1E0SA

Small g protein arf6-gdp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
GKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-RIBOSYLATION FACTOR 6
publication title Structure of Arf6-Gdp Suggests a Basis for Guanine Nucleotide Exchange Factors Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags G protein
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e0sA00
4KFRA 4ZDIA 3QPVA 3DHWC 2REXB 2GZHA 2H57A 5KDOA 4D26A 3B1VA 3TBKA 3LVQE 3Q7PA 2FPMA 2ZIAA 2ZROA 5J5CA 2QSZA 1SVIA 3PEVA 5CYPA 2MMCA 1AN0A 1WE2A 4YONB 3CRW1 1H65A 1OPXA 1XRJA 2NIPA 3LX8A 5FOWA 2JLZA 2WSSA 4QNMA 2HT1A 3SJAA 1ZC4A 1GIAA 2WJVA 3QPUA 5EXXA 2JLXA 2IL1A 4MGIR 1S1MA 2IYXA 3QKSA 2D06A 4FMCB 2G77B 3FHCB 4L5BA 1VECA 4V0NA 1DEKA 3E2IA 4B32A 1NRJB 4C30A 4BLTA 1PJRA 2F43B 3MJRA 3E70C 4JVSB 4M0LA 1GNPA 2WJYA 1XCPA 3K09C 5DNYB 1KO4A 2IF0A 2ZQ5A 1T3LA 3A4NA 3SJBA 1OKKD 1R6BX 5C1BA 3X1DA 1E6CA 2GWHA 1ZVQA 3R9WA 2CNWD 1E0AA 1S4QA 4UJ3A 1CF4A 821PA 4HATA 2FN4A 3N5CA 2FSFA 2BV3A 2WWWA 2WMNB 4DUGD 3CPJB 4PZZA 4URXR 1S1CA 5LPNA 2F43A 5JSZB 2B6HA 5FL3A 2OXCA 2OHFA 3L8YA 2EFEB 3QVUA 1EFRD 4X8MA 5FR2A 1F60A 2A9KA 2EWVA 4EPYA 4O2LA 5H1YA 2WWXA 2BMJA 4OK3A 1DVRA 2QMOA 3TNFA 3R7WA 1W4BA 4O2RA 4IVPA 4II7A 3RS3A 2F6RA 1R8SA 4TMZA 3GJ3A 1SXJD 4PSVA 1ZM2A 1Z8FA 4M1YA 1O3YA 1LFDB 4R71A 1P2VA 5DH9A 1VG9B 4ACAA 5EE9A 3ADDA 1P60A 3QE0A 3QXCA 2PBRA 1YR8A 1G20E 4PTLA 1IHUA 4U5XA 1N6IA 1JR3D 4Z1MA 5TDHA 4EFLA 2J0VA 1E2NA 1X3SA 4UXHA 2QTHA 2I3BA 1US8A 2DR3A 4XVRA 2F3RA 3SJZA 1QRAA 2ZJBA 5KUTA 1KJYA 4HZUA 3A8TA 1H8ED 1T3SA 2BBWA 4M1OA 3AP1A 4QM7A 5BN5A 2VBCA 2PJRA 4RCYA 1G16A 1ZRHA 2OM2A 3I73A 4KJZA 1DAEA 2LKCA 4MQBA 2FDCA 2KB0A 2VP9A 2WAYA 4A2PA 2R9VA 4HEJA 3TJZA 3BWDD 4D81A 1D9XA 4IOMA 1Z6TA 3BOSA 1NLYA 1E2GA 2NO1A 1F2UB 3W5IA 6Q21A 1N2CE 1J8MF 3T15A 1NLZA 4K81B 1FQJA 4B48A 2Z6VA 2XSZD 2QI9C 4GOJA 2AN9A 4NCKA 1OE0A 4G3XA 4L4UA 3VAAA 4L15A 3MWJA 4ZCLA 2DPXA 2XJ9A 1B0UA 4LZZA 2J7PD 1U90A 3VNVA 2C9CA 4D0NA 1E2FA 3WNCA 1MO5A 4OKSA 4YMTA 2GZDA 2OCBA 1YZLA 2VSOA 1F2UA 1WA5A 2BDTA 2IS4A 5JBQA 2QAJA 2BC9A 1SVSA 2Q3FA 5HKKA 1RRGA 4BFUA 3ADCA 4DBLC 4F92B 3OEEA 2PLFA 5DHFA 3MRSA 521PA 3E1SA 1T0JB 2HV8A 4B2PA 1EWRA 3LQRA 4D4JA 3UANA 4ZV4A 4U02A 1IONA 1Q1QA 2RH5A 1QBKC 4P33A 2V3CC 4KVGA 3TVTA 2P3SA 1IM2A 3SQXA 5LBIA 3NBXX 2C96A 4M1MA 3KB2A 3MMPA 1R10A 5L3QA 4AKIA 3ASYA 3DO6A 3Q5DA 4ABYA 4FMBB 2QMEA 3EARA 1EFHA 3IHWA 5EZ5A 3FHTA 2OG2A 1JPJA 2Q9BA 4KBFA 4IVQA 4QBGB 2ZI5A 3K53A 3LLMA 1YZUA 2H1LA 3FFBA 4C0JA 2GCOA 5G40A 2GCPA 1ZM9A 1SKQA 1ZMXA 3A37A 3FB4A 4OJQA 5J40A 3WBKA 5JWOA 3OZXA 1WB9A 1G3UA 1W0KA 421PA 2ZEJA 3AVUA 2MMGA 4MKFA 3WRXC 1G7RA 4MRSA 2IWRA 5C2JB 2IS1A 1I4TD 3VFDA 1JQJC 3VU9B 5HCIA 1X8KA 3K8YA 1XTIA 1PLJA 4PPFA 4LHWA 4CRWB 1OT3A 1UKEA 1KHTA 1F2TB 4JS0A 3SYKA 5EJEA 4BGDA 2R6AA 2ZR9A 1XFAA 1VG8A 4NHOA 5CIQA 4C0AC 3O8CA 4ESVA 5FH9A 1M8PA 1WCV1 4MGZR 2FFAA 3QSYA 3QY0A 1HT2E 1KI2A 3CB4A 1AS3A 4LJ6A 1BO6A 4TQUS 5FOXA 2GILA 1VCMA 4CEHB 2WWIA 3KQKA 1OKKA 1E9BA 5LD2C 3CZQA 1TADA 4KYIB 4FMCF 3CX8A 3SE0A 2XZLA 1SXJB 3W8RA 1I4DD 1KY3A 4M2LA 4MUAA 4WIAA 4NYMQ 4DUGA 3T1QA 4TLDA 2FSIA 2JLWA 4FD2A 4QC2A 2DFNA 3K0CA 3D6TB 4XD7A 2EFGA 1HQYE 1G8GA 3LO5A 2HDNB 4FCTA 4NYJR 4YMVA 2IYRA 1M6NA 1OV4A 3LWNA 4WXPA 3N70A 1NSFA 4PC7A 5JS8A 4HAYA 3NTUA 1KK3A 2PCLA 5E95A 2CHQA 5FOSA 3GJ5A 1RVDA 5CIWA 4LC1A 2FFQA 2ZI6A 1NMYA 3BE4A 5HE9A 3T61A 2PL3A 3VX4A 1N6RA 1X1RA 1Z6GA 2WWFA 3HR8A 4QG7A 1CBUA 2FU5C 3THXB 2V6IA 1W2GA 2B7CA 3F5FA 1PLKA 1W48A 4WZBE 3M1IA 4A1FA 1NI3A 1Q20A 5CITA 1KDPA 4AYXA 1S3SA 3EG5A 4PHFA 4MKGA 2GNOA 3DVLA 3AVPA 4CIDA 3GFTA 2IC5A 2MSEB 3QKRA 4QHYA 1BYIA 3BAFA 1R5OA 1L8QA 4Q1CA 3SU8A 3PENA 3AKYA 1YVDA 4NYIR 4EIWA 4DSTA 8OHMA 4HAUA 3BFXA 2PT5A 1SHZA 3CWQA 1DG3A 1IXRC 1TEVA 1P61B 4HLUA 3L0PA 1G6HA 1DAMA 2G1KA 5KNCA 4J0QA 4Z51A 2IW3A 4LWZA 1ZUNB 2FPLA 3QNUA 1A4RA 1E2JA 2BEKA 1II9A 1QHGA 2V9PA 3EZFA 3K0FB 5FBQB 4B3CA 4AWXA 1Q3TA 1R0YA 3LA6A 3Q72A 4P3YA 5AWFC 1Z08A 2XZOA 2BMFA 3KQUA 1LVGA 2Q0HA 2X2FA 4TMXA 1N5KA 1ZUIA 1G8YA 5ELXA 3AP2A 1PVOA 1GSIA 1T3HA 4EFMA 2P67A 4IW3B 2XSZA 1TF2A 4R9UC 2O52A 1QHXA 2FV8A 2GAAA 2D2FA 2H8KA 4MUBA 5DSZA 2IYSA 2VEDA 3DMNA 1UAAA 4EQ6B 4LYHA 3K0AB 3K9LA 2FH5B 3OIWA 4LOAA 4P4TA 4K46A 2JA1A 5AJWA 4JZKA 1ZUHA 3WP1B 1E2MA 1OH6A 4B75A 2ZRIA 2WHXA 2IYWA 2KJQA 3V9PA 1KMHB 4B73A 2WWYA 2ZRFA 3UKDA 2WMOB 2O8FA 5CDFA 4RD6A 1G21E 3MAAC 3GLFA 4Y0AA 1SVMA 5KHOC 2J1LA 2EW1A 3EPLA 1EXMA 3EA0A 1KI6B 2LWIA 4Q7LA 4KITB 2VH5R 4V03A 1E94E 2HXSA 1W7AA 1G3IA 4DLWA 3QUSA 3L8ZA 5TVKA 2DFTA 3FMOB 3HR7A 5FTLA 4KLZA 1E4YA 1GITA 2HEIA 3WYFA 3IO3A 3EXAA 5FTNA 1GRQA 4AK9A 4M22A 2ZJOA 5LB4A 5DISB 1D2EA 4P31A 2KI5A 5FBVB 1OXVA 1YZGA 4R2IA 4UNNA 3DOEA 3SN6A 4DLVA 4YC7A 3Q85A 3I1FA 1S9DA 3W6NA 1GG2A 2RGNC 4TL7A 3DZ8A 1KI6A 2O8DA 3PV0A 2V1UA 4HAXA 3EPKA 3EPHA 1W0JA 3EIHA 3KXIA 1BYUA 3IQXA 2F1JA 2NO6A 3C5CA 2CLCX 1XMVA 1C4OA 1NN3A 4Q4LA 3AQ4A 2NTYC 1ZCBA 4OI2A 1QG4A 3X1ZA 2QAGB 4A0FA 2PEZA 4Q19A 1HT1E 1ZBDA 1P73A 4W7SA 5FBWB 4LYFA 1VHTA 4Q4HB 5KYKA 1Z0JA 4QOSA 2PZEA 2QE7D 2JLVA 4HLDA 1ZJ6A 4W9MC 2WKRA 1K5DA 4O25A 3RRZA 4AC9A 3OE7A 3U7GA 2YWHA 4QXAA 4EPWA 1P72A 4UXJA 1LY1A 1G5RA 1P9NA 2NO9A 3CX7A 3IIKA 2ATVA 4Q1FA 1DTSA 3FFAA 2YKGA 3W6PA 4O3MA 2ODBA 2W00A 4TLEA 1VG0B 3CRMA 3SJCA 1J2JA 4C0LA 2NO7A 3HJNA 2QA5A 3SNHA 3BGWA 1Z2CA 4JLPA 1S0UA 1G5PA 2ZUCA 1AKEA 3CONA 3PEUA 4JJKA 1E2LA 4N3NA 1YRBA 1JBKA 1P9RA 1DO2A 1LNZA 3LFUA 2VP5A 2VO1A 3IPXA 4A8JA 2P6UA 2PMDA 2D2EA 3TUJC 1HQCA 4TSFD 1FNNA 4BFSA 2Q21A 3U44B 2WJHA 2JLRA 1UKVY 1E1RD 2GVDC 4KVAA 1OIVA 2EWWA 4QGHA 4OYHA 5K8TA 2RAPA 4B74A 4C4PA 4XOIA 1ANKA 1OIWA 4IOLA 1CS4C 3DL0A 4W5WA 2O8CB 2ZS8A 1Q44A 2ZRMA 1BKDR 2CL6X 2XITA 1R0XA 4AYTA 4XSHA 5JJIA 1R7RA 1XDBA 2B8WA 2D74A 4CZ2A 5EQTA 3I61A 1LW7A 4DCUA 4TYWA 2ORVA 2PH1A 2F3TA 2IYQA 4I99A 3U44A 3FE2A 1ELOA 1FOEB 2WSSD 2PX0A 4M53A 1E9FA 1Q1ZA 1KKMA 3NKVA 1E69A 3TE6A 2XEXA 4ZDJA 2BCGY 2WAXA 4Q4JA 4OL0A 1GRRA 3M0EA 4PXAA 1OHHD 2XJ4A 3ZQJA 1E9RA 4TMKA 1XEWY 3PUYA 2J0QA 1M7GA 2QQEA 1U8AA 2O8EB 1II8B 4KI0A 4QBHA 2ZETA 2GJSA 1N3BA 3KKPA 1CU1A 2ZJ2A 4I4LA 1G3QA 5DI3A 3UMRA 1ZP6A 4GFDA 4DIDA 3ICQB 1XZQA 2OFOA 3LV8A 3B85A 1N6HA 3DKPA 1E0SA 2VP4A 3BS4A 3P27A 4JLVA 4YMUA 3K70B 2OEPA 3WY9A 3L2OB 4AY2A 1G8HA 4QHTA 1Q3HA 2XNDD 1E1QA 1GAJA 4EJSB 2ZRGA 3PG5A 5CK5A 4TL9A 4BZQA 4PPNA 2ZAMA 1KKLA 5AR1A 5FUVA 1MO4A 1VIAA 2EYQA 2YYZA 4LJ8A 1XBTA 4ARZB 4G01B 1AS0A 1KI8A 2ZI3A 2A5GA 2JLSA 3SEAA 1TQ2A 1SGWA 4U7DA 2DB3A 1DARA 4F4JA 3B8HA 2Q9CA 4YDHB 5SZIA 4IFBA 3K9GA 4NCHA 2J41A 1XCMA 4OBEA 2ODWA 1KOFA 2A2ZA 2O8BB 4M1KA 1X8LA 2PLRA 3WMFA 4EJSA 2H16A 3X2SA 4A6PA 4QKQA 2JLUA 4X8OA 1E9AA 1W36C 1E99A 1E2QA 4HLCA 5FUWA 2WSMA 3TSZA 5HZKA 1FX0B 1TU4A 2ERYA 1P6XA 1XMSA 5FR1A 3QPWA 5H68A 3ZVMA 2HF8A 1NVVQ 1FMLA 1MABA 5DI9A 2V4ZA 3ZZUA 4BEJA 2UKDA 1XXHA 1OFTA 3C14C 3NC0C 2VF8A 3AF3A 2CCGA 4HUTA 2WOOA 1YRAA 2ZSAA 2R8RA 3KFVA 3SFVA 4JLJA 4OQNA 2I1VB 4QGAA 2VTKA 2XNSA 1GKUB 3KJEA 3ONWA 3U3OA 3UXMA 4P4SA 1PV4A 4DKXA 3CRQA 2DWPA 4PZLA 1XPUA 1IN5A 3CF0A 4V0ME 3C15C 1YR9A 4BZPA 2ZSEA 3LBNA 2ZRJA 4A0RA 5IHPA 2ZYWX 2QROA 1G3MA 2J59A 2W6ID 5HR5A 3NDPA 4LPKA 1UF9A 4ITRC 5F9HA 1E9CA 3W3ZB 1AJEA 3F0TA 1U0JA 2QPOA 4KBGA 2R6GA 3MCAA 2W2VA 4AIIA 1MOZA 4W5HA 4DSOA 1YU9A 3VX3A 3I62A 3K70C 1JEEA 3LBHA 4PAQA 3ZVRA 3RANA 1J99A 1KO8A 4IKEA 5JCPA 3FOZA 3OEED 3AVTA 1TEXA 4Z8XA 4CEJB 2Q9AA 5EP4A 2CLDX 2IXEA 3B6EA 4LJYA 1ZC3A 4R2HA 3AGPA 1VDZA 2CDNA 3P26A 1PLLA 5UKDA 3TKLA 5J4HA 2QY9A 4B47A 1HH4A 2CK3A 2GK7A 5EXSA 3AVOA 1OFUX 3GD7A 5JWRA 4ZDWA 2W0SA 4JSYA 1ZU5A 2F9LA 3AB3A 5BN4A 3QKSB 4P32A 4Q02A 2G9NA 4DLRA 2FZLA 2JGNA 4NKRA 4Q47A 3ECCA 3WNBA 4C0SA 4E03A 1R2QA 4PSAA 3W90A 1UPTA 2EVWX 3CZPA 3ZVLA 1X86B 3NC1C 1CEEA 2X19A 2CCKA 3TSWA 4CEJA 3GFPA 2IS2A 1OSNA 2ZANA 3EZ9A 4Q1EA 2I4IA 4PO9A 2ANBA 1RRCA 4Z8YA 3QG1A 4LBWA 3I8SA 5IK2D 1Q21A 4GMXA 1W0KD 5GVSA 4WZAE 2BBOA 5P21A 1YZQA 1SVKA 1YR6A 4QHSA 1HE1C 1DOAA 1P75A 1HEIA 3EAQA 4DLZA 3GJXC 5TMPA 1OHHA 2PMKA 2XTNA 1ZINA 4PR0A 1FTSA 5B30A 4RSGA 3ND9A 3W5JA 4F38A 3Q5EA 3LVRE 5JZVA 2UZIR 3VR3A 2JJ1D 2NGRA 2OXRA 3I72A 4JLDA 3SZRA 4LRWA 1JJVA 1TQDA 3N2IA 2RMKA 1F48A 1Z2AA 2AD1A 1Z0FA 3NH9A 1Z6YA 4BLOA 4PQYA 1QHYA 4TLCA 3R7WB 4OHWA 2VP0A 2RHDA 3T06B 4RD1A 1KI1A 1Z6AA 2P6NA 5ANRB 3FDIA 1NKSA 3LAWA 3WMEA 2FF7A 4YMWA 4UNQA 2KBEA 1J7KA 3PUXA 1NIJA 4HB3A 4KV9A 3U3JA 4ZI3A 2XNDA 2RCNA 2RGGA 3AP3A 4XD7D 2H5EA 1I2MA 4GZLA 1BMFA 4ERNA 3CH4B 3R9IA 4TL8A 4D4LA 1CP2A 1US8B 2BKEA 2Z43A 3I5YA 5HE8A 1ZD9A 3SBDA 1JAHA 3B9QA 1DAKA 1GL6A 2QP4A 3L43A 1M2OB 4HZUB 1L2TA 2J0SA 1SULA 3W6OA 2QT1A 3T5DA 2VL7A 1AZTA 3HPRA 4AKEA 3TGPA 1E2DA 5BYKA 1UEIA 2HF9A 3FMFA 3LDAA 1QHHB 5AJXA 2GAOA 4PQFA 2IYZA 2QGZA 1P4SA 1E2HA 2ZRKA 2QT0A 2IYTA 3WHKA 1ODFA 2GCNA 3H84A 3RS0A 3V4FA 4AG5A 4BPBA 1HE8B 1T4GA 3O8RA 5DIFA 4FMDB 4M9SA 3M6AA 1ZCAA 4GPTA 4KXFB 4URZR 2OFXA 1CJTC 5BQ5A 1N0UA 1G7SA 3VHXA 3ZGXA 3UATA 2C9OA 3FKQA 1R8QA 3L82B 1RC8A 1QHHA 1E0KA 3A1VA 3KKOA 5GADl 2AKAB 1NMXA 3AM1A 5L3SA 2JEOA 4DXAA 1LTQA 1T8TA 1OJLA 1KSHA 2FG5A 4QJ3A 5A4JA 2O0KA 1KSFX 1KO1A 1M7HA 1FPMA 1IXZA 3KKQA 3QBTA 4D4KA 3U3KA 2TMKA 4EDHA 2XX3A 2AL7A 3GJ8A 2D7DA 1CR4A 4D25A 3ICEA 2WVJA 3PIRA 1P2UA 3K0EA 2XB2A 4IXNA 1UADA 3THOA 1GKYA 4BLSA 1Z29A 3AH8A 3KKNA 4TQAA 1FUKA 2ZTSA 1ZNYA 1XD2A 1OLOA 3HWSA 2W6IA 1U9IC 3SHWA 3TR0A 2FEMA 2ZJYA 4JLBA 4DEYA 2ZYTX 4URUR 1AGPA 3TMKA 4BE7B 4ZO4A 3VKWA 2WIAA 2WICA 221PA 4A0HA 4Q4AB 2DFKB 2IUSA 2CEAA 2HLDD 3IGFA 5L8VA 1AGRA 3X1XA 1WRBA 1UKZA 3PXGA 1KO7A 5L3QB 1SVLA 2EFDB 2N1BA 5GJBA 2JJ2A 4EPXA 3THWA 3O8DA 1CJUC 2Q3HA 3MUFA 2REBA 3QOFA 2C78A 5DHAA 3ADBA 1KDRA 1NBME 1GUAA 1N6PA 2ODNA 1SHKA 4ZIRA 1SKYB 1R5NA 3O8BA 3E5HA 2V6JA 3DM5A 3WNDA 2GCOB 3PQCA 1QVRA 2QPAA 5E4FA 4Q4AA 5AUNB 2ODEA 3L0IB 4QM6A 2ZS9A 4TTPA 4XJXA 4DCNA 3KKMA 2IX3A 2GBLC 3V00A 2ZAOA 1GM5A 5KSOA 1JEDA 5H8WA 3IBGA 4AI6A 1QHNA 2DWOA 5D3MA 3CKLA 5AJYA 5FTKA 4KO8A 1GZSA 2F55A 3W34A 5BW8A 1RRPA 5F98A 2Z4RA 4EPTA 4Q48A 3MSXA 1NL3A 5KO2A 4I1VA 4DDVA 3VNUA 4B76A 2X2EA 2WWHA 2RGEA 2WIBA 2ZRCA 1NLFA 1W0JD 4RD4A 5EUMA 5IK2A 3H4MA 5FFMA 2CVFA 2H18A 3K1JA 2ZRAA 2J46A 4CF7A 4MYTA 3U60B 5FBRB 4A4DA 3MJHA 4QBIA 4LGMA 3O47A 3R8CA 2Q6TA 4A82A 4NL4H 4HLQB 3T34A 1RIFA 4TL6A 2PZGA 3R8FA 4L9WA 1DG1G 4LBYA 3TQFA 4NCNA 5SZJA 3CW2A 1HY3A 2JJ1A 2ZU6A 2OBMA 4WA7A 3I4LA 2P5TB 1VKJA 2AD5A 4S2EA 5IRCD 1OFHA 2DHRA 2ZU0C 1ESMA 1N6OA 4GI7A 4NPHA 2D4HA 2IXGA 4M1SA 3T1VA 3REFA 3W9YA 3OE7D 2AXNA 4F7WA 3DKVA 2V1XA 2QORA 1R0WA 2E1RA 1KIMA 1EGAA 3CWZA 4NYJQ 4BFXA 3KB1A 4YLGA 3ND8A 1QZXA 3GFOA 1CULC 5FTMA 4A92A 4DRZA 4LYJA 1Z5ZA 4LHYA 2VP2A 1Z06A 3D8BA 3RC8A 4BRUA 2IYYA 2ZE8A 1NJGA 4DB4A 3QKRB 4BFWA 1D2NA 3BH7A 1E79A 3L0SA 1ZU4A 2ZITA 4G5OA 2XXAA 5CB8A 2GRJA 2J45A 4OQLA 3X1WA 3VKHA 4GL2A 3QXHA 4MRVA 4JBYA 1NVWQ 2E9SA 1UFQA 1JALA 1ONBA 3OIUA 4JBWA 5EE1A 2H7VA 3C8UA 1EX7A 2BJVA 4URYR 3GLIA 3BD9A 3I5XA 4NYIQ 2IYUA 4P0TA 4IDQA 5AUPB 3HYRA 3N2EA 2GEVA 1AZSC 4D0GA 1YQTA 3CO5A 1FFHA 5DE3A 3AVVA 1F3OA 1D6JA 2G1JA 2HUPA 1IAQA 4DSNA 2QM7A 3A4MA 1RW4A 2FPKA 4B35A 3W8NA 3EZ2A 2JLYA 1MH1A 1XU4A 1YJ5A 5FOVA 4TZ6A 2DYKA 3VR5A 3TUZC 3NVAA 2WKPA 1Q12A 1S9HA 4IHQA 5E7IA 2YOHA 3H1TA 3U3MA 5JI3E 3NG1A 5E3HA 2XB4A 4TMWA 1SXJE 1XJQA 2NMVA 2L0XA 3RRMA 2BBSA 2CL7X 4FMDF 1G4AE 4UNPA 4EUNA 1I2DA 4A2WA 1UBFA 2ZSDA 4ZPXA 3UG7A 3I3SR 4DB2A 2OSBA 2R6DA 4Q7KA 1S8FA 1JR3E 2IUTA 1Z0AA 4GNKA 1GTVA 2O8FB 2G6BA 3HU3A 5FOTA 3SYLA 4M1WA 1ZNWA 1U8YA 3GLFB 1G18A 2IXFA 4KODA 3A36A 4TYYA 2FFBA 1JPNA 2D7CA 4E5UA 2Z5FA 3GLGB 3U6BA 2HLDA 2CE7A 4WOPA 2CBZA 2GEUA 3AF2A 3DZDA 5D3QA 4IRUB 5KSYA 1LF5A 4B2LA 2C5LA 2C9YA 2GEDA 1GRNA 1SXJC 1XTRA 1E1QD 1OXTA 1T8UA 1OH5A 2DFLA 4M1TA 5KU1A 2FWRA 4M8NE 1MO6A 5JJKA 4KFTA 1KNXA 1WMSA 5EZ6B 4IDOA 1KTVA 3BXZA 4DDTA 3Q8XB 3HPQA 4WBSA 3RS4A 2J5XA 3SS8A 1ZD8A 5B64A 1V5WA 2O8DB 2OUKA 2GJ9A 2YWFA 2ZYVX 5FL7A 5L3RA 4DIEA 3GLGA 1IY0A 2NZJA 5JI2E 1C9KA 2F1IA 1BIFA 2RGXA 1Z47A 4MITA 3NWJA 1JAIA 4G5SA 1GDDA 5KNBA 2HT6A 2V7QA 4LDJA 2VQSA 3T1OA 4FIDA 4JLNA 4JVLA 4X8HA 1XCGB 1LS6A 3IIMA 2XOKA 2KBFA 1V43A 5JFGA 2QPTA 2Z83A 5FPHA 1GP2A 1VYVA 3B78A 3CR7A 1DAIA 1KSGA 1CLUA 3HU1A 4XWOA 3EX7C 2FZ4A 4NH0A 1N5LA 4NMMA 3GJ7A 1P5ZB 5CDFE 1NN1A 1KJWA 2CVHA 3TLXA 3G0HA 3LBIA 5EE3A 4RZXA 4DDWA 3VMFA 1DAGA 1Q1EA 4HDQB 2ZRNA 3BK7A 1AK2A 5BYJA 4URWR 2FE4A 4F4CA 4HI0E 3QJYA 2WJGA 4FINA 1G17A 1A5TA 4JVMA 2WBLC 4Y0VA 4LI0A 1T5LA 1NF3A 4D80A 4V0KA 2B8TA 1OXXK 4QRHA 2RGBA 1A82A 4XH9B 3EC2A 4OI4A 1KI4A 2IYLD 3A6PC 2FGKA 4F4IA 1W46A 4BZXA 4C0KA 2EFHB 4KSCA 4A8JB 5K8UA 3BERA 4Q00A 3VQTA 5L3VA 4HUQA 1NG1A 2ZE7A 4LHZA 2OZEA 3T5GA 1OB2A 3AVWA 5F2EA 2R2AA 4BLPA 3BB1A 4Q9KA 2A5JA 5TB5A 3WMGA 4POAA 4MKHA 4NONA 4DCTA 2JIZA 4ZI2A 2FGJA 1IN8A 4LV5B 3GMTA 5F3WB 1VCOA 2GF9A 2VA8A 4H1VA 1DAHA 1U0HC 4US0R 2ZS7A 2OLJA 2VPPA 4ACBA 4PANA 4XTCS 1KK1A 2CK3D 4ZCIA 1QVAA 3G82C 4OK6A 4ZCMA 2FMXA 4GRAA 2VHTA 4OI1A 1DE0A 2VYFA 4N0EA 4PX9A 1XEWX 1JXOA 1RKBA 3LQQA 4Q4JB 4TTRA 4LYAA 2ZVQX 2C95A 3KXKA 5JECA 3RWOA 2C99A 1VHLA 2WKQA 5GJWC 1XEXA 3TVDA 4KCGA 2CE2X 4US1R 1BS1A 1WQ1R 3MGCA 3GP8A 4W5JA 5CM9C 1RPZA 2Z0MA 2UZ3A 3SYNA 1UJ2A 2J0UA 3MD0A 5DI3B 3PVSA 2GJ8A 2V8OA 4GP7A 1J90A 2C77A 3CPEA 5B57C 2Z4SA 3FPAA 1NIPA 1KI7A 4WAUA 4URVR 2OE2A 3CF2A 2GHIA 4JL6A 4TMTA 4UJ5A 1SVOA 3QG5A 3A1WA 1E2IA 2CCJA 4G5QA 3IUYA 1KZGB 1UDXA 3EWSA 1CR1A 3WRYC 1MO3A 1E2KA 1DS6A 5B2ZA 3Q9LA 3T35A 3UWKA 3PJRA 5K8LA 4DEXA 2YC4C 1ZAKA 5HCNA 1Z07A 2QAGC 1P2TA 1FTNA 2RKOA 1RYFA 5J4YA 3GQBA 4PPGA 2C98A 4KYUA 4PSKA 2F7SA 2VP6A 4A36A 2X1VA 5BXQC 1AM4D 1YZKA 5G3ZA 2AR7A 3ADKA 1OF1A 5TV2A 4B3BA 3ZVNA 4DZZA 1HTWA 5KSZA 1EFTA 2GXQA 3QKTA 1E98A 3R9XA 3T12A 2YZ2A 1JJ7A 1U81A 3ZD6A 1E9SA 4B3DA 1H8HA 4LUCA 1TNDA 1JQLB 4C7OA 3KTAA 4Q01A 4UQOA 4HYYA 4WVFA 1KZ7B 1BMFD 4UNRA 2HCJB 3RRYA 3QI2A 5JWHA 3DM9B 1NY5A 4XVQA 3TAUA 3KL4A 3KZ1E 1KI3A 2E87A 2XTMA 2ZE5A 1CRPA 5CLLA 3JZMA 3VHLB 2NO0A 1DAFA 2N42A 1Z6XA 1ZD1A 1MABB 1X1SA 2UVQA 1XXHB 2FX3A 4BUJA 1QDEA 2VF7A 4LSGA 2YNMA 2HJVA 5HPYB 3TSOA 4WZ6A 3A1UA 5JJLA 4JL8A 5FBLB 4DVGA 2VSFA 1D2MA 3CNLA 3R20A 4TTQA 3THYA 4GT1A 4P4SB 3RS2A 5M04A 4QNRA 1G8PA 1A2BA 2BWJA 4C3ZA 4TN1A 1U99A 2YWGA 4RVCA 1GL7A 1GOTA 4CDGA 1XP8A 4I1SA 4BQSA 3NDBB 4TWZA 2ZREA 4RFSA 1IBRA 3D3QA 1ZM3A 4UKDA 1ZNXA 4CEIA 1IN7A 1K5GA 1X8JA 2YJTD 1T5IA 5JMTA 5LB2A 2YOGA 5KPDA 3VTKA 4CYMA 3NBFA 4B3FX 2CLSA 5AUQA 2HJGA 2WOJA 2VHQA 2OO7A 3UK6A 3LH5A 1RZ3A 3GLHB 1G7CA 3L0OA 4LJ4A 3K0SA 4LX0A 121PA 3IBYA 4JYCA 1IJFA 2O0JA 2A78A 2LKDA 2OT3B 4LHXA 2AK3A 4RZUA 2V54A 3A4LA 1OH8A 1W4RA 3EA5A 2D62A 2OCPA 4IDNA 4MKIA 4D2IA 2P6RA 1W4AA 1IN6A 3PUWA 2HCBA 2ORWA 5KDDA 2OFWA 2JDID 3GEIA 1XXHE 2P65A 3QF4A 1VYTA 3LXXA 2W6JA 2XAUA 3CX6A 1IN4A 4Q1BA 3REGA 3GLHA 3BH6A 2J3EA 4DHEA 4DT1B 1YKSA 1FZQA 3S1AA 3TUIC 2JJ2D 4PQRA 1Z0KA 2A3RA 3A1SA 2N46A 2ERXA 3ZIAA 3EIEA 4EJSC 2GETA 1U0LA 2OESA 4P4UA 2ZRPA 3K09A 3KDSE 2OAQ1 5C4MA 2BEJA 4IDPA 4JT2A 1MT0A 4IVRA 2AWNA 1NN0A 2QNRA 1W44A 3IO5A 4QGGA 4D82A 4DT1A 4CW7A 1KSJA 1OIXA 4H9GA 3UPUA 2A5FA 4LBVA 5GVRA 3WP0A 1S3GA 2R6FA 1II0A 2X77A 2JATA 3MWLA 2DWQA 2VLIA 1E3MA 2B92A 1CJMA 1VTKA 1Z0IA 1YZNA 3EZ7A 4I1OA 3RWMB 2Q3MA 1XNJA 4HDCA 3BC1A 1KK0A 1KYIA 1T91A 4JIMA 3TIFA 1XD8A 3GPLA 1E96A 1NKTA 2W0MA 4RD0A 1QHSA 3SOPA 4KFSA 1OXUA 4V02A 4C0BA 3IDQA 2WPDD 2OILA 4N1AA 2PEYA 1NVXQ 3I32A 2B7BA 3B2EA 5FPYA 2VHCA 3ZZTA 1U8ZA 2AK2A 5TARA 1WBBA 3WXMA 1KAOA 2BM1A 4PC3A 4AKHA 3VR6A 4AKGA 1SQ5A 1TX4B 2P5SA 1E32A 4RD2A 1E4VA 4DWJA 2QTVB 2YINC 1VIYA 2CMKA 2AFHE 2GVZC 4IEEA 4YXWA 3J81k 2EYUA 1FQKA 4DJTA 2A30A 1N6LA 3IQWA 5AUOB 2ASEA 4PAMA 2ZSFA 2YWEA 1XEFA 4WW0A 4X8LA 1WBDA 1P7CA 2JASA 1KGDA 2GXUA 3NEYA 4LJ7A 3OEHD 4U00A 2ONKA 2IWHA 5E7MA 3TK1A 3WHLA 3MWKA 4TYNA 2FA9A 2JCSA 1G64A 4LK2A 4DLYA 2GA8A 3TW4A 2W58A 2GJKA 3HU2A 1TUEA 4TT3D 1XX6A 3KFXA 1E79D 2MSDB 2WV9A 3RABA 2ANCA 3SQWA 4LJAA 1IY1A 3PITA 2J7KA 4FWTA 2IT1A 2P0EA 4DLSA 2KE5A 2PZFA 4CT4B 1U98A 1X6VA 2HXYA 4E22A 4A2QA 2HYDA 5L3SB 1A2KC 1OXSC 3AV0B 2RGDA 3GJ0A 3RS7A 1U9IA 1ZIPA 2IS6A 4M9QA 3GJ4A 5EP1A 1L7VC 1E2EA 2MSCB 4FW9A 1IY2A 2QN6A 4QGFA 5FUXA 2ATXA 1G8FA 2ZM5A 3SI7A 4EPRA 5EE5B 3QBVA 4HB0A 3RAPR 4ASUA 1T0HB 5C46F 4NZYA 2BHRA 3VR1A 5A0FA 2F9MA 1DADA 5F9FA 2VHUA 1Z22A 3UG6A 5DN6A 2W2XA 1XD2B 3U4QB 3AKCA 2YHSA 1CIPA 4PHTA 1TU3A 3LW7A 4LHVA 5JSZA 4WXRA 1G6OA 3RLFA 5CJPA 1W4CA 1AQUA 4AURA 3OIYA 1VCNA 3EZ6A 2ONJA 1WDTA 1XF9A 3U7HB 2C2HA 3D7MA 3FHOA 2IBMA 4JMPA 1EESA 4A15A 1GNRA 4EPVA 1PUIA 5K8IA 3U7FB 1Q57A 2GBLA 3LXRA 2RB4A 2QM8A 2G0TA 2PCJA 4KLNA 4QJ5A 3THWB 2RGCA 1KK2A 4I81A 3U4QA 4TLAA 1JI0A 2QEQA 2QP9X 2Y8EA 2QTFA 3CH5A 1CJVC 1N0WA 4R98A 4TQ9A 4ZIRB 1XJ0A 4RZ3A 4XWAA 3UMSA 1COWD 4MDEA 2CHVA 5FOUA 3W3AA 4Q1DA 2JDIA 4PO8A 1HYQA 1TL7C 3ZDQA 1NBMA 4GDFA 4ZKDA 5LD2B 4GBMA 4Q03A 3I92A 4FWIB 4DDUA 1A1VA 2VRWA 3BB3A 1CR2A 1AS2A 4PHGA 3TAHA 4A0GA 3CIOA 1Z28A 4NBSA 1J8YF 4RZ2A 1KDTA 1ZM7A 4Q18A 2G0NA 5D3MB 1TTTA 1L4UA 2WTUA 3SFZA 4UNSA 4JL5A 5SZKB 2ZJ8A 5J4VA 1S96A 1GFIA 4JKYA 3DEFA 5IF9A 5KOYA 4XSGA 3ZJYA 1MV5A 5FL7D 5HTKA 3KJHA 4TYQA 1DPFA 4E07A 1G7TA 3B60A 4G0NA 3LD9A 5AJZA 1N5IA 1OB5A 3C5HA 1CJKC 4OHVA 1VYUA 1IJEA 3LLUA 4RKEA 1YHNA 2V7QD 4DCVA 4YMSA 3IKJA 3MG9A 2QMHA 2VHJA 4C0QC 3FVQA 2XTZA 1IOZA 1TQ4A 4HAVA 4MRPA 4RKFA 2OLKA 2XOKD 3AF0A 3FKSD 4S35A 4TLBA 2GK6A 5FTJA 3X1YA 5EE0A 2AXPA 4KHZA 4NCIA 2IA5A 4FCWA 3C7KA 2ZI7A 3SC3A 4TMVA 5A5GA 1E9EA 4LV8B 4ESHA 1J70A 4G5RA 2FSHA 1P62B 2EU8A 3NBYC 4OQXA 1MKYA 4XIGS 5FPSA 5JEDA 4DC9A 2ZRLA 2OCYC 3SBEA 2WPDA 4M21A 1G1MA 3PEYA 1D8TA 3EIQA 4Q5IA 3KQHA 1NY6A 1SZPA 2R65A 4A6XA 3BFVA 3UMFA 2GJAA 3AUYA 4MYUA 1ESNA 1FNMA 2ZJZA 3DPUA 1W2HA 4B33A 2C04A 2DBYA 3C4JA 3A1TA 4YDSA 2NOAA 4MYHA 4OJKA 2XXAB 1Q1BA 1A7JA 1SVWA 5EUQB 1SKYE 1TPZA 3EPJA 1M1YE 2BVNA 2CHGA 3MLEA 5J4LA 3OESA 2C03A 1R0ZA 1D9ZA 2W2TA 1QHIA 4PO1A 4EAQA 1M7BA 3OEHA 3IPYA 4C2TA 2ZXUA 3GLIB 4CGZA 5EP3A 3BB4A 4K8OA 1EK0A 2REOA 3BBPA 3JZAA 1FL9A 2FOLA 1MRNA 1N6KA 3OFND 2DCUA 3QENA 2GKSA 4G5GA 4LBZA 5KNDA 4TT3A 2JIZD 3U61B 4O0MA 4CVNA 4D6PA 1HURA 2IEZA 3RYTC 2CNWA 2OCAA 1XB2A 4QBFA 3VU9A 1XMIA 4E09A 5JCZA 5CYOA 4PC1A 2O0HA 3KX2A 3QQ5A 1F2TA 3FTQA 3AUXA 4PFSA 1EFRA 2OV2A 4PC2A 1EFCA 4B6FA 2QBYB 2IHBA 4BFVA 1O87A 2O5VA 2R6CA 4NYMR 5EP2A 1XTSA 4GP6A 4I1UA 2XZPA 4BRWA 1RYHA 3CPHA 3PEWA 4CEHA 1QF9A 2IUUA 4EKDA 3GJ6A 1FMJA 1DELA 2PJZA 1LV7A 3EC1A 3RSLA 1CR0A 3KQLA 4NCJA 4ON9A 2P2LA 3ZLJA 1SXJA 2WWGA 1Z0DA 2GTPA 1TMKA 2IK8A 4H1UA 4PHHA 1CTQA 3ZYCA 2AFIE 1KDOA 4NU0A 3Q3JB 4F93B 2R62A 3CUEF 4GOXA 1JR3A 3RHFA 1ZW6A 2F1HA 5KSPA 4ZDKA 2QBYA 1GWNA 1GKIA 2G88A 1VG1A 5DO9A 3TR5A 2IHYA 4NDZA 4PPQA 4QL3A 3B1WA 1XTQA 2J9RA 2QQ0A 2ZRDA 3IEUA 1H8EA 4IOJA 4ZKEA 3GLIE 3ZS8A 4BFYA 1F6BA 2GF0A 4BWYA 3RRNA 1MRSA 4US2R 1S2MA 1FW6A 4LJ5A 1RFLA 3AKDA 4IOKA 3K0CC 5FUYA 3THXA 1W36D 5JRZA 1KO5A 1L4YA 3BORA 3V4RA 1HUQA 3PR1A 1COWA 2IF2A 2G83A 4B71A 3QEJA 3K9HA 2RGNA 3HYTA 3LNCA 1G291 3CRVA 1D5CA 1DBSA 1PUJA 1XTKA 2GXSA 4RY2A 1XD9A 4B44A 1C1YA 3VR4A 4XWKA 1H8HD 2X8AA 3AKEA 4XVUA 2GXAA 1NN5A 2EQBA 4R7ZA 2RGAA 3OHMA 4JKIA 4OQMA 3H2YA 4LJ9A 1NVUQ 4C0HA 1FP7A 2WJJA 2KWIA 3LW8A 4D0LB 1G41A 5FPKA 3PFIA 3RSOA 3RC3A 3C41J 3MFYA 3P4YA 2CL0X 1WF3A 1FP6A 1T9HA 5EXTA 1IXSB 3K0FA 2SHKA 3IILA 2J7PA 2OAP1 1OFIA 3EW9A 1P2SA 1XJCA 3DDCA 4LPSA 4OHXA 1E9DA 1UBGA 1Z83A 1B23P 3WBJA 5DYGA 1OW3B 4M9XA 1HV8A 4AG6A 4HLUC 4BASA 3ZD7A 4G1UC 2J87A 3BFKA 4PC6A 3JVUA 2JAQA 3FKSA 3G5UA 5CK4A 1OH7A 3LRPA 3ETLA 4B6EA 1HA3A 1NMZA 4GOKA 3U7EB 4NTZA 4RCZA 4EQ6A 5E7JA 2QGNA 2FJUA 4MRRA 4LC0A 2FFHA 3K0AA 4KSBA 1NSTA 1KJZA 1AKYA 2G3YA 4B3XA 3K70D 1JR6A 3U3RA 4RD3A 2ZI9A 3AF4A 1YR7A 1UKYA 3ASZA 1LB1B 3IIJA 3KJIA 1EFUA 1Y3AA 4FN5A 3GLFE 2BCJQ 5C4GB 1KMHA 3TH5A 1ZIOA 4AYWA 4C9BA 4LCBA 5HZHA 1GILA 4RFVA 3KJGA 3GLGE 2QG6A 3PUVA 1QG2A 3P1JA 1N5JA 1OYYA 4HUQB 5G3YA 5JHHB 5IDVA 1G4UR 1N6NA 2ZUDA 1W1WA 4GSYA 4KU4A 2GESA 3AVXA 4Q9IA 4CT5A 1GNQA 3P4XA 5CM8B 4JLAA 4PAOA 1JB1A 1KAGA 4MYCA 5IT5A 1UBEA 3GCGA 5KDLA 5CLQA 5KTYA 4KFUA 2WM9B 2QRZA 2BMDA 3PUZA 4Q7JB 4RJLA 2QMUA 3FMPB 4BECA 2OBLA 3P32A 2W6JD 4Q9JA 1DO0A 1KNQA 1U2RA 3NH6A 5FI0B 1E2PA 4IXMA 3U2QA 2BBTA 3NHAA 2ZRHA 3QKUA 3RVBA 3OFNA 2KSQA 1Z3IX 4HZIA 4OQFA 3QEOA 3NHBA 3RS5A 4TYPA 3UWOA 4DLXA 3B1ZA 5AJVB 1XEXB 3ZIAD 3EWAA 3CR8A 4M4SA 2YOFA 2K5UA 3GEHA 1NNEA 2ECKA 1TF7A 3Q7QA 1EWQA 2J0UB 1VMAA 2QAGA 3RDPA 1KI9A 3MWYW 2ZE6A 4OK5A 3TW8B 4LY6A 4Q4HA 1ZYUA 3SHFA 3AGQA 3BIFA 4JYBA 1I4LD 3OAAD 5BN3A 1NJFA 1OYWA 5H70A 5TY0A 5JEEA 5FI1B 1ZNZA 4F91B 5G41A 3KXLA 1CXZA 3K9NA 1XPOA 2ORIA 2QENA 3KUCA 2V55B 1F5NA 3BJIC 1TQ6A 3B1YA 1RRFA 2BMEA 3U5ZB 4FCVA 1W36B 1GL9B 4B2IA 1KY2A 2A7QA 3NEJA 4XTRA 3LY5A 4BFZA 1Q22A 2QSYA 1M34E 3UIEA 4BLRA 1Q0UA 3EASA 1YZTA 4B34A 4D4MA 1VCIA 2AX4A 1JNYA 3QF7A 5AK0A 3FGNA 4C7OB 1FUUA 4BFTA 1W5TA 3KTAB 4OI0A 4JSTA 4HAZA 3QXJA 2CJWB 3NBZC 4JT4A 3WYGA 3PCRB 3ZZ0A 4Q1AA 2C8VA 1W5SA 2EFCB 4Z54A 3CNNA 4Q9LA 4LV6A 1UDWA 1GVNB 2ZJ5A 1MR3F 4YXWD 2R44A 2H92A 1WXQA 2VSXA 4Q66C 1ZM4A 1E0JA 1PZNA 1TF5A 4Q21A 4QJ4A 2O8CA 1WP9A 4M9ZA 3CF6R 3H0KA 4FXPA 4BLQA 4A8JC 2CJWA 1JECA 1P9WA 1VPLA 4JLOA 4HB4A 5TXGA 1RJ9B 3QIAA 4JLKA 3THYB 621PA 4KAXA 3CBQA 3RNLA 2JLQA 2IYVA 1N0VC 3KUDA 1UEJA 1XTJA 4MA4A 3CNOA 4AD8A 1KMQA 4RFSB 1TAGA 4MDFA 2BKUA 2AHOA 4A9AA 5CB6A 1U94A 3AVQA 5SZHB 3AEZA 4CEIB 1G9XA 4GZMA 2O8EA 1II8A 4GMDA 2A5DA 2AWOA 1G5TA 1K6MA 1LS1A 1RJ9A 1YE8A 3P20A 3HP1A 4ASUD 2ZVPX 3QXXA 1M74A 4FI3C 2DY1A 3CLVA 4L16A 1K8RA 1XPRA 4B3GA 4HSEA 2H17A 1UM8A 1XMJA 2I1QA 3BH0A 5GJVC 3NXSA 3DMDA 5DN6D 2ZJAA 3F8TA 2A5YB 3FWYA 5JRJA 3IHLA 2FNAA 4HAWA 2NG1A 3A58B 3ZS9A 4Q7MB 5G53C 1EG7A 3H86A 4V0MA 5CJ2A 4B43A 5J47A 4TZ0A 3U6KA 4Z1MD 3IEVA 4L9SA 1G3RA 4JVNA 3OIVA 3ZH9B 4JJZA 4BEBA 4V0OA 5DLQC 4OHZA 1TUIA 3AF1A 3QF4B 4ARZA 2B21A 3TRFA 1T6NA 2CXXA 5EXPA 3C16C 1EX6A 4DSUA 5BWMA 4IJMA 2YV5A 4NE2A 3S1AB 4HDOB 3TQCA 3SR0A 5JLJA 4ILEA 2NQ2C 4DCSA 2BIFA 2OBNA 5FPTA 4DLUA 5J4KA 2PT7A 2ZPTX 2ZUBA 2O8BA 2FEOA 4L8GA 4HB2A 2BM0A 2NPFA 1NVVR 3KQNA 721PA 2ZR0A 3B1XA 4IFEA 3DOFA 3SDZA 4V0LA 4PZYA 3VKGA 3B5JA 3QXSA 2ZRBA 1FX0A 3BRWD 1NBMD 2NPIA 4YQFA 1NP6A 2HYIC 5DGXA 1W49A 2JJ8A 2QE7A 1R4AA 1RE0A 2ZSBA 4MRNA 4C2UA 3OF5A 1Z63A 5JS7A 5C18A 3B7GA 1XZPA 4MGKR 2GDJA 3ZQ6A 1IQPA 1LF0A 4UXIA 2GZAA 3GEEA 3D31A 2NZ8A 3HDTA 4Q9HA 1AIPA 3I8XA 3LX5A 2YC2C 3B13B 4JLMA 1CRQA 2D3WA 2QP3A 2QRNA 3FYHA 1NG9A 4DLTA 2ZYUX 3QVVA 5B58C 3AVYA 3WYAA 4JBXA 3T1TA 4MGYR 4MH0R 1Y63A 3F3YA 3OAAA 2F1RA 2ZI4A 2PX3A 1CKEA 1P3JA 5HKKD 2VIIA 4OHYA 2W83A 4N0DA 2AKYA 5DYIA 2QUZA 4IEIA 2WZQA 2BOVA 4EFNA 2QU8A 3M4YA 5LDDC 3GLHE 3FMIA 4QFMA 1R5BA 2FSGA 3NIBA 1BH2A 1AQYA 2QZ4A 2RHMA 3B9PA 1XWIA 3CRRA 2XGJA 4TSFA 3B82A 4NP6A 5GJCA 2QL6A 5KPJA 1UBCA 1E1RA 1G19A 3VR2A 1JXMA 4IDHA 5JHGB 1BOFA 2YVUA 1ETUA 3CM0A 2LCFA 3JVVA 1AA9A 2BJWA 2ZR7A 2WJIA 1W47A 1N25A 2IEYA
chains in the Genus database with same CATH superfamily
4AO6A 3EQ6A 1M6WA 2REXB 2CJPA 3KLNA 3PYMA 5FXMA 5JAMA 2YUIA 2ZVJA 2FPMA 1XQVA 2XVAA 1MC4A 1KBZA 1JH8A 2LDXA 2MMCA 1MU0A 1AN0A 5ENDA 3LY8A 4MS4B 4YONB 5J3JA 3STYA 1AUVA 3LX8A 4BO9A 5FOWA 2JLZA 2WSSA 1GIAA 3PDCA 3AY0A 4YYEA 2NUTB 4J1SA 4L0DA 4ZPJA 2CLMB 2ST1A 1JHYA 2YBEA 3UJAA 2D7JA 1NQVA 3ZKWB 1NRJB 4MQMA 3UGTA 4BLTA 2RHGB 3H0CA 3MJRA 1J2RA 2XT9A 1SB8A 2B0CA 3BIOA 1EFVA 3A1DA 3TKAA 3MS2A 3W2GA 5IBPA 2IF0A 3HCRA 4O08A 1RAIA 2YHAA 1DOZA 4EDFA 1VE9A 3CF4G 4YJ3A 1QCZA 3FD8A 4A6DA 4CE6A 3H13A 1QV6A 1OKKD 5KNDD 1R6BX 5K09A 2CLFB 2G4VA 5AOAA 2C5AA 1OX5A 5DYTA 2IEIA 3R9WA 1JFLA 2FWMX 2CNWD 2RIRA 4UJ3A 4IX9A 3E23A 4HATA 4GYJA 2A33A 1K6XA 3EWIA 1I2ZA 4ZT4A 1DEHA 2WMNB 3CVJA 4DUGD 4XDZA 3WYEA 1U3TA 2F43A 4Z3DA 2X0IA 1YAJA 2B6HA 3ZWCA 5JSZB 2CXRA 2OXCA 2W4MA 5FTWA 2QR3A 4EA7A 3L8YA 4X8MA 5FR2A 3HN6A 4REQB 4YASA 5B3AA 2A9KA 2H9AA 1NW8A 3D3KA 3WDSA 4O2LA 2P2SA 4PYRA 5J1SB 3EEYA 4WY8A 3JS5A 4HWPA 5CDUA 1FP1D 1D03A 2Q4RA 4OBXA 1W4BA 2O07A 3ZY6A 4C6TA 3RCBA 3RFTA 4UAJA 3RS3A 5CAEA 1UMCA 2R5WA 1EFPB 1U31A 1YUBA 1R8SA 3ZX4A 2C4KA 3TFQA 4TTTS 1XZLA 4MROA 5BN5B 5HK8A 1LFDB 1WS6A 3LS2A 1TZCA 1MJGM 4MVJM 1XL1A 3E4DA 4EB6B 4R71A 4RPIA 5DFAA 2OM6A 1GXSB 1Z62A 3B3JA 4L4XA 1NXTA 4AP5A 4AZVA 2AG6A 2PBRA 1G20E 3EGXB 3J7TA 4N54A 1UAAA 4L0CA 5GM1A 4EFLA 3SZOA 1X3SA 1Z7GA 1KP2A 5EHGA 2PRJA 3ZDCA 2H1WA 3H7AA 1LC0A 1QRAA 2O7RA 5M7EA 4BWGA 3OIDA 3NS7A 1ESZA 1UDAA 2JFVA 1DJQA 2QYHA 3A8TA 5THKA 1T3SA 3SOZA 4KG7A 2BBWA 1PT8A 4F2GA 1GPAA 2BE9A 4YCSA 5JISA 4QDKA 1GARA 3AP1A 1XLUA 1KYVA 4HEA1 4WRRA 4C08A 1N75A 1QQ6A 4WXYB 2WTXA 1BX0A 1KEKA 2O2CA 4YAEA 2GN2A 2OD2A 1PJAA 2JEYA 1H6AA 3KBBA 4M76B 2HM7A 4QPZA 3I73A 5G1NA 3I5AA 4KJZA 4QOEA 1DAEA 2WG2A 4Q82A 1VRVA 4OQDA 4P9NA 4MQBA 4QXPA 4AJ9A 4YHHB 2FDCA 4AY6A 5E2IA 1Q0ZA 3KPVA 2VP9A 3K4HA 5EIBD 3HY6A 4QREA 2FUKA 1D9XA 4DCGA 1HLFA 2PGAA 2HIAA 1CZRA 3CLKA 5SYNA 3LM8A 4PS0A 3EFHA 3ODPA 3BOSA 3CUTA 3HDHA 6GPBA 2WJZB 2WU3A 1F2UB 3PC8C 2R6ZA 3JVEA 3PRYA 5IVDA 3RHZA 3CGWA 3ZHTA 3TLMA 3F7NA 5CHEA 5IVIA 5JJCA 1OAAA 4HQKA 5JH7A 1SXQA 3OUZA 2JZOA 4GOJA 3OZEA 4B8YA 4UTPA 1XCLA 1H1LA 3VAAA 2B34A 4I1IA 4L15A 5K3FA 3MWJA 4ZCLA 4NFSA 2JIDA 1XC7A 2XJ9A 3B1JA 1N34B 2IE8A 1ETHA 1ZJ4A 4LZZA 2J7PD 3O8QA 5T6BA 3GZNB 3VNVA 2C9CA 1EAMA 1E2FA 2NVOA 2Q8NA 4D0NA 4LMBA 4R8SA 2WF5A 2GZDA 3CW8X 2BDTA 3NFRA 5DCUA 2Q7OE 4FQ7A 4WQMA 2Z9DA 1SVSA 2ALJA 3BXPA 3G1UA 1RRGA 3ADCA 4BNVA 3LDGA 2WFZA 1W5FA 3FLEA 2PLFA 1YRYE 3N75A 3MRSA 4IZIA 3V46A 3DDNA 3MZ0A 1T0JB 4DWVA 1CIVA 1U0OC 2WJAA 3H5VA 4D4JA 4IS3A 3OCZA 2RH5A 4KWEA 3RRFA 4Q3BA 1IM2A 3PWZA 4S04A 5K0NA 3MB5A 4G8JA 3B3GA 3HKEA 3KB2A 5EWLB 1P29A 3FHJA 4WZAA 1E5DA 5F2OA 2PA3A 4FMBB 1KL7A 3OPVA 1K27A 3B53X 3PD1A 1NP3A 4EX6A 1K1EA 2XUGA 3HB9A 2VOEA 1RXIA 3GPDG 1XR3A 3WLFA 2OWEA 1H85A 1VJ0A 3OCCA 3AI2A 1M66A 3A05A 4CMCA 4EHFA 4KHPB 1XCBA 2D13A 1KDZA 3BSYA 1T5BA 2E55A 4QBGB 2ZI5A 3LLMA 3EVNA 4NJMA 1BXGA 2GYYA 4R8KA 1ZFNA 4Z3KA 3HZHA 1GCIA 1ZM9A 4HZGA 4YP5A 4B81A 4IICA 5J40A 4EF6A 5A6VA 2J5BA 3H19A 4M60A 1L7NA 4B2YA 1JT9A 1W0KA 3DKIA 5JXGA 1WB9A 1K4YA 2ZEJA 4JXZA 1FS6A 1GQOA 2MMGA 3L7KA 2VATA 3NAGA 4Y67A 2I4OA 1G7RA 4MRSA 4RV4A 4ZQCB 3WLEA 3TLCA 2FSPA 3VFDA 3VPFA 2B8EA 5HCIA 1XTIA 1I51A 2GBCA 4ZYZA 5BR8B 4NNJA 1EUCA 4RESA 4CRWB 1ZQ9A 2AIRA 1UKEA 4HNSA 4P98A 1B6GA 1H4VB 6NULA 4M9UA 4X1KB 2R0QC 3BKXA 2MR6A 2ZR9A 3DTNA 1VG8A 4NHOA 3O8CA 1A9YA 1F4LA 3QSYA 1M8PA 2FFAA 3JQCA 3QY0A 3CB4A 1JFSA 2H7CA 4FU0A 4LJ6A 4TQUS 1MXHA 1TB4A 3ZLUA 5BNTA 4DIUA 3OE1A 5TGTA 2AEMA 3JRWA 3M2TA 3ORHA 3K7EA 5AKYA 4IHAA 5LD2C 3O9MA 3QFTA 2VWGA 3U17A 5BSWA 4FMCF 4NJEB 2ZTUA 2QUBA 1SXJB 1T10A 3W8RA 1U02A 1SBCA 3MMNA 4MUAA 2WSIA 3HXOA 2P11A 1OWMA 3M9XA 3NBUA 4L3OA 4QUAA 4XEHA 5HFNA 4CQNA 2B1JA 4KRXA 1T4DA 1FQOA 4HH0A 2GK4A 3W1VA 1ND6A 5ABPA 5DTEA 4LJKA 1YFLA 4DV2B 2VJCA 4DREA 2AFIA 4NBRA 1MC5A 1ZX1A 1VJ1A 3N70A 4FOTA 2C7RA 4WLVA 1YS6A 1Z4MA 2AW5A 3N2NA 4ESOA 4N5LA 5E95A 2QLNA 4YP7A 4N5MA 5HJ5A 3E2MA 2Q3CA 5HE9A 5DRTA 3AETA 3BL5A 3FCUB 3VX4A 3FZQA 4AMGA 1X1RA 1W4LA 2BTEA 2CNLA 3HR8A 1QKJA 1FYVA 4JUFA 4BUCA 1BRTA 2FU5C 4OUDB 3VR5H 3THXB 3I04M 3PQ7A 4OKNA 4TTJA 3S2IA 3R4CA 1FRZA 3OECA 4XRRA 3EG5A 4HH4A 4MKGA 4OCZA 4QARA 2A14A 5HJ2A 5BUCA 2GNOA 3DVLA 4LJSA 1DIOB 3DB1A 1BYIA 1R5OA 2KMLA 1CFJA 3DXZA 3MW8A 4J0JA 3PENA 2KM1A 4EIWA 4KE9A 4DSTA 1PQ4A 2O2GA 1DHRA 4S24A 2JFYA 1QM5A 1SHZA 3CWQA 1DG3A 3KSUA 3OU6A 3OZTA 4RCVA 2W2PA 4P7FA 3HCCA 1MOSA 1IPFA 1DAMA 2WM2A 4LEIA 4F3YA 4Z51A 2IW3A 5KOHB 3BEOA 1IWPB 2HU5A 1Z12A 1I5OA 3DONA 1VRCA 1II9A 1LI4A 2DPLA 2IU3A 2V9PA 3P0FA 3PUIA 4BE4A 5BNZA 4B3CA 4OIFA 2W93A 2Q6VA 3SX0A 4AWAA 3Q72A 4D9EA 3TL6A 4P3YA 4KXYA 1Z08A 1JAXA 7REQB 2XZOA 3KXPA 4F21A 1C9DB 2I2XB 3LUHA 1YACA 3ZWWA 3W8DA 3K0KA 2IVZA 1HDXA 1FDSA 1CWUA 2Q0HA 3IEIA 2TS1A 5LP1A 1N5KA 2AOXA 3F2IA 3LYAA 1F7UA 4D42A 2H1SA 5JH7F 2IYEA 3KQQA 4FZVA 3FVRA 4MMXB 5BV7A 5GIOE 3HBMA 4JUCA 4RF3A 1LXCA 3TRHA 4ZCPA 3ORSA 4BU1A 5K3OA 5IKPA 2ZVDA 1TIBA 2O2EA 2V8BA 4MUBA 2V4UA 3K31A 3Q5GA 4LA4A 4IJKA 1QB8A 3KVNA 3NO4A 3QPAA 4N5HX 3K0AB 4XZ3A 1I0IA 3VU0A 4TTVA 5HA5A 2UYHA 3WP1B 3MJ4A 1QX3A 5ECGC 3RV4A 5KTSA 3C3DA 4HWOA 2ZRIA 2O7QA 4NBLA 4YN3A 1KVRA 1KMHB 2P2YA 5FO1A 4B73A 2YVKA 3KR2A 3AXSA 4UU0A 3SVZA 5FCDA 3AJ9A 2XGSA 3DBHB 5CDFA 1J24A 2X0EA 1YS9A 4MJ3A 2MYUA 4RD6A 1Y5MA 4KQFA 5EG5A 4QKQA 4E0BA 2W2QA 3BWVA 4UAUA 2J1LA 4Q7LA 5IAGA 2LBPA 1BMQA 1SHUX 2HXSA 1UR5A 2GO7A 3B2NA 1W7AA 3D6UA 1RYYA 1E18A 2QTTA 3MXTA 4DLWA 4LF7B 3K6KA 3O9VA 1BWQA 1PHPA 3L6OO 1NBAA 1P2BA 2VDKB 4MXDA 3TRJA 3DEZA 4DR5B 1RRMA 2F9FA 3QM1A 4M0FA 3WYFA 1E4YA 1GITA 3PUKA 5FTLA 2UXBB 2PWBA 1H9BA 1PTJA 3DQPA 3L7YA 5BMVA 3G89A 1WXXA 3GVCA 3GRZA 5DISB 2QJTA 3PFKA 1D2EA 4W5QA 4IXTA 4MDYA 4FSXA 1Z45A 2CXOA 4AZ3B 5DBOA 3SN6A 4B09A 3Q85A 1LK5A 4A0SA 5BSTA 2ZUTA 2AG0A 1L5HB 2RGNC 4FYYA 3W6NA 1KI6A 1GR0A 2WYIA 3PV0A 3C97A 2HUNA 5T67A 2ZSHA 2V1UA 3EPHA 4V39A 3EB9A 3D64A 2O8VA 3I39X 4Z7JA 2F1JA 1N2XA 2GUGA 4E3WA 3NOXA 4J3JA 2IOFA 1UINA 2HMUA 2XKJE 3PWSA 1HTTA 4F9TA 3S8EA 3VTZA 4RVUA 1NN3A 2R8OA 4Q4LA 2YWRA 1ZCBA 1M0WA 1D4OA 2FUG1 1BGXT 1X7ZA 3O83A 3OTIA 4ZRMA 3F6RA 3F1LA 4D97A 4D6XA 4PHCA 4Z3OA 4OBWA 4BO0A 4DLPA 3D54D 2GFHA 5KAPA 3PNOA 3UAXA 1DUVG 2QLTA 1U3WA 1VHTA 2YR0A 4EKIA 3G8BA 4A8PA 5C51B 1GPDG 1Z2NX 3FM9A 3A6HA 3ZWOA 2ECQA 1KWGA 3FUUA 2J3MA 4BNUA 2HWUA 2JKYA 4E5SA 1YJBA 2O23A 3KAPA 3IUBA 2VQFB 3D1LA 3G0HA 1R1DA 4GMHA 4O25A 1KA9H 1A71A 1LW6E 2QDKA 4AC9A 4BU0A 4C05A 2YHBA 3BF8A 4EPWA 3BMCB 1CUIA 4NS4A 5AVVA 1H5QA 2C2OA 1WDKA 2Q45A 3N2GA 3QFFA 2X0RA 2YKGA 4P92A 4GXTA 4TLEA 2DERA 4MR7B 4IUCS 3CRMA 4OO3A 3P45A 3OPMA 3HXKA 4S1NA 3KYBA 4KIFA 2JGJA 3KS9A 3E6AA 3UAVA 3HJNA 4R1SA 1J00A 2NVWA 1FTYA 3A28A 3Q0EA 4IRMA 1ZVVA 2O2ZA 4V24A 1AO3A 4Q6WA 3MWDA 5DHQA 4L2IB 1JJAA 1MJ5A 1R18A 1JHMA 1S0UA 3ACBA 1MB9A 5TSDA 4ZJYA 2XLBA 1ZH6A 1RWQA 1RZRA 5AKXA 1DJNA 4GYWA 3ST7A 1E2LA 1U8UA 1YRBA 2UUAB 4MQLA 3EULA 4IWYA 2PV7A 3IPXA 2JFUA 2ZB8A 4OY3A 2P6UA 1KAHA 2I76A 2Y0CA 2PMDA 3D8TA 2R3SA 3E4CA 2D2EA 3GYGA 3OZRA 3QUQA 3TUJC 4GEKA 2Q21A 1AQLA 1G38A 5G02A 1EMDA 2LIVA 3GUCA 1L5QA 5LP6A 1H0SA 2NVUA 1UKVY 1E1RD 2PYZA 5KI6A 5BUQA 3VR2D 5C37A 1CUGA 1MJNA 4QGHA 2J09A 3MS7A 1U0FA 4QOIA 4B74A 5FA6A 2WABA 1EA7A 1EZ4A 1OIWA 2FCRA 2NTVA 2O6LA 3B6KA 3DL0A 3HZZA 4G1EB 4IOLA 4YRRA 1FFXB 5GOTA 5L95A 2O8CB 4L7VA 2ZS8A 2C61A 1Q44A 3KCQA 2CL6X 4PNZA 1K06A 2XITA 4ZREA 3F9RA 1Y1RA 3ZWXA 4CLEA 2WQZA 3RODA 5EQTA 3SS9X 4TYWA 4TMYA 2ORVA 4Q7QA 2NXWA 1E1CA 2F3TA 3ICPA 5BWBA 2IYQA 1YBFA 2C54A 1A69A 1ELOA 2WSSD 3ELYA 5E9JA 2B2CA 2ZJ7A 3EFBA 4CMHA 5I8WA 1R4MA 5EIXA 1WPXA 3NKVA 1E69A 3TE6A 4C01A 4HXGA 1K7YA 1H42A 3CA8A 3RPEA 1GRRA 3M0EA 3U4IA 4KACA 3WI7A 3U19A 1B4DA 3WNQA 1E9RA 2Y9PB 4FONA 1XEWY 3RUDA 4B8WA 3WGHA 2DBRA 4UDXX 2IX9A 1I7QB 5K0CA 1JDBC 4IIDA 1II8B 1Y37A 1TZ2A 2OLEA 3QGMA 4FLMA 1MZPA 1PRYA 1N78A 2GJSA 4F2DA 1QQ5A 4CLOB 2BFDB 2YHIB 1N2JA 5DI3A 1ZP6A 3ICQB 5KAMA 2Q1UA 1NNI1 5FA8A 1H1TA 1N6HA 4ARBA 1JHVA 5L51A 3TD9A 4MB0A 1NVEA 1H2FA 4BMVA 2Z6AA 3A10A 1OOEA 2VP4A 3H97A 5CBPB 3H9QA 1Q0RA 2PZBA 2OEPA 1ADJA 3PA8A 2J3KA 5HRUA 2PLNA 1JFFB 1Q3HA 1M76A 3MINA 4LWPA 1GG5A 2XLCA 4NZMA 1U0EA 1R0CA 2HK6A 2YXBA 3PG5A 4EEZA 2GBPA 2XCQA 2ZIUB 2ZAMA 2ZRQA 2JG3A 1HNNA 1DXOA 2HA3A 1KY5A 5FUVA 1YB1A 1LFAA 4OH1A 1T29A 2YYZA 1G42A 4MS3B 5ALOA 2H29A 4G01B 4MUHA 3WB1A 3ZK8A 4DPMA 1WG8A 2PSSA 5GMOA 5AKKA 1SU7A 3KNZA 1TQ2A 2VF4X 2DBZA 1SGWA 2B0JA 3AQIA 4KKXB 4ZV9A 5C31A 2DB3A 1DARA 1E92A 1TM4E 2Q9CA 3PNQA 3RTEA 3GT0A 3L8FA 3LLVA 4ILKA 3ESCA 1ZR2A 5T3UA 4FNAA 3EDCA 1R37A 3SXPA 2C1EA 3HXQA 2O8BB 2NTEA 5JAOA 1X8LA 2PLRA 2XH8A 1J1UA 4EJSA 2H16A 2PVPA 4A6PA 3I0NA 4CKCB 5JAHA 3PGJA 3W5DA 1IDN1 1XAIA 1Z7EA 1TFRA 2NLOA 4K8RB 5FUWA 1FFYA 4FFVA 3SJ7A 4E12A 2XVYA 1XMSA 3G9UA 4HH1A 1UZAA 1XZFA 3ZE8A 3ZVMA 2AZTA 1NVVQ 4HN9A 1ZEMA 4QQKA 5JTTA 1X1TA 1K8ZB 1GTRA 2V4ZA 1WXEA 1T0PA 1WHTA 1XXHA 3GGPA 2VUUA 3L7NA 4UBIA 4B6OA 3IL2A 3NC0C 3PPWA 1C7JA 1FLVA 2CCGA 1DV1A 2X6TA 1YRAA 3H5WA 4UUBA 3HEMA 4FX2A 4A0QA 2CUTA 2IITA 3KFVA 4OHKA 2F00A 1U1GA 4F84A 3AEYA 1SK9A 3RIXA 3P8ZA 1S89A 5IVPA 1GKUB 2OR3A 3KJEA 3QOXA 2C9DA 1PV4A 2JI4A 3QVWA 4ZGBA 3WWCA 1J56A 5AM2A 4C2BA 4RTKA 4FJ2A 3IURA 3K9FC 3TN7A 1AK1A 1DINA 3D81A 2ZSEA 4BZPA 3EQ7A 2X9NA 1BEEA 3C3KA 4JLUA 1Y4AE 1K8QA 4RGYA 4Z9YA 3BWMA 1G3MA 2W6PA 3JD2A 1ZGAA 2AOUA 4KQCA 4OXQA 3BSWA 4DXHA 2ZBPA 4FFDA 4F8YA 2YN0A 3PDIB 3W3ZB 3QVXA 4GAEA 4J7XA 3KUUA 2VK4A 1SCUB 3OUUA 5IWAB 2W6QA 3D0RA 4Y6OA 1I4OA 4RPKA 1CY6A 4LNHA 2XPCA 3MCAA 3SIPA 4ZYTA 4OAQA 1QE0A 2ZSKA 5JE8A 4DDKA 2H07A 4W6ZA 2WIDA 3CZCA 2NU7A 3WA7A 3LBHA 4KAFA 5ALMA 3Q10A 5CT6A 2O5RA 3TLBA 4TWAA 1B16A 4BAGA 1KO8A 2V03A 4HH3C 4JI3B 3EJ6A 1D2AA 3L7OA 4Z8XA 4J16C 1DBQA 1QO7A 4G5FA 2RHBA 1BWRA 1L6IA 2AFHB 2CLDX 4KGVA 5LNK6 2ACEA 1AV6A 3AGPA 1UP6A 5EWMA 2A9QA 1OX4A 1MFZA 3FCAA 3WL6A 1N2SA 2W43A 2NYRA 3AUJB 3DFMA 1Q7EA 4FKZA 4JSYA 4RADA 4Z9XA 2F9LA 4PWYA 4Z0HO 3AB3A 1T5OA 1MAVA 1U9ZA 3DMTC 3RVJA 4LFBB 3PQ3A 3ECCA 1Q84A 4AVYA 5A0TA 1NT2A 4PSAA 1S7CA 3EFEA 3W9BA 1CEEA 2YS6A 1XNRB 1EDDA 3IP5A 3UW3A 2XE6A 1TLFA 2CCKA 4G36A 2VWQA 2XMDA 4FLEA 1GHTA 2NU8A 4CEJA 3FWPA 5U1PA 2E4WA 2JIMA 2QRMA 2ZANA 3A6LA 3EZ9A 3L6RA 4W1RA 5CX1A 4B7XA 4X85A 3IV7A 1ORTA 2J6BA 1RRCA 4LBWA 3LGAA 4YP0A 3ONFA 4A8TA 4CTKA 8GPBA 3MTIA 1PJZA 1W0KD 4R2LA 5GVSA 3C87A 1E60A 3Q41A 2Z58A 2AUMA 1RXYA 3F8WA 4G0YA 1YR6A 2C2YA 2WHPB 1DOAA 4TRRA 1NWCA 2ZT7A 5F52A 3ZCTA 1SQ6A 4I4TB 4AIRA 1R9GA 4NXMB 5T4HA 4HMOA 2BYTA 2XTNA 4X7PA 1PX0A 3Q12A 4RSGA 1JG1A 1ULZA 2W48A 4OPMA 2JCBA 1EGVB 2GEBA 1WDMA 3VR3A 2WF9A 2GAFA 2ZIZA 1SHTX 2QRKA 1Z2AA 1OC4A 1BN6A 3Q7IA 5IAKA 1MAUA 3T5MA 3LCVB 1MPXA 1ZMTA 3NH9A 5FWNA 4KR7A 2HU7A 1ZY2A 4PQYA 5F77A 3FH0A 3STWA 2CB9A 2EJUA 3EXHC 3F6CA 4YUAA 2QX4A 2DR0A 2CDCA 1CUVA 3GIWA 4K6CA 4R1TA 4MWOA 5CYFA 5FV4A 1IXKA 1KI1A 3BD7A 3DUFA 2M2IA 1NQXA 4MR8B 1F3LA 4Y2YA 4YMWA 4UNQA 1AURA 1IEQA 2HJWA 3U3JA 3PUXA 2PVSA 4M83A 4KV9A 1TI7A 2J4FA 2XNDA 3DG9A 3V4OA 4BNJA 5K9ZA 2XKKA 3RJ5A 1C4XA 5IX8A 3GNQA 4K5QA 1JIXA 4P5EA 5C5IA 3CH4B 2OGSA 1JMKC 4NG5A 4TL8A 1O97C 2CD9A 4YT8A 3NZEA 1MH9A 4PV7A 1UPAA 2VDMB 4IGAA 4CFYA 1LRJA 3TTWA 1R0SA 2ASVA 3GEMA 2JAOA 3NDIA 4INJA 3WWOA 1G20A 2WMDA 2H4FA 2QP4A 1GL6A 4IILA 4YFYA 2J0SA 5C8YA 1L2TA 4K2HA 1SULA 2VTEA 3AOEC 2GZ3A 3PC8A 2QT1A 3QKIA 3R9KA 1AZTA 1ZH4A 3C3MA 3T5DA 1JHUA 1RPAA 4DG9A 3OY7A 3LY7A 3LDAA 1QHHB 1TYDE 3PLNA 2QGZA 2R1ZA 2VNAA 1TJYA 3Q2OA 1E2HA 2E89A 2ZRKA 3B51X 2QT0A 2R7LA 3P9NA 3G59A 4MV0A 4UMFA 3UA4A 3WHKA 3TSCA 1FCJA 3SYTA 3A9VA 3IMCA 3RD5A 4AG5A 1D7OA 1ENPA 1FSSA 4U0KA 2HDOA 1VL2A 3HG7A 1LLCA 2VJQA 4L4SA 4U9HS 4F9EA 4RDXA 3A6KA 2NX2A 3VO8A 1I36A 4AO8A 3QU4A 3M6AA 1F8XA 4WBNB 3MK31 2QNIA 4GPTA 4QBKA 3NMUF 5BPFA 3M5DA 1HFWA 1N0UA 1G7SA 1RLTA 2GN8A 4J1NA 5DNDA 3VHXA 2DTDA 1R8QA 2FRXA 2X9VA 4BOYA 3NOOA 2YRXA 3O2NA 4C7JA 3A1VA 2N9UA 3B9BA 3P9SA 3P9RA 4NV3A 3RW9A 5C8VA 1OJLA 1VPDA 4BV2A 1PG5A 1RS0A 1TM2A 1QR6A 4J7CA 2QS9A 1IVNA 2XNKA 2O3TA 5K1ZA 1CY8A 4YHBA 4IDFA 3E5NA 2TYSB 3UJ9A 5C32A 1VMDA 3D8UA 4D25A 4NQZA 4HV4A 4BLWA 1VL0A 3OE5A 4EO9A 2HH9A 3L7DA 3PA6A 3LSYA 1SUDA 1UADA 1GKYA 3THOA 1Z29A 4G1FA 4Y9RA 4NE7A 4PZUA 4KPUB 2ZTSA 3CGGA 4TQAA 1ZNYA 3BFJA 3OEWA 3I12A 4H1HA 2OYRA 1PJ3A 2WV7A 1ZK3A 3FZGA 4KNWA 1U9IC 2I67A 3TR0A 4CTJA 2ZJYA 1Z16A 1QPGA 2G9VA 4URUR 1AGPA 2X0NA 5TJHA 3NKFA 4YWJA 4Y1RA 2WIAA 3CRNA 2VHEA 3DR3A 3AHJA 4KEAA 5E1BA 1UBRS 3JZDA 1U0TA 4L4YA 3RGGA 3PYXA 3RYIA 4RTPA 2HXGA 4MHSA 1GPMA 1UKZA 2XMSA 1KO7A 5NLLA 7ABPA 4NHEA 2FWAA 5ESWA 3NVMB 1JKFA 4EPXA 4O4HA 3THWA 1E4EA 3PLRA 4ZZ3A 4X60A 1Z74A 3AB8A 3MUFA 5ILOA 4R5HA 3BD8A 1MX9A 2WB4A 1B6TA 2VYNA 1KYQA 1SHKA 1U1DA 3O8BA 3E5HA 1KH2A 1M1YB 2C3MA 1RSZA 5E4JA 2GCOB 5B1HA 1SPBS 2A6PA 5CH5A 2QPAA 2H2HA 2I7CA 3AEUA 3NJRA 3R7DA 4C4AA 5I7EA 3V4LA 2ODEA 3BULA 4DCNA 4TTPA 3DE1X 3MMZA 1VMKA 4MR9A 1NASA 3DL2A 5EMNA 3UO8B 4G0ZA 3V8VA 1I7DA 1JEDA 3C4VA 3KJZA 5KNBD 4M9RA 1FS4A 5ITZA 3FVTA 5D3MA 2P3QA 3CKLA 2PA0A 5AJYA 5G0SA 5DIZA 2HV9A 2F55A 4ALNA 3GUUA 2H4WA 4H4CA 4A73A 4MVYA 4DPKA 5ITVA 3HR4A 1EP9A 1EWTA 1WKBA 4Q48A 1U7DA 4I1VA 1NW6A 3P2IA 4GO1A 2X2EA 2WWHA 5IK2A 5I7WA 4OFXA 3WA6A 2H18A 2YFKA 1Q5PA 1WU8A 1BFKA 2YJZA 2PRSA 3ADPA 4MYTA 4CF7A 1L1FA 3U60B 1U5BB 2O20A 5FBRB 2C9BA 5AOVA 4TXJA 3UV6A 5I4IA 5AI4A 5DK4A 5HIJA 2HW8A 1AHHA 1GFZA 5BRAA 1RIFA 3MLAA 3R8FA 4J75A 4L9WA 3RUCA 4NCNA 2EJWA 5A6SA 4QLBA 4G1MB 4HMQA 4HWGA 4RGVA 1HDIA 2CZGA 1CUYA 4F9FA 5JQGA 3ORYA 2JIQA 1HE4A 4KO3S 4FSHA 1MV8A 1QG6A 1Y0BA 3JCZA 4RK1A 3R2JA 5IRCD 5BWNA 4GD3Q 2DHRA 1W9HA 4HDKB 4PTYA 1N6OA 2OGZA 1GUDA 3L79A 2IXGA 2PQ0A 4M1SA 3T1VA 3V4SA 3WAKA 1YTUA 5KNDH 3EAFA 2OTCA 1ZSVA 1XWWA 2PYDA 3P7MA 1LZLA 1QV9A 4P08A 4F7WA 2ZT5A 3C3XA 2QORA 3NB0A 1M83A 3TMYA 4NYJQ 2VQ3A 3D5EA 3DWIA 1T26A 2YXEA 3HP7A 3U49A 1VLQA 3ND8A 1QZXA 5JDIC 1XIVA 1DX4A 3QEMA 3WL5A 4YT2A 1M0EA 4Z1OA 3IMEA 4XEUA 5AHKA 1I33A 3QLVC 1WHSA 4EB6A 5TVGA 4J1TC 2H2AA 4UM9B 2FMTA 3BHNA 3JYNA 1FJ2A 4AXBA 1FB5A 3V7UA 4N5NA 3UKJA 2QN2A 3I2JA 3LO8A 2P1RA 2C5FA 3L0SA 2XI4A 2H4XA 2ZITA 4PLTA 3TZ6A 5C8YF 2B7LA 5CB8A 2O1EA 2XXAA 1RZRD 2J45A 4UEOA 5D51S 3T3DA 4P0PB 3I2HA 1LTKA 3N0XA 3Q98A 3FF1A 1FDTA 3WWPA 3AWIA 1C5KA 4MRVA 1FS5A 4BXOB 4RF5A 2A9PA 5I9SA 4OB8A 4QODA 1ONBA 4GOLD 5EE1A 1KYWA 4D46A 1EP1B 1EX7A 1CCWA 2WDPA 3GHYA 5K7SA 3Q7EA 3I5XA 1LPNA 1QLJA 2QJOA 2O9JA 1HDYA 2ZSJA 3ICOA 2FN9A 4M9CA 4PZCA 3VU3A 2ZUWA 1GFWA 2GEVA 3GH3A 2HWYA 5DP2A 2Q46A 3RT1A 1YQTA 2ZDQA 1FFHA 3AVVA 3M33A 3EH2A 1UZMA 3RK0A 3RV3A 5BURA 4CF6A 1UC5B 3HB5X 2G40A 1GADO 1KU0A 3JQDA 1K08A 4JXKA 1J0AA 1XU4A 4WI1A 2JLYA 1ZPDA 2PMFA 1IOVA 1THTA 2HSZA 2WKPA 3DVAA 2ZTLA 4X1OA 5E7IA 4BN5A 1JIQA 2YOHA 2Z2JA 1UMBB 3U3MA 1W34A 1Y4ZA 5JVDA 2DTEA 2JH9A 2XB4A 5E3HA 4MVJF 1PD1A 2EW8A 1SU8A 4K9NA 4LRUA 1G8SA 4UNPA 1VBMA 3AM5A 2FUNB 3I04A 4K9QA 4ND8B 2CYAA 2IKSA 4HPWA 4DB2A 2AC4A 3UG7A 5KYUA 2OSBA 3SQNA 2R6DA 2I7DA 1JR3E 3GVXA 4AM8A 1GU1A 1PAUA 2PWAA 2RI1A 2YY7A 3GA7A 2R8EA 1AUXA 3BJZA 1Z6PA 3SYLA 1YU6A 4I5EA 1CF2O 3G2QA 3HP4A 3NJ8A 4RANA 1G18A 3GLFB 1MOPA 3C45A 4TVSA 3ESYA 1PT9A 5KIAA 2X23A 1N1MA 3TCNA 2D7CA 1CUBA 4MLZA 3NDJA 3GLGB 3F74A 1EVLA 2HK7A 2BFPA 3U7QB 1Y3IA 3AF2A 2BI4A 3W2IA 4CDMA 3DSRA 5D3QA 5KSYA 1LF5A 1IJBA 2GM5A 2K7ZA 2GPBA 3S2ZA 1P5FA 2C5LA 2EHDA 3ZWMA 1OXTA 1YXMA 2V0CA 2DFLA 2O2JA 4JI1B 5KU1A 1YK1A 2QE6A 2QVZX 1UQTA 2XMGA 3EGVA 1Z34A 3S2SA 5EZ6B 3H2IA 2PH7A 3ZY2A 3TNLA 4TV9A 4WBSA 1N9GA 1X0XA 3FWHA 3ZE1B 1VI6A 2JA2A 1ZD8A 3ZV7A 5B64A 1V5WA 3FDZB 4U5QA 1DIHA 3UMBA 4DIEA 3KAQA 5JI2E 5LYJF 3F6PA 5K2MA 2F1IA 1BIFA 3H4IA 2RGXA 3K2QA 3F5QA 4MV8A 2YNMD 4DDHA 3VSEA 2O2HA 3TXXA 3V4ZA 3W8EA 1GDDA 2Q3LA 1XRSB 4FBLA 1CNEA 2HT6A 2V7QA 1IU9A 3A7DA 3DCNA 1UPFA 4OJMX 2VQSA 3RVKA 4FS8A 4JLNA 3WFJA 5AVUA 5JZMA 2C42A 4RIEA 3IIMA 1V39A 3ODGA 5FQNA 5DNUA 1NT4A 4TTSA 3W8FA 4CLHA 2WU0A 3PC3A 1VYVA 3B78A 3FYDA 4FC7A 3CR7A 1YJAA 3RQIA 4U7JA 4XQ9A 2FPXA 1JAZA 1CLUA 4LRXA 3QW2A 1IIRA 1N5LA 3FRJA 4BB6A 1ZJWA 3TB4A 5A4FS 5FLXA 5EOVA 2FSSA 4B3TB 1CUCA 3U9LA 1KHHA 1FDRA 1TO6A 2OMEA 3EEQA 1LNQA 1Z5GA 4G89A 3VMFA 1ECJA 3B20A 3BK7A 3HLYA 4QEZA 2OG1A 3A11A 3MILA 4OAPA 5EJFA 5FYQA 1VJTA 1O5OA 1NE7A 1UBKS 2WJGA 4N41A 4TLLB 4K9KA 3MTGA 1IHPA 4RZIA 1DDOA 1X42A 4I50A 1NF3A 1V1RA 2WJPA 1YL7A 2OENG 3HYCA 3L02A 3ZE0B 2ZB3A 2M1XA 4XH9B 4OI4A 4EMBA 3UJDA 3A6PC 2D0DA 4CLRA 3HBJA 4BZXA 1DX6A 3PE3A 1DU4A 1T9BA 2X15A 2Z2YA 4BO1A 2YWDA 3FTNA 4J94A 1ZD3A 4QTTB 1Z7YA 3WGOA 2WYWA 4XYEA 2AN4A 5P8WA 5IDWA 5EZSA 1FYWA 1UZUA 3ZHRA 2I3GA 1PFGA 3I6YA 3T5GA 3G0GA 5F2EA 1ZJZA 4C7MA 1UT8A 2P9TA 3IE1A 1N8SA 1GR1A 1D0IA 1QLWA 4POAA 4MKHA 1YVPA 1H9AA 1Y3FE 3HMQA 4NONA 5AKJA 5AW5A 4KRFA 4XIJA 2JGKA 3WGZA 1FSZA 2FGJA 3RVSA 1IN8A 4AX8A 4RHXA 2YMMA 5HJ7A 2GF9A 1DAHA 4US0R 1W2WB 3L84A 3TIGA 4D9MA 3R7LA 3TLGB 1ML3A 2FZ5A 4LZAA 5AM1A 1U9CA 3H8VA 1D6NA 4B6RA 1QVAA 4OK6A 5JJ5A 4RDCA 3FUWA 2ZYGA 2IPNA 4WNYA 4OI1A 2VWPA 5B2EA 1ADGA 1JSCA 3B3AA 5D3KA 4DNFA 5KOIA 4D9FA 1DP4A 1YA6A 3DDUA 1OBCA 3TG2A 2B36A 5JECA 3OH8A 1L5KA 2C2WA 3CZRA 1JYFA 2ZWPA 1GQ2A 2BCEA 4MA5A 5D8DA 4KQ1A 4FYMA 4X6LA 3GP8A 2R85A 4RPCA 4FR5A 4D7AA 1RPZA 3W78A 2UZ3A 4EYQA 3CLRC 3AU8A 3MB8A 5ALZA 3VO2A 4CUKA 4EHBA 1GZUA 3MD0A 2J0UA 5LZ7A 1JHOA 2HJ9A 3PVSA 4GP7A 5ALRA 4AUNA 1M2WA 3D2CA 1J90A 3MELA 3G7SA 2C77A 1YBMA 2EX4A 4F4UA 4ROTA 3T5BA 4D9BA 1KI7A 1POWA 4YJ2F 1JQ3A 2QLMA 5DT9A 4LDZA 3P9XA 4JL6A 4OYRA 1IRXA 3THRA 3DZJA 4F5DA 1SVOA 4H6PA 1I6WA 1U7HA 2CCJA 4JCCA 4RZHA 4A6EA 4BNXA 1KZGB 1B14A 5E9AA 3L4JA 3EWSA 2D00A 1CR1A 3Q4GA 2OOSA 2WDZA 3VR3D 4UOEA 1G66A 1CW2B 1XK6A 5B2ZA 3UWKA 4IP0A 2NZWA 1JPVA 2YC4C 1ZAKA 1RQ7A 1USIA 1W5BA 1X77A 3GARA 3OCUA 3PR3A 1FTNA 5CCXA 2PY6A 2RKOA 1RYFA 2XCOA 3U7GA 2F7SA 2B5OA 1P7VA 4WTOA 3Q9UA 4A36A 4X61A 4LNUA 2NZYA 1AM4D 1YZKA 1X7WB 3FGOA 5JMWA 4Q9DA 2C83A 4GXNA 1T2AA 3G7UA 3HSSA 3KB8A 5T4FA 3T12A 2DF8A 1JJ7A 2Z04A 3D6FA 1IL0A 5C0OE 3AEKB 1QANA 2O14A 4B3DA 1Z35A 1NYLA 2V0NA 3NV9A 4KXMA 4Y2GA