1NXOA

Micarec ph7.0
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
116
Chain Sequence
KKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title Crystal structure of the response regulator 02 receiver domain, the essential YycF two-component system of Streptococcus pneumoniae in both complexed and native states.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Signaling protein
total genus 41
structure length 116
sequence length 119
ec nomenclature
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nxoA00
1YMVA 1HEYA 2R48A 4H3HB 1PHRA 4MLCA 3SNKA 4MAAA 5IBQA 2YHAA 1DG9A 4KK3A 5KQPA 1BDHA 2FQWA 3QELA 1YK1A 1ZGZA 4KPYA 7ABPA 3HUTA 4F3TA 1KMIY 3IP7A 1JFVA 3UUGA 2F8SA 4P98A 2PAFA 1U0SY 1P6QA 2GBPA 4JB2A 2PL9A 1VLZA 4GPAA 1YMUA 4LDAA 4MQEB 1NXWA 3HK2A 2FEWB 2IDMA 4MS4A 4KREA 1BDJA 4IILA 4G0OA 1YTUA 1ZH2A 3NNDA 5JS1A 1A0OA 2JRLA 1M5UA 2V0NA 2NZVG 1W25A 3LMKA 1U8TA 2E4ZA 3SY8A 1SXIA 1R8JA 1JF8A 4EYKA 1BDIA 2RJNA 3BRSA 5IUKC 4Z4IA 2QXYA 4FB4A 3GV0A 4L4UA 4XFKA 2JBAA 3H5VA 3I09A 3LUKA 2LBPA 5GQSA 5KC9A 3CHYA 3MMNA 5FWXA 2QV0A 2E4YA 3CZCA 1B00A 1K68A 4MQFB 5TQJA 3RVOA 3HVRA 1ZGGA 4L85A 3RVKA 3H5LA 3Q7TA 2I6FA 5IC5A 1JLKA 4DADA 3QK7A 4H60A 4MS1B 4F8JA 1GCGA 4FE4A 4MRMA 1ABFA 3N53A 1Z26A 1JH9A 1M5TA 2OENG 4D6YA 3HSYA 4TN5A 1GLGA 4LE1A 4CBVA 3RVQA 5ABPA 2FXIA 1PNRA 3KHTA 1Z15A 4G97A 4EYGA 4NCBA 1JX6A 4N76A 3Q15C 4WWHA 1LJUA 5B3JA 3LOPA 1BVHA 4MYRA 1F51E 3N0WA 5DGCA 4RK1A 2PE5A 5JNVA 5C5CA 3CZ5A 4YV7A 1ZN2A 3H5OA 4G86A 8ABPA 1P6UA 1YVUA 1YS7A 3I45A 1CHNA 3JS5A 1NXTA 4IRXA 3F6PA 3BRQA 4N0PA 3BREA 3O1HB 3D8UA 1PEYA 3CKMA 4P1ZA 5B3JC 6ABPA 4YGXB 3O1IC 5TPWA 2FN8A 2IYNA 4UHJA 1KRWA 2FW0A 1DBQA 5TQ0B 3KKEA 1DZ3A 2HPHA 1XHEA 5TQ2A 1ZHHA 1FFWA 3LFTA 5FBKA 1RPJA 3OLXA 3TMYA 2R4QA 1ISSA 2JVJA 4PICA 5FWYB 5EWLB 2ID9A 4NICA 2WRZA 4G0ZA 4WXEA 3OO0A 1BA2A 2QU7A 3E3MA 1FQWA 1SD5A 1SXGA 2X7XA 1Z25A 4MR7A 5EWMA 3W9SA 2RGYA 1QQBA 3CG4A 2FMIA 3MIZA 1JYFA 3RVSA 5HM6A 3A0RB 4MR9A 4ETIA 3L49A 2NZUG 3LUDA 3JPYA 4Z0NA 2FSPA 3GT7A 2W42A 4OLAA 1LJLA 5T7BA 3QELB 3ROTA 2A9RA 5TPZD 3OQNA 4Z9BA 1J56A 2GI4A 4MPTA 3L6UA 5CHYA 1JWLA 2HQBA 2MSWA 3CLKA 1QO0A 3QX9A 3EULA 2FQYA 4W5RA 3RVLA 3FFWA 1PUXA 3Q9SA 3OO1A 3G1WA 5KC8A 3HO1A 1ZVVA 1RNLA 1S8NA 1UDRA 4KV7A 3N8IA 1K66A 2IPAB 3C3KA 1OXBB 1E6LA 1NY5A 1JHZA 5DKFA 1FFSA 4Z4HA 3EQ2A 1JDPA 4MS4B 2F8TA 4HYEA 3T6KA 4KFCA 2WB4A 1XWWA 3DLBA 2JVIA 1RZRD 3N6VA 4D6XA 3DLHA 3OMWA 2VUIB 3QEMA 1DCKA 3QEKA 4RY9A 5JNSA 1L5ZA 5C5EA 1QP0A 1Z12A 2P9HA 2QSJA 2A9QA 4IGAA 3RVPA 4JAVC 1RXEA 3GBPA 4YS6A 1ZAYA 4JB0A 2FN9A 2NUBA 4QICA 3H6GA 4DQDA 3IPCA 1T34A 5FWXB 2PUAA 3Q41A 4S05A 5CNIA 1A2OA 3DGFC 2A9PA 3KYIB 3N0XA 3RVNA 2HQOA 3T8YA 3FDFA 1LK0A 2RJOA 1MIHA 4WXMA 3M9XA 5IUJC 1EFAA 4RU1A 2WJAA 4RKQA 3HM9A 3OQOA 4N03A 4TLMB 4PYRA 3QX8A 3H1FA 3TD9A 5JNUA 3LTEA 2KYRA 4MRMB 3CNBA 1QP4A 3IDOA 1U2QA 1NATA 3C97A 5KQGA 3VNAA 2E4WA 1P8AA 3JVDA 4IF4A 1Z17A 3NHZA 1LBHA 3M6MD 2PUGA 3H5IA 1ZESA 4LE0A 4ZYLA 5FBHA 3NBMA 1D5WA 4N0QA 3A0UA 3NHMA 1DBWA 2JB9A 4WT7A 4EY3A 2FMHA 1FSPA 1H9CA 4MR8A 2PL1A 3I42A 3K4HA 4F06A 5HQJA 3CTPA 4ZMRA 4W5QA 2PMCA 4KQ9A 1U2PA 4YWHA 5HKOA 3URMA 4M88A 1L5YA 2FLWA 3H5TA 5TPWB 1MB0A 4DN6A 3EQZA 3K9CA 2LP4Y 1MAVA 1PEAA 3HXMA 3IP6A 3IP5A 4O5AA 3F73A 3EDCA 1ZDMA 3KSMA 3KG2A 4Y9TA 1EWKA 4Z4CA 1LBIA 2JVKA 2FVYA 1SXHA 4EVQA 3H1GA 1DC7A 5EWMB 2JK1A 2GWRA 4MQEA 2VYCA 1I3CA 5JNTA 4EUKA 1Z2EA 2PUCA 1ABEA 1NXSA 1YS6A 4XXHA 4JOQA 3C6QA 3O21A 4YLEA 3A3KA 1DRJA 4KK4A 4N41A 4G0PA 5CNMA 3RQIA 2PUFA 4RY0A 3DGEC 4RV5A 1VKRA 3HJFA 3GWGA 1E2BA 3KJXA 4W5TA 1JFTA 3HV2A 1C4WA 3QLUA 4S04A 1DC8A 1QNLA 4MS3B 4XASA 3EJWA 4NQRA 2CWDA 3D02A 1D4ZA 1D2AA 1EWVA 2NT4A 3ILYA 5DTEA 3T95A 3EAFA 4RS3A 4LE2A 4MQFA 3CG0A 1JBEA 3G85A 5JS2A 2HQRA 2QZJA 6CHYA 1E6MA 4IMJB 5BR1A 4NV3A 4MS1A 2GKGA 4QYWA 5E3JA 1NTRA 5CNJA 3F7NA 4JASB 4Z9AA 4WUTA 4LRQA 3UK0A 2MYNA 5CNKA 2IPMA 1BAPA 4PE5B 2VK2A 5GOTA 4Q6BA 3QEMB 2E4UA 4EYQA 3LKBA 3N0RA 3O2QB 2TMYA 3FFTA 5IEJA 3CFYA 3UKJA 3LUAA 3R0JA 3E61A 3JVIA 3TB6A 2ZWMA 2FEKA 5KQLA 1USGA 4XLTA 1IIBA 1NXPA 3QLTA 1QO0D 9ABPA 1VPWA 2VUHB 3CS3A 5IEBA 3C3MA 3SG0A 3A10A 1DBPA 4RXTA 4XAQA 3EODA 4JA2A 1TJYA 1VRVA 1EAYA 3HZHA 4G0MA 1DCFA 1QMPA 2QVGA 4ZMSA 1JYEA 5KQMA 2DRIA 3MM4A 3Q7SA 5EWJA 1EWTA 3O74A 5ED4A 2L18A 3OM0A 4QYMA 4G0XA 5FWYA 3OQMA 2JBAB 3LUFA 3OLWA 1TLFA 2E4XA 4O1IA 1Z16A 4JP1A 3HS3A 5IUNC 2IOYA 2L19A 3NNSA 4E7OA 4RK7A 3JY6A 5KI6A 2PUBA 1USIA 4Q6WA 3B2NA 3KYJB 1RZRA 4Z4EA 2QW1A 4KZKA 4KNYA 2CD7A 1OXKB 1M2EA 3KCNA 3OMXA 1URPA 2CHEA 4E7PA 3QLVA 4FE7A 1CYEA 4EVRA 2WJWA 3GA5A 1A04A 2FMFA 3LUHA 4ETNA 3GRCA 3O2SB 1KGSA 4HNSA 2OQRA 2ZAYA 2MSLA 3DBIA 3F6CA 3HCWA 4OG2A 4Q7EA 5F64A 3KLNA 2PLNA 1D1PA 3P9YA 5DCLA 1JL3A 2Q5CA 3VNBA 3OLZA 4RZSA 3SAJA 2R25B 1SRRA 2BGGA 3QLVC 2IPNA 2B1JA 3GBVA 2PUEA 2QVCA 4G0YA 5BQ3A 1WETA 2FKAA 4TMYA 1CEYA 2N9UA 3N75A 4YP9A 2FTKE 4HNQA 2P4UA 3JTEA 1ZH4A 3SM9A 1GUDA 2XDYA 5T3YA 3IP9A 4LX8A 1RXIA 1DRKA 1Z18A 3BBLA 2NT3A 5BRJA 1KRXA 2M98A 1M2FA 1Z13A 2LUOA 5TQ2B 2FQXA 1EHCA 3LUCA 3M9WA 5I4CA 3FGZA 3DZDA 3HDGA 4GNRA 5HSGA 3RVMA 1JDNA 4PEVA 3MF4A 3C3WA 5KWSA 4MR7B 1MVOA 3GYBA 1YK0A 4OATA 4F11A 3ROFA 4MR9B 4Z99A 4TLLB 4XARA 1DCMA 4G0QA 1ZY2A 4NCAA 4RK0A 3GL9A 2WY2D 2A9OA 3H1EA 3H6HA 3SQNA 4OTZA 3HUUA 1D1QA 5JNWA 3MQ4A 2MSKA 1QP7A 4W5NA 2FMKA 4KVFA 4Z4FA 2B4AA 3O2JA 1ISRA 4KMRA 1PNTA 4IMIB 3CU5A 3HEBA 5IX8A 3KTOA 2PUDA 3JPWA 5TE9A 3LUJA 3OM1A 1TMYA 3NNNA 1NXOA 5IULC 2J48A 2M1ZA 4YO7A 1QQAA 2QR3A 2AYZA 1MB3A 3IPAA 1C0EA 2WWVD 4EGSA 4ETMA 4OBBA 5JNRA 3S99A 1APBA 1FFGA 2MYTA 3Q7RA 2CHFA 3QLUC 4ZPJA 4YR7A 2FLKA 1XHFA 2O20A 4UHKA 1GCAA 4H3KB 4LDZA 5EWJB 3T38A 3H5WA 3O75A 1NXXA 1DP4A 1W9HA 2GX6A 4MLDA 4ZJPA 2H3HA 2PJUA 3O1JC 2LPMA 4RXMA 2YHBA 4MGEA 3TX6A 3LUGA 2HSGA 3FMVA 4PZ0A 3RH0A 1Z2DA 2R47A 2FEPA 1F4VA 5PNTA 3FFXA 4Z4GA 1NXVA 3H75A 2L17A 1E6KA 4LZLA 1DJMA 3MA0A 2JCGA 1AB6A 4YRZA 2IPLA 1USKA 2WMYA 3KLOA 4ML3A 4KRFA 1TVMA 4RK5A 4RY8A 4O1HA 3OLYA 4RWEA 3OLVA 1TM2A 4F12A 1Y1LA 1U04A 5TPZA 2ID7A 1ZITA 3I5AA 5D2CA 2HJ9A 4W5OA 3ILHA 2AYXA 2LIVA 4HNRA 5TQ0A 4RK6A 5BRAA 4B09A 4WZZA 2H0AA 3CRNA 5DLEA 1GUBA 4EVSA 4RDCA 4RSMA 1JFSA 4MS3A 2RDMA 3BILA 2PKXA 3EGCA 2IKSA 4KQCA 5EWLA 3RVRA 3RVJA 3LKVA 4D74A 1YIOA 3TO5A 4N47A 2MYPA 4RK4A 3MYYA 4OLBA 4YCSA 4RXUA 2MYUA 1QPZA 3HDVA 4MR8B 1QKKA 4QPJC 4RKRA 1AB5A 4EYOA 2L2QA 3KS9A 2E4VA 1P2FA
chains in the Genus database with same CATH superfamily
4GYKA 1FYDA 1AF4A 1DXHA 2Q45A 3NIBA 1H5NA 2YH2A 3D6HA 5IWAB 2VHXA 5IBQA 4EY7A 4ACAA 5DM70 3S7TA 2G83A 2WD7B 1PJTA 2D3WA 1VPEA 4DCOA 3QFHA 1DBVO 3T52A 4YT5A 2DKOA 2DYKA 3W1WA 2O5CA 1IZ8A 3N2IA 3Q9UA 4ZOLB 4ZVTA 3EG9A 1IATA 1LNZA 2ECQA 4GLFA 1RQRA 2J5BA 4HI0E 1OBHA 5JDCC 3IP7A 3RC8A 1FMLA 1IY8A 1A7JA 4HB0A 4W5JA 3MJDA 3FOZA 1G5TA 2QJTA 4N49A 2TECE 3PCTA 2HK7A 3RFXA 3V1MA 3L02A 4M60A 1T4GA 1L5VA 3OT4A 3AG6A 4LRSB 2YYSA 2H18A 1SCKA 4L78A 2ZJ1A 5JCZA 4D3DA 3AV0B 5B7GA 1ZJWA 2C2OA 3EUEA 1T8YA 4IEIA 2RH8A 3T12A 4D8XA 4HFMA 1C9KA 4A9AA 5B7NA 3EXHB 5BQ5A 1B4DA 1UXJA 2GPNA 1JF8A 1ZSVA 2FW7A 5LYJA 1DT5A 3GJSA 3CVYA 3IP1A 5AQ1A 1VG8A 1E63A 3IIEA 4Q47A 1A72A 3DKIA 2JRCA 2JBAA 1OFUA 2C3PA 2WKRA 3H9EO 2ATVA 2BM1A 2NO0A 3QTLA 3OT1A 2WPDD 3P9XA 5EKTA 5KC9A 4R0VA 5KNCA 1ORVA 1KPGA 5KOJB 2DT5A 1HE1C 4L6CA 4EX6A 4ZAFA 1FS6A 1GWNA 2KM1A 3NV7A 4MI9A 2BR5A 3DXZA 4TMTA 3RVKA 5J4HA 5IC5A 1EX9A 2WU3A 3C15C 3ODGA 2CYBA 2FSFA 1JQEA 4S24A 5CXXA 4YASA 5E9JA 4PN3A 4E5SA 5BOVA 1B3RA 1M1YA 3SYTA 5IT9A 3OZFA 4C4AA 2AN3A 5G2OA 3UICA 2X8AA 4ZI7A 4I1PA 3L07A 2WZQA 1AM4D 4G5FA 1TM4E 2XUGA 2DZDA 2RHRA 3LL7A 5EJMA 4RFSB 3THXA 1EDZA 4A7PA 3I37X 4YRLA 2N1BA 2OUKA 4YUXA 5T8KA 3RVQA 1NJSA 4O2LA 2OWEA 4HN4B 4O4JA 4A0QA 1KIMA 2YJ3A 2LTAA 3PNPA 3ZJ5A 1IBMB 5EN4A 2O0JA 3CZ5A 4BLOA 2XCSB 5G1OA 1FYEA 2YHIA 4NZPA 1RD4A 1TU0A 2EX4A 1LVUA 3Q98A 3UKDA 3P97A 3BREA 3IH5A 2XZDA 2C82A 2QPLA 3G9XA 4UDOA 1NTOA 2WDPA 3HP4A 2FN8A 3EH2A 4AJ9A 4X1YA 4YAIA 1IOWA 3SGLA 2DCUA 3CRZA 1E1RA 2Y3IA 2BUAA 4PXAA 4E4TA 2QN1A 3OH8A 1X7WA 5GONB 3OO0A 4C0JA 3E3MA 2F43A 4OOFA 4OU5A 4FBGA 1P0PA 3H9JA 2FP3A 4J29A 2PUHA 1SR8A 4XYMA 4E5MA 2Q3EA 3E05A 1FSSA 4K1XA 5HM6A 3ILXA 1GTZA 1LS1A 1RWQA 2G09A 1CDZA 3GEPA 5B3LA 5HZKA 2ZYIA 4P81A 4Q4JA 5EQDA 1IPHA 2J8ZA 2CUTA 1GPNA 2F1KA 2R6HA 3L9WA 3P1JA 2PKRA 5E6SB 3GT7A 4C3VA 3DMTA 3JQDA 4V1CI 1AV6A 2YR0A 5H4HA 3ADCA 4JBLA 4WD3A 1DAEA 3LX5A 1TGYA 3O8OB 4NYJQ 4ZK2A 1IJKA 4MWDA 2G5PA 2JIPA 3IT0A 1U7XA 2H92A 3LC1O 4HYYA 4L4YA 3FSEA 1LJ8A 1XFAA 5FTKA 4QLAA 3S68A 4KN9S 2CLMB 3TMKA 2AJLI 2Q4TA 4WEOA 5IJ9A 3U4QA 3WOHA 3KJHA 3ZBQA 5DHRA 3K6SB 3DVQX 3FHTA 5KC8A 1JTFA 4UCFA 2UXCB 1R8SA 1IY2A 4JYBA 2Z5LA 4KV7A 1IHOA 4QTUB 1WPRA 3C0KA 5ANRB 4DBZA 4V0OA 4FUQA 3VFDA 2OD9A 1D0SA 2DQ4A 2HU5A 3UJNA 2ZJ0A 4MV6A 4BX2A 3PQEA 5JBQA 1KBQA 1T2EA 1XWWA 3EOBI 2D6FA 1E0KA 2GJ8A 3B9PA 1I1QB 3KL4A 1RZRD 2UKDA 2OE2A 3MGBA 4LKRA 4FFWA 5JD5A 5A0VA 2WWXA 3OTIA 1J70A 2O8FA 2F1IA 1Z12A 1J8QA 1LQUA 1DMSA 2B1RA 2QSJA 4MVJE 3TFQA 2W93A 5BYKA 1YBAA 2XOKD 1FXSA 4BYMA 1VMAA 2O8NA 4MWZA 1Q91A 2XGGA 3G8YA 2EX0A 5CEFA 1UJMA 2UUOA 3I9KA 3KLMX 1F2UB 1T1GA 1ZH0A 3L1KA 3MFQA 3LOUA 2HRBA 2UVPA 4QSHA 4XJSA 2CUZA 3WWYA 4ERXA 5BQOA 1EI9A 3ZLTA 2WAMA 1A8PA 2WJAA 4D0SA 5BSUA 1VCMA 2WA2A 3G79A 1NWHA 3KQTA 1OU4A 5DRYA 5AUPB 1GPYA 1N5LA 3GAMA 4ZREA 1LBQA 4B43A 4NPHA 3KJEA 4YP6A 2BMJA 2B7CA 2J5QA 1DXYA 1GXSA 2WBLC 2I4LA 3BDAA 4UAJA 3WLNA 1U0LA 4BKQA 3OQ1A 3RS3A 4JJ6A 3L7NA 3M49A 1IWBB 2E1PA 3AY0A 4K1LA 3NBMA 3T5BA 4NMHA 3UQYS 4FVTA 1DQPA 5BUSA 5SYMA 3R6GA 2VDQB 2CFSA 3IB3A 3CUKA 1CY1A 2BFPA 4BAGA 1JFLA 2Y4OA 3IQGX 1O4WA 2FW9A 2C3MA 3D31A 4JLBA 4O8ZA 3T35A 1RXCA 1P31A 2YCLA 3ZVKA 3CH5A 3KNZA 1XZ8A 1W96A 3QA9A 3O8QB 4ZMRA 4RE6A 3SJUA 3AESB 3QPAA 1RKUA 4HJXA 2G82A 2YFYA 3HB4X 3IEVA 3IJPA 3PXCX 4GQBA 2FJ0A 1G17A 1N6KA 4U6SA 5LQSA 2P4QA 4XUDA 3EPRA 3UJAA 1GAJA 2ZIXA 3OZIA 3TUJC 4B6JA 3V9PA 5IF9A 3PGMA 2DPYA 4YN3A 1R6XA 1AMNA 2FU5C 1GNTA 3L1JA 2BBTA 5BWBA 2IYVA 2AEMA 3PDIA 4KMMA 4FFSA 4PF1A 4EVQA 3C6KA 4DJJA 3RUHA 1G4UR 1ZSNA 1JSLA 4IOMA 1RIIA 3H11B 3E4CA 2WF8A 2GEKA 2QNIA 3EJ6A 5EVJA 3V8EA 3NASA 4CTMA 3GHHA 4PZEA 1N0WA 5JG7A 2PGAA 2ZR0A 5EQTA 3TQOA 5CB4F 5I9NA 3C2QA 4S1OA 1E7RA 2JGIA 1ZGBA 3LQRA 4G0PA 2ZP1A 1F7UA 4RY0A 1MC5A 1VPVA 1OLSA 2E6UX 3AETA 4U6QA 4C0HA 2CCKA 3CNHA 4W5TA 2HBRA 4C43A 5CFOA 2H5JA 3UAXA 5KYGA 3DBVO 1ZW6A 2HW8A 2HJGA 4XASA 2XRFA 1PG5A 2XXBA 4L3OA 4DY6A 1Y8QA 1L7VC 1VHTA 1OX4B 1A4IA 1VIMA 3EAFA 4F4CA 3MHTA 1GAQA 5F77A 4ZTBA 1NX6A 4I4TA 2Z8YA 4LA4A 1JA9A 3AW9A 4M9UA 4XWOA 1DTSA 1E2HA 1R64A 3ELBA 2ZJ4A 3EXG2 3NP9A 4NV3A 3RHFA 3V7YA 3U37A 1HTBA 1TJ3A 3T61A 3W4KA 4ZI5A 3CLVA 4YUAA 4KLZA 1ZQ9A 2AK2A 3FG9A 2CEAA 4G8DA 4LY9A 3W0LB 3RU9A 3HA5A 1UPAA 2CDBA 4MP8A 1N3YA 5KEIA 1V1MB 1ZJ6A 4XX1A 4LHSA 1NVUQ 4LYYA 4YRAA 4BWFB 2X2OA 3UMBA 1IIBA 3HRKA 1YI8A 4L8GA 4AO6A 1OOEA 4RY2A 3DMTC 4I46A 4YMTA 1QYRA 3G2HA 1BXGB 1GGMA 4JIGA 4IIEA 4KR7A 4AFNA 5EMJA 3E53A 4HQFA 3F96A 4EJMA 5BQFA 1K92A 2Y0BA 4HFNA 3D3NA 1K1EA 4ISBA 2YV2A 4P86A 5DEIA 5KOHA 4G0MA 1SXQA 2BFOA 3EEOA 2R97A 1SA0A 5HXAA 3EZGA 2DRIA 4E5NA 4KACA 3FGPA 4X64B 1QORA 2OZVA 1KFKB 1NW4A 2ZULA 3AUJB 3BMQA 4H1VA 4QO8A 2OQVA 2GYWA 4OXYA 1NNEA 2MT9A 3OU6A 4NYIR 1C1YA 1Q3HA 5F23A 3L4EA 2YJTD 4MRNA 1J7KA 1YA6A 2H7YA 3W04A 4JBGA 4F3CA 4U2BA 1BE8A 5HGJA 1T2NA 4G1UC 3WL8A 3AF1A 4HDKA 1V9CA 3NX4A 3PTZA 5E1DA 3TSCA 4G5YA 1A96A 1FSGA 2O3TA 2X7HA 3AUFA 2WVJA 2AYYA 3A9SA 3JV7A 4RJ2A 3UBMA 1CUSA 1RXVA 2G7MC 2O0KA 2CHEA 4GZ5A 5FOSA 2HF2A 2UXDB 2PMFA 3A4IA 3NS7A 1AN9A 1O89A 2YXBA 3IERA 2WJWA 4K9DA 1A04A 4IEFB 3B3AA 4MKRA 3C45A 4RJLA 1LY1A 3MS4A 1JJAA 3NTRA 1K88A 1TE2A 1EFKA 3HYTA 2HX1A 2I4NA 3O2SB 3QJYA 1SUIA 4GR9A 4EHHA 4ER7A 5MDHA 3KLNA 3P9YA 4O4IF 5DCLA 2WG0A 2Q5CA 3CZ9A 3LPLA 5JSUA 1GUZA 1TEXA 5TJ9A 1GA6A 1D6MA 1O5TA 2EFCB 4IY1A 3ZXIA 4E13A 4EPVA 1XZFA 2IPNA 3S1LA 4EENA 3ZKWB 3LBNA 3KJNA 1OV4A 5BQ3A 1AS3A 2GN1A 3AF2A 1ISIA 4U39A 1KI4A 1R8XA 2B8JA 4I14A 1MV8A 2F3SA 2Y4NA 4GBED 5KTPA 1KZ6A 2X8LA 1QRTA 4FXPA 1DEKA 4P4TA 3UMCA 4D8UA 1AT1A 3OFVA 1FUYB 1GTJ1 1W6RA 5T3YA 2NO9A 3NAMA 4Y30A 3QVMA 4UARA 2QL9A 1I3MA 1Z18A 1W36C 1CZLA 2NT3A 2I5PO 3F46A 3KUUA 5D01A 1RRKA 1M34E 2CFCA 1DJOA 4GEGA 4HTFA 4OGGA 3V00A 2ZWIA 4QOIA 1A5ZA 2BWJA 2IYEA 1X38A 4OF4A 3V8PA 5FV7A 2DR0A 2FHSA 4FB5A 4ZOQI 3FF4A 4MDFA 5DTIA 5H1YA 16PKA 1ZIOA 2M6KA 3FROA 3NH6A 5MN6A 4YCLA 4BMDA 1DTEA 3K09C 4CQMA 4EGQA 4LK3A 1B0AA 2LR0A 4URHA 4ZQBA 4Y7DA 4Z99A 4MUAA 1MO5A 4RZ3A 5ALXA 1Q7TA 4ESOA 2LV8A 4NENB 2X40A 5F98A 1HDGO 3RTAA 2GN2A 3QKSA 4OYHA 1VXOA 1WMSA 4FGLA 5HOEA 1TW2A 3FCCA 3I8XA 4EFNA 4Z4FA 5I48A 3RK1A 2YXLA 1FLNA 3DL0A 3LF1A 3K70B 1ZLYA 1C5KA 1WZEA 4TMKA 2WWIA 3CWCA 2A35A 3G0DA 3NNNA 4H6XA 2P3QA 2X0EA 3UFXA 5IC4A 1L7PA 3EQ7A 3UOWA 3WNVA 4YRFA 1RVV1 2IOFK 3VUFA 3AJEA 1OLXA 2DSTA 4Q02A 4UAGA 3UUWA 1N0UA 3CQ9A 3K0EA 3IJEB 4NMWA 1KGDA 4P31A 1N2JA 4YMGA 1B6TA 4NZ9A 4QT0A 5GY7A 2YTZA 3RSZA 1VKOA 1SVUA 4QQFA 4HTAA 4KPEC 1TO6A 2ZT6A 3KOOA 1UAGA 2VHZA 4R54A 3WWCA 2D59A 2B34A 2FZEA 2QPOA 4ZOLF 3TNFA 3MJFA 1JE1A 1JLLA 2FAXA 2VBCA 2JGKA 3LCUA 1XWIA 2J0UA 3FRIA 4M1KA 5EWJB 4ND3A 3OZBA 1AKUA 1U8ZA 3Q2KA 3M6IA 1KDVA 4B4DA 4DT1A 3S2UA 4M89A 4QUBA 4HEHA 1N9GB 1XTJA 2JFZA 2XYRA 3AJ9A 4G26A 1ZD5A 3UW3A 2M6LA 1H66A 5LXTB 5PNTA 2IX9A 2GBLC 4G4SO 4XUCA 1YRYE 4WACA 3RFFA 2DPMA 1YNOA 1EA7A 3ELDA 3P4XA 3LGXA 3LT2A 4UEKA 1V0JA 1YRBA 2GK6A 3FZQA 1OYVA 3KLOA 2C58A 4RA6A 4TS4A 3UV6A 1GZUA 1RWKA 1QZUA 2H48A 4FJ0A 1E69A 2DFNA 3AEYA 4R16A 3KUKA 4RKRA 5ILGA 3BGSA 1QYVA 1ZXBA 1OFVA 3RU7A 1P1CA 4NNPA 2ID7A 2IE0A 1H2XA 1ZITA 3HLYA 4Y2QA 3T54A 3WK4A 1LBTA 1O3YA 1Q0LA 3L1HA 1ZP6A 3HQ4O 1POXA 1RCTE 4WZZA 3EPPA 3WNDA 1P2SA 2YQ4A 3LCJA 4UC0A 3OEWA 2PKXA 4C7BA 4CQJA 5EWLA 5A1JA 2V55B 1ZK1A 3NHBA 1S3GA 1X7ZA 4MULA 1YTLA 2MYPA 1YU9A 4KQHA 1ID1A 1QUFA 4FC6A 3U1BA 3F6EX 4FQ5A 2F55A 1X0VA 2HA3A 1QE3A 2E4VA 4FWBA 1RI2A 1XVUA 2L2QA 2E7ZA 2YC2C 3NBYC 4ND4A 3JQRA 3AEQA 4E3WA 3B3QA 3MJVA 1A97A 4MLCA 2Y0PA 2NAPA 1LW7A 3PKJA 2J30A 3K9FC 3SCZA 2C8JA 1D0VA 2IYSA 5K0FA 5TGTA 1QAMA 2C98A 4URYR 4ZK6A 4ZALA 4E46A 3DDUA 4H4DA 1OB2A 5TQVA 3R3HA 3REQB 3MJSA 3QELA 3GFRA 1YFLA 1XZGA 2DWUA 3LT4A 5AKLA 3CVVA 4N0DA 3ER6A 5A04A 4IOJA 4G5QA 1Z0ZA 1JEQB 1UR5A 2P0EA 1Z6QA 1WPXA 3OOSA 4JLMA 4R05A 5CLHA 3T7SA 3TMAA 4DF3A 2R44A 4MW4A 4XQ0A 1VLZA 1UCFA 4J4BA 3ASZA 4OQPA 1FTWA 3T7JA 1WMDA 2ATIA 4QXQA 3VX4A 1W46A 3K5IA 5TDHA 5KSWB 3PFNA 1QGAA 3B9BA 1VJDA 2J3DA 2VJPA 3GIDA 1ZRNA 2D3TA 3HI6A 5KNDD 3SEZA 1A0OA 1TF2A 3U44A 4F04A 1E9CA 2XYVA 2OSVA 1U4SA 2VPZA 2XTNA 3EVTA 3IULA 3LX8A 3SY8A 5BURA 3QFCA 2PA0A 2PSJA 5H9VA 2VBIA 5GONF 1TF5A 4KYUA 3CT4A 1WY7A 3EHDA 3TXYA 3VYVA 3KB6A 1PWXA 1TU3A 2Y1GA 5ENZA 4AICA 4Z7NB 4OLFA 3ECCA 2QRHA 3OAAD 3VPXA 4LF9B 3S2SA 1XR3A 2BI7A 2D0PB 3CHYA 1O95D 3MRTA 2VWHA 2QV0A 2YMMA 3KWMA 4LTNA 5AXAA 5EJ8A 1F60A 1B00A 1HE4A 1K68A 1KNQA 1ZN9A 1X86B 2C92A 1G8PA 1X7XA 2EJVA 3R6WA 2CZGA 2YYYA 4NIMA 5IBPA 1SOMA 3V1UA 3WYGA 4D96A 4EJ0A 3OOEA 1J8VA 1YZUA 4XIGS 3ZJYA 1V9LA 2D0OB 5HTOA 2INGX 2PBLA 1C2TA 1H6CA 1W0KA 4HAWA 4XVRA 3H2YA 2ZYHA 1N6HA 4S1NA 5C8YA 3T4XA 1M5TA 2H3EA 1NJ6A 1U6KA 5FEUA 3PLAE 1NUAA 2QV7A 2R5WA 5DTMA 3DL4A 1K8YB 2O2GA 4XSHA 5DMXA 3OJCA 5AUNB 4V0NA 4G97A 1OAOA 2AUNA 2QZ4A 3B38A 1RYHA 4FZJA 3F3KA 2RI0A 3N0WA 4REMA 4EPYA 1CDOA 5DGCA 3SQLA 3SK0A 3W8NA 5A5EA 5B57C 3BIFA 1CQZA 1QLJA 3OHSX 3C6YA 1ENZA 3PNBA 4FS3A 1E3EA 3A8TA 4JS0A 4TXLA 1YDGA 2ICAA 1P6UA 5AM4A 1S8AA 3V4VB 4JNKA 3I45A 4HXEB 4ZCRA 1CHNA 4NF2A 3SZOA 2A5DA 1NXTA 2VUTA 3BQNB 3QQ5A 3GLRA 5H8WA 4WASA 5ES4B 1ESMA 3V2HA 2C2ZA 1MJHA 1S2GA 1N4DA 1Y3DE 4UUOA 1SIOA 1WQ1R 3OUZA 3O1IC 5FFMA 4YXWA 1X7YA 3ZW7A 5IBCA 1MZPA 3DBHB 3Q3CA 1GCOA 1Q1EA 3KEOA 3GPIA 1WNTA 1S4MA 3QFFA 4KIJA 3NP7A 4BBZA 5CAEA 2HPHA 1ZHHA 3SDZA 1JG6A 1F14A 5L6MB 1HOTA 1KEKA 1HFEL 3HA7A 4CW7A 1E1YA 4PS0A 4ZVKA 3BE4A 1KS2A 3LQ1A 5FWYB 1U7UA 1TJ5A 3E6AA 4NICA 5KSPA 3RSCA 1U0RA 2G04A 1DPGA 4AG3A 4BIMA 4MR7A 1TRKA 3KJFA 4NDNE 4F84A 3QUQA 4UEJA 4K6CA 3KWLA 3ZBPA 5AHRA 4XVCA 4A8JA 2G72A 3SQMA 2IZ0A 1ZM7A 4RIHA 5L9AA 1C7FA 4GRAA 4J4TA 1PW7A 2V03A 2H4WA 3R09A 2P6RA 2KJQA 5T7BA 5J4KA 1V6AA 1ZMRA 4BLRA 4LBWA 2WF9A 4DRYA 1JR6A 2HQ1A 5FT9A 4HRAA 4KR3A 5A06A 6Q21A 5IK2A 3UW1A 4AJEA 2B98A 2NACA 2KW5A 1OH5A 3A1VA 1JWLA 5DN6A 5C1BA 2R5FA 2WNIA 2VKTA 3PC6A 3ZY6A 1DAPA 1V8FA 4Y1RB 3V48A 3ZDFA 5K45A 3HO1A 3LDAA 2XDWA 5BWOA 1UDRA 4C7OB 3M1AA 4MUEA 2IS6A 1Z6GA 2B4QA 5HCUA 3RS2A 1T29A 2O7VA 4N1AA 2IYPA 1PI3A 2WICA 2V65A 2CBZA 4LKOA 521PA 2FP4A 1KMHB 3LNTA 3FYHA 3JQGB 3W34A 2Z5VA 4MQ5A 3WV4A 1UM9B 2VJCA 3C5WP 4JEIA 3W6UA 1SQGA 2ZYVX 3ZJ4A 4LISA 2FWAA 3WGQA 1IUNA 3W8RA 4EKDA 2F4VB 3WHPA 1JN0A 4Q7QA 3ZVMA 3RSLA 3FCYA 4B84A 1QAOA 3CW8X 3FPAA 3AMVA 3Q7IA 5HKKD 2DFVA 1YVPA 1RAIA 3H6GA 3U4IA 3I6QA 3I58A 1GDTA 2QK4A 2QTTA 2NXWA 2CLEB 2YBEA 4MUHA 1U7OA 2GXAA 2P1RA 4HR7A 3VZPA 1W5TA 1Q7RA 1BVYF 4FBLA 3GUYA 4FR0A 2E87A 1KEVA 1G7CA 2OCLA 1CRZA 1QV7A 4EZBA 1NSTA 4PS1A 1NDQA 5IVHA 3ENZA 1BCSB 2EXXA 4KB5A 3RJ5A 1PJSA 1T6ZA 1DAOA 2DC1A 4EG8A 1VDMA 4PRKA 4YJ2A 2HRCA 4JKIA 1E1CB 4RC9A 4BB9A 2A5GA 4TKVB 4V3BA 1C1XA 5DHUA 1II8B 1LI4A 2JIRA 2LE0A 1SVLA 2VO1A 4PLPA 1U2EA 2Q6OA 1UBOS 3HACA 1X2BA 3I30X 1AA6A 3BT7A 2OQIA 3I6ZA 4HRXA 4IDGA 3OZDA 2AN9A 4U3JA 5L3ZA 4GDFA 1WD7A 2QSUA 3IBTA 4M2LA 5AICA 3TH5A 1AC5A 4JVNA 4MJ3A 2DQKA 4DREA 2XNDD 3PGXA 5BY2A 4DMLA 3EXFA 4YV2A 1U2PA 4ZV7A 3TE7A 2I55A 4C88A 3DDHA 2OG1A 2O06A 4MMXB 5FDFA 1FOEB 5EP2A 4DYHA 1LK5A 1N2EA 1N7GA 2FLWA 4LQDA 4ASUD 4BNXA 4HUTA 1PTKA 4DCUA 3WB0A 1OIXA 5MFPA 1TIPA 1MAVA 1PEAA 3H5AA 3RC1A 5LQAA 1VJ1A 3L8FA 3RS0A 1K86A 2N42A 1TYAE 3B5IA 2RBKA 2ZSBA 3EUFA 3G5AA 3GLHE 4LCEA 1TB4A 1U0FA 4NBSA 5CLQA 1L7RA 4LYDA 4WZAB 4DHEA 2VDOB 4AKHA 2P79A 3RBAA 2XUHA 2JIZA 3DEZA 3PNMA 2Q4RA 4RANA 4S2UA 2RB4A 4JVSB 2GARA 1EVIA 2YJ5A 3K9NA 3PKIA 5H4GA 5EWMB 4X92A 4C6RA 3CNNA 3EDMA 2D1TA 4U02A 1E0AA 2F7SA 2PMBA 2Q6VA 4DJDC 4JKOA 1GV1A 1XQ1A 5AHXA 2Y67A 3R23A 2L42A 2ZT7A 2XB6A 5LQJA 3FZEA 1NPTO 1BQ3A 1YCGA 2ZUWA 4DMHA 2BDEA 4DXHA 2J46A 2VQSA 2R8OA 4V2UA 4B6SA 2ZWAA 1XROA 2Y6VA 2HB6A 2PNFA 1PTJC 3PGA1 3W8DA 1BX1A 3A4TA 4JJEA 3VR5A 1Z39A 3BFKA 1RPZA 3F97A 2CWDA 1EQUA 4GXRA 5CBPA 4GGPA 4CM4B 2DUUA 2Q2VA 2R751 3UXHA 1G20E 5JCXA 1DFHA 2PSFA 2WZDA 3NFYA 4BTVA 5A9SB 4PLZA 1EBBA 4IMJB 5EFOA 4RABA 3TE6A 3UMJA 4AU1A 2HEIA 4JBHA 2A8YA 4KFTA 3GVXA 5KTTA 1I4TD 4Y2XA 3GT3A 4BLTA 3CSUA 3RKRA 3GY0A 3PIDA 4LAFA 1VRCA 3A1CA 2RH5A 4NLLA 1NFRA 1U7ZA 1SURA 2F9FA 1EGAA 2WWHA 2XUQA 3WLRA 2H1IA 4LF8B 3U3XA 2X2FA 2PAAA 3HCEA 1GA4A 3K31A 2VJQA 3CFYA 1MOZA 4TL9A 1IHYA 3EG9B 3E61A 1TPZA 2PT5A 3PUVA 1J5EB 1SO8A 1Z74A 2FRXA 2OGUA 3DC2A 2HLDD 2WUFA 3P0HA 3TRJA 3BMCB 3P9QA 3EXEA 4HEA1 4A8JC 4A2WA 4GI1A 1HR0B 4YJDA 3BIWA 1P7ZA 1JJFA 1LPPA 3EGIA 4QU9A 1D4OA 1ZR2A 5J5VA 2I9PA 3E8SA 2FN4A 4CCYB 3I5XA 1WV0A 4GSLA 3H8SA 1K0UA 3OCJA 2ES4A 3RJMA 4B4KA 5CCBA 2J1LA 1G5IA 1JS1X 4Z5XA 2IVZA 5KQMA 1VSBA 4UPEA 1HTWA 3G2QA 4J1QA 4RPGA 4W9NA 5H82A 4P36A 4QOFA 2FRDC 1SIBE 2JIMA 2VNKA 3WDMA 3GNQA 2B0JA 1REQB 1KFJB 1X7DA 2CSUA 2UZIR 5EE1A 2YVKA 2VTKA 1EDBA 1TUGA 1Z47A 2JBAB 4ZT7A 4O1IA 5I9LA 1WSBA 2WTMA 2Q99A 5A1TA 2DLDA 3OT1B 2GCEA 2G07A 3JWPA 2QX4A 4RQAA 1Y82A 2VDJA 5J4LA 3FCSB 2DOKA 2CLSA 3ESCA 2ZRGA 3ACBA 4LVNA 1B23P 4YK7A 3A28A 4UZFA 5TLSA 4P5PA 1JB9A 5KHOC 2GBCA 1UJ5A 1ZBDA 3HKBA 3RYHA 2PLRA 3LO5A 3CLUD 3PR2B 1P3Y1 4GICA 2NVWA 4GSYA 4KZKA 3EVFA 5A6SB 5JSFA 2ZIEA 1IIRA 3JX9A 2QZSA 4DC9A 2WV9A 3IKLA 1Z4JA 3S1AA 5I6DA 1J2TA 3NDPA 3E9RA 3I92A 2V6GA 2RGNC 5FD8A 3ZJUA 3D5TA 1SXJA 2O07A 1Q50A 2OB2A 1Q7EA 2ODWA 5A4DA 2OTCA 2EU8A 3I32A 4XM0A 2IK8A 1Z4IA 2GD6A 3ASUA 3K3PA 4FOSA 5F12A 1OXSC 2GNOA 4MMYB 5J63A 1W44A 1GM5A 5D6OA 1XNRB 4TVBA 4TV9B 4D5GA 3JSXA 4JXZA 5G0WA 1A9XA 3F9CA 5L53A 5K3AA 4M21A 1IMOA 1NBAA 5LQMA 5FL7A 3JR7A 4IHAA 4P7FA 2FUEA 2WHPA 2YHIB 1GPDG 2CMKA 1T8RA 3FXAA 3DQPA 1T0PA 1U3VA 1VP3A 1WXHA 3AH8A 1E77A 3IV7A 1A9PA 1XJ5A 2AFVA 4HB2A 4RPIA 4UFOA 1H3EA 1TVEA 1DRKA 4K28A 5HA5A 4LMRA 4NX2A 1VL2A 5LXTF 4DEXA 1Z13A 4B7XA 3AP2A 2C5FA 3H19A 2NZWA 4IJWA 4RDXA 3DZDA 1FVOA 1E20A 4KO1S 1E60A 2V5AA 1SJ9A 3AZOA 2HMAA 1G2QA 2AJBA 1LDMA 3C3WA 2F3QA 3MWLA 2G8NA 3U3ZA 3IA7A 5K4HA 2HZ7A 2IP4A 3DTVD 4LYEA 4NOMA 5ULLA 2XGJA 1HYQA 4XTRA 3OCWA 2YQ5A 4YDSA 4ZRMA 1JG2A 4W9MC 1OH7A 3NYQA 3CTMA 4P22A 3ZWXA 2XLBA 1H42A 3N05A 5KTNA 3MUOA 1SKUA 2VA8A 3H1EA 3BHJA 3HEMA 2I7CA 2YV1A 5LQKA 2A92A 2ZYUX 1C9EA 2XUPA 3EGVA 4EHDA 1JDTA 1ESDA 4DEVA 3HBNA 2C99A 3PX7A 1ES9A 2Q3DA 3KAKA 4D82A 3FOFC 3ZV4A 5IX8A 4EO9A 1R0LA 4UEWA 2ORED 1LK7A 2P9TA 3OM1A 5DOZA 2UUPA 3RI3A 3V1TC 4D9HA 1D8AA 3CZQA 3I39X 3O6VA 4FDLA 1JZQA 1Y6FA 2QR3A 2W6IA 3ANSA 3LSYA 1SVMA 4P54A 5KKNB 2IX3A 4EL0A 3FAZA 4QSMA 1NKVA 1UOOA 1G8SA 3ZH9B 4ESEA 1LX7A 1RC1A 2IITA 1F7VA 3PDCA 4LI0A 1UJ4A 5BOSA 4WLNA 3G0BA 1L0BA 4LHWA 3TZBA 4EJSA 5IXSA 1V7QA 3B1ZA 4IYJA 5CA0A 1UT6A 4TOIA 1SB8A 1A9SA 1T3HA 5TV2A 1QUEA 1U3TA 2PNJA 5KAPA 1Z6TA 2JAHA 3FOCA 1LFAA 2O8FB 1KWGA 1QTIA 3ZK9A 2OV4A 1JR4A 1XDDA 1ZINA 3PA6A 2W43A 1ZOPA 3FTNA 1K9SA 3D64A 1Y9EA 2ZYRA 1YBHA 2ZB2A 3CCFA 3STTA 2XCLA 1YB6A 2GLXA 2L17A 1E6KA 2HHHB 1IULA 4M7OA 2F3PA 2MINA 1USKA 2RBEA 1A1VA 4WI1A 4EFMA 4QXPA 3W3AA 1TVMA 3ABQB 4DWWA 5C81A 3WWOA 2JIDA 2YZ7A 2OFFA 5ARBA 1A9TA 1J23A 4F12A 1GTRA 2X4LA 2Y71A 1UF9A 3I5AA 1PSZA 2BR3A 1GHTA 4JSTA 3JQ7A 3U5TA 2AYXA 2EERA 2HFJA 4QNMA 4MUKA 1XBTA 3DVLA 5TQ0A 1J90A 1L5GB 3T0FA 1WW8A 3CRNA 3IVAA 1SCAA 3JD0A 3LCVB 3TRDA 1MO6A 3UCEA 3ZDRA 3LZ6A 3B3JA 1NW7A 1K3UB 2ZT5A 1R9GA 1YRAA 3PB3A 4FXOA 4NOLA 5C8ZA 5GIOE 2PRZA 1Z5ZA 2ZU0C 1N1EA 3KZCA 1RJ9B 4Q1FA 2NUTA 1KOJA 2QEQA 4P3XA 4OI0A 1IOLA 5E8JA 1ZUD1 1H6AA 2VZ8A 2C4VA 4JUDX 4CTOA 2JGFA 4W9NC 4C1BA 1MC8A 5A7GA 1RPTA 2Q9UA 3WGYA 1T9ZA 3BGOS 3GPDG 3QBEA 2DKFA 3DMYA 4Z49A 2O2ZA 1Z83A 1HEYA 3AWIA 4PG6A 4IHQA 1JLRA 2Y66A 3A36A 4DDVA 1QVWA 3PYLA 3DE2X 5ALUA 2ZRCA 3UT0A 1EM8A 1T6BY 4PCVA 1F6DA 3IKTA 5ICMA 4KK3A 3CZRA 2EJCA 4XIFA 1ULSA 3VDXA 1TK2A 1YK1A 2XMDA 2O2HA 3OQPA 1LBSA 3DF9A 4I6GA 1CVLA 2O7RA 3CGWA 4FFMA 4MVYA 2ETVA 4PIMA 3V3KA 3NM5A 3SZGA 3WGLA 5SYNA 1NBMD 1XVAA 1GPKA 4RD0A 2H06A 1N9ZA 1PYGA 1A8HA 2XF8A 4U9UA 4BO7A 4C22A 4YQZA 1NQ5A 3D7KA 1YMUA 1TJNA 3LZDA 4FE3A 3ZGLA 2IHVA 1M0TA 2R6GA 4NAUA 3IDZA 4X1KA 3A6KA 4ENTA 1SXJC 5A4MS 2GBIA 5FUYA 4CT0A 5EUBA 2JGLA 2D74A 2YOHA 3CUWA 1ZH2A 2GKSA 2Q2OA 1X92A 3DT8A 3L7AA 2CB9A 3PPYA 1E5TA 2JRLA 3VJMA 2B61A 5GM1A 1XQYA 5GP1A 2W2QA 3F9IA 4EA9A 3ANXA 1LPOA 2NNWB 2AUMA 4C0AC 3AR9A 4X8LA 1DX4A 2RJNA 4J1SA 2P30A 3O38A 1SN7A 4RMIA 3PXXA 3P0FA 4C1NA 2AL7A 1J9EA 4HAIA 1K89A 3M4ZA 5C1OA 1H22A 1Y81A 1KI9A 1ODJA 3VPHA 3DDOA 1Y8QB 3JATA 5JCOC 5DHTA 1KA9H 2V97A 5L3VA 2C61A 1PV1A 1YS2X 3N3BC 1GQ2A 1SH7A 4MYCA 4WNAA 5K3SA 1ACMA 4HAYA 4IOLA 3WHIA 1FLAA 4WKCA 2DVMA 1Q92A 4M1ZA 3WKBA 2VYVA 4FFBA 1C41A 2VSXA 3ONVA 1EIZA 4GX5A 4RMGA 2ZATA 1FJGB 2V6MA 2Q4BA 2UDPA 3IFSA 2JEYA 3M6UA 4JDUA 4K5QA 4XD2A 4XIJA 4TN5A 3NBUA 4KQWA 4BPBA 5LL6P 3MXOA 2JD1A 4PHGA 5ABPA 4OM8A 1II9A 2P2NA 1JHOA 4K6OA 3K1AB 3SFZA 4PZUA 5AW9A 1GSOA 1G42A 2MR5A 1TDJA 4C30A 1JHAA 1ZM3A 4MGHA 1GKKA 4G0UA 2QVBA 1SCUA 1SCNE 3C5VA 5KYWA 2GPAA 3GRUA 3KQPA 1SEVA 4AZ3A 3VTZA 3PPVA 4BP8A 4EATA 2W98A 4LHVA 1PEYA 1BWPA 2B37A 4N12A 3H8VA 3LA8A 4OL0A 4CV0A 1LDNA 2HSEA 1QHEA 5HF6A 4U0JA 1T2VA 2AFIA 1NL3A 5IFKA 2WM2A 2N0SA 1L7MA 3BMQB 3TDKA 4BEJA 4BVGA 5AW4A 5T4HA 3QBDA 1JVNA 3OLXA 2AKAB 4ZI3A 2V3VA 1KI1A 1G21B 2P2LA 3QUCA 4WPGA 4BB5A 3VZDA 3LT1A 4AMGA 1YA4A 2OBBA 2NXCA 2Q3MA 1O58A 2VDNB 3F90A 3L0DA 3LA6A 4K81B 4B3XA 4HQOA 1MENA 2V7GA 1KFCB 3B5JA 1DJLA 4L4RA 3N6RA 3AXSA 4CF6A 4P0QB 2YMLA 1VIDA 4KRXA 4UUNA 1EUQA 2WA1A 4HB4A 3HMQA 3RYIB 1G41A 3HN2A 1M2OA 3A9RA 2XCIA 3JYPA 2P1DA 3O1LA 4TWJA 1KYTA 1PVVA 5IBRA 1TPYA 4Q9DA 4CM9D 4I08A 4CKEB 4BNNA 1AO3A 1LJLA 3NKFA 5HMMA 1USUA 5IH3A 2VJYA 3PC2A 2P0YA 3U19A 4DR4B 3PC7A 1EP9A 1Y0BA 4GEKA 2JCSA 1KC3A 4Y2TA 4ZPXA 1KI2A 4Z9BA 5A5VA 5B12A 2FPGA 4RELA 3CLKA 1E6CA 1I4DD 1GRVA 4FNMA 1DOZA 2FPXA 2NYVA 3SFTA 3ABIA 5H16A 2YN2A 3F5FA 2W6JD 2RCNA 3BG5A 1RMQA 4WADA 2OCKA 4X85A 5CLJA 1AUOA 3DAOA 5LPNA 3H3JA 2EDCA 2SCUB 3MWJA 1WCIA 2F8TA 1D4AA 2GFQA 2XNKA 1OMOA 2WB4A 4HYEA 2FK8A 4JMPA 2X9NA 4AZ0A 3NC1C 5HBRA 5IVPA 2F8LA 1P3DA 2Q7DA 1Y3BE 3ORFA 5K9ZA 4UQOA 3HFGA 4WY8A 1CF2O 3EW7A 3DOJA 2JZNA 4MWGA 4MVJP 1PT9A 2J45A 1DZIA 2VUSA 3RLIA 3P9KA 1XV5A 5EMNA 4C5AA 2AD1A 4UM9D 1TUBA 2XR1A 1RXEA 3HVHA 2AX4A 1N2IA 3PL1A 3AZPA 4HTFB 2EF0A 3U2QA 4NFSA 1DBSA 2NUBA 3MWDA 5G1PA 2B36A 5T6BA 3SZLA 4AUEA 1BHQ1 2QGFA 5CNIA 1M8FA 3GJYA 1GSHA 3M1IA 3T8YA 5JJCA 3LV8A 3ODPA 3GCGA 2FMUA 2AGVA 1F2VA 4RKQA 2J07A 4X1IA 2VAPA 5IAGA 5HFJA 4X20A 2RHGB 1V41E 3NHFA 4BQIA 3LIIA 5JS6A 3GDWA 4QFBA 3BM5A 3L06A 3W5UA 1E7QA 3UB3A 2GCOA 1Q1GA 2HRDA 2O0MA 1Z0SA 3HL4A 4LMBA 4OBEA 4PSCA 4RNCA 2EJTA 4GT1A 3VQTA 4BLSA 2BMVA 2QAIA 1P2BA 1NNUA 2PTGA 2XY4A 1WHSB 5FBZA 1NHGA 3F1LA 3I9FA 5ALYA 1AXGA 1UODA 1GITA 4RAOA 2LVBA 3QU2A 4L2IA 2J6IA 4N0QA 2GASA 3GCDA 5EP1A 3BEOA 1L9KA 2I66A 1OXMA 2P8JA 1VIVA 2AK3A 1G7RA 3KDAA 4EY3A 3LSTA 2HU8A 2D0DA 2ODEA 2QE7A 4HF7A 4RX1A 5JQWA 4EUFA 5D3MA 4Q4HA 2V5VA 3TQFA 3CSSA 5FJIA 1M73E 1W29A 3D6JA 2VQFB 3QXCA 4Z53A 3WNBA 2HHJA 3TK1A 4CF3A 1MGPA 3LK7A 1LQTA 1JLLB 2PCJA 3M5DA 2LP4Y 2D06A 4QUHA 5KYVA 1AE1A 2J0UB 1E8DA 6NULA 3DEHA 3P2MA 2Q8NA 2RK3A 4OLHA 2YOGA 2RK6A 2GM9A 4MIYA 2F90A 1I0LA 3RS8A 3V6MA 4MYSA 2ZLBA 3G49A 1ND5A 1SZJG 2IYLD 1WU8A 2JVKA 4L4XA 1E1QD 1HFWA 4O2BA 4V0LA 5A05A 3LF2A 3MPOA 3GOHA 4QQRA 5KCZA 3CB2A 2AG6A 3QXSA 3IIIA 2PX3A 3EGOA 1LH0A 4A8TA 1H69A 5KTRA 4QM7A 4XXHA 2CL7X 3D7LA 3DJYA 1HLGA 2A67A 5CHEA 4I8XA 3UK7A 1PT7A 2BEWA 3VAAA 2I6QA 1DRJA 4KK4A 4IICA 5TRTA 3VC7A 3BWYA 3FR8A 3G8DA 5I8WA 1I6KA 3RQIA 3E3AA 4L5AA 3UEOA 4ZCPA 4FOTA 4IXTA 1FPMA 1TZ2A 1VSVA 4BMZA 5JR3A 4GP9A 4GR5A 4IFTA 1TVKA 1I13A 1UK8A 3ZCTA 2Y77A 1XQVA 4J0GA 3T3HA 4BASA 4KG7A 4C06A 5A7FA 3EJWA 1KEPA 3H2ZA 4ZI2A 4H6PA 1B93A 3R0ZA 3T95A 1ZPDA 1GQSA 4XB1A 4U5XA 4LOLA 2YS6A 4WZBE 1M2VB 5LZ5A 1A1SA 3W6PA 2Q4EA 3EHEA 2ZS8A 1WZ2A 4C0LA 4JASB 3MWEB 2HYDA 4LSWA 5CNKA 2RI6A 1UDWA 5K6AC 1OU0A 2AFHA 1KY5A 1DEXA 2JGEA 5D84A 5CDFA 3I1JA 2COUA 1CZKA 3MT7A 4JL8A 4H7DA 5IKMA 2C7QA 2A33A 1R5NA 1VYVA 3P71T 4ZZIA 1VB5A 5ALIA 2P9EA 2GFHA 4TV9F 4ECEA 5KVQA 3PQ7A 3X43A 3TRKA 2XKAA 3EIXA 4NHEA 4FDMA 3M1YA 4IM7A 4PWYA 1TKCA 2ZROA 1R1DA 3QLTA 4OYRA 4HDCA 1U2DA 3U4DA 3U5ZB 3AEKA 4DZRA 2I62A 1QRSA 1N0HA 5JAHA 3ZE8A 5CGZA 3D2LA 3OX4A 2UUBB 3GDHA 3ZHYA 1ZIDA 3LPNA 1U6IA 1XVVA 5KAMA 3TM4A 4EG1A 3NDBB 3HCNA 4NU5A 1XRSB 4OYLA 3WMGA 3KB2A 1Y48E 2JFHA 3AFHA 4AO8A 5JECA 5K0BA 3PUKA 1J2RA 1DRUA 3KOWA 2X0KA 5KVCA 3ESBA 2HNBA 3AIIA 4GPD1 4X94A 2L18A 3OM0A 3W6OA 2CJXA 5KNCH 1RI4A 2ZBPA 1SHJA 3VBEA 1EB8A 2BGMA 4NNJA 1RZVA 4AS1A 4F97A 4B3JA 2E4XA 4IUBS 4JLAA 2JD2A 1N77A 3C1UA 3KVOA 2DTDA 2QN7A 1N0VC 2VF8A 1ZWKA 4P4UA 1MAWA 5B3KA 4PYJA 5FNVA 2EW8A 3CVWA 3QZUA 3NDIA 3IQEA 4QDXA 4RK7A 3KE8A 2A0XA 2C9DA 2EG5A 1X7XB 1WM1A 2ACEA 3GUZA 1FYWA 1T24A 2JJ1D 4H1TA 3GGJA 2QVZX 3VJRA 1ZBQA 5EIBD 5ARDA 4KNYA 2PN1A 1EJ0A 2F67A 2P40A 4CFYA 3ND8A 2J0SA 5D1NA 4DW8A 4FE7A 1EP1B 4I5FA 5C8YB 4EVRA 2B7BA 1Q5PA 1X7GA 2B5OA 3NBKA 4MVJG 4ETNA 1BGXT 1B6GA 2YVUA 1Q44A 3QVTA 3VR3D 3WJ1A 1F3OA 3DT9A 1KGSA 3BMOB 1GGFA 3I5MA 4CM5A 4COKA 1GA1A 3GD7A 4LF5B 3OQIA 4RTLA 1ICEA 2YUTA 4U8GA 2IW3A 2HXYA 3ESQA 1U0OC 3HB5X 2H52A 1GPUA 2JGAA 2ZE6A 4BPRA 1C30A 3KDPA 4QU5A 4ZXFA 2IDZA 2ZSAA 2C9OA 2FFJA 3BD9A 2BTEA 2IF2A 1FDSA 4Z4QA 3SI7A 3FHOA 1AMUA 3SSNA 1U90A 3SEAA 2AI1A 1ZAKA 1A2KC 1FSZA 3FBGA 4XWKA 4ZZ1A 1XP8A 2YRWA 4F6RB 4Q1AA 3M3DA 4ZCIA 1OIVA 4R8SA 5G4LA 1JR2A 1PZEA 2D2XA 3EUAA 4WFQA 4TL8A 3UMGA 3IAM1 1R0XA 1X8XA 3B52X 3G5UA 3NONA 3PXDA 4IDEA 3QYAA 4JP8A 5A03A 5HUHA 1H8EA 5JHHB 1W1UA 4EMTA 1YKSA 4ZODA 3RTCA 3IA2A 5IASA 5K51A 4B33A 4RIGA 1CZRA 1V5WA 4E30A 5L6LB 2NX2A 4GNRA 2FPWA 3QXHA 2I7DA 3B53X 1DAIA 4JLPA 1QKIA 2C4KA 4L27A 5H02A 4XKJA 5FI3A 4O2AA 2AJDA 1QYIA 4MR7B 4KXYA 3HBFA 3GELA 3WWPA 4HG2A 2YWBA 3C87A 3TQRA 4FCCA 3R3UA 1P4RA 2O5RA 1W0CA 4NCAA 4A8JB 3BERA 3SZMA 3PRYA 4BIIA 2A58A 3EWAA 4I5EA 1N8TA 2A9OA 1OT3A 2J85A 5DNYB 4K9PA 1TECE 2QUBA 2CLDX 4IIYA 5BPFA 2OCPA 1VJGA 3H1PA 4OMCA 2AR0A 4WGFA 2UXBB 1ISRA 2X8WA 2PT9A 2UZ0A 3PZRA 4R8VA 2ECFA 2JCXA 1FX0A 1IK4A 4PSDA 2A0YA 4JEUA 3RHZA 4ALIA 2GJSA 1DBRA 2HGZA 1JW9B 1M67A 1TFUA 1AA9A 3FKSA 5CT8A 2QAJA 2ZXEA 1ZM4A 3E22B 5BV8A 3PVCA 3AIMA 1TK9A 3G6WA 1Z82A 4Y0NA 1DJPA 2GZRA 3DFIA 4QG7A 2NSDA 1JHYA 3QHPA 4ZPJA 2R7NA 5GPBA 5A5FA 2OHIA 4WDQA 4CIWA 1EX6A 1FMCA 1JDZA 2QLTA 3OD1A 5B64A 4HWTA 4CM7A 1ZOOA 2WV7A 5ERXA 3UJ3X 1YRLA 1OBOA 2CCJA 2PSHA 2WSLA 4WXHA 3EMVA 3HB0A 5TVKA 3VVMA 1N36B 3KQOA 1XTSA 4NC9A 1FYFA 3A14A 3EIFA 2ZSDA 3KHUA 4QUIA 3U9SA 1ZRMA 1FX1A 3EDRA 3I53A 4DC0A 2FEPA 1WAMA 1UC5B 2RHCA 3WJAA 4Q00A 2OPBA 3TDNA 4EHJA 3AGQA 2P6OA 3IHTA 4BFSA 1JV2B 1RAAA 2X9LA 5NLLA 4QULA 4ML3A 1C9DB 4YVFA 3SYKA 3VX3A 1CJKC 1V2GA 2NTJA 5E7IA 4EFDA 2R6CA 5DX8A 1FW6A 3FLBA 3E3NA 3QY0A 3EC7A 1U04A 4R1OA 3WSVA 1E3MA 1UPCA 1NW6A 3WIDA 4TX1A 4J7UA 3ANTA 1XEXA 3RC3A 4B09A 4MGYR 4AW9A 4O33A 1UT8A 5AHOA 4MS3A 1F1JA 4E51A 1TZCA 3UWPA 4PZDA 1CV2A 2GZ2A 3OEEA 4BO0A 1A95A 2MMGA 2VIIA 4JI0B 3L8EA 1GDDA 1DKPA 1YB4A 2NU9A 4HH0A 1KYXA 1E59A 2X1MA 4PLCA 4RO0A 5FPQA 4Z1MA 3TO5A 1LV7A 4KGVA 1LSUA 2WD8A 2HWXA 2WHQA 3EZ9A 3V5NA 4RXUA 4IH1A 3THYB 1TAGA 3NV9A 4R2MA 4II7A 3W2HA 4QBFA 3I9NA 1US8A 3WSWA 2C2GA 3H9BA 3BSFA 1FPQA 1U2GA 2Z4TA 2Q49A 3OZEA 4L5JA 1ZK4A 3SEQA 1XE3A 2OHGA 3ZE9A 2YHAA 3IAS1 3X1JA 2QORA 3A6LA 4UTVA 1M6EX 4F56A 4RD3A 3ZI4A 5KQPA 1KJWA 4EEZA 5FWNA 1M6VA 2RHJA 2X9GA 1E2QA 3PF9A 4MVJA 1RLJA 2G1AA 1DKNA 4L15A 2DFDA 3CXUA 2A2ZA 5K3DA 4NOKA 4DNPA 4EF6A 3KFVA 3AUXA 4NG5A 3BWCA 3O83A 4OFZA 5ES3A 1GNVA 4QM6A 1IDN1 5EOVA 9MHTA 1GOTA 1HYGA 2D5LA 2RGXA 2JI6A 3P0EA 3ME5A 3NUQA 3B2EA 1KJJA 4BMPB 3W5AA 3SIWA 2O3UA 1ZXLA 5EIAA 4U6NA 4EB8A 2JJYA 4CM8A 2UZ3A 4HXGA 2G8LA 4EY5A 3P5BA 2W2VA 4AKTA 4R9NA 2NP6A 4EYKA 4PSAA 3ELWA 4I55A 1NSYA 5GAJA 4G5OA 1QAQA 3IMEA 3OIWA 1SQ0A 3AU9A 4K03A 3T5DA 3THRA 5HQ3A 5K6TA 1PWEA 1YGPA 1X1TA 2OYSA 2PX2A 1XZEA 3HKEA 3K9QO 3KVNA 4BRZA 1HE5A 4R2HA 4CRWB 5CBPB 2YXNA 4CI9A 5TQJA 1RC8A 3HVRA 1RTTA 4RDHA 5CW2A 4QE3A 4RIIA 4X6YA 1NJFA 2D5IA 3VH2A 1JLKA 5CYGA 1DUSA 4LRUA 2ZB8A 1FJHA 4ZEWA 4HYTA 4GHWA 1P18A 2GESA 3BRWD 4KWTA 4KQ1A 3AP3A 1T36A 2VCHA 1VMDA 3EIOA 1QQ7A 4ZAGA 4DGQA 4GQAA 3DBRB 2C20A 2QY9A 2CCGA 2X5KO 4B82A 4BO8A 1LFDB 1XAJA 2WR8A 5ICGA 2H8KA 3HFJA 5DSTA 5F1YA 4YJFB 3VU9A 3B7GA 4P38A 4Y3UA 3MUNA 2MTBA 4GU5A 2YHUA 4BXOA 1ZMXA 4D9KA 4J2TA 1MEEA 4QXOA 1SNYA 4KX3A 1Z6ZA 2HFKA 3OCUA 2FPMA 3EDOA 3EXEB 5JNVA 5D7NA 5C5CA 1Z2NX 4K8OA 2BMFA 5DHQA 4F2PA 1OILA 2QRVA 1MH1A 3D0RA 1PFKA 3R7WA 1VGQA 3AR7A 4B48A 2HCFA 5ALEA 5EINA 1PEKE 1T4MA 3LLCA 1U0EA 3ADPA 1H1DA 1BJTA 2XECA 4HEA6 3KLBA 2YINC 4DR6B 6ABPA 1NYTA 1QDEA 5TPWA 1H6BA 3JZIA 5IHPA 4CEHA 1E98A 4IIJA 1KJQA 5TNXA 2IJGX 3L40A 3TLYA 2X8JA 2EBWA 1PG0A 2JHGA 1RCFA 1ZA1A 3PEEA 5FTNA 3UWDA 4I19A 1VECA 2VYFA 1CW2B 3B8HA 2WRZA 1G8AA 3FH0A 3FYDA 3AJDA 4PFKA 4B35A 3RKUA 1ID8A 1YB7A 2ZWPA 3LRTA 1EK0A 3BCHA 4EUSA 2NZJA 2EIHA 3OZTA 4YH1A 3T38A 4FQ7A 4O59O 2RHDA 3DULA 1WKCA 3VBCA 2V7UA 3D2BA 4MR9A 5EUMA 4YHHB 4LXYA 3LUDA 4EABA 4ZHQA 3ZDCA 2O3SA 1MBZA 1D6JA 2JJ2D 2WU8A 5EIOA 1UDBA 4V38A 3CMCO 1XB2A 2V0GA 4POOA 4LS3A 4CF4A 1U1FA 4DIKA 4CKZA 4EHBA 2R1ZA 4LHEA 3ROTA 5A62A 2YY7A 2VSNA 3AW8A 4G2TA 1SXJB 4W6QA 2TMKA 1IXYA 2GI4A 5AJZA 1ECCA 1Q7BA 1QCCA 1YI1A 3PGLA 1YUNA 2C5AA 4YRJA 3GCZA 1XLTC 4TL7A 3G9ZA 3RUEA 1UT5A 3VOAA 5F5NA 4DUGA 2ZTHA 1H0HA 3FPHA 4B6OA 2J59A 1Y98A 4FQ8A 1TKRA 2QD1A 4XE5A 5GV8A 1UXOA 2O8VA 2O1XA 3K9GA 3GJXC 2DJIA 4UDXX 3MN1A 1W30A 4ZZ3A 2WTEA 2WHPB 2DPLA 2RONA 1V8PA 1Y4UA 3LPMA 1OTYA 1O03A 4UOQA 3U31A 4ZAZA 1DO0A 1GKLA 2VHCA 3LYAA 2DQSA 3UZUA 2PR2A 1F6BA 1YT5A 3SM3A 5E4YA 1EESA 3IHKA 1XP5A 1EGQA 4L8FA 3ROXA 5JBNA 2LXNA 1ZAYA 1XZHA 5IRCD 4US0R 2HDWA 1SWVA 2C8KA 4I99A 2GYUA 1SCIA 3UJBA 2BC9A 3ZLVA 3R41A 2AXQA 5G0SA 4OBXA 2PWPA 2QMHA 3KYIB 4S12A 4HGRA 5TC4A 4D4JA 3Q6NA 3M6VA 4QA9A 4U1RA 2RJOA 1MIHA 1M6NA 1W49A 1YH3A 3L4BA 3M9XA 4FSDA 3WA7A 4ITRC 3ZKAA 4XDHA 3WLQA 1J5XA 1B8VA 1J33A 3QX8A 4FMBB 5LOVB 1FBTA 4MRMB 3T9EA 1X1DA 2HCBA 4XR9A 2IXAA 4M8NE 1ODIA 3RREA 4NG4A 3X1WA 2H29A 2VTVA 5BN1A 5JTTA 1NE2A 3ADDA 1RWMA 2NGRA 4GIBA 1DKOA 4RF4A 4YJHA 3VYRB 3QH4A 4Y9RA 3SNHA 4AF7A 1JKFA 3B89A 4WL0A 2R7LA 4QYSA 3B7PA 2WJPA 1QGDA 2P3LA 2E5LB 1C8KA 5KOYA 2BD0A 2DSNA 3DVAA 1XJCA 3VVLA 1RADA 2H1RA 1MIOA 3CM0A 3KB1A 3R7DA 3AEZA 2CNWD 1NW5A 2KS6A 2QM7A 4AMZA 1IHXA 2CMHA 4HO1X 4MP6A 4X95A 3NDRA 3P0RA 4YIKA 5FEMA 4EA7A 5BOSB 3CEPB 4DZZA 1GZHB 1PFYA 1MB4A 5CA0B 1XYGA 4JCOA 1SM4A 4ZCQA 4ALMA 4GOLD 1G5RA 1UMDA 2JJQA 3PI7A 5FWAA 2RGRA 3BJZA 3HXMA 3WZ2A 1M34A 3IP5A 2JI4A 2D4AA 4HSEA 3THWA 4R2LA 4Y9TA 1EWKA 4D4HA 2JLXA 2WJHA 3TEJA 1O54A 1J2UA 4D43A 5JO0A 4HX9A 5KVAA 3ZYCA 4BZQA 4QO7A 3A9UA 2QLBA 2OKCA 3GFGA 4X0EA 3F6YA 4PIVA 2W6ZA 1I3CA 3KTAB 1BMFA 1CY4A 3E1GA 2V7XA 2MINB 3MTDA 4E5KA 5EP3A 4YQYA 2O1EA 3C6QA 3VVBA 5IJZA 3AQ4A 3MMSA 3LCCA 5A4IS 3PQCA 2BKAA 4DVJA 4AWAA 2Q6LA 1FVXA 3R9XA 3AVYA 1WDWB 3V4OA 2VBGA 4RV5A 4CT4B 5J2TA 3AF4A 4DGSA 4Q01A 2H1CA 1D07A 4ZOAA 1E2BA 4V03A 1KDPA 1XDBA 4OP2A 5HF5A 2Q8QA 5AKYA 3VKFA 4H18A 1QNLA 3LVBA 2AN4A 3A6PC 5TY0A 2O19A 3L8DA 4CV3A 1D2AA 5KVVA 4ND8B 3WRXA 1TZJA 3B1VA 3G0CA 1KRWA 2NUTB 2FPUA 2W11A 4C4PA 2ZRAA 2REXB 1W19A 5CYOA 5FB3A 1V43A 2A7XA 4BO6A 5DXFA 3CX8A 1HKUA 4OXXA 5C8YF 3ENKA 3PX2A 1JKMA 1M9NA 4TMWA 1JHRA 1NV9A 2JI7A 1C81A 5CNJA 1Z0AA 4L3WA 4DV6B 4WK0B 3DW3X 3NMUF 2VLIA 4HDAA 4GD3Q 5F51A 2ZB4A 2PMEA 1EM8B 2OHHA 4DIMA 1B26A 4DA0A 1WU7A 1GU7A 2ZRNA 4KXMA 2IHJA 2Y1EA 4GI2A 3UKJA 2IYQA 3LUAA 5DXJA 4YX9A 3TB6A 3VH3A 1JILA 2R8PA 1Z5GA 4W9RA 5P8WA 5L7TA 2IXEA 1PYOA 1BROA 2JLSA 2MU1A 2OGSA 2P1ZA 3W4IA 5LQDA 2NNLD 4TS9A 4Y2JA 4I1IA 3AHFA 1NUPA 1P9RA 3MINB 3MGKA 3B5EA 4X1KB 2W6PA 3PSHA 2IUUA 4PTYA 4LQCA 2H08A 3V4FA 5FUQA 3EODA 3MJHA 4RZHA 3HSKA 1VRVA 1EAYA 4UBMA 4P7GA 4C08A 2F1RA 5FI5A 3W06A 4X7BA 4AN4A 4DMUB 5AFSA 5BSFA 2ENWA 1CY2A 1RU3A 2OCBA 1CCWA 1XK6A 3B48A 2PXAA 5E9QA 4I1UA 4NULA 2YWFA 2CKMA 3DDWA 2BKEA 4UHHA 4G0XA 4BWGA 2WK1A 3GDGA 3ID6C 4C6HA 1PD1A 1QB8A 3KBBA 3LUFA 4DG8A 5M5BA 3FA2A 3M34A 4MKFA 1XC7A 3QMPA 2RI1A 1SCQA 1LDBA 4FFDA 2BHLA 3N8KA 4R9UC 4CIDA 5K0TA 1JVBA 3BULA 3GJTA 3H83A 4TRRA 4TYYA 1PS9A 4L7QA 3HJBA 3WBFA 5FX2A 1JDVA 3TR6A 3TCXB 1SHKA 1N4AA 4HWKA 1JHXA 1IHUA 3OZAA 1URPA 1Y1KE 4RF3A 3HC7A 4LJLA 4OO3A 3ZI7A 4FFBB 4DYDA 3GLQA 1DQSA 1CEQA 3LUHA 5JCJD 3ASVA 3FKJA 1QK5A 1Y8AA 1RZUA 1ECJA 1GQRA 4DBLE 1WZIA 2WW8A 3HCWA 1ACJA 2OP0A 2QJOA 4MV1A 2W58A 4NJMA 1D1PA 1L8AA 4DDWA 4GKKB 4B85A 2XCQA 1CC1S 4OFBA 2EJWA 1FFHA 2EBHX 1SK9A 4L50A 1SUDA 4C29A 5IXYA 4BAUA 4B87A 4KE8A 1W85B 4YI3A 2VNJA 1SCUB 4YAJA 3WIEA 2PVCA 2Q5HA 1OVGA 3MWGA 2AEFA 3O8NA 5NULA 2HHCA 2IODA 1TQ8A 5SZJA 2XGOA 4JC5A 2PT6A 4NABA 4WNIA 2P2SA 3A6JA 5E7QA 4GKJB 2W5UA 1XZBA 5AO9A 3QPCA 3SLRA 1RYZA 4D02A 1E1MA 2O1WA 4R1NA 1NOJA 1K08A 1YKFA 2AFIB 1BD4A 3DR5A 2M98A 4R1SA 1Q7CA 4CPDA 2LUOA 5ARCA 2BJVA 4L1KA 3USZA 3A2NA 1XMPA 4JXJA 2QAGC 3OI7A 2R11A 3MTIA 4QBTA 1ZOLA 3TI7A 3WAJA 1SUWA 4JFAA 5E6UA 2AIRA 5LN1A 4A15A 3C24A 2DWQA 1H2ZA 4RLQA 2ODTX 2Y2VA 2BFBB 4E5VA 4ETWA 5K09A 2QUHA 3QNMA 4GI7A 2J32A 2NPIA 3ZJVA 4ZOEA 5LC1A 4KUEA 3PEYA 3GYBA 5IKXA 1JMVA 1UOPA 1E1LA 2QB5A 3A3YA 3TN7A 1M2OB 3OKFA 4G4JA 3SC2A 2P4SA 1YQWA 2DBQA 2F9MA 4W1SA 4ZVMA 3WL3A 1N57A 4I50B 2QQEA 4KBGA 2IY7A 4Y1EA 1L5KA 3UJHA 4IHJA 5DTJA 3SX2A 3L84A 3E5NA 4RJJA 1Q1QA 3INNA 3HEBA 2FPGB 4E6PA 5KMGB 2I3DA 4Y9SA 4K9SA 3LUJA 5TE9A 1SU7A 2HJSA 3I72A 1KI6A 2P6UA 4EW6A 3MJTA 2BFFB 4WBSA 4AUNA 4PLWA 3H13A 4UBJA 4L9WA 1N5JA 1R4NA 3KHKA 4MCIA 4OGLA 3W2TA 1I2BA 2W6MA 4Y2RA 5KKCA 1QQ5A 1ZD1A 5HWSA 1Q57A 4CKBB 4AZ0B 2FZKA 2V6FA 1ZISA 5E7MA 2R1VA 1NYLA 3BB4A 4E08A 3D3EA 2F1HA 3LI2A 3N8HA 1JHMA 2B3DA 1OGYA 4HQRA 4BWVA 1UPXA 3T7KA 2I9KA 1NVVQ 4PZZA 2R00A 3CX7A 1F6WA 1TUBB 2VPQA 3SHFA 4EBFA 4P4LA 2H4FA 2YHBA 3LUGA 4EPWA 1J0EA 2QRMA 3MWDB 3IAEA 4QGGA 3O8BA 3K70D 5L8VA 2G9VA 5KPJA 1IBSA 1U11A 4MV0A 2DY1A 4P83A 4YCBA 4OA8A 4LZLA 4WFIA 4CL8A 3E3OA 1P60A 2H51A 2WEKA 2ET6A 1ULTA 4E12A 3PQ4A 4AZVA 1Q1ZA 4KO2S 1V37A 4BX9A 4HMPA 1SHUX 1WMAA 2VQEB 1SKAA 1Q3KA 1COWA 4JR1A 4RK5A 1GZ3A 2IF0A 2I4IA 4X20B 4RCVA 4WFKA 4J0IA 4RWEA 2J6BA 2Q3CA 3GJ4A 1K5GA 3LP5A 1T4CA 2EP7A 4CTJA 4AP6A 5KJFA 4X66B 3GLFA 4HNRA 4G67A 1X9IA 2BHTA 3AHIA 3G0OA 1NMYA 3H6KA 3U16A 5THQA 1Z0KA 1SEPA 4C87A 1EUDA 1U0GA 2OK7A 1J24A 3FR7A 2ZJ2A 3HY4A 2IZ1A 4MITA 4QNNA 1QE5A 3ZYZA 2ZOSA 1W1IA 2MSDB 3B9QA 2Q7XA 1T6XA 2X0RA 3O95A 4U7DA 3ZVNA 2DHQA 1YIOA 2VPXA 3EWIA 2P2DA 4L2IB 4PG5A 4Z8YA 4OLBA 4JV5B 3FTDA 1Z6AA 4KQXA 5EHNA 4UATA 1AHHA 4Q4HB 2J6CA 3F0TA 4G63A 4DLRA 4RXTA 2GB4A 1HDXA 3BQMB 3HGTA 1SKBA 3TINA 4ACBA 1X3SA 3AZQA 5REQA 3KD2A 2P9JA 4FILA 4GXQA 3U13A 5KTYA 3PXEA 1UFRA 3OE5A 1NONA 1ONPA 4QBIA 3X1KA 3EPJA 2CNLA 3RBZA 2C04A 3STUA 4W8HA 1M2JA 1KDZA 3E0QA 3UA4A 3FWPA 2RMKA 4HC4A 3HUTA 4KWIA 5DYWA 4F3TA 5AKXA 3KP1A 1P9WA 5AVVA 3PIRA 2AX3A 1RAHA 2NADA 2HNAA 4MVXA 1I1OA 2OR3A 4PZPA 1P6QA 2G4LA 2NZ2A 3K94A 5I4BA 4EY6A 2Q1UA 2GT1A 4OHBA 1C3JA 2GPJA 3ND5A 4S1TA 1JQBA 4XIYA 5I4CA 3TECE 1VHWA 4G01B 5IM4F 2EL7A 1BDJA 3INTA 5TARA 4TVOA 5FNZA 4Q34A 4Y2GA 4AB1A 8ADHA 2BEWB 2G9UA 1UZNA 3UV7A 1TIKA 2H16A 2V0NA 4KUHA 3WMRA 4BQSA 5FPKA 2AR9A 4QGBA 3RE1A 1PFQA 2PTHA 4RD2A 3T5GA 1QCZA 3I4LA 3L6OO 3SMVA 1JXAA 3U81A 3GJ0A 4CCSA 2VP5A 3DB2A 4FB4A 4Z4IA 3EC2A 4NYJR 4HDRA 1PJZA 2Q2NA 3OQHA 3PC8C 1NE7A 3ZIUA 4EO4A 5J5CA 1I7DA 2FZGA 3MMNA 5AJHA 1RXYA 3F1KA 1E32A 1SPBS 2K2QB 4MRSA 3N3AC 5KUTA 4CEJB 3EGXA 4LF4B 3OCVA 1AK9A 4AROA 4ZCLA 3DHNA 4FDTA 1XD2A 1NW8A 1XOIA 4IG9A 2UU9B 5JAPA 5BSTA 1ZJ4A 2CLHB 3KPYA 1QVAA 4NVRA 4O4HA 3SYRA 1U63A 4K6FA 3T9BA 4S1WA 4W5HA 3CWQA 4BNKA 3GVPA 4NJEA 2C4WA 3B1FA 3GJ5A 5D5HA 2I99A 1WW3A 3OJXA 1KZHA 4BVBA 1MFZA 4E2WA 5JAIA 1DMRA 3DHEA 3GLHA 1PNRA 1A7AA 1ZK0A 3DUFB 4HDNA 4JY7A 1ZKDA 4AKSA 1O97D 3CUSA 1GIAA 4PC7A 4WWHA 3U7QA 2BFAA 4WMLA 4ENVA 5ILOA 3QY9A 1H4SA 2GD0A 4M0CA 4PYMA 1L7EA 3WBJA 4G1FA 1UKYA 2X2PA 3AR3A 3VHRA 3PBKA 2F17A 3AEKB 4W6ZA 1X1AA 1NBEA 1UADA 3NCHA 3QIAA 4C7VA 4DCNA 4NARA 4J7XA 1XEAA 1YI0A 2JGDB 4HQKA 4IRXA 1NMXA 4RVUA 5BWMA 2C00A 1A8UA 2YN4A 2X5OA 3UJPA 4QZVA 1JALA 3DLCA 3SVLA 2HM7A 1RHMA 4RLFA 2UZ1A 4UHJA 3U7HB 4TT3A 4ITVA 5ECGC 2FW0A 1DBQA 1DZ3A 2A4KA 1Q2UA 3IIKA 3HY3A 3KKPA 3LFTA 1SBTA 3ADOA 2WUVA 4US2R 1SKYE 1VKHA 1BGVA 3DL7A 3GGCA 2J5RA 4GPZA 2YY5A 1J21A 5DASA 2AF3C 4GWGA 3DWGA 1EJ6A 3K16A 4G9EA 5KBYA 2FEAA 2XVYA 3U4CA 4YLGA 1G20A 2B1GA 5K3OA 1AKQA 2FWPA 1YCHA 3GQVA 4EOGA 3ZI0A 2HY7A 3RVSA 5LOVF 3A0RB 4DLVA 3A3NA 1G7SA 3AFMA 1U5BA 3L77A 3A9VA 2YNMA 1NT2A 3FMFA 2R00C 5BXYA 3CLSD 1TL7C 3ONNA 1FFXA 4EQ6A 3EGEA 3JWGA 3QBTA 2IYXA 1MUUA 1WNFA 1CBUA 5DLYA 2IY9A 2DPGA 4N8SA 2A9RA 5TPZD 1L5LA 2W9XA 2LCFA 2ZKIA 4AG5A 5L3SA 2GUGA 5MFZA 1AUQA 4YP0A 2FFRA 1YZ3A 5G0TA 1F0YA 1RQNA 1I1HA 3CH7A 5JS8A 2PL5A 5I5EA 1T9KA 2ZSIA 3G1WA 2BEUA 1CB0A 1MW9X 2O52A 2CVZA 2B6HA 4C3ZA 1QHFA 3FCAA 3IQZA 4BB0A 4ECAA 2B2NA 2W2LA 821PA 2ZJ6A 4Q1EA 3EQ2A 2LD4A 4I3GA 5DCYA 1V1RB 5CA0F 4NYMQ 1C0IA 4KFCA 1EVLA 2LDXA 3LVQE 1JXMA 2CLLB 4DQVA 2QTMA 4CI0B 4YRBA 2IEDA 1GGNA 4N7JA 5HCNA 2RG7A 4Q24A 4W63A 1J9GA 4HGNA 2NQ8A 1L5ZA 1VC2A 1ZGHA 3IT2A 1U5AA 5C5EA 3VKUA 2QTNA 1GZ5A 2DWOA 1ZN8A 3QVXA 1P6XA 3IT3A 3WRYC 1QO9A 3CVOA 1MXHA 1WB5A 4UUQA 3SLKA 3ZLJA 1L5NA 4DQDA 3IQDB 4O25A 2RGUA 4EAQA 3IAM6 4JUCA 4LOAA 1IZ0A 1E2KA 1WWKA 4OV6B 4R69A 5TGZA 5DNEA 1T5LA 4GWKA 1KP2A 5LLTA 4O2AB 1LK0A 4G2NA 1EFAA 1J49A 1JECA 1THMA 2WKPA 4C4OA 2GS9A 5CFNA 4RACA 3VAYA 2WNHA 2C88A 1KAHA 1ZK3A 2WMNB 3JQ8B 4PLYA 2WTAA 4D80A 4ZGGA 1CQIA 3GB9A 3I83A 1FRFS 2PGDA 1UBLS 3C97A 5FFNA 5KQGA 3G0IA 3Q7EA 2C2YA 3WC4A 2J3QA 2ZCUA 4Y2UA 1GZSA 4IIDA 3QV2A 1FRNA 5FF9A 3P0JA 3LU1A 2VHWA 2AXEA 3A6HA 4DWOA 2YASA 4IDPA 5CA1A 2QSYA 2ZDQA 2ZRLA 3QFTA 1B14A 4RVNA 3UK2A 2XNHA 5T67A 1P73A 1I5OA 4EYSA 2VNIA 2QRZA 1DU4A 1GQFA 4QKQA 3E7DA 1QFJA 4WEQA 1DGQA 1DBWA 2WFLA 2FSIA 1CUDA 3GLKA 2C2KA 4X90A 1SIUA 3RJZA 1QNFA 4WXRA 4R5HA 5EMLA 1JNYA 1OD6A 4PO9A 5DSXA 4X1IB 2X8BA 1VL0A 4R9SA 5C3UA 4QVIA 1HQCA 5P21A 1VXRA 3GRKA 1J2JA 3I4FA 1O0BA 1YONA 2HMYB 3ICWA 5FA5A 3FVVA 3KHSA 5ELMA 5KU1A 2VAXA 4XPIA 1TQ2A 4X93A 3VDNB 2CL5A 2PX5A 2G76A 2Z95A 4E5PA 1KH3A 4MO9A 1L7BA 1WP9A 4DSTA 3ZHOA 1GU0A 1QGZA 2Z2YA 2L69A 1HT3A 4FLEA 4M3NA 4CL3A 1O77A 3AJ8A 1QRUA 3VPAA 4BNZA 4IMPA 1C8VB 2BDTA 3LLMA 3UJDA 3W3AH 3IE1A 2CXQA 2NOAA 1CVRA 1GEEA 1OKKA 2ORWA 3PCRB 3AFNA 1YBMA 2UZAA 4I66A 4BCDA 2Z3ZA 4CHTA 4XUGB 1A4UA 4IGKA 2F3RA 4LJSA 2HREA 2PDAA 3BVPA 4URFA 3ZQJA 2W70A 4BN4A 2PEZA 2WJIA 3WP1B 3JU3A 1U0BB 2I6XA 3PIIA 3STHA 1QO7A 1J8MF 1HRKA 4GWLA 2W8BA 1XEXB 3EPHA 2BTQA 2BZGA 2QT9A 2V1XA 3QLUA 2PH1A 3O8CA 4WOCA 1CFZA 1DC8A 2ZCJA 5K8LA 1E89A 4IEEA 4MS3B 2D7CA 2XUAA 4XYBA 4MQBA 4W4TA 3PFGA 4KXLA 5CVJA 3ILYA 4PVCA