5H4HA

Structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 2.2 a resolution
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
144
structure length
144
Chain Sequence
PLPPDITFDSLALIKMHSQNMKRILEVTLAKFTVNLSIVTVYRYLTARAYLKKNIEAEFEILKDIYNIVPLLDDIAIKAAQIEANLIKKEITLDMEDIITATTAIYTNSLLVTDDPKRYEPIRRFGLDTMPLDKFIKEVELMVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease VapC4
publication title Structure determination of contaminant proteins using the MarathonMR procedure
pubmed doi rcsb
source organism Pyrococcus horikoshii ot3
molecule tags Hydrolase
total genus 52
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2016-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1010 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold 5'-nuclease 5h4hA00
1A77A 5K8JB 3IX7A 2MDTA 3ORYA 3QE9Y 2HWYA 5H4GA 3H87A 3I8OA 5HP4A 3H8SA 2IHNA 1UL1X 3Q8LA 2LCQA 4XGQA 1TFRA 2IZOA 5ED0A 3QEAZ 3ZDAA 4MJ7A 1O4WA 5SV2A 3ZDEA 5FV7A 5ECDA 1B43A 1UT8A 3Q8KA 1TAQA 1EXNA 5HNKA 3ZD8A 5HMLA 5HMMA 3ZVKA 2QIPA 1YE5A 3H7IA 1XO1A 2FE1A 1UT5A 3ZDCA 2BSQA 3DBOB 4CHGA 3ZDBA 2WP8J 5ECYA 1A76A 1BGXT 1TAUA 5ECWA 3ZDDA 3Q8MA 1RXVA 2HWWA 2HWXA 2H1CA 3QEBZ 4WA8A 1W8IA 1MC8A 2DOKA 3H8JA 5H4HA 1V96A 3ZD9A 5L6LB 5L6MB 3TNDA 1RXWA 1V8PA 2H1OA 1Y82A 3H8WA 1V8OA 4XGRA
chains in the Genus database with same CATH superfamily
4PTLA 4RJ2A 2OD2A 1ESNA 4P34A 4I19A 2ESRA 3RRBA 3VPXA 4E09A 1NYTA 1J56A 4X41A 1CZHA 3R5XA 1QYIA 4YJ2F 2VNKA 3FFBA 4D6PA 5F23A 2QZPA 3JYNA 3V8EA 4IO0A 2IF0A 2H31A 3K20A 1ORHA 2CLFB 4L22A 2EERA 1SD5A 4DGSA 1R7RA 1YOVA 3BILA 5BN5A 1KC3A 1SWVA 3HO8A 4RIFA 3HKEB 4BVFA 1ODKA 3EBOA 2WVGA 3CCBA 2OGZA 1J8FA 4I6EA 4RFSB 1ABFA 1E2KA 3PHHA 3Q87B 4JOCA 4KMMA 4Q39A 2IOFA 2JVKA 4PCUA 5T67A 4BGEA 2XGMA 3L0DA 1A69A 3ZS9A 3L9XA 4JLSA 1E3QA 5T4HA 4ZAXA 3GGOA 4E03A 3NRCA 4US1R 1RQNA 2DT8A 2W2NA 3WS7A 4ZEMA 3T9FA 1Y6QA 1D2AA 2Z2XA 4F2DA 1ZCZA 5ISMA 1VCNA 1DQPA 1LNZA 3LYAA 1QO9A 1XPJA 2O3QA 3KZMA 3PQ8A 3HJBA 3GWZA 4PQEA 3CEMA 1K7YA 2ZUDA 1WS6A 1DKQA 3ECAA 3GLKA 3KKQA 4RK1A 3UTCA 1ZMOA 2C96A 1U8UA 1J8VA 4O2BB 4Z3DA 2NP6A 1QAMA 1ZEMA 3BREA 3L7YA 4DV2B 4CMAA 2BRUA 2CVFA 3IP3A 4W5WA 2Z2JA 5IUKC 4DSOA 1PWHA 2GF9A 1EFRD 4DA6A 5A4JA 3HRKA 1RFGE 1KK2A 3G5AA 4MRRA 5B4UA 1OE0A 4IWNA 1ZH6A 2QORA 2YIVX 3BPSA 4II2A 5TQVA 4O08A 1VA5A 2B7BA 4A8PA 1TGVA 2HT1A 4CLXA 4F3TA 2NOAA 2NU6B 5AJZA 5CCDA 5DKFA 3I4CA 3OF3A 4LJAA 2QVCA 2WWFA 4RDHA 4J1TC 3M6WA 4A2QA 3EWAA 1C9KA 3MT7A 1ESMA 5FLKA 1GDTA 2HJWA 3FDZB 2CCJA 2OO5C 1FBNA 3B1ZA 4M0DA 4UULA 3V34A 1LUAA 4MWSA 1LA2A 2W6OA 4ZANA 3JASA 2XYHA 2BKAA 4BRZA 5K0GA 4N8DA 4ZMSA 5MFZA 1VG0B 4Z51A 1XJ5A 5E4TA 4ZT3A 1QK3A 3PQ3A 4XUDA 1JU3A 2R6JA 3UYLA 4PZ0A 3ZLUA 1Y5LA 1E3SA 1L5GB 3UNXA 2X0DA 3NUGA 5GTDA 4UJ5A 1YGYA 1RHRA 4K9DA 3AB8A 3UGKA 3OQVA 2OHIA 4DLYA 2WA1A 1HTTA 3W9UA 1H8ED 3RUAA 1JJFA 9LDBA 1IFXA 4WKNA 1GZVA 1Q1GA 2ZUTA 5IULC 3S44A 1NMSA 2DBYA 5JS8A 2XQVA 4U7HA 5KUTA 5HK8A 2WINI 5DLQC 4CL0A 4C06A 3O4FA 4CIWA 3U3DA 2I2XB 2HCFA 1XTPA 3DHYA 2FQWA 4MI6A 1X39A 2VSXA 5IMSA 3ZQKA 3PI6A 4DTCA 2A58A 1M2OA 5KVQA 2ZB3A 3M9LA 3JZFA 3V00A 3FVVA 4M8LA 4F46A 3QEMA 4NI5A 3VKUA 2F3TA 1Y80A 3JALB 1KDVA 2HXYA 4UC0A 4GI7A 4Z86A 3AYZB 4B87A 5KYNA 1SXQA 3OU6A 1JEYA 2CNWA 4J3FA 1FJ2A 1ABBA 4FOSA 2OBXA 3I04M 1LD3A 3EZLA 4MB2A 1VI2A 4QOJA 2DECA 2AN1A 2P30A 4UOQA 1MW8X 2I8LA 4JYPA 4BQFA 1XU4A 3QVTA 4TMKA 2WYHA 3EDOA 5AW6A 2VF4X 1M2WA 1U7XA 3TBFA 1FLAA 5HYVA 1JI0A 4M9UA 1EX9A 2M98A 2XWBF 4WADA 3FFWA 1G7SA 3DT9A 4YXFA 1EINA 2DX7A 5DYGA 3AFIA 3IVMA 4PPYA 5EP2A 4RY8A 1Z5ZA 3SKYA 4EPXA 1QPBA 2EGGA 4QGHA 4G01B 4HL6A 2QUKA 5JIBA 1QG4A 1RVV1 4BRUA 1LGYA 3F71A 3ONNA 3O9ZA 1OLSA 4L9SA 4X8LA 4B46A 5KC9A 3HJAA 1YQWA 5AUPB 3PHLA 5H59A 2QLMA 1X7YB 1UINA 1O9GA 3PNMA 4WFIA 5JG7A 5IYZA 1OYOA 3UJ3X 3WAKA 3I23A 4JFAA 3RKUA 1SK8A 5CM2Z 1NLZA 1JW9B 1YS2X 2DHRA 4GLOA 4G41A 4Q7LA 2BD0A 4P86A 4YMHA 2H4FA 1UPXA 2YV5A 1Y7IA 3DDOA 2WSYB 4Q1BA 1NVGA 2I4LA 3OZCA 5EUQB 8AT1A 4BZWA 1GILA 5KTPA 3OZDA 1KJWA 2CLSA 3EEYA 3OZXA 4LRSB 4F6RB 1M1ZA 4O4LA 1UWVA 1O6FA 1WPQA 4HEA1 4UHHA 1SC1A 2W6NA 1GZDA 4IS3A 4FS3A 1XLTC 2FE4A 3O38A 1VGQA 2OUKA 3V8VA 3U19A 1P45A 4DCUA 4ZCMA 3ZWOA 2J41A 1P5ZB 1RMYA 2JBAA 4G9BA 4F71A 2WABA 5E9WA 2I7VA 4LZAA 3O90A 3U7QB 2IU0A 2OV3A 3ZXUB 4B79A 3I3SR 2IZ5A 3F1KA 3SP1A 1UQTA 3E53A 5AHWA 3N59A 4MKZA 5D00A 4AKGA 2NP7A 1A9SA 4U0KA 2GARA 3KRTA 3QKRB 4KR9A 5K8IA 1NN5A 1KJIA 1JLSA 3BCHA 4HRVA 2HSGA 2WTBA 5EJMA 3ISVA 4HDRA 1RYNA 1XZKA 1BQ4A 1AHIA 2NZ2A 1KYIA 1PR5A 4XARA 5SY6A 5JJIA 4QDKA 2LRHA 2BH9A 1L5SA 4MV3A 1YHZA 3EBLA 3DTVB 2O2XA 4IF4A 5DM4A 1O8CA 5FCDA 2QLTA 1U02A 2E49A 3RPEA 2NVOA 1MJGM 1AKNA 4MVJA 4BVAA 2OHVA 1ZWKA 1VMKA 2DUJA 2H4XA 2IP1A 2VWPA 1OU0A 4NKRA 3KWLA 4NAHA 2F1JA 2I8CA 3QTTA 1LDBA 4EHBA 1R0RE 1F3LA 3W6OA 4QODA 2YHUA 1L7DA 5T4BA 3RF6A 5A4AA 3VYRB 2RGNC 2IYOA 3AM3A 2F00A 3GW8A 1J2UA 4N9QA 5D01A 2UUPA 1X1RA 2X0NA 4WLNA 4WLFA 1M2EA 1YFKA 5KJ1A 4E32A 1SJ9A 2RH5A 3KFXA 4B7AA 3HYSA 1GPNA 3C45A 4LJKA 3TO5A 1MA0A 2GAOA 3FG9A 3X3HA 3K6KA 2B1JA 5JVDB 3RT7A 3H2KA 4NV1A 4KVGA 1OAKA 3IHLA 4O2BF 2X5KO 3ETJA 4CPDA 2VCYA 1AUPA 3VRHA 1UP7A 1C0EA 1FUIA 2ACKA 2UYYA 3E5RA 1ULUA 1Y9EA 3MGAA 4BWVA 3ESRA 3LQ2A 1Q50A 3JARB 4X93A 7GPBA 1U65A 3R5SA 1JAIA 1VPDA 2J0UB 2ANBA 1WSWA 2ZP1A 3K8QA 5FBQB 5KTTA 5CLJA 3W3AA 2QT0A 3AUJB 3GNSA 4Z8XA 1TEZA 1OH7A 2EKZA 1N9KA 3E3AA 4OKSA 5EZ6B 3NZEA 3QEJA 4G0XA 1OLXB 2OCGA 3EXG2 3QFHA 4EG4A 4B4WA 3VUFA 3OT1B 1TAHA 2PPLA 1ZQ1A 4RENA 4IDFA 1MJHA 5F7ZA 3CYFA 2QUZA 1E2IA 1I0LA 3D4PA 3IP9A 3IPYA 1P80A 3C3MA 3R1IA 4OK6A 4PC3A 2HDOA 1IG0A 3L7KA 3PTZA 4I1SA 2VF8A 5LQUA 5ED0A 4XVCA 2PHZA 3DAYA 4NRDA 4IEIA 3M4YA 5ALUA 3PTLA 1YJCA 5CW2A 5E2AA 1ATIA 3QKIA 4XWAA 5JMOA 1NP7A 1JHRA 4RDCA 1MENA 3ZXIA 4TTPA 3NIDB 4R9UC 5F7JA 3WLKX 2Q1XA 5G0WA 2XCSB 3TNYA 4XDGA 3FPFA 2QE6A 2ZJ5A 4L8VA 4DWJA 1FFCA 4FFMA 3V46A 3PS9A 1YHNA 1R5NA 2W6CX 3E58A 2YNMC 1Z9BA 5JMPA 1SU8A 1OH5A 3QPBA 1M1NB 2FK8A 5IJ0A 2JBHA 2VDJA 3DP7A 2ZAYA 1XHEA 4G8DA 3PQ4A 5TNXA 3AQ4A 1CHNA 3W2GA 4QBTA 1AGXA 1THTA 3DE1X 3UOWA 4NOLA 4RTMA 2PSSA 3R77A 1QGUA 3VSEA 1P4JA 4IIXA 2V4ZA 3QF7A 3GP8A 1S8NA 2WWTA 3ZLJA 2REBA 4HAUA 3EK2A 1Y6FA 1RYZA 1U6KA 1YCDA 3H4VA 4HMPA 2ODPA 2CNKA 1FFSA 3RF7A 2LPMA 2QRLA 5CB6A 4OSEA 3FGZA 3GUHA 1X1BA 4LXXA 2BIFA 1ZRSA 1KH1A 3WDLA 2ZCJA 3CWCA 3GT7A 2ZRDA 5F3WB 2G9QA 2HUNA 3A2LA 3HCFA 2YRXA 3R7FA 4P9NA 5C35A 2PL1A 5DFAA 4EGSA 2FEMA 5BURA 1X13A 4XYEA 1W5SA 3K9GA 1OR8A 2I0FA 2W58A 3CUWA 4EB6B 5K8UA 2QD2A 3G59A 5EWLB 2I62A 3VA7A 2FMUA 2P9FA 4OB6A 1MJ5A 1ODTC 5TSDA 1P4AA 4F2HA 4H4DA 5C1OA 4DV5B 4M3NA 2IU4A 2Y0EA 2BTQB 3BXEA 3RABA 1Z36A 1W8IA 1IMJA 2PR2A 1SUIA 2PX3A 1NBIA 4ZWNA 2FF7A 1WXXA 3IE0A 2FWIA 1WXHA 4XWGA 3ZBUA 1YVDA 2EYQA 4G5RA 3ZH9B 2J6IA 1Y37A 2BM8A 1I3MA 4V2IA 4XX0B 5DULA 5HGXA 3TLCA 3ZD9A 1M74A 1OAOC 1IRXA 1NN3A 1X7WA 1VE6A 1MO6A 2KLBA 3GRRA 4E6PA 1I7LA 3UJAA 4HWTA 4R7ZA 2IYFA 2BMDA 3L8MA 1XOIA 4H2DA 3L6DA 4HDAA 4TUYF 3DMYA 1OT5A 1RZ3A 1S2NA 5KPDA 3FB4A 4PZPA 3EW9A 1PYDA 1IL0A 1HQYE 3JQ9C 3VOBA 2PK3A 5HPYB 3OO0A 5FF9A 4LV5B 5EJIA 4YEDA 2VYCA 4S1TA 2X0EA 3CE9A 2QE7A 3W1EA 5IANA 4I5DA 1E18A 3DE7X 3QNWA 4RAOA 1SBNE 4C20A 3IAEA 4IIYA 2BDTA 2ZWIA 5FKJA 3SYTA 4EHFA 1JDPA 1DJLA 2C77A 4DG5A 3REQB 5FX2A 1OH6A 3BTVA 1QKKA 5A62A 5L51A 1TQDA 4Q34A 3OQHA 5K7SA 4QBIA 1ZAYA 3QFSA 4XLLA 4YQYA 2D5CA 3L7NA 2PUTA 4HB2A 1WKVA 4P08A 1KEEB 1LBQA 2QMOA 4EGAA 1W0KD 4X44A 3HR7A 2EW8A 2Q0XA 3FPAA 3GJ0A 3HVJA 1RBZA 3MGCA 3FPBA 2GQ0A 2WZCA 1OZFA 3OE7D 3Q0TA 3V1TC 4RW0A 1GPJA 1VBNA 3B89A 3DYBA 2AHOA 1ZUNA 3MFYA 3C3KA 4OUDB 2GJSA 2EFCB 4B5LA 4D4IA 4U9UA 1RZUA 4KPEC 2WM3A 2GGSA 4RV5A 2M6RA 5DVZA 4N03A 2RGUA 4KIGA 1GN9A 5FDFA 2F59A 4KXVA 3OX4A 4DWOA 2IYEA 2CFTA 4J0JA 4K1LA 3IXMA 4HDSA 3P2JA 2DWCA 2WPNA 1CIVA 3WKEA 4PZYA 1FFEA 9GPBA 3B9QA 3IGFA 3DE4X 1SXIA 3CEJA 4Y2YA 3U9SA 1PZNA 1BEZA 1BMQA 3B6JA 2BFFA 5AO9A 4I8XA 4L8LA 3E5HA 4ZIRA 1KXJA 3R9XB 3BULA 1ZUHA 2GJ4A 4MW0A 5DK4A 1FP4B 4ZO4A 1KS2A 1MEJA 4LYYA 1W4ZA 4D81A 4KXQA 1D1PA 1W94A 1F6DA 1MFZA 1RE1A 1SU7A 3QLJA 5EJ2A 3RSSA 1E2GA 2GA9A 2VRCD 4GSLA 5C18A 5JHHB 1C2TA 4J0EA 4B4VA 4EFNA 4P4LA 4HH3C 2O07A 2FVYA 2NM0A 4LMRA 2W6JD 1P39A 2GUWA 2YWCA 2MMGA 5IG2A 4X1KB 2CVOA 5FP0A 3SY8A 4WJLA 4J0HA 4CIVA 3GOQA 3QVKA 1DOAA 4HN9A 5JS7A 1R8JA 5EQJB 4ETNA 5AKYA 5JDCC 4V02A 4NCJA 2ODTX 1NMZA 3MB8A 4ENWA 1A9XA 2QS9A 4B81A 1AQIA 1J42A 4QJ4A 2DWOA 2IRWA 5BY2A 4X92A 3TQSA 5KDLA 3WLQA 2R6R1 4US2R 3LL7A 2RH4A 2GBPA 5EKSA 2JJ2A 3LPDA 1K6EA 4MGYR 4TYMA 4D96A 1KI6B 2H51A 1IBMB 1TPZA 1IWOA 1X87A 3ZX5A 1QHYA 1R6DA 3RNOA 4C5CA 4EHNA 1XTVA 3PIRA 1PWYE 1GL3A 1TYZA 3ENQA 3Q3JB 4LOHA 1DIHA 5EEHA 3CN9A 2JI6A 5B1DA 4X8OA 4R68A 1X3SA 1PT7A 3T5PA 3RUIA 3R40A 1OREA 5E2BA 4OMUA 5KWSA 1T1GA 2D5IA 2I7XA 4TQUS 1S7GA 4C7OA 1OFUX 1VMIA 3PFNA 4FK8A 4X9XA 4LJSA 1VXOA 3CLTD 3H97A 1NUTA 3MWFA 3PX2A 2D4AA 4A16A 4MR8A 2DFDA 4X20A 1KC1A 3CLRC 1M5UA 1ZRMA 1Z0JA 2FMXA 2MYPA 3FNEA 2GLXA 3ICOA 3JAKA 2CHFA 3O4IA 3VHQA 3ONFA 4J6FA 4UUPA 1QF7A 3WE7A 3AI3A 1IWBB 3LUHA 3L43A 3LQ1A 3EFOA 2PWAA 3QE4A 4Q93A 5AT1A 4EW1A 5BWNA 5IVKA 3FH0A 1BGWA 3VDRA 3LTNC 3OX1A 2O7QA 1IEWA 1KZYC 5BSVA 1WMDA 4UE3S 3WA7A 3HYRA 1P3Y1 4LRTB 3AM1A 5FUXA 2P77A 4IJMA 4M60A 3RR2A 5C81A 1GRVA 4DUGD 4HLUA 1XVAA 4DRYA 3T41A 3KOOA 3D4IA 1IBLB 1C9JA 4JUCA 3WTCA 1BH6A 3RC8A 1Q3HA 4IIEA 1Z33A 1UBEA 2NZVG 4UPVA 5AI4A 1FW8A 4COKA 5LQNA 3CNHA 2JJQA 4RAQA 1PK8A 1SZPA 5CX4A 2LR0A 4L08A 1WU7A 4DQLA 1AK9A 2PT6A 1Y7HA 3OC6A 3WDKA 3EXG1 3D3NA 3HZRA 4YT2A 4RPJA 4B7UA 2ON6A 2J9FB 1LW6E 2AVDA 1T8PA 1PW5A 5EI5A 4B3MB 3W79A 5KQPA 1FP1D 1UT8A 3A7EA 4QPZA 3FZGA 5DOVA 5TPZD 3T5DA 4F7DA 1W29A 1EFVA 1I6MA 1PS9A 1KZGB 4P7BA 1UFQA 5L3ZA 4BX0A 1U0LA 5JCXA 4TKLA 5BW8A 1AUQA 2C29D 1FMCA 2BC9A 1ZCJA 1YDMA 2YN2A 1NV9A 2VP6A 2QG9A 4ATNA 4F4FA 1QOZA 4JC8A 3RHFA 2IS2A 4Q7MB 1OC4A 1Z45A 2GKOA 3Q6MA 4JJKA 5H9VA 5BT9A 1XK6A 2WUFA 2YMQA 3W6NA 2EBHX 1BFKA 5FI0B 2ZRGA 1JFSA 2OV4A 4A0RA 4DV7B 2Z1DA 1XEWY 3HP1A 3M1YA 2PGOA 4JKIA 1F3OA 1YAHA 1M0WA 2VHJA 3CUKA 4E7PA 4QGAA 1B1CA 4DKXA 3TD2A 3DDWA 4IZHA 2ZYIA 1JWLA 3NXKA 5FPHA 5F5XA 3HJNA 3RWMB 5LXTA 5IS2A 4Y6RA 3AIOA 4B8YA 2EDCA 2C1XA 1PW7A 1NULA 1UC8A 2CD7A 2CXXA 2IX9A 3C5HA 3EVFA 3I92A 1RHKA 4Z0TA 3TTYA 2G0TA 2XQGA 4H0FA 3TIXB 7ABPA 5IF3A 4Q7KA 1KI4A 3SIWA 2GEUA 3L4KA 5EHGA 1DX4A 1ZLXA 1P0PA 2QTTA 5HKBA 3H5NA 5J2TB 4DNFA 3AXTA 1ELOA 2ZQZA 4Q9DA 3DH0A 3KOYA 3U3OA 2PO7A 3IDFA 1KEUA 4RJKA 4IGAA 3KM0A 2R8EA 5F73A 3HWWA 5ALWA 4R0VA 1G1MA 2DGDA 2ID8A 4YIHA 1G3IA 3IUBA 2QX7A 3ZKWA 1TA0A 3HSKA 3FI9A 3ACBA 3LZCA 5JWOA 4I4IA 1T8RA 4ZVNA 3HE3A 5FLEX 1Z4KA 1EK0A 1YAJA 4HGQA 4QHSA 4OI1A 2J07A 2ZS7A 2DWUA 3EUWA 1NUUA 2P4QA 2YJNA 4EDHA 1OUMA 2GMWA 1VSBA 4YRDA 3R7DA 4OXQA 4TWJA 2BFNA 3CVWA 1YO6A 3UXYA 5FR1A 4L9AA 4CKEA 5DLEA 5T4FA 5JSZA 3CKLA 3OEWA 1A4RA 1HPLA 2AD1A 3A37A 4YAFA 5EXSA 3KVRA 4KMRA 3H2BA 4YPFA 1SVWA 1L5HB 2Y1GA 3C1OA 2DC1A 2GRJA 2ZQYA 2R751 3EWSA 3ESYA 5HUQA 3EZ9A 3V8NA 1ZESA 5C80A 3L4JA 1C0PA 2BFWA 2PX8A 5A5EA 2H5IA 2BTOA 3IFSA 4DQUA 4H7IA 1SVSA 3G1UA 1XELA 3R3WA 4I3FA 4GPZA 5K51A 3TDKA 3Q4GA 2YJ6A 1E1QD 1Y3AA 4FXOA 1XLUA 5I8WA 3N3AC 5H4GA 1JVNA 3QM1A 4KQ9A 4MO9A 4N1AA 4Q9HA 3P94A 4OHBA 4C2TA 1RFLA 3K70C 3QUAA 3NI2A 3C3JA 2I1QA 3V4ZA 1W1UA 2P1RA 4HQFA 4JCCA 3NHZA 3F90A 3H1AA 3H99A 4R1LA 3EXHA 4CGYA 2R7KA 3OPQA 3ZCQA 3K7EA 4OUKX 4CV1A 3JR3A 4WT7A 3WR5A 1WBDA 4NPAA 3TLGB 4C4TA 3AY6A 3EFHA 3EJWA 1ML4A 3E9YA 4B31A 1COZA 1VZ2A 1ZOPA 3ITDA 4MIEA 1Z38A 1PWEA 2NUPB 2WC1A 3M81A 4BP9A 1UEJA 1FMFA 1J49A 2H6EA 3A4LA 1PEDA 4IOKA 2EGUA 3V8PA 4X45A 4RWEA 3MW8A 3BHIA 821PA 5FV4A 2X4IA 13PKA 2C5HA 4H3SA 4C43A 4EPYA 2OBLA 3A1TA 1FFWA 1P4GA 2BCGY 2A1UB 1OX5A 1KEZA 1NIJA 1V2HE 2GM3A 1SRRA 1NPTO 3DS8A 2XH8A 1K5GA 2PZKA 1IYZA 1CETA 4CDNA 4N5MA 2UXBB 2Q2QA 1DIGA 3QBVA 1FSSA 3K05A 1Q0HA 4HJXA 5FOSA 4FGLA 5KSOA 3LVFO 4KKXB 4IHKA 1KI9A 4NICA 2QNIA 3EGVA 3FDXA 4RORA 3P96A 4CBVA 2IPAB 5CA1F 3SC6A 7REQA 4WW0A 2FDRA 4IUCS 3QELB 2CEKA 1V3TA 3OPMA 1E66A 1THZA 3SLRA 4BVKA 1UBGA 4LGYA 1WHTB 1CEYA 3WQBA 2NYUA 4QUIA 3VV2A 5AVSA 5JNUA 4CQMD 3PL1A 4B6GA 1RI4A 3UJPA 4P3KA 4AG6A 3MCAA 2RCYA 2BI7A 5B2EA 1OXMA 3F3MA 4I55B 1FFHA 2KJQA 1SR8A 1S2IA 2Y6VA 5IKOA 5L40A 1GKKA 1ODSA 2XPCA 4B6SA 4RK0A 5EWMB 1RAGA 1UDBA 2A2ZA 4DW8A 4M9CA 4AJLA 2HB6A 2EXXA 1QE5A 3D8HA 3DJYA 4F8JA 1WZNA 1DCMA 3UXMA 1IIRA 3N76A 2PE5A 1I7SB 2QUAA 2ET6A 3KV3O 3ZKAA 4WDRA 2R8ZA 3T4XA 4RD1A 1H4TA 1NXQA 4MDFA 3G88A 3ILYA 4LJ9A 1GZSA 1ECFA 1JWAB 4PYOA 4NMWA 4TV8A 1E7RA 2YXEA 3V2HA 1LLCA 3OO1A 1OH8A 3QGMA 4BMNA 2HUPA 4TLLB 2OILA 2HSZA 3H5LA 5BQFA 5KYKA 4DA0A 2OZPA 1KFJB 1TM7E 3WGQA 3MQFA 4QVGA 3M7IA 4DMGA 4NE9A 4P32A 1H5UA 3FYTA 4IHQA 3NFRA 3C43A 2WAXA 2YYZA 1C7IA 1I0ZA 1T1RA 3FCXA 3H2SA 1JT2A 4CL8A 2O2DA 1L7PA 1VJ0A 2VUIB 4O5AA 1L4LA 1VSVA 3IR6A 3V8RA 5HQTA 1JHXA 1NQAO 3L8EA 3WLOA 5HKOA 2P9GA 4JOQA 1LBSA 4CM9D 4EEXA 3HBFA 1TE2A 3I9NA 1V8BA 1R18A 1XEXB 3IP1A 5AVOA 3CVUA 1AU9A 2IXFA 4OGLA 3TGLA 1TF7A 1T9HA 2ZIFA 1TIKA 3LTEA 2RBKA 4PSDA 5KTYA 2ORED 3H4IA 1G8PA 2HFKA 2HJRA 3MFQA 2MINA 3I9MA 4MDYA 2IWRA 4B09A 5A9SA 4JHXA 4BNNA 4DE5A 1AD2A 4W5RA 3J80A 3KUDA 2H08A 1E5LA 2P9YA 1X15A 4PPNA 1U0GA 1FCJA 3EPPA 3TFWA 2PUDA 3E9ZA 1N3IA 3G9TA 3TTXA 4W6QA 1WKCA 1XTSA 2OBFA 5I7RA 4D0GA 5C7YA 4B40A 4F12A 4QBHA 3HM2A 3NEYA 2X8AA 3A3YA 1BE8A 4IQFA 4W5HA 5EKDA 5JPCA 3OPYI 1RYYA 5AVQA 4Z54A 5JS1A 1JHVA 4PV7A 1L4EA 5EHIA 3WISA 3JR7A 1KI1A 3O7MA 4RA6B 3UAGA 5HA5A 1AKWA 1V5WA 4JVOA 1C0KA 2B9EA 3E27A 4LHVA 1J23A 5H83A 3W2HA 1A7KA 1D03A 3N8KA 2RH9B 4FDTA 4FYJA 4K46A 4BVJA 1QDLB 1T4DA 3P9CA 2QTAA 1B76A 4J0KA 1T5IA 2R5FA 2PZAA 4LZPA 3BDAA 3QXJA 4ZOLF 4E1BA 5IDQA 4QUKA 1Q5PA 3R7WB 1EWVA 1Z37A 2I55A 3GA7A 1Y8RB 3I34X 3R0JA 4FC6A 4MYHA 4W1SA 5AJVB 1IIBA 3O2SB 2E3JA 2HF2A 1NIPA 3IEPA 4LGCA 4KAXA 3GLHB 1PS8A 1XWFA 3O21A 3LM8A 4LHWA 4MCIA 4KSBA 4PU0A 3V8BA 1KK1A 4DUZB 2K2QB 4OP1A 4DLTA 3VYSB 4CEIB 1A9OA 2WUDA 1DLJA 3O3MB 4UASA 3PDJA 1Z7EA 2B20A 1MU0A 5HE9A 5KTMA 1DI0A 2Q2OA 2PAFA 3K0FB 1AS3A 3LV8A 4JP1A 3CZQA 1D6MA 4JEHA 3RUFA 1XDGA 4U2BA 2BY4A 1WW8A 4U2DA 1JIKA 4L5AA 3W9SA 4LK2A 1ST3A 1VM6A 3ZHOA 3AVYA 3TAXA 2QJFA 3O92A 1O54A 2G1AA 2WKQA 2W5UA 2J0VA 4GKVA 3GY0A 4D41A 1GSOA 3L0YA 4ZQFA 1XRLA 4CW7A 5IWAB 2CNNA 1B8UA 2IGTA 1LS1A 4JK3A 5F2OA 4U1RA 1JNYA 2PN1A 5J47A 1NG1A 1TO6A 2QVZX 3E70C 3EA0A 1SPBS 4B6PA 1E4EB 3TEFA 2M6LA 3NHLA 1GCIA 4O6VA 2ASVA 4X8HA 1CY1A 3A1EA 2WK1A 2IV3A 2QTFA 5D1HA 3PUIA 4M6WA 1FYVA 2XI4A 2HSDA 4RV9A 1U0FA 3EODA 2DCMA 2WSSD 2HMSA 2UV8A 1RXYA 4HZGA 4N0DA 4XOUA 4DC1A 3OIFA 3HA7A 3OH8A 2R6GA 3PQFA 4RZXA 3NG1A 1X7XA 1KSFX 3R3XA 4BHTA 2Y1DA 2UVQA 3RE1A 4CQLB 1BW9B 3G23A 1YVUA 2X42A 2OCPA 4FIZA 1VBMA 5BO5A 5BSWA 5A7FA 1GFSA 3NBAA 1U3DA 1PVOA 4URUR 1H6DA 1G3QA 2IUSA 2X40A 3PXAA 4GBED 3WL4A 3FBWA 1T4MA 2OHXA 4TVBA 4J2HA 1RJGA 1FK8A 1OA1A 1SY7A 4JC5A 4BTLA 5DHRA 4AYXA 4RPHA 2C9CA 5BSEA 4CKWA 4G84A 2BONA 3GFVA 4NNJA 3R6WA 2X2OA 2Q41A 2YIMA 1PR2A 1JR3E 4HAZA 2PZMA 1AKRA 1H8EA 2W8BA 1H4SA 4HFJA 3KUKA 1U1IA 5TXGA 5BVGB 3NBYC 1WPGA 3T3DA 1G2QA 2PGDA 4Z4FA 4GQBA 2I2DA 4LZOA 1U5CA 3A14A 4CTKA 1O97C 3B6MA 2HWYA 3TTVA 4F92B 1AH2A 2X6QA 4MH0R 1HE2A 4R2LA 3H87A 4TGLA 1EBFA 3LXMA 2WTAA 3SZUA 2C7RA 5HP4A 3PA6A 1IVSA 1A82A 1F0YA 3L18A 4KDRA 4TQ9A 4ERNA 1JLRA 4E22A 1TRKA 4KODA 5CLQA 4DNQA 3DEFA 4PAWA 2VTBB 3AF2A 5TV2A 5CDTA 1VI5A 2DHEA 2VUUA 2YHAA 3LAWA 3JVEA 4XPIA 1G0NA 1QUFA 1PP4A 1Y42X 4F1WA 2EWWA 2ZUVA 3TEJA 4ZU6X 5TE9A 3S2GA 4QULA 1GL7A 3MWJA 1ZD5A 3WG9A 4BQPA 4MYUA 2UKDA 2ZETA 4I55F 4GLLA 3BB1A 4FJ2A 2PUGA 3JRNA 4XGKA 5MFPA 4DSNA 5I01A 5LBIA 4Q3KA 3FTFA 1N6RA 1Z18A 4LI0A 3IAAA 1SKAA 5CHYA 3Q40A 1H1TA 1UPBA 3P9XA 4IIJB 3JS5A 1C3LA 5AI9A 1J0BA 1CSEE 1XCPA 3AEZA 5FORA 2PBZA 3AW8A 5BN5B 3WB0A 1ZNWA 5EIAA 2BR3A 3BFPA 4IXTA 4HBGA 3DNMA 4Z9BA 1F2TA 4B3JA 3KQMA 1W6RA 4DLNA 5IHXA 3RAFC 2VJCA 1E59A 5KSPA 4BX2A 4TYNA 3R6LA 4W1QA 4KSYA 4HY3A 3F74A 4CIDA 3ZVKA 1I1HA 5I9TA 4YMUA 3TW0A 4U7GA 4TYWA 2ODNA 4DSZA 2BUBA 1TT5B 3F6RA 2C7PA 4V0NA 2JI4A 1KJQA 2OL4A 4W5QA 1A3CA 4WGGA 3H1GA 3LPNA 2QV0A 2UXDB 4GKAA 4RA9A 1LNQA 4HUJA 2V54A 1JR2A 1T2DA 1ODJA 2VLIA 5MHTA 5EPOA 2FVXA 4EATA 4ZALA 3S2FA 4L5BA 1W1WA 1NUAA 4AQYB 5JSUA 1W581 1ITZA 1P1RA 2YWXA 3QW4B 4FMCF 3W8RA 3CT6A 1GPDG 2ATVA 1ZN9A 2DR3A 2JW5A 2OD9A 2ZYDA 3D1LA 4LXUA 2R86A 2CHGA 5DV9A 2XGJA 1N3YA 2GN4A 4IILA 2XCUA 4P4TA 3IPXA 3MQ4A 1GTZA 1YB1A 2VP2A 2O0LA 2ZJ1A 3W78A 1BXGB 1L5ZA 2X14A 4KO3S 2GBLC 3WO0A 2ZWPA 2C0CA 1XX6A 2FZLA 3AMVA 1U0NA 3EVAA 1K68A 3RTBA 2DZDA 4EY3A 3SNHA 1VJGA 1Y5IA 1YJ5A 1E2JA 1L5VA 1UK6A 1JUDA 5CH3A 1QRTA 3W5JA 1QGAA 1R4ZA 1YTLA 4AKTA 4C29A 4WNCA 2XVXA 2LWIA 3CRZA 3G2PA 4BEJA 4D3ZA 4WINA 2HC9A 3QMMA 4IIVA 4PZAA 4MVJH 3UKJA 4KN6A 5I51A 4HAVA 4NJOA 5DEIA 3KKOA 4ER5A 4BLWA 5C53B 1NVDA 2V6BA 2KW5A 4QVKA 5JPDA 1NYLA 2YZ2A 4D8WA 1XVTA 3A1NA 2X4DA 1Q7TA 5ALIA 3MS4A 4UTPA 2XVMA 2ZRPA 4V38A 2PV0A 2JKVA 3II6X 3UT6A 1C80A 3I5AA 5AUQA 1XMJA 3NJ4A 2IZ1A 1QDUA 3RIEA 1CRLA 5CNJA 3V97A 3FPLA 1S1CA 2H8KA 5K3EA 1G5IA 4KO2S 1KY2A 2XB2A 2VRNA 3BZBA 1PFKA 3LUGA 3TRJA 3G8AA 1WEKA 2EWVA 2H5EA 2GK3A 3OTWA 4PVDA 5H80A 4KO1S 1RQPA 4S1NA 4IZIA 4WESA 4BAGA 2C4HA 1ZGCA 3FNGA 4M76B 4Y6GB 4HNAB 1RPNA 4MQ6A 5COBA 4DV6B 2HA3A 5B1HA 4OKNA 3TXXA 1U9CA 4GP7A 1DJPA 2VSOA 4D3DA 1NVAA 3UB3A 1C7JA 4DCVA 1WXQA 1X7ZA 1N75A 5C4GB 1JXQA 4J43A 4XRRA 3IV6A 3L1IA 4J3JA 2CNDA 3W9YA 5IJ9A 3URKA 2OV2A 4O1MA 1PL6A 3W3AH 1ZJ4A 2AFIA 1XD2A 3JTMA 4O4IB 3ME5A 4TL7A 4KBGA 4ZJUA 1SKUA 5AMXA 1K5PA 1B0AA 2ZPUA 3R7BA 3TTTA 4DDWA 4CNBA 1QKJA 1ESEA 3P5SA 2ZBEA 2ZI9A 5J2UA 1FTSA 2PO5A 3LQRA 1L0BA 3PHGA 5EXTA 5BWMA 2EYUA 3E15A 1R6AA 1FFXA 3G5UA 3WA6A 1SVUA 5LU8A 1D2NA 2OMKA 3D7MA 5DO9A 3BE5A 1O77A 3GD5A 2P8SA 3HCEA 3IYLW 3TCKA 4YP7A 5IDVA 3PYLA 3R5HA 2J9XB 2OYSA 4TXJA 5FPTA 4GGPA 1JKJB 2FN7A 4FFWA 3R9KA 4AF7A 3OJCA 2ZI3A 5ALEA 1K5DA 2DG2A 1SEVA 1R2QA 1PF7E 3KIPA 2FMIA 3NWPA 3RYCA 1FLVA 3ORSA 1ISHA 4OXRA 2ZB4A 4KPUB 3IJ5A 2Z04A 1B8NA 3O4JA 1Y3FE 4GLBA 3KOUA 4ACAA 1Y8ZA 3PENA 4PXSA 3LPLA 5ENZA 3IH5A 4X1OA 5AW4A 5C0OE 1UDWA 1XYVA 2JAWA 1SZJG 3KG2A 3CLUC 3MSCA 3BH0A 4LOJA 3MRTA 3WYNA 4C22A 1S2DA 5K8VA 3DV2A 4GL4A 4PYNA 1W5TA 2P9QA 1CZOA 5KX5B 1D2MA 3LYUA 4GLFA 2ANCA 1BZYA 2NACA 1JZTA 2AUMA 3U3RA 4QECA 1D04A 4C5BA 5CFPA 4MK4A 3CX4A 2P41A 2G0NA 1UODA 3S29A 4N9WA 4UHKA 4W9MC 3NU1A 2QN1A 1BEUB 1TLLA 1QWSA 3UJ8A 1T13A 2XITA 1SIUA 1HFKA 1V5GA 5EESA 2YJZA 2YDXA 3WJAA 2P2GA 3ZDFA 4EKYA 4TWBA 5CFMA 1NKVA 5CGZA 4BZQA 4DPMA 2IW3A 1M34E 3ZY4A 3BT7A 1Q19A 1M8PA 2V55B 1G291 4A9AA 4UMVA 1FUKA 3VR5D 4OYRA 5F2EA 3KJNA 1PL8A 4PHGA 2EV9A 3URMA 2ZBFA 4IIJF 1FDIA 2QX6A 4U2FA 1E1RD 1V11A 1SUEA 1WQ3A 3HDQA 3IEKA 4FYXA 5A0FA 2YQ5A 4ZHQF 1NWHA 3THWB 3E61A 3UOGA 1CY2A 1JEEA 3GELA 4F6CA 4HDMB 3ZHBA 4AL4A 4ZVTA 1U4OA 2G08A 3QJYA 4YCCA 1KEKA 1SZDA 2Y1WA 2CFOA 3I30X 5CM8B 1J00A 4O8CA 4Q18A 5FOWA 4KREA 2X8JA 5EC8A 3ZDZB 2ZJ2A 4BO4A 2Y71A 4UE2A 1QGYA 4KITB 4LEIA 1XMVA 4QPCA 5C31A 3W2TA 1CZNA 2AKAB 3H9EO 3MERA 1OFVA 1LI7A 3D4OA 4OQPA 4YP1A 3DONA 5A03A 3WP0A 4XAQA 1P60A 4X6LA 1NMQA 1JIJA 4YA6A 2O1EA 2GCOB 3OPVA 1KPGA 1R0KA 1UMDB 1WQ4A 2XSZD 1PR0A 2JIDA 3LT2A 1L4MA 4UBJA 4GFDA 5GGXA 2XMZA 4RGBA 1F17A 2D2XA 3F3SA 4OJYA 5LYYA 4GBMA 4BOYA 4QU8A 5KU7A 3RD5A 5BN3A 3TZHA 1EXDA 4OM8A 2PH5A 3LQ4A 4L4XA 2RHGB 4QXRA 4YPOA 3ZHXA 2Q29A 1E3LA 4J16A 2PFGA 4IIHA 4WZBA 2ZSBA 3HRIA 3KZVA 4QTYA 4YO8A 4FB5A 1SG6A 5KYGA 1PGQA 1A9YA 4Q3NA 4EUNA 1K98A 4G26A 4GOLD 3SSAA 5CPBA 3HO1A 5CIYA 2MWMA 3M0EA 1JIIA 5FTMA 3TQTA 4L28A 1YUBA 1W0KA 5U4QA 3FAKA 1R0SA 2RIRA 1XQWA 2W98A 4I8DA 1E7WA 3OE7A 2R2GA 3GEDA 1GPKA 5FOQA 4Z4GA 2J7PD 1C30B 5A1TA 3IELA 2J9YB 2B4KA 2JGDA 1HQDA 2JGLA 2QW0X 1AO0A 4TRRA 4ZT7A 3DWEX 3I9OA 4ZCSA 1A4XA 4LE1A 1E96A 3ED1A 2VK8A 3GN1A 4OKIA 1J0AA 2O8DA 4KIUA 1DZIA 4K9NA 3STXA 4DMFA 4XSVA 3AHHA 1TQHA 3R4CA 1WETA 1BFDA 1FXUA 1H0RA 2JI9A 4MV6A 2XUOA 5ECYA 3RRNA 3TQOA 4ND5A 2QDKA 1ML3A 5HCNA 2F8MA 3EF3A 2C3OA 3VR6H 2FMKA 4P1ZA 3K35A 4US0R 3NORA 4B6EA 3FKJA 1YACA 2FCRA 5AHOA 5EP4A 5HZMA 1VHQA 4DA4A 4IOLA 2QVBA 3CZCA 4TPKA 3IQHX 3LCJA 5PGMA 4B3CA 3GR6A 2Z2YA 3DQZA 3SKXA 3ZBQA 1EWYA 3KXLA 4FBMA 4KQCA 1GIAA 2YYYA 3GWGA 2YV3A 3I1JA 3DF7A 4D9JA 2QRQA 5LKAA 1YFJA 3MTAA 6CHYA 3GLRA 1X94A 1GZUA 2DBQA 2VWGA 3O73A 4WN9A 2GX6A 4A82A 1PSZA 3GJQA 5KYWA 4YMTA 5CDFA 2VRCA 4XJVA 3B82A 3NQ41 1YNOA 4BLTA 3HFRA 5HOEA 2IIQA 3GRYA 4QDXA 4BNWA 4UQPA 3Q98A 3QBDA 3DLAA 3EVDA 2QTVB 3WLPA 1G9TA 4PGMA 1EK2A 2IIBA 1LRLA 4UD6A 3SR0A 3TM5A 3UKOA 1YF3A 2ZRKA 1XXLA 1XP5A 4MW7A 4H7JA 5U4XA 4RYDA 3BB4A 4EVIA 3BFJA 2OA0A 4X7BA 1I2CA 1G20E 2AI3A 3JQ8A 4GZ6A 4HVCA 1JIUA 1G64A 2XYRA 3EVEA 2DY0A 4TWRA 1NMXA 4D46A 1FDRA 1LTHR 4L0DA 5TC4A 3TKLA 4YRPA 1HA3A 1EB8A 3PVCA 3D9QX 4RTPA 1SQ6A 4S1PA 5EGSA 1MFPA 3GQBB 3PCTA 1M1YA 5IEJA 1DC4A 3U44B 1GPBA 2GXSA 1M2FA 3ELDA 1KEWA 1Z2PX 4YLGA 4TV9A 1Q7RA 1XD9A 1TUGA 2OORC 2ORIA 4M8NE 1P7WA 2H7CA 3KSAC 5AQEA 5TMBA 5HW0A 4INOA 3CONA 1LK7A 1D2CA 2MSNA 3LQFA 1EVEA 2ZWAA 2EAUA 3Q2IA 4GMKA 2JLWA 1H4VB 2VC2B 2ZITA 3OQJA 5ILOA 3GVIA 4ROSA 1OVMA 1DCFA 2AG8A 2G5CA 2F4VB 2JIRA 1R5OA 3LBFA 4W6ZA 1DKRA 2VK2A 1GQOA 4KQFA 2C5GA 3L0PA 4I3HA 3OWXA 3SXJA 4NJMA 2BM9A 3SOZA 3ADCA 5DBIA 5I4KA 5A6SB 1FMLA 5G0SA 4F1KA 3V4PB 1C41A 1NPDA 1EK1A 2QLNA 3AL3A 4G1FA 5ECDA 3RS7A 8ABPA 4YRJA 4LC9A 1YMQA 1U8TA 4MS1B 3WSTA 1KZ9A 2XB8A 2AK2A 1FL9A 3RC3A 3QWAA 3FCCA 3HKCA 3L92A 1HFEL 3EA4A 3LMKA 4U4AA 5LOVF 5MN4A 3FFTA 5K0FA 2Q21A 4CODB 4DUGA 3E1GA 5DRTA 4MKRA 4RPCA 5K3AA 3DF9A 3UB4A 4LHEA 3EDRA 4RVCA 2BFCA 3UFBA 1B73A 4FFLA 5EIXA 1GTMA 3IS3A 4QTUB 3RV4A 2FQ1A 2KBEA 2VL7A 1WAMA 1YJQA 2C94A 1G8FA 2ZT6A 1I6LA 1UIMA 1UT5A 5EWJA 2FZWA 4IGEA 4LJ5A 5REQB 2FPWA 3M6LA 3GQVA 1NVKA 2WE8A 3OJLA 3KJIA 3OPYB 4QARA 3W7VA 4BFWA 3EZGA 5DZSA 1J5XA 4K9PA 3DV0A 4FNMA 2LUOA 2PMWB 1JZQA 3S68A 3QFFA 1Z7BA 2XT0A 4H18A 5CG2A 3Q7EA 2HM7A 5I9MA 1AXGA 5CT8A 1QIMA 3SI7A 3RKRA 4DDKA 5BNTA 1WNTA 4LZLA 3W5DA 2HCJB 5F98A 3LUDA 1OV4A 4DRXA 1KTVA 2I71A 3OZVA 5TPZA 4QOGA 4EPVA 1FNSA 1PJSA 2M2IA 5H16A 2UZ4A 4NHEA 1L6IA 3L04A 2FSUA 4AP6A 4D0LB 1IHOA 2GVZC 2R1VA 4FE3A 3LC0A 4D1YA 5K0ZA 2Q3CA 3G7NA 5DK6A 2QR3A 2ORWA 2BSAA 3DOUA 2IVZA 1Z82A 2W2KB 3JZDA 3K8OE 2O1SA 1FU4A 1Y1KE 4Y9SA 3GK3A 2A9KA 4TX1A 4FEEA 4HNVA 2RBEA 5CG1A 3CC8A 4M0KA 2XHEA 3DA8A 4R4JA 2R6AA 3BC1A 1FNDA 2NW6A 1BMDA 2WNSA 2ICAA 1U2ZA 2OM2A 4RWZA 1Z16A 1N0UA 4DLSA 4NH0A 3X2FA 3BD9A 2C9DA 4I1RA 4Q37A 1CDDA 1P4RA 2X1MA 3IT0A 3KEMA 5I7FA 4KV7A 4RESA 1DIBA 2AD5A 3O8QA 1PT5A 1HV8A 4L4UA 4YCLA 5H7XA 5BSFA 3QPUA 1BCRB 5AXAA 2GA8A 1FSFA 3BGIA 5JZVA 4XIJA 3QWFA 1Z6ZA 1M6EX 2ZB2A 4YROA 4HP8A 5E6RA 5T57A 5K05A 2RD2A 3SBEA 3NBZC 2C4UA 3FRIA 1E63A 4JI4B 1NVWQ 2G88A 3VSBA 3PUKA 3AVVA 4KQWA 3K15A 1E0JA 3PKJA 2AF3C 1OHHD 2YWHA 2BELA 3COSA 2OFOA 5DSTA 4EFLA 5BVHA 5FBRB 3LW8A 4LDZA 3G6KA 3TRHA 1W5FA 5H0IA 3TPFA 2AMYA 4QGSA 5EE9A 3H2JA 3PUZA 1QU3A 1Z29A 5KX5A 1ODIA 5FA8A 1P9LA 4KZKA 3T52A 2GNAA 3IMCA 3HB5X 3I2IA 3AHCA 5ALFA 3VPCA 1LPPA 2FHPA 4NJEA 4B73A 4KUEA 4P6VF 3W8DA 1E6WA 2I4RA 2PLRA 1TA4A 4FDUA 5JH7B 3H6HA 1IOWA 3EXFB 1I5RA 1T1SA 2QKYA 3H18A 4F06A 1PG5A 1RW4A 3ND8A 4O2AB 1BX1A 2ZR7A 4EENA 1N32B 1VL5A 3PFCA 1JLLB 1FDOA 4J4BA 4JASB 4IV8A 1OLUA 2Q0QA 1HMYA 4GOND 1VL2A 4EBFA 4B2YA 2HX1A 2YWBA 2NV0A 3QPAA 5DOZA 3MCTA 5DTJA 1NM5A 2I29A 1E60A 2VT2A 3B60A 4IQGA 2O7SA 3GC6A 2XTNA 1PZXA 1US8A 4FKZA 1BOOA 3C7DB 5AK5A 5EMHA 5KPJA 2ZRMA 3ORFA 1BGVA 3FCAA 3W5VA 3IUJA 2H1WA 2OVFA 3PQ6A 1YQ9A 1E1QA 3Q6IA 1P18A 1CZRA 3J81k 1M83A 2L69A 3C5EA 1EVIA 3CZAA 1RIIA 3B38A 5FNVB 2VUSA 5DF1A 3GT3A 3T9DA 2FY8A 1XKQA 4NE7A 5G41A 2BCEA 2A14A 2H06A 3OCWA 4EJ6A 4QU9A 2DFLA 3T7CA 3LW7A 5DI9A 3RSZA 2PX4A 3O4VA 5BV0A 1HYEA 3L8HA 4TKMA 1Z7YA 4HMOA 3RASA 4IG9A 1BJRE 1LB1B 3TB4A 4TYQA 4L0QA 1I32A 3BA1A 4WHMA 5EJGA 1ZD8A 1GOTA 1VPTA 4TVOA 3IE2A 5DYTA 4OBBA 4EKEA 2QVXX 3KD2A 4H7EA 4EJ2A 3ERCA 5JNTA 3HLTA 2HZ7A 4V0RA 2A3NA 5G3ZA 1WHSB 4XWWA 2BGJA 3LY8A 3C6ZA 4BEBA 3DOEA 4HLQB 4UDOA 4B3GA 5FTWA 4NAVA 3RT1A 3FYSA 1XCMA 3RB8A 2YQ4A 2FMHA 1RP7A 1MRZA 3I83A 3IVRA 4N7RA 4HEQA 4JBLA 1W9HA 1LJ8A 3V33A 3SYNA 1MO4A 3R8FA 1W48A 4ZPJA 3D7SA 4MJ3A 1KJ8A 2QPAA 2R6DA 3RJ5A 3EMDA 3FWNA 4R9VA 4R84A 3SEFA 4JJZA 1IEVA 2O52A 4FGUA 4YYZA 1XMOB 1L3CA 2AN4A 4KLNA 3GRAA 1XKTA 1JMYA 1A8QA 2QROA 4CQMA 4DV0B 3KKLA 4M8KA 1PFUA 3S2EA 1N6HA 1NDUA 1GPUA 1SFRA 2HOQA 3H5RA 3OBBA 4WVFA 4IVPA 4OHFA 5K0NA 2FN4A 4HWKA 3BDIA 3H3JA 5F7OA 2J59A 4N0QA 1MD9A 2PKQO 3BOSA 2E21A 1QC5B 4M37A 3LYLA 2UYHA 2K4MA 4XEUA 5LBUA 4D3XA 1VZ3A 3C3EA 5AKHA 1E2BA 1Y98A 1V71A 2O0KA 4QNMA 1MX5A 3T94A 2O7VA 3ZY6A 3BTSA 2F48A 1DO2A 1G5HA 4BJ6A 5HUHA 3L7CA 4Y1EA 1HT1E 4DL9A 3GFSA 4RLQA 1LWOA 2QN2A 3SBDA 3QLEA 2G9RA 4HN2A 4JT2A 5KOIA 1T1EA 4WZAB 4MNTA 1JAXA 1PAUA 4RZQA 1FRVA 2YY5A 4L78A 3S1AA 4QA9A 4QM6A 2OSBA 3IUPA 1M6NA 4W9NA 1W9MA 4UEOA 1XA4A 1IXYA 5AW7A 3H9UA 1X1CA 3S0JA 4AFNA 2WWYA 1UBCA 4TL8A 2GHQA 2JS7A 3USZA 2P3OA 4L6CA 2ZYTX 2BHLA 3RTDA 4FWTA 4P4NA 2HK8A 5FTKA 5KNLA 1XI2A 5I7AA 4LYJA 1RRPA 4F96A 3LCMA 4CM9A 1CKEA 3ETLA 3KYDA 3TLAA 3A4YA 1R15A 1XEWX 3OZIA 2WM2A 2X0RA 1JFFB 1K4KA 1YK0A 1O96A 2R00A 3IIMA 1B1AA 4KUGA 3L7OA 4JODA 1CT9A 1MGOA 2VZEA 4PCVA 4MP3A 4RABA 4OA5A 4LS3A 1FW6A 1FFBA 2OTCA 1AN9A 4IDPA 4Y18A 3WOVA 4MVJG 4EAQA 4P0TA 1DLIA 3ZV4A 3DD1A 3LHKA 4HDCA 2UZ1A 3TUIC 3HBLA 1PQYA 1DKUA 3KDSE 1K92A 1DWUA 4HGPA 4MWBA 2OHHA 3JU3A 1G1AA 3OQ6A 2JFUA 5BNZA 4YJ2A 2DQSA 3KCQA 2P4HX 2R1TB 3LDHA 4J90A 4O2LA 3UMRA 2ZSAA 1E3WB 2QPTA 3M5DA 4O33A 2O14A 2B2CA 4U9IS 4A8TA 3GP3A 4G1CA 3PC3A 3JWEA 4AJEA 3AW9A 1DQRA 4DVJA 1WUIS 1G6HA 4GWLA 5B4VA 4MVJE 5TJ9A 1J4AA 5KNDH 2ZSKA 2Q3LA 3KQQA 4I9UA 2IXDA 1TAGA 1CG6A 1BRTA 4LUCA 4LG1A 4HQLA 3BHNA 3AGPA 1SD2A 3BMXA 3SJ7A 1JLHA 2NVBA 2YY6A 5J40A 1AJEA 3QVOA 2Q6KA 3AKYA 2YVLA 5MGBA 1XTJA 2OGWA 3H1TA 4I66A 4HX5A 4MKXA 4YRQA 4CUKA 4ZI2A 2VF2A 3TW8A 1QB7A 5L3SB 1U2DA 2HWWA 3K70B 4ZCLA 2D1TA 4BLRA 3AETB 1MBZA 2CL6X 4K6HA 2A1TS 3JPWA 2DOKA 1XRMA 2IY8A 3AIIA 4D7AA 1K9SA 3PQ7A 5CFZA 1C7QA 1R3UA 2GK4A 2Q5IA 1AA6A 2NNWB 3OY2A 4MPJA 5IBPA 3TQIA 5ALYA 3BQNB 3N3BC 2X3YA 2VPZA 1LF0A 4KO4S 3UC9A 4IIUA 2P3SA 3DBLA 1IJFA 1G8SA 5FOUA 3I64A 1J0EA 4AZ0A 4DNOA 5KHOC 2JFBA 1R1DA 3CR7A 4K9QA 3T9EA 4KWTA 1IULA 2ZM5A 4QO8A 2AN3A 3GEIA 3GF4A 4DDMA 4PBTA 1KK3A 2P75A 1DEAA 3IBTA 5F3DA 1B6TA 4C7VA 3AR8A 2FETA 3GEEA 4JLWA 2GDJA 2XNJA 3IIIA 1OROA 2IVFA 3KZKA 5ITVA 1B74A 2I1WA 1SBHA 4B6RA 3ODPA 3UV6A 3PHIA 5FNVF 5HFNA 2WSSA 5AI8A 1BMTA 2Q1WA 2AOTA 4JB0A 1TD9A 5BWLA 1M54A 4GPBA 1E5VA 2Z08A 3VPFA 1KY5A 3EULA 3IIJA 4HLNA 1YBHA 5J5AA 5FEUA 1INLA 4FR5A 4JR2A 4FZRA 1QIIA 2YIDA 1BX3A 1N0WA 3S7ZA 4ARZB 4DNXA 3KETA 2O8CA 1KBZA 2RI0A 2QSYA 1N1DA 3LQQA 2JAUA 3O84A 1ZZEA 3VUEA 3GJ7A 5TT0A 1DIAA 5ENDA 1G5QA 1OYYA 1U8ZA 1ZZGA 1YB5A 4DTIA 3CB4A 1S5PA 3QKSA 1C1HA 4MR9A 3LCVB 3N74A 3U4HA 2XF8A 5JAQA 1WCYA 3NS7A 1T9DA 5H3HA 1IXSB 4LMPA 2REOA 1HMPA 4HZUA 2FFBA 3AUSA 3F7OA 3I45A 4AYWA 4EI9A 3A2KA 2QL5A 4ZQBA 3PSAA 1RAIA 1TJNA 4AS1A 2FP3A 4YDSA 3FGNA 3I2YX 2OV1A 4MYDA 1PL0A 1Q3TA 3PC7A 5KQRA 4LF6B 4OFZA 1UMBB 1CF2O 2E1PA 3RJMA 1SHJA 4UXHA 2PKCA 5ETJA 3MWGA 3VDNB 2FUNB 5JANA 2WDZA 1G9SA 2ZRFA 3ORQA 5AXDA 5LA6F 3RAEC 3N05A 3WLTA 3GLFA 4EPRA 2PQMA 1V45E 1VE9A 1RPTA 3NWJA 1DG1G 1GA4A 1UJ2A 1USIA 3HP7A 5HRCA 4PCAA 2CMFA 3F49S 1JH9A 1DTEA 1HG0A 1PHRA 5CJPA 3T7RA 1FUUA 3EGXB 1TCBA 3OEHD 4X7PA 1E3MA 5K0BA 3BIFA 3GXBA 3ZQJA 5U1PA 3WGIA 3VJRA 1FNMA 4JYBA 1G2IA 3SYRA 3VC3A 2O2ZA 2K87A 2YL2A 1D6JA 1YQEA 1NU6A 3ELBA 4NNPA 3S81A 3RW9A 2IXEA 2NNLD 4LXQA 2GN9A 3RVLA 1KYTA 3C1AA 3LXUX 5DM60 1DGQA 3KSDO 2B6HA 3FCYA 3O03A 2F1RA 4OLFA 1XJ0A 4A2CA 4RVFA 3SVLA 2V3VA 4GU5A 1CS0A 2PZ8A 2W4MA 2X6RA 4FINA 3QF4B 4MCAA 1FZQA 2BHTA 1NZFA 1RWVA 2JA2A 4RU1A 5JXGA 4UBKA 4I2NA 5I4CA 2GCIA 2YWEA 1C8LA 3JSAA 3D6JA 3I9LA 2WYUA 1L7MA 3W7BA 3WGLA 5HIMA 1B14A 4LRYA 4Q4LA 4WOCA 5K3FB 2BBOA 4IAOA 1E3TA 1F2UA 1KQPA 4Z7OB 4ZZ0A 1O5IA 3IAS6 2F90A 1UJNA 2BGGA 3LLMA 3NHMA 4ZZ1A 4JI2B 1U0BB 2YOGA 2L17A 1U1DA 1YL7A 2GI4A 4B9EA 1K63A 3OUTA 3PZBA 1Z68A 2I1VB 1PLLA 2Q6LA 2W2XA 4CJXA 2EVWX 2QLLA 3GLQA 3INRA 4P3NA 4R7GA 1F2VA 2PZFA 1VGRA 1RI2A 4GM4A 1ILWA 4LA4A 4F4HA 4RTOA 3P0JA 2AEJA 3N0WA 1ZIDA 1N6OA 2XX3A 4PRKA 4W7IA 1WY7A 1A7UA 1QWOA 1V8OA 2YRFA 4IGFA 2VNJA 1EE9A 2D5AA 3X1JA 4KR0A 4FBGA 1B6RA 3F46A 4M38A 4MUXA 1HT0A 2BP7A 2HLPA 4FVTA 1SU6A 2JLVA 2EL9A 3KXDA 1ZM4A 3MUOA 4PFKA 2PXAA 3I5XA 1NSFA 3EXEA 3RJ9A 4A8JC 5IUNC 3OFKA 1BG6A 1C50A 2H3HA 4ADSG 3LUJA 2VAVA 4AULA 4Z1MD 4XD2A 1PJBA 1LVGA 1JG2A 2ERCA 1Y9DA 2WF6A 1PQPA 4BYGA 1U99A 3H3XA 1UMCB 3QOFA 1DO0A 3D4NA 3G0GA 2FRDC 4DLZA 2FUG1 3RS3A 1O87A 1EGHA 4UM5A 4DBVO 3T35A 3AO0B 3QXCA 4LX0A 4AJHA 3QV1A 2BZ0A 3A58B 4I6GA 5I7HA 3G9ZA 4FEGA 3VTAA 1C4OA 2ACWA 3X1MA 4DPKA 3GO4A 2HXSA 2H1HA 4JOBA 1K6XA 1QJ4A 2CXSA 4IVQA 4YJGB 5IXYA 3PITA 4OV6B 2IZ7A 1H2AS 4Q3DA 2Q1YA 1NBEA 2XKBA 1H6BA 4IMIB 5D86A 5B7GA 1CJVC 2C82A 4FX5A 5JQGB 3G8DA 4PVCA 4YV7A 3QXXA 3IUMA 4FLEA 4WOBA 5T41A 4EY5A 3R5FA 1ZIXA 5EJEA 1Z0ZA 1V95A 5KYXA 4E5MA 2I3BA 5JASA 4ZT5A 2A0KA 5JAMA 3AG5A 1JFLA 2WWHA 3A6LA 3AUTA 3LC7O 2O2CA 4KYUA 4A6DA 1DDOA 1RJ9B 4GE3A 1XJCA 1T6ZA 1DUIA 3BWDD 2CLDX 3PL5A 3CW9A 3N86A 4QBKA 1DTWB 4AN4A 5C5CA 2DETA 4O4JA 3KQTA 2YR0A 3MLBA 5LZ7A 2HSEA 1S7CA 2L2QA 3S5JA 4BN0A 1T36A 1Z4MA 4K8OA 2QIPA 5K0LA 1I4WA 3CRNA 4OGKA 1J5PA 3OZSA 2ZZMA 2WD7B 1RJFA 1X7DA 5E8JA 3WRYC 4M9XA 1RKBA 2WILA 3WK4A 5JS6A 2A3RA 1S3FA 1TU4A 1W36C 3KOXA 3HY6A 2FX5A 3EX7C 4TSRA 3V1MA 1TJ5A 3AKDA 3ZQ6A 4RC9A 3RYIB 4N6NA 3MMZA 3LFHA 4CHGA 2A9RA 1RNLA 1OCEA 1XRQA 1FJHA 4DQKA 2VHYA 4AS2A 1RYFA 1XALA 4YRMA 5CXQA 1G19A 1AKUA 4MTLA 3W6UA 1FYEA 5AIBA 2OESA 5IEBA 1OZ0A 4BO3A 3P71T 1QIDA 3H0EA 3Q3GE 5CA0A 4Q4DA 5BUQA 3AKEA 1ZR2A 2OFFA 4CG1A 4QM7A 4Z4QA 3L0SA 3T1QA 2VBGA 4UVDA 2LVBA 2C2WA 4NPCA 3RTAA 3SJUA 1I1QB 1NVVR 1OFIA 1Z5VA 1W2GA 4GWKA 1GN8A 4RD0A 4MQUA 4TS9A 4WXHA 3GEBA 3SE0A 5DU2A 5DI3A 1VG9B 3PE3A 1IBCA 3H4TA 1NY5A 2DLNA 1XTTA 3AUFA 1NXSA 3OUUA 1Z0SA 4HKTA 5CVJA 3GGCA 3WL7A 2HGZA 3HZZA 2VDWA 1ZSYA 3ORRA 1YZQA 2RHLA 1QHIA 3C4VA 1M76A 1DBIA 4FYKA 3L02A 1T34A 2XAUA 4OQDA 1I7PA 4LBYA 1N8KA 4R1TA 3K0SA 5C1BA 1EDDA 1YRQA 3TZBA 3OZTA 5AHXA 5CNKA 3WHKA 1U0HC 1YOBA 3FBGA 2L18A 2JVIA 2P9EA 3MCWA 3AEUB 5CLFA 3T1TA 4S0ZA 3MTQA 4YWJA 4P7GA 2IS6A 2GN2A 2ZPTX 4C2BA 3OU7A 1W46A 4OHCA 2R0QC 1V9LA 1NFFA 3EIUA 3CPEA 2E48A 2I2FA 4HATA 4JP8A 4J1QA 3IRUA 4PZCA 4Y2RA 5B12A 5IKMA 1GZ7A 1J90A 2C98A 2L42A 4KXMA 2BW0A 4ISCA 1V26A 2Z56A 3MAAC 5DB4A 3UWDA 4QQKA 3O8RA 1XP8A 5JYEA 2R66A 2O5VA 1AHPA 2IBTA 3CH6A 1YKGA 3UY4A 2HYDA 4Q9AA 1EFAA 5AFSA 4EG0A 4HPJB 4MI3A 4KAFA 5ITWA 1RD4A 4DZTA 1AF7A 3H65A 5D84A 3RU3A 5CM9C 1WW3A 4KIFA 4ALNA 3OD5A 1G6KA 4LDQA 2HO4A 4F6RA 4ETIA 3U4DA 2O57A 5HBGA 3VR5A 2X1LA 3AUYA 5LIRA 2O2YA 1Y3HA 3DMNA 3DZGA 3QFRA 3M4ZA 4KDEA 3SSMA 4FN4A 3U4GA 1DE0A 3KJGA 1JSZA 4YWHA 3WLHA 1E1RA 4RZUA 3LC2O 3QKWA 2C1EA 2WHEA 2CYCA 3OZRA 3CINA 4TUYA 1ZAKA 5AJWA 4I9FA 3ILHA 4BNFA 4F5YA 4A2WA 1K97A 3Q10A 1S9DA 1U8EA 2F1KA 3A6GA 3LCCA 3RG2A 2I7CA 5B6JA 2PEZA 3Q2OA 4EWLA 5LCXA 2H65A 3SZOA 1V8DA 2VNSA 5H5JA 5F77A 2PKEA 2VBIA 2QRVB 4H17A 2G25A 3EF1A 4Q01A 2Q9AA 4NCAA 1CVLA 5JU6A 4EGCB 4EJSB 2VA8A 1L7QA 2JJMA 1Q3KA 2KM1A 2FWJA 2EHDA 3DEKA 4IP0A 4UNPA 3ER6A 7AT1A 1QLWA 3VGPA 3H9QA 1M0EA 1NR1A 2A5DA 3M9WA 4DDVA 2I2AA 1JALA 3CLKA 3CSDA 3HLKA 1LV8A 1QVWA 2QZSA 2XSZA 3NANA 4NENA 5FPSA 4WV3A 4C4AA 4EO9A 4YJHA 5KYUA 4EAAA 4D25A 1KU6A 4G6ZA 4K03A 3NMUF 1Z4JA 3H0KA 3D8TA 1ZM3A 1NVUQ 1SCKA 4KEAA 4Q16A 1B41A 4WKOA 1Y5MA 3RODA 4RHCA 3UFXB 3VR2D 1RHQA 1C3OB 1D2RA 5DJ5A 4HLDA 3BXXA 4NFYA 2YZGA 5F9MA 3AF1A 4IJVA 3TLXA 4CKCA 2MOKA 2F64A 4EB3A 3T99A 1W5EA 4L16A 3BS4A 3VH3A 3SBXA 1RXEA 3GEHA 5KJFA 4G2TA 1ZH0A 3H16A 4YJFB 3WX0A 1PTJA 1FX1A 1R50A 1PE0A 4OA8A 5CT4A 5DX1A 1YKFA 1ECCA 1ONPA 4X91A 3TOSA 2R60A 4X00A 4XM2A 2XVAA 5KB3A 3KZNA 2F17A 1BXZA 1J2RA 2C5LA 2PH1A 2J7PA 3NHPA 3TRIA 3GPLA 2CFSA 2CWWA 1ICEA 2VDVE 4PYLA 5T3UA 3VDMA 1QF9A 1YL6A 3TSAA 1VCHA 4YQFA 2G04A 3K4PA 2ZUFA 2PSFA 2CJWA 3K6SB 2P2ZA 3SYLA 4CHTA 1WD5A 1QR2A 2DTDA 3KHUA 4JX8A 2GM9A 5TT1A 2WF7A 4AZ3B 3R74A 3NAMA 4M9RA 4HXFB 3ZZUA 4DN6A 5JV5A 3K1YA 4CGZA 2WU4A 1QGED 4ERXA 1LSJA 2K2WA 4ZCTA 2ZJZA 1GGJA 4RMJA 3ZHCA 2C2OA 4J2TA 3L1HA 4QJIA 1P7VA 1TA9A 2WAOA 3PXXA 3SSOA 1RM3A 4AXBA 1TVEA 3MRXA 4A73A 3DKRA 3EIQA 4MUKA 4PZ9A 3UMCA 3V2GA 1Z08A 2XEXA 1TKBA 4L8FA 1AO3A 5G1OA 3ZY3A 1B00A 2X2FA 1VKZA 3TTUA 4IXNA 1N6KA 1CRZA 2AT1A 2QGFA 3BGSA 1N8SA 2VFAA 5GJBA 4YRKA 1UFOA 1KJJA 2PT5A 3DB2A 3LECA 3N2NA 4L57A 5BW6B 5JNWA 1XNRB 2J3HA 4GXQA 2QQ0A 1I5EA 3C7CB 4OHVA 1WE2A 4LN1A 1AMOA 2YHSA 1II9A 1ULAA 1V3UA 3K0AB 3Q1LA 4H77A 4IRXA 5DHAA 1Z3CA 1W7AA 2ZPAA 1XYGA 3KBOA 3RT9A 1H9AA 4BLPA 4UMFA 5JJKA 3C6BA 2EZ8A 4JJ4A 4QPJC 3T4UA 3O4HA 4MX8A 2DAPA 2O3UA 5ALJA 1DB3A 3O8BA 1SAYA 4AN0A 2IEIA 3EBPA 4HGOA 3RVDA 1RACA 1ULBA 3ADPA 4WASA 3ZGZA 3SC2A 5K0TA 3NC1C 4GOMD 1FC0A 3CJQA 4QEZA 4D6XA 5LLDA 1YUNA 1GT6A 2Q5HA 3L40A 3O8DA 4GVXA 3UV3A 3HBJA 5FI1B 4BKPA 4EGJA 2QM8A 1XN4A 4GI1A 1XZHA 2H1IA 3T5TA 2VK4A 1KRHA 5E2IA 3IKTA 2PS3A 2FSVA 2PY6A 3M6FA 3EUEA 4UDYX 5E4YA 3U31A 4ENPA 1VDMA 3PLAE 3KFLA 3WGKA 3UMBA 1JF8A 1G63A 4BJ3A 3N6VA 4KPGA 4AZVA 3GVPA 2HMAA 4ER7A 3GJTA 4ESVA 2VP3A 4QWMA 5CJJA 5C34B 1M1NA 2FE1A 2C7QA 1V1MA 3BKWA 2WMDA 4XFJA 1Y8QA 1DWOA 1GQRA 2WFLB 4ZO9A 1BHO1 4EQZA 4MGEA 5HHTA 4F0JA 1KYZA 1UKZA 3CCCA 4IDEA 3CR8A 3PPXA 4JLPA 3RM3A 3WVNA 1U3VA 3C4QA 3K30A 4PFQA 3GT0A 3IPLA 3OOHA 1JDVA 1E77A 1HEIA 1T10A 2ZTVA 1NURA 3KHTA 3UBTA 4BNHA 2XV1A 2Y4NA 4N3NA 1CNEA 2WJPA 2HK7A 4CF5A 1P74A 3KEQA 3UGQA 1WX1A 1Z6TA 2G67A 2ZYAA 4D0RA 1YJBA 1BKDR 3G5MA 5ALHA 5IAJA 3ED5A 5EUMA 2AG5A 5IVHA 3C3WA 1X9HA 3GBPA 3FA2A 4TKVB 1A98A 4HNUA 2H1FA 1N6IA 2NSHA 1A7AA 1XZEA 3GOHA 1MABB 3WK7A 1KMIY 3PDHA 3UZUA 4BLUA 3LHIA 2AB0A 3DLHA 1NLFA 4OJNA 1QM5A 3S40A 4DMUB 2JFPA 3PKIA 3JWGA 4BKOA 4CCYA 3NALA 3HR8A 3G0HA 4ND7A 4FXPA 3Q0IA 2QTLA 4W8GA 2JCXA 2AMFA 5FO1A 4C2UA 2PSHA 3MGBA 3IPRA 4D5GA 1BCSA 4FBLA 3A6PC 2ZB8A 5JZSA 2W37A 2ZVJA 1WM1A 1EP1B 1P7PA 3TB6A 3WJ2A 5MDHA 3P2EA 3LIPA 1QZTA 1MOQA 3GJZA 2O8VA 3QNUA 3T3GA 1E9EA 3HEAA 1CW2B 1CQXA 1VE7A 2HV9A 1C8KA 1AUXA 4TROA 2XBMA 3VZPA 1UOPA 3RVMA 3BERA 4PZDA 3RDPA 2FR1A 4TL9A 3GJ5A 2CVHA 1EVLA 2ISCA 3G2LA 1Q0PA 1VKRA 2NUTB 1FU7A 1S8FA 1UQRA 2AJ8A 2Z2ZA 4L8GA 2X8BA 4RO0A 4PX2A 2DRIA 5AM3A 1H6AA 1SCNE 1GR0A 3GH3A 2ZYHA 5D3MB 1AV7A 2MSEB 3MAJA 2BEUA 4DWVA 2ZUWA 4KI0A 2WF5A 4Y8VA 2OWEA 1Q14A 3HUTA 4LECA 4MW9A 5TQJA 3WBFA 5HJEA 3KQLA 4Z0HO 3ICVA 1IXRC 4B4UA 3NCTA 4YALA 1KMHA 5FTJA 5B6IA 4OO3A 3RFFA 1JTEA 3M8KA 4UD2A 1BVYF 1HNWB 4BNGA 4D4LA 1RRCA 4XB1A 4D9KA 1V6AA 2BTEA 3LY7A 2I99A 4UUOA 2YIJA 4GNRA 4ZEWA 2NVUA 2BUAA 1X70A 5JY1A 1GZHB 3ZWVA 2FLVA 3DW1X 4LIPD 4KLCA 3KVVA 4DLKA 1URPA 2NU9A 3OLZA 4AM8A 3WXMA 3EVBA 3G85A 3ZD8A 4MQEB 1S1MA 1V6CA 4PBRA 1N1MA 1L4BA 3CVYA 4XA8A 4X97A 4AIRA 3A26A 3TW6A 4HG2A 2VHWA 4TKUA 1WQ1R 2C8KA 4NF2A 3FJYA 3OTHA 1UJ5A 2BUCA 1OI7A 4QEDA 2I7TA 4CIBA 3SC4A 1UANA 2QT9A 4ER6A 2IXBA 2V8BA 1QNLA 3FAZA 4BQIA 3K5WA 2Y1LA 3MS7A 1NTOA 3C8MA 1VYVA 2WMYA 3X1WA 3N2GB 3P9YA 1PFQA 3G1TA 1KSGA 3L6OO 4RZ3A 1CQIB 2WWVD 4CG0A 2P8JA 1XVUA 4L8YA 1EFDN 3DCIA 2FQXA 3TRFA 3A2NA 5HR5A 1WVIA 1I3CA 1ILEA 4DC0A 1CX9B 1XAIA 2HWUA 2SCUB 3G79A 1ABEA 1V43A 1S2MA 2VCHA 3SNKA 3KDPA 1P17A 4MQ5A 5ITZB 1KEVA 1Z6YA 2FSSA 1BVRA 1GZ5A 4BVGA 2GN0A 2BEVB 3K5IA 3FWKA 4FKBA 5CAEB 1I3KA 2RGRA 3MJDA 4P3OA 4YONB 4IH4A 4RGQA 2XZDA 5IJWA 4JC4A 2LTAA 2E6UX 2HAEA 2XIJA 3MD0A 1CR0A 4G2NA 4J76A 4PPQA 2YNMD 1E9VA 1ZA1A 1ORRA 1FTYA 2WNHA 5BQPA 1OW3B 3MMPA 4BJ5A 4EG5A 4CLRA 4ZQIA 3I6IA 4LC0A 4I1YA 2BEKA 5LYJA 1H2FA 3FDJA 3WIVA 3WMGA 1Z07A 3HMKA 3QLVC 4X8MA 2PUBA 3STTA 4KVZA 2VHUA 3JD1A 1DOHA 4QU5A 1Y1QA 2C42A 4R71A 2IHTA 3C4JA 2IEAA 1XZJA 2LNDA 1OX6A 4D5EA 2XTMA 5CA1A 3GDFA 2RE8A 1AE1A 1E99A 1E1CB 2BI4A 4AC9A 3PRYA 5BRAA 2N47A 3WGYA 4S2UA 3ONEA 1SCDA 3IUYA 3V4SA 1M1XB 4DDUA 2V6JA 3JRXA 5AM5A 3SE7A 3BJIC 4KJXA 1P4SA 3U17A 2O8EB 2MDTA 4Q3BA 4TZTA 5K4HA 4U2EA 1XZGA 1OBFO 5ULLA 1P4HA 2LKCA 4W7HA 1QONA 1S8OA 1VXRA 5DCWA 1CUDA 1PG2A 5C46F 3OZUA 4LCEA 1V7PC 2ODEA 1GP2A 4MS4A 2VDMB 2XT6A 3H1FA 3LPMA 5FPQA 3RARA 5CVTA 1C0LA 1AGNA 3H84A 5T8KC 2Q07A 1K3TA 3EMVA 4D43A 1JEQA 1HDOA 4HXEB 4UBMA 5CLGA 3S99A 2VDKB 4P0PB 2FNAA 3EG5A 3AZQA 2NXEA 4UCWA 1KDPA 2B98A 4ZK6A 2H2GA 4G4GA 3SVZA 4GPAA 4CN9A 1F0NA 4ODIA 4Z6KA 5M29A 1G38A 5KJ6A 4U63A 5DM1A 5FIUA 3U49A 5I9IA 1J25A 2YS6A 2WSIA 4UZSA 2AKEA 1VRCA 3HHPA 3QYPA 2JCGA 2O0HA 2V6GA 4MIKA 4MIYA 4XQGA 1JDBC 1GEGA 1JIVA 4W8HA 1FTQA 1G2PA 3I6BA 1K1EA 2CLLB 4IICA 4L85A 4RM3A 3FGOA 1C14A 4KQ1A 3QUQA 4C4YA 1DBWA 1PTKA 1A7JA 4RZHA 5BVHB 1YDFA 4RIEA 2BN4A 4EA9A 1XZFA 4M7OA 5FRDA 4B45A 1KAQA 4JUIA 2ZZKA 4WCDA 1T0UA 2C58A 3TVTA 2J33A 4CFYA 4F11A 2AH5A 2C9MA 4UOZA 5JAOA 2GCEA 2JIOA 4JVSB 1G5PA 2UVPB 1UEXC 1Z47A 1U81A 2NYAA 3BZUA 3WSWA 2BMFA 4LY9A 1OI3A 3BK2A 2E4XA 2CFRA 1K0FA 2ZWMA 3KB2A 1MB3A 1C1DB 4X84A 1HKUA 4GAEA 2IYXA 3V2UA 3OZEA 4EDFA 4FCWA 4LX8A 5DNWA 1QRUA 1JDZA 5SY9A 3SU8A 2ZXFA 5GJVC 1XTQA 1EQ2A 3AUUA 4H7FA 3RUEA 1NKSA 3WZLA 3G2HA 1XZCA 3ZU3A 5BN1A 3ROXA 3K2IA 5JZBA 2NTYC 4FYIA 3C3BA 3FMOB 1IBRA 1FF9A 3JV7A 3QVWA 4IXMA 4J03A 1XN1A 4UZEA 4IO1A 4LGMA 1WBBA 2WTMA 3AB7A 4DSTA 4OOFA 2ZUUA 2PX0A 3AIKA 4MVYA 3IXLA 1E0DA 2WJ3A 2QVGA 4BKQA 1QP7A 5FWYB 3KWJA 2C4VA 2JFGA 3LJKA 3TQRA 1U7HA 2WHPB 3AVQA 4GP9A 4KDCA 1ETUA 2C83A 4NBWA 4ZOLA 3U3KA 4WBSA 3KR1A 1EVZA 2SHKA 3WFIA 2HBRA 3PC8C 2OM6A 4F7WA 1IPFA 4E70A 3DE3X 5D5HA 1A8SA 2Z8XA 2Q4TA 3OFND 3ZN2A 2A4KA 5H68A 1GUFA 5A02A 3RC1A 1A04A 3VR1A 3E3NA 5B1IA 4YHBA 1EUQA 4IHJB 1XTIA 3C1UA 4OYYA 3AVWA 2FLKA 3K5HA 4I81A 4MLPA 3OQMA 3S4YA 4LVNA 4D98A 2P79A 4ZOBA 5KOHB 4XFKA 4K1XA 4WOPA 5C4MA 3MLAA 5E0KB 4FOOA 1T4CA 4GI3A 1ZHOA 4A5OA 2HEGA 4L9RA 3U7GA 1GNTA 3CO0S 4RXUA 4D3FA 1ADBA 1UZUA 2FG7C 4V3BA 3M49A 3LZ6A 4RIIA 4K6KA 3ZE6A 2WQ6A 3MF4A 4HV4A 5BOSA 1K75A 2VNHA 1B0ZA 1DC8A 2P6OA 4DR3B 1MJGA 1YCGA 5JE8A 1X8JA 3QUBA 3JQRA 4FMDF 5JZOA 3U56A 4DABA 4O02B 4QQNA 3ZHUA 2AFIE 1MRSA 2QN8A 1OIWA 1ADCA 1Q15A 2VSFA 2XDAA 3B1VA 4NOMA 3Q3HA 2JAPA 4GD3Q 1DEOA 1NBMD 3UMSA 2EF0A 1D9ZA 2PXHA 3NNDA 1XZDA 4L72A 4OH7A 3L8DA 4XEHA 1KQOA 5DLPA 3FUCA 3TIGA 4DVGA 3DXZA 3NETA 4DRZA 5KOJA 2PYZA 2X0JA 1E1YA 2FF5A 4FE7A 4MGKR 2J4FA 4GIBA 3A4VA 5SV2A 3VPSA 4MUNA 3JQFC 1R6TA 1DAIA 1IHUA 1PZFA 2FOIA 3CLRD 1H0KA 2H2WA 5BNIA 5LMNB 3NDBB 4EJMA 2WV9A 3EGDB 4BMOB 4WXEA 2Q27A 3GFBA 3HC7A 1XT6A 4EW2A 2ODWA 3ZE2B 1YXMA 2WU3A 2DJ5A 3IHWA 1HQKA 3L4EA 1GADO 3L8FA 3ZWBA 1LBTA 1TK3A 1J21A 1ZNZA 4IXWA 4O1IA 2ZLBA 1T5DX 5HJ2A 2B83A 2ZYRA 3SIPA 2VT3A 1AKEA 3CH5A 3F5DA 2DY1A 3G89A 4G09A 3ENVA 2C2XA 4LOLA 4N6OA 3D7KA 4P3PA 5DNAA 3ZCUA 2PUVA 3WLEA 4OLBA 3FN4A 2G5GX 3MJFA 1Q0RA 5D1NA 1YIDA 5EIBD 1P9WA 1QZ3A 4QGFA 5GOZA 3P4XA 4I4NA 3A6FA 2HRBA 4Y1RA 2BYTA 2FWBA 1TF2A 1EUCB 1ZICA 5M5BA 2HCRA 3USCS 3ZWYA 3PF8A 1RZRD 2KPOA 3FSEA 2A1IA 5JJCA 3RVBA 1HX7A 2TECE 3TE7A 2J9GA 1L6RA 4LRUA 5JROA 5EE3A 5B1YA 1UXIA 1R9NA 2IHUA 2NQ8A 1MOPA 3KQPA 2IYZA 4FWBA 5C52B 1EEHA 3K09A 2ZULA 3DUWA 4GMFA 4IDQA 3TSCA 4AJPA 1XZQA 3WL3A 1WLSA 2GTHA 4JR1A 1P2VA 3LC1O 2HK6A 2Y2VA 4Q00A 5ITSA 2Z4TA 4HLUC 3U13A 1PV4A 1K7FB 3RAJA 3DB1A 4BNLA 3P0IA 3B2QA 4PHCA 1GTVA 1G2OA 3PPYA 5DRYA 1TCCA 3QBJA 1PR4A 3CGGA 1IZ7A 1Y4UA 1JHDA 4BNYA 2FZ4A 2NMVA 3ZU2A 4F72A 3SN6A 5IXSA 5HCUA 5A3VA 1LQUA 3OIYA 5L45A 2A0WA 4ALMA 2ID9A 1AHHA 2LXNA 1V0JA 3OEHA 1Q0SA 4EARA 3LKVA 3HEBA 3VOSA 4KO8A 4U7FA 3JWPA 1ECPA 2OG2A 5L6LB 1D09A 2JKZA 1G5RA 2CXQA 3TD9A 2ETVA 3U3XA 3ZWAA 1I51A 4Q5IA 4AUEA 4C6TA 1JYFA 2P9BA 1U1FA 1PX2A 3QVMA 4IDDA 4IBOA 4R8MA 4ESEA 2X3FA 4MCJA 3W6ZA 1E5TA 5LD2C 4PF1A 2ECOA 4F3YA 1TC2A 4B3FX 2VHEA 3F6EX 4L73A 5DSZA 4RM2A 4GQIA 2NSJA 3ROFA 3BGWA 1A1VA 3UH1A 2CE2X 4LXIA 1QZUA 1T9KA 3R7LA 4WMLA 1D6SA 1N6LA 3JD0A 4CM4A 1FS4A 2G28A 5FQNA 2O3SA 5CHEA 3VISA 2J6HA 3WGUA 4H0CA 4K88A 4EHAA 4MAFA 5I3CA 3KPVA 3ZV5A 2B36A 3I8OA 1GQQA 4LOKA 3THYA 5HIAA 2D1RA 3RTGA 4LK3A 4FKMA 4C3ZA 1HDIA 1XMIA 4Y7CA 2BFBB 4IX9A 4G37A 1LX6A 4KQEA 1TJPB 5DGTA 1K89A 1VLZA 2VT7A 3F9IA 3IQWA 4GW3A 1DMRA 1H69A 4TQAA 4WZBE 4EYGA 2OPBA 2EJVA 3RSLA 4R8KA 5ESXA 1BEEA 1WR8A 1Y3DE 3FYUA 1CZLA 4MQFA 4R01A 3MXTA 3DDUA 3K0CC 3T4PA 3COJA 2VXCA 5IFKA 4DA7A 1NUPA 3CZMA 3GHHA 5CCXA 2O2JA 3CURA 4ES6A 4KXFB 1NHWA 5T5QA 5IAEA 4FCTA 3AEYA 4W7SA 1I9GA 3G82C 4RA6A 4Y9UA 4YT4A 5EXXA 2ISQA 4DG8A 3DDSA 1UZAA 4NQRA 2WWWA 3D6HA 3DZKA 5ELLA 1XZMA 3TTWA 1ZPDA 2PS0A 4D45A 1Z8HA 1QB8A 4R81A 4MARA 4Z1MA 1SXPA 4RIHA 2KLHA 3AQIA 2P9ZA 2X5NA 3EQ7A 3R3SA 4ND8B 3PG5A 3ZYZA 5JQWA 4FGSA 1NW7A 1J0DA 2FMFA 1P2TA 4G5OA 1TPYA 4J0GA 4JLVA 1YRBA 5J59A 4RNDB 3FHTA 4IDHA 4L27A 1WDTA 3BMOB 4QLBA 1SUDA 1EVKA 5C32A 3N8HA 1XDSA 1MH9A 3DGEC 4D0SA 2ZG6A 3G49A 5DX8A 3PQCA 3BE6A 3ZHRA 2DHQA 1BJTA 4UHCA 4JQYA 4BMSA 1BDMA 3MINB 4QQFA 3M1AA 2G71A 1P3JA 2O6HA 2R8OA 3MB5A 4I3GA 4LDPA 3BCSA 1H05A 2D06A 2G82A 3SYKA 1OKKA 4CRWB 4D8UA 1DJQA 5IBRA 5KOYA 4MVJI 1PJCA 1ENZA 1H9BA 2DHDA 3RK0A 4YDHB 3FPJA 3K0FA 2IT1A 4UVIA 4ZGWA 4UJ3A 2DYKA 1E5QA 3AGQA 4L07A 1LRJA 3IIKA 1ZSVA 1QP8A 4LNUB 2O8BA 3O7WA 1YE8A 1II0A 4M7RA 1NXWA 3A28A 1Z6PA 1MG5A 4GUDA 3KAJA 3DXFA 2XE8A 2VQFB 4DIKA 1QH8A 2G1JA 4R98A 1SZCA 2B78A 5B3LA 1