1LY1A

Structure and mechanism of t4 polynucleotide kinase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
152
Chain Sequence
MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKGVIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELVKRNSKRGTKAVPIDVLRSMYKSMREYLGLPVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords polynucleotide kinase
publication title Structure and mechanism of T4 polynucleotide kinase: an RNA repair enzyme.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 53
structure length 152
sequence length 152
ec nomenclature ec 2.7.1.78: Polynucleotide 5'-hydroxyl-kinase.
pdb deposition date 2002-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13671 AAA_33 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ly1A00
4MGYR 3CF0A 1XZQA 1TNDA 2A5GA 4TMWA 4ZKDA 1LS1A 1R0WA 4BEJA 1KO5A 2WSSA 2MSEB 2WIBA 4I81A 1AQYA 4URWR 4PPFA 2G0TA 1GUAA 2JJ1D 2QNRA 3BB1A 4QGGA 3W8NA 4ESHA 3OEED 1KI2A 3BJIC 5AK0A 3AKCA 5FL3A 3VR3A 4EJSB 1GRRA 4P4SA 4DHEA 2JLXA 1OHHA 4V02A 1N0UA 2PZGA 3QJYA 4ON9A 5FOWA 1YVDA 1ZM9A 2OFOA 2QAGA 2GBLA 1KDPA 3LXXA 3MCAA 2BKEA 5JJLA 2CJWA 2QUZA 2FEOA 4XJXA 4F4JA 1VYVA 1SVWA 3I92A 2CCJA 3IBGA 2O0HA 3SC3A 2ZXUA 2UKDA 3A6PC 1OPXA 3KQHA 2QMOA 3FTQA 3GCGA 4ZDIA 1CRPA 3RRYA 4A0GA 2CL6X 2O8BB 2X19A 2IF0A 4LBZA 2QQ0A 4IOMA 1ZD8A 5EE1A 1OF1A 4TMZA 2AWNA 4OI4A 4ESVA 4ERNA 1KDOA 2ERXA 1W36B 4I1VA 4RZXA 3RHFA 1OE0A 1GIAA 4M1SA 4F92B 4P32A 3MFYA 2GTPA 2QBYB 4LGMA 2RGCA 3CONA 1DPFA 2RCNA 3B78A 1XTKA 1Y3AA 3CM0A 3RAPR 3LFUA 4A82A 3MLEA 4O25A 5AWFC 5HKKD 1P5ZB 2EFGA 4PZLA 1U98A 2GZDA 4TSFD 1CJMA 3GFTA 4HZUA 1IOZA 2A7QA 2DPXA 2RGGA 3GJ7A 4CIDA 4LHVA 3SZRA 3SDZA 2W83A 3ONWA 1OH7A 2EQBA 1TPZA 4MKHA 1ZRHA 3NHBA 2PH1A 5J4VA 5CYPA 2P0EA 1P61B 2JLZA 2BMDA 5TXGA 3V00A 3DO6A 5LB2A 1UM8A 4NZYA 2P2LA 1XXHE 5KU1A 2CVFA 5C1BA 2GF0A 5DO9A 4CW7A 3FKSD 1M7HA 4IDQA 4MKIA 4BZXA 1NN0A 2JJ2A 2OAP1 1MO4A 2BEJA 1DO2A 4NTZA 2C9OA 2XNSA 1U99A 1LVGA 1EX7A 4PC1A 3KX2A 1TX4B 4NE2A 2PMDA 3K0AB 1ZJ6A 5AUPB 3K0FA 5IK2D 5F3WB 3I62A 1T3LA 1YZLA 4L4UA 1ESMA 3GEEA 2HYDA 2JA1A 2YINC 4H1VA 4JLVA 4A6PA 3WRXC 2G3YA 1D2MA 2NIPA 2QA5A 2R6GA 3T1VA 3ADBA 2YVUA 4Q19A 4XD7A 2FH5B 3CWZA 3OHMA 4DSUA 1KI3A 5CIWA 4PPQA 1VG0B 3ZD6A 1FTSA 3DKPA 4UKDA 4Q4JB 2RHMA 4HAWA 1RFLA 4GOKA 4EPYA 3AVXA 1I4LD 2J9RA 1SVIA 2VP4A 3ASYA 4YDHB 4DT1A 3QBTA 3KDSE 8OHMA 1E2LA 3CZPA 3L82B 2PT5A 4Q9IA 4H1UA 5JRJA 1FZQA 4XTRA 4DLTA 4ZI3A 3CPJB 3GLFE 2QE7D 2JLSA 3RYTC 3GLIB 1S0UA 4Q9JA 3WNBA 4M0LA 1W0JA 3GEIA 1T8UA 1GP2A 5FBWB 4MDFA 1W2HA 3RS2A 3SFZA 2NO0A 3I1FA 2Z5FA 4HZIA 2R6AA 4NYIQ 5KDOA 1KJZA 1BOFA 4DDVA 2IWHA 2CBZA 2V6IA 2C5LA 1U2RA 1IQPA 1SXJD 5JCPA 4UJ3A 2BCGY 3WP0A 1IJFA 1NBMA 4LHXA 3MRSA 2XITA 3WMFA 1FQKA 2QAJA 3EA5A 1JJ7A 3MGCA 2DFTA 3FB4A 2QT1A 3HR7A 2OLKA 1CR1A 3QKRB 5CDFE 4WZ6A 1KO4A 3W6NA 2QTVB 2QENA 4DSOA 1W47A 2R44A 4NMMA 4DKXA 2VP9A 4P4UA 2JLRA 3L8YA 1R7RA 3CNOA 2ZRPA 2FZ4A 2ZJZA 2AL7A 1Z29A 2WWFA 2O8CB 5CB6A 3QI2A 2ZTSA 4TL7A 1E2DA 2ZAOA 2FSFA 4PC2A 4ZKEA 4DC9A 4C0LA 5K8IA 3QKSB 3CF6R 3L0IB 4M1OA 1NVUQ 3FHCB 2IYRA 3B1VA 3OEEA 4HB0A 4P4TA 2VF8A 4LC0A 1Q57A 1FNNA 4EIWA 1Z47A 4KI0A 2FFBA 4YMSA 3VR1A 1HQCA 5AUNB 1DAFA 4QGHA 1R6BX 4HYYA 1KSHA 1K5GA 2ZVPX 1WCV1 5H70A 3GFOA 3IUYA 3LX5A 3M1IA 3SFVA 1KMHB 3TK1A 2Y8EA 3DKVA 5JSZA 4X8HA 3QSYA 4WW0A 2ZS7A 1Q3HA 3M4YA 3P4YA 4LHYA 5FI0B 1G4AE 3LBHA 3O8BA 3U7EB 1DADA 2C9CA 1Q0UA 3OESA 4HAZA 1XJQA 2O8FB 2K5UA 4D25A 2GJKA 1D2EA 4K8OA 3Q7PA 1N5JA 4A6XA 1TMKA 1ZM4A 1CEEA 5BN4A 3B9QA 3W3ZB 3CX6A 3WBKA 4B6FA 5EZ6B 4CDGA 3SOPA 1P2SA 4B75A 1TUEA 2BJVA 4U00A 5KUTA 4IOLA 4DXAA 4PAMA 3THWB 1KI7A 4CT4B 3WP1B 4PHFA 4KVAA 4URXR 4TSFA 1M7BA 4BZPA 1PLLA 1Z06A 2NZ8A 4RD0A 1Z6XA 1BKDR 3QNUA 1UPTA 5IF9A 1U90A 1X3SA 2ZJYA 1WQ1R 3CO5A 4FMCB 4NYJR 1T3SA 1XEXA 3U60B 2XZLA 4M4SA 4OQFA 4OQMA 4YQFA 1RJ9A 3MWYW 3IQXA 1XPRA 1O87A 3A1SA 3EC1A 3QG1A 221PA 3GFPA 4YDSA 4TYQA 1T5LA 1KSJA 2R8RA 1M1YE 2GZHA 4HB3A 3EPKA 3NDPA 1K5DA 2QRZA 2ZR7A 4GSYA 1X1RA 4F91B 1WP9A 2REXB 1Z6TA 3GLHA 4KFTA 1XJ0A 2WOOA 1QG2A 1XU4A 3O47A 1GNQA 1G291 3W5JA 4ZIRA 1NKSA 4XWKA 3GMTA 4NCIA 4A0RA 1O3YA 1OT3A 3TSWA 2YNMA 1J70A 1GTVA 3FWYA 1Z2AA 1ESNA 1G8PA 1KKMA 2Q9AA 4L16A 1Z0DA 3KFVA 4M1WA 3R9IA 5K8UA 4MRVA 2SHKA 3MJHA 4MGIR 3AQ4A 4P4SB 2W6ID 5FBVB 1GILA 3SS8A 3K1JA 2H18A 2QAGB 2ZRAA 2RMKA 3NC1C 1HTWA 4HDCA 1GNRA 2CJWB 5JI3E 2LWIA 2E1RA 3TQCA 3UXMA 4CT5A 4FMBB 3C5HA 4WXRA 4DCTA 2FPLA 3BORA 4M21A 5KNCA 3AP3A 3NTUA 2GCNA 1FTNA 4Q21A 2HDNB 4C7OB 4C3ZA 3LVRE 1P9NA 3AKYA 3TMKA 4OJQA 3OEHD 3UMSA 4EAQA 5HR5A 3TSZA 4P3YA 2P3SA 1R0YA 1E9SA 1WRBA 3IQWA 4URVR 4GT1A 1RE0A 4QM6A 1ZYUA 3EWAA 4KCGA 1GL9B 2ZI9A 1BMFD 1OLOA 3R8FA 4MRSA 4KYUA 4OQLA 2ONKA 1N6NA 4Q7JB 4PXAA 1U94A 4XVQA 3C14C 3THOA 3SQWA 5GADl 2XGJA 4HZUB 1AQUA 5TVKA 4EDHA 2ZRNA 4ZI2A 2NG1A 4PFSA 1DAHA 2VYFA 3T1TA 1IN7A 1E1RD 5AUQA 3G0HA 1NMXA 1X86B 5JHGB 2F1RA 3I4LA 3TJZA 1ONBA 5FTKA 1MOZA 3IHWA 1W49A 1QHXA 4JBWA 4JZKA 1VKJA 4ARZA 4A8JC 4C4PA 1ZW6A 5JWRA 1KZGB 4FI3C 1NP6A 4TYWA 3RNLA 4XH9B 1JAHA 1JQJC 2PLFA 1NMYA 4QOSA 3CB4A 2LCFA 4FD2A 1L8QA 2P67A 2QZ4A 4PQYA 3TR5A 3WY9A 4M9SA 3PEYA 1ZUNB 1XRJA 2Q9CA 4IFEA 3RWMB 4ZV4A 4DSNA 1XB2A 3HPQA 4II7A 2WKQA 5KNBA 1XMSA 2DBYA 3DOFA 4CZ2A 4BLSA 3AVVA 2ZYVX 4IJMA 4QG7A 2CNWA 3C41J 1DAEA 4D26A 3CW2A 3GEHA 1G3UA 621PA 1NJFA 2YOFA 2A5JA 3A4MA 1DOAA 1ZM2A 2AKAB 2VL7A 3GLIE 4DT1B 1AK2A 2CE2X 1UKYA 3P4XA 2Z43A 4IVQA 1D2NA 1UBCA 2QPOA 4BASA 1PUJA 3OIWA 4MKFA 3FPAA 4TTPA 3R20A 1EFTA 4IOKA 2HT1A 3K0CC 3VAAA 4EUNA 3AP1A 2QORA 3ND8A 1YZTA 4JLDA 4O0MA 4PQRA 2GEDA 3K09A 1NF3A 1L4UA 2IS1A 3UIEA 1G17A 2ODBA 4QKQA 2IT1A 2J45A 1QVRA 4L15A 3RS4A 1Q1EA 3I72A 4N0EA 4D4LA 3CRMA 2H16A 3VR5A 4B76A 3HPRA 1N6IA 1NLYA 1Q1BA 1UKZA 1VPLA 2D06A 4YMWA 2D7DA 2O8DA 2RGNC 1G7CA 1T5IA 1IN6A 1H8EA 1E2QA 2HLDD 1NG9A 3J81k 3LAWA 2QI9C 1Q21A 5JFGA 1IJEA 2NZJA 3WRYC 4ZO4A 3VKHA 4WZAE 3MSXA 2C78A 2IYTA 1W44A 2MMCA 4Q01A 2V4ZA 3AUXA 2D3WA 4IDPA 1XF9A 4JLNA 2OBMA 4R2IA 4L5BA 1QG4A 4V0NA 4IXNA 1IY2A 1AGPA 1P73A 4EFLA 3EX7C 1I2DA 1US8A 1CULC 2W58A 3IIMA 2BC9A 2G0NA 3SHWA 3PFIA 2JIZD 3E1SA 3F8TA 3M0EA 2F6RA 1W4AA 2V6JA 3EW9A 5IRCD 1GFIA 3MAAC 4MA4A 2WMOB 1CIPA 1EX6A 2GCPA 4MUAA 1ZNXA 2QTFA 3MMPA 4ILEA 4RD2A 2AFIE 1CR4A 3TUJC 4B3FX 2GHIA 2RGNA 4LYJA 5J4YA 4DVGA 1G7RA 4A36A 1SKYB 2WSSD 1CR2A 3Q72A 5JSZB 3FFBA 1TU4A 2F9MA 1S8FA 3UANA 3BD9A 4B6EA 1NKTA 4LK2A 3CIOA 2OSBA 2GDJA 3SE0A 3U7FB 4LJAA 1H8HA 3AVQA 4HB2A 2V8OA 1CLUA 1OHHD 3FOZA 2BBOA 1G8YA 2RGEA 4S2EA 1XD8A 1N3BA 3LNCA 1UKEA 2NMVA 2EFHB 4F38A 1R8SA 3EAQA 2J41A 3AVPA 4V03A 3UG7A 3X1ZA 1SZPA 2J0UA 3KB1A 4A1FA 2CL0X 4Q4AA 1KMQA 2VSXA 3D6TB 3MWLA 1VTKA 2VHTA 3CNLA 3U6KA 1ELOA 2DY1A 4JKIA 1BYUA 3A1WA 4KFUA 3HR8A 1MABB 2OZEA 2IEYA 3BAFA 3QKTA 4RD1A 5SZJA 4D4KA 2RAPA 3DM9B 4TYYA 4I4LA 1IN8A 1ZIOA 1E1RA 4NYMQ 4QHSA 1U0JA 1YZKA 4X8LA 3ECCA 2ZUCA 4JYCA 2NOAA 5A0FA 1J8MF 1GDDA 2VSFA 5DN6D 3EPHA 2JASA 2PMKA 2ZITA 3TUZC 4C2UA 4G5OA 1QVAA 1JECA 1N5LA 4M1YA 1V43A 3QOFA 3W3AA 3GLHB 4B32A 2XXAA 4LC1A 3FVQA 3IGFA 1OFUX 2VLIA 4DLUA 4ZIRB 2IS2A 1FL9A 2AK3A 3HU2A 5CK4A 1QHIA 2P5TB 2ZJOA 3ZZ0A 1FUUA 1FOEB 3N2EA 1Z0JA 3AVTA 1P60A 4JLAA 4JMPA 4PSAA 1YRAA 2JJ2D 1G8HA 1VCNA 3OF5A 5E4FA 1N5IA 2HF9A 3IPYA 3EASA 1N2CE 4XOIA 1N6RA 4ITRC 4TT3A 3AF2A 3VHXA 1NJGA 1C4OA 2VP2A 3SYLA 2MSDB 3I5XA 1UEIA 1R5NA 1X8KA 1E9EA 2QTHA 4B71A 3L0OA 1EG7A 1Q3TA 2YC2C 2YZ2A 4QBHA 5E95A 3EZ6A 4G5SA 1E6CA 4XD7D 2NTYC 3TAHA 4MGKR 2WJJA 3QVUA 1DVRA 4X8MA 5DI3A 3GP8A 3B5JA 3Q8XB 1AKYA 1Z6AA 2YWHA 1JR3E 1WMSA 3CPHA 5DNYB 3U4QB 4BFZA 3RDPA 5FPKA 2WPDA 3KXKA 2BMJA 3TAUA 4BLQA 2DHRA 4OK3A 2AXPA 2OFXA 4EPXA 2BIFA 5IT5A 4JVSB 4OHVA 3LX8A 4BGDA 5D3QA 5E7JA 1W0JD 1UKVY 1KI9A 3ADKA 2WWIA 3LBIA 2C77A 4Q1AA 5FBQB 2QGZA 5ELXA 2ZVQX 5GJCA 3LD9A 4JIMA 2A5DA 3NBXX 2LKDA 5EP1A 1XJCA 3PG5A 2HXYA 4RSGA 3SYKA 3VMFA 3BERA 1VIYA 2CHVA 3IEUA 3V4RA 4KAXA 4FN5A 5UKDA 1H65A 4ARZB 1RVDA 3AF4A 5CK5A 5DGXA 3W5IA 2QSZA 2J0VA 3JVVA 521PA 3REGA 4FXPA 2IUTA 3GJXC 5GVSA 4PHTA 2R6DA 4E03A 3NVAA 4ZDJA 2C2HA 4LJ7A 2REOA 3GJ4A 1UDWA 3ND9A 3B1YA 1OSNA 4Z1MA 2ZRHA 1Z8FA 2A2ZA 2C95A 1N6PA 2IUUA 4RVCA 5FTNA 2B6HA 1NVXQ 3L43A 4DCNA 2PX3A 5JLJA 1F2TA 4B3XA 4URUR 1ZNWA 1UDXA 1A4RA 2ZJBA 4UNQA 1NN5A 2ZRKA 3C15C 2FSGA 3SBEA 1NMZA 3OE7A 1DS6A 3KQNA 4RD4A 4UQOA 3KJIA 4HAVA 5DYGA 4V0ME 1L2TA 2ODWA 2Z0MA 2ZYTX 1AGRA 2IXGA 3UWOA 1OFIA 1ZINA 1OIWA 1KO1A 2L0XA 1X8LA 4K81B 3GQBA 1D8TA 4TLAA 1SHKA 2ZR0A 4JVMA 4AYTA 3AVOA 3LRPA 3QPUA 5FBLB 3U3KA 2ZR9A 2ERYA 4AYWA 1EFCA 4MGZR 1G3RA 1N6LA 2XTMA 3FGNA 2GETA 5B2ZA 2RGXA 2ORVA 1NI3A 3VX4A 5JS8A 3REFA 1MRSA 1YR6A 1NBME 2AX4A 1GOTA 4PC7A 5G3YA 4AURA 4B48A 3WBJA 1LW7A 1ZUHA 1E96A 3KZ1E 3PEUA 3SR0A 5L3QA 4Q9LA 1LB1B 1P6XA 1VG9B 2IYZA 4AG5A 1E2FA 3HWSA 5FL7D 5CB8A 1QHGA 4JL8A 3CH5A 2G1JA 4XWOA 4PSVA 2XTZA 5CLQA 1J7KA 3IILA 4JLOA 4US1R 1XD2B 5DN6A 2FV8A 1US8B 5B57C 5ANRB 2VP0A 5TDHA 4OJKA 1F48A 4XTCS 4PAQA 3QF7A 4Q1CA 4Z54A 1M34E 1I4DD 4KLNA 3AEZA 3I32A 3AM1A 3IIKA 3BB4A 4WBSA 2WHXA 1XDBA 4JVLA 2HJVA 5BWMA 2J0SA 1SVKA 2PBRA 3BK7A 1SKYE 4TWZA 2YV5A 3L8ZA 3RABA 1E0AA 4O2LA 3ICQB 4TMXA 4IW3B 2J0QA 2P65A 2ZRBA 3KJHA 3I61A 2EFCB 5DLQC 3WNCA 1SGWA 3AF0A 5J4LA 1ZCAA 1Q44A 1ZU5A 4OK5A 3FMPB 4OK6A 3MWJA 4AKHA 2J3EA 1RRGA 2G83A 1VHLA 3PITA 3LQQA 5TY0A 3CRVA 3ASZA 2Q3FA 3AGPA 2ANCA 3VU9A 3EZ7A 3QEJA 4D0LB 4NL4H 3E5HA 4LRWA 1CXZA 1E69A 1OJLA 3SJZA 1JEEA 4JLJA 2KJQA 1ZU4A 2J0UB 4Q4AB 1CR0A 2ODNA 4TMTA 5FI1B 3ZH9B 1DG1G 1J90A 1ZC3A 3GPLA 1R2QA 1FP7A 2JLWA 4DLYA 4Q1EA 2FFHA 3KKOA 4FCVA 1TADA 3T5GA 2EYQA 4QJ5A 5G3ZA 1XPOA 1WBDA 2J7PA 1NIPA 3DMNA 4WOPA 1KY3A 3PJRA 3OFNA 3AF3A 5KSYA 1E2HA 1YHNA 2IYWA 5CJ2A 4Z8XA 1W7AA 5HCIA 2VP6A 1FPMA 1PJRA 2BBWA 3W6OA 1AIPA 4Y0AA 1E2NA 4TN1A 1G20E 4Z8YA 5FUYA 2FMXA 1JALA 2CVHA 2ZJ8A 4GZLA 4W5WA 2ZRMA 3KKPA 2GCOA 1G64A 2D2EA 1RPZA 2W00A 2EU8A 4IDHA 1TF2A 1XCGB 3TE6A 2HEIA 2V55B 1KDTA 1G6HA 1ZBDA 2ZE5A 3SI7A 1Z63A 5BYKA 4JLPA 1G5RA 4A2PA 2C9YA 2C96A 1HT2E 1DAGA 1MKYA 4G01B 1KI1A 2WJYA 4RFSB 2WAYA 1KAOA 1OIVA 2VIIA 4Y0VA 2NPFA 5KOYA 3F5FA 4RZ3A 3QXHA 2HCBA 2ZQ5A 1Z6GA 3LW8A 4NKRA 2IYUA 2OM2A 4ZPXA 3S1AA 1F60A 1FUKA 4A0FA 3U3RA 3DDCA 1G5TA 3KKQA 4HLCA 3MUFA 2ASEA 4OQXA 1DG3A 4KU4A 3ZVMA 2G6BA 4LI0A 1DEKA 1G5PA 4HAYA 1HE1C 2I1VB 2ZE7A 4D0GA 1NY6A 1P3JA 3A36A 3PVSA 3BC1A 3U7GA 1U9IC 3A37A 1FMJA 2KBFA 2CNWD 421PA 2R2AA 4DCSA 5DI3B 3AV0B 1P7CA 1TQ6A 3P32A 4LDJA 2D2FA 2ZI5A 4C2TA 3RLFA 2IF2A 2QU8A 2RGBA 4XIGS 1AZTA 4R7ZA 1NSFA 4YXWA 3H1TA 1SXJE 5IDVA 2NQ2C 3CBQA 3PENA 4G3XA 3KQKA 4FMCF 4G5GA 1JXMA 1GL6A 5KTYA 4B3GA 1Z5ZA 4QBGB 1E98A 1XXHA 2GWHA 1XEFA 1SVSA 2FEMA 2IS6A 1E2PA 3SNHA 5FL7A 4UNRA 2FE4A 2QP9X 1VCOA 1JJVA 1NN1A 1F2UA 4Q1BA 5HE9A 4DCUA 2ZU0C 3NG1A 5HE8A 5LDDC 4P33A 2QMEA 5JCZA 3ZJYA 4Q18A 1E9FA 4V0KA 3BFKA 1U9IA 4UNPA 1CJTC 5LD2B 2ZRJA 5EP3A 3RC3A 2GNOA 1GVNB 4GFDA 1H8ED 4B3BA 2GXQA 1T0JB 4KJZA 4EQ6A 3B8HA 4NYJQ 2AXNA 2AN9A 1OXTA 4Q03A 4Q48A 3EZFA 3CRRA 3FE2A 3X1WA 3PIRA 1ETUA 3CH4B 4AKGA 2PEYA 1HURA 2C98A 3EZ2A 3Q7QA 1S1MA 3TRFA 3WHKA 2B92A 2Z4SA 1E9RA 4GMXA 1JXOA 5KHOC 3TGPA 2FGKA 4Q4HA 3A4NA 2WWYA 1ZMXA 1WDTA 2VPPA 4HATA 4U7DA 3CRW1 1ZVQA 4DBLC 4ZDWA 1CKEA 3K70B 2QGNA 3HYTA 1J99A 4R71A 5J4HA 4OL0A 1WF3A 3AGQA 1MR3F 2ZEJA 3D7MA 4CYMA 1DAIA 5CM8B 5EXSA 1S1CA 1JAIA 1JB1A 5GVRA 1JEDA 1Z0FA 2CHQA 1P62B 3QXJA 3DMDA 1NVVR 3KKMA 4LJ8A 1BO6A 5DHAA 1VYTA 2G88A 1H8HD 1P9RA 4U02A 1TU3A 4PO1A 2RH5A 3C5CA 4TL9A 3ZS9A 3DZDA 1OH5A 3DOEA 5CDFA 1LNZA 1R4AA 3SEAA 2IW3A 4HLDA 2PJZA 1W5TA 3PV0A 2FF7A 1SXJC 3R7WA 2Q6TA 3X1XA 3UG6A 4G1UC 2CLSA 3LA6A 4QL3A 4W5HA 3VR2A 5L3QB 3LBNA 5AJXA 2QEQA 3PQCA 4L9SA 3C16C 3OIVA 3RRMA 4W9MC 1XCMA 4OYHA 4DIDA 5FH9A 2ATVA 2H57A 2EYUA 1MO6A 3T1OA 3O8DA 3JVUA 4TQAA 5C46F 1ANKA 1KNXA 4FINA 2UZIR 2GXSA 3NBZC 4M2LA 4MYHA 1IXZA 1T9HA 5DE3A 5E3HA 5C4MA 2XZOA 1QHYA 1Y63A 3UPUA 2VHUA 1DE0A 3VR6A 1VCMA 1E0KA 2X1VA 1E99A 4PZYA 1IXSB 5FR1A 1L4YA 2MMGA 4NBSA 4QHTA 4IFBA 4D0NA 4JBXA 2IYYA 2EWVA 2JDID 4Q5IA 1KI8A 1XMIA 1YQTA 4V0LA 4MRNA 4XVUA 2Q3MA 2PT7A 2FU5C 4JKYA 3H2YA 5DH9A 4HLUC 3B1ZA 4R98A 5BXQC 3AVWA 1G4UR 4WVFA 3TNFA 4DLWA 3SQXA 4ACBA 2KE5A 4URZR 1U8AA 2BOVA 3NIBA 2BM0A 2RHDA 1KI6A 3B9PA 4AWXA 5TV2A 3IHLA 3K0FB 3FMFA 2BDTA 4JSYA 5KSZA 1NY5A 2ZANA 4OHYA 1N6HA 3C8UA 3SJCA 1AA9A 4O2RA 2F3TA 3FHOA 2WJGA 2QM7A 4UXIA 4EJSC 1CJKC 3VU9B 4ASUA 1AS3A 1G9XA 3SN6A 4CGZA 2HT6A 4JT2A 1IXRC 2G9NA 4BFSA 1CJUC 1TEXA 3B2EA 2LKCA 1PV4A 1SKQA 2BCJQ 2IYXA 1U0HC 2ODEA 2ZSDA 3QQ5A 4E22A 4TT3D 1KAGA 1QHNA 3ZD7A 2GF9A 4KBGA 2A9KA 1G7SA 5FOXA 2ZJ5A 1Z28A 2BWJA 3GJ5A 2JLVA 4B2LA 5F9FA 4L9WA 1GKYA 2CDNA 1VG8A 5JEDA 4XVRA 4A8JA 4B2PA 4GBMA 2BKUA 4KYIB 4PZZA 4TLCA 4A2QA 1UADA 3K9GA 2WV9A 3CUEF 4M1KA 1EFUA 1W36C 2FWRA 5LPNA 4DSTA 3LO5A 2KBEA 4C30A 2ORIA 1GKUB 2VA8A 4QRHA 5FPTA 2OILA 3EPJA 3OAAD 3RS3A 1Z6YA 3AUYA 2WPDD 4B3CA 1HYQA 3UMFA 2BM1A 2XOKA 2A78A 4M9QA 3ZS8A 3AKEA 2GCOB 3QPVA 4PANA 1PVOA 2IWRA 1G1MA 3L0PA 3B1XA 2FN4A 3IO5A 1XFAA 4IOJA 1RRFA 5SZHB 4BFXA 3KQUA 2HV8A 2WSMA 3BOSA 4UJ5A 1LY1A 1YR7A 4C0HA 1W48A 3IO3A 1K6MA 3F3YA 1Z2CA 4LWZA 4PHHA 4AI6A 4QHYA 4I1SA 1N25A 3ZVNA 2QM8A 3Q9LA 4RD3A 4MRRA 2JAQA 4KVGA 2X2EA 4ABYA 2IX3A 3VHLB 2JLQA 2OAQ1 1W4RA 4QJ4A 2EVWX 4MDEA 1A82A 4NONA 4AC9A 4KODA 3K0CA 4JL5A 4P31A 4AIIA 5KDLA 4DDUA 2ZSBA 5IHPA 4NCNA 4QNMA 3EG5A 3IEVA 1AS0A 2IK8A 3KXLA 4DEYA 1BS1A 1P2VA 2FDCA 1XD9A 2GESA 4B3DA 1Q12A 2IC5A 4M8NE 3HU1A 3CPEA 5KPJA 4FIDA 3VR4A 3K8YA 4Z1MD 2V7QD 4FWIB 1E9AA 2IUSA 2HCJB 4ZCMA 2XXAB 3BS4A 2DWOA 4LJ5A 3Q3JB 3QIAA 4BWYA 4JLMA 2FSHA 4P0TA 3LLMA 2JLUA 1F3OA 4A9AA 2I1QA 3EXAA 3OE7D 3K70D 2C03A 4PQFA 2VP5A 3CF2A 1FQJA 1KIMA 1R10A 2VHQA 2OO7A 4D80A 2WOJA 1SVLA 2GAAA 5H8WA 1E2GA 2VHJA 2GXUA 4PC6A 5FBRB 3H4MA 1FFHA 2N46A 4N3NA 4CEJA 2ZE6A 3TKLA 1OFTA 4EFNA 2Q3HA 3VTKA 1OXVA 1G3IA 1T91A 3LQRA 4B43A 1CU1A 1T4GA 3ZYCA 3D3QA 3MWKA 1ZAKA 2ZJ2A 3K0AA 2N42A 3FMIA 3EIEA 4CEIA 3WXMA 5AJWA 5A4JA 2ZYUX 1JI0A 4UXJA 2PCLA 5P21A 1ZP6A 2QPTA 1UBEA 2UVQA 3SJBA 3JZAA 1GM5A 5JI2E 3AH8A 2F1IA 3KB2A 4BLTA 4HI0E 1NSTA 1EFRA 2FFQA 1WB9A 3VKWA 1XEXB 1G3MA 1DBSA 4Q4JA 2QP3A 4EQ6B 1RJ9B 1GNPA 2W0SA 3QENA 2GVDC 1II8A 2J5XA 2IHBA 2GKSA 3KUDA 5B58C 3WYFA 2YWGA 5FUWA 3D31A 2ZRFA 3BWDD 1M74A 2JDIA 1HV8A 2ZSEA 4BE7B 1NL3A 4A2WA 1XX6A 4Q4HB 3T5DA 3AKDA 4KFSA 2B7BA 4PO8A 2CL7X 4DLSA 2IHYA 1OW3B 1GWNA 1M6NA 1WA5A 3H0KA 2JLYA 2ZJAA 3CR8A 3RS5A 1G6OA 4OQNA 5EP4A 4M53A 2OXRA 5EQTA 3WNDA 2TMKA 3RS0A 2QROA 2XTNA 3FFAA 4BZQA 3T15A 4TYNA 4EPWA 5DHFA 2A5FA 1G41A 3CRQA 4URYR 3SBDA 3H86A 4KFRA 1GL7A 2WZQA 2I3BA 3QXXA 1MH1A 3ZZUA 4EKDA 2ZRIA 2RGAA 4Q66C 4GOXA 4KITB 1NN3A 2QPAA 3PUYA 1HH4A 3LLUA 3NXSA 4TQ9A 5L3VA 2IA5A 3KTAA 2CK3A 4LZZA 3R9WA 4W7SA 1E2KA 3X1DA 3FHTA 2OT3B 2WWWA 3QKUA 4I1UA 2ZETA 2JJ8A 2ZM5A 5EUMA 5GJWC 3O8CA 3R7WB 2R6CA 2ZUBA 1OH8A 2VBCA 1CP2A 4AD8A 3AVYA 1AS2A 3M6AA 4Q1DA 4HDOB 2DB3A 2PCJA 2YWEA 3E2IA 1VG1A 2ZRGA 3OAAA 5B64A 1PLJA 1QDEA 1E2MA 4IKEA 4PSKA 4OHXA 1G8GA 4ZCLA 4DUGD 3TLXA 4S35A 3BE4A 2Z83A 1YZGA 3FYHA 3P26A 4MYUA 5JS7A 5TMPA 2J46A 2MSCB 3B82A 4MH0R 2J7PD 5JWHA 3GJ3A 1T0HB 1G8FA 2GVZC 3E70C 1C1YA 3ETLA 1KKLA 2F1HA 3OFND 4TLDA 1G7TA 1NNEA 4TL6A 1YRBA 3B7GA 5AR1A 4A0HA 1QHHA 2O0KA 2OG2A 2H5EA 2WJHA 2EW1A 1NLFA 2QRNA 4BRUA 3EIHA 4KSBA 1TL7C 4PHGA 3R8CA 2ZI6A 1VYUA 1W1WA 1ODFA 2G77B 3TVDA 5JZVA 2EFDB 5DSZA 3I73A 4IEEA 4WA7A 1KHTA 1KI6B 3A1UA 4HAUA 2XX3A 4MYCA 4KLZA 1OKKA 4TMKA 1II0A 1RYFA 4BUJA 2V7QA 3EPLA 5JEEA 2DR3A 3KFXA 1DO0A 2QP4A 4O3MA 3W6PA 3I8XA 5K8LA 2HUPA 4NDZA 1RYHA 5HTKA 1VDZA 2BBTA 2QAGC 3K0EA 4DLVA 2GBLC 4YMTA 1HEIA 2V9PA 1MV5A 4W5JA 4BFYA 1KJWA 2O52A 4K46A 2OXCA 1PUIA 3RVBA 1JQLB 4PR0A 1KTVA 5CLLA 3TVTA 1J2JA 5GJVC 3JZMA 1NRJB 1XMVA 4C0KA 3BIFA 4A8JB 5EXPA 4HEJA 2O0JA 4Q4LA 1R5OA 3CX8A 5BN5A 1E79A 4E09A 3VKGA 1OH6A 4NCJA 2GJSA 1X1SA 2BVNA 1T6NA 1OB2A 5EE3A 1A2KC 1GSIA 4C9BA 1N0WA 5FPHA 1E1QA 3QUSA 2BEKA 2P6NA 3RSOA 3U7HB 4YXWD 5KDDA 1KY2A 2NO1A 4HUQA 5A5GA 2ZPTX 4RJLA 4B74A 3A1TA 1G19A 1CF4A 1KK1A 2QMUA 2O8DB 1K8RA 1I2MA 1EWRA 1ZIPA 2BHRA 3NWJA 2VQSA 3UK6A 4IVRA 1HA3A 3LH5A 3TR0A 4Q7MB 1J8YF 4C0JA 5F98A 2R9VA 1GITA 1XMJA 3CWQA 3BFVA 2UZ3A 4NHOA 5TB5A 1D5CA 2Z6VA 2XSZA 1E32A 2IEZA 5F2EA 4DLZA 3PXGA 3BH6A 3K0SA 2ZI7A 1W4BA 5K8TA 4DDWA 4C0BA 4C7OA 3A1VA 4DLXA 2PLRA 2W2XA 2ZSFA 2XB4A 5FOVA 4ZDKA 4QBIA 1UF9A 2OBNA 2ORWA 3KXIA 3NKVA 3PUVA 4RKEA 3ZZTA 5BW8A 2BJWA 1ZNYA 4LJ6A 3OIYA 3GLGA 1Z0IA 1E0SA 1COWA 2IL1A 3PUZA 2E9SA 1GZSA 2KWIA 3FDIA 1JR3A 4CF7A 5HZKA 3L2OB 3Q5EA 1XBTA 1AN0A 1VMAA 1UAAA 2Q21A 3I3SR 1YZNA 2PZFA 4G0NA 3U3MA 3QF4A 3ADCA 1YE8A 2B21A 5C18A 4A15A 4IVPA 1D9XA 4US0R 5JWOA 1KO8A 3QBVA 1GAJA 1DAMA 4DIEA 1OXUA 2XZPA 4RCYA 5FTLA 4DZZA 1OFHA 2ZI3A 5FUXA 3DHWC 4GP6A 4TLBA 4EPRA 4CEJB 4HAXA 2F9LA 3X1YA 1ZD1A 1P2TA 5KO2A 2XB2A 2DFNA 1N6KA 4MRPA 3N70A 3T61A 5JMTA 4LJYA 4IRUB 1IAQA 3TW4A 2WWHA 4DUGA 5L3RA 3TW8B 1XEWX 4CEIB 2XJ4A 3AP2A 4B47A 3SJAA 4EFMA 3KUCA 1HE8B 3TIFA 4RY2A 3IBYA 5FTJA 4XSHA 1Z07A 2C8VA 2GXAA 5FUVA 1IBRA 3T1QA 4Q02A 4OHZA 3DPUA 1RW4A 1ZM7A 2REBA 1XTQA 3SHFA 3GJ6A 3ZLJA 2RB4A 1II8B 3ZQ6A 1LF5A 3ZVRA 4DEXA 1IONA 1MRNA 1JR6A 2OCAA 5FFMA 1RKBA 1WXQA 2IYVA 2OEPA 2VO1A 2PJRA 1W2GA 4IXMA 1L7VC 1SVOA 3LWNA 4XSGA 3ZIAA 3GLHE 3TH5A 3U44A 3T12A 1T3HA 1KSGA 4V0MA 5L3SA 1Z08A 3GD7A 1E0JA 5FOSA 4WIAA 3RWOA 1R0XA 5DI9A 4OI1A 1Q22A 4M9XA 3UMRA 1W0KA 5EE5B 2A30A 4RZUA 2IBMA 4NYIR 1ZCBA 2N1BA 2ZE8A 3CKLA 1E4YA 3PEWA 2GZAA 3ZVLA 4NPHA 4DCVA 2DWQA 3HYRA 4LBWA 1FP6A 3LVQE 4BFTA 2DWPA 4GI7A 3A8TA 5KSPA 1QHSA 2FPKA 1DAKA 4LCBA 4NCHA 2O8EA 1KO7A 1AM4D 1KI4A 4LYFA 3TQFA 1CBUA 2HF8A 4GDFA 1E4VA 1Z0KA 3KKNA 3KJEA 3O8RA 2I4IA 3R9XA 4JJZA 3KTAB 1S9DA 4Q7KA 4AY2A 1SULA 4JJKA 5GJBA 2DCUA 4POAA 2WVJA 2R62A 4ASUD 2OV2A 1P4SA 4LUCA 3AVUA 1R5BA 2QG6A 2B7CA 2FJUA 4MUBA 1JNYA 2O5VA 3FMOB 4KV9A 3DM5A 3U5ZB 2QL6A 2JJ1A 5G41A 3K53A 4I99A 2NO9A 4GOJA 4WXPA 2Z4RA 2W6JD 3DL0A 4R9UC 4F7WA 5AJVB 2QT0A 3X2SA 4LYHA 4CEHA 2NGRA 1A1VA 3PCRB 1EK0A 2VTKA 5EXXA 2GEUA 3NC0C 1A2BA 1W5SA 3HDTA 2C99A 4DRZA 3THXA 1Z22A 2OLJA 5C4GB 3THYA 4LBYA 1IM2A 1AKEA 5JECA 2F3RA 1BYIA 1QHHB 2WAXA 1P2UA 3QPWA 1NG1A 1U8ZA 1G18A 1NIJA 1OXXK 2XOKD 2ZI4A 3C4JA 4GL2A 1S3GA 1E94E 1HQYE 2QMHA 2ZRDA 4M1TA 1E2JA 1GG2A 1W4CA 5LBIA 3EZ9A 4KHZA 2WICA 1DELA 4JLBA 4TL8A 1LFDB 3MG9A 1VCIA 4LV5B 2GILA 2IYSA 1IY0A 4TTQA 2WTUA 1YZQA 4OI0A 1IHUA 5SZKB 5HZHA 5HPYB 4OHWA 2R6FA 4PX9A 4R2HA 3KQLA 2Q9BA 2GJ8A 2W2VA 5HKKA 2VSOA 1CRQA 4G5RA 4PO9A 4HSEA 4RFVA 1MABA 4E5UA 2CLCX 1F2TB 3GJ0A 3T06B 1NVWQ 4M1MA 1W36D 3RRNA 3GLFA 3N2IA 3B60A 4JSTA 4YONB 1D6JA 3RC8A 4BQSA 3RS7A 1RC8A 4M9ZA 4I1OA 1XTJA 5C2JB 2AWOA 2D4HA 4LHWA 2P5SA 2H8KA 2ONJA 4J0QA 1E9CA 4HUTA 3D8BA 2J7KA 4YMUA 2OUKA 3WMGA 3FKSA 1TF5A 3G82C 1KGDA 2BBSA 2W2TA 2FSIA 1ZUIA 5CM9C 1LS6A 2P6UA 1EWQA 4A92A 2V1UA 2IXFA 4JT4A 1KK3A 4JLKA 4N0DA 2F1JA 1NVVQ 1HUQA 4C0AC 4CRWB 1TTTA 2JCSA 5IK2A 1Q20A 4YC7A 5BQ5A 4HUQB 2D74A 4GPTA 2XEXA 5E7MA 5AUOB 1S4QA 2XJ9A 1FMLA 2OBLA 2HYIC 1P72A 4FMDF 3BBPA 3U61B 1C9KA 3FKQA 2XNDD 4BEBA 5H1YA 2VF7A 2KB0A 4Q7LA 4QXAA 3BH0A 2AK2A 3Q5DA 3I5YA 1P9WA 1U8YA 5BYJA 1IN4A 2GAOA 1UJ2A 4LV8B 3P27A 2BMFA 4FCTA 1Z0AA 3T34A 3CX7A 4GP7A 4RKFA 4AK9A 5KPDA 3U3JA 2AKYA 4KO8A 4HLQB 3W8RA 2QE7A 1EFRD 3G5UA 4MKGA 3K9HA 1QBKC 4Z51A 4BLRA 2QN6A 2YC4C 4JBYA 1YU9A 3U4QA 5D3MA 2JGNA 4CVNA 3LDAA 2PL3A 2WM9B 4FMDB 3GLGB 4LPSA 1OIXA 4KBFA 3AB3A 3I8SA 2FX3A 3AF1A 4ZCIA 3BFXA 4NU0A 2F55A 3H84A 2OCPA 3IDQA 1AJEA 1M7GA 2CEAA 2X8AA 1SXJA 1X6VA 2JATA 4LSGA 1G21E 4LJ9A 4TLEA 5EZ5A 5H68A 1FX0A 4LJ4A 1QRAA 3F0TA 3K9LA 4NCKA 3TSOA 3NH9A 3QF4B 2YHSA 1OB5A 2CCGA 4N1AA 4US2R 4E07A 4BLOA 2H7VA 2OHFA 2NO7A 1CJVC 4NP6A 2IXEA 2QY9A 4RCZA 1U81A 2GRJA 2P6RA 4JL6A 4HDQB 4Q9KA 2OE2A 1YR8A 1DARA 2F7SA 3TBKA 1TQDA 2F43A 2ZUDA 5JJIA 1MO5A 4H9GA 4LX0A 2YYZA 4LHZA 3PUXA 1OYWA 2KSQA 1ZNZA 1ZM3A 1E2EA 1KDRA 4L8GA 3OIUA 3TUIC 4QM7A 1HY3A 5J40A 1KYIA 1LV7A 3LV8A 3K09C 4MQBA 2X2FA 1N0VC 2AD5A 2WKRA 2W6JA 2GA8A 4EPTA 5AJZA 2CK3D 1IY1A 2R65A 2ZREA 1IN5A 4NH0A 3LXRA 2EWWA 2IS4A 2H1LA 3SYNA 4DB2A 5HCNA 4B35A 4D2IA 3WYAA 4HLUA 4D4MA 4BLPA 2GK6A 721PA 4KXFB 1RRCA 5G53C 1QF9A 5LB4A 4OKSA 3QXCA 4BFWA 4AKEA 3QEOA 4F93B 3MJRA 1KJYA 2KI5A 2WJIA 1B0UA 2AHOA 1VECA 1KK0A 2PX0A 2ZYWX 3RANA 4GZMA 1Z3IX 4EJSA 2D62A 4TZ0A 1E9DA 4F4IA 4BECA 1GRQA 1NLZA 1VIAA 3WMEA 3U44B 4TQUS 4MITA 3CR7A 5L3SB 1XNJA 4TZ6A 3UATA 2V54A 1II9A 4BPBA 1XZPA 1Q1QA 2H92A 1E2IA 1BH2A 3V4FA 1AZSC 2FNAA 4QBFA 2XAUA 4QGAA 1N5KA 2O8BA 4QC2A 5EE9A 3W34A 1Q1ZA 1M2OB 2RKOA 3QVVA 4YLGA 1RIFA 4BFVA 1PZNA 3K9NA 1TQ2A 3VNVA 2HXSA 3IKJA 1ZD9A 1HT1E 3C7KA 5FOTA 2O8EB 3NBYC 4HB4A 2B8WA 4DB4A 5J4KA 3S1AB 1JBKA 2ATXA 2QBYA 2DYKA 3ADDA 1XP8A 5F9HA 3NHAA 1QZXA 1OKKD 1YZUA 5AJYA 3HJNA 3UWKA 1UEJA 1FW6A 3QE0A 4UNSA 3IIJA 4JVNA 4QGFA 1S96A 3EA0A 4BFUA 1XD2A 2VH5R 5KNDA 4D82A 1B23P 2BV3A 1TQ4A 4V0OA 3EARA 4C0SA 2E87A 2HJGA 1CS4C 2EFEB 2J59A 2OCBA 1M8PA 4MYTA 1XTRA 4IHQA 4FW9A 4XWAA 4M22A 5M04A 1E3MA 2WIAA 4PTLA 3NEYA 4QFMA 1RRPA 1XPUA 2ECKA 1PLKA 1G3QA 4CEHB 2VHCA 1EGAA 2W6IA 2OCYC 5FR2A 3ICEA 3PR1A 4FCWA 3RSLA 1P75A 3MD0A 2VRWA 5B30A 2Q0HA 1E79D 4B44A 2NPIA 1XXHB 4X8OA 1SHZA 2GJAA 1XEWY 2XNDA 2AR7A 3EWSA 4TTRA 4G5QA 4DLRA 5BN3A 3THXB 4GNKA 3THYB 2G1KA 3KL4A 5J47A 2V3CC 3KJGA 1E1QD 5EP2A 5JJKA 4U5XA 3ZQJA 1F2UB 3VNUA 1TUIA 4EPVA 5EE0A 1GRNA 1EESA 2J87A 1WE2A 1KNQA 1JPJA 4LYAA 4D4JA 5J5CA 2C04A 2W0MA 3OEHA 1F6BA 4OI2A 2YOGA 2J1LA 4JYBA 2FPMA 4Q47A 3NH6A 5E7IA 1KZ7B 4TMVA 5FPYA 2GJ9A 4RD6A 2VEDA 5EXTA 1BMFA 2ZS9A 3LY5A 2OESA 1A5TA 5CYOA 5TARA 3P1JA 2B8TA 1OXSC 3B85A 4WAUA 2WJVA 5KSOA 4LBVA 2FG5A 3NEJA 2XSZD 3W9YA 4UNNA 121PA 4AG6A 1DTSA 2ZROA 4RZ2A 3GLIA 4AKIA 2FGJA 3BB3A 1V5WA 4F4CA 3NDBB 1YKSA 3U6BA 2CHGA 3P20A 1UFQA 3U2QA 3GLFB 2ZIAA 3EC2A 4PAOA 1KOFA 1XTSA 4NYMR 3CNNA 5G40A 3T35A 4B33A 5JRZA 2QQEA 3LW7A 1SVMA 2GEVA 2DFKB 1RZ3A 3BH7A 5FPSA 1COWD 4IDNA 1MO3A 2H17A 3B6EA 1JR3D 2YWFA 1S2MA 2A3RA 3CLVA 1BIFA 5JHHB 4B34A 2FFAA 3W90A 2JEOA 5CJPA 2CE7A 5DISB 3WYGA 5FTMA 3SU8A 4YMVA 3B1WA 4A4DA 2AFHE 2IYLD 1XTIA 1Z83A 2OFWA 5KYKA 1KSFX 4LPKA 2ZRCA 2FOLA 1R0ZA 3WHLA 3QKRA 4DJTA 4GMDA 1EFHA 4LV6A 1X8JA 1T8TA 3HP1A 4AYXA 1TF7A 3U3OA 1EXMA 4RFSA 2ZSAA 2O8CA 4QJ3A 4Q00A 5CITA 4PPNA 4PC3A 1I4TD 5JBQA 2CMKA 4WZBE 4IDOA 4C0QC 1F5NA 5DYIA 4IEIA 3PUWA 4ACAA 4DDTA 1ZC4A 2ZRLA 3QKSA 4QNRA 2FA9A 3L0SA 4BRWA 1G16A 2IYQA 3DEFA 1WBBA 4Q9HA 3PEVA 3ZDQA 1D9ZA 1W46A 3N5CA 5SZIA 1MT0A 4Q1FA 4GRAA 1XCPA 821PA 3ZGXA 2CLDX 2WMNB 1VHTA 4FWTA 1XWIA 1JPNA 3V9PA 1KMHA 3A4LA 4UXHA 1OV4A 3A58B 4D6PA 5LD2C 2GK7A 3GLGE 3B13B 2WBLC 2ANBA 4LOAA 2CXXA 2ZU6A 1UBGA 4TYPA 5D3MB 3HU3A 3QG5A 2PZEA 5DIFA 3VFDA 3GJ8A 6Q21A 1YJ5A 3ZIAD 2ZAMA 4JS0A 5FOUA 4DWJA 4KSCA 2O8FA 2YKGA 3NBFA 2YJTD 3IPXA 3BRWD 2WKPA 3CZQA 4OBEA 3EIQA 2DFLA 1S9HA 1UBFA 3DVLA 1SQ5A 1SXJB 2BMEA 3BXZA 1FX0B 1W0KD 2RGDA 1CTQA 1TEVA 1E9BA 3Q85A 2HLDA 3VQTA 1LF0A 2PEZA 5CIQA 3VX3A 1YR9A 3QY0A 1TAGA 4D81A 1N6OA 5EUQB 4B2IA 3K70C 3DZ8A 1R8QA 2D7CA 2WWGA 2V1XA 1LTQA 3OZXA 3BGWA 3THWA 2A5YB 2FZLA 4PPGA 2WWXA 4LY6A 1GKIA 3QXSA 1OYYA 5EJEA 2F43B 2QSYA 2CCKA 3RRZA 1A7JA 2AD1A 1NBMD 1U0LA 1S3SA 3UKDA 2NO6A 1KK2A 5L8VA 2JIZA 1FNMA 2X77A 4B73A 2YOHA 2ZS8A
chains in the Genus database with same CATH superfamily
5I45A 4HQNA 2I2BA 1JDNA 2IODA 2DWUA 1YB1A 4Q3LA 1TNDA 2A5GA 4OHCA 3EXIB 2P4QA 3N8HA 1BU5A 5DSXA 3STUA 3IDAA 3C3XA 3UBTA 2Q1WA 1BDMA 1U3DA 2WSSA 1T5HX 2ZB2A 3KPWA 4W7HA 3O2QB 3R5XA 2O2ZA 1H6DA 2QYTA 4HKTA 1JIXA 1A9QA 1FK8A 3Q7IA 4PPFA 1GUAA 3PQFA 4UQPA 4QGGA 3A04A 5E38A 1DC8A 1E4OA 1TEZA 2H4YA 3LI2A 5JJBA 2ZZNA 3OSUA 3L06A 5FL3A 2VDMB 3VR3A 3HA3A 3LPCA 2JLXA 2WV7A 4WZZA 4V02A 1UC4B 3QJYA 5FOWA 1O6ZA 3ZWPA 1YVDA 1ZM9A 4KPFC 1D4AA 5BNFA 1IHXA 1D2HA 1Z75A 4HPJB 2N47A 1R0RE 1EP9A 4YJFB 1XQ6A 1VYVA 5BV8A 3I92A 2WYVA 4OUKX 2Y1EA 3SC3A 2UKDA 2XVMA 1QTQA 3A6PC 5H3LA 3HSKA 2F3SA 4ZDIA 1TYCA 5DYTA 4HNHA 1Z5NA 2OGUA 3W5DA 2CL6X 1MQSA 1OV6A 2X19A 4GWGA 4CMAA 4ARCA 2FFJA 1QTIA 3H0CA 3VGJA 3L7LA 3MLAA 3U4HA 1L6IA 2ZSIA 4TMZA 3C5EA 2B82A 2AWNA 3MMSA 4B4WA 5DN9A 2J9XB 4CTJA 1JLSA 1V5GA 1BHQ1 2J4FA 1ZJ4A 4J2HA 1H2YA 3DCYA 4F3NA 1KDOA 1NKVA 1SUDA 1VPDA 2HMAA 2H54A 1LDBA 3X1JA 1GIAA 4BS9A 1PZEA 4CM8A 3A9SA 4U7WA 3Q10A 4RTKA 2GTPA 2H65A 3CONA 5AVXA 2RCNA 3B78A 3RUDA 4CKBA 3MLEA 4HOYA 5AWFC 1MTOA 3LUJA 1AN9A 1VBFA 1P5ZB 4N6OA 2Y4NA 5F2KA 1GU1A 2GZDA 3TGWA 1K8YB 1T2NA 5CG1A 3BCHA 2O14A 1IOZA 2PG3A 2DPXA 2RGGA 3GJ7A 4M0DA 4BCDA 5BR8B 2V03A 4M9RA 1LUAA 3JRXA 1HYGA 1VI6A 1CHNA 1NE2A 1HDCA 1TPZA 3Q2KA 5TE9A 2RG7A 1R9JA 3NHBA 4YRLA 4PW0A 3BGDA 3UJ8A 3BKWA 1Z4KA 3NS7A 4ARSA 4X84A 3DO6A 4Q05A 4RIEA 3UXYA 4DKXA 2G5TA 2ZYAA 2OB2A 3G8DA 4BZXA 2JJ2A 4LY3A 2FDRA 3GNQA 5TRTA 2HCFA 5DTMA 4G0VA 3SZOA 1U99A 2JB9A 2WUWE 3SR4A 2JARA 4CKXA 3GRYA 1Q7CA 3TI9A 3KX2A 4DABA 2FWBA 3KOWA 3K0AB 4QUKA 2TS1A 4OMDA 5IK2D 3G85A 4OD0A 2Q2NA 4B3JA 2E1PA 1YZLA 4GICA 3BZUA 4U7JA 3MWEB 3A2NA 4XQGA 2JA1A 2QSJA 3GNSA 3I6QA 4J0KA 4IF4A 4JEMA 5K3AA 4MVJE 2QA5A 4UVIA 3ADBA 1U4OA 4BN4A 4C3VA 5A02A 2SKEA 5AVJA 4KLCA 4XFKA 3ZHTA 2ECOA 3FNIA 3EXG2 3L0YA 4DSUA 1D4OA 4PPQA 1VG0B 5CRIA 2YIDA 1A7AA 2TYSB 4DM7A 3O93A 4UKDA 5EVJA 1IBCA 4BMOB 4GU5A 4L85A 2C4UA 3B3QA 1F6WA 1ZD2P 2MIIA 4KQIA 1P7ZA 4YDHB 5TQ2B 3GGGA 3KDSE 3TYXA 3CE6A 3CZPA 4Q9IA 2PT5A 4B4DA 4BX8A 5JRJA 1JFTA 3LYUA 2VUIB 3K72B 1NF8A 2CJPA 4XTRA 4DLTA 2OCXA 4ENQA 3BRWA 2JLSA 1HE2A 4QREA 3QWIA 3BL8A 3SKYA 4C20A 3KD3A 1W0JA 3SF0A 3QTTA 1IB0A 4UU8A 2O7SA 3P0HA 4J1NA 1GP2A 4L76A 3ZW8A 3B1FA 5LDHA 3IVRA 2B2NA 2BI8A 4MDFA 2VYND 1W2HA 2RIRA 5TEWA 2NO0A 1HTBA 2POCA 3PPVA 5I5EA 2CD9A 3CW8X 3VR4H 5I4KA 1RZRD 1NC1A 2FN8A 4RV4A 1N77A 3KQTA 1SCIA 5BSWA 2BLLA 3CPSA 2YJZA 2QVLA 5KDOA 2V0CA 2XYHA 4DDVA 3FFXA 3HBAA 5HIKA 2HIAA 7YASA 1YE3A 2CBZA 2V6IA 2C5LA 4MIKA 1SXJD 2OV4A 2AJLI 1X39A 1FXSA 2BCGY 1JMVA 3QUQA 4UD6A 3WP0A 1U8EA 4LHXA 4JT9A 3WMFA 4J3NA 1FQKA 2QAJA 4AJ1A 2PGDA 2DFTA 3LUFA 2ZTHA 1J07A 4MIEA 2BKLA 4EBBA 4JV5B 2OLKA 5GZ1A 2REQB 4KNYA 2Q7OE 3W6NA 4PYJA 4DSOA 4GMHA 3X1KA 1W47A 4NMMA 3O3OB 3PE6A 3DE3X 3HCWA 2P0AA 2VP9A 3F74A 3L8YA 4MPRA 2DBRA 1CUGA 4WFKA 1BWPA 1R7RA 2PL1A 1A9PA 4PBSA 1XKXA 4WZAB 3BE5A 3RSSA 2YN4A 1OMOA 4E13A 4IQ8A 2XIQA 2VPIA 4J43A 2WYIA 4JUDX 1GYQA 1D0IA 2ZSKA 5K8IA 1GADO 3QKSB 4L5JA 1V7QA 4X94A 1NVUQ 3I9MA 3B1VA 2VN8A 3OEEA 5LQDA 2VF8A 2EW2A 1AV7A 3AHIA 4EIWA 2H51A 2XPCA 2FFBA 3EHEA 1H5UA 1HQCA 2OP0A 3VR1A 5CDSA 1R6BX 5MGBA 1KSHA 4YJ3A 1OBVA 4N8EA 4R9VA 1PDWA 4F86A 1W8IA 4HADA 1DFIA 1B15A 3LX5A 4HL6A 3SFVA 3NKFA 2E3JA 4YCLA 3SVLA 2AFIB 4ENRA 1Y1KE 5M29A 4WW0A 2ZZKA 4WCDA 4EYEA 4LHYA 1D2GA 2VATA 3N0TA 4DWVA 3QX7A 1JAZA 4RV9A 5HA5A 3I42A 2P8JA 2PZLA 3EMKA 3O8BA 4LQCA 5A3RA 2F8LA 2JH9A 5JATA 2O8FB 2K5UA 2JD0A 4ETMA 4D25A 3LBFA 1ST3A 3E6AA 3PB3A 2EEPA 4FB5A 1N5JA 1AMOA 1R6TA 1ZM4A 2ZIEA 4A6XA 4GZ3A 4U7PB 3GB9A 4EG4A 5JBNA 4B84A 5JNWA 2AOTB 2YV2A 1NQTA 1D5WA 2DM6A 3WBKA 4NBNA 1QDLB 3H9QA 2J3KA 4B75A 1I3OA 5TMDA 2CT8A 1XLVA 3KYCA 4U00A 2IW1A 2JJQA 4RF4A 3ZDDA 1GTG1 1VP3A 2LP4Y 1W59A 5DMHA 4CT4B 4PHFA 1YQEA 4URXR 2X4GA 4QULA 1GPAA 2QUIA 2OGTA 4RD0A 4CCAA 1BKDR 1WTAA 3RVSA 2J30A 2WINI 1J5EB 3UPDA 4AWBA 4I9NA 1UPBA 1MJGA 4ZOAA 3HB9A 5J1SB 4FHDA 1AB5A 3EXFB 3MWYW 1XPRA 4KIJA 1O87A 2A1TR 3EC1A 221PA 2XVAA 4RIIA 5AW0A 1EEXB 4F04A 4O33A 2H31A 2WVAA 1T5LA 1KSJA 2PSSA 2R8RA 3BMCA 3FTPA 4KIWA 1UAYA 2P69A 3BIXA 3HB0A 3NDPA 4ARBA 2GTHA 3O9VA 1K5DA 2ZR7A 4GSYA 1TJYA 3OQHA 2REXB 1EQUA 1N4AA 2QRPA 3F7NA 4C88A 1E2UA 5AM4A 4PYQA 2BFDA 3M9LA 1WU7A 2WOOA 4N3CA 4WKOA 5LQSA 3W5JA 1R64A 1MLDA 1NKSA 1Z4IA 2HY7A 3FSGD 4L74A 1EVEA 1TO1E 2IOYA 4MS1B 5ECDA 3GOHA 3TSWA 3UEOA 3O38A 3TRIA 3WIVA 1X77A 3FWYA 4AM8A 1ESNA 3WDSA 2QUJA 2BTOA 1DBQA 2IP1A 3IMGA 4LMPA 3L0CA 3R0VA 3RC7A 3RYIA 2HU8A 1GGHA 3G9UA 3QVTA 3NC1C 1HTWA 1X1DA 3H5LA 1GNRA 1ZN8A 3L01A 4PYIA 4X0EA 5JE8A 3DZGA 1O58A 8ADHA 5IANA 3TTUA 4CT5A 1BN7A 5LQCA 1R0CA 2DSNA 1KEKA 3HGMA 1DFHA 2CLEB 2YMQA 3C5HA 2XMSA 3N7UA 3QVMA 2P2YA 3HJBA 4V24A 2PX2A 3AESA 3HE3A 4DSAA 1CRLA 5ARDA 2XUJA 4CIBA 5KNCA 1PNOA 2GCNA 3O0DA 3C3CA 4C3ZA 3LVRE 1HR0B 1XRQA 3RK0A 2BFWA 4D9EA 3OEHD 4EAQA 3O26A 4RVFA 4P3YA 5ILQA 4F4HA 1GVHA 1WRBA 3MW8A 4RHUA 1LPNA 2E37A 4QM6A 1U1DA 3DZBA 3VA7A 3AW9A 4E30A 4CM8B 5TVGA 4MRSA 4FUTA 4KYUA 4HO1X 1D07A 4WJKB 3NDIA 1WSAA 4FQ5A 1F3LA 3G49A 4UAUA 4CKBB 1V8FA 5C8YF 2BTEA 4PXAA 1R16A 1P1RA 3OM1A 4F6CA 4U2CA 4XVQA 4RHTA 3THOA 4TV8F 4U3JA 1FA9A 2XGJA 3OZVA 2LCQA 3JD0A 4XJVA 1SCAA 2G72A 3KQPA 1LEHA 4UBMA 4ZZ3A 2JEZA 5L9AA 4X3PA 4EA9A 1WNFA 4HJXA 5ADVA 4EZIA 4DLLA 2VYFA 4EY7A 1C7JA 3BILA 1B7GO 2NYRA 5IW8A 1E1RD 1TKBA 2CGEA 2OLEA 1Z68A 2Q2VA 4JDUA 2XNJA 2ZWAA 3P7MA 4QVKA 2P2NA 2F1RA 5F1PA 3H9CA 4K05A 5DSTA 2Y1GA 2I3AA 1ONBA 4BBAA 5FTKA 1MOZA 5CH5A 1W49A 3V6MA 4JBWA 3L6RA 2D0PB 5JWRA 3X0DA 3ER9A 4G4IA 1KZGB 2PRZA 3AUSA 2BH9A 1PFWA 2XYRA 2VHXA 3HCAA 4D9FA 4TYWA 4BMCA 2AMFA 2V59A 5FWNA 4X6UA 3RJMA 5J58A 2GYYA 4N3GA 1V95A 4QOSA 3SSNA 3CB4A 3AUKA 4FD2A 3WWPA 4PQYA 5LR6A 2VYVD 4M9SA 4IQ0A 2YUTA 1SCDA 3IDOA 3JQ9C 1ZUNB 4RKYA 3ROFA 1B43A 3BXEA 4EHHA 1QRTA 2QLBA 2GYWA 2W8ZA 5JYEA 5KNBA 2CYCA 5F51A 3MNFA 5C31A 3A31A 3AVVA 2DHCA 3KWLA 4IJMA 1M6VA 4G1VA 3F4BA 3RT7A 2B1RA 1SCKA 2I7TA 2GPAA 3GEHA 2DBQA 3IDFA 4FILA 2GD2A 3RREA 4D26A 1KQPA 3A4MA 4TM7A 2JIBA 1U9YA 3WE7A 3I6MA 1CY1A 4RXMA 2WMYA 4GOMD 2A67A 3BTSA 3JQ8A 3RFTA 2CE2X 2JI6A 4Z3KA 3KSBC 2LPMA 4IVQA 2Z43A 2C3MA 4G0PA 4R2MA 5CGQB 4ZC8A 2YVKA 3U31A 4NZ9A 1E1YA 4M8KA 2D3TA 3KELA 1TJ5A 3IBTA 2EF0A 1Q74A 3FOWA 4DJAA 2SCUA 3WGYA 5HHTA 1T4BA 1GU7A 3H7IA 4CM3A 3MXTA 5E8JA 4EUNA 3DDUA 3AP1A 4ALKA 1YZTA 2FKAA 4ZVPA 5EY5B 4JLDA 2P9BA 4C89A 5ALPA 1V1JA 4NBUA 1SHJA 2IS1A 1Z62A 2ODBA 2P9ZA 1ZO8A 4XRRA 5AHKA 3VR5A 4B76A 2DZDA 3HPRA 3R5TA 3K4PA 5BSFA 2RJNA 3PIDA 1M8FA 1UEXC 1Q2UA 1R12A 2D06A 4YMWA 3CUUA 2RGNC 4EF6A 2ODTX 2O8DA 2RE8A 4GOOD 1HLFA 4CUZA 3J81A 2G07A 2AG6A 3FWHA 1IN6A 1H8EA 2HLDD 3HJRA 4FSDA 4H0CA 4RK5A 5K1ZA 1P7WA 2F90A 5H7XA 2I1WA 3H9EO 4K87A 1BWQA 2AZTA 1IJEA 2HRRA 2NZJA 1K27A 5JFGA 2PMWB 3WRYC 5T7BA 3O4HA 4ZO4A 3IP1A 1JA9A 2FRDA 5D7NA 1PVDA 5IAOA 1HGXA 1YHYA 3OLZA 4IDBA 1I6WA 5ISMA 3R5SA 2OBMA 4EFLA 4B7CA 3T41A 4IXNA 1CNEA 1AGPA 1P73A 1XQWA 2VSYA 4RLHA 1AUQA 1I2DA 2X86A 3R5HA 2DBZA 1CULC 2IKSA 3AXTA 4XGNA 2GDZA 4IIDA 1Y3DE 1P2BA 2BC9A 3DE2X 3ZN2A 3W8DA 3A28A 5ER9A 1YASA 3SHTA 1QH0A 4MWBA 1N4DA 1IU9A 3AUTA 1JHVA 3F8TA 2H2FA 3VDQA 2FWMX 3EW9A 2RI0A 3OX1A 3VNBA 3KZMA 2R7KA 2XI4A 3TIGA 1JU4A 3TSCA 3UAOA 4EATA 4U2EA 1IDOA 3MMPA 4A0SA 3ROQA 5H9VA 3TUJC 2GHIA 2RGNA 3F78A 4LYJA 4DVGA 3A7EA 1GR1A 4A36A 4EUFA 2DR2A 2WSSD 3H8JA 3Q72A 5EHGA 5E3JA 1HO3A 3GZTB 4ZVVA 1B93A 4LXHA 3WLNA 2RK3A 2GSDA 1KJIA 1XZNA 3GF4A 3GN1A 3IJEB 4FEYA 4FLMA 1C30B 2ZJ0A 3I30X 4KX5A 1EUQA 3SE0A 1GPWB 1SFRA 4JI2B 2YJ3A 4HB2A 3EFOA 2I78A 2RGYA 4JP3A 2X0EA 8ABPA 3RVQA 3FOZA 2YDXA 4RTLA 1IMJA 2RGEA 4DUPA 3DA8A 2WQ7A 4EMUA 1XD8A 1LBEA 2DHQA 3FWZA 3LNCA 1VSBA 2I1LA 1E1LA 4GKBA 1AX9A 4TRMA 2EFHB 1E3JA 4F38A 3EAQA 2J41A 5I51A 4WL0A 1KEEA 3D5EA 4LF7B 4YRCA 3UG7A 3X1ZA 2J9FA 2O4UX 5EJ7A 1LC0A 3DR5A 4YVFA 4NFYA 4GPIB 3OJ0A 2VSXA 3BIOA 3MN1A 3MWLA 4TWRA 4GKAA 1XN4A 4R8VA 4V1CA 3KYCB 1SCBA 4DV2B 3F73A 2FX5A 4MVCA 1U1GA 2FPGA 3LPNA 5DZSA 4KFUA 3TEMA 3HZOA 4AF8A 1MABB 1QIMA 4JT8A 5E2IA 1JDVA 3QKTA 4RD1A 1GNTA 3IS3A 2RAPA 4F4DA 1Q7RA 4TYYA 4Y2XA 5F5NA 1YT5A 4K6HA 4D46A 3EH1A 3FNHA 3TLBA 5TX7A 2ZFUA 4CQNA 4HGOA 4DIKA 3PJGA 4NYMQ 3VJLA 2A3NA 2C00A 3EYAA 1QFMA 4FC6A 3ECCA 4CCSA 1EIWA 3EN0A 1M6WA 2NSHA 3BMCB 1F9AA 3TDMA 4OQ4A 3FKJA 4GI1A 1OAOC 2G80A 3F3SA 1EWYA 2BGMA 2JASA 3NP7A 3VJKA 4KXVA 4ZQGA 4G5OA 4G1EB 1PL7A 4MVJP 3ZCXA 5MHTA 4LYGA 3W3AA 3QOFA 2FEAA 3RF7A 2ZVJA 1JUDA 3C3AA 4MULA 4DMMA 5JDIA 1T26A 3UB2A 2GUGA 3FI0A 1Y37A 4DCOA 2DC1A 2HQBA 2IE8A 4YPFA 2ET6A 5L7YA 1FL9A 5JRDS 3PC3A 3ROZA 4KH0A 4YO7A 1XZDA 1QHIA 1XDSA 3ESQA 5CB4A 2W4MA 5ED0A 4Y6QA 2W2LD 3PGA1 4QAJA 3ZZ0A 2CWDA 5IYZB 4JI7B 2YQ5A 2IX9A 1YZHA 3ONFA 4JMPA 1D2CA 3DHEA 2JJ2D 3DONA 4RABA 2GK3A 3OF5A 4P83A 5K99A 5JNTA 1MDBA 3IPYA 3EASA 2XT9A 3AHHA 4E51A 1WDMA 2RFLA 5AVKA 3WJ2A 4W6QA 5JXHA 4H77A 1IAVA 1CCWA 1W94A 4GVXA 2MSLA 4ITRC 4JVOA 4MCIA 1NJGA 1C4OA 1IHYA 1N2OA 2VP2A 3AESB 4RDIA 2QRGA 3HM2A 4KLAA 2GLUA 1GAEO 1A4IA 1YBAA 1HFEL 4LDAA 3HYNA 5HF6A 4AICA 2AOXA 2PTHA 2YZ2A 1ESCA 1OQAA 3LYHA 4PZCA 2NTYC 4D3YA 2DQKA 2Q4BA 2WJJA 1ECFA 1JWBB 3R6LA 3T7AA 5AIBA 1K6JA 1U2GA 5DI3A 5FNVF 1AH2A 2CFOA 1UDBA 1K3FA 2HB6A 1Z6AA 2Z2XA 3CURA 3EA4A 3NANA 3B2QA 1RD4A 4RY9A 5ESWA 3MBKA 3NO4A 2XZDA 4XYMA 1E89A 3NTRA 1M83A 4O02B 4Y2QA 4CGZA 5J2UB 3TAUA 3ZX5A 4WGFA 1Y7PA 1N3YA 4RMHA 4OK3A 5BVGA 4I36A 5C80A 2BIFA 4ETIA 5B53A 3LX8A 3PLAE 4MMZB 4BGDA 1GPBA 1OGJA 4U3JB 5E7JA 1K8XB 4B6RA 3DL7A 1W0JD 4G24A 4D3SA 4MRAA 1FXWF 4IDCA 2IV2X 3V2GA 3U3XA 3ZLTA 4A16A 3M1YA 2ZR8A 4HAIA 4QPZA 3RUHA 4B6SA 2C77A 3N6RA 2PMEA 2J67A 1YMUA 4FFDA 1YFLA 3TXYA 2A5DA 4TWIA 1QSGA 2ZQYA 3H6GA 4QFBA 1XJCA 3FLBA 5FADA 4D41A 4YBRA 4R16A 4RSGA 3VMFA 2UVPA 3BERA 2HCRA 1VIYA 2CHVA 4GW3A 1FFCA 4KAXA 4TUYB 3WV4A 4ZCTA 5CCEA 1M0SA 2JVJA 1LVHA 2EZ8A 5AJUA 3T7RA 3L4JA 3Q7EA 4CM4B 2QSZA 3WYDA 4CF3A 2J0VA 4IWXA 4DMUB 2WTXA 3GJXC 3CUKA 4J7UA 1M6EX 3HN7A 3WA7A 2NU7B 1B14A 1ECBA 2VRCA 3H16A 2PYIA 1Y81A 1QZTA 2ZIVB 4OGLA 4ENPA 4GPD1 1SUIA 2REOA 3GJ4A 2O3QA 4RKWA 4DMRA 2C7GA 2A2ZA 4EW6A 4MDHA 4B3HA 5F76A 3W9UA 1N6PA 2IUUA 4RVCA 5FTNA 2B6HA 3FNFA 5KOHA 3I1YA 3T4EA 2W9XA 4ZRDA 3WZ2A 1ZNWA 3KYBA 3O4IA 1BVRA 1OWNA 2LDXA 1A4RA 2PDAA 1QLJA 2IYPA 2ZJBA 3B6MA 1JSZA 5DJ5A 1JDZA 4NXMB 2FHSA 3WX0A 1EBBA 3SBEA 4EY6A 4ER5A 1QKIA 4ZMSA 2JK1A 5HDBB 5HIAA 4N18A 4RD4A 3KJIA 3JQ8B 2ODWA 5CTAA 3KLBA 1AGRA 2X42A 3F46A 4M99A 1M72A 2IXGA 3UWOA 1N8SA 1ZINA 2IYFA 1PQ4A 5AW8A 3SG0A 1D8TA 2HK6A 1SHKA 1WAMA 2SCUB 1RXCA 3B3JA 3K5PA 3SC4A 4AYTA 2J3QA 3AVOA 3LRPA 4MS4A 4PSCA 2D54A 4YUVA 2HKIA 3U3KA 4DCCA 2GPBA 1XEAA 3OA2A 1HSZA 4MGZR 1UXHA 1SG9A 4HNRA 4IRXA 3PRHA 2GETA 3V4LA 3TL2A 2OYCA 1KQNA 2RGXA 1ZK0A 2ORVA 5JS8A 4MARA 1RM5A 2C94A 1KP3A 1R8XA 1RLUA 3OF3A 1MRSA 4GH5A 2BH2A 2HU5A 4LXQA 1P8JA 5A6SB 1GOTA 3ANMA 5C1DA 3NM6B 4AURA 1T8RA 1YCFA 4DRYA 3V46A 1E2BA 4I50B 5DGTA 4G6ZA 3OQNA 1D0SA 2DEUA 3SK0A 5ITSA 4Z99A 1E96A 3PEUA 3SR0A 3LXUX 4BC0A 1I0ZA 1P6XA 1VG9B 2QZ9A 3TINA 1QHGA 3KYDA 2G1JA 5CFRA 4PSVA 2PUBA 4ZVNA 3T5PA 4MJLA 5CLQA 5T3YA 1TKAA 1R27A 3OWXA 1WNTA 3EMDA 3IILA 4Z86A 3EVEA 4JI0B 5FKJA 3V2UA 4DA7A 5L51A 2RI1A 1WMDA 4TVOA 4FDVA 2VRNA 5E1OA 2ZCJA 3W2IA 4B4OA 3PI6A 2IDKA 5DCUA 3KJXA 5TQVA 4TN5A 1TTPB 1MA3A 1NVFA 5DM60 3DBHA 5TDHA 1CT9A 4YRFA 1KEUA 5B1YA 5EJ8A 1VDMA 1TRKA 4PAQA 5LZ4A 4GMFA 2JGEA 3N7AA 2Q2QA 1KFKB 2VJMB 4Z3OA 3C1AA 3EYWA 3QOXA 4NHEA 3KVOA 4PF1A 1CJSA 2Q0SA 3MQ2A 3WIBA 3I32A 5DP1A 3AM1A 3H2SA 1UPCA 1MW9X 2AC7A 2FZWA 3BB4A 4IIHA 1ZA2A 2HJVA 1T1JA 1MOQA 5BYBA 1SVKA 3QVLA 1P4JA 2J0SA 4LQDA 4KXUA 4S1OA 1M1NB 3RV4A 4BGVA 4ZJYA 2QRQA 4XDHA 4P0PB 5JAHA 2ZRBA 3KJHA 2II6A 2B2XA 5DLQC 4H6PA 5GM1A 2Y2UA 3SYMA 5J4LA 4KDCA 1VKHA 1R9MA 2NVUA 5CNJA 2OPHA 4OK5A 3FMPB 5IH3A 4JI8B 3G9QA 2IXDA 2WU3A 5L45A 1RRGA 4FHFA 3MJTA 3EFOB 2V7PA 4AUMA 4CFSA 3UHJA 3P96A 4QQKA 4JQZA 5TY0A 4BO9A 4CKYA 3CRVA 4DHWA 5LZ5A 4RTRA 4NCAA 2ANCA 5E9JA 1NJ2A 3WDKA 5FI3A 4Q3AA 4TKLA 4KGZA 4NL4H 2FMHA 4CIAA 4RA9A 5JNSA 3QEAZ 1GQQA 1CXZA 4LXXA 4NFSA 5BUSA 2GASA 3DQZA 2J9FB 3NOOA 4RENA 1UP6A 2WWRA 1HZZA 2OBBA 3RIEA 4FBMA 3VH1A 1BHO1 3FBWA 4TVSA 1VE9A 5KNCD 3QSGA 4J0GA 5AO9A 1LW6E 3ZWMA 2ISCA 1QP8A 5T57A 4A3SA 3UENA 3G1UA 4WCVA 2EYQA 4QJ5A 1YFZA 3PGJA 1TUBA 1XZBA 3IE0A 4LRXA 4A91A 3CCBA 2H1OA 3ZXSA 2H1VA 3TQRA 5L4LA 1KY3A 3PJRA 3HL0A 4JD5A 4JP2A 5CURA 3MT9A 3NRCA 2HSZA 4XSVA 4Z8XA 5HCIA 1X19A 1FPMA 1PJRA 4QUIA 4BO1A 3JYHA 1E2NA 4BGEA 2D5CA 3IDSA 5FUYA 2F3UA 3MTBA 4B6GA 3O3MB 3K1TA 2CVHA 3WYBA 4GZLA 3R6WA 2E21A 1QIEA 2J9GA 4FX5A 1G64A 2D2EA 2ZUUA 3ICVA 4EYSA 2P77A 4AQDA 3DF7A 4LFAB 4MW5A 1O4WA 4DAOA 3DLBA 1OFUA 3C4VA 4V0QA 4NOMA 3PDCA 1T6YA 2R751 1M2GA 5LA6A 3EVNA 1YAJA 4UUBA 1I2AA 1TJNA 5JVDF 3T3HA 1JQAA 1G6HA 4F06A 1ZBDA 3SI7A 2AE2A 5AKLA 3WMXA 3OA0A 3KCQA 4A2PA 3ABZA 2C96A 3AONB 1GLVA 1QV7A 3D4PA 1TTQB 2FP3A 4P58A 4RH3A 4RFSB 1TD9A 3G9ZA 4H7FA 4E5DA 3EVGA 1KAOA 1OIVA 1RBQA 4OG2A 4NEQA 1E5TA 3QXHA 2HCBA 4PYLA 3GX1A 5SY9A 3QMWA 1KYWA 2IYUA 3SMQA 5KTRA 1FUKA 2C2XA 2QR5A 1E4EB 5BR1A 5WRFA 4ZK6A 1G5TA 5LQMA 2XOXA 3QKIA 3KKQA 3ZQKA 1E9VA 3UAYA 2WLTA 4OQXA 1QOZA 3FNBA 4D8TA 2C92A 1DG3A 5KNBD 2OWEA 1EM8A 2ZE7A 3MMZA 3JPYA 4FE4A 2Z08A 3PVSA 4D99A 3IEKA 1WXWA 3DE4X 2ZB3A 1TAQA 3EIFA 4DCSA 4DLPA 4KKVA 5DI3B 1GQYA 3CZ5A 1TQ6A 4JU8A 4UTOA 2OC9A 2YMLA 5EIWA 4TKUB 3VZQA 1ZKDA 4AO7A 3WFIA 5KYYB 3MJDA 4GBGA 3E9YA 3UH1A 3ZDEA 1VP9A 1QYIA 1KFBB 1XTTA 4O59O 5JCOA 2OHXA 3OM0A 4GGOA 3VC1A 5BVGB 1SXJE 3C3JA 3DLPX 2NQ2C 3PENA 2BEVB 4G3XA 4QA9A 4BVKA 1C3XA 1G9TA 3FIUA 4G5GA 1JXMA 1RCTE 1NDHA 1D7AA 2B6NA 1OR8A 1L7DA 2EX4A 2JLAA 2XHEA 1C7IA 4L4YA 4YWJA 3TTTA 3VH3A 3ZOZA 5BT8A 1Z5ZA 5JYCA 1BEEA 1WMFA 4MLPA 1H2EA 4HPXB 2X9LA 1EAYA 3N2YA 1X2BA 1XEFA 1SVSA 5IBRA 2FEMA 1JHOA 2P40A 3JQRA 2N3ZA 1N2EA 1QONA 4TXNA 5FL7A 4UNRA 2FE4A 3ZQUA 1F2UA 4I55F 3IQZA 4Z9XA 3KUKA 3TECE 3VR5D 5BURA 4A5SA 1RCUA 2UVPB 5DNDA 3ZJYA 5MN6A 1UUFA 4MQEB 4HSGA 4M8IA 4UM8B 5THXA 2P3LA 5A9RA 4YUZA 5TGDA 5GINE 4ESEA 1CJTC 1V41E 3D1VA 5E4JA 5ALNA 1YA6A 3PC8A 1BGWA 1DC3A 2X22A 3DOUA 3A6EA 1H8ED 5CNMA 4DMGA 1SXPA 4F1JA 3CKKA 5K9ZA 4AAYA 5H59A 4NYJQ 4DR4B 2JLBA 3EZFA 2QRUA 4D44A 1OZAA 2CNDA 3FE2A 4FR5A 3FCYA 3PIRA 3R2JA 4N82A 4EL5A 1PP4A 1ETUA 5EWLB 2JRLA 2OSVA 3HO6A 1HURA 3K9FC 2F1KA 1EZ4A 3KQSA 3TXAA 2B92A 2YY6A 1E9RA 1JXOA 4FYPA 3KOMA 3M2PA 1ZD5A 1I6LA 5KOHB 1N1MA 1CZKA 2HA7A 5F1OA 4PG5A 3VO8A 4RGYA 3E3AA 3QVSA 5HM6A 4B6QA 3CRW1 2OVFA 2KM1A 5DV9A 4L57A 3ZUGA 4DBLC 4AROA 3T3OA 1IQ0A 2J32A 1CKEA 3C39A 4DMKA 3HYTA 1TM7E 3F5SA 1OX5A 1A5SB 4OL0A 3V4VB 5TNXA 2ZEJA 1DAIA 1V96A 4ZA2A 5CM8B 1WCYA 3BQMB 1LD3A 3H5RA 2RHOA 3D1LA 3LL4A 2NU9A 4ID3A 3LKBA 4KRGA 1K4YA 1XHFA 2DUWA 5FUBA 5GVRA 2GM9A 2D2IA 2FRXA 3K0HA 3QQPA 4MS4B 4NPAA 4Z3DA 4LF8B 2COEA 1JIUA 2GZ1A 4ETNA 3DMDA 3M5DA 5DHQA 2C58A 4F84A 2YV4A 4U7TB 3A10A 3ETCA 5EJAA 2PBFA 5IC6A 4XARA 4HBGA 3JAMA 4K03A 1YJQA 1BO6A 1O96A 1N7IA 1VL5A 3BFJA 1MU0A 3TQOA 2G88A 2A0XA 4BV8A 1BCRA 1P9RA 1TU3A 2P1ZA 1T1RA 1ZY2A 3IB6A 4KAJA 2RH5A 2HIHA 1BQ3A 3CZRA 4PO1A 4TL9A 3DZDA 4UAVA 3ZS9A 4C05A 5LP1A 1FDSA 1LNZA 3SEAA 2G4CA 2Q1UA 1Z34A 1L4KA 1PFQA 4MUHA 4PBTA 1T8YA 1W5TA 4B46A 4EG7A 4CR7A 2IHKA 4KE9A 5H80A 3R7WA 5JMWA 3S2SA 3UG6A 2FUNB 3LA6A 4W5HA 3VR2A 3OKAA 3VBCA 3LBNA 3ZJ4A 2QEQA 4L27A 1FSFA 1JLLA 3KYDB 2E5WA 3G1TA 3C16C 3S6JA 4CMIA 4NENA 1ZEMA 2CXQA 3E9QA 2W2OA 4OYHA 1F7VA 2VXBA 2ATVA 5AM0A 2XQJA 3ZHCA 2WRZA 1AKVA 1KPIA 1N9KA 2FQQA 1GYRA 1POWA 1Q7TA 3MB8A 1IZ8A 2PGXA 5C46F 1PJLA 1KNXA 4O4JB 4FINA 1X0VA 2GXSA 4Q3DA 3W2TA 1WPRA 3DMRA 1T9HA 4F3YA 3O4FA 1Y63A 3DBHB 1PTKA 2FEWB 4RQTA 2XZOA 1VCMA 1E99A 1LV8A 3E2PA 4X97A 1NFFA 2NP7A 1R15A 3OE5A 1FFEA 3RODA 1WXDA 2JF0A 2DPLA 2L69A 1K9SA 4QHTA 5LVAA 2PN1A 4D0NA 1ECCA 2ACWA 5ALWA 3I83A 5EZYF 3HLKA 4OIFA 2DJ5A 3NNDA 5JSFA 4MO2A 4A03A 4LDRA 4JWTA 1HYEA 3R0XA 4INPA 3IAM1 1FTQA 3UV7A 3MINB 2ZPUA 3SYRA 1TFRA 2I99A 1PZFA 2VJQA 3W3AD 1UXOA 1YS2X 4C22A 5DH9A 4HLUC 3B1ZA 4NH4A 3LCJA 3SJUA 5E6UA 2P79A 4Q12A 4CT0A 3AVWA 2FE1A 1AY0A 2H59A 4WVFA 3HYSA 3TNFA 3W1WA 3DZCA 4EG8A 2KE5A 5F1KA 2VNHA 4KK4A 4Y1GA 3Q6NA 5TV2A 1W88A 4A2CA 4OHYA 3I2GA 1AA9A 4I5DA 4L9RA 4F2GA 2D1SA 3IEMA 1CIJA 3QU9A 4J0DA 3PQ3A 3TTYA 1U1CA 4CIXA 4CODB 1K7XB 4ASUA 3IJRA 1FBTA 1VL0A 4X92A 2HT6A 2XQIA 3CF4G 4JT2A 4RA9B 3IKMB 4JB8A 3SBXA 5LMUB 2LKCA 3VHRA 2GHQA 4Y9SA 3AF5A 1PV4A 1GTMA 1WOMA 3BEDA 4BNHA 2BCJQ 4CDMA 2FR1A 2IYXA 2ZSDA 5DU2A 2YFHA 3HLYA 1TMGE 5FBVB 1KAGA 2MINA 3N5KA 2GF9A 5K01A 4KBGA 5EHNA 3K2EA 2A9KA 4PZDA 3U17A 1SUBA 4U9HS 3UXHA 4ZALA 2ZJ5A 1RHUA 3GCWA 4B2LA 4QEKA 3GAZA 4L9WA 2XHZA 5DHSA 4RULA 5JD5A 3CUYA 1VG8A 3IQDB 1MX1A 3M6XA 3PNSA 1H6CA 4JH0A 3Q11A 4B8YA 2FWPA 1TUBB 1DO8A 2Q4EA 4E14A 1R6AA 3N0WA 2BR5A 4QXMA 3GA0A 5KQGA 5U4QA 3ER6A 1W36C 2WU1A 2Z3WA 5J9FA 3ZTWA 2KBEA 2QVXX 2RAVA 3CHYA 2OILA 3BSYA 2HLHA 1SCUB 2OZLB 4EOGA 5IEJA 2C5EA 2C5GA 2DH6A 2GHTA 3B8EA 4GRIA 2QL9A 3UMFA 4OLJA 1KAMA 3F6YA 3JQAA 2J48A 3B9RA 4M9QA 3SD7A 1N8TA 3QPVA 2PQ6A 4UDOA 3F6EX 3MOGA 1G1MA 3DXYA 4KREA 2BRUA 3BOSA 1BVUA 5EJIA 4RETA 1K6MA 2EFYA 4PPYA 4LWZA 1GYPA 3EGWA 4RWEA 5A0TA 4DGQA 4AI6A 3PI7A 3ZVNA 4LJKA 4F5EA 1O9HA 4KO4S 3AY7A 1NJ5A 3FTCA 4ABYA 3IBSA 3S7ZA 3VHLB 3BHMA 1A82A 4IHAA 4H7EA 1XQYA 3K0CA 4JL5A 1MQ8B 3QIVA 4IICA 3V2HA 3K4HA 5FORA 3BMQB 3COWA 4NCNA 4QNMA 1YQ9A 3EB9A 1G0NA 4BX0A 1SC4A 4NBVA 1BS1A 1P2VA 4BQIA 1CZNA 1QV9A 2VRCD 2FDCA 5DT2A 1NJSA 1V4BA 2E4XA 4IHJA 2IC5A 2HOQA 5LYJF 3D4BA 4GX1A 1AG9A 3K6JA 3K8YA 3VR4A 3JS5A 1E9AA 2IUSA 1PKEA 1USUA 2FWAA 1ZLYA 3CSUA 1QGOA 3DE7X 1EM8B 2JJMA 5JTTA 4AQYB 2K7FA 1BHJA 1CETA 4BWYA 4OVKA 2BDEA 1C81A 5IS2A 2JLUA 2DUMA 3HCOA 3S1LA 1RHMA 5EWJA 1F9EA 3U62A 1F3OA 1G21A 3VOBA 8MHTA 2I1QA 2NNLD 2WA1A 3D3WB 1QRSA 3BKXA 1E3TA 3CJQA 3N1UA 3EVAA 2IZ7A 2QDXA 1H0RA 3FRJA 4D80A 5C8DA 3OZAA 3LTNC 1H6AA 5IM4F 4FFVA 4PFKA 1FFHA 1EUYA 3D02A 3QYAA 4KZKA 3S40A 4WPGA 3OPNA 1K75A 3L0BA 4HQLA 1OXVA 1RHRA 1X87A