1NXOA

Micarec ph7.0
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
116
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords DNA-binding response regulator
publication title Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 41
structure length 116
sequence length 119
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxoA00
1LK0A 3T6KA 3L6UA 1E6MA 2QR3A 4MQFA 4G0MA 3ILYA 4UHJA 5TQ2B 2ID7A 2MYNA 2WMYA 4QICA 4EVRA 1Z12A 4RKQA 2PAFA 4RY8A 5KQPA 1GCAA 2VYCA 3LUFA 1DC7A 1JHZA 2HQRA 3OO0A 4G0QA 3EQZA 4ZPJA 2MYPA 3Q41A 5IUJC 3SQNA 5BRAA 5ED4A 1RXEA 1L5ZA 2PKXA 1KRXA 2IPNA 1YK0A 3A0UA 4JP1A 4EGSA 4B09A 2HQBA 3BREA 3M9WA 4YWHA 4ETIA 5PNTA 1RPJA 1Z26A 3S99A 2JVKA 1KMIY 3I45A 1USIA 3N75A 3BBLA 3G85A 3N0XA 2WY2D 2P9HA 3UUGA 5DLEA 4KMRA 3QX8A 3CKMA 1EWVA 4ZMRA 3HK2A 4G97A 1F51E 4ML3A 4EYOA 2E4WA 1WETA 2M1ZA 1D2AA 1P6UA 2IPAB 3CG0A 3HM9A 3QK7A 1DBWA 3T38A 4RXUA 2FLWA 1AB5A 3DBIA 4E7OA 1C4WA 2E4VA 3H6GA 1FQWA 3L49A 2WWVD 2PUGA 3GWGA 1MB3A 2L18A 4LE2A 3Q9SA 3H5WA 3O75A 4WUTA 1U2PA 4ZYLA 5T7BA 5TQ2A 2PUDA 3QLVA 1Z13A 3N0WA 4OTZA 1SD5A 3GV0A 5B3JA 4ZMSA 2H0AA 3H1EA 3Q7SA 4O1IA 3VNAA 4RK4A 3OM1A 4TN5A 2B1JA 5TPZD 3FMVA 2E4ZA 1M2FA 1Y1LA 4RXMA 5I4CA 5CNMA 1B00A 3KHTA 3LKBA 4MAAA 3RVLA 1E6LA 4W5RA 5FWYB 1Z16A 3Q7RA 3JY6A 3EQ2A 3OLXA 3EULA 3TMYA 4NV3A 1QMPA 3LKVA 5FBHA 4Z0NA 5BRJA 3A3KA 5KQLA 5HQJA 3O1JC 2FEPA 5TQJA 1F4VA 4RK6A 4JOQA 3DGFC 1ZH4A 1DCKA 1P6QA 2KYRA 4HYEA 5IBQA 4ZJPA 3F7NA 3GL9A 3RQIA 4QYMA 3HDGA 3JPYA 3N0RA 1U0SY 3C3KA 2A9RA 1MB0A 3M9XA 1GUBA 2QW1A 1JX6A 4N0QA 3RH0A 1QPZA 2QV0A 3IP5A 4F11A 2OQRA 3LMKA 3RVQA 1JWLA 2NT3A 2MYUA 4WXEA 1PNRA 1ABEA 5DTEA 2HSGA 2L2QA 2PL9A 3FGZA 3TD9A 1YTUA 4TMYA 1DC8A 4KK3A 2CHEA 4MS3B 1Z15A 5BQ3A 4MRMB 4Z9AA 1TM2A 5TQ0B 2GKGA 3HUTA 4JB2A 1Z25A 2IYNA 2IPMA 5KWSA 4LE0A 3LUHA 3K9CA 4CBVA 1LBHA 1PEYA 2JVIA 2HQOA 2NT4A 3GBPA 3T8YA 3QELB 2A9QA 4RK7A 5FWYA 3C6QA 3JPWA 2PUFA 2RJOA 3MQ4A 4MS1B 1ZDMA 4KZKA 4W5TA 2FKAA 4Q6WA 1VLZA 2R25B 2YHBA 3BILA 3EJWA 1NXTA 4RSMA 2BGGA 4TLLB 3CRNA 2FMHA 1OXKB 3QX9A 4RDCA 3LUJA 3CZ5A 4Z99A 5KC8A 1AB6A 2NZVG 2F8SA 4XFKA 1JDNA 2WJAA 1NXWA 3NHZA 2QU7A 2L17A 5CHYA 1TVMA 4F06A 2FW0A 1JLKA 1U8TA 3RVKA 2PLNA 2VK2A 4XAQA 3LTEA 4ETNA 3H5OA 1ZVVA 4KNYA 4YRZA 4E7PA 5JNRA 4WXMA 3EODA 4G86A 2PUBA 2PMCA 4D6YA 1EWTA 1LJLA 1H9CA 1A0OA 3W9SA 1NY5A 1K66A 2LBPA 3BRQA 3LUDA 4TLMB 5CNJA 2GX6A 2VUIB 3H6HA 4MS3A 4G0YA 1RZRD 5IX8A 3JS5A 1NXVA 4NQRA 3MYYA 3ILHA 5EWLA 3RVNA 3QLUC 5TQ0A 4PEVA 3QEKA 4EYQA 3F6CA 1YS7A 4MR7B 3KS9A 4N41A 1ZGZA 5KI6A 2R4QA 4FB4A 3SAJA 1YMUA 2HJ9A 1BA2A 3RVRA 2WJWA 3HCWA 1JFVA 1P8AA 2GBPA 5IULC 6ABPA 3F73A 3D02A 2N9UA 3QELA 2FN9A 4NCBA 1QQAA 4Z4CA 5EWJB 3KCNA 1BDJA 1ZY2A 4MR8B 4MS1A 1M5UA 2JVJA 4H60A 4YR7A 3LUGA 1JFSA 4EVQA 4LDZA 3O1IC 1U04A 4HNSA 3IP7A 4IILA 1GCGA 4H3HB 4MLCA 2FQYA 4P98A 3CFYA 3FDFA 4XXHA 1ZAYA 2FN8A 1JFTA 1CHNA 5JS2A 1ZGGA 4RWEA 3MF4A 1T34A 3MMNA 2LUOA 4Q6BA 1VPWA 2O20A 4HNRA 4L85A 3URMA 2R48A 1RZRA 3OQMA 4IMIB 1QP7A 4MPTA 1W9HA 5EWMB 1I3CA 4N03A 3RVSA 4Z4HA 7ABPA 2ID9A 2L19A 4YCSA 3ROFA 3UK0A 3C3MA 1NXSA 3M6MD 1EHCA 4L4UA 2H3HA 1FFSA 5D2CA 3KG2A 1RXIA 1S8NA 3I5AA 2FMFA 6CHYA 4QPJC 2ZWMA 2X7XA 4GPAA 4KK4A 1YS6A 2FMIA 4MQEB 3I42A 4MR7A 4IMJB 3F6PA 3EDCA 5C5CA 2GI4A 4RK5A 1A2OA 3OLYA 2WB4A 3N53A 5TPWB 1PEAA 3E61A 1NXXA 4PE5B 4Y9TA 4KQCA 4LRQA 2F8TA 4OLAA 3KLOA 4KV7A 3RVOA 4Z4IA 5EWJA 5JS1A 4G0PA 4MGEA 4EYKA 4MR8A 3HSYA 4DADA 1JYFA 2FEKA 3H5IA 3NNSA 3N8IA 2QZJA 1JYEA 4W5OA 4Z4EA 1KRWA 1XWWA 2IKSA 1DZ3A 4NCAA 3HDVA 4OG2A 4KREA 5IEBA 4H3KB 2I6FA 4EVSA 2PJUA 2HPHA 2JBAB 3GBVA 1SXGA 1DRKA 1KGSA 4JASB 2CD7A 5EWMA 1IIBA 3TX6A 3CHYA 4MR9B 3R0JA 1JBEA 1ZH2A 1LJUA 2RJNA 2P4UA 1PUXA 3ROTA 3TO5A 3SM9A 3A0RB 1Z17A 2MSKA 4Z4GA 3GYBA 3NHMA 1DCMA 2PUEA 2IPLA 1FFGA 3HXMA 4KVFA 5DKFA 2QXYA 3MIZA 2FSPA 1XHEA 3NBMA 4UHKA 4LDAA 1K68A 4KRFA 3NNNA 3EAFA 1USGA 1QP0A 3OMWA 4MQEA 3A10A 1ISSA 2YHAA 2FEWB 3MM4A 4RU1A 3VNBA 2NZUG 1SXIA 3D8UA 5TPWA 3SNKA 1M2EA 1RNLA 3SG0A 4W5NA 4FE4A 3HUUA 4YP9A 3DLBA 3CLKA 2TMYA 3HJFA 3C3WA 3H5LA 1EFAA 1ZHHA 4XASA 4YV7A 4RS3A 1NATA 3CS3A 2PUAA 1TLFA 1Z2EA 4D74A 3O2QB 3HV2A 4RKRA 2FLKA 1GLGA 3SY8A 4F8JA 2AYXA 3QLTA 3QEMB 1BVHA 5T3YA 4P1ZA 1LBIA 1GUDA 3BRSA 3NNDA 1ZN2A 1SXHA 4XLTA 1APBA 1R8JA 3OQOA 3IPCA 1MVOA 2JBAA 1ABFA 2FQXA 4LZLA 3IPAA 3Q7TA 5KC9A 4WT7A 4YLEA 1JL3A 1FFWA 4MR9A 3E3MA 2LPMA 1DCFA 2FQWA 3P9YA 4WWHA 4EY3A 4MRMA 2JRLA 4WZZA 1W25A 1A04A 3KTOA 3CTPA 4LX8A 2XDYA 3FFXA 3HS3A 3OLZA 4N0PA 3RVJA 2MYTA 3LFTA 3FFWA 4HNQA 3CZCA 3H75A 5E3JA 3C97A 3KKEA 5ABPA 3QLVC 1NTRA 2R47A 5B3JC 3GA5A 5IUNC 5DCLA 2GWRA 1C0EA 1DP4A 2MSWA 1MAVA 4S05A 3CG4A 5TE9A 1QKKA 3H1GA 4RV5A 2OENG 1QNLA 2VUHB 1QQBA 2E4UA 1QP4A 9ABPA 2PUCA 1E2BA 4RZSA 1TMYA 2QSJA 3QEMA 3KJXA 4DN6A 1J56A 3LOPA 4GNRA 1OXBB 4ETMA 3H1FA 1DG9A 1VRVA 4DQDA 1ISRA 3OO1A 3O74A 4JA2A 3CU5A 5F64A 4YS6A 3KLNA 1HEYA 5CNKA 2LP4Y 1BDIA 3JVDA 1E6KA 1PNTA 5FBKA 2IOYA 4LE1A 3MA0A 3QLUA 1YVUA 3OQNA 1VKRA 2PE5A 3FFTA 2A9OA 4MS4B 3HZHA 4RY9A 2B4AA 2RGYA 1ZESA 3CNBA 3K4HA 5IC5A 4N47A 4YO7A 1USKA 1YK1A 3T95A 3KSMA 3OLWA 3LUAA 5GOTA 2CHFA 4O5AA 1P2FA 5KQGA 1Z2DA 2DRIA 4Q7EA 1TJYA 4KQ9A 5GQSA 3IP9A 1M5TA 3O21A 4Z9BA 4NICA 1DBQA 2CWDA 4JAVC 1BDHA 5JNTA 1NXPA 3OM0A 2QVGA 4PICA 3HVRA 1EAYA 2MSLA 3TB6A 2JK1A 5CNIA 1YIOA 3IP6A 8ABPA 4KFCA 5C5EA 3I09A 4S04A 2FXIA 4RY0A 2QVCA 5FWXB 5HKOA 4EYGA 3OLVA 4OATA 4W5QA 4YGXB 4OBBA 1QO0D 3OMXA 2JCGA 2PL1A 4FE7A 4RK1A 5IUKC 4RK0A 5JNVA 2E4XA 5HM6A 4IF4A 1DRJA 5DGCA 1BAPA 2A9PA 2FTKE 2NUBA 3LUCA 5HSGA 3O2SB 1D1PA 1L5YA 3G1WA 3H5TA 3HO1A 1NXOA 1SRRA 4IGAA 2FMKA 1EWKA 4MQFB 1YMVA 4D6XA 4OLBA 2JB9A 4MLDA 4MS4A 2V0NA 1PHRA 4QYWA 5TPZA 3N6VA 4N76A 5KQMA 3GRCA 4M88A 2E4YA 4MYRA 3EGCA 3H5VA 2WRZA 4Z4FA 2ZAYA 1D5WA 4EUKA 3DLHA 2FVYA 2RDMA 4RXTA 3O2JA 5EWLB 3RVMA 4G0OA 4JB0A 4F3TA 4PZ0A 1D4ZA 1DJMA 1QO0A 1Z18A 3LUKA 1DBPA 2LIVA 5BR1A 3GT7A 1CYEA 2AYZA 1URPA 1XHFA 3DZDA 4G0ZA 1JDPA 3B2NA 5IEJA 5JNUA 4KPYA 1JF8A 1JH9A 1FSPA 4IRXA 4PYRA 3KYIB 5FWXA 3KYJB 3JTEA 1ZITA 4F12A 1U2QA 3UKJA 2J48A 2Q5CA 3Q15C 3JVIA 3DGEC 3RVPA 4G0XA 3HEBA 1MIHA 1UDRA 5JNWA 2W42A 3IDOA 5JNSA 4O1HA 3O1HB 1CEYA 4XARA 1D1QA 2M98A 2IDMA
chains in the Genus database with same CATH superfamily
5EE9A 1YA6A 1KO5A 2VUSA 2IEDA 3L6UA 3JAWA 1YRYE 4XWGA 5E4YA 1V3VA 1YMQA 4PGAA 2A9VA 1NKTA 4PC7A 3ZHVA 1CYDA 3AOGA 3ECCA 2SCUB 2JGFA 2DHQA 4IGIA 4PFQA 2R8PA 2Z30A 3E27A 3L79A 3OO0A 1QDEA 4YC7A 5FTJA 4WBNB 3A3OA 3W2TA 4MUMA 1I1QB 2GESA 1UFQA 4PCAA 3KXPA 2Y0PA 3ZPXA 4JP1A 1ZIXA 4P3XA 2QGFA 4QLAA 1EFVB 3IDQA 4JZYA 1RRKA 4LC1A 2I6QA 2R86A 1QIJA 2IUFA 2ZZKA 3BBLA 3ETJA 3FOBA 1C30A 2FDXA 3IP8A 4O6VA 1ECJA 4OU4A 1XDGA 3WLNA 2WWIA 1XEAA 3R3XA 2WYVA 1YR7A 3N3AC 2ZIAA 1VGQA 1DKRA 1GG5A 1C9EA 3NXSA 4FSHA 4XSHA 1PX0A 4K6OA 1HUQA 4JBLA 4MKIA 5LZ8A 3WYBA 5ES4B 5JBIA 2R00C 4BWFB 3TR5A 1E9RA 4CM5A 3URKA 3CG0A 3NBFA 5I3CA 2AXEA 3ZX5A 4DCVA 2EV9A 1KDPA 4DB2A 3FA2A 1HH4A 4JI0B 2FLWA 4AKEA 2WT4A 3AY6A 3FW1A 3CLTC 1TU0A 4OO3A 3AI7A 2PM8A 4GT1A 3EWAA 1U1FA 3L0DA 1HNZB 3RIHA 1SQGA 5DM4A 1RRFA 2FW7A 4W6QA 2BEUA 2XKJE 4C08A 1NVKA 4EUHA 2IZOA 3LY7A 4E4YA 4NONA 4B76A 1TA9A 2WF8A 1PDWA 3UM9A 1E5TA 2YV5A 3AETA 1I7PA 1FJXA 3EG9A 2G83A 3Q7SA 2O05A 3VI3B 3E1KA 5F1PA 4HLDA 4PBRA 4HXGA 1PW7A 3KELA 4L5JA 1SU7A 2HC9A 3IV7A 3GCDA 3IQZA 3PDIB 2DBYA 2YJZA 2NU8B 4AN4A 3LKBA 4D46A 1M83A 5DVZA 4B73A 3EEIA 3A58B 3AUUA 5L6LB 3OU6A 3LS2A 3PUIA 3IOCA 4BQOA 5KUTA 2BFFB 4QPNA 3ABRB 2KX7A 3BWMA 4UNPA 1NPTO 4Q7LA 3EVBA 2Z6QA 4DMGA 3F0TA 4B3SB 1SCQA 3SMQA 3D0QA 4Z0NA 3UH1A 3OQ1A 4FE3A 2W6ID 3DBLB 4B82A 3ZHUA 4HV4A 4KHZA 2V7UA 1WB9A 1T0UA 3ICEA 3O1JC 4MYDA 5TGDA 1VZ3A 3BZBA 3DOEA 4B7ZA 1W1WA 1N1MA 1UPXA 2VAPA 4IJ6A 4L4ZA 4L8WB 5A3VA 3H2KA 4DDHA 3NWJA 3F7NA 5AIBA 4OSEA 3RFCA 2BD0A 2CMFA 3ADOA 3ZDYB 2YOGA 3O3MB 4C2AA 4EGAA 2IBTA 3S2ZA 4WGGA 2W6CX 5HFAA 5CJJA 4HRAA 3A31A 3RC1A 3RH0A 2W6QA 2QV0A 2P2LA 2GEUA 1A4RA 1DRWA 1ZM4A 4LWZA 3KOUA 4CLRA 2NU7A 2A5FA 4IW3B 4Q9IA 3N74A 4ZXPA 4B8WA 2H4YA 2G5PA 3JR3A 1CUSA 3R6WA 2XNDD 3PU6A 3ZWCA 3K9GA 1FSGA 3LECA 4JB3A 1C1XB 1SA0A 4TTSA 4I5FA 1KC3A 3BMQB 3DMFA 1Z5VA 1V3QE 4D25A 3CEJA 1VCMA 1JNYA 2W6IA 2OGZA 3SIPA 4EBFA 4ECAA 1CQIA 3V8VA 3KAJA 1TA4A 3FHTA 4BXOB 2Z5LA 1MTOA 3CH6A 4E6EA 3TLJA 1DFHA 4L50A 3WBBA 2WMOB 5EHQA 2ZWVA 1XTQA 1VQ1A 2G7MC 3JQFA 3OA2A 5F3DA 5ADWA 1CUFA 3BXEA 3VBEA 4ARBA 4S1WA 1ZDMA 3BWVA 4C4XA 1PBNA 2HMSA 4HAWA 5D01A 5IP5A 4INJA 2UZ1A 2ZIVB 3V1NA 2DR2A 4QOFA 1L7DA 1YR3A 1T13A 3G1UA 4G63A 4ZVUA 1PGNA 3Q3IA 4Q18A 2UUBB 4J0DA 1KO7A 2C5SA 1WABA 1Y3HA 4JZKA 5C4IA 3R5JA 5K20A 2DX7A 3BDIA 5CFPA 5ALWA 4BX0A 4OJQA 5E3IA 5JJLA 2L17A 2XNDA 3HVIA 2VFAA 1FU4A 2SBTA 2FW0A 3LOQA 4TL9A 1U8TA 3HA5A 4URXR 2VK2A 3F8TA 4CM8B 5IAOA 4UARA 1TNDA 3PTAA 2PNJA 4RTQA 1GEEA 1RMQA 1PZGA 2QVYX 1LI7A 1Q22A 1NQTA 1T29A 5DFAA 1S3FA 1F6BA 1EK5A 2QRLA 4AZSA 1VI6A 2NPFA 4DIOA 2H92A 1Z62A 3FLEA 5E7JA 1OYWA 4DM7A 4ZOLB 1T3LA 2D62A 1EQ2A 1OIVA 4YFYA 2P4EA 3DTVB 4PHHA 4XDGA 2GCNA 3Q0EA 3CZ9A 4GF5A 4PPGA 1G7TA 3EVDA 4R1LA 2FOIA 2ORIA 3ZKWA 5KNDD 4KIUA 5JANA 4I4NA 2O2IA 2GRJA 2XX3A 1AKQA 2IV3A 3SEZA 3F73A 3TSZA 5BQFA 2NAFA 2Q7XA 1J06A 1EHYA 2FN9A 2P27A 2XVMA 3RYHB 5B7QA 2R7LA 1EHIA 1TC2A 3KCNA 1MEEA 1MOPA 3B3GA 5A9SB 1SBCA 3ZY3A 3WIBA 1MQSA 4M55A 1PQ4A 1IEWA 1PG5A 3O38A 1CPYA 4C87A 3TEJA 5K1ZA 3C8MA 3GZJA 4P98A 2H1HA 2CDCA 1B1CA 3NIBA 4XQEA 5JS2A 5MN4A 5GIOE 3KAPA 2V0CA 5D00A 3ZNQA 3PJDA 3BCUA 1P29A 5C52B 4U4AA 3MMNA 3PE3A 1U80A 4OOFA 5JXGA 4HJRA 5TJ9A 1Z68A 3E0XA 3ZNOA 2OCLA 1QMGA 3BK2A 4I6JA 1CBUA 2VZLA 2WG0A 4G5HA 4GLBA 1T25A 3G5MA 5CMLA 5C32A 3BA1A 421PA 1JMKC 1NHWA 4AIRA 4HQRA 2L19A 1K6MA 2BIFA 1ZXLA 3EZ6A 1H2WA 3GEHA 3Q87B 4KUEA 1OF1A 4OGKA 3ROFA 1JG7A 3SIRA 3R3SA 1WXDA 1IN7A 2W22A 1FFSA 3CPJB 1KAQA 2LDBA 2PGAA 5ECGC 4NPAA 4Z8YA 3DLPX 4PTZA 3ZH2A 4CIAA 1OAKA 3GLUA 1ISIA 2Q5IA 3PEVA 5BQOA 2H1LA 3CRRA 1CRWG 5CM2Z 8GPBA 4H9GA 3OLYA 1HLDA 2VJYA 4UBMA 4UOQA 4BKMA 4U02A 5DHUA 3PLAE 4UAGA 4Y2SA 1X3LA 2B21A 2RKBA 2XCIA 4LIPD 4KQCA 3WYCA 3OWXA 4OLAA 3OU2A 4US0R 3PNKA 4H59A 2GBLC 4P5DA 4BYMA 1SPXA 3O91A 1RYYA 2H7YA 5LB4A 2R6HA 5K0GA 5KYGA 1K7SN 1DAOA 4J76A 3ORYA 1IJKA 4BLTA 3A32A 3R7DA 4BX2A 3H2ZA 1C1DA 3K0EA 3ZYCA 3IBFA 5DB4A 2EJBA 3RT9A 1QFXA 2PBFA 2XUPA 5EZSA 4JP3A 1UKAA 4QTXA 5IKOA 1RR6A 2EKBA 3RKUA 1SCAA 1AMUA 1NL3A 1JIIA 2OV8A 1OKKD 1XZ8A 1ZI9A 3IJ5A 4NCIA 3AL2A 3LBFA 1NVVR 3ZXXA 1NJ5A 5KQRA 2GKSA 1UFKA 3LD9A 3LX5A 5TEWA 3ZU2A 5L4NA 4X62B 1DUVG 1WSDA 3JTMA 4JL5A 1U5AA 2BSAA 2CL5A 4QT4A 1PUXA 1QJ4A 2G67A 4B35A 4U2DA 2C0CA 4L5YA 1T91A 1Z17A 2OD7A 3OU7A 4TZKA 3GYBA 2C9CA 5CVVA 4UJ5A 5D3ZA 1DCMA 1H23A 2R6AA 5ITVA 4AQ7A 3N2KA 4EQ6A 2EYUA 2YRFA 1IYZA 3SEQA 2WKQA 2V8BA 3SZRA 5REQA 1KAEA 1MXFA 2FCRA 2V6JA 3UWKA 3WTBA 4REMA 4C2BA 1AQYA 3ST7A 5HIAA 1WPRA 1USGA 4L0MA 4HDMB 1CP2A 1QHEA 4FHZA 2AMLA 1W88A 2PXAA 1WM1A 4QJ3A 2EKDA 4WFQA 4CKZA 4YLYA 3HB9A 2UVPA 4PAGA 2PHZA 2JA1A 2GFQA 3CVOA 3ZWWA 4C3UA 3PK0A 3HXQA 4CM6A 2ZR8A 4S2UA 1OKKA 3K31A 2WUGA 3WZLA 3LPCA 4H1UA 1VKNA 3AOEC 3CPHA 4BNHA 1XG5A 2QRJA 4ZGWA 4OP3A 4MV1A 4RS3A 6ADHA 5DNUA 1Y5LA 2VDWA 2P5YA 2XBUA 4RKRA 3BB1A 4P58A 3DVSX 1TYEB 5EZYA 2NSJA 4JR0A 5DLYA 2BI7A 4JOCA 3RPEA 3UMFA 5H5JA 3UNXA 1LBIA 2Y05A 1RWPA 3HXPA 4O2AA 4HQFA 1K7EB 4CF4A 2DCMA 2VSFA 4F7WA 5E6SB 3U09A 1KWGA 3H9BA 1GPDG 1SZPA 4WV3A 1MVOA 3FYHA 2FQXA 4LZLA 1M1YA 3AR3A 2CLSA 4DZRA 2LZ0A 4N0MA 5LA6F 2CV2A 3EH1A 3SI7A 3I9JA 2CVOA 1O97D 4YY3B 4Z1MD 2P9JA 5AUQA 4WWHA 3EMKA 3R7LA 1WV0A 2WWTA 1P44A 3GUHA 3NH6A 2CMHA 2JRLA 3LHKA 4H35A 5K8TA 4UPEA 4LI0A 4DCMA 1JPUA 1VRCA 1ZUD1 3C6XA 4QULA 5C3MA 3C7CB 3SHFA 2WWYA 1XNHA 5DWQA 3H75A 3IQHX 5JWHA 1GVHA 3TLXA 4L4RA 1PR3A 3DWGA 3JWPA 2RD2A 5AICA 3PCXA 1NJ1A 2AG8A 3GA5A 1DJMA 1EWQA 1BKDR 4OFWA 4MW1A 3RROA 4C0HA 4H6VA 4OXXA 3H97A 1SBYA 5TC4A 3ONDA 4EW2A 2JJMA 4K6MA 2A67A 3QJYA 1YWGO 1CJVC 4TS9A 3TD6A 4FUTA 2J09A 2GK4A 2VTEA 2PUCA 2XUJA 1OIWA 2C77A 4O0MA 4LXYA 3DEAA 3QFCA 1X7GA 4JQOA 4DWOA 4ZVVA 4NCHA 1GNQA 3O4FA 4G5OA 4PN3A 3Q3JB 3RBXA 4TKUB 1JMYA 2FKNA 1YS4A 1BHO1 4EGCB 1UPBA 4GP9A 3BQMB 3VSAA 2HGZA 2I2DA 4FQ7A 4AJ1A 3R5XA 2HBRA 4F5WA 4JVNA 6AT1A 3L4JA 1YZKA 3Q3GE 5AI0A 4FQ5A 2A5JA 1SCBA 3AHJA 1KSJA 1NX9A 1RM4A 2VUTA 1ZK3A 3FPSA 5TT0A 5C8XA 3BX1A 3ENNA 1T8SA 4O4JB 5K0LA 1B6RA 2XMDA 2FZWA 2B7LA 4MO9A 3ZXIA 1PNTA 1U7TA 2IOYA 1J09A 5DYGA 1YVUA 3KFVA 5J9FA 1W34A 3N8DA 4U8GA 2VKTA 3ZDXB 1KQ3A 2FSGA 3D43A 1FFXB 4IIXA 4AICA 4E14A 2FPLA 2II6A 1PJQA 1R6BX 3GJ5A 2FY8A 3KVNA 3WYEA 3NBQA 3NM4A 4W1SA 1P2FA 1WXWA 2DRIA 3TDNA 1A5ZA 4YRBA 3K1AB 10MHA 4DDVA 1FEZA 2QQGA 3UJ7A 1Q50A 5EERA 5TB5A 3OC6A 3U7JA 2XA9A 4OHZA 2K5UA 1IVSA 3NHSA 2HF9A 4X1KA 1W0CA 2MIIA 3OM0A 1TIKA 5AHKA 3KQMA 3LX8A 1EAYA 4Q7MB 4IZ6A 4R1OA 3K70D 5BRNA 2RIPA 2AJDA 4DLBA 5ALQA 3WNCA 3MILA 3VNQA 1PNRA 4MB2A 3X1MA 4J7UA 3ZV4A 2DKFA 5ITZB 2NG1A 4HBZA 4PC6A 4WLOA 3X1ZA 4MMYB 5MFPA 5FTLA 2AOTB 3BWEA 1AXGA 1MMFB 1Z2AA 4X1YA 3WJ2A 3L02A 4IJWA 1PHPA 4ZZ2A 1CCWA 2WHXA 5HJ5A 2DEUA 1FNNA 1ULAA 4JBXA 4N3BA 3RSCA 5JCOC 1P0MA 5DWVA 4LECA 4CKCA 1BQ3A 1ZU5A 1SWVA 2YXEA 4BQRA 3NBXX 2NSYA 1W581 2C9YA 3IAM1 4JP5A 1D1PA 1PD1A 3DOOA 4NNJA 3ZN2A 3HO1A 4OLJA 4IGAA 1IZ8A 1VSQA 1V3UA 4MQFB 1QGDA 4OJMX 3CZMA 4IUBS 1QU2A 5K3FA 3CBGA 1G4AE 1QIKA 3CKLA 3EA4A 3MC1A 2QJFA 3D9QX 1FE8A 1T9CA 1ZK4A 2Y0EA 3GJZA 3LQFA 3PPXA 1KOFA 3T7JA 2CUNA 3I39X 4A5OA 2H7XA 4LAFA 2ZYVX 3DULA 3KKNA 4KQJA 5EMKA 1NVAA 3LHIA 1OWNA 1V8BA 2WBLC 2C7VA 2J0EA 2Y1OA 3SX4A 4KL8S 4G0OA 2WKPA 4F3TA 3CZAA 1V45E 4HAVA 3F49S 2FCAA 2RC5A 3X0DA 2J3JA 5AK6A 3R9IA 2RHLA 5ADUS 3DBRA 3DHEA 1XHFA 3OZFA 4V39A 2SECE 4LFAB 4J91A 1A2KC 3I6ZA 1H0KA 4A0RA 1C3OB 3CRVA 4IRXA 1KERA 1KYZA 4IJQA 5I3ZA 1W0JD 2X9NA 4CGYA 4HQ0A 4X5OA 1KZGB 4IDAA 9LDTA 2QDKA 5A71A 1TYAE 4BZWA 1EB8A 4MTLA 5FUXA 1GADO 3IMFA 4L2IA 2JI7A 2WIFA 1VE1A 4AJ9A 5JYEA 5LD2B 1WCV1 1N2HA 3E9NA 1LDGA 3E82A 3ELDA 2CV0A 1F6WA 3D3WB 1WDKA 1KFJB 5FOQA 3KZXA 4Y67A 3V7FA 1WCIB 4WZBE 3DAOA 5A4IS 1DXQA 1JECA 4OX9B 1PJBA 3ZZNA 2XVYA 2JFYA 2XMGA 4CWAA 1II8A 4A2CA 2VH1A 2OLJA 3Q3VA 1E1RD 3LF1A 1AQNA 3UG7A 4DUGD 3HI6A 4QJBA 5KVCA 1QLJA 4LNUB 3TAXA 2VH2A 4JXJA 5D5PA 3QX3A 1G20B 4TXNA 5IRCD 3TLMA 2VDMB 1JQEA 5LUAA 2WTUA 2I4IA 5I8ZA 4KBFA 5FKJA 1Y3BE 3VO9A 3Q1KA 2WZDA 2IPNA 1W0JA 1Q1AA 3TZLA 1NW7A 1D2MA 2Z83A 2HQBA 3OCCA 2HA4A 4CMJA 1Q1ZA 1NM5C 2WEKA 1FFHA 1PR2A 2AH5A 3N75A 4M99A 4J0EA 4XQ9A 1HY3A 4XYLA 2H5IA 1XEXA 3G85A 5B1HA 3S7ZA 1WHSA 3TSWA 1M6YA 4F6RB 1ZL0A 4ZI2A 3FIJA 4BJHB 1SUFA 1X1QA 1ZIPA 5B57C 4JI4B 1OB2A 5JI3E 5EPEA 4DA0A 4GFDA 4DA8A 3HN6A 2E4WA 4JK3A 1WETA 2M1ZA 1E1RA 3IH5A 3L7CA 4DUGA 2Y3IA 2FPOA 3T1OA 2GBIA 1DBWA 1MT3A 3W5HA 5J58A 4H7FA 4YWJA 3PI6A 2FFRA 2R1VB 4A16A 1MP0A 1W5BA 4AULA 2AFIA 1FQWA 3LT4A 5SY6A 2DTDA 1P17A 1TYDE 1W46A 3MJ4A 4DQLA 4ZKDA 4R71A 3CH7A 1X77A 3ULKA 3X2EA 1WUYA 1JZTA 3NRBA 1K6JA 3NAGA 2XMCA 3OQVA 4TLEA 2PKWA 3MTIA 3WOHA 1GSHA 2IYRA 4IIBA 2SCUA 1WU7A 4QXPA 4F92B 5K6RA 1D0SA 2AQ8A 1B0ZA 5D5QA 2C3OA 4NAHA 3FPAA 1IEXA 1THGA 3GEBA 1Y98A 4WBNA 1IUPA 1DKMA 3K8QA 2LR0A 1Q14A 1ZHFA 2ZUBA 2AN4A 3R0QA 2BDEA 3SYRA 5G53C 2Q3BA 1YTLA 3HCFA 4P9NA 1B42A 2DXIA 1EFVA 1NBME 4HH4A 4LF7B 1SCKA 1IY8A 1TM3E 1K2WA 4HG2A 4R2LA 1UBEA 4UNIA 2AX3A 4ZQHA 3H8SA 5C8VA 4QLBA 2GZHA 5BO5A 2BOVA 2WOJA 5JFGA 5E0OA 3KUXA 2AZXA 4X85A 5CHEA 5FBHA 2Q3MA 3KQSA 4TXJA 5ARCA 1EK1A 4QOEA 2PXHA 2IYQA 4ZQGA 1CE8B 2X5OA 5DX1A 3QH4A 1W30A 1ZH4A 2ENUA 3I76A 1P6QA 4A0FA 1GL9B 3UJ3X 2JA2A 4P2BA 1HF3A 1H69A 2HO5A 2QYHA 4WASA 4ZCLA 4QBGB 4HX9A 4CMEC 4C0KA 3EY4A 4L74A 2HPAA 1HTWA 1QHNA 3GI1A 4MV8A 1KJJA 4YIKA 4XYBA 3TVYA 4EO7A 4OQPA 4OJTA 1V2GA 2PWBA 2C9ZA 1K4MA 4Q4DA 3VO2A 1I4LD 3HP4A 4M7OA 5HCIA 4IDDA 3E5MA 4HN9A 3U80A 1YGPA 3LDFA 2I5PO 4DNPA 1Q1QA 1M1UA 2CHEA 5JZMA 3PENA 1OC2A 4BMSA 3R75A 2C57A 3MK31 4JA0A 1ZH8A 2GZRA 2H8KA 1JHRA 1UODA 4FZJA 3EGXB 2AWNA 4H7PA 4LXTA 2M2IA 2IPMA 3PDIA 4N0EA 2NU8A 1JHVA 5CDYA 5B2FA 4WD3A 4YH1A 4XX0B 4DIBA 2Q46A 3DE0X 3HEMA 2JVIA 3EXIB 5GONB 3HR7A 5EXTA 1LH0A 3WYAA 1TAHA 4OM7A 1WUHS 3T0IA 2BMJA 2BFFA 4FJ0A 5CJPA 3KNZA 5GOZA 2O7NA 2PA3A 5EPOA 2VQ3A 4X8MA 2FKAA 2PPLA 3HGTA 4OEHA 4JKIA 3EJWA 3VAYA 4PO8A 3BIJA 3C6KA 3EGEA 5FR2A 1NRWA 3EN0A 1TMOA 2IEBA 4PC3A 5G0UA 3TQOA 2ERYA 3DKVA 4ZDKA 1H0HA 1WSAA 1ORVA 4GVLA 5T4BA 5E2IA 5A7FA 4LF4B 3AHHA 1FP1D 5COQA 2F8SA 1Z8NA 2VJLA 4XWYA 2NU9B 3UN1A 4GL2A 3H2IA 4ARCA 1JDNA 2FN3A 3WIDA 3NEPX 3L8MA 5J2TF 4PS1A 5KTRA 2XCSB 4AROA 2RI1A 4NK5A 3PPVA 4WZAE 3B6EA 3G0DA 4G8BA 3D8HA 3EF0A 3KPUA 4DF3A 8OHMA 4IQ8A 5GTDA 2EKZA 3L8CA 4BFVA 5AW5A 3GFRA 1Z22A 1JKXA 2AXQA 2EIHA 2ZWOA 8ATCA 2HWUA 1PWYE 4YDSA 1G66A 3COZA 1IB0A 4M7PA 3ZCQA 4R9SA 3UB2A 2VNKA 3TR0A 4ES6A 2GA9A 4K40A 3UCXA 4RMJA 1TMKA 2X19A 1UWLA 1C1XA 1T15A 3A1CA 3U0VA 3BMQA 3GROA 2LNDA 4GYWA 4WA8A 4Z9FA 1Z0JA 5L95A 2P6RA 4BL5A 1GZ4A 4ZT6A 4U7FA 1AKMA 3COJA 1VYHA 4BXOA 2J3QA 1EX7A 3I5MA 3M4YA 2NAPA 5A5FA 4WKGA 4I1UA 4ZQEA 3FYUB 4MHSA 1M8FA 2WG2A 3HADA 1W0KD 3B7GA 1T8YA 4QDUA 5ECDA 2Z6AA 3DTVD 3DUWA 4KREA 4YRGA 4MV5A 4C4TA 1AN9A 2LXNA 2FQ1A 4QHYA 4KBGA 4W4TA 1GRVA 3C8HA 5SZIA 3CN7A 1GNPA 1GPBA 2QY6A 5HHTA 4C5BA 4RPHA 4KRXA 1KDZA 1JFTA 1C4XA 2PWZA 2GF2A 4I3HA 4MCHA 4N5LA 4UVGA 4EARA 4I4TB 5EJ9A 1MDFA 2ZROA 4L02A 2W6ZA 2LGJA 1ZUNB 3EZGA 3ZU5A 3GWZA 3CZ4A 2DE0X 3ZBTA 5BSUA 3MBKA 4EGFA 7MHTA 1U0GA 1NWHA 4R69A 5CIYA 2QXUA 4CM8A 1RAHA 1Y3CE 4D6PA 3K09A 5K8UA 1L7MA 2I76A 3UUEA 3L40A 2ID9A 3KT6A 4KI0A 4UD6A 1RI3A 1CUVA 1YD7A 3M6MD 2NO0A 3RIYA 3L0CA 1U2DC 1L3IA 1RABA 3S7TA 5BV8A 2RARA 4HGZA 3FPEA 4ZOLA 4V38A 1W0KA 4J3FA 1ATZA 3WK6A 3DTVA 3OIFA 3AEXA 3RI3A 3UTCA 1S4MA 4GKJB 3AEYA 1VLMA 4IIJB 4JLWA 4MKGA 3M6XA 4KKXB 2F17A 2B7CA 1XFAA 3LCJA 1GSOA 1TW3A 2GLTA 2ZJYA 3HCRA 3OZWA 4M9QA 4P3KA 5CLFA 3L0SA 2NVWA 2EP8A 5CD9A 1C3EA 4WESB 5A4AA 3TQCA 2WZBA 1IFXA 3RYHA 4ZODA 3C74A 1F2DA 1LXCA 1NVGA 3IAS1 3GRZA 4UPVA 5A9SA 4Z4IA 4G0PA 4C7XA 3QEAZ 2IW1A 3DVRX 3O3CA 3V7UA 3ZWQA 4BCDA 1T2VA 2FEKA 3OD1A 2FMTA 4J6EA 5EIWA 1GG2A 3OI7A 4CIBA 3ABOB 4LV8B 4ITVA 1J20A 1LK5A 4O4IF 1QPGA 1TW2A 2GJ4A 4PBSA 1N0HA 2R60A 2YZ2A 4FR2A 1G98A 3BXZA 4GM4A 3RSFA 4IV5A 1T2AA 4KR3A 3N28A 5H8WA 1O4VA 2CWWA 4JUAA 2PY6A 3JQPA 2XRYA 4MRNA 4Y3UA 3HCDA 4YQYA 1CUCA 3USCS 4TMKA 2FPMA 3KZKA 1Q20A 3R0JA 4HH0A 2UYGA 3PV0A 2AUNA 1X3SA 4LRWA 3KOWA 1VDMA 3NHMA 1E0KA 2EFDB 4YUWA 3JVUA 3GX1A 3ZWBA 1G55A 3DEJA 5LOVB 1EJ6A 3TZBA 3K1JA 3HFGA 4R3WA 2QXYA 3ZWPA 4JLMA 2G3YA 4YJ3F 1AV6A 4HX5A 4LUCA 4M89A 2O6LA 3B78A 2REXB 4DKJA 2AZDA 2R8YA 5DNVA 1I6MA 4HMPA 3DDUA 3KYCB 1N2SA 1ZCBA 2NZUG 3PGLA 1KJZA 4P4TA 2PFKA 3K0CC 4HUTA 2ERXA 3ZR4B 3VR4D 5AH0A 5AJHA 1YE3A 3HJFA 1DC3A 3P2KA 4KTVE 4CMHA 4CUZA 1E7MA 3LKZA 4YRDA 1EFAA 4B7AA 5ALOA 1I7DA 1O0SA 1WQ3A 4UULA 1H4TA 1QR2A 1TLFA 3KDAA 4TLAA 4F8JA 2J5RA 3QLTA 5F12A 1CS0B 1II9A 1WW2A 1IN5A 2QKYA 4BTVA 5K7SA 1TU3A 2ZB7A 4LOHA 4EG6A 2IS2A 1T2FA 1EK2A 1NBWB 4D0RA 4FEGA 4KSCA 2CXUA 4ZDIA 2C82A 1UDXA 2HV8A 5FJJA 1V35A 2VATA 4J6FA 3WLTA 4CYMA 1O77A 3KKMA 5T6MA 1T24A 4DQUA 2ST1A 2VP9A 4KQHA 1FMTA 4RF4A 2I2AA 4X00A 2WU1A 3AF0A 1IE3A 3QQPA 4INOA 3NT4A 2ATCA 4C7KA 3IL2A 2VK8A 1AZTA 1TTTA 2QL9A 1KAMA 4W8GA 1PLKA 1TKCA 3L1HA 3KYBA 4C05A 3PNLA 3KTOA 2I1VB 1PGQA 2ECOA 4MWGA 5GMOA 2F1HA 2JLQA 3U4CA 5JI2E 2Y0CA 2G9QA 3HBJA 1J6UA 1GFIA 3HJHA 3CZCA 4HDMA 2ORYA 1FS5A 4JYZA 3MWDB 3ASUA 1YJCA 4EITA 1O6CA 4BY9E 3WIVA 4IJUA 4PLCA 2PGNA 3Q3EA 2EDAA 2WUDA 3IV9A 1E8DA 2JJYA 4N4AA 3KFXA 1WVMA 2X2FA 4GPEA 1A8HA 1X9HA 1V96A 1Y34E 2BRUA 2ISSD 2JZNA 1T5OA 3AW9A 3IUJA 4FZ3A 1DKUA 1CG6A 4P31A 4US1R 3AI2A 3DB1A 3U62A 3O4VA 5JZ9A 3AQIA 4FFNA 4MARA 2JAPA 1HQYE 1OROA 3D1JA 1EQAA 1NR1A 2IYZA 1XQWA 1FRZA 2WMDA 1TK2A 1YJXA 1VI5A 1ZG3A 1VL1A 1QZXA 2QSJA 4Z0PA 4E31A 1TUGA 3QVXA 4GNRA 1IHYA 4ND4A 1G38A 4JBNA 4LZPA 3DZIA 2JEZA 1Q0TA 3CX7A 2HSZA 3I2KA 4WCVA 2Z8XA 1PDVA 1VLVA 5E6SA 5HIIA 4CEIB 1WMSA 1LC3A 4J16A 5H0IA 3ETLA 1BTOA 1PL7A 3ZV5A 1DUSA 1HYBA 1T5HX 1T4CB 1CRZA 3BVPA 4MVJE 5AI5A 4J2OA 3M0EA 1DTWB 2CFRA 3GLVA 4MB6A 1JAXA 5TSDA 3ZW8A 1YGYA 3B1VA 1VMAA 1FJHA 1XMPA 4XA8A 3Q2KA 4J1SA 1ZEMA 2QRQA 4LE1A 3EGDB 3MLEA 4J8PA 4WCFC 2JW5A 1EGMB 4UU1A 2DUNA 2XQJA 3CUWA 1NVTA 4RTLA 4RY9A 5IDWA 1ZESA 5AM5A 1D4FA 4YO7A 1YH3A 1A50B 1JR3A 1AK9A 5KQGA 2A35A 1T3SA 1TJYA 1IHOA 2HHHB 1E6WA 4E5DA 2OT3B 1KO1A 3JQQA 2V7QA 4HL6A 1XZGA 1CZRA 1J8FA 3NT5A 4V2IA 2J4DA 3IKTA 2CWDA 5CXSA 2J3DA 3VJKA 2DBZA 4CIYA 1R15A 2I78A 1KZ7B 2IYPA 1EP1B 1MX3A 3GFPA 1T0BA 1WB4A 3I12A 3QX7A 4MUAA 5EIFA 3I6MA 3I09A 4UE3S 5D86A 5KYUB 3IIEA 1ECLA 2PQ6A 3L7IA 3PXDA 5LU9A 1P2BA 5FBVB 2ZJ4A 3WGOA 2VPIA 4YRPA 4XM0A 4TKUA 4TRJA 4Y0VA 1T6BY 3G2MA 1XLWA 3STYA 4DRZA 1XLUA 4II2A 1FSSA 2ZOSA 1P6XA 4E5PA 2O6HA 4INZA 2OUKA 2QG4A 2YJ5A 3LCVB 2OC4A 4KPUB 3DOUA 2IHTA 2XDAA 3GARA 3GJ7A 3AB7A 3KVRA 4O4JA 5IJXA 1QUFA 1XFDA 2ZE8A 3K32A 4HWRA 1G7RA 3A9VA 2I91A 1VLHA 1OX6A 1YA8A 2VJAA 3JQRA 2CY0A 2FMKA 4R1UA 4BNTA 4DCSA 1E1DA 1NI5A 2O8BB 1QRUA 1FFXA 4KGZA 4C4YA 1H8ED 4GR9A 3GRCA 2EBHX 2GN4A 4MYRA 1HDZA 3RRNA 5KQMA 3EARA 2WRZA 1ODLA 2WSIA 4WHMA 5AJVB 3K1AA 2ICAA 3IAAA 3C4VA 5CDFA 4GLJA 4M1YA 2VSYA 3CF2A 3K8ZA 1TZKA 1QYXA 5ENDA 1G41A 2GYVA 2OV3A 2V7BA 3R24A 3L8DA 1P7VA 2DU8A 1SG0A 4PAWA 1CUWA 4RLHA 4RSHA 3EWSA 5CYPA 4U9HS 1JHMA 1YUNA 2ZYSA 2P69A 2R2AA 1Z0SA 4LEIA 4UJ3A 1J22A 2GFIA 4M49A 4LMBA 3SVLA 2RKOA 2XKBA 4XUGB 3ZY5A 1VXOA 5AVVA 4GKKB 5AM4A 3N0VA 5G1NA 1JH9A 3S70A 5ITZA 3QF7A 4OGWA 4C0BA 4BX8A 3W8RA 5EIHA 2Q3LA 3FCXA 1Z07A 3H9GA 4GYJA 2AOTA 4J0HA 4AKHA 1XI2A 1XYGA 1GV0A 5IHXA 2G8LA 5FHQA 3UZUA 2IX3A 1LA2A 5EXDA 4MA0A 2ZSKA 3UOWA 4RZ2A 1JEYB 1MJGA 4BC1A 3KT3A 3BREA 2HZ7A 4BRZA 1JDUA 2RHDA 3C6ZA 5ERYA 2A4KA 3P5SA 2C4HA 4HB2A 5JG7A 2P1DA 3TQRA 3ZHBA 1Q21A 4EG5A 3GH3A 5FOSA 4ZEMA 5BYKA 1B8OA 3ERCA 4J07A 1S4QA 4MQFA 3IEMA 2ZJOA 3ZZ1A 1RAFA 3IVCA 1IUKA 2QTNA 4GEKA 5KWVA 3Q8KA 2IYOA 1PJCA 4FYKA 1XZHA 2ONZA 2GAIA 4UNSA 3GIDA 1EI9A 1TGYA 5C0OE 4KQMA 1WB5A 2V6MA 3AFHA 5KTOA 2BONA 1AXRA 4CV3A 4F2HA 2WAXA 4M76B 5AVXA 1RXEA 1M76A 2GN2A 4TSFA 4R31A 1TZJA 5AK0A 1C50A 1JT9A 1S3SA 2IF0A 4IDOA 4BWGA 2FX5A 2VHEA 4B09A 4BNIA 2FE1A 1XD8A 2GTHA 1GNLA 3IP3A 4FW8A 2NP6A 1N5DA 1KJYA 2B0CA 3CC8A 2Z5GA 2ZRGA 4E1VA 5DTQA 1D2CA 1TQ8A 1W87A 1C3OA 4PG7A 3QPVA 1T2EA 2VHXA 1V4BA 2NO6A 3LWBA 4EL0A 4ENRA 3D6MA 4G67A 2YV1A 3OE4A 4GOLD 2XUDA 1JG3A 2UUAB 1RACA 3P2JA 2A0YA 2I33A 2XRFA 5HDQA 4ZQIA 2VWQA 1J5XA 3HXTA 3NIWA 3PRKE 4TVBA 3W9UA 3D3WA 1TE2A 3PFNA 5AVQA 1KMCA 1T2NA 1WCIA 2ADFA 4BMNA 5TMBA 4AJOA 1G8MA 4KJZA 3HN7A 4MQLA 3B3FA 4B3FX 3AV3A 1J7KA 3EIEA 5AHOA 3B52X 2JH8A 1DINA 3QVVA 3C87A 2IXEA 5TRTA 1Z4QA 3CQ9A 1W36C 2J8ZA 1B93A 2OOKA 4RQTA 1RQ7A 1BN7A 2V7PA 1H2YA 2ZVJA 1JN0A 4HAIA 1MX9A 3G9TA 4LNUA 3PNMA 1G20A 1ZJZA 4OTZA 4WK0B 5BYJA 4DCGA 1ZR2A 3PGMA 3FUCA 4PCLA 4ZI5A 3T61A 3C70A 1UPUA 4ZOEA 5HQTA 3LGXA 4M6WB 4PPYA 4W63A 2QTGA 4E15A 1JJBA 3JV7A 5F4BA 1EDBA 3G7SA 1AZWA 2GK7A 4K3UA 4ZEVA 1HNXB 3DWFA 5KNDH 4ZAXA 2ZPAA 5KNBD 2AMFA 2JATA 3DPUA 1J23A 2HK6A 5IAGA 4UEJA 5BPHA 1P9LA 4F6RA 1E3EA 1Q0HA 1H2EA 2ZJFA 3KPJA 2H51A 3ZW9A 2G9VA 4LDQA 1GHTA 3ITNA 4JFAA 4YCCA 4BV8A 1O94D 5HQJA 3TPCA 3AUTA 3CN9A 3OETA 3DE6X 4MW4A 4QU9A 1EP2B 2QHXA 3JATB 4RK6A 3TOSA 2IWRA 2I1QA 2BGKA 5K51A 4M8LA 1AO3A 4N6GA 3TMKA 2P2ZA 4IRMA 2D2IA 5AW6A 1TJNA 2GA8A 1DS6A 4M1QA 2R1VA 2WF6A 3D6VA 1FZTA 4MQ4A 5WRFA 1DQYA 1DT5A 1FTGA 3KTFA 4D44A 2IWHA 4ZYTA 4N0QA 1WG8A 2HTEA 3IP5A 3P20A 1FX0A 3QU2A 2A7XA 1IY1A 3VU1A 3T5TA 2B5OA 2XIJA 1V5EA 5AKHA 3EEBA 2IHVA 4G0WA 3WL5A 3ETCA 1H0RA 1N7GA 1FDUA 3FGZA 4JBGA 1ODCA 4URFA 5KNBA 1FFCA 2P0EA 2ZT7A 3DMHA 3VC2A 4BQQA 1MXHA 4MRMB 1B4DA 1DBIA 4P5EA 1T8WA 5D1NA 1NMZA 2ZVDA 4Q24A 2H1WA 1QCYA 1XTJA 2EDCA 2H8GA 2IYNA 1O94A 1B2LA 2X8BA 2VZ8A 4LDPA 3LVRE 3E5NA 3F6YA 3K9CA 1C0PA 3FPKA 4P4UA 3ZIUA 4BZQA 3WL7A 1QRRA 3FVRA 1YNOA 4PNZA 5U4XA 1C8LA 4G01B 5AKIA 3T3PB 3GNSA 1Z0UA 1N77A 2EJWA 4Y9SA 3PITA 2YJNA 4LFCB 4O4LF 3ZVLA 5KREA 3ZNPA 4AJ2A 2PSJA 3OSUA 5DEOA 2WTEA 1M2HA 5ALSA 2K87A 5B1EA 4JIGA 3UT5B 3VKFA 4KC0A 1EFLA 4B71A 1CE8A 2NZVG 3DPSA 1U5BB 3IJEB 3TKLA 3FCCA 3K5WA 1BKYA 2TECE 3GMTA 1I1NA 3OEED 4MW5A 4NECA 3JAMA 2CLLB 5DZSA 3QU4A 3BMNB 3P9CA 3VPFA 3RVKA 2CFCA 1VIMA 3RR2A 2B6HA 5FA6A 1BZYA 1ZO8A 4ZJYA 1B3RA 4NARA 4YAWA 1Z39A 2YWDA 1B26A 1IY9A 3EGWA 3BCSA 3LDGA 4K9QA 2UXDB 2MCFA 2JFZA 1W5EA 4ALLA 1WX1A 2OZPA 3OOHA 3JZDA 3SYKA 1DPFA 4GD3Q 2Q2WA 2GX6A 4KJXA 4I4IA 1QS0B 4EHNA 4L3WA 5EWLA 2PZEA 3QLUC 4WNCA 3ENQA 3MTBA 2JARA 3PUKA 4FR0A 4L9AA 1Z7EA 2CXQA 3TNYA 1IPHA 2VH5R 1FRQA 3CEAA 3EGXA 1OBFO 1JJIA 2Z1NA 3GR6A 2HJ9A 2DLCX 1VE9A 3VR5D 3NBUA 5JASA 1JFVA 2GBPA 1V26A 1PP4A 2O07A 2ZJ7A 1T6NA 3E3NA 3EXIA 4XX0A 5GONA 4D1YA 1V95A 3UJNA 2Q3EA 5KX5F 3A1FA 4G26A 4HC4A 3RHSA 4Z4CA 3K0KA 3OEEA 4A0HA 4YRJA 2WQ6A 5IG2A 4KGXA 3WNDA 4L6IA 4WMLA 1RWKA 1FQOA 1RQLA 2J5XA 1KF0A 5I7SA 2HMYB 3G9XA 4RTKA 3Q0IA 3GJXC 2NU9A 3WI7A 4G1EB 3M6LA 4JUFA 2GEDA 2O20A 3ZDQA 1QDLB 5FXMA 4HEA6 2XR1A 3T3OA 2GD2A 2D1SA 3D6JA 4QBIA 4PCVA 1GAWA 1OI3A 1MAWA 5HPYB 1FRNA 2P9FA 2V7TA 1SQFA 2JH9A 1SVWA 5BT9A 4YV1A 3VR5A 2VRCD 2PKQO 1AMNA 5LMNB 4YT5A 1ZI6A 4H08A 3GLHB 3S28A 1DQRA 3MQFA 3W5UA 3PGA1 4IX1A 1QHIA 2NQ8A 4P80A 4RNDB 3I62A 3NKVA 2FMFA 3NTUA 1YL6A 5EQJB 1LLUA 1DUIA 4NZOA 1JDSA 3OT1B 4GP6A 1Z8HA 4MQEB 4GI5A 4HQOA 2XQVA 2ZI4A 4XIJA 5L3VA 5FEUA 2KLHA 2QVBA 2J3KA 1X70A 2GPBA 1SUCA 1NV9A 4XUCA 2HN9A 4QIHA 1PEAA 4BO7A 2C5EA 5EKDA 1YZNA 1P19A 4KO3S 4CL3A 1Z4PX 1C4OA 1PQYA 4I7EA 5LLTA 3FYUA 2MSCB 1TVEA 4KXFB 3HCEA 2I62A 3CVWA 2Q1UA 3NC4A 3D7MA 4JJ4A 3N8IA 1M2JA 1PYDA 1XF1A 3MMSA 3SYLA 1XWWA 4BGEA 4BGDA 5HTOA 1EXMA 4OHXA 3CIFA 1RAAA 4M1EA 5HX7A 3FFBA 3DQPA 1Y7PA 4I4TA 4OG2A 4RPJA 2OHIA 3WKBA 2JCYA 1ZUNA 2BSXA 3F6RA 4XI9A 4LWQA 1YHZA 1E79D 1DWQA 1PEKE 4JN6B 1YFKA 4O02B 3UAWA 1XDDA 5JAMA 5C46F 5ESXA 4CDGA 1WWKA 3L0OA 3W3ZB 3RIXA 3S6JA 4F9EA 4PYQA 1R3DA 2PUTA 2DG2A 3EF1A 2ZJ2A 2PEYA 3TO5A 1FZQA 4RDHA 4GMHA 4WINA 4HTFB 3C3XA 5K0SA 1OGIA 4Z4GA 4QUEA 1LFAA 4LQCA 1E1YA 2BHTA 1H5QA 2ZFUA 3EW9A 5EHGA 4TYNA 2ONCA 4UBLA 1K5GA 1T4MA 2I6XA 4NIMA 4QLOA 4RKEA 3Q40A 4Z0TA 3U7RA 3ZI0A 4C6SA 1XTIA 4LDAA 5ESRA 1K68A 2ZRPA 2P77A 5CVUA 1VLQA 3A10A 1QORA 1ORDA 1P9OA 3QA9A 4IIJA 5AK5A 1VJ1A 5ICCA 4JT2A 2E4AA 4LC0A 3AB8A 4AJEA 4WESA 4FHGA 1A4IA 1UKCA 1X1DA 2GPAA 2FWJA 1E79A 1YZLA 2FZEA 3C3WA 3GFQA 3PZBA 4YJDA 5E38A 4H18A 1MABB 5LC1A 4C5AA 2QDXA 3OJXA 1YAJA 2AI1A 1NATA 3NGXA 2XD4A 2IZ6A 4NNPA 5JRZA 5FBQB 3C85A 1DBVO 1T0PA 5T4FA 3WGJA 1GQ2A 4D8VA 2V54A 1RWWA 2MT9A 2V4UA 2EGHA 2W6MA 4KQXA 5DIFA 1UBUS 5F2KA 1KGDA 3R9KA 3TBHA 5J4YA 2QTFA 4BNKA 2ZTSA 4RZ3A 1Y6JA 3NJ4A 3SJ7A 5FPQA 4Q00A 1NNLA 1MQ8B 4URZR 2JLXA 4V3CA 2OM2A 1GR0A 1OFTA 3MERA 5B1IA 2HHLA 3P4XA 2WIDA 2BCGY 3AP1A 4J2TA 1V4VA 1UFVA 2NVOA 3WQHA 2TMGA 4UEWA 4D9NA 3O83A 4WDRA 3BWYA 3FOAA 5HP4A 3G2IA 5EIBD 2ZZMA 1E3JA 1TJ3A 2LCFA 2BW0A 5LOVA 5AOVA 5IJ9B 4LX8A 1OUMA 1KVTA 3A6FA 3DONA 1J8DA 1QH0A 4ARVA 1ZUIA 2M6SA 4UZSA 2E21A 4B0OA 2VCHA 2JI6A 4JSTA 4DWJA 3Q8XB 1X94A 4JXKA 3P9SA 4RQBA 5ABPA 2RGGA 4QYXA 5BNTA 3SDZA 1U0JA 2YC2C 3KYCA 4E4RA 2CMGA 3SICE 2R47A 4MUEA 4D4KA 4ESHA 5B3JC 4H1WA 1OXSC 1D9XA 4MPJA 2IIPA 5TE9A 2HJWA 4OGGA 2DWQA 2RSLA 3NHKA 1UP7A 3GGSA 4J49A 5AHRA 4FONA 4KV9A 4PN7A 1AKVA 4ZCQA 3OQBA 3G8AA 1NW3A 3ENKA 3GELA 3OIGA 4RHYA 4LJLA 4PNPA 4YJ2B 1LPSA 4OL0A 3A6GA 2OQVA 3VPAA 1CS0A 1ZVKA 3ZWDA 1JHQA 1AG9A 3OX1A 3R5HA 2GRUA 1HRKA 1M3SA 3H1FA 4NYJQ 5JJIA 3W1VA 1N32B 4K0KB 3BOSA 2GAFA 4Y6RA 5JJBA 2P2GA 3SLKA 4U2BA 4D3YA 1TQHA 4MZXA 3SX0A 4CG3A 3CZRA 1PJ3A 1RZ3A 2ZUVA 1NYQA 4ZMBA 3AFOA 5KNCD 1G4UR 5CVEA 3A9TA 3BXOA 5CB0A 3CA8A 1SZCA 1WLYA 1HE4A 1NW5A 1E6KA 5FBKA 3IVRA 3KU1A 1XZQA 3MELA 3N70A 2F00A 1VKOA 2W83A 6Q21A 3PEFA 2PSHA 3HUFA 4FX5A 4NE9A 4ECEA 4WKNA 3WISA 3CNBA 1ZD5A 5IC5A 5JDIA 1I6WA 1PJZA 1QVAA 3HLKA 3OLWA 2EHDA 3WWYA 1QHGA 3KKKA 3VDMA 3MWDA 3KUDA 4EKIA 3EHDA 1E2NA 1FFYA 3KPVA 1V5FA 4EFLA 3IURA 5JALA 4NICA 4W9RA 4JDPA 5E3HA 1I5OA 2PZAA 4EY7A 2YVQA 1RYNA 3QPAA 5SYNA 5FQNA 4DL9A 2HA6A 1EFHA 1SVOA 3MTDA 3ORHA 3ZEAA 4ZVLA 3HVRA 2I71A 2QL5A 5FUWA 3TKAA 2WTAA 2FHPA 2GHQA 4GIBA 2YVAA 4IIEA 3OTHA 3HLYA 3UJDA 2G0AA 3IO5A 4EPVA 2PU5A 2EARA 2AW5A 5DNAA 5E9WA 1X2BA 1E66A 1FB5A 2BVNA 3IR6A 4GZ6A 5KNCA 1SVMA 2C2ZA 1PW5A 4AY2A 3P9IA 2A84A 2YWEA 2PQMA 3T7SA 3LTNC 1R8YA 4S24A 5F51A 3SQXA 1F4PA 4OATA 3WGHA 4EDHA 2Y6UA 1VSUA 4CEIA 3P71T 3ND5A 1Y9EA 4OBBA 3TM5A 4FYHA 3VR3D 1NSTA 4BN5A 1VBKA 1GLVA 4MKRA 4MI3A 1BU5A 2CK3D 1L5MA 3VJMA 1E8MA 1T4CA 2WM2A 3D4IA 1YQ9A 2HCFA 4YP6A 1HQCA 1DTWA 3HJRA 3UJAA 1KZYC 1TTHA 1UC5B 2DQZA 4B32A 5KWJA 2XNHA 1YI0A 4GZ3A 2C94A 3VVCA 3ZDEA 4DJ5X 1IJFA 3OSZA 3F3MA 3SFVA 3EGDA 5JYBA 1EWKA 2I3DA 1I5EA 3WRYA 4QDXA 3MGGA 3IAUA 4EJMA 5JZBA 2V0NA 4FYJA 4DJFC 1DDIA 3P8ZA 3QNWA 1E7YA 2SKEA 5TPZA 4IZIA 1P3Y1 4DA9A 2OCXA 4BS9A 1P1CA 1DPGA 2C5LA 2FMUA 2XCLA 4L9WA 3S1AB 1PJ8A 3AU8A 2Q99A 5KU7A 2WHQA 1BXKA 1T43A 5LR6A 3AZPA 1IDN1 2VXYA 4AM8A 1GDHA 3H4IA 3H13A 5DM1A 3ZWYA 2CK3A 1W96A 2IVZA 5BMOA 2ISCA 1FC0A 1OZ0A 2WHRA 4FTWA 4MWBA 3P19A 4QQRA 2FVXA 3ZBPA 5NLLA 5KYUA 2Q4EA 2BFEA 4QUGA 3USZA 2JF0A 4DV3B 3LBIA 3HJNA 5E6UB 3RT7A 3OZXA 4H7EA 3D3QA 4I81A 4JC8A 4IJ5A 2Y6VA 3UK2A 3OMLA 5JSKA 5DNCA 2VDPB 3AKEA 4IS3A 4TT3D 5UKDA 3RB8A 1J24A 4KPUA 1UC8A 3IALA 4Q1AA 3L82B 5NULA 3JARB 3ACBA 5J1TB 2CT8A 3AM1A 1XNGA 2B5WA 3GH1A 3QPUA 5JMOA 4DMUB 1L5RA 3O84A 4D8TA 4FHFA 2X4IA 3LQ4A 3FRHA 3AUXA 5A5DA 4LXQA 2O8BA 3KZNA 4DLTA 2QX9A 3OFJA 4IDQA 1AM4D 1GU0A 3HR8A 1WQ1R 1KWKA 3FD8A 1LSJA 1ZA2A 2ID7A 5AVKA 3LPDA 3IBGA 4EVRA 4D92A 1VPVA 4A3SA 1ONOA 3VUFA 3PXGA 2A94A 3IJPA 2YXPX 1RHMA 3T06B 4JELA 3PEWA 3ZVKA 1HDIA 3PHIA 4Z7NB 5LWHA 1BYIA 1EZZA 1H2ZA 5C53B 4D26A 2FSVA 1KRXA 2VNIA 5E9QA 3JWJA 2HRCA 3B1JA 4RENA 3I5YA 3NV9A 3TLBA 4BC0A 1Z26A 3EXEB 2JGRA 4DZZA 4B31A 121PA 1NASA 3M34A 1NE7A 4TT3A 3BJIC 3UQYS 2QLLA 4R81A 4BUJA 2AQIA 3C41J 3PFGA 5HJ2A 2P9ZA 2W0MA 3MUOA 2FZGA 1BS1A 1XZCA 2JIZA 2PD6A 3KEOA 4MK4A 4IQGA 4NOKA 2W2PA 3D4NA 1ISHA 2GBGA 2BI4A 3TEMA 3JZFA 1YJQA 4RD1A 2G0NA 4IGKA 4EHJA 4RTNA 3H5NA 1N5LA 5I7WA 3HM9A 3B9QA 1QYVA 3KJZA 5HE9A 1E99A 1XWFA 1E9VA 3GZNB 3H65A 2UKDA 3LK7A 5GM1A 2N75A 1JEYA 3B2EA 3HKCA 4O2BB 5A3SA 5JJCA 1SN7A 1PFWA 2Q5JA 4G09A 5DBEX 4CIVA 3B20A 1QYRA 2YXDA 4QUKA 1X39A 3LFHA 3SHTA 3K2QA 3PGVA 1IC6A 3F78A 4L6CA 1HKUA 3GJ3A 3RK1A 4BB6A 5BWMA 2VRWA 4KE6A 3BWCA 5LQJA 3GW8A 3E2PA 4QGHA 1MW8X 1PRYA 5BXQC 2QPTA 3BGIA 9GPBA 1OY1A 3LZDA 3NOOA 2IE0A 2VQFB 1RXWA 4XWOA 3GCWA 3H4VA 3OF2A 5A4FS 2CLCX 3Q8LA 621PA 1TMGE 3OKFA 3Q7IA 4MQ6A 1ANKA 5DHTA 2ZRQA 1Z08A 3H2YA 1ZH6A 5COBA 4PYMA 2Z4RA 3HN2A 3RK4A 4FDUA 5CNMA 3N87A 2ROQA 1E6LA 4BOYA 2D2VA 4JUDX 5FWYB 1K8XB 3I01M 3E35A 1KE2A 3KZMA 3WQQA 3Q88A 4BVAA 1AKUA 3H6KA 5K3OA 5JCXA 2CNNA 4R8RA 4P36A 3SEFA 3VUEA 1DZIA 4RJLA 3B1WA 3OZDA 1VDZA 3BWDD 4QT0A 3FCAA 1UF9A 3NTVA 1DEHA 3CIOA 3IP1A 4D79A 4MWOA 5LMZA 2B30A 3OX4A 2AEJA 4HLQB 3SZGA 4IFIA 5FP0A 2XUAA 2ZJ8A 1P1BA 4MPDA 4UQPA 1A5AB 5M04A 3PGJA 3R0XA 1L4MA 3VPBA 3IT3A 2QW1A 1OWPA 3GFBA 5CJ2A 4MIEA 2OQRA 1J0CA 2IY9A 3HGMA 5T4HA 1Y7IA 4C4AA 1OILA 1JPVA 5J43A 1M34B 2FWBA 2ZDHA 1BRTA 2VQDA 2L2QA 1R0KA 1GCIA 3JQ7B 4AT1A 1NLUA 4ND1A 3P1JA 3E9RA 4KK3A 4MWCA 5FPHA 1UZNA 1RYDA 2YINC 3A6EA 3M89A 1ISMA 1BWSA 2QF7A 4F3NA 1DWOA 1G1AA 3K0BA 4KR9A 3C4QA 1ZCAA 4U8HA 3Q72A 1VG0B 3FVTA 5FT9A 4BAUA 4Q93A 4Z2YA 1T3GA 4RTRA 4D4LA 2Q8PA 5ALTA 1NPDA 3EEOA 1O5TA 4HR7A 2BFOA 3UGKA 1JR6A 3PEEA 4GYYA 1ATIA 1KTIA 1JQBA 4EJFA 4TS1A 4JQSA 4RSMA 4C4RA 2J9GA 3RBZA 5KYVA 4R1MA 1Y9ZA 1DCTA 1B8VA 1XUOA 2FMHA 3CRNA 1NBHA 4JLUA 2NZXA 3F98A 5EZYF 3UV7A 3JATA 1O89A 1XZDA 2H63A 2ORED 4V0QA 1JPNA 1XDSA 1XK7A 1CZHA 2AQHA 4IIYA 2BHNA 5DH9A 4HT3B 2IEIA 1UKVY 2YBEA 1N5OX 2ACWA 3MCUA 4JCOA 4E2YA 1R64A 3HVKA 1P7ZA 4BPRA 2FU5C 2A33A 3KK0A 1ADGA 3K35A 1JEQB 4CCSA 2AG5A 4E7PA 3PWSA 2NO9A 3K15A 1HZJA 1RC0A 3R0IA 5CB4F 4ZOAA 3VU3A 4HDCA 1WXQA 1D4AA 1M8JA 1KPIA 3L05A 4IAOA 1I32A 3QPBA 2X2EA 2QPAA 1Q6ZA 3BTSA 3W34A 1VM6A 2QR2A 1Q0RA 2XV1A 4M0EA 4QXQA 4ZO9A 4BJ3A 4KG7A 4Q9KA 3NXKA 2V7XA 3IEIA 1TF2A 4MR7B 1JXAA 4IDCA 3FOEC 2MMGA 1OH8A 1NNUA 2ZRCA 2YYYA 1RHKA 2EX0A 3F46A 3FWPA 5FTMA 3L5OA 3R5KA 1ZONA 2B2XA 4NOJA 1FUUA 1G21E 2DPYA 3JQCA 4FLFA 4C30A 3VR6D 4DAOA 3R3HA 4Z53A 4LJAA 4DR1B 2QUZA 4OSOA 3WFIA 5KOHA 2XI4A 3HNRA 4PZEA 2P2SA 3C8UA 4WOBA 4EPWA 5E8JA 3VR4H 1Z4IA 1MDBA 4L9SA 4S0ZA 2IH5A 2FZKA 4I9HA 3UT5A 3WLSA 1IZ0A 2EFHB 4RWEA 1WA5A 5I7VA 1RLJA 1U5BA 5C7IO 2WAOA 2FB9A 4P86A 4C29A 4GOMD 4CFZA 2WYOA 3AW8A 2ERCA 1QB8A 3CJTA 4LWOA 3T34A 1LK7A 4H0NA 3MOGA 3WJ1A 1CHDA 2DSNA 5EE1A 4C20A 5EWMB 5LZ9A 4GQAA 4N03A 1RVV1 2DYKA 2K2QB 3JASA 3NS7A 4UBJA 2WIAA 1JDBB 2QORA 1DIOB 4XIFA 2C2OA 3D2LA 1FRFS 3ANMA 2HF7A 2GK6A 2R68A 1NQ5A 2R7MA 4FVTA 4OB8A 2VHZA 1QS0A 2AX4A 1I4EB 3VR6A 5AKJA 3EJ6A 3OOSA 5HS4A 3LKDA 1EUDB 3T1TA 3LQ2A 1DXHA 3K6SB 4Q3CA 1PDOA 4ROTA 3T5DA 3UAGA 5CFQA 3W5BA 3CW9A 2GYUA 2JCSA 2Y68A 4YCDA 3F2VA 3NMUF 5IAEA 2GM5A 3VJLA 3LOUA 1LPAB 3GHYA 1JSZA 3SHWA 3V2HA 4ESOA 1Q57A 4QKQA 4CI9A 3AXSA 2JD2A 5JU6A 5JS1A 4HPWA 3V7YA 1KIMA 3L6CA 4WW0A 4P6VF 1KK2A 3PICA 4LMAA 2XDQB 2UUCB 1AY0A 1WUKS 2RHCA 2PCJA 3KZ1E 1F6DA 2QAIA 3P9NA 1P1KA 3ICOA 4L5IA 1RJGA 1Y81A 1Y6FA 3OWOA 2EZ4A 1YR8A 3S2FA 5M5BA 4P7JA 4GPTA 4ZT3A 2WTBA 3I73A 4OUDB 4CRWB 1U7UA 1JAYA 1D2RA 1R1DA 1KGSA 4KWTA 3HWSA 3A1VA 5K0NA 3ZOZA 4KAAA 1E2MA 1Q7BA 4BKQA 4BECA 1SQSA 2SHKA 3WNVA 4Z3OA 1LLCA 2JLBA 1KFEB 1RAIA 2H1CA 3UIEA 3UWMA 2QXTA 4ND5A 2FW8A 2PVSA 3JQBC 5B2EA 3H0CA 4DANA 2JLRA 3MB8A 3GLHA 4GI7A 4EZIA 3RWOA 4KO2S 2C1XA 1U7PA 1QH9A 2HUPA 2IJGX 4DHEA 2RCNA 3QXSA 4MPRA 3C1AA 1HTBA 2VLIA 3GJ4A 1WUTA 4MQEA 4YRFA 4BGVA 1QP0A 3TG2A 3Q8MA 1F0PA 2W71A 5LBIA 4L5BA 1LRJA 2A4MA 5LQAA 3U16A 2DETA 2HBZA 5K6AA 3A4MA 4JXZA 1RNLA 3C1UA 2PGJA 4YP1A 1XVVA 1UBNA 2XCRB 1X80B 3CUYA 4EA7A 4EPYA 4L07A 4S1PA 2W0SA 3IAEA 1Z2CA 1ICEA 3VC3A 4QU5A 1CUIA 4NBKA 4HRVA 2CYAA 3BMOB 2IHKA 1NBEA 1JKMA 3CVUA 5FA5A 3RTGA 2E9SA 4F3YA 1C3XA 2I99A 1N8KA 1O3YA 1G6OA 5KQSA 1CJMA 3BRSA 5LQSA 4Q39A 4D4JA 2ZJ5A 3ETGA 4XFDA 3TL6A 3TQTA 4V24A 3RJTA 4AP6A 4BLOA 3HM2A 3EVEA 3QP9A 2JIQA 3ZHQA 4IVQA 1Z5ZA 2HDNB 4QARA 4WLEA 1PT7A 5JY6A 1FDOA 5TMEA 5IVKA 3PEUA 5SICE 3W7AA 3BORA 1QQ7A 1P81A 2JGDB 3GFSA 4GRDA 4TVKA 4D9EA 1R0WA 3FWZA 4HTFA 1V6CA 1E1KA 1G3MA 2IXFA 3TECE 1F9AA 2QYTA 4S0XA 3RC7A 2XOXA 1HE2A 3OHPA 1S96A 4XGNA 4E3WA 5EGNA 4G5GA 4OX9Y 1A9PA 4KLZA 1KEPA 1H66A 3LPAA 4PRKA 3UHFA 2CEAA 1DSSG 3G79A 4BU0A 4NU5A 4HMOA 4WQMA 1JIJA 4R5HA 2X4LA 4Z9YA 4AJJA 1YVEI 4Q3OA 4IP0A 1XROA 1ZM3A 4IHJB 4RL4A 4RBNA 5IUNC 2W6PA 1Z83A 1Y3DE 2D7CA 1JR2A 2MSWA 1U4NA 1JDJA 1V6SA 1CV2A 2PS1A 3PVCA 2C95A 4D57A 1QKKA 4JJAA 3FDJA 1G5PA 1MABA 1RZUA 2WF5A 1DO2A 1TAGA 3I1YA 3LFUA 3W7VA 4M4SA 4X90A 4BFTA 1YS9A 3SEAA 4M0KA 4EKGA 2QD3A 1IZ9A 1M73E 1CUXA 4NCXA 3QWAA 6GPBA 2F7SA 3S2UA 5ARBA 2W58A 3L8HA 4ETMA 4YRKA 2B3DA 4AQDA 5F2OA 1YBVA 5JRDS 2HYDA 2O2YA 4X0EA 3K05A 2ZPTX 4IO0A 3ZWNA 9MHTA 4R40A 3L5KA 5JJKA 4RIIA 4U1RA 1M5RA 1BCRB 5LFAA 4QM6A 1SCUB 3ROGA 3B7WA 3S29A 3DCJA 5AM1A 1H0SA 4DTCA 1RBQA 3H2HA 3KLNA 5DI9A 2IIVA 1UDWA 4G9EA 5ITSA 3NT2A 1X0VA 4GVXA 1JG1A 2WJPA 3W8NA 5BMVB 4EY4A 2QAJA 5FIUA 1EDZA 1PYOA 1V1RB 5FL3A 5IJ9A 1N9GB 3ED1A 1X7ZB 2ZE6A 1QH8B 1JKJB 4FDLA 1LPMA 2I7TA 4IS2A 5MGNA 3T9FA 3HE3A 4LNAA 3KSMA 2N42A 3K5IA 2CHFA 4GR4A 2QTWB 3C8DA 1E9AA 2DUMA 1TYBE 3NH9A 3B5IA 3SQWA 2FAXA 2REQB 4GX1A 4EM6A 1QFZA 1K7CA 1QGOA 2BDTA 4WBNF 3I9OA 1XDUA 1L7AA 1P1RA 2OB2A 4HEHA 3FJ1A 3PQCA 3GEEA 1C3VA 4POAA 2NYRA 1USUA 2ZS8A 2GOYA 3PZRA 3QI2A 4K6FA 4BX3A 1US8B 4HXYA 1N6RA 1OXUA 2I87A 3I1FA 3KR1A 1XXLA 2PX8A 1R6DA 4YJ2A 1YBMA 1N1EA 3OAAD 1PTKA 1NVWQ 4CMCA 3FOFC 4LSGA 2XGGA 2B35A 4L5AA 3C6YA 4ZGBA 3WLOA 4G4IA 3K0FB 1SNYA 3GK3A 1HX7A 2P67A 4B6GA 3BFVA 3HRHA 5FNZA 1N5MA 3HB4X 1N8TA 3K4PA 1EVKA 4YRRA 7AT1A 5C4GB 5LBTA 3EFBA 2FW1A 1TTQB 5FLXA 1Q7CA 3PTZA 5BSEA 4UM9B 3QMVA 2QSZA 5A06A 3OHMA 1BAPA 3LUCA 1DHTA 2OAEA 1DEXA 3UMJA 3KJEA 4LRSB 3H2GA 4X7MA 3H5TA 4C2UA 3NGMA 4PX9A 3F3SA 1GDDA 1U0RA 4XVQA 1EFPB 1HORA 3WV4A 1LEHA 2EZUA 4YJFB 5C2JB 5JARA 2EJUA 4OHVA 1GJRA 5CLJA 2WABA 4TMVA 3S40A 4D9CA 3H9CA 4O4HB 2JGKA 4M9UA 1N4DA 5F7ZA 2ABWA 4X93A 3OAAA 4RGBA 5H68A 3W79A 3ESRA 3P45A 3DLHA 2NIPA 1ESDA 2VWGA 3V7WA 1QRSA 4E22A 3O2JA 4RC9A 5EVCA 4QUHA 4CTMA 1HYGA 1CEXA 3E2IA 4ZVRA 2WE8A 1XU7A 3AG5A 5HZHA 3U7GA 4IICA 2ZI3A 2RGNC 2W2VA 1SVIA 1DJLA 2IUEA 5G40A 3K6JA 4RJKA 5TS3A 3A1NA 2DBQA 3SQLA 4BO2A 4EFKA 1VE6A 5ER6A 4YUAA 2XZLA 4XJXA 5EHZA 2NWQA 5K0BA 1GP2A 1SD2A 4RFSB 4S1TA 3GEDA 4ZT5A 1EXWA 4EW1A 3S1SA 3RC3A 1U2QA 2YL2A 4CLXA 2EEPA 2QZ4A 3GDOA 4TMTA 1KVQA 2EKPA 3W2IA 3FKSD 4Q1DA 2RH5A 1ZD3A 1D09A 3NJ8A 3D7SA 3OEYA 4C7MA 5I8PA 3LCRA 4NJEB 1VHJA 4EVIA 2QY9A 1LK0A 3OFKA 5LQDA 2REBA 3TZCA 2FWIA 4L0QA 5TIIA 1MEJA 1DHRA 1TPYA 2OP0A 4MZDA 4N65A 2C3UA 2V74B 3A4LA 1CIVA 1G7SA 2AJCA 4AMUA 1WMFA 4IOLA 2W6OA 2UUOA 1W5FA 4OAPA 4QATA 2VSXA 1MTZA 5AKGA 4ODIA 4HSGA 4O63O 4QPCA 3MWGA 2XAAA 4NYMQ 1E2DA 2OAP1 3WKAA 1SC3A 3AXTA 2GXSA 1NN3A 2AK3A 1P2VA 3NDJA 4WXPA 3G5UA 2Q28A 1YZUA 3E81A 3LYHA 4F91B 7REQB 5CLQA 2ZTMA 1HPLA 2TRSB 4M0FA 3A28A 2X0FA 4ETIA 3I2HA 1JIKA 3MBIA 4NATA 1KIFA 2Z2YA 2Z5FA 3JRNA 2HF8A 1EP9A 5G3ZA 4DNQA 3U4QA 2VJKA 1YDFA 5LDHA 1U3FA 3OPMA 3UUGA 3AFNA 1V25A 1JJVA 1YZGA 3NHLA 2NLOA 2D5IA 3Q10A 1CUZA 4H16A 4IL5A 4MW9A 5EHIA 1WZNA 3GQVA 5F2NA 1R5JA 5HG0A 1ZVMA 3R7AA 4MUJA 5E6UA 4B2IA 4EYOA 1KXJA 3ORRA 4JI2B 1V8DA 4Q82A 1N57A 2ACKA 5FADA 3UXYA 4Q05A 2QN1A 4WNYA 1AUQA 1XCLA 4LYEA 2DB3A 3FETA 4CKWB 3G17A 3DXZA 3JARA 4Y1EA 4Z8XA 4E7OA 4XRGA 3TK1A 5EMMA 3UJ9A 3NYIA 5CCBA 4B3GA 4XD2A 2G07A 4FZRA 4EY8A 1S02A 5HFJA 5L7TA 4EUNA 1XWIA 2XQGA 4I55B 4EKNB 4Q9LA 2DGDA 2RK3A 1D0IA 1ZOSA 3ZE1B 3I61A 1OTXA 2OGTA 3O75A 4UTRA 1ZMTA 3RSOA 4FOSA 1A69A 1ZL2A 2E55A 2IE8A 5LMCA 3PA6A 1IXRC 4L7VA 4EI2A 5BV1A 4HK4A 1OR8A 2GM9A 2YZ7A 3H1EA 3JQAD 4GOJA 4ZOLF 5E1OA 1PQPA 2GCPA 1M6EX 1ZW6A 2VHUA 2WTNA 3AEQB 1UFRA 1VBMA 3P2YA 4M36A 4MVJG 4O0LA 4Q03A 3LA8A 2XBMA 1WDMA 1GSAA 3FMVA 2PS0A 1VJGA 3NEAA 3EDOA 2ZT5A 2BFMA 3GXOA 1M2FA 2FPUA 2W2NA 1F3LA 5DBOA 2GUGA 3SHOA 3EXEA 1YI1A 1OLSA 4EPXA 2CE7A 2CNBA 3L41A 2O2GA 2WM9B 2Z8ZA 1XQ9A 5BSTA 1XZJA 3VR5H 2X76A 5DLQC 4PSDA 4RJTA 1XRRA 1QG6A 4PC1A 4PQGA 4I66A 1GCOA 5AVJA 1X8XA 2HNKA 1E5XA 5HVNA 1K4YA 2XLBA 2IU6A 1L3CA 1IB6A 1OWOA 2GZ3A 2WNIA 2C8LA 1GN8A 1KKUA 4NBTA 4ZV7A 3I83A 3I3SR 4KZPA 3NASA 3BSWA 5IDVA 2G06A 3BDVA 3UW3A 3GZNA 4GICA 1UKYA 3IX7A 1ZVQA 1GPUA 4O2BA 4WOPA 1HRDA 1MB0A 2GCOB 5CIWA 4YALA 1JG6A 2JPDA 2BR5A 4PIMA 3VU9B 1K06A 3GT4A 3CLRD 5H3HA 1CJTC 3T3GA 2X8JB 4IINA 3TQQA 1OIXA 4D8YA 1ABEA 3IAFA 4NZMA 5IJWA 2ZWPA 3ENZA 4UNNA 4F85A 3VPXA 4IIVA 2OECA 1CP3A 2QEQA 4G65A 1ZD8A 4TLDA 4ZVNA 4PZ9A 4Y0NA 1MO4A 4YGYA 1JEAA 3TPFA 2IYWA 2CYCA 4K87A 4QRHA 3WGTA 1ZNWA 3ZOKA 4K9RA 1RCTE 2Y71A 3PFIA 4R98A 2QZZA 1GKLA 3BE4A 1EDEA 1XKQA 3JD0A 3KKPA 3PCTA 4CTNA 4Z6KA 2J3MA 3D0RA 3DE4X 5B6JA 3NUZA 3RUCA 4LF9B 5FWYA 3L7AA 4KUGA 1UXOA 1ZN9A 5JAUA 1HV8A 2VOEA 1WOMA 4BGUA 4DMLA 4GSKA 2CXSA 4F4HA 2FJPA 4TLLB 1J0BA 1Z4MA 1U3VA 3STXA 3UHAA 3D8TA 1SMKA 4Z99A 2CHVA 4DG5A 2CL6X 4FIZA 1YC5A 1ZCFA 1G8YA 2Q1XA 3OTIA 1LX7A 1OU4A 3GZTB 3R9XB 1R5OA 1XDWA 2ZDQA 3MGAA 1DAHA 1PFVA 3PQ6A 3BJEA 3UWSA 4AO7A 3TG8A 1GLNA 4GUAA 4WN3A 4DC0A 1UKZA 4HO1X 1KHTA 1XZFA 2OBBA 3IHWA 1K0FA 1U1EA 3W4KA 3REOA 2XXAB 3HA7A 2C04A 4IJVA 2WP8J 1NJGA 4U6QA 3FYSA 1EUCB 5HIKA 4HSEA 3I4CA 1NW9B 3DJYA 1M34A 1IOZA 4MRRA 2H52A 2WT9A 2YHSA 4BQFA 3WOVA 4FFVA 5COAA 1K66A 2VK1A 1KP9A 4JFRA 3JQ7A 4XGIA 2QG9A 3SLGA 1UIRA 4K86A 3WSTA 4LQLA 3H6HA 4AB1A 5L3QB 5LYJB 2JKVA 3O8OB 4NQRA 4QFBA 3R7NA 4WPGA 2H08A 5IJAA 1VCOA 1HDOA 3ZJ4A 1V9CA 4F2GA 4ZAFA 4RLFA 1YS1X 3L2OB 1OU0A 2UZIR 2WQZA 3PE4A 5IULC 2GBCA 2X9VA 5HRAA 5KHAA 3A1WA 3LYLA 3D02A 4QO8A 2VDOB 1YB1A 1HURA 5DGTA 5T8KC 4AYXA 3HJUA 5BSVA 4WKPA 3IA7A 3ZWVA 221PA 1NN1A 1K92A 5AOAA 4JS0A 4LDZA 1ZJ6A 1DC5A 1TYCA 2AA3A 2YZMA 3GIWA 5ALNA 5EJ6A 3CFYA 2ANBA 4XXHA 4C0SA 4ZVKA 1XVAA 2ZJBA 1JBKA 1K5PA 1VL2A 5BQ5A 2DWOA 3KC2A 1YOVB 4MYUA 4ND2A 4Y9DA 2Y76A 1XMSA 4U6SA 3OZVA 5CK5A 3URMA 4BHTA 4DZTA 2TMDA 3N8KA 3CNLA 3VNRA 2HT6A 4NS1A 5ALVA 5JC1A 2EERA 1N0WA 4IFTA 5HMLA 4X6UA 2H4JA 3A2MA 3LM8A 4DHWA 5KAMA 3UJHA 1C80A 4LYHA 4ENQA 3I72A 4KMSA 3RUAA 5FH9A 1VJDA 3DDOA 4MQUA 2YFKA 4JVSB 1I2MA 1RXIA 1Z0AA 2D0PB 2X14A 4BQNA 4AK9A 4Q4CA 2BM1A 2CXOA 4QPJC 4A23A 4XCXA 2JDIA 3KQVA 2WP0A 2FMIA 2NTYC 1RADA 3I42A 3PNYA 4MR7A 4IMJB 3UMGA 1ZRMA 1ND5A 3TTVA 3FCEA 1UJ6A 2GI4A 4RK5A 1OLXB 1C7ZA 4OYHA 3MS7A 3N53A 3V48A 1Y4UA 1C14A 3PT5A 1T1JA 2H1FA 3CX8A 2HJRA 2D54A 5EINA 2P62A 2IL1A 2VS1A 3K53A 4DAEA 1GZ5A 3BYZA 4C4ZA 1UWVA 1WRBA 3ETDA 5EQDA 1V1MB 3IBSA 3TINA 3I5UA 1RFLA 2VP6A 5DTIA 3GU3A 1JTFA 1J07A 2WR8A 2JLSA 2O5VA 2R5WA 4GPIB 3ZVMA 1JV2B 1ZINA 4OMCA 4K8OA 1MKYA 4O8CA 2P30A 3AHCA