3D0KA

Crystal structure of the lpqc, poly(3-hydroxybutyrate) depolymerase from bordetella parapertussis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
287
Chain Sequence
b'DLTNADRIALELGHAGRNAIPYLDNADRPFTLNTYRPYGYTPDRPVVVVQHGVLRNGADYRDFWIPAADRHKLLIVAPTFSDEIWPGVESYNNGRAFTAAGNPRHVDGWTYALVARVLANIRAAEIADCEQVYLFGHSAGGQFVHRLMSSQPHAPFHAVTAANPGWYTLPTFEHRFPEGLDGVGLTEDHLARLLAYPMTILAGDQDIATPNLPSEPAALRQGPHRYARARHYYEAGQRAAAQRGLPFGWQLQVVPGIGHDGQAMSQVCASLWFDGRMPDAAELARLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative poly(3-hydroxybutyrate) depolymerase LpqC
molecule tags Hydrolase
source organism Bordetella parapertussis 12822
publication title Crystal Structure of the LpqC, Poly(3-hydroxybutyrate) Depolymerase from Bordetella parapertussis.
rcsb
total genus 90
structure length 287
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d0kA00
5AKKA 4G1FA 2QJWA 4K6HA 3PF8A 3V1KA 2WUEA 4UFNA 4U2EA 2Y2VA 5ALSA 3AZOA 2Q0XA 1XZBA 3I2IA 1ZD3A 3G0IA 4KYVA 3T4UA 3R41A 3W2TA 2LIPA 4A23A 2WIJA 2XUGA 2BKLA 4KAAA 1ZIYA 1EVEA 3O4JA 1THGA 4FLMA 3HACA 1WHSA 5AIBA 1Q0RA 1F6WA 1CUUA 2QT9A 4ZWNA 1TCCA 3DYIA 1P0QA 4U2GA 3LS2A 1Q84A 3ZLVA 4H7EA 2J3DA 3FSGA 4EY4A 3I28A 1XRLA 1QIJA 4M0FA 1WOMA 3DOIA 2Z8XA 2BAGA 5BWBA 1R1DA 1WM1A 3I6YA 1GQRA 2ONCA 3B5EA 3R3ZA 5KWJA 4WFJA 1AGYA 4BCDA 2WHPB 5ALEA 1BRTA 4FBMA 4GBGA 4QDUA 4FFWA 4DYHA 3ESAA 5A7GA 1QONA 2ACEA 3A2LA 2HM7A 5LZ4A 1EB8A 3A6ZA 4UBJA 5LZ5A 5AI0A 3BE8A 3CN7A 4Y2JA 5A2GA 3NUZA 2BUAA 3R40A 5AH0A 1HBJA 3AUKA 1ORWA 2FX5A 2CEKA 3F8SA 1BEEA 2C7BA 4CI9A 4ROTA 1TRHA 3WWOA 3WK6A 2VAXA 4DNPA 5E4JA 1IZ8A 1ZD5A 1AZWA 5CT4A 1VZ3A 5AP9A 2HFKA 3E3AA 1N1MA 1DWPA 2XI4A 3H2KA 5AKHA 1SOMA 3WK9A 1UWCA 5T4FA 3C43A 1AURA 2JEYA 1EK1A 1TQHA 4UBIA 1O6FA 2IX9A 5AM4A 1ZD2P 3R3UA 2JGLA 3QMWA 4I4CA 4AQDA 2HA4A 5AK6A 4G9GA 5CMLA 3KSRA 4AX4A 3BIXA 4KR0A 3AIMA 2JF0A 1MX9A 2DQYA 3D59A 5LLSA 2J3QA 2PU5A 3IURA 4AO7A 2PBLA 2BGRA 2OGZA 5K3EA 4Y2QA 3C5WP 3DD5A 5LZ9A 1P0IA 1CIJA 2XUQA 1R9NA 2XLBA 5K3DA 3I6ZA 5FDFA 3HEAA 3C45A 3U0VA 2XMQA 5ALRA 3W04A 2XQJA 3C8DA 2HDWA 1GPKA 1ZJ4A 1D07A 5A6VA 5JANA 2GBGA 2XB6A 1XLWA 1MO2A 1W6RA 1LZLA 2XMRA 2I3DA 4H7DA 4IH4A 4MQMA 3WK7A 4GW3A 3DCNA 4X85A 4X7BA 2GZRA 1ACJA 2BJHA 2RHWA 5K3FB 4GXNA 3F67A 3WWDA 4WY8A 3JWEA 2Z8ZA 1LPOA 2XE4A 1CUEA 4X71A 3KWFA 1QFSA 3AINA 4X92A 3IB3A 4UBKA 3IULA 3DNMA 2YXPX 4KE9A 4W1QA 4B81A 3R3WA 5JIBA 2GBFA 2GZSA 1W75A 5CT5A 1G42A 1TK3A 3JW8A 2OCIA 1UK7A 1A8QA 5EIEA 5AI5A 4EBBA 3N0TA 4JYMA 2ROQA 4OPMA 2D0DA 2JIDA 1N5RA 1C4XA 4KAFA 1MAAA 2JGKA 1FSSA 3X3HA 5ALFA 4B0OA 5DJ5A 2B61A 3HJUA 4H7FA 2HA3A 3QMVA 5ALTA 2O2IA 4Q3KA 3DOHA 3M81A 1K5PA 3WKCA 2WFMA 3K9BA 4B0PA 5EIAA 3FLEA 3I1YA 4JUIA 3GELA 1HPLA 4BVKA 5ALKA 4MEAA 3DJYA 2PM8A 5JAHA 4RNCA 5AKGA 3JYHA 2Z3ZA 4Y2TA 2VT6A 4BAGA 1S8OA 1LPMA 3KXPA 2AJ8A 2QS9A 2O2HA 1CUVA 2WUDA 2P8SA 2OLEA 4DMKA 4B80A 1GPLA 3EQ7A 4M0MA 2AXEA 5H3HA 1BROA 3ICWA 4EB0A 1XZAA 2Y6VA 4EUSA 5LZ2A 1UKBA 5EIHA 3H2IA 4UFPA 5I9IA 2D5LA 1WHTA 1EXWA 2ZJ6A 4C6HA 3WYDA 2PSFA 4ZXFA 4F21A 5E4TA 4AN0A 3WJ1A 4I3FA 4XIIA 3K2IA 3H1BA 3F97A 4M0EA 2FUKA 4GLBA 4CIAA 5IKXA 1BEZA 5D3ZA 5JD4A 2WLSA 4Y2YA 4EZIA 1TIBA 3HZOA 4N8SA 3OPMA 1CUFA 3DQZA 3MVEA 5A62A 5KBYA 3PUIA 4BDSA 4G4GA 3QITA 4W1RA 2R11A 1A8UA 4Y9SA 3ZLUA 1CUCA 1CQWA 3AIOA 2XUAA 3B3QA 5C8XA 4G4IA 3DKKA 4A16A 3SX4A 1E3QA 1JJBA 2C5FA 1FFAA 2VT7A 3BL8A 3ICVA 4F0JA 5AKZA 5ALQA 4BRSA 1YA4A 3VDXA 3FCXA 3RARA 2QKYA 2PSHA 4UHFA 4MJ3A 2O2GA 1UKAA 5FUMA 4QDZA 3G02A 5HQ3B 5HKBA 2XMDA 4KRYA 1Q0ZA 4X90A 2B20A 5C8VA 2RONA 5LP1A 1CQZA 2WQZA 4H18A 3V1LA 4DMCA 3ESDA 3DEAA 2QTBA 4BVJA 1SCIA 4W63A 4DMHA 3VJKA 1YSCA 2HA5A 1XZLA 2C0QA 4TPKA 1VKHA 2X5XA 1CUSA 2ES4A 5C8ZA 2JGFA 5T4HA 5JATA 4X6XA 3RK4A 3H2HA 4H0CA 3I2KA 4FNGA 4KACA 1LPAB 4HRXA 1Y37A 3AJAA 2GBCA 3QPAA 1A8SA 2WU3A 1ETHA 3TEJA 3KDAA 1JKMA 1XLVA 2ZVDA 4P9NA 5HCUA 4RE6A 1WPXA 1JMKC 1EI9A 3P2MA 3WKEA 1TCAA 1J07A 5SYMA 3TRDA 2Z3WA 5CH3A 1XRPA 3GBSA 3STUA 2HRRA 4OSEA 4B6GA 3NWOA 3OOSA 4PF1A 3O4GA 1Y7HA 1DWQA 4QDOA 1VXRA 2AJLI 3HABA 1CUXA 2CKMA 1GKLA 4XX1A 2OCLA 3C87A 4MYSA 1UT6A 4EHBA 1XQVA 1AMNA 1HDEA 2HU8A 4NVRA 1CUAA 1XRMA 2VEOA 2WG1A 3QZUA 3E0XA 3M3DA 1H23A 4UBLA 3LLCA 1JFRA 1UKCA 4AXBA 1UK9A 1XRRA 1ZJ5A 1HKHA 3C6ZA 4OB8A 4Q34A 3EIOA 5C7YA 4GHWA 5HF5A 1LGYA 1MN6A 3F98A 5T4BA 4N8DA 5CT8A 2G5TA 1AKNA 4OYYA 2O7VA 1CUBA 1KEZA 1XRNA 1BN6A 5JYCA 1DT5A 1LPPA 5HZGA 3IUNA 1QIGA 5FLKA 1DINA 4PSDA 2QUAA 1UOOA 4ZGBA 4BZWA 2PPLA 2OGTA 2PX6A 3FYUA 3PE6A 4N8EA 4QE3A 1GT6A 4W9RA 1VZ2A 4PQEA 5D6OA 5IVKA 3N2ZB 2VF2A 1CUWA 4MYDA 3WL7A 5ALIA 5ALYA 1UOPA 5CW2A 4LHEA 1W4LA 5EHQA 4OB6A 6YASA 2CMFA 2WUFA 1JMYA 3FWHA 4P92A 1MX1A 5AKXA 4Y2RA 4YK7A 3G9UA 3WWCA 4BAZA 3W05A 2WHQA 3R3XA 4H77A 2RIPA 2Z5GA 3RKSA 1E8DA 3W9UA 1VOTA 3VKFA 1TCBA 4L3WA 4A5SA 2XLCA 1XKTA 4J3JA 3STTA 3C70A 4J0IA 5JZSA 5IVHA 3SK0A 3FVTA 5ESRA 3GUUA 4PSCA 4CCWA 5AM0A 1CFJA 4UFOA 3BIWA 5K3CA 1DWOA 3ZPXA 5CH5A 2B9VA 4QA9A 2Y2UA 4HS9A 1LLFA 4J7AA 3WL5A 4AO8A 4C87A 3R3VA 3FSGD 4PV7A 3V48A 4JH0A 4BATA 3DS8A 3WA6A 1QIKA 1E8MA 3OTQA 1TAHA 1IVYA 1GPNA 5JAOA 1XROA 1PJAA 1A7UA 1G4HA 3DDUA 4U2DA 3QMMA 4WCVA 4C01A 2RAUA 5CT9A 2JGMA 1U4NA 5K5EA 3BXPA 3RM3A 3SWWA 5EHXA 3L1JA 5AK3A 2E3JA 2V96A 4MWTA 1XZGA 5AI8A 1SCKA 5ALNA 1IMJA 3OURA 5ALOA 2HRQA 1MX5A 1QFMA 2PKYX 3DLTA 1R50A 5JZBA 3H19A 2QXTA 5ALZA 5D7BA 4U2BA 4WFKA 4BCCA 4MQLA 1XZFA 3M83A 3WWEA 2WSLA 4X6UA 3T52A 3WZMA 5AOCA 2G63A 3WKDA 1F0NA 4UHDA 4JEIA 1N5MA 5AKIA 1Z68A 5CH8A 3L1IA 4BCBA 1XRQA 3M82A 2IIVA 1A88A 2XUPA 4DSZA 1SCQA 4UBOA 4G4JA 5HFAA 4E14A 1XLUA 4EY6A 1K4YA 3Q0TA 2H7CA 4V2IA 4BDTA 4GWLA 2HA0A 5HQ3A 3G7NA 5CBKA 5HF8A 4RE5A 3STWA 2ZYHA 5IVDA 5CXUA 4UHCA 4IO0A 4BE4A 4NS4A 4G8CA 4G8BA 5DTIA 2DCMA 5IH7A 4B9AA 2XQFA 2H7YA 3EBLA 2AJCA 5CURA 3H17A 3OG9A 4B85A 5AM5A 4X95A 4G5XA 4J0CA 5LKAA 1VLQA 3FLAA 2RHTA 5ISMA 4IH9A 4ZREA 1QOZA 2XUJA 5AM2A 1X70A 3ZV7A 4AO6A 2WG2A 3IDAA 3FNBA 1GGVA 4LXGA 3UUEA 1SC9A 1H2YA 4P93A 3WK4A 3H0CA 4ARAA 3VJMA 3ZI7A 2X76A 1J1IA 4KE6A 3SC2A 3V9AA 1LZKA 1JU3A 1YB6A 5BOVA 3R3YA 4GI1A 2QR5A 3TJMA 5K3AA 2VJBA 5D3KA 4D9JA 2WUGA 3ED1A 4FBLA 2XUOA 4K6GA 3HYSA 4X91A 5FKJA 5K3FA 4BTLA 1F8UA 4LXHA 3ESBA 4QDXA 4BC1A 4LYDA 1EA5A 4DMFA 2C0PA 3WL8A 1DQZA 3WK8A 4BP8A 1BCSA 4KRXA 2XUHA 1EK2A 4I19A 3L1HA 1LPBB 4CCYB 3HC7A 1M33A 3ESCA 2WJ3A 3R0VA 3O0DA 1QIDA 4MXDA 2XDWA 2WIFA 5DYYA 5CTAA 1L7AA 2ZJ7A 4YASA 5EGNA 3D2CA 1W1IA 1C7JA 2ZYIA 4J03A 1H2ZA 3KD2A 4UHHA 3I6MA 5AIAA 2CUTA 3HXKA 1ZIXA 1ZGBA 2BUCA 1ODSA 1UK8A 2I3ZA 2BUBA 2I03A 1CPYA 3A2MA 3C6YA 1UXOA 4MWSA 3HI4A 5AKJA 1MT3A 3WMRA 4FKBA 2UZ0A 4FMPA 5ALMA 2HA7A 4CG1A 1QE3A 2WFLA 1AQLA 4L0CA 3V1MA 2GYWA 1MNQA 4C4XA 2XUDA 1BS9A 2DQZA 4UHEA 5A7HA 4C4YA 3G0DA 5AI4A 4X00A 1VXOA 3WKBA 5JASA 4QWMA 5JZ9A 5A7FA 4DNQA 4P08A 1FFDA 1ZI9A 5LZ7A 2XMZA 4X6YA 3BWXA 5IVIA 1G5FA 4LXIA 4PW0A 3W9BA 4BYMA 4BB0A 4J0KA 1CUIA 4Q05A 1YS1X 5ALLA 2C58A 5EFZA 1H22A 5DYTA 5AOBA 4Y7DA 2X8BA 4PO3X 1HQDA 4H7JA 1XZEA 3A70A 4HZGA 1UK6A 1CVLA 4KEAA 4K5QA 1VA4A 5DWDA 3F9CA 2ORYA 4Q3OA 1GQSA 1HL7A 2HU5A 5CRIA 2R8BA 3G0GA 2WJ6A 4HXEB 3FYUC 1X2EA 1BN7A 4QNNA 1ZI8A 2WTNA 1F0PA 2XMGA 2VSQA 3S2ZA 5AO9A 1AC5A 2AJBA 4U2FA 1EH5A 2ZJFA 2WTMA 1ZICA 2QMQA 3D3NA 4DSAA 2WIKA 3D2AA 3BDIA 5DNWA 2BGNA 5AM3A 5DNUA 4B7ZA 3TGLA 2PSDA 1CLEA 1UZAA 1RYYA 2HIHA 5HF6A 1U65A 4J0DA 1XKLA 5DYWA 4NZZA 4CG2A 3KWJA 2WIGA 3GROA 2HHAA 4KE7A 5JARA 4UHBA 4X97A 1YCDA 3FBWA 2GYUA 1SFRA 3LCRA 1K63A 2QM0A 2O7RA 4K2AA 2HU7A 4LYEA 2ZSIA 5EI5A 3I2FA 1ACLA 4AZ3A 1LBSA 2XUKA 3VJLA 4F60A 4GECA 3S8YA 2W6CX 1KU0A 2XMCA 4ETWA 4H7IA 1QGED 3AILA 3I1IA 4KE8A 1EX9A 1FJ2A 2K2QB 3QM1A 5I7UA 1IUOA 5SYNA 2V9ZA 3CCBA 5I8PA 2ZYSA 5AOAA 4HXGA 5F4ZA 1EDBA 3STXA 5FV4A 5T4EA 2VJAA 3H18A 1J2EA 4Y2PA 4OU4A 1B41A 3YASA 4F5ZA 2DHEA 2RGUA 4ZV7A 3MUOA 3V1NA 1UOQA 3E4DA 1CRLA 2XQKA 2NW6A 1Y7IA 4XWGA 4AN1A 2WJ4A 4Q82A 1YAJA 1JJIA 2WKWA 4J0GA 1LPSA 1CV2A 2DSNA 3MUNA 2H1IA 1VE6A 5EHNA 2PL5A 2AJDA 2VJDA 4X93A 4OU5A 3HLKA 1QIEA 2BCEA 5K3BA 1YB7A 5HK8A 2DHDA 4GDMA 4Y2SA 1QLWA 1QTIA 4INZA 3ILSA 3ANSA 2G4LA 1KU6A 2G5PA 2JGJA 2JBWA 1PV1A 3QYJA 3IIIA 1XQWA 4DIUA 1C7IA 4BC0A 2HFJA 3PICA 4QEKA 3WYNA 5FPPA 1VJ5A 1GZ7A 4BBZA 2CJPA 4PSUA 1XZMA 5JAPA 3C5VA 1ISPA 1RP1A 2FJPA 1R3DA 5A71A 5AI6A 2VTVA 1AX9A 3QBJA 4UBMA 5E2IA 2JGEA 2XUFA 1GKKA 5HF9A 5KREA 3PUHA 4OCZA 4JYPA 3H2GA 4EY5A 3O95A 5ALUA 4DNFA 3FAKA 3D5EA 3WK5A 5ALJA 3OM8A 3BF8A 3C6XA 1NX9A 3QPDA 2V97A 4BE9A 4AB1A 5JD6A 1ZI6A 4TVKA 1U8EA 2OPHA 1QZ3A 4Q3LA 4FWBA 2PUJA 2QJRA 5LYYA 4DGQA 1U2EA 4H7KA 5ALPA 3K6KA 3FYUB 1R4ZA 1MPXA 2QOEA 4E11A 2GBIA 1P0MA 2XQGA 2HA6A 2VQ6A 1DT3A 4HTAA 2Y1KA 1CUZA 3LP5A 4B82A 1DX4A 2WFLB 4C88A 2PSEA 2EDCA 1USWA 4EA6A 4E46A 2C4HA 4KJXA 1CUJA 4Z49A 1E5TA 1CUGA 1K6EA 2W22A 3O4IA 4WDRA 1QTRA 4BRZA 3WIOA 3U1TA 1UFOA 4ZRDA 1E8NA 3B12A 4XVCA 1JT2A 2HA2A 1WCYA 1R9MA 2H7XA 3PDCA 4PNZA 3WWPA 1CUYA 4BAUA 1BU8A 4DNOA 4B9EA 1B6GA 4ITVA 5AKEA 2WU4A 3WKAA 4CIBA 1CUHA 3DL4A 3VISA 5ALGA 1THTA 2DHCA 3WI7A 4FDMA 3IBTA 2XQIA 1RWQA 4L9AA 1Q83A 1EDEA 1YASA 1ZOIA 1PFQA 5E4YA 1XZCA 1T4MA 3NOXA 1DU4A 5AM1A 5CXXA 1QIMA 1EVQA 1XQYA 3D2BA 5AKLA 2WHRA 5DTJA 3H2JA 5BV7A 2XMBA 5LIPA 1LNSA 2ACKA 1ZD4A 3C6BA 1E66A 2B4KA 1IZ7A 2ZSHA 1JJFA 2DFPA 4WJLA 2VAVA 5AK5A 1IUPA 4BZZA 3WL6A 4E15A 4W1PA 5KWIA 3CN9A 3BF7A 3BDVA 1QO9A 5FRDA 2OCGA 4FFVA 3WLAA 2QZPA 3G9TA 4H35A 4LKOA 3UUFA 4QDTA 4BTVA 4AMYA 4N5HX 4CCYA 3I2JA 4OB7A 1G66A 3W06A 4C89A 4RGYA 3CCCA 1WB4A 3WA7A 5HFNA 1XZHA 4IQ4A 2C5GA 5LZ8A 1YAHA 1NU8A 4X3CA 1QIFA 1VA5A 3OC0A 3VXKA 3WZLA 5AHXA 1XQXA 3AFIA 5BWCA 4YX9A 1WPRA 2YH2A 5AK4A 1EINA 1YR2A 5ALXA 4EY7A 5JAUA 2RI6A 1QIIA 5JADA 1CR6A 4BP9A 2HL6A 2OQIA 3FOBA 5AJHA 1WB5A 4NMWA 3D4LA 1T2NA 3IUMA 3DL7A 3G0BA 1CEXA 2QUBA 3PF9A 2EEPA 4WY5A 1DX6A 1XZJA 1BE0A 4X94A 3STVA 4DM7A 3ZLTA 3UMJA 4CG3A 2J4CA 3PI6A 1H2XA 3D0KA 4OYLA 1TKRA 3Q8WA 3G8YA 5DNVA 4K6KA 1L7RA 1VE7A 3O9MA 3GZJA 1OCEA 5DLPA 1DTEA 1JU4A 4B84A 2WG0A 3G9ZA 3IVMA 4HRYA 1XFDA 3ZWQA 5LKRA 5HKAA 4L72A 3ANTA 4J0HA 2OQVA 5C81A 2FJ0A 1FFBA 1GXSA 1W52X 3G9XA 3LIPA 3EQ8A 3GA7A 4FLEA 3FLBA 2OXEA 1H2WA 2DR0A 4G8DA 2OAGA 1K8QA 2Y6UA 1MJ5A 1ODTC 1ORVA 1AUOA 2GYVA 1NU6A 5JALA 4JNCA 4FHZA 2I78A 2XT0A 3CXUA 1E89A 2ECFA 4Y2UA 1DQYA 1OXMA 3VVLA 2WHPA 4J0JA 1LBTA 2JGIA 4EY8A 3NGMA 2CZQA 3FYTA 4Y2XA 1MTZA 4U2CA 1WB6A 1ODCA 1EB9A 4Y2VA 5YASA 1FFEA 3RLIA 4DTCA 1QO7A 3WQHA 4G9EA 4OUKX 3BJMA 3WIBA 5EHZA 1MNAA 3FCYA 1N8SA 4ZV9A 2YASA 4N5IX 4QZVA 2QXUA 1ZGCA 3LIIA 1HLGA 1MU0A 4QLOA 2EDAA 2JEZA 4UBNA 1YA8A 4DLNA 2IITA 1QJ4A 3O4HA 3GFFA 1XZIA 2OG1A 1I6WA 3G0CA 4OD0A 4RPCA 2XUIA 2CB9A 4ZI5A 4QWWA 4MEBA 3AIKA 2OAEA 3IUJA 1QIHA 1FFCA 3D7RA 4H7HA 3DKRA 4QLAA 4HXFB 4UUQA 3E1GA 2QRUA 5AI9A 3QH4A 3IA2A 2YYSA 4AMZA 3O9VA 4IH1A 3EQ9A 3I2HA 2H9YA 5ALVA 3QPCA 5FP0A 1XZDA 2WILA 1O6GA 4KAJA 2PVSA 2QVBA 3H04A 4O08A 3AZPA 2VATA 4LIPD 4YPVA 3KOOA 2OCKA 3I2GA 1EHYA 5FPQA 3PFCA 4UPDA 1YS2X 3BJRA 4B83A 3STYA 1J06A 5J3JA 2PUHA 1EDDA 4FOLA 4XJVA 4HVTA 4GEGA 3HRHA 1CUDA 2PU7A 2WIDA 3F96A 4ARBA 1LPNA 5CT6A 1P0PA 2OGSA 3VVMA 3WJ2A 4WFIA 5FOQA 1BCRA 1R88A 3A2NA 3DYVA 2VJCA 5HK9A 2CBGA 5AICA 2XMSA 4W1SA 3QVMA 4CFSA 4AZ0A 2HADA 4C4ZA 1JI3A 2ZYRA 3FVRA 7YASA 4Q1VA 3HSSA 1OILA 2BFNA 4HAIA 4FTWA 1XZKA 4FLFA 2PSJA 5ALWA 3MGAA 2WFZA 1MAHA 4BVLA 4S0XA 3EF3A 2WM2A 4WDQA 3AZQA 4IHAA 5AKYA 3PFBA 5FXMA 5JD5A 2J4FA 2VA9A 4FNMA 1IUNA 2V98A 3IUQA 5ALHA 1W76A 4TGLA 3C8HA 1X2BA 1L7QA 3H1AA 5ALDA
chains in the Genus database with same CATH superfamily
3B20A 1XXHE 5AKKA 4D02A 1V96A 4V24A 3GDHA 2XGJA 1EGVB 4K6HA 1HV8A 3TW8B 1L7DA 2FLVA 3VGJA 1BD4A 3PF8A 1U1CA 3KQHA 2AQHA 1T9AA 2UVDA 5B2ZA 1O4WA 3LC7O 3Q1LA 3X1JA 1TTTA 2YOHA 1MC4A 2YVUA 4FR5A 3K9HA 1W7AA 3R9XA 4GC9A 3EFEA 3AZOA 5NULA 2Q0XA 4JB0A 4YQYA 4TVSA 4G56A 4F3RA 5IJ0B 2ET6A 4F6CA 3G0IA 4QXMA 3RROA 3PXXA 1YDHA 3RS3A 1C30A 1KEEB 3RHZA 4ZHQB 4K6MA 4FHEA 4YAJA 2ANCA 1YVPA 1PW7A 1PQYA 1MVLA 1A1SA 2JJ2A 2YHUA 1MKYA 3BD7A 3EDCA 1MZVA 1CU1A 3E9CA 3VHXA 5JBQA 3W5AA 1B7GO 3OWOA 3PTLA 5HE8A 1XTPA 1E7QA 2TECE 3DCYA 1OB2A 4KAAA 4L6AA 4I4TF 5DCLA 1C80A 1EVEA 2ZI4A 1Z5ZA 2KX7A 2B0CA 2QL7A 1HRKA 3AB7A 3QJ5A 3H7AA 3CS3A 2GJSA 4B4WA 3PDHA 3FB1A 1YRLA 1JVNA 3OQMA 4DCUA 4BKMA 3N2GB 1SIBE 2B2XA 3VC3A 1DFIA 3GN1A 4V02A 1JIQA 2IXTA 3FHLA 3HVIA 5L6LB 1TRKA 4ALKA 2IHNA 3HCNA 4UQOA 2JFNA 2MYPA 4DSUA 2I1WA 4MEJA 1Y1TA 2ZXUA 1FLAA 2BCGY 1ZCBA 5E7JA 1HI9A 3HHEA 4ZWNA 2GPYA 5LNK1 4L50A 4WECA 5CDSA 2GAIA 1G5IA 3UJPA 5L6MB 1Q84A 2NO4A 2UVQA 2X58A 1PK8A 3BZUA 3INGA 3T5CA 2FSUA 5CB4F 5JLJA 4EKNB 2P2DA 3ZLVA 4N7JA 3TH5A 1P29A 4MI9A 1N8KA 2ZI3A 1L7PA 2QJTA 1SZDA 1C0EA 4LZPA 4DXDA 2XXBA 1TQ2A 2DHQA 4P3XA 5CB6A 4L8LA 1LJLA 1R10A 1EFRA 3ZJ4A 3AKZA 2WTBA 1UEJA 1I7DA 1MRNA 1TJ3A 1A82A 3PRJA 3KAPA 3CLSD 3RKUA 1YOBA 2GD0A 1QDEA 1ADYA 3A3YA 1GPJA 1H8HD 4LW8A 1K7FB 2WIBA 4NJOA 4JL5A 1PD1A 4U7HA 3LDUA 3JQPA 4CZ2A 2ONCA 4QYMA 1C9DB 1Y8AA 1V4BA 3UH0A 5KWJA 1AGYA 1M8FA 1XALA 3B5IA 3DE5X 4RWZA 3AWDA 1D2AA 2WHPB 4OHMA 3H86A 3LECA 1Y4ZA 5ALEA 3TLYA 4A8HA 5AW3A 2QBYB 4QNMA 2WV7A 2NWQA 1A96A 1R8SA 2C2OA 1AHNA 2A33A 3QFSA 3VO1A 5HSGA 4FFWA 4W6ZA 4AJIA 5A7GA 2F8MA 3CNOA 2C9DA 1FSPA 3A2LA 2CYBA 4LE0A 4WBNB 4GD3Q 3U7QA 1EB8A 3IPRA 4GKJB 3FOWA 4PTLA 2OYCA 4YMVA 2WNIA 3PYLA 1I94B 3HB4X 1NWHA 3IBCA 3F4KA 4RVNA 4JUBA 3NTLA 1K98A 3DDCA 5A2GA 3ABIA 3KE9A 3DF7A 4NE7A 5BSGA 1Z7WA 5IDVA 1PT5A 1MC5A 4ENRA 1W59A 3GLFE 3R40A 5AH0A 1HBJA 1YCFA 4TSKA 4MVJA 1RHQA 4GNKA 3I6QA 2CEKA 3QEAZ 3K72B 1BEEA 1D1SA 3N3AC 2C7BA 4DCSA 3FIJA 3QOFA 3G0OA 4WXYB 3DOJA 3ZQUA 1Q0HA 3EZ2A 3U48A 2GR9A 3B7PA 1T5IA 1O5IA 4RPJA 4F1JA 2OBFA 2QYHA 4LDZA 1GY8A 4AZ3B 3P0HA 5A0TA 3U49A 4HR7A 1B6SA 3PV0A 3RO7A 2RBEA 2OV3A 3WYAA 1GDHA 1Y3HA 1VBFA 2BBWA 2QRLA 5DNYB 2GXQA 3EZ7A 1EE9A 1YZFA 3HPRA 3CBQA 1LJUA 5AW4A 2Q4RA 5BR8B 1YK0A 3F9IA 2Y8EA 4S1OA 2O54A 3C41J 4L4SA 1Z7EA 4H59A 3E3AA 1BH2A 2AW5A 4KWCA 2GFIA 4ZZIA 2YBDA 3OLVA 4RADA 4WZBB 3WBKA 2PWBA 2ZBVA 1HDGO 3K0FA 5LB2A 5BORA 4HG2A 1OWPA 2BGUA 2TMDA 2XI4A 1NNSA 4IWYA 1SOMA 1XD8A 4K8OA 3B9PA 2FLWA 3EFOB 2E55A 1ZOSA 2IYVA 1A9ZA 1FDWA 2GF0A 3NAQA 3NEPX 1F5SA 1UWCA 3PEEA 5D1HA 4EPYA 4L8VA 3B8EA 3VDRA 1E62A 1GCGA 3PR2B 1G19A 3LY5A 3IUBA 5DRTA 5IAEA 2TSYB 3TM4A 1ESNA 4RJIA 3U13A 2JEYA 2YJZA 4FSDA 1ZISA 1MORA 3SQWA 2V5UA 4YAOA 4HTFB 4I1VA 2H18A 2CHGA 4WXMA 3QMWA 1YE3A 4I4CA 1WSDA 2CYAA 3OPYA 1GCIA 2PPVA 4JJKA 2HA4A 1NBMA 2ZE5A 5AK6A 4H27A 3VR5H 4G9GA 5CMLA 3MC1A 2OB2A 2C03A 3KL4A 4ZQFA 4AX4A 3PJGA 5EUCA 3CLKA 1V7CA 5FLYA 3OBBA 5EZ6B 3ZGOA 4B3BA 3RYIA 1OYWA 4YJHB 4D9MA 1EUDB 4JOBA 2G08A 1LWNA 4PCUA 3REQB 1MX9A 5L7TA 3D59A 2IH4A 4LF9B 1V9LA 1PR1A 4D6PA 3PVCA 5LLSA 4FGZA 1P6UA 2PU5A 3IURA 3KQVA 1G18A 2ST1A 4FQ7A 2HK7A 1V5EA 1OT5A 3OY7A 3QUTA 5EUBA 4HFJA 4D3YA 2R96A 1E1DA 2OGZA 8ATCA 2W2TA 2DU8A 1TKAA 4PC1A 4Q3CA 5AXBA 1M0SA 5ICGA 4U0KA 5HYVA 3IVGA 2QSZA 3E03A 2HLDD 3Q8XB 3K2EA 1K97A 1GFWA 5LZ9A 1CJVC 4K9RA 3LQ2A 4L4UA 2CF6A 2FFQA 3TE7A 1YL6A 2XLBA 1QOPB 3AFOA 4LSZA 5FDFA 2OXTA 3HVRA 2XODA 3F5QA 1LFAA 3DE3X 4R9VA 3B60A 3UKOA 1ZONA 5CD1A 4D8XA 1VMIA 2P75A 3P9YA 4ENPA 2Y99A 5HQTA 2J8ZA 3M6LA 2E9SA 3OLYA 3QXJA 3W04A 2O2XA 1HGXA 4MARA 2VJQA 2DFNA 5DBEX 4IG9A 1ZUNA 4BECA 4ONEA 4ZEMA 1HO3A 4TZKA 4N1AA 2MINA 5JANA 2FWNA 5LBUA 2PXCA 4C4PA 1LBQA 1A7AA 3LXUX 4YROA 2QN6A 5TIIA 1B23P 1W6RA 2XMRA 1RHRA 3KJIA 2W70A 1AO3A 4H3HB 5K8CA 3L4JA 4OH1A 1TI7A 2F64A 4QIHA 4H7DA 1MRZA 2J30A 3EG9A 2W83A 1M67A 4YRZA 3DHYA 1LBIA 1ZR4A 3P71T 2VP2A 2Y0BA 1J2TA 2CXOA 1OQAA 3PQ7A 3I9JA 1L5KA 4LC0A 2OV4A 4GW3A 1NRJB 3WK7A 1MO6A 2XB4A 3HY3A 4X85A 3DLIA 221PA 1WW2A 5DI9A 3WL3A 1HT3A 2BJHA 4M0CA 4U7FA 3SIWA 3CH6A 3RYFA 4A2PA 3EAQA 4KNYA 3HV2A 1QHSA 3F67A 2OECA 1L1RA 1NOJA 4LZAA 3UAWA 3TQFA 1QHIA 2WR8A 2FCAA 1W581 3D02A 3AVWA 1DEOA 3AFHA 1VBNA 3C1OA 4OP3A 2A57A 3IHLA 4EF4A 4F9GA 3GD5A 2QTGA 1J0BA 2RG7A 3O7MA 3I04A 4S2UA 3WLLA 1EVYA 2D1RA 2DULA 1LS6A 3AINA 3BCRA 4KO2S 4X92A 3IB3A 4EJ0A 4BKQA 4NZNA 2AFIA 1EFPA 4FFNA 2Q3DA 1SULA 4A0SA 4IGKA 4D41A 5C4GB 2B7LA 1U9ZA 3R3WA 4JLOA 4QBKA 1XMXA 1X86B 1CB0A 3DGEC 4KQCA 3IUEA 3O9ZA 4RF2A 4DXHA 3ZVMA 4E22A 3GGJA 5CYPA 4EPRA 5CT5A 1YZTA 4DT1A 2YMPA 2HKIA 1G42A 3SE0A 2EFJA 3M4XA 4Q00A 5BW6B 1JSXA 4ZIRA 2AHRA 4CEHA 1Z2AA 1TK3A 1Z4PX 4B74A 1A8QA 1ICEA 3SHTA 1P2DA 3WLJA 1E1LA 1OXVA 2YMMA 2JCSA 1KERA 3GDWA 1FX1A 3RWMB 4GKKB 1IQRA 1QQ7A 3N0TA 2IY9A 4Q03A 3LWNA 3EEBA 1CY4A 2PMEA 4YAGA 1VIDA 4AKEA 1O0BA 2JIDA 1E7RA 3MOIA 1T1IA 2GLTA 3NJ4A 5F12A 3K4PA 3W1VA 4IFBA 5FTLA 4KAFA 4KQIA 4R71A 1D3AA 3QFFA 1MAAA 4R1SA 1W4CA 1FSSA 2WOOA 1J8QA 1HA3A 1MOZA 3E9ZA 4FUQA 4Q3AA 5ALFA 4FZ5A 2UVPB 4OHCA 2IE8A 1Z34A 4V0ME 3RSGA 4AZSA 4C20A 5KAMA 1IOLA 1XK7A 1J39A 2QLMA 3I34X 4GLFA 3Q7TA 4DWWA 5AW0A 4HX5A 1OHHA 1E2BA 1XDUA 2JBHA 3L8ZA 2O4CA 3EXHC 4RHYA 4CN9A 2CNNA 2EP7A 1XBTA 3U61B 3C3CA 3SR3A 2RCNA 3WSVA 4HH4A 5DISB 1L7EA 4OL9A 1Z3CA 4IR7A 4ZCPA 2OFFA 5DSXA 1GAWA 1SUCA 1EFHA 2A4MA 2X0JA 3E27A 2WA1A 3M81A 1YL7A 4BJ6A 3DHNA 5GGYA 5E6UA 2GEVA 1VKOA 4EYKA 4B0PA 4BNNA 2FR8C 1FDTA 4JT4A 4DLRA 4PGMA 4DA4A 3KSBC 3FLEA 3I1YA 4IICA 3PDIB 1J20A 1M1UA 2FFBA 3G6KA 5DDIP 4Z0PA 3RSLA 2Q3BA 5ARBA 5GWXA 4OKNA 1IU9A 4YV1A 4R0NA 1BJRE 1YJAA 3MMNA 4EPXA 4HRVA 3RLFA 4MITA 1F06A 1GU7A 1IJKA 1G8HA 2Q9BA 4XD7D 4MGKR 3REQA 5A06A 4DIMA 4OJQA 3DG9A 4KPEC 1HE3A 1NQVA 4FGWA 4B2IA 1RZRD 5KO2A 3M0EA 3RCBA 5GIOE 3VSEA 5CP8A 1ULZA 2Z3ZA 1EKXA 1DFHA 2Q8NA 2D4AA 1KI2A 4UUOA 1XD2A 1ZK4A 1THZA 2EWMA 4MQFB 4Q4JA 1AXRA 4BAGA 4F3CA 1Z4KA 3O4FA 2QS9A 4FILA 4K9QA 2JFUA 1L5OA 3THYB 2WUDA 3OEYA 4C08A 4IM7A 2W00A 1NMXA 3DLPX 4PIMA 4D9FA 3DXXA 3FUCA 4O8ZA 1Q1NA 4DIDA 2AT1A 3MFYA 2OLEA 4NMXB 5AXAA 2Q7XA 4Q37A 5TXGA 3WYCA 1YS4A 2P78A 1TYZA 1T35A 5IYZA 2OO5C 1Y8QB 3CQ9A 3CWCA 2ZJ1A 3DO6A 4ISCA 2LTAA 4MQ4A 1DBPA 3WV4A 1KGDA 2NAFA 1PVDA 2KLHA 1GA4A 3EQ7A 3H3JA 1C8LA 3M1IA 4HLDA 4ZRMA 4DMMA 3U44A 3AR8A 1BROA 3ICWA 3MK31 4HTFA 4MQFA 3DWFA 4U0JA 3TUJC 1DOZA 1LVHA 3DAFA 5CW1A 1BX0A 2X0NA 2Z1MA 3PDUA 4NEQA 1CKEA 1FEZA 1CY7A 1XMPA 2Y0EA 5EIHA 1T8TA 3NBXX 3CUVA 3ZQJA 4YRMA 3WNBA 2GGSA 1JMVA 3S44A 1ML4A 4ZYVA 1TEHA 2VHTA 3DDHA 2GD6A 1QCYA 2I54A 5DIZA 3OPNA 2GCPA 3D2LA 4MVJD 3WYDA 4AI6A 3DZIA 1V16B 3OECA 1HLFA 4D3ZA 3HZRA 1E1RD 2G70A 3K1YA 1G3RA 3ENNA 4LRXA 4CM3A 3ONNA 5JNRA 4I3FA 1Q57A 1YMUA 3Q15C 2YYAA 3UK0A 3HWX1 4EFKA 1ZNXA 4C7OB 3H1BA 3ZLJA 3ZDFA 1ZVQA 4TKVA 3M2PA 2NSDA 1J4AA 3NRJA 4MRPA 2HWWA 4RV4A 3RVKA 3Q3GE 4NI5A 4PPQA 1PI3A 5IM5A 1BEZA 1LV7A 1WP9A 1SHKA 4Q7EA 3U62A 5C53B 3HXMA 4MVJM 4MKRA 3H2ZA 1E6LA 4KXMA 4EZIA 1TIBA 3ZU6A 1MO5A 2QMOA 2IP4A 4RM2A 1T29A 1CY2A 3N05A 3FRJA 4R9NA 3TRFA 3L8HA 1EVZA 1KZYC 2YR0A 4NWIA 4A27A 4C6TA 5DEOA 3JRWA 3JZDA 3O1HB 2WAYA 4LHYA 4G4GA 1L4UA 3HA5A 4NJEB 2A88A 4J3NA 3HRKA 1DEXA 2R11A 3Q0EA 1OYYA 2ZEJA 1XTJA 1Y8CA 3R7SA 4RLHA 5DK6A 4IO1A 3WGLA 1U8ZA 3O83A 3LT0A 4NFYA 1E1QD 3QU9A 3QEBZ 3RFXA 4UOZA 5CIYA 1A5SB 2WF9A 3LDGA 1MGPA 2J9ZB 4A7PA 3ZW9A 3BK1A 2OCYC 4YQFA 3AIOA 1E1CA 4I81A 5FBHA 3B3QA 2ZRHA 2HMYB 2V0CA 3MCWA 1DSSG 4A16A 1P9NA 4KU4A 1WDMA 1B0ZA 4EAAA 3IP5A 1EP3B 2OLJA 4OHZA 2XCTB 1SCDA 2KHZA 3BAZA 2JH8A 1I3KA 4P3YA 2ALJA 4BQPA 4O3MA 1AVTA 3LRPA 2A30A 2ZBGA 3VKUA 4F86A 1ZIOA 4Q4CA 2DG2A 3FPEA 4JHXA 4CNBA 3IGFA 2B36A 4UMDA 5CJPA 4LYHA 5AKZA 2IF2A 4F8JA 1ZSYA 1UBKS 3P2KA 1C3XA 2O8FB 1YA4A 1FDVA 3TOZA 3FCXA 1E3WA 3ZCPA 3LAWA 5DLDA 1Y89A 4WOCA 5A9TA 3SF0A 2IYZA 1IVNA 3L7YA 3QW2A 3SICE 4UHFA 4A5OA 1U7TA 2AFHE 2INGX 2O2GA 2WTAA 3NG1A 4W6QA 3ORQA 4E5PA 3T1VA 4QBTA 2PZGA 1IBCA 5TMEA 4P2BA 4BBJA 2I8CA 1YJXA 5JFOA 1TQDA 3OIDA 3O8OA 1I33A 2OEPA 2P6NA 2XMDA 4O25A 4PX3A 2OK8A 4UQPA 4XYMA 4BFUA 1GM5A 3OY2A 3LPNA 3H0EA 4J9VA 5ELMA 1Z6PA 2IKQA 3GT7A 4XSHA 3UJNA 1P74A 3GGCA 3LY7A 4MGHA 5DHPA 3ZIAA 1RI2A 1MB4A 3ZEIA 5LP1A 3KB2A 1ZHFA 3TD6A 3ELUA 3PWKA 4PAWA 3N6VA 4H18A 3PA6A 4MUBA 5EVJA 4BGEA 2VXCA 4DWJA 4RMGA 4B6RA 1FQOA 4L5IA 2Q6IA 4PYOA 1J49A 2O3RA 3T7JA 4FFLA 1OXXK 1YACA 5IP5A 3ZHTA 4RTSA 2IYTA 3N7TA 4BVJA 1AB5A 5ULLA 4RM3A 1ZK1A 1ZQ9A 3R5FA 3UT5B 1PNVA 1DARA 3JS5A 1Y5LA 1XZLA 2HA5A 5KS2A 1OXTA 3JQDA 4BQRA 3DBRB 4TKUB 1TAUA 1VKHA 3MWEA 4HNAA 2ECPA 3GNLA 3NVDA 2D00A 2BEUA 4IG4A 3RJTA 3MYYA 4QM6A 2Q4TA 3FCAA 2P2CA 1CDOA 3KPWA 4DV4B 3FNGA 5EXDA 1YGPA 2R5FA 1QZZA 3JAWA 1FLDA 4XVUA 1NJ2A 1GARA 2R6ZA 3N53A 1BMFA 1H2HA 2QUKA 4XDYA 2REQB 2JFQA 3NALA 3RK4A 3VR4A 3ZXSA 4D8VA 2QYTA 1D9XA 3BFKA 4AKSA 5EXXA 1JHUA 1Y4DE 3VC2A 4YV7A 4ZAGA 2H3HA 1H2FA 2IL1A 4B1FA 4B43A 1S3FA 4TLBA 1LPAB 1RAHA 4HT3B 4Y9TA 3OH8A 1CY8A 3NNDA 2XCIA 4KOEC 3FPCA 3GC6A 3PL1A 1Y37A 3AJAA 5TVKA 3SFVA 4LJAA 5IYZB 1YO6A 3GGGA 3OCCA 1W25A 4YJFB 5F7OA 2GAFA 4E1VA 1ETHA 4YBRA 4DABA 3AEXA 1SRRA 2RD2A 2WIAA 4P9NA 4EDFA 3A1VA 5HCUA 4RE6A 4ZCLA 1JMKC 3P2MA 5C1OA 1TCAA 1J07A 1LNQA 3Q87B 5BSTA 4J94A 4B46A 2IPAB 3TRDA 2JJ2D 3FHJA 4URHA 5CH3A 1XRPA 2BZSA 5ENDA 1TM5E 1T6NA 3EUAA 1R6DA 4N0EA 1V95A 4PQRA 3OX2A 1OPXA 2BGJA 1OBFO 2JFXA 4MUHA 4KOAA 2I8AA 4OSEA 2HSDA 4RX1A 2PWPA 4AZ0B 1DGQA 1PCXA 2RHHA 4WASA 5HIMA 3FTFA 2AS0A 2FPRA 3S2FA 3UWKA 3O2NA 3O4GA 3RRMA 1KK0A 3OPYB 2XQVA 1G16A 1U6KA 3O91A 1Z5GA 1A76A 2JHPA 3DZKA 3QSGA 4PCLA 2XBMA 2GN0A 4FKMA 4Q3EA 4QDOA 2CCJA 2YX1A 2VXBA 3KFXA 3TSCA 3U4CA 5BN5B 4ZKDA 1WZNA 3CKMA 1Z4OA 3ZX4A 4PG5A 5CLFA 2ATCA 2V54A 5E3JA 2CKMA 1Q1AA 4IYJA 4RXMA 5EXPA 3TQQA 2AG5A 4P38A 2VH2A 2SHKA 1E5LA 2QTZA 2F2TA 2QW0X 2R97A 2IPMA 3JYNA 4CMGA 5EYPB 4CEJB 2HOQA 4MYSA 4N6NA 2VJPA 4Z7OB 1MD9A 5A3RA 4PG6A 2HLPA 2RK4A 4N7BA 1J99A 3HO8A 4NVRA 1FU8A 4IZIA 2SKDA 4XQ9A 1ZUIA 5GZ3A 3LFHA 1NV8A 3RYCA 5G1PA 3W6PA 4OQYA 2WG1A 4LNUB 1M2JA 3D54D 1ZVMA 3LT5A 5AJUA 4GVPA 4B5KA 3WQQA 5CFMA 1STOA 1XVVA 2LUOA 2WMOB 5CX1A 3LLCA 1S9DA 4YACA 4I0WB 1UKCA 2O48X 1VECA 4A8JA 3OM0A 1FUIA 1J0AA 3PC7A 4JA2A 4NBRA 4HDNA 4DA6A 3BSFA 4DIBA 5JISA 1ZJ5A 1S3SA 5SY9A 4ZCTA 2UZ1B 2UUPA 1FFGA 3HNPA 2J1LA 4EG3A 2NUPB 2XW6A 3B3JA 4XB2A 4DVGA 3PUXA 2Q1YA 3LUGA 4NOKA 4JFAA 1LGYA 4DR2B 2G40A 2X5KO 4WW0A 1KDRA 1ZGGA 2V3CC 1VLZA 1U5BA 4DLPA 4RVCA 2G5TA 3GLIE 3C4JA 4LJ4A 3MWGA 4RFSB 2PYZA 3AHIA 4AZVA 4G37A 1G4UR 2O52A 4PYIA 3LX8A 3GW8A 5G0WA 1CUBA 1Z33A 1JHXA 1GGNA 1SCNE 1TM3E 1H0HA 2ZIUB 4KKXB 3ABQB 2IW1A 3FI0A 1BN6A 3ZWKA 1OTYA 1V1MA 1T5SA 3GX1A 3E9EA 4XGNA 4I50B 3GP8A 4EPWA 4REMA 5HZGA 1J8FA 4LQDA 1DINA 5DK4A 4QTYA 5HZHA 1BMDA 4WCFC 5INTA 5DWVA 2PPLA 3E82A 4LXYA 2OGTA 1UUFA 2PX6A 2C61A 4MW6A 3RU2A 3OOHA 3PEVA 4EENA 1VE9A 2F1JA 3PHJA 1J1ZA 4K6OA 1COZA 3N8HA 4M9CA 5FYDA 2DUMA 1VZ2A 2HU2A 3SC4A 5KJ1A 3RVQA 3Q3CA 1NQ5A 1P8AA 1OX5A 1GPH1 2VF2A 2YW9A 5SYAA 5DSTA 2OR3A 1YMQA 3K4HA 1G5TA 2Z56A 5DLYA 3WB9A 3PBKA 2UXBB 1T9DA 1YL5A 2I2CA 4BNFA 2WMNB 1W4LA 1NI5A 1X42A 4LHEA 1KARA 3KJFA 4I9NA 4OB6A 1Z26A 2VRCD 2P9GA 3AXTA 3EGXB 3LL7A 2WUFA 4AICA 5A9SB 2XVAA 4RFVA 1A8PA 3OTWA 4IS3A 2WJHA 3T5GA 2PNFA 4UAJA 3FWHA 4QQNA 5CNIA 4AJKA 3V7FA 4MPPA 4A92A 1LS1A 3QVXA 2A7QA 4P92A 2QNBA 1L8LA 2AG6A 1MX1A 3Q7QA 2EFDB 2GZHA 5AKXA 2WPDD 2Y27A 4ZT4A 3R8XA 1FXWA 1X15A 2GPTA 3DDWA 3KX2A 4AG5A 3OC6A 3G9UA 2A4KA 4BAZA 3EOZA 2P1DA 2H63A 3W05A 3C1TA 1E5VA 2WHQA 3UXHA 3OIGA 2P77A 2VZLA 2BR4A 2J67A 3L0ZA 3R3XA 5L3ZA 3T3EA 3NOQA 4EF6A 3GJ6A 3Q41A 5B7PA 1N7JA 1E63A 2HQRA 4HEA1 3O4RA 4B6FA 4JI1B 2WEKA 4BV8A 3Q8KA 2GETA 1UINA 2QB5A 4IIJF 2MSLA 1P4RA 1Z73A 1H6BA 3B1ZA 3RBZA 4YEDA 3T3DA 5BMOA 1IY9A 2VSFA 1PD0A 2H5JA 2PRSA 3KSUA 1B42A 2DVMA 3VKFA 4C0BA 4DDWA 4ZHSA 1D2NA 4KAXA 5G4KB 1KRWA 4RF5A 2DPXA 2XLCA 3A6EA 1PNQA 2J0VA 2JLRA 3AFGA 3EA4A 3STTA 3R77A 1WUHS 3C70A 3TLMA 1N6OA 3EIXA 3TINA 4DV6B 1JFFA 2WA2A 3VSCA 2B69A 2H5LA 5MF6A 3AEUB 3FVTA 1Z56C 1GIAA 1II0A 1TLTA 3G2NA 5ESRA 1RR6A 4NBTA 3SDBA 4CM6A 2OILA 4W82A 5JS1A 1D1QA 4D96A 4BEBA 1O3YA 1PJBA 3K16A 4QULA 1CFJA 4J9UE 4UFOA 5SZIA 1HSOA 2R6AA 4OKIA 3DOOA 4ZC8A 3JARA 3U9SA 5C34B 1DWOA 2VEDA 2W2QA 5B3KA 2XYRA 5CH5A 4OA5A 4QA9A 1ECBA 2Y2UA 3REFA 2GT1A 3H5OA 4XW2A 1JB1A 3WL5A 5JSQA 1K5DA 1P5FA 2AFIE 3UW1A 3WMEA 5ECWA 1RRFA 5DBOA 3I9V1 2VDWB 1TQ6A 3KLPX 3LCJA 5EIBD 1JECA 1U7OA 2C94A 3V8EA 5A2QA 1BFUA 2Q1TA 1Z62A 2VRWA 1CSEE 4HB4A 1Q2XA 2VOJA 5J5CA 3ANYB 4FQ5A 4B31A 2GTPA 3CMMA 3WA6A 1DJOA 1XMQB 1I30A 2H2AA 1H8HA 1UH5A 1Z7YA 2OUKA 4DJAA 2O5VA 1D5WA 1RPNA 1VKZA 1E99A 4BVEA 4YXWD 4RDCA 3RNOA 2NYUA 3CPJB 4H17A 3E9NA 3U9TA 3PC2A 2O50A 3L8GA 3VR4D 4TUYF 3QKRB 3QELA 4REQA 2V6MA 1X38A 4HVCA 3L7IA 3N0RA 1BGWA 4FWIB 4LXXA 5D5QA 2WPNA 4GI5A 2H2IA 3DDUA 4MR7A 3ZZ1A 5C4IA 4UTVA 1F51E 4XX0B 3NO4A 1G6Q1 5F76A 1Z2NX 4GYWA 4IGFA 4WCVA 5DEIA 1PWYE 5JO0A 1XC7A 3SXPA 2ODTX 1CJUC 2AN5A 3DUFA 4YUWA 4WI1A 2DOKA 2KQUA 1YVEI 1ESMA 1JU9A 3L8FA 1Y8ZA 4NC9A 3PA8A 4Q4HA 5K5EA 3K6SB 4I4TA 3JZMA 3AI2A 3PNYA 4X7RA 1K7SN 3BHMA 1JG7A 2AVDA 3V4LA 3NRCA 3E0QA 1C1YA 3DHVA 2V7QA 1SCKA 1ZD8A 4FX2A 1KC1A 4U8GA 5ALNA 4C3UA 1Q20A 1IMJA 2ZCVA 4Q7LA 1R0RE 2ZPAA 1K3FA 1TAQA 2CNWD 4QOEA 1SU4A 4RSRA 2HRQA 4BU0A 4N0PA 1IG3A 1QFMA 1UPTA 4G89A 3DLTA 3G3EA 4RFLA 4XQ0A 3H5WA 4JP2A 5JZBA 1GQ2A 1DRVA 3DC2A 1NZDA 4YRQA 3ZE0B 4JJ8A 4Z86A 4E07A 4CETA 1BQEA 1IK6A 1Z2CA 3GU3A 3CRNA 4LGVA 2NO7A 2Q99A 3LWBA 3RAGA 4ZCIA 1Z22A 3OJXA 1Y4SA 2A5LA 4CT4B 4JV5B 5CFRA 2FEOA 1YUNA 1U3CA 3SR4A 3U1VA 1HDRA 2AUMA 4L9SA 3VNAA 2GFQA 3QK7A 2GN2A 2XNDA 3MWYW 4JVNA 4NLLA 5DHSA 1JQLB 1E9FA 2CL7X 3I4LA 3IQDB 3D6TB 4M6WB 4Z3DA 3RRXA 4Y6LA 1C9KA 521PA 5LBIA 3W8EA 3ZYZA 1VSBA 2W6OA 3D6NB 3WWEA 3KPJA 2AKAB 3T52A 1BFDA 4JOCA 3OMLA 5AOCA 5BV0A 2XEXA 3C7AA 4EOGA 1EVLA 1P8JA 3P5BA 3ZE2B 4AYTA 4ETIA 1CE8A 3PX3A 2VKTA 5CAEB 1PFYA 2GEBA 4QJ4A 2ZR7A 2QZZA 3KU1A 1H94A 1M2FA 2B99A 4KYUA 1EQ2A 3H75A 3HZZA 4LTDA 4BCBA 3CW9A 2IIVA 4H1TA 3X44A 4AM8A 5B36A 3H9BA 5DNAA 1O57A 2QTVB 4L07A 2W8BA 4MV4A 2GA8A 4XLZA 4LDNA 2HV8A 1PEDA 1WU8A 2PXAA 3ZWYA 2J9YB 2ZSJA 4E14A 4O63O 4OHXA 4EFLA 3OQ1A 1DG1G 1AUVA 1RAAA 4Q4LA 4TLLB 3D1LA 2RGGA 1QE0A 2SNIE 3SXUB 2EZ4A 5L4LA 2IVZA 1LTHR 1RYEA 1PEYA 2ZJ0A 4E5DA 4G26A 2NQ2C 1XWWA 3L7JA 3O1IC 4I4NA 4TTIA 1WVGA 3SYTA 4LJSA 5CBKA 3OZGA 3L07A 1CG6A 1M73E 4UOQA 2G1JA 3SR0A 1FP1D 5IVDA 3CRW1 2BSAA 2GJKA 4BE4A 1MQSA 3BRCA 3CNNA 4G8CA 4A2QA 5EJ6A 4XR4A 4YGXB 2HLDA 3GVIA 4QAJA 1ANKA 3MB5A 2PGLA 3I5MA 2FX3A 4JLAA 3VUEA 4UDYX 1JQKA 3FD8A 4F2DA 2JFVA 3PWSA 4O0LA 3V4PB 1AXEA 4WZAA 4MYUA 4XARA 1RMTA 5KOIA 1ZUWA 4OG2A 2P30A 3EBLA 1HE5A 3HCDA 4QVIA 3SIRA 4L5CA 1H4TA 1EFLA 2DR2A 1C3VA 1Q1QA 3VH2A 4FI3F 1DJNA 2I2AA 3LKZA 1KZ1A 2ZYVX 4X95A 5C31A 5LUAA 1LW7A 3LUDA 2YMQA 2ADMA 1AZSC 4R2MA 3FUVA 4XUGB 5E7QA 4AJ1A 1AUXA 2WHEA 3FLAA 2RJ3A 4BNVA 4IH9A 1QPGA 3KLOA 1Y3FE 1MW9X 3BPSA 5FCDA 4WN9A 1V1RB 2OHIA 4ND2A 4QQKA 2PUVA 1X70A 1MOQA 4ZO9A 1YQDA 3ZV7A 4ZO6A 4DLSA 3EULA 1N2EA 1GGVA 3O8QA 3QI2A 2JK0A 3BX1A 4J8PA 4IV8A 5BR7A 2M1XA 3SZRA 1CEYA 4CFYA 4HYEA 3IQXA 1PAUA 3GLTA 3DBHA 3DPSA 3IO5A 3OLCX 2BDUA 4J49A 3LYAA 2QTVA 5F1OA 1FUUA 4ZJZA 4ZV4A 1CERA 3GT4A 2VT3A 3H5RA 3RUDA 4JI2B 2AMVA 1FOEB 1YS9A 1QPZA 1XEAA 3BBPA 2BEWA 1XU4A 1EE1A 2JA1A 3KJXA 5JFTA 3EGVA 3LF1A 2OFOA 2WAOA 2J9RA 4ZMRA 3VTFA 4CJXA 3ZBTA 2B98A 1R37A 3A1UA 3QHPA 1UQUA 3BA1A 5BOVA 3DMDA 3R3YA 5JAIA 1Y3CE 1CP2A 3VNBA 1SXJB 1QBGA 4P3PA 5AW2A 1UAGA 1QAQA 2OLKA 1N57A 1VHDA 3DKPA 3TL6A 4QUGA 4JXZA 4Q18A 1GL6A 3OE7A 2OQRA 1NN5A 2FXVA 1HDIA 4NEHB 3EH1A 4MO2A 1GL7A 2ZRQA 4BLOA 1E18A 1NPYA 4R31A 3ED1A 2PT6A 3H8SA 3EDOA 5M7EA 2UZ3A 1WKVA 2VHVA 4OHPA 1N2IA 1NE7A 2XUOA 2XWJI 2ORWA 4FBLA 4PHGA 1ZG3A 2B21A 1BXRB 2EFCB 2W71A 3BKWA 4YNBA 5CFNA 2VHYA 1G60A 1CEQA 2REXB 4U6SA 1FDSA 4JBLA 4NZPA 3ESYA 2FF7A 2I6UA 3DE4X 3M5WA 1W93A 1F8UA 1NQUA 3USZA 1PZMA 4LXHA 3UMBA 4DMUB 1WUJS 4EITA 1KY5A 4BC1A 2GD2A 1JL3A 4Q9AA 2PZLA 4TQ9A 3X1YA 4IIUA 3OZ7A 2OZVA 4KGZA 3WL8A 4DZRA 4EQZA 3RC8A 3FYSA 4FOOA 2H6EA 2LNDA 3F5SA 1BCRB 2F48A 2YQ5A 3FFXA 4KRXA 1YJQA 3HBFA 4M4SA 5AYVA 4ZJYA 4OBWA 4QVKA 4P5DA 1L5HA 4B34A 4S0ZA 2OC9A 1RS0A 4UEOA 2ONZA 1ZN8A 1Z63A 3A31A 1YC5A 2BP7B 5B58T 4NBVA 4NKRA 3R0VA 1RWOA 5DLQC 3O0DA 5KNDD 1TIPA 1L5FA 3SKVA 4YV2A 2FPPA 4BN4A 5T67A 4JWKA 3LO5A 4CF6A 2ATEA 4GG1A 5H7XA 1AKMA 4NOMA 4RTKA 3ZY4A 5DIFA 1PTJA 2V8OA 3EEFA 2WIFA 4R1LA 2WHYA 4UCQA 1ENYA 1P3JA 3B38A 4M99A 4AJHA 2XUZA 4A8JB 2O2ZA 4REQB 2QX8A 5E6RB 4EL0A 5GADl 3GZNA 3HCOA 1DDGA 1S8NA 1LF0A 4KWTA 4LDAA 5EESA 2ZBPA 4U7TB 3VPFA 4LF6B 1UZNA 1W4BA 5D84A 1UDAA 2I3GA 1XHLA 4Y30A 2YVLA 4Z9AA 3WLRA 4ER6A 3P52A 1T5DX 5J2UA 3BFXA 3HA2A 5KINB 2PFSA 2MSKA 5IT0A 4RKYA 3V33A 4F84A 3HKBB 3QKTA 1HOTA 1M2WA 3SC2B 3KV3O 1PT8A 1TF5A 2YV4A 3PXBA 3KJNA 1L1FA 3GEDA 4ETNA 1H2EA 5E0OA 5ADUS 3A2MA 1UXOA 4OOFA 2JLXA 1NW3A 3AU9A 3LUBA 5CIQA 3C1AA 1YQTA 3BZBA 4FMPA 4DCPA 3LFTA 5HS6A 2WFLA 4NZ9A 4L0CA 4U9HS 3UY4A 1ADCA 1JAIA 2AYYA 5TDHA 5CJJA 4C4XA 5C80A 3II6X 1DBWA 1TF7A 4N41A 1JLMA 1IHUA 2B7BA 2DQZA 2VT2A 5AT1A 1FJGB 4I8IA 4C4YA 3V2UA 3G0DA 1DAPA 1K2WA 2EKBA 4F6RA 5AI4A 2IDZA 1JA9A 3L93A 4RTQA 4CQMB 3HL4A 2Q6TA 2HX1A 2NPOA 4GYKA 5A7FA 4ZEOA 2IEBA 2WYIA 1MJNA 2ZT8A 3O93A 3NEJA 3FUTA 5LZ7A 4ITUA 3UK7A 3X2FA 1UT5A 1UC8A 2J5KA 3P26A 5C3MA 6REQA 1G5FA 1U7WA 3NC1C 4YP7A 4L16A 4PW0A 3TSYA 4X3OA 3W6OA 3ZXXA 4BYMA 5HUQA 1SUSA 3PTAA 1GNPA 3V4SA 4A26A 3IMEA 3GXOA 3R75A 4EECA 3MQFA 3TJZA 4EGJA 2V74B 2C58A 5KJEA 1B4DA 3GNTA 1H22A 3GMSA 3NDIA 5DYTA 1IRXA 3DEFA 3JQ9C 1DPFA 3K92A 3VR5A 3TSWA 4RDIA 5TB5A 2CSXA 3TCXB 5B64A 4JJZA 1B3RA 1IHOA 2O05A 4I4LA 5KUTA 4FN5A 3R0XA 3F6PA 2CVQA 3WDMA 4IKOA 4IIXA 4D0NA 4QJ3A 2PGOA 5EJ7A 3F49S 1G41A 5I6DA 4HZGA 5A05A 4MYRA 4C0LA 3B3FA 1B26A 2FZGA 1IBSA 4G1EB 5AVOA 4JOQA 1YDMA 5EKXA 3KRTA 4EVRA 2RH5A 1VA4A 2BEWB 2QTAA 4NCKA 2X7JA 4LDPA 3ZKWA 1FVXA 3R5HA 4RTNA 2EIHA 4FZJA 4J16A 5IANA 3ELWA 1JQBA 3D4IA 4LQCA 4O5OA 3KLNA 4RMIA 2ZUUA 3NHAA 5CX4A 1T34A 2OSVA 3LI2A 5AMXA 1X2EA 2V5AA 6PFKA 2H7VA 3TKLA 1B16A 9ATCA 2I3AA 4ZVMA 4DV1B 4D2IA 4ESVA 4IQ0A 1N25A 1VJRA 3DNFA 3W2FA 2CUKA 3OQHA 1VE3A 4OXXA 1Q1GA 4B6EA 1T9CA 4N3AA 1E1QA 5LQRA 1RHMA 2DUWA 3H3XA 3ZVNA 3NIDB 2JHFA 2GCOA 3S2ZA 1A9OA 1AC5A 1FYVA 2AJBA 3DMFA 4TYMA 4U2FA 4RKQA 4WVFA 2J33A 1P5ZB 4YJFA 4PEVA 1XPRA 2E89A 2DYKA 2QQEA 3NHZA 3ZWPA 1TZBA 2HHLA 4JGGA 4ZQBA 3TCNA 2P40A 3OEHA 1RDFA 3GAZA 1HMPA 1Z35A 5A5FA 5AM3A 4AY2A 1JDZA 4XJSA 2JI4A 3IIJA 1SBZA 4ZAYA 4FCTA 4PFSA 4G0XA 2ZCJA 1J00A 1RYYA 1OSNA 1V1MB 2QZ9A 4TMYA 5HF6A 3RVNA 3UMSA 4M6WA 4GI3A 1YS7A 2VYCA 3W2IA 4J0DA 3ZGNA 2GHIA 1T8WA 4NXMB 3LT1A 3ORFA 1DELA 3U5TA 4WKGA 3BERA 4IOMA 4M49A 1WSWA 1WR8A 5T8KA 5KDDA 1KNXA 4GYJA 1MV8A 4KE7A 4XGIA 3Q72A 3T7RA 1BOFA 4UHBA 3P4UA 3VFDA 5FA6A 3OETA 4ZZ0A 1XP8A 4R81A 4FEGA 4O4IA 3PFWO 4O4JF 3NP9A 2QRKA 5K45A 1SEVA 3GH1A 5HJEA 4ZZ2A 3ZCRA 5AVWA 1K63A 3VHLB 4Q1EA 3DLAA 5EOVA 5C1DA 4K2AA 5B37A 3JVDA 4C78A 4ZFNA 1XDDA 2L42A 5EI5A 2EU8A 4TROA 2Q5EA 4GVXA 4EHKA 3I2FA 1JEQA 2XUKA 2YIJA 3ET4A 4M3NA 5JCJD 2AQKA 3IMKA 4QJIA 2VUIB 2I8LA 2B94A 5DSZA 5K09A 2F3UA 2XMCA 5EWJB 5GM1A 4ETWA 3PQ3A 2I4NA 4MTCA 3R8CA 1AO0A 1RPJA 1K1EA 4KE8A 4FIZA 3QM1A 1U5AA 1X0VA 1E94E 4RHXA 3P20A 1PVOA 1ACMA 2P7IA 5LYJA 1MIOB 3CCBA 1U0GA 3UMMA 1GZVA 4RJKA 3OQNA 5BNIA 3UHPA 3SQOA 4IIYA 2I67A 1P45A 2YWXA 1O0SA 1FYWA 5C52B 2P9TA 2GPWA 4C7BA 4LI0A 4DC9A 1FQJA 2YZGA 3I9OA 3QUSA 1J2EA 2VI5A 3VO8A 2A1UB 2F1OA 4BKRA 1RFLA 1T3SA 2J6BA 3IHTA 3T7TA 3O4VA 1JB9A 6Q21A 4UEJA 5H59A 5DH9A 1M1XB 2WWVD 4KQJA 1C9YA 5JR3A 1F60A 1OAKA 2KPOA 1KH2A 3BTOA 3KKQA 1L5VA 3WLKX 4HHEA 3FKSD 1MIOA 1NDQA 1T0BA 1PVVA 2DHEA 2ICAA 1R9JA 2PRJA 2RGUA 2TMGA 4GOKA 4J7CA 2VP6A 3QFHA 2G8LA 4ZV7A 2NXWA 5U1PA 3OCJA 5CGQB 3VV2A 2VUUA 3GDOA 1CRLA 4M89A 4OHKA 2WSSA 2Z2KA 2ZIXB 4PSVA 4MLDA 3PQ4A 1HUQA 4LEIA 3T5DA 4TV8B 2PL9A 4NU6A 4AN1A 1AS3A 1YC2A 3ZWOA 1JEEA 3ZJYA 3D4OA 4EMSA 5J5AA 1YAJA 3L06A 5DVZA 1F0YA 1OLSB 1LPSA 2AR7A 3JU3A 3JY6A 4BFWA 2X3YA 2GYYA 1WUKS 4XRGA 1BEUB 1S2DA 4DM3A 4MQEB 5REQB 4E21A 1KIAA 1W46A 1CIVA 1YQUA 2I76A 2C2YA 4B8WA 5EHNA 3NBMA 4YONB 1Y8QA 2AKYA 1NC1A 2PL5A 2WBLC 2VJDA 3OX1A 1BWQA 4RKRA 4K9KA 4X93A 4Z7QB 5IBPA 5DHRA 1QYIA 1ENOA 5T5QA 2XY4A 3OWHA 2EF1A 3QNUA 4O5AA 4D3XA 4DILA 5KMGA 1P73A 3OP1A 5FL3A 5HK8A 4DANA 1QZTA 3QBDA 4A0HA 5IHXA 3NHUA 1ND5A 1QLWA 1ZN9A 3AR3A 3GRAA 3KSDO 4HQFA 5HZKA 3H42B 1GVHA 1KU6A 1O58A 3O2QB 2O57A 1ETUA 3H2BA 2WU0A 4H1UA 4UU7A 1X0XA 2VPYA 3N2IA 2EG5A 3N6XA 2WP0A 3KEGA 4JC4A 4LJLA 1E9EA 1JFFB 1FU4A 1Q2UA 1VHJA 2FWIA 2VH1A 4J4BA 5H4HA 4B17A 2C7GA 1XQWA 3JARB 1C7IA 2XOKD 1I3LA 2Q1WA 3Q85A 1QVRA 3B78A 4MX8A 2PXHA 4IFIA 2Q3CA 1H9AA 3VTAA 1P2VA 1KO5A 3X1WA 3KJQA 3GH3A 3NHWA 5JHGB 4Q9HA 4BNDB 2WU8A 4OXQA 3U7JA 5BV2P 5FPPA 3LDAA 1G4AE 1Q21A 3WQSB 4G5SA 1O8CA 4U2KA 4N03A 5ITSA 4BBZA 3GF4A 3DVSX 2CJPA 3NHFA 4KUGA 3FSRA 3MJTA 5TQ0B 3AF3A 3FKQA 1M76A 4WEOA 2O7QA 1KI8A 3Q12A 3AUAA 3RG8A 3SE7A 4O1HA 2V8BA 2W2OA 1XAHA 1GLGA 2NSYA 3GNQA 5CEFA 5KKNB 1R3DA 2C5LA 5A71A 2QRNA 3MJVA 3VSBA 3T95A 5IDYA 2MTBA 2HH9A 1AX9A 1TTHA 1PJ3A 4WXPA 4DBVO 4LK3A 1CYEA 4XXHA 3IBGA 4YVFA 5B6IA 3T9EA 5HF9A 4GX5A 4DMLA 2ZXEA 4QPJC 2C83A 4BNTA 1QQTA 2JLSA 3KG2A 6GPBA 4PNEA 1YTLA 1OF1A 4EY5A 2E85A 1AN9A 4CKWA 1IIBA 1Q1EA 3IDZA 3FDJA 4FK8A 1U2RA 2QWXA 4JUDX 3FCCA 3RRFA 1KXJA 3WK5A 4BP3A 4C5BA 5A5EA 1OH6A 2DF8A 2WM3A 4G4SO 2GDJA 3EODA 1FRFS 4GS5A 5C7OO 3DT9A 4QTXA 5A1JA 5LWQA 1GTVA 3BF8A 4NENA 4Z4IA 4PIPA 5H0IA 4QTZA 4KQ6A 4F71A 1F9AA 1PN3A 2OZPA 1NX9A 5L3QA 5ELXA 3OA0A 3QPDA 1GAXA 4CVNA 1WKCA 2IHBA 4IBOA 1QANA 1VGRA 3DMTC 2I7CA 3TNFA 4LNHA 4MS3B 5E6UB 2CD7A 4XGRA 4CMKA 1UPFA 4TVKA 2OPHA 3CNQS 2HF9A 2W6ID 5DOVA 3BD8A 2H1CA 3PD7A 4Q3LA 1BIFA 1Y3AA 2PUJA 2OA0A 3EPHA 1ZHHA 2X5NA 3F7MA 4G5QA 5COQA 1JP7A 2ZBQA 1PGJA 1XU9A 1BHO1 2NIPA 2PRYA 3M5DA 3U3KA 1IVSA 1GKYA 2BZ0A 2HDOA 1C7RA 1L8AA 2PN1A 2R48A 1U3DA 5I48A 4TYNA 2QOEA 5F1YA 3Q7RA 3DMHA 5FADA 2PBZA 4I5EA 4MHOA 5LA6B 1KR2A 4NFLA 1OD6A 4Y0AA 2BFFA 1N6IA 4HYQA 2A94A 2AOTB 1JSLA 3AUYA 3ABOB 4RIIA 3RVRA 5K8TA 5KOJA 3GUZA 3FRHA 3OCVA 1TJNA 4HTAA 4K1XA 3DAPA 1EZ4A 3VPXA 3O38A 1JKFA 1LLUA 3MMPA 3ZZTA 3T7AA 1ODFA 4ZT5A 4B75A 4ZDIA 3UKJA 5C7IO 4FNOA 1OLUB 3A28A 3N74A 2VH5R 1ECJA 4E13A 1RIFA 2P9HA 3W3AA 2BKVA 1RQXA 2DBVO 2PJDA 4V2UA 4AKHA 4F7DA 1FUYB 4RAOA 1DEKA 2R4QA 3I01M 3SP1A 1GZ6A 3D5TA 5KYYB 2O1EA 2VKQA 3CIFA 2G9UA 4BNGA 3FPBA 3LZ6A 1CUGA 3SXJA 4EP1A 2PZBA 2VRCA 1II8B 1TVKB 2L69A 3ZQ6A 1JHYA 1L7NA 5BMVB 5HZMA 4PLVA 1YZQA 4XEHA 5B4UA 1LF5A 1SBCA 3ND9A 2ZQ5A 1CEEA 1HYEA 4OHUA 2HMWA 5LMZA 5G02A 3Q2OA 4W5TA 3E3MA 4F92B 4RW0A 4HNSA 3RH0A 4FGJA 4BRZA 1DO8A 5DBGA 4NMHA 4N01A 1YOVB 3G8AA 5DHTA 4TZTA 1SXJA 1LI7A 2EKZA 3CLTD 5H5JA 3U1TA 3HEBA 2Z5LA 2EATA 5AJVB 2PUAA 4H4CA 2GEUA 1KH1A 1Y5IA 3RYHB 4HFMA 4IV5A 4TX1A 5H3LA 4KPYA 4CEJA 1WPGA 2O8BA 4XM0A 3E7DA 1P19A 3M4NA 4RFSA 2AN4A 3NFRA 4PGGA 4AY5A 2GILA 4WPGA 3AEQB 2H7XA 2QE7A 2WJAA 4PNZA 1XJCA 3W4IA 3WWPA 1PGNA 1TDJA 2OP1A 3NVAA 2X1LA 1TX4B 3FNQA 4KZKA 4JLBA 2JZOA 3FBGA 1KY3A 2QTRA 1W4ZA 2RGWA 3VR4H 1NW4A 3WLHA 3NM5A 4HFNA 3P9RA 4QO8A 4EZEA 5F64A 4KWIA 4DC0A 4CTMA 5JNLA 5JMWA 1AMUA 1TZJA 3I2YX 1V25A 1PBTA 1Y48E 2IKSA 2QD4A 1KTVA 4DMGA 4GZLA 2H4HA 5FO0A 3V4VB 3Q88A 5H8WA 4BMXA 4B9EA 4DQXA 3TG8A 5FF9A 3CHYA 3AHCA 3IEUA 4I1PA 1FYXA 3GLIA 3UMGA 4OMUA 2QX4A 5BVHB 5J9FA 3RU7A 621PA 3KEQA 3D6JA 4G65A 2C07A 4DREA 1ORTA 2IXGA 3C0KA 1NVVR 1J7JA 4MYCA 4L4XA 1WIWA 4LSGA 2W6JA 2XQIA 4K88A 3K9WA 4J1NA 5GP1A 1TO2E 2BFEA 2ZPTX 1V37A 2W98A 4L9AA 1FMTA 4MKFA 2M6RA 1L5YA 1ESEA 3DV0A 5IYZF 5FNVB 3V7NA 5JSZA 2VPZA 1HWYA 4EQ6A 1OV6A 3JR7A 3HADA 3DBRA 5ILOA 1P5HA 1DWUA 2JD1A 2LCFA 3K70B 1R5NA 1T4MA 2OM2A 4FHFA 4FKZA 4Z2AA 2QQFA 1C3EA 4HGZA 1WTAA 4EJ6A 4G0PA 4D8YA 1T24A 2A9JA 3HKDB 4P53A 4YS6A 5DGHA 1JR3E 2JK1A 1L3BA 2SCUA 2O2DA 2V1XA 2NUTA 3ZVLA 1SZJG 5CA0A 4EI7A 4DJEC 3IAS6 3UPDA 1JDBB 1T1GA 5HEKA 1SB8A 2FN8A 2HXSA 3TZBA 4KQWA 3QVOA 4KREA 1KAOA 4N6GA 3HYLA 1UEIA 1LNSA 3MWLA 2PGDA 5I3ZA 2DQKA 2ACKA 2VHEA 2FPGA 1K6XA 1DC7A 2O5CA 3LLMA 5GONA 3RS5A 4C6SA 1E66A 2GARA 1JWBB 2XOKA 3VZDA 1Q0UA 2G9QA 1WOYA 3OQOA 1JJFA 5LA6A 5EP4A 4PWYA 3OAAD 3PUZA 5TEWA 4WJLA 5K6AC 3R5XA 5CLJA 1WNFA 4U5XA 2X9VA 1SK9A 1JPJA 4MS1A 3WL6A 4E15A 4ZDWA 4QUEA 5JZSA 1VJCA 2H2GA 3D6MA 4LN1A 2I4RA 3FOEC 3FVWA 2OCGA 1P7WA 1WXGA 3KBOA 1JILA 1E3WB 1QV9A 2AGVA 4PAOA 4ZVUA 4C30A 4BX2A 3GDFA 4C0AC 1E61A 4HAVA 2FMIA 4LKOA 3UUFA 4RTPA 1EFCA 1HFJA 3EBPA 4Q9IA 1NONA 2HBYA 3ZV5A 1N36B 1XPOA 1OGYA 1Y80A 1CD5A 2VYND 3KIPA 1M0WA 4OB7A 2JIZA 4UHJA 2QAGB 3R24A 2VXYA 4HDAA 4DQUA 3GHYA 3M4ZA 5DASA 1Z45A 4Y8VA 2VZ8A 4JASB 1LJ8A 1QO0A 3LXXA 3NYQA 2JCVA 4WWHA 3JV7A 3JQ9A 5HFNA 2Q5CA 1Q7BA 3MJ4A 1WW8A 3I3SR 4DHWA 2BSXA 1Z8NA 2XGOA 1F8GA 1E9DA 2CDAA 4HPWA 4TTQA 5LZ8A 3O3CA 3WYGA 3EQZA 1TEXA 3KQYA 1DBQA 2AEMA 3KO8A 4RS3A 2DB3A 4OHWA 4NECA 4G5GA 2GFHA 2ZWPA 3DV2A 4NG4A 2NT3A 2E6KA 2P5YA 1QIFA 1DRJA 5LC1A 3AGPA 5JVDB 1QGAA 1ZH6A 2H2WA 3GIWA 3KUKA 2PRKA 1HLPA 1XQXA 2PT5A 4QXQA 2F59A 5IBQA 4LV6A 4YCDA 1VP9A 1SUWA 1WPRA 3W9YA 3OLWA 4J4TA 1V16A 1G9XA 4MKZA 5FI3A 2RGCA 2W6ZA 4OI1A 3MXOA 2HGSA 3CLSC 1XA3A 3I0NA 3CF4G 5ALXA 3RVJA 1D09A 5EZYB 2FZCA 5JAUA 1N5KA 3O8BA 1U99A 5JADA 1VLLA 4ABYA 4US2R 4BP9A 1H2RS 1Y63A 4GUDA 2HL6A 2P91A 4NJEA 5TGTA 3QX7A 5KU1A 3K9GA 4RLSA 3JD1A 1THMA 4DQKA 5JECA 1WB5A 3FVQA 4LWOA 3VYRB 1ZEJA 2Q6LA 4EH1A 4WAUA 4RZHA 4WLEA 3NWEA 1ZNZA 3DL7A 4NK5A 3TEMA 2NQ8A 1YH3A 3AK4A 5GQSA 1ZUHA 3PF9A 2R47A 5D3MB 3IEXA 2Y1LA 3N9IA 1XZJA 4WY5A 4A8TA 3HM9A 1BE0A 1XDBA 2PQ2A 4NDAA 4NZYA 4X94A 2YXDA 3L7DA 3PWTA 2AH5A 4R3UC 2I4OA 2X6TA 4RCVA 4RL6A 5ESXA 4N54A 4WCFB 4X44A 5ENVA 3RSOA 2G4CA 2HQBA 4DBLC 4DIKA 2CHUA 3FHOA 5HIJA 4C5AA 4B3FX 1NW8A 2MU1A 2P2GA 5IARA 1P2BA 2BBTA 1VPEA 3TQOA 1R0XA 1E9AA 1H2XA 2Q50A 3N07A 4HWPA 5G53C 1YE5A 2PWAA 4QOJA 3G8YA 4G1UC 2HMVA 1QP8A 2D2IA 2D1TA 1L7RA 1NIJA 2UDPA 3A9VA 3GOHA 1L8QA 4JCCA 1O94D 1OCEA 4A82A 5C2JB 3X1DA 1XYGA 4F91B 4BLQA 4AECA 2WG0A 3M6MD 5E7MA 4ZVVA 4MYHA 3IVMA 3OCUA 4R54A 1XR3A 1JQAA 1M6EX 2HZBA 3VR6D 5LVAA 2QTNA 1I9CA 2JDID 2C59A 4I2VA 2FQ1A 4Y6QA 3OCXA 3ZWQA 1CW2B 5F2KA 2Q7DA 4QT4A 3ANTA 1M1YB 1Y3IA 4X41A 3N59A 2Q0SA 4HUTA 2FJ0A 1C30B 2DTDA 3U4HA 3S2SA 2W8ZA 1FVFA 2X2PA 3G9XA 1SUFA 3LIPA 3E22B 1CZUA 1J0XO 1FK8A 2N46A 1GU0A 4BO0A 1QG2A 5KC9A 2VDLB 3QLTA 2D59A 4ZZ3A 3FLBA 3CFYA 3H6HA 1JUDA 3CEHA 5F2EA 1H2WA 2RKBA 2XX3A 3LX5A 2DR0A 3GAMA 3H7IA 3CSUA 3IDOA 1XZ8A 3QFTA 5AJZA 4B32A 5B2EA 5KSYA 2J5BA 4LCEA 3L18A 5LP6A 4DRZA 3QXHA 3VYVA 5I4BA 5DO9A 1RABA 1UMCB 2OHVA 3AOGA 1MPTA 3DJFA 5FLEX 3TRKA 1N6KA 2JVKA 5HDQA 1ODTC 2KJQA 2P6OA 1P17A 1W0JD 3TNYA 1BXKA 2J3JA 2GYVA 1NQTA 2HQ1A 5LYJB 1KAQA 2Q2WA 1FX0B 1NU6A 1O54A 3GJSA 4R2WA 2REBA 3LWZA 1NBHA 3EC2A 5KVVA 1FP7A 3H1EA 1E92A 1RAGA 4ABTA 2QUIA 1YQGA 4YRLA 5DI3B 5TR9A 3HN7A 2B2CA 5IEBA 2ZBDA 3LNCA 1TYDE 1RC0A 3CH7A 1U2DA 2F62A 2QR3A 1G63A 2BW0A 4P84A 2AV6A 4HAWA 3VVBA 3TNLA 3EPKA 1DQYA 3SEQA 1HG1A 1SVWA 3LGAA 4J0JA 3IR7A 3P9CA 1CJBA 1Q7EA 2OENG 4LXQA 5GJWC 1OI2A 5GM2A 1UBHS 3NGMA 4EY8A 2O8DB 5F1KA 2H00A 1HDYA 2CZQA 4Q1BA 4FUTA 3EH2A 1UWVA 4K0RA 3RSFA 3MAGA 2BHTA 3Q0IA 4XFJA 4BO5A 4XI9A 1JKJB 2EWVA 2GKSA 2Q4BA 3CKKA 2VJOA 4J1TA 4ZOAA 4O59O 3P19A 2IYWA 3NBKA 4AUEA 1FFEA 2R1ZA 2VDOB 3NHSA 3VR2D 3EVFA 3KQNA 5E6SB 1FVOA 1AKRA 1M5TA 2R6R1 5C8YF 2AN3A 1QO7A 3DMNA 3PQ5A 4M76B 4OUKX 4RY9A 2JI6A 3MCZA 3FE2A 4OVKA 5FWNA 3RT7A 3EZ9A 1RXYA 1MNAA 2J9FA 3FCYA 1IONA 2P0EA 3K0AA 4YALA 2YASA 2CUNA 1CETA 2PBRA 5D2CA 5DHFA 1RKBA 1YJ5A 3I23A 1I1HA 1L4GA 1LQ2A 2ONJA 4M8IA 4KXVA 4QLOA 3RKRA 2X40A 2Y9MB 2O8EA 4PN7A 3QVGB 3JASB 1IB6A 3TZ6A 4DLNA 3QVVA 3T4PA 2P9CA 5BRJA 1HXHA 2CZCA 1IEWA 4W7SA 4PM4A 1YFLA 4HDRA 4IVNA 1IN4A 2O7SA 3GFFA 2C7QA 5JROA 4HJRA 1QJCA 1BZYA 3CUWA 2DJ5A 4HGQA 4LAFA 4O2AA 1R4AA 2H1SA 2YZ2A 3QJYA 4NPCA 3SOPA 1IATA 4FR0A 4AMUA 1AKQA 1U63A 4IDGA 2XUIA 2G77B 2ZRIA 3K0AB 4E3WA 4QWWA 3EPJA 2QM7A 1U0HC 2K4MA 3IUJA 1QIHA 2OL4A 1EM8A 3LOUA 1FFCA 4WK0B 5HA5A 2QVLA 1E0AA 2BI8A 4QO7A 2W2MA 3OIFA 4H7HA 4EJ2A 4NE9A 1XCGB 3L02A 3B3GA 4A73A 1MAWA 1ML3A 1OXBB 4HAYA 2AK3A 2B4RO 4HXFB 4LJKA 3ZC3A 4MLZA 3GLFA 5IJAA 2ZSDA 3R7AA 3A4YA 3QH4A 1DKRA 1E3SA 3Q2KA 2CNLA 2QPOA 4FVTA 2PR2A 4FGLA 5JYDA 5JH7B 2F8SA 721PA 3ZOKA 1KVUA 1NYRA 1UOEA 2PEZA 1B8PA 2SICE 1XLTA 2VTDA 2A59A 1U2GC 2IXDA 1VJDA 2D1SA 3IDQA 3BE6A 2HZ7A 3FJYA 3NKLA 1J23A 4HQLA 4NCJA 4EB8A 4YJ3B 4JX8A 1WMSA 4KIUA 3QPCA 3ZZ0A 4HKTA 5EZYF 3ZZMA 2X9GA 2XADA 4URUR 3AYXB 4INPA 4ND1A 2QVZX 3H04A 2IZ0A 3QWBA 5CDFA 1HQKA 3W4KA 4C03A 5JSUA 4LIPD 3EARA 3VO2A 5DM4A 1IXSB 1H93A 1ID1A 3B5JA 1EHYA 1HYQA 3ZHSA 2QD2A 3OD5A 1V7QA 4Y6PA 3BJRA 4LZLA 3DHEA 4YMIA 4EQ6B 3K8ZA 4B83A 3STYA 1IWOA 3LYLA 2AYZA 5FYQA 2C82A 1NLFA 1V7PC 3AEQA 5TSDA 4DCGA 4FM9A 2ZSEA 2GCIA 4MA5A 5KAPA 3KZVA 5LDGA 4FOLA 2EL9A 4XJVA 3IP3A 1WDTA 4TLMB 3S1AA 2C0CA 4CV3A 5AVSA 3OTOB 3D1JA 1ADFA 2XV1A 3IRVA 1UP7A 3JQ7B 2FVYA 1N7IA 3KZNA 4HVTA 1Q14A 3W5JA 2H07A 3OAAA 1FMJA 4TUYB 4Z4QA 3ABZA 3R74A 3K71B 1OMOA 1C7FA 3ICCA 2Z98A 3SZOA 4TT3D 5JY6A 4GX1A 1Q6ZA 1WXEA 4IJVA 1HMYA 4LS3A 4ND5A 2WIDA 4R2HA 1MB0A 1Y9DA 2ECOA 3JD0A 3AL3A 2HDNB 1DXOA 1P39A 2QDKA 3DE7X 3U2QA 3OA2A 4ND8B 3UA3A 3W8NA 1UBOS 3DDSA 5EGSA 1BTOA 3OT1B 4OLJA 3VVMA 3JWHA 1DMRA 3LHKA 3WJ2A 1E59A 4FFSA 3FWZA 4G84A 4WFIA 4HMQA 5JI2E 2ZRNA 4WQMA 4CT0A 3OUUA 1QHEA 1KKLA 1C9EA 2EZTA 2FE4A 3UTCA 3V1TC 2NO6A 2WF8A 2EGGA 3WSWA 3CUTA 1G3MA 2GPSA 2IEYA 3EZ6A 1UR5A 1F8XA 4PZLA 4YJ2F 4Y7CA 4KPUB 4MJXA 1UC4B 1RJEA 5FAXA 2HSZA 2CBGA 4RY0A 3JZIA 5HK9A 2JGAA 5JAZA 5K7SA 3PLAE 1QUEA 2G07A 2WLTA 3H65A 3AUFA 1UKZA 3NHLA 5KNBD 3Q2IA 4B2YA 3NV9A 4W1SA 4YAEA 1GGJA 3NU1A 3EZNA 4YB8A 3H9UA 4PYQA 3RTBA 3CWZA 2XCOA 1HDXA