1E0SA

Small g protein arf6-gdp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
GKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Arf6-Gdp Suggests a Basis for Guanine Nucleotide Exchange Factors Specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags G protein
molecule keywords ADP-RIBOSYLATION FACTOR 6
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e0sA00
2ODNA 2V4ZA 3GCGA 1G1MA 2F43B 2GK6A 3Q9LA 1S2MA 3QF4A 4PPGA 4ZIRB 1UKVY 2F3RA 2ODWA 2WBLC 1R5OA 4O2RA 1GUAA 4LJ6A 1E2FA 1UKZA 4PQFA 2FNAA 5JFGA 1ETUA 2BEKA 4LK2A 4RZUA 3CH5A 1X1RA 3BD9A 2ZUDA 1IY1A 2R6AA 4PPNA 1C9KA 4LJ9A 1N0VC 2RGEA 3VHXA 3VR2A 2F1JA 1IN5A 2W2XA 4IDPA 4GMDA 1XCGB 1IJFA 2BMDA 3P4XA 1AN0A 5J47A 3O8BA 2ANCA 2C77A 4D82A 1S9DA 4PR0A 3S1AA 3A4NA 1S8FA 4JT2A 4NYMQ 1S3SA 4DKXA 1YZUA 4HLDA 4LBZA 1LS6A 2FZ4A 4NU0A 4LC0A 4HUQA 4LHWA 1YU9A 3QPWA 5JECA 1KK2A 1X1SA 5EUMA 5HKKA 1OH5A 4Q4AB 2ONJA 3GEHA 2X77A 4TMTA 2V7QA 1WMSA 3UXMA 2GHIA 4CIDA 2JLQA 4M1WA 4V02A 4DLUA 1EFCA 4EQ6A 3N70A 2GESA 4GRAA 3B1XA 1E0KA 2ZS7A 1N6NA 1GTVA 2ZRHA 4EFMA 1DAGA 3HJNA 2ZJAA 1G3MA 4L4UA 4D4LA 5HE8A 4NYJR 4BRWA 3OF5A 3GLGB 2Z83A 221PA 3D7MA 4A9AA 1X8JA 4YQFA 5EXTA 4PTLA 4GDFA 2WOJA 2GXSA 3U3KA 4BFVA 4DLXA 2QA5A 1R4AA 4TYPA 3WMFA 1TL7C 1G6OA 4E07A 2ZE5A 2QNRA 4EPXA 3U7GA 1IXZA 3L82B 2JDIA 1I4DD 3AVVA 2HEIA 2GF0A 3TK1A 4Q1CA 3VX4A 4B47A 3BK7A 1OB5A 5H8WA 3RRZA 1NVVQ 1Z0KA 2H18A 2F9LA 2YWEA 3KUCA 2D7DA 1IJEA 3NBXX 5HZHA 3ZD7A 1E2LA 3I32A 3ZQJA 4KXFB 4ACBA 4FWIB 5J5CA 3VKGA 4B3GA 1MRSA 5JCPA 4TMWA 4MITA 4B43A 2KBEA 5JJKA 1K5DA 1W7AA 5DI3A 2ZQ5A 1AKYA 4JZKA 3ND8A 2O0KA 1KKMA 4ON9A 2ZAOA 2P5SA 2ZRKA 1KK1A 3BWDD 3N2EA 1FMJA 3T1OA 3BIFA 5EE0A 1W0KD 5SZKB 1OIVA 4PZZA 2AFHE 1CIPA 3DMNA 3PJRA 1MO6A 1U0HC 4KHZA 4LV6A 5J40A 2ZXUA 3EWAA 1ZMXA 2O8EA 1SXJD 1OXTA 2YOGA 2QM7A 2VP6A 1ZUHA 2A5JA 4CRWB 4ZCLA 3WP1B 4A92A 1AGRA 3NC0C 4UQOA 3ZS8A 1Q21A 2IA5A 5KTYA 4BFXA 4C9BA 4HDCA 1KNQA 5SZIA 2Z0MA 5J4HA 1ZVQA 3L0SA 4JYBA 2WPDA 1YKSA 3ZVRA 2W00A 2O8BB 3PUVA 1XEXA 3GFPA 3GLGE 2YOHA 2YYZA 3RSLA 2GDJA 3SS8A 3MLEA 2ERYA 3NBYC 4H1UA 4EAQA 3TR0A 4DZZA 4TSFA 3KJEA 5DIFA 4UXJA 1TPZA 3MJHA 4ZPXA 1ZNZA 4LRWA 4RZXA 1N6LA 2VYFA 5UKDA 2O8DB 1GKUB 1Z0FA 1NVWQ 3BH0A 4CT4B 3FDIA 4DLWA 4GI7A 3RNLA 2CLCX 3HR7A 4ZCIA 4UXHA 1F6BA 1LB1B 1II8B 4RCZA 2YKGA 2WJHA 2JJ1A 1T8UA 5CB6A 4R2HA 4CEHA 4N1AA 2OCAA 4JSYA 1N3BA 3AF4A 2REXB 3DZDA 4DCSA 3I4LA 1ANKA 3A36A 4CZ2A 5J4LA 3U6BA 1E4VA 1T5IA 2EFCB 2OLJA 3K8YA 1NG9A 3H4MA 2ZTSA 2Q9CA 1Z08A 3X1YA 3SHFA 2CCKA 5DGXA 1A82A 4JLNA 2NO0A 3OEHA 2B7CA 4P32A 4B76A 2WIBA 4FW9A 4RVCA 3ZZ0A 4DSNA 3WNBA 3SJCA 3SEAA 3EASA 4LI0A 3T1TA 2RHDA 1P2VA 1YZTA 5C1BA 3SI7A 3QEJA 3JVVA 2P3SA 3L8YA 2ONKA 4MRRA 621PA 3IIMA 3RABA 4NZYA 1BS1A 2V6JA 1XCMA 4TYQA 1G21E 1A2KC 1HURA 2IEYA 4M9SA 2G83A 1HUQA 2QSZA 3HPRA 3QXXA 4M1SA 4Q1DA 3OFNA 1AIPA 3AKDA 3NEJA 1AK2A 1X6VA 1AZTA 3LO5A 3EPLA 1G3UA 1LTQA 2WTUA 3TE6A 3EG5A 3SBEA 1FFHA 4LSGA 2OBLA 4JT4A 2MSEB 4LBVA 4FCVA 2ZRLA 1RIFA 2REOA 3RRMA 3GJ6A 2Q6TA 1KDTA 2WKRA 2JGNA 2QUZA 4WOPA 2IYSA 1BOFA 4GOKA 4NYMR 3K0SA 1CJVC 1Z28A 4HLQB 5FTKA 2PJRA 3GJ8A 5E95A 5DH9A 2RGXA 3AH8A 3IDQA 2ASEA 2EYUA 1XMJA 2B21A 1VECA 1LF5A 4BFYA 1ZU5A 3D8BA 1G7SA 2VP9A 5FOXA 4BGDA 1AS3A 2DFKB 1CP2A 4MA4A 1CJTC 2GZDA 5KDOA 2FEOA 3QG1A 4MRSA 1W44A 2IEZA 3RWOA 1SKQA 2AL7A 4JMPA 3K09A 4KYUA 4LYJA 5J4YA 3L0PA 4M22A 1EG7A 3VTKA 2CL6X 1XPRA 5A0FA 1SULA 2HXYA 3AVYA 4FINA 3UWKA 1NG1A 1W2HA 4IDOA 1K8RA 1MOZA 4QC2A 1OKKA 1GWNA 3D3QA 1S0UA 4HLUA 4EPRA 4PC7A 1P73A 2P67A 2WSSD 3IHLA 2AN9A 2X2FA 4URUR 5EP4A 5JWHA 2C5LA 4IOMA 2BDTA 4LY6A 3X1WA 4NCIA 3CR8A 3VR3A 2QI9C 3A1TA 3THYA 2DWOA 4C0KA 4RSGA 5BQ5A 1DOAA 4DXAA 1K5GA 3TLXA 4A2QA 1W4CA 3BH7A 5EE9A 4C2UA 3TR5A 4P0TA 2MSDB 4EFNA 4A2PA 2ZU0C 1FQKA 4NCNA 1JNYA 2R62A 2PLFA 2I1VB 3B9QA 1F2TA 1VMAA 4YONB 1Z83A 3CW2A 2C04A 1MH1A 3U7HB 2WAYA 2NTYC 5CK5A 3SBDA 1W49A 4CEIB 4IVRA 1PLJA 1U98A 3T1VA 1W4RA 3FMFA 2D2EA 3MRSA 4V0MA 2EVWX 5HKKD 2QG6A 3TUZC 3I1FA 1LV7A 2ZROA 3LVRE 1DAEA 2R2AA 1U8AA 2OFXA 4US2R 4YLGA 3LDAA 1GM5A 2RGCA 4DLTA 1F2UA 4IOLA 2GEUA 5AJYA 2QAGC 1T9HA 3AP3A 4Q1AA 2I3BA 1KTVA 2GTPA 4IHQA 2Q9BA 3CX7A 3MWKA 4NKRA 3TJZA 4OL0A 3OE7A 2ZANA 1RKBA 2CLDX 1XDBA 1FUUA 1E2EA 1TEVA 1JI0A 3PEYA 2ZRNA 1XMVA 2FF7A 4Q9IA 2PH1A 4TQAA 2VP0A 8OHMA 3BRWD 2QENA 4AG5A 3SFVA 2ZRBA 1G8PA 2P6NA 4AKGA 1E98A 5DLQC 4NCKA 3BAFA 4DUGA 2J0UA 3U7EB 4B34A 3PIRA 1HEIA 1KOFA 1BO6A 4OHZA 2R44A 3TAUA 1RPZA 4GL2A 4YDSA 3KKQA 3I5XA 5JS8A 2QBYA 4MRVA 1ZNWA 3U7FB 4B3CA 1KI4A 2IC5A 1B23P 1JQLB 2A5DA 2WJIA 3JVUA 2ZYUX 4XD7D 1M8PA 4M0LA 2ZETA 5LB2A 1ZRHA 3UIEA 2QL6A 4BEJA 1ESNA 2AFIE 3KB2A 1MABB 1COWD 4O3MA 1OXVA 3FYHA 1ZUIA 1E79D 3ND9A 1PVOA 2G0NA 2H92A 3C7KA 4D2IA 3U61B 1XCPA 2H17A 5JJIA 3CWZA 1W48A 2QP3A 1XU4A 3SU8A 2BM1A 1KI3A 4PO1A 3M1IA 3X1DA 1SHZA 2R6FA 1Z29A 5JS7A 5DN6D 2C99A 5E7JA 3UMFA 5BW8A 4OK6A 5LD2C 4BZPA 1KZGB 1P5ZB 1ZU4A 4JL5A 4PZYA 4CF7A 1GIAA 4BFUA 1E0SA 3T5GA 1R10A 2EFEB 3ZJYA 1NLZA 1UBEA 1J99A 1CRPA 4DT1A 3QKRA 3CWQA 1GNRA 4MUBA 1QHYA 4JLJA 4XOIA 4C0AC 4UXIA 1A4RA 2ZVQX 1E2DA 5J4VA 1UEIA 2QY9A 3H86A 4DBLC 5LDDC 1P62B 1T0HB 4V0OA 1IY2A 1N2CE 2XTZA 2JLRA 1UKYA 2CNWD 3AV0B 3CUEF 2N46A 1MO5A 5B30A 3MGCA 4FMCB 1Q12A 1XTKA 4H9GA 421PA 5DYGA 1KI2A 4C0QC 4KO8A 2P65A 1CRQA 3KJIA 5LB4A 2DBYA 1YR7A 2F1IA 3I62A 3NH6A 2HLDA 4W7SA 2X1VA 1WDTA 3DPUA 4KFUA 4F92B 5K8LA 3KJGA 3NWJA 3R9WA 4P33A 1TNDA 1I2MA 1IXSB 1GNQA 1M7HA 2OHFA 1BMFA 5TB5A 4EJSC 2ZAMA 4QM7A 2O8DA 4LV5B 2N42A 2DB3A 4LGMA 2AKAB 1AA9A 1JEEA 3VR5A 1E69A 2WWHA 2EFDB 1XX6A 2WWIA 4QOSA 4G01B 3I92A 4I4LA 4P31A 4KFSA 2GJ9A 4C0SA 1XWIA 3ZQ6A 1T4GA 2GKSA 3EIQA 1E9BA 3VX3A 2KJQA 2PZEA 3IEUA 4Y0AA 4BUJA 2IF2A 3AQ4A 1X8KA 3KZ1E 3GPLA 1II8A 1JBKA 1PUJA 1FZQA 4QFMA 3HR8A 2XZPA 1L2TA 4POAA 2NQ2C 5HPYB 3H84A 2QM8A 3IBGA 3LLMA 4W9MC 1ZM4A 2IYQA 3IIKA 4QG7A 5FPHA 2EU8A 3IPYA 4A15A 2NZ8A 4URZR 3DDCA 2ZRGA 4B3BA 5B64A 1DEKA 1ZM7A 2AHOA 2PMKA 3B8HA 1V5WA 4PFSA 2XB4A 4Q4HB 3SR0A 3RC3A 2PEYA 4OQNA 3VU9A 4DDUA 4TL9A 4C0BA 3CF6R 3WP0A 2E9SA 2O8CB 4LPSA 4B35A 4OK3A 3KTAA 1OLOA 1G3QA 3EZ9A 4WW0A 3FMIA 4BLTA 4KLZA 4XWOA 1GVNB 4WVFA 1JJVA 3LXXA 3EARA 1S96A 3AUXA 1EFRA 4DHEA 121PA 2GRJA 3WBKA 1U8YA 2ZJBA 3B9PA 3ECCA 4IDNA 1E2PA 1I2DA 1Z6AA 4NDZA 2CK3D 2GZAA 2OZEA 4M2LA 3JZAA 3J81k 2D06A 3QIAA 2HLDD 2XJ9A 5BN4A 2OO7A 3HDTA 1N6OA 2GJSA 4ESVA 3DMDA 2JLVA 3NG1A 1U90A 1YZNA 1OFTA 5HTKA 2FEMA 3P27A 4LX0A 2ZYWX 1E1QA 3PXGA 4LV8B 2G1JA 2F43A 2WIAA 1M74A 2W6ID 2V1XA 3I8XA 3VMFA 3BBPA 3O8CA 4QRHA 1G17A 3KKNA 4Q00A 4TLCA 1JR3A 2E87A 3CZPA 4JLPA 4TTPA 4WXRA 4GT1A 2VHTA 3K9LA 5FI1B 1E79A 3NHBA 1NMYA 3VR1A 4G3XA 2C2HA 3KDSE 1CULC 3C5HA 4GOXA 1G3RA 2QU8A 3Q85A 1ZCBA 2PX3A 4KAXA 5E7IA 1G18A 4JBYA 4OBEA 5FTJA 5B2ZA 4A8JC 3CPJB 1GKIA 1WF3A 2C03A 5CB8A 5JRZA 4C7OA 4M9QA 4DLSA 4NH0A 5DE3A 2WKPA 5FL7D 1KY2A 2CE7A 3A4LA 1JR3D 1VDZA 2QMUA 3DZ8A 3P1JA 4L15A 4ABYA 3ZH9B 2ZRPA 3W5JA 2WICA 1E9DA 5G3ZA 4JVSB 2B6HA 5CYPA 3WXMA 1IY0A 1W46A 2OFWA 2BEJA 4TMZA 3IUYA 4PHGA 1R8QA 2TMKA 1XNJA 3S1AB 3GLGA 2WHXA 1P60A 1Q20A 4ERNA 4OHYA 3KKOA 4ITRC 2OLKA 2NO9A 2VHCA 2O52A 3NC1C 3W5IA 4Q19A 3KJHA 5EP1A 5FBQB 3QXCA 5AUOB 1SVWA 4NPHA 1E9AA 4PPFA 4TMXA 3CRW1 4MQBA 4OQLA 4C30A 5D3MB 2A9KA 4G5OA 4Q1BA 4PC3A 2C8VA 4Q4JA 2D2FA 5DI9A 2O8FA 4BFWA 1J2JA 2WJYA 4I1UA 2YWFA 1SQ5A 5GVRA 3CPEA 4WIAA 4WBSA 3MCAA 3IHWA 3FOZA 2WOOA 2JJ8A 2YNMA 4Z1MA 1UADA 2EW1A 1E1RA 2F55A 2JLXA 4Q9KA 4NCHA 5F2EA 3UANA 4HATA 1ZM9A 1ZM3A 3MMPA 1XMSA 4HDOB 1KI9A 4M1YA 2EQBA 2R6CA 1SGWA 3RS2A 1TTTA 1JXOA 2ZE7A 2FSGA 4RFVA 3K53A 4NHOA 2F3TA 2FFHA 5L3SB 1CLUA 2FH5B 3IO5A 4BECA 4O25A 2Z43A 3C8UA 1E3MA 3IILA 2XJ4A 3K0CA 3A1WA 3QKTA 1JB1A 3EZ2A 2QPAA 4W5WA 1K6MA 1LS1A 5B57C 1IOZA 4IFBA 2O8CA 1KMHA 4QNRA 1A1VA 3V00A 4LZZA 2OXCA 1OKKD 4IVQA 4AD8A 1M34E 2IUUA 1VG0B 2QAJA 3GLIE 3M6AA 2GBLC 1RYHA 2IBMA 4NE2A 1W4BA 3EX7C 1JJ7A 1KY3A 3RRNA 5KNBA 2IYUA 1Z5ZA 5FH9A 1G8YA 1NBMA 4ZI2A 2QPOA 4MGYR 2HT1A 1XXHE 2GVZC 2NGRA 3A4MA 4QHYA 2W58A 3UWOA 4GFDA 1OHHD 1S1MA 2ZS8A 3CNNA 3DEFA 5FPYA 1ZC4A 1EX6A 1VHLA 3RS0A 1SZPA 5LPNA 3AM1A 4QJ3A 1P2UA 3GQBA 3SZRA 4D6PA 1PLKA 1ZP6A 2BBWA 2C95A 2GCOA 3LAWA 2BBTA 4B2LA 3CH4B 3WHKA 3PUYA 1GZSA 2DPXA 4JLAA 3QEOA 3TIFA 2XXAB 2O8BA 2Q3MA 1IN8A 4HSEA 3LW7A 5B58C 2VLIA 3CKLA 3OFND 3CRVA 1Z6XA 4TTRA 1HY3A 3VKHA 4BE7B 5FTNA 2IYRA 2NO7A 3B5JA 3MG9A 1L4YA 4ZKEA 3NBZC 1D2EA 1EFUA 2XEXA 3LBIA 1UM8A 1HQCA 1F3OA 4B3XA 5JWRA 2IWHA 4PPQA 3W3AA 2C9CA 3EZ6A 1KAGA 4MDEA 2F1HA 1RRPA 5CITA 3A37A 3QSYA 3DKVA 4M1KA 5GJWC 1J7KA 1OFHA 3QF7A 1G16A 1R0XA 4KJZA 5DN6A 2JAQA 2FWRA 4HAVA 1JAIA 3MWJA 2PCLA 4OJKA 5CIQA 4LBWA 1ESMA 4MYCA 1V43A 2VIIA 2CHGA 3KXKA 3Q7QA 5KU1A 4ACAA 3AP2A 2J46A 4DCNA 1X3SA 1RRGA 2HF8A 2ZREA 1Q22A 4JLMA 5L8VA 3QKRB 3P26A 5F9HA 1ZNYA 1CJKC 1COWA 4J0QA 1GL7A 2VSOA 3LBHA 1MT0A 4QXAA 2ZPTX 3D6TB 3TQCA 4ZDKA 5KNCA 1Q3TA 1TAGA 3ZDQA 3AEZA 1ZD1A 1EGAA 4EFLA 3OIYA 5CJPA 3EPJA 1EK0A 2VBCA 3UMRA 1VCOA 4B71A 2ZSEA 4BPBA 3OEHD 4W5JA 1H8HA 3KUDA 2W2TA 1F48A 4OYHA 2GZHA 4BFSA 2RGNC 4ARZB 4PZLA 1LW7A 4DUGD 3C16C 4B73A 3B6EA 3LA6A 1SVOA 1E94E 3NXSA 5F98A 1MR3F 4R71A 4QM6A 1VG1A 3R9IA 1N5JA 4UNRA 4F4CA 3RRYA 1S1CA 3MWLA 3PUWA 4JYCA 2J5XA 4EUNA 2K5UA 3TGPA 1TF2A 5EQTA 5D3QA 4OQXA 4DT1B 2GA8A 2XAUA 3VR6A 3BXZA 2IYWA 1Z06A 2A5YB 3MWYW 4HEJA 3I73A 4PSAA 2RHMA 1O3YA 2GEDA 1HE8B 2QT0A 1NLFA 4TYNA 4DLYA 4DLRA 1XD9A 3REFA 4BLRA 3LNCA 1CBUA 3PFIA 3FVQA 5AUQA 4EPVA 1FOEB 3LLUA 1KMHB 2IT1A 3RC8A 1P9NA 2QRZA 3WNDA 2VSXA 2YZ2A 3PEUA 1E2QA 1OV4A 1N6RA 3BFXA 2IXGA 3R7WA 2IUSA 2B8WA 3FHOA 2H16A 4PHFA 1JEDA 2VO1A 4D4MA 1YR8A 3BE4A 4YMSA 5FR2A 1FPMA 2BMFA 1YR9A 1Z2AA 3MJRA 4IVPA 3C14C 4TQUS 3IO3A 4KVAA 1G7RA 1AGPA 4IFEA 4LWZA 5EZ6B 5TY0A 4DRZA 3RLFA 5L3QA 2ODBA 1I4LD 2VF8A 1US8A 4TQ9A 3U2QA 4OI1A 4AIIA 3OIVA 4OQMA 5KPDA 1W5SA 1EWQA 1YQTA 1N5IA 4US1R 4ZIRA 1N5LA 2BBSA 3FMOB 3A8TA 2IYZA 3U60B 5CDFA 4CEIA 4Q03A 1HT1E 2BMJA 4WXPA 3CX8A 1OHHA 3UPUA 4D4KA 2JJ2A 1QVRA 4A2WA 4Q21A 3THOA 5L3QB 3EPKA 1D6JA 1SHKA 4P4SB 2CXXA 2XOKA 4LYFA 3WHLA 3ZZUA 3I5YA 2JA1A 1II0A 3BGWA 2KB0A 3GEEA 3ZGXA 1JXMA 4QHSA 2ANBA 4LOAA 1N6PA 2PL3A 1N0UA 1P3JA 4M4SA 3EAQA 4HUTA 1SKYB 3R20A 1N6KA 3PV0A 3VKWA 3GFTA 3QKSB 2O5VA 3SOPA 4B3FX 1F2UB 2DR3A 1KK3A 2ZYTX 1ZCAA 1IHUA 1WCV1 4GP7A 4HYYA 3ZYCA 2YC2C 1S9HA 5CDFE 3CRQA 1VCMA 1KO1A 1IM2A 1G8HA 2ZJOA 2ZI4A 2OEPA 1XJQA 4M9ZA 5TDHA 2Z4SA 3U3JA 1CR1A 4TN1A 5FL3A 4Q4JB 4XVQA 1U81A 4QHTA 1OPXA 4PHHA 5FTMA 3X1ZA 2PT7A 5EZ5A 4I1VA 1E0JA 4US0R 1E9CA 2KBFA 2RGAA 2I1QA 2VHQA 4C0HA 5FOVA 1TF7A 2QRNA 2XTMA 1U0JA 1NKTA 3A1UA 4LHYA 4TYWA 2HXSA 3RYTC 1RRFA 4Z1MD 2ZS9A 1Z0IA 4HAZA 2FGKA 3K0FB 4NCJA 5TARA 4LHZA 4HUQB 2GEVA 2WV9A 2Z6VA 5KUTA 3RDPA 3SJZA 1P2TA 1RC8A 2DFTA 2XNSA 2C78A 2QP9X 4Q7KA 4BEBA 4U02A 4F38A 4M21A 2ZE6A 1ZIPA 4P4UA 2QTVB 1GFIA 3QUSA 3SJBA 3T15A 3QPVA 2O0HA 2YVUA 2G0TA 3RS4A 1PUIA 1HV8A 4QBHA 2ORIA 3W6PA 1Z6GA 3WMEA 4F4JA 5JWOA 3B1ZA 4NP6A 3TQFA 5KDDA 2CE2X 4U5XA 1OIWA 4JL6A 5JEEA 1XZQA 1GITA 2C96A 1JAHA 1XRJA 4KFTA 3LBNA 4TL7A 4A4DA 3KXLA 2B92A 3GLHB 4NONA 2R6DA 2OSBA 1E6CA 1TEXA 3EIEA 3UK6A 1JECA 4RZ3A 4Q9HA 5TVKA 1E2JA 1G19A 1MKYA 3SE0A 4CVNA 3CM0A 4PC2A 3KQUA 3B1YA 3CBQA 4PHTA 3QG5A 4TSFD 4V03A 3OESA 4JBXA 3CRRA 1OYYA 3MFYA 4CEJB 5BWMA 5FL7A 1G8FA 4P4TA 4AYXA 1KI6B 4DDWA 2G6BA 5IRCD 2EFHB 5K8UA 3CNLA 5AJZA 1E32A 3K0EA 4B2PA 4HAYA 3ZLJA 3RS7A 2OUKA 1C1YA 3B1WA 5CLQA 4CEHB 5DYIA 1KJZA 1ELOA 1QZXA 5TXGA 1KO8A 3QENA 3TKLA 2OAQ1 4C3ZA 5DSZA 2Z4RA 2REBA 2YV5A 5JZVA 3M0EA 3A58B 4JSTA 4MKHA 1XF9A 2RMKA 1YZKA 3SN6A 3AP1A 5FOUA 2F9MA 3TW8B 4NYIR 1P7CA 2QPTA 5IDVA 5TMPA 1DADA 4II7A 5L3VA 3NVAA 1W47A 1J70A 4QGHA 4ZV4A 1QHNA 2DWQA 521PA 4NTZA 1N0WA 1OF1A 1EWRA 3RS3A 1G4UR 4FXPA 3SYNA 1FX0A 2V8OA 1AZSC 1OJLA 5JCZA 4AKIA 5AWFC 5EE1A 2FPLA 3QXJA 1FW6A 4HAUA 2D4HA 4Z8YA 2CK3A 2ZI5A 1QVAA 2OV2A 1KSGA 2G9NA 5HE9A 4KITB 1XZPA 1Q44A 3TW4A 2H8KA 5EP2A 1QHIA 2QE7D 1NBMD 4MKIA 4BLSA 1Z3IX 3CF2A 1Y63A 2ZRFA 2BKUA 2BMEA 4X8OA 2XNDD 4B6EA 5IT5A 5L3RA 4B48A 1IAQA 4KU4A 1D2NA 2R6GA 4D0GA 4G1UC 1NP6A 1JQJC 1RE0A 2XTNA 4ZDIA 4TTQA 4F91B 1TQ2A 1U99A 2FV8A 3QBVA 1U9IA 1E9RA 4S2EA 1E99A 1QG4A 2J9RA 3PG5A 1ZYUA 4QGAA 5IK2A 3FE2A 3X2SA 1I4TD 1BYIA 4R7ZA 2ZSBA 3QI2A 3ASYA 4HB2A 4MYHA 4V0LA 3ADDA 721PA 1E0AA 3LQRA 1T6NA 2X8AA 2C9YA 3P32A 2ZSAA 3QNUA 3DM9B 1XD8A 4UNNA 3U4QB 2JLSA 1LFDB 2GXQA 3R9XA 1YZQA 3QVUA 1VG8A 3OIUA 3LX8A 1VIYA 1VYUA 1UEJA 2IHYA 2I4IA 1OT3A 3LXRA 5GJVC 1VHTA 4MUAA 3T35A 4NBSA 1OE0A 5KPJA 4GNKA 1NLYA 5C2JB 1KI6A 2V7QD 3Q5EA 2OFOA 5ANRB 5FI0B 1R8SA 3K0FA 1XEFA 1Z47A 2FMXA 3E2IA 4ZO4A 2ZRAA 2C9OA 4A6PA 2OCPA 2Q3HA 2RGDA 1CTQA 1G7TA 3K09C 4Q1EA 2H7VA 1SKYE 4DVGA 2G3YA 4JLOA 1Q3HA 2B7BA 4HB3A 1BMFD 2CJWB 4YMTA 1AS0A 3B85A 2CL7X 2ZRIA 1RVDA 1KNXA 1D5CA 3C5CA 4DLVA 1OH8A 1C4OA 3GJXC 1U9IC 1BYUA 2NMVA 3I8SA 3K9HA 3DM5A 1CR2A 1DARA 1T91A 2ZR0A 1TUEA 5FUYA 4TL6A 4YDHB 1D2MA 2KE5A 2J0VA 3GJ3A 4M1OA 2DWPA 1UAAA 1OW3B 1NL3A 1DAKA 1MO3A 2HUPA 4TL8A 2D7CA 1YR6A 2QP4A 1GRQA 1EXMA 2FOLA 4UNQA 4EPTA 1ODFA 5AUPB 1IONA 2JLWA 2W6JD 4L9SA 3T5DA 1AKEA 4Q18A 5HCIA 3GEIA 2LKCA 5A5GA 1RJ9A 4A0RA 4DIEA 4FCTA 3O8DA 4C7OB 1G20E 5FBRB 2NG1A 3OIWA 4LHXA 2PZGA 4FMDB 4HZIA 4M8NE 1TADA 1CR0A 3PEVA 5KOYA 1ZM2A 5JI3E 1E9EA 2RGGA 4EQ6B 4AURA 3EC2A 2VH5R 1W0JD 3ZD6A 1E96A 2QAGA 3DVLA 3ADBA 5KYKA 2GWHA 1D9ZA 2NOAA 2SHKA 4LCBA 2OE2A 3WYGA 4V0KA 1G6HA 2CHVA 3KB1A 2AD1A 2FU5C 2KI5A 3CRMA 5AK0A 4FD2A 1NMZA 1VCNA 5ELXA 4L8GA 4M1MA 1F5NA 3CF0A 2H1LA 3FHTA 4AKHA 1E9SA 4FMBB 4GSYA 2IUTA 4CDGA 1CS4C 3LWNA 2NPFA 4UNPA 2OCBA 4TZ0A 3EIHA 1SVMA 1F2TB 2QQ0A 2IXEA 5FUWA 3W8RA 4AI6A 2QSYA 3RAPR 1O87A 2ZJ8A 3LFUA 5AR1A 1A5TA 3WYFA 3RHFA 2UZ3A 3GLIA 2QZ4A 5TV2A 1G5PA 1G8GA 1QRAA 5K8TA 3TSWA 3KFVA 2IYVA 3HYRA 3CNOA 4JVLA 4A82A 1Z8FA 3EC1A 3MD0A 2PEZA 2UKDA 2QEQA 1EFRD 1RJ9B 1AQUA 4WZBE 2QN6A 2XSZD 4IDHA 4AYWA 2Q9AA 4TMVA 2G1KA 3L0OA 3THWA 3KKMA 5C46F 3UATA 1HYQA 1TQ4A 3OAAD 3M4YA 4BFTA 4DSTA 4JVMA 1EFHA 1T3HA 1XEWX 5E4FA 3GJ4A 2W0SA 2YWHA 3OHMA 1UFQA 2GCPA 2RKOA 1GG2A 1M7GA 2HV8A 5AJVB 3JZMA 3WRYC 4ASUD 2O8FB 2A7QA 5FUXA 3P20A 3IBYA 3BERA 1DPFA 3AVTA 1G64A 3PUXA 1XPUA 4V0ME 3LY5A 4TLEA 5CYOA 4MH0R 2W83A 1FQJA 2XITA 4AG6A 4ZDWA 4KSBA 1M2OB 5JEDA 3G0HA 1RZ3A 1E2HA 3KX2A 2F7SA 2W6JA 3Q5DA 2PLRA 3K70D 1KJYA 4C2TA 5CLLA 3K70B 1TU4A 4PXAA 5FUVA 4LJAA 2V9PA 1XMIA 1CJMA 5IHPA 1W36D 3BB1A 2JATA 3AB3A 3KFXA 4LDJA 2UZIR 2Q3FA 4BASA 4FN5A 1G9XA 2AKYA 2OBNA 2Q21A 4F4IA 1DVRA 5GJCA 3SFZA 2RGBA 2H57A 1U8ZA 4NYJQ 5DISB 3B78A 3U4QA 4R2IA 5FTLA 4G5SA 1NIJA 4JKIA 4CT5A 4URWR 5F3WB 3L8ZA 4OI2A 1E2MA 3SDZA 1XXHB 2NIPA 3UG6A 2OBMA 4TMKA 4X8LA 5IK2D 5JMTA 3VNUA 4ZI3A 1XD2A 1HA3A 3BB4A 5G40A 1IN7A 2DY1A 4RD0A 4ARZA 3U5ZB 2AWOA 4HAXA 3KQKA 5G53C 2CEAA 2IYXA 1IN6A 2BJVA 4EJSA 1XTIA 1WBBA 1MO4A 1E2IA 4I99A 3SJAA 2P5TB 1DAFA 2OCYC 2DCUA 4UKDA 4FMCF 1NIPA 5JLJA 2IS2A 1T3SA 3BJIC 5KDLA 4FCWA 4C0LA 1S4QA 1KDRA 2ZI7A 2E1RA 4UJ3A 3ZIAD 3QPUA 1E2KA 1R7RA 3IQXA 3ZVNA 3LX5A 3T61A 2F1RA 1DO0A 1JR6A 1VCIA 1Z6TA 1OYWA 1UDXA 4RKEA 1YRAA 4B32A 4MYUA 2GAOA 1W36C 3R7WB 5JHGB 1TMKA 4ZKDA 1IBRA 2Y8EA 2WWFA 4B33A 1CEEA 3O47A 2H5EA 1QHGA 2GCOB 4GOJA 4HAWA 4RZ2A 5DO9A 3K70C 1KZ7B 2NPIA 2Z5FA 3T12A 1D8TA 1GOTA 2GXAA 2HJGA 3E5HA 3KQLA 1W36B 1HT2E 1NBME 3LH5A 2GJAA 2AXNA 1R0ZA 4M9XA 2GVDC 2J0QA 1EX7A 2F6RA 4IDQA 3NEYA 3RVBA 5HR5A 1X86B 1R5NA 1N25A 4JS0A 1ZC3A 2A30A 4LC1A 3ICQB 1Q1ZA 2QE7A 3BH6A 1OH6A 3VNVA 5AJXA 1KIMA 3BB3A 4AK9A 3QOFA 2FA9A 3GJ7A 2FN4A 4O0MA 2BOVA 4KLNA 3AKCA 5EXSA 2WZQA 1FMLA 5FOWA 1KSHA 4KI0A 4Z8XA 2QT1A 1GL6A 1IXRC 2HCBA 2ZSDA 4EKDA 3B13B 3I3SR 3HYTA 4EJSB 2VRWA 4CEJA 3HP1A 1II9A 2ORWA 2GXUA 1Z0JA 2AK2A 5SZHB 1KGDA 1NVUQ 1QG2A 3TMKA 1FP7A 1XEXB 2IXFA 4DB4A 1E9FA 2FX3A 3BFVA 2W0MA 1OIXA 3AF2A 4OHWA 4EDHA 1NRJB 2GAAA 5CM8B 3VFDA 1VIAA 1XP8A 2BV3A 3N2IA 3TSZA 4YXWD 4Z51A 2ZUBA 1W2GA 1XFAA 4PANA 3LRPA 1T8TA 4LYHA 4PQYA 1U2RA 4G0NA 1Z0AA 4TT3A 3DKPA 2GCNA 4M53A 3B1VA 3GLIB 2DFNA 1ZAKA 3Q7PA 1YJ5A 4OHXA 5JHHB 3QY0A 1NSTA 2CHQA 1W1WA 2FDCA 5EE5B 1DELA 1E2NA 1M6NA 4Q9LA 3OZXA 3VAAA 2O0JA 5P21A 4X8HA 4DLZA 2OG2A 4DDTA 1GILA 4A8JA 5IF9A 1PLLA 3F0TA 4DEXA 4D4JA 2IYYA 3UG7A 2PX0A 3TAHA 3MUFA 1T3LA 4G5GA 5CK4A 3U6KA 5H68A 2QAGB 5FPTA 1ZD9A 3A1VA 3SQWA 2ZU6A 3W6NA 2BWJA 1WA5A 1NN3A 4FWTA 5JSZB 3IQWA 3L2OB 1M7BA 3LQQA 3ONWA 3EZ7A 5A4JA 3OE7D 4BLPA 3THYB 3GLFA 4YMVA 4EIWA 4PX9A 1XTRA 3FWYA 2XXAA 1WP9A 3HWSA 1GDDA 4PC6A 1MV5A 5HZKA 2VP4A 4Q4AA 1ZIOA 3B7GA 2WSSA 2VQSA 4PSKA 5EXXA 4QBGB 4M1TA 2CL0X 3EZFA 4A0FA 4PAOA 1ZJ6A 1WB9A 5FPSA 3W6OA 1UDWA 4BFZA 1GNPA 4AC9A 5BN5A 2PT5A 4CW7A 2XZOA 2ZRJA 1D9XA 2ZE8A 2FFAA 1LVGA 4Q5IA 3E70C 2J7PA 3KKPA 2J1LA 5D3MA 1SXJE 4IEIA 3SNHA 1KI7A 1VPLA 3IPXA 3P4YA 2AWNA 4A1FA 3NBFA 2JJ2D 1SVSA 2QMEA 2JDID 2ZIAA 5CJ2A 1YZLA 2VF7A 4JLKA 4DJTA 3RS5A 3A6PC 3C4JA 4Q4LA 5J4KA 1NKSA 2AX4A 1CF4A 4PAMA 3QF4B 4ZCMA 4QNMA 3U3RA 3WBJA 3DO6A 3WNCA 3D31A 3DOFA 1G291 2JLUA 2WVJA 4RJLA 2OXRA 2C98A 5LD2B 1L8QA 2BKEA 3H1TA 4QBFA 2WJVA 3THWB 2J87A 1NI3A 4Q7LA 5H70A 2V1UA 3CLVA 1ZW6A 1TUIA 5KSPA 1KK0A 3TVDA 3AVXA 4IKEA 2RB4A 5L3SA 3FGNA 2XOKD 2BCJQ 1DE0A 2LCFA 4P4SA 1L4UA 2DYKA 4RFSA 3GJ5A 3Q8XB 2J0SA 2IL1A 3F8TA 3K1JA 5FOTA 3VHLB 4ZDJA 4RD2A 3B60A 2YINC 3FMPB 1P61B 1H65A 3AF3A 2CCGA 4Q7JB 4Z54A 1JR3E 4RY2A 4HB4A 2QGNA 5JJLA 3ZS9A 2KWIA 2JCSA 1LNZA 1P72A 4GBMA 1QHHA 1KSJA 1P9WA 4JVNA 4L5BA 4KFRA 3BOSA 2WSMA 3W90A 3PVSA 1SVLA 4CGZA 2IS1A 2HJVA 2RH5A 2EYQA 1KKLA 2UVQA 2ZRDA 4IEEA 4URXR 3Q72A 3PITA 4OJQA 2R8RA 5FBWB 2JJ1D 5C4MA 2GETA 3U44A 4LUCA 1NNEA 5GADl 3GP8A 3TUJC 2DHRA 4TYYA 3W8NA 1QHXA 1RYFA 3TH5A 2CJWA 3H0KA 3V4RA 4G5RA 4MGKR 1WRBA 3BORA 1SVIA 4H1VA 1UF9A 1KO5A 2ZSFA 1LF0A 2QMOA 5DNYB 3SHWA 1U94A 1WE2A 1ZBDA 3NIBA 4Q48A 4BLOA 3HPQA 3B2EA 1XPOA 3L43A 4B75A 4D25A 5EUQB 4LJ4A 4L16A 4XVUA 2WPDD 4QBIA 3GLFB 2IYTA 3AVUA 4MGIR 4LYAA 3F3YA 2L0XA 3CIOA 1NY5A 3ADKA 4RCYA 3DOEA 3UMSA 2GNOA 2QTHA 4K81B 1Z2CA 4RKFA 1Q0UA 3IKJA 1J90A 2P6UA 5JRJA 4GPTA 4XH9B 2IHBA 4A36A 1GP2A 1DO2A 2OILA 3BS4A 4Q02A 4Q1FA 4HZUB 3WMGA 1KHTA 4XSHA 3GJ0A 3DHWC 4QGGA 1TU3A 1W0KA 1H8HD 3QE0A 4XIGS 2ATVA 1ZINA 2GK7A 3WY9A 5EE3A 4OI4A 5EP3A 3EXAA 2A5GA 1QBKC 4KSCA 3QXHA 1XBTA 1DG1G 2D3WA 1BKDR 4OQFA 4TT3D 1W4AA 2XB2A 3R8FA 4GZMA 1UBFA 1EESA 2VP2A 1KI1A 2RGNA 3AGPA 3CPHA 2IWRA 5FR1A 4A6XA 1YHNA 1UKEA 4YXWA 2V55B 3EA5A 4DIDA 2YOFA 1SXJA 2LKDA 5FOSA 1RW4A 1YZGA 4XSGA 2WMOB 1U0LA 4D0LB 2FSFA 2FSHA 1GAJA 1KSFX 1KO7A 1QHSA 3A1SA 1DBSA 2CDNA 3X1XA 4K46A 3W3ZB 1VYTA 3F5FA 2VHJA 1NN1A 2PBRA 3PQCA 3FTQA 2MSCB 2JLYA 2VHUA 5AUNB 1GSIA 3PCRB 4HZUA 3LW8A 4N0DA 4FI3C 2WWWA 4O2LA 4B2IA 3QVVA 3V4FA 1KAOA 1XTSA 3B82A 4PC1A 2BBOA 1VKJA 2A3RA 3N5CA 1PV4A 4Q66C 4IOJA 3ZZTA 1NF3A 3RANA 1AS2A 1YE8A 3ZVMA 1MABA 1RFLA 1XEWY 1X8LA 2PJZA 1DAMA 2WJJA 1S3GA 2FJUA 4I1OA 5G3YA 4JKYA 4D81A 1YRBA 3KQNA 3K9GA 4KCGA 2QBYB 4IXMA 1P9RA 1E2GA 2ZI6A 1P75A 2CCJA 4G5QA 5EJEA 1JPJA 3IGFA 4WZ6A 2V3CC 1SXJC 3REGA 4C4PA 1FNNA 5H1YA 3TBKA 4HDQB 1AQYA 2R65A 4LJYA 4DWJA 4TZ6A 4NMMA 5JBQA 4JJKA 2WWXA 1NJGA 4MKGA 2IX3A 2XZLA 5C4GB 4EPYA 1CKEA 5FBLB 4FMDF 1QF9A 4WZAE 3SQXA 2OM2A 1UBCA 4HLCA 4CYMA 2CBZA 4QJ5A 3U44B 2BCGY 1Q1EA 4EPWA 1DAHA 2FPMA 1UJ2A 1GRNA 4TWZA 2J3EA 2J7PD 4MKFA 4B3DA 1T0JB 1BIFA 1R2QA 4ILEA 1KDOA 4AKEA 1G5TA 1R0YA 2BC9A 2IK8A 2WAXA 2NO1A 3FKQA 1IQPA 4XJXA 1Q1QA 1NMXA 1A7JA 1G41A 1ZNXA 2ORVA 2ZUCA 2ZJ2A 3EW9A 4LBYA 4W5HA 5AJWA 4D0NA 5KHOC 1OXXK 2HYIC 4TLAA 4A0HA 1R5BA 2J41A 5KSZA 2HT6A 2ZJYA 1TQ6A 2FE4A 2HDNB 1P2SA 4K8OA 4JLVA 4PSVA 4YMUA 4IW3B 4KV9A 1OH7A 2AXPA 1XJCA 4RFSB 5EXPA 4Q9JA 4S35A 4U7DA 1H8ED 4D80A 3LD9A 1JPNA 5E7MA 4Y0VA 2B8TA 3AKYA 4TLDA 3W9YA 1ZD8A 3E1SA 1Z0DA 2YWGA 4WA7A 2JLZA 2IS4A 1KMQA 1LY1A 1TQDA 2FSIA 4DCTA 3NHAA 3BC1A 4OK5A 5BYKA 4LJ7A 2VTKA 1XTJA 1FL9A 2N1BA 3TNFA 5SZJA 1E1RD 3GLFE 2ZRCA 2WJGA 5CIWA 4HB0A 3OAAA 1R6BX 821PA 1GKYA 2ZITA 4OHVA 1XTQA 3BFKA 2CLSA 4D26A 4E22A 4DSOA 3THXB 2V6IA 2MMGA 4RD1A 1DAIA 4BZQA 3VR4A 1FP6A 3HU1A 3FKSD 1NVXQ 4B44A 5GJBA 4MYTA 2R9VA 2ZJ5A 3O8RA 2QGZA 4N0EA 4AWXA 4XTRA 3K0AA 3NDPA 2NZJA 2BJWA 3TVTA 2GJKA 2PMDA 2CMKA 4WAUA 2IF0A 2W2VA 3SYKA 4F93B 2JASA 1HTWA 1KDPA 1Z07A 4ASUA 1UBGA 1B0UA 1TX4B 3CONA 3K9NA 4KVGA 4JLBA 4IOKA 2IYLD 4URVR 4KYIB 4RD6A 1Z63A 2YC4C 4MDFA 1BH2A 1YVDA 3IEVA 2ATXA 3PEWA 4DC9A 3THXA 1CR4A 4DCUA 4A8JB 3NH9A 4V0NA 1E1QD 2JIZD 3T1QA 4IJMA 2ZVPX 2P2LA 4E09A 3CX6A 3FFBA 3MSXA 2FZLA 4N3NA 4UJ5A 3TUIC 2JEOA 2XSZA 2ZM5A 2ZRMA 5BXQC 1R0WA 1US8B 1FTSA 4MRNA 4LJ8A 1N5KA 2BM0A 2YHSA 3AF0A 3WYAA 3U3OA 2WKQA 4QKQA 1IN4A 2QMHA 1J8YF 3QBTA 5JSZA 2AD5A 3I72A 2J59A 2EWWA 3FKSA 1L7VC 3Q3JB 3KQHA 4KBFA 2GILA 4OKSA 4KBGA 1WXQA 4A0GA 1XB2A 2ECKA 2WM9B 4LPKA 4PO9A 1Q57A 3KTAB 1W5TA 2W6IA 4PO8A 1FNMA 1J8MF 1NY6A 3NKVA 2J45A 4Q4HA 5KNDA 2VP5A 1UPTA 3G5UA 3QJYA 1CJUC 4PQRA 3OEED 4GMXA 1SVKA 3AVQA 4PAQA 2VL7A 1DS6A 1W0JA 3PENA 5LBIA 3LV8A 4XWAA 2QQEA 1HE1C 4OI0A 1OSNA 4GP6A 4HI0E 2GF9A 5G41A 1AM4D 5C18A 5M04A 2BHRA 2WWGA 2ZI9A 3FFAA 1OFUX 2OT3B 1HH4A 3FB4A 4L9WA 4NL4H 4DEYA 2X2EA 3H2YA 4MGZR 2CVFA 2YJTD 3TSOA 1KJWA 2ZEJA 1VTKA 3WRXC 2G77B 3ZIAA 1OXUA 3AKEA 3K0CC 2GBLA 4QGFA 2WWYA 1WQ1R 1FX0B 6Q21A 5K8IA 1NSFA 2A5FA 4HLUC 4XWKA 3VU9B 3PR1A 1F60A 4E5UA 4LJ5A 2EWVA 4I81A 4IRUB 4IXNA 3AGQA 2ZR9A 1KI8A 4BQSA 3RWMB 4AYTA 1SXJB 5KO2A 3KXIA 2WMNB 4ESHA 4XTCS 4RD4A 3GD7A 1Z6YA 2RAPA 2QROA 2AR7A 1NN5A 1ONBA 2AK3A 1JALA 2GJ8A 3EWSA 1CU1A 1A2BA 3IIJA 2NO6A 2G88A 2VEDA 1G3IA 3GLHE 5CM9C 4X8MA 3VQTA 2A2ZA 2O8EB 1N6IA 2IW3A 4Q01A 2V54A 1EFTA 1XJ0A 3LVQE 4UNSA 3ICEA 4Q7MB 4P3YA 2MMCA 5F9FA 2RCNA 1G7CA 4KODA 1GL9B 3V9PA 1OXSC 3C15C 3U3MA 1G4AE 1NN0A 3QQ5A 2XGJA 3ASZA 5HCNA 4B6FA 2CNWA 3ETLA 4MRPA 3GLHA 2ZI3A 2D62A 2XNDA 5KSYA 1KYIA 2HF9A 2EFGA 2X19A 2ODEA 4JJZA 2A78A 3AVWA 2VPPA 2HYDA 3FPAA 4U00A 4BRUA 4DSUA 1MRNA 3R8CA 4FIDA 4GZLA 4LHVA 3HU3A 1N6HA 2FGJA 2FFQA 4URYR 4JBWA 5DHFA 2ZYVX 4E03A 2BVNA 3SYLA 2P6RA 3NTUA 3OEEA 1PZNA 2IS6A 3GMTA 2ZJZA 2DFLA 3CO5A 3G82C 3QKUA 3TRFA 1E4YA 3RSOA 1OFIA 1XD2B 2LWIA 5DHAA 4R9UC 1VG9B 2P0EA 4RD3A 2ZR7A 1G5RA 1T5LA 5DI3B 5BYJA 5BN3A 4DB2A 3CZQA 4JLDA 1XXHA 1NJFA 1M1YE 2FPKA 2D74A 3I61A 1P4SA 4XVRA 2FFBA 4C0JA 4BWYA 4BZXA 1VYVA 1FTNA 4QJ4A 1PJRA 1Z22A 3CR7A 2OESA 3K0AB 4BLQA 5E3HA 2PCJA 3C41J 4I1SA 2ERXA 4JL8A 3MAAC 2FG5A 3HU2A 4Q47A 1QHHB 1Q1BA 3ZVLA 2J7KA 4AY2A 2KSQA 2J0UB 5GVSA 4R98A 3UKDA 2JIZA 4JIMA 1AJEA 1FUKA 4B74A 1RRCA 5FBVB 5KSOA 2VA8A 3AVOA 4YC7A 2CVHA 3DL0A 1DG3A 4NYIQ 4DDVA 3T34A 2QORA 3CB4A 1DTSA 3QKSA 1P6XA 3SC3A 2XX3A 4DCVA 4YMWA 2BIFA 4F7WA 3NDBB 1KO4A 3GFOA 1GRRA 3L0IB 5FPKA 1WBDA 2OAP1 1QDEA 3AF1A 2VSFA 5FFMA 3EPHA 3PUZA 3ADCA 3AUYA 4XD7A 1H8EA 1HQYE 3KL4A 1TF5A 4TLBA 5JI2E 3FHCB 2Q0HA 3EA0A 3T06B 3W34A 1CXZA 2HCJB 3AVPA 4QL3A 1Y3AA 3QXSA 2PZFA 1NVVR 1ZUNB 2QTFA 1OB2A
chains in the Genus database with same CATH superfamily
3UICA 2V4ZA 5MF6A 1SNYA 2F43B 3Q9LA 3EIOA 1SUAA 3ENQA 4ZTBA 1POXA 1EAYA 3QF4A 1AU9A 2RJOA 4HAIA 4IMPA 4QLBA 2ODWA 5CTAA 2PKCA 2WBLC 3RTDA 4O2RA 1GUAA 2PRZA 4I3HA 1ZN2A 1E2FA 1THZA 1UKZA 3GGJA 4FN4A 4Z3OA 4FDAA 4IGFA 4BAUA 1I9GA 4PPNA 3V34A 2R6AA 3NBAA 3KCQA 5IN4A 1VM6A 4C2AA 3VR2A 1N0VC 2NW6A 3K3PA 2YW2A 1ZHHA 5ALIA 2XW6A 4GMDA 2FE1A 2FLVA 2C83A 3GUHA 4X1IA 4BMYA 3PWZA 2ANCA 2C77A 2QJOA 3FWKA 1S9DA 5DTRA 5ER6A 3SIWA 3E5MA 4D82A 3GC6A 3HB1A 4YECA 3ELUA 3S1AA 3A4NA 4JT2A 1TYAE 1DBPA 4NYMQ 3X2EA 1S3SA 1V1MA 4GRIA 2DWUA 2ST1A 2BN4A 2M6SA 4I3GA 3T0GA 3B3QA 1RQRA 1BMDA 2JVJA 1D8AA 2FPSA 1KK2A 1Z5GA 5EUMA 3V4LA 1C0PA 1GPKA 3SJ7A 4U6NA 13PKA 3WK5A 4UE3S 4TYMA 1ATZA 3LKVA 4QRIA 3ZHQA 3D6VA 3FDJA 2GHIA 2Q3BA 1XRSB 4HMQA 4XFJA 1WXGA 3D0KA 4TWIA 4DMKA 4AN4A 3DCYA 4AWAA 1SZCA 4GXQA 4M1WA 4EQ6A 1JDBC 3N70A 3H5TA 1I2CA 1ZOLA 1L7BA 1CB0A 3AU8A 3C43A 2D1FA 1DAPA 2QRHA 4JBGA 4Q3AA 3MWGA 4F86A 1C9JA 1BQ3A 1DAGA 1P45A 2ZJAA 4M7RA 4L4UA 1JF8A 5HE8A 3GRKA 4BRWA 5IYZB 2ROQA 2Z83A 3BRCA 4MLDA 3FCOA 4YNBA 2JCGA 3IODA 4U8HA 3C7CB 4PTLA 1DRVA 1ZW1A 3ZJUA 2PKYX 1VMEA 1S2LA 4PBRA 1GNVA 5IU6A 3TBFA 3JQ6A 3LNTA 3MTBA 3CUTA 3EXG2 1U3CA 3FJOA 1KVTA 1VJGA 1RJFA 3CZ9A 1G6OA 4YB8A 4G2NA 6ADHA 1NXXA 4K9SA 4BEVA 4G0YA 2J30A 4MS1A 1WQ4A 2AW5A 2QNRA 4CDMA 1EIWA 2R5NA 3L82B 2QR5A 4FKMA 2ZB2A 3AT1A 4CM5A 1HFKA 1ZN7A 4Q1CA 1YDEA 1RHRA 1G1AA 1O4WA 4JSRA 3WYBA 4B47A 3BK7A 4GWKA 1N36B 1NVVQ 1Z0KA 2VOEA 3O8NA 3FYSA 2HA6A 3E22B 1K9VF 2B3TA 3KR9A 4ZYTA 1E5DA 5A3SA 3NBXX 5CBPB 4BVKA 2BDEA 4KXFB 4GI1A 3GARA 4ACBA 2FWAA 4FWIB 3PKIA 1ZXLA 2IZ0A 5JCPA 1XU9A 2CNOA 4BMVA 4B43A 1Z2NX 1OX4B 1WR8A 1HORA 5DPMA 2YFQA 4ZZ3A 3F7NA 3F74A 2O0KA 3ND8A 5F73A 1M8GA 1N4AA 3A25A 5DCUA 2ZRKA 2IZZA 3ZH2A 1UP4A 4G5YA 3OZIA 4L74A 4PZEA 3ZQUA 1GXSA 3HADA 1XDSA 3N2EA 1KDYA 4HDAA 1W0KD 4MV3A 4BKRA 1G0NA 1BDBA 2FW9A 4RS3A 4BNYA 1OIVA 1OPRA 3QNWA 5CVJA 3PJRA 4FK8A 3NV7A 1C8LA 4HH1A 4TXNA 1IM8A 1I24A 4JWKA 4K9LA 4C3UA 1ZMXA 2QQGA 1SFRA 1RKVA 3GNTA 2PD4A 3RS8A 1CZNA 2QM7A 3OKPA 2H1VA 4J9UE 3OZWA 1FBNA 2FRXA 2VP6A 5FT9A 1L4KA 5LZ4A 4WLVA 3NMUF 2J4FA 4ZCLA 3I9MA 2Y67A 1X77A 2Q5JA 2QYOA 4J0DA 2FY8A 3FTCA 3I1JA 1NXWA 3I0MA 2X6TA 2NV0A 2Q27A 3I3OA 1XTZA 3AFMA 4RLQA 4MW5A 1OBHA 3EIUA 2C2KA 4BFXA 5KTYA 1PFUA 5ECWA 1FFXA 1BJTA 2WW8A 3DE4X 3OG9A 1GTMA 3EB9A 4ZT7A 5A06A 5MN6A 1A04A 1SUDA 4FX2A 4DA6A 5J4HA 3L0SA 3AHIA 1ZRSA 4LC9A 1PG0A 2JL1A 3OIFA 2O8BB 2JFNA 2VXBA 2XQGA 1VLHA 1E18A 1XEXA 3BWVA 4GF5A 1TA4A 4G4SO 4CQJA 5FA6A 1KQGA 1FMFA 2YYZA 3RSLA 4EAQA 4QJBA 1EUDB 3JSXA 2WFZA 4TSFA 3O93A 2BHSA 4UXJA 3PJEA 3WLPA 1TPZA 1ZNZA 2FWMX 2HA5A 3HMKA 2DG2A 3DOIA 4B6SA 1N6LA 1JKJA 5UKDA 2O8DB 4BLUA 4WUVA 1JH9A 1YACA 2OD2A 1USVA 2B6NA 4F5DA 5ERYA 1P2GA 2CLCX 4F12A 4Q39A 5CP8A 5M29A 3IQEA 1F6BA 1JXQA 1OZHA 1YB2A 3LC7O 3VYWA 3E23A 1T8UA 2VSNA 3RF6A 3GAFA 1KH1A 4CEHA 4CQLB 2B1JA 2I4OA 2R7MA 3MF4A 3NBKA 1UFRA 2V7WA 4JQOA 4CCAA 1AKRA 4J29A 4CE6A 4WCFA 3FUTA 4CZ2A 1VP9A 2EFCB 3WGMA 3C1OA 4F60A 1T3ZA 5BP7A 2X15A 5BORA 5HUQA 3EVNA 3SQNA 2Q9CA 1BWPA 2RKBA 2EEPA 1HK7A 2DSNA 3U1VA 2GPAA 2A14A 4OSOA 5DGXA 1A82A 2VT2A 2NO0A 4JLNA 4UBJA 5BPHA 2WHPB 3EDRA 3AHEA 3LPMA 3SEAA 2FB9A 4LI0A 1ZD5A 2C5BA 4U7PB 4BMZA 1NXPA 3VOTA 1Q0PA 3QEJA 1B23P 3PL5A 1IUOA 4EB8A 4DNQA 3DMFA 2RIPA 2ZSHA 2PSSA 3RABA 1SM4A 2EG5A 4NBVA 1U7OA 2IU0A 2DPMA 1XCMA 4TYQA 2XWSA 2C2ZA 2HO4A 2G83A 1HUQA 3HPRA 3MJFA 3QXXA 4KQWA 1NPTO 4BN0A 4FXOA 5C9ZA 3Q8KA 3OFNA 1AIPA 3AKDA 1NMSA 1L9XA 2CYAA 1JRLA 3D1LA 3D7KA 4AUMA 4MV8A 4U7HA 1GCUA 4UASA 1LTQA 2WTUA 4GKJB 2QMQA 1ENOA 4RDCA 3WLEA 4YFYA 4NESA 3OHSX 3EDOA 2B7LA 2YQZA 1QS0B 3K4HA 3N2GB 3RPEA 2XUPA 3EHDA 1TZMA 2YMQA 1RIFA 1YBHA 3GJ6A 2A59A 4WOPA 5SY9A 3TQTA 3KM0A 4Q3KA 3VYUB 1Z28A 4XR4A 4OHOA 5FTKA 3FTFA 1DUVG 3B6KA 1KS9A 2I6UA 3AH8A 5IP5A 2VNHA 5C4IA 2UUBB 3KHSA 1JAXA 2XTAA 4JEHA 5CB4A 3WGGA 3IDZA 3A6ZA 2Y68A 1B8VA 5FOXA 4IJQA 3I6QA 2XUZA 4K05A 1R3DA 2P2YA 1CP2A 1FJHA 1W5FA 3JYQA 5KDOA 3ELBA 2DT8A 2FEOA 2YN0A 2XODA 4EF4A 1UOPA 3MM4A 1UZUA 4ZQGA 5DOVA 1W44A 5M3BA 2VR1A 3P9CA 3EFOA 1SKQA 1MPTA 4KQFA 5A5VA 2OTCA 3NCHA 4KYUA 4WE3A 1GZ7A 3OPQA 4GI3A 3N7TA 1QANA 3TZEA 5U9CA 1SULA 2J32A 1T9AA 4BB6A 3B52X 2VT6A 2MSKA 1K8RA 1T6ZA 2PD6A 3LF1A 4IDOA 4D3SA 4JQSA 1OKKA 4QC2A 1T4CB 2I7XA 1KZHA 1SO8A 5LL6P 1LTKA 4HLUA 4ZZIA 4HOYA 1SVNA 4E7PA 1U0BB 4Y6QA 1P73A 2X9NA 1KY5A 2IODA 3IHLA 1RAAA 2AN9A 2W6PA 5EMJA 4PU0A 4IOMA 4G1VA 3ZE9A 2BDTA 4Z9FA 2CUKA 3ICPA 5E6SB 4LY6A 3TCXB 1P19A 3MCVA 3CR8A 3GMIA 4E5MA 5B5SA 5IYZA 2VWGA 3IP6A 3Q3HA 4XSVA 3V7YA 1A8QA 2YHBA 4BBPA 4C0KA 3RYIB 5BR4A 1T2CA 1JJBA 5BQ5A 1DOAA 3STXA 4DXAA 4YDQA 4A2QA 1W4CA 5ADHA 4KPFC 3FR8A 4UHHA 3RC1A 1N2IA 4REQA 3TR5A 4P0TA 4CMJA 1E2BA 3L49A 4EFNA 3HHPA 5A7GA 3B9QA 4DOMA 3L0BA 3ASUA 1PR4A 5LA6B 4YONB 5C5CA 1ECBA 4M36A 1MRZA 4UAVA 4NS4A 1NI4A 4MR8B 2WJ4A 2WAYA 4MV5A 5CM2Z 2RG1A 5DI3B 5ERXA 4P86A 4AICA 5LWQA 4N5IX 4ZRNA 1WTAA 3HK2A 4ETNA 1U98A 1JFFA 3T1VA 3MRSA 2D2EA 1R1DA 4DWOA 5K8JB 2QG6A 2PXXA 5ESDA 3VSAA 2XECA 3VHQA 3RNOA 5ALRA 3LVRE 4P83A 5MGBA 1HL7A 3N53A 4RM3A 3SEFA 4FFPA 1Y89A 3KOOA 1K7EB 2I2DA 1XLTA 2RGCA 3D2CA 4IOLA 4XYEA 4QBKA 4UUBA 2F64A 3QX3A 4DMMA 2I6QA 4N12A 2CXHA 2I3BA 4OA5A 1RWXA 5HQJA 5AXBA 3BCUA 3TJZA 5K0JA 2IXDA 5EIBD 5HK9A 1DP4A 3DONA 1XDBA 2JGMA 1RHJA 1FUUA 1E2EA 1TEVA 3HP4A 4ND5A 5IN5A 4B7XA 2PH1A 3IAM6 3AQIA 5U1PA 3WDKA 2QENA 4MJLA 4C7XA 1H5QA 1NASA 1RJDA 3HCRA 5K6AC 1YJQA 4OM8A 1UWKA 1FTGA 2WIKA 2ZRBA 3AY0A 5CFOA 4DUZB 1HR0B 1R4MA 4DV4B 4PLVA 1SUEA 4AKGA 2PY6A 3DMTA 3NTXA 4QUKA 4ZOLB 4ZPJA 4XGKA 4XX0B 3U7EB 2WVGA 3PIRA 5KYYB 1BO6A 2R44A 3TAUA 4UUPA 4GL2A 1TO1E 1SELA 2NZWA 3W6ZA 1K08A 2DBQA 4MRVA 3DEKA 4ENPA 3I5XA 4LMBA 4RA9A 4ARVA 4DJAA 3X1KA 2H0RA 3BD6A 1GZ6A 5G1OA 3KSBC 4J7UA 5DK6A 5L6MB 2XHZA 1JQLB 2W2KA 2WJIA 3KELA 1KMMA 4XD7D 2BM9A 4DRYA 2G8NA 1TVKA 2WA1A 2YDYA 1FCJA 2AR0A 1X2BA 5EZSA 1COWD 4O3MA 2PAAA 3FYHA 1M8FA 3BSFA 1E79D 3MTEA 4ZXFA 4Y2GA 4YWJA 1RM4A 3EZYA 3TTTA 5JISA 1PVOA 1P5RA 1XCPA 4OLFA 3OWOA 3QWIA 1W48A 2G5PA 4H59A 4MWCA 3RIMA 1BDJA 3R0JA 3JYLA 3LTEA 2TSYB 4PO1A 5IHXA 3GRCA 5BSFA 1SHZA 3KUKA 1EGMB 2R6FA 1JFLA 3LOPA 3VSDA 1CRZA 1VJRA 4HWSA 1R0BA 4IZIA 3UXEA 1J0XO 3MOGA 2ZUFA 5BW8A 4BAGA 5JNLA 3GV0A 1HEUA 1KZGB 5JR3A 2Y92A 1ZU4A 2C5GA 3R5FA 5IJ0B 1JFTA 3RBXA 4UM9B 3BIOA 4ADSG 1ZS9A 3BF7A 1OX5A 2GHQA 3VZDA 1Q84A 1NLZA 3GDFA 3TM4A 1J99A 3HH8A 2YY7A 4D6YA 3CWQA 2FK8A 2OV8A 4WXHA 4G8CA 4ND2A 3ULKA 2A1UA 5JNVA 4R51A 2QR2A 3RODA 4B3JA 3K6SA 4ZANA 3F7TA 3FYCA 1A4RA 2ZVQX 5FIUA 1TM5E 1J56A 2N1MA 5IKEA 3H86A 1V0JA 3RIHA 1FRVA 3L9WA 3WGVA 1UKYA 4V1CB 1DWQA 1NXVA 1BVUA 2P2CA 2WHPA 4NBWA 1H6BA 1XMXA 5ES4B 1YAJA 1ZJ5A 5LZ9A 1A69A 1WBJB 1N2ZA 2OMKA 4QPZA 2A67A 3H8WA 3MGCA 5IJWA 1Q12A 1XTKA 5DYGA 2D59A 4C0QC 2GKOA 1JHDA 3WK8A 1BJRE 5LB4A 4RULA 4PYNA 2A0YA 4F3RA 4DCCA 3NH6A 5B3AA 3P7MA 2WG1A 4W7SA 4KFUA 4F92B 4UREA 2GK3A 3KJGA 4OXRA 1D3AA 3EAGA 4GRDA 2QVLA 2I4MA 1C9MA 3KVRA 4P33A 1L8AA 1TNDA 1ZVMA 5B55A 1B8PA 5IKOA 3AKZA 1BMFA 3RTBA 3NBQA 2ZAMA 2VK1A 2O8DA 4LV5B 3FPHA 2G36A 4LGMA 1JEEA 2VWPA 4D41A 5AHKA 3K15A 3ZCQA 5INTA 1XX6A 1IH8A 4I4LA 3B89A 4X93A 5TRTA 4MXDA 4P22A 1PGJA 2XUAA 2C2XA 3DE6X 2ZB8A 4UQPA 5G0SA 4BKQA 3WFZA 2FDXA 3EDQA 1XDGA 1BDMA 1XWIA 4J3NA 3V8PA 1JJAA 2Q29A 1T4GA 3PF9A 4RV9A 2GKSA 3EIQA 1MJGM 1D1QA 5FAXA 4AECA 1NQXA 4UDOA 3VX3A 5EQFA 2KJQA 3C24A 4Y0AA 3IAEA 3FCSB 4LXYA 3Q0TA 1M2FA 1QKKA 2OXFA 3TO5A 3U31A 1AK9A 4D5GA 4XPZA 3KZ1E 2G71A 5E0OA 1N32B 1II8A 1JBKA 4N47A 2CJXA 3FDXA 1SJ9A 3UHAA 1W59A 2XZPA 4UOZA 4POAA 2NQ2C 2VZLA 3W05A 3H84A 1WUJS 4J2TA 4FEEA 3UGJA 2VDLB 1NT2A 2XDQA 4QG7A 5FPHA 3WGKA 4ER7A 4KX3A 5KOHB 1TYEB 1GUYA 4ZEOA 3DDCA 8ABPA 3SAJA 4B3BA 3J81A 1ZM7A 2CMDA 2JEYA 4DDUA 2XB4A 4Q4HB 5KNDD 4AP5A 2OORC 3TG8A 2OK7A 1AKTA 2E9SA 5HDQA 4EKIA 4JJ8A 1IPFA 4EG5A 4JDUA 3EZ9A 1G3QA 4WW0A 5DM70 3OKFA 4JUAA 3GEMA 3GRUA 2GWRA 4H4DA 5EN4A 1GKLA 4WVFA 4XWOA 2VQFB 5FRDA 4N4AA 3ZIDA 4LYGA 2IJGX 4ECEA 2LR0A 4Z6KA 5CBPA 2XWBF 4IDNA 3ZY4A 4RY9A 5BV8A 3UJHA 3RYFA 4DY6A 4M2LA 4IIXA 3BKXA 2XT9A 4ZTUB 2Q49A 2D06A 2WQ6A 3NWPA 4M0PA 1CV2A 4EOGA 5DTEA 2XH8A 3A9SA 5C7LO 3HDTA 2EQAA 3AJAA 1F3LA 2GN9A 3BPSA 1YMVA 2NWQA 4PSDA 5EAIA 4C20A 1OFTA 2FEMA 3ONFA 1J9ZA 3D8RA 1ORHA 4LX0A 4RHYA 1EUCA 4AZ0A 5IX8A 3UO8B 2X13A 3PXGA 2Q3CA 3NETA 1UBTS 1M74A 2W6ID 2X0IA 3QLVC 1VL0A 3VMFA 4A8HA 3O8CA 7REQA 1G17A 1JVSA 1R4NB 3VYVA 1MMFB 1DIAA 2VF4X 3BE6A 5U4QA 3UOGA 3RSZA 5LLTA 2OCKA 3CZPA 4JLPA 4WXRA 2JGRA 3QMMA 5FI1B 1W85A 2XE8A 1K98A 1L6IA 4EY4A 2AI1A 3PDWA 3S5UA 1AD2A 2GASA 2GT1A 2DQKA 2PN1A 1CULC 1G3RA 3O2NA 3Q85A 3K8ZA 2PX3A 4KAXA 4YY3B 3GHYA 1DMSA 1EGQA 5B2ZA 4AY3A 3ROQA 2YBEA 2VJBA 4LF4B 3CY6A 2WKPA 2J9FB 3M5PA 2CE7A 1E4EB 5I47A 1JR3D 1B2RA 3QHQA 4JR0A 1EEXB 1HDXA 2ZRPA 2UUOA 3INGA 4H3VA 4PG7A 4DMCA 4RYDA 1E9DA 3L8DA 2DPHA 4JVSB 4PG4A 2B6HA 2OFWA 2VT7A 2NTVA 4EG0A 2X1MA 2Q2OA 2YWBA 4GYYA 1R8QA 4UBNA 3O4RA 3BULA 1C14A 1YCHA 2NUBA 3FG9A 1DOZA 2HM7A 4HUJA 1OLSB 5D87A 1Q20A 5IT4A 5JNSA 4UMEA 1SC1A 4ITRC 2OLKA 3JZDA 4X0EA 3RH0A 3D2AA 2Z9CA 5AUOB 2OWDA 1B4DA 1OFGA 1PR0A 2I8LA 3EVGA 4O4LA 4BQEA 3ZE0B 2ON6A 4OQLA 4ARUA 4KI7A 1A5AB 2A9KA 2O2JA 4G5OA 4PC3A 2C8VA 1CUYA 2NVUB 3U7IA 4L4SA 3AW9A 3VXKA 4Y2HA 4F5ZA 4D8XA 2EERA 2WU0A 3JYHA 1SQ5A 5E4JA 1MB2A 3P0EA 3CPEA 3FSJX 4JJ6A 4WBSA 2AUNA 4C06A 1O5TA 3IHWA 3MCAA 2XA9A 3HL4A 3EEIA 3M1AA 4XVCA 5IABA 1TA9A 3RTCA 2WOOA 2JJ8A 4ZGGA 1T4MA 4Y6RA 2EW1A 1E1RA 2EGUA 5FNVF 3VV2A 2JLXA 4Q9KA 3UANA 3IUBA 1E6EA 5KU7A 2HLNA 1DB3A 1PEKE 2E5FA 3OCXA 2DKFA 2RK6A 1NYLA 1ZM9A 1JWLA 1Z68A 3FDFA 4HDOB 5F4BA 1KI9A 4IWXA 3T7IA 4CM8B 1QCCA 2EQBA 4TRNA 2XRYA 4KKVA 2NQ8A 2VAPA 1S2GA 1KKUA 1PR9A 1CLUA 4OH1A 2HSDA 1JH8A 4CV3A 4WBNA 2FH5B 3MT8A 4MUYA 2XA1A 4MWGA 3ZE7A 1X8XA 4O25A 1THTA 3I23A 4U6QA 3ITKA 3TPCA 3VTAA 3HO8A 3IILA 3KWJA 4G4GA 5L3ZA 3LUDA 5CG1A 2O5RA 3I9V6 1FVHA 2PUFA 1E92A 2KPOA 5L7YA 3EZ2A 3ZWNA 2C97A 3GPDG 5REQB 2QPAA 3K5WA 4AUEA 4BQRA 1U8CB 1IOZA 1KMHA 2UZ0A 3CBGA 1GDHA 3G9QA 2JAOA 1Z8HA 4NENB 4E5DA 1L5OA 3NFYA 3OZTA 4IVQA 4YAJA 2BFOA 1V3UA 3G88A 3HYLA 3G7UA 3KSUA 4I9UA 4H1WA 3Q7IA 3G7NA 5G0TA 3F67A 1O9GA 1VG0B 2QAJA 2WWVD 1LTHR 1NI4B 2FRVA 2WB4A 3M6AA 4S04A 1SQGA 2G0AA 3JZFA 4LDRA 3R76A 4B0PA 3CE6A 2QU7A 3I1YA 3VR5D 1W4BA 1Z26A 5AICA 1OI3A 3RRNA 3FUCA 3IFSA 2BFWA 2PLNA 3MYRA 4TWRA 4IIFA 1QO0D 1JHUA 5AVQA 3NDJA 2HT1A 4AJNA 4MGEA 1XVIA 5JD6A 1UK8A 3DAHA 2NSYA 1Z4NA 2VS1A 4GFDA 3W2IA 2AMFA 4W9RA 4I8DA 3DFZA 3HV2A 3AJEA 5EVJA 3UT6A 1NAIA 1XQWA 1SZPA 1MAVA 4L73A 5LPNA 2RHJA 4QJ3A 1U2GA 3RKUA 1RABA 3CWCA 3GRRA 3KZKA 2VDMB 2BBWA 2P40A 1L5FA 2GCOA 4OHRA 4BX2A 2BBTA 2V0CA 3DMHA 2R48A 1B74A 1F8FA 1XA0A 2DPXA 3IA7A 3L9XA 4JLAA 1ZFNA 5C1IA 1D6SA 3M4ZA 2HIGA 3C6QA 4HEA6 4OQYA 1IN8A 4QVIA 4UU8A 1Z74A 5F2OA 3HCWA 5EIOA 4KR9A 1VE6A 1OASA 2XKBA 5CT5A 5B58C 5GGYA 4S0XA 1D07A 3QLTA 2C7VA 3UN1A 2V6GA 1SQ0A 2GGSA 3CRVA 3OI7A 1Z4LA 4ZQEA 3WJ7A 3P5BA 3UA4A 5CB0A 4CCWA 1HY3A 2HU8A 1KH2A 3N6XA 3JPWA 3QU7A 1QTNA 1YS9A 2IYRA 1YJAA 3JQ8A 1YFLA 1ORTA 2P0YA 3T5CA 3JQBC 4F71A 1CUFA 4F9TA 4WJLA 2K7ZA 4KQJA 3PGKA 3VPGA 4YCCA 1JVNA 2I3GA 1EFUA 2VHXA 1XZMA 1V8FA 1UM8A 4DRXA 5JWRA 3CEHA 2AVNA 3GGPA 3GEDA 3EZ6A 2APJA 4MDEA 2F1HA 1KYWA 2QAIA 1GZ3A 5GJWC 2PR2A 3GAMA 1C29B 3SZMA 4DPKA 3DVSX 4E31A 1OTXA 1L8OA 3P52A 5EMHA 4HAVA 1U7XA 2VNIA 3RSGA 5K4GA 2DXIA 1BC5A 1L5NA 3HFGA 1IBKB 4LBWA 2JHCA 1Z5OA 2FXVA 4YRMA 4GO1A 2VIIA 4YAWA 5JYBA 5KU1A 1EFPB 1GARA 3CVWA 4DWWA 2QDKA 1DWUA 2JCXA 5AD1A 2YCBA 2PLAA 1Q22A 4JLMA 2JF0A 1PYGA 4C7VA 4FB4A 1RKQA 5F9HA 4AQ7A 1AQ6A 4QDTA 4EG8A 3LQ4A 4YTEA 4BMCA 1MT0A 4QXAA 1Z7BA 1ZJ4A 2VJCA 2ZPTX 4WN9B 5KNCA 2P8SA 1TAGA 1Z13A 3UH1A 4N7MA 5EG5A 1G5FA 1VCOA 4B71A 3HI4A 2V7PA 2FKNA 1AF4A 4EJ2A 2EDCA 5GY7A 2W2TA 1V11B 2YV3A 1JHQA 4PX3A 1Q2UA 3FKJA 4AY5A 3A6GA 2RGNC 4MS4A 3T1NA 1LW7A 3WGNA 4BFSA 5HXAA 3ZDBA 2DUMA 4B73A 1IDOA 4YWHA 1SVOA 2RI0A 3HO1A 2YN4A 4L4YA 4R71A 1MDFA 4QM6A 3DTVD 3HNOA 1N5JA 3QRWA 4DQLA 2E4YA 4ND3A 3I1IA 3MWLA 3PUWA 3QX9A 3TQRA 3V7WA 4EUNA 1QIDA 5L45A 1TF2A 4PRYA 1ESDA 2QSJA 2ZDGA 3EXHC 1QRTA 1U0EA 1UJ6A 1ZPDA 1S6YA 2EF1A 2VYQA 2XAUA 2BAGA 2Z3WA 4D99A 1L5ZA 2AN1A 5B6JA 4UVIA 2AMYA 3T5AA 1Z06A 2VNKA 3ZCTA 1YJCA 3D7NA 5FPQA 4EY8A 1VZ3A 2JIMA 4DLYA 4I08A 4UNIA 3REFA 4X1YA 1EP3B 4EPVA 1AUXA 1KBZA 8GPBA 3S1LA 3W3AD 3N8HA 4RQTA 4Z0TA 1GJRA 4U2CA 4RMIA 4CM3A 1P9NA 3CKYA 2CDBA 4PBSA 3ZV5A 1XROA 1IVYA 1E2QA 1F8YA 2B20A 3D9QX 3PEUA 1XCBA 2IXGA 1QFXA 2IUSA 3EGWA 1GZDA 3MW8A 1XRRA 3PCTA 4PHFA 5DGDA 3V3KA 5B1YA 4D4MA 1YR8A 1R0LA 2WTNA 3CH6A 3GFBA 1FPMA 4DDMA 4BGUA 1PFGA 1HG0A 3AHJA 3C14C 3DJYA 4P4LA 4TQUS 1G7RA 5TY0A 2ZG6A 1Z56C 3PQ2A 5EWLB 1HTBA 3AFIA 3QFTA 1B3RA 3RLFA 2ODBA 2Y1DA 4AN0A 3S44A 4HEA1 4TQ9A 2H9AA 4OI1A 4JI4B 5TGZA 1OGIA 1P6QA 3NXKA 1EWQA 4FNAA 1PNOA 2JFXA 1YQTA 4R3NA 1PUXA 1VRVA 3NFRA 4R68A 2YR0A 5EIFA 2C42A 4FJ2A 5EGNA 1GG5A 4FNOA 2QVGA 3B6ZA 3H4IA 4ZWNA 4JBHA 3ZXIA 3JD3A 5CDFA 3FSGA 2P2SA 1T0PA 2VAWA 2BFEB 3DFKA 2DHEA 1GSOA 1X13A 4ZAYA 5IUJC 1BMTA 2VHZA 3BMNB 3C3DA 5AM1A 1AQNA 2MYTA 3L46A 2GUGA 2QTCA 4P4SB 3PRKE 2XOKA 3WHLA 4ENRA 2JA1A 3NOOA 3BGWA 3E22A 3EZXA 3ILSA 4XYMA 3DDZX 5I7HA 1XRPA 4KWIA 2GD6A 2PVPA 1OXKB 1N6KA 3PV0A 2JFVA 3I01M 3AG5A 2XIQA 2B3DA 1NHWA 2E4AA 2XYQA 3DEHA 4NBKA 4MI9A 2ZYTX 5H82A 4D9MA 1IHUA 1JIQA 2VDWB 3K94A 4PLWA 1O77A 3UMMA 2IX9A 1QDLB 1VKRA 4GP7A 2B4KA 2OOKA 2VQDA 3T3IA 4TZTA 3DOJA 2YC2C 3ZV6A 4DV6B 1Y4SA 3CRQA 1NW8A 2E5WA 3HKEB 3D6JA 1WVIA 2CLOB 2EBWA 2XMZA 3I9JA 3UB2A 2ZJOA 3GVHA 3TMYA 2JFOA 3PUJA 4S1OA 4YP7A 4M9ZA 2Z4SA 2GO1A 2JKVA 3INNA 3OSUA 4TN1A 1U81A 1FQWA 1N9GA 2C5EA 2EFJA 2IITA 1A96A 1CY6A 5FTMA 2DUUA 4IVNA 4IUDS 2JIQA 2FOIA 4KRYA 3RM3A 1XCLA 5TT0A 1E0JA 3Q8LA 3N7UA 2FX2A 5CLHA 4DS3A 1E9CA 5MN5A 1QF6A 2RGAA 2I1QA 2VHQA 4C0HA 5DLPA 1U0JA 1V16A 5LYJB 3T4XA 4NBNA 5FADA 1W2WB 3V5NA 2ZIXA 3ADPA 2OCXA 5B1DA 4Z1MD 2R5FA 4ZMSA 2RONA 2ZS9A 4Z2AA 3NTRA 3N0VA 2FKAA 1L4GA 4NR0A 4EF6A 1U4SA 2FGKA 1XSEA 3GT0A 5JPDA 4EA6A 3K0KA 2YMPA 1ADFA 3CZ5A 3ITNA 3QW4B 4MQUA 4BX8A 1QRRA 2CB0A 2GN6A 2HU2A 2VYVA 4Q16A 3RDPA 4YJFB 1TJ4A 5C1DA 2ID4A 2XNSA 2C78A 4BFLA 2QP9X 4LTDA 3FH0A 4ZT2A 2EC5A 5DCYA 2Q2WA 1M2KA 3FSEA 4F38A 1BQEA 4QLAA 2ZE6A 3TQHA 1ZIPA 4GC5A 2IH5A 4WWHA 3QUSA 1H2BA 1FFYA 1A5BB 1KF0A 2O0HA 2YVUA 1FTQA 5JD5A 2X86A 3A4VA 3RS4A 2COKA 3WGTA 1PUIA 3W6PA 2O0MA 4KUEA 3S2IA 4F4JA 2PNJA 3I0NA 1MGPA 4U5XA 4DIMA 5LNK1 3L8GA 5E6RB 3MPOA 3V7NA 5JEEA 1GITA 2AIRA 4F45A 1XRJA 4KFTA 4TL7A 4A4DA 2PA3A 4NZOA 3GLHB 3PGVA 5HVNA 1U3TA 1UMKA 1B8OA 5CCBA 1EQAA 1TEXA 2NZUG 3EIEA 3KZCA 1D04A 4RZ3A 4LF9B 1W52X 2V74B 5CD1A 5TVKA 4TM8A 1E2JA 4CVNA 1HNZB 1Q50A 2EKBA 3KBOA 4PC2A 3L7CA 4A27A 2BI8A 2DX7A 4PHTA 3TTYA 2DUJA 2WU8A 4AS2A 2Q0QA 3CRRA 4AYXA 5CRIA 1KI6B 4RH1A 4DDWA 2WJ6A 1H2WA 3CNLA 4G0VA 1E32A 4B2PA 2YMMA 3ZLJA 3LFHA 2JAPA 1DSSG 4U7FA 5KNCD 3TTUA 4KR7A 2PMBA 2I67A 3U1BA 1HZZA 4CEHB 1RPNA 3I42A 4MWSA 2FG6C 1KJZA 3JQ8B 3QELB 4YRCA 3TKLA 3HDHA 2FZKA 2COEA 3F47A 3HCPA 3L1JA 2IEAA 3JRNA 4I4NA 4K3VA 4F6LA 3A58B 1MFPA 5IUNC 1VBNA 2HWXA 3IEMA 1J5PA 3M4XA 3EGCA 3NHRA 3K96A 4NYIR 5TMPA 1GZHB 5L3VA 1YGYA 1D0SA 1J70A 1I7LA 1PI3A 1W47A 3DLCA 4TV9B 4WX2B 5EJ9A 521PA 1N0WA 1JGTA 5AVOA 1I0LA 1QWOA 1SBNE 3QKIA 3NR2A 2DR2A 4U1RA 4WCFC 3LOQA 3HM9A 5FLEX 3ETCA 4AF8A 2CZGA 1OJLA 5JCZA 5BR7A 4M46A 1C3VA 1GYRA 4IMRA 1JMYA 3EXIA 3QXJA 4I50B 5FNZA 4J0FA 3DZKA 4YVFA 1FW6A 4KR3A 5DM60 2I03A 4RTLA 1U7WA 1M2JA 2OV2A 2H63A 3MOIA 2QL9A 4IPTA 1VLQA 4CF6A 3ZU5A 1IE3A 4D9FA 2H8KA 1GUDA 1QHIA 4IZOA 5EP2A 1NBMD 3N2YA 1Z3IX 4ZVOA 3AR5A 3CF2A 1WXEA 2BKUA 2BMEA 3JX9A 3RSSA 5IT5A 3OY7A 3OUZA 4B48A 5AOVA 5AM3A 1D2NA 2P30A 2R6GA 4HK4A 3KOWA 1URPA 1NP6A 3RHTA 5HJ5A 4XJTA 4MCAA 1W30A 3ZE6A 2XTNA 3G1TA 4JCOA 1GV0A 3IVGA 1V5GA 1U99A 3CSUA 3RBZA 1F4VA 3UCEA 1Z4IA 4LSZA 4F91B 1RWOA 3QOXA 3QBVA 3R5SA 1K0UA 2MYPA 5EHGA 1PL8A 4UPVA 4X84A 4A91A 2HDOA 1QG4A 3PHHA 3WWOA 4YRFA 4AM8A 4BO0A 1Z39A 3PG5A 5IK2A 2SKCA 3FE2A 4HGYA 4LNAA 3S4YA 1PD1A 1BYIA 2ZSBA 3HDYA 4HB2A 2POQX 4BNMA 1FS6A 2JHGA 1ILWA 4E5NA 3LQRA 3DBLB 3P32A 2C9YA 1PT9A 3TVYA 4BJ6A 3DM9B 4CWAA 4UNNA 2ACKA 1CUJA 1AN9A 1LFDB 2C2GA 4HQ0A 4MQLA 2NYUA 5JT1A 5JAPA 5AHWA 4XE5A 1ZR2A 4B82A 2EBHX 2FQWA 2OGTA 5HCUA 5J59A 2Z8ZA 3PJDA 1EWTA 4AROA 4DLAA 3EE6A 2G25A 1DIRA 1HSZA 3T35A 2NVWA 1Y1QA 3PBKA 4AZTA 2HA7A 2PV0A 4YRDA 3LLSA 3WSWA 1EX9A 1S3FA 2COUA 4MDYA 2Q2NA 3SZGA 3V1YA 7ADHA 1YRHA 1I5EA 2V7QD 2A86A 1YOVA 3G5TA 3GG9A 5KHAA 3CC8A 4C1NA 3WLOA 4NWIA 4A6PA 2HMYB 2ZRAA 3A0RB 1LQUA 1T43A 1G7TA 3BZUA 2WUDA 2OR3A 1SKYE 3D02A 3G7SA 1WS6A 2QRLA 5HQ3B 4LJRA 1WU8A 2G3YA 2IIQA 3IIEA 1Q3HA 1BMFD 1N5MA 2CJWB 4UD6A 2AC7A 2NP7A 2CL7X 3JWIA 1JTEA 1KNXA 1D5CA 1B41A 1G4HA 2MSWA 4O1IA 2NMVA 2PPVA 4CQMA 1V5EA 1XZHA 2PQ2A 1XMQB 1WXIA 2H2GA 1JBQA 1H69A 2H11A 2WM8A 4E08A 3I2JA 2ZCUA 1K4MA 1KARA 5FUYA 2Z56A 1NQVA 1ULHA 3BGSA 3CISA 4DY4A 4YDHB 4UEJA 3VR4H 3WTBA 4EI9A 1Y4ZA 5T5QA 2J0VA 4GDMA 1P4HA 2DWPA 1SOUA 2WQ7A 4MQ5A 3DBOB 2ZXEA 1F8GA 1DAKA 4Y9TA 1MO3A 1YF3A 5JG7A 2D7CA 5EQDA 1YR6A 4RC9A 1OBCA 1R8XA 2ADMA 3NIWA 4ISBA 4UNQA 3BILA 3FHLA 4TV9A 5AKZA 1C7JA 1OJ7A 3JYPA 4J07A 1SBCA 2PZJA 2M9MA 2JIRA 2W6JD 4UM7A 3BL6A 3SM9A 3DTNA 4BNZA 3PSHA 3KAPA 3PUKA 2UDPA 4A0RA 4FCTA 3O8DA 3DTVB 4IS3A 4C7OB 1SR8A 2AQ8A 2NG1A 1RLMA 1XN4A 1R6UA 3VNQA 2I3ZA 5LZ2A 4MTCA 3O1HB 4M8NE 1U3GA 5KOYA 2XDAA 4G4IA 4K7JA 2Z57A 2RH4A 1K3UB 1O95C 1QZTA 2RGGA 3TQQA 1YB5A 4WH0A 1Y8RB 5EGSA 3EMBA 3SYRA 1M33A 4RHCA 4J8PA 3ZR4B 3DP9A 1WD5A 4YRKA 1C3EA 2WD7A 4OJTA 4PX5A 4QDXA 1QK3A 4XJXA 1BG6A 4QYIB 2SHKA 4E6EA 3EGIA 2VYNA 2XAAA 3Q2IA 4FNGA 4UEWA 1G6HA 3HKEA 2AD1A 4FYPA 4CUZA 2DJ5A 5HUHA 3ODPA 1M72A 2ODQA 5DXAA 4JU9A 5LQAA 1VCNA 1CYDA 1MC4A 3HC7A 4CR6A 2G40A 2GZ2A 3COJA 2H1LA 4AKHA 1E9SA 2NPFA 5DULA 2JGKA 5ICFA 3GLVA 3STUA 1J8QA 1H6CA 2CVZA 4UM9D 2IXEA 5FUWA 1W581 3WWDA 1A9QA 3JQAB 4MPTA 1TIKA 1O87A 2C94A 4ZC1A 5C8DA 2VDVE 5SY4A 3RHFA 2UZ3A 3WK7A 4OVKA 5TV2A