2A78A 3AVXA 2XX3A 1YZKA 1U9IA 2F1JA 5D3MA 2ZRPA 821PA 2CCKA 3K53A 3MFYA 4EJSC 5GADl 2JLYA 1XWIA 2Q21A 2Q6TA 4MUAA 1NP6A 1GKIA 2XGJA 1W5SA 2RGBA 4PTLA 5LBIA 4DLZA 3IIMA 4DHEA 1E9SA 1R7RA 1OH8A 2R2AA 3ZQ6A 1ZD1A 2ZS7A 4JKYA 1OIVA 1P5ZB 3K70B 2H7VA 5JCPA 4NKRA 2JLZA 1NMYA 4JSYA 2B7BA 2KB0A 2ZR7A 2ZRAA 4HUTA 2OUKA 1DO0A 2G1KA 2WMOB 4DIEA 1XEFA 1QDEA 3ND8A 1IXSB 4BFTA 2ODWA 5B57C 4JL5A 1YZGA 2A3RA 2VH5R 2JIZA 4A0GA 3K9LA 2PEYA 1Z08A 3BK7A 5EP4A 4BE7B 1ZIOA 4OI4A 1F48A 2VO1A 1E2IA 2V1UA 1G64A 2IC5A 4V0MA 3LVQE 4Q47A 3MSXA 3VAAA 3QENA 3CH4B 4EPYA 1YR7A 3Q3JB 4WVFA 3I8SA 3NEJA 2RGAA 3U6BA 1FW6A 3MJHA 4FD2A 1EX7A 3CIOA 3MCAA 2ZM5A 4LOAA 3AVQA 4OK3A 1SVOA 2IXEA 1E9EA 2QORA 5CYOA 3CPHA 1G17A 4JJZA 2QBYA 1W2GA 4TMVA 1ELOA 2O8CA 1EK0A 3FPAA 1XTIA 1NVVR 3K9GA 4Q9HA 4OKSA 5BN4A 1NRJB 2WZQA 3MWKA 4M1SA 2HEIA 4KLZA 3L8ZA 3N70A 4NTZA 1K5DA 1JJ7A 2GILA 2ORVA 4DWJA 1KI6A 1T8UA 4CEHA 1J70A 2E9SA 4Y0VA 4BFXA 1E9RA 4DEYA 2R65A 4NYIQ 3OE7A 3ZDQA 3KQLA 1R4AA 1W4CA 3DOEA 5HCIA 5BN5A 3I5YA 2QTHA 3SHFA 2VIIA 3SJCA 2QSZA 1W0KA 4M22A 1HUQA 1Z6GA 1FNNA 1P2UA 1TF2A 4OQMA 5K8IA 3ADDA 1K6MA 1UDWA 3I32A 4LPKA 4DLRA 4JMPA 2IYYA 1OYYA 2OLKA 1GKYA 1Z06A 1IM2A 3Q8XB 2NO6A 2ZRNA 3NKVA 3KXIA 4LJ9A 4MRPA 2FF7A 1N6NA 2Z43A 2ZRLA 1GZSA 1GILA 3KUDA 2KBEA 3P20A 4POAA 3EASA 4RZ3A 3RNLA 4JJKA 1HQYE 1P72A 1U0LA 4AYXA 5EE1A 5J4YA 3SQWA 2CHVA 3EX7C 1KDOA 4JLBA 1QHXA 1VMAA 2A5FA 2DFKB 3DM5A 2ATXA 1P2TA 4TLBA 1FP6A 4UJ5A 5FH9A 1RJ9A 3FHOA 2MMCA 3KFXA 3W6NA 2CVFA 3BH6A 1KTVA 4QNRA 3A1SA 2QENA 3VU9A 4JBWA 2B8WA 3CPEA 4DLVA 1OKKD 1NJGA 2ODNA 3P26A 1UF9A 3L82B 3AM1A 3QQ5A 3GEEA 1Q3TA 4ZDWA 3TSOA 1N6RA 4US1R 3T06B 4A2QA 1OIWA 4B2IA 1PLKA 4NL4H 2IXGA 2HT6A 3IHWA 2GZAA 3FMOB 5JECA 3RS3A 4D26A 1HEIA 5FTMA 4L16A 5G3ZA 3M6AA 4IDQA 4ZI3A 1OJLA 1F6BA 2NO0A 1DAFA 2YYZA 5E3HA 4P3YA 2VP0A 5FBLB 5GVRA 1G6OA 4NH0A 3V4FA 2PCLA 1U81A 4MGYR 5E7JA 5EP1A 2OCBA 1XZPA 1GDDA 4A6PA 5DYGA 2QUZA 4V03A 2IYZA 2ZTSA 5A0FA 3ONWA 2WJIA 4DLXA 3IO3A 5F98A 1PVOA 4BZXA 4CEIA 3CF0A 2XSZD 1YRBA 2ZUBA 2AXNA 3TVDA 1TL7C 3QSYA 3NC1C 1W0JD 4XVQA 1GOTA 4KVAA 3NDBB 5CM8B 1W5TA 3UG6A 4YMUA 1N5JA 3U3OA 3Q7QA 4D4KA 5CJPA 2ECKA 4IOLA 3TSWA 3IQWA 5EE9A 5BWMA 1NSFA 1W46A 4LBWA 1ZIPA 3NG1A 4X8OA 2RGXA 1OHHD 2FGJA 4FWTA 1UDXA 4F4IA 3U5ZB 3Q9LA 3E2IA 1VG9B 4Q4HB 5JSZB 4KYIB 4Q66C 2OLJA 1XMVA 1KZGB 5J4VA 2XNSA 2AN9A 4AG6A 2QTVB 2G1JA 5H1YA 3DDCA 3U3JA 1M6NA 2VL7A 3QKTA 3ADCA 1G3RA 4F4CA 2N46A 2QY9A 3G5UA 4R9UC 3O8CA 2BMEA 1YZTA 2F7SA 3OESA 3ZLJA 3QKSB 3FKSD 4G1UC 1G8PA 2V1XA 4AG5A 2BMDA 2IYLD 4EIWA 4ESHA 4J0QA 1BOFA 4Z1MD 1CXZA 5DIFA 2ZI9A 2DFTA 2AK3A 1T5IA 3D31A 1PJRA 4I1UA 4D4JA 2IYVA 1LVGA 2QROA 3FHCB 1YRAA 4Q4HA 1GL9B 3LRPA 4L5BA 5J4HA 5EUQB 3VTKA 2NGRA 1CBUA 1LFDB 1QVAA 2Z4RA 3BB1A 2CK3D 4JL6A 3T1TA 2CL0X 2C8VA 1GVNB 1GP2A 5CDFA 1TNDA 1R0XA 3BH0A 3DMNA 4O25A 4KHZA 3LO5A 4TL8A 1JEDA 2QT0A 1OIXA 1T0JB 3DVLA 3ADBA 2AD1A 1OW3B 1S2MA 2JJ2D 5KTYA 5B2ZA 4AKHA 4GRAA 2OHFA 1RIFA 2CNWD 2VHJA 2QAGC 2GAAA 1NN0A 3JVUA 1SQ5A 1BKDR 1MABB 1OFIA 4FXPA 2FA9A 3L0SA 4OQXA 2ZJYA 1V5WA 2QM8A 3I5XA 3U7FB 2A9KA 1ODFA 5EE5B 4PX9A 1Z0DA 3W6OA 1UAAA 5FUVA 3ASZA 4ASUA 1P9NA 4Q7KA 3MWYW 2F1HA 3CNOA 3NIBA 1Q1BA 4CVNA 3LLMA 5JRJA 2AKAB 2FFQA 3WHKA 3VR2A 4QHSA 4PPQA 3THOA 3IBGA 2BDTA 3KB1A 3CM0A 2W6JA 1G4UR 4TL6A 4M1KA 3GLHA 1LTQA 4K8OA 1W48A 4P4UA 2ZANA 2GJAA 2J9RA 2ZI4A 5CIWA 1QG2A 3C41J 1T3HA 4OI2A 1I4TD 4DJTA 1KNQA 4EDHA 1Z0FA 4D80A 1N3BA 2KSQA 2Q3HA 5KHOC 3KQNA 4BLOA 4US0R 2F9MA 4DT1B 3DO6A 1OE0A 1GTVA 1S3GA 5J5CA 2VRWA 3K09A 1SZPA 2FPKA 4GDFA 3VR6A 2DWQA 2NIPA 4DBLC 1AS0A 4PHTA 2Z83A 1RE0A 3RS4A 3R9WA 1ZNYA 4DSOA 1VYUA 2C9OA 4LC1A 2ATVA 2ZE6A 1QHGA 1UKZA 1UFQA 2MSCB 4ERNA 4F93B 1T4GA 2PT7A 4NYJR 3U44A 1KKLA 1F2UA 3NBZC 4AIIA 4P4SA 4B35A 4MYCA 4TLAA 2AFIE 1SKYE 2EQBA 3TLXA 5FUWA 5HKKD 2FFAA 4UNQA 1ANKA 2JEOA 3KX2A 2BEKA 4RZ2A 4TL7A 1N6IA 3VNUA 2F6RA 1A1VA 3VR1A 4UKDA 4F4JA 4R71A 1R5BA 2CLCX 3ETLA 3T35A 4NBSA 3QG5A 1COWA 2E1RA 3HPQA 3QVUA 1P2VA 3UKDA 2VF8A 1GG2A 4JLMA 2OFWA 3BS4A 3NTUA 4M0LA 3C4JA 4UXIA 3T15A 2B92A 2FSIA 2ZJ5A 3G82C 4C0AC 4B2PA 4MKIA 3GLIE 1W44A 4IVPA 2IYQA 1T8TA 3LV8A 4IOKA 4TLEA 1QG4A 1FP7A 2ZRGA 3NEYA 1E2GA 4URWR 1Z0KA 5EP3A 3B78A 3EAQA 4BPBA 1H8EA 5E4FA 4W5HA 1B0UA 4IDOA 3H2YA 2IF0A 2F43B 3KKMA 2ZE5A 4A8JC 2VSXA 3FGNA 4L4UA 2FSGA 4JLOA 1KAOA 2R8RA 4W7SA 5DO9A 4A1FA 4PAOA 2JIZD 2QTFA 3LBIA 5L3QA 1Q57A 3K1JA 3R8CA 2KI5A 2BBWA 2GZDA 1VG8A 5TY0A 4G5SA 2OXRA 2G0TA 3CWQA 4HB4A 2J59A 2AFHE 4JVMA 3IQXA 5JI2E 5JCZA 1EGAA 3BWDD 4XWAA 2F3TA 2C77A 3THYA 3RS0A 4URZR 1WE2A 3A58B 1K5GA 2BM1A 3AF0A 4Q1EA 3EZ6A 3GMTA 1Z63A 2GJ8A 1KKMA 3B9PA 2NZ8A 4W5WA 3RDPA 4A0FA 3HU1A 4AKEA 2QN6A 2RHDA 3ASYA 4Q4AA 5HCNA 2ZSDA 2F43A 2NO9A 1MR3F 1PUJA 3WYFA 4MYTA 5BW8A 4TT3A 2GCOB 3G0HA 4LYJA 1EWRA 3R7WA 3CB4A 3DMDA 1SHKA 3W5JA 3DKPA 2F1RA 2GF9A 3AUXA 3OEHA 4GP6A 1FMJA 3GPLA 3LNCA 1RRGA 1NBMD 2EYUA 1E32A 1KI2A 2ZYWX 3THXA 1JBKA 2X77A 4BFYA 4TMTA 1RYHA 4M9XA 2OV2A 3U6KA 2JLXA 1KMHA 3IILA 1XD2B 3W90A 1XU4A 1J8YF 4PQYA 1XMSA 1Q0UA 3OE7D 5DHAA 5CB8A 1YE8A 5HE8A 4F38A 4QG7A 5DN6D 3O8RA 3HJNA 1XD8A 5JZVA 4C7OA 5B58C 2MSEB 5L3SB 2NZJA 2QAGA 3UMRA 1AQYA 2DR3A 4PHFA 1SKYB 1M74A 1VKJA 4IHQA 2OEPA 1DAHA 5FTNA 4PPNA 1ZNXA 4TL9A 1KYIA 1FFHA 4ON9A 2CBZA 4ZCIA 3W3ZB 4PR0A 2OO7A 4OYHA 1YR8A 5AJXA 1OXVA 1VDZA 1LF0A 4DRZA 1CJUC 2ZJZA 3L43A 3A4NA 3I4LA 2PZGA 1G7TA 4B34A 4LWZA 1KDPA 2RGNC 5GJWC 2DFLA 4XWOA 4PO9A 2RCNA 1R8QA 1D2EA 4FCVA 2WKRA 5ANRB 3I61A 4UJ3A 4NU0A 1W36C 4EPRA 1GL6A 1YZQA 5DE3A 4C0JA 4LBVA 3GJ4A 2IW3A 1U98A 3U60B 2D62A 3LX8A 1NVUQ 4LGMA 5IK2A 5F9FA 3TW8B 5GVSA 2CXXA 5L3VA 3ZVNA 2ZYTX 3EZ9A 3GLIB 5FFMA 1XTJA 1E9FA 3OAAA 5JEEA 1ZU4A 3OIYA 2ZETA 4O2LA 4URUR 2OAP1 1DPFA 1ZM7A 4JT2A 1KNXA 1IN7A 2DPXA 1IY0A 1MO3A 2QT1A 4XSGA 2H57A 4UNRA 2HLDA 1ZC4A 2X19A 1CR1A 3QPUA 3QPWA 1E4VA 1II8A 2YWHA 3T61A 4ZDIA 1XPUA 2YWEA 3MWLA 2O8EA 5GJBA 1ZM4A 3NC0C 3WP1B 4UNSA 2ZUDA 5HTKA 2QU8A 2ONJA 2WPDD 4KO8A 1UBFA 1TQDA 3A37A 2ZR0A 4DDTA 1OB5A 2X8AA 4Q9JA 1G3IA 4YMSA 3TVTA 4RD2A 3RC3A 3GJ3A 3V00A 3FOZA 2FZLA 2NPIA 2RHMA 3SHWA 1R10A 1E1RA 2Z5FA 4Q1AA 4M1YA 3K70C 1EFRD 4PZYA 4D0NA 2QM7A 3N5CA 2O8BB 3BXZA 2IYXA 2GDJA 3QPVA 2J0QA 1FX0A 5BXQC 5JHHB 4PHGA 2XZOA 1MKYA 2ZU0C 4QGFA 1E0KA 5IHPA 1XP8A 3CRMA 1G5PA 2AKYA 1NBME 3VKWA 4GBMA 2HF9A 1F2TB 1RW4A 1MRSA 4Q48A 2QP4A 2W6IA 1N5KA 3C5CA 2PMDA 3AV0B 1X6VA 4EPVA 3JZAA 3I92A 1E2EA 4CW7A 4M9QA 4P4TA 4QOSA 3TK1A 1SXJA 1IJEA 2WWWA 1FL9A 1RKBA 4NCKA 3AVPA 5ELXA 2OT3B 2R6FA 1D9XA 4TZ6A 1S96A 4JLPA 4HAYA 3HYRA 2FDCA 1G21E 2ANCA 4XVUA 4IXMA 2IL1A 4JVLA 3MD0A 2XTMA 3B9QA 2PX0A 4KITB 3THWB 1F3OA 5CLQA 4A8JA 3L0OA 2VP4A 3B1VA 3SR0A 4YXWA 1DG3A 4JLNA 1G3QA 3VX3A 1UBGA 1KI8A 4A0HA 3KQHA 2VLIA 3ZH9B 1DVRA 2CDNA 4DCNA 4TLDA 4B3FX 2BEJA 3W8NA 1SGWA 4MDEA 1N6PA 1U0JA 5G3YA 1E99A 2XTNA 2OILA 4K81B 1DAIA 3RHFA 3QXXA 5B30A 4HLUC 1TF5A 1AGPA 3TBKA 4JVNA 4KBGA 1KGDA 3TR0A 4KCGA 4EFLA 4B74A 1P3JA 3PFIA 4JYCA 5D3MB 2WSMA 5K8UA 4JLDA 2CLDX 3AVYA 1KO5A 1W49A 1DAGA 3AKCA 4ACBA 3AVTA 3L0IB 3ZVRA 3A4MA 2ZRMA 1HT2E 3WBJA 4B2LA 2ZRCA 4TMZA 4DEXA 1PUIA 1T6NA 5DH9A 3PUZA 2GAOA 2QMUA 1KJYA 1TTTA 4RFVA 2ZJOA 2Q9AA 1HTWA 1XEXA 3TUIC 3AF2A 3QUSA 1Z0IA 2J41A 3E5HA 2D3WA 4G3XA 3A8TA 1G1MA 5SZKB 3DPUA 3TIFA 5C18A 1L4UA 4LHYA 2ONKA 1NVVQ 3RWMB 5EZ5A 3X1YA 1SVWA 3KJEA 3W5IA 4G5GA 3CKLA 4RFSA 1AGRA 2WKQA 3LQQA 4EUNA 3QKRA 1G291 2Z6VA 3S1AA 4MKHA 4RD0A 3EW9A 4ASUD 4W5JA 3NH9A 5L3RA 5FUXA 1X1SA 1XCGB 2H16A 3MLEA 1L2TA 4AYTA 1P61B 2HJGA 1E94E 4II7A 1VCIA 3AKYA 1E9DA 1ZM2A 3BD9A 2ZROA 4A82A 1JB1A 5JWRA 1J99A 2BBOA 1R5NA 1UJ2A 2W6JD 5KDOA 2CEAA 4BZPA 1FZQA 3T5DA 1PLLA 4JSTA 2QBYB 3B1YA 3ZS9A 3AUYA 421PA 4B43A 3QBTA 4RKFA 4CT5A 3LW8A 2RGNA 2ZRFA 2O8CB 1R0YA 1Q1EA 3CRVA 4X8HA 5JFGA 4KODA 3C8UA 4GZLA 3B2EA 1IN5A 2N1BA 1UPTA 2OFOA 4KSBA 3IPXA 1WRBA 1KI3A 5AWFC 5HPYB 1A7JA 1KI6B 4C9BA 3U7HB 1W7AA 4M1WA 1XCPA 3BFKA 2PLRA 1XPRA 1DADA 1E4YA 2OFXA 1XTRA 1Z83A 4MGIR 5EQTA 4PSVA 2IUSA 1C9KA 3UWOA 2EVWX 3B5JA 1EFUA 3OZXA 3UMSA 1OXTA 1E9AA 2GXSA 2K5UA 3LAWA 1R6BX 2IBMA 1RRPA 3W34A 5FPTA 1Z6TA 2YHSA 4OQFA 4QM7A 4QJ5A 5EXSA 2KE5A 4GP7A 5AK0A 1G7RA 5B64A 2JASA 1MRNA 4NCHA 3W9YA 2JJ8A 3FFBA 2H92A 2VF7A 2VHCA 5CK5A 3QBVA 4RSGA 1A4RA 2WSSD 3TQFA 4BLRA 1TX4B 1A5TA 2VHQA 2YNMA 4C4PA 4XD7A 1CJMA 1SHZA 5CDFE 2J1LA 1RJ9B 3QVVA 1N6HA 4PSKA 4C2UA 2QGNA 1JECA 1S1MA 2FWRA 4IEEA 1CS4C 1D5CA 2CL7X 2B7CA 1W4AA 3K8YA 4FWIB 2IEZA 1G5TA 1KAGA 3Q5EA 1UEIA 4U7DA 1HE8B 1GL7A 3MUFA 4XH9B 3VU9B 521PA 4H9GA 3SQXA 3JZMA 4HDOB 3PJRA 3D7MA 1OXXK 4DB2A 3SYKA 3B8HA 3B1ZA 3H0KA 4A92A 4LYAA 1H8HD 3FWYA 4JT4A 4Q1DA 2VHTA 4MGKR 5CB6A 1CIPA 2BJVA 3GLGA 1BMFA 1E9BA 1N25A 3CNNA 1U94A 2QRNA 3CPJB 1N2CE 4YQFA 1P75A 4BEJA 3SN6A 2WWYA 2PH1A 2ZPTX 1E2JA 2A5DA 3QY0A 2IF2A 1E0AA 4IVQA 4IKEA 4DCUA 5EP2A 3ZZUA 2D74A 3T12A 4YLGA 1JI0A 2YOFA 4AK9A 4HLDA 5C2JB 1ZBDA 1MT0A 5KPDA 5AJWA 2VSOA 3HPRA 4HB3A 4CEIB 1XPOA 1CF4A 2C04A 2IXFA 1FOEB 4LZZA 1AKEA 3IUYA 1LB1B 1CRPA 5HZHA 4G0NA 2QQEA 1S9DA 2H5EA 2P6UA 4HLUA 5JI3E 2JLQA 2RGGA 1EWQA 1UKYA 2F9LA 2FNAA 2NOAA 2ZVPX 4GPTA 4TT3D 5HE9A 2J0SA 3GLFA 4LHZA 5FL7A 2I1VB 2I3BA 3CNLA 1KK0A 4FMBB 3BC1A 4FCWA 4UXHA 2XNDA 5E7IA 1E2MA 3GFPA 3K0SA 2IX3A 3IIJA 2W2XA 4JLVA 1XZQA 2QNRA 2ZYVX 4DCVA 2WKPA 3K0FA 4IOMA 3SYLA 2BVNA 2WOOA 2WV9A 5J4LA 4UNPA 3PENA 1VTKA 4BFVA 1Z3IX 5C4MA 4ZIRA 4MH0R 4KSCA 4Q19A 4F91B 1YZNA 3CR8A 3RABA 1XBTA 5KDDA 3LDAA 3ZZTA 3SU8A 1NSTA 4TWZA 2R6DA 4PC3A 1TADA 4GMXA 5TB5A 2CE2X 4YC7A 4I1VA 4IDPA 1U8ZA 1D2NA 4HAVA 1NJFA 2FG5A 2BMFA 2FN4A 3NH6A 721PA 1X8LA 1CTQA 3LVRE 4JLKA 3RAPR 1KDTA 4EJSA 3SBEA 2ZRHA 5EZ6B 1E0JA 3TUZC 2ORIA 3UWKA 1B23P 3WMEA 2JCSA 1MO6A 1ZD8A 3I8XA 2WIBA 3KJGA 4OI0A 3NXSA 2O5VA 4DDVA 2CJWA 2HJVA 2WJVA 8OHMA 3KXKA 3U3KA 2MMGA 2ODBA 5E7MA 4N0EA 2C78A 1XJCA 3PEUA 1XTKA 2BV3A 4I1SA 2HF8A 4RJLA 4XOIA 4DLTA 2PZFA 1JNYA 2GJKA 4DUGA 2AXPA 4RVCA 3WXMA 4B33A 3RANA 3OAAD 3AF3A 4PANA 2EU8A 2ZS9A 4Q7LA 1OFHA 2C96A 2W00A 2X2EA 4I4LA 5FUYA 1Z22A 5TARA 1QHHA 3ZD7A 1AJEA 4DSNA 5DISB 2FJUA 2FZ4A 2DYKA 4MUBA 1AA9A 5JLJA 3P4XA 3WMGA 5KNCA 1NI3A 1NF3A 1WMSA 3PEYA 2QE7A 4KFRA 2IYRA 1AN0A 2UKDA 3I72A 3SFVA 1OFTA 2BHRA 3TSZA 4BQSA 1GM5A 1MOZA 4B3CA 4NYJQ 3KQUA 2IWRA 2A30A 3GEHA 4XTRA 1OV4A 5BYKA 1XJ0A 2OCAA 4QBFA 1JAIA 2VTKA 2YOHA 1N5LA 4L9SA 3GLHB 1OXUA 3HDTA 2W2VA 4S2EA 2V54A 4M8NE 2Y8EA 1CJKC 2EW1A 3RVBA 3GEIA 1I2MA 3AGPA 4PPGA 1G5RA 5J4KA 2CCJA 4OJKA 4NCIA 5G41A 4CGZA 3RRZA 4FIDA 4FINA 1XEWY 2REOA 2Q3FA 3B6EA 2A5GA 2F55A 1WDTA 3LH5A 5JBQA 4TSFA 3BGWA 1IBRA 4GFDA 4C0HA 5C4GB 3RLFA 4A2PA 2OZEA 3SEAA 1TU3A 4DIDA 1Z8FA 2C9YA 2V3CC 4BGDA 1SXJD 2RGDA 2WHXA 2BMJA 1NMZA 1DELA 4RZXA 4A9AA 3QEOA 4DKXA 2VBCA 3L2OB 2LCFA 2EFCB 3U44B 1E2PA 1F2UB 2EFHB 4PQRA 4P4SB 3C14C 1TQ2A 4RZUA 2P0EA 2ZI5A 4QKQA 4C2TA 1HURA 2HV8A 4ZO4A 4A0RA 3NBXX 1L8QA 2BIFA 2FX3A 2WAYA 1PZNA 4LBYA 3PUXA 3KKQA 2QSYA 3BORA 2JDIA 221PA 2R6GA 4WW0A 1R0WA 2ZSFA 1WA5A 2HXYA 4DVGA 3BB3A 4A15A 2WJYA 1ETUA 2C99A 4RY2A 2FV8A 1QF9A 5AUQA 5SZJA 3K0CC 4BLTA 1OH6A 2QZ4A 3X1WA 621PA 4XIGS 3P32A 1VCOA 2J7PA 2W83A 4HAXA 4OQLA 4MKFA 2EFGA 3R9IA 4PSAA 1SULA 4B73A 2Q3MA 3TAUA 1WQ1R 2BCJQ 3M0EA 4PC6A 1S1CA 1X8KA 3PITA 4RD6A 5H70A 2WMNB 4Q00A 1OXSC 3CZPA 4TTQA 1JR3D 1NIJA 3AB3A 2QPTA 1S8FA 4LHXA 1DARA 2NTYC 1JXMA 3OFNA 4IDNA 4LUCA 1JR6A 4PC1A 2CCGA 3AGQA 4TTPA 3I3SR 3LXRA 4GL2A 1TEVA 3QOFA 1NL3A 2J46A 3AVOA 4JYBA 5FTJA 4FMDF 2QMHA 3IO5A 3RC8A 1W4RA 3IGFA 4M1MA 2OG2A 1XXHA 4UQOA 5L3QB 2IA5A 1P2SA 4LPSA 3H84A 2ZS8A 3ZVMA 3FHTA 3VX4A 2DWPA 4TYNA 3MMPA 3WMFA 4FMCF 4O2RA 4I81A 2BC9A 5LD2C 5FI1B 5AUPB 2RMKA 1YQTA 2IS6A 4V0NA 3B1WA 4EQ6A 3SFZA 2JGNA 3LD9A 2RKOA 4WAUA 1KI9A 3THYB 5TVKA 4TMKA 1CR0A 2V9PA 1G9XA 2WJJA 4M4SA 2PZEA 1AS2A 2ZRBA 3LY5A 1XRJA 1HH4A 4AY2A 1GUAA 3CRQA 3P4YA 2VP2A 1GAJA 2V8OA 2ZSEA 3CRW1 3H86A 4LYHA 4Q4AB 1JEEA 4B3XA 4H1UA 1E2DA 3R7WB 2UZ3A 2P3SA 3OIVA 3QXHA 4HB0A 1H65A 3CR7A 2GWHA 1OYWA 5CIQA 1QHNA 4B76A 1F5NA 3SC3A 3W8RA 1E3MA 1SXJE 1J8MF 1U2RA 1E2NA 5KNBA 1G8YA 4URXR 3THXB 2QMEA 4HDQB 4KFTA 1DOAA 3O47A 1KMHB 1J7KA 3SDZA 2QPAA 4CIDA 2ZAMA 6Q21A 4RD1A 1G4AE 1WBDA 1OT3A 1Q3HA 3TQCA 3AP1A 4C7OB 2JAQA 3E70C 4EPXA 2QAGB 4Q18A 2ZXUA 5K8TA 2QQ0A 1EG7A 1HT1E 2IK8A 1VIYA 1M7GA 5EXXA 3IKJA 2PJRA 1M7BA 4E22A 1HE1C 1LY1A 1EFHA 3HR8A 4ARZA 2XZPA 2IS2A 1XJQA 4LI0A 2RGCA 3ZYCA 4AYWA 1NMXA 3IEUA 4GSYA 4RD3A 1ZM9A 3KFVA 3LX5A 3MAAC 3PUVA 4XJXA 3UXMA 3RS2A 3KQKA 3DL0A 4QBGB 2VSFA 3NBYC 2J0UA 1NLZA 2AWOA 2CLSA 1C1YA 4W9MC 4Q1CA 1GNQA 1LNZA 1AIPA 3QF4A 1NVXQ 1JR3E 3RYTC 3E1SA 1T3SA 5FBRB 1OKKA 4DDWA 4XD7D 5JHGB 4HYYA 3SBDA 4Q7MB 3KJHA 4PQFA 3IEVA 2FFHA 4GOKA 3SS8A 1ONBA 3U3MA 3VHXA 4CF7A 4Q5IA 1BYUA 2EWWA 1W0KD 3HP1A 4TYPA 5F9HA 4MRNA 5FOUA 4OI1A 3U7GA 4P32A 1ZYUA 4Q4JA 2NG1A 1VECA 4P31A 2LKDA 3CLVA 4GMDA 5JWHA 4IXNA 5FL3A 2ZREA 2FPLA 1SVLA 4KV9A 5FOTA 4NP6A 4N3NA 1KY2A 3B7GA 4IFEA 2GETA 3H1TA 3K0EA 3T1VA 5LB2A 4KU4A 1II8B 3O8BA 4LJ7A 2O8EB 5AUOB 3WYAA 1FQJA 1EXMA 1P9WA 3FFAA 1U99A 3LQRA 3SE0A 4DB4A 3NHAA 1Q21A 2NO7A 2KWIA 4LC0A 2WOJA 1KJZA 4KLNA 5KSPA 1ZNZA 3CX6A 1W0JA 4DCSA 3GP8A 3TH5A 4US2R 1HQCA 5BYJA 1VCNA 3L0PA 3UMFA 4A4DA 2BOVA 3HWSA 4OHXA 1G7CA 4MKGA 3NWJA 1FX0B 1UKVY 3C7KA 1SVKA 2XXAA
chains in the Genus database with same CATH superfamily
1IEXA 1Q14A 1VMEA 3CH7A 4L5CA 2MT9A 4JLUA 3VQTA 1IQ0A 2XQGA 2HTEA 1ZUHA 2JFYA 2GPBA 5CK4A 2GXQA 4CI0B 1VJRA 3RYFA 1GPYA 2NU7B 2UYOA 1IL0A 1RP1A 3ANYB 5TS2A 1QRUA 4RA9B 3HACA 3L1JA 1NY6A 3ZWMA 2C2YA 4V0ME 2QL6A 1T0PA 5AVWA 3CQ9A 1DHTA 5JMTA 3LW7A 3AUFA 4MR9B 4KRXA 5FF9A 9ATCA 1RXVA 5BQ3A 3KWJA 2XNDD 3VOTA 1GRNA 4QYWA 2QA5A 5E6RB 5IJZA 2FR0A 3UUGA 4WZAE 5KTPA 1Q12A 4ED9A 1CULC 4LVNA 1C7ZA 1E77A 1M2NA 4OHWA 1LK0A 2Q45A 1PFQA 2ZAGA 1CPYA 3JASA 4MLZA 5DLEA 5HFNA 3OZBA 4CMHA 4RTLA 5CCXA 3WO1A 3N87A 3KLBA 3VZSA 3WRVA 4LDQA 2E6UX 3ECCA 1PBNA 2GPYA 3LE8A 4FUQA 2O0LA 3H04A 4QHTA 3UANA 1PR4A 2Y6VA 2PK3A 4GRIA 3GLQA 2PT5A 4RWEA 3RU7A 1WXQA 2CEKA 2DRIA 4EJ6A 4E5UA 1NX9A 1EESA 3CX3A 5AVTA 3FDIA 3I09A 1NW3A 3PFWO 4OPMA 1FIUA 2QRJA 4BVEA 2VPXA 1Y7TA 1JL3A 2HWKA 2IEYA 2HRRA 4IJQA 1C7FA 4URVR 4PIPA 3BCUA 3WLNA 4QARA 1ZH2A 4KGZA 5TPZA 1T8RA 2PTGA 4PC7A 3LPLA 4JC4A 4RPHA 1E0SA 2HPAA 4RENA 4CQMB 4S2UA 3ZCVA 3RIYA 1BS1A 3I76A 1Y8QA 1DKRA 2YN4A 3F7OA 3GP3A 1KO8A 4HVAA 1WDKA 3AO0B 4F85A 2Z1MA 4O5OA 3GRRA 2ECQA 1M2GA 4UHDA 4YQZA 4LF9B 5ESRA 3BOSA 3KQWA 2KHZA 3EZGA 3P27A 5ALHA 1D6MA 3OJEA 4F3RA 2C59A 1LV8A 4E33A 1KJ8A 2BM9A 4JJIA 2O8FA 1IUNA 1CRQA 4I1YA 2CMGA 1OLOA 4UHJA 3E9MA 3SG0A 5KNDA 2RGRA 4IINA 3ISTA 3FWKA 3UT5B 3AG5A 1IC6A 2E4UA 4PS0A 1JJIA 5KPJA 5JNVA 2AQIA 5CM2Z 3H5IA 5EJ5A 1XDBA 5HBGA 3DOFA 4GOXA 5KSYA 4XI9A 1EXWA 2HRQA 2AFHA 2ZI6A 2FR1A 3IPAA 1AHNA 2I1LA 4BEBA 3RYIA 3PR2B 3I0ZA 2GKSA 4D1YA 1JGTA 3EWSA 4BNNA 2R97A 2I5PO 2BGLA 4O29A 4ILKA 6ABPA 1SBQA 1X3LA 2V7TA 4BECA 5BQOA 2WJ4A 1XJ5A 3L18A 4D4IA 3W6PA 4LX0A 4UDXX 2RFLA 4MUGA 4PRKA 4QQNA 3DLAA 2CDRA 1DHRA 1ZISA 4ZT4A 5K7SA 4V0QA 2B1JA 2JAWA 4K9QA 4I4TA 3KU4A 4EMBA 1KIMA 2BF4A 2OD7A 4R2MA 1ES9A 3HO6A 4EI2A 3EZFA 4RKWA 4N8DA 3OG9A 2B2XA 2QP9X 1ORIA 2ISCA 3C3AA 4GOND 1MJGM 4I1PA 1R8YA 1OLSB 2GUGA 1QV9A 2XODA 3GJ8A 4LF7B 1MX5A 5FOXA 4LMAA 1L1EA 3F8WA 4YMVA 5L4LA 1RACA 3OX4A 4KLRA 1MO5A 5CB0A 1UADA 2H2FA 3NGLA 4LRWA 1HKHA 2QTLA 3FPFA 4CEHA 2VPWA 2P4SA 3PX3A 3UV6A 4EB0A 1BWQA 4F06A 5KO2A 1WSDA 1DJLA 3P1JA 3RUHA 2V96A 5A03A 5JQGB 4GOJA 4R1PA 4ZPXA 3IELA 4EITA 5JV5A 1QTQA 1TEHA 3C1AA 1W75A 1L7OA 2I6SA 4DCOA 3WNBA 3A0UA 1AF7A 2OGTA 4ZT3A 1II0A 1E1QA 1MB9A 1QDUA 3KWLA 4MR8A 1N1MA 4HC4A 4OHFA 5FXMA 4CF3A 4HNVA 1TB4A 4KQMA 3EIEA 1A5AB 1WU7A 3N0XA 1SCNE 3KZ1E 4GBGA 1HYQA 2BEWB 4RJTA 3E23A 4D2IA 3GR6A 4FFSA 1DC8A 3BIWA 3DEZA 1Z4QA 3L8MA 3FBWA 4JBIA 3ZE8A 2QP3A 1P5RA 3A2LA 4IZIA 4QGHA 3WSVA 2P3OA 2PUWA 4BNWA 3EH2A 1U8AA 3NBQA 7ADHA 1KK1A 2BBSA 2PR7A 1FUKA 3LUBA 4OLJA 4HATA 4YPFA 3RRMA 4E13A 1A82A 2R6HA 2YWRA 1AUQA 1FNDA 1UPAA 2QZPA 4G1BA 5EJEA 1KJNA 3FD8A 4MUEA 1XQ9A 5JS8A 2XE8A 3UAVA 1MB4A 4B6FA 1Y7PA 4JN6B 5H68A 4IOJA 4EK9A 3HU2A 2OCXA 4H0NA 3G02A 3KR0A 2H59A 2Q41A 1PV1A 1QE3A 1JSXA 2I71A 3K4PA 3AKDA 2ZIAA 1MU0A 3HTXA 2Z2XA 3W78A 3T3EA 5IN5A 2A3NA 4QIHA 3G2NA 1EBBA 3IH5A 2GF0A 1UMBB 2JK0A 3A1FA 3OFND 3PPXA 4KOAA 4EYGA 4X6YA 3KDSE 5K2OA 2Y6UA 5J58A 1UC4B 4W1SA 3O84A 1Y4AE 4R3UC 4D82A 3OWOA 3LA8A 3UJ9A 2JVKA 2X1VA 4EFNA 2DHDA 2WHYA 2R96A 4INZA 4PV7A 3RVDA 4IV0A 3FYSA 1RCUA 2JBHA 2J30A 1C1XB 1IJKA 3FCYA 1GL3A 4LJSA 4TX1A 4ZV4A 2ZDGA 2AZTA 4NENA 1N0VC 1MB2A 2CUTA 3QFRA 4YMIA 2OE2A 3O9MA 4BX9A 4ZO8A 4M8IA 3UPUA 1FVHA 1GCUA 1TI7A 2I4IA 2XKJE 3AFOA 4XVCA 1G20B 1W5BA 4KYTA 3GCZA 5KTSA 4E07A 3QFSA 3HN2A 4QFCA 1QGUA 4D25A 2P2SA 2HNBA 5D1HA 1ZOIA 5CR9A 4AAYA 1JZTA 2GKGA 3F6YA 4JFRA 2H1OA 1OI2A 1MVLA 1NGSA 1WZCA 3DHWC 4G8DA 1V41E 2JKVA 2BKEA 3PPWA 2UZ1A 2OD2A 3G17A 1NXQA 1PFVA 2IGTA 4XFJA 4ESEA 4PSUA 4RTRA 3WWEA 4E1BA 2I8CA 4CM1A 4L2IA 3DKKA 1W59A 1RQLA 1HNWB 4DA8A 1XYYA 3HABA 3COWA 2GNOA 3E7DA 3BMCA 1MT3A 2R00A 4RMNA 2C5AA 4TWAA 2PA0A 4UD6A 2ZKLA 5AJZA 3R7NA 2AJDA 3UJPA 3MIIA 3U81A 2ZBUA 1CUAA 1T5HX 2QPOA 3ACDA 1F2DA 1I0IA 1SVUA 2VQSA 2YRXA 2BFMA 3MMZA 4ENQA 1X0XA 3I9NA 4AX8A 5DGCA 3AB8A 1G21A 2XOKA 1MC5A 4RANA 1J1ZA 5HGJA 5DTEA 1H94A 3RC9A 3FUWA 2XW6A 1CJTC 1FCJA 3JQ9A 1ZK1A 2FSSA 2WWRA 4FK8A 4MXDA 1PHPA 5BSTA 1ZMXA 4AW9A 4BB6A 3OY2A 2C83A 1WP9A 2NUAB 1QVRA 3N8GA 2UVDA 2YTZA 1BHSA 3GLHE 4ZVTA 3O4IA 2PNFA 3CVYA 4QGSA 3MWFA 4YONB 3LHDA 4RK4A 4ZIRB 5JZMA 4HNGA 1CKEA 1J2JA 1THGA 4BX3A 1RYBA 3FI9A 1J06A 2DG2A 2KYRA 2NO1A 2QVYX 3Q88A 3USZA 5JSKA 3OP1A 4IDHA 3LOQA 4OSPA 2ZBRA 2ESRA 1GRRA 4NONA 3OQBA 3NB0A 3UJ3X 1LZKA 2VYCA 3K9HA 1R4MA 1S9HA 1JG1A 1Z74A 2CMHA 3QZUA 1OFUX 4XUCA 3N59A 5ALMA 3HYTA 3QPCA 1Z0JA 1M33A 2EYQA 4MQBA 4UM7A 3TJMA 1EVZA 3H5RA 2XRFA 1OT5A 1Z6XA 4D99A 5MGBA 2XTZA 5EFOA 4PNZA 4E31A 3TLGA 4JYMA 1LH0A 2J3QA 4DV3B 4I4TF 4MRAA 4DV6B 4G1FA 3BB4A 4OMFG 1XCLA 2P4HX 2XUFA 3VZQA 3AETB 5TQVA 2NUAA 1XDDA 5J47A 1K75A 2QUKA 3HBLA 4RABA 2FSUA 3AXSA 1U1IA 4MDFA 1BW9B 3ZW8A 2R44A 4BFCA 1YZ3A 3AOEC 5CM9C 1II9A 5F1PA 2ZE7A 3P2OA 4AJOA 5T7BA 2XB9A 2ZBGA 4FEAA 2PLFA 2WU3A 4JR1A 4IWXA 2OAQ1 2VSYA 1EXDA 3DA8A 1SQ0A 2AWNA 2N42A 3WNCA 5JS1A 3JR3A 4PLPA 4M7RA 5KWIA 2GUWA 5BQ5A 2J5XA 3CVUA 4L95C 1FS6A 3S8EA 1E98A 2GLTA 3IDQA 3EGEA 3KL4A 2AOTA 3OZ7A 2LXNA 3HMKA 1I10A 2COUA 3M5CA 4ZHSA 3GZJA 2YC4C 3ZQJA 2AVDA 3M4YA 3ST7A 2VWQA 3U61B 4JI8B 1Z5NA 5CLLA 2JGFA 5E4YA 2ERYA 4CRWB 1ZPDA 4REQB 5K45A 2D00A 5FOSA 4KX3A 3WAGA 4E09A 1NKTA 2HWYA 4PCLA 5H82A 5HR5A 2BH2A 2VT2A 4I9GA 2WZDA 5LB4A 1TUEA 5EVCA 1LPAB 2VPPA 1RLOA 3BD8A 3EVZA 1XAJA 1OBVA 1AXRA 5JMWA 4RPJA 1UWVA 1GTSA 3DONA 2JCXA 2IPMA 2AR7A 5KDLA 4DNQA 1X86B 4QFMA 2VWGA 1IZZA 3WSTA 4ETIA 3NAMA 4DZRA 3R20A 4B85A 1E2HA 2Y27A 3TZQA 2Q1XA 1SOMA 2P0YA 3UCEA 2GJSA 5H80A 2JRCA 3DAOA 4EO7A 4Z4IA 1KQFA 3EISA 1KY5A 2FEAA 1QVWA 4IIFA 3HJGA 3GW8A 5CLIA 5K8LA 1BH2A 4X1IA 1YQEA 5THQA 4M99A 4ZP1A 4C5CA 2OO5A 5HG0A 1CJSA 2QDKA 5DW0A 2ZI7A 2C4UA 3DVAA 1IB6A 1YBVA 3AEZA 1HE3A 4H1TA 4LOLA 4P93A 3SKVA 5BT8A 3FZEA 2PDAA 1SBZA 2HV9A 1J0CA 2FRDC 1JH9A 5CT6A 3ICQB 3O4HA 3HMQA 5EHQA 2BR4A 5CHEA 5FULA 5KQRA 3ODPA 1TF7A 3DCJA 4JGGA 3SY8A 3B51X 3EMVA 3SI7A 4G5RA 4EABA 4JODA 2GBFA 4K05A 2XY4A 5K4GA 3HVHA 4Y1FA 2C29D 1TGYA 3DKVA 5IM4A 4B6EA 4ZI7A 1XROA 4A36A 3CSDA 4ZCLA 2W98A 4ERXA 4B75A 2FSPA 1ESNA 1I7DA 3ZCXA 1ODSA 4UTVA 3R0IA 3V4RA 1YHNA 2PGJA 2QQ5A 4UDNA 1CQIA 4QBHA 3JD4A 4JBXA 2H2DA 3KKZA 3CCBA 1Y8RB 2XEXA 3MYYA 3PNBA 4UE3S 3V8MA 1RBQA 2DSTA 4FFDA 5A62A 4WOJA 2BFCB 4OJQA 3WWCA 1Z4IA 3ZK7A 1U4SA 2F2TA 2DFNA 2IYAA 4BUJA 2WFAA 2FW6A 5I51A 1NE2A 5ICFA 4CG1A 5I8WA 4Y1RB 1Z17A 2NTJA 3M6IA 1ZO8A 1WUHS 3C3MA 4S1WA 4BO8A 3OIUA 3GFSA 4OFWA 3NDPA 5JPIA 1IN1A 2XDWA 2GMWA 4G85A 2BTQB 1AQUA 4GM0A 3TWOA 4KI0A 3VAZA 3E22B 5JANA 5IT9A 3CBQA 4ZRNA 3GDHA 2J4FA 1FX1A 4BRWA 1R6UA 4UMFA 1PGPA 3KTAB 2JJ1A 3KR9A 4EA7A 3ZXSA 1NWHA 5FBVB 3ROMA 4YXWD 4Q3NA 3LC1O 1TYZA 2G88A 3QI2A 2VTVA 4REOA 3SNKA 3NHPA 4UNNA 4R1LA 3TD9A 5KNDD 1G2QA 1R16A 1J90A 3UK0A 3D6MA 1SKUA 1A7AA 2CDCA 1P2FA 4PHHA 3X1ZA 3IQGX 3SSMA 3FCUB 3GOHA 1ZQ9A 4F2GA 1Y6RA 1XXHB 1JDUA 1EAYA 2IEDA 2BFCA 5CVEA 1VKZA 3V42A 5A4DA 1C3OA 1U5BA 1RHQA 3TW4A 1E7RA 2QGFA 3D8BA 3HUUA 3I9V1 3CZQA 3JVVA 3ONEA 4G8BA 4KJXA 4WIAA 4G4IA 3NWEA 3W9SA 1Y89A 4NZNA 3IDSA 2H1WA 2XMCA 4CQMD 1ISSA 2HA6A 1NVGA 5F4BA 3RSLA 2KS6A 3QKUA 2AN4A 3WL8A 4WXEA 4NCBA 3J81k 3I45A 5CW2A 5J40A 1YH3A 1DG1G 4WL0A 2ACWA 4DC1A 1J07A 1U7XA 4V38A 1ZHHA 3KTAA 3PGA1 5F5LA 1QB7A 1X7HA 2GPAA 5IAKA 3MBKA 3ZJYA 2W42A 3NJRA 5JJIA 2B4QA 4NJOA 3W6UA 4HN4B 4DBLE 5TXGA 4EY4A 1W6UA 3A3YA 3PT5A 4OD0A 5DHRA 3EIQA 1AO3A 3DR5A 2IYTA 1MC8A 2XEDA 4GOLD 1XNGA 1A72A 2JKYA 2NVOA 4RD4A 3KKNA 2QI9F 3NDIA 1E1DA 5IUNC 5IYZA 3QEKA 1P1KA 5A1TA 1IAQA 2ANBA 1ORWA 3KUCA 1VHLA 2GESA 1ADJA 1I0LA 3MEQA 4X20B 1SU6A 2R1TA 4L1KA 2CSXA 3GJ6A 5IXSA 5JOQA 2VF4X 1HRDA 1VLJA 5FEMA 3KQOA 4EFKA 3MINB 3I2KA 2OVFA 2XBMA 1QJ4A 4RV9A 1MIOA 2WWIA 1VHTA 2FQ1A 3K3PA 3OPYB 1E1QD 1Q20A 2WSYB 1YNOA 1UANA 3FTQA 3QY9A 5LIPA 3SS9X 1JG7A 3ZTTA 2C5HA 3BERA 1AK2A 3H5AA 1OU4A 4MIOA 4OREX 4CL8A 1MF7A 5HKAA 4DT1A 3X1DA 4RTMA 1PEYA 1XV5A 1WMDA 1YULA 5ER6A 1DAEA 5K6TA 5HDBB 4L0CA 4EPTA 2N3ZA 4EMUA 2XF8A 2CJXA 1WKBA 3IMEA 3JVIA 4Y0AA 4BFWA 7YASA 4HWRA 1JSCA 1Q1NA 4WDRA 4IFIA 5FPHA 4X71A 5KQSA 5DFAA 1V8DA 3IJRA 3PQCA 4RZIA 3PTLA 2PZBA 1RVDA 3AI3A 4CMEA 2WU4A 2J6IA 4U5XA 2MYUA 1QE5A 3AFIA 4FEYA 3SC2A 2GRAA 1IPHA 1OYVA 3QF4B 4HDKB 1J49A 2QT9A 3FMPB 5H81A 5JJKA 3HKBA 4B3MB 2AUNA 1FFWA 3GMIA 3MLAA 1S0UA 3TB6A 2JIMA 3W1VA 3E6AA 3M9LA 4NPAA 1NJ2A 1T15A 2XAUA 1B43A 1C2TA 3FAKA 4XD2A 1DP4A 3CSUA 5DWVA 4PN7A 1H8HA 2W2PA 3FPKA 3IUJA 3VHXB 1I2DA 3K05A 5DI3B 1PQWA 1H2ZA 1KR5A 2GVZC 2HXSA 5DBGA 4X1YB 1N4DA 3L7DA 3WRYA 5JNTA 4GZMA 4QUDA 5FLXA 2ZYHA 4I6GA 2H1LA 4D0GA 4XQGA 5JYEA 3TOZA 3W8FA 2DF8A 2H18A 4RDXA 4RKRA 1V1MB 2MSWA 1XZKA 1N9KA 4YDSA 3VDNB 2SHKA 1E2KA 5JW6A 3VGPA 3G2HA 4ZKDA 3QSGA 1E6KA 3AVUA 3T3PB 2WYUA 3L79A 1XRNA 4X93A 2QX8A 4HRVA 3PQ7A 4L4SA 4Z0NA 5HIIA 3LM8A 1RIIA 2XOEA 1V4NA 3I83A 1UKCA 2Q2VA 1ZJJA 3RJ9A 4MHTA 3ZGZA 2XYGA 4WFJA 3EG9B 5FWXA 1AKYA 2C07A 2CDBA 5K3AA 3ZXXA 5LC1A 5IDQA 4GWGA 1Z8NA 3WB9A 1S6YA 4ZI7F 5IM4F 1T9GS 1TW3A 2AG1A 2C5GA 4JI0B 3HDGA 2EF1A 5E4TA 2H7CA 1VL6A 2HFJA 1OBOA 4NMMA 4FCCA 5DI3A 3BCHA 1DZ3A 1DBPA 1DOZA 2BWJA 2YFKA 3TW0A 4EJ2A 1MUUA 2Y77A 4FT4A 1C3VA 1G7SA 2PS1A 1EGQA 2CB0A 5EG5A 1JQBA 4QRDA 3TTUA 3ROEA 1XDUA 1U11A 5U4XA 2BGUA 4MW7A 4OK5A 1NKSA 2FSFA 4WJKB 3S4YA 1I1HA 3UT0A 3E15A 1I32A 2ZLBA 5CLGA 4EOGA 1V8PA 3GEGA 4EHIA 3IBTA 1U8EA 4R9SA 1L4YA 3SMVA 4LXUA 3SBXA 2BI7A 4NBLA 1KQ3A 1H2AS 1L7XA 2XOKD 3CC8A 5GJVC 1WF3A 3HA5A 4OA5A 5F1OA 4V02A 4NDZA 4L9RA 4QATA 3H3XA 3VNRA 3IR6A 4LV6A 1XMJA 4QXOA 4AWAA 2FEOA 1ID1A 4F4DA 5KMGA 2A86A 1RWKA 4E2YA 3HY3A 2IBSA 1OC2A 2JAOA 4RHEA 5AQ1A 2FMUA 5E2AA 4JEUA 1FTSA 1R6AA 3ICWA 1YVRA 1NFRA 3FSGD 4YUYA 3EG5A 2V6FA 5JRDS 1AHPA 1JLLB 4HLQB 4HLCA 3L7LA 5CB4A 4FYXA 4CLEA 1ONSA 2HK8A 5EKTA 2ZVJA 2WZBA 1PQYA 2VBIA 1FW6A 1R74A 2PYDA 4DLUA 2B3TA 2FMXA 1CR2A 4HI0E 1YI1A 5EWJB 4ITRC 3RSFA 3VYWA 2GXUA 1ECLA 1XD2A 3DQZA 1OFGA 1OROA 4K6GA 4FCTA 4LY6A 5SZHB 3D81A 4XPIA 1U9ZA 4AC9A 1ZUWA 5BNZA 4N5MA 4G5OA 4N39A 5FR1A 1JJBA 3B85A 1XIVA 3JQAA 4ZEWA 1Y9EA 2VP6A 5LWHA 3D6HA 3A6FA 2C2BA 1BHO1 2HWXA 5UKDA 5L8VA 5LYJA 3D3QA 5IVDA 1PWEA 1TCBA 1GAQA 2AFIA 5KU1A 2JG3A 2XRZA 4LDZA 4KE9A 4WECA 3BQNB 4RHTA 4NESA 4CFYA 5KQMA 1SBYA 1RJEA 1V1RB 1K6JA 1IUPA 2BKUA 1N7GA 2ZI3A 4L08A 3CX8A 2ZPAA 1QANA 1G9TA 3DAYA 2PMEA 1CFZA 2OL4A 4BTVA 4S05A 1FZTA 2O4CA 1Q6YA 1VBFA 2I4NA 4I08A 2BGWA 4KDFA 3IAUA 2QMOA 1NRIA 4WBSA 4FB4A 4IDCA 2FN3A 1ECCA 3OE4A 2HA0A 2WV7A 3HB1A 4NPHA 4XFKA 3B12A 5F2EA 5IYZF 5TR9A 4DDMA 2RAUA 3KT3A 5I5GA 1NAIA 1GWNA 1XVLA 3SXUA 1QRSA 2FE4A 1U8YA 1V2GA 3HJCA 5HMLA 2BJWA 3AT1A 4F92B 1ZHFA 4BFXA 4IDGA 1EINA 3TW8A 4MUNA 5INTA 3NTOA 1MX3A 2Q62A 2PUHA 2GBPA 2J5BA 2AG0A 3NOOA 3R0VA 5H9WA 2WP8J 1ZKMA 2C9CA 2D5AA 4HADA 1P60A 4MQEB 1T5LA 3ZNNA 3QBEA 3V4VB 2PLWA 2W8ZA 1F17A 2CNWA 5JISA 3RASA 5MF6A 2FDRA 1FSFA 3VYUB 5BR4A 1QGDA 1YJBA 2WMYA 4C7XA 5A5GA 1RHUA 2XCIA 2PD6A 2IIBA 1Q7BA 2PL3A 2OWDA 2ZXEA 5CNKA 4DUGD 2GTPA 4I0WB 4IJKA 5CFRA 1DEHA 3HJAA 3VMFA 5FX2A 4JNCA 1RSZA 3ITDA 1RPZA 4QASA 1BGVA 1QQTA 4MV5A 4NEHB 1KMIY 4PZZA 3OUZA 3TXYA 4C30A 1HC7A 3L6UA 1P4RA 2EWVA 5T67A 1BU5A 3GZNB 4CKCB 4OG2A 3PXDA 5BMVB 3PWKA 1HETA 1PEKE 1U5CA 1WWKA 1D5WA 2PU5A 1DC7A 2X9QA 3V7NA 4LRSB 4QJ3A 3ZJUA 1KMQA 3R5XA 4HFRA 4I2VA 3WLHA 4ESVA 4U00A 1P9OA 4GR9A 3B3GA 4HUQB 1ZJWA 4BMCA 2PUEA 1G20E 1MX9A 4IJMA 1FTYA 2AL7A 2C95A 1L7VC 4MQUA 4PPFA 3OF3A 1YJCA 3PNLA 4RO0A 4QOIA 2O8BA 1HLPA 4ND1A 4F3TA 4DUYB 4O0MA 2YV3A 2EJTA 1HKUA 1YV9A 2AD5A 3FFXA 4GPAA 1YCFA 1D4FA 3GZ4A 3T34A 2HADA 1RPNA 2X4DA 1IOZA 2RHLA 3UOWA 1W1WA 2Q9BA 4L27A 5ER9A 1DFIA 2IOHA 3V4PB 2RH5A 2I4MA 4DJDC 2V5VA 1IHXA 2PGXA 3N8NA 1UPUA 3PR1A 3WK7A 4DXAA 3O31A 1E69A 1ZIDA 3GVHA 1GKUB 2FWMX 2G04A 3EMKA 4TQGA 1ZOOA 1A8SA 1VLHA 3TQQA 4YJGB 4KI7A 4F5DA 3L6CA 5TDHA 4FFOA 2Q4RA 4MWTA 4L3OA 4QNMA 2OXCA 3VZDA 3WBKA 4Q1FA 3GG9A 3MJ4A 4FOLA 3JQFC 4FS3A 3GCGA 4PQGA 4BV8A 3RFFA 4OH7A 2O05A 2AOXA 3ZHXA 1XTTA 4YWHA 1F6DA 4O4JB 1EH5A 2OORC 2F00A 5CT8A 5LP1A 4M1OA 4UEKA 3TJZA 4MW2A 2RD2A 7AT1A 1QIIA 4HFNA 4NNPA 3OZAA 1GPNA 2FPIA 2B5OA 2ZSBA 3KQSA 4NMXB 5EOVA 3W3AH 3ZHVA 4L9AA 3ZBPA 4OQNA 4FR5A 4FOTA 1WSBA 4TLCA 2O8DB 3BAZA 1N6KA 3A7DA 3A4YA 4DJJA 3TE7A 1Z5WA 3K0AB 3R9XA 1X7XA 1X38A 1XQ1A 1QOQB 4XEHA 4IH4A 1CUCA 4M0DA 2B6HA 4BKOA 1ZVVA 1W47A 1QH9A 3O8DA 2HLHA 3DJYA 1CR4A 2JJ1D 4COOA 1IZ7A 1CJVC 2OZPA 1BEEA 3B60A 5CA0A 3L6DA 2X42A 1EFCA 2XDAA 1BKYA 3JTMA 3I28A 3O3NB 2VH1A 4DG8A 2PKQO 2W2TA 4DLWA 3PEWA 2GAIA 3PDHA 4GKKB 1EEHA 1U9IA 2D0OB 4ZGGA 4D98A 1OX4B 5AHRA 2N47A 1AE1A 2JHGA 2CCKA 3K53A 3MFYA 4RK6A 2NSDA 4NJMA 4KN9S 2Q21A 1I2ZA 1SCDA 5AI4A 3SAJA 4FYVA 4PTLA 1YFJA 2VH2A 1DEAA 1X14A 4L8LA 4DHEA 1R7RA 2AOVA 4QQFA 1FVFA 2V97A 2IZ0A 1ZD1A 4KO4S 5F1KA 4AMGA 5AVQA 1OH8A 3K70B 4H3KB 4NKRA 1LRJA 1ZI6A 4CLXA 5AXCA 5MHTA 2A9VA 1CUFA 2A9PA 3UENA 2HSJA 3W4IA 2Z5VA 3VU1A 3CKMA 4UTZA 3K71B 1MORA 1XN4A 5FWNA 3V2IA 2GSDA 2VNAA 3IB6A 4LAFA 1IXSB 2FP4B 5CB4F 1R8JA 1ZXXA 3E8MA 4LYGA 2H0QA 4GX5A 3VYVA 3OF2A 1E3DA 4NZ9A 2JIZA 3C7AA 1VKNA 2PEYA 3K9LA 1I2BA 2VHEA 3E5MA 5J63A 1PE0A 5JVDA 4KQIA 2V1UA 3PJEA 1NYRA 2IC5A 2O2YA 3F9CA 4S1PA 4Z2YA 1Q0LA 4G67A 4HNAB 4C7BA 4CM8B 1F0PA 4FZ5A 4X91A 4XQ0A 2IDJA 4GP9A 3QJGA 3RYHA 3WIOA 5L53A 5KYNA 1KERA 1WVMA 8ATCA 1BMDA 1XVTA 2RGAA 2VPYA 4NDNE 3JZFA 1FFEA 3DZKA 4TKUB 5D6OA 3SHOA 4YRAA 5L6LB 2V6MA 3AXTA 3OMWA 3I9FA 3FHLA 3T4XA 4ARSA 1ULZA 1SPBS 2KQUA 4IMPA 4F71A 4RAOA 3FCOA 3FNHA 4GD3Q 3CPHA 3DZCA 5CYOA 4DLPA 5KJCA 4FJ0A 4M0EA 1GPAA 3IJEB 2QL9A 2HK6A 4JJZA 4NV0A 4XARA 4MKZA 3LF1A 3SSNA 2M1ZA 4WRRA 4CM7A 1ELOA 3H1FA 4IDFA 2ZSHA 2I0FA 2QRVB 5BV8A 1RM5A 1VXOA 5CH3A 4H0FA 3V46A 3KAJA 3EOAI 3K9GA 2EX1A 3N0VA 3LFHA 3DUWA 1YB4A 1ZGCA 2OHIA 2V65A 4MMZB 4Q9HA 2X0DA 4BIIA 5IVPA 1ZWLA 1D1PA 3LQ1A 4L0QA 3ESQA 3L0CA 4AN4A 1A5BB 4EF5A 2CV1A 4E6PA 1S8NA 2C5EA 3N70A 4NTZA 5FB3A 1JJ7A 2GILA 4OP1A 4E4TA 5B6IA 1RHKA 4IS3A 5JAOA 3HVKA 1PNQA 2ZWOA 4J07A 1J70A 2G07A 1NI5A 2NVWA 1E9RA 2DQSA 2FZGA 3OE7A 4NYIQ 3ZDQA 1R4AA 2WT9A 4DAEA 1JWBB 2E4YA 2QTHA 3SJCA 4TT8A 3MERA 1USUA 1Z6GA 1FNNA 1NUSA 5K8IA 3KEFA 4PLTA 1BQEA 1OAKA 1DZIA 3IJPA 4LPKA 4DLRA 1A9ZA 3CJQA 4JMPA 1OYYA 1P2GA 2XPCA 3A1NA 3FUVA 1ECFA 1B2LA 1CIJA 1VPVA 4PS1A 3U7QA 1C81A 4B82A 4BNKA 3T9EA 1UPFA 2VUTA 4KQ9A 5FDFA 4KV7A 4MRPA 1JFFA 2DWCA 3HH8A 5CD1A 2PANA 3HA2A 4JP8A 4KR6A 1X70A 3KUDA 4PWYA 4MWGA 2DFDA 1GGHA 4I55A 4POAA 3EASA 4RZ3A 3RNLA 5SV2A 1HQYE 1P72A 1QIKA 1NYTA 3UJDA 2GHQA 2FUNB 5J4YA 1L7MA 3HYLA 1KKUA 3ZWXA 2P79A 4Q9AA 2NAPA 2DFKB 5F5XA 3TQOA 1L6IA 2QU7A 1P2TA 3L6BA 3OY7A 5FH9A 1X1TA 2POCA 3EPRA 4L4YA 2I6QA 3W6NA 3PNOA 2BHSA 3UBTA 3OEYA 1O6BA 1RTKA 5K51A 4MIKA 1RWNA 2YQ4A 1IEWA 3JQDA 1A9YA 4GHWA 5TQ2B 2G82A 4JBWA 1N2ZA 3U9SA 4DLVA 1GTL1 4IGKA 4KMOA 4YAOA 3WQRA 1D07A 3C6QA 3L82B 4YREA 5LP6B 3T5TA 4ZDWA 4MVJM 1T0UA 4RH1A 1UQRA 4RDHA 4B2IA 1PLKA 3I42A 3OMXA 2UVPB 2BFFA 4TTVA 3RFCA 2GF2A 2SKDA 3FMOB 4D26A 2KX7A 5FTMA 4MWSA 4LC9A 3PA6A 4LFBB 1DV1A 3O82A 2Z58A 3WNZA 3T9DA 1O97D 4HVTA 3O9ZA 1PT7A 2ZT7A 4IV8A 5ALIA 4ZI3A 4KXMA 3TEMA 2Q5IA 5GVRA 3U4HA 5DHSA 4YT4A 2XT6A 3B8EA 3GJQA 1U81A 3S40A 1B42A 1G55A 2GT1A 2QLBA 3H4TA 3AY0A 1I1QB 1MB3A 1XZCA 2OCBA 3GP5A 4MJ7A 1KEEA 1XU9A 5DYGA 4YMLA 1BXRB 2DR2A 1H2EA 1TM5E 3L7BA 5EWLB 4DLXA 3ODGA 1CZHA 4K26A 4DMLA 1PL0A 4CKEA 3CF0A 2PKYX 3OWXA 3UFXB 3H42B 1UJBA 4UAVA 4BV2A 2P78A 3R5FA 5LM3A 1A4XA 4OKNA 1EAMA 3QNMA 3NC1C 3JTEA 2CYAA 2OCIA 4XXHA 1GOTA 3AR8A 3ZIDA 5ETJA 1KZ6A 3T3GA 4ZZ1A 1E1LA 2H1HA 4UUBA 4BYMA 3JPYA 5CM8B 4EGSA 3F67A 4CV3A 1N5JA 3U3OA 1C0KA 2A94A 4JB3A 3SEFA 5CJPA 2ECKA 1K3UB 1JQ3A 1ILWA 1PCXA 3IQWA 2C2WA 4IOLA 1NSFA 5B53A 3TSWA 2C54A 4QO7A 4TKVA 4LBWA 3RIEA 3H3FA 2DQ4A 2IXBA 3RU3A 2HRCA 3L4BC 4NU5A 4X8OA 5EIAA 4UC0A 3U1BA 1X7WB 2R8BA 1VG9B 3FNQA 4JUCA 4QGBA 4Q66C 3ETDA 5J2UB 4A0QA 4RJKA 2OLJA 1VBKA 1ZR4A 1ZH0A 4ND7A 2VHZA 2QTVB 4V1CB 1DCTA 3JQAD 2P7HA 1NM5A 2E6KA 2VL7A 5L7TA 1E1NA 1EWTA 1NR5A 3AEQA 3PJDA 1Z34A 3DD5A 1QM5A 5CH8A 4F4CA 3UFXA 5CT9A 2QY9A 3SZ3A 4HP8A 1NUAA 3FNIA 4RIGA 1U3GA 1YZTA 3WDMA 1CDOA 4TMYA 3D3KA 3QKSB 1VM6A 5JAPA 5JVDF 1JPVA 3JD1A 5IXJA 2W37A 4AG5A 2IYLD 2YVLA 1UT6A 4CUZA 3OM1A 1N32B 3QVKA 4TRRA 1BVHA 3KD2A 2P9ZA 5HUJA 3NWOA 4BN0A 3EZLA 1XLTC 1Z82A 4QQKA 4NF2A 3PRYA 2DFTA 1ZS9A 3NT5A 1IIBA 1HFWA 1EDOA 1WHSA 1X7WA 1XA3A 2QROA 3PVZA 4J9VA 1GL9B 4L5BA 2HB6A 3PB3A 1OTXA 2R4TA 1JA9A 1CBUA 1LFDB 1AMUA 1ONPA 1QVAA 2HQRA 1ZN9A 1QMPA 2Z4RA 2BGTA 1RT9A 4UM8B 5JDCC 2JIRA 4O25A 1QLJA 3IC5A 3ZCUA 3JVEA 4I4IA 3FTDA 4PYNA 4RAQA 3DXFA 1OIXA 7REQB 3EQ6A 3QLVA 2OHFA 4KXVA 5AXDA 3ZWNA 2BEUA 5AKJA 1EIZA 2XVMA 2CNWD 4UFNA 2VHJA 1EM6A 2JFUA 2QAGC 3DVRX 4FXPA 2FA9A 2F64A 2JGEA 2ZJYA 3O8QA 4R41A 4MI1A 3LP6A 5AHOA 3TD6A 1XKLA 5IDWA 4PX9A 5FUVA 2JNWA 1QO0A 1GPWB 1U7UA 3I01A 3UUWA 1G0NA 1RQNA 2PT9A 3LWZA 1Y9JA 1IEVA 1F8UA 2H63A 3I6ZA 1SO8A 3CNOA 3TOCA 5K0EA 4CVNA 1DJQA 2B9EA 5JRJA 3HLYA 4C6RA 2FFQA 4RADA 1ZIYA 3KHTA 3R9KA 3VR2A 1U1EA 4PPQA 4QHSA 3THOA 4YJ2A 2DH6A 3A9TA 3IBGA 3KB1A 1Q5PA 5JJBA 3KR1A 1OTYA 3MMNA 2WVAA 4TL6A 5AOVA 5K0CA 4NU6A 2FOXA 3GEPA 4LMRA 1R0LA 5EXDA 1YFZA 1WEKA 2ZANA 1UP6A 2GQ0A 1XRPA 2RARA 4YPOA 2ZI4A 5CIWA 2IP4A 1QG2A 2OYRA 4I55F 5FUBA 1Y0BA 4AIRA 2Q0SA 1I4TD 5T6MA 1KNQA 3D59A 1Z0FA 4A10A 1BX1A 1GAWA 1N3BA 5E3IA 5EKSA 4ZXFA 3CO0S 3LXUX 3RUIA 2WQ7A 2F9MA 3EF3A 3EVCA 4HG2A 5TX7A 1OE0A 1S3GA 2VDPB 3GBSA 4HRYA 4HQ6A 4Z5XA 3D9QX 3VR6A 3ZLVA 1GZ4A 1UK9A 2HIHA 3A4IA 1MJGA 3V1TC 5E9JA 3I6QA 1RE0A 3DZIA 3RS4A 4DSOA 4LGVA 1OAOA 4G0PA 3M6FA 1ZRNA 3E61A 3GQVA 5TC4A 4ERNA 3RVSA 2OBBA 4YT8A 3PHBE 3V34A 2PIAA 2FP3A 3NBZC 2CT8A 1Y1LA 1ADGA 1GZDA 1SKYE 1Q7TA 2AFIE 2EQBA 2LDBA 2Q3JA 1K4KA 5FUWA 2VK4A 4EKYA 3T9AA 5AW2A 1ANKA 4BV3A 3LUAA 4XKJA 3FXAA 5IJ0B 3OJFA 4KWIA 4JEHA 1B73A 1KBOA 1DJNA 2F6RA 4XJSA 2FJ0A 3A25A 1CY2A 4R68A 1UPBA 1R5BA 3MTIA 4R71A 3C6KA 3CSSA 3B89A 5DSTA 1T5BA 3ETLA 1GZ6A 4YJFB 2PUBA 3OLVA 1Q2UA 1KQNA 2H3HA 1COWA 3DNMA 3HPQA