1NXOA

Micarec ph7.0
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
116
Chain Sequence
b'KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
total genus 41
structure length 116
sequence length 119
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxoA00
4MR8B 2PUGA 1D1PA 2LBPA 3H1EA 4P1ZA 3L6UA 3CKMA 3LUCA 4O5AA 3NNSA 4Z0NA 4MQEA 4W5TA 1LBIA 3KLNA 3MQ4A 5KC9A 1ZDMA 2VUHB 1DZ3A 3ROFA 4Z4HA 3GBVA 2FLWA 1PNRA 4Q6BA 3O1HB 3LUDA 4N0QA 1DRKA 4G86A 3RVNA 3FFTA 3CS3A 1NTRA 5CNKA 4MQEB 1L5ZA 1PNTA 3NHMA 2A9QA 3CRNA 4TLMB 5JNWA 2ZAYA 3H6GA 1SXIA 3EJWA 2YHAA 1MB3A 2RDMA 3CFYA 4RXUA 3IP9A 3K9CA 4QICA 2R25B 4F8JA 2PUEA 1XHFA 3ILYA 4LX8A 4ZPJA 3QEKA 2KYRA 3M9WA 3N8IA 2Q5CA 3OQMA 1DCMA 2MSKA 4IF4A 4NQRA 3DGEC 1ZESA 4S05A 2YHBA 5KQLA 4HYEA 4EVQA 5IUNC 3O2JA 4LDZA 4GPAA 4PYRA 1Z2DA 3T38A 1D2AA 1CEYA 1YK0A 1QP7A 3W9SA 4KVFA 1ZITA 2M1ZA 1OXKB 1FQWA 1NXPA 2ID9A 3EDCA 3GV0A 3HXMA 1RZRA 1F51E 1FFGA 1EAYA 2MYNA 1S8NA 4W5QA 1GLGA 2LPMA 3TD9A 2QR3A 2OQRA 3OO1A 1BVHA 3RQIA 4OTZA 3OMWA 3RVRA 3H5WA 3OMXA 3IP5A 1ABFA 4RXMA 1KRXA 4IMJB 1SXGA 1FFWA 2QXYA 1YS7A 3UKJA 3JY6A 5FBKA 1BAPA 1Y1LA 1XHEA 2QSJA 4O1HA 1UDRA 3KLOA 5TPZD 3LTEA 1JDPA 4NCAA 3H5TA 2NT3A 3H1GA 4NV3A 2JB9A 2FW0A 4WT7A 2CHFA 2PUCA 3QX9A 1ZN2A 3QLUC 4XAQA 2P4UA 4N0PA 3CHYA 2O20A 3JS5A 3LUGA 4F3TA 2JVJA 3K4HA 5T3YA 2IPLA 3HDVA 3QLVA 1U0SY 1JHZA 4RY8A 4N41A 3NBMA 1MB0A 3CTPA 3T95A 3Q7RA 2ID7A 3FGZA 4L85A 2QZJA 5IUJC 2H0AA 1P8AA 3HUUA 1NXOA 5FBHA 2IYNA 3JPYA 5C5EA 1EFAA 2IPNA 5TE9A 2FEKA 3T8YA 3M6MD 4XFKA 4RXTA 4IRXA 3MA0A 4YP9A 3RVQA 2JVIA 3O74A 3KS9A 1SXHA 5DCLA 1LBHA 2E4VA 1JX6A 1U2PA 1USKA 2FLKA 4FE4A 4Z99A 5IC5A 1QP0A 1AB5A 1BA2A 1K66A 4JB2A 4DADA 2NZVG 3HV2A 1SD5A 5KI6A 3EQZA 3VNAA 1DP4A 4LE2A 1DBWA 4F12A 4KRFA 1QKKA 1VRVA 2L17A 2V0NA 3UUGA 2RJNA 5IEJA 2QU7A 2J48A 1APBA 3H5LA 2HQRA 3RVSA 3SAJA 2L19A 3DZDA 4YRZA 1YMUA 5KQMA 2JVKA 1TM2A 4KK4A 2FTKE 4MS1A 1JF8A 2L18A 3EODA 1QPZA 1D5WA 2R4QA 2PL9A 3GRCA 5ABPA 2FEPA 1E6MA 3O2SB 2MYPA 3GL9A 3I5AA 5DGCA 4RK4A 1R8JA 2CHEA 1D1QA 3KG2A 2R48A 4LRQA 4PEVA 1PEYA 3BBLA 3TO5A 1VKRA 4KV7A 1JBEA 4MS1B 3E61A 3H75A 2FQYA 1M5TA 3NHZA 3C3MA 2I6FA 3FDFA 3A0UA 3QLTA 5B3JA 5HSGA 1NATA 5EWMA 5I4CA 4Z4IA 5JNRA 3N53A 3SNKA 3TX6A 4H3HB 3HJFA 4HNRA 3Q9SA 4JP1A 1EHCA 1I3CA 2FMHA 3N0RA 4MQFA 5BR1A 4Z9BA 1GCGA 3F6PA 1NXXA 5EWMB 1HEYA 4QYWA 1U2QA 3HSYA 1KRWA 4G97A 4JB0A 4WXEA 4LE0A 1USIA 1U8TA 2A9PA 1USGA 4YS6A 1P2FA 4MQFB 3GWGA 3UK0A 5T7BA 2AYZA 3OQOA 4LZLA 2GI4A 3IPAA 3A10A 4MLCA 4N03A 4Q7EA 1H9CA 1ZH2A 2HPHA 4MPTA 2E4WA 4RKRA 2CD7A 3EAFA 1DC7A 2WMYA 4MR9A 1QO0D 3F7NA 3GYBA 1JFVA 1RNLA 2VUIB 3G85A 3KCNA 4F11A 3EQ2A 4EVSA 3LUFA 1YK1A 2NZUG 3NNNA 2E4UA 7ABPA 4IMIB 3L49A 3O1IC 4MR9B 4RS3A 3IP6A 3RVOA 3HUTA 4JAVC 1FSPA 1NY5A 1NXWA 4EGSA 2JRLA 3CZCA 1ISSA 4OBBA 1ZAYA 4L4UA 4NCBA 3CZ5A 4Q6WA 4ETIA 1JYEA 3E3MA 4EYGA 1KMIY 4N76A 3N6VA 2AYXA 4FE7A 3Q15C 1D4ZA 2HQBA 2FSPA 3MIZA 2PJUA 3CU5A 4NICA 5JS2A 3SG0A 5CHYA 1ZH4A 4KFCA 3KKEA 2FVYA 1QQAA 1YTUA 3F6CA 2A9RA 4TMYA 4S04A 1JFTA 3KYJB 3R0JA 2WY2D 2M98A 3FMVA 2X7XA 3QK7A 2JK1A 4ZJPA 2RJOA 5IEBA 3O1JC 1NXTA 2MSWA 5PNTA 5KQPA 2PKXA 2NT4A 2PL1A 3B2NA 3MF4A 3MM4A 3Q7SA 4G0YA 4TLLB 2FQWA 1ABEA 3JPWA 2GKGA 2B1JA 3NNDA 1P6UA 2WB4A 4MAAA 2QVCA 4RKQA 1SRRA 4XASA 5TQJA 3HEBA 2QVGA 1LK0A 3QLUA 3MYYA 3IDOA 2MSLA 2WJWA 4LE1A 5JNVA 4ETMA 1GCAA 2PUDA 2IPAB 3BREA 5JNUA 2IKSA 4QYMA 4MR7A 3LUHA 5IX8A 2DRIA 1DBQA 3OM1A 5IBQA 3TMYA 2A9OA 1FFSA 2IOYA 1GUBA 1DCFA 2LP4Y 2FN9A 1YMVA 4MRMA 1VLZA 4O1IA 9ABPA 3HM9A 2HSGA 3OM0A 3JVIA 1M2FA 4MR7B 4KNYA 3LUAA 4HNQA 2ZWMA 5HKOA 4PICA 1TJYA 2JCGA 3Q41A 5EWLA 4MRMB 2FEWB 5DLEA 3KJXA 3Q7TA 1YVUA 3KYIB 1BDJA 3C6QA 4IILA 2TMYA 1ZGGA 3QELA 1AB6A 2XDYA 4RZSA 1PHRA 2B4AA 3LKVA 3RVLA 4Y9TA 6CHYA 4OLAA 1QO0A 3OO0A 2WJAA 4KK3A 1MAVA 1BDHA 1DBPA 2FQXA 2PAFA 1Z12A 4JA2A 1ZHHA 3JVDA 4PZ0A 2PUFA 3QELB 1TMYA 2GX6A 2PE5A 2QV0A 4YGXB 4JOQA 3OLYA 3GA5A 3F73A 3I42A 1CHNA 5ED4A 1BDIA 3CNBA 4YLEA 1ZGZA 3HS3A 4G0QA 4IGAA 3D8UA 4E7PA 2E4XA 1GUDA 1Z13A 1ZY2A 1E6KA 3CG0A 4KMRA 3I09A 5C5CA 4N47A 1E6LA 4EYOA 4D6YA 3QEMA 1P6QA 5E3JA 1A0OA 2NUBA 4GNRA 5HQJA 5FWYA 4YWHA 4OATA 4MLDA 4MS4A 5BRAA 5GOTA 3DBIA 3FFXA 1IIBA 4WUTA 4B09A 3BRQA 3SY8A 3S99A 3QEMB 5TPZA 2R47A 3URMA 3KTOA 3CG4A 3OLVA 3VNBA 5FWYB 4MS4B 1JWLA 1E2BA 1T34A 2WRZA 4KZKA 4RK7A 2IPMA 3RVMA 1QP4A 4ZMRA 4EVRA 4KPYA 2FN8A 3RVKA 3N0XA 5CNMA 1Z2EA 1F4VA 3I45A 3N75A 4Z4FA 4RU1A 3MMNA 1J56A 3OLWA 2PLNA 4XARA 1YIOA 1PEAA 4RK6A 4ML3A 4G0OA 3RVJA 3DLHA 4MS3A 2PMCA 3OLXA 1KGSA 4TN5A 1DRJA 1YS6A 3SM9A 3LUKA 1RXIA 4M88A 4YV7A 1DJMA 4RY0A 4JASB 1C4WA 3N0WA 2FMKA 1URPA 2HQOA 3C3WA 2RGYA 2JBAA 4HNSA 2LUOA 1B00A 3HZHA 4MS3B 5TQ0A 3DGFC 4G0PA 5TPWA 4PE5B 3GBPA 1Z17A 4D74A 3QX8A 4KREA 1VPWA 2FMIA 4YCSA 1QMPA 1DC8A 1EWKA 3C97A 5TQ2A 3KSMA 1TLFA 2JBAB 4Z4CA 1Z18A 4ZMSA 2IDMA 5TQ0B 3G1WA 4EYKA 5D2CA 5TPWB 8ABPA 1QNLA 3A0RB 4UHJA 3H5VA 2N9UA 5CNIA 3LUJA 3FFWA 4KQCA 5TQ2B 1Z16A 2VYCA 1A04A 5FWXA 5BQ3A 1M2EA 4FB4A 1DG9A 2BGGA 4EYQA 4W5NA 3JTEA 6ABPA 4LDAA 3OLZA 5F64A 2HJ9A 2MYUA 3DLBA 3O75A 4G0ZA 4OG2A 4XXHA 4DQDA 5KC8A 1JYFA 4WZZA 5JNSA 3EGCA 5FWXB 1LJUA 3BRSA 1PUXA 4W5OA 3EULA 3HO1A 1TVMA 4G0MA 3O2QB 3RVPA 4UHKA 3KHTA 4P98A 1JLKA 3QLVC 3SQNA 4CBVA 2F8TA 5DTEA 4H60A 4H3KB 2CWDA 1W25A 1C0EA 3ROTA 4QPJC 4WXMA 1A2OA 4OLBA 2VK2A 5IUKC 3ILHA 3T6KA 1CYEA 4KQ9A 3TB6A 3HCWA 4YR7A 1OXBB 2W42A 3CLKA 4ZYLA 4RV5A 5BRJA 3LKBA 1W9HA 2FXIA 2FKAA 4D6XA 4W5RA 3HVRA 5JNTA 3IPCA 1MVOA 1EWVA 3O21A 3LFTA 1WETA 1XWWA 1JH9A 1M5UA 3M9XA 3HK2A 1JL3A 4RK5A 5HM6A 4MYRA 1Z26A 2L2QA 1L5YA 2FMFA 5DKFA 4EY3A 2MYTA 4Z4EA 2LIVA 1RZRD 5EWLB 2GWRA 2P9HA 4WWHA 3IP7A 1NXVA 5JS1A 3D02A 3C3KA 2WWVD 2OENG 5KQGA 3A3KA 1DCKA 1MIHA 3HDGA 4RY9A 5CNJA 4RSMA 3BILA 5GQSA 1Z25A 3H1FA 4Z4GA 3LMKA 2H3HA 4RWEA 2F8SA 4E7OA 3RH0A 1EWTA 4ETNA 3LOPA 4EUKA 2PUBA 4RDCA 3GT7A 5EWJA 1JDNA 4Z9AA 1Z15A 4RK0A 4YO7A 5KWSA 2PUAA 1NXSA 3P9YA 1JFSA 2E4YA 4F06A 1ISRA 4MR8A 4RK1A 1ZVVA 1LJLA 1RXEA 1QQBA 2GBPA 3OQNA 1K68A 2QW1A 3H5OA 3H5IA 4DN6A 3H6HA 1U04A 2E4ZA 4G0XA 5EWJB 5B3JC 1RPJA 5IULC 4XLTA 4MGEA
chains in the Genus database with same CATH superfamily
1DBSA 2BFPA 3DAHA 3ANXA 1Z22A 3D6NB 4MR8B 4PZUA 3QHPA 4X1IA 3T7AA 3MGCA 1AHHA 1RQ7A 2Q6KA 2CL6X 3H1EA 4CLRB 1GSAA 4CPDA 1CETA 3ND5A 4W5TA 3PK0A 1OX5A 4OK6A 2WTAA 1PJLA 2IBSA 4QDOA 2VI5A 3UGTA 3GBVA 4M22A 3U4QB 4J0QA 2PX3A 4R69A 4Q6BA 3LUDA 3MRTA 1JQJC 1B3RA 2PZMA 4N0QA 3U7QA 5KKCA 1XZEA 1OLUB 4OCZA 4Q3KA 4C6SA 5KOHB 1A8QA 1EVKA 1IE3A 1P9NA 3HN2A 3JZMA 3MOSA 1OT3A 4HDNA 4OJNA 4RH3A 5AK4A 3OKFA 3WLQA 2ONYA 4D9EA 2CW5A 1HL7A 1P5RA 4ZZ2A 3T0GA 4Q5IA 1ETHA 2J5XA 2RHGB 4HDRB 4N8EA 5AK0A 2QW0X 3RIXA 2B5OA 4F2HA 2WUFA 3HWRA 4EY5A 3PCXA 1BYUA 3V1YA 1TZJA 1DKMA 2AQIA 1IEVA 3MJTA 4S2UA 2FPPA 5HW0A 1CF9A 3HUEA 4G1FA 3HFGA 1E1CB 4NK4A 1C4KA 2DECA 4FHEA 4R2XA 2DPMA 5ITWA 4QQRA 1DCMA 4JJIA 4JT2A 1X19A 4B83A 1V2HE 1YDHA 2ZSIA 2E89A 1ISMA 3PEFA 1U9IA 3K73O 1JILA 1HL3A 2V7VA 3IIIA 3N2GB 4M99A 4P92A 4PYRA 2GSDA 3T38A 4EKGA 4ESHA 5JIBA 4JBXA 4QXMA 1YK0A 4ER0A 1CQZA 3P4UA 4O2BA 4U7PB 2HCFA 4EA8A 5KYUA 5MDHA 2E21A 1H8ED 1NV9A 1NXPA 3Q8KA 4QO7A 4DLKA 4PLYA 3DNFA 2ZDGA 1N2SA 2OQRA 1P1BA 4A8JB 3EQ7A 2X77A 2ZZMA 1G8AA 4EG3A 1J9GA 4LF5B 1RPZA 3C8MA 3N70A 4K8OA 2G06A 4XUCA 4HWPA 5H80A 2QX9A 2EQBA 4U7DA 1WW2A 3FPSA 4GWKA 4YAEA 3PUZA 1IG3A 2NZYA 1GA4A 3HDJA 1QF7A 3GLRA 4R6WA 2O07A 2X19A 3ZE9A 3TZHA 5DSTA 2P3LA 2PSHA 3GB9A 4MVJP 4NECA 4DHWA 1LDYA 3DXXA 2FNAA 2IDJA 4XVQA 4DA7A 1TRKA 1NW7A 3LUGA 4F6CA 3AFIA 1ACMA 3AM5A 2FW9A 4J94A 3CEPB 4RY8A 4DV1B 4QODA 4ASUA 1NY6A 2J7KA 3UCEA 2E85A 2QRVA 1Z4NA 4JX8A 4PINA 4X8LA 4IDGA 4TPKA 4DSUA 5KYYB 1GTSA 3ZZTA 1UJNA 4J1NA 3SQXA 1QGOA 4MGIR 1NM5C 4RNCA 5AXBA 4BBPA 1ZW1A 2HWXA 5EKSA 4KYVA 4GXNA 4XRRA 3ZDQA 4F5YA 3S8MA 3KXDA 4QGBA 3CH5A 1GZUA 4M0UA 2D2EA 1G6Q1 2F43B 4YP9A 3JARA 5FJJA 5JT1A 3L8DA 3E7DA 2YW9A 1SBIA 3EK2A 3STWA 5M3BA 1FYEA 2FUG1 4DXHA 3NUQA 4LISA 1DDIA 3P26A 1JDTA 3M6IA 4XWAA 3RGGA 3VRHA 3TPFA 4EY8A 2VNIA 4KCGA 5EOVA 4GECA 3FVVA 4F92B 4MB2A 1UFVA 5M29A 3K1AB 5C8DA 1GSHA 1O9GA 1DBWA 1KBZA 2B8NA 1GYQA 2CFOA 3TNLA 2O8BA 2WJPA 3MT0A 4FFDA 3S2EA 4LGVA 2QZSA 4UHCA 4EJSA 2RKWA 4AZ0B 2DTEA 2B35A 1HFEL 4H7IA 4FBLA 1M83A 3ELWA 3JAWB 4G67A 4XJSA 5DE3A 2CVHA 4DDTA 1W93A 5CD9A 1VE9A 4NDZA 1GUYA 1T0JB 1YDFA 3JD3A 1CPYA 1QFJA 4ANFA 1X13A 3ZDYB 4B7AA 2OR3A 1SMKA 4MIOA 5FR1A 2O8DA 4PY2A 3DZJA 1FNMA 1GFIA 2OO5A 4N39A 5FOSA 4HNUA 5ICMA 1NYLA 4KFUA 4MVWA 1Y6FA 1NV8A 5GIOE 5K6TA 2HA3A 1SN7A 4DQXA 5FBVB 3D2AA 2ZBVA 1YQGA 2GARA 1HI9A 1KRHA 2NV6A 3M6XA 3Q6IA 3TO5A 5FA6A 3EB9A 3GRFA 1E9SA 1TAGA 1GUFA 3AEKA 3KJHA 3LE8A 4B76A 3PNSA 1Y8RB 1KWGA 3C3DA 5EWMA 2XGSA 4DCUA 1AOXA 5D5HA 2XXAB 3SZUA 2YVUA 1PJ2A 2R8PA 4GYWA 4HWGA 2HUPA 3C3EA 3IHTA 3NBXX 4U63A 1B76A 3EQ6A 3AEZA 5WRFA 4II7A 4RPKA 2R6GA 1B23P 2BM8A 1GU7A 2OLKA 1TF5A 1PG0A 4EQZA 5BSHA 2EEZA 2XMBA 5DDIP 4AICA 3DO5A 3WLEA 3EVEA 3VPXA 4C4RA 4AQ7A 1KRWA 3EZ7A 4OPMA 1X86B 2GEUA 2VWPA 2YHSA 1OPXA 4MQFB 2YXDA 1SHTX 1WLSA 1YBHA 2JGEA 4OO3A 3WIBA 1LDEA 1V9LA 2I91A 4WN9A 2OCIA 5IU6A 4BNWA 4RZIA 4Y0NA 2WIKA 4EATA 2GZSA 2E5LB 3V00A 1H9CA 4HNHA 3IVGA 3OJ0A 1Q12A 1OZ0A 1AKMA 3EAFA 1KMNA 4I4CA 5IJWA 3TGLA 3VU3A 2BGIA 3H0KA 1OH5A 1NBMD 4INPA 2HDOA 2VUIB 2WB2A 1CIJA 3DO8A 4WBNA 1Y6QA 3CVOA 4EZIA 3U44A 3A1TA 2X5NA 4WZAB 1G8FA 1X9HA 4E21A 2YXPX 2QM7A 2VWGA 3ZCXA 1C7FA 4KWHA 1SC4A 1FSPA 3C6MA 1NDHA 1MEOA 3WVNA 2RCYA 4JYPA 4PG4A 5MGBA 3N05A 1GTL1 1T0BA 1U0EA 3G79A 3TJRA 3T94A 4IZ6A 2IPOA 2R7MA 3JYQA 3NI2A 3PHLA 4KL8S 4QXOA 1WXDA 4GI3A 3TQFA 4AS2A 1NSFA 3UC9A 2W93A 1EBBA 1H69A 5GVSA 4W7SA 3UK1A 1Y6GA 4MXDA 2SECE 5ADWA 1WHTA 5FNVA 3O1LA 1J8DA 4L5AA 4NH4A 4YT5A 4RPIA 3CV3A 1EXDA 3VC3A 1LPSA 1JFFB 3ZIAD 4BNTA 1DEOA 2HI0A 1O77A 5E0KB 2A9RA 2Z8YA 3AUAA 3PS9A 4PSDA 4CLXA 1MO3A 1VKZA 3A1CA 4IJKA 2JJ2D 4F2DA 4F97A 1K8RA 4DCSA 3O0TA 3AHGA 4UTXA 4XIGS 3OWOA 1LCIA 4CVNA 3EVDA 4CCAA 1QANA 1DIGA 2IU3A 2F9LA 2JIMA 2NT4A 3I8SA 3PNBA 3BA1A 1N0WA 3Q7SA 121PA 1KOLA 4D4MA 4B48A 4LXGA 3WGTA 4MI6A 2R7KA 3VR1A 2XECA 4FE3A 3GJ8A 3FW1A 4XASA 3LH5A 3R0ZA 3FHCB 3NTUA 4OSEA 4YAWA 5FOXA 1KO5A 4R31A 3PTAA 1OBVA 4YXWD 5FTLA 1A5ZA 3OJOA 3PU6A 2AX4A 3FNEA 2A92A 3O7WA 4D7AA 2FPKA 2ZU6A 4KKVA 1VBKA 3FVTA 2OQVA 2YXBA 5F9FA 2ODNA 2W6NA 1NKVA 1PJRA 3S81A 4FX2A 4RF2A 1W8IA 4LZWA 2A9OA 5I7RA 2RH9B 1I3MA 2OFPA 3AF6A 4Q02A 1X8LA 5CG2A 4G09A 1H2FA 5L7YA 4CFYA 3W3AA 4M8SA 2VBGA 2IYAA 9ABPA 4UVDA 3EMBA 5K4AA 4XM2A 5B7NA 1OLXA 4IDAA 3NALA 4QZVA 4KNYA 1X2EA 2B25A 3IH5A 3NH9A 2C7VA 1FRQA 1RMTA 5GY7A 1AGRA 1WMSA 2BEWB 5JMTA 4DR5B 4ZT3A 5T6BA 2PPVA 3BMCA 3LVRE 1AKQA 1V3QE 2CUNA 2HRRA 3QFRA 4I4NA 5CYOA 3KLPX 1RMYA 1YKFA 1BMQA 2JL1A 2I4IA 1P1IA 2JAQA 2JFYA 2XKJE 3C6QA 1MMFB 4HO1X 4S2EA 3WB2A 6CHYA 1YHYA 1HT3A 1MB9A 2XBUA 3JCZA 4IBOA 3L7BA 3SOZA 2YHUA 3H5RA 1FSSA 2DR0A 2B4AA 5KJEA 3X1MA 2FSUA 4C2BA 1FS4A 5AIBA 1KI2A 3B6MA 2CLMB 3ORSA 3KJNA 2IDKA 3CW9A 3QBDA 4ZQGA 2OXRA 3DOHA 4D9HA 1L7MA 1G20B 1JWAB 2B0JA 3PC7A 4QG7A 4C5AA 1Y7PA 1MX9A 2Q3EA 1ELOA 3KPUA 4BFLA 4RSRA 4Y9SA 1NL3A 2GX6A 5BMVB 1ODTC 3HC7A 2BGUA 3HGMA 1U0LA 5KVQA 1L8XA 1VL2A 3WGLA 1W4BA 2YASA 1QLJA 3IUBA 5ALUA 1CNFA 1DUVG 5AXCA 1QGDA 4G0QA 3SICE 3BCSA 3IS3A 3T5MA 3FHOA 4JB3A 2GPAA 4S1WA 3A1SA 3IELA 2ZUWA 3PZRA 2R97A 1WCIA 3M2TA 4QXQA 2GAFA 2YY7A 3Q7PA 1ZOSA 4QECA 2FJUA 3E2IA 4URVR 2OM2A 5CFZA 2VK8A 3TIIA 2PRJA 4BB0A 4TSFA 3FFXA 1C2TA 1HT2E 1R9JA 4KQ2A 5DW3A 2Q27A 4D9KA 4HUQB 5AESA 4R81A 3ANTA 4ZT5A 4RAQA 1GPYA 1RWNA 1T35A 5HFAA 3W9BA 4EPWA 3MJVA 3I1YA 4NFLA 5IBPA 3HNOA 4AP6A 2EJVA 1PLJA 3DEHA 1L9XA 3Q4GA 4PO9A 4HTFA 3U3MA 1U31A 3WI7A 1I14A 2EVWX 3AR3A 4AAYA 1T1SA 3R7BA 3V33A 1DKPA 1FFXB 1TT5A 2VEOA 1HDIA 2D7CA 2IEAA 4D3ZA 3QEAZ 2ZSUA 3E22A 3R3HA 4EFDA 3IEUA 1BCRA 3EPLA 4Z4FA 2Q1SA 3PR1A 4RHCA 3OLWA 1NXQA 3OCXA 3NXSA 4PCAA 3F9RA 5REQA 1QGAA 1FP6A 1BXZA 4MS3A 2A1TS 1VHTA 3PIDA 3QU2A 2WHPB 4UPVA 2VDLB 4DUGD 4FMDB 4ERNA 1DIHA 3TZEA 4YV7A 4A0SA 2F3RA 2XA1A 1TJ4A 3GJZA 3P19A 4M2LA 5A2QA 4KGXA 3NHJA 1PR1A 1SVOA 4PZCA 3VAZA 1RKXA 1SCKA 1ZU4A 2IOHA 1TO1E 1Z0JA 2P9YA 3CY6A 4IIEA 4RCZA 4LXHA 2CFSA 3WR5A 2LUOA 1B00A 2R86A 2ZAGA 1JEQB 3HZHA 1S9HA 1YL6A 3MCUA 1KAOA 5AK5A 3ADCA 3PKIA 4ONEA 5JRZA 1G1MA 1MF7A 1BVRA 1DC8A 1EWKA 2G0TA 3C97A 1I7PA 5E0OA 5J9FA 1EMDA 1O9BA 4I08A 2XBLA 2FPWA 1HO3A 8ABPA 1ZC3A 3TG8A 2ZSKA 4PANA 1OTYA 3OD5A 4IHJB 1HYHA 1RZUA 1VDZA 4J1TA 1CV2A 3GLTA 3KWMA 4RH0A 1YSCA 2IIQA 3F6YA 3HN6A 4EUEA 1MXHA 1RAEA 1UMCB 3OUTA 3THOA 6ABPA 1SBTA 1IN8A 4ZAWA 1IIRA 3A9SA 4HXYA 1PV2A 1A4RA 5CA1A 1TI7A 1JFLA 3AUXA 3PF9A 1TD9A 2HXGA 2WIBA 4BEWA 2WWGA 3D0OA 1KL7A 3QUBA 4FK8A 4PG8A 3EMDA 3SBOA 4BUZA 4C0QC 1J8FA 1JH8A 2IVZA 3EXHB 2BHTA 4EPTA 1BYIA 3DZHA 3GGPA 2O2ZA 4C03A 2CFCA 1C9KA 2OECA 3IXLA 4PM4A 4BNXA 3GVPA 4FMCB 1MDFA 1NPTO 1W25A 2L42A 3JX9A 4NDAA 2HIAA 1Z7YA 3C3YA 1UJMA 3KU4A 3N8NA 2CT8A 4DTIA 3T6KA 4G0UA 4P5PA 5DTMA 3GGCA 2QL6A 1OXBB 2R8RA 4YR7A 5LZ9A 4AWBA 1T2DA 1W6UA 4Y1RA 2RHRA 4XDHA 2HRZA 3TVTA 3PLAE 3V1TC 3CUKA 5HK8A 3N2IA 3QYPA 5EJ7A 3WYAA 3GJXC 5AUPB 4Q3OA 1O89A 3OU2A 2ORIA 1RWMA 3C7KA 5HX7A 5FI5A 3TSCA 1P9WA 2XE8A 4GZMA 1NONA 2G77B 3MUNA 4WCFC 2IS1A 1F2VA 3ND7A 4JD5A 2AJ8A 4DUZB 1K63A 1E2QA 2OV2A 5F21A 3B3FA 4MV7A 1A8PA 4P2BA 2ZRPA 3GLVA 2AOVA 1QK4A 2D2VA 2QUAA 2ZRJA 3NATA 2A1TR 5BYJA 4DOMA 3AXSA 3PTZA 4C7OB 4MYTA 3PDWA 1KZ4A 1Y34E 5AKLA 2WF5A 1A9YA 4ZC8A 3V4ZA 3WGUA 1RWXA 4IGIA 1GKYA 3K9FC 4J0DA 5F3WB 5IC4A 1P5HA 1R12A 3ORQA 3FR7A 2DEUA 1MIHA 1U63A 3HRIA 4FC6A 5CNJA 3VJLA 4PO1A 1Z07A 1WBJB 1AY0A 4B47A 2RIRA 4XM0A 4V0NA 1WF3A 1VRWA 1X1BA 1EK0A 3TDKA 4MVCA 4P81A 4RJJA 5JOQA 3BMOB 3FFBA 1M8JA 2Z95A 2ZP1A 3QG5A 1ESNA 2JI6A 3GRAA 4LRXA 2AJCA 2EZ4A 2OGTA 1ZZGA 4FKMA 4BL5A 4NXMB 1K0UA 1Y80A 2HA0A 3PPYA 4HGOA 4QIHA 5CAEA 1H0SA 2YY5A 1J8MF 3MXTA 4KIGA 5CFPA 2GYWA 3WLMA 4QBHA 1KTIA 2XTAA 3BZWA 3T1QA 1L4KA 1L7DA 2F4VB 1CY0A 3VXKA 1GPLA 2H1VA 4ASUD 2OZVA 2VHWA 4O33A 3CLRD 3SZMA 3KYCB 3VKHA 2JZNA 4LXQA 1D04A 1CUXA 1UQTA 3OM9A 5AVKA 2VJLA 3VQTA 2K87A 1R10A 1WD5A 3B38A 2H54A 1G41A 2PVSA 1XZNA 3LUCA 3NNSA 4KO3S 2L69A 4RKWA 5EQTA 3MQ4A 4PU0A 3R76A 3LT0A 1GOTA 4GVPA 3OY7A 4IXWA 5K0FA 4GC9A 4FC7A 3RIGA 3U7JA 4U9IS 1E6CA 1F3OA 4IIVA 1AO3A 4AJ1A 5K3BA 3HACA 3OPXA 3IOEA 4GIBA 3FYTA 3SK0A 3IVCA 5E7IA 1XQVA 2VUTA 4S1PA 3RFCA 2HJGA 3RC3A 3G17A 3NBYC 4UNRA 3K0SA 2CXNA 1P7YA 3CRNA 2PZJA 1P5ZB 3A9WA 3K2BA 4DDVA 2K6GA 2CV0A 1EK6A 5B2EA 3CN7A 4YTEA 3BSWA 3H4MA 4PFSA 1PR6A 5FLEX 4DTCA 4HEA1 4RXUA 5KEIA 2VH1A 1LF5A 3K9CA 4RIIA 2ZYRA 2X1MA 5JCJA 3MT9A 3MTIA 5H70A 2X76A 2HT1A 2Z58A 2CLEB 4ZPJA 1EFLA 4HI0E 4E2WA 3SDZA 3IXMA 4ZOLF 5DCUA 4AJEA 5A7FA 2HV9A 2MSKA 2V7TA 1T9ZA 1FJ2A 4ESEA 1XQXA 2QVXX 2RSLA 5ALLA 3T1OA 1WEHA 3QXXA 3I4LA 5FPKA 4OFBA 1VCNA 4F5DA 4W4TA 1QP7A 3E8XA 4X7MA 3U17A 5JADA 5JO9A 2HDWA 4GLOA 4LWOA 4CIYA 4UTNA 3ECAA 4BMDA 5E2IA 3RRXA 1N2CE 1GLGA 1N2CA 4POOA 2BSXA 1NASA 4BNJA 1V16B 2BI8A 1E3QA 3OX4A 3AQIA 1R15A 1GEEA 1FLAA 3J7AC 4C0XA 4UTZA 4HAXA 4IIUA 4TZTA 1MN6A 3UXHA 2IZZA 3V1KA 4XLZA 1PIWA 2O0KA 5DV9A 2HCTA 2CSUA 1XHEA 1BW9A 5GVRA 5TEVA 2WQ6A 4XA8A 4AS1A 2XRMA 5NLLA 1ADFA 5IVKA 5G02A 4DBVO 4F46A 3P32A 2A6PA 4WCDA 4AKIA 4OHRA 3ICOA 5IABA 1C4XA 4ZI7F 2JB9A 1SXJB 2Q50A 3LPDA 1W2HA 3LHDA 4HLQB 4JJ6A 4WBXC 2NUTB 4OD0A 4N0PA 3TQHA 2ACEA 4NOLA 4BGIA 4UTVA 4ZJUA 2IPLA 4UM7A 5FAXA 2Q6IA 1JFRA 1KEEB 3DE7X 3JWEA 4JC5A 1QCCA 4EEZA 1VLHA 2PV0A 3DBVO 3DUWA 3NGLA 4S1NA 3UMYA 2F2TA 5FFFA 2FPSA 1LLFA 1Q7BA 3ZHRA 3TB4A 3G0OA 3TZQA 4BX0A 4BBAA 1TU3A 2F3TA 5I8WA 1P0CA 1M6EX 3D3EA 2ZSAA 5EFZA 5LB2A 3PXCX 5BSVA 2JFHA 1VE5A 1MENA 1A2QA 4IRXA 3WK6A 1SUIA 4XYMA 3RVQA 3ZQ6A 4DCVA 5D3MB 3WP0A 5AW0A 1SXHA 3VV2A 5KOJA 2UYQA 1IM8A 4JGIA 2B4QA 1USKA 4BLRA 3UW1A 2WYVA 4C6HA 4MJ7A 1AB5A 3GDOA 1BDMA 3OOWA 2YICA 2WSMA 4JB2A 4WKNA 2ZETA 1PJ3A 1G7TA 1JPNA 1QZ3A 2GD2A 2X7HA 4LIPD 3CTMA 5H5JA 2CUZA 4UU1A 5EP2A 2BLNA 2H1RA 1AV6A 2HO5A 1VJ1A 3PFHA 4FGKA 5ALZA 1RRMA 2YQZA 3JTMA 3AONB 3I3SR 3KSAC 4QDKA 3AY0A 1G38A 3B52X 3ZWXA 3GLFE 1IVNA 3GLFA 3FJ1A 2BGWA 2W8ZA 1BROA 4MROA 3T9BA 4BLPA 4WN3A 2H8KA 5K4HA 2VJPA 2JH8A 5CVVA 1IWOA 3I04M 1YMUA 4YRZA 1PX2A 2JVKA 1GZ7A 1RQLA 2PR2A 2JLRA 3PKJA 2Q29A 2H18A 1LI7A 2XA9A 2YWCA 2NMVA 1W4ZA 2H48A 2VYFA 4YP1A 4X62B 4RZHA 4QWMA 5B64A 3CVJA 4C29A 5DGCA 1BSVA 2IP2A 1TMGE 3HWX1 3K2QA 3PHIA 4RK4A 4LRQA 3QUQA 4NX2A 3NC0C 1U7TA 1PWEA 1NGSA 2Y71A 1P19A 2QMEA 2AI2A 3SLRA 3SJ7A 3M3DA 3GJTA 4Z7JA 2O1SA 2XDQB 5HM8A 5HOQA 5AWFC 1KDVA 2RARA 5HUHA 3SNKA 3HJFA 5BVHA 3V9AA 1A76A 1T4GA 2G71A 4O4HB 4OI4A 5EPEA 3E1SA 4RAOA 4MYUA 2YOGA 2DKOA 1QHEA 3W3AD 1GCGA 4Q19A 4DR4B 1IHDA 3FVRA 4E09A 4MJ3A 3NTRA 4YY3B 4DVJA 1TCAA 4DMFA 3SVTA 2PKQP 4QGAA 2CD9A 1S1CA 1VA4A 3O38A 4I55A 4JB0A 4WXEA 4YPVA 1V0JA 2PGNA 3L7DA 4IO0A 4WEQA 1Q2XA 2XUIA 3H65A 4IHKA 2BFCA 3GZJA 4UD6A 3U5ZB 3L7JA 2B37A 4QTZA 4UCXA 3N5CA 3PRKE 3I2JA 3JD2A 2XVAA 3QPBA 3ZVRA 1OB5A 2CNKA 4G8BA 3KR2A 2B99A 2X1HA 4KPFC 4EOGA 2O2CA 4IZHA 4MPTA 1Y42X 4YUAA 1EEHA 1W36C 3VPBA 2PVCA 3IHKA 4QRHA 4GQBA 4JJKA 4MW9A 3GQVA 3QU5A 5IWAB 3D0RA 1T91A 3NANA 2H29A 4QT0A 2H65A 2I03A 4Q48A 4BEBA 3H17A 1YK1A 1YR7A 3DDWA 2NSDA 3QZUA 2FN4A 4EELA 4H7FA 6LDHA 1GAXA 1CVLA 5CCXA 1VC2A 1IXYA 3NIGB 1VXOA 3WRVA 2W71A 3LKZA 1BWQA 1JVBA 3GEMA 4Z2AA 4YV1A 1SAYA 1X38A 4PHGA 5EMJA 5TJHA 1DTWA 1J5EB 1G8SA 4MW0A 1ZAYA 4JCOA 1AUPA 2Z5FA 4CI0B 4RABA 1K5DA 4Q6WA 3E3MA 3ZY5A 1X1DA 1KMIY 1NBIA 1T8PA 4FE7A 1TTHA 4MLPA 5EEHA 4D41A 4DT1A 1TIPA 4TSFD 4WD3A 5DGTA 4D80A 1T4CB 4K3UA 4NXNB 3KZKA 4LHEA 2YJ3A 4P3KA 4NCNA 2YIMA 4BWYA 2BGNA 2KI5A 1PR4A 2DHCA 3C87A 2QENA 4I50B 3N58A 1LDMA 1FNSA 1O1YA 5BWOA 1ZR2A 1RRPA 3VAYA 2DKFA 3GYGA 2M98A 4KDRA 2WY2D 3WRWA 1AA9A 1FW6A 1DL5A 5EEGA 2AOWA 2XUOA 3GT0A 3EGIA 4M36A 2NUAB 3R4CA 3W6NA 4DZZA 4F2WA 2AXQA 4K8RB 5GGYA 2HK6A 1ZCFA 3GDFA 3MRSA 3PGXA 1MOPA 3CNQS 3PC4A 1XQ1A 2BFFB 2ZANA 2WNHA 2BZGA 2GKGA 4XD7A 1U8AA 1BO6A 1KXJA 3EGDA 3WB9A 5G1OA 5BW4A 4QNMA 4MJXA 3SC6A 2QAGA 3I5XA 2QVGA 1KYYA 3MYYA 1GAEO 2AZMA 3DHWC 2QMUA 3IDOA 1P1HA 4FBGA 4P82A 4LE1A 3VKUA 4YALA 2PMKA 5U4XA 3BREA 3U80A 1XZCA 3LX6A 5DP1A 1K8XB 2LD4A 4U7TB 2R8EA 1KF0A 3CLRC 1P2BA 3OPVA 1JKJB 2E49A 3BB1A 2GCGA 1GUBA 1COZA 1ND6A 1Q1ZA 3TQTA 3R8FA 3P2JA 1VB3A 5EFOA 3CMMA 1HYQA 3IQZA 3FJYA 2X2OA 4JWTA 2DG2A 2IP1A 4DMUB 2DR3A 3DEJA 4BB6A 3F5MA 1C1DA 1UFQA 4PGGA 3TI9A 2IXGA 1K9VF 5C8YF 4ZIRB 4PICA 4EWLA 5EWLA 5J63A 3QX7A 2WF9A 3AUFA 4KO1S 3HJRA 2EKQA 1QDEA 2Z6VA 3DE3X 2O8VA 2X9QA 4AJKA 3WK9A 2LR0A 2D5BA 1NWCA 1UWLA 2DU8A 4JGBA 5JSYA 2CSXA 1BXRA 2CDCA 3E1KA 3PX2A 4I4TF 4P7BA 2JFWA 3ABOB 5DULA 1I10A 3ML1A 4B33A 4GOND 2GVDC 4L5IA 4L8LA 4MVXA 4EJSC 3KZ1E 1L3CA 3H4VA 3L18A 3GOQA 1E7WA 1O4WA 1FC0A 1YB5A 4I4LA 5FQOA 5GJVC 3B5JA 5DNEA 1CHNA 2G83A 3CINA 1M34B 3OPYB 3B1YA 4YLEA 4OQLA 1C30A 1LGYA 4UARA 1EQ2A 1Z13A 2GM9A 5HOEA 4L8WB 1GAWA 3CH6A 2DUJA 3EWAA 2A30A 5CW1A 4Q7JB 2CE2X 4TMZA 5IAGA 3RADC 1E6WA 1UDBA 4LY0A 1BGWA 2D59A 1RC8A 4WAUA 2Y0CA 3FKJA 1OFVA 4NJMB 4WV3A 3K0EA 2OCKA 3LYLA 3WHKA 3PVSA 1T9CA 5JJKA 5TVGA 2W6QA 1CULC 3FPAA 4FFBB 1I51A 2FR8A 2VDUE 3NHLA 1M1NB 4GP7A 3ZQJA 2R5FA 4BNHA 4E31A 4OLAA 4YAGA 1KO4A 1VYHA 3QIAA 2VAMA 2H1OA 3DBHB 2PD6A 1P7PA 2ZJ2A 4HPWA 3AP1A 2ZRMA 3KEQA 1NVWQ 2YV5A 3RVKA 3N0XA 3AY3A 1FZQA 1N2BA 3MINB 4TSRA 4JQYA 3IDAA 1RM3A 3CO5A 4BFVA 5I7VA 2WM2A 4IIJB 4PC7A 1Q19A 3V97A 1U1CA 1YASA 2PMDA 4BGVA 3WTCA 1YUMA 1C8LA 5EZYA 2PGOA 3KR0A 5BYBA 5U4QA 1EFCA 2XT0A 1MAAA 3SX4A 1PQWA 4M9RA 4TKLA 2ZATA 1XNHA 3JQGA 4JOBA 4F1JA 2GTPA 1G9XA 1Q17A 1XEXA 3KTAB 1KAHA 3JRNA 3MNFA 4FHGA 4A6PA 1MAWA 2J9FB 2NZXA 3HO6A 2Q1XA 3C3WA 1XMXA 4EO4A 7GPBA 2JDIA 3AX6A 1K2VN 1XXHE 1XXHA 1NJ6A 1P4HA 4R0NA 2JFQA 2ANBA 3P2OA 1KHHA 2VT2A 4QAJA 2B82A 3DULA 3ST7A 1LU9A 3RAEC 3TM5A 1XDWA 4H7PA 1SR8A 3E9RA 3IIKA 4ADSG 1JN0A 1KOJA 1RZ3A 1QGUB 3GFVA 4UOZA 1CDZA 4QFBA 4W5WA 2QTCA 2MWMA 3L92A 2DFLA 4Y2PA 3KOUA 4BIMA 4CN9A 5F9HA 1ODKA 1NX9A 3OFVA 4I4TA 5IXSA 1QNLA 1HKHA 2XSZA 1ORRA 3K0FA 3O47A 2N9UA 3NB0A 3QYAA 1ZVMA 1KEVA 3PZBA 2IKQA 1N75A 2P9EA 1W59A 2QVLA 3HFSA 2KX7A 4C30A 1QZTA 3AI7A 1CDDA 1RQNA 4HSEA 5G41A 3NJ8A 5B36A 1CUUA 3LECA 5D87A 5EVCA 4BDTA 5FH9A 3VNRA 3D8RA 4QNNA 1KSJA 1L5NA 1UZMA 2JCSA 1N5RA 2MYUA 2NU6A 2QRPA 2JCBA 4M0MA 5F64A 4DQ0A 3LNCA 3MMPA 4D9IA 1O9HA 3O9VA 4PGFA 3MWDB 4YMSA 1GWNA 2NTNA 3V4FA 4DMKA 1Q0HA 3IEPA 1VJDA 1K92A 4TN1A 4E88A 3C7TA 3IALA 4EUSA 5J3JA 4J2OA 3ENNA 1TU4A 3OZIA 3SSAA 3WFJA 1CP2A 1E5LA 3NAMA 4R9VA 4WLFA 1TVMA 1UAYA 3QJYA 1TYDE 4PZDA 1J09A 4IRUB 3ZU3A 2H31A 2QYHA 2PGDA 1M8GA 4M7PA 4BO4A 3ROTA 3R44A 3F7MA 3UKOA 3TB6A 2QSUA 4TV8B 3PFBA 3CLKA 2Q8NA 4MYHA 3VPCA 3DT6A 3G9XA 4YMWA 5JCJD 1RIFA 2B1IA 2P5SA 1KZ6A 4IM7A 5C7YA 1KY4A 1ZVKA 2R79A 2VHJA 1V8DA 2WWXA 2YYZA 3F96A 3IQDB 3O31A 1D9XA 3I53A 3H9UA 2YFYA 3ESRA 2YXEA 4NBRA 4E5YA 2IS2A 1SVKA 2SNIE 2EIHA 1G64A 2PJRA 1ZNXA 5BN3A 2YW2A 3L8CA 1ZCZA 1J49A 3WZLA 4GSLA 1QF9A 1Z26A 1U0BB 1HMPA 2YZ2A 4E15A 4IQFA 3K31A 3W4JA 1XL0A 1RRKA 1ZNZA 2JG3A 5CJ2A 1PL7A 5EQDA 4DIKA 1LH0A 1YIAA 3ZI0A 1W30A 2CXTA 4D9JA 6Q21A 3W34A 5HQ3B 5JHHB 1MU0A 3P45A 3NMUF 1T36A 3OZGA 2I6QA 2QJOA 4YRDA 3S55A 3LT2A 4RDHA 4F71A 3JQPA 2ZULA 4WPGA 4XZ3A 1T8WA 5AOVA 3TMKA 5TMEA 4HNGA 5GQSA 4IYJA 1VSTA 5HKAA 1GNLA 2H3HA 5KWIA 1V48A 1UP4A 3MPOA 3IIMA 2EX4A 2IV7A 4JROA 1ZOPA 1MGOA 2EZTA 3BWYA 5F77A 1CUJA 2BMVA 3MD9A 4F93B 5KNBH 3UC5A 3U16A 1N7GA 3GK3A 1RHRA 3A2LA 1JIQA 1G5RA 3QPUA 2E4YA 1FYFA 2RB4A 2ONJA 4NMWA 1UK7A 1OTXA 2G5CA 3K8QA 2Q3MA 4FXOA 4G8CA 2VSYA 3WGMA 2YYSA 3FPGA 1CZUA 4Y7DA 3ZGYA 5JJLA 4XX0A 3ZHZA 1U99A 3T15A 2R2GA 1ESCA 2NTYC 5FLYA 3TE7A 1E98A 1C0PA 5ALFA 1ZFNA 3R7NA 4AF6A 1JE0A 2PS0A 5F33A 4AXBA 2P3OA 4PHTA 5EI5A 3W2TA 3AVTA 3M3PA 2O0HA 3R5FA 3JWIA 1W34A 1P7ZA 3ZE2B 3ZBQA 2P27A 2PZAA 5JRDS 1A8IA 3DDHA 2E6UX 1AU9A 3BB3A 3HMKA 3PPWA 3M1LA 5C31A 3OFKA 4KX5A 4BX3A 2BL4A 1YZVA 4UZEA 3O1HB 4XFDA 2P9GA 1GGMA 2F3UA 3OF5A 4GKBA 1BRTA 4R8MA 5ALOA 2D5LA 2VH2A 5LZ4A 4ND1A 3ZGVA 2X4LA 2PLWA 3LLCA 2BDUA 5TNXA 4JXJA 3O4JA 2CF6A 1X42A 2ZAYA 1UANA 5BQFA 4ZTUB 2J85A 3EJWA 4KLCA 2NU8A 3LP8A 2IOQA 4WASA 2BFNA 1Z5NA 4OKNA 1ZD8A 3DAFA 4UOEA 2PN1A 5H1YA 3EGOA 1KYZA 1DAHA 4C4SA 4EJ0A 2EHDA 3USCS 1QHSA 1EXMA 1P91A 3W5CA 3TLMA 5TGDA 4HTAA 1NRJB 1PJ4A 4KBGA 3L6EA 3DLPX 3THYB 1A9ZA 1HTBA 1LDNA 1LBQA 2OE2A 4W5HA 3Q2IA 2JIDA 4M1SA 2QE6A 4YJFA 4D9NA 3RDPA 3BORA 1G8GA 1ZITA 4KU4A 2FKNA 1C7ZA 3WO0A 3RUHA 2W6IA 5C8VA 2WAMA 1FFGA 1KYWA 4GPTA 1HE5A 3EWNA 3MTGA 1G7RA 3REGA 3SLGA 1H9AA 1SC6A 1X8JA 2ZTMA 1RPAA 3JAMA 2ZJOA 3LIIA 4FTWA 4G4SP 4XJVA 5HKKA 2WSSA 3VDRA 4J1TC 3I1IA 4A82A 3EZGA 1FFDA 4X20A 4HZGA 4B3TB 2INGX 1HRKA 4CQLB 1FVHA 1XTQA 2MMCA 3H9QA 4I46A 5C46F 3O7MA 4ILEA 2PD4A 4U6SA 2QSJA 4Y2VA 1UDRA 4JXXA 3KT3A 4CL0A 5IDYA 1W96A 4ITVA 5DHUA 4RA9B 4NOMA 1T5TA 2P0EA 4NV3A 5HTOA 4TWRA 5AVOA 3DWGA 2HNKA 3OQ6A 1M5RA 2EJCA 2I4TA 3SHTA 1RI5A 3GJ0A 3A9VA 1O96A 3BFPA 4EDHA 2RKOA 3VKFA 5DBOA 1CFZA 1YGPA 1EG7A 4PYLA 2JVJA 2LIPA 5EIBC 4RTLA 2OK8A 2XYQA 2ZFUA 4TXJA 4TZKA 4XSVA 3E1GA 5IH7A 2C99A 4XWWA 2X23A 3ZU2A 5EJEA 2PKWA 3KV3O 2BM1A 4OJKA 3G2MA 3HYCA 1TF7A 3MUEA 4ND3A 1L5VA 8AT1A 4G41A 5E6UB 1EE1A 1JIKA 1T3TA 3IV6A 4IRMA 4CLHA 2AOXA 4PZ9A 5AXDA 3E0QA 4JLVA 3D59A 3I0NA 4UM5A 5DGHA 2O2IA 5AP9A 4UFPA 2GR9A 2IRWA 3LPLA 5B7PA 4IH1A 3H11B 4JBWA 1N6NA 4DUYB 3KOYA 5FHRA 1JVNA 2EL9A 1ENZA 1QRRA 3R3JA 3L8HA 4JS0A 3MGGA 5JXGA 2AT1A 1ONOA 1CUEA 3K09A 5IS2A 1AURA 3HV2A 4AKTA 5BUZA 1CNMA 2QQGA 2QK4A 4K40A 3IOCA 4TVOA 3AFGA 2NZ2A 3RRNA 2QTWB 3NKVA 4URZR 2VTKA 1HBJA 5EXEA 1QKKA 1KPIA 2HA4A 1QCYA 1N0HA 2CJXA 2PSEA 2V96A 3MMZA 4UMVA 1E20A 1GDDA 2HHAA 2VF2A 4IQ0A 3EUEA 4BQIA 1YB6A 2ZBDA 4DIFA 4ZJZA 1IQPA 2QU7A 1TM3E 1G0OA 3NRBA 4UZSA 3UK6A 1MX1A 4X8HA 5FPTA 5JFGA 1Z3IX 1ZRNA 3DZFA 1COWA 2A86A 1R7RA 4FZJA 4XD7D 3KVRA 4FB5A 4C7KA 4ECAA 5AK6A 2PWZA 2QUJA 2UVPA 1XDZA 2Y0PA 4GI1A 4AJIA 5K4GA 2PRKA 1F1BA 1VIVA 1GPBA 1MO5A 3ZJ5A 1QBKC 3NBKA 4MS1B 3TR5A 5BT8A 2PXCA 1HSOA 4QEDA 2XDAA 3C4QA 3RB8A 4NHOA 2RH8A 1R6XA 1KE1A 3TXYA 7REQA 3KQQA 2ZYSA 1NN0A 3KFLA 2B7BA 1DX4A 4L3VA 2ZCJA 2VP2A 5J4LA 1W2WB 4FW8A 4YAUA 3WDMA 5DHSA 1VL6A 5K8CA 1OFUX 2ERCA 2QMZA 1T8RA 1X7YA 4M9SA 3LGAA 1QTQA 2GSWA 4U7HA 3NIFB 3T3HA 1M54A 4QYWA 4E22A 5CEJA 3ZOZA 4NY1A 4I6GA 2ACVA 4Z1MA 3UH1A 4LE0A 1USIA 3SM3A 2GGSA 3E15A 1ONBA 2HKIA 4JSRA 1KHTA 2IWRA 2EKZA 5MFZA 1E8DA 1Y6JA 3TEFA 1E96A 1EK1A 5ALEA 4Q7EA 4QXRA 5E6SB 1QG6A 3SSOA 4TVSA 3VR3A 1Z35A 4LGYA 3OURA 5E9WA 4Y2XA 1YZKA 1GA6A 1MG5A 4QLAA 1I2BA 2XOEA 4YMIA 4YDRA 5K9ZA 1PTKA 2XUHA 1N57A 2PKQO 2V7PA 1EFVA 2R1VB 3PDCA 4TGLA 2JJQA 2C3YA 5LOVB 3DP7A 2OYSA 4A91A 1K6EA 3SXPA 3FE2A 3PRHA 2AXPA 3GC6A 5FADA 5FP0A 1CS0A 1EX1A 1YUBA 3GMTA 3DOJA 5FIUA 3VR4H 1QE3A 3AFOA 3JZDA 2HXSA 3ES9A 4GDMA 3RSOA 4OBBA 2O3TA 3RRBA 1JHOA 3CUSA 4TV9B 4QYIA 2B20A 1DDGA 1H2AS 1JYEA 4RD4A 3AO0B 4GOXA 1G42A 3BEDA 2V0CA 3ZYZA 2WE8A 5EKTA 3RS0A 4ZO6A 1WF6A 2DBQA 5FUYA 4NICA 5IZ4A 3IP3A 2BE9A 2NWQA 3SG0A 5BN4A 3IT0A 2QI9C 3D6FA 4KODA 2D0DA 1QG4A 3FDZB 3FNFA 4ND7A 3W06A 3QPVA 3FTFA 1KJIA 5LWQA 1G16A 4BZWA 3QVOA 1ZQ9A 3QFCA 4HEQA 3I37X 3AJDA 1G0NA 1N4DA 4HLCA 4PYIA 5THXA 3TW0A 5PNTA 1IWPB 2XZLA 5KQPA 2PKXA 3RNLA 2EFCB 5CB4A 2CBZA 2XLBA 3LBFA 3THWA 4H7JA 1Z6PA 5EXXA 1XU7A 2P7HA 1ABEA 5CVUA 1YKSA 3NNDA 5TQJA 1BHQ1 4B81A 1SRRA 2VHEA 721PA 5LUAA 1AZTA 2AOTA 3PL5A 2PKYX 5KYVA 2GLUA 4R3UC 2AKEA 1KDTA 2A1UB 3G2IA 1TX4B 4KWCA 1NT4A 1VP3A 1P74A 2ZE5A 2VPWA 4QQKA 1G6HA 1J2TA 3S40A 3AI3A 4KN8A 2IKSA 1E66A 4P36A 2VT6A 4Y9DA 5JS8A 3LUHA 1UBJS 3PQ3A 3UMGA 1IL0A 4JYCA 1H6BA 2DPLA 8GPBA 5IVHA 1B0AA 1RBZA 2NW6A 3HJBA 2JDID 4XQEA 3U3RA 4HGZA 4JLWA 4O1IA 3DWFA 4V0KA 3QOYA 1V11A 2UZ1B 2GMWA 2OV8A 1GXSB 1GFWA 4D0GA 2AJLI 4KACA 1W73A 5BV8A 2CXRA 1QE0A 4B6RA 2JAHA 3WZMA 3KKZA 1FP4A 3BXHA 5LXTB 2X0FA 2PFSA 3KWFA 1O54A 4R05A 3D7RA 2FEWB 3I39X 4NZZA 1U1EA 3C3BA 5AM2A 3UKDA 1WABA 2I2WA 1TK3A 2XSZD 2FFHA 3OTWA 3R9XA 3QELA 1AB6A 3AERA 4MITA 5EAIA 1NI4A 3S2IA 1JQDA 4B7ZA 2IIBA 3LKVA 2CDRA 3L8MA 2GXAA 2ZRAA 1KI9A 4G9BA 3H7IA 4PF1A 1GARA 3RVLA 5CDUA 2ZIUB 4P35A 4X24A 2COEA 4YAOA 5TT0A 2QM0A 2C94A 5BQXA 4XH9B 2A67A 3EIOA 1NYTA 2QMHA 2VDVE 3NV9A 5CH5A 5ALGA 3DS8A 2F3SA 3JVDA 1EUDB 4TROA 3BQMB 4WY8A 3ZCTA 5KTNA 3EG9B 4OMDA 1TMYA 3PDJA 5FL3A 5ICFA 1RXWA 3S68A 4P08A 2AD1A 3OLYA 3GA5A 3PNLA 1KO1A 1LWOA 2H1HA 4LJ5A 4M1EA 2AKYA 2P3QA 1FTGA 3HS3A 1QYWA 1I2ZA 3F90A 3GUHA 1YS1X 1ZY2A 3HFJA 4KNWA 4WK2B 1CJBA 1D7AA 3IFSA 2ODEA 2EKLA 2NP7A 3ZPXA 2B7CA 4OIFA 1UPBA 2J07A 1A82A 3KZCA 2ARKA 4UXIA 1XN1A 3GAAA 4ZDKA 3IX7A 3NIBA 3K6SB 1Z2AA 4N5LA 4DLAA 4NOJA 2GJ4A 2EP5A 3O8OB 2BLLA 3QYJA 4Q66C 2C2BA 3TRFA 2DWPA 3VO1A 2Z56A 1QFXA 3B36A 3ELDA 3QI7A 3QE0A 2HW8A 1FDSA 1NF8A 2C5LA 2EQ5A 1Y4ZA 4LJLA 2HRDA 1Z37A 4PONA 1W4LA 2PGLA 4KMOA 4AWAA 3FNQA 1RYMA 2X15A 2FW8A 4WEOA 3O83A 4KXVA 3OZTA 1P4SA 2BELA 1UBNA 2C1ZA 3U40A 3CRW1 1OX4B 4ZMRA 4EVRA 4AUEA 2FN8A 5BQOA 3VHLB 3QLJA 3GP8A 2ZQ5A 3Q87B 2HU7A 1NG1A 2BMEA 4RACA 3CUYA 1ARZA 4HPJB 4RYLA 3NYIA 1WW3A 2PEYA 3AGQA 2YOFA 4XSHA 4XQCA 1TZCA 2PZFA 3ZCUA 1FYDA 3PEWA 2QB5A 2AA3A 2C2HA 1VFPA 2DLDA 2OK7A 2ERXA 5H4HA 4ZKDA 4RF5A 3OLQA 4A15A 3E9ZA 4DC9A 1BH2A 4G0NA 1QOQB 4AG6A 1U8CB 3PIRA 4IL5A 3ZDBA 2IEGA 3OKAA 5FI0B 3LYUA 5EPOA 5AVWA 1RYZA 1TYCA 2WK1A 1NW3A 3WRXC 2NM0A 2XWQA 4QFMA 1PT6A 3LIPA 2D5AA 1RJEA 1N7JA 4EW3A 1C9MA 2BJHA 1B0ZA 3L04A 4D0NA 3OEHA 3MGBA 5G4KA 3WXMA 1KGDA 3ERCA 1TD1A 3GRVA 5DGIA 1O6ZA 1Z18A 3SYRA 4F1KA 3GRZA 2O05A 5EIFA 1UOPA 3PVCA 1V3TA 1ZCAA 5D2CA 5G2OA 2UVQA 3A0RB 4FFPA 4UQLA 1VG8A 2R96A 1MEJA 4Q1VA 1Y5NA 3CR8A 3EZLA 4ND8A 3EXFB 2MU1A 1M7HA 1MB4A 1O6CA 5AUQA 4EITA 5AUOB 3VI3B 1LB1B 1U1FA 4JT9A 5B3LA 4I19A 1A04A 3HLTA 1PR2A 2H07A 16PKA 2GBGA 5MN6A 1XYYA 3JTEA 3TR6A 4LDAA 3V9PA 3E4CA 5E7JA 1XNQB 3AJ9A 4GZ3A 2ZCUA 2ZU0C 4B3HA 3HEAA 1X80B 1LJ8A 1DG3A 5BWLA 2ZJ3A 4JBYA 3Q9UA 1RLUA 1XTVA 2NPIA 1Y0BA 2QRJA 3ZDEA 4HN9A 2J87A 3UCFA 2PD3A 1V7QA 3KOXA 2XE4A 2CVPA 4CRWB 2HJRA 3KUXA 4DLYA 3KHTA 1G8KA 2O5EA 1ZMTA 1XAHA 4N3AA 4X85A 4XVRA 1EDBA 5CTJA 1ZWLA 4NP6A 3I4CA 2GDJA 3IKJA 2P6PA 4PPYA 1F4LA 4JLAA 2QAGC 4QPJC 2AGVA 3AEUA 5EMKA 4PQYA 1X9GA 3BXPA 2IXFA 5A5DA 3KKNA 3DL0A 5HJ5A 5M7EA 2OHXA 2VNHA 2PU5A 2J5RA 2W98A 3JATA 2CCKA 4C5BA 2OLEA 5LC1A 3AUTA 3EZ9A 2WP8J 2IU0A 4HQNA 4C2AA 5D7NA 5HZMA 4MZXA 5JO0A 4BZPA 2LRHA 1Z62A 3EIEA 1Y89A 3QF7A 1ZUIA 4YMTA 4E4YA 5DBGA 2HMAA 1GFZA 2OBMA 2Y1DA 3AWDA 5AW9A 5LBIA 3M9XA 3LQ4A 2B7LA 5TVKA 5B58C 4XI9A 2HCJB 2AG5A 2VA9A 4RELA 3FZYA 4X93A 2ASVA 4Z7OB 4P93A 1T0HB 3DDUA 2CL0X 1KMHB 2XNKA 2W6ID 4HCJA 1N9KA 3D2LA 1TJ5A 4JHXA 1C9YA 4YJ3A 1EFKA 2WHRA 5JDCC 3AT1A 2GHTA 2OENG 3HCCA 4RIHA 1VLVA 2H1CA 2JI4A 1BWSA 2WSSD 3RYHB 5HKKD 3TZLA 5HWSA 4OP1A 1CQXA 3AHEA 4QE3A 2AFHB 1FVXA 2QPOA 2QSZA 2F8SA 4REOA 4AQDA 1LPAB 5DLPA 3L1UA 3MUOA 1XTUA 2Y8EA 2FX5A 3HDQA 1KSGA 1DIBA 4CDMA 2VSFA 1YZLA 4YB8A 3EAQA 1XZ8A 1RAFA 1U7OA 4F7DA 3EA5A 3CLVA 3K72B 2X5XA 3JALB 4CDNA 5GJBA 5KNDA 1UMDB 2BZ1A 3NYRA 1HQKA 4HFRA 5KYXB 1Q0UA 2IL1A 1R9MA 3QPDA 4DN6A 1IG0A 4B3FX 2P4QA 4CQMA 1J00A 1XPOA 1FMFA 2BMJA 3SJBA 5DTQA 3TFWA 4OA8A 3ZTTA 5HUQA 1HZZA 1X87A 3DDNA 2OKCA 1TQDA 1QR2A 1ZVQA 2XGGA 4RIGA 5C8ZA 4XVCA 4TVBA 3RK0A 3FD8A 4UQOA 4PZLA 1D07A 1WKBA 2Y1LA 4NCHA 1V5WA 2NSYA 4DSOA 2EXXA 2FR8C 2VS1A 2XMGA 1CKEA 3R1IA 1GPUA 4IJMA 4U3JA 3TLGA 2AYYA 1W88B 5IHXA 1GPMA 5DH9A 3RREA 4BKPA 3L7CA 2DHRA 2FG5A 3DTTA 3RPEA 4F2PA 4B4UA 3GLIB 1J1IA 2IP4A 2WM8A 3CR3C 3F98A 3AHDA 3G23A 3ZH9B 4F6RA 1QIIA 1YBFA 5D3ZA 1D4AA 3MS4A 4LEIA 1I4TD 3JYNA 5IZCC 2CJWB 1MV5A 4Y0VA 4IFTA 4LNUA 3U7IA 2XXJA 3C7AA 4HYQA 4AUMA 4CDRA 3K8OE 1HWYA 1SK8A 2JLVA 2DFNA 1C8VB 1U7PA 2CNBA 4FSXA 5F7JA 1WXEA 3CSDA 2Q2VA 4JJ8A 3D8HA 4OVKA 1M2HA 4LSMA 1TJ3A 2MSNA 2PGJA 3MJSA 3G1UA 3UBMA 4X71A 3WJ2A 4P86A 3FOEC 4F8JA 4A2QA 1G7SA 1LWNA 1JEYA 3QEKA 4DARA 3I2FA 4DCPA 5ES3A 4C3UA 5LR6A 3S8EA 1SG6A 4FJ1A 2Q9UA 4V1CA 2C0PA 2H5EA 1I6MA 1RAGA 3QW4B 4D4JA 3U1TA 1J5XA 4ZQHA 2EDCA 1I5OA 1RKVA 1QV9A 2WZQA 4O08A 4PZYA 1COWD 3WK4A 3ZW7A 1FDVA 2Q6OA 3EVBA 3VSEA 2HWWA 1M9NA 1POXA 5BMVF 3W8EA 3OZAA 4BV8A 2WTBA 3MEQA 4R1SA 4DCMA 1LX7A 2CZQA 2HU2A 2I2XB 4LXUA 1NG9A 1OIWA 3EDCA 2JIBA 4R54A 1K4MA 5C51B 2PDAA 4TKUA 3NBZC 5AVUA 2CYCA 3UAOA 4I99A 2IE0A 2QY6A 4ZVVA 3TD6A 1HEIA 5HMLA 5LA6B 2QQ0A 2X6QA 4UM8B 4UU0A 1J2YA 3ZY6A 1OPRA 3ZCRA 4E2FA 1SKBA 1TJPB 1YVEI 2P9ZA 1SCDA 2VF5X 2C2KA 2ZT5A 1HMYA 1SXGA 2IYXA 1CK4A 1N2GA 2OEPA 1BEZA 1L3BA 3IO3A 1U3WA 4BWFB 2GERA 2QYTA 4J8PA 4M83A 1E2EA 3PJFA 1T1EA 3A9UA 4HLNA 4G1UC 1MOSA 4IJQA 4O1HA 2KE5A 4L75A 3V4LA 1S4QA 3WGQA 2Z0MA 2OCBA 1VKHA 3JV7A 4B17A 1VYUA 4DEXA 4DYVA 1OVGA 3FNRA 1ZIDA 1W7AA 4H16A 2XYVA 3VAAA 4Z1MD 2HCBA 2XYHA 5KTRA 3T3PB 2ZPUA 3M81A 4K1LA 1SEPA 3V2UA 3QX9A 4N4AA 2I2FA 5FTJA 3I0MA 1KDPA 3CHYA 3GNLA 2O20A 3LLUA 2Q7XA 1E1NA 1XGKA 2QGNA 4INOA 3N39C 4GT1A 3U4IA 3VR3D 2HTEA 4KV9A 3G88A 4BYGA 1R00A 1GKIA 3TIFA 2G6BA 4P54A 2W22A 1FX0B 1HYBA 3TJMA 3BD7A 1H8HA 5JY6A 3JXEA 5ARBA 3LG2A 4PR3A 3ZWOA 5SZKB 3VSAA 5IAAA 3LRPA 3O8CA 4FMDF 4KIJA 3MIIA 1TM5E 1JDBC 2A7QA 2EW2A 4FHDA 3ND9A 4MIKA 1Y98A 1IZ7A 1IHPA 4DJFC 3NCTA 3CGWA 1XYGA 1FDUA 3FXAA 2DCUA 5DM60 2NYVA 1Q3KA 2C20A 3OQ1A 3T5PA 4HZUB 2Q5HA 4XVHA 4TKZA 2FPUA 3NVDA 4QU0A 3ZWWA 1FJHA 1QFSA 2WWTA 4WJLA 2H3EA 4GXRA 4A16A 1E0KA 1N6KA 1KWKA 1X77A 3MW8A 4QLOA 5LUBA 4LYAA 5AOCA 3PUKA 3OU6A 2EKBA 2H4JA 5DTRA 4MQ6A 4KRFA 2O7NA 5KWVA 5F23A 3K6KA 1S2MA 1QAQA 1W4RA 2W7TA 3AJAA 3K16A 4IHJF 2A84A 2GDZA 4O2AB 1MPXA 2A5DA 2JHPA 2A0UA 4F38A 5L53A 1AUXA 2YRFA 5A9SB 4YP0A 4B4VA 1HNZB 5IEJA 3A6FA 1V45E 1CJTC 2OD9A 2W43A 3EGXA 4R98A 3LI2A 1KK2A 3VR2A 3WV5A 3QXGA 1CF4A 3RVSA 5A3QA 3EEYA 2IU6A 1OXMA 2NYRA 3L5KA 3FROA 2NG1A 3EIXA 3G59A 3K9QO 1A27A 2IXTA 1A5AB 1I7QB 2IHVA 1WA5A 3KT8A 1PX0A 1QVAA 1OC4A 2WR8A 1ZXBA 1WUKS 4NBVA 2DBZA 4RA6A 4YP6A 3RS3A 2RC5A 4BHTA 5LWHA 3FF1A 2CHEA 2X3YA 4LVNA 3SBXA 3ZY4A 4EHHA 1CCWA 4EKNB 5LP6A 4ZEMA 2J3DA 3N2YA 2WF6A 2JGRA 4KV7A 1PTJA 5DBEX 1EUCB 4CKBA 3A6ZA 1EU1A 3T5TA 2C96A 3FDFA 4KE7A 1IY9A 2HMYB 2P8JA 4PC3A 5B3JA 4FMCF 1M73E 1XPRA 4RFSB 4OQYA 4UXJA 2JGJA 2QY9A 4HNRA 4R1TA 3SZ3A 3WMFA 3A6HA 5KOIA 2REQA 4KC0A 4QSHA 3H2HA 3VUFA 2ADOA 4B74A 4N7MA 5KJ6A 2HF2A 1ACLA 1W4CA 2JFZA 4HWSA 2ZAMA 3PNPA 3KT0A 4QBGB 4B6GA 2IXEA 3PP8A 4IGEA 4TTPA 3BQNB 2VHTA 3IR6A 4MRNA 1SQ5A 2R3SA 1SBNE 1P2FA 4JEUA 1PI3A 5IN5A 1RFGE 4DEVA 1ZJ4A 3RFFA 2VCYA 3D3WA 5IKMA 3TLXA 1PSWA 4ARSA 3A3OA 3EDYA 3TFQA 1E99A 4O63O 4Q00A 1X92A 1N36B 2O7RA 3QVGA 4RKRA 4F21A 4OX9B 1VJ0A 2BKAA 3G8DA 3LVFO 2ZSDA 1QYVA 4J3JA 4Q4JB 4UDOA 1VSQA 4EJ6A 4KDCA 3KCNA 4MK4A 3BIFA 5B1YA 2HR1A 2I71A 3U6BA 3ER8A 3CH7A 5EE3A 2WWFA 1JA0A 1ZM3A 1T9DA 4PIVA 3RJTA 1SVNA 4YC7A 3ZHBA 1EX6A 5FOUA 1T6XA 3KEMA 1YQTA 1RKUA 2OO3A 2JRLA 3LCVB 1ISSA 4GM0A 3W90A 5J1SB 2JK0A 5KYWA 3WHLA 4RTJA 4NCBA 2GK3A 1WU7A 1QYCA 3KQSA 3WKDA 2JLSA 1G9TA 4XIJA 1L4YA 4KLNA 4EG5A 3GW8A 4PGHA 5C4GB 1VPEA 1TOAA 2FUCA 1IOLA 1KK1A 1PD0A 2G72A 4LY6A 4Q9LA 2GZ2A 3GLGB 1AQUA 3CU5A 1NOIA 2BEVA 4CEHB 2VFAA 1W85B 2DOKA 2WV9A 3PFIA 4MUIA 1Y4UA 3RSHA 1U2DC 4AS3A 3SSMA 3GA7A 4QREA 3SEAA 4XIFA 3BEOA 2ZAOA 5JAPA 4YJ2B 2IV3A 2NU7B 1DIRA 1VI5A 4I1YA 3OCJA 4KIWA 3HSKA 2NVUB 3UYLA 2VH5R 1N8KA 1PGOA 2JAPA 3QEJA 1XRRA 3M34A 4MAAA 2QVCA 4QJ4A 5EXPA 3IMCA 3ZHTA 2REBA 1MC4A 3QVKA 3NHSA 3ONFA 1G291 4NMXB 3BHMA 3I6BA 4BAUA 4TMWA 4CKEA 3IR7A 5JQGA 4RKEA 3S0JA 4KP7A 4DSNA 2XF8A 4PRYA 1WDLA 1GZVA 2ZYHA 6ADHA 2Y1GA 3BKXA 3CEHA 5JCZA 5JANA 2M6SA 1MRSA 2DVMA 2J3EA 2NVWA 3OT5A 4Q9HA 5ECYA 4CMEA 3OM1A 5JAQA 4ENTA 4F56A 1WDWB 4WGGA 5BSWA 1YI1A 5CU7A 5A5FA 3GFQA 3GDWA 1AXEA 3OM0A 3UHPA 3GEDA 5FUQA 2V8BA 3GX1A 2Q4EA 2OZLB 2CNLA 4P9NA 3OEHD 2G08A 2PCJA 2RI1A 4MO9A 3VSDA 4CMCA 5ITSA 4D26A 4UZFA 4KVGA 2GCNA 1XO1A 3KJXA 4L73A 2P4SA 2W6CX 4RD0A 3RGWS 3F49S 5EJ9A 3IJEB 3N2LA 4JP3A 5F7OA 1PFKA 1T2CA 1D6SA 2QXUA 3T3DA 1NLZA 2I2CA 2BKEA 2IZ1A 3ODPA 4A5OA 5K0CA 3BA6A 5B7QA 1U2ZA 4YPFA 4NEHB 1ORTA 1XD2B 2NXEA 3WKAA 4D3YA 2JJ1A 4I9NA 4LF7B 3ZHXA 4H1VA 2OFOA 4EZBA 1DKNA 2FFBA 4QPNA 4H1UA 2W8BB 3Q5EA 3W8FA 2PE5A 4YGXB 4R84A 2R60A 3KP1A 1TE2A 1U0NA 2WJGA 3QFSA 3D8UA 5JAUA 1OV6A 3JR3A 4KMRA 3DBOB 4A0GA 4KITB 3IAUA 4Q34A 1ONPA 1XEFA 3OQIA 3QEMA 3HKDB 4HS9A 3ZXYA 1U7HA 4R71A 1CTQA 1TU0A 4KXWA 4NAHA 5HZKA 4J0FA 1E9RA 4OA5A 4MS4A 3RC1A 4JB8A 3UV3A 1C1XB 3MCAA 4MHTA 4TMTA 1YAHA 3BRQA 4RJ2A 3N8KA 3SEZA 4F72A 4TTAA 3RHTA 2D1TA 3S99A 2Q0HA 1OI3A 5TPZA 5K01A 1E7MA 2XUZA 5DYTA 4HMQA 1GZ6A 1KNQA 821PA 3QTLA 4D3XA 3CE9A 1B16A 3R74A 2O23A 1MTOA 1XKQA 5FOTA 5KVVA 5IXJA 1GZDA 4QU5A 3L4EA 4BNNA 2J46A 5CLGA 4E6PA 2NO9A 4JVNA 1SQ6A 1E2KA 2ZJ8A 3C1TA 2OGWA 3R6LA 4N8SA 3R9KA 5JASA 5HBGA 1C0KA 3DUFB 1XVUA 2ATVA 2O3UA 1J8YF 5IDQA 3MD0A 1E5DA 4CIAA 2VJYA 1EGQA 3IHLA 4BKQA 4R1QA 1GG2A 2AIRA 4FN4A 2Z83A 3EW7A 3RE1A 4TN5A 1Z8NA 4PRZA 3UTDA 2WKSA 4RMIA 3V6LA 5CT8A 1M2OA 2VP3A 4PTLA 1E3IA 1YB4A 3TAXA 2FPIA 2XMSA 1Z8DA 4ARBA 1KMCA 4Q1FA 3JSXA 5F73A 4WQMA 1GNPA 1Z6GA 4NEQA 5D1HA 5A1JA 3ZV3A 4I9GA 2XCLA 5ALWA 3GRRA 1EINA 1Q44A 4UCWA 4HGNA 2CLIB 4CMAA 5K45A 5KNDD 3A70A 2CL5A 3K0BA 4YRBA 1CRPA 3KOWA 1ZUNB 4FT2A 4WXPA 3LGSA 3W05A 5J43A 1P0PA 4CQMD 1YU6A 1XZLA 2AG0A 2Q2WA 4G4JA 2IFTA 1I6KA 5TPWB 3ZKWB 5AW6A 3P5BA 2RHWA 5IJAA 1U0HC 3U26A 3EF1A 2OBNA 2XCQA 3D8TA 3FUVA 3DEAA 4F4JA 3CZRA 3PHBE 1N0IA 3FPJA 4L5YA 3CQ9A 3MWJA 2BGGA 1NC1A 1UDCA 2BEUA 5BURA 5JV5A 1MIOB 2HSJA 2ZJYA 3K1JA 1R5BA 5HCNA 2GJKA 2WMOB 5CA0B 2AV6A 1P72A 1DWPA 1QIHA 1M8FA 4N6NA 4O4HF 5KMGB 4IGKA 2BN4A 3IUMA 4N5HX 3V2GA 3K70D 3UAYA 2X8LA 4Y6RA 4ZAGA 3S1AA 3KL2A 3E4DA 3R0QA 3SR0A 3RVPA 1QUFA 2VPXA 3GFSA 4CBVA 3IAS1 4NYIQ 4TRJA 2AG8A 4R1UA 4WVFA 1K7SN 2PH5A 2QX6A 4DYDA 4RFLA 4WXMA 3BFJA 1RHKA 2HJWA 3CEAA 3ILHA 3KO8A 1CYEA 2TMKA 4KQ9A 3HCWA 2W42A 3GVIA 2BFAA 2HRBA 3UMVA 1OLSA 3P94A 4OHUA 2D1QA 1VIYA 1KO8A 2QJRA 1IPHA 4YIHA 1DO8A 1LBTA 2DSTA 2A9FA 6AT1A 3A04A 2Y1OA 3IPCA 1WQ3A 2OM6A 1YR6A 2R1TB 2TS1A 3DVAA 3EE6A 1UKBA 3OCUA 3MJFA 2PA3A 5SZJA 2QD2A 4IS2A 4AK9A 2ZTUA 1SUAA 1Z56C 4UMDA 3HDYA 4JK3A 4RTOA 1JH9A 3LXXA 3GP3A 3QE3A 2TMDA 1SOMA 2DULA 3GXOA 4OU4A 1X6VA 1TW2A 2K4MA 5FXMA 1J0BA 4DWWA 5FEUA 4GSYA 4F96A 1XOIA 1Z63A 4URWR 3F4KA 1R27A 2H1WA 1XTRA 1XA4A 2HO4A 3A4TA 3QP9A 3RU7A 2X86A 3C3PA 3QGMA 1ZKDA 3A36A 5A6SB 4MKZA 2WYOA 2IK8A 2Z3WA 3WMEA 2DKNA 3WQHA 1B4DA 3SFTA 2PU7A 4RZ2A 3HDGA 1A5TA 1VDMA 4NZYA 1R5OA 2QX4A 4QUJA 2QNRA 3P0EA 3ENZA 4C0JA 3NCHA 3EXIA 4WOCA 5ER9A 5TMBA 3IMEA 3RH0A 4O0MA 4I50F 5T6MA 5BN1A 4DMMA 3AIOA 1SFRA 4QPPA 5JH7A 1RI4A 1IK4A 4RDCA 3V4VB 1SZDA 1T2VA 4RK0A 3ZLUA 7MDHA 5DYYA 3PEEA 2AH5A 1NXSA 4POAA 1XRPA 1MR3F 1Z0SA 4NU6A 3AKEA 5LMZA 4I1UA 2Q6TA 4J4TA 2HU5A 2JCVA 2HCRA 1QH1B 1RT9A 1LJLA 2OGZA 2ZYAA 1RXEA 2DWUA 1G3QA 3EOAI 3K2EA 3KJEA 2GRJA 3F3YA 3IVAA 2QLNA 3H5IA 3GZNB 3KVOA 1PJQA 1BNCA 4Q7LA 2Y2UA 1J9EA 4OREX 4BRUA 1EXNA 4F4CA 2MINA 1VLJA 2BGJA 4JOSA 3R0XA 5IULC 4U2CA 5C3MA 1XU9A 1SU4A 1H8HD 3L0DA 4QOGA 4ZVUA 1IOZA 4PC6A 5FBRB 3LM8A 1X9IA 1RFLA 1UADA 5COAA 2QTVB 2NU9B 1SM4A 1GL3A 3KLNA 4LZJA 5JS7A 1N5IA 3MC1A 2WFZA 1VJGA 3VHRA 4G2NA 5CYPA 2FOIA 4KBYA 4KPUB 4AJPA 5F78A 1XAIA 2AN9A 1BS2A 2KS6A 3NM5A 4X1IB 4KFTA 5A3VA 1U28C 4TT3A 2C5AA 5JDIC 5AVTA 3FI9A 2DFKB 5K03A 2OZPA 4X6LA 3CJTA 3MTEA 1WNTA 3DB1A 1UQRA 1EKXA 1OAOC 3UHAA 3B7PA 4LJ6A 3EBPA 4M9XA 3DYBA 2CMDA 3HABA 4MWDA 4GYJA 2XAUA 1U94A 1D4OA 1WG8A 3U7QB 3KPVA 2H2WA 1O95C 4EHLA 1K97A 3K5HA 4IVRA 2NP6A 3CFYA 3L8EA 5AVYA 1CFJA 4HDNB 5AJXA 2B61A 1FLDA 1SURA 3DOUA 2OCXA 2XCOA 3K0CA 1IPFA 3GPCA 3VR2D 1E1LA 3HA2A 2WZBA 2VBIA 3HR4A 1PZHA 1II0A 5AXAA 3ZTYA 4EFLA 3WLOA 4C22A 4A8PA 5AVVA 1E1MA 2ONZA 3BSSA 3I2GA 5JXWA 5TF4A 4ZXFA 1Q11A 1KEWA 3QBJA 4PR0A 5L3RA 1CY6A 3OA0A 3ONEA 1UT6A 4H9GA 4QPZA 4UJ5A 4JHLA 2OUKA 1H1TA 4GZLA 1ORDA 2NX2A 2NO1A 1ZH6A 2NZJA 4IINA 4RM2A 1M6WA 3AR9A 4Z2YA 2WT9A 4DV6B 2OORC 3C0KA 1E8MA 3LUBA 1BVHA 2OFWA 3QWAA 1DARA 3KV1A 3OMWA 1NUUA 2ZIZA 2MHCA 5BORA 4FGZA 5KYUB 1M1XB 5AI6A 5DI9A 1GPNA 1C1YA 3ZE8A 2NUAA 1W5BA 1A4UA 1OC2A 5FFNA 5EJ6A 3MXOA 1T5BA 4C4AA 2H4FA 3C6XA 1V4NA 5JCXA 3PXGA 3OWXA 4CIBA 3RS5A 1XVLA 5FCDA 1NNUA 4DZRA 1SKAA 4CETA 2PUCA 4ARZB 4J6EA 2P4UA 1SD2A 2VDQB 1LF0A 1Q0SA 4OBEA 4LHXA 4BVLA 2ON6A 4DBLC 3BIWA 3RNOA 1FP2A 5KTOA 1U0SY 3GDGA 4IIJF 3C15C 4JWKA 3I9V1 2PLFA 3KFXA 1Q50A 2QZJA 3REOA 2P0YA 3G2PA 1T0IA 3LLVA 1X3LA 2GVZC 3V1NA 2I66A 3KHUA 4QSMA 2Z9BA 4GYKA 3UENA 5C5EA 1SPXA 1L5WA 2YXNA 3SE0A 4B8YA 3T8YA 3C5CA 4MV3A 3LKDA 4BO8A 2O54A 1D9ZA 3V7WA 1JZTA 1PGNA 4RVUA 1BRMA 1N1EA 1ZJJA 2QRVB 4ZIRA 4MDFA 2JVIA 2ZYWX 3IPLA 4P38A 2DWOA 5DCLA 4NZMA 1G5HA 4D3FA 2EKDA 1N3BA 1NKSA 2RGDA 5P21A 4ZVSA 2Q6LA 4U7GA 4BMZA 3TOSA 1H4TA 4ENUA 3ZGZA 1OZFA 3G68A 4QFDA 2QD3A 4EI8A 3GLUA 4YUYA 2J0QA 2BVNA 1PNOA 1CW2B 1EDDA 3M4JA 3OC6A 4M0PA 2OYCA 1EDEA 3TSYA 2G4CA 3JARB 2Z5GA 3KB2A 5GMOA 4GMGA 2ADFA 2O50A 1JSCA 4KN9S 1HF3A 4OFWA 2X3UA 1VM6A 3UY4A 1X0XA 2F48A 3A3YA 5SY4A 1XFAA 3M6VA 3AM3A 3EA4A 4FQ7A 5G3ZA 4ZTBA 2WDPA 3UJCA 5FL7A 4RDIA 5BR7A 2CEKA 1FK8A 3ZE6A 1V7CA 1OBCA 4CM7A 1GRCA 1K89A 1CR0A 1UBOS 3R8XA 3SZOA 4DUPA 5BSKA 2O8BB 2VCEA 2ZE6A 3QVVA 2JGDA 3SDBA 2A88A 1O5OA 4EJSB 1T5IA 2L18A 3L1IA 3LOQA 2GEFA 5JCOA 1WB5A 1QPZA 2VK4A 3ANNA 5EJ8A 4TSKA 3T1VA 4E12A 1FU8A 4OQ4A 3ZTWA 4Q1EA 4KN5A 2M6RA 4H08A 4NARA 3ZWVA 1BD4A 1VA5A 1YB7A 5D5QA 4GXTA 2O8DB 3Q3VA 2FQYA 1KBOA 1UPTA 4J49A 4LOLA 1A2KC 3C5WP 4CQJA 4D98A 3A0UA 5HMMA 5F2NA 1RI1A 1HZZC 1FDOA 4A36A 3UAXA 4Y7CA 1PWYE 4CR8A 4RULA 3C3CA 3AF4A 2PS1A 5IW8A 1G8JA 2XNCA 4TV8F 3WNZA 3SS8A 3BCRA 3EIWA 3P2MA 4G5SA 3M6WA 2X7JA 4WE3A 1BN7A 1RABA 4Z9BA 1PF7E 3AEKB 3TNJA 2AHRA 4AYTA 1CJMA 2V03A 4GFDA 3WKBA 5AHRA 5JYBA 1U3TA 3NVKI 4P4SA 5EWMB 4P32A 3CBQA 2XMQA 3MINA 4YI5A 4FOPA 1P60A 1P4JA 1R6AA 3A4MA 3PCRB 3QFHA 1VCHA 4IKEA 4AZVA 2PH1A 3RKUA 4GBMA 3ZLVA 4AO6A 2AN4A 4CM9A 4EX7A 5JLAA 5T7BA 4YRAA 1SOUA 1OXVA 1ODFA 1RPTA 5DK4A 2W00A 3F4LA 4DLTA 4BY9E 2H17A 3GAZA 4QX6A 4YCJA 4HDAA 2YMLA 1MJHA 5C80A 1F12A 2MR6A 4IV0A 4JLDA 4MVJM 4RESA 2JJ1D 4OQEA 4A8TA 4GR4A 4WN9B 3RWMB 1H22A 2BUAA 2EKPA 1KYQA 3BWDD 4I2NA 4P2GA 1LY1A 4A2WA 2IDZA 4RVOA 1NVTA 3LDHA 4YJHA 3GNSA 3NHFA 4RE6A 5KYKA 4FOOA 1T29A 5F51A 4HQRA 5IFLA 2JLWA 3HQ4O 3CF2A 5LDHA 1TQ8A 1D5CA 1Q1BA 4WBNB 2DY0A 5FULA 3BHJA 1IHXA 5I7OA 2X1VA 3OEYA 1L1EA 3QOWA 4HV4A 1QLWA 1ULZA 3O4GA 1MQ9A 1RWKA 4Q3CA 1BX3A 5TMPA 1Z6AA 3X2FA 1PWZA 5LQMA 3LRTA 5FORA 1Y8QA 1XDGA 2ZG6A 3C6YA 3OEEA 5D3KA 3VZPA 1I4WA 3HCBA 3PL1A 2WA2A 1ZH4A 4NCIA 2Y1FA 3VSCA 1A9QA 2AEMA 3MAGA 1P2VA 3LO8A 4R01A 2YN4A 2JNWA 4UUNA 3UWPA 2ZS9A 4URFA 4BPRA 2OHFA 1WHTB 1BVUA 2NXJA 3PT9A 2B36A 3Q72A 5F76A 4JYBA 3BXXA 3OIUA 5FNVB 1BMTA 4KAJA 2AVDA 5ARCA 3ZUPA 4MMZB 4P58A 4R9RA 2F6RA 3AR6A 5L9AA 1QF6A 3BXFA