3D0KA

Crystal structure of the lpqc, poly(3-hydroxybutyrate) depolymerase from bordetella parapertussis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
287
Chain Sequence
b'DLTNADRIALELGHAGRNAIPYLDNADRPFTLNTYRPYGYTPDRPVVVVQHGVLRNGADYRDFWIPAADRHKLLIVAPTFSDEIWPGVESYNNGRAFTAAGNPRHVDGWTYALVARVLANIRAAEIADCEQVYLFGHSAGGQFVHRLMSSQPHAPFHAVTAANPGWYTLPTFEHRFPEGLDGVGLTEDHLARLLAYPMTILAGDQDIATPNLPSEPAALRQGPHRYARARHYYEAGQRAAAQRGLPFGWQLQVVPGIGHDGQAMSQVCASLWFDGRMPDAAELARLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative poly(3-hydroxybutyrate) depolymerase LpqC
publication title Crystal Structure of the LpqC, Poly(3-hydroxybutyrate) Depolymerase from Bordetella parapertussis.
rcsb
source organism Bordetella parapertussis 12822
molecule tags Hydrolase
total genus 90
structure length 287
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d0kA00
4OYYA 1XLUA 4XWGA 1U8EA 4OB7A 4E14A 4LXHA 1K63A 5K3FB 2QXUA 3QBJA 4Y2UA 1P0QA 5ALDA 1JJBA 1YR2A 1EXWA 1AKNA 3QZUA 3D2BA 3KWFA 2BKLA 5AOBA 5C7YA 1BN6A 3RKSA 1UK8A 4B9AA 2PL5A 2DFPA 3OM8A 4L0CA 3PI6A 2BUCA 4ROTA 3AIMA 2VQ6A 1THGA 1Q0RA 4O08A 3B5EA 1N1MA 3IUNA 4Y2JA 5JARA 3SX4A 4L9AA 1MNAA 4X6YA 4UHFA 4BBZA 4XX1A 1HLGA 4CCYB 1T4MA 4BCCA 5JANA 4QEKA 4TPKA 1W4LA 1FFBA 1CUSA 1G42A 5AM2A 4ETWA 2OAGA 2XI4A 2OCKA 1CLEA 1OILA 2FJ0A 2CB9A 5AK6A 4BCBA 2V98A 1L7QA 1SC9A 2XUGA 5CMLA 2I03A 5LKAA 3PICA 2VAXA 3SC2A 3FLBA 5EHXA 4QWMA 2WHPB 3H2IA 4AN0A 5HK9A 4HZGA 1YAHA 3DCNA 1DT3A 1H2YA 4BC1A 5AIAA 1TRHA 4B80A 4OSEA 4UHCA 2GBCA 1FFEA 2H7YA 2DR0A 3O4GA 3F96A 1LBTA 1B41A 4A5SA 3FYUB 1XRNA 4A16A 5C8VA 4G8CA 1WPXA 3GBSA 4IO0A 3RM3A 3HSSA 3WI7A 1R9MA 3QM1A 5E4YA 3WKEA 5D3ZA 2OQIA 3HXKA 1CUIA 1LPMA 2OCIA 4Q34A 2BUBA 1Y7IA 3V48A 4AN1A 4B82A 4J0CA 2O2GA 2QTBA 1W1IA 3QPDA 3O4IA 3NUZA 4FLMA 4CCYA 1E3QA 1XQXA 1FFDA 1VE6A 3AZOA 4FDMA 4BYMA 2XMCA 2RGUA 1CRLA 5T4FA 1MAAA 3C70A 2WFZA 5CT6A 3I2KA 1L7RA 2W6CX 5IVIA 3QH4A 3TJMA 3WMRA 5J3JA 5ALKA 3C8DA 4LXIA 4LKOA 2WFLA 1DX6A 4J3JA 3DS8A 4HXFB 2WHPA 1QIDA 2HDWA 5FDFA 1UK7A 1ETHA 5E4JA 2QZPA 1XRLA 4BZWA 3FSGA 4H18A 4U2FA 5FKJA 3DOIA 4UPDA 3AZQA 3KDAA 2ZVDA 2H7XA 2QRUA 1MX1A 3STTA 5FUMA 1XZEA 4RPCA 3G0BA 3LCRA 3WIBA 3DYVA 4QE3A 1CQWA 4C6HA 3GFFA 4Y2PA 3I2GA 2WFMA 2B4KA 5DLPA 3OC0A 3ILSA 3IB3A 2XUOA 2UZ0A 1IUNA 1NX9A 2CKMA 1IMJA 4OD0A 1C7JA 1H22A 5CH3A 2DQYA 3W9UA 5AI5A 3KD2A 5AOCA 4BVJA 5A7HA 4FLEA 2YXPX 2WIKA 3A6ZA 4W1PA 1YAJA 2FJPA 4C01A 2XMQA 3HI4A 1WB4A 5CRIA 1OXMA 2WHRA 5A2GA 2AJBA 3R3VA 1UWCA 1TCBA 1SFRA 3BF8A 2XDWA 5HFNA 5AM3A 4X95A 1A8UA 2X5XA 3VVLA 2XQGA 1EI9A 2WIFA 1IUOA 3U1TA 3VXKA 2Y2VA 5AM0A 2ZJ6A 4EB0A 4Q1VA 3FWHA 1B6GA 1RP1A 1GPLA 3BF7A 4ARBA 1XKLA 3QYJA 2RHWA 1G66A 2PSHA 4BVKA 4INZA 2BJHA 1CUVA 3IUJA 3FNBA 3G0DA 1U4NA 5ISMA 1LPPA 3WLAA 2RI6A 5CT5A 3F8SA 5HQ3B 4MWSA 5BV7A 4ZI5A 4JYMA 3E3AA 4UBIA 3I28A 3WK8A 5AI9A 4ZXFA 3KXPA 4ZREA 2BFNA 5CT4A 4AMYA 3F9CA 3D4LA 2JGLA 4W1QA 3DDUA 3N0TA 5LZ8A 4H7EA 1M33A 3WJ2A 3NOXA 3D59A 1CV2A 1XLVA 1BU8A 5AK5A 4P08A 1BN7A 4ARAA 4E15A 1BE0A 5EIEA 3W2TA 3OURA 4IHAA 2VATA 3LIPA 1XRQA 4J0KA 5JZSA 5JYCA 4B84A 1YS2X 5LZ5A 4FTWA 3H04A 4W1SA 1X2EA 2XUDA 4LHEA 3HYSA 2IIVA 4BP8A 5JADA 4UHHA 5H3HA 3CN7A 2WQZA 1MX9A 1VLQA 3SWWA 4G9EA 4MWTA 5IVDA 4DNPA 3R3XA 3H2HA 3HABA 5C8XA 4GHWA 2JGEA 3F67A 2PBLA 4MYDA 1ODSA 2HA3A 2XUJA 1CUUA 4W63A 2J4CA 3STXA 3I1YA 1JKMA 5HQ3A 1QIFA 1P0PA 3QPAA 1C4XA 3FCYA 4QDXA 4Y2RA 5ALMA 2AXEA 4K6GA 3MGAA 3ESCA 3O95A 2WM2A 3R3ZA 3F97A 1U2EA 4OB8A 5ESRA 3WK7A 4MQLA 4AZ0A 1TIBA 2CMFA 1CVLA 4LYDA 4F60A 3PF9A 5ALHA 3WWEA 4Q3LA 1BRTA 4YPVA 1XZAA 3MUNA 1CEXA 5FRDA 3V1KA 3D7RA 4KACA 4X92A 2QUBA 4AB1A 4ZV9A 4MEBA 3R0VA 3FVTA 3A2NA 2XUIA 2QXTA 2XUAA 3G9ZA 3VVMA 5BOVA 4BCDA 3UUEA 2CJPA 2WSLA 4KE6A 3RLIA 2XUKA 1CUFA 1PJAA 1QGED 5AJHA 1GQSA 1HDEA 3IA2A 5ALVA 4PV7A 4B81A 5IVHA 4PO3X 3H17A 1O6GA 5F4ZA 1K5PA 2WIDA 3Q8WA 1EDEA 1QIKA 4JYPA 3LLCA 5DNWA 1X70A 1QO7A 2WU4A 1CUJA 1KEZA 4GI1A 3HJUA 4QDOA 1CUAA 5HF9A 2O7RA 3TRDA 1WPRA 3UMJA 3IIIA 4GEGA 2QOEA 2WUFA 3WKCA 4Y9SA 2XQFA 4Q3KA 1VA5A 1ORWA 1QIMA 1BROA 2HM7A 3M81A 3PFCA 3I2FA 1JU3A 4BRSA 4EY6A 2X8BA 1X2BA 1XQVA 4QDTA 5KBYA 2WTNA 2IITA 2Z5GA 4DIUA 1CFJA 1MT3A 4PSDA 3OOSA 4Y2QA 2ONCA 4CFSA 2ZYRA 3AJAA 4I3FA 3STVA 4CIAA 4GECA 2B61A 2JGJA 1EINA 3VDXA 4HTAA 4C4XA 3WK4A 4QA9A 3K6KA 1MNQA 2C5GA 5EHNA 1MAHA 4X3CA 3O4JA 1EH5A 3C5VA 1S8OA 2K2QB 4UBMA 3E1GA 3EQ8A 1USWA 5JD6A 2ORYA 5AK4A 3NGMA 3VJMA 3H1BA 3D3NA 5HCUA 2HRRA 2XUHA 2PX6A 1CUCA 5AKHA 3ZV7A 5EIAA 2JIDA 1JU4A 1XZMA 5JD4A 3E4DA 5BWCA 4W9RA 4MYSA 1AC5A 3JW8A 4C4YA 3STUA 1DTEA 3AZPA 5DYYA 2XLBA 3WK9A 1ZIYA 1VZ3A 2JEYA 2XLCA 4G1FA 5LIPA 2WIGA 1DWPA 4QLAA 2OGSA 2PVSA 4J0HA 1GKLA 2Z8ZA 1LPNA 3LP5A 4GDMA 4DNQA 3UUFA 2Y6UA 2XMZA 1XZDA 3STWA 4DSZA 1UFOA 3H1AA 4FBLA 5D7BA 2HADA 2VT7A 1CUXA 3HRHA 5IKXA 1YASA 3VKFA 1MX5A 1XLWA 4J7AA 3FOBA 3F98A 3T4UA 1ODCA 5K3AA 1ZD4A 1F0PA 2FUKA 1LZKA 2XMGA 5CXXA 3DYIA 3KSRA 2OAEA 5AM4A 1FSSA 4X71A 4UBNA 2WHQA 1SCIA 5ALOA 5K3FA 3STYA 1E66A 4FFWA 5ALIA 1TQHA 3GUUA 1R1DA 4BAUA 4X6XA 1VOTA 1K8QA 3G7NA 1BCSA 2WG1A 2G5PA 4BAGA 2WJ3A 4CI9A 2Z3WA 3WK5A 1LPBB 5AKZA 2BGRA 2YASA 1JT2A 4P9NA 3C6YA 4JNCA 1GGVA 2WILA 2HA5A 1EVQA 3I6MA 5AKXA 5ALSA 1E8DA 1TCAA 4EY5A 1R3DA 1QOZA 2XQIA 1T2NA 1HKHA 1LPSA 2HHAA 4X00A 1ZICA 3WL8A 3DJYA 2RONA 1CUBA 3O9MA 1ZIXA 3I2JA 4J0GA 4G8BA 4IQ4A 1XRRA 3DD5A 4BRZA 3G9UA 4BP9A 5AI8A 2HA4A 2HU7A 2J4FA 3S2ZA 4BTLA 1MTZA 3I2IA 3N2ZB 1TAHA 4H7DA 5CH5A 3P2MA 1ISPA 4LYEA 4X7BA 1K4YA 1J1IA 4N5IX 4AO7A 1GT6A 4FNMA 4KAFA 1XFDA 1XKTA 5HF5A 1G5FA 5AICA 3H18A 5FPQA 2JBWA 5JAHA 5EFZA 4GXNA 3L1HA 4X97A 3V1MA 3MUOA 2EDAA 1ZGBA 1QFMA 3FYUA 2GYVA 2Q0XA 3WL6A 4DTCA 3EIOA 3C8HA 1EK2A 2WJ4A 4K2AA 4H7IA 4AQDA 4PSCA 4WFIA 5T4EA 4E11A 3O4HA 4C88A 3WL7A 3DEAA 3CCCA 3IUMA 4FBMA 3WA6A 3FYUC 4DGQA 3KOOA 2DCMA 3QVMA 4YK7A 5T4BA 4X85A 1BCRA 5AM5A 4OUKX 4QDUA 5FPPA 3R41A 2QT9A 2C5FA 3G0IA 5AIBA 5AKJA 5DTJA 2OCLA 2HA6A 3WWOA 4FNGA 3C45A 1OCEA 4PSUA 5A71A 2BCEA 3BJRA 1HPLA 4I4CA 2OPHA 4B0PA 1JJFA 3LS2A 2XMBA 1WCYA 1R4ZA 2VT6A 1Q0ZA 1MN6A 2HRQA 1QTIA 1YCDA 5D3KA 2XUQA 5CBKA 4B7ZA 4QDZA 1QO9A 4KRXA 1IUPA 3PF8A 3ZLVA 3IBTA 4N8SA 4BZZA 4WDRA 1XZIA 1ZJ5A 3IDAA 4OYLA 3M83A 3R3UA 1UK9A 5CTAA 3WWCA 2HA2A 5AP9A 4M0EA 1Q84A 4JH0A 5AKIA 3G8YA 3WQHA 2XMRA 5ALQA 2HA0A 1I6WA 1XRPA 3VJKA 5AKEA 2BGNA 3DNMA 4C89A 3TEJA 2P8SA 1FJ2A 4P92A 1CQZA 1A8SA 3ESBA 2HU5A 4H35A 1H2ZA 2VAVA 2QM0A 3DLTA 3LIIA 3I6ZA 1U65A 5JAUA 2DHDA 5SYNA 4AXBA 3E0XA 4J03A 1ORVA 2WUDA 4UHEA 4KRYA 2LIPA 2Y2UA 2XUFA 5A6VA 1WHTA 2ZJFA 1F0NA 2G5TA 4OPMA 1DX4A 4U2CA 1N5MA 2CBGA 5LZ4A 5FV4A 2AJLI 1R9NA 2QVBA 2QKYA 4UBKA 3WWPA 1ZOIA 1UK6A 5ALRA 5K3BA 1Z68A 2WG0A 3T52A 2QS9A 1XQWA 3ESAA 2GBIA 4Q05A 4K6KA 4Y2SA 4Y2VA 3H2GA 3GROA 5LZ2A 4UFPA 4Y2YA 4NMWA 1QIHA 4BATA 1KU0A 1PFQA 4UFOA 3HZOA 4ITVA 3BDIA 3GZJA 2VA9A 1GPNA 1BS9A 3WKDA 5HF8A 1DU4A 3AILA 3I2HA 4HVTA 2RAUA 3FYTA 2V96A 1THTA 1J07A 4RE5A 1UKCA 4MEAA 3X3HA 4MQMA 4U2EA 4CG3A 1G4HA 3C43A 3ICVA 5LKRA 1ZI9A 4QWWA 1AZWA 3A2MA 3A70A 2V97A 2ES4A 1QFSA 2GYUA 3M3DA 5A7GA 4BC0A 1UZAA 1UOPA 4V2IA 2HFJA 1EX9A 1ODTC 3I1IA 3PUHA 5AM1A 4WCVA 1UKAA 5JASA 2GYWA 1QJ4A 4G9GA 3OPMA 1DWOA 4UFNA 1GXSA 1WOMA 2GBGA 3IUQA 3ANSA 4CCWA 3WA7A 2O2IA 2ZYIA 5JD5A 1GZ7A 1LPOA 4Y7DA 3R3YA 5EGNA 5A7FA 2I3ZA 1VA4A 1LBSA 3ESDA 3O9VA 4EY4A 3CN9A 2XE4A 3G0GA 2J3DA 2ZYSA 5JZ9A 4NZZA 2CZQA 1JMYA 4GBGA 2ACEA 2PUHA 1QIEA 1EB8A 3K9BA 1WB6A 5JALA 4YASA 1Y37A 5JIBA 1W75A 5HK8A 4AO8A 2WG2A 4ZV7A 4E46A 2B20A 2QJRA 1ACLA 3VISA 3IVMA 2PSJA 2GZRA 4UBOA 4H77A 1JJIA 4H7JA 5DJ5A 4J0IA 4OCZA 1QLWA 2QJWA 3G9TA 1MJ5A 3D2CA 4IH9A 4HXEB 5IH7A 4KE7A 1EDBA 3SK0A 3G0CA 1BEEA 3W04A 4BB0A 4B6GA 4RE6A 3WKBA 2Y1KA 5DTIA 2O7VA 1GKKA 2JF0A 5LLSA 1Y7HA 2G63A 1E89A 5I7UA 3TGLA 4OB6A 4EHBA 4WFKA 4KE9A 4XVCA 1XZKA 1UOQA 2Z3ZA 3HC7A 3BDVA 5KWIA 3C5WP 2FX5A 5AO9A 3G02A 3FAKA 1VKHA 3AUKA 5ALXA 3BE8A 2VJAA 1VJ5A 3OTQA 1XZLA 1IZ7A 1QIIA 2WUGA 3V1NA 4EBBA 1QTRA 1W6RA 3DKKA 2BUAA 2DHCA 2VF2A 1GPKA 1AGYA 7YASA 3A2LA 3YASA 5A62A 4G8DA 4UBJA 1MO2A 1MPXA 1EVEA 1ZJ4A 1XRMA 3PDCA 4DMCA 2C0QA 4FFVA 3WIOA 4F5ZA 5K3DA 3AIKA 4PQEA 1TK3A 2ZYHA 3ED1A 5ALFA 3BXPA 1DQYA 1QIGA 1XZFA 4DLNA 4GLBA 1HL7A 2JGKA 2EEPA 4BDSA 1H2WA 4RGYA 1CUGA 4FHZA 4GWLA 4LIPD 1VE7A 4B9EA 2VJCA 2O2HA 3EQ7A 2RHTA 2PM8A 4WDQA 5IVKA 1DQZA 4G5XA 4KAJA 1TCCA 1EDDA 2DHEA 4HS9A 5JAOA 1LZLA 1VZ2A 3BWXA 1W52X 1ZD2P 4MXDA 4CG1A 4DMFA 3GELA 5HF6A 2DSNA 5FOQA 1KU6A 3M82A 3IURA 5FLKA 4KAAA 1P0IA 2Y6VA 3O0DA 3ZLUA 3WWDA 4CIBA 5LP1A 5C8ZA 1MU0A 1R88A 4UHDA 1RYYA 1K6EA 2C7BA 2Z8XA 4HRXA 3WYDA 2WFLB 4PW0A 4B85A 4IH4A 4G4JA 2PU5A 2WLSA 4ZRDA 3IULA 3ZWQA 1GQRA 1W76A 3HLKA 5LZ9A 2PSFA 5DYWA 3U0VA 4J0JA 4WY5A 3DKRA 1BEZA 1P0MA 3PUIA 3QITA 1F8UA 4B0OA 1N5RA 4H7KA 3JYHA 3H19A 4P93A 3BJMA 2QMQA 2PPLA 5AI0A 3GA7A 4MJ3A 1E5TA 5SYMA 2I3DA 4D9JA 1SCKA 4QNNA 1XZJA 4F21A 2WKWA 2YYSA 2OGZA 5ALGA 1FFCA 2ZJ7A 2R8BA 1XROA 4G4IA 1XQYA 5ALPA 4WY8A 3BIXA 3G9XA 2W22A 5CXUA 4K6HA 3FSGD 2H7CA 4EZIA 2GZSA 3BIWA 4OU5A 1AURA 3ZLTA 1JI3A 4KE8A 2GBFA 3WL5A 1YB6A 2OXEA 5AKGA 1A8QA 2PUJA 2HFKA 3L1IA 3ZI7A 3H0CA 1J06A 5ALZA 5KWJA 5AKKA 2DQZA 4KYVA 5FXMA 1XZCA 4BAZA 4X94A 3VJLA 2XB6A 5AH0A 1PV1A 4Y2TA 4N8DA 3V9AA 5CW2A 1QONA 4NS4A 4Q3OA 5LZ7A 2CEKA 1RWQA 1ZGCA 3FLAA 4C4ZA 1FFAA 2XT0A 3ICWA 1UKBA 5YASA 1WHSA 5ALWA 1CPYA 4L72A 4EUSA 5DNUA 2NW6A 3AINA 3DOHA 4H0CA 5CT9A 1AQLA 2QUAA 1YA4A 2XQKA 4PF1A 2WJ6A 1QZ3A 1YB7A 2D5LA 3C6ZA 5CURA 1ZI6A 4OU4A 3C87A 3CCBA 1QIJA 5C81A 4QZVA 2XUPA 3RARA 2JEZA 3W06A 2JGMA 3L1JA 5AI4A 5EIHA 4AX4A 2VSQA 1LGYA 4U2BA 3I6YA 4GW3A 1QE3A 3ZPXA 3WKAA 3BL8A 2VJBA 2WUEA 4DMKA 5AKLA 4Y2XA 1E8NA 5EHQA 4QLOA 3C6XA 4IH1A 4X6UA 4I19A 4N5HX 1XZHA 2AJDA 3EF3A 1WB5A 2OGTA 4S0XA 3WYNA 3K2IA 1XZGA 5JAPA 3QMVA 2G4LA 1YS1X 4U2GA 2PSDA 5ALLA 4EY7A 1CUHA 3H2JA 4WJLA 4XJVA 3WZMA 1UOOA 5BWBA 5EI5A 2D0DA 1ZI8A 4UHBA 2C58A 4C87A 4LXGA 4RNCA 5CH8A 4FMPA 4X93A 4DMHA 1DINA 5KREA 4FLFA 5AK3A 4DYHA 1DWQA 4JUIA 4Q82A 3ANTA 1LLFA 1YSCA 1CUEA 5D6OA 5AI6A 1VXRA 4AO6A 3FCXA 2BAGA 4CG2A 4JEIA 5LYYA 3B3QA 6YASA 2WTMA 4W1RA 3D2AA 4Z49A 1WM1A 3KWJA 1F6WA 4G4GA 4J0DA 5DYTA 4U2DA 2EDCA 3B12A 4FKBA 2AJCA 3R3WA 4L3WA 2PKYX 1R50A 1JFRA 4FWBA 3DL4A 3QMMA 4BDTA 1ZD5A 4DSAA 1YA8A 2PU7A 3R40A 1H23A 5E2IA 2XMDA 5K3EA 1VXOA 4BE4A 1AMNA 3PFBA 3FLEA 2OLEA 5K3CA 3PE6A 4DNOA 1SCQA 4YX9A 4UBLA 3H2KA 1UXOA 3WZLA 2IX9A 3FBWA 1N8SA 1TKRA 2ACKA 2ECFA 2C0PA 5I8PA 4NVRA 5JZBA 4X90A 4XIIA 1AUOA 1CIJA 1J2EA 4KEAA 2YH2A 5DNVA 3S8YA 2VEOA 4UUQA 5ALEA 4X91A 4ZWNA 5AHXA 4EY8A 1LNSA 4FOLA 5HKAA 1H2XA 2HA7A 5ALUA 1CUZA 4WFJA 3QMWA 1DT5A 1NU6A 2HIHA 2H9YA 4M0FA 1IVYA 4H7FA 3D5EA 3MVEA 4AZ3A 2VJDA 2AJ8A 3OG9A 5FP0A 1SOMA 3W05A 5EHZA 3WK6A 4B83A 4BVLA 2RIPA 1ACJA 1CUDA 1E8MA 4A23A 1HBJA 4DM7A 1AX9A 4AMZA 4TGLA 3D0KA 5DWDA 1EB9A 1CUWA 3W9BA 3AFIA 4F0JA 1D07A 3EBLA 4ZGBA 1JMKC 5AOAA 4PNZA 5T4HA 1ZD3A 4DNFA 3HEAA 4BE9A 3RK4A 4KR0A 3WJ1A 1A88A 2ZSIA 2V9ZA 3CXUA 1L7AA 2X76A 4HXGA 2H1IA 2WIJA 2XMSA 2HL6A 2HU8A 2C4HA 2PSEA 3V1LA 2ROQA 5AKYA 3FVRA 2OQVA 2WU3A 2E3JA 5ALTA 2VTVA 3AIOA 5CT8A 4H7HA 3QPCA 2R11A 5ALNA 4BTVA 5E4TA 5HZGA 4N8EA 3DL7A 5JATA 2B9VA 2CUTA 1C7IA 2XQJA 5I9IA 1EK1A 1CR6A 4HRYA 1IZ8A 4M0MA 2OG1A 2OCGA 1HQDA 3NWOA 1UT6A 1NU8A 4K5QA 2JGFA 3EQ9A 2J3QA 1LPAB 3JWEA 2I78A 5HFAA 1Q83A 5ALJA 1CUYA 3HACA 1A7UA 2ZSHA 4EA6A 1EA5A 4TVKA 3DQZA 1EHYA 2QR5A 5K5EA 3Q0TA 4KJXA 1XZBA 5ALYA 2JGIA 5HKBA 4HAIA 1O6FA 3C6BA
chains in the Genus database with same CATH superfamily
4KVGA 4LSZA 2ATVA 2Q1TA 1QHHB 1BU5A 3A04A 3AFOA 1K06A 1TA0A 1VHDA 2HGZA 3DE4X 4I9HA 4JLUA 3IP7A 4E12A 5DM1A 3GRPA 5ULLA 5GVRA 2O7SA 3H1GA 3ZDXB 2QXUA 2I8AA 3BREA 3REFA 2JHAA 4MCHA 3JAWA 4ZCQA 1P0QA 3LY9A 5BNFA 1EFDN 3A6PC 1JG1A 2UXDB 1LEHA 1NI4B 1J49A 1V1MA 2QMHA 3GAAA 1NHWA 2AMJA 4ZOCA 5ALDA 1EWVA 1SUPA 5JS1A 2NU6A 1EXWA 1TO2E 1YQTA 2DTEA 5IBCA 3V8QA 3P52A 2VZ9A 4Y98A 5FHRA 2FPKA 2W6PA 1Z4MA 3EEFA 3VR3D 3W8RA 3ZD7A 2WF9A 3CUSA 2H59A 1UDWA 1V47A 4B73A 3SXUB 2IVFA 1AQUA 1W1WA 3C3EA 6ABPA 2X3YA 1N32B 4J9VA 1NPTO 5F9FA 2QMUA 4L07A 2ZYGA 4LSGA 3KIPA 3FROA 5FB3A 3SZMA 2V6MA 3LAWA 4BBAA 2LV8A 3PUVA 4BVGA 5JWHA 4F5YA 1X7XB 1ZOPA 2C88A 2DFPA 3PKZA 3SHWA 4D3DA 1K7YA 4ROTA 3ZI4A 3LLSA 4CV0A 1R0ZA 1ZVQA 2O3UA 1D2MA 1V7CA 5KJEA 4J6FA 1NUUA 1Q0RA 2G25A 4MZXA 5CNMA 4EP1A 4IWYA 2ATCA 2IYUA 4ZVQA 4C6RA 3B5EA 1UPBA 2EGUA 4ZOLF 4XCQA 1DC5A 3LO8A 1YB4A 3M5CA 1XKXA 3RYFB 4DV5B 2W6QA 3C74A 4TKUA 3MJTA 1UM9B 4OHMA 5EJ2A 2E4XA 1WSBA 1ZCZA 1KQOA 3DEKA 3R5SA 2ODPA 4PRLA 4BBZA 5CAEA 3GLSA 3NJ4A 4U7JA 4COOA 4PAMA 4XX1A 4ZHQA 4EWLA 2AGVA 3A3KA 5C5IA 1RQXA 2FHSA 5F2OA 5U1PA 4Q3DA 5DW3A 1GCIA 4BCCA 4TPKA 3GMSA 2VWQA 4I66A 2IH5A 3B1WA 3PNPA 1FFBA 1ZBQA 4GGMX 3UHOA 2FQQA 3OIDA 5JQGA 2DMRA 4KW7A 4NJEA 1YE5A 2OAGA 2XI4A 1NR1A 4ESHA 1P7ZA 4E94A 3H0KA 2HRCA 1SBHA 3FPJA 4HWSA 3FCCA 3E7WA 3NMUF 1Z5PA 5AK6A 2X0IA 3VU1A 2V98A 3DHVA 4FEEA 3VHLB 2W2KB 4A0HA 2C4TA 4MQ4A 3CIFA 5A3RA 1SC9A 4OMFG 1KR5A 1O95C 5LKAA 3HS3A 5DO9A 2HLHA 2VAXA 3NFYA 2R3SA 3U4CA 1GL3A 3V3KA 4L6AA 1BVHA 5B3LA 1NLMA 1QANA 4NBRA 4Q1FA 3GLGB 4H6XA 1YAHA 5DT2A 4YXFA 2Z09A 2BFFB 2C2YA 3L7DA 4N5LA 5I7OA 4U3JB 1P45A 1Q7RA 4NESA 2QVLA 2YXEA 3GDFA 5L4NA 3MUEA 5LU8A 1SVIA 4G5YA 5B6PA 3CH4B 2GN2A 1YUBA 2IS1A 4XPZA 2GXUA 1YBVA 3RV4A 4LOHA 2F1IA 2R1TB 1GIAA 3H4TA 4HJXA 2W2OA 3SF8A 4C4AA 2XOKD 4PO8A 3LHIA 1E1QA 1KO5A 1RBZA 1U28C 4OVKA 1UEJA 1T8SA 3TNDA 1QCYA 5ADWA 2GZAA 5JT1A 3F96A 4X20A 1T8UA 3IUPA 3ZQ6A 5L3SB 3OI7A 3W8DA 2NO4A 1NULA 3AY0A 3F3YA 4RLHA 1XTKA 2DB3A 1DFGA 1XRNA 4R1SA 4CKEB 5C8VA 1JEDA 2XA1A 3FMPB 3IJEB 4YRCA 4NF2A 5IAAA 1ND6A 1Z4KA 2GZMA 4CYMA 4F4FA 1O58A 2VK2A 1NLUA 2ZLBA 3HSSA 5KZMB 2CMHA 1LJLA 1FW8A 3HA2A 3PXAA 1RLIA 3HFGA 5AVYA 1CQJA 4FDVA 2FPPA 3IAUA 2B92A 4IDQA 3IELA 5JAMA 2OHGA 4M1MA 1X1QA 2Q50A 1JJVA 2XKKA 1LQUA 2RHOA 3GCDA 1QHXA 4FMDF 3AFGA 3ULKA 3TZLA 2LGJA 4Q34A 4JBYA 5J58A 1E5QA 3NS7A 1U0EA 1DC7A 2PGJA 1Y7IA 4AN1A 1ETUA 5DWVA 1Z5OA 4LY6A 1R4NB 4J0CA 3UF0A 2PKWA 5JC8A 1GM5A 4A8JA 3RFVA 1KVQA 3FDJA 5J23A 1W1IA 3SC6A 2O1SA 3TSCA 5IJAA 1IAVA 3D8BA 4OAPA 4BEJA 2WWYA 2DF8A 3KKKA 2IW3A 5BYBA 3ZV5A 2DH6A 4WSOA 3FDXA 3HCWA 3MB8A 3QG5A 4BIMA 4Q1CA 5AUPB 4CCYA 3EDRA 1JZTA 4X65B 1RHQA 5B4TA 3K1AB 3DZGA 3WHIA 1XQXA 5KU7A 1EAYA 3QF7A 2AMLA 1U99A 3AZOA 4DJAA 2Y27A 1OKKA 1PDOA 2Z58A 3DOFA 4YAKA 1Y6FA 1GD1O 2GD6A 3O4RA 4GOXA 4QBTA 1K3FA 2DBRA 2POQX 1NUTA 4OXKA 5E4FA 4Z4CA 4Z1MD 5KTKA 1CQIA 4G63A 4H0FA 4NPHA 1O6BA 3NO4A 1X9GA 5T4FA 2IH2A 3LW8A 4NL4H 2JFYA 1WRBA 1EPUA 2H8KA 2VJYA 2YY5A 5G0WA 5E6RB 4A73A 4DMGA 1DJNA 1JHMA 2DT5A 4EG4A 1BEUB 3F6SA 3FVWA 1JS1X 3AGPA 1S3FA 3HXTA 3L4SO 4PCLA 3TJMA 5AW2A 2XRFA 2H0AA 1J39A 2EW1A 4Q3AA 2ICAA 3HKBB 5JFGA 3AEQB 4GM0A 1VMEA 4R16A 5ALKA 3C8DA 3U4QB 3B48A 4ZK6A 1IG0A 2R8RA 4WINA 4Y9UA 5G0VA 5ER9A 1ORHA 1ZY2A 3QNWA 1RZUA 1SQ5A 3BXGA 4HXFB 4A0RA 2WHPA 1QIDA 2IHTA 4V03A 1SWVA 2HDWA 2DY1A 5FDFA 3NJRA 1Z74A 2AZTA 2CJXA 3RG2A 2OFOA 5CB6A 4NNPA 5E4JA 5H7XA 1G5IA 4Q5IA 5BWNA 2W6MA 3AVOA 3K0KA 4RPHA 5CLQA 2FOXA 2WR8A 3VV3A 1HT3A 4NDNE 4UPDA 3VVBA 3KDAA 5CCXA 4CLOA 4BKRA 1Y33E 4R2LA 2O7QA 4RVNA 3U3RA 1N9GB 3NOVA 1QAMA 2QRUA 2V7XA 4IKPA 5L9AA 1CQPA 2J9YB 1JEAA 2JLBA 3Q6IA 5FUMA 3IVCA 2WA1A 1E2PA 5JVDA 3T06B 2C9ZA 2BIFA 2O6HA 4H31A 3VPHA 2G5CA 1C0IA 2AFIA 1YU6A 2YVAA 5KWSA 1QQ6A 1FDVA 1RKVA 1CQWA 4CL8A 2IW1A 4PHTA 4C6HA 1BD3A 2ZIFA 3L6RA 5CDGA 2F8TA 2F9MA 5KNDH 4EENA 4YIKA 2RB5A 3HVHA 3OLXA 4LTDA 3PGVA 2V7UA 1A77A 1RIIA 2WOOA 4C08A 3OC0A 1WCIB 4IKEA 3QK7A 1I4OA 3O2SB 3ZE9A 3ICQB 1N78A 2UZ0A 3CX6A 1XKQA 3WOHA 1JX6A 4ZRMA 2CNOA 3A3NA 1NX9A 2G9RA 2CKMA 3RU9A 5JROA 4Q93A 5JPDA 4G0QA 1C7JA 2ZXUA 3DHNA 2VQDA 4J4HA 1O96A 1JDUA 5CBPA 3E8MA 2C3OA 1MR3F 1QP8A 2O2EA 2I6XA 3LPDA 4HRAA 1NSFA 3Q8MA 3DJFA 4CLHA 3KD2A 3L77A 2NN3C 2DUNA 2PV0A 2WF7A 3MGGA 5CW1A 5DK6A 2X86A 5A7HA 4FLEA 4KO4S 1C30B 1H8ED 2EWWA 3EZFA 4WK4B 3PFFA 4LYGA 1DL5A 4YRMA 1KOGA 2VEDA 4W1PA 4DLYA 2X13A 3RWMB 4B6RA 4OXNA 4CTKA 1HT1E 3L43A 1ZWKA 3ODPA 4MMZB 4RPLA 1PYOA 2Z98A 4MO2A 3WLFA 4MV5A 2IDJA 1WB4A 3SHTA 3BD8A 2WHRA 5A2GA 3BXEA 1ZN9A 5B3JA 5HMLA 5FOUA 2AJBA 3BMOA 2ANCA 4RMJA 2EL7A 1SCUA 3H9GA 4G41A 1NQAO 5AJVB 5EKXA 1QFJA 3WV4A 1BC5A 4PLWA 1A8UA 1C1YA 1E0DA 1T35A 4G1CA 4PLTA 2VKQA 3P9KA 3VVLA 2XQGA 4DR7B 1GNQA 2Q9BA 4TWJA 3AK4A 3FNIA 3E9ZA 3VXKA 2R7MA 3OQ6A 2Y2VA 3VAZA 1SVKA 2VXOA 5ICCA 5IPFA 4LVCA 4BWGA 4KTTE 5C4IA 5AXCA 5KPJA 1JV2B 2ZRMA 3LHFA 3L7BA 5K09A 3SBXA 1B6GA 4WIAA 4N6GA 5J40A 2QLBA 3QF4A 1RP1A 3NALA 1UXHA 4Q19A 5KKAA 5LN1A 3DPUA 1PR4A 3BMXA 4ARBA 1GPBA 2RHWA 3PIDA 1V4VA 3VO8A 4A0GA 4BVKA 1WXGA 2WP0A 3RVNA 3PGKA 1OT5A 3MTAA 3HDYA 2WTXA 4LYAA 5DDIP 4D0RA 3LCUA 4ECAA 2YIDA 3L93A 5A2QA 1ABFA 3RVMA 4TTIA 1T2EA 3KLNA 5F1YA 2FPGA 2PUAA 2G0AA 4I50F 1E7MA 1GAWA 4UEQA 2WMNB 3QLJA 1CRWG 1QLHA 2KSQA 4YRSA 4OLAA 2VQEB 1NC3A 1WXXA 4JI7B 4BHTA 4X24A 2IU4A 4FBGA 5BV7A 1GN8A 4YQZA 2P2NA 3EDMA 3ZWNA 4JYMA 4L5YA 1EFVA 4YUXA 3THXA 4LJAA 2VXBA 1O9HA 5KKCA 5HQTA 1NM5C 1R0RE 5JWOA 1WVGA 3E3AA 4OHWA 3QPWA 4INAA 1JLSA 3UQZA 3ZGNA 4J0QA 4L76A 4ZVVA 3Q11A 3LTEA 4ES6A 5IJZA 1K97A 3OCJA 5JTTA 3GQVA 4JKYA 4JOSA 4PZZA 4BEBA 5AI9A 3T5CA 3K0SA 3FTEA 3B8EA 4GIBA 4GSLA 2ZYUX 2W11A 1XMXA 3P2OA 1PV2A 2FW8A 4UEOA 1SPXA 2BFNA 4RSMA 3UJDA 3HHEA 3SPXA 4J90A 2FW1A 3THWB 2GX6A 3BSWA 3QX8A 4G09A 4I8XA 4Q7JB 4YCDA 1GCGA 4CR7A 2GB4A 3KS9A 1UPTA 2DC1A 4CLDA 1ILEA 1IN4A 2OVBA 4FMCF 2ASVA 2BM0A 4ZVNA 2DVMA 3GVCA 2YXLA 3PHGA 5KWEA 1GAJA 3EDQA 2NPFA 4GE3A 4V1CA 2YIMA 3SS7X 3NXSA 4F5EA 2KLHA 3B9PA 4X1KB 4IL5A 3PWTA 2EKBA 1YF3A 1M33A 2XTNA 3LQ1A 1NG9A 4A82A 4YAEA 3R24A 5BWMA 4M7PA 3RD5A 1TMYA 2VTDA 4BZPA 1O87A 1ZH8A 1JEQA 2RKBA 4D0GA 3V6LA 5TS3A 4DBLC 2FEPA 2NP7A 4OGFA 1IG3A 2EKPA 3PXGA 4DY6A 1PCXA 5AK5A 3N5KA 4KH0A 4NYJQ 4CXMA 3HWWA 3VJRA 4P08A 5LLTA 3OMLA 1BN7A 4G5HA 3ZKWA 3GLHB 4AKSA 4ARAA 4ZAWA 3W2TA 3OURA 2NYRA 2P3LA 4H60A 3SE7A 5HOQA 5LQDA 1AV6A 4B6EA 1JZSA 1EUCA 2IUYA 2MSEB 3ED5A 3IDSA 4FYHA 5JZSA 2QRVB 2QN8A 2P1ZA 4LJ8A 3UK7A 1YS2X 2O0HA 5P21A 2Z1MA 2JAHA 4FTWA 3TOCA 3DO6A 1Q0LA 2IEGA 4MUEA 3NBYC 3WRYC 5ILQA 2DE0X 1UOEA 2GXAA 4Q0MA 3WLNA 1JN0A 6LDHA 4J1QA 1QHSA 3BAZA 1O3YA 5HVNA 3NP7A 2BFPA 1WG8A 1NAIA 3NHJA 1G17A 1XCPA 3O21A 2F3UA 2YQ4A 1QF9A 3G7SA 3FHCB 4P84A 4LRUA 5FX2A 2WQZA 4ME6A 1Z12A 2ZB3A 3W8NA 1XRJA 4YDSA 1BHJA 1FVHA 2ZG6A 3FI0A 4YCJA 1ZCJA 1EG2A 2IYTA 3R3XA 3ZC3A 4DNPA 5DEOA 5C8XA 2EQBA 1LBEA 2JGEA 3F67A 4XCXA 4MV9A 4WBNB 1AXRA 1H1DA 3KZOA 4A8TA 4F91B 3DVLA 1CUUA 2ZANA 5ES3A 2A5YB 4PLPA 4CTOA 5A6SA 1KMHA 2B69A 1H6BA 4E1VA 5HQ3A 1IOLA 1KH2A 1ESDA 1ZUIA 1E62A 2C31A 1QIFA 1MENA 1ZH4A 1Y4ZA 1P0PA 2RAPA 3IAEA 4QU8A 4RV5A 3RSHA 5I9TA 4C3ZA 6Q21A 3QEBZ 3U3JA 2CVPA 5ALMA 1TMGE 3MGAA 4K6GA 3O95A 3Q6MA 3OX1A 1P4SA 1BG6A 3DBOB 3MRTA 4GG1A 4IUBS 4ZOEA 2X8LA 3JPYA 3K9CA 3VFDA 3EZYA 2LD4A 3RVKA 3KEFA 3LWZA 4NBVA 4G1VA 4OL0A 1Z2PX 5H81A 3KE9A 4O2BA 2Y1OA 2WM3A 1RSZA 5IN5A 4YRAA 1KJ9A 4W5QA 4B34A 4AZ0A 1U04A 3DE2X 4LHVA 2BD0A 2JIZA 3D6VA 4EHNA 4EVQA 1X8XA 2GJ4A 3ZCQA 4JC0A 1MC8A 2WWGA 2YMMA 1TJYA 1C9DB 3UJ3X 1IBKB 4MUNA 1PZEA 2ZBRA 4H3VA 2X7HA 3DZKA 4N82A 4UE6A 4DUGD 2XXAB 3Q8XB 1XC7A 2A92A 2ILVA 2PIAA 3ITKA 4HR7A 2ZT5A 2JGDA 4II3A 4F4JA 1KFEB 4YPVA 4ILKA 1CEXA 1XXHA 4BX0A 1K5GA 3WNZA 3A1SA 2IYYA 3GMIA 4GBED 4JJ4A 1A8IA 3U6BA 2OB2A 4YAWA 2WE8A 1PT5A 2JFVA 4X92A 1TD9A 1E7RA 1ZRNA 2A2ZA 3UV3A 3HBNA 4IHKA 4D0LB 1XCGB 3Q41A 3ZBTA 1OY1A 1AGPA 2PA0A 4JJ6A 4V1CI 1G19A 3ZJUA 2WV9A 3TGWA 1KYWA 3HLYA 4N7JA 4ZIRA 5CFQA 4LNHA 4XIJA 1C1HA 2XUIA 5THKA 2QXTA 1N9ZA 3NZEA 2DR3A 2C20A 5TIIA 2XCTB 1RBMA 4OXIA 1LDGA 2EJVA 2HTEA 1J9ZA 3IAXA 2DBQA 5T64A 4A6EA 5DGXA 3RK0A 4BCDA 1JE0A 1KYZA 3UUEA 2VT3A 3DEYX 2WSLA 5CR9A 3CNOA 4KE6A 4YQEA 3B20A 1K8ZB 1WXWA 5C5EA 2GM3A 4G1BA 4PXYA 5I7FA 1QGED 5AJHA 1Y9ZA 1Z2NX 4A36A 4LUCA 2J0QA 3E27A 5LJIA 4CM8A 1IQPA 1FVFA 5ALVA 3WFIA 2O54A 5TPWA 4PV7A 5FAXA 3OX3A 4AU1A 2P2ZA 5LA6A 3M3PA 1ZN8A 4AECA 4AJKA 4ER7A 4EEXA 2ZUVA 1J20A 3A14A 1WWKA 3O03A 3R20A 4HQRA 2NU8B 1X86B 4WESA 1UZMA 1AS0A 2I2DA 4MH0R 2NYVA 3RSCA 1MJFA 2VTKA 4I8DA 1NYRA 4AM8A 3PD1A 3M4YA 2P5TB 3QI7A 1UJ5A 4KO3S 1NOIA 4HEQA 4XQCA 5GZ3A 5DNWA 4AJ9A 1IZ9A 4DIOA 1QO7A 4N12A 3RFUA 1JQBA 2GNPA 3COSA 1K7SN 4QDOA 1YKGA 4EPRA 1VPVA 1W2WB 4IIUA 2LCIA 3OAAD 1MA0A 4ZT5A 2Z08A 2C4NA 3HMQA 5GONB 5AVRA 4XJTA 3MTJA 3TRDA 3G2JA 4TTAA 4JB3A 4J07A 3LT0A 4GEGA 1CJVC 1UMCB 3OOYA 5JJ5A 5K0GA 2V03A 4LZNA 1AUVA 1D4OA 4PSVA 1V5WA 1VE1A 1NUHA 3PGXA 1PR9A 5C53B 4LX0A 3CVUA 1OB5A 3TSYA 2FI1A 3F7MA 4BP1A 3GXOA 5JOQA 3QHQA 2QIPA 2Y77A 4IJWA 3QXXA 4BY9E 4S2UA 3RB8A 1AO3A 2C3UA 3M81A 3MMZA 4JK3A 2J5RA 4JI3B 3U44A 3GGJA 3P9XA 1IWOA 1V1JA 1WD7A 1Y3BE 4OUDB 1HEUA 1Q14A 2IT1A 1FUYB 2W83A 2X8BA 3PDIA 4WKOA 5TGZA 3T3IA 3PE3A 4BRSA 3ZD9A 5AVWA 4HEJA 5JCPA 5JY6A 3K70B 4D92A 4QPPA 1OIVA 1UPFA 3C48A 4Q48A 1BDIA 2OBBA 5IULC 1VSVA 2E4ZA 4RD4A 1IQ0A 1LV7A 3V42A 1UP7A 2HY7A 3T8YA 1YA6A 3AR3A 1XPUA 4H6WA 2BKEA 1VHWA 4GOKA 1U11A 1JAXA 2O4UX 4E2ZA 3DKVA 1Y1QA 3B3JA 1RU3A 1OFUA 4QBGB 3A6JA 2FPIA 1TIPA 4QJ5A 2ZBEA 2C29D 3ZDYB 3EXIA 2DPHA 3DO5A 2BFCB 4MQBA 3PPYA 1Z3IX 2A5DA 4RPIA 1QZXA 5JMTA 4I55F 3AJAA 2RJNA 3IDOA 3UBTA 4ZC1A 5G3ZA 1ZK1A 4CIAA 5HJ5A 1JR3D 1OAOA 2B61A 3KAKA 5D3MB 4BFUA 3AVYA 1Q1ZA 1FU7A 2FW7A 3AUTA 2PTGA 1V41E 4JJFA 2XX3A 2ZAIA 2EJWA 2E4UA 4HC4A 3W5AA 1YRYE 3DB2A 1QFZA 1ECLA 1S0UA 4HTAA 1GRRA 2CHQA 1YJCA 3I83A 3QFRA 4HZIA 3WK4A 5JXWA 3K6KA 2FMTA 2SKCA 4IVQA 1W94A 3GPDG 2C5GA 5LBTA 5KKNB 2ZAGA 4FZ3A 1TVEA 2YY6A 3GRZA 3WLHA 1PSWA 2QQEA 3K8QA 1S8OA 2ZRFA 3EXFB 2TECE 4GM4A 4G1EB 1QS0A 3LZCA 4UBMA 3RAGA 3B1YA 2D13A 4HS4A 5LVAA 1ADFA 3LYAA 3NV7A 4PTLA 4CQMD 4RPJA 3TLZA 2BW0A 1USWA 1EX7A 2WJAA 3AEXA 3EQ8A 3PNMA 4MPPA 4AMBA 5JD6A 2RH5A 4E3WA 1P2UA 3BM5A 1D6SA 5FBRB 1I4WA 3BK1A 4KDCA 3TO5A 1ZU4A 1P1HA 4YI3A 1IZZA 2IWHA 3OBBA 1Z4LA 3C6KA 2ZZMA 4IMIB 1YIOA 2WYOA 4IHQA 2GLTA 1Q50A 2ZQYA 5EFOA 2Q41A 3GCWA 4AULA 5JSZA 5KTRA 1JH9A 4Z54A 2XUHA 1XEFA 3JVIA 4UZFA 1M34A 2W2NA 3OJ0A 5TQ2A 1DHTA 3V7YA 1CJMA 1QG6A 5MN5A 2B94A 2R47A 4FIZA 3TCNA 3KCQA 4B2PA 4X7PA 1FNMA 3GJ8A 4BP9A 3ES9A 3OJWA 3B78A 3GLIA 2QPAA 1QGAA 1JU4A 2BP7A 4JP2A 4F5DA 3W04A 1SOWA 5JD4A 5KTPA 2C9DA 2P7IA 4BNXA 5IDWA 4LE0A 4W9RA 5EP2A 4DPMA 4MYSA 3IP6A 4QFDA 3PJDA 5FUWA 3I9V1 3RQIA 3SOZA 5F1PA 3NTVA 1NBMD 2CF5A 2I62A 3HVUA 4HDRA 4IG9A 4X1YA 5K8JB 4LFBB 4WH0A 4E07A 3P9ZA 1DTEA 3BFPA 1DUIA 1HLDA 1AKMA 4FHCA 5DLEA 5EXEA 2HMYB 2VUIB 5DYYA 4IEIA 2O7NA 1IJKA 3KKEA 4NK4A 5L3ZA 5I4IA 1FXWF 4FFSA 4CDMA 4B3GA 3FG9A 2COUA 3HEBA 1KMIY 2BEVB 4XTCS 2XNCA 2XLCA 3CLKA 2P3SA 5C8YA 1YHZA 2GILA 2YZ2A 4G1FA 1ULUA 3ADOA 3DZBA 4WT7A 3V4FA 1V45E 3JQ8B 1WW8A 3VH1A 4Z2AA 2WIGA 3SQDA 3LUKA 3EOAI 1J7JA 2E21A 2HEGA 3JWPA 3MCWA 4FCVA 3OLCX 4MYRA 3TF5A 5IX8A 5FD8A 1JH8A 5FBKA 4KBFA 1W5SA 3X1MA 2PY6A 4LDPA 1NR5A 1PJ3A 2IYVA 4RMGA 3IKTA 1RLMA 1QV9A 2W93A 2ZBPA 3D8RA 3EX7C 2QQGA 3UB4A 4YRFA 4LFCB 1EBUA 3HA5A 4OJNA 2HADA 5KHAA 2J3JA 2YWFA 3EPHA 4QODA 1CUXA 2RBKA 3KTAA 3JALA 5C37A 4OMCA 1G8PA 3SP1A 3INTA 2WB4A 3VKFA 2VNAA 3KG2A 3PVCA 5IM4A 4CL3A 1COWD 2D5BA 3VSEA 2BR4A 4WV3A 4QYWA 2BSAA 5SYAA 5LLDA 3RUCA 4RZXA 2WAYA 2OCXA 2D2VA 3CZCA 3F98A 1G9XA 2VPIA 1GO2A 4X54A 5LP6C 3TW4A 5BNWA 5HRUA 1XELA 4DSTA 3ROGA 2FUKA 2GHTA 4YJGA 3RSLA 3VU9A 1GNTA 3CNEA 1KZ7B 1F2VA 2BMVA 3EWNA 3KSRA 4J2TA 4RKRA 4AMUA 4TWBA 3GP8A 4B47A 2QX6A 3L8ZA 1A7AA 5CJ2A 4ZGGA 2G6BA 2NYAA 4TKVA 1US8B 1SK8A 3TUJC 4C4SA 3VNSA 1YDHA 8GPBA 2WHQA 5ALOA 5LMCA 3UC5A 4CQJA 3FUUA 3WL4A 3EZ2A 5L3VA 1WUTA 3UYLA 3AR8A 5E8JA 3VGPA 4NYMR 1Z7BA 4HYQA 1N6KA 3MM4A 5JXGA 1G5HA 1P29A 5A3QA 2JD1A 3WDLA 5LMNB 5HM8A 1U8FO 3OLYA 1W49A 4BAUA 4ZHQF 4X6XA 1WXQA 3TEFA 2FPRA 2ATXA 3KZ1E 1M6HA 2IPNA 2VBGA 3G7NA 2MIIA 1VSTA 2WG1A 1EG7A 2G5PA 3JARA 3NDBB 1F5NA 4RVHA 4TV9B 3ZR4B 4R1QA 3RT7A 5JQGF 3KQYA 1RXVA 1NRWA 2CL7X 4WHMA 3HDQA 3IIKA 4IF6A 2CW5A 2YASA 3HBAA 3QIAA 4ETNA 2QX7A 1JKXA 2PKQP 1JT2A 2UYQA 4RA9A 2ZYDA 4P9NA 3CWZA 4B8ZA 3LFTA 4D4KA 1GGVA 2HA5A 4F6RB 3O75A 4EYQA 1VIDA 4BGEA 1BWRA 2A1UB 4V0SA 2I6UA 1KJYA 3LCJA 4UM7A 3DBVO 2V74B 5EZYA 4EY5A 2I7VA 1XCJA 1ZL0A 3S28A 1Y8AA 4K9SA 1FQJA 4UPEA 2AW3A 3FW1A 4H6VA 2G1AA 3DO8A 4H3HB 1N8TA 2IEZA 3NUGA 5IEBA 3A1UA 4IIJB 1FRVA 3H4MA 4XUCA 5M29A 3JRNA 4MQFB 4Q4JB 1EGHA 2IZ5A 1VJGA 4RDIA 5HJ7A 5L4LA 3SVLA 1YVEI 3EXHB 4JMPA 5CP8A 1REQA 3KD3A 1BGWA 3ENKA 2G1KA 4TKZA 3FJYA 2BRUC 3QLUA 4XB2A 4NZMA 3SFZA 3E5RA 1E0SA 1IOZA 1P7WA 3BWYA 3QHPA 4K9PA 1ZIXA 2F3TA 1V3QE 3IAS6 3ONNA 4M0LA 4J0GA 2SBTA 1UXJA 4HFJA 2QYOA 1KDYA 4NG5A 3R8CA 4BO1A 1U1CA 4E08A 1ORDA 1F2UA 1VP3A 4GWGA 4Q21A 4YBZA 2HU7A 2VDKB 4UEKA 2I34A 5C5CA 1M2VB 1GA1A 4JBNA 4AY3A 3UFXB 1F4VA 1NVKA 4JJZA 5AW7A 1GZ4A 2H2WA 3DMGA 1KDPA 2GNAA 4FEAA 4MARA 3TQHA 1GSOA 2YFQA 1XFAA 3TX2A 1WY7A 1TAHA 4R0VA 5CH5A 4DLPA 4IINA 1TFRA 1W44A 3U09A 1Z5VA 3WNCA 4GOND 2RE8A 3Q9NA 3S2SA 4N5IX 4HV4A 1RJFA 2O23A 4FNMA 1K9SA 4RKWA 2M6LA 5JDIA 2IEIA 4ZV4A 3GRYA 3WMXA 1XKTA 1G41A 4K40A 2RCYA 1QGUB 2AVNA 3GLQA 4P5EA 3L7CA 5AICA 5FPTA 3OH8A 1HQCA 5FPQA 2OXTA 3NBMA 5JDCA 4LSMA 4BLQA 4I1OA 3QYPA 4UM5A 4GI7A 4WVFA 4Q24A 4KNVA 4DA4A 1CRZA 2QYHA 2P6RA 3E58A 3ZQ4A 1CY8A 3C1OA 1CHNA 3DC7A 4LCJA 4RK7A 4OQYA 2AOVA 4X97A 1L4GA 5CFLA 3B9BA 3UMFA 3V1MA 1I51A 1WTAA 1ZGBA 1OMOA 2GAAA 2L2QA 1F2TB 1KDRA 1TEVA 2P9ZA 2QD1A 4MHSA 4DCGA 3AWDA 4D3SA 3A4IA 3TFOA 1SHTX 1PR0A 4H4CA 4P5PA 2PGXA 2XEXA 1G60A 2GA8A 2DWOA 1GPJA 1I7DA 1EK2A 3QUQA 1FC0A 3BE5A 2G7MC 4JB8A 3JQ9A 2FP4B 3S8EA 1KAGA 3TKLA 1BO6A 4MJLA 1M1NB 1Z7YA 1B1AA 2VDNB 4WFIA 5HM6A 1MO3A 2BVNA 3I8OA 3O4HA 4G1UC 1VCNA 4N5MA 2L19A 3KR9A 4MKGA 2E82A 4HBZA 3QV1A 4OOEA 5REQA 2GARA 2G7ZA 1G64A 1TZCA 2Y1XA 5EWMB 4AYTA 4EG8A 3IUMA 1YQEA 2H08A 3Q3EA 1KAOA 4HQ6A 2JKVA 3K94A 4W9MC 1HC7A 4YJ2A 1S2NA 1WX1A 3BWBA 4QEDA 3MEQA 5E6UA 2WAMA 2PS9A 3KUUA 3CRZA 3B2QA 3O92A 4M55A 4BO4A 5HDBB 3L0SA 1RLOA 4NAVA 2A9RA 2PE5A 2GBLA 3R5HA 4OHUA 3EIHA 2H1RA 4Q3EA 4TV8A 4U0KA 3PRHA 4OUKX 3ELBA 4QDUA 3V4ZA 3VI3B 1GN9A 2A5JA 3L6UA 1DRJA 2RJOA 4Q1EA 5DM0A 3LZDA 2H2GA 3WYCA 1S2MA 2XYQA 2C5FA 1RLTA 2XH8A 1WHTB 3EC1A 2CBXA 5AKJA 4FYKA 4HNSA 1J2TA 1DARA 3OT1A 4CLXA 4CR6A 4F8JA 2HA6A 5IMSA 1GEGA 1YOVA 1Z8DA 5HA5A 3EH2A 3OPNA 4EKIA 2Q4OA 2V1XA 1UMDA 3HCEA 4NOLA 1BHO1 4YRRA 2PK3A 3HFSA 4KXUA 4R8MA 4DQXA 4OYHA 3K0AA 3FR7A 4B0PA 2LBPA 3NPAA 4PEVA 4RVFA 3AIIA 4E33A 3LS2A 4TT3D 2V5VA 1QRAA 2CXUA 4QPCA 2XMBA 2CXNA 1G2IA 3AJ9A 5D7NA 4EHLA 2VT6A 2QUJA 3P2EA 4PLYA 1E7WA 3DTVB 2YQ5A 1PYGA 2XVYA 3GU3A 5CLLA 4KGXA 2ZDQA 4TRRA 2WA2A 3TQQA 3VSCA 2BGLA 2OESA 1N6PA 3LCVB 3EVEA 2EZ8A 2ZIEA 3BFVA 3GHHA 2GZ2A 2GCPA 1WMFA 3PITA 3KBOA 4I6JA 1TF7A 5SZHB 3CH6A 3LT5A 4CLEA 1U1DA 2FPWA 3VPAA 2MINB 1VSUA 1EHCA 4O33A 1EUYA 3WFZA 1AB6A 1RQ2A 2IRWA 3VYUB 1SRQA 5A4AA 3U62A 2HNKA 1R2QA 3HK2A 4LK3A 4H1WA 1K8RA 4JS0A 1QRTA 2XJ4A 3EGXB 4BVFA 1QR6A 1P9NA 1JEOA 1XIVA 2PCLA 4N8SA 2OORA 3ZLVA 3EMKA 5SZIA 4BZZA 4KODA 4WDRA 2KI5A 3BHJA 1QHGA 3WNBA 5EE0A 3VTKA 4R1MA 1DAGA 3UNXA 2VF7A 1UINA 1L8QA 1R18A 3K1ZA 2ZTMA 1Q57A 3EGCA 1XZQA 3PV0A 1NY6A 4HDSA 3RSOA 3L04A 4JB2A 1VGVA 1C1XA 4FFDA 3AR5A 3HSKA 3VI4B 3D3JA 3UT5A 1N7GA 4TN1A 5AP9A 3Q87B 2G9ZA 2QA5A 5EQDA 1Q84A 4JH0A 3R7WB 4HN4B 4OJMX 3WQHA 4Z9AA 3S70A 5IJ9B 1YNOA 2FMIA 4FHFA 1USGA 3UV6A 1NRJB 5I9SA 3V6MA 2BGNA 2P9BA 3LQRA 4GICA 4HGOA 4PHCA 1U8CB 4JC4A 4UMEA 3OPVA 4MVYA 3K30A 4UUOA 2P8SA 4XSGA 5A5EA 4XLZA 1S7GA 1CQZA 1TJ4A 5H9VA 2AOTA 2RHHA 1I3MA 3NVKI 4V39A 4CN9A 3D3QA 1U0NA 2C4KA 4FHGA 1DC4A 1NKTA 1QQAA 4BB9A 4HPXB 4YJ3A 4LRYA 4KXYA 1DZIA 5KCZA 5LDHA 4CM4A 3SFTA 4UNNA 3THRA 4O2RA 2PV7A 3GJ3A 3H8WA 4DV0B 1SXJB 3F3KA 1PD0A 3ZLBA 3E0XA 3R0JA 4XIFA 1FBTA 3AFMA 3FJOA 4A91A 1TAGA 1LLDA 3FRJA 2N46A 3ENVA 3TMYA 3ZIDA 5A6VA 4D5GA 2JH8A 1HORA 3IPAA 4QHTA 3UFBA 2D1TA 4AJNA 1S2IA 1Q20A 3BULA 1OC2A 3PFNA 4K03A 4UM9B 2C92A 4HAOA 3WLPA 1JDVA 1JA1A 4R9VA 3DSRA 2N42A 4XARA 5DGCA 4MINA 1ZVVA 4DRYA 2O06A 4U2CA 1W88B 4RWEA 3BH6A 3DZDA 2VWPA 4F6CA 2CBGA 3OFND 3BJIC 2F8LA 4JVMA 2RC5A 1WO8A 3UQYS 4O3MA 1GDHA 3FN4A 2ZUTA 1RT9A 1FDTA 4UAUA 3AKZA 1H42A 5L7TA 1YE8A 3SAJA 3ZHCA 1QYRA 2AHRA 1WUYA 3OETA 2D1RA 4K9LA 4MUMA 1KO1A 1U8UA 4GYKA 4DR5B 3NHKA 3L7AA 1M8FA 3VX3A 1E1DA 3B1JA 3AR9A 1FFGA 3NVAA 3T52A 2Y0DA 3KL2A 1XQWA 2PH3A 3ESAA 1CE8B 3MS4A 4IXNA 4PGFA 3T38A 3TD6A 3WMFA 4ABTA 4K6KA 4BMDA 2NSLA 4M86A 1N2CA 4IMRA 4H1UA 4KI0A 1W5EA 4WY2A 3ZWXA 4RVGA 4RIIA 1Y1PA 2B8JA 3AV0B 3Q2KA 2PQ2A 4NAHA 2YYZA 4AIRA 5EUBA 3TSZA 6PFKA 2Q3HA 3REOA 1PJ4A 3GK3A 1LLUA 4J94A 4BATA 2Q3LA 5FYDA 3DA8A 3VGJA 5BVHA 4DOMA 5C7LO 4CKWA 1Q17A 2P77A 4I5GA 4I9GA 1PF7E 2OR3A 3FF1A 3BX1A 4ITVA 3BDIA 3GZJA 4P3XA 3PP8A 4G65A 1NVGA 5DLDA 1SVUA 1CF2O 1X1TA 4DHEA 1QXSA 4JC5A 3MF4A 1Z2AA 3WSWA 4ER0A 2RFLA 3I2HA 3IA7A 2BTOA 2CLCX 3L0BA 2HMTA 3FZYA 4GX0A 3CZPA 3S27A 3U7RA 4IY1A 3PQEA 5JCOC 3ZV3A 4RHEA 1N4AA 3E5HA 4OGKA 3NQ41 3ET5A 4GGPA 1S96A 4LZWA 2WTUA 1UKCA 1SUAA 1P17A 4E1BA 2OHOA 2MMCA 1KP9A 1JNXX 1TUGA 1V5EA 1KSFX 4OHRA 4UEJA 4H4DA 4YO7A 4C30A 2XCSB 3DL2A 4LY9A 1IN1A 1RMYA 4PYLA 1F0YA 4G56A 3QVVA 4KKVA 3FCSB 5PGMA 1J1UA 3PTLA 1JTFA 5F2NA 1B0UA 2E48A 1XWFA 2YZ7A 1QX4A 5CXSA 1A9QA 2LE0A 2P6NA 3IE2A 4L16A 3JQAB 3K53A 4YMWA 5KINB 1AO0A 2PUGA 4YBRA 3ENNA 1FYVA 3PIIA 4AKIA 5DN6A 4C6TB 1QE0A 3ICVA 2FGKA 2B1GA 4F3TA 3GV0A 2WKSA 4RHFA 1TTTA 4ZYVA 2IQ5A 1CY1A 1NMYA 3B3AA 4E5YA 4M1OA 5CUQA 2WT8A 2GYUA 5JHGB 2REQA 4N7BA 4JCOA 5A7GA 1GGMA 3C7DB 1UOPA 3R2JA 3CNHA 4M9ZA 4WLVA 4QHSA 5K4AA 5JY1A 2AX3A 2HFJA 3BHNA 3WXMA 4LXYA 4LF5B 2TRSB 3L0OA 1IOVA 1KEEB 3WB1A 3OMWA 2OGUA 2VDUE 4TMVA 2VZEA 1B3BA 4H17A 1QJ4A 2JNWA 2PVCA 5FORA 1ZZGA 4PNHA 4R1TA 3L4BA 1SA0B 5AVKA 4IBOA 4QYXA 4EM6A 2EWMA 4JT4A 4XIYA 3KVNA 4O2BF 4TMTA 3ANSA 3BHMA 4MHOA 4CCWA 1HZZC 1K86A 1EVYA 5HKOA 1HNWB 4AS2A 2ZYIA 3ROPA 4GZLA 5BSWA 5CB8A 4I4TB 1UC4B 3DBHA 4OHCA 2P0YA 4Z3OA 5BNIA 3TQIA 3L0DA 3JTMA 4R41A 2I3ZA 4I2NA 3OFJA 3TAHA 1ZHOA 3WO1A 4B3SB 4EY4A 4Q9KA 4IJUA 1SWWA 3GFOA 1RMQA 4EMSA 2R84A 3IPLA 3E8SA 1Y4SA 2VJNA 2ZIXA 4JR2A 3W5JA 5TB5A 1G291 2CZQA 1GVHA 3IH5A 2VWGA 4Z4FA 4X62B 1JMYA 2Q2WA 3DAOA 3OA0A 5EL0A 5IXSA 1VYHA 4FI3F 4E5UA 5LSAA 2NACA 2YMPA 3EE6A 4ZOLB 5BUSA 5CFPA 1ATZA 4M7RA 4BB6A 3TLCA 1EX6A 4HEA1 4IGAA 4AKHA 1WL8A 3HZHA 4YV2A 5JALA 2WVAA 1PZFA 4AJ2A 4E5SA 1TTQB 4C5AA 1XUOA 4CF4A 3IBCA 3HI6A 4HZUB 3J7TA 3IDQA 4HYEA 4BFVA 2NVUB 3PTAA 2BZSA 4LSWA 5EMJA 2NV6A 1U2SA 2IHUA 2FMXA 3QSYA 4X5OA 2V0CA 3WMWA 4TS9A 1Y8ZA 2O8BB 2P90A 4S05A 3A3PA 2DUMA 3SQMA 4ERXA 5KNBA 1N92A 4UUAA 1RWBA 5L6MB 4KR7A 3TPFA 1T3TA 1BS2A 3L4EA 3A6FA 4XOUA 2XKBA 4X60A 3TTWA 3IUEA 4PC2A 5TJ9A 2YUIA 2B1JA 2DX7A 1SBZA 2QJWA 4KGDA 1C9JA 1OJ7A 1B93A 1PWXA 4NMLA 4CM7A 3M5DA 2F1OA 3M1IA 1BQ3A 3RGWS 3FBGA 3BA6A 3W3AA 4ENRA 4JGBA 4MWBA 3G0CA 5LA6F 2GN1A 1BEEA 3WLEA 1T8YA 5M34A 2QNBA 3N9IA 4M37A 5BRJA 4ZVKA 4B6GA 4RL6A 1P2TA 1B43A 1EE9A 1FP6A 3F6CA 3RWOA 3LF1A 2WJYA 3W78A 3WDSA 1G6HA 1GL6A 1M2GA 3KC2A 2JIOA 2R2AA 1VIVA 3BN3A 3M33A 3AV3A 4HY3A 4RA6A 4V24A 4Z0TA 3WKBA 3AVTA 4DSOA 5HE9A 2O7VA 3P5BA 1GKKA 2WZQA 3IYLW 4L75A 1HH4A 1TVKA 3FB1A 3UWMA 3ZJ5A 5LLSA 1Y7HA 1E89A 1UZLA 1D8TA 5KCMA 2FOIA 1E79A 3CPSA 3GJ4A 4OB6A 2K6GA 1BS1A 3ZZMA 1N2BA 2IZOA 2JRCA 5E0KB 1Z7WA 2VDPB 3BMCA 1JEEA 3GXBA 4KE9A 4AIIA 4D3FA 1FJGB 1PX2A 1XZKA 3E5MA 4X63A 1N3IA 2I7XA 4RD3A 4RM2A 1N25A 3DE0X 4NQRA 2A0XA 3NGXA 3BDVA 3HNOA 1SCAA 4R83A 1HYEA 4QQRA 2WC1A 2NYUA 4HUQA 2HV8A 2V7WA 3ST7A 3T5DA 2P8JA 1XP5A 4BZQA 4EEKA 4MR9A 2O8FA 4GZ5A 4C76A 3DZCA 3FAKA 1VKHA 4LXTA 1YD7A 2WLTA 4URZR 5IYZA 3SSOA 2JVIA 3RS3A 4C07A 4F92B 5KNCA 1XZLA 2HPAA 3OEEA 1IZ7A 3QFSA 3B3FA 2WUGA 4UXHA 2OOKA 2B21A 2X22A 1OV6A 3GHYA 3SF0A 3WRXC 1NVUQ 4QGFA 1QTRA 1W6RA 1Z18A 4HADA 5J5VA 2J59A 2QPLA 3W5VA 2I33A 3B85A 3KEQA 2BUAA 3ZWBA 4BPBA 5M7EA 2VF2A 4HSGA 4FMDB 4R5MA 7YASA 3A2LA 1X1BA 1E0JA 1EUQA 4A92A 4C04A 2GXQA 3S3TA 3I4CA 3H75A 4G8DA 1MO2A 2GCOA 2NO7A 2YNMC 3Q3CA 5EXXA 3VYWA 3O0TA 4W5NA 2V7BA 4S1WA 2NUPA 2ZRQA 3AY3A 3RFXA 4KK4A 1W5BA 1XD9A 4I81A 3ZVLA 2VTBA 2IOQA 1UFQA 1O5TA 3HUFA 4YECA 1J2RA 1YS6A 2IS2A 2F6RA 3BBPA 3DT9A 1S2LA 2OAP1 4FFVA 4RD2A 1MRNA 5K3DA 4PZAA 4AC9A 4WPGA 3BCRA 3AIKA 1ZAYA 4P3OA 4PG8A 2GEJA 1TK3A 4QU5A 2FVXA 3TPZA 5C7OO 1GEEA 1KYVA 1TM1E 2PDAA 3AVXA 1QIGA 4LY0A 3OM9A 3FRIA 4KLRA 3DF7A 4YI5A 4O2AA 4WNYA 3R3SA 1O8BA 3PRKE 4LZZA 4L4RA 4HNAA 1YI0A 4MEJA 3THWA 1V37A 1MGPA 4NAUA 3AETA 4GPZA 4MW9A 3AJ8A 3AP2A 4BDSA 1JWAB 1P3JA 5I51A 3MW8A 4CRWB 5BN3A 4LEIA 2CNWD 4HDKA 1VP9A 2CCKA 5LQSA 4LGYA 3U61B 1JFFA 4BX2A 3HA3A 4M76B 4GWLA 4CR8A 1EUDB 4LIPD 5KQGA 3BGVA 4IIFA 4X1IA 2Y68A 4B9EA 1U2ZA 2O2HA 2I7TA 3THYA 5EGSA 2UZ4A 4FFBB 3WMGA 3ZD8A 1DQZA 1PQPA 1XVIA 5KMGB 1ZNXA 1FRFS 5F2EA 4XB1A 3S40A 1F1JA 1TT5A 1M0TA 1OLOA 4M21A 3QUCA 4KAJA 3FR8A 3TNLA 1XD2A 1RYHA 2QROA 2Y0BA 3WQQA 3CGGA 1X19A 1QC5A 4QFMA 2JJYA 3OF3A 2WJHA 3QJYA 1LK7A 4KC0A 4IICA 3PRYA 4ZDJA 1ZD2P 3DOCA 4YRIA 3I0ZA 2ZS7A 1V5IA 4LJKA 2WMYA 1JLLB 1KZ9A 5HF6A 2NXNA 4NEHB 4HN2A 4PS1A 1IL0A 1T6XA 3GJ0A 4KAAA 1P0IA 5G53C 3CUWA 4JDPA 4ZT4A 4CIBA 3MA0A 3CUKA 1XL1A 1YJAA 3C8MA 3IP8A 3KSUA 3U0BA 4D9MA 4DN6A 5KSYA 2HMUA 1X8JA 3BIFA 3M4ZA 3OQJA 4NYMQ 4YN3A 3FKJA 4OLHA 1KPHA 3NYWA 5KDDA 5GOZA 4L3OA 5F12A 4AP6A 4EF5A 3E6AA 5BSKA 3DD1A 1NAHA 4LOLA 2WIAA 1ZK4A 3ZQKA 5IJXA 1CY7A 2MCFA 5C8YF 1XPRA 3CIOA 4M9RA 1F20A 1QYDA 4WNAA 5JBNA 4MI6A 4P7GA 3WLLA 4IH4A 4B4KA 2R00C 2YHBA 1X74A 3LY5A 1P8JA 1V3UA 2PU5A 3NHMA 2WLSA 4K7JA 4KQGA 1R6AA 1SIWA 2BEWB 4KVAA 2ZPUA 3B3GA 3NG1A 2DERA 4LYFA 1PBTA 1ZITA 4GMDA 5AXDA 1UODA 4JQOA 3T1YB 1BWQA 3SG0A 4HWRA 1W76A 4LBWA 4D9FA 1PRYA 3NWPA 4GRIA 2XB2A 2RARA 3MTQA 4D26A 5KYKA 3ZK8A 2ZIZA 1ULSA 2B1IA 1R37A 1JGTA 4RD1A 4S35A 4NJMB 2J7PA 4OIMA 1L1FA 3TJZA 3PUIA 2Z56A 3AONB 3ADCA 1KP3A 3EA0A 2X5OA 4UU1A 1L5WA 3DWEX 2GFIA 4WGFA 4XRRA 3UIEA 2VLBA 5E7JA 4Z5XA 1B0PA 5H3CA 5DTEA 1N5RA 3A4VA 4LVOA 2ZSDA 3EG5A 4R68A 4W8OA 1P18A 3R76A 4AF8A 5JISA 4TQ9A 1LDYA 1G7TA 3TZEA 1FDWA 1PNQA 3JYHA 2YHIB 1O94C 4P93A 4IV0A 4WOBA 3TCXB 2FJUA 5EJEA 2C94A 2E85A 2QLJA 4MRVA 3GI1A 5M5BA 3CVXA 5C46F 4QXAA 3PA6A 2X2EA 3R5XA 2YQZA 3NAGA 1E5TA 2O3TA 4MJ3A 4EX6A 1GTMA 1V43A 2I3DA 2JBHA 3Q7QA 5JTUA 1SCKA 3DPIA 4B87A 3DCYA 2ET6A 3TE6A 2WF8A 1PHRA 5FNVA 1BX1A 1XTSA 3DAYA 4OL9A 3N8KA 4U7PB 4BUCA 2YYSA 4F9FA 4Z4GA 2OGZA 3W7BA 3F74A 2J6HA 3X1XA 5JCZA 2XZLA 3KXKA 4G0UA 5T57A 1UC5B 1VYVA 2EATA 1Z83A 2J08A 1JWBB 2IYQA 3LBHA 3PI7A 4J16C 4Q37A 5EE1A 4I50B 4TXNA 3QNUA 4TLEA 4ZOBA 5G4KB 3U7GA 4QBIA 2B1QA 4NCNA 2DXIA 2O8CA 2JATA 1IPFA 2Q62A 1POXA 1T9HA 5IW8A 3FSGD 4X9XA 3SJBA 5K8TA 2AFIE 3D8SA 3KKOA 4R4JA 3N7TA 4ZI7A 3D8HA 5LNK1 2GZSA 4LDRA 4OU5A 1Y4DE 2C00A 3JVDA 4REQB 5DHQA 1EKXA 4W5OA 2QQ5A 3K5WA 5TQVA 1FFYA 5HS4A 2GBFA 4EYEA 1SKAA 4J3FA 2Q45A 4BV8A 5T3UA 2ZBGA 3VPGA 1G9SA 1ZISA 4NEGA 3EPJA 4Y8VA 4KWCA 4AXXA 3B5JA 1U5BB 3T9DA 2AD5A 3DMHA 3OLZA 2P9HA 5MN4A 2H11A 2Z57A 3A32A 2PUJA 2ZITA 3FNRA 3KWMA 2YR0A 3N2KB 2F2TA 2FVYA 1CRQA 1NZJA 1XU4A 2FSGA 2CMDA 3CO5A 3QW2A 4OQFA 4PG6A 4EPTA 1XHFA 1R64A 2ZVJA 3L06A 5TEWA 3JQ7B 5EZYF 3AHCA 3SJZA 3INRA 1J06A 4TUYA 5E9WA 3NPMA 2IYFA 2QI9F 4RZIA 4ABYA 4P53A 4EJSA 5CJJA 4K3VA 2DQZA 4MDEA 1QQ7A 2XAAA 4LGCA 5FXMA 3PNOA 4BAZA 4UDOA 5B3AA 4DRXB 3MHTA 3EJWA 5ICGA 3ZOKA 2Z6UA 1T1EA 5AH0A 4LCEA 1AY0A 6CHYA 1T25A 4G97A 4Z1MA 3M9LA 2F43B 3LF2A 2H4HA 2I71A 3LVFO 4JWTA 1QONA 4NS4A 1YK0A 5E6SA 3UK6A 3CGWA 3PQ5A 3ETDA 4X8MA 5KTSA 2JIQA 3PDHA 5LZ7A 1F0KA 3WRVA 5D5HA 3O4FA 4JT8A 3ERCA 4KMMA 1AS2A 5HIIA 3WQSB 3SD7A 5K0NA 2G04A 3QGMA 2BM8A 4C4ZA 5F7OA 1NN0A 2OHXA 1SC4A 5M2QA 2Q3DA 1FFAA 4R6WA 1YDWA 3ICWA 1WHSA 2XA9A 1EJBA 4C06A 2XZDA 3O1JC 3SGLA 4EUSA 3KJQA 2PS1A 4YXWD 4A5OA 4GI3A 4RMHA 2CLLB 4IZHA 4FT4A 1KK3A 3AINA 3DOHA 5CT9A 4TMZA 2QUAA 1KO8A 2IOYA 5AJXA 4V0QA 8AT1A 1YA4A 2JBAA 3NWEA 1HE5A 4PF1A 3OIYA 3IBGA 2P4HX 3D6UA 3F4LA 1PR3A 3SNHA 1U8XX 5JU6A 3ZDZB 1LLQA 2XB9A 2OLKA 5K8LA 2H4YA 1G16A 3IQDB 3U4DA 2AA3A 2V9PA 2ZTLA 1PFWA 2VRCD 5JNTA 1QPBA 1KZ1A 1ZI6A 4NBTA 2A57A 1K5HA 1E18A 1U8AA 3FPGA 4LYYA 5AW4A 2DWQA 5JFOA 4G0WA 3E48A 3NATA 1MHTA 1S2OA 3WSVA 4TWZA 1BJRE 3D3KA 5GIOE 3RIHA 4UVDA 4RMNA 3V2IA 3E22B 1F8GA 3RBAA 3G13A 1FUEA 1V8PA 1PEDA 2ODAA 1V16B 2QXYA 3BZBA 3EHEA 3IEIA 4HX9A 4EKYA 1P3Y1 1OLXA 2JEZA 2SHKA 1O0CA 2A3RA 2ZQZA 3P9IA 4L02A 4UCWA 4QREA 4Y0VA 2NUBA 1THMA 3HB4X 2ZE8A 3QKUA 4KN9S 1WZUA 4KLNA 3T7RA 3FKSA 4DV4B 1XX6A 4RH1A 3HYRA 2REOA 2WHYA 3EXHC 1TGVA 3EXEB 2F9FA 1B8UA 3OU7A 2FWJA 3IMCA 3MWLA 4H1TA 1H8EA 2PLAA 1GR1A 1M2HA 1KO4A 3ZWPA 5HUQA 4ZMRA 1H2RS 2QLFA 1LTQA 3K0CA 3AR2A 3OA2A 3NYQA 4GW3A 3ZPXA 2ERCA 4Q6BA 1WETA 2BFDB 4N03A 4Q3CA 2RBEA 2E89A 5L45A 1YCFA 5CG2A 2WUEA 1EK6A 3ND7A 3S2UA 3WBBA 1PQ4A 1TUBB 3PWZA 4YJHB 4UQLA 1YRBA 1K6MA 5AKLA 1X3LA 5K6AC 3ZNQA 2XXBA 3GT0A 4TV8F 4UW9A 5LR6A 2CT8A 1VBMA 3D7MA 4EEZA 1K89A 3RAFC 4EFLA 3CE6A 4IH1A 2IUSA 4YT8A 4XX0B 2H1CA 4LJSA 4A15A 5LCXA 2G9NA 1LUAA 4HDMA 4N5HX 4YREA 1XZHA 2Q5LA 2ECPA 4JBWA 4ZZ0A 1Q74A 1WB5A 4YALA 3WRWA 1Z6TA 2OGTA 2WIBA 2ZTUA 1DQRA 4YNBA 4HGZA 5CFMA 3TDMA 3K2IA 3DE1X 4NCKA 2VYFA 3W0LB 4L4UA 1YRHA 2OBXA 2Q5EA 4MVJA 3PG5A 4EIWA 1YS1X 2DJIA 1SKYB 1KSHA 1UIMA 2ZIVB 3OFKA 4U2GA 1E5VA 4E7OA 4EY7A 9ABPA 2NU7A 1HYHA 3H2JA 1M7BA 3V4PB 1N2GA 3OPXA 4ENPA 3EIEA 3MSCA 3TBHA 1UOOA 2A0FA 3VKUA 3TKYA 2A58A 5E2BA 5EI5A 3R9WA 3KL4A 3FWZA 4QT4A 2VRNA 1DDOA 5IKOA 4EVIA 4OSPA 5F64A 3D3WB 4YR9A 3M0EA 4FMPA 1DINA 1MZVA 3MWDA 1ZEMA 3BZWA 1KHHA 5KREA 4GMGA 4NP6A 2RHCA 4R7TA 1OYVA 2VUSA 2ZSJA 1L8AA 3G8BA 4DYHA 4RACA 1EK5A 2PZAA 1X7WA 1IJEA 4D43A 2AL7A 1W1UA 1DWQA 2AG6A 2UUCB 4WXEA 3ZV6A 4C14A 4BO7A 3QPUA 2AD1A 3IT2A 1NVXQ 3ENQA 2ZCVA 2BJWA 1XB2A 1JYEA 1LLFA 5B7NA 1YSCA 1JQLB 2IHYA 3VYTB 1V8BA 4KPYA 3H5IA 3PQ2A 3RV3A 3ZCXA 4N48A 3VR4A 3GT3A 3OLQA 2ZQ5A 5ELXA 1Q6YA 1JTVA 4WNIA 1SHZA 2UYOA 4EITA 2AYYA 3FCXA 3OF5A 3B5IA 4JUBA 4JEIA 2FWPA 4ISBA 5JLAA 5LYYA 4ZGWA 2DULA 2Y0CA 3RVSA 5B1EA 5HTOA 3SM9A 3EVDA 5FEUA 4Z4QA 4EAAA 2R6HA 3L0CA 3GEGA 4EB3A 3IQZA 2D4HA 3Q12A 3LBFA 4QASA 2H51A 1UJCA 3CBGA 2R48A 3ORSA 1QTNA 1ARZA 1XDDA 4EB8A 3GFQA 1IN5A 5C8DA 1D7AA 2QM8A 2XEDA 4FGSA 1Y5LA 2VP4A 3BWEA 1P1KA 2I9KA 2AJCA 3C3CA 3OFVA 4D8YA 4B09A 4OREX 3RAEC 1K75A 1Y5RA 1L4UA 1ZWLA 2VHXA 3ZE1B 4AG3A 1JFRA 3OCWA 3OX4A 1C50A 1VLMA 5GJWC 2DBZA 2NVOA 3RSSA 4ALLA 4B76A 4ZZIA 5KO2A 2PU7A 3FPAA 3F3MA 5J2TA 3DMTA 1OROA 4YJ3F 2X9QA 5I9LA 2RGBA 4G5FA 4EJ0A 4QX6A 2O20A 3TM5A 3G1WA 3SLGA 4EO9A 1QH1A 2DR2A 2FWNA 1J24A 5EMHA 3R0ZA 3OUZA 3DBRB 1NW7A 1G7SA 1T2VA 1XTUA 3KUKA 4IFEA 5DN9A 3QVUA 3UA3A 1USVA 2N75A 1R0YA 1XXHE 5LBIA 4DNOA 2FWMX 4D6YA 1RWNA 4NHEA 2V0GA 1SG0A 4L50A 1YB2A 4ZYZA 2GVNA 2X0FA 4PX5A 3QVWA 1J2YA 1E94E 2D00A 1UBJS 3JAKA 3EDOA 3ND6A 3ROMA 4E4YA 2PUDA 2H4JA 2WYVA 3RTCA 2Y1LA 2ZUUA 4K46A 4RL4A 2AEJA 4CKCA 1EJ6A 1N8SA 4I55B 3W1VA 2H2FA 1ZCBA 1P62B 1TKRA 2ACKA 3IMFA 4MW1A 4D44A 1EQAA 2W9XA 1Y6GA 1UDAA 1VC2A 2B9EA 2C0PA 2C4VA 5FFFA 1XAGA 4XIIA 1CIJA 3P2KA 4KEAA 4I6EA 3T3MB 5TQJA 5BYKA 4Q4AB 2VEOA 2DFDA 1C81A 1SIBE 3AHDA 2OENG 2BTQB 4Q4HA 4MVJI 4GYJA 1L4HA 3NNNA 4UHKA 1ADJA 5AHXA 8ATCA 2Q5QA 3K9WA 4WERA 3FSRA 3QKWA 4QUKA 4I6GA 5JXHA 1LNSA 4FOLA 5HKAA 3GLFA 3JQGA 4TL7A 4G25A 1H2XA 3RADC 4U63A 3W6UA 2F8MA 3TPCA 4HLDA 3A11A 4TKLA 3KX2A 1RFGE 1V71A 4FZRA 1Q11A 3AVUA 5K01A 3A0RB 3JASA 2XHEA 4JEUA 2RG7A 3O94A 3OZGA 3TDKA 2POCA 1ZJJA 2COKA 3AERA 1VL0A 3R6DA 4OGLA 4WFJA 4ZEOA 4CTJA 3TW8A 1Z6QA 4KYTA 5HRCA 3QMWA 4WN9A 4P54A 1AZLA 2OXCA 1FDIA 1DT5A 1PK9A 3Q0EA 4C29A 5F5LA 3OCVA 3U26A 1EFKA 2A5GA 3NHPA 3NTUA 3RR2A 3FRHA 1VG1A 1I24A 4YCCA 2B8EA 4WXHA 2H9YA 2ZIUB 4KQFA 3FGPA 4M0FA 2H17A 3CRVA 3K9LA 1WQ4A 3L8EA 4H7FA 5A9SB 4GKKB 1SXJC 3JWIA 2GO7A 1UBKS 3MVEA 2J0VA 4AZ3A 2VJDA 1C9MA 4R31A 2H52A 3SXPA 1KL7A 1K6XA 3ELDA 1EDZA 5FP0A 5JNVA 1H0RA 3V4VB 2Z30A 5EHZA 4UD6A 2HJRA 1ULTA 1BXKA 3GRVA 4MRMB 1E2UA 1Z26A 2W98A 4S2EA 4CM9A 3M7IA 1VMAA 4GR5A 1VFNA 3ENZA 3N8NA 1MVNA 2XECA 3RTBA 4A23A 1RYNA 1IC6A 4R01A 4BMYA 5AW9A 3EBOA 4MNTA 3VC7A 2PNJA 1V8OA 2BZ1A 4UVGA 3I4FA 2O3RA 1EFPA 3V55A 4BGVA 3I9NA 2CLEB 4JA2A 1C0EA 4F06A 2WQ6A 2ZI4A 3EISA 3ONEA 3UB2A 3P32A 3ZW8A 1SZCA 3UGTA 1E2MA 4J76A 5CDUA 2NNWB 5K8IA 3P27A 3OKFA 1JUDA 2HWXA 4OQPA 1R9JA 5BWLA 3TB4A 4PNZA 4AZWA 3JRWA 3QEMA 1YH3A 2ID7A 3MSXA 2YXNA 3VR5D 4CU2A 1ZD1A 1NQXA 2IYAA 1TW2A 2ZKLA 4JLOA 2EF1A 2QD5A 3HEAA 5CVVA 1R74A 4MLCA 2EGHA 2HT6A 2ZT6A 1A88A 5DIZA 4M60A 1JFVA 1NQVA 1H0SA 4A4DA 5HNKA 4G36A 1QLJA 4BNGA 5A4JA 2R66A 3GGSA 4GR9A 5DCUA 5A02A 3PZBA 4EQ6B 4ASUA 4BN4A 3BH7A 3CNNA 3KPWA 2YRWA 3JAWB 3FHOA 2XMSA 3FUTA 1V1MB 2J5QA 1HGXA 4ZCMA 4GXTA 3K7EA 3U7IA 5JJKA 2HU8A 2PSEA 2PUTA 3NRJA 4KYIB 2G17A 2NU6B 2ZYTX 3X2SA 1Z82A 1RYBA 2X23A 5AKYA 2IEBA 3D4BA 3P0EA 4JVSB 4PR3A 5FTMA 2WBLC 1Z36A 2D7DA 2QRJA 1RZVA 1ZK3A 3KETA 3DL0A 4WOKA 1E59A 3NIBA 3HCAA 3AIOA 5DVZA 2O8EB 3VDQA 1KQGA 2GAOA 3BRSA 1DP4A 3KKZA 3R3JA 2JGRA 3TTYA 3I9OA 3C24A 5ALNA 4W99A 2ZBUA 3ETGA 3MXOA 2QX9A 5HYVA 4CVNA 4PZDA 4L4XA 5COAA 2GSDA 4MYCA 2NSJA 4N8EA 4EFDA 3DL7A 1PFGA 2R2GA 3CX8A 1RWVA 3TDNA 3NRCA 4TLMB 4XI9A 3E9DA 3IT0A 1C7IA 2C07A 2A78A 2XQJA 1VL2A 3OZSA 1RCUA 2BMEA 2BHNA 2I6FA 5ELMA 4INOA 3QEAZ 2UUBB 2YNMD 1CR6A 3KQWA 2Z2IA 3NHUA 1NF8A 1Q16A 3BXFA 3F3SA 1ZS9A 2CNKA 2OCGA 4MLPA 1GARA 4UOZA 3ELYA 1CD5A 4TKUB 5D2CA 3T3DA 2QTVA 4LYHA 5K0BA 1CP3A 4BYGA 5KHLB 4MITA 3DTTA 1UT6A 1ORIA 2AF4C 3OT4A 1BQEA 3Q7RA 3E53A 3G59A