1E0SA

Small g protein arf6-gdp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
173
structure length
173
Chain Sequence
GKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags G protein
molecule keywords ADP-RIBOSYLATION FACTOR 6
publication title Structure of Arf6-Gdp Suggests a Basis for Guanine Nucleotide Exchange Factors Specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1e0sA00
1WF3A 2D7CA 1Z0FA 2ZVPX 4LHYA 2OCPA 3L2OB 2J9RA 1QHHA 5A0FA 2J7PA 2X8AA 3GEEA 1AKYA 3WMGA 1ZU4A 2V8OA 4IOJA 1RRPA 4URUR 2KE5A 3FKQA 2CJWB 2IXGA 3IIKA 4IFEA 1XF9A 4PTLA 2GZHA 3C15C 1NBMA 2IS4A 3M4YA 5JHHB 1EG7A 5CB8A 1TQ6A 4JT4A 3RC8A 3B7GA 4Q1BA 2J1LA 4F4CA 2ZYUX 3FYHA 1OH7A 4BASA 2GZAA 4YDSA 2GEDA 4IOKA 1QHYA 3QJYA 2J0UB 1FUKA 4MRVA 4V0LA 2C03A 3TW4A 3ZGXA 4BECA 2A7QA 2YWHA 3WHLA 1OIXA 3FKSD 3OZXA 4A92A 5CK5A 3IPXA 4DUGA 4B3DA 3K70D 4LPSA 4DCNA 3THXA 3DEFA 2WMNB 5JI3E 4YQFA 1LTQA 4OJQA 4OI4A 4O25A 2QTHA 4IDNA 1VCMA 1VDZA 4DLTA 2OE2A 2EVWX 1YZTA 3VAAA 3SR0A 3C14C 3VNVA 3LBHA 4EFLA 4H1UA 5IK2D 1VCOA 1XX6A 5JRZA 2GJSA 4I99A 1E69A 5ANRB 1DG1G 2WZQA 2WWHA 2ZETA 3G82C 4UJ5A 3QEOA 3U3KA 1D9XA 3TE6A 1ZW6A 1DADA 2ZRLA 2ZU0C 3ZJYA 2ZROA 1EWQA 2WWGA 5H68A 2O8EB 4L9SA 2NO6A 4A2QA 1T3HA 1E1RD 2G3YA 3BS4A 4JYBA 4LBYA 4OHZA 4RZXA 1HV8A 4DVGA 1G20E 1U90A 1Z0IA 2ORWA 3SYLA 3BORA 3QXHA 1BOFA 4WOPA 4YXWD 4JVNA 1FOEB 3WP1B 1HH4A 2CEAA 4QHTA 1CRQA 1JAHA 2J0VA 4M8NE 3GLIE 2GBLC 2CL7X 2J0UA 4PPNA 3EWSA 3T61A 4PZYA 3SN6A 5BN3A 1Z29A 3LH5A 4R2HA 1DG3A 1QHIA 2IUUA 2UZ3A 2ZSAA 4WZBE 2XZOA 4A0RA 4DKXA 3TGPA 1FUUA 4CEHA 1S1CA 1E9FA 5HCIA 5F9FA 1G7RA 3NWJA 2ZRGA 3FTQA 1OHHD 4WA7A 2FE4A 4ZCIA 3BH0A 2WKQA 4C0JA 1WXQA 4E5UA 4AKGA 2CVFA 1NRJB 1E9RA 1N0VC 4HDQB 1II8A 3GJ3A 3I8XA 2JLYA 3CRVA 4G5OA 5JEEA 2G83A 1WRBA 4N1AA 2ZJBA 3RABA 3IIMA 2VSXA 1YJ5A 2H7VA 3MRSA 4M1OA 2OXCA 2D7DA 2XITA 3FMFA 1KY2A 4QFMA 3I73A 4NH0A 4PXAA 1N6PA 3NKVA 3FHCB 1XRJA 2C5LA 4PZZA 1G8HA 1W44A 2OEPA 5J4KA 1H8EA 2HYIC 3UK6A 1I4TD 5EJEA 4GOXA 2BM0A 3GLGE 1MRNA 2WSSA 4QHYA 4IDHA 3BK7A 2ZRHA 4TQUS 2VP6A 2DBYA 2OBMA 3GJ8A 1RIFA 1OXSC 1Q21A 2YOFA 2FFHA 4DLUA 1ZP6A 2YC4C 4KU4A 3L8ZA 3P27A 1KMHB 1Q22A 2HT6A 3MWKA 1G41A 2FSIA 2FF7A 2WPDA 2WAXA 4MGIR 1E9BA 4N0DA 3CW2A 3EAQA 2Q9BA 1UBCA 3T1QA 4KAXA 3LQQA 1US8A 1GVNB 1NLYA 3GLHE 4MGYR 2VHJA 4B48A 1ZD8A 4LYJA 4OHWA 5SZJA 4A9AA 1XEWX 1G5PA 1HTWA 1RRCA 4IHQA 2VA8A 1X8KA 3ZDQA 3RRYA 1KI6A 5AR1A 3SOPA 2EYQA 2QRNA 421PA 1KSFX 2ZE7A 2ODEA 4URYR 4CRWB 3SYNA 5JSZB 5EXPA 1IY1A 4JVLA 4TL9A 5GJVC 3VU9B 3BGWA 1X8JA 4NMMA 2JEOA 4XVQA 2NOAA 1E1QA 1O3YA 3C16C 3KXLA 2VSFA 1XXHB 1ZAKA 5FL7A 1OSNA 4HB0A 4AC9A 3KL4A 4O0MA 5KPDA 2BCJQ 4W7SA 1NY5A 1QF9A 4PHHA 3DZDA 3QENA 4V0NA 1XP8A 1MABB 4B2LA 4AY2A 4DT1B 2PX0A 1GL9B 3EW9A 1FTSA 2C95A 2R44A 1HYQA 3RS4A 4BQSA 1Z07A 1RRGA 4IDQA 4KFUA 4NCKA 4ZDIA 2P6NA 3EZ9A 1KMHA 2IYTA 1FTNA 1Z08A 2ZRJA 1G3QA 3LLMA 3VMFA 3KKOA 3BE4A 3BERA 3KTAB 5B2ZA 4GSYA 2YINC 5K8UA 3AVVA 1E1QD 4GZMA 4PX9A 3HWSA 2ZE6A 2ZUCA 1MRSA 1CKEA 4IOLA 3P20A 1U0LA 3CX7A 4CEIB 3ADCA 2BIFA 2J0SA 5KDOA 4IRUB 1NMXA 3FVQA 3RSOA 3NHAA 4JLAA 4Q00A 2IEZA 4A2WA 2CVHA 2QMEA 2QU8A 3HU3A 3ZVRA 3TSOA 2RGAA 4HATA 2G77B 3CBQA 5JSZA 1Z0AA 2IYSA 1FQJA 2PCJA 5DYIA 1CEEA 3GP8A 2B7CA 3DM9B 1E4VA 3T34A 1ZBDA 2F1HA 2QT1A 4ACBA 2ZJZA 3U3MA 1XXHA 2Z43A 3PV0A 4LJ6A 5FTKA 3C5HA 1ZC4A 3U61B 1VHLA 1LS6A 2HLDD 1KO7A 1XTQA 2WJIA 1CR4A 3MD0A 2RHDA 4V0ME 2WKPA 5H70A 1GITA 1U81A 4TLCA 4XD7A 4DT1A 4MDFA 4KSBA 2L0XA 1SHZA 2PT5A 1E2MA 1TUIA 4ZIRB 3FDIA 3TKLA 5DO9A 1NSFA 4PO1A 3O8BA 3PUVA 2NO7A 4D81A 1R8QA 2QE7A 2VP4A 1ZC3A 2H92A 1HT1E 3KTAA 3AUYA 2ZYVX 1OFUX 4M9ZA 3VNUA 3NC0C 3SQXA 1ZNYA 4RZ3A 5A4JA 2ZXUA 3NH9A 2QENA 1AZSC 1S96A 1TMKA 1UDWA 3THYB 1XFAA 4CEIA 2PL3A 2JJ1D 4P0TA 5UKDA 1XPRA 2GXSA 5JJLA 4X8OA 1YZQA 4FWIB 4HUTA 3AV0B 3HU2A 3KDSE 4PQYA 1F3OA 3KJHA 1CJMA 4XVRA 2AFHE 1YHNA 2YOHA 3CPJB 3KUCA 1E2IA 2CCJA 1S8FA 2QP9X 2TMKA 3B60A 1G8YA 2ZRNA 3H86A 4KYIB 3KQHA 1JQLB 1IN6A 3TLXA 1B0UA 1TU3A 4LV5B 2VHUA 3O8CA 2G0TA 1IXZA 1A2KC 2JIZA 2D62A 4EAQA 4Q9HA 5LD2C 5E4FA 2ZSBA 4EJSB 4URWR 3K9NA 5M04A 3IBGA 3RS7A 2V9PA 3FHTA 821PA 3OF5A 3MWLA 4JSYA 3H2YA 2F9MA 3P32A 1VIAA 1M7BA 4TLAA 1GP2A 4B6FA 1NN5A 1TPZA 1A82A 3NBXX 4ZIRA 2AK3A 2PLRA 3B85A 1GWNA 1P75A 4I81A 1T9HA 3U60B 2WWXA 5L3SB 4FINA 2WWWA 3PEWA 4U7DA 1G18A 1AS0A 1NLFA 3K0EA 2ZJ2A 4PPQA 4MITA 4D0NA 2XX3A 4EPRA 4ZKDA 2PZEA 4L5BA 5GVSA 3KB1A 2QRZA 3THYA 1KJWA 1LFDB 2VO1A 1W0KA 2DB3A 1R7RA 3BFXA 4ZDWA 4LPKA 1Y3AA 4D80A 4L9WA 4MYHA 3GFTA 3B2EA 4NL4H 4ZI2A 2GESA 1CU1A 1EFTA 1VYVA 2V7QD 5FTJA 4HUQB 4CIDA 4KFRA 1JQJC 1LV7A 4TMVA 5CM8B 4KBFA 2W00A 4DLZA 2Z6VA 3VR5A 1E9CA 1OXTA 4BLQA 4R7ZA 3HU1A 2IEYA 4UXJA 3TSZA 2DFTA 3KQNA 1X6VA 4EJSA 5CDFE 1YR7A 4YMTA 2RCNA 2ONKA 1DAFA 3WYGA 1FP7A 4ZCLA 1SXJB 1MO4A 1TQ2A 2JLXA 3PQCA 1E96A 1RE0A 3AVUA 1E2DA 3U3OA 1AJEA 3ZD6A 5FR1A 4QC2A 1YZLA 1JJVA 1N6NA 2R9VA 5E7MA 1MO6A 3A1WA 3L0OA 5JJKA 2VSOA 4HEJA 3QKUA 4TT3D 2PT7A 1UJ2A 5L3SA 3VKWA 1GIAA 2XNSA 2QORA 2QPTA 1WCV1 4U02A 3N70A 5JWRA 3N2IA 1G7TA 1AKEA 1OYWA 1YRAA 5DSZA 3ZQ6A 1BYUA 1XEXB 3BXZA 4AK9A 2WWIA 5P21A 4P4SB 5HE8A 1HURA 1A2BA 2GNOA 1M8PA 3AEZA 3CZPA 4AI6A 2YHSA 2EU8A 2XZPA 3QBVA 5FI1B 4BLSA 5KDLA 3CM0A 2RGNA 4B74A 1G4AE 3W9YA 4DCSA 1RZ3A 4CT4B 4WW0A 3BWDD 4Y0VA 3LW7A 5EP1A 4C2TA 3OE7A 3LQRA 4G5QA 2FU5C 4JKIA 1XDBA 1S2MA 4ASUA 2QMOA 5JJIA 1EXMA 4JJKA 1M6NA 4C0LA 2ORIA 2W6ID 4PQRA 1XD2B 5KNBA 1ZJ6A 2JCSA 5FTMA 3QKTA 2AXPA 2QP4A 2P5SA 2RGDA 2C77A 4BFZA 1NN1A 4UJ3A 2ZE8A 2RGBA 5K8IA 1SXJA 4RCYA 3FMIA 1VCIA 4O2LA 4DSOA 1NJFA 2OLJA 5EE3A 2P6UA 3BFKA 4Q21A 3GQBA 1UPTA 4M1TA 4AKIA 1NSTA 4H9GA 3X2SA 4M0LA 4F4JA 4KSCA 2D3WA 3REGA 1J8YF 1K5DA 3FFAA 3HR8A 1SGWA 3X1ZA 3OFND 5EP3A 5H1YA 2RH5A 5JECA 4E22A 2CNWD 2VLIA 3DHWC 2MMCA 4LJ8A 1OV4A 4ZDKA 2PMDA 2ZVQX 4JLDA 2ANCA 4M1SA 4UNSA 521PA 1HQYE 2OV2A 1RYHA 1XEXA 4OI0A 3KXKA 3OEEA 4C0AC 3ADBA 2FSGA 3TNFA 5GJBA 3CF6R 4JIMA 1W4AA 4Q66C 5GADl 2BBWA 1SXJD 3Q85A 3RRMA 2QM8A 3HYTA 4PAOA 1XBTA 2O8DB 4QM6A 2REXB 3PEVA 3BAFA 1OXUA 4F93B 2P65A 2NIPA 4Q9JA 3BIFA 4Q7KA 3QIAA 2NG1A 2OILA 1R4AA 1UEIA 1BYIA 3Q9LA 1XD2A 3R8FA 2R62A 3MSXA 3B1WA 4KITB 1N25A 2O8BB 1IBRA 2H16A 1G19A 3I32A 3EPKA 1Z0KA 2FG5A 3RWOA 5FOUA 4AYXA 3BJIC 2C99A 3B9PA 1XTSA 1Q44A 3TR5A 2O0JA 3WMFA 4WIAA 2IWHA 1GL6A 4KVGA 3TW8B 4MYCA 1DTSA 1SKYE 5J4LA 1F6BA 1Z63A 2O0HA 1OIWA 3QVUA 3T1OA 4AIIA 2WWFA 3KKQA 4NZYA 4KODA 4B2IA 3FOZA 4Q7LA 1UKVY 5FI0B 4L4UA 3BB4A 1E9SA 5L3VA 1W5SA 2ZTSA 4LUCA 3T1VA 5CK4A 3EG5A 3W5IA 4Q4JB 4MDEA 1D5CA 2IYXA 3M1IA 2CL0X 5HE9A 3G5UA 1KDTA 3RS5A 4ESVA 1P2SA 2O8DA 3QF4A 4NCNA 2BVNA 3AF2A 1SQ5A 2J45A 3OESA 2O0KA 3AVQA 5DN6A 1NG1A 2JLZA 2OXRA 2AN9A 3X1YA 1E98A 3SJBA 4U00A 2OCYC 4OKSA 1CJUC 4IJMA 2YNMA 2JATA 2O8BA 2BKEA 4IDOA 4Q02A 3GCGA 5D3MA 1JR3E 3A1UA 1N6LA 4V03A 3GFOA 2HCJB 2A5DA 1LB1B 1SZPA 1QVRA 2F43A 4Q4HB 4YMSA 4C0SA 4D4MA 3OAAD 1M7HA 1G3UA 2OBNA 3LNCA 2KSQA 3NHBA 4X8MA 4ILEA 1XD8A 3TH5A 2IXFA 3K09C 3QI2A 2W0SA 4WAUA 3BRWD 1XNJA 3LY5A 4IW3B 2JJ2A 1W0JA 1XJCA 3S1AA 4F92B 1ZNWA 2A30A 4RKEA 3JVUA 1CR1A 1KZGB 5E3HA 3IEVA 2IHYA 3EWAA 3G0HA 3U4QA 2A3RA 1Q3HA 4M4SA 1E9AA 4NYJR 4PC2A 4TQ9A 2GF0A 3RS3A 2CCGA 1XJ0A 5IRCD 1T8UA 2DWQA 3LX5A 2H17A 4UKDA 4Q4JA 4CEJB 4KO8A 1DAEA 1KI7A 2AXNA 2Q21A 2BMFA 4LRWA 3TVDA 4OK5A 3BB1A 4LHWA 4RFSB 3KJGA 4TSFA 4QM7A 2IYZA 3WYAA 2J3EA 2J87A 4PZLA 1JI0A 2W2TA 2ZRPA 4F91B 4XTRA 1QDEA 1FMLA 1N5LA 3AUXA 1SVSA 1GNPA 2Q3FA 1RRFA 1HE8B 1IJEA 4BFXA 1CRPA 3A4LA 4Q9KA 4DWJA 4QBHA 3UMFA 4Z54A 4CT5A 4GOJA 3B82A 4PQFA 5AUPB 1AM4D 1QG4A 2XB4A 4IVQA 2PH1A 3L8YA 4TLDA 5LB4A 3RWMB 2CLDX 4DCUA 4RJLA 4TTPA 5BXQC 1E3MA 2G1KA 4LDJA 1JJ7A 1KK1A 3KJEA 3IO5A 4MGKR 4TQAA 2VL7A 2CBZA 5KUTA 4B2PA 4RD0A 4GL2A 3EZFA 3K9LA 2EWVA 2ZRDA 3FKSA 1T5IA 2F6RA 3VR3A 3AVPA 3GLFB 3QF7A 1G291 1GFIA 2OAQ1 3A1SA 3BBPA 1ZNXA 1G1MA 2OESA 5FFMA 4NYJQ 5EZ5A 1J90A 4D2IA 2ZPTX 3QPWA 3U7GA 1GRNA 5EXSA 3WMEA 3WY9A 4KXFB 3CH4B 1VYTA 1KZ7B 3R8CA 3T12A 4JLBA 4OHXA 5IK2A 4JYCA 4EFNA 3AF1A 3ASYA 4B75A 1KI1A 2UVQA 3SU8A 2HXSA 4AYTA 2A5YB 4Z51A 2J5XA 5EE5B 3W8NA 3EPLA 2BBOA 1NMYA 3PFIA 2P2LA 4GI7A 3LWNA 4B35A 3AF0A 5JI2E 3W3ZB 3ZVLA 4BFYA 5AK0A 4C0HA 1E1RA 1GZSA 3W90A 1A5TA 1G3IA 3LFUA 3T5DA 4Q9IA 4OYHA 4PSKA 3F5FA 2GCPA 5SZKB 1LW7A 1ZYUA 3IPYA 4MGZR 1NKSA 3GEHA 2PX3A 4YXWA 3MUFA 5L3QB 5EE0A 2EQBA 2ZYWX 1YR8A 1C4OA 1VG9B 2A5GA 4HDCA 4LHVA 1P3JA 2B8WA 4TTQA 3IIJA 2HF9A 1T0HB 1L8QA 3DDCA 1W36B 4BEJA 4PR0A 1FFHA 4QBFA 3GLFA 2C78A 2R65A 4XIGS 2B8TA 4QBIA 1RPZA 1VMAA 1NIJA 1G3MA 2PZGA 3C8UA 5GJWC 3IKJA 5G3ZA 2CJWA 1W1WA 4PHTA 1IN4A 1JR3D 1BO6A 1OF1A 2Q9AA 3ZIAD 3EX7C 3UIEA 2ZRCA 1OHHA 2AKAB 4BWYA 1EFRD 5C1BA 4KJZA 1G4UR 2Q6TA 1V5WA 2OM2A 3ND9A 2Q0HA 4KHZA 2HUPA 4EPYA 1YZKA 3QKSB 2FGKA 4Q1EA 1W36C 1UM8A 1CR0A 3LVQE 4TYWA 3ZD7A 1G17A 3QXSA 4F38A 4D4KA 1G21E 4R9UC 5EE9A 4B44A 3N2EA 1BMFD 3HDTA 5FR2A 1XB2A 2IW3A 3QPVA 4X8LA 1G64A 4MUAA 1CR2A 5FOWA 4XTCS 3CZQA 1XPUA 2AX4A 4I1UA 1C9KA 1JPNA 3K0CA 4DEXA 4JBXA 1ZMXA 2C8VA 2VBCA 4V0KA 3PITA 2KB0A 4KLZA 5L3QA 3MCAA 1KYIA 2W2VA 5LBIA 2G88A 2BCGY 4A82A 1GKIA 1YVDA 1ZIOA 1CULC 1L4UA 2BMDA 1XMJA 3IO3A 3ZZUA 5DI9A 4QJ3A 2JLWA 3QUSA 5HTKA 6Q21A 4GP6A 1MR3F 4YMVA 3OIVA 1OKKD 5TVKA 3SHFA 1RYFA 2V1XA 2GBLA 1NVWQ 1ZM7A 2BC9A 5C4MA 2ZJ8A 2IC5A 2O8EA 5AWFC 1EFHA 3W5JA 3UATA 3PEYA 1R0XA 2ZUBA 4Z8XA 2KI5A 2W0MA 4QXAA 3L0SA 2GZDA 1SVIA 2J7KA 4JBWA 3QKSA 1SVLA 1T8TA 2NO0A 1T4GA 2JASA 1RJ9B 3VR1A 3TQFA 3LO5A 1PJRA 2GILA 4FD2A 2ZUDA 1NMZA 5BQ5A 4DZZA 2BV3A 4Q1DA 2FFBA 3DOFA 2BOVA 3WBJA 5BW8A 1TF2A 4MYUA 1KOFA 5JBQA 1W36D 3TMKA 2F3RA 2NO9A 1YU9A 3GLIB 3AF4A 3UWOA 2ZIAA 2EW1A 3KKPA 5FUWA 3U3JA 3UANA 1AGPA 5FOSA 4CW7A 1O87A 4WZAE 1P72A 2FFAA 1SVOA 3KKNA 2AKYA 4P4UA 5JS8A 4A0HA 5AJWA 4G1UC 5KO2A 3JZMA 5CJPA 2VRWA 3ECCA 1GUAA 3LBNA 3PUWA 3SHWA 1ZM2A 1RFLA 5KSPA 4HLDA 4AYWA 2R6FA 4TLBA 1TL7C 3PUYA 2QTFA 2DFLA 5FPHA 3WXMA 1UDXA 3CNLA 5KNCA 4GP7A 4LHZA 4Q01A 3PJRA 4BEBA 1HA3A 2LCFA 4M9SA 2BMEA 4FCTA 5DE3A 4O3MA 2N42A 1Z22A 5KSZA 2F7SA 1DEKA 1F60A 1Z6XA 4Q47A 1ZUNB 4RZ2A 3BFVA 2V3CC 3EZ6A 1Z8FA 1VKJA 2KJQA 1CLUA 2QBYB 4A8JC 3CRQA 2WV9A 1RJ9A 3PIRA 4JLNA 2HV8A 4DRZA 3SEAA 4F7WA 3DMNA 4O2RA 2VH5R 3RS2A 2CK3D 1KK3A 5ELXA 1UADA 3U7HB 1WB9A 3I5YA 3AM1A 1E2NA 1U99A 3KB2A 3V4FA 3GLGB 2GWHA 2QPOA 4QRHA 3TBKA 3GLIA 5JLJA 1DELA 1GILA 3CPHA 1ETUA 1COWD 1DBSA 3F8TA 4BPBA 1SVWA 5FL3A 2WVJA 1IXRC 1UBEA 3SNHA 4AURA 4IVPA 4Q4LA 1L7VC 2ODBA 3M0EA 5JCPA 2WM9B 2ZJAA 5J40A 1P4SA 1HQCA 2HLDA 4U5XA 2GVDC 1Z2AA 1KO4A 1P2UA 3SI7A 1IHUA 3IILA 4OQLA 1YQTA 1DARA 4E07A 2PMKA 1HT2E 221PA 4PPFA 4GPTA 4TMZA 5TB5A 3GLHB 2VP5A 4V02A 5FUXA 4BGDA 2REOA 3CF2A 1OB2A 3W34A 3IGFA 4KVAA 5BWMA 1XTKA 4B32A 1T91A 1X3SA 1DO0A 2CHQA 4BFWA 2REBA 4FXPA 3VU9A 2WSMA 5LDDC 4TMKA 3K0SA 5F3WB 5JWOA 5D3QA 3CKLA 2E1RA 1FNNA 4M9QA 4LOAA 4FCWA 4C2UA 3AVXA 3FE2A 2HT1A 4URXR 2EWWA 2P0EA 2YWFA 4BRWA 1PV4A 4LC0A 1D9ZA 2QBYA 3TAHA 2J0QA 1DOAA 1UKEA 2JJ1A 1IONA 2PCLA 3TUJC 3FFBA 3QNUA 3E70C 4JMPA 1AN0A 3U6BA 2YWEA 1MO5A 4TMTA 1GG2A 1MABA 1NG9A 1UKZA 3LRPA 3NXSA 4MH0R 1UAAA 4MRSA 2F1JA 2XAUA 3MWJA 3SFZA 1P5ZB 3SS8A 2FOLA 2D06A 1DVRA 2GCNA 4XVUA 1R0YA 2KWIA 3CONA 2IYUA 4B3BA 1EK0A 4M9XA 1WDTA 1KNQA 1SULA 3A36A 3L0IB 1OE0A 4AWXA 1TF7A 4DLVA 4QGFA 4QJ5A 4C7OB 1GKUB 5LD2B 3ZH9B 3GLHA 2QQ0A 3EZ2A 3GJ5A 4C3ZA 1H65A 1XCMA 3RLFA 1FQKA 3KFXA 1Z0JA 3CRRA 1KDPA 4D0LB 2QAGC 5HKKD 2K5UA 1VCNA 3EIEA 2ZS7A 2YZ2A 2C98A 4UXIA 3WHKA 1B23P 2F9LA 3PR1A 3K9HA 2FDCA 3TRFA 3JVVA 1ANKA 4HZUB 4LX0A 3F3YA 3NEYA 2JDID 2X19A 1IQPA 4QNMA 5L3RA 2WKRA 3VR6A 1P7CA 4LYAA 4JLVA 4JLJA 3SYKA 4A0GA 4BLPA 4HLUC 2ZI7A 5CYPA 2G9NA 2IYYA 3SE0A 1R8SA 2V7QA 2IA5A 3O8DA 1VG0B 4RZUA 1WA5A 3IEUA 1W4CA 1ONBA 3ZZTA 2ZI3A 2IWRA 4C0BA 1Y63A 4GFDA 3OIWA 2E9SA 1V43A 1MO3A 2RB4A 2YOGA 5B64A 3U7FB 4DDVA 3H0KA 2P6RA 2H57A 2P5TB 2HJVA 3AVOA 1QVAA 1F2UB 1D2EA 2AWOA 2OAP1 1L4YA 1P9WA 2FEOA 3FMPB 4B47A 4C7OA 2KBEA 3CB4A 1ZCAA 2HDNB 5TXGA 3VKHA 5EE1A 1P9RA 2XOKD 1E2PA 1QHNA 4TT3A 4YMUA 1U9IC 3W6OA 2C9CA 2JLSA 2V55B 2ZU6A 2ATXA 2ZSEA 4I1SA 4JL5A 2EFHB 4MKIA 1XTJA 3MJRA 1NY6A 1J70A 1S9DA 4L8GA 1XTIA 1DAMA 1G6OA 1Q1ZA 4URZR 2ZAOA 4BFUA 4D0GA 2V6IA 3DMDA 4GMXA 4C0QC 4LJ9A 4W5JA 3RDPA 3H4MA 1N2CE 4ERNA 4M1YA 4XWOA 4BUJA 3GJ6A 2PJRA 4IKEA 2BBSA 1Z5ZA 4ZPXA 4DLYA 1I4DD 3BH6A 1DAHA 1CJVC 3UMSA 4TTRA 5DISB 2ONJA 1M2OB 3SQWA 5J4VA 2WJHA 1FMJA 4V0MA 1E2GA 1KK2A 2W6IA 4LV8B 2NPFA 4CZ2A 2QSZA 5IHPA 3QEJA 5FBWB 2OLKA 1II0A 2RGCA 1OPXA 4ABYA 1IAQA 4PC1A 121PA 1T5LA 5BN4A 2CCKA 1F2UA 2O8CB 3NG1A 3LV8A 2NQ2C 5AUQA 1E2LA 4F4IA 3THOA 3O47A 3AP3A 2VPPA 2PBRA 4IEIA 4M53A 1KO1A 2WJGA 3PVSA 5BYKA 3K9GA 2GVZC 3BOSA 1UF9A 4QOSA 3M6AA 5KNDA 3OFNA 4I1OA 4WBSA 1DPFA 4HUQA 2YWGA 2CNWA 2DR3A 3J81k 2VHTA 1T6NA 1P62B 3QKRB 4GRAA 2ZREA 4OQMA 2FWRA 4DDWA 1PUJA 1IY2A 2ATVA 3Q8XB 2OUKA 4PHFA 5GVRA 3NDBB 3I3SR 1BH2A 1NL3A 1U0JA 1VHTA 1HE1C 2YKGA 2VEDA 2OCBA 1OH6A 4RD1A 3HP1A 2CXXA 2JLRA 1ZD9A 1E0KA 5FBLB 1VTKA 5EXXA 5FOXA 2QGZA 1KI9A 1Z83A 3KQLA 1HY3A 1LF0A 2QA5A 1GTVA 2QNRA 2LKDA 3CH5A 2BDTA 1Z47A 2VHQA 2Q3HA 2ZRAA 3A1VA 3T06B 2BJWA 1EGAA 4NTZA 4JVSB 3U7EB 2BJVA 1F2TB 4HAWA 4IFBA 1R5BA 4P4SA 2VF8A 1W46A 5FBQB 2O8FB 2OFXA 1QG2A 1TF5A 1XEWY 1Z0DA 2Y8EA 4NU0A 3U3RA 2OCAA 2ZEJA 1N6OA 1E79D 1Q1QA 1PLJA 2FPKA 1P73A 1Q12A 3X1DA 5JS7A 1FPMA 4HB2A 4ITRC 4DB4A 4LJ7A 2R6CA 2OHFA 3T1TA 1Q3TA 4DDUA 2B92A 2RKOA 2ZRFA 3ND8A 2X2FA 1DS6A 2CLCX 2F1IA 2QP3A 2Z4SA 2AFIE 3PG5A 3ADDA 4GMDA 4UNNA 1FW6A 2IYVA 5HPYB 2HJGA 2J59A 3N5CA 3TR0A 4ARZB 4DB2A 1G9XA 2P67A 3I5XA 5CDFA 2ZE5A 2GTPA 5JEDA 1H8HD 3K8YA 2CL6X 5GJCA 3IBYA 3EIHA 2ZI4A 4QG7A 3X1WA 3B1VA 3PUZA 2FPMA 1AQUA 1YZGA 2V6JA 4E09A 4TLEA 4EKDA 3OEHD 2GDJA 3QE0A 1OB5A 1CXZA 3TJZA 2XSZA 4DXAA 2ZRIA 4EPWA 4OL0A 4NCIA 3W6PA 3CRW1 3OAAA 2O8FA 5JMTA 1ZNZA 4DIEA 5E7JA 4FN5A 1A1VA 4DJTA 1I4LD 4DLSA 4HLCA 2ORVA 1J2JA 1D8TA 2HYDA 5TY0A 1MOZA 3U44B 2ERXA 2EFGA 3QG5A 4XSGA 4J0QA 1KI8A 1ZRHA 3I92A 1NLZA 5FPTA 4B3FX 3ONWA 4B71A 1UBGA 1GAJA 2BBTA 4K81B 2IF0A 2ZS9A 3TQCA 4KCGA 4NBSA 1ZIPA 3REFA 4NCHA 5EUQB 4LC1A 3DM5A 1OXXK 3CWZA 2XSZD 4D6PA 1NBME 2IUSA 3TUZC 2GXAA 1VYUA 4HAXA 2AD1A 2IT1A 4ARZA 1GOTA 4EQ6B 4OHVA 1JNYA 1N6IA 2O5VA 4C4PA 1U8ZA 4Z1MD 2SHKA 4OI2A 2W6JA 1W4RA 721PA 1F48A 2WTUA 1KSJA 4M21A 1XMSA 1E2FA 3KZ1E 1QZXA 2W58A 5TV2A 1VPLA 2NZJA 2XJ9A 2ZSDA 1PLLA 4HAYA 4QGGA 4BFTA 2NZ8A 3I61A 2MSEB 3Q5EA 1MT0A 4OJKA 1XMIA 2XNDD 1OFIA 4D25A 1SKYB 1TEVA 3MGCA 2PEZA 3NH6A 4A6XA 1JXMA 4N0EA 2I3BA 3Q5DA 5KYKA 3DZ8A 4R71A 2J46A 1Z2CA 2YYZA 1EWRA 4NE2A 2W2XA 1E6CA 2FNAA 2HCBA 3K0AB 4DIDA 3EA0A 5FOTA 5FPYA 1G8PA 3U44A 1U2RA 1KSHA 1N5JA 4Y0AA 2W6JD 4WVFA 1KY3A 3B13B 2F1RA 3SDZA 4P4TA 4MKHA 1DAKA 2IK8A 2ECKA 1I2DA 4IDPA 2WHXA 2XTMA 3K09A 4IVRA 1FNMA 2DWPA 3GLFE 2I1VB 1KNXA 1R0ZA 2AHOA 3NBFA 4JJZA 1XCPA 4AD8A 5J4HA 2FN4A 5DHAA 1X1RA 2LWIA 4Q7MB 2OG2A 2DYKA 2ZQ5A 4JVMA 1Q57A 1DE0A 4Q4HA 1E2QA 4KV9A 2A2ZA 2GA8A 3A37A 5G3YA 1XMVA 4QL3A 4FW9A 1EFCA 4LCBA 2BMJA 1DO2A 1TADA 1KGDA 3GJ7A 3RVBA 4XOIA 4M1KA 5EUMA 4P33A 5BYJA 3FB4A 3PENA 4CF7A 1T0JB 3AGQA 2XTNA 2ERYA 4LWZA 2FFQA 4FMCB 5CLQA 4B6EA 4A4DA 3K70C 3THWB 3LBIA 4FMCF 4RCZA 2P3SA 2R6GA 3WYFA 1Q20A 1E2EA 3R9XA 4TN1A 2B7BA 3VQTA 3A8TA 2EFCB 1ZCBA 2A5FA 3I1FA 4US2R 5G53C 2RGXA 2FPLA 2Q9CA 3VKGA 3THXB 1G5RA 3NDPA 2YVUA 4XSHA 1XZQA 4DC9A 1NP6A 2YJTD 3DL0A 5EQTA 2VQSA 4EDHA 4CEJA 1XWIA 1ZD1A 5KTYA 1VIYA 2H18A 3WRYC 4LJ5A 4DSUA 4M1WA 3CF0A 3RC3A 3HJNA 1SVMA 2ZYTX 4RFSA 4B73A 3CR7A 3QSYA 4LV6A 4BZPA 4URVR 4XJXA 2GCOB 1K5GA 3ASZA 3CRMA 3WBKA 3LAWA 1PUIA 1Z6TA 2H1LA 4H1VA 1P60A 5KSOA 1YE8A 3RYTC 2BEKA 4ZKEA 3JZAA 4PFSA 1S4QA 1WBBA 4FI3C 2ASEA 2QM7A 1JR3A 3ZIAA 1KAOA 1ELOA 3VX3A 2QMUA 4EPVA 1TEXA 3BH7A 1S3SA 1S0UA 4PAMA 4TL7A 1EFRA 2Z0MA 4BLRA 3FHOA 5FTNA 4PAQA 3CR8A 3THWA 1U0HC 1EX6A 4CGZA 1XZPA 2G6BA 5CYOA 1SHKA 1T3LA 3VTKA 5EP2A 3B6EA 4TYYA 2IUTA 1JXOA 1OIVA 2EYUA 2WIAA 2XXAB 1BMFA 4C9BA 2ZAMA 4ESHA 1P6XA 3WNCA 5F9HA 3TVTA 3D6TB 4NYMR 2ANBA 3EA5A 5B30A 2J7PD 4B43A 4E03A 3GJ0A 3AVYA 2IL1A 2FA9A 4W9MC 2IYWA 3V9PA 3AVTA 2DPXA 3IDQA 1W4BA 2CE7A 1NBMD 4PC3A 2QT0A 1KSGA 3AGPA 4S2EA 3RHFA 3OIUA 4QGHA 3QOFA 1S3GA 2GCOA 1MKYA 4B76A 1E2HA 1N0WA 1II8B 1U94A 1YZUA 2VIIA 3KXIA 1RC8A 2AR7A 3UKDA 4YONB 2B6HA 1AGRA 5SZHB 1OKKA 3B9QA 5G41A 1E94E 1IXSB 3AKDA 4US0R 3ZYCA 4DHEA 3MWYW 3K0CC 1GRQA 4ZV4A 4DUGD 1D2MA 1QHSA 4US1R 4LJYA 4Z8YA 2EFEB 1KAGA 3FMOB 3SJCA 5LPNA 3T5GA 3SFVA 3RAPR 4M2LA 4LZZA 1Q0UA 4MYTA 1Z6GA 2PJZA 2UKDA 2OT3B 5EZ6B 1KDOA 3WNBA 3CNNA 5FTLA 1OH5A 1E0AA 1P2VA 3K0FB 3ZLJA 3QQ5A 3DOEA 4RKFA 2XXAA 2FZ4A 2CE2X 1NKTA 4HAUA 3Q72A 2AK2A 5FPSA 2JLUA 5HCNA 4Q1CA 2GK7A 4Q1AA 3ETLA 2QMHA 3GMTA 4ZO4A 2DHRA 2ZS8A 5HZKA 4FIDA 5IDVA 2GJAA 3SJZA 1GNQA 4EFMA 5J5CA 4NYMQ 4BLTA 1Z06A 1NF3A 2QAJA 3E2IA 3R7WB 1UFQA 2DFNA 1CBUA 5E95A 5JWHA 1US8B 2FSFA 4A2PA 3AF3A 4JBYA 1D2NA 1M34E 3OHMA 4TMWA 3EIQA 3RSLA 1A4RA 4W5WA 4LGMA 4Q5IA 4P31A 2QG6A 1KI6B 1YZNA 1WMSA 3ZZ0A 1WBDA 2JA1A 2DWOA 3A6PC 4RY2A 4A15A 4BZQA 1DAGA 1XXHE 2IS2A 2ZANA 4G5RA 4Q48A 3AB3A 3U2QA 2C9OA 3GEIA 5J4YA 4QHSA 3EC2A 4JKYA 3EXAA 2A78A 3FPAA 1E0JA 2BM1A 3EPHA 1MH1A 3CX6A 3R9IA 2D4HA 1G7SA 4DSNA 3MLEA 3CLVA 3K0FA 1XTRA 3CO5A 2CK3A 4RFVA 2QUZA 2ZJOA 3E5HA 1N3BA 1EESA 1GSIA 4M1MA 4A8JB 2B21A 4MKFA 3U6KA 5B57C 2MMGA 4BLOA 4CDGA 1AA9A 3W3AA 4LBVA 5DHFA 1COWA 2Q3MA 1YKSA 3VFDA 5DH9A 1TQ4A 3UXMA 2IX3A 3R7WA 2W83A 2D2EA 1CIPA 4G5SA 3AP2A 1BIFA 2WIBA 4LI0A 1AIPA 1H8ED 4MUBA 4DCVA 2QI9C 4XWAA 2ZRKA 2NGRA 4UXHA 1CJTC 2WSSD 4B34A 4ZCMA 1G8GA 4KI0A 1W49A 1ODFA 1M74A 1GKYA 1G6HA 1KO8A 3CPEA 2E87A 1M7GA 2R8RA 2ZRBA 4TZ6A 5A5GA 4Q18A 2MSCB 3IQWA 3SZRA 2QPAA 3TAUA 1AS2A 1P2TA 4Q4AB 2VP2A 2WPDD 1X8LA 4AKHA 1N0UA 3AKEA 4HAZA 3C4JA 4HB3A 3VR2A 5JCZA 4RVCA 1ZU5A 3RS0A 3CNOA 1UBFA 1YR6A 2GXUA 4L16A 1KI3A 1W5TA 2HEIA 4D82A 3ADKA 3WP0A 5CITA 5AUOB 3TUIC 4EPXA 3TK1A 4A8JA 1W7AA 2EFDB 3KQKA 2ZITA 3T15A 4IOMA 4HLQB 3TIFA 2VTKA 2J41A 3BC1A 4CYMA 1CJKC 1G5TA 4RD3A 3B5JA 4LHXA 3SBDA 1T3SA 1OW3B 1CF4A 4BFVA 1NVXQ 2G0NA 1KTVA 2ZI5A 1R5NA 2JAQA 3TSWA 4EIWA 1DAIA 1NVUQ 1MV5A 2ZR9A 3DPUA 3KX2A 5FL7D 1JBKA 1AS3A 3A4NA 4L15A 2QEQA 621PA 1J99A 1KMQA 1XEFA 2FEMA 2R2AA 5JHGB 4NPHA 2ZM5A 3BD9A 3CIOA 1FL9A 3KJIA 5JRJA 1NNEA 2AWNA 1PLKA 2GETA 8OHMA 3GLGA 2Z83A 5HKKA 5E7IA 3LLUA 4B33A 4I1VA 1YRBA 4Q4AA 2RHMA 3AH8A 3QY0A 3LX8A 2IYRA 2QAGB 3VHXA 2HF8A 1E0SA 2IYQA 3P4YA 1S1MA 5L8VA 3UG7A 2OZEA 1KHTA 2JDIA 2JLQA 4HYYA 4AG6A 2GAAA 1JAIA 2XJ4A 4UNRA 4KFSA 5FH9A 3GPLA 1NIPA 1LS1A 3C7KA 3U5ZB 1PVOA 5C4GB 2DY1A 4QJ4A 1EX7A 3EZ7A 3AKCA 5JZVA 3L43A 2VHCA 3GD7A 5B58C 3IHWA 1IN8A 4BE7B 2PEYA 4G0NA 2YV5A 1C1YA 3LA6A 4B3GA 4KLNA 5J47A 4HDOB 4AG5A 2KBFA 4FCVA 4DLRA 2C2HA 1LY1A 1KI2A 3C41J 5F98A 2FV8A 1SKQA 4TZ0A 1KJZA 4R98A 3PXGA 2WAYA 1TNDA 2PLFA 2BWJA 2DFKB 4HI0E 2GF9A 4NHOA 3WRXC 5CIQA 1Q1BA 4QNRA 4JT2A 5H8WA 3B1YA 3GFPA 4OBEA 2H5EA 2ZSFA 4XD7D 1M1YE 3Q7QA 3DVLA 1KK0A 2XOKA 1E9EA 5F2EA 2MSDB 4X8HA 5DYGA 2BKUA 3LW8A 3RNLA 4WXPA 5HR5A 1G7CA 3V4RA 1NI3A 2QE7D 2VP0A 3MAAC 1ZVQA 3PUXA 4A6PA 1Q1EA 1SXJE 1R6BX 2WBLC 2QZ4A 4ON9A 3RRZA 2FH5B 1LF5A 2QAGA 2X1VA 3K1JA 4IEEA 4IXMA 1IM2A 4RD2A 3RANA 3GJ4A 1JPJA 2GKSA 2N1BA 3GJXC 1N6HA 3ZQJA 3R9WA 1R5OA 2FSHA 4YLGA 1P61B 2QQEA 3R20A 4II7A 4MA4A 4GNKA 4LJ4A 3ICQB 3C5CA 3LDAA 4PPGA 4BRUA 1WQ1R 4JL6A 1RKBA 2GEVA 4GOKA 5CIWA 2GJKA 1E99A 1K6MA 3W8RA 1FP6A 2OSBA 1UEJA 4HLUA 4FMDB 2O52A 3D8BA 2IHBA 4FMDF 1ZM3A 3UPUA 1BKDR 3AKYA 4GBMA 4EJSC 5KSYA 2IS6A 3P4XA 1OFHA 4NCJA 4UNQA 2JIZD 1P9NA 5CB6A 5KHOC 3IHLA 4HZUA 1TTTA 5FOVA 4N3NA 5SZIA 2XGJA 1E32A 1G16A 2X77A 3BB3A 3D3QA 3FWYA 4TMXA 3LXRA 1HUQA 2JLVA 2DCUA 5IT5A 4PC7A 1KKMA 1GL7A 1WP9A 4DSTA 2GK6A 4A36A 4RSGA 3VR4A 1N5IA 3H84A 2VF7A 4POAA 3T35A 1S9HA 3D31A 1XU4A 1Z3IX 2RGNC 1U9IA 3P26A 4LBZA 2ZRMA 5FUVA 1OJLA 5HZHA 2R6DA 5DGXA 4D4JA 1N6RA 2AL7A 3SC3A 3EASA 1W0KD 3NC1C 2N46A 4TL8A 5FBRB 4NKRA 4R2IA 4DBLC 5K8LA 1R10A 3VHLB 1OLOA 4KFTA 5JFGA 5C18A 4OHYA 5CJ2A 3QXCA 1U98A 3W6NA 3MJHA 4OQFA 5AUNB 2GEUA 3QBTA 4NYIR 3A4MA 4MRPA 4UNPA 4C0KA 1CTQA 1G3RA 3A1TA 3MFYA 3K53A 2UZIR 2YC2C 1SXJC 5DIFA 2C9YA 1W2HA 2WJJA 1IN5A 4KYUA 4WXRA 2QN6A 4DLXA 1OFTA 4B3CA 3ZVMA 5KOYA 2C04A 2BHRA 2CDNA 5AJYA 1ZUHA 5TDHA 3NVAA 2I4IA 1JEEA 4TYNA 3X1XA 4P3YA 3QXXA 1E79A 4P32A 4CVNA 1ZINA 3NIBA 2ZI6A 2WJYA 4OK6A 3QG1A 4Q19A 4JLPA 1AZTA 2X2EA 4LK2A 1HEIA 5TMPA 5DI3B 2FX3A 2RGGA 3SJAA 1J7KA 1UKYA 1CP2A 1JALA 5TARA 2FGJA 4DDTA 2G1JA 2JJ8A 2VYFA 2O8CA 2CLSA 1JB1A 2ODNA 3QXJA 1W2GA 5FUYA 4A1FA 5C46F 2JGNA 1II9A 4NP6A 5AJZA 2WMOB 1H8HA 3HYRA 3OE7D 1XCGB 1IY0A 1OT3A 2A9KA 3LVRE 4ASUD 4LBWA 5AJVB 1RVDA 1IJFA 5CM9C 3L82B 3QKRA 2OBLA 4EUNA 3OEHA 3I62A 4PSVA 2I1QA 2QTVB 1NVVR 3MMPA 4G3XA 3WNDA 4TYPA 2V4ZA 2CMKA 2FMXA 4MQBA 4NYIQ 4QBGB 2F55A 2BEJA 5EP4A 4LSGA 3AP1A 1LVGA 2FZLA 2ODWA 1D6JA 1TUEA 2C96A 3NEJA 2GHIA 3QF4B 1JEDA 4JL8A 1QHXA 1XJQA 4PC6A 1Z6YA 3F0TA 4Q03A 2GJ8A 4QKQA 4ZI3A 1RW4A 1AK2A 2IXEA 2RMKA 4OK3A 4YC7A 1L2TA 5DI3A 1Z28A 1ZM4A 1E9DA 1ZM9A 2QSYA 3DKVA 1XPOA 1E2JA 1J8MF 4QGAA 3DKPA 3D7MA 5D3MB 5DNYB 1OXVA 3NBYC 1TU4A 3AQ4A 2RGEA 3UWKA 4CEHB 2F43B 2FJUA 3OEED 2D74A 1F2TA 3LXXA 3MG9A 3B1XA 3P1JA 4I4LA 1QRAA 2CHVA 4IXNA 4Z1MA 4WZ6A 1F5NA 1XD9A 3KKMA 5KDDA 1N6KA 4OI1A 4OQXA 3PCRB 3NTUA 4S35A 2ZR7A 2Z4RA 3ZS8A 3S1AB 4DEYA 4HZIA 4MKGA 2XNDA 2XEXA 2XZLA 5IF9A 3U4QB 3Q3JB 3IQXA 2LKCA 2NO1A 3A58B 2VP9A 4G5GA 4V0OA 3ZS9A 3EPJA 1VG8A 1E2KA 3RRNA 3V00A 5FBVB 3KQUA 1YR9A 1X86B 2F3TA 4DLWA 1NN0A 1WE2A 2OFOA 1NVVQ 1GNRA 3CUEF 4K8OA 4LYFA 4DCTA 1OH8A 3H1TA 5KU1A 2ZJ5A 1JR6A 2NTYC 3I4LA 4Q1FA 4GZLA 4UQOA 4YDHB 5DLQC 1K8RA 1FX0B 3SBEA 2HXYA 4B3XA 3HR7A 3I8SA 1GRRA 4JLOA 4JZKA 5KPJA 3O8RA 1KKLA 2QROA 2CHGA 3IUYA 4G01B 3CX8A 2A5JA 4JSTA 1TX4B 2WOOA 1X1SA 3L0PA 1TAGA 5G40A 3CWQA 4XH9B 1OYYA 4RD6A 2IS1A 4Q9LA 5C2JB 2OFWA 3ZVNA 4PANA 4PO9A 1NN3A 3QPUA 2WJVA 1QBKC 4PHGA 3EARA 4KBGA 2V1UA 4W5HA 2R6AA 2XTZA 4BFSA 1KI4A 4ACAA 3KFVA 4YMWA 4A0FA 4D26A 2NMVA 2OO7A 5DN6D 4C30A 2Z5FA 3Q7PA 4HSEA 4K46A 2QY9A 1QHGA 3PEUA 2QGNA 4XWKA 1EFUA 5FPKA 4TL6A 3FGNA 2GAOA 5AJXA 2ZJYA 2V54A 3HPQA 3OIYA 1KDRA 5LB2A 4BZXA 3K70B 3UG6A 4JLMA 3EC1A 1NJGA 2GXQA 1GDDA 3DO6A 1QHHB 2GRJA 2IYLD 4GT1A 2D2FA 5BN5A 1IOZA 2IBMA 4EQ6A 1IN7A 1N5KA 1PZNA 3B78A 3NBZC 1ESNA 4FWTA 1A7JA 4GDFA 3AVWA 1FX0A 2QL6A 4M22A 4EPTA 3ICEA 2WICA 1BS1A 1R2QA 5CLLA 2JJ2D 2AD5A 2IF2A 1W0JD 4AKEA 3QVVA 3HPRA 1JECA 4LYHA 4OQNA 2XB2A 1W48A 5EXTA 3KUDA 1U8YA 3LD9A 4RD4A 3UMRA 1KJYA 3I72A 4TYQA 4TWZA 1KO5A 4MRNA 2RAPA 2GJ9A 1CS4C 3VX4A 1KIMA 2ZR0A 1AQYA 2H8KA 4LY6A 1GM5A 3K0AA 4HB4A 1ZUIA 1G8FA 1TQDA 4FMBB 1VG1A 1FZQA 1VECA 1Z6AA 1ESMA 1LNZA 1U8AA 1I2MA 2NPIA 4TSFD 4NONA 3E1SA 5K8TA 2WOJA 1R0WA 4JS0A 4PSAA 4MRRA 4D4LA 2WWYA 1SVKA 4HAVA 1W47A 4NDZA 4LJAA 4PO8A 3B1ZA 4ZDJA 4Q7JB 1E4YA 3B8HA 2ZI9A 4JLKA 2PZFA
chains in the Genus database with same CATH superfamily
1VB5A 1WF3A 1Z0FA 4GL4A 5CXXA 4OXRA 2J9RA 2CXPA 1XTZA 4NFSA 3PC7A 4CKXA 2V8OA 2WP8J 3DAYA 5I9MA 3A1CA 3HQ4O 4QOJA 3RSZA 4BX3A 2CB0A 2FG7C 2R86A 4HZGA 2IY7A 3IVCA 2IBTA 1NBMA 4WASA 3KRTA 5JLAA 1AQIA 2XPCA 3M4YA 5EMHA 1EG7A 1JHXA 2YTZA 5CB8A 1BHSA 3GOQA 3U13A 3SKVA 1TQ6A 2H29A 2UU9B 1RTTA 4RVSA 1Y33E 2J1LA 3WRYA 3QWAA 5ITZB 1N1GA 1QWSA 4BXOB 1BE0A 1UINA 2JGLA 2PSEA 1CQXA 3R09A 5E9JA 1KORA 5HQJA 3VDNB 5L4SA 4MRAA 3RWBA 2HA2A 1PGPA 2IDJA 4MRVA 5TGDA 3TW4A 3ZGXA 1H66A 2EARA 2PRZA 3FKSD 3OZXA 1JKXA 3IPXA 3KB8A 2QJRA 4GGMX 4LPSA 5CK5A 4DUGA 3DEFA 5BN3B 3THXA 1R6VA 3WJ1A 2YN2A 2GN6A 5IARA 2LUOA 2G1AA 1LTQA 1SOMA 2PAFA 3GVCA 4IS2A 4OI4A 4CBVA 3PICA 4IDNA 1WXEA 4IV0A 4BAGA 3TZKA 2V0GA 1YQ9A 3RVOA 2NAPA 1XRRA 2D54A 5DSTA 1A04A 1KFBB 2ICAA 2GPTA 1YZTA 3CE6A 1B00A 3C14C 3VNVA 3AM3A 4EFLA 1HLDA 2PRSA 5HM6A 3AESA 3GIDA 3AL3A 4GUAA 3X3HA 1Z9BA 4C2AA 4YCNA 3RVNA 2GJSA 4RZHA 1ITZA 1K08A 1DG1G 4LCEA 2WWHA 4UJ5A 4B6OA 1BQEA 3QEOA 3L7BA 3O4RA 2PZ8A 3PNKA 2R1TA 1W4LA 3QWBA 1YBAA 4JKOA 4PLFA 3UFXA 4O8ZA 3KT3A 3ZJYA 2GM5A 2WWTA 3KL2A 1V4NA 3L84A 4WN9B 4Z0PA 4EY8A 3AIMA 5H68A 2O8EB 4ND8B 4A2QA 1TTHA 2NO6A 4B6GA 3SXPA 4R7GA 2C4HA 1K0UA 4KRGA 4LBYA 4N76A 4RZXA 3FOFC 1YRQA 3JAWA 3L0ZA 3TD9A 5DGTA 3BORA 1WS6A 3MF4A 8AT1A 4LW8A 4FYHA 1GTSA 1LBQA 3OCWA 3RHTA 4R8VA 5F2KA 5CFOA 4RTRA 1JIQA 4QHTA 3ETHA 1CRQA 2BF4A 2PKQP 4M0KA 3KM0A 5M29A 3GLIE 2PUAA 2VJNA 4UASA 1QHFA 1SNYA 4OYYA 3HKDA 3ZDXB 3ZPXA 1SG9A 2V9ZA 1MENA 4QELA 1NW5A 4PZYA 3SN6A 3LH5A 4MWGA 1QHIA 3DGFC 4QXRA 4R2HA 3TBHA 3ZDRA 7REQB 2YJGA 2ZSAA 3D4BA 3GLRA 4WZBE 3GW8A 5DU2A 5LCXA 3UJCA 4A0RA 3TECE 3TGPA 1E5DA 4FFMA 1PJCA 1S1CA 5BVHB 2GM9A 4FYMA 5F9FA 1Z56C 3NWJA 1HPLA 2ZRGA 3BSFA 2FE4A 1DTEA 1JSXA 4TWRA 4ZCIA 1FE8A 1Q1AA 3BH0A 3C98A 3Q7SA 1WXQA 4OSOA 2C5FA 5EIBC 3TF5A 4OSPA 1F4LA 2HQSA 1N0VC 4DLKA 4HDQB 3TIGA 3KG2A 4Z49A 3O1JC 3ORHA 4A8TA 1PW7A 4WFQA 5LR6A 1BWPA 4F5WA 2P2SA 1IJKA 5HGXA 3NANA 4PM4A 5TS3A 1P8JA 1LI7A 3MRSA 3ISTA 2D7DA 4ZVRA 3RODA 1GZUA 3FOAA 4HGNA 4AY3A 2QRUA 1N6PA 3ED1A 3OOWA 5JC8A 4K6HA 1XRJA 3RF7A 2Y68A 3ES9A 1G8HA 2OEPA 2Z8YA 5TF0A 3FBTA 1E7WA 1TVMA 4BO0A 4Z0TA 2ID4A 1JKMA 3LZCA 4CU2A 4AJLA 1GPWB 4RTQA 4Q4DA 4TQUS 2C8JA 3LSTA 4RF5A 3HYSA 5GWXA 2A0FA 1F51E 2XQFA 3H2IA 4UE6A 5L53A 3ZJTA 3PEEA 4DMHA 3EA4A 2GBIA 4DR4B 1SWVA 2R7MA 5AHWA 1Q21A 1VMEA 1Y8CA 2FFHA 3A14A 4DLUA 4P3NA 2EJTA 5TT1A 4G8DA 1ZP6A 4ZWNA 3LX4A 3ZWNA 4CR8A 1T10A 2XMZA 4IUCS 3MWKA 4PG5A 5DGIA 3RJ9A 4M60A 1X94A 2WPDA 1E9BA 3CW2A 3EAQA 4L7QA 4UUPA 2FP4B 1DINA 4KAFA 4UVEA 3T1QA 1ZXXA 1XDGA 2HNBA 2IEDA 2R6JA 3EIOA 4W1SA 2IZ5A 3HKCB 3QLJA 4Q0MA 4DA0A 1V8BA 1CNMA 4B48A 3Q8LA 1ZD8A 5KYGA 4TTVA 3LXUX 5SZJA 5IFLA 1XEWX 4G89A 4FMPA 3FA2A 3O31A 4IHQA 4YPOA 4IGAA 3SOPA 1LPSA 1T25A 3GA0A 4Q3LA 1GT91 4U9HS 2FEKA 3UK2A 3ZWXA 4BO4A 3U5TA 5EOVA 4URYR 4F85A 1XA0A 1UFRA 5EG5A 5EIBD 4CRWB 5LOVA 3BMOA 3BTUA 2I6TA 5LKAA 5EXPA 1LZKA 4YP6A 2IP4A 2A4KA 3KETA 3W8DA 3BGWA 1QIIA 4RACA 4BC1A 2AYZA 4NMMA 1FVFA 5HDBB 4XWWA 4F84A 2NOAA 3FMVA 1L5NA 2JH3A 3BREA 3KXLA 1Z2PX 2Z1DA 3OLZA 3WRWA 1OFGA 3EFEA 3ZCUA 3A26A 3ORYA 3R24A 3LHSA 3RJTA 1NWCA 3KL4A 1XLWA 4XYGA 4W7SA 1ZQ9A 2G4CA 3UO8B 1DWQA 2CXSA 1U3GA 3FBWA 4PHHA 3DZDA 5M3BA 2CMGA 1RZUA 1MABB 3HDVA 1GL9B 4AO8A 1C0IA 5JDIA 2R44A 3PNMA 1UAYA 3Q9NA 1KC1A 2HX1A 3K4QA 3BIJA 4G1VA 4KVFA 4OMDA 4EHIA 4J0DA 3DHYA 4GE0A 3EZ9A 7MDHA 1F14A 3L6RA 2IYTA 1YXMA 1JHAA 3VMFA 4XVHA 3ZLVA 1CF2O 3KJZA 3SSNA 1W4ZA 3TOCA 2BH2A 4MCAA 1UC8A 4LXGA 5E8RA 5I7UA 2FPPB 4GZMA 2WNHA 5EMNA 2ZUCA 4CDNA 1X74A 3FYUA 1TMGE 1QIMA 3P20A 5L95A 3KC2A 2ZSUA 5H16A 3LPMA 4CLDA 2IITA 3ADCA 5DT2A 1QNLA 5AHXA 3WWPA 3H6HA 1H94A 1O95C 4IQGA 3NHAA 4I5IA 4EW2A 1LLUA 4A2WA 2CVHA 3HU3A 4D3SA 1Z5WA 3ZVRA 2RGAA 1MAAA 5HRAA 4KZKA 3CBQA 2DRIA 5JSZA 1FJXA 4AIRA 1ULAA 1W8IA 1YTLA 2QR2A 5HRUA 5HQTA 3DO8A 1HOTA 3F5SA 3L06A 1E4VA 4BO3A 1ZBDA 2F1HA 2WJ3A 2QT1A 3WLEA 1K4MA 1QLWA 5MFPA 2LCQA 2GYVA 1XXHA 1XZLA 1A4UA 4GI5A 1OBHA 2QRPA 1KDZA 1V37A 4U39A 3PV0A 3SZLA 2VT2A 1X3LA 4NBUA 3SR4A 3Q3VA 4BZZA 3EZYA 1H2FA 1I2BA 3ZR4B 3O4FA 2XCIA 5HHTA 4Z9BA 2FY8A 5DGCA 1Q14A 2JVIA 1GAQA 1JQAA 1X92A 2RHDA 3B53X 4V0ME 2ENUA 5B7NA 3O8CA 2TRSB 3IBTA 2Q2VA 3OTIA 4DT1A 2PT5A 4L5CA 3V4LA 4K6MA 3NIWA 3ZWCA 4KB5A 4WPGA 3ZEIA 3DLTA 2A92A 1NSFA 3ZKWA 4ECAA 1HTTA 1DEAA 3PUVA 2NO7A 4E08A 2QE7A 3LHKA 4KH0A 2X7JA 5DCUA 3KTAA 3VU8A 2X0FA 1M1NB 5GZ3A 2ZYVX 1XK6A 3D6HA 1N3LA 3COYA 4FFWA 4RV5A 2ZP1A 4RZ3A 3ISVA 4PGGA 3M3HA 5AVKA 2ZXUA 4CEIA 1SU4A 1WX1A 1XFAA 3THYB 1TIPA 1EA5A 3IE0A 1F8YA 4HY3A 4QFBA 4BJ3A 1XR3A 3DVSX 3B2NA 1YZQA 3EUWA 3JQAA 3KELA 5GV8A 4FWIB 3X2EA 4HUTA 3KXDA 3HU2A 4CV2A 1NDHA 1FNDA 3T9BA 3OQMA 4MB0A 4KN9S 3ZE8A 5GINE 3OI7A 4HEHA 4JMLA 1S8FA 2VUHB 1O95D 3ODGA 1G8YA 3PVZA 4KYIB 4II2A 3RV4A 4CM9D 2FSVA 5B12A 3O0DA 5IKPA 2AZTA 2MINB 2XUOA 3TLXA 1JAYA 3G02A 4Z1MD 1KTIA 5EWJA 4BQOA 4UTRA 1O5OA 1ISHA 4J4TA 1XYYA 3M6IA 2D62A 3OIFA 1SMKA 4KOAA 5JD3A 2R68A 1P1KA 1XVUA 3NHFA 4I19A 3JSAA 1KKUA 1S2OA 2CBXA 4ZT3A 2OK8A 4RS4A 3ZU3A 2BFEA 1LUAA 2CL5A 2ZJFA 4OAOA 2V9PA 3QYFA 3H2YA 3GMIA 2QNBA 3QYPA 5IVIA 2JH8A 3HY3A 4TLAA 1ADJA 4YRTA 3C3KA 1MFZA 1LZLA 5CJJA 1EE2A 1WETA 1NN5A 3P7MA 4JBNA 5IYZB 4ZOLA 1P75A 1GPDG 1YOVA 3LC2O 5EPOA 5GV7A 3J81A 2QXYA 1T9HA 4JC0A 2I7XA 1TEHA 3EG9B 3UMCA 2RAFA 1T1JA 2W6ZA 4FINA 3PEWA 1C9EA 4B84A 3TL6A 4M0FA 2QIPA 2ZJ2A 4PPQA 5A6SB 1TA9A 4NJOA 4N39A 2Q1YA 4UHEA 1KWGA 4K0KB 2PZEA 4L5BA 1LLDA 3R6DA 3WL3A 1QORA 5JMPA 3L1IA 2O2CA 4EM6A 1LFDB 4MVJD 3JQQA 3L77A 1O08A 1GAEO 1W0KA 2X6RA 1X87A 3NORA 1IBLB 2BGMA 3L7YA 4DHWA 9ATCA 3DE5X 3TW0A 4D80A 2OTCA 1TRKA 1YR3A 3GFTA 3WGGA 4HWSA 3T41A 4ZCRA 2V7QD 3EHDA 4WOBA 4X6LA 5CM8B 1LV7A 2Q50A 4QBKA 2WHPB 2NV6A 4FX2A 4L57A 3SQMA 3VR5A 4EUEA 1E9CA 1OXTA 1N5OX 3PJEA 1QPBA 3DMFA 2DFTA 5ESRA 1X6VA 2R4UA 1Z5OA 5T6BA 4BBPA 1GXSA 3KBBA 3NKLA 3WGKA 3RW9A 4FE3A 4LWPA 1MO4A 1I2CA 1TQ2A 2OY0A 3MBIA 5T4FA 3K9FC 1F2VA 1E96A 3RBXA 1P4AA 1PJQA 5E6RA 3RUFA 1H0SA 4X92A 2X23A 1E2DA 2DKFA 3EXG2 3HM2A 3I1YA 1YZLA 2XXBA 3L0YA 1LDNA 1N6NA 4FEAA 1E92A 2OHVA 3DNFA 2NACA 3AR9A 3DL2A 2Q0QA 2C0QA 2YJNA 1MO6A 3A1WA 3L0OA 4GI2A 3A9SA 2ZCUA 2VSOA 2O19A 2A9JA 3QKUA 4HEJA 1UJ2A 3VKWA 4R1MA 3OQIB 5IZ4A 4N0MA 3ZY5A 5JWRA 1ZJ5A 1T9CA 1PJ2A 1AKEA 3U80A 3ZQ6A 1AHNA 4AK9A 1BYUA 2WWIA 5HWSA 2QZ9A 1HURA 1M8PA 2V7BA 1XKXA 2GN0A 3IPRA 4GMHA 3QBDA 2OK7A 4AI6A 1PEAA 2RGNA 2NT3A 3W9YA 1DFIA 4DDKA 4DDMA 1DJPA 1ZLXA 1AGNA 4WW0A 4Y0VA 5EP1A 2FW9A 2JK0A 3B8EA 1AUQA 2FU5C 2LE0A 3SICE 1AUOA 4F3RA 4JKIA 1XDBA 4F9TA 5B7QA 1R16A 4H4CA 2YZKA 1PJ3A 2HU8A 1RWXA 3ZNQA 1DRVA 2AXEA 3ECAA 3ZHOA 1ENPA 4BMSA 3HUTA 3HNOA 4RXTA 1EXMA 1TO2E 4RHFA 1PT9A 4C0LA 3W5DA 3A9VA 3GFVA 4HC4A 3VYTB 2GZ1A 5KNBA 1ZJ6A 5FTMA 1FRQA 3E23A 1D2AA 3QKTA 4IJQA 4FYVA 3WGTA 4BHTA 2C77A 4KXXA 5JR3A 1NN1A 2J4DA 2N75A 2EBUA 2PN1A 5EIEA 4DLLA 2HBZA 2ZE8A 2J3KA 3VSCA 3F6BX 3TZCA 4CM5A 1RM4A 4GBJA 3FMIA 1VCIA 1SJ9A 2OO5A 2R7LA 2GNPA 4F6LA 3RHSA 1S89A 1RC1A 3CGWA 2B82A 4OGLA 2X4LA 1QZUA 5CCEA 5I9SA 1FQWA 3NEAA 1K66A 2Q2WA 2QJOA 4F4JA 4R1SA 3REGA 2Z3VA 1J8YF 3HR8A 3L4BA 2JGDB 1SGWA 2WD7B 1UDRA 4E5KA 1UQUA 3FSJX 2EJUA 3W6ZA 3NHYA 4D6PA 3IP1A 4E22A 2VLIA 4FFLA 4K9MA 4P35A 1YUBA 4DA9A 2Z6QA 4ZDKA 1BWSA 4ZAGA 3I6ZA 4NATA 3CEPB 1GPMA 2OV2A 1P74A 1YTUA 1K7EB 5BOVA 5L7WA 4W5QA 4MQ5A 4WERA 3GP5A 3UZUA 2GR9A 2BT4A 1E6UA 3LS2A 3ADBA 3S7ZA 2UUAB 1IZ8A 2FSGA 3TNFA 3NPMA 3CKMA 4MRMA 1VPEA 1E5VA 2FSUA 1W4AA 2QL9A 5MN4A 3T7TA 1AV6A 4DPKA 5KIAA 1NYTA 1XTVA 3DZIA 3V1NA 3HBFA 2I33A 2PWPA 4GKBA 3K1AA 3DS8A 1V71A 2UVPA 3LP8A 3R3JA 2BR3A 4ESOA 5K0CA 3GT4A 2O05A 1TB4A 1KVSA 2I7TA 3SXUA 4QYIA 5AH0A 3U81A 1R4AA 4WY2A 1JJIA 1XD2A 2R47A 3DE0X 3P9QA 3V48A 2R62A 1RM0A 2OG1A 5HQ3A 4RHUA 3B1WA 3GZ4A 2VZ9A 5HUQA 1N25A 1TUBB 4RY8A 3G23A 3P0IA 4BU0A 2AC7A 2PXCA 3OZFA 3S8EA 1ZJYA 3RWOA 2P2ZA 2XGGA 3PQ5A 3UWSA 4JUDX 4AYXA 4D4IA 3OTWA 4WVLA 3IP7A 3MXOA 1CIVA 2FOXA 4X1IA 1E63A 2WU4A 2Q2QA 1L7NA 2VYVD 5T7BA 1A9XA 1OIWA 3EW7A 2OHXA 4CIXA 2I4MA 1NUPA 5P8WA 2G4VA 4NK4A 1PD0A 1Z36A 4NZYA 2O7SA 4H7JA 4Q7LA 5JW6A 4B3IA 2QNIA 2DSNA 3GFGA 2LXNA 5AOCA 3VSAA 4A5OA 4L4UA 4BQIA 3BB4A 1CR6A 1E9SA 3SC2B 1W5SA 2ZTSA 2JFQA 1F8FA 2RK3A 1ML3A 3T1VA 2VWPA 4I50B 3EG5A 4Q4JB 1PTJC 3M1IA 2CL0X 3RS5A 3VR0A 4ESVA 1BX1A 2ID8A 4W99A 2GT1A 2LZ0A 5EKXA 3RAFC 1E2BA 3EIWA 2BVNA 1WG8A 3RREA 5BYAA 2HBQA 2FZGA 3NFYA 2ZK7A 1MQSA 3DE2X 5LIRA 1C1DB 2REQB 3ZHVA 4D9BA 2JLZA 1EI9A 3L6UA 3WDKA 2Q3JA 1WOYA 2RK4A 3PWZA 1JLLA 3NM6B 1PV1A 1RP7A 3SJBA 1AA6A 3PX7A 4IJMA 2YNMA 2K87A 1WPXA 1YRHA 2JATA 2XMPA 3AQIA 5ER6A 4DLBA 2VTBB 4Q02A 5FX2A 1I9CA 3MFQA 4PG6A 3VH4A 1ABEA 5JT1A 3WK6A 2HCJB 3EVFA 1SZPA 4YMSA 3R7AA 4CEHA 4ZHQF 3I64A 1AH2A 3C6QA 2FPSA 3TJMA 3TMAA 3ID6C 3HA5A 2BKAA 1EXDA 2I1WA 1KJNA 4WLFA 5FA5A 1XD8A 1FU4A 5IS2A 1PZGA 2V3VA 4I9NA 1YJ8A 1D7OA 1XZIA 2W2QA 3K09C 1HSZA 3O6VA 4IIHA 4YCAA 1QE0A 1H2YA 2H54A 4FDMA 3LY5A 4IW3B 2JJ2A 2B99A 1XJCA 1XQ9A 3S1AA 4BGEA 4B3JA 5AIBA 1NXSA 4TV8F 3JVUA 1CR1A 2PKQO 4FZ5A 2A5LA 5TJHA 2PK3A 4KQCA 4RTPA 4KRFA 3BZUA 1U8UA 1EE1A 3AOEA 2W71A 3W5VA 5A7GA 3WIOA 1IZZA 4H15A 5H5JA 2JRLA 2UYCA 2VKTA 4HGOA 1J8QA 3V4PB 1V6SA 4IG9A 2B7LA 2VCEA 2ZIUB 4KO1S 3JRNA 1U04A 2JFHA 4J2HA 1E1KA 2VHVA 2FVXA 4W6ZA 1GQRA 2D0PB 5KZMB 1KI7A 2AXNA 2BMFA 3UQZA 4DS3A 4ZQEA 5CDYA 3VOTA 1P0QA 2OBXA 1H1DA 3OY2A 3W9UA 4EELA 1L5YA 2RH8A 5HF8A 1W29A 2WIFA 1QDEA 4XUCA 5AK5A 3R7FA 4GBED 1IHOA 2HGZA 4P0QB 1SVSA 4Q15A 4DCJA 1Z0SA 2GKGA 2TECE 1XDZA 5IVPA 5BSMA 2GX6A 4BFXA 3E9RA 3HO8A 4UM8B 3ENZA 3AR8A 4D3YA 3A4LA 2B83A 4JP1A 3UMFA 1GO2A 4ZHQA 4GOJA 1NT2A 1Y7TA 2BFMA 4GX1A 5AUPB 1AM4D 4QRDA 4IVQA 4TLDA 3RIEA 5T4HA 3HCNA 2NSDA 4DQXA 3IR6A 2YHIA 4KKVA 1XZDA 1RWKA 3OLVA 4XCQA 1EUCA 5BUZA 5HA5A 1UPCA 2YH2A 2WQ6A 2ZG6A 3EXG1 1DMRA 5B3KA 1KK1A 1UXHA 1U2GC 3D2BA 3KJEA 5AKKA 4UFPA 4RVFA 4J16C 3G2HA 4TQAA 4TV8A 1B4DA 4BS9A 4BVBA 2CBZA 3A28A 4GAEA 4ZTBA 1JKIA 1LBIA 4GL2A 1DQZA 1XZNA 1YE3A 4BFCA 2GEJA 3EZFA 5DWQA 4OLAA 2Z3ZA 3K9LA 3LJKA 1YS1X 1R0RE 3FKSA 3UAXA 1C30B 3GLFB 3OEWA 4NK5A 1FIUA 4Y2XA 1MA3A 4MQ4A 4ZV7A 3ROZA 4AY6A 1EFVB 3UMBA 2NXEA 2P4QA 1Z3CA 4U2GA 2C8KA 2ZPTX 3NTXA 3JWHA 4K9KA 4D2IA 3QPWA 1Q11A 1N8NA 3WY9A 2P4SA 3IMFA 4MR9A 3GRUA 1GDTA 4RPJA 2ST1A 3O94A 1FUYB 1K6XA 3VV2A 3Q3GE 1YFZA 1AG9A 1M6VB 1Y34E 3LU1A 4JLBA 2WV7A 5EVCA 3IP9A 4AY4A 1M5UA 4EB6A 1J4AA 1UPAA 9GPBA 4N9WA 2FETA 1PU2A 5ALRA 1PS9A 2ODPA 3EPLA 1KQ3A 3R3UA 2RC5A 3PFIA 4H3KB 1I33A 1IRXA 4L5JA 3SLGA 4LGVA 1KMNA 3ZVLA 1YS4A 2OSVA 1Z4JA 3KT8A 2HNAA 5E9QA 1PX2A 1GZSA 4JHLA 1A5TA 1CZKA 3GT0A 3PE6A 5ESWA 3KWFA 4OYHA 2GCPA 1CRLA 3VH2A 3KLPX 2ZBEA 2WHYA 1NKSA 1KY5A 3DQZA 3GEHA 1DAPA 1NATA 4KTVE 2WQ7A 3PGLA 3VHRA 3DTNA 2ZYWX 4Y6LA 4G09A 5K01A 1YR8A 2PA3A 1VG9B 2PTGA 5EUCA 1UC9A 2FB9A 2XHZA 4QO8A 4ZYYA 3GDHA 4B80A 3MJSA 3OY7A 1G2PA 1H0HA 2WPNA 4YP9A 4BMNA 3CUWA 2OAGA 4X1KB 5BWOA 2XODA 3G49A 4Q3KA 3RF6A 3FCXA 1QZ3A 1UBHS 2I6XA 3AWIA 1KETA 3HUFA 4KO2S 2B8TA 5JXHA 4U7GA 1VMAA 1M75A 1NIJA 1RC0A 2I7CA 5ITVA 2C2KA 3FNHA 4GX2A 3WQHA 1ODCA 3AILA 1W1WA 1WULS 5AKHA 4PHTA 1JR3D 2IZ7A 3ZIAD 1I7DA 2PKWA 2Q9AA 5HS4A 3UIEA 2Q3BA 2ZRCA 4BAUA 1OX4A 1EFRD 1V7PC 4IILA 2OM2A 2W11A 1H05A 1YZKA 4ZVQA 2ZOSA 2C20A 2I78A 1FFXB 1UM8A 3P9PA 5FJIA 2WAAA 1ZGAA 1JEJA 3GEMA 3MN1A 4JLUA 1IH8A 4RM3A 3UH1A 1G1AA 3ZWPA 2XMCA 3WOVA 3N2EA 1H69A 5HXAA 5LJIA 2H0AA 3L8MA 4WKCA 1Z26A 1GUDA 1MB4A 2ZB4A 1G64A 1LV8A 3VUEA 4KR2A 4XSVA 3PNYA 1LPNA 5FOWA 4AKGA 4XTCS 2O9JA 1ML4A 3HKEA 3CKKA 1PNTA 1F8XA 2FRDA 3IDSA 4KL8S 1EIZA 3K0CA 1A76A 3G89A 2C8VA 4V0KA 1EQAA 1T0UA 4FYPA 2P68A 3STWA 5LBIA 3CNBA 4QAJA 1F9EA 2DLCX 3D7RA 1YVDA 1L4UA 4NNJA 1XMJA 2QW0X 3Q1KA 3ZZUA 4TPKA 5DI9A 2JLWA 2L17A 6Q21A 4GP6A 3WLLA 3ZY6A 1MR3F 4MV1A 2G70A 2IHVA 2CVOA 5TVKA 3SHFA 3KHKA 1JLMA 1VCHA 4OHFA 1I1HA 1K9SA 2BC9A 3JARB 5GGYA 3UK7A 3GP3A 3IT0A 3G9XA 2VK8A 2X4IA 1NZDA 5LMCA 1EFHA 3KYBA 4Q24A 4YJ2F 3PEYA 2ZUBA 4K1LA 2KI5A 4R81A 1CHDA 4QXAA 4AL4A 2R8EA 3KPJA 4H16A 3JD4A 3EYAA 2AOXA 1KR2A 1ZZEA 1XZJA 3BFPA 1JHRA 1QIHA 3OBIA 4EVSA 3AY0A 3IT1A 4QYMA 5EHIA 1IK4A 2XADA 1PJRA 2GILA 4FD2A 4DZZA 4RVOA 3N53A 4RKRA 3ZE0B 1W5AA 4ZAWA 5CH8A 1P91A 1Z12A 2X58A 3H65A 4XOUA 1OI7A 2NU6B 3A31A 1GRVA 1SHLA 4IYJA 3Q9SA 3RYHA 2NO9A 2NPOA 2XIJA 4BMYA 4QT4A 1NXVA 5HJEA 2ZXFA 5TF4A 4FDUA 2DPLA 3UWOA 1X38A 4PVDA 3UKOA 4BMXA 5G1NA 1JFVA 1L4GA 5FUWA 3OQNA 1FMTA 3MINB 1AGPA 1PT8A 1IUPA 1KEEB 2CBGA 5FOSA 4ADSG 1P72A 1YAJA 1WKBA 2AKYA 2I1LA 1DUVG 3MQ2A 5ALGA 3MB5A 2AT1A 1RPJA 3UW1A 1ZKMA 2TMGA 5KO2A 4BNLA 3Q8KA 3ROMA 4HUJA 2SECE 3HKBB 4WACA 4EVRA 3Q6MA 4XFKA 5DBGA 5FLYA 2DQKA 3QNMA 1EIWA 1KZ6A 3ZY4A 2R6FA 5C8DA 4QU5A 1T1EA 3NEPX 1FYVA 4HNSA 2AN4A 5ULLA 3W2HA 2PJDA 2V96A 3HDJA 2J6CA 3PSAA 1SCNE 3PYXA 4FIZA 1Y1LA 3HL4A 3OTQA 3L1UA 4Z3DA 5JVDF 4IXDA 1RQ2A 3P0JA 2HSDA 3ORQA 1NVGA 1IOLA 3D6JA 4YJ2A 3D8UA 1EM8B 1DEKA 1Z6XA 3A6LA 4Q47A 4LYYA 2GPJA 2CNOA 4Y9RA 2V3CC 1N4DA 1CLUA 5DMXA 3HTXA 2HRRA 3EE6A 1TK9A 2OV1A 1CJCA 3WGOA 2PJUA 3PIRA 4U9UA 1KFKB 2HV8A 2OZVA 1DC8A 2FUEA 1IOWA 1P6UA 3DDOA 2QTNA 3I12A 3P0RA 1E6KA 2H7XA 1GPNA 4RZIA 3VKFA 1WB9A 3COWA 5BR1A 2PUFA 1E2NA 1VRVA 3V4FA 4FTWA 1M2VA 2EG5A 2QPOA 4PQEA 4LFBB 1HWYA 4J07A 1NMQA 5FV7A 3P0HA 3RVPA 3UENA 1RACA 3JATB 3VI4B 3ZE2B 5LDHA 1KQFA 1GILA 3CPHA 3LKZA 3C3XA 1O6ZA 1DBSA 3EQ2A 3TKAA 1YC5A 4K9PA 4CV1A 5LM3A 1SVWA 4FFDA 3HI6A 4OP2A 1FF9A 2Y1CA 2Y1LA 1LCIA 4IVPA 3PQFA 3RR2A 3SKYA 3WB9A 1DEXA 1PWYE 3HG7A 3M0EA 4KPGA 5J40A 1HTBA 2Q0SA 4GM1A 4U5XA 1Z2AA 1PO7A 1P2UA 2VJMA 3IILA 1M72A 1HF3A 2B25A 3OFVA 4OQLA 3RH0A 1XQVA 4B7AA 4E07A 221PA 2BE9A 5TB5A 1NPDA 1VI2A 4ZPJA 3CF2A 3W34A 5AHRA 3IGFA 4KVAA 4REOA 4YY3B 2FX2A 1G2IA 1PEKE 4R1LA 3QA3E 3R74A 1O1YA 1X8XA 1NW6A 2D1RA 3VSBA 3ADPA 1KU0A 2Y05A 3LC0A 1DX9A 3KPVA 3F9RA 5D3QA 3CKLA 3W6UA 1B2LA 4YRNA 1F0KA 4FCWA 4FFBA 4JX9A 4OQQA 1H23A 3VYRB 3QEMA 2YZMA 1U1FA 3FE2A 3NHLA 3AVXA 2EWWA 3VR2D 2E4YA 3STVA 3EMVA 4FDLA 2PX8A 4LC0A 4YLEA 5JD6A 5JYDA 3L4KA 4BE4A 2QY6A 3C87A 4G65A 3DVQX 1IONA 4MVJF 3RS9A 1C50A 1IPHA 2QUKA 1R6UA 3X44A 2QKYA 5J59A 4EHNA 3NALA 2YWEA 1MO5A 4MDYA 1Q74A 3BXOA 1MB2A 4N8DA 3HCPA 1GG2A 2HCFA 2XLCA 1L5SA 4R3WA 1GPYA 3LRPA 1PYGA 3M9LA 5ENDA 5F9MA 5IN4A 1C8BA 2GERA 2F1JA 1O95A 3CZMA 9MHTA 3SFZA 3KJNA 2FE1A 1JHQA 2CNBA 1DKOA 1BD3A 1DVRA 1AN9A 5LYJB 3GU3A 3JYQA 1NURA 4NJMB 4IRXA 3P9XA 3NHZA 4B3BA 1R0CA 1EK0A 4ZJZA 2J3IA 1UCFA 3FLBA 1YV9A 4PR3A 2AIRA 4HDSB 5DTIA 3JYOA 3M9WA 4PLGA 3GUHA 4ARVA 5LP6B 3AL0C 2BGTA 1MVNA 3OOHA 1ADCA 1C3JA 4C7OB 2ZBFA 1A7KA 5LD2B 3DCIA 3R1IA 4ND1A 2X2OA 3V1KA 2F48A 3GLHA 2AG8A 2QQ0A 4J76A 2X22A 4Y2QA 1NM5A 4PLZA 5KAMA 1KFCB 2BZ0A 4BNDA 1XRPA 1Z0JA 3CRRA 4LFAB 3IHTA 3WWDA 4WFKA 4K9LA 2PBFA 4EGSA 3DCYA 1VCNA 3EIEA 2ZS7A 3RVRA 5EQJB 4YUYA 2C98A 4OJMX 3N76A 3L92A 4PN3A 4TTSA 5DWDA 3PR1A 4F86A 3W5UA 3TRFA 3EFBA 2QV0A 1M6HA 3VH1A 5B3LA 2BSQA 1ANKA 2X5NA 2ZFUA 2C2GA 2CJYA 2DLNA 1WTCA 4MVJA 3WYDA 1Q17A 1U7UA 2JDID 4TV9B 3EGDB 4F2PA 1IQPA 2HSGA 4JLJA 3UHJA 4HLUC 1DOHA 4UFNA 2XAAA 4S1NA 2V7QA 4RELA 3W1EA 2ZUUA 4LSMA 5DYWA 2FUKA 3ZOKA 1WA5A 4X3CA 4Y0AA 4O63O 3G8BA 2FWBA 3ELUA 2IWRA 5I3CA 1E4EA 1HNNA 4D97A 5JQGF 4MIOA 4D9FA 3FWKA 4GICA 1THTA 2XUDA 3ZBPA 3HSKA 1L1RA 2BRUC 5IAKA 3HGQA 1NUUA 4NE9A 3GEDA 2H57A 3I05A 3B48A 1WSAA 2HJVA 4JP8A 2VOEA 1FBNA 1QVAA 1PL0A 2GZRA 2FEOA 4JI8B 3FMPB 3CE9A 4RK0A 6LDHA 3TTTA 2EQ5A 3CISA 1DKRA 4V24A 1XPOA 3OOJA 5AKLA 1WXFA 2HDNB 5TXGA 3LCCA 1QO7A 3EF3A 4GKKB 2XOKD 1J39A 3QX7A 1QHNA 3DYBA 4PNPA 2JLSA 5KWIA 2O2JA 1KXJA 2ZU6A 3RT1A 1U0EA 2AEEA 2ATXA 2OAEA 3FOCA 2ZSEA 3OQ6A 3EIXA 4TSRA 1ILWA 4Z2YA 3VZCA 4OGKA 3Q5GA 3IELA 4JL5A 2XWJI 2H2AA 3G2NA 3O4HA 1XTJA 2AC2A 1NY6A 1J70A 1XTIA 4LYGA 1NASA 1Q1ZA 2COKA 5B58T 1L1FA 4C78A 1UL1X 4DNPA 5JMOA 1SQFA 2V6IA 3DMDA 5TPZD 1PZEA 4XWOA 1N2CE 2PT9A 3QLTA 4Q6WA 1FP4A 3RPEA 3V7YA 1VA4A 1WCXA 2BBSA 3CLTC 2YBDA 3AC0A 1QG6A 2HJ9A 1LU9A 2PUWA 3LYUA 1AQ6A 3UMSA 3QBEA 3D2LA 3MWEB 5DISB 2ONJA 3RC2A 4M6WB 5JAIA 2ASVA 2WJHA 5KYTA 1E2GA 2PANA 3B36A 1YJBA 2C3UA 3LVBA 3KFLA 4KE8A 4MARA 4JXXA 2A1UB 1MDBA 3IDZA 2XT0A 5CLHA 2IHNA 3LYHA 5FBWB 1II0A 2I34A 4G8CA 1EU1A 4PC1A 4AX8A 3UMVA 4CQMB 1OX5A 3ONNA 4DR5B 3KAKA 3QHPA 2NZUG 3HUEA 1CB7A 3GZTB 1SC6A 4H7FA 4YX9A 4ZAYA 2WSLA 5A9SB 1ECFA 1L4HA 1CIJA 5D00A 5E2BA 4X60A 3PQEA 5DWVA 3THOA 3O47A 4BJHB 2PBRA 3UT5B 1NMSA 1N7IA 4QUKA 3PVSA 5BYKA 3K9GA 3N0XA 2BKXA 1VC2A 4QOSA 4QDZA 5T5QA 3X0DA 4BVAA 2IH5A 3GUYA 2CLMB 4IZHA 2VHTA 1P7ZA 1T6NA 1V5FA 4LZWA 4ZO6A 1FVXA 3VR4D 4R8KA 4UUMA 1L4BA 2VEOA 3PFGA 3T7RA 3NDBB 4JROA 4YT8A 4G56A 1GU7A 1NL3A 5IW8A 3LUHA 1DJOA 1VHTA 2GK4A 3FNEA 1HBJA 1HE1C 3T7IA 1IFXA 3HXMA 1QS0B 3TEFA 2SCUA 1OH6A 1K6IA 3HP1A 5EMLA 5A62A 2JLRA 1Y3FE 2BGLA 4RE5A 4AS2A 1ZZGA 2QLMA 2Q27A 4LWOA 2LGJA 2QGZA 5TS2A 2DXIA 4W8OA 1JYSA 1RIIA 1M2OA 4TUYA 1WIWA 3ZHUA 1WMDA 4R8RA 1I7QB 4YRIA 1DJNA 1EXVA 3KQLA 4M0DA 3C1TA 1SRRA 2RH9B 3CLTD 1IZYA 2LKDA 1SCKA 2HM7A 4H6XA 3TQSA 5DX8A 3E3AA 5ERXA 3HBLA 1XKTA 4GSLA 1PQPA 3DULA 3RO7A 5EEHA 4HAWA 4IFBA 4O4LA 1DGQA 1LBSA 1ZEJA 4GG1A 4OUDB 6GPBA 5ICSA 2O8FB 3OP1A 2OFXA 2GCEA 4HLNA 2QMQA 5CYGA 2FKNA 2ZBQA 3RVLA 4JI0B 4DR3B 3KLMX 4HV4A 4C7XA 2VYVA 3T3NA 4CMIA 4L4SA 3S2UA 4BCCA 3X1DA 3MPOA 1OJ7A 5JV5A 1VM6A 2DHCA 1UR5A 2BTQB 4E88A 2Z4TA 3SYMA 3UHAA 4I4NA 3WIDA 3T5TA 3DMRA 3TW6A 5HILA 3EH2A 4UMFA 4DV4B 2EJVA 1U3VA 1Y4UA 3M49A 5FLKA 5KVQA 3ADDA 3D4NA 3L7OA 5HPYB 4IAOA 5HTOA 2HJGA 4XA8A 3GEBA 1ZGHA 2ZSKA 3BEDA 5I47A 2GPBA 1MBZA 2PZMA 4G4JA 1G9SA 1ICEA 1X9HA 2J48A 2P67A 2CVPA 4S1OA 4WKGA 3SBOA 3KOMA 2FVYA 2AYYA 4LE1A 2RBEA 1A8SA 1J9GA 2ZIGA 1V0JA 2W2KA 3OA0A 4KX5A 3IJRA 3V1LA 2ZI4A 1M2KA 1WLSA 3X1WA 4CTOA 1TJNA 4MWSA 1CZRA 2CXQA 2FPMA 3HFSA 4K2AA 3S2EA 1AQUA 2V6JA 4ZO8A 5JBNA 2AJDA 2XUJA 4TLEA 3HN6A 3IAM1 3QE0A 4R0MA 2YN0A 1OLSB 1JEYB 4K6GA 2BH9A 3NDIA 4OL0A 4GLLA 3CRW1 2RDMA 3VR5H 2GARA 1ZNZA 3B70A 4BEWA 5B55A 2DP4E 2IYAA 5E7JA 3PC4A 3GGOA 1YVRA 4FN5A 1LDBA 3NT2A 2VBGA 4B3MB 4BKOA