5H4HA

Structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 2.2 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
144
Chain Sequence
b'PLPPDITFDSLALIKMHSQNMKRILEVTLAKFTVNLSIVTVYRYLTARAYLKKNIEAEFEILKDIYNIVPLLDDIAIKAAQIEANLIKKEITLDMEDIITATTAIYTNSLLVTDDPKRYEPIRRFGLDTMPLDKFIKEVELMVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease VapC4
publication title Structure determination of contaminant proteins using the MarathonMR procedure
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase
total genus 52
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5h4hA00
5K8JB 5HMMA 3TNDA 2H1OA 2WP8J 1TAUA 5ECYA 4WA8A 3I8OA 2MDTA 5ED0A 1YE5A 2HWXA 3QEBZ 3H7IA 5HMLA 3ZD9A 2HWWA 3ZDAA 3H8JA 5SV2A 3H8WA 1UT5A 2IZOA 2FE1A 1A76A 2HWYA 2BSQA 1EXNA 3QEAZ 1B43A 1V8OA 2DOKA 4CHGA 3Q8KA 5H4GA 3DBOB 1UL1X 2H1CA 5ECWA 3Q8LA 2QIPA 1O4WA 1Y82A 1TAQA 3ZD8A 1A77A 4MJ7A 3ORYA 3QE9Y 1V8PA 3IX7A 5ECDA 4XGRA 5FV7A 3ZVKA 3ZDBA 3ZDCA 5H4HA 5HNKA 3ZDDA 5L6MB 1TFRA 3H87A 2IHNA 1RXVA 3Q8MA 3H8SA 1BGXT 1V96A 1RXWA 1MC8A 2LCQA 1XO1A 1UT8A 3ZDEA 1W8IA 5L6LB 4XGQA 5HP4A
chains in the Genus database with same CATH superfamily
5DCLA 1M2JA 1KS9A 1QX3A 3B5JA 4C04A 2CFOA 4HBGA 3JALA 1M1YA 3GHHA 3TNDA 2HRZA 4YR7A 1HC7A 1ZU4A 1CERA 2OHHA 3KKLA 1NN1A 3P71T 4JX9A 1C4WA 4D8TA 1MT3A 5AW7A 1A8PA 1H1DA 5JZOA 1T4CB 4HWKA 3W2HA 1VL5A 2XGGA 2YVUA 1U3FA 2FZCA 2WIAA 2A33A 1LBHA 4PHFA 2D2VA 1ZNZA 1GPDG 4AUKA 4DZRA 3B7GA 4F7WA 4W1QA 4J8PA 4BWGA 1OXBB 3G68A 1ZJWA 3LL7A 4UUOA 1FFGA 3LQKA 3AEQA 1X15A 2I6GA 1M5RA 2VHUA 3JD2A 1KDTA 4B9AA 2X9NA 2PH7A 3P9XA 3UWDA 2VT7A 3ICVA 3DDNA 3SQNA 1KYVA 1TTPB 2ZAIA 4RKEA 4GC5A 4ZV9A 4DY4A 3LP6A 2ZAGA 1RWMA 4YRSA 1Z63A 3JYQA 3WZ2A 4IKEA 1DWQA 5E7IA 1DXHA 1Y8CA 4QXAA 4ZP1A 2OOKA 4JL5A 4NY1A 2H1IA 8LDHA 2CNOA 1OLUA 1YJQA 2Q3MA 2PYDA 3RARA 4OXYA 4AQYB 1W88A 3HI4A 1Y34E 4PG5A 3RM3A 1FFHA 3DEFA 4TT8A 5AVVA 4CHTA 1QAOA 4OLBA 4FFDA 5FI0B 4LHEA 1U8FO 3R8XA 2QRGA 4BNYA 1NXPA 2REQB 8ABPA 1LK7A 3KQVA 3QBTA 4DLLA 3K9BA 4XVUA 1ZA2A 2JGJA 3TD6A 4DANA 4DLTA 1H9CA 2FW1A 3N7UA 4BX3A 5JXWA 1FRQA 2HRBA 4YJKA 3QITA 1O95C 3QFHA 4D8XA 2L69A 1NBEA 2W2OA 4DHWA 2YN0A 1XNHA 3BHMA 5FI1B 3SLGA 4FYMA 2RH4A 3COYA 4X92A 4HH3C 2I2FA 3DV0A 2G77B 4BFUA 4RVSA 2NUAA 2H7CA 3HH8A 4B3GA 4QTUB 4K6KA 4NAUA 4K1LA 5D8DA 1QIJA 3V8NA 5FOWA 4ASUA 1XQXA 1NW9B 1EINA 2BI7A 3Q1LA 3ZI7A 5B7NA 2ZUFA 1CRQA 1PR1A 1G21E 1RRGA 3KR1A 3MGAA 3THWB 5FPTA 4TWBA 3FPGA 2XNJA 4BNWA 2K2WA 3GEIA 4RMHA 3QV2A 4AIRA 3DE2X 3T7AA 3A4IA 2ERXA 1EDZA 2D5CA 4PPNA 3OC6A 4NDNE 1E1DA 4A8TA 4IL5A 4XLLA 4DLXA 1I7SB 3I2KA 1P72A 3A6KA 3B70A 4YMWA 4AKHA 1JIUA 5J23A 2H59A 1UKZA 1NMSA 3OU2A 3AETA 5TVGA 5EIAA 2YRWA 5AOAA 3O4FA 1J7JA 3N6XA 3CUYA 4FFOA 1T6BY 3QX8A 1RWQA 5JCJD 1E6UA 4PFKA 3KTAB 2GEVA 4Z9YA 2OMKA 3I5AA 3LBFA 1BA2A 5HKLA 5LSAA 5LMNB 1USVA 2HYDA 3P0FA 2OKCA 4QNMA 3RHTA 2CHQA 5JO9A 4EYEA 1NFFA 1E3LA 2NSLA 3EXHC 1V95A 2BZGA 5ARCA 3RAPR 4E5UA 1UOOA 5DLYA 3EVDA 4JT9A 1DJNA 2P79A 4DCUA 1H1LB 3F3KA 1BN7A 5TEVA 3LUCA 1SJ9A 2FK8A 3N0VA 3MTDA 1FTNA 3T9FA 3R23A 3RAFC 3MPUA 4BVGA 5KYGA 1GU1A 4B35A 4PBRA 3JATA 1H8EA 2CFSA 2B4YA 4ND8A 3LWDA 4R98A 4RJIA 2CJXA 2RK6A 5KINB 3CINA 1NXOA 3WL7A 1BVRA 2HD4A 4U39A 2VPZA 3TAHA 1XWWA 1E7QA 3WAGA 3WJAA 3DLHA 5KKCA 2VA8A 1YJXA 4O2AB 2WA1A 3K6RA 3BWEA 5ISMA 2IS2A 3TTUA 1TUBB 2XUZA 4U7TB 4QLOA 2HA3A 5EOVA 4TKVA 3T35A 4PZZA 2QLTA 3DQPA 1DG1G 1JLRA 2QW0X 1LC0A 1TD9A 1Y9EA 3RWMB 4YAFA 2WUDA 4D4HA 4L75A 121PA 1U81A 1J8QA 1WNTA 2Z5LA 3IQEA 1I4LD 2B36A 2OKGA 1FFCA 1GAWA 3N76A 3UCEA 3IEIA 2B8JA 5PGMA 3BFXA 1F2TA 3IC5A 4TV8B 4QVKA 1G42A 2QI9F 3W9YA 4JL6A 2IWRA 3ND9A 3AVVA 2CMHA 3RKSA 5JD5A 2WINI 1KEZA 1ORRA 1SZDA 2WNHA 4AMYA 4S1WA 4Q47A 3OFVA 1CR1A 3PC4A 4GPBA 3VHQA 4V0KA 4QQ8A 3AJ8A 2DFVA 2FQWA 4PZLA 4OXNA 2X4GA 2WNIA 3D31A 3EXAA 3DTTA 2Z04A 1DQYA 3IDAA 4TL9A 4RBNA 1JFFB 3EBLA 1DEXA 2PWBA 4ZHQF 5DCWA 2V4MA 2BV3A 3I0MA 3VTZA 2OENG 5FPHA 4Q3KA 1G9SA 3C5VA 1JHRA 1VPLA 4TMZA 5E3JA 3RDPA 4K9SA 1JJBA 3KETA 2EGHA 2VP4A 2X58A 1X7XA 3KNZA 1BWSA 2I4RA 2Q28A 4WY8A 3SJUA 1UJ6A 3J80A 3V8PA 4MVJI 5ECGC 2HDWA 5CH5A 1JEEA 2F8MA 3NBQA 3SXPA 3UAXA 4YCCA 3F96A 5KTYA 1NQ5A 2ADMA 3KOXA 4HH0A 1SZCA 4V2UA 4X61A 3OPNA 2QXYA 2R79A 4MDYA 1EDBA 3TLAA 1G2PA 5C35A 4FWIB 4PBTA 3HUUA 3THYB 4S2UA 3ZZTA 2OV4A 4JS0A 1TFRA 4DSNA 2I6SA 4Q9NA 4BVJA 2PZKA 4WXMA 4Y1EA 3EXG1 1ZUD1 2AFIE 3CPSA 4E5NA 5EJ6A 2UYHA 3V4OA 4MQFA 3ZE7A 1QU3A 2KHZA 4LRQA 3HTXA 3AEKA 3AP1A 4HVLA 2QV0A 3TPCA 1UZMA 5I7WA 4RELA 4G4GA 3HDVA 2PUCA 5K0SA 4LSGA 1N7GA 1DWPA 3H8VA 5CNKA 2EFGA 4ML3A 2HLDA 1DKNA 4L5CA 4OY3A 1GNLA 2WILA 5AVZA 5KWVA 2WTBA 4F5EA 5FR1A 2VJOA 4FDUA 4XUDA 1QRTA 1L4NA 4MVJH 5T4FA 3FNHA 4R84A 5TJ9A 3SFZA 1IN7A 2XUJA 1BX0A 1U2QA 5D7NA 1IHPA 5DM2A 2VQEB 3QPBA 3VNRA 1GTRA 3BAZA 2CD9A 5BQFA 1I51A 2J1LA 1ZI6A 1MXFA 3FNRA 2R4QA 1P31A 2X8JA 2Q0SA 3F6EX 3GFVA 4IDAA 3OBBA 5AKGA 3RABA 4EHFA 3X3HA 2CJFA 3I0ZA 2IHVA 2PTHA 1L4UA 3CZPA 3I8OA 2HNAA 2G40A 2GK3A 3OAAD 4MRMB 4M0LA 1U2PA 1YO6A 2G0TA 4C6TB 5J2TA 1DEAA 2J59A 2HHHB 1H6AA 2DYKA 3N5CA 4IWXA 5DW0A 3F7MA 2G5CA 5ED0A 3BOSA 3OZCA 1N0HA 3OO0A 4GE0A 4H1WA 2GN1A 1C1XA 2C2HA 2WVHA 4JJ4A 4WCFB 3UUEA 3RGWS 1CS0A 4CEHB 1MB3A 4B6QA 5BN3A 3RVLA 1EA7A 2C2XA 3SXUA 2RHGB 3UHPA 2VUIB 2VJMA 5DX0A 1LB1B 2AQKA 2BUCA 2ZE6A 4LDNA 1BRTA 4M8SA 4ND3A 2Y4OA 3MT0A 4ARSA 1E5DA 1OFUX 1IEWA 1FS6A 3QKUA 4MO9A 4RPHA 1E6LA 2QE7D 1U2TA 3CWCA 4JUFA 3W5UA 3K0SA 5ALGA 1RFLA 2YINC 4A6XA 3L5KA 4FE7A 3UY4A 1ZMOA 1TF2A 2HDOA 1P7VA 2QGFA 1U1DA 1YONA 2WU0A 4JMPA 5KVVA 3T7KA 2VJLA 4RZSA 5B55A 3NDRA 2QUHA 1O8CA 3CLRC 2MMCA 2X77A 4EEKA 4DQKA 1QR2A 1FNCA 2GBIA 3T06B 4TV9A 4D3XA 4Y2PA 2OCIA 4EUEA 3TF5A 3FLMA 1E9CA 3EA4A 1U1IA 4B82A 4RK0A 3BRSA 2VJCA 1OFUA 3MB5A 4WFJA 3ZHRA 3WGUA 1X94A 3EPKA 4Q9DA 3WGJA 2W6PA 4MEAA 2B3TA 1FX0A 3JX9A 1VMIA 4RHUA 3K6SB 1NU6A 3SXJA 1RLTA 1B42A 2ZAMA 2HU2A 1ZWLA 2YWJA 3N2IA 4OP1A 4QYTA 3MHTA 3EK2A 1U3CA 1QJ4A 1UPCA 2ZZMA 1HYGA 1KVRA 3S5UA 3KL2A 1TT7A 1E98A 1MVLA 4M37A 3VR3D 4UM8B 3N74A 2GZAA 1POXA 5CB0A 2G1JA 3SSAA 3IE0A 3GAAA 3V8RA 2CVZA 1E66A 3C6QA 4GP7A 3STVA 1AKTA 4Z1OA 3NHRA 4I6JA 3EISA 4EG7A 4MS4A 5C7LO 1DOHA 4S1OA 3CYFA 2GHTA 4D9FA 1DG9A 1Q83A 1XXHB 1TUIA 4UCFA 1TK2A 1XLUA 3MJFA 1WUIS 2VWGA 1QHEA 1QH9A 4V0MA 2GXAA 4PYOA 3CQ9A 3SHFA 2J46A 4PYQA 2QYHA 5EIFA 1KMIY 2VHTA 3OZGA 1XROA 1P5HA 2XUHA 3PPIA 1JDUA 3IAFA 3W6ZA 1Z5ZA 2Q07A 1P0QA 2ZK7A 3A6EA 3TEFA 4DJ5X 3DBHA 4XCVA 5JRJA 3LOPA 1VSVA 2YJGA 1U31A 2IIPA 4QOJA 5D1HA 3D3JA 1YA6A 1XVVA 3KZKA 2GYYA 4LTMA 4G41A 3RS2A 4QXQA 2ZWIA 1WW8A 2H3EA 1PP4A 2VTBB 1WBDA 2Q3BA 1E7SA 4IMJB 5KJ1A 2PKRA 4OHUA 3A0RB 4FE4A 1M6VB 1M34B 5FPYA 3TBFA 5LPNA 2HJGA 1AS2A 2HDNB 3D7RA 3BILA 4G8DA 4JEHA 3E3OA 4Q4LA 3I8SA 1OXSC 5TEWA 1BRMA 3PPYA 3GLHB 3VAYA 2QG4A 1F9AA 2ZATA 4NEQA 4I2NA 2YWFA 2WWHA 3KQSA 4R69A 3Q9UA 1GILA 3QF7A 3WLTA 3NPAA 3YASA 3WIUA 4LJ7A 3STUA 4OOFA 1WVGA 1TCUA 2ISCA 2QVBA 2X0IA 1S8FA 3D8BA 1A9XB 4B48A 4H3KB 3H2KA 3H1AA 4DTCA 5C4GB 4BL5A 4V0OA 2I71A 2A1UA 3G6KA 1KBQA 1E7YA 3UG6A 3GMSA 3VYUB 1G0OA 3QLEA 1C1YA 3T4UA 5DI3B 3VDMA 2MTBA 1DOZA 4G65A 1J1UA 4LW8A 2N46A 2BGTA 2XWBF 4EMBA 4XCQA 4FR0A 5CLFA 4QWMA 5K4HA 4UUAA 1JTEA 3QUBA 5HFJA 2A4KA 1J8MF 1N6IA 3K9NA 2F2TA 1PEYA 1WR8A 4O2BB 2X7HA 2E48A 4PLFA 1RPNA 2H17A 2ODBA 3OPQA 3IP8A 2HWYA 4IJ6A 4M9CA 1OFGA 5LMUB 4JAVC 1A1SA 5IKEA 1P5ZB 3D43A 5HTOA 2FSVA 1U8UA 1YRBA 4KXNA 3HFJA 4FVTA 4XD7A 1QOQB 1K2VN 3B78A 4CQNA 2VBIA 5TMPA 3P9YA 1LK5A 2R47A 4CTJA 1MJHA 2H8KA 2XMQA 3KJZA 1US8A 3LKVA 2J0QA 4NTZA 1DQSA 1V2GA 4R51A 4ZOLF 3Q3EA 4AP6A 2WM9B 3I6BA 1SXJE 5F51A 3LHDA 4LWQA 1RIIA 2GZ1A 2OV6A 1L1EA 4NF2A 4CT4B 2I1QA 4DL9A 3KWFA 4EBFA 4F60A 2PZ8A 3QWBA 4UW9A 1TA9A 2X1MA 5JJLA 4KOAA 3K2QA 1WDMA 1EM8B 4IRXA 2PD6A 3P9PA 1W4CA 5FUBA 4HGRA 2Q29A 4P4GA 4URZR 4YH1A 1E7WA 2IEDA 4GOJA 3CZAA 3ZWCA 2QBYA 4UUBA 2XITA 2BFCA 1HDIA 1RBQA 1CEXA 1F4PA 3PL1A 3KQMA 2Q41A 4O33A 3VJMA 3FWYA 4HDNA 3LM8A 1AIPA 4M6WA 1BEEA 3IFSA 3EXIB 1NV9A 3VR4D 4H6XA 1OZHA 3OLCX 3U9SA 3S1SA 4B3TB 3TQSA 4LECA 1HETA 5FDFA 3U26A 1BMFD 5ALDA 1NN0A 3H97A 1ABFA 2R97A 2NPIA 3LQ4A 4IKPA 4DA6A 3M8KA 3L41A 4MICA 1RRFA 5DHAA 1F1BA 2F9FA 2BJVA 2I7XA 3OSZA 1CRLA 2G08A 2QTBA 5BYKA 5ITZA 1NDQA 3TDMA 1I24A 5LP6B 2WR8A 1O6BA 4V2IA 4Z3OA 1X1SA 1JPVA 2VPTA 3K3PA 3N39C 2QW1A 4G5XA 1QPZA 1IAVA 4D3YA 1BS2A 3KT6A 5EWJB 1DV1A 1YA8A 4KN8A 3NBZC 4NEGA 1P8AA 1S9DA 1K8XB 5BSFA 5C7YA 1H0HA 2PFKA 3CZRA 4S2EA 4ITRC 2EJTA 1YU9A 1BQ3A 2Q1TA 3L8ZA 4G0QA 1OXKB 4RZQA 4ENUA 1C9YA 1NXWA 3O4IA 4YMUA 1RCTE 3KQPA 3TNFA 1PZFA 2GAAA 3ENNA 3KD3A 4BX2A 1M9NA 2B30A 1HE8B 1LPAB 3VPBA 1PFKA 1V7CA 1NA5A 3WNBA 3AVWA 5IEJA 1O9BA 1KP9A 3FDIA 1E1QD 2B1IA 4G24A 5SZIA 4JP2A 3TS1A 4P9NA 3FFXA 3P2IA 2QORA 1FTWA 1KMMA 3EQ2A 4M8IA 1U3GA 5THKA 3AVOA 1KH2A 1GGEA 1KK0A 1QF7A 3KJGA 4GI3A 5AHKA 3IJRA 3CW9A 1T9KA 1ZLXA 2ICAA 4FCTA 3K1YA 2PDAA 2XUKA 1R0SA 4BZQA 3UCXA 3EGXB 2DM6A 3QVGB 1T0UA 1QHHA 1DCFA 1GT91 2QAGC 2RG7A 4QNNA 4WL0A 3T9AA 2HJ9A 1THTA 2VCEA 1XCPA 2CT8A 3C7TA 4MKGA 3RW9A 1DX9A 1JLKA 3ELDA 2C61A 3T5BA 1CB7A 4CF3A 3SX4A 1ENYA 5CNIA 5IC6A 5L9AA 4BXOB 3T7EA 2ZSKA 3E4DA 3MAGA 1KEUA 2HRRA 5K3SA 1QO0A 1XU7A 1ESDA 4X62B 3LIIA 1DBIA 4N8DA 3ABIA 4Q1DA 1P2BA 4L4SA 3GXOA 2BH9A 5F78A 1ZKDA 2VYQA 3MGKA 4AY4A 3LH5A 5REQA 3X1ZA 1C80A 2CDRA 3ESZA 4TV9F 4U7WA 5COAA 4ZALA 4AO6A 4C06A 2NYVA 3ELBA 5CDFA 1V11A 4QBGB 2NW6A 1AK1A 4HDKB 2UUPA 3RU3A 3DPUA 2QMEA 3D4BA 2UXCB 1TC2A 1THZA 1VP9A 2J45A 3LO8A 3OCXA 5IBRA 2PZJA 4HGQA 3WO0A 1ISHA 2JW5A 3K9HA 3RHZA 3UPTA 2FOLA 4HF7A 1B1CA 3ONWA 4RVUA 4EGAA 3K9GA 1V26A 4MKFA 2E6UX 3JQ6A 3K5HA 5KNBA 2O3UA 2UVPB 2PX5A 3JAWA 4JCOA 4WQMA 3LDUA 2J6BA 4BO4A 4YMHA 3EQ7A 2WW8A 1N8SA 4PYMA 4C0QC 1WCYA 3H2SA 1NUAA 1Q5PA 4GG1A 4GW3A 3GJSA 4HKTA 4EY4A 1KI7A 4WJKB 2I4TA 4J9VA 1RI5A 3SZLA 3UF0A 4D4MA 1GZ7A 1WQ3A 1DIOB 1EUDA 2ASEA 1ZSNA 4JZYA 3UWPA 1GYQA 1EGQA 1L8QA 3IH5A 4QODA 2KE5A 3QA3E 3F7NA 5CP8A 2FE4A 2DFPA 4EJSC 1F5NA 1XQVA 4I4TA 1KWKA 3VR5A 1WSAA 4KXWA 3PPXA 4NC9A 4QQFA 3QXHA 2HRQA 4DKXA 1X0XA 2YY6A 5FT9A 1BXGA 1M5TA 4QBTA 4JYAB 4Y0NA 4IVQA 1RP7A 2WJYA 5EQDA 3HJRA 1M75A 1IRIA 3P9IA 2OV1A 3MTBA 1NBME 1GDDA 3HNPA 1MGOA 3H18A 5T8KA 5KS2A 3K0CC 5FBZA 4Y18A 2ZYVX 5BVGA 4NMLA 1KK3A 2VJKA 3B20A 1EVIA 3BHJA 3EEQA 3O4GA 1KJJA 2FWBA 2H1FA 4DREA 3AYXB 1PL8A 1HI9A 1V4VA 1GZVA 1TVKB 3ASZA 4OBWA 4KK4A 1K0FA 2CFCA 1UWKA 3Q9LA 3V9AA 2AIRA 4M1TA 4XKJA 1L5HB 5IAEA 1EX9A 1KJNA 1VJ5A 4HGNA 4UXIA 4F2GA 4ZKEA 3WV5A 4EPYA 4IGKA 1Y3DE 4IF6A 3V46A 5F2EA 3D8UA 4KUHA 3QMVA 3DBRB 4JT8A 3UQYS 5HOQA 1RC0A 1XHEA 2QU7A 2O05A 4JBXA 1DRVA 3TIIA 3LWNA 4WK4B 2O50A 4R3UC 3TZKA 1M6NA 1YR3A 1FDSA 5K05A 3JAMA 1E3WB 4FGWA 4CU2A 4UMFA 3QYAA 2D7DA 3H7AA 3L9XA 2CUKA 4EEZA 1FU4A 1P2FA 1P3DA 2QG9A 4EKEA 5JMWA 2ZUCA 1P61B 3P4XA 1L4HA 3BYZA 2I7DA 3OA0A 4JLJA 1GHTA 3VR2D 3MXOA 3WQBA 4JI4B 4NENB 5LQRA 3GPIA 2F8LA 4R1NA 1Y1TA 3HZZA 3FG9A 3R3HA 4ALIA 2G4LA 3LXUX 5EINA 4XWYA 3URKA 1J90A 2GK4A 3VO8A 1PJZA 2VDWA 1CDDA 4GSLA 4AYTA 2Q5IA 3DAOA 1BU8A 3E9RA 1Y8RA 4MARA 1IY9A 1JVBA 5DYIA 2UU9B 4DV2B 1ESNA 3DHWC 1YKFA 3UMBA 3UYLA 4KE8A 4Y2RA 2X1LA 4BQIA 3QQ5A 4IIHA 5D3MA 3W8FA 5GZ3A 2CNDA 2PKYX 3MZ0A 4GH5A 1C1DB 3EGDB 4AXXA 4Q24A 3DE5X 5EQJB 3I6QA 1LZKA 1SCUB 4NVRA 1U3UA 3P9CA 2OBXA 3SI7A 2GUGA 4X84A 1KE1A 4ZHQB 4Q82A 4R7TA 2IS4A 4X97A 3VHLB 4NOMA 4QOHA 2VHVA 3TPFA 1R18A 3QW2A 1E9BA 1M7HA 1RJEA 1CR2A 4MJ3A 2HI0A 2PL1A 3OJCA 3K0FA 4ESOA 3L02A 4I1RA 4ODIA 2GMWA 1TRKA 2Q1WA 2DFTA 2O7QA 1KO8A 1RKVA 1TAQA 4OAOA 2P40A 3O1JC 2FLWA 1VLJA 2XE7A 2XVMA 4UTZA 3KU4A 1IBRA 4J1QA 4MEJA 3OEYA 1FOEB 1OWPA 4Q1FA 3L4SO 3PRHA 3ZCQA 4BKPA 1L7OA 1NNI1 1PWZA 2IW3A 5J47A 1DO0A 3OHSX 1N57A 1RHUA 1K97A 4LFAB 4F5DA 1P1FA 1E9EA 5K0JA 2I4MA 1J7KA 3UMYA 1P4AA 2CNWA 2R751 2FTKE 4PLGA 4B43A 1PUXA 5T57A 3MUFA 2A9OA 4R1OA 2VJQA 1BHJA 1U2DA 3IIKA 1ZQ1A 4EKNB 2ZROA 1CHNA 1WHTA 2DKOA 5E4JA 2PU5A 4EY5A 1GCIA 2VIIA 1P3Y1 4UM9B 2VRCD 7YASA 4OB7A 1D4ZA 2WA2A 5FJIA 4QXPA 1QIHA 2DHEA 4K0KB 1A69A 2R8PA 1Q1EA 3KPWA 1JGTA 3UMFA 2CV1A 1K8RA 4EYQA 5EMMA 4DNQA 1VIVA 1QS0A 3BXZA 2PGIA 3RYFB 3H6HA 4QOIA 2XZTA 4ZMBA 1RXWA 4KDFA 2BGGA 3JALB 1M1YB 1XTTA 3DVSX 5E7JA 3R7NA 3I64A 4F3RA 5A06A 4BWVA 3T3OA 2B4QA 2KLHA 1JHYA 2PQ0A 3QKSA 2NSDA 4A8JC 2HPAA 3NHAA 4JKYA 4L73A 4UUNA 3T5GA 1K0UA 1L7EA 1VKJA 2ZBFA 3T9DA 5AW0A 3RSFA 2B8TA 3ZGZA 2FMTA 3I52A 4JP3A 2J7PA 2Y1DA 5F3DA 4JLBA 3B9BA 1DRUA 4EW3A 1CUXA 3B6MA 1UAGA 5D3ZA 3LK6A 4B6FA 3OVMA 1VGQA 2O2XA 2E4WA 1RKUA 3SGLA 5LOVA 2OXTA 2ZBVA 1B15A 3Q9SA 4CQMA 1I30A 1B73A 3AEQB 1DKQA 1T6XA 4GBMA 1OX4A 3B48A 4GVLA 3CH4B 4TTAA 4DWVA 5A3QA 3F4LA 1Y1RA 4MH0R 1HFWA 1IVYA 5DXJA 1TEZA 1D04A 4J6FA 1N2SA 3ZDAA 4ZU6X 3U62A 4JYPA 2CCKA 3LYUA 4RTLA 3AVUA 4JROA 3G49A 4ZAWA 5CNJA 2Q5CA 4P32A 5TDHA 3ORQA 3O83A 4UXHA 3WL4A 4YEDA 4A4DA 2HBRA 3QVJA 5EWMA 4FR5A 3U80A 1C2YA 1VI5A 3C7KA 2AXQA 3V3KA 3ZQJA 2RGDA 1ULAA 2FOIA 1WABA 4EX6A 4HUQA 1T4DA 3MN1A 2K7FA 3GYBA 3QP9A 1COWD 1ADFA 4V0QA 1C14A 1UPTA 1YZLA 2CW5A 3QFCA 5K4GA 4N48A 1HV8A 3DKIA 3GXBA 4LK2A 4B4OA 1IE3A 2B1JA 2RKWA 4PYLA 4C1NA 1I80A 3A3KA 3JRNA 3LJKA 1V1RA 1G4UR 4FFBB 2DHDA 5ALLA 3TVYA 2OEPA 2EX1A 2JK0A 3I9MA 4EPTA 1C0LA 1O03A 2BC9A 1VM6A 2G76A 2HFKA 2JA2A 2X4LA 4E6EA 2H2WA 3ULKA 4HB3A 4UQLA 1IY8A 1T6NA 2JLQA 2GD0A 2IHYA 2XIQA 3E4CA 3IOBA 1LRLA 1QG0A 1SXIA 2WJAA 2E3JA 4LC0A 3TOSA 4PZDA 1IATA 2QTCA 1PFUA 2J31A 5JFTA 1HMYA 1NUUA 1TEHA 2A0FA 2R11A 3BA1A 4MPTA 2CGEA 2YJ3A 4ND1A 1CY2A 4US1R 1KETA 4ZQIA 5ICFA 2XCSB 4PQEA 2PKQO 2FMFA 4K0RA 1XN4A 3SYNA 3AR4A 3ZQ4A 4BUCA 4GOLD 1UMCB 4NU5A 3PDIA 4R0NA 2PUVA 1L5VA 1KI6B 4FHDA 4DCJA 2PVSA 4MUEA 3GEHA 2YWBA 2PT5A 3EH1A 4UNNA 1OJLA 3AGPA 3KDSE 1SVSA 2YQZA 1GRVA 2PBZA 1NI5A 1OI4A 2H1VA 2CLIB 2EQAA 2M6RA 3AETB 3X2FA 1PZEA 3OY7A 1PQYA 4C01A 5BYAA 2JLWA 1I32A 2JBWA 2SBTA 3IAS6 3D6MA 1ESEA 5AYVA 1CJTC 1L5MA 1TM3E 1ZGBA 2DQZA 2X0JA 3LQQA 3HJTA 3KOYA 1A97A 1Z8NA 2IDKA 3T5CA 2GO1A 5F2KA 1MZPA 2IOFA 3N9IA 3CO0S 3GUZA 3PEVA 2QTVA 4ZYXA 3MB8A 3D3NA 4PTZA 5CB6A 1QE0A 4MUNA 5IFLA 3HHPA 3MOSA 2DCMA 1QQ7A 4PINA 4OGGA 1OOEA 4ND8B 4CM8B 4Z3KA 2OLEA 1VBFA 1E1MA 1Z6XA 5B4UA 1OZGA 4X7MA 1EUYA 8AT1A 5E1OA 5ELMA 1HA3A 1EG2A 5CK5A 4CM4A 4NBKA 1I0LA 1LC3A 1SXGA 4XARA 4FNMA 4EJ2A 3OT1B 4Q4DA 3BXXA 5EIOA 5G02A 1PG5A 4N0PA 4TKVB 4YAJA 1KVTA 1H4VB 3ENKA 5ALVA 4PXYA 3Q10A 1ADCA 2JFXA 5HJ5A 4L4UA 1IVSA 1GADO 3ANNA 2BMAA 5GTDA 2XRZA 3H1BA 1YR7A 3FVTA 4OPMA 4HSEA 3BB1A 1CJKC 3GUUA 4YP1A 2YOFA 3W4IA 5KJCA 5BV0A 4OLJA 5DV9A 1YE3A 3EMKA 1F2TB 3PGJA 1UEXC 4ZEWA 1Y4UA 2A1TR 1TNDA 1C3XA 1F48A 3OKPA 3LBYA 3MTEA 1GGFA 3LK7A 1Q1GA 3LT0A 4G2NA 4MW4A 2JK1A 4DBLC 4F4HA 4KZKA 3AB7A 5JCXA 3GLIB 4AMZA 5IJXA 1IYZA 3I83A 4A2PA 1K8ZB 3DEZA 4LOLA 1VBKA 1BQ4A 1VA4A 2MT9A 4FNAA 1CU1A 4ZOBA 3DJFA 2L82A 3UQZA 5TIIA 4E09A 4X8HA 4RH3A 1SR8A 1XQWA 3ACDA 4PYIA 3WYEA 1HG1A 3PXAA 3HJHA 1XA3A 4OG2A 2NYAA 4GBGA 4NBNA 2BR4A 2BEUA 1NLUA 4HC4A 3FNFA 2JNWA 5IDYA 4XSHA 5C32A 3K30A 3A4LA 4GD3Q 1GTSA 1TW2A 1XZHA 2JGEA 2VEDA 4F86A 2NTNA 1XV5A 2I6FA 4JC8A 3TKYA 3WR5A 4MYHA 2Y0DA 3FYTA 1Z5GA 1R4NB 5EFOA 4OH1A 5CA1F 2V7QA 2ZANA 2FEXA 4TMXA 2ENUA 3FVQA 1T3LA 3GRPA 1EX7A 1ZH0A 5EHXA 1QORA 2WJGA 1EWYA 1ZMTA 4NV1A 2JLAA 3LZCA 1JR3D 3HC7A 4GX2A 2I8CA 2XOKD 4FEEA 4M1ZA 1N6OA 2CNNA 4QT4A 1JG3A 3N2EA 1KORA 1QYWA 1P9LA 1PVVA 1R1DA 2H2HA 2QA5A 2ZB2A 2GA9A 3NQ41 1V8PA 4KE6A 3LZDA 3MMSA 5J40A 2G8NA 5ECDA 4ZDKA 4DC9A 1BJTA 3HKEB 1GFWA 3UKJA 5CVJA 3ZZ0A 1KIFA 1CY6A 3OLQA 2EHDA 2HSDA 4OCZA 2MSLA 3M6LA 4EA8A 1Y4SA 1TTTA 3H1EA 1EFTA 4G0NA 2ZI3A 3Q7QA 1WP4A 2CDCA 4O4HA 3STXA 2Z6QA 3ORHA 1E2GA 5CBPA 3HKCA 1C3LA 2BZ1A 1K6MA 2CHFA 4Y9TA 4CT5A 2C5FA 3AEKB 3A2LA 5CEJA 4O4IF 4Y2JA 1MOSA 2HNBA 1J2YA 5JEEA 4BCDA 3UZUA 1CUCA 1I3CA 4RKWA 2EYQA 1BMQA 2AF4C 4CN9A 1UJ2A 4IV5A 4XWTA 4ARBA 4JOCA 1LNSA 4PR3A 5K45A 2PL5A 1MKYA 1IK4A 4BNTA 4PCLA 3GDOA 1G20E 2V7EA 1JLMA 1NDHA 4FMPA 4I6GA 4QPDA 5JAUA 1PLKA 2CEAA 3QH4A 4MUXA 4A0FA 2J9RA 3QE2A 3QUCA 4JUAA 4PLYA 2FZ5A 2NXEA 3QJ5A 5DIZA 1X7YA 2IELA 1FDTA 2IZ0A 1A8SA 1QZZA 3MWEA 4CM6A 3QI2A 1NQOA 3P4UA 2GXQA 4CR6A 4EZEA 1UKAA 3O1HB 2HRDA 4XB2A 5HIIA 1ZL0A 2OORA 3X1XA 4W5QA 2NVWA 3ZE9A 5HUJA 4YYEA 4WGFA 4HTFA 2BDEA 1JEYB 1C1XB 1P4SA 1RYYA 4ZQGA 1V7ZA 1CS0B 5BN3B 2UVQA 5HDQA 4MITA 3SXUB 3G2PA 3QSYA 2O0LA 1DKPA 2VJMB 3NHLA 1D4OA 4OSOA 5I7VA 1O9HA 1Q3TA 4PC2A 3C3YA 2XZPA 3HNOA 4EW2A 5LDHA 2CFRA 1JHXA 5DF1A 4NRDA 2KBEA 3GD5A 1FS4A 5F5NA 3S2SA 1XDBA 4J0CA 2V97A 3CCFA 4NQRA 2GESA 5G40A 3RIXA 3NHWA 2WWFA 4HLUC 2IF0A 2NVOA 3W3AH 1R50A 5HIKA 3RYHB 3K0KA 2QTRA 1MV5A 1EH5A 4TV9B 2HM7A 3KWJA 4JWKA 4KXLA 5BNTA 4BGVA 2X3UA 3FSGA 3PC6A 3MIZA 4Q9KA 2LE0A 3U39A 1R0LA 2CVOA 4YWJA 4ER3A 1D2NA 3CEJA 1AF7A 3H1PA 3QXXA 2WNSA 3ZX5A 1ZH4A 2P5TB 2VDKB 3GA0A 3FA2A 2VFAA 2WWIA 2XQJA 2XEXA 2HCFA 3LFHA 5FAKA 3TSWA 1KO7A 4EUSA 2IUSA 3BB3A 4J4BA 2WJ6A 1QFZA 3VKFA 3QBDA 1LSJA 1DFHA 4F91B 1X8KA 1SGWA 1CUHA 1DQZA 2Z5GA 4XXHA 2WYUA 2X0RA 3R4CA 1DKRA 1TYCA 2BISA 3DZHA 3QVKA 2PL9A 4XAQA 3KQWA 1O9GA 3FOCA 3ILHA 2RH5A 3L7NA 4J1SA 4KQHA 4PYRA 3ZQUA 4AX4A 3INYA 1UOEA 4UTPA 5C8VA 3O3MB 3Q98A 2V4UA 2WKSA 5EUMA 3CKMA 2ROQA 3GJ6A 1PHPA 4MVJE 1YDHA 4JJFA 3HM9A 1FDVA 4WY5A 2ZVDA 4EO7A 4GEKA 3EJ6A 1RBYA 1SU7A 1P7PA 1UXKA 1X7WA 2JB9A 1I5RA 4MS4B 4NCXA 1C9MA 2ZU6A 1B3RA 2HV8A 4A15A 2MSKA 1XMXA 1A50B 2QTAA 2C57A 1FS5A 2PAAA 3OEED 3QVXA 1S9HA 4Y6PA 3TTWA 3WMXA 2PX2A 5KREA 4BLSA 4ID3A 3TI7A 4CCYA 1TW3A 3A26A 1DLJA 1OZ0A 5KTSA 5DHPA 2IDJA 2GD1O 2PBRA 1W35A 2GWHA 3DYVA 3P9NA 4WHMA 5IPFA 1FTYA 3LY5A 4KIUA 4PSVA 3RVPA 3TIXB 2QPLA 4MUAA 3DKVA 4YK7A 3DBHB 2O20A 3BC1A 4JBHA 3ZCTA 2DPLA 2FEOA 5H3HA 4WZBE 1K3TA 1SKBA 2BN4A 2ZYUX 4UTRA 2OQIA 2QRMA 2JGDB 2IUTA 2Q62A 2WV9A 1YB5A 3KFLA 4RIEA 4HDSA 4NBVA 3W4JA 3KYDA 1VPWA 1A4RA 5EZYF 3THRA 4DCGA 5IU6A 2QZ4A 4BNGA 4H6PA 1IY2A 3D6JA 3LCUA 2OO5A 4RU1A 4OIMA 2G6BA 1J4AA 4KPUB 4ARAA 1TJ3A 3DVQX 5DGTA 1KC3A 3K4QA 5J2UF 1TIBA 1M1NA 2GAOA 3OP4A 5KVAA 1DMSA 3FSRA 2X8WA 2EEZA 2EARA 2QTFA 2DHQA 4CUKA 1I3KA 4KN9S 3IPRA 5E4YA 1T0PA 2BFNA 3C6KA 4TM7A 4TYPA 4XDYA 4KVZA 3JWPA 5E9WA 4K6CA 4S1VA 1GAXA 5IJ0B 1K4MA 2J5QA 3HBFA 4D4JA 1ULHA 3IVAA 2LIVA 1KRWA 4B3IA 5JCZA 2A1UB 1SVUA 2QM0A 2BL4A 1EDEA 1Y4ZA 4V1CA 3HFSA 5CDHA 3DE1X 1P39A 1Z3CA 1Z22A 1GG9A 4PRYA 3GN1A 4QL3A 4EHKA 3B1XA 5HR5A 4EJMA 2GHRA 4OJNA 3QX7A 4X9XA 3PD1A 4CETA 4W7IA 5JSFA 1IHDA 2XGMA 4GMHA 1TYBE 3T52A 2AUMA 2WVGA 4AUNA 4DV0B 1DHRA 3GDGA 3OOEA 4Q3AA 4UEQA 4D0NA 5EWLB 2VBCA 1FX1A 4KDRA 4PLVA 2VBGA 1H3EA 2QR2A 4HBZA 4HLDA 1UZLA 4FS3A 1IWPB 1MRSA 1NLFA 3ZS8A 4BMYA 2GPAA 1X42A 3NAMA 1PFWA 4JQSA 3RSHA 3M4JA 1C8LA 1TZCA 3GEGA 5IVKA 5JQGF 1NMZA 2OD2A 4M0MA 3QXGA 2RHBA 4HQ0A 3RVSA 4CMAA 4Q6BA 1PX2A 3EOBI 1I9CA 2FI1A 1RLMA 1XFDA 2FWRA 3T3PB 4PC6A 2XNSA 5AVOA 2OCAA 3RHSA 3UJ8A 5FF9A 1IUNA 4RTMA 1F6DA 2NP7A 1KHHA 3IP7A 2LIPA 2G7ZA 3HCOA 1JBEA 3TIFA 1Z2PX 5U1PA 2ZR9A 4TXMA 1FF9A 4G5RA 3M70A 4Y30A 2YIDA 3UJDA 4JOBA 1X80B 5K03A 5CFPA 1Z13A 4ZEMA 3N2YA 2CXOA 4BCBA 2YZGA 3VA7A 3DBOB 4F3NA 1NMEA 5EZSA 3R6WA 5IF9A 2JLUA 3V1YA 1A7AA 3P0RA 4KO2S 2HIAA 3EF0A 4QE3A 3SSMA 3VRHA 2BFCB 1G8KA 1OW3B 1Z0ZA 2H31A 4BNMA 2DERA 4W7HA 4KE9A 1AHPA 2H4FA 4HDNB 3WRYC 1PWYE 4M6WB 2Y1FA 4BASA 2PRJA 3BBPA 4TTTS 5A62A 1E1YA 2AYXA 2YHUA 4GM4A 1R6DA 3EYWA 3D7LA 3RO7A 2ZIXA 3OX3A 1H66A 3GELA 5CDUA 3KK0A 4JLAA 4IZHA 4YAKA 4FZ5A 5C46F 1OI7A 3BORA 4TVOA 1JRLA 1G9TA 3D1JA 4FEGA 1RPZA 5JDCC 5KTTA 4LXQA 4YQZA 2WZCA 3GFSA 5FV7A 4OXXA 5ICMA 3UEOA 4G0VA 1NJ8A 1P2VA 2IX9A 1QMGA 3NBYC 1S4QA 1Z7EA 3NUGA 4JR1A 3OPXA 2Q1XA 3IXQA 1VKHA 2JHPA 3AKDA 4JVLA 4BHTA 3NEJA 1QM5A 4DCCA 1GPAA 4DUPA 2WSMA 1YDMA 1YHZA 2H1LA 4IR7A 1N75A 5DKFA 5BOVA 3UWOA 2FGKA 2YQ5A 4QICA 1D9XA 5TMDA 1QDEA 1D6SA 2FPUA 2NZXA 1H2ZA 2D1QA 3K9LA 2ARKA 3MWDB 4HAVA 4LYFA 3RIGA 3VV3A 3WGLA 1MABA 5JROA 4LJRA 3OUUA 3UPDA 4EUFA 3QJGA 3UWMA 4BQQA 5LQAA 5CVCA 4K9QA 5KQGA 1ZHFA 1JVNA 2V55B 2IYUA 5JADA 3H99A 1ICEA 2IYXA 2FR8A 1QG4A 3ABRB 2A4MA 3F8TA 1ESZA 4RCVA 5FPPA 2OYRA 5FPKA 3O38A 1JZQA 3F78A 2EP7A 4GLLA 4LVCA 4P86A 5AHRA 1UWVA 2A7QA 3CIFA 3SDBA 2CVPA 4AF8A 1ECJA 3Q7EA 3R7DA 1DJPA 1II9A 2QT1A 3K6KA 4CIVA 3ZIDA 3WJ1A 1Q3KA 9LDBA 2XVZA 4KN6A 2XSZD 2QQ5A 2W2LD 4L2IA 4PIPA 5ALUA 1KE2A 2QD4A 2A2ZA 1CW2B 5HE8A 4BCCA 4LYEA 2WP8J 2LUOA 2NU6A 4UZEA 4DC0A 3L01A 3SWWA 4Y2QA 1YB2A 2F9LA 4HPWA 4O29A 3U1TA 1AMUA 5DHTA 2D62A 1ZDMA 1P8JA 2ZBPA 2ODQA 3GH3A 4MRAA 1FNSA 3I28A 2YVAA 3M6MD 1QHHB 2NZWA 2IXBA 3G2QA 3MF4A 4O1MA 4FDTA 2QD1A 1N5RA 3W06A 3ZZNA 5KPJA 1LF0A 1G8MA 3IAAA 4JV5B 3B6EA 4RQTA 4UMVA 1BEZA 1F4LA 2E37A 2SECE 5LXTA 1N2GA 3RRJA 4AAYA 2IJGX 2ZJ6A 1CG6A 3S4YA 1JHPA 5CFNA 2EFHB 1DFGA 1NSTA 2B2CA 3D0RA 5JATA 4P1ZA 3E48A 2PZBA 4EQZA 2GKGA 2WWXA 1P33A 1H6BA 1G7TA 2CLMB 2PGXA 1Z2CA 4WLVA 4OA5A 5DNUA 3A05A 3V1TC 3IIMA 1U9ZA 1LI4A 1NJSA 1SFRA 3K4PA 4H7IA 3PC8A 4WKOA 1FK8A 3N8DA 4IZOA 3FF4A 4UHCA 5TS3A 1V11B 2QLMA 2X6TA 2YYZA 3VR4H 3L8DA 4ZRMA 2VJDA 4FFNA 1S96A 3HK2A 1VE9A 4G5FA 4RETA 5DWQA 2GB4A 2DX7A 2FN9A 4TYMA 4WGGA 2XEDA 5B58C 3PQ8A 2R62A 4LG1A 1OIXA 5DNEA 2QUZA 3SS8A 4YJHB 5B7QA 3P5BA 4GZ3A 1OU0A 4MV1A 2X8LA 4X1OA 1SOAA 1PS9A 3W3ZB 1GSAA 4QG7A 2BKAA 2JFGA 3SM3A 4UTVA 3PNKA 2CDNA 3D8TA 3JAWB 5ILOA 3X43A 3RBXA 2ZYGA 4MMXB 3TFQA 4JXKA 4NCIA 3ZHZA 4CF7A 2FG5A 1TUGA 4DM4A 2IEYA 1U1EA 3I30X 2DQSA 3PLRA 4RFVA 1XK6A 2PSDA 4AURA 3WLPA 2Z5FA 1EUDB 1RPAA 2HOQA 3FHOA 4I3GA 1E79A 2B1RA 4IGAA 1OYOA 5AI4A 3VPGA 4UASA 5DLQC 4AU1A 4BFTA 4DAEA 5ADVA 5K0EA 1YNOA 4W82A 5LQSA 3JYPA 4P84A 3SF0A 1AA6A 5IDWA 3BJMA 1HEIA 1HUQA 1L7VC 2O8FB 3VTKA 2JFHA 3KDPA 2A0KA 3QHPA 4QPNA 3V8BA 4MQEA 2XGSA 3HYLA 1IHOA 3DUFB 5JFOA 5AM0A 1J21A 3SQLA 2P6NA 3NIFB 1PL6A 3DULA 3QNUA 3R6GA 3QKIA 3UGQA 3E23A 3KEOA 5JW6A 1FYFA 2ZPUA 3G1WA 5AI0A 3GP3A 3CZQA 4A10A 4HXEB 5F5XA 2DJIA 4E2WA 1LUAA 3R7BA 3L8GA 4ZI5A 2YXBA 3H9EO 1RLIA 2FFBA 4QGHA 2EL7A 2XJ9A 3FTFA 5J9FA 2BTOA 3E27A 1NOIA 3M6UA 2WOOA 3WL5A 3PHBE 2JBAB 3I9FA 4D4IA 3GGOA 7MHTA 1KNXA 2JDID 4XEHA 2JAHA 3RVBA 2FPIB 1HKUA 1QCDA 2FFJA 3EB9A 2W93A 3IBYA 3UMCA 5C4IA 3ANYB 3BK1A 4L6CA 3PHLA 4F4FA 3FMPB 5IK2A 3QUSA 1H4SA 1E0DA 3LT4A 1RI4A 2PBFA 2UV8A 3Q40A 4G84A 2V3WA 1DJMA 3SHVA 1NX9A 2H0QA 4LS3A 3CVXA 3ESYA 4IDPA 3WYDA 3ZCXA 4FPXA 4AQDA 4BUJA 5LQDA 3PPWA 1XVIA 1ZY2A 1XTIA 3N86A 4CCAA 5JS1A 2XE4A 2E89A 1DKUA 3ELWA 4FT4A 3WIDA 3OPYB 4ENPA 1AF4A 3ML1A 5AXBA 3BX1A 1R0BA 5AVXA 2H0RA 4YNBA 3SC2B 1NPYA 1LDMA 3DMYA 5GONA 4C78A 3SQWA 2F55A 3AVPA 3TSCA 3ZR4B 4BNXA 2GAIA 1ZRHA 2Q3DA 1OXVA 1YS1X 1NQVA 2QX4A 3LYAA 3CT6A 3CEAA 2ZIAA 2YWDA 3JWEA 1LY1A 1QKKA 4FJ1A 1Y8RB 1QH8A 5EXEA 4F4IA 3JASA 3EZFA 1EU1A 2O5VA 4KG7A 5GV7A 1PWXA 1PK9A 3RUIA 4YRMA 5D3MB 1SKMA 3FTPA 1GZHB 1OMOA 1BH6A 2AN9A 2XZDA 4JD5A 2ZPTX 4ZK6A 3KR2A 4BBZA 2VTEA 4BWFB 3WWPA 3TE7A 2MSEB 4BNLA 3TD9A 4ZAYA 1L8OA 3GUHA 4RTQA 1G9XA 4YP5A 1JFVA 1KIAA 5J4LA 3V2IA 3EMVA 5HKKA 3OOWA 1TIPA 2DWUA 4E32A 5ILGA 5FTJA 5CJ2A 2QPTA 2ONKA 1QO9A 1O95A 2ZRFA 3LKZA 1HNZB 4XM1A 1ULSA 2GX6A 2DAPA 2PUHA 4I9UA 1GEEA 2AZTA 2VT2A 3GNLA 1ZWKA 2PS1A 4DMLA 5EMJA 1Z6PA 4BATA 1D2HA 3AP3A 5DISB 1I1QB 1LA2A 1OY1A 2BIFA 2H4ZA 1X74A 2Y1KA 2GOYA 2J3MA 2KX7A 2IFTA 3HB5X 3LX5A 4QJ4A 2PMEA 3LLSA 1DV2A 1V41E 3M6AA 2C3PA 1GPUA 5AD1A 1GA1A 4REQB 4ENTA 5A4JA 5D00A 1N3IA 2RIRA 3A6FA 5FWAA 2G9UA 3LUAA 1SUFA 1YR1A 1CUZA 5CXSA 3Q6NA 4TKUA 4XRRA 3HXKA 3KE9A 4CW7A 5CDYA 3JZAA 3QVOA 1E20A 1J00A 2F7SA 5JAQA 1ULBA 1FFBA 3CZ4A 4C03A 3MJRA 4RX1A 4EYGA 3PUXA 4O4IB 4MS1B 2D4AA 3HZHA 4R6WA 1U2SA 2ZQYA 2BZ0A 1N6HA 1RBMA 3G6WA 4UHJA 5B37A 1N2HA 3ZOZA 5G41A 3IO5A 1M8JA 5TPZD 4KPYA 2GPWA 5LMZA 5F21A 4EVSA 3EPJA 4JLPA 2HMAA 4B8ZA 4XJTA 1FW8A 1UMDA 1U3WA 2C7QA 4B4UA 1CNEA 1T2NA 2P8SA 2YXEA 4KX5A 2X76A 4X64B 2VT3A 2CWDA 1IHUA 3RK1A 3WNCA 3OE4A 3U3RA 4CKXA 1ODTC 1RMYA 2VUUA 4ARVA 1E0SA 3F2IA 5JSQA 3QKSB 3FDJA 4OMCA 3PKIA 4F9EA 2RGWA 4W4TA 2ATIA 5H82A 2HSGA 1SIBE 3AX6A 3EXHA 2J8ZA 3Q3VA 3JD0A 4N0QA 1N1MA 4YC7A 3S68A 4CKZA 3EEOA 2D74A 1QONA 4JP5A 2AL7A 2ATCA 2X9LA 4I08A 3LUPA 5EXTA 5BUQA 4GGMX 1KY4A 1EEHA 3LGAA 3O8LA 1GUBA 2HCRA 4LXHA 4XGQA 5AXDA 1XEXA 1WQ4A 3LVQE 5HRCA 5LLSA 3QHAA 4X1YB 4NS1A 2FCRA 5E9JA 3FTQA 5B3LA 4KMRA 4D74A 1OC2A 3P2KA 3LRXA 4EG4A 4CV3A 2HT6A 4PIMA 4G0XA 4HNAA 4WCFC 4LZNA 4GXQA 2EAUA 4XQ0A 1TZBA 2YJ5A 1MLDA 3Q41A 4L7VA 4QYXA 4EJFA 2O0KA 3OU6A 3RRFA 2HCTA 4F1KA 4I50A 1RJGA 4HN4B 3HEBA 2G09A 2PQ6A 3W5BA 5EWMB 1YBHA 4C0KA 2A67A 3PNLA 4KQKA 2PGOA 3ZD9A 2P2DA 4AJLA 4YCDA 2JAXA 4ZV7A 2PT6A 4DNOA 1T24A 3RK0A 4DIDA 1HDGO 2CUZA 2P41A 2NMVA 1F3OA 3HDGA 5J43A 1UPAA 1DB3A 2IYTA 2ZYIA 3DEJA 4IMPA 3BSSA 4N9WA 3A7DA 4Q7EA 1Y1SA 3AEZA 2DUWA 4M9RA 1QWOA 3PUWA 4PX9A 1Y63A 2SCUA 1V1RB 1NT2A 1ETUA 3MRVA 4MAFA 3KQUA 3VQTA 3BERA 1NYTA 1TLLA 2ZJ0A 3OFNA 4YRAA 4Q1VA 3AHJA 1L1FA 1OB2A 3H2GA 2VC2B 1T5HX 4WINA 4BKRA 1YDEA 3QWAA 4S05A 4FUQA 3KOWA 3DMDA 1YA4A 5KYYA 4O0MA 4JJAA 1UBHS 3UOWA 1EXVA 2J41A 1FZQA 2C84A 3FPLA 2QZZA 1QX4A 2F9MA 4D9IA 1YR2A 3LPLA 2D1TA 1UXGA 4LF9B 2COEA 1XDDA 1Z74A 2FG7C 2VI5A 4JDPA 3TL3A 4B3JA 2QVXX 3WK6A 3Q0TA 3WLJA 3MUNA 3R3SA 1VSUA 1A4UA 3BN3A 3LY7A 3EZ2A 3QNMA 1RAHA 1V6AA 4FZJA 4G0PA 4QFDA 4AS1A 2WFMA 3GFOA 1V4BA 4OLHA 3ZY5A 3A6LA 3PGXA 5ALRA 3UT0A 2ZBEA 3WYCA 2XYGA 3FUUA 3PGLA 3BXHA 4TN1A 2X13A 5KYUA 1PWHA 3WBKA 3WWEA 4BKMA 3JSXA 1MAAA 1MU0A 1N8KA 1VKOA 1LXCA 3CA8A 3F74A 3G02A 3D4NA 1TJ4A 5IJ9A 4TYNA 4HPJB 5BSRA 1NX6A 2J9GA 1KF0A 3GFRA 1GPLA 1CZNA 1SQFA 1QPGA 3DEKA 3CN7A 1D09A 4YACA 2XOXA 1YAJA 5LYJF 3FDZA 1MO5A 4I66A 3GF4A 5GZ6A 5IH3A 2X3FA 5EZYB 5BN4A 3CV3A 3ICCA 2Z56A 1EP2B 1VHDA 3QEKA 5BQXA 3U09A 1W1IA 3C4VA 4I1YA 3FCOA 2VTVA 5LM3A 3TZHA 1KAQA 1UJCA 4CLDA 4I3FA 3RYIA 3DTYA 1FNNA 1Z2AA 2XXJA 4P08A 4Q93A 5J2UB 5K2MA 4HNUA 5KYKA 2PEYA 3CO5A 3R5KA 5KDOA 4MIYA 5GVRA 2ZSJA 1AUPA 2P9ZA 3EZ9A 4MKIA 3AV0B 2WV7A 3GN2A 5JBIA 2FP4A 4O4JF 1SIWA 4FQ8A 1L7DA 1XCJA 4MSUA 4CCSA 4DSOA 3RS3A 1WB6A 4JA2A 2NXCA 2R6ZA 3TW8A 3A06A 1JU4A 3G0BA 4S1PA 4BC0A 1KI4A 5ES3A 5GJWC 1EDDA 1T2FA 3H9BA 1RAGA 2A5GA 4OL9A 1YCFA 2I65A 4QA9A 3UENA 1VKZA 2BFEB 3ZVNA 2ORYA 3SPXA 5HKOA 2V74B 1XZPA 3VZDA 2OO7A 4IHKA 4MINA 1EB9A 1VZ2A 3DOIA 4N7RA 4C29A 2A94A 1H8ED 5ALMA 4G5GA 3E9EA 3OQ6A 1SXQA 3Q7SA 2C8KA 4UFNA 1JTVA 4JLSA 5IT4A 2WB4A 2NO7A 1ZOIA 3GLGE 2Q1SA 3HN7A 3A4VA 1Y1PA 3ECAA 1WXIA 3FH0A 2FK7A 3D9QX 3HUDA 1FY2A 1PX0A 1BKYA 3DXZA 3KHSA 4ZRDA 3DTVD 2H07A 1EHIA 1VECA 2JCXA 3ANTA 4IGIA 1GCOA 4AF7A 1M2HA 5LZ7A 5CT9A 1NOKA 3OECA 2EWWA 5JQGB 5C8YA 1FJXA 5DWDA 4YCMA 4MVJP 2CB0A 1KYWA 4ZT3A 1VIDA 1JAHA 5EPUA 2OP1A 1FMCA 2LWIA 2N75A 3S81A 1KGDA 1KRXA 3L06A 3HWX1 4IJMA 3A1EA 4IXDA 1LPMA 2UXBB 3KSMA 1XKLA 1A5SB 2VCYA 4I8IA 4GMGA 1JJIA 1SCKA 2AOUA 2QR5A 4G85A 5I5GA 4US2R 2GZDA 1EQAA 5BNFA 1YSCA 5A7HA 2BEUB 1T2VA 1XDUA 1LH0A 2RHOA 3HBNA 3UANA 4KTTE 1CJUC 2BF7A 2IA5A 1KMNA 1RXEA 2G9QA 4IDGA 3N7TA 3PJFA 1S8OA 4FYIA 3KDAA 4MGIR 4D1YA 5FWDA 3CVUA 1CP2A 2IBTA 3JARA 2COUA 1OYYA 5G4KB 2P30A 3UATA 4WEQA 4QPZA 2DQKA 1Z35A 4O8CA 3MCZA 3P96A 5HJEA 2H2DA 1YAHA 2JAUA 3HP1A 2ODTX 3IVXA 4URXR 2H1WA 3EAFA 3NKLA 4NOKA 3FYUB 3SBEA 1LK0A 3IOCA 2FUG6 1CEEA 3B3JA 1Z6YA 2QN2A 5JV5A 3EH2A 4YHBA 1NN3A 3VVMA 1APBA 1MIHA 2O57A 2RH9B 2C9OA 3B13B 4L5AA 1LLDA 1RYBA 1TYEB 2QJWA 4GPZA 4NDAA 3SU8A 3U4AA 3GLFA 3K31A 5JXJA 5G53C 2FFRA 2R48A 4HNGA 4ZJYA 1ZM3A 4AS3A 3HKDB 3NV7A 4QHSA 2F48A 1L6IA 5L3QA 1RWWA 1NNUA 2PUJA 3VU3A 3ZU3A 1SB9A 2FPGB 2RARA 4WBNA 3AF0A 3VR6D 4Z4FA 1MX3A 1PR3A 4YRGA 1NNLA 5ER6A 4U7FA 5LP6C 1P1IA 3ZY3A 3OQNA 2HIGA 1JTFA 4YRQA 2V4ZA 5A7FA 1CQJB 2XMPA 2C42A 5DSZA 5EGSA 3AFMA 3WB2A 1JLHA 4KQIA 1NMQA 4BZWA 1KI2A 1CDOA 2YWEA 3M34A 3H87A 3B53X 1W9HA 2ZLBA 5C53B 2ZW9A 2ONZA 1E3QA 2CUTA 2P6MA 3JAKB 4N54A 4MDEA 3C7DB 4OXQA 1OWOA 4Y7DA 1ISSA 3FYDA 2CMDA 2WY2D 1IDOA 1KTIA 2VNAA 1X7YB 1KEEB 1XZGA 1VRVA 1LBIA 2BDUA 1Z15A 4ZXFA 1J0XO 1A7KA 4W5WA 5D7BA 2N3ZA 4EHHA 1T8SA 3ANSA 1I4OA 1SNYA 2A92A 3OURA 1IN5A 2RGAA 1HQKA 2VVTA 2Q3EA 3G2JA 2ACEA 2BP7A 1U6IA 2PX4A 2YMLA 4HTFB 3KZXA 4XPIA 1CC1S 4IQ8A 2WE8A 1CY0A 3HYRA 4ILKA 5CM9C 4IMRA 2G5PA 1QU2A 1T2AA 2YWHA 4IIJA 3ZI0A 4X90A 4H9GA 1QBGA 1ZRNA 2CDBA 2PKCA 1QHIA 3KXLA 2JLXA 1IQPA 3NBAA 1TLFA 1UC4B 3GJQA 4L1KA 4QU0A 3UJ3X 5CTAA 4JP1A 3PZRA 3VC7A 1IM5A 621PA 5KHLB 4MIOA 1P7WA 4XASA 1QYCA 4NABA 3CU5A 1XNRB 3C6XA 3WS7A 3LX8A 4I50F 3URMA 2Z4RA 2IITA 4YLEA 4C6SA 3OJWA 1YQWA 1NJ1A 5F4BA 1FMFA 2WWTA 2OV3A 2DPXA 4JBLA 2GCOA 3G1TA 1WLYA 4D3SA 2C4UA 3GEPA 4LOJA 1H9AA 2XB2A 1M8GA 2LKCA 5TY0A 3PUIA 3MXTA 1Y89A 3KB2A 1UEIA 2BKVA 1U5BA 1CBUA 1LQTA 1VLLA 1ZMXA 1KQ3A 3IJPA 4NV0A 4UVDA 5HBGA 4LWZA 5HF6A 4J9UE 5EESA 4CDNA 3OIYA 5EEGA 1VG8A 1QTIA 2I22A 3QIVA 2DC1A 3PFWO 4UFOA 4LF6B 3CUUA 2PR7A 1LD3A 1CRZA 1E2HA 1E1RD 1Z4IA 4XFDA 4WZAE 1A4IA 2CDAA 4TUYA 1CY4A 1XRSB 1NXQA 2XX3A 1KZ1A 3T3MB 3WKCA 4DQUA 1BD4A 4L8FA 1GRRA 2NNLD 3CLUD 3JD3A 1P1HA 5JWOA 4QX6A 4IFEA 3AVTA 1D2RA 4IIFA 1WLSA 1X1QA 3QELB 1V35A 1QQ5A 4L3VA 1BHSA 1DKOA 3ETDA 4M1SA 3R3WA 4F8YA 1PCXA 1R3UA 4A6DA 1X7WB 1MJGM 1EP3B 3DT6A 3GJ4A 4QAJA 4A2CA 1OIWA 2NM0A 3WGQA 4PONA 1JQ5A 1SG9A 1U9YA 4S24A 1BE8A 5CNMA 2WWYA 1IG0A 1L0BA 5K3DA 1ECFA 4CCYB 4Z53A 2PJRA 5DDIP 1YD7A 4KI7A 4PYNA 5HFAA 1RLUA 3OWOA 3WLIA 3R75A 2N9UA 5EHZA 3NDBB 4LDJA 3NANA 3NP9A 1DRWA 4LJSA 2V7VA 1K7EB 1XZBA 1UBEA 1VJGA 4HXFB 5IC5A 3U13A 4EHNA 4X65B 4C0BA 3ICOA 5FP0A 4LRWA 4HQOA 1AMNA 1LBEA 4EP1A 3B2EA 1W75A 4LMPA 3DG9A 3GU3A 4HDSB 2IYQA 1VSBA 2A9KA 1DLIA 2H7VA 1ZSVA 2Y77A 3N1UA 5EXSA 4ZTBA 4ZD6A 3OKCA 5L51A 4NE7A 5JEDA 3G9UA 5ALIA 5FL7A 1UZUA 2KMLA 1MVOA 1KO1A 2IGBA 3PFNA 3KLOA 4N7BA 4W8OA 1PV2A 2ZWOA 3VDRA 4HADA 3WKBA 1PR4A 2BDTA 3JD4A 4KEAA 4CNQA 5ESWA 3V7WA 3Q11A 3A70A 3KKQA 2F1HA 4DXAA 3SLRA 5AW1A 4LVOA 4ZCMA 3VX3A 2PFGA 1RYMA 2UDPA 4WADA 5JNWA 4NXMB 3L8CA 2WWRA 3Q88A 2W2TA 1U9CA 3IJEB 1RCFA 1D7AA 2BHNA 3O93A 4MUKA 2B35A 4MUYA 2J3JA 3ZE0B 5JARA 2H5JA 1F51E 1UT8A 3DLIA 4YONB 5THQA 1RACA 3V32A 3T0IA 1FYWA 2J3KA 1NLYA 2BEWA 2F6RA 3BCSA 3NIGB 1G8PA 4NBWA 1HNWB 1VQ1A 1KDRA 3TRJA 1JYSA 1PFQA 2YW9A 4R54A 3VNQA 4ALMA 1UWCA 1QP0A 1X1TA 2HMWA 1SC1A 3GRZA 3MK31 3A25A 4WNAA 3VPDA 1I4TD 2NOAA 2Y1OA 5DN6A 1BE1A 4YX9A 2IPLA 4MP3A 3C8DA 3GC6A 2YASA 1FSGA 6REQB 1BOFA 2QAGA 3KKMA 1AN9A 1QDLB 4EARA 3M6XA 1YZUA 2WZQA 3H7IA 3F73A 2GJAA 3FFBA 3G8AA 1ZYUA 3HFGA 4REOA 1G8YA 4N5HX 5JS8A 5LZ8A 1R4ZA 1TQ6A 3VO9A 5F9MA 1TK3A 3PCXA 5JJ5A 1HT3A 3H2BA 3AF6A 2RBGA 4EA6A 5KSZA 2DH5A 4KIJA 3I5MA 5FHQA 3QYJA 1W0KD 1BH2A 4L3WA 3PEYA 1UJNA 2B5OA 2GZMA 2WD7A 1YUBA 3DF9A 1SEVA 4D9CA 4DIFA 1L8AA 4IHJF 2A9RA 3GPBA 4DGQA 1HRKA 3UJHA 3ZGLA 3MSXA 5JG7A 2DTXA 4KQXA 1ORVA 3MW8A 2WAXA 5K0LA 1T3TA 2EZUA 1KP3A 3ZPXA 5JPDA 3BE6A 3F46A 5LU9A 1J0DA 1XJCA 4NQZA 4PS0A 5A71A 2JJ8A 4D8UA 5HF9A 2K2QB 2FN3A 1EVZA 2C4HA 4XTCS 1Q16A 4LOHA 4PC3A 4B8WA 1YTLA 1UZAA 4KB5A 2W2KB 4FBGA 4NKRA 3SEAA 5JMPA 2OHIA 3GZJA 4J07A 1HOTA 2Y66A 1EYZA 3WBJA 1Q0UA 4IDCA 2PL3A 3NM6B 4H0CA 3RUEA 3ZXXA 3NGLA 1ECPA 4KMMA 2CBZA 4BLRA 2D1RA 1OT3A 3MRXA 9ATCA 4Y2XA 3DAYA 5LNK6 10MHA 1Q0ZA 1U9IC 2OSBA 4WKPA 3MEQA 3Q7TA 1QV9A 1C0EA 1VLVA 3QEJA 2G1PA 2IXTA 4UAUA 2V5AA 4Q9JA 4R0VA 4B79A 4H3HB 3QWHA 5F98A 2DR3A 3AI1A 1SKUA 3IHLA 2IP2A 4KXUA 2NPFA 1F0YA 2GDZA 3EC7A 1YZNA 2Q3CA 2WTXA 4L02A 1I6WA 4BYGA 1NWCA 4EJSA 1G5QA 5AWFC 4XQEA 2ZIGA 2Y0BA 3GZNA 3PICA 2O1WA 4K3VA 4KKVA 4DA9A 2X6RA 1Q84A 2PZAA 2VF4X 1W5SA 2AG5A 2BMFA 4ACBA 3ZLVA 4LRYA 3CMCO 3UAYA 1U8AA 4J75A 5JCJA 3DCIA 4C0SA 3LYHA 1N6PA 1PVDA 2J0EA 4RK5A 3SMVA 1MABB 3M5CA 4IG4A 3TX2A 3VX4A 1VE1A 3Q3CA 1ZP6A 1CETA 2HK6A 2YV5A 3K0CA 4WVFA 5KNDD 3HY3A 5J4YA 4FOLA 3KJIA 5MN6A 3OQPA 1JQEA 2B9VA 1T2UA 4LY3A 4U3JA 4LUCA 2CXRA 3TTTA 5EXPA 1IQUA 1SB8A 3WQRA 2OUKA 3MGCA 3W9SA 3IR6A 3M4NA 3C3KA 4PF1A 5LOVB 4B7UA 5GAJA 4MVCA 5IVPA 1NVTA 4IQFA 1TLTA 4IJWA 3HA5A 3A7EA 3BMQB 1N9GA 4GM0A 3F5QA 2NU6B 1HDZA 1S4MA 4FN5A 4ED9A 1JSLA 2ABWA 1BCRA 4CLOA 4KXXA 1E1KA 2RGUA 2ZCJA 3NYWA 1WDKA 2LD4A 2C9BA 3O75A 2AYZA 2YZNA 3T1TA 4LSZA 1U90A 2P3LA 2PD4A 3G2IA 1Z4KA 4YREA 1J5XA 3PDCA 2F1IA 1L7AA 1AZWA 1ZINA 2VR1A 1GQRA 3R40A 4RIFA 3C6MA 1SD1A 4P81A 5AHWA 1HYEA 2R2GA 1XKTA 1FQKA 4W8HA 1YF3A 1QZ3A 2J3EA 1W2WB 3A32A 5CITA 1G16A 3EBPA 2IYOA 4HB2A 3QE4A 3U3DA 2QUKA 2YY7A 4G23A 4M0KA 2EGGA 2BGWA 1EUCB 2OGUA 2VZ0A 2ZTVA 4NAHA 3LY9A 4LJ4A 3WXMA 4UU8A 4LGYA 4Q7KA 4PZUA 1D2EA 2AQIA 3P97A 4IS3A 3KSBC 4LDAA 4TL8A 5E2BA 3L6BA 5EQTA 2J4CA 5EZQA 2V9ZA 1AQYA 3KUUA 4OMUA 4IWNA 1R0XA 1U4OA 2OT3B 1B41A 4K9PA 2GPNA 2BD0A 1NW3A 3EQ6A 4PHTA 1VE5A 3IS3A 3TSZA 4ERNA 2I1LA 4CMJA 5CGZA 2X5OA 3PYMA 1MB9A 1VHJA 4TUYF 4JODA 3L84A 3TLCA 2D5LA 3NKFA 4FILA 1RLOA 2P0YA 1SVKA 2NUPA 4MUHA 3WZLA 3NB0A 3AIIA 1UDBA 2C8JA 4F45A 2OAQ1 4IX9A 1OGYA 3NXSA 2V7UA 4L4XA 5JFGA 3TBHA 2R6GA 3OF2A 4XLZA 4ZVTA 5CYFA 3Q2IA 4ZAZA 1JXAA 5I4KA 2H2AA 2Y68A 3BMNA 5DBEX 4Z8YA 2AF3C 4EITA 5IULC 1ULZA 1E92A 1OILA 2AQHA 2ZBDA 5GIPE 8MHTA 2GLXA 5FWYA 2C03A 2PU7A 2HCJB 4ATNA 1AKUA 3E6AA 1S01A 4AZVA 5I7OA 4KV7A 5H59A 6LDHA 1JWBB 3PUKA 4FONA 3VH3A 1A77A 4HGZA 4YB8A 3KB1A 3WB0A 4KWHA 5LYJB 3GEEA 2M98A 3NHSA 4PZAA 4K5QA 4ALLA 4IOJA 5HTKA 3IRUA 4R1TA 3RTDA 2FPKA 2O8DB 1E7MA 1YVEI 1ISJA 2ZB8A 4PFSA 4LFBB 4GS5A 4DEVA 4WE3A 4E1BA 5A7GA 3HVUA 5CRIA 1TRHA 2HLNA 5TF4A 1FNMA 4P4NA 3RLFA 3U7QB 4KLZA 2EBFX 3DWIA 4I4IA 1FDOA 2XDWA 3JCZA 1Q0QA 1XFAA 5JO0A 4EO4A 2OBFA 3C1AA 2EJCA 4I1UA 4AB1A 1PHRA 4NK5A 1AUQA 1LLQA 1EGAA 1ZO8A 3AHEA 3FUWA 3N58A 4O4JB 3QLVA 4HWSA 1TEXA 2OGWA 2P1RA 3AZQA 4LJYA 1RJDA 3E8SA 4M0EA 1TA4A 4LYHA 4UM5A 4ZT6A 5CAEB 1Y98A 3CEPB 5EMLA 3GVCA 4A8JA 2WJIA 2WAYA 5K6AC 5AOCA 1UPXA 1CT9A 1ISPA 3W9UA 3UMMA 3T4XA 1Y42X 3DWEX 1Q7RA 3OAAA 4F8EA 4ZI3A 2NU9A 3GD7A 3M6FA 4HWTA 4KJZA 4KJXA 3ZVMA 1QTNA 1OLXA 3CEHA 4F04A 2LP4Y 4JYMA 2A0WA 2HMVA 2HU5A 1RXIA 1RHRA 3PENA 4G5QA 3TFWA 1WUKS 1ZW1A 1ZISA 2IXAA 1XZMA 5G0WA 3CRRA 4E5PA 5HP4A 1Z2OX 2CYAA 5AT1A 4C3VA 4TLBA 1PZMA 2Y9PB 3BE8A 1NG9A 3PEEA 2C58A 3QFSA 3ZQKA 2E1PA 2HGZA 5GONB 2WIFA 1DTWB 1QK3A 3HBAA 3K35A 3TM4A 1T26A 4QGFA 1EI9A 5KNCH 3K15A 5DTJA 2Z2IA 1K6EA 5HILA 3I5YA 2QE7A 2EZTA 2PO5A 1DZIA 2X41A 3ANLA 3Q2OA 4M0UA 1CUGA 4IIYA 2VUSA 1IOLA 1JDPA 4R2XA 1ADYA 1QH8B 3RTGA 4K86A 1O94D 3JASB 4C7BA 3KUCA 3D2CA 3JZMA 2ANCA 1MD9A 1N2CA 1Y37A 1GRNA 4NOLA 4R8LA 5TJHA 3IE1A 3NAGA 4LNUA 1JS1X 2NZJA 1AD2A 2QTNA 3H8JA 4L78A 5H81A 4F5WA 3I4FA 4FSXA 3EIWA 4NZYA 5AOVA 1IJFA 1P2GA 3NNSA 3UT5B 1WAMA 3TPZA 1VBNA 2P9BA 2WWWA 2BLNA 4RSHA 5KX5A 1GQFA 3WK7A 2UUOA 3F67A 1LX6A 1E3IA 1DC6A 3H9CA 3BB4A 2BCJQ 2ZT5A 4U9HS 1QGED 1N6NA 4DDUA 4YRTA 3HNRA 2B4AA 3GRUA 1IZZA 1K2WA 1UMBA 1JQAA 4HX2A 4B17A 3DNMA 3RJMA 4KQEA 3UT6A 1G5FA 4ZRNA 1AVTA 2GF0A 3VR3A 3H0CA 3WGTA 1XCMA 2QGZA 5C0OE 3QVVA 3MJHA 1BFKA 3I5UA 4KLNA 1BVUA 1C4KA 3W78A 3C3AA 3REFA 3CNNA 4N03A 4RGQA 3O8DA 3M4ZA 3FF1A 2IDZA 1YFKA 2XF8A 2AZ4A 4ZDWA 4XWOA 2AFHA 1GDHA 1XLTC 1CNFA 1MX5A 1EQUA 1QGDA 2RGXA 2W8ZA 3MRTA 4KQMA 4PXSA 4C5BA 3ZWOA 3ADDA 3CE6A 5ICGA 1AXGA 2ERYA 3IR5A 3QW4B 1GUAA 2BM1A 4MULA 4ZIRA 3AR3A 1B0ZA 2AHRA 3CX8A 2IRWA 5EE9A 3RH0A 4ZI2A 1U99A 3DBIA 1V0JA 3WBFA 4DXHA 2ACVA 3L77A 1DGQA 3CH6A 5C5CA 2IW1A 1UMDB 1OROA 1PL7A 1QVVA 1JDBB 1R6BX 2RGEA 2WT9A 3BG5A 4BP1A 4NJMA 1Z06A 2FXVA 3GBVA 1AKRA 1Y7HA 2H1SA 3AUTA 1ANKA 2OECA 3CRNA 2A57A 3NTVA 4N5MA 1PR2A 4XR4A 2OSVA 2ZBGA 4DV5B 4X1IA 1RM5A 1GQYA 3F90A 4JNKA 1N32B 5ER9A 1DP4A 3SM9A 2RHWA 3NTLA 1TTQB 5K9ZA 2B2XA 4TLAA 5DMXA 4IUDS 5BT9A 1BW9A 3G2KA 1Y3CE 4OKIA 3EXHB 2GJSA 3OZFA 1PBTA 3R0XA 3EIHA 4BNJA 4DEXA 1GDTA 1CYDA 2QJRA 3TSAA 1RJ9A 4B6EA 1YB4A 3W7VA 2QUAA 3PXUA 4YRDA 4MV4A 5AIAA 4J1TC 1YB7A 3H3JA 3KAPA 1XEXB 4Y2TA 1KQPA 3FLAA 1H22A 4J4TA 4OXIA 3A04A 1QP8A 1XAHA 4BAZA 4JR2A 4YGXB 1J99A 4L76A 5CHEA 5LZ4A 1YC5A 2JIQA 1FMLA 1AUXA 3BF8A 4A36A 3Q8WA 3D6VA 2XYPA 1D2MA 1JKJA 1YI1A 3AXSA 1Q2UA 3K5IA 2UZAA 5FRDA 3WLHA 3W7BA 1Q21A 2IU4A 2PRKA 3STYA 1YBVA 4K9RA 3K70B 2WIDA 4OB6A 4H0NA 1F2UB 3DHVA 4I50B 4UNSA 2IVZA 2GEFA 3W1WA 5HX7A 1AQ6A 2JFNA 4CV1A 4KQGA 4LJAA 4OREX 4FC7A 3LC0A 3S2UA 1DE0A 1EWTA 3G8DA 2BFOA 4LJ5A 2XGOA 5D2CA 1CUJA 1UJ4A 5EAIA 3E22A 1LPBB 4Q3OA 1BE6A 4M1QA 2R6FA 4MPPA 4ZZ0A 1F20A 4J94A 4KZPA 3ZXSA 4GF5A 4FKZA 2J3DA 1AK9A 3TGPA 2ZYRA 4CKBB 3NEPX 2O2HA 2WYVA 3S27A 5JVDA 3P94A 2HBZA 1QKJA 4G0OA 4M83A 5SV2A 1XTUA 3KXKA 1E59A 1HWYA 3PXEA 5DYGA 3I8XA 3EGCA 2E0IA 3L05A 4XYEA 5L3ZA 1X1DA 3AO0B 3C74A 3LWBA 4MKXA 3CLUC 1EX1A 4YQYA 3FVVA 3BWYA 3NLLA 5FEMA 2IEBA 1SKYE 1NUHA 2H2IA 2QYTA 2FKAA 3E5RA 4UMDA 2UUBB 5FPQA 4H3SA 4EAQA 3D3WA 1CSEE 1KFKB 3D1VA 1YH3A 4CHGA 1R2QA 2WZDA 3ASVA 3PFGA 1YZHA 2AEJA 4IOLA 4BVKA 1QYVA 1NXXA 3JQGB 3OZAA 3PZBA 4AN0A 1P1BA 4DA8A 1TZMA 2P1DA 5BVHB 2VZ9A 5GIOE 4TTPA 3VZQA 1MFZA 4N6OA 3VR4A 1FCJA 2ZXFA 3IMEA 4QTTB 2JI4A 2ZSDA 3BWMA 3SSNA 3NC1C 1ZD1A 1D0VA 2P68A 3A4YA 1BMFA 4HWGA 4RENA 4ZZ2A 5I4CA 4M3NA 3DWFA 3KT0A 1WUJS 2GTHA 3LC7O 4UNIA 2JGLA 3O8RA 4CF6A 4QUDA 2I7CA 3VU9A 5KJEA 3I9OA 4PN3A 5IJ9B 4R31A 5TQJA 4PTLA 3DVLA 4DUYB 2W0SA 4MYTA 2QDXA 2XWPA 4E51A 2ZYHA 3T61A 2XWSA 1TM1E 3EGVA 3FDZB 5BN4B 4RXTA 2P0AA 3SE0A 3CY6A 3L9WA 2QRJA 2ZJ8A 1YBAA 2CKDA 4KNWA 1ABBA 4UHHA 1HM5A 1AY0A 4K8OA 3HGQA 5TXGA 2CXHA 1QIEA 4JB0A 5J4HA 1A9ZA 5DB4A 2P75A 1XD2A 2Y76A 2NVBA 2Q6OA 1P4JA 1OR8A 3ZV3A 1GQSA 4BO2A 3BL6A 5HVNA 1T5TA 2PRYA 2X5JO 1HBJA 4LCEA 5CHYA 3A9VA 5KJ6A 2FZEA 4RHEA 4HDRA 5I7HA 1S8AA 2GJ8A 3B3GA 4BTLA 1BXZA 4BLTA 4JU9A 2ZETA 2IZZA 4F6LA 1NJ6A 1P1KA 2JA1A 3G3EA 1U98A 2NSJA 4OJKA 4R5MA 3F0TA 2X2EA 4MVYA 3O90A 4BP3A 4KLRA 5KYXA 1E1QA 1GGKA 1KMQA 3PKJA 4D46A 5D1NA 1FQWA 1IFXA 3PX2A 3ZX4A 4CYMA 5KC8A 5LQUA 1F7UA 4F3YA 5ALFA 4PHHA 2W90A 3WGGA 2AI2A 2C92A 3CFYA 3CF2A 4AYWA 2GNAA 4LF8B 3NJRA 1Y3AA 1Q11A 2XTNA 3OPVA 2IWHA 4UUPA 3ZJUA 3CJTA 1XEFA 2QYOA 1S3GA 1ZK0A 2FPRA 1UDAA 3NHKA 2FW8A 3TG8A 1RWKA 2W5UA 2D7JA 2VK8A 5C8YB 1KP2A 1V25A 3BAFA 3BZWA 4QU5A 2OV8A 5C7IO 4KXQA 2RJ3A 1XU9A 3KRTA 1ZGHA 2ZU0C 3HA2A 3OTIA 2Y0PA 2RG1A 3AZPA 4XOUA 3PWKA 1E2BA 1XZNA 4GM1A 4HLUA 2D5BA 3GQVA 4Q1BA 1A9TA 4Z8XA 3V3TA 2PD3A 1DIHA 5A6VA 2HYIC 1NNSA 2GTPA 2WG0A 2AOUB 1PS0A 3O2SB 2B3DA 4IHJB 1IMJA 2CXUA 4PX5A 1MOPA 5E7QA 1C41A 3QX9A 2Y1EA 3RYCA 3R5FA 2R8OA 1NP7A 1DINA 1W1WA 4G4SO 2ZJ7A 5HGJA 4DMCA 5KZMB 1MEOA 2ONYA 5L95A 3DVAA 4W5TA 3FI0A 3G7UA 4YO8A 1EFVB 2DWOA 3FHCB 4RFLA 1HY3A 2VBFA 3JARB 4ZKDA 1CTQA 5A4FS 4RAQA 2WIBA 4Q4AA 3PK0A 2GBGA 2MYUA 4JK3A 3RRNA 3TTVA 2VP2A 4OQMA 2ZRDA 3MJTA 3M0EA 4BFXA 5T6MA 2X23A 5DEOA 1OU4A 1UC8A 2R1VA 1H05A 1UM8A 4B1FA 4EO9A 2Q27A 1D0SA 1FJHA 4HDOB 2EJVA 3C24A 1ACMA 4Z4CA 2QVYX 3LX4A 1FJ2A 1NFRA 2NO0A 3GAMA 3GRKA 3KAKA 5FA8A 4QDJA 4EPWA 1SEPA 4F11A 3GLFB 3C98A 4ZVNA 1K68A 3I6IA 4CTNA 1BS1A 1G2QA 2XCLA 5LZ2A 2QLJA 4ARZA 2RKOA 1U8XX 2ZRAA 3E5NA 5KYVA 2IEAA 3ONFA 5FFNA 1T6ZA 4AL4A 2BSXA 3V34A 4TXHA 1XMIA 2OUIA 4R1PA 4EHJA 3DONA 4WBNB 3L93A 3U6BA 3B52X 3U44A 3AYZB 2ADFA 2GAJA 4KFSA 4UTXA 2AFVA 3MILA 1PTKA 4KGDA 3Q3HA 3ZXUB 6PFKA 2P2LA 4AN4A 2GN9A 3OLVA 1YTUA 1U7WA 3FPCA 4AI6A 3T1OA 2V7XA 4JZKA 1OFTA 1IAQA 4E31A 5AIBA 4TSFA 5EP2A 5JYCA 1H0SA 2JKZA 2YWRA 4J6EA 2G07A 4FXPA 1W6RA 2ZVPX 2AOXA 5DHUA 4G0ZA 3RSCA 4G86A 2AMYA 2R68A 4V0SA 4IJKA 1CE8A 1XZAA 1E77A 3DD5A 2ZEJA 1XU4A 1HO3A 2ORIA 3FNIA 3H3FA 3KYJB 4KQ6A 1Y8ZA 4A82A 2AFIB 3IP5A 3NHFA 2VF8A 1KYYA 3INTA 5ALKA 1HQDA 3PS9A 2I4NA 3OLZA 4IWYA 1N5MA 5K3FA 2BP7B 3Q7RA 4HPXB 2F3QA 3P9KA 3L3BA 1W4LA 4I4CA 4ND7A 3K96A 1S1CA 3KP1A 3MA0A 4I8XA 2WSSD 2HK8A 5CYPA 4X94A 4J3JA 4QUGA 5BW5A 4HQFA 1DAMA 4JC5A 4HFJA 2C7OA 5SY6A 4FINA 3KU1A 3KOOA 4A2WA 4B74A 1TM7E 4R1UA 4OEHA 1RRVA 2OTCA 4EG5A 3QIAA 4LYDA 4RD4A 4NYMR 3UK0A 2FQYA 3KVNA 3VR2A 4TYWA 1E94E 2JIDA 1Z6TA 2MYTA 2VPXA 3F7OA 1ZITA 3WYGA 4OO3A 2FX2A 2C78A 2I1VB 2RHHA 2ZI5A 2OZLA 2RGGA 4HJRA 5EJFA 5AVJA 5IBQA 4DT1A 2QS9A 1E6KA 2Z1DA 4H27A 3WWDA 4RA9A 1I01A 3E9MA 3QFRA 1X6VA 2GEKA 4R1LA 2NSYA 4UKDA 3G2LA 2C2GA 2P3OA 2YMQA 3H11A 4PSDA 1OHHD 1W87A 4V24A 4QZVA 1Y5LA 3PBKA 3FSGD 1TC1A 1UBLS 3JQBC 1B8VA 1JG7A 2OK7A 2RHCA 3IMFA 4PWYA 5GWXA 3WSWA 2V54A 4TUYB 4I9FA 3T5PA 2F1RA 5AM3A 1M54A 1C8BA 4MWBA 1DRKA 3NOQA 1FU8A 1F8XA 2P5UA 4OH7A 2IUFA 3PE4A 2BGJA 1HDRA 3LZ6A 1O6FA 4NNJA 4RL6A 2G9RA 4TGLA 5ULLA 4X85A 4KAAA 4DF3A 2EQBA 4E15A 2HW8A 2EFCB 2ODAA 3H17A 3DO6A 2CKMA 1K98A 4YGYA 4AJIA 1PNOA 2VPYA 5FI5A 5EJ5A 1R5BA 2ZTHA 3KAJA 1NVUQ 4G09A 6GPBA 4MW5A 2AH5A 1PWEA 3AF1A 3F1KA 4XIJA 4N6NA 3PYLA 3R9IA 4YMLA 1SH7A 3TXXA 5AQ1A 2CCJA 4BNKA 3BGDA 2JZCA 1KOJA 5DNAA 3P19A 2MSDB 4O1HA 4Y9UA 3PR3A 4EHLA 4U2EA 4ITVA 3LCMA 4C4ZA 3PFFA 3QKTA 2X1VA 1AK2A 1JU9A 3OI7A 4TTVA 5D86A 4GYWA 4TWAA 1KZ7B 2FWAA 1P0CA 1UJBA 1XTSA 5JDCA 1YRWA 3NDIA 4I9GA 4IDEA 3QG1A 1NJ5A 2QZPA 3NOVA 4KUGA 5HG0A 2H9AA 2VRCA 4EG0A 3IMGA 2NU8A 3ZHCA 2ZSAA 3PDUA 4CN8A 1TE2A 4K6OA 4BMPB 3SR4A 4H18A 4I19A 1F2VA 1JH8A 1P60A 3FDXA 4D9BA 1IJBA 5CT8A 2F67A 3GVXA 2UYOA 4GWLA 1T15A 1UQRA 3ER6A 4Y6GB 5HKBA 1PV4A 1U7ZA 1B93A 3ZWQA 1SOWA 2O0JA 4BGUA 3C3EA 1YS9A 3HCCA 2Q21A 4UBKA 5EJ2A 1FDIA 1AN0A 2ORWA 4X6UA 4EW6A 1DTEA 3LFTA 3EPHA 5FI3A 4FFWA 1QO7A 4DR7B 1Z7BA 2QRNA 2AJ8A 1MJFA 5ESXA 4TWIA 3COSA 1Z5NA 1D6JA 3LVFO 1I2AA 4QOEA 2GZRA 1ZUHA 2YJ4A 3MWKA 5JRZA 3RSQA 1C9KA 1R6TA 1II0A 1V96A 2VQDA 1FXWF