5H4HA

Structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 2.2 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
144
Chain Sequence
PLPPDITFDSLALIKMHSQNMKRILEVTLAKFTVNLSIVTVYRYLTARAYLKKNIEAEFEILKDIYNIVPLLDDIAIKAAQIEANLIKKEITLDMEDIITATTAIYTNSLLVTDDPKRYEPIRRFGLDTMPLDKFIKEVELMVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease VapC4
publication title Structure determination of contaminant proteins using the MarathonMR procedure
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
total genus 52
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5h4hA00
3Q8MA 2H1CA 1V8OA 1MC8A 5HMLA 3ZDCA 5ECYA 2FE1A 3TNDA 2HWXA 1XO1A 5H4GA 3IX7A 4MJ7A 5HNKA 1UL1X 3DBOB 2HWWA 4CHGA 3H8WA 2IZOA 3H7IA 5ECWA 1B43A 3ZVKA 5ECDA 4XGQA 2LCQA 1V96A 1RXVA 5H4HA 1BGXT 3QE9Y 3ZDAA 1O4WA 5FV7A 4XGRA 2MDTA 5ED0A 2H1OA 1UT5A 3ORYA 3ZDBA 1Y82A 3I8OA 3H8JA 4WA8A 3ZD8A 3QEBZ 1TAQA 2WP8J 3Q8KA 3Q8LA 1EXNA 5HMMA 2BSQA 3ZD9A 1W8IA 1YE5A 2IHNA 1RXWA 3ZDEA 1V8PA 2DOKA 3H8SA 5HP4A 5K8JB 1A77A 5L6LB 5L6MB 3H87A 3QEAZ 3ZDDA 1TFRA 5SV2A 2HWYA 2QIPA 1TAUA 1A76A 1UT8A
chains in the Genus database with same CATH superfamily
1QS0A 4IKOA 3TTWA 1CQXA 2P9FA 4FEGA 4RMNA 2VTDA 4P6VF 1N0VC 1U6KA 2H4HA 5BORA 4XCXA 2F1RA 4I1PA 3R9WA 1XMXA 4JYAB 2FKNA 4PTYA 1D4AA 4BX2A 4OX9Y 4KXVA 1DU4A 2XQGA 5EIBD 5KU1A 3VUFA 3KJIA 3AKZA 2DB3A 4FYIA 2H52A 4HNGA 4HNAA 1H2BA 1O97D 1V4NA 2Y1OA 3SS8A 3OQ1A 1M34B 1HH4A 2BMJA 1FUYB 1REQA 2XWPA 4HCJA 4XASA 3DAGA 5FF9A 3A6FA 1Z4KA 5E6UA 2UUAB 1WTAA 1P1JA 4J0GA 4Q00A 2H16A 1N0IA 4CF6A 4PR0A 3W6NA 4KXMA 3MYYA 5C7IO 2ODQA 5HFAA 4HDSA 5K4GA 1F9EA 1TT5A 3DONA 1OH8A 1WE2A 2D2IA 2HJVA 1RQ2A 2V7WA 3HNPA 4K5QA 4OIMA 5DHUA 3EMVA 3TAXA 4IS3A 5DGCA 1PW7A 2QRKA 3D4LA 1MB4A 4CEIB 4II2A 3GQBA 2QL6A 1I1QB 1X3SA 1CD5A 3OOEA 2AEJA 4QA9A 1QORA 5BVHB 3QVGA 4JBIA 4GW3A 1M8PA 2B0CA 4C2BA 3A6GA 4KIFA 5E6RB 3DE7X 1O95C 4TLBA 4CNBA 5JBNA 2W6OA 1KAEA 4H1UA 1H6DA 3N8HA 4TSFD 2PVSA 3B6EA 1JQBA 5PNTA 2LTAA 4F11A 3MELA 4C5BA 2Q62A 2V7EA 3B85A 2UUCB 1BCSA 2WJYA 5TF0A 3OO0A 3F5FA 5DFAA 3HP1A 4NH4A 2OGWA 4ZEMA 2QRVA 4JDPA 4K9NA 1N75A 2Q9AA 2EERA 4JI2B 4B32A 2D8MA 4AJ2A 5IAAA 4WTOA 4WA8A 1EJBA 1ZNZA 1DTEA 2G0TA 1C3XA 2ZGVA 4K28A 1JR4A 4DR6B 2CMKA 5ALEA 2BT4A 3AF0A 2NVBA 1V3QE 1QP8A 4A03A 4EKIA 1UK8A 1DBVO 3OY2A 3WRYA 3N2IA 3BSWA 5EZQA 3VSAA 3FOBA 1XXHB 1NX9A 4BCCA 4I4NA 3JD2A 1H1LB 1JDTA 2CVPA 1WKVA 2NXWA 3Q11A 4HB3A 4EO4A 1PVOA 4PTLA 2QQGA 4R41A 4B31A 3OLVA 4P9NA 3L07A 1X1DA 4A8TA 4HDMB 3FGPA 2QVXX 4LWPA 4JZKA 1LU9A 3PL1A 3JZFA 4J9UE 3FXAA 3M6MD 1CDZA 2E48A 4KMMA 3OCUA 2HMVA 4ZIRA 1BMFD 3H5VA 5IJ0B 2X6QA 3IUNA 1AV7A 2RHDA 4QJ4A 5SICE 4AZSA 3DL4A 3D6FA 3WFIA 3QLUC 5SZIA 3QNMA 5DTJA 1ACMA 5FPPA 5KS2A 4OP1A 1KNQA 1DIHA 2ISQA 1ZVVA 1AQYA 4H2DA 5EE0A 4YDQA 3NBFA 3O4VA 4FFRA 1PZHA 2XE4A 4I8IA 5IJAA 4DIMA 3HHPA 1KR2A 5JAPA 2CV2A 3C3CA 2EYUA 1G20B 4FSHA 3JASA 2G83A 3HVJA 5CB6A 1SCUB 1C8VB 1XJQA 4JX8A 4JKYA 4MQLA 5CU7A 1PF7E 3DKPA 4YJDA 2EJBA 4KMOA 3E0QA 1EFVB 2XCUA 4PZUA 3HCAA 3RC3A 3TLGB 1R12A 4O4LA 1EYZA 4OQ4A 3RREA 2HCRA 5BMVF 3BWCA 3O8OA 4EF5A 3W7VA 1VMAA 3PQ4A 3VGPA 4GKJB 2GZMA 4OL9A 3BM5A 4RZSA 3A4MA 4BB5A 1T8YA 2DUJA 1NU8A 5ANRB 2I55A 2HWUA 1J20A 1F2UA 4FTWA 5D2CA 4CLHA 2AWOA 3K8YA 2NOAA 4L76A 3RQSA 2GN9A 3I39X 3OJEA 3S29A 3V5NA 1DJPA 5J5VA 3U3MA 4CF5A 2H5EA 4V0NA 1NSYA 3CUWA 1EDEA 1F0NA 1DJLA 1W35A 3FE2A 5GZ6A 4AZ0A 5LU8A 4C5CA 4LYDA 3G2KA 3W2EA 3R9XA 1KYTA 4KNYA 4JGGA 2Y27A 4TV8A 1ZOOA 5JECA 4KDRA 3NTUA 1JZQA 5H02A 3SJUA 3SZGA 4OA5A 2ISCA 3V8MA 3ZDQA 4Y0VA 4DIOA 5BXYA 1ILEA 2GTPA 5FO0A 5HF8A 4DLKA 3B9PA 4BNVA 1P4JA 2JKVA 4Y2YA 3W3AA 3B6IA 3TECE 3P2OA 2XF8A 1YS9A 3HL0A 1WXIA 2E21A 4D4KA 1R4AA 5KX5A 2OPBA 1G8HA 2IY9A 3Q5DA 4DSTA 4YUAA 5EZYB 4FW8A 2N75A 2W6JD 4QGGA 1JFTA 3OQHA 3W5UA 1G6KA 4KKVA 2WPDA 1V3UA 1KFKB 4KFRA 2X5KO 1KMHB 2FCAA 2FRDA 4XVRA 1SU8A 1OE0A 1CE8B 2NQTA 3FMOB 3NHUA 4O2RA 1HT2E 3I09A 5DCYA 4L4YA 4PG8A 3V8NA 1X0VA 4MZDA 4UNSA 3EK2A 2QJFA 3LK6A 4IGEA 1U02A 1WVIA 4CF7A 3LAWA 1NG9A 3MTAA 1EK6A 2O5CA 1AF4A 4P3KA 1ZY2A 2VWHA 4P4LA 4Z53A 3D6NB 4J7XA 4A27A 1VIDA 2GJSA 2AQKA 1NVFA 3QTTA 2R8EA 4D5EA 1LDBA 4OJQA 4ZYWA 2AB0A 3CFYA 2O0LA 1W0KA 2JG3A 3OFJA 2ZJZA 2I6SA 2VQ3A 5FO1A 2EARA 3MINB 1GXSB 3LLSA 4R31A 3VDXA 4Z9XA 2DFLA 4RHFA 5H8WA 3U62A 3UJ9A 4WAUA 1CNFA 4IV0A 4FZ3A 1O03A 1S2DA 2GARA 1Y0BA 4L2IA 1NOJA 2XNJA 2ZWAA 4O2BB 1E20A 3FJOA 3UB4A 2Q5IA 4EHDA 3ER9A 4KO2S 1U9JA 4X1YA 3O2QB 4D9GA 4YK7A 1V6CA 4W1QA 1HE5A 1WQ3A 4ZI5A 4D4JA 4YJ3B 4KO3S 3DTNA 1T6YA 2AFIA 1ZJYA 3H2SA 4F4UA 2AFHB 1E6WA 2F48A 3OLWA 4FFBB 5EIWA 5K8IA 3T7TA 2GPTA 1YE8A 2D1FA 1DC7A 2VHXA 2YIJA 3WX0A 4IW3B 1EVLA 1H22A 4KN5A 1VLMA 1RQNA 2DVMA 3H18A 1WZ2A 1K63A 1QO0A 2X8LA 2XJ4A 3FR8A 3FMPB 2J0UB 1IL0A 1AUVA 2Y92A 3ROPA 2A5JA 3KE9A 2X2PA 2V98A 3TEMA 3PC8A 4DA6A 3UATA 4ZYTA 3GY0A 4HADA 2B0JA 5KVAA 2CXOA 2WJ6A 3ETEA 1B0ZA 1VKRA 2VZ0A 1VPDA 4IP0A 3A1VA 4MS1B 4WBSA 1EWQA 2H57A 1E77A 1QPZA 3H4MA 3MCWA 4G23A 2C9BA 1NJ5A 4QSHA 3EPPA 3LPDA 2X42A 4FYMA 4X3PA 4NZZA 5J2UA 2QD3A 4GGMX 1DEKA 1YBFA 1E62A 2QL7A 4UUQA 5AOAA 5FUVA 4HLNA 4DNQA 2AG6A 4RE6A 4ZN6A 2H1VA 1X1TA 5CAEB 4PINA 5K01A 3GJQA 3MWDA 1H0RA 4MZXA 2ZE5A 5CVVA 1YFZA 4XQ0A 3DVQX 4ABYA 4ZJYA 1J2EA 2XLBA 2IBMA 3H3XA 2PXCA 1MC1A 4GUAA 3T1OA 2P67A 3LIIA 1V4BA 3ADDA 3KELA 5CYFA 3VA7A 4C0QC 2HIAA 4YO7A 4DEXA 1XZKA 4TWBA 5CCXA 4DA4A 3AEKB 2V65A 5AK3A 2X3FA 3DVAB 4ODIA 5I8WA 3CLHA 4F4CA 2NG1A 4OM7A 2I6UA 3ZGVA 1QU2A 3HJFA 1YFLA 3OZCA 4JI5B 1A2OA 4HWPA 4YN3A 2AG5A 2CB0A 2YASA 4M9ZA 4MYCA 4ZCIA 1NAIA 4B17A 8GPBA 4RF3A 3HFRA 3EC1A 1C9YA 5IAEA 2GCOB 3H5LA 4GOLD 5LZ2A 4PZLA 1U99A 2PWZA 3ESQA 4MX8A 3HKCB 1T43A 4X9XA 1OVGA 3ZH2A 3VHQA 3I61A 1NPTO 2DHDA 5ENDA 5LOVF 2HU8A 5KSYA 1MP0A 2CK3D 1SOAA 1F7UA 2RGEA 2GLTA 5CVUA 3WFZA 1WUIS 3PNYA 1ZUIA 3R5TA 2UZ4A 1UMBB 2A86A 3UXEA 3A3YA 1HV8A 3STUA 3GZNB 3SS7X 5L3QB 2BOVA 4XZ3A 1GPKA 1TTHA 3C39A 3T9EA 4BV2A 3ESBA 1E9FA 3LTEA 3NDJA 5HM6A 4M8NE 3EXIB 1UWLA 4LRUA 1VJDA 2EBFX 1V9SA 1KVTA 3QA9A 5CLJA 1WL8A 4PQFA 2JI8A 5I7HA 3G9UA 2XSZD 2JBHA 2OLEA 1G19A 3GAZA 4JLNA 2O8FB 2BGJA 3GLUA 4KIGA 2W6CX 4HYQA 4FGWA 4XOUA 1U90A 2I03A 1QKKA 1ISFA 1DTSA 2CDNA 1BTOA 1L3BA 5HRAA 1YFJA 1ZM9A 2WJVA 1PZMA 2CVFA 3D8HA 3LD9A 4CM5A 4URZR 4RTJA 1WCV1 3IEPA 2DUWA 4FMPA 3EA0A 3FSEA 4HQ0A 2B8JA 4F5YA 1U6IA 3IC5A 4DLTA 3IALA 3QMMA 1NT4A 3WAKA 2HIGA 1CF2O 3CRQA 4F92B 1A9TA 2GCGA 4MVJA 1UJ6A 2X9QA 4B43A 5DM60 2GFIA 1XJCA 1VTKA 2N3ZA 3EUFA 4IHJA 2PUAA 5KNCD 1E18A 4JP1A 3QPCA 2DQZA 4ASUD 4ED9A 4UM8B 2DBRA 5ECGC 5L7YA 4DR5B 1EQUA 4TXLA 4N48A 2VA8A 2BFNA 3NBYC 3EEOA 2XUIA 2P2YA 2FFRA 1T4MA 5HE8A 4CL2A 1TDJA 2HYIC 4PGHA 4Q3BA 1PLKA 2Q2OA 2QGZA 3C16C 3R4CA 2XF2A 1JDJA 4JQOA 4MPDA 1W44A 4WCDA 2JPDA 1BMDA 1VI5A 2VKQA 1KTVA 1S8AA 4KUGA 3JZMA 4EQZA 5BSFA 1LD3A 4PBRA 1A8IA 2XCOA 1FQWA 4J4BA 1HETA 2QAJA 5JPDA 3DOEA 1LXCA 1XRSB 4WGFA 4Q3LA 4WJZA 4AJEA 1L9KA 5KQRA 3ZHZA 1Y7LA 3IIJA 1FDWA 3K15A 4BO1A 2JAUA 5C8YB 3R0QA 3VHXA 4WEQA 4OQFA 2G08A 2BEUB 4JT2A 2ZPAA 3GL9A 2BJVA 3G5MA 3PF8A 5MN6A 4OYHA 4WK2B 2GEUA 5P21A 3ZWMA 4V1CI 2DRIA 1TJYA 1ZOSA 4Y67A 5EJIA 3FMVA 3KTAA 2OXIA 2WMYA 5I51A 1XYVA 3HXLA 1Z8DA 1JBQA 3DZFA 3AONB 4GOXA 4H3HB 4JJ7A 4XUGB 3ZBPA 5DNDA 1NQTA 3FHCB 1QQAA 1AJEA 3MS4A 2G4VA 3V6LA 3ZUPA 4FE7A 4ZRNA 1K4KA 3FNEA 1VLZA 1WCYA 4DCGA 4EARA 1V1MA 3U7HB 3EXAA 4JB0A 4J0DA 4DCNA 2EIHA 2VPIA 1I4TD 4BXOB 4IIJB 1KK1A 1VGQA 1VE7A 3DBHA 5HIJA 4L16A 3E9DA 3P2YA 2HAEA 5DXAA 2X40A 3EEYA 2IOQA 1J4AA 3BDIA 4UPEA 1R00A 3LY8A 4FT2A 3RRXA 2IBTA 1P9WA 1RLUA 1X92A 1Z5OA 3BD7A 3ELBA 2SKCA 4RC9A 3MTIA 2Q4OA 1MMFB 2JHFA 2ZKIA 2Z8YA 4NK4A 3FLEA 3VC1A 3DF9A 2X0JA 2WEKA 3I8OA 2QT0A 2TYSB 3OFND 4P83A 4N5IX 1BWPA 4UMDA 1U0HC 1UP4A 1LK0A 3E5NA 3TINA 1OI3A 4OXNA 2HDWA 4JUBA 1JPNA 2ZVDA 4OB8A 5GOZA 2GZHA 4XRRA 4C1BA 3G3EA 4RNCA 1I7QB 2VF2A 1CQIA 1BZYA 1BWRA 1KA9H 1GQYA 1W94A 2B83A 2HA4A 4XX0A 3TZQA 3UENA 3ZZ0A 5A7FA 3ASYA 2PFGA 2DYKA 2FCRA 3CR3C 5K2MA 1VMIA 1Y5NA 2X6RA 3A6EA 3GLRA 5DX0A 3GJRA 2VRCD 2C95A 1BE1A 4KFSA 4KC0A 4N47A 4MUFA 4NOMA 4LJLA 3JAMA 3PS9A 3L77A 4MV3A 5DTEA 1FFDA 5BV0A 1QR2A 2WT8A 1T2UA 2R3SA 2G77B 2ILTA 3DLAA 5JZMA 5BNTA 4LW8A 4BQIA 2IH5A 3GUCA 5FBKA 1PJ4A 1RXIA 3IFSA 3KJFA 3OURA 5JO9A 3L8ZA 3X1DA 1V9CA 1S9HA 2OCIA 3NDIA 4HHEA 2A1IA 1IONA 5B58C 2NT4A 2P4EA 4LHVA 5F2EA 5I8ZA 2E4XA 3D5EA 3H2IA 2E6UX 1Z5PA 2I2BA 2RB4A 2R9VA 1GYQA 3LP6A 4NZYA 1E1CB 3VBEA 1PKXA 1WCIA 3OZVA 3V55A 4TMTA 3SC4A 3HB0A 1NF8A 4GI7A 5LSAA 4RTOA 2MWMA 4YAEA 4NYIR 3BMQB 1GZ6A 4QRDA 3SEZA 1Z2OX 5A4IS 3JPYA 3SIXA 3RFVA 3A1NA 4RM3A 2FB9A 1XTPA 2HNBA 3VKFA 1U1IA 4I55F 1TIKA 2PWPA 1MENA 1H2FA 3CM0A 3WBKA 4TMXA 4IYRA 2IUUA 1Q0SA 1J8QA 2YIVX 3A31A 4HFRA 4N6NA 3WLFA 1DIGA 5FI1B 4HLDA 2E82A 4D80A 2QSUA 3ECAA 3HU5A 1KPHA 1UPTA 2FPIB 2O52A 4UARA 2EP7A 3H6KA 3Q7EA 1MR3F 3X2FA 4PEVA 1RFLA 4QTYA 2AG0A 1HDCA 1A9OA 3EG9A 4ZREA 1P7CA 1QHHA 4PLCA 2Q7OE 4ERNA 2JI4A 2YHSA 4QYTA 4WVFA 4OQYA 2A9OA 3WE7A 4YB8A 3G17A 3GLQA 2TMKA 3JQ7B 3Q3VA 5BSMA 1HKUA 1NDQA 2ZRQA 2P5SA 4MMZB 3VC7A 1ZH2A 2PGIA 2ERXA 2BKUA 1U4NA 2A1UA 2PS3A 1E9RA 2QQ5A 2QTGA 2HD4A 2QE6A 4IUDS 1B23P 2AA3A 1GGHA 4R6WA 2C07A 4D43A 4UM7A 2Q7XA 4GXQA 1TFUA 2O57A 1P81A 4WV3A 5C34B 1DQRA 3KPYA 1I2DA 4ROSA 2VJNA 1VXRA 4BVKA 3R3XA 4KQEA 1QGAA 4MB0A 4Q7QA 4TM8A 1R3DA 3UANA 5IAOA 3TW0A 1OBOA 1YBMA 2C9CA 2MYTA 3E3AA 3ILHA 4WDRA 4WW0A 4C88A 1VFPA 2AMVA 4YT8A 1XP8A 3O1IC 4KMSA 2RCNA 4NSNA 3I01A 1P9LA 2ZI7A 3ABQB 2PKCA 3ADBA 1D2RA 3U4DA 4C89A 2AXQA 3W9UA 4CKBB 1SH7A 3PXXA 2NLOA 1D1PA 2WIGA 2YJTD 3DEHA 4P36A 4JLAA 3ZWXA 1RZUA 1KARA 4OHKA 5CT5A 2C84A 4LYEA 3C8ZA 1C7ZA 3KWMA 1G2QA 1C2YA 3IMGA 4KBYA 5IZCA 2HQSA 1G60A 3KAQA 1AKWA 4K2HA 3JQQA 3K9HA 3NT4A 3PC6A 1TB4A 3O0DA 3C7AA 2K5UA 2YJNA 1GTSA 4GBJA 5AW1A 5EUMA 4AUEA 1U3VA 4C76A 1QVRA 3IP5A 3EBLA 1IQ0A 1G55A 4YASA 5FBWB 4B3BA 2PNJA 4HB4A 1YA6A 1ZMRA 2G71A 3CB4A 5KYUA 4B5KA 2AFIE 2C5FA 3RLFA 4KWEA 1RWWA 1A9SA 2VIIA 3IESA 3MIZA 4ND8A 4UU8A 4AY4A 4C7XA 1KXJA 2YS6A 4YMGA 3GH1A 1DOZA 4R1PA 3ED1A 2DBZA 4GWLA 4MVCA 1VIYA 4NZ9A 3TRFA 2EDAA 3WY9A 2W2OA 4HXFB 1UBFA 1ZSNA 2WY2D 3RYFB 2ZJ8A 3CRRA 4Q1FA 4I1VA 1H0HA 1G3IA 3PGA1 3QOXA 4UNRA 3R6TA 1QO9A 1V43A 1XZAA 2ZBRA 4RFLA 3WRVA 3VZQA 3I04A 3U56A 2ECPA 3JD4A 2OMEA 3C3AA 4N3CA 2O7QA 4TVSA 1WIWA 5BVGB 4G1CA 3UYKA 2IA5A 2J5BA 2OO7A 2VDRB 3FOAA 3FDZA 3Q41A 2EHDA 1UAGA 4HGPA 2SBTA 1ODLA 2ZLBA 3LYAA 3IIMA 1R88A 2SNIE 1Y4AE 4JBYA 1T4DA 3HI4A 3TPFA 1L4MA 2F3SA 2FPLA 1W2HA 2VDKB 1IFXA 1WBJB 3OSZA 1YCDA 4LMAA 5CM9C 5IABA 3KB8A 4MYTA 2X13A 4ZP1A 4M0LA 1NN5A 3LXMA 1RMYA 1UBOS 2QZ4A 4PC6A 4AJOA 4TZ6A 1NVTA 1DKOA 2VJQA 4BU1A 1T1IA 3LOQA 4DRZA 2RONA 3D5QA 3PI7A 3ESAA 3ESCA 1JR3A 1YZ3A 2EF1A 3SHVA 4ZCRA 2YFYA 5E1DA 1A4UA 2XHEA 1PT5A 4YCDA 5A1TA 3BRWA 4NZMA 3K5PA 3UA4A 3C4QA 4CHGA 3RRFA 1MO4A 2WSYB 2J5QA 3H8WA 2G72A 3WIVA 1QV7A 2C3PA 1KDRA 4JBNA 4OGKA 4HT3B 4MMXB 4QECA 5AK6A 1DO8A 3C5WP 2HJHA 2H54A 4NH0A 2ADMA 3V8PA 3H1FA 3QJYA 1PJ3A 2I71A 1EGVB 4RVCA 1Z4NA 3WDSA 1IN5A 1KVRA 1Z74A 1Y4SA 2W6ZA 3Q9UA 1U8TA 4P4SA 4PLHA 4DV2B 1TRHA 3BC1A 4DS3A 2BN4A 2QTFA 4E3WA 1YR1A 3FTQA 1V26A 4GMFA 3HY6A 1CDEA 1MLDA 3A9RA 3O4IA 2JDIA 1L9XA 1NVAA 2ZW9A 1JEOA 1MX9A 1GD1O 3LP8A 3N2EA 1X9GA 4LFCB 3ZTTA 3ZHUA 1KYQA 1T36A 2XQFA 3LUJA 5CB4B 1RHMA 2V7QA 3IVXA 2A5GA 4ZEXA 3W5JA 1X1AA 2WLTA 5I4IA 4DEYA 5EQTA 3NHYA 4MCJA 4W6QA 4KH0A 3O91A 1SVNA 2PSHA 2OMKA 4QUBA 3T95A 5JALA 3I83A 1QUFA 2A9FA 1SUDA 2W42A 4ZQCB 4ENTA 1DAGA 1YZTA 1ADGA 2BEVB 4OXXA 4Y18A 3I1JA 3ZCQA 1WEKA 3SK0A 5HJ5A 2JD2A 3AJEA 5L3RA 4BMZA 1OU0A 2UKDA 3OZDA 3QKRA 3T52A 3SYLA 4G2NA 2HGZA 2VEDA 2HA2A 1JKJB 2PKXA 3DTVD 4OOEA 3AR2A 5CNIA 4C87A 3Q15C 1J0AA 5K0FA 3FTCA 1ODIA 3K6JA 1ZD3A 4K9QA 2IIBA 2QUIA 2ZTMA 4HQRA 3M89A 3AKYA 1IZ0A 3M8KA 1XQ6A 4LC0A 2BFBA 4TVKA 4IDAA 2Q5LA 5C8VA 4RDXA 1YZNA 2FVYA 3GLSA 3GUVA 1J2JA 2R6FA 2WG2A 3G8DA 3JARB 4CTKA 1JDBB 1WMDA 3R0XA 5FI3A 1JG7A 4C3VA 2G0AA 3I42A 4W8GA 5HP4A 4KTTE 5FR2A 1ZA2A 10MHA 4QBFA 3CR8A 1NFFA 1TIPA 4RK6A 4CN9A 3ELDA 4MVJE 4ZGWA 3R6LA 3HO8A 1G5HA 3MN1A 4TRNA 4KR9A 4OCZA 2NPFA 4E03A 1Z12A 1RTKA 3NH6A 4BAGA 2VNIA 1Z0FA 2OESA 3GGCA 1ZAYA 3I2YX 4KRFA 4UHDA 1XEXA 3INTA 4NFSA 1EVQA 4EOGA 1T4CA 1Y48E 2L0XA 1E32A 5EHGA 1H3EA 3L4KA 3ZCTA 2R6AA 1XA3A 3PPVA 5GWXA 1AHIA 5ALOA 4MJXA 1X74A 5JHHB 3AC0A 3FCOA 4ZYLA 5HW0A 5CXQA 3DOOA 5JQGA 4MWOA 2GBIA 2ASEA 1E96A 4NESA 2PT7A 4GS5A 4QD3A 1HDOA 4II7A 5JS6A 2Y71A 4INZA 3VU3A 1KC1A 3KLPX 3GJ7A 2VOEA 3AGQA 2B3TA 5IKMA 1RYFA 4OK3A 2HREA 2XEDA 3RNLA 1BFKA 1SC3A 2VJMA 3GFSA 2JIDA 3Q6IA 3VTZA 4WBNB 4EG5A 1ETHA 1JEYA 4YV2A 4CKWB 1L4FA 4LDPA 2A5FA 2H8GA 3UW1A 1ABEA 4EA8A 2VP6A 3SXUB 5AKLA 3DOUA 3BIXA 4BUCA 1CCWA 3TL2A 1PNOA 3C15C 1D2HA 3TLZA 4L4ZA 3VISA 4IJ6A 4RTKA 4KGVA 1V71A 1IXSB 3DLPX 5GPBA 4H15A 2G63A 2HRBA 2H2AA 4M1ZA 4BE7B 4G4SO 1U11A 2XDQA 4Q1EA 2AT1A 3D3EA 5AM5A 3L0OA 3KUUA 5JJCA 1ODJA 1LDMA 1S1CA 4TMVA 1JLRA 3FGZA 1D4ZA 2X19A 3FYTA 1JLLB 5CT9A 4WLEA 1ENPA 3NIGB 3G2PA 1CIVA 2DETA 2OBXA 4FYWA 4O1IA 1OFTA 2I3ZA 3ZV7A 5K0SA 2WTUA 1RJ9A 1Z8NA 1TT7A 4DLUA 4RJKA 1HL7A 2VK4A 3NHKA 3TMKA 4OLAA 2NNLD 3K09C 3JAWB 3VZSA 1X7WA 3BH6A 5GVRA 2O2IA 4FYKA 3BJMA 2SKEA 3EDOA 1KY4A 4JEUA 3CURA 4MHSA 5EEGA 3L6OO 4YCAA 2NYRA 2TMYA 4M9XA 4Q4DA 4YHHB 1N57A 4UDOA 3GFVA 1BHJA 1H6CA 2OXRA 2RHMA 1U5BB 4E5DA 2OP1A 2WHRA 3OIFA 1IH8A 3R7LA 4UFNA 3ANLA 3TQHA 4DV1B 2BZ0A 4XM0A 3T5MA 4JGIA 1MAWA 3IRUA 4EHHA 3H2GA 2O2ZA 4Q6WA 1Y6RA 1X80A 5DB4A 3WYAA 3FMFA 2AUMA 4UNQA 3AVXA 4QYSA 2QTVA 4A2WA 4HG2A 1UR5A 3KZVA 5REQB 2JBAB 2JF0A 3TB6A 3ASUA 4YCSA 1VE5A 4P82A 5DLQC 1LLDA 2N42A 5EJ4A 4IQGA 4ZZIA 1Q14A 4XYBA 4X1IA 1IBCA 4DV0B 2VYVA 3EGOA 4N4AA 4QG3A 2Q6TA 5CUQA 4OXKA 2VC2B 2IYWA 2Z2JA 2ZUSA 4UM9B 5K0GA 1QX3A 1EUYA 2QBYB 3VJLA 4LF8B 1LSOA 3N28A 1AGPA 4V1CA 5DGTA 4JNKA 2EW1A 1J0BA 1F8GA 3FSRA 4CM9A 4EB0A 2Z8XA 3SDSA 4IV8A 5KVVA 1P39A 3KQHA 3H2KA 2MSKA 1VKHA 3N2LA 2OV3A 4IG4A 4TLMB 2Z83A 3RVRA 4EY3A 1FMCA 3OM9A 3RS2A 1JDPA 5DW0A 4EQ6A 1XGKA 1KP2A 3EEQA 1C1DA 5AICA 3IT2A 2P41A 3E18A 4ZT3A 2E37A 3F6EX 5HF9A 1EUDA 5A7GA 3M0EA 2BP7B 2XUFA 1YDHA 4QDZA 3SC2B 3RHFA 2ZUUA 2IODA 1AK1A 1LDYA 1LPPA 2WAYA 1YKFA 1XL0A 4EUSA 3HNRA 3T61A 3T4PA 1Q3TA 1OFUX 4FX5A 5AT1A 3R40A 1RHRA 1T9KA 3DFKA 4B6RA 4TGLA 3ZW8A 2GJ4A 5K3FA 2WD8A 3HJAA 2PGJA 3WLQA 1YOVB 3JR7A 3NB0A 5FOXA 1CDDA 4KXYA 4TRRA 4Y1FA 3WGUA 1C7QA 3KHUA 1EXMA 4RMHA 1L1QA 2AV6A 4TKLA 1PS8A 3SDBA 2AZDA 4PO3X 4URXR 4WFJA 4K40A 1LNQA 4O4IA 4D4IA 3EA5A 1IOVA 1FRQA 3SFTA 2WLSA 1P8AA 2Y4OA 1MVOA 3C1TA 5D1HA 1PT9A 1UM8A 1C30B 2RHOA 4QRHA 4GWGA 4BNWA 7MDHA 3VNVA 3RUEA 2UZ0A 4G6ZA 1MAVA 4HTAA 2F4NA 3LECA 4I99A 2A35A 1EZ1A 2WVHA 3CRZA 1R6AA 2QG6A 3RT1A 2IHKA 2Q0SA 1E61A 4MI1A 2F62A 4E2WA 2VQSA 5FL3A 1F20A 1NV9A 4A82A 4CDRA 3PDIA 4EW1A 3W9YA 2VUIB 3PB3A 1VJGA 1Y5LA 3VSEA 2NZXA 4RL4A 4EFKA 1WZIA 1FLNA 1IZZA 1VECA 1U5CA 4YFVA 4R6XA 1P73A 1GNVA 3R7SA 1ZD4A 5E3JA 3IA2A 2PUTA 4RENA 4UASA 2EZUA 2PLWA 5DTQA 4A23A 1JDBC 4GPTA 5AW0A 1L4NA 4HL6A 1QYIA 1L4BA 3RSFA 2L18A 1PUXA 3MWGA 5EIXA 3KQVA 3Q3EA 4E1VA 1DELA 1W19A 2I8CA 2UVPB 3KZCA 3L8HA 2VT7A 2Q2WA 4JKOA 3O03A 4Q9NA 5IH7A 2MYUA 2C7RA 5JPIA 2JCYA 3OJXA 3OUZA 3P32A 4KX3A 4YRDA 3S5JA 2BE9A 2C58A 2K87A 2Q3JA 5KTSA 1YQGA 4FI3F 3U4AA 2H7XA 3CUVA 2ZIZA 4X7BA 2A3RA 1K6XA 3B1FA 1Z6ZA 2ZTUA 3FYUC 3QPWA 1C3OA 1VPVA 1G21B 3RF6A 1XDDA 3DUFB 4E5KA 1EFPA 3BTSA 4EB8A 3TTSA 1C3EA 4GOKA 3R77A 4C29A 2HSDA 3MJDA 2E89A 3FKSA 3ZHBA 4DJFC 3O8BA 2R60A 3KD2A 3RNOA 3VMMA 3L1KA 4EPRA 4IGAA 4X44A 4HH4A 2QIOA 1V7QA 3MJRA 2HDHA 2G06A 4AMGA 3R5SA 4F38A 1M6NA 1S4QA 2FP3A 3QFHA 3W3AD 3B6ZA 4G8DA 1IRIA 3D3WB 4DQVA 2J1LA 2OUKA 5C1OA 3KR0A 1VHTA 1Q95A 2MJLA 4LSGA 3WB9A 4FYYA 4UBNA 4I2NA 3AIOA 4YDSA 2G7MC 3ZBUA 2A0YA 2EL7A 1A5BB 1E92A 2YKGA 1YS6A 1CUZA 3JVEA 3IXQA 2P0YA 2WPDD 4DV5B 1Q0RA 2ZBGA 2IWHA 4WNYA 2FQWA 3A06A 4YRFA 2YDXA 1K4MA 2PL1A 4UPDA 4AW9A 5HM8A 4E6EA 1XZPA 3JRNA 2DKOA 4BKMA 2QL9A 1ELOA 3C70A 1L7EA 2HDOA 3R5JA 5ER9A 4DJDC 3QBDA 2WFLA 3RYHA 2Y6VA 2HMTA 5FAKA 3ELWA 2BBOA 3PHIA 4A8JA 3S6JA 2Q8QA 2MU1A 2WDPA 1ZL2A 4X20B 3LW8A 3P4UA 4J16A 3JQFA 2XKAA 4GSYA 4HDNB 4NCIA 1FS4A 4HSGA 4RJJA 2JVKA 1NW6A 4RMIA 1P19A 2CXTA 2IUYA 1JDNA 2QX9A 3AUSA 4IZHA 1JR3E 5G0WA 1M73E 5LD2B 4RK4A 1U7UA 4IVQA 4R9VA 2Z2IA 4HXYA 4Q4HA 1E3TA 2IKQA 4YYEA 4US2R 3ZXYA 5IKOA 1R5OA 3DMGA 4AYTA 2OE2A 1WDMA 5KNCH 1JA1A 1JIUA 5HPYB 3EY4A 3TGLA 1U98A 1ULTA 4MJLA 4NBSA 1TJNA 1K3UB 1SHKA 2R7MA 3OM8A 4BNLA 1EZ4A 2JHGA 1T26A 2R8PA 3U44B 3EPKA 3U1VA 2JBWA 3M33A 1WNFA 1EMDA 1DC8A 1MABB 2FEPA 3VOAA 3IVGA 4Y2XA 4B3JA 4J07A 1I3NA 1M2KA 1DAMA 3ZXIA 5AHRA 1W4ZA 3AVYA 5LP6B 1L7PA 1QMPA 3H2ZA 5JFTA 4PYNA 4X45A 3D0RA 1RXCA 3O92A 4U8HA 3SQLA 1PTKA 4S1WA 4WT7A 4BRWA 3BXHA 2EEPA 4KHZA 5E1MA 3LXRA 1QTRA 5AM3A 4B3HA 3QF7A 1P2VA 2XDAA 5CNMA 1N1EA 3LUDA 2RHWA 5AI9A 3W6UA 1U8EA 3NX4A 4MYHA 3PXDA 5JNTA 2YHUA 1UFKA 2FPKA 1V1RA 4C78A 2WUGA 4R1LA 4S1OA 5HTKA 4EO9A 3CNHA 2XB9A 5T57A 4D45A 4F2DA 4A2CA 3FTEA 4OMDA 2J3KA 4L78A 3RVPA 3ZX4A 1R4NA 3QFSA 3VR4A 3ZW9A 5JVDF 4C0XA 5L45A 3INGA 1T0HB 5I9SA 4G84A 4Z9AA 3RC2A 1XD2A 3WB1A 2QVGA 1D9XA 3HNOA 1UCFA 4G65A 4B47A 3PU6A 4E5NA 5IFKA 3NEYA 2YC4C 4S2EA 2PH1A 4GHWA 3IQEA 2HB6A 3CG4A 4E51A 4GH5A 2JGIA 3T7SA 5AUNB 5KMGB 4PQYA 3AOGA 2PX6A 4XJSA 1EFCA 1Y1KE 1ND5A 4Y6SA 1VKZA 2PTGA 5LBUA 4Y6GB 4EJ2A 3RK0A 5F2NA 1OI4A 1ZIPA 2REOA 3A3PA 1RWOA 2K6GA 3P2EA 2P11A 4K81B 3RARA 4DLWA 4DDKA 2QORA 1VHWA 1AKVA 4MXDA 4NARA 3DHWC 1OFVA 1A7KA 4EGSA 4C43A 1QH1B 1AUOA 4H1WA 4PLWA 2YC2C 3ANNA 4FGZA 4ZJUA 4D02A 3CLRC 4CTJA 1K2VN 3RC8A 1Z6XA 2Q0QA 1EXWA 3VSDA 4A10A 3ZIUA 3MMNA 5FXMA 4BMNA 1X38A 2HRDA 5EWLB 2YMLA 4BAZA 1VMDA 3OT4A 4BE9A 2FMFA 5T8KC 3LXUX 4PYLA 4X63A 1DAHA 3C6YA 2CFSA 3MWJA 3ZWWA 1WMAA 1YOBA 3VR6H 1KGDA 3FUCA 1KEEA 3IUBA 3LHDA 3EVZA 3UK0A 4WEOA 2GWHA 3RW9A 2PQ0A 3DL7A 1WNTA 2LKDA 2WJHA 1H6AA 5BN5B 4UTZA 4O6VA 4JSRA 3WLHA 4AZWA 2CBXA 2PJZA 3COJA 4JP8A 1ZR2A 1K6MA 3O95A 3OMWA 3HWWA 1K66A 1U2DC 4PZ0A 4JT9A 2XYPA 3B7GA 3K6KA 4OH7A 3I6QA 5EEHA 1EJ2A 1M2EA 3U3KA 4P8RA 1UKZA 1HA3A 3V7YA 3TTUA 3LT0A 4YI3A 1TL7C 1CERA 2OHIA 3G68A 3R7WB 1I3LA 1HYQA 2KHZA 2XT0A 1PK7A 3AEUA 1FX1A 1MQAA 1N6NA 2J9GA 4I4TB 5FBRB 3B9QA 1DC5A 2DU8A 3OP4A 4O1HA 1UMKA 3IUQA 1XRNA 4Z7QB 2Q4DA 1ZN2A 3D7NA 3GJ6A 5DOZA 4KR6A 2JKZA 3GWZA 1JV2B 3UGKA 3CE9A 4KSBA 1HE3A 2H1HA 2JLRA 3NBUA 3NPAA 4J03A 4MTCA 1PJ8A 3AESB 1P17A 2W90A 5DSXA 4F2WA 3HJUA 3IDZA 4MVJD 4YRIA 3VMFA 5IASA 3DF7A 3ORFA 1QLJA 5IP5A 5LQUA 1B8NA 3GDFA 3HKDA 3OJLA 2FEXA 5C2JB 4PQEA 2YQ5A 4F9FA 1KJWA 2PUJA 3CX8A 4QYMA 3X44A 3KXIA 4O2LA 5CDGA 3N05A 4OQQA 2H7CA 2CC2A 2O1WA 4K86A 3RYTC 3CBQA 3TZ6A 1NZJA 5CIWA 4UFOA 4ZC8A 3D4BA 2XWBF 3TZHA 3GBSA 3NT2A 1XQWA 5EP1A 4V0MA 2VAMA 1E3EA 1IQUA 3TD6A 2Q2VA 2PAAA 1R4MA 1N6KA 4FGKA 2DQ4A 2G0NA 4JC0A 5CW2A 2XHZA 2XGOA 1DTWA 2V58A 3A9VA 1GA1A 1PS0A 4IZ6A 2NAFA 3KHSA 1ZX1A 3U16A 2XMGA 5H0IA 1BJTA 4WXEA 3SE7A 5LYYA 5FNVA 5FTJA 1Y1SA 3JVUA 1Y6QA 2H6EA 2W4MA 1W6RA 3AERA 1MCZA 1RSZA 4PONA 2FR8A 5CDYA 2UZ1B 4WGGA 4R0MA 2FMTA 2NSHA 1RLOA 1GJRA 5GV8A 3CBGA 4ONEA 4TV8F 3AUYA 1W581 3TFWA 4GR4A 3V9AA 2IGTA 3E3NA 4ZD6A 4RMJA 3PJRA 2H5IA 4FVTA 4NV3A 1YR9A 3MTQA 2O5EA 4YRBA 5JY6A 2OA0A 3VVBA 3U4HA 2IDZA 1W4LA 421PA 1MA3A 2UYHA 2XRMA 3Q87B 2P9GA 3VRHA 3CNQS 2QX4A 1JQLB 3CZ4A 1S8OA 4KVAA 2GF9A 4JYCA 2X5XA 3KZMA 5B64A 2CE7A 2VTBB 1NQ5A 3OBBA 5LD2C 4DDWA 2P3LA 3D0KA 3LZ6A 2PZAA 4DVGA 5F2KA 1C9EA 1Z07A 2ECOA 1V2GA 3HWX1 4OBXA 1GTZA 4KQWA 1YCGA 4ZTBA 3RIGA 1L5SA 2WJZB 2Z9BA 4KQXA 1KC3A 4ZQGA 1Y5IA 4DNPA 5KDDA 1HTTA 4FR0A 1POXA 3WSVA 5B6JA 1KAOA 5JYDA 2EAUA 2LNDA 1FP1D 2C82A 2WHPA 3LZDA 221PA 4TWZA 1YBHA 2JJYA 4GECA 1OD6A 3NC4A 3L8FA 1LW7A 1U2EA 3LFTA 4HX2A 2VDMB 1NI4B 4QOSA 3AHJA 2BHTA 4ZQIA 1WMFA 3ORHA 2FVXA 3DSRA 1IZ9A 5GONA 4KQJA 5LP6C 3BIWA 2GEBA 3IP8A 1JPUA 1NLFA 3CV3A 4ZCMA 3RADC 1DHRA 1QBKC 1XTRA 2PEYA 3PRKE 4V02A 2ZM6B 3ZDXB 2F3RA 3UJHA 1HO3A 4E7PA 2RGNA 3K1TA 1OA0A 1T1JA 2WUDA 4Z7OB 3HU1A 3BMNB 4QXRA 1NPYA 3OCJA 2IYZA 4JN6B 2PBRA 3B1YA 1R8SA 4WNAB 2X8AA 2VHZA 1Z75A 3C5VA 2PVPA 2O3RA 1O58A 2HWKA 5LQSA 3H9CA 5K0LA 1RRKA 3VM6A 4BFLA 3OTOB 4D6XA 1LSSA 4MGIR 4OLJA 1ENOA 1GT6A 5IYZF 3ZVKA 3HYRA 1GR0A 2G5GX 2J0VA 3L7KA 2ZUEA 1BMQA 1F2TB 4IIBA 3M9XA 1FFYA 4MDYA 2IEAA 1E2GA 1J39A 5CDTA 2J7PA 3N5CA 4AVYA 3WLOA 1BGXT 1MJGM 4YCNA 5C8DA 3L8MA 1FTGA 4H9GA 1LPOA 4QJ3A 1KO5A 2Q3LA 1C9MA 4HLUC 2JVJA 1WAMA 3ADPA 3H2BA 4XSVA 4CR8A 3EPHA 3MTJA 1NVUQ 2RCYA 4ITRC 1T9HA 4S1VA 4D3YA 3HVUA 1KMQA 3E7FA 2Q3HA 4UUBA 1SGWA 1KI6B 4YV1A 5LQCA 1E7QA 1H93A 1KH3A 3GJ8A 4BYGA 4BVAA 5AJYA 2CL0X 2I2WA 5JAQA 5FQOA 3STHA 2VDVE 4IIHA 2OGSA 3ZI0A 5J2UF 3ZU2A 1UFQA 2PA0A 3BIOA 2CEKA 3IBCA 3U3ZA 4PXAA 3HR8A 4RK5A 3U7IA 2EFCB 4DC9A 3BWEA 2DUNA 5HKBA 2H5JA 1CQJA 2ZWPA 4L3OA 1MNAA 4L5JA 1GVHA 1VHJA 1PT8A 1K5DA 1DBIA 3HDHA 1S2NA 2AC2A 1I5OA 1II0A 3N9IA 1AKQA 3NWPA 4CUZA 2WF8A 3H8VA 4ITVA 4X0EA 5C8YF 3Q98A 4M99A 3BMXA 1E8NA 1W96A 1BDIA 2XMCA 5AQEA 3O4GA 2D06A 2CFIA 4YJGB 2X2EA 5A5DA 4PNHA 1N6HA 1TX4B 1AQLA 2QN1A 5FA6A 4CMEC 5TEWA 3OEYA 2PVCA 2GCPA 2QSYA 2VSQA 3Q9SA 4XPZA 1CU1A 1FCJA 4GIBA 1M7BA 1NJ1A 3DMTC 1Q17A 4O08A 5FIUA 2XQVA 5FWXA 2GAAA 1UAYA 1SBIA 1Y1QA 2AR0A 3RFXA 4DQUA 1EINA 3E5HA 2WVAA 3QV1A 5D3QA 4CCAA 1PVDA 2BFAA 1HZZC 2ZSUA 4C6RA 3G7NA 2ZXUA 4L6AA 5DISB 3IT1A 3R24A 1Y8AA 2AFRA 3C5CA 2GZAA 4DRXB 3ADCA 3HE3A 4CEJB 3L92A 4J1QA 1K7FB 4KDCA 1NX6A 1K5HA 1XVIA 1OFHA 2A9KA 2QZPA 1GAJA 1CW2B 3KXPA 3QA3E 1TCUA 2QG4A 3JQEA 2CL6X 2BI7A 4FINA 1P4AA 4W63A 1RI1A 1QQ5A 2NO9A 3TZKA 5F7OA 5KC8A 3W5CA 1B0AA 4FZVA 3DKKA 2CXUA 5CJ2A 1NVEA 3N8GA 3D1VA 2IS4A 1A71A 4XPIB 4ZI7F 1P91A 3OQJA 4G5RA 5LQDA 1E2UA 1XCPA 2RC5A 3OPYI 4I8XA 4KE8A 5BYBA 2WAMA 2ZT5A 3VZBA 8AT1A 1IHOA 4V0LA 1ONNA 1CUJA 2IYUA 1NW5A 3EFHA 3OEED 5EYPB 4W7SA 3AY3A 4B8ZA 2OHXA 2Y0PA 1J24A 1ZD8A 1GZHB 2EZ9A 1YJQA 2DR2A 2DULA 3DYBA 2FWIA 3H11A 4YCLA 2HQRA 3FZEA 1ESMA 1YJAA 4KPUA 4C4AA 4BEBA 3OE7A 3T3NA 1IQRA 3X1XA 1I9CA 4P3PA 1USWA 1G8SA 1DAOA 4NOKA 4AG3A 1N2CA 1YZLA 2EEZA 1EI9A 2WJJA 4I46A 1F8FA 3VO2A 5LXTA 1ISRA 2PG3A 1EVKA 1OLSA 1JECA 1G17A 3DXZA 3O73A 4M1QA 3OQOA 5LQJA 1ZISA 3UC5A 2E4AA 4YI5A 5KBYA 1JUDA 3K9BA 4R8VA 4C0LA 4Z3KA 3WK5A 3SYNA 2BW0A 5TQ0A 2IZZA 4XFJA 4LZNA 5EJEA 2RH8A 2YRFA 2P4QA 1TTTA 1NFQA 1G2OA 2INGX 3OTGA 4LDJA 4XVUA 1EUQA 3GRRA 4U0KA 3RIMA 1KJQA 4CW7A 1YF3A 3DO6A 3S99A 2VG8A 1QE5A 1E2DA 4BNFA 3QNWA 4AKIA 1IDOA 4ND5A 1A2KC 1DEOA 4IGFA 2P9BA 2O2XA 4R98A 1A95A 1QS0B 4P0QB 4JASB 3UPUA 2KBFA 2WSBA 4CKEA 5ALKA 3GRFA 3TG2A 3O90A 1G7CA 1CWUA 4KAAA 4OMUA 3HDQA 4QT4A 3ND5A 3IMCA 1RPAA 2X5JO 1RXSA 1MOZA 4L5BA 4TLDA 4US1R 4FNOA 1PAUA 3D7KA 1ZRNA 3SVTA 1FNSA 3R5XA 4HDRA 1Y7HA 2R6DA 2R44A 1X9IA 3PUZA 3OPQA 3OCYA 2BMDA 1MO2A 5A7HA 4EATA 4Q0MA 1SMKA 3R6WA 4TLAA 4HNAB 4K05A 3IOMA 2C4KA 1BHO1 4M8SA 1XFAA 2BJWA 2KW5A 5BR8B 5YASA 4UULA 4ZJZA 1XCMA 1MW8X 1JR3D 4XSGA 3SZMA 4BNHA 5F23A 1B7GO 5HJEA 4G0MA 1REQB 4R9UC 5EP4A 3TX2A 1DKLA 1GRVA 3BA6A 1I0ZA 4AUKA 3E4CA 3BHNA 2CNKA 1M5RA 2BELA 5H3LA 3B6KA 5DNAA 1U2PA 5J2TA 2P27A 4J0JA 3F4BA 1JEJA 1K6JA 3I0ZA 3MBOA 4INJA 1G8PA 1NVDA 3ORRA 5JOQA 7MHTA 4ER6A 2Z6UA 1FP6A 1TT5B 4JA2A 4ZHQF 3UHJA 2E5FA 1A9QA 1Z33A 3CISA 5IK2D 3BHJA 2XCQA 4M53A 1G4UR 4HFMA 4M54A 4O59O 3JU3A 3R23A 1W25A 3R74A 4PYRA 1YB1A 3AR8A 2PZJA 3IAM1 5EMKA 3STYA 1XPRA 3GEEA 3GQBB 2HW8A 2ZI9A 2O1SA 4PHFA 3RS0A 2Q6KA 1YQDA 2P6NA 2VPQA 2XBUA 3QVGB 2JDID 3L7CA 4RZ2A 3T5BA 1FFWA 2IHUA 1C0IA 2HTFA 3E9YA 2W58A 4ALJA 5I7VA 3PE6A 4PAMA 5CM2Z 4JJIA 1DX6A 4M83A 4B8WA 2CV1A 4ERXA 1P29A 4Y30A 1E7MA 2Q5EA 3MAAC 3NATA 4R69A 2HA5A 3TKLA 1GCIA 3O8NA 4J49A 2AI1A 1Y98A 4B9EA 1BCSB 1CJCA 3NRCA 3O4FA 5EIOA 3KTOA 5DDIP 4CIDA 1CTQA 3PWSA 3L84A 1Q77A 3PFNA 3QU4A 2RBEA 2FZ5A 2H1CA 1OBVA 3I72A 2UUBB 1AKEA 1CF9A 1ZRHA 2QXUA 2CSUA 3DFFA 4MQ5A 4PSKA 2XXJA 4RH3A 3WZ2A 4I1YA 4ETWA 1Q19A 1WJGA 1J00A 3ZX5A 4BN4A 4G3XA 5D51S 3RKRA 2XUAA 2OPHA 2RGWA 1T34A 1I4OA 2FSHA 2RHTA 4LECA 5HCNA 3WRXA 4BLOA 1EM6A 2HCFA 3L0PA 2I4OA 3FG9A 3REFA 1TU4A 3BE8A 5HZHA 3OOWA 3TPZA 3MCUA 4HH1A 4KTVE 2KE5A 5IEJA 2PGAA 2FJ0A 3UW3A 1F9AA 3HWSA 3B2EA 1ULUA 3PHGA 3A2KA 5I9LA 2UYGA 3QFTA 1VSVA 3K9QO 3P9NA 5A4KA 4YGYA 2ZROA 3BUSA 2IYNA 5JH7B 4IXTA 4R3UC 2AZ4A 3DTYA 2PJRA 3HB1A 4CI9A 1NQOA 4ZIRB 4ZFNA 1EVYA 2B82A 5C3MA 1DHTA 2QUHA 3TNJA 2FMKA 3KE8A 2OQRA 3JD1A 3KOWA 1TQ8A 2Y0DA 1EK0A 3D6AA 3VKWA 3V33A 3UUFA 2BONA 2X0IA 3A9WA 1B8OA 4MUNA 4R54A 1TLTA 1I10A 4XGRA 4Z7NB 4JJGA 4LAFA 5CURA 1LZKA 1UMCA 5F77A 4UEJA 3ZJYA 1Z6YA 1QIKA 3FI0A 1NBWB 3JASB 3I73A 1I51A 1GLGA 3EFBA 3JPWA 4IKEA 2PO7A 4WZAA 5CH3A 1QQBA 2ZZKA 1SQSA 4RZUA 4OHWA 3RFUA 1CRWG 4YJ2A 1Z83A 4RM2A 1CUAA 4O4LB 1E9VA 1ZICA 4I3HA 4A0QA 4FQ8A 3O8OB 5FWDA 3DWEX 4F91B 1PFWA 3FLMA 2VQFB 3M81A 4DMKA 3T3IA 1C0EA 3RG8A 1YB7A 3E9MA 4QREA 3AGPA 2WNIA 4OHOA 1GFIA 4LOAA 2WM2A 4AJKA 4CT4B 1AKTA 4WIAA 4JC8A 4WNCA 1DJNA 2VJDA 4ILKA 4MR7B 1POWA 2QAGB 4YV7A 4DR1B 4MW2A 1A97A 1XU9A 1F2UB 3DD5A 4IEFB 2Q1UA 1JE1A 1VYHA 2VATA 3FD8A 3E2IA 3PVZA 2P8SA 4RDCA 4U3JA 3OOYA 5CVDA 3WLSA 1VCIA 2EWVA 1ECJA 1D2NA 1KORA 2DFPA 4YONB 4MAMA 4UXJA 3N70A 1XUOA 5T3YA 3QLVA 1PDOA 4E2ZA 2DFNA 1BHQ1 4AG6A 2O9JA 4Q15A 4MV7A 1KO8A 4AP9A 4JQZA 1Q5PA 1BD3A 2I4TA 3MLAA 2NVUB 5LP1A 4B3RB 3GEBA 5FPSA 1FRNA 2AG8A 4U7FA 4EW6A 4KACA 4LJAA 2I1WA 1T3LA 4LV5B 2FDRA 5KX5B 1V7PC 3WWZA 3TJRA 4AKSA 3O2NA 4DTIA 3IKVA 1VYVA 2O06A 2XRZA 4B3GA 4QM6A 2WFMA 3OM0A 4GG1A 5EZ5A 1VCMA 3SYKA 4P80A 3IHWA 4ZOLF 4C7JA 1EBUA 3RTAA 5KOYA 2VLIA 1FC0A 3P9QA 3FLAA 4RK0A 1W36B 2I78A 2QI9C 1EWVA 2PU7A 4R2XA 5K3DA 1OYVA 4TYQA 3IUJA 1NTRA 1FP2A 3HGQA 1XU4A 2IYSA 2W37A 3HDYA 2D0OB 2IP1A 4NJEB 5LBTA 3IAS1 3W3AH 4A9AA 1J5XA 2IXAA 2DX7A 3IV7A 2X76A 1KH1A 2VUSA 2ZYGA 5COAA 2D6FA 2ATXA 1C7IA 1PYGA 2X86A 4G89A 4WLOA 4GMKA 4BAUA 5DNCA 3F67A 1QHIA 2JGLA 2I65A 2VYVD 2I3AA 2ZWOA 3SIWA 4XTRA 3T0FA 1FDVA 2MCFA 1MDFA 5KOJA 4KN8A 5ALGA 1NW4A 5COBA 1JFFA 1J90A 1HOXA 4I5EA 1EK5A 1IXRC 1GPLA 1MEOA 1NMQA 3M70A 1RADA 4L2IB 4ZVQA 4DABA 2HPVA 4KOAA 4ZV9A 3SDZA 3IMKA 3D1LA 3AT1A 3DPSA 4TTRA 3SHTA 1T5SA 1T6XA 5DYYA 4CM6A 3NTQA 4FE3A 5U4QA 2V8BA 3LYLA 1IOWA 1HKHA 3MWEA 3O82A 4LMRA 4CCYA 3VZRA 5BQXA 1NNUA 3Q2IA 4JLKA 2NYUA 1A7UA 3QPAA 3RE1A 2AVDA 2ZDQA 4CL3A 2IDKA 3PKZA 3RBXA 3I9OA 1F2VA 1ISSA 5I7WA 5F73A 3SEQA 2QVYX 2CNDA 2H65A 5FHQA 3SGLA 4E14A 1QQTA 3DEJA 3N0VA 4YALA 3GLFA 2Z5FA 5LQRA 5DSZA 2UYYA 1R5JA 3ZCXA 2AEFA 3C5EA 3EZXA 3PUJA 4H16A 3SYTA 4B4DA 2DZDA 4DIKA 3W5HA 1QH8A 2VVTA 3QBJA 3RVMA 5KQGA 4MCAA 3LRTA 4AO6A 4XE5A 4P33A 1GG8A 2LXNA 3IQFA 3QF4A 3Q0EA 1HTBA 2C97A 5AI0A 2O8EB 2OCBA 4CKXA 1QH0A 2C2ZA 3SM3A 4BMVA 4D6PA 4JJ4A 5EC8A 5FV4A 1W47A 1UXIA 3ND7A 2FUNB 3E9QA 5EJ2A 3OETA 4GC9A 1XMSA 3ESXA 5KYVA 5NLLA 3T94A 1OROA 1JU3A 3DV0A 5DK4A 2R79A 2W43A 4B46A 3DB1A 1I2ZA 1U7OA 3MWDB 4Y9RA 3E61A 4DFDA 3JRXA 1CVIA 2XUOA 4Q1VA 3MK31 3TMYA 1KERA 4MGZR 2C2KA 3K0AA 2BVNA 2EOAA 3GR6A 2QUZA 2QLJA 3CSUA 3OTIA 4GEKA 1QAQA 3P9IA 5E7QA 5KTTA 4AD8A 3K9FC 5J59A 3BRSA 1C0KA 4YVFA 4I08A 3WHKA 4QLOA 4HEQA 2R1ZA 1TO2E 4P22A 1MPXA 4B2PA 2FFJA 3CT6A 1SIBE 1UKVY 2E3JA 2HT1A 4B6FA 1RYDA 1FP4A 1TQ2A 3FNGA 1X86B 3P5SA 4BNXA 5KYGA 2QN3A 1E2MA 3GCWA 1M6YA 1J0CA 7GPBA 5K05A 3D1JA 4HH3C 5GGXA 4P7FA 4QUAA 3TW8A 2IQIA 3D6MA 3E3OA 1LJUA 2NPOA 3GT0A 3MSXA 4MR8B 1M6VA 4OXYA 4U5QA 5LYJA 2ZAOA 1LFAA 2C59A 2V6FA 4GBED 3WL5A 1NUPA 1Z26A 3SX4A 1IM5A 3IQZA 3T7KA 1NYQA 2BR4A 1PIWA 3QXCA 1LX6A 3CWZA 4ZAFA 4AMBA 2IE0A 3I4FA 4B3TB 1LZLA 1HLGA 3WYFA 2R68A 3FI9A 5DYGA 2G3YA 4FWIB 4M0UA 4PLGA 3C7CB 1SKYE 2EGUA 1QHNA 1XZMA 2C2GA 2WOOA 1TO1E 4DSZA 4YPFA 4EUHA 1G5FA 3MUOA 1EHIA 5GAJA 1AQ6A 3LF2A 3ZS9A 1P6XA 5KHAA 4RS3A 3R3WA 2HJSA 4MWDA 4BUJA 5TMDA 4BPBA 1YQEA 1ZWKA 3KYCA 1E0AA 1KS2A 3UBMA 5BP7A 4TS3A 2BMVA 3K1AB 4IOMA 2EQAA 4N0DA 3NH9A 3NDPA 2CXNA 2QMYA 1N2CE 2QD2A 4MUGA 4ALIA 3K5IA 3ZE8A 2GBGA 4RQUA 1U0NA 2BHSA 4ZOAA 4YUZA 2CL5A 2AKYA 3ZGOA 3KTDA 1ZU5A 3D3KA 4YREA 1R0WA 2Z3WA 3K94A 4RKYA 1L5WA 2HWWA 2H4JA 1KP9A 4IJKA 5KJFA 4MSUA 1YB4A 5EE3A 3UM9A 1U7WA 2ZYSA 1B2LA 4BATA 4LISA 4CT0A 5FOSA 1AUQA 1D4FA 1QC5A 1ZH0A 5LUAA 3OJWA 3RAFC 3JWHA 4REOA 3KZKA 4NCKA 2KSQA 2CVQA 1CFZA 2GNPA 3P9YA 4YQZA 2O05A 3C3WA 1KRWA 1A72A 1ORVA 2DH5A 3EA4A 4YROA 3INRA 2QAGC 3KZOA 3HDJA 1E7SA 5F3RA 4IHJB 4UHJA 1KVUA 4FOOA 4GDMA 2H1FA 2NXJA 4C0JA 4GXNA 3IR6A 2IHTA 5TQ2A 2Y8EA 1H94A 3CO5A 4BVJA 3L05A 3PC2A 3WWOA 4X92A 5K6TA 2YZ7A 4NV0A 1A50B 2ZIXB 4DBLC 3IKLA 2RHCA 1DE0A 1OLOA 3AM5A 3A26A 2EKZA 4RSRA 2PXXA 1P1FA 1IG0A 2XZTA 4NOLA 3T7EA 3L02A 4V0KA 3FWZA 5D3MA 2IHJA 3ISJA 4YRPA 3GBPA 3NHZA 1UEIA 2BC9A 2I3DA 3T1YB 3R44A 1RPTA 1ZBDA 2NZVG 1Q11A 1T5OA 3DQZA 3UGQA 4QUHA 3L4SO 1QYVA 1KO7A 1YULA 1CF4A 1M10A 3OZIA 4MVJH 4RX1A 5KYNA 1FNNA 2VHEA 3R3HA 5AHWA 1TZKA 3LBFA 1PJQA 3MRXA 3A2MA 4L22A 2YFQA 4HMQA 1NNSA 2WYVA 1KOLA 3VHXB 4E22A 1DO2A 1E3QA 4Z0HO 4Y8VA 1U7HA 4RIFA 2FRDC 1Q1AA 1AOXA 3V8BA 4WCFA 4FCTA 5DGIA 3DZDA 2XBLA 3FDJA 2HRQA 3NC1C 1SXQA 1W36C 1CEYA 2YW2A 3LDHA 1E2FA 4AO8A 1EXNA 2BV3A 2RKOA 4N0MA 1YO6A 2JIQA 2VZ8A 3KQWA 3KTAB 1SU4A 3W5IA 3AVUA 2WAAA 3ICQB 1GNRA 4CKYA 1JQDA 3RTDA 4Z8YA 3ZZNA 1GQFA 1NSTA 4G5HA 2FSGA 3ROMA 1CEQA 1EA5A 3UHPA 5BN3B 1DIAA 2ES4A 3HWRA 3NONA 4KLCA 2PUGA 2AR7A 2DG2A 4D96A 3QKIA 4N7JA 2E18A 4Z3DA 2JFOA 5JFOA 4R2LA 2X7JA 2VRWA 1WY5A 2JAPA 4UBJA 1OLUA 1YH3A 2FQXA 3L0SA 3JQBC 2VWQA 3DBHB 2EFGA 4MDFA 2V8OA 5E3HA 4B85A 4YMLA 1EVZA 2FUG1 5DU2A 5IF9A 2O8VA 1H65A 1NY6A 4OQNA 1I13A 1WF6A 3IBFA 3D2BA 4ZT2A 4E7OA 1MXFA 1V7CA 3R41A 2G17A 3QVLA 3I5UA 3OKFA 4G0ZA 5B30A 2VAWA 2XOXA 5D7BA 4XCQA 3WMRA 4C30A 4DV3B 2ZYAA 3B7PA 4BQEA 4PZDA 1AUXA 2J46A 3TOZA 4OYYA 2AJCA 4AUNA 1E58A 2ZITA 1UOQA 3HCDA 4H7FA 1NULA 4GZ6A 4ZOEA 4CFSA 5B1SA 2QMUA 3AJAA 3H2HA 3PXCX 4UVDA 5BXQC 1CQIB 1SPBS 2ZBFA 3COZA 3DDSA 3NAQA 4XX0B 4GWKA 4DLYA 1F6DA 4DUYB 4GICA 1CY4A 4QM7A 3FWHA 3B3QA 1NOIA 4MLZA 2Z95A 2PMBA 1JB1A 3DW1X 2X7HA 1THZA 1S02A 3IPXA 3MMZA 2QD1A 3M6IA 2W6QA 3RRYA 3QHAA 4JJAA 3BB3A 3AUTA 2W4IA 2AFVA 3O26A 3THWA 4L7VA 3EE6A 4BLPA 1XX6A 3G5TA 3W2HA 4WFIA 5AW9A 4GGPA 3F6CA 2QN2A 3JWIA 4M98A 4NLLA 2XIQA 1QHGA 2HBRA 3VDNB 1PI3A 1UQUA 2OOKA 3DFMA 4YP9A 2XNSA 5M29A 5A9SB 3HY4A 3M6WA 3ND9A 3AFMA 1N9ZA 2RHGB 2DEUA 4IDPA 4JZYA 3N7TA 4OXQA 3VTKA 5JROA 3FPFA 2ZBVA 2B1QA 2O59A 3A37A 3LGSA 2RAVA 3OZWA 1GHTA 4X93A 1JJVA 4XARA 4AMYA 2J3QA 1Q0HA 3EVGA 3PGXA 2IHZA 4WZAE 3WYEA 1Z2CA 1WCIB 4EG3A 1GGMA 2J07A 3UN1A 4D9FA 3P0RA 1O3YA 3BQNB 4N6GA 2PS9A 3UFXA 4N8EA 4DC0A 3C1UA 5FBZA 1G6Q1 5EIAA 2BL4A 2C83A 5DM0A 4DA0A 1BKSB 2D54A 2QW0X 3NEAA 2O4UX 4MA0A 5BSTA 4YV0A 5CG2A 3HJTA 1JQJC 2JAHA 2VSYA 4P93A 5I9NA 4R7GA 1JI3A 4WSOA 3RS7A 5C5CA 2WYWA 3AFNA 2IK8A 2Q3FA 1JALA 2YJ5A 3AFIA 4ZU6X 1V16B 4Y2UA 3WK8A 1JHZA 1TLLA 2WABA 2Q9BA 4MIKA 2E4UA 3RV4A 4AJNA 4H4CA 4B82A 4O4JA 1L8AA 2Y67A 3N5KA 3ZHOA 1ADBA 5JS7A 1GM5A 1K8QA 5FJIA 3ANSA 3IAXA 4TM7A 2CV0A 3E9ZA 1XU7A 4CDMA 5KQPA 5BNWA 1HOTA 1JSLA 2ZB3A 2ZBDA 2PJUA 2Q8NA 4BB9A 2FX2A 1QHHB 3JYNA 3LHKA 5IZ4A 2CKDA 5JZOA 4M86A 5F64A 1ISHA 4LTMA 3TO5A 4V2IA 1MT0A 3O9MA 3QW4B 2GFQA 2IHYA 3IHKA 5KO2A 2BBSA 2P2CA 2W2PA 4QTUB 2C0QA 3L79A 2HV9A 4IY1A 2QRHA 4I9NA 1M8JA 4U2BA 1LTHR 2QJWA 1Y81A 3OVMA 6Q21A 4WOJA 5FDFA 2ANCA 2OFFA 3WFJA 1CRPA 4N3NA 5H83A 5JW6A 3HXMA 1IM2A 4MW5A 1NDUA 3L18A 1RCUA 2QM0A 4M1YA 3GPLA 4J91A 2ZSEA 4JQYA 4P7JA 3IOYA 3CGGA 3RVSA 4DMFA 4JJ6A 1R6VA 1L8OA 2GX6A 5ITZA 2JHCA 2WUFA 4TMKA 1Z7WA 4IIFA 4REQA 4BB6A 3GT4A 3NWBA 6LDHA 1SHLA 3ORQA 5CFNA 3M2TA 1VKOA 4KNWA 3PHJA 1VI2A 1SCNE 1X1EA 1H23A 4FFVA 4FR5A 1Z3CA 5FL7A 1FW6A 1K8XB 3A4IA 3PI6A 3PQDA 4GLOA 1XJ5A 1Y9ZA 4E5SA 3CS3A 3HA7A 2FGJA 3ZD6A 3QEMA 2QDXA 5F2OA 1YVRA 4HOYA 1OT5A 4U63A 5FOVA 3WGYA 4EAAA 1VBFA 4RCYA 5JNUA 3FFTA 3NGLA 4J2OA 4W82A 3NBQA 1PD0A 3DP9A 1Y8QA 1X1RA 3H99A 3Q7SA 4F86A 5CFZA 3E1GA 4AZTA 2AKAB 4J1TA 4IQFA 4NXNB 2BEWA 3UOAB 3K70D 2H4WA 4KXNA 3ZU3A 1GPWB 1NI3A 1IC6A 2CVOA 4EBFA 3HXPA 1U9CA 2IU3A 3K4HA 3B60A 4B33A 5C7OO 4K6CA 4GPAA 2CT8A 2VCEA 1OXKB 4HLCA 3SBEA 2GRJA 5KYUB 1DIOB 5TS2A 1J06A 3V97A 4ND8B 1ZYUA 2ZDHA 3TXXA 4ATNA 1T6BY 3SMVA 1HRKA 4B7AA 4DMUB 1DC3A 1JDSA 5K0TA 4G0NA 1SUWA 5F9HA 3PKJA 1GSHA 1JG3A 1WOYA 4Q9HA 3ZH9B 3OG9A 2DLDA 2JFUA 2O7NA 4BJ3A 3GLFE 4FMCF 1WEHA 1L4HA 5ERGB 4MVJG 4TKMA 5A0FA 2VAPA 3TIIA 2I29A 2W83A 1TAGA 1G9TA 1I4DD 2BFDA 2YV4A 3KSZO 4R3NA 4TYMA 1MB3A 2I6FA 4Q4AA 1X2EA 3NHWA 4XUEA 3OCZA 4Y0NA 1XEWY 3W77A 1K7CA 1T2CA 3IP6A 1W1UA 3GVCA 3ZTYA 1EX7A 4IHKA 4ECEA 4EYOA 2PZ8A 2PUVA 2PSSA 1LEHA 2GAJA 1JIQA 1W0JA 1H3FA 4WVLA 2HPAA 3WMWA 2W2MA 4NMMA 5KOIA 3AHIA 2R7LA 3LRPA 3ZD8A 3A1WA 1U80A 3K31A 1MFPA 1Q7GA 1SN7A 2GF2A 2PTHA 2WHXA 4IG9A 3GMDA 4LXTA 5AHXA 2G9NA 3UKOA 4PRZA 3VU9A 4DIUA 3VU1A 4D9HA 5ED4A 1ICIA 4UC0A 2GM3A 2VF5X 3E7XA 2DR3A 3FGNA 4LS3A 2NTVA 5TPZA 1RRCA 4UVIA 2NMVA 2JLSA 3OFKA 4D79A 3DKVA 1EJ0A 4LJ6A 5HQJA 4TV9A 1TK2A 4KYTA 1EX1A 1Q7EA 3EZ6A 2XADA 2VNSA 2ZIGA 4Z3OA 2FHSA 3RS9A 1LW6E 2D4HA 3I4CA 3QWHA 1TD1A 4NWIA 4Y2PA 4ARBA 3QXJA 4LX8A 4XEUA 4P4SB 4PXYA 5LMZA 1E5XA 4Y7CA 3LOUA 1C0LA 3RUPA 3KSBC 2G1PA 3LHSA 4MQEA 4NDZA 1Q7TA 4RPKA 3SCZA 1ECBA 3QSYA 2FXVA 3T0GA 5EERA 4GMGA 4KW7A 3IHLA 4QJ5A 3H13A 2HHLA 1VHLA 1GQRA 4DIFA 3KJZA 1KH2A 3NOQA 2JI7A 3O1LA 4FIDA 5DBOA 1A5SB 4IDNA 3LQQA 4BP9A 2WM3A 4HNHA 1LI7A 2F8MA 3NC0C 1KZGB 1M2JA 2NV0A 1CR1A 3JWGA 1NLMA 4N5HX 4YIHA 5B2ZA 2IKSA 2XYRA 3JR3A 1NXSA 3B8HA 4RD1A 4WFKA 3GIDA 1NF2A 4OJNA 4ZJPA 3U60B 2B20A 2IF0A 4NQZA 3G1TA 4RY9A 4HXGA 3QUSA 5ARDA 3ID6C 4QUKA 1ML4A 3SZ3A 2EX4A 4LWZA 5FD8A 4NBRA 3ILYA 1Y3HA 1MAUA 3H9UA 4KI7A 3NAMA 1L4LA 1IXZA 1QP7A 3CEPB 1KO4A 1UXKA 3KP1A 1QR6A 1YHNA 3KAKA 4GQBA 4DT1A 3SHOA 4I1IA 3ZE1B 3B3AA 2CN1A 1ADCA 4CNQA 1T8PA 3T9AA 4Q66C 5BSWA 1CP2A 1QJCA 1EWYA 1UBKS 4JLBA 3V1UA 1NZFA 1I33A 2D5BA 2XE8A 2YZ2A 1EWKA 1UM9A 3KLOA 2PDAA 1GNSA 1C1XA 3KYDA 4A5SA 4W5TA 4FWTA 1JAHA 1HDYA 2FA9A 1N5DA 2HHJA 2HRZA 2C61A 2HT6A 3DMYA 2QJTA 1UIMA 1QRUA 1GPYA 3FX2A 1XALA 4FILA 3WI7A 4CWAA 2Y76A 3ODPA 3UK6A 4OAQA 2I6XA 3MSCA 1ZA1A 2CJXA 4LX0A 4M0DA 2ZBEA 3MWKA 4LZOA 5CCEA 2R97A 2X9LA 3MRTA 5E95A 4ZRMA 4LGYA 1JLHA 1I0LA 1FDRA 1YB5A 2ZI3A 3NVMB 3ZVLA 3PLNA 1T4CB 3SSAA 2YNMD 5A6VA 3K0CA 2GTHA 1VMKA 2J6HA 2C78A 4LWOA 1M75A 4ZAWA 1XROA 2H1SA 1JXQA 4IDEA 4DMHA 4G0YA 4GUDA 4BRUA 1HBJA 4PHGA 2YOFA 3TCNA 2PGNA 2RK3A 3VOSA 2C92A 4ETIA 3RC7A 4BO4A 3LP5A 4NFYA 4W9MC 3PQFA 5ICMA 4GPBA 3DCYA 4KDEA 4W7HA 4A15A 2NU7B 1IQPA 5ALIA 2I7VA 5F51A 3T3MB 3H17A 2W0MA 2ZJ2A 4BLTA 3CLTC 4R7TA 1O0BA 1VHDA 2VJMB 4U2DA 3I37X 5DLPA 3K9WA 3SJAA 1JEYB 1CZKA 1KSJA 1RPJA 5AVWA 2I3GA 1YL5A 2GBLA 1QIJA 2RBGA 4FCCA 4GPEA 4MPJA 2QN8A 1DRUA 4DJEC 1ZMBA 1PW5A 1QDLB 2FWNA 1OZGA 3VYVA 3DG9A 3LT1A 2WRZA 4JI0B 2Q46A 1V35A 4IGKA 2NIPA 4PBSA 2D2FA 2OC9A 2ST1A 2VCHA 3A4NA 1XHLA 5FPQA 3WP1B 4C07A 4MINA 2PRKA 3CUSA 5AFSA 1IN4A 3BDVA 1BS2A 1KI4A 3DEFA 4GDFA 4TXMA 1W75A 4RA9A 1MB0A 1A8QA 2XDQB 3C1OA 2FMUA 2ZDGA 1VGVA 1TYCA 1NN1A 4JS0A 5FWYA 5FYDA 1KAMA 4KQCA 4O2AF 5JZVA 1AV6A 5JJLA 4ZOCA 5LUBA 4I5FA 1ST3A 2ENUA 5EJ5A 2EJUA 2PM8A 3DNFA 3A25A 1LPBB 1PJTA 4RIEA 3H6GA 1THGA 1FDIA 3ES9A 4HN2A 4NK5A 4QO7A 3FBTA 3NASA 4U9IS 5JCOA 2OFPA 3AIKA 3NFYA 5IHXA 2WP0A 3S2UA 1ZVJA 3HC7A 2OSVA 2YDYA 5MGNA 5F9FA 3TKYA 2BGWA 3NV9A 4XM1A 2W48A 1X7WB 4V24A 2BJHA 2XWSA 5DNWA 5JSKA 2NWQA 1VC2A 1E89A 2VCYA 3FPLA 3KOXA 1EKXA 3D8SA 3LKZA 4KGDA 5CDFA 2ZE6A 3T5TA 4OX9B 2WKQA 2DPMA 2X7XA 5E4FA 4AI6A 2ZB2A 5IVKA 2DQYA 5H16A 1NRWA 3AEQA 1YAJA 4IVNA 4OJMX 1XRJA 2D7DA 5L40A 4M87A 1A4IA 4OAPA 4IDBA 4P34A 4QDUA 2N0SA 4FZRA 4IFEA 3ESYA 1SBZA 4DNFA 4DUPA 2B61A 2RH9B 4H77A 2BM9A 1M66A 5F1KA 5BYJA 4HN4B 2YN0A 4G8CA 1UANA 2XIJA 1RWXA 3OD1A 3A6ZA 4RQAA 1ZLXA 3LUFA 1K8ZB 1ZINA 1GGNA 4POAA 3V1KA 2B8NA 5FLYA 4ZO9A 1SKQA 2OV4A 1DQZA 2DC1A 4O4HA 4RGVA 1LRLA 1JKMA 3CX3A 3HJGA 3UXMA 1XLTA 4BNGA 1X8KA 2HJWA 3FH0A 2JFVA 5IN5A 3DDUA 2VAXA 3K9NA 4OATA 5DCUA 5BT9A 1MB2A 2P9EA 4LDNA 1R5BA 5DXFA 1XRPA 2P9TA 2M6KA 3W8FA 3WZMA 4JNCA 2CMGA 1FU8A 4IZOA 4LTNA 4U9UA 1KE1A 3BJZA 4FUQA 4O02B 3OJ0A 3WYBA 3G13A 3L6BA 3FPAA 2ZUTA 5JDIC 3QKTA 5AJVB 1VPWA 4RXTA 4LCEA 1OLXB 4BNDB 1V5IA 1TADA 2QRMA 4WZ6A 4LNUB 4HEJA 3TE7A 2DHRA 3E84A 3R6GA 4EQ6B 4ZMRA 4BX0A 4F5ZA 1XVAA 3I2JA 4TYPA 3S2YA 1RWMA 2GF0A 3B3GA 4PG4A 4RXUA 3T99A 3LDFA 3SYMA 5MHTA 4NCXA 3WNBA 2HHCA 3IMEA 3OU7A 3QELA 3OP1A 1P61B 3AHGA 4FPXA 5JCXA 1Y34E 5IT0A 2JZNA 1URPA 3TRKA 1U0EA 5GONF 2J8ZA 3BGSA 4PW0A 4YXWD 3KEOA 3DL2A 2P75A 3BL6A 2R1VA 4FN4A 1L4YA 2C7VA 2II6A 2OAEA 2FZGA 2R8ZA 4H0CA 4LQLA 4TLCA 3FUUA 5BQFA 5K6AA 1V8DA 1XEAA 3DZCA 1SVWA 1TW3A 2QX6A 3NJ8A 4LNHA 1ZH4A 3H2JA 3I5AA 1VPEA 2ENWA 4GQIA 2MR5A 2XB2A 2YXNA 2W6PA 1VFNA 1KI7A 1S4MA 1XMPA 1I4EB 3JQGB 3P9ZA 4HY3A 4LHZA 1SUEA 1GDTA 4O4IB 3KSRA 1WXEA 1JZSA 4P4UA 3CN9A 5ICGA 4OHMA 2PT6A 1SXHA 2VT6A 5KYTA 3S70A 3WGJA 4DIEA 2QR3A 3GOQA 3OZGA 2WSSA 3KPVA 5KNLA 3IEMA 2QPLA 1WO8A 1P62B 2P8JA 1NXPA 2QI9F 4HWOA 1E6EA 3BXOA 1UXHA 2VP4A 5I9TA 2VZLA 3UWPA 2R1TA 2K4MA 3VO8A 2ZUFA 1WSWA 3PDIB 1TZ2A 3QVWA 3B5JA 4MULA 1YE5A 2K7ZA 4G5FA 1AQUA 5IARA 3C6ZA 4TKVB 1NVVQ 1TM4E 4TL9A 2O2EA 4GM0A 1V95A 4MEBA 1UP7A 1E1QA 2Z09A 1KQPA 3G2NA 3RABA 2YWGA 1Y3FE 1A5AB 3DFZA 2C2YA 1UBTS 2FY8A 2PS1A 5EFZA 3USCS 3MGGA 2YUIA 4OYRA 1JWBB 3CSSA 1DXQA 1OXXK 4O5OA 1C4KA 5J23A 3I9NA 2OHJA 3KC2A 4P53A 4RGBA 2BGUA 1EDBA 3HBLA 4IRMA 4H27A 1EQ2A 1YI8A 3O31A 2B92A 1NP7A 4TUYF 4ZAVA 1SUPA 1MV8A 3V34A 4Q34A 3WLNA 2X41A 3H4VA 2B1GA 4M9QA 2WWFA 5JASA 3PT5A 1N2EA 3PWKA 3AF3A 4M22A 1XWWA 1J7KA 1C5KA 1C3OB 3ETNA 1P45A 1JKXA 3K20A 1EFPB 1DDIA 4COKA 1Z38A 3PRJA 3L9XA 1BX3A 5AH0A 1R16A 5CEJA 3U9TA 4FS3A 1DRJA 1LBQA 3UPTA 2OBFA 4GLLA 5CYOA 5KCMA 1MTOA 4L5YA 3TNYA 1RCFA 3DPUA 2ZEJA 3F6YA 1HZJA 1N5KA 3WHPA 3OAAA 5COQA 2CFTA 4QIHA 3HGMA 4D57A 1Q57A 2HNAA 4CF3A 5T4BA 4DMGA 3HYCA 3K96A 1UJ5A 4HEA1 1EM8A 1B43A 2BUBA 5D01A 4WERA 3VJKA 4GE0A 4GE3A 4DQXA 1KVSA 1TQHA 3L06A 2FTKE 3ANTA 2JIBA 4QEDA 4R9NA 3E35A 5FAXA 3VHLB 2CLHB 4XB2A 4QU8A 1RAEA 1QCYA 3KWJA 1ZGGA 4WXPA 3VQTA 3OT1A 4JITA 2F9MA 3C3EA 1NY5A 2Q5OA 3CLUD 3SZRA 5ALLA 1P31A 3BZWA 4KYVA 3TNFA 3M6LA 4D8WA 2XB4A 4EWLA 3MMPA 3RLIA 4HYYA 3V4FA 4HDKA 5E2IA 2P4SA 2W6IA 2WFLB 1IE3A 3CIOA 1J2TA 3RYHB 1AA6A 3KEMA 2KLBA 2IEIA 3PEWA 4DMMA 5BR1A 4I50B 3WB2A 1SVOA 3PG5A 3F7NA 3JAKA 2NYVA 4A92A 2KM1A 2XGGA 2FWRA 3F6PA 4XDGA 3UUWA 4U2GA 1GPJA 4RHXA 1DS6A 2HU2A 1QHXA 3OE4A 3OPVA 4J29A 3WYNA 1JF8A 1XPJA 3FOWA 3LS2A 1QHEA 4Q4HB 3HB7A 2QP4A 3SKXA 4DA9A 2CD7A 2OCLA 3WQQA 2PA3A 1HE1C 4IJQA 4INPA 1PVVA 5LIRA 1B8PA 4H1TA 4PZAA 1T4GA 3EDMA 1DJOA 3KL2A 1RMTA 1O94A 4BWGA 3Q8LA 1XNQB 1GAXA 1Q0PA 2C4HA 5JH7F 1JVNA 1BRTA 5DHRA 4X7RA 1V5WA 3BD8A 1X8LA 1YL6A 4NQRA 3QOWA 4RY0A 3GC6A 2H31A 1T0IA 1D0VA 1G8KA 4MAAA 3B20A 3KKZA 2HCBA 1OAOC 2Z2YA 2P9YA 4RABA 4ZA2A 1Q50A 3R20A 2JCSA 4FYXA 5IULC 3RGGA 4BB0A 2GEJA 3LY9A 2BWJA 2C9ZA 2FF7A 1UBCA 1FX0A 3HLYA 4O0LA 5L4LA 2WJGA 4AMUA 2AOVA 5EJGA 2EJWA 2PT5A 1JG4A 5FLKA 5GZ1A 1QG6A 1RLTA 1Z0AA 4WH0A 1RRGA 1KBOA 3W2TA 1FZTA 4DV4B 1J8MF 4DWJA 3AOEA 1X15A 3AU9A 3W7AA 4DQLA 1U81A 2FWMX 3LDGA 2OZEA 3CGWA 1CJUC 4EKYA 3LWDA 2WINI 3Q7QA 2NP6A 3EH2A 3I8XA 1TU0A 4OUDB 1UBRS 4DM3A 1JQKA 1WV1A 1SUIA 1XD2B 5AHKA 2G5CA 4B4WA 4PX9A 4BFZA 4OEHA 3IQWA 1ZH6A 2HA6A 2X8WA 1NLYA 2B4AA 4G36A 1U1EA 1WDWB 3IDFA 4YAIA 1YGPA 1FYDA 3NFRA 1HORA 5EHZA 3D54D 2O2JA 1I5EA 4BP1A 1BFDA 4ZXPA 2QE7D 5CEFA 3HCPA 4M9CA 4OQZA 5F33A 3AL3A 5J3JA 1W2WB 2IXTA 4BNJA 1J21A 1X70A 4OHCA 4Q16A 2L69A 1U9IA 3LCUA 3ANXA 3RUFA 1N1MA 1AF7A 4L07A 2CHEA 1KZ1A 4Q7LA 5TQVA 2HLDD 4K46A 4RQBA 3VR4H 1FTWA 2QGNA 3S1AA 5ALHA 3P9KA 1IBLB 2XVZA 2IZ6A 1WMSA 3A2LA 4TMWA 2LCQA 3VKUA 3RAPR 4DCMA 1XTVA 2XKKA 5H4HA 1A9XA 3U31A 4IEEA 1DI0A 3UTDA 3A6DA 2Q07A 3QUCA 3T9FA 1U8UA 5JLJA 3MXTA 1FUEA 3DHVA 3T5PA 3ROXA 5IVHA 1TTQB 2HLPA 1KEEB 3HFGA 4L6IA 4R2HA 1TK9A 3ZWKA 1U0OC 1OKKD 3CNEA 4BP8A 3D59A 4DLPA 1D2EA 2CJPA 3LQFA 2DFDA 1VRCA 4IFTA 3DP7A 5ADVA 3B53X 4AYWA 1E9DA 5EINA 3I0NA 4I1SA 1CBUA 2JC3A 4ZYUA 1NW8A 2E9SA 2VNKA 4Q3CA 1M1YE 4XH9B 5AMXA 3EY9A 2QG9A 5B58T 1KZ4A 1QRAA 4LDAA 5DXJA 2X0FA 2FK8A 4LMPA 1PSDA 1ZM4A 3N8NA 1XZCA 2IOHA 2LZ0A 3AEUB 3HACA 3F6SA 4UEQA 3RIYA 1E2BA 1W52X 3P4XA 4DA7A 3R2JA 5LJIA 1GPMA 3HP7A 4YMSA 3VO9A 4IWXA 3GLGA 3PL5A 1BVRA 1C7JA 1U0SY 5AW3A 2GN1A 2ZUWA 1I3MA 2QD4A 4KIJA 3VI3B 2DWPA 4RSGA 4EPWA 2ODEA 1Z37A 3AWDA 1Q1NA 3O8DA 4TSFA 2YS7A 4BQNA 1UJBA 1WDKA 3KL4A 7REQB 1WB9A 2D1RA 1AGNA 2HYDA 4U7TB 3RO7A 2RGGA 3ONEA 1MJ5A 1QFXA 5AM2A 2IS1A 1G8JA 2V54A 3HKDB 1WXGA 3ER6A 3KBBA 5T67A 3NBZC 4IH4A 1RKUA 1JAXA 1GTVA 3O8CA 5H59A 3Q40A 1OIWA 5A4DA 1IHXA 4QC2A 1N9KA 1PLLA 1X1QA 1XC7A 1MBZA 3D2CA 4D9NA 5LLSA 4HO1X 5F5LA 3SHWA 5JXWA 5LOVA 4DR2B 1R18A 1IY2A 1XDGA 5G02A 4YUVA 4RTNA 3CEJA 1NSFA 5HRUA 3OQ6A 3CF6R 3AB3A 4X6LA 3UGJA 2XAAA 5JADA 2AN5A 1DWOA 1GPDG 5SYAA 5C46F 1N4DA 2A4KA 1R8XA 3GN2A 4QOHA 4W9RA 1UBUS 2VXYA 4COOA 2LPMA 3OQIA 1IUNA 1Z9BA 1B76A 1DTWB 5BSUA 3G9XA 3MHPA 1ZMOA 3QTLA 2A59A 2WIJA 1Q84A 3CHYA 3U7EB 1DAPA 1LY1A 5B2FA 3BCHA 4LHSA 2IE8A 1MC8A 1YNOA 5FNVB 5HUHA 3ZOKA 1SEVA 1CUIA 2AMJA 1XB2A 3ASZA 3PUHA