3D0KA

Crystal structure of the lpqc, poly(3-hydroxybutyrate) depolymerase from bordetella parapertussis
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
287
Chain Sequence
DLTNADRIALELGHAGRNAIPYLDNADRPFTLNTYRPYGYTPDRPVVVVQHGVLRNGADYRDFWIPAADRHKLLIVAPTFSDEIWPGVESYNNGRAFTAAGNPRHVDGWTYALVARVLANIRAAEIADCEQVYLFGHSAGGQFVHRLMSSQPHAPFHAVTAANPGWYTLPTFEHRFPEGLDGVGLTEDHLARLLAYPMTILAGDQDIATPNLPSEPAALRQGPHRYARARHYYEAGQRAAAQRGLPFGWQLQVVPGIGHDGQAMSQVCASLWFDGRMPDAAELARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative poly(3-hydroxybutyrate) depolymerase LpqC
publication title Crystal Structure of the LpqC, Poly(3-hydroxybutyrate) Depolymerase from Bordetella parapertussis.
rcsb
source organism Bordetella parapertussis 12822
total genus 90
structure length 287
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3d0kA00
2RHTA 3CN7A 1CUJA 5CT4A 1UKBA 2O7VA 5C81A 4QDUA 1HLGA 4C89A 3FLBA 2XMCA 2OAGA 2CMFA 3WMRA 2HA3A 3G9UA 4MQMA 3YASA 3QPDA 4E11A 2GBFA 5AKJA 3PI6A 3HC7A 1Y37A 3MUNA 1O6GA 4BRSA 4GHWA 1EA5A 2VAXA 3F67A 2QKYA 1VXOA 4DNQA 1DTEA 1QIGA 2RGUA 1QO9A 1MO2A 3C6ZA 4OB8A 4EBBA 4N8DA 1PJAA 1YSCA 1YS2X 4WDQA 4B84A 1CUZA 2WTNA 2GYUA 3IVMA 3HZOA 4DMCA 1XZFA 1EK1A 3H17A 1LPPA 4RE5A 3QPAA 1VZ3A 4N8EA 1WHSA 2AJLI 1XLUA 1CR6A 2C5GA 2VEOA 3D5EA 5ALDA 1JMYA 3CCCA 2RI6A 4BE4A 4C01A 3ANTA 2PSDA 1FFCA 4GXNA 1NX9A 3BDVA 1MX9A 1DT3A 3HEAA 4QWWA 3RLIA 1ZICA 5K3DA 5EHXA 4AX4A 5AI0A 2C0PA 4X6UA 1RWQA 1TCAA 2I78A 2YH2A 3WA6A 3WK9A 4J03A 5A7GA 5KWIA 4JYMA 3LS2A 2QRUA 4FOLA 2HRRA 2WFLA 7YASA 4BVKA 4BTLA 4WFJA 5JIBA 2ZSHA 4YASA 3GROA 3PFBA 1R9NA 3T4UA 3A2MA 1Q84A 3HI4A 3S2ZA 2GZSA 4X93A 3LP5A 5ALIA 2WHRA 3IUNA 4EY8A 2HL6A 3IDAA 5ALLA 3OTQA 2HDWA 3W2TA 3MGAA 3KSRA 3WKBA 4GWLA 4UBOA 4F60A 2D5LA 5FKJA 3H1AA 4C4XA 2B20A 2UZ0A 2PU5A 1CEXA 5AH0A 5IVKA 1D07A 3BDIA 3I2FA 1WB4A 2GBIA 4ZV9A 3U1TA 3WL6A 3JW8A 1FFBA 5EI5A 5HF5A 5AP9A 3WYNA 1DWPA 3AINA 3I2JA 1AMNA 1Q0ZA 4G8BA 5ALWA 3DJYA 3WK4A 2G5TA 2XQJA 1UOOA 2CKMA 3N0TA 2GYWA 4LXGA 1H23A 2JEZA 5HFNA 4AMZA 1E66A 1UXOA 2K2QB 1YB7A 2PSEA 4QLOA 2YYSA 1VXRA 5BV7A 3D7RA 2Y2UA 5LIPA 1BN6A 3STXA 3AIKA 2WJ3A 4MYSA 4Y2PA 4QE3A 4RE6A 2XUGA 4M0MA 3PF8A 1HQDA 4KE9A 1PV1A 1XZGA 3JYHA 1K8QA 1DX4A 4Q3LA 5AI8A 2I03A 1NU6A 1THTA 3QYJA 2XQGA 4GDMA 5J3JA 3F9CA 4LIPD 2XQFA 4JYPA 4G9EA 4G8DA 1EK2A 3STUA 4HTAA 1WB5A 3R3UA 1MX1A 4H18A 4PNZA 1CLEA 5HF6A 1W52X 2DHCA 2ZYIA 3HACA 4N5HX 1OCEA 3C6BA 5AOBA 3WKDA 3R3XA 1EB8A 1A88A 2ONCA 2OCIA 4A5SA 1CUEA 2W22A 1AC5A 4ZWNA 5FLKA 4PW0A 2HHAA 2DR0A 4DNPA 5JAUA 3C45A 3C8HA 3ZLTA 1DWOA 3BWXA 4YX9A 3UUFA 1J2EA 1QOZA 4UBNA 1DX6A 1YB6A 2WSLA 3FSGA 4W63A 5KREA 2CJPA 2JGMA 3ILSA 2BCEA 2OGZA 1IZ7A 3O4HA 4AN1A 1VE7A 3IUMA 3CN9A 5EIEA 2WU3A 1ODTC 1Y7IA 1ETHA 2XMGA 4UHHA 3A6ZA 1N5RA 3KWFA 1IUPA 1JJIA 1ZOIA 5AI4A 3BIWA 2LIPA 1CQZA 2C0QA 2WUFA 4DSZA 3RARA 2XMQA 4FFVA 4NZZA 1N5MA 5LYYA 5I9IA 2XUFA 5ISMA 1WPRA 3AIOA 4U2GA 3M82A 3GELA 2JGIA 3WKEA 1N1MA 1ZI6A 1Q0RA 4HRXA 3JWEA 3WIOA 4KAFA 1C4XA 4BZWA 5DNWA 3VVMA 1L7RA 1QFMA 2XDWA 4J0DA 4O08A 4CFSA 1ZGBA 4DLNA 4BDTA 2XUQA 1CUGA 3E1GA 2OPHA 2DCMA 1XZJA 5HF9A 2ECFA 2JGEA 4I4CA 5K3CA 1ZGCA 2ACEA 3OURA 1LPAB 3LIPA 5T4FA 5A7FA 1FFAA 5D3KA 2VTVA 4FKBA 3VDXA 5ALPA 1VKHA 1VOTA 3AZOA 1U8EA 5AI6A 3DYIA 4UBLA 3PDCA 3EIOA 2ZVDA 1ZD5A 4QA9A 3O95A 5JAPA 2HU5A 5ALTA 1VZ2A 2WM2A 3H2HA 2HRQA 3HJUA 5HF8A 4DNFA 4WCVA 2XB6A 1ZI8A 3UUEA 4B85A 2XUIA 1QE3A 4BCCA 5AK3A 5LZ5A 2WFMA 4J0JA 1IMJA 2G63A 1CUHA 3EQ7A 1QIIA 4OU5A 3BE8A 3QM1A 5JARA 4KAAA 5JALA 3ZV7A 3C6XA 4MEBA 2Z3ZA 1U4NA 1LPNA 2ZYSA 3KOOA 1I6WA 3PUIA 4X6XA 2WIFA 5AI9A 1XQYA 4EA6A 3WL7A 1R1DA 4W1RA 1HPLA 3WZLA 1LPMA 2PSFA 3I28A 5DYTA 3I2HA 5HKBA 3H18A 1XZAA 1AQLA 2X76A 4K2AA 4DMKA 4UFOA 4M0FA 2PBLA 3L1IA 4GI1A 1MPXA 4W9RA 1CUCA 1MJ5A 2XI4A 4CG1A 3WWEA 1USWA 4HVTA 1WCYA 4UHCA 1PFQA 5H3HA 2WIDA 4P9NA 1BCSA 4X91A 1FJ2A 2ES4A 3I1IA 2YXPX 5ALMA 1XZLA 2Q0XA 1BROA 5D6OA 1AZWA 5SYMA 4GBGA 4V2IA 1XKLA 2HA6A 3WWPA 3B3QA 3AILA 5DTIA 1OILA 5FXMA 3N2ZB 3FLEA 3R40A 1C7IA 1MNQA 5JZSA 3LCRA 1EHYA 2WIGA 1LNSA 3FYUC 3I6ZA 2FX5A 5FOQA 1AGYA 4FLEA 4KE6A 2QMQA 3O0DA 4Y7DA 5CMLA 5EIAA 1O6FA 3VJKA 4C4YA 5FDFA 4X00A 1A8SA 2HADA 5F4ZA 2IITA 1JI3A 5DYWA 1AX9A 5E4JA 3AZQA 1TCBA 4H0CA 5FUMA 1XFDA 4BAGA 2RIPA 4LXHA 4GEGA 3AFIA 1EINA 1CUBA 1TK3A 4Y2TA 4QEKA 6YASA 3ICVA 4WFIA 5JAOA 3D3NA 2HM7A 2BUCA 3OC0A 1WM1A 2FJ0A 4G4IA 4B80A 3L1JA 2Y6UA 4W1QA 3EQ8A 3VJMA 4BAUA 1IUOA 1AKNA 1QIHA 3LLCA 2ZSIA 5CT9A 3ED1A 5DJ5A 4BC0A 1GKKA 3DOHA 5CXUA 3G0GA 4BRZA 3DYVA 1ZI9A 1JU3A 1EDEA 5AIAA 4IH1A 4KAJA 1FSSA 1A7UA 5D3ZA 2V96A 3RM3A 2WHPB 5CXXA 2BFNA 2C5FA 3O4IA 2JBWA 1EI9A 2PUHA 3W04A 2RAUA 4UHBA 3I6MA 2J4CA 4P93A 3ANSA 3G0BA 2ZJ7A 4ZREA 1XRQA 2HA0A 4B0PA 1FFDA 1J06A 2BGRA 1TAHA 5AKHA 1XZKA 1THGA 2EDCA 1P0PA 5AI5A 4RGYA 5LP1A 2XMZA 2VJDA 4FMPA 2H9YA 1EXWA 1DQYA 1GQSA 2O7RA 4CCWA 2WJ6A 1XZHA 4Y9SA 4MJ3A 4X90A 2GBCA 3FYUB 3R3VA 3HLKA 4EUSA 1BN7A 1XRLA 1DU4A 3DOIA 4HXEB 4H7EA 2H7CA 1SC9A 5CH5A 1MU0A 4UHDA 2PL5A 5IVDA 5AJHA 4UFPA 4FWBA 4WDRA 3EF3A 5A62A 4K6HA 5ALVA 3G7NA 1U65A 2YASA 3BF8A 4UBIA 5FP0A 5CTAA 5LLSA 2JGJA 3NUZA 5LZ2A 3DS8A 3D2AA 3DCNA 1XQXA 5ALZA 3GBSA 2XMBA 1ODSA 1QFSA 2B9VA 4UHFA 5IVHA 1JJBA 5LZ4A 5JAHA 4GW3A 4EB0A 3QMWA 4Q05A 2DFPA 1L7QA 4Q1VA 5AM2A 1GQRA 1LPOA 3ESCA 4IH4A 5K3FB 2HFKA 2BGNA 3M81A 1SOMA 2OLEA 4X97A 3FAKA 3FBWA 4Y2VA 4AMYA 4PSDA 2FUKA 1RP1A 3O4JA 3H2GA 2VQ6A 3STVA 3TRDA 1XZMA 3AUKA 2EDAA 3I1YA 4OB6A 5C8ZA 1YAHA 3V1KA 4J0IA 3G8YA 4FHZA 2V97A 4AZ0A 5DWDA 5AM3A 2XUOA 5K5EA 4GECA 5JADA 2WFZA 3KWJA 3QBJA 4B0OA 1QONA 4UBJA 1QIJA 5E2IA 3IURA 3E0XA 1CQWA 3E3AA 5AKKA 3U0VA 3CCBA 5BWBA 5BOVA 1X2EA 4CCYA 3L1HA 1E8NA 2RONA 3WL5A 4X94A 3BIXA 3BJMA 1EDDA 3QMMA 2FJPA 4ITVA 2JF0A 4FNGA 4RNCA 4DTCA 4BZZA 4C6HA 3MUOA 3F96A 3SK0A 4AO7A 2QVBA 3R3ZA 2WU4A 5CH8A 3W9BA 5AM4A 1MX5A 1MAAA 3F98A 3FYTA 4ARAA 2BJHA 2WUDA 3H19A 1H2ZA 2QT9A 3W06A 3D0KA 3WLAA 5HQ3B 3WKAA 4OYLA 3FVRA 4BATA 3EBLA 2DHDA 4WY5A 5KWJA 2P8SA 4HXFB 1W6RA 4JH0A 4AN0A 2HA4A 4H7HA 5ALYA 4TGLA 4EY5A 1F0NA 1CPYA 1ZIYA 3IBTA 1BS9A 2NW6A 3D4LA 5E4YA 1K6EA 2O2HA 1R50A 2WILA 4MWTA 5EHZA 1KU0A 5AO9A 4BCBA 2W6CX 1CUSA 4ETWA 4X3CA 1AURA 3QVMA 4FNMA 5AOAA 3TEJA 4QNNA 2OGSA 2OAEA 4XJVA 1RYYA 5IKXA 2WTMA 4Y2SA 1YCDA 1AUOA 4X6YA 3WK7A 3FLAA 1XZIA 4FBLA 2Z5GA 4EZIA 2PSJA 1UK8A 2I3DA 4OCZA 4AB1A 3UMJA 5C8VA 1KU6A 5DLPA 4DNOA 4Z49A 5JD4A 1SFRA 4L3WA 1ZD2P 3HRHA 1HBJA 1M33A 3M83A 3BF7A 3WK8A 2WKWA 3P2MA 1WHTA 1DQZA 2XUHA 3TJMA 2VA9A 3FVTA 3F8SA 4WJLA 3WWOA 5T4HA 1MTZA 2VJBA 1YASA 3C87A 3HABA 5K3BA 2PVSA 1TCCA 1GKLA 3DDUA 3CXUA 4UUQA 4Y2JA 1K4YA 3STYA 3A2LA 4FTWA 4G4JA 5K3EA 1SCQA 4QDTA 1VE6A 2H7XA 5ALXA 5AOCA 5ALGA 1LPSA 2C58A 3DKKA 5JASA 2WG0A 4ZRDA 4AO8A 4OPMA 2C4HA 1CUUA 4AZ3A 1CV2A 1JT2A 4ZI5A 2QR5A 3DLTA 2PPLA 3NOXA 2HA2A 3S8YA 1QLWA 1CRLA 5AK6A 1UK7A 3GFFA 4ZXFA 5JZBA 4DM7A 1H2XA 1QO7A 2JEYA 3OG9A 1QJ4A 2ZYHA 2CB9A 1P0MA 3DNMA 1EH5A 2GBGA 3FNBA 5LZ7A 3NGMA 5BWCA 2JGLA 2WFLB 2EEPA 4G5XA 4J0HA 1XKTA 3H0CA 5A2GA 1A8UA 3AIMA 5AHXA 1F8UA 4EHBA 4E15A 1UOPA 1YA4A 4K6KA 3H2KA 4DIUA 5ALJA 1QTIA 4BC1A 3QH4A 3V1NA 5JATA 4X95A 5AKEA 1FFEA 1CVLA 4LHEA 1G4HA 4LKOA 1ZJ4A 1CUFA 1H2YA 3KXPA 4WFKA 4Q3KA 1CUDA 4EY7A 4AO6A 3QPCA 3ZPXA 5IVIA 2B4KA 1H2WA 2DHEA 2GZRA 5CW2A 4B7ZA 4X7BA 5E4TA 5AM1A 3V9AA 3FWHA 2QUBA 1E5TA 1QTRA 3QITA 1A8QA 2ACKA 4H77A 4P08A 1XZDA 1E89A 3A2NA 4B9AA 1B6GA 2J4FA 1BU8A 1ZIXA 4KJXA 1DINA 2O2GA 1GXSA 4L72A 4OU4A 3IIIA 5I7UA 4OD0A 4KYVA 1QIEA 5CURA 3BL8A 1XZCA 1UFOA 4G4GA 4KACA 2CEKA 1TKRA 5AKYA 4BAZA 2ZJFA 2E3JA 2XLCA 4MQLA 5DNUA 3K2IA 1VA4A 5ALUA 3SC2A 2WG2A 5LKRA 5AKIA 1W4LA 3R41A 5CT6A 1GGVA 4DYHA 5DTJA 4IQ4A 3DQZA 5HFAA 1LZLA 4I3FA 3STTA 4H7IA 5I8PA 5DNVA 5AKGA 4Y2XA 2VT7A 3MVEA 5ESRA 2X5XA 2OGTA 4MXDA 4M0EA 4NMWA 1DT5A 4PQEA 1E3QA 1BCRA 1QIKA 2OCGA 1UWCA 2HA5A 4AXBA 3W9UA 1TQHA 1XRMA 4LYDA 5FRDA 2BKLA 3X3HA 4UBMA 3GUUA 4Y2QA 5AK4A 2HFJA 1ZD4A 5AKXA 4W1SA 4U2FA 1EVEA 3ZLVA 1LBTA 3IUQA 2Y6VA 1SCIA 2WIKA 4F0JA 1K5PA 2XUJA 2X8BA 1YS1X 2CUTA 5CRIA 4JUIA 4FLMA 3STWA 1WB6A 5ALKA 4CG3A 2VSQA 2ZJ6A 2Z8ZA 3OOSA 3I2GA 5KBYA 1H22A 3TGLA 3HSSA 1XRPA 1UKAA 2H7YA 2AJCA 4A23A 3RKSA 3V1LA 3IULA 3AZPA 5EFZA 4CIAA 4HXGA 5T4BA 2WUEA 1CUVA 2QM0A 4X92A 3B5EA 2PU7A 1XQWA 2DQYA 1XLWA 1XRRA 2XLBA 5ALQA 4B81A 1ACLA 4UFNA 1XLVA 1MT3A 4U2CA 1UOQA 4Y2YA 5K3AA 4J0KA 2IX9A 3K6KA 3QZUA 2V9ZA 4H7FA 4I19A 3A70A 2D0DA 1Z68A 3W05A 2XUPA 1ACJA 2AXEA 4MWSA 1MNAA 5ALEA 3DL7A 3FSGD 4UPDA 4KRYA 4J7AA 1JMKC 4OUKX 5IH7A 4DMFA 4G9GA 5ALNA 3K9BA 3DEAA 2G5PA 4MYDA 5D7BA 5YASA 5C7YA 4PO3X 1JJFA 4P92A 4B9EA 4X85A 1QZ3A 4E46A 3VISA 5CT8A 4C87A 4CI9A 4J3JA 3QMVA 1GZ7A 1G66A 3NWOA 4QZVA 3FCYA 3OPMA 2Z3WA 4Q3OA 2XUKA 2OQVA 2RHWA 4J0CA 1F6WA 5FPPA 2VF2A 3D2BA 1JFRA 4U2EA 4TPKA 1W76A 1T4MA 4FDMA 3LIIA 3WJ2A 3HXKA 1CUYA 2G4LA 4ROTA 1GPLA 3VVLA 3IUJA 4Q82A 2PX6A 1ORVA 3FOBA 1MN6A 2WHQA 5ALHA 4RPCA 4ZGBA 5HK9A 1UK9A 3DKRA 2PUJA 3WKCA 1XRNA 1F0PA 2XMDA 3G02A 5FV4A 4QWMA 1EDBA 2VJAA 2ORYA 1NU8A 2HU8A 4XIIA 3KDAA 4G1FA 1YR2A 1TRHA 5JYCA 1LPBB 4W1PA 5JANA 4KR0A 1OXMA 5FPQA 3SWWA 2VT6A 1LLFA 4U2BA 3EQ9A 1Q83A 4G8CA 2XE4A 1U2EA 1E8DA 2R8BA 3G0CA 4PF1A 2OG1A 5EHNA 4KE8A 2XUDA 3M3DA 1BRTA 2PSHA 2C7BA 4H7KA 2VATA 1ZJ5A 1SCKA 1CIJA 5AKLA 4D9JA 3ZWQA 3R3YA 3C5VA 1C7JA 2OCKA 1R3DA 1VJ5A 1KEZA 1JU4A 4OSEA 1S8OA 2QXUA 2WIJA 3I2IA 4S0XA 4K5QA 5AKZA 3C8DA 2J3QA 2AJBA 2QS9A 3Q8WA 4JNCA 2I3ZA 2VJCA 2PKYX 3D2CA 1LGYA 4NS4A 1ZD3A 5CBKA 1E8MA 2Z8XA 2QZPA 4H35A 5EGNA 4Y2RA 5T4EA 3O9MA 5A71A 4BP9A 2QUAA 3E4DA 3WQHA 2OCLA 4XVCA 3PE6A 3SX4A 1UT6A 1IZ8A 4Q34A 2JGFA 4YPVA 3B12A 4YK7A 2QOEA 1G42A 2B61A 5LZ9A 4HS9A 2WQZA 3VXKA 1WPXA 4BCDA 1LZKA 4ARBA 1LBSA 1IVYA 2WJ4A 1CUIA 1R88A 3FCXA 4U2DA 5ALRA 4XWGA 3DL4A 2DQZA 4PSCA 2AJDA 3PUHA 4MEAA 2WHPA 1BEEA 4BE9A 1QIDA 3ICWA 2H1IA 2ZYRA 5ALOA 2Y1KA 2OXEA 1VLQA 1YAJA 1R9MA 3I2KA 2WUGA 3WIBA 5AM5A 4TVKA 4GLBA 1R4ZA 4F21A 3D59A 3H2JA 5JD6A 1G5FA 3ESAA 1HKHA 2OQIA 3C43A 4LXIA 1GPKA 4QDOA 1P0QA 2XMRA 1UK6A 5AICA 3IA2A 3WK5A 3H04A 3G9ZA 2O2IA 2XUAA 4QLAA 5C8XA 3FYUA 1BE0A 2HIHA 1XZEA 3O4GA 4XX1A 1T2NA 4FFWA 1W1IA 4K6GA 4C4ZA 3H2IA 2CZQA 2JIDA 4B82A 4ZV7A 2BAGA 2V98A 1K63A 1VA5A 1W75A 1EX9A 3R0VA 4FLFA 3C70A 4DSAA 2XMSA 2HU7A 1CUAA 3G0IA 1ODCA 4DMHA 2R11A 3H1BA 3R3WA 3ESBA 2QXTA 1DWQA 3BXPA 4OB7A 1P0IA 3RK4A 2PM8A 5A7HA 2DSNA 2XQIA 5EIHA 5HZGA 3GA7A 1WOMA 3V48A 5K3FA 4CIBA 1TIBA 3WI7A 1EVQA 4PSUA 1ISPA 4IH9A 3G9TA 5LZ8A 1XQVA 4PV7A 5DYYA 1QIMA 1GPNA 4Y2UA 3PF9A 3V1MA 5CT5A 1CUWA 3DD5A 4H7JA 1J07A 3ESDA 3WZMA 2QTBA 5CH3A 4LYEA 3VKFA 5JD5A 3PFCA 3PICA 1UZAA 4HRYA 3WJ1A 3C5WP 4AQDA 3F97A 5JZ9A 4QDZA 2BUBA 3G0DA 5ALFA 3G9XA 4BBZA 4QDXA 4A16A 1CUXA 2XQKA 1XROA 2AJ8A 1EB9A 3C6YA 3BJRA 1MAHA 1IUNA 2VAVA 4IHAA 4X71A 1L7AA 1X70A 4E14A 4N8SA 1J1IA 4FBMA 1QGED 2JGKA 3Q0TA 4UBKA 2XT0A 1CFJA 2J3DA 1HL7A 1UKCA 3WK6A 3WYDA 3AJAA 4BB0A 3IB3A 2WLSA 5AM0A 3ZI7A 4UHEA 3HYSA 2GYVA 2QJRA 3GZJA 3WA7A 5SYNA 4KRXA 4L0CA 5EHQA 4INZA 5AK5A 2QJWA 5HQ3A 3WL8A 3OM8A 4CCYB 1ORWA 2ROQA 4KEAA 4H7DA 4L9AA 4EY6A 3KD2A 3ZLUA 3WWCA 3O9VA 2CBGA 1N8SA 4BYMA 4WY8A 1BEZA 3WWDA 4IO0A 4KE7A 2IIVA 4B6GA 3VJLA 4JEIA 1XZBA 3I6YA 2Y2VA 4B83A 5ALSA 1YA8A 2WG1A 4C88A 4BP8A 5LKAA 2BUAA 4BVLA 5A6VA 4EY4A 3T52A 5HCUA 1GT6A 4BVJA 1B41A 4CG2A 4BDSA 1QIFA 2HA7A 1Y7HA 4DGQA 1HDEA 4J0GA 4NVRA 1X2BA 1JKMA 4OYYA 4HZGA 5HKAA 5AIBA 5HK8A 4F5ZA 4HAIA 4N5IX 4BTVA
chains in the Genus database with same CATH superfamily
4PGFA 3LV8A 1HNXB 5F2EA 1BH2A 1Y8QB 1Z8HA 10MHA 3PNVA 5TX7A 4HLCA 4JNKA 4MB2A 4C89A 4NCNA 1MH9A 1MJHA 2HA3A 5TGTA 5F7OA 4JVNA 3G9UA 1NBOA 3NNDA 4JLOA 4P36A 1X80A 1X7XA 2XJ9A 3G2MA 1P73A 4IVQA 5F4BA 5T41A 3ZXUB 4OXNA 3LQKA 4LWPA 1YULA 4AG3A 1R0RE 2QJTA 4JSTA 3PEFA 1DKLA 1JAZA 3R0ZA 2C92A 1EA5A 2W6ZA 1ZWKA 5FOSA 2AK2A 4AY2A 1L4GA 1MFPA 3MRSA 3FCAA 4GZ5A 5J5VA 3W5HA 1RRPA 2A5LA 4W5OA 3P9RA 3C6ZA 3MJEA 4P35A 4RWEA 3WLMA 1PYGA 4HAVA 4BEWA 4YJKA 1W59A 2C2YA 2EL9A 3HA7A 1KY3A 1UBFA 2J3MA 4D9NA 2XRMA 5DGTA 4EBBA 4PYIA 1XCJA 4U00A 2CNDA 2VWGA 4R2IA 4BQFA 2G17A 1PGQA 1ULTA 2PMBA 4AJ1A 4KB5A 2DPLA 2OV2A 4QFCA 5T8KC 1DS6A 3T8YA 3VYRB 3QU7A 2ZJ0A 4FZ3A 1RW4A 1U0JA 2WTNA 4NNOA 3SN6A 1SVSA 4OGWA 3ORYA 1PVDA 2PL1A 4R5HA 4P32A 2H6EA 5DTQA 3B9RA 4A8HA 1QX3A 1Z0FA 1I01A 2FLVA 2YWJA 4O4HF 4OI1A 3VYTB 2WYUA 1T9DA 4GR4A 4N8EA 5DN6A 4DWOA 1I7PA 5EXSA 3M2TA 4E31A 4MR9A 1GZDA 3JRXA 3BMNB 4LYGA 4MUIA 2IWRA 3JZDA 4AG6A 1WKCA 3CBQA 3LSTA 3HEBA 3AQIA 2F9FA 3ND6A 3HVKA 3AM5A 2VEOA 1QAMA 3TW4A 2HXSA 3UJ7A 2JG3A 3JWGA 3LLSA 4ZRMA 2PT9A 2OZVA 3O4RA 2RI6A 1TM3E 5D51S 5EJAA 4BE4A 3JU3A 3Q8MA 1SVMA 3LTNC 2AEFA 4S1TA 2ZI7A 3H84A 4KPGA 4ND2A 4OI0A 4U7GA 2OWDA 2IUFA 3BDVA 3QYFA 1CZHA 2WR8A 4PEVA 2JLAA 4RA6A 3ONNA 1FY2A 1VCNA 4V3BA 4XGKA 4ZT5A 1GZVA 4RTMA 2QRMA 2QX9A 4V3CA 1H65A 2INGX 5J40A 1FNBA 2DR2A 4TWIA 4XASA 1UMCA 2QPOA 4LNUA 1DJNA 1HRKA 4D4KA 5JU6A 3EEIA 1RWQA 1R4NB 2I78A 3KQPA 2F62A 3IQDB 4PZ9A 4A1OA 3FTFA 2VDLB 2JD0A 4JQZA 1CR0A 1ECBA 4RS3A 1MG0A 3CF2A 4F3YA 1VB5A 3OE4A 5L45A 3E03A 4FOLA 4PYOA 4B3CA 3FUXA 3M33A 2Q29A 1EUQA 4TKUA 2HRRA 1WPQA 1M2HA 5CM9C 1SQ6A 4E2WA 4YCSA 2ZAYA 7YASA 2ZM5A 2AI3A 4BVKA 3LXUX 3DAYA 3NHJA 4O2LA 3NEAA 4B09A 3ADDA 2IRWA 3LA6A 4KMMA 2OV8A 4F12A 3HU1A 3FPCA 4HBGA 4UTZA 2O9JA 4RY2A 3WC4A 4F6LA 1MABA 1YJ5A 2QN9A 3L4EA 4MV8A 5LXTF 2GXQA 3EOZA 1MGPA 1PYDA 3H16A 2C78A 3ITNA 1RQLA 4II3A 4QARA 1AG9A 1CR4A 1XRJA 2YY6A 2ZBPA 3BREA 3BWEA 4HCJA 4WFQA 1GCUA 3WLLA 3CM0A 4MMZB 1DEXA 4R41A 4LHZA 3I8XA 3T4UA 4G65A 2J48A 3H2ZA 1Q84A 5GIOE 2IEDA 3N2YA 1YRQA 5TRTA 4ARUA 5GAJA 4ZGWA 4D4GA 4F7DA 1RFLA 3EZ9A 2I91A 1CZRA 3OQIB 4ZU6X 5LUBA 2P3OA 3SQDA 3ZBTA 5IDXA 2WHRA 2PFGA 2J4DA 1GGNA 4W7IA 3EZGA 3ILXA 4DADA 1DIAA 2V0GA 3WIVA 1XWWA 4MV9A 5KIAA 4YJFB 4YO7A 3IUNA 2FFHA 4OBBA 3DZDA 3IDAA 1NV9A 1P2FA 1Z15A 4DDTA 3OEHA 5C8YB 3PGLA 5ALLA 3TDKA 4XB6B 4B4VA 2ZUCA 1U3FA 1W5BA 2KM1A 1YOBA 2NO1A 1AQNA 2GPAA 2HDWA 1ZK4A 3GRYA 5JCJD 1MHPA 1NASA 2HXYA 3G2KA 4ZOQI 1AKQA 4Y6QA 2JFZA 2NADA 2EJTA 4JKIA 5DHSA 1P4HA 3DB1A 3FPEA 3U61B 2OK7A 2QE6A 3U4QA 1NOJA 3PD0A 4BQSA 1G55A 3RIYA 3L0DA 1JXOA 4C4XA 3TSOA 2L0XA 2UZ0A 3PPYA 3IPXA 4EQZA 3OZGA 5B5SA 3S1SA 3ELWA 3KDPA 3WOHA 1T3GA 1CEXA 1ZH6A 4NR0A 1EFTA 4EI9A 1X94A 3V1UA 1EUZA 2HO5A 1DP4A 3I2FA 2GBIA 4QTTB 3FROA 3NHRA 2BFBB 3CVWA 1NBWB 1FTNA 4JQOA 5DK4A 1BC5A 3NDJA 1HE3A 1BJRE 1OWMA 1R0ZA 1WIWA 5EI5A 5COAA 2DUUA 5HF5A 2XODA 3DEIA 3OLZA 5AP9A 5C0OE 4AQYB 3U60B 1U90A 3GRRA 1QBGA 4P7GA 1AMNA 1Q0ZA 4XTCS 2F1HA 5AW8A 5TY0A 3WK4A 3IQIX 4IP0A 5EQJB 4CMKA 5CA1B 4PLTA 3DDZX 2WQ7A 3KJFA 2CKMA 3BZBA 1DEKA 1DQPA 1N2EA 3GA0A 1JHQA 2GYWA 3AEKA 3HFSA 1R2QA 3N0TA 3O7MA 1SVOA 4OHOA 3UG6A 3FDIA 4O8ZA 4WT7A 1QG6A 5CVTA 4Q4HA 5HFNA 4DIBA 3ZN2A 1DEHA 3DE5X 4ZEOA 1E66A 1UXOA 221PA 2G9RA 2EFYA 1LF0A 3IT2A 3VX3A 3L1KA 4LF6B 4NFSA 1YB7A 2I67A 3JAKB 2RARA 4LDJA 1V45E 3H9EO 4DPKA 2AZ4A 2RIRA 1YACA 4PYNA 1I6LA 4YXWD 4QM7A 4A2CA 5HJ7A 1FP6A 4X8HA 3DUFA 2UVPB 2CLDX 3QWHA 1DAGA 3F2IA 1ZGHA 4KO3S 1PNOA 4QE3A 4YRQA 5BPHA 4R1PA 5BN5A 1B0PA 3OTWA 5E6UB 4ZI7B 1JH8A 1U0EA 2OB1A 2XUGA 4YRDA 1BKDR 5JNVA 3PEWA 2G9VA 2QTMA 3DM9B 4IFTA 4BMSA 4PLCA 1E1QD 5HDQA 3PF8A 1HF3A 1ZY2A 4LHSA 5CVCA 4Q1EA 1E3MA 1QDEA 5TT0A 1WDKA 4WZAE 3B7PA 4HYQA 3A0RB 1U1CA 3I39X 4K26A 3ODPA 3PKJA 2YYAA 4L75A 2WKRA 4EG0A 1UQTA 1DX4A 4Q3LA 3UJBA 5CA0A 1F2TB 1QHNA 2EP5A 2O4UX 4LOLA 2I03A 2WUVA 1NU6A 5KYXB 2KJQA 3UMFA 2F43B 4WZ6A 1QM5A 4DLBA 1BHSA 1Z7YA 1GXSB 2FHPA 2WMNB 2ZYUX 3HL0A 3IQEA 2K7ZA 3MIIA 4Q9IA 3AR8A 4S24A 3V33A 3WGUA 5BMVF 4EQ6B 1DPGA 2EWWA 2CY0A 2QLJA 2VHWA 2PYZA 2XQFA 2R48A 3LBFA 3I0NA 3PNBA 4W82A 3ZDRA 4G8DA 5DX8A 4AXXA 3R5KA 4MP8A 4ZK2A 4S2EA 1P39A 2FMIA 1J5PA 1WB5A 2AFHA 2HNBA 4XLTA 3S27A 4IICA 5FPHA 1UWKA 4PNZA 4DC1A 1YZKA 5B3KA 3L04A 3TH5A 1G8SA 3VH3A 1QLHA 4NARA 3MA0A 1N0WA 1U5CA 2C9DA 3HACA 1K7YA 3RREA 2O50A 1P9OA 1QX4A 2W8BB 5U4QA 1W85B 3WKDA 2W6JA 4IIVA 4OSOA 3HM9A 1J1UA 1YJXA 3QP9A 4U9HS 2Q0SA 1X9GA 5H83A 3D7SA 3SQWA 1XDDA 1NI4B 1UPCA 2PK3A 3GRZA 3AC0A 4FFMA 4R16A 3U3JA 3WB0A 4TXLA 3KYCB 4HB2A 1WSWA 3OCYA 2NZYA 2Z04A 2I6UA 5ERYA 1NNLA 1NJFA 4IINA 5E6RB 2FZEA 1ZITA 2ZKLA 3P27A 3WRXC 1U0FA 4D4MA 4Z4GA 1GUBA 3BJZA 3G1UA 4UQPA 1E5DA 4EX6A 1NGSA 1NL3A 1T4CA 2GD0A 3AFMA 3H4IA 4FYXA 4QREA 4RHTA 5MDHA 1ODFA 2H31A 3UGTA 1W2GA 3TX2A 3EEBA 1RLUA 4D3YA 3UJ6A 3IAEA 3K0AB 1MD9A 2HV9A 1OXKB 1VJRA 4EELA 3VGJA 3DXXA 3EIUA 3X1KA 5A5VA 2IEGA 3O83A 5EJGA 3N9IA 3E82A 3RYFB 1E2FA 1J2EA 2ZANA 3MCVA 2ZI3A 1QOZA 1WSBA 4LBVA 4UBNA 4FHGA 2Q1UA 4HOYA 1E0DA 1P2DA 4XWYA 3VPDA 4C7VA 1DRVA 2WSLA 2Y1FA 2BI8A 4PG6A 4OKNA 4R7GA 3VNQA 1M2VB 3FUVA 1P7WA 2DOKA 1PZFA 2X1LA 1Z2AA 2H11A 2Y0EA 1XF9A 4D3SA 1OROA 3B9BA 3FCUB 1NMZA 5EVJA 4R71A 1ISIA 2HSZA 4GVXA 4EHJA 1KPIA 4WCFA 1XTVA 4MW4A 5E0OA 2ZCUA 5T3UA 5DM2A 3N07A 4MRMB 4Q48A 4AN1A 4BLWA 1VE7A 2WF8A 2ZR7A 3GXOA 2ZJ2A 4FEYA 4IOMA 1QHXA 1HRDA 2NO4A 2H2WA 5DEIA 1ID8A 2Y0DA 2VJQA 3ORQA 3K9QO 2WU3A 4HDAA 4BQIA 1RE0A 1ODTC 4L22A 4PAQA 3RUPA 4MJXA 2FMFA 3F74A 1PZEA 3E3NA 3KXKA 4ZKEA 2XMGA 1KE2A 2CYAA 3VVCA 1PR3A 3BIFA 5TQVA 3R7WA 4F5YA 3A6ZA 3M6WA 4EKDA 1GDHA 1SAYA 3KWFA 3KRTA 2RJOA 2F48A 1ZOIA 1EIWA 4HQLA 5AI4A 2C0QA 3KSAC 1DBPA 4YH1A 2JL1A 3NNSA 1EQUA 3KXIA 4MVJA 3FE2A 4X1YB 4DSZA 3EOBI 4MQEB 1ZVJA 2BTQB 1U6JA 4LJ8A 1HYGA 1NQAO 2EV9A 3U7EB 5JDIA 3C4JA 1KJJA 3JD4A 121PA 1WPRA 3OT5A 2BZ1A 1NN5A 3BCHA 2WBLC 3HBNA 2FUNB 1N3IA 2PRJA 3L7YA 5DBEX 2DUWA 3C16C 4U2GA 4Z3OA 4LY3A 3P9XA 3RUAA 5DOVA 2ZBUA 5E9JA 1OLUB 2WJIA 4MO2A 2FWMX 3WNVA 1BSVA 4IQ8A 5LQUA 3BE6A 1MRZA 4RCZA 3DJFA 3WKEA 1K08A 3NUGA 3P4XA 1FX0B 1EP2B 3JWEA 5KOYA 4P7BA 1E9DA 4KAFA 2JCSA 3EXG2 1V8PA 1TEVA 3NALA 3C0KA 2Q9CA 2XF8A 3F6SA 4KVZA 3NHPA 5HZKA 1L7RA 1ZHOA 1MQ9A 3FNEA 2QW0X 1QHHB 4LE1A 4J0DA 4OP3A 3L0OA 5EE3A 3FKQA 4CFSA 1EVJA 1C7ZA 3W7AA 1D7AA 3JZFA 3WG9A 1TQ4A 2Q46A 2NTJA 4XGNA 1T5OA 4C5CA 2QT0A 3CIOA 4G1UC 3V7YA 5B4TA 2DCMA 1XZJA 2ZUTA 3L0SA 4QBFA 5HF9A 4EJ2A 3TUZC 4MI3A 1O6BA 1RI5A 3WJAA 1NBIA 3CSDA 1YMUA 4I4CA 1JDVA 1ECJA 4MUGA 4O5AA 3UJ8A 3OURA 3RC7A 1UBKS 2Q2WA 3EGEA 4TZ6A 2VCHA 2CJYA 3KSDO 3ISTA 5HTOA 3R9KA 4DV3B 1SEVA 2ODPA 3AR2A 3MINB 5HIMA 1TMGE 5T4FA 4CNQA 4H60A 1K2VN 4JT9A 4S0ZA 1FFAA 1CLUA 2FU5C 4N82A 1DL5A 3DWEX 1HNWB 1X7GA 2OV3A 4RESA 3K0FA 3VDXA 3H5NA 1KAOA 2Z5FA 1T91A 1C50A 1ZCAA 4RY9A 1VOTA 4BV9A 4YRNA 1RJDA 1U8EA 3AZOA 4QRDA 1I7NA 5AI6A 4DARA 2Z5LA 4TVOA 5FL3A 1CB7A 1GFWA 4YREA 2QG4A 4H4CA 3D4IA 1OU4A 4B7UA 5DB4A 4EPYA 2Y71A 3LMKA 2HRQA 4PSKA 1DOHA 2BF4A 2AXQA 1CG6A 4PVDA 4DJJA 1W4CA 1P5RA 5HF8A 5JJLA 1V4BA 4LWQA 4JI5B 4DNFA 3BZWA 4NENA 3BMOB 3CEPB 3EWNA 4P1ZA 4DSUA 5C9ZA 3Q8KA 3UUEA 2AW5A 1NBMA 1RKBA 3LGSA 3V4PB 5CDFE 3COZA 2QL5A 3K0BA 5DNCA 4BCCA 4Q66C 3A4YA 1NZFA 2LCQA 5BSGA 5AVXA 1NVKA 1WPGA 3FBTA 3C3PA 1IZYA 2WFMA 3KU4A 3L7OA 3VM6A 2NACA 3EGWA 3NOVA 4PS1A 1CZNA 3K8OE 4J0JA 4BNGA 4FHFA 2P9YA 4NULA 1HWYA 1HG1A 1QYVA 1WVMA 2G63A 1U94A 3OHMA 2VYVA 4HUQA 4WJZA 3NT4A 3VA7A 5IP5A 3EQ7A 1QIIA 1Z6QA 3A58B 3LY7A 4LYHA 2QTGA 1KVQA 4OU5A 5CCDA 3TMYA 3D0OA 5EJ4A 4N41A 2R8PA 1HG0A 1WXIA 2J6HA 1PWZA 3COWA 2A7QA 1JFSA 1NT4A 3HVJA 2P2LA 1HFKA 4JYCA 3VPBA 3HB1A 1JFFA 2PJUA 3HO8A 1X39A 1UEIA 3BKWA 1LPNA 1QGOA 3MWEA 2D62A 4R7TA 2WAXA 4HN4B 1I6WA 4GPEA 2WIFA 4N7JA 3VU1A 3K5IA 2UYYA 1LSJA 1YTLA 2GK4A 1PEYA 4P4SA 1D0SA 2R3SA 4L28A 4HK4A 1E6MA 3L8MA 3AOEC 4W1RA 2HHHB 1E7RA 4HDSA 5IF3A 2Q6VA 2D1YA 1P1RA 2XGJA 4QOSA 1FNCA 2W6IA 3TJZA 1NHGA 1PK8A 1YRWA 4KI7A 3H18A 2YNMA 2VZ8A 2Q4EA 4OF4A 5EJ2A 1KDTA 4PINA 3E61A 3C1TA 3MMZA 3GJ0A 4PQFA 1QFJA 1T0UA 2JHGA 4JP5A 5FUVA 2ZRLA 3T5MA 4B17A 5FQNA 4JVSB 4M0FA 2PBLA 1LFDB 2QN7A 3OEEA 3HE3A 3ZGVA 1VMDA 1KH3A 1ZESA 1RXYA 2WM3A 2N3ZA 4WH0A 1A4RA 2IYZA 4BNHA 3QI2A 1PQ4A 3ROGA 3V34A 1PV4A 1PFQA 2XGMA 3A6GA 3DZKA 4MKIA 3VR3A 1IEWA 4HC4A 1JHDA 4PC6A 3OX3A 2HY7A 1CF9A 1W8IA 1ZMRA 2XTZA 5FBWB 3R7DA 2W6OA 1E4EB 1PGNA 4X91A 1GQFA 3GO4A 2XIQA 3DMFA 4XM2A 4PLHA 2DPXA 2YXPX 1WF3A 2VS1A 2V6BA 2IKQA 3Q85A 5I9SA 2AMLA 4O3FA 5K3SA 4I5IA 3LPNA 5LB4A 1LWNA 3DMHA 4LNAA 2H1FA 4AECA 5BOSA 5JBIA 4IIEA 3VR2A 1YZQA 3KVOA 1GFIA 2Q5FA 5KCMA 5SYMA 4DQXA 1W34A 3PQ5A 1CNMA 2KE5A 4ND8B 1WX1A 1MJNA 4X84A 4GBGA 4DIDA 1OUMA 5F9FA 2FSGA 1PJCA 1XKLA 3EQZA 2HQ1A 1SPXA 3CNHA 4HNQA 4I1PA 3QWBA 4JZKA 4BKPA 1MZVA 4LF8B 4GWKA 2IA5A 3HI6A 4PRZA 5BSWA 3E22B 4DIEA 1JZSA 1M7BA 1ZDMA 1C7IA 3SM3A 4ENPA 3LCRA 4KXVA 2QQ5A 2W37A 5HIKA 1EHYA 2AD5A 2X1HA 1YD7A 4V0KA 2R6R1 4NQRA 2C9OA 2PS9A 1LU9A 2CXQA 3FYUC 3TDNA 1QH0A 3A3PA 4V2UA 4D45A 4RMGA 1YB4A 3PA8A 5AJVB 1D1PA 3QTLA 2ZTUA 1GAXA 1GJRA 1YJQA 4NY1A 4G25A 2QL9A 4NDNE 1JFTA 3G7SA 4II7A 5HE9A 2IHVA 1NSYA 5H59A 2Z2XA 1CY7A 8ATCA 4M1ZA 3H9JA 3DLBA 4KE6A 2QMQA 3X1WA 4MKFA 4Q7MB 4GE3A 4PZDA 3EVDA 1AIPA 3OKCA 3G5LA 5F9MA 1YB1A 1T2UA 3GZNB 3HY6A 2IHZA 5CMLA 5KYVA 2HWWA 4R1NA 1T2DA 2F64A 3ZJ4A 4Y7CA 4A3SA 4EMBA 1T9CA 3IQGX 1J8DA 5A9SB 4XCVA 3VSAA 1O97D 5FDFA 4NV0A 3UMCA 2QRJA 3UBMA 3A1UA 2HMWA 3T9FA 1GAWA 5F4ZA 4CF7A 2IYNA 4MPJA 3DMGA 3I53A 5FFFA 1E6LA 3P5BA 5IKEA 1TIPA 2NXEA 2REOA 5CLIA 5CNIA 5E4JA 4ER5A 4EPRA 4NICA 3GT7A 5CHYA 4B45A 4EH1A 1XCOA 4CQLB 2HRDA 5JRJA 3WAJA 1XFDA 1EAMA 4GSYA 4NSNA 3O47A 4XYLA 4BAGA 2OL4A 4LXHA 5DBOA 1T6NA 1WW3A 3LUPA 2CL5A 1RD4A 5DXAA 4GEGA 5AHWA 2X6QA 3KETA 1SK8A 2Q2VA 2HREA 2HZBA 2QMHA 4QHYA 1JG7A 1XNGA 4D82A 3DUWA 3RUHA 3ZWAA 4D8VA 2QTVA 3W6PA 4P53A 4EG5A 2G36A 1TK3A 3K1ZA 3LKBA 5MF6A 1JZTA 4DR2B 1AUPA 4JT2A 1RC8A 2IVZA 1KK0A 1VLZA 2Z43A 1Q0UA 1PD0A 2RC6A 2SECE 2V4ZA 3DR5A 1I5OA 1J5EB 1FFXB 4ZQFA 1YZTA 3C1AA 4N3BA 4WFIA 1C3JA 4BJ5A 3B8EA 3EJ6A 4PBSA 2JRLA 2DFKB 3D3NA 3ZQUA 2WP8J 3A1TA 4JI1B 5CLHA 4KNYA 1WM1A 1LD3A 1DPFA 3AGPA 3MILA 3OF2A 2VPTA 4FHDA 3VO1A 3GF4A 4MOWA 4CBVA 1PVOA 1V41E 2XR1A 3SDBA 1GSOA 1IN8A 1K8RA 2Y6UA 4RD4A 1OW3B 1J8MF 1JXQA 3HG7A 4R69A 2R85A 4RF4A 2IZOA 3S6JA 1DZIA 3CZ9A 3E3MA 1Z39A 3CR7A 3IXQA 4UDNA 3HO1A 3AXSA 1KS2A 4GP6A 2AJTA 2ZIVB 5FLYA 4CM4A 3LLCA 3GIDA 4DPMA 1O0SA 5LQKA 2JIPA 2V0CA 4N54A 2ZVJA 5DJ5A 2DUMA 4M49A 2HMVA 4BC0A 4C4OA 4ENTA 1AQIA 2IK8A 3DOHA 1IK4A 1EFCA 3G0GA 4PLFA 4XW2A 5A0TA 2PXAA 4TTAA 5TJ9A 2WJWA 1T5SA 2FJUA 2ZUSA 4O25A 2C20A 1GHTA 3ABOB 4IH1A 1REQA 2PWYA 3LT1A 4RA9B 4QVGA 1ZUD1 1DAOA 1E7QA 3PP8A 1FSSA 1A7UA 1WXQA 1QHEA 3OIYA 5D3ZA 1O5TA 2EXXA 2G9UA 2P68A 3BUSA 3R0QA 1GLNA 1DB3A 4UJ3A 1I4EB 3BG5A 4BO2A 4P5DA 2CHGA 1PYOA 1I2DA 4PNHA 1ONNA 3H1EA 1XNRB 1LH0A 3OLCX 4UAUA 1OH6A 4O4IB 1LSSA 1SOVA 2JBWA 4R1MA 4MQ6A 2PUHA 1OKKD 5LD2B 2J3KA 3S2FA 1S9HA 2Q2NA 2VRWA 4G0ZA 3SQOA 2YINC 1ZJ6A 1RPTA 3B1WA 1PGOA 3C8ZA 4D9CA 4X1IA 2WDZA 1TUGA 5IARA 1OFUA 4DA7A 2COKA 4F06A 4CEIB 1XC7A 3PV0A 1FFDA 1WEKA 1CZUA 4S1PA 3AO0B 3EB9A 3A05A 2BGRA 3LBHA 4O4LA 3WX0A 1FFYA 1V5WA 2Q0HA 1NDHA 1ADJA 1SXGA 1JIXA 1ZVKA 2HHJA 1KARA 4WWHA 4A1FA 2EDCA 1BQ4A 1Y7LA 1Z47A 4LQDA 4OFZA 5DI3B 5C4GB 1O58A 1P0PA 1W0JA 2FG7C 1OD6A 4M7PA 4NCJA 4TV8B 2XMZA 1GAJA 2OBXA 2VJDA 4GZ6A 2H2FA 4UUBA 1FPMA 5GOZA 5IBPA 5AESA 3B38A 3FNFA 3LRXA 4IFBA 1G8KA 3G2PA 1QGUB 2OD7A 3PT9A 1BW9B 1GZ6A 1RVV1 5L3QB 3W2IA 4ZCPA 1YZGA 1G6OA 4YDSA 4TTPA 1U0NA 1L5KA 3ZWWA 5DASA 4M6WB 2XJ4A 1LI4A 4PG5A 3VBEA 4C76A 1QQBA 2Q1TA 4MJ3A 5AFSA 3FYUB 1Z4JA 3R3VA 3HLKA 4Q4CA 4PYQA 1BN7A 3FNHA 2HF2A 2ZUEA 1R4MA 1SVKA 2C95A 3V4ZA 5HXAA 1E3TA 3DGFC 1CY6A 1QXSA 5REQA 4E32A 5CFPA 3ROTA 3HV2A 4HXEB 2H7CA 3DG9A 5CH5A 1L7EA 5LQNA 1CBUA 2P6RA 2PE5A 2O1EA 2GN1A 5AJHA 4UFPA 4XQGA 4FWBA 3TAHA 4PZAA 4FINA 3HDGA 2CVHA 2QSUA 2QLLA 3OJ0A 1J56A 2X4GA 1HSZA 3KLMX 4OA5A 4X3PA 3UNXA 1XDZA 4EI8A 4H15A 4HGRA 4P58A 5L51A 4AZTA 1N0VC 1U65A 2I6TA 4UBIA 3VAAA 1LW6E 3F1LA 4EM6A 3MJHA 4LVUA 1Q1BA 2ZIGA 1E9AA 1MEOA 3AB8A 3LC7O 3HFGA 3WHKA 4CFZA 3H8WA 2HI0A 2QTNA 4X61A 2AT1A 3DOOA 3E8MA 1B2LA 4WY2A 5GM2A 3D2AA 3PPVA 5J1TB 4JXZA 1Z08A 5ALZA 1RTTA 2BFFA 3JWPA 4P82A 1ODSA 5EKUA 3WBJA 3M0EA 3MCUA 5IULC 1ODIA 4XKJA 3WGYA 3HR8A 3GU3A 1PTJA 3PX2A 1T4BA 4UHFA 3CKKA 1KQ3A 2CLHB 5F5XA 5JAHA 5KHOC 1M1ZA 3WGTA 4ZYUA 3QMWA 3KJEA 3L06A 5LPNA 1MAVA 4DF3A 4UEOA 3R9XB 3KHSA 2P90A 3DZIA 5AM2A 3B51X 1C3LA 5KWEA 4M1SA 1M2OB 1S2NA 4BQRA 1K4MA 1LPOA 2GEJA 5CFQA 1RQRA 5K3FB 4C4TA 2HFKA 2I4NA 4DLKA 1MV8A 3EEFA 4X8MA 3M81A 4OI4A 1Q16A 3PSAA 2X1VA 1MIOA 3HP7A 3E5RA 4B76A 5K20A 2OLEA 3AF0A 3FSJX 5KWVA 1V1RA 3KEQA 4UD2A 1E2UA 3LHSA 5KSYA 3WGKA 4BVFA 4WW0A 5GGYA 1YDMA 4CUKA 1G5HA 1PR2A 1RVDA 4JCCA 2Y76A 3LCUA 4AMYA 5K3OA 3FWKA 3E9YA 1O5IA 3T4EA 3ZDXB 3EEOA 1QV7A 4RTNA 4ZKDA 2M6RA 2D1RA 4RGBA 1WXHA 3IJRA 1NXSA 1VYHA 2FUKA 2FEXA 4AJ4A 1NUQA 3K71B 3TNFA 3RJ5A 4MUKA 4U5QA 4KN5A 5ICCA 3A6FA 3SSOA 3U4GA 2X4IA 3N76A 4KH1A 1P2UA 1QKJA 2NOAA 5ESXA 3RQSA 5EP2A 4CTKA 2XWJI 3BERA 3QOXA 4ZCSA 4BHTA 3X1YA 2P2DA 2OHHA 2WRZA 1V9SA 1RHUA 2FZ4A 3FAZA 4RMIA 3L8CA 2WT8A 1NXWA 1VJCA 4CHGA 3L93A 5KSOA 1YAHA 3EIHA 5EE9A 3UM9A 2J6CA 1RYDA 5DWDA 4PG7A 1U8ZA 2WSSA 2DH6A 4M98A 5K5EA 5E7MA 3TPZA 1IJEA 1DHTA 4GECA 1K8XB 4Y6SA 1CRZA 2WFZA 2VYFA 4QC2A 3QEMB 2WTXA 3N74A 4RK1A 3BWBA 4P4UA 4PVCA 3QBJA 1ISMA 4Y9DA 5BR7A 2ZJ3A 4B0OA 3PC3A 1E7SA 5AVKA 1X77A 4IMJB 4U7WA 2Q4BA 3JYQA 3NRJA 3D31A 2A3NA 2ILTA 2OXCA 5A4JA 4C7OA 2J5RA 1CQWA 3E3AA 3FXAA 3G8BA 4Y6OA 4DIFA 2PCLA 3GGDA 3NC1C 5BOVA 1NVWQ 1F9AA 4F84A 5LNK1 1CCWA 1E8NA 1TT5B 2I22A 1WMFA 3Q3CA 1TCUA 2HLPA 2VHYA 3F90A 4ND1A 4PC1A 1D2CA 2FVYA 1DJOA 1JDPA 4IKOA 3WL5A 6PFKA 3FRIA 1B8OA 1JVBA 4X94A 5SV2A 3W6ZA 1SELA 5JVDF 4ZD6A 1CT9A 3DBRB 3AHJA 2JI7A 3OPYA 3QMMA 3OHPA 1I5RA 4WLUA 4ITVA 2L18A 4RNCA 4TYYA 4DTCA 2F8TA 4C6HA 1WUJS 1IONA 3MUOA 3BHNA 1I3LA 1YRBA 1V0JA 3E5MA 2H8GA 2FPPB 1KR5A 1S2IA 2BFDA 1TECE 5TF4A 2H85A 2AL7A 2YC4C 4DA6A 2VP4A 4NDAA 1G20A 2QTZA 2WA1A 3R3ZA 2F2TA 1YZUA 3EVCA 3ZD9A 1VLVA 3TW0A 3OU7A 4E4RA 3W9BA 2AFRA 4LMRA 3OIDA 4NXNB 1I51A 1MX5A 3JATA 3E7DA 1A76A 4EHAA 2IYAA 4ZT2A 4NOLA 1G5RA 1XMJA 4FEGA 3T94A 4JA0A 2BJHA 1LLQA 3N8NA 4Y98A 5E0KB 1IFXA 2W0SA 3AM4A 3KOYA 3S8MA 1ULAA 2JFHA 2DQ4A 2PNFA 3S55A 3X1ZA 4JN6B 3D0KA 2LW7A 2PFSA 3OD5A 4Z9FA 4Z3DA 1BFDA 1EUCA 1NBEA 4FDAA 5DHRA 5IH3A 5K0TA 3QXHA 5TC4A 4HDRA 2CL6X 1RJEA 3TW8A 2G5GX 5KYUA 1YB2A 3TKLA 1H5UA 2X9NA 3KKKA 2YUIA 4Q9JA 1CY1A 1E2JA 1G5IA 4XVRA 3QEBZ 1YCHA 4JYZA 1G4UR 1KK1A 4PAGA 3EBLA 3UMBA 2EBWA 4HUTA 4WY5A 1YQDA 2AR9A 2JHCA 1JKJB 4FKMA 2FSHA 2P8SA 3L4BA 4BCBA 4RIGA 2QUZA 2Y1XA 3MWDA 4HZIA 1CJTC 5AXDA 4IR7A 4CU2A 3CRZA 1YVUA 3LDHA 1VPTA 4I08A 2H4JA 1SKUA 4H7HA 1H8HD 4EY5A 1IRXA 4Z54A 4HMOA 1E2MA 1T10A 2DAPA 2ZAMA 4L74A 1Y89A 4ZFNA 3E3LA 5JZOA 3U80A 1CPYA 2HMTA 3OQBA 2DMRA 1VKRA 1JEJA 2XOXA 1AA9A 3EFBA 4S1WA 4B3XA 5JDCA 2GN9A 3VOTA 3SXPA 4LI0A 2Z1MA 3GOQA 2NW6A 1II8A 1TYDE 1PS9A 1W5SA 1XTIA 4BLSA 4J9UE 2OY0A 1WD7A 1C1HA 4CM7A 5BQ3A 2O2HA 4KQXA 4RTQA 1I36A 1RZVA 1Q57A 1VL2A 2FKNA 3CPHA 1GFZA 2JZOA 3KWMA 4HAZA 1B74A 2FSSA 2PRZA 4JROA 4WBXC 4XQCA 3TR0A 4CMCA 4EARA 1U0LA 1Y48E 4MWTA 3H6KA 2IIBA 4R0MA 2FN9A 3AEUA 1AN9A 3MMNA 3G1WA 1KU0A 1R0SA 5EHZA 2X5JO 1UF9A 2W6CX 2R8EA 4RHEA 1Z8FA 4X3CA 1AURA 1YZNA 2ECQA 2O3UA 2RC5A 3BH7A 3ZIDA 5B37A 3FWZA 3MLBA 4ISBA 5AOAA 1O96A 3JQGB 3EG9A 3AEXA 1WAMA 3JQ9A 3HS3A 3K73O 4NBRA 4WKOA 5D5PA 1T6YA 2OVFA 4WGGA 4ZARA 1J0XO 4XJVA 4V0RA 1N2ZA 4KXNA 2WTMA 1R27A 1BD3A 2AW3A 2JCVA 5AJYA 4Y2SA 2JLUA 2P65A 3O8CA 3WK7A 2JA2A 2VKQA 3PD7A 2CVOA 4KIGA 1KH1A 2VF4X 1QYXA 2Z5GA 1X15A 2I3DA 1YB5A 2B8TA 2WVHA 5FO1A 3GGOA 4TSFD 1RWNA 1OGIA 3MCZA 1BXKA 4IVRA 4F9GA 5C8VA 5DLPA 2YL2A 1MLDA 1T4DA 4D42A 4A0SA 4Z49A 1KFJB 1ZD2P 2VAWA 1HEYA 4I50A 1FVOA 1QRDA 2XADA 3ROXA 2ID4A 2BI4A 3RU7A 4EG4A 2WKWA 4EFKA 1M2GA 2CD7A 4GWGA 4CI0B 1GTVA 3I3SR 3P2MA 4O2AA 1XZNA 1VSVA 2D3WA 2VJYA 3GJYA 1OA1A 2XUHA 4PYRA 1U1DA 3WGLA 5HP4A 4FSXA 5ILGA 1IY0A 2J0QA 4OA8A 1O94A 1U9IA 4WJLA 4B6JA 5T4HA 4IOLA 4RHFA 2CWWA 3C87A 1CIVA 1RYBA 3ETEA 2B1JA 4EJMA 4RTPA 1OH8A 3DNPA 4HD8A 3MMSA 4BGEA 1FVFA 4DIOA 3S2UA 2WY2D 1ZLXA 1RMYA 1UZMA 1YR6A 2Y68A 4F72A 4PONA 3CXUA 2Q3FA 1VG0B 1UIMA 3I4CA 1T9AA 4FTWA 4TLDA 3JR3A 3L01A 1OF1A 5JTTA 4QDTA 3L41A 4P22A 1QOQB 1VBMA 3OQPA 4E94A 5ALXA 1KETA 3RSFA 1FXWA 1G3IA 1BGXT 2P9ZA 3QVTA 3RJZA 2KBEA 3PGKA 4HG2A 1K7XB 1PGJA 4R9NA 2I2WA 3SEQA 2V3VA 1T9KA 4MQFB 1ZA1A 3JALB 1EVLA 3ZY4A 4ILEA 5BNZA 1HSOA 2VP2A 3ZK9A 3W5CA 3W5UA 3JD2A 4L0DA 1JQBA 2FWJA 3WAKA 2BEUB 3HZHA 1A8PA 2MU1A 3M1IA 4JP8A 2WPNA 4JKOA 1PUIA 2I2FA 4NPHA 2X3FA 4YRSA 4UE3S 1GNTA 5ITVA 3VR4D 2RAFA 3PFWO 1FLDA 3PD1A 2XNDA 4CU5A 5BN3B 4OXYA 4YALA 2IYSA 1NQVA 2HBZA 1WZEA 2BZGA 1ZOOA 1X92A 1TMOA 4OMDA 1JT2A 2X58A 3E4CA 5I4IA 2WOOA 4ZYVA 1I4OA 3IJPA 4DUGD 2N46A 2QR5A 3T0IA 1UJCA 2PGNA 3JZAA 4MR8A 1XPJA 4W9NC 2UXBB 1WO8A 4RV9A 1CHNA 3VO8A 5JS8A 3S28A 2YJ6A 1FRQA 3QKTA 5CK5A 5I6DA 1ZHFA 3RS0A 3ILYA 2YZNA 3IALA 1TU0A 1KOGA 1S2GA 2CWDA 2V7BA 4RPHA 3ZWYA 2H5IA 4QPCA 3GFFA 2VH2A 5KNBD 4ZXFA 4M1OA 1ESNA 821PA 3E9NA 4QODA 4RXMA 5K0LA 2BGLA 5JZBA 2PCJA 1QJ4A 3RVDA 1NWHA 1AK1A 1NPDA 2GEFA 2ZYHA 4C9BA 5DN9A 1E4OA 1H2FA 1QQ7A 3AHFA 1Z73A 3PYXA 3AF3A 5CM2Z 3BRWA 3ETNA 3TSWA 4HN2A 3EBOA 2H0AA 5DLYA 1BMDA 1XKQA 1UAGA 4UTXA 1CDOA 4K9RA 4U8HA 5HZMA 5T6BA 1CSEE 2BCGY 4LF9B 1R0CA 2H0RA 4BFYA 1XEXB 2JGLA 4QUAA 3SIWA 2VFAA 3E58A 3FYSA 4G2NA 3SC4A 4DLTA 2DC1A 2EEPA 4ENRA 4J0HA 3O1HB 3WLNA 3CWZA 1NVEA 3HXPA 3C7KA 2DFDA 1QSGA 4C04A 2WYWA 3A25A 3R6WA 4PPFA 1A8UA 2A0KA 3AIMA 2OFWA 4KXMA 4OHWA 4ZTBA 3ZD6A 1IL0A 1LX6A 1L5FA 1PHPA 1NXTA 1YA4A 3VTFA 3FDXA 1N6LA 3HZZA 2J59A 4DMLA 2O8EB 2E85A 3V7FA 1YOVA 3OF3A 2Q4TA 5CCXA 1F14A 2XH8A 4L27A 3NBZC 4GI5A 1CQIB 1F06A 3NIGB 4ABYA 1EDZA 4WNIA 1QTIA 1ZKMA 2ASVA 1W88B 4UOQA 4G0VA 1P1KA 4KQFA 3Q9SA 1K97A 1E6EA 4HX9A 1VL5A 4MGIR 4GXTA 3A9UA 4PICA 5AKEA 1YVPA 2AS0A 5E7IA 2M6LA 2IH2A 5EJ8A 2CXTA 2F9LA 2PX3A 3PXUA 5LMUB 1G4HA 3SZRA 2I62A 1U8UA 1XHEA 2Z95A 4LKOA 1L4LA 1Q1QA 4MVCA 1BXRB 1E9FA 1ZJ4A 2F3TA 4LV8B 1I3OA 4H6VA 1CUFA 5IG2A 2V3CC 1Z07A 1KXJA 4WFKA 5PGMA 3TX6A 3H5LA 3WGQA 3VDMA 1KZHA 2VWPA 3LC2O 3G49A 2ECOA 3IXLA 4YMIA 1YT5A 4UCXA 4DREA 1R6XA 3QPCA 1MEEA 3GDFA 4XPIB 3VC7A 3I8SA 3L4SO 4FDLA 1C1XA 5JISA 3ZPXA 3B1FA 5IVIA 1T9ZA 3R7AA 3UMRA 3II6X 1H2WA 4RSMA 3BXFA 3F5SA 4IWYA 3RS5A 4MCIA 4L5CA 4CM9D 1JEEA 4AAYA 2FP4A 2WWRA 4B7ZA 4DC0A 1YQQA 2FRVA 3EAFA 1FPQA 5GJCA 5U1PA 2QRGA 3CX6A 2EF0A 5AM1A 3GLIE 4KBGA 1M1YA 3SS7X 4RFSB 3ER9A 3D8UA 1UP6A 4MKXA 1STOA 4E21A 3AYZB 1C9KA 1WBBA 3WYAA 1QCZA 3PXCX 3QITA 1V1MA 3JQ6A 1DBRA 5E9WA 1M7GA 5BV1A 4H77A 4LJYA 4MKGA 1O95D 2B25A 5IYZA 1MC4A 4LGCA 1C9EA 3GNQA 4ZC1A 1NFQA 2OESA 1PJBA 2VYCA 3GEMA 3A2NA 1O94C 4L5JA 4MUAA 2GHTA 1MC1A 1DDGA 2IOYA 4CLRA 2Q0QA 1Q17A 2RGAA 2P0AA 2ATIA 3PNSA 4CQMB 3GJ3A 5BWLA 3B1ZA 1BU8A 4C2BA 1ZIXA 1U3TA 4U6SA 1SUPA 1FTSA 4MCHA 1IAVA 1H3NA 3IAFA 3ONEA 2V65A 4FR0A 4G09A 4S12A 2I1WA 3WO1A 4RXTA 5I9BA 1JE1A 5ICGA 5LM3A 4TRRA 1MB2A 4MW6A 4FBGA 2HCBA 3IIIA 5KWSA 2GKSA 3NWJA 3BCUA 4KYVA 1BOFA 2GEDA 4ZI3A 4UU1A 3ABIA 4IYRA 3U26A 1E1YA 1CE8A 1UPXA 2MYPA 5EL0A 2A1IA 4U8GA 1DBSA 2PDAA 3RVLA 3W2FA 1JILA 2VDOB 4WZBB 4G41A 2SCUA 3H4MA 1C1DB 2AG0A 2QWXA 3KEGA 4LJKA 4MX8A 3RVBA 2HJSA 4R31A 2E3JA 3NM4A 4XZ3A 4YMUA 2XLCA 3GBPA 5A03A 3HKEB 1TW2A 1G59A 2A59A 2HTEA 5EWJB 3PNYA 1LY1A 4LXQA 1IQPA 1JLSA 2VYNA 4GOOD 1TJ5A 1E63A 2W9XA 3AT1A 3HHPA 1KKUA 4HAYA 4IEIA 2VTBA 2WG2A 3GB9A 5HW0A 3R41A 5D87A 1GGVA 1CIPA 4MW0A 4QGAA 3C7CB 4TKVB 4DYHA 4OREX 3E9MA 4I4TB 3S1LA 2CXSA 1QCYA 4C07A 2XZOA 4TMWA 1JQKA 2VSFA 3W3ZB 3ZHUA 1EQ2A 5K6RA 2GF9A 4P7KA 4I3FA 3F8TA 4IZHA 4N3GA 4PTLA 4PYLA 3FPGA 4O0MA 2PG3A 1KRXA 3GHYA 4FSHA 4B6SA 3NHBA 4CQMD 1JE0A 4E51A 5D00A 1HL3A 4B2YA 5LOVB 2LCIA 1EBFA 2UKDA 1KAQA 5ETJA 4S04A 4CL0A 1KJIA 1DT5A 4OP2A 5F77A 4LOAA 4Z4EA 2WOJA 1H6BA 2BSAA 1BCRA 2IUUA 1P17A 3I45A 4PO1A 3VQTA 5WRFA 1GPJA 2PO5A 3X3HA 3A6HA 3ORRA 5HRCA 4IIFA 5CVEA 5DCWA 3LG2A 4UBMA 2Q8NA 3GUUA 1P4GA 4IYJA 3FRHA 1NXOA 3EXFA 1X0VA 3IDZA 4WRRA 4Y2QA 4JJ4A 1O4WA 2YCBA 2PX0A 4DLYA 5A1TA 1XPOA 1C7FA 2FNAA 2Z4RA 4WA8A 3CVOA 5AKXA 3NPMA 3F4BA 2YQ5A 3GI1A 3GLSA 4KYIB 4BZQA 1K8ZB 4F04A 3OZ7A 5JS7A 1YR9A 1JEQB 4MIEA 4U2FA 2ZR8A 4EECA 3O3OB 1Z0JA 4ERNA 1GTMA 1N2CB 2IE0A 3KVVA 4J3NA 2DXIA 3S1AA 3FI9A 1OIXA 1H0HA 4HATA 5JHHB 4F0JA 3L77A 2ZOSA 2WU1A 2CK3A 2G8LA 2WZBA 2XUJA 1NHWA 2X8BA 3GFGA 4KVFA 1AXEA 1JUDA 4TKLA 5ECGC 3ZDZB 2FWAA 2PHZA 3K53A 3EIXA 3LH5A 3WYGA 4YT8A 2NG1A 2R6DA 3JQ7A 2IOFK 4FGWA 3L7AA 4C08A 3NO4A 4KVAA 4CG3A 4BNFA 2CHVA 1QF7A 4GXQA 5KJCA 4J0FA 3REOA 4XVUA 5HKKA 2FWNA 2QQGA 2WNIA 3I2GA 4AMVA 4KK4A 2BGIA 1H22A 3KJZA 2AKEA 2FZVA 1YL6A 3A6JA 1P4SA 3USES 3GLFB 3M6UA 1KYYA 1N3LA 4GC9A 4C20A 4D8UA 1NI5A 1T43A 1YQ9A 2ECPA 2XWSA 3HCCA 3EF1A 3O75A 2C1EA 4CIAA 2EGUA 2XRFA 2XA9A 4FDVA 4CMEC 3W77A 5A4AA 3JVDA 2JI6A 1X1BA 1PJ2A 4X92A 3R3SA 1YHYA 1M6YA 1D3AA 3R7NA 1YGPA 3UMSA 2AN5A 3TNDA 5LYJA 3B5EA 4DCTA 3NIWA 4CE6A 5L6MB 1N2IA 2BM9A 3D8BA 3KKMA 3ACBA 4JR1A 4TQUS 5FI5A 4CKYA 1EJBA 1XRRA 1Q3HA 2XLBA 5CB4F 3UEOA 3TN7A 3GNTA 4GRAA 5IEBA 4MA5A 5FLEX 1IXSB 2JLSA 3K32A 3ZS8A 3VOAA 4EPXA 1TZBA 2NZWA 4U2CA 3M4XA 1AK9A 3WNDA 4YP1A 4BMXA 4QKQA 2PUDA 4MWEA 4ZP1A 4RD3A 4EP1A 2REBA 1AGPA 1RXSA 2E4AA 4J0KA 4NEHB 1A72A 4UTPA 5DP2A 1ETUA 3QZUA 1MH1A 1P4RA 3DTNA 1Z68A 4NPCA 4QHSA 2V7TA 3ROEA 1DZ3A 1SBQA 1VYVA 5FHQA 3VUFA 3LKZA 4G5GA 3PRKE 1JDUA 4O2RA 4J3FA 3D64A 3L8ZA 3CO5A 2ZJBA 2ZGVA 5BUZA 3VMFA 4UVGA 2A9VA 1YMVA 2EERA 1T25A 4HWPA 3LWZA 3CVUA 5CYPA 1Z2DA 2QVXX 1GRCA 3DO8A 3FSGD 3K72B 4UPDA 4CM3A 1OBVA 5KTPA 4JWKA 5I7WA 2C9BA 1MVLA 2QTWB 4WUVA 1JMKC 4QJ3A 1AHIA 4L8YA 4HWKA 3COPA 5B1HA 3ETHA 3IOMA 2VSNA 5ALNA 3ESZA 3CHYA 1T8YA 2A6PA 1UM9A 2G5PA 4FQ7A 4Y0VA 5GTDA 1U2QA 4LJ6A 4MYDA 5C7YA 3MT0A 5YASA 2QM3A 1KIMA 1KZ4A 4EVRA 3SYNA 1Y1RA 1VG9B 3EWAA 3T99A 4ZYZA 4MPRA 5BSEA 4M8KA 2OYCA 3U9TA 3FDZA 3DQQA 4V02A 1CP2A 4MTLA 4XB2A 4E46A 1IULA 2JJ1A 4R6WA 2YR0A 2JIMA 4RDXA 3SX0A 3QLUC 1A4XA 2C98A 2VDJA 1AS3A 1UZLA 1YJAA 3B5JA 3QMVA 1HE4A 3AF4A 3OHSX 4CM8B 1JIVA 2PGDA 2YS7A 1BNCA 1H5QA 3NWOA 3SMVA 2B6HA 5GJBA 1W4BA 5BSHA 2EFEB 3CRNA 4Z1MD 1Y3AA 3AH8A 2Q7OE 3TRKA 3HL4A 1SOUA 1WMAA 5CIWA 1Z6GA 4KIJA 2FP3A 3WY9A 1EFVB 2JS7A 1OBHA 4R81A 2YHUA 2WDPA 1PEDA 4LF7B 4Y6LA 2LWIA 2XGSA 2WSYB 13PKA 3Q7QA 3VTZA 1F6WA 4KNVA 5FPPA 3D2BA 1JFRA 4G0WA 3AVQA 3NBUA 2Q41A 1DAHA 2ZT7A 1NVXQ 1XYYA 2OHVA 4TPKA 1T4MA 4N48A 1EWVA 3GEDA 4NJMA 1KI6B 4MCAA 4Q7EA 5K7SA 1CUYA 2VPYA 1ESMA 1GUAA 1C0LA 2EKBA 1ISGA 2FY8A 3LOUA 1GPYA 1QE5A 1ZK2A 4M8SA 4OMFG 2ZZKA 3NH9A 2JA1A 4NJEB 2HGSA 5ARCA 4A8JA 3NTOA 4UMEA 2O1XA 2JGDA 2B3DA 2FEKA 2XWQA 3P9QA 5EHGA 4EENA 2JDIA 4WKNA 3UJNA 2A0WA 1TDJA 4HWGA 2ZRFA 1XMQB 2ZT5A 3TR6A 5H9VA 3UQYS 1ORVA 2QRVA 3FOBA 4WE3A 5FUWA 3W3AD 5KB3A 3PHBE 5FCDA 3MS7A 1U3DA 3KUXA 3TPFA 3NIDB 4E7OA 4EVIA 5C3MA 4IIUA 5ALHA 5F52A 3ZIAA 2QVZX 1D03A 2LE0A 3DXYA 4LMPA 4QX6A 1AKMA 3GJ6A 4RPCA 3G13A 5I9MA 2IYWA 4WADA 3I0MA 3WFIA 5CLFA 2PUJA 5PNTA 4ZT6A 2XKAA 1XUOA 4TTVA 1XRNA 2G9QA 4S05A 2BLLA 3M34A 4GX5A 1Z5UA 2Q5QA 4KG7A 5FBQB 4REMA 4DM4A 2XMDA 2DTEA 3E8SA 1OFVA 4M8NE 4TV9A 5L3ZA 3ZNQA 1AB6A 2VJAA 3ID6C 2GJ8A 4RQUA 1XTRA 4L1KA 4YRZA 5A3VA 4E08A 1IEQA 1M2FA 3O8OB 2VAMA 4X65B 1UJNA 3JQAA 3RT9A 3BJIC 3GMTA 4FYYA 1M34A 1SC4A 1F60A 4LXXA 4W8HA 3LY5A 1R16A 1SG0A 5H7XA 1R8JA 1I80A 2P2NA 5K8JB 2OKCA 4W1PA 4B4UA 5K1ZA 4KR0A 1OXMA 2C8LA 2FN7A 3KXLA 5B6IA 5IRCD 2ADFA 3T1HB 1V16A 2H51A 2VNSA 5FT9A 3ZDBA 1LTKA 3EQ9A 4ZZ1A 1Z33A 3UH0A 1QPZA 5EKDA 2F67A 3FYDA 2LXNA 5C8YF 2R97A 3CLSD 3AUAA 3UPDA 3OCWA 4DABA 4AL4A 5HM8A 1ZGGA 1NLUA 4E5PA 1WDTA 3NKVA 2V1XA 1N32B 1KEEB 2A9JA 3K4PA 5TEVA 3E7WA 3QF7A 4HH4A 1NIJA 5TGZA 4CV2A 1ZJ5A 2VL7A 2QTLA 3S7ZA 3VU9B 5FPKA 3ZWQA 1S9DA 4GSLA 3GFOA 5KKAA 3A6EA 4PBRA 4CLOA 5KNDA 3INYA 3QE0A 3TTSA 5B7NA 2W5UA 3R5JA 5ESDA 1U5BA 4MEJA 3FOAA 2RGWA 2E7ZA 1B43A 1R3DA 1VJ5A 3GAFA 4IUDS 4J1SA 1YZFA 4MW2A 3PC4A 4CNBA 4L8WB 2IYUA 3F8WA 4N4AA 3OKPA 4X7RA 3IE0A 1FP1D 2OT3B 3NJ4A 3GJRA 1T2VA 3VPCA 4A91A 5DK6A 1OAOC 3KPVA 4YJ3A 4P81A 4UPVA 5DYIA 4EUNA 3L18A 3DOCA 1WNTA 2QXUA 5H4GA 2WIJA 1G8PA 3I2IA 3MWKA 4FX2A 4K5QA 4R1TA 5B1SA 4BS9A 1GG8A 1VSBA 5JD3A 4B46A 4N5DA 2QS9A 2O0KA 1Z3CA 2CLIB 2D5CA 2XD9A 1N9GA 2C2MA 1CJVC 3PJDA 3WNQA 3R0IA 1JHVA 3GNSA 3LBAA 4ZAGA 1QP7A 2C31A 1A71A 1W44A 3DZGA 4BO4A 4IFEA 3V6MA 2HBYA 2L2QA 4ASUA 1H93A 1RRKA 2EEZA 3HCRA 1MC8A 1KKMA 2I3ZA 2UVDA 2VJCA 4FQ5A 1EFRA 4AZVA 1BDIA 4UDYX 3RKUA 1L8QA 4RY8A 1CJUC 3IEVA 1G291 3D2CA 4OL9A 1NOIA 4KWTA 3AXTA 1L8LA 4NH0A 5EXEA 5SICE 3ESXA 4LJRA 2CFOA 3UWPA 1LQUA 4MYRA 5CBKA 1E8MA 5JSZB 1F7UA 3ZXIA 1F5SA 3EIEA 4FD3A 5LA6B 3R4CA 4G01B 3R6DA 4H35A 4LG1A 4E09A 1FNSA 2VCEA 3O9MA 4O4HA 4TROA 1J2YA 1WQ1R 4KFTA 3HDHA 1SU7A 2JB9A 4EF5A 5AVQA 1S8AA 1PG0A 3KFLA 4Z8XA 4TL9A 4B6OA 5ARBA 5KQLA 3FWPA 3M9LA 2IDZA 4ER6A 2FE1A 2OCLA 2NVOA 1J0CA 1FTQA 1QNLA 3F49S 3LPLA 3PE6A 5B12A 5B1EA 4Q34A 4ZI7F 1GO2A 1SHUX 2W2MA 2JH8A 2ZB8A 3B12A 3TZKA 4YPVA 3RIMA 2VUSA 3PGJA 2RG7A 4AU1A 1F0KA 5F1YA 4Z9AA 2QOEA 4TS9A 3B89A 5JY6A 1Z6TA 1HDZA 4NCAA 1XXLA 5KZMB 1PK9A 3GGCA 2XTAA 2YDYA 2VT3A 2FETA 3NHUA 4GUDA 4XWTA 5JH7B 5LZ9A 3TLGB 3WGIA 4R1SA 4IHKA 3ZWKA 2IV7A 4JB8A 3PIIA 1ADCA 4Q3AA 5J2UB 2A0XA 1WPXA 1TW3A 3IMCA 5P21A 1MO3A 4ARBA 3KLOA 4N0DA 1YBHA 3COSA 2OXTA 3V4OA 1JPNA 1CUIA 4MVJI 1JIKA 2NZ2A 3A1EA 2NGRA 2JFOA 3FCXA 1Z45A 4U2DA 2QRZA 5ALRA 2ILVA 2X15A 2ZFUA 4MARA 4XWGA 4D2IA 2DQZA 2IHJA 4HFNA 1RRFA 1S8NA 2VH1A 5SY9A 1DRJA 1RLJA 2NX2A 4GLLA 1CR2A 1TAGA 3CNEA 2LKDA 3G79A 2RH5A 2G70A 2BVNA 3G2IA 3T61A 5JXIA 4FZRA 3DFFA 4BE9A 1R6AA 2R2AA 2ZJ4A 3ICWA 4R2XA 4Y1EA 5HVNA 1QR2A 1E3SA 4XUGB 2BELA 3LW7A 5I47A 1SZJG 2Y1KA 4ODIA 3VNVA 4FHCA 2H2DA 2OXEA 1T9GR 1PFVA 3TTXA 2PUVA 2IOQA 1EFKA 1RLOA 3F6YA 2CUZA 3Q5DA 4JBLA 4IGKA 3UBTA 1BKYA 4RAOA 4TVKA 4GLBA 3M4ZA 1IK6A 1UQRA 1ZFNA 4HGNA 4ANFA 5LXTA 4B6FA 1Y82A 3OQMA 2Q3LA 3LOQA 2GZ2A 3D59A 1V8BA 4PRKA 4NYJR 1R3UA 2EATA 4EKNB 3CVJA 2AI1A 3UHFA 4Q0MA 1XD2B 3HN6A 3FIJA 2VZEA 4DCOA 4BGUA 2ZAIA 1XTTA 3ESAA 4MROA 2HQSA 4TTTS 1ZU5A 2FI1A 1DO8A 1XN1A 1U2SA 4EGAA 3EPJA 1WTCA 2AQ8A 1TRKA 2WWXA 4CEJA 2XMRA 3HPQA 3MT9A 3HV0A 4WNYA 3H75A 3ADKA 3DEZA 2XCQA 3VOBA 2A86A 3OE1A 1EUDA 1SU4A 2R6ZA 2XYVA 5CNKA 1YQEA 2I6SA 3C15C 3LF1A 1FE8A 1L7XA 2C82A 4MHSA 3KXDA 4OAOA 4JLUA 4QJIA 1MAUA 2XUAA 5CEJA 4R2MA 4RIEA 4IHQA 2AXNA 5GJWC 4NESA 3GMIA 2AOWA 2HIHA 2VNHA 1SCJA 3NEYA 3JYNA 2UZIR 1Y9JA 1DIBA 5I8WA 1HFEL 1XU9A 1FX1A 2X0JA 1TEXA 4I6GA 3BN3A 4JAVC 2J08A 2OO5A 3F5FA 3LXMA 3PDHA 3HADA 2XDAA 4KXFB 3SVZA 1GR1A 3WIEA 2YWXA 3U4QB 2CXXA 4I55A 1D1TA 1HTTA 1RQPA 3FW1A 4FXPA 4MWGA 4D02A 3SX2A 1DRKA 1LV7A 1Z34A 2VHUA 3ZY6A 4B82A 4PM4A 2AYYA 4DR5B 2QVLA 1L4NA 4ZV7A 1WLYA 2BAGA 1C9NA 1EFHA 2A0YA 1K63A 1E1RD 1L5WA 4R1UA 1M1NA 1RIFA 5C4IA 1J0EA 2Z2KA 1QF9A 1W75A 3IVRA 5F3DA 3VNSA 5BQ5A 4QUGA 4YV1A 4RA6B 4A7PA 5HUQA 5KCZA 5KYWB 2J0EA 4DSAA 3PNLA 2WV9A 2XMSA 2HU7A 1IY1A 3EPLA 3ELDA 1V47A 3WOVA 1U3WA 4PWZA 3U7RA 1JR6A 3K0EA 4XUEA 4HBZA 2RGNA 4EG1A 3MLEA 1UMCB 4ETMA 3ESBA 3UB4A 1QVWA 5CLQA 4DUYB 2HLHA 3BXPA 2ECKA 2G6TA 1FF9A 4HDKA 4HSGA 4Z86A 5FIUA 2AKAB 3UKJA 1SKYE 3QEJA 4LRXA 1Q7RA 2JBHA 2HZ7A 3T38A 4F6CA 1TEZA 2I3BA 4D25A 1HT0A 2JFFA 4ZYWA 1NMQA 4BUCA 5HOQA 1J0AA 4LWOA 4BMZA 4C6RA 4UDXX 3ORFA 2JFXA 4TMKA 4CF3A 1AKYA 4EMUA 5K0GA 1ZXBA 3RYTC 3FPHA 1SKAA 3VHQA 4ZO4A 5I9LA 5EIHA 5DVZA 5JNWA 1OFIA 3GA7A 3O7WA 4WHMA 1XQ9A 5IMBA 3V48A 1G8JA 4DLXA 2W70A 5B4UA 2JD2A 1NFRA 2C04A 3PUVA 1EFPA 2ZPTX 3D1LA 4JEHA 2CNWA 2GXSA 1ZEJA 1SM4A 3OVMA 4V1CB 4J6EA 2FN3A 4PCAA 3ZXYA 1IJKA 1CNEA 5CD9A 1HV8A 1TIBA 2PKQO 3GZTB 3R8XA 1EVQA 1MABB 4PSUA 3WI7A 3ZHXA 1M83A 2Y3IA 5IT5A 1I14A 2QP4A 1VMEA 1R0BA 4N01A 2FR0A 4TS4A 1S02A 3IOBA 4HYEA 1LC0A 2IPOA 3OZSA 4L57A 3K9CA 4QTYA 2ERCA 4BN4A 3ER6A 1QIMA 2CVFA 1GPNA 2WJHA 5IS2A 3TXXA 3EARA 1XDUA 3GFTA 4H7JA 4UOEA 2IPNA 3IMFA 4MA0A 4YUZA 2CDBA 5EZ6B 2AC4A 5DIZA 2JD1A 2FN8A 5A6SB 1ULBA 2XMPA 1T3TA 3UATA 1TKCA 5CH3A 1KOLA 1L5HA 1N0UA 5H16A 4B3JA 3DDSA 3CJQA 1R8QA 5F23A 5KNLA 4TSRA 2NQ2C 2G06A 2NV2B 1KDOA 2RFLA 3P2EA 4EEXA 9ATCA 3PFCA 3PICA 4GX2A 5JD5A 4LDPA 4JKYA 1IM5A 3V8MA 2VSYA 4JV5B 1E64A 2MIIA 4RSRA 3LZDA 3WJ1A 3ORSA 3NHZA 2EHDA 4AQDA 3F97A 4QDZA 5BMVA 4FN5A 2BBSA 4HT3B 2J9RA 1XJCA 5C53B 2P9EA 3F71A 3FR7A 2WMDA 1OFGA 5ALFA 4CKBB 3CVXA 3D7LA 5EP4A 3S4YA 4BBZA 2PEZA 4G3XA 1M8KA 2XRYA 1MB9A 4QDXA 4A16A 2FLWA 4L95C 3EPPA 1FJGB 2DBQA 2VZ9A 5DHPA 3VO2A 4JVLA 1OYVA 3SZGA 1KTVA 5CX1B 2C54A 5DO9A 1VRWA 3WNBA 2PVPA 3PR2B 4DYVA 2QMZA 2AJ8A 1JG3A 2OO3A 3C6YA 1ABBA 1ZXLA 2BBOA 5EIXA 3BM5A 1MAHA 3KQQA 3FZGA 4KGZA 3RV4A 5LDDC 2IQIA 1Z6YA 1CQJA 3B3AA 4B5KA 1ZH4A 4EDFA 5E1BA 2XA1A 4LXYA 3LQ2A 3O8RA 4ZAYA 4WK4B 4X24A 1Z3IX 3PB3A 4ZTUB 3QVVA 4PFKA 4N8SA 2I8AA 4HB0A 1RI3A 4MV3A 3SHVA 1J1IA 5FWXB 2HWXA 3S68A 4GNKA 1CY8A 2TMYA 5AJXA 4EWLA 5ICSA 3Q0TA 3BSYA 4UBKA 3TM4A 1RJGA 3MS2A 4JLPA 3VSEA 1CFJA 2QT1A 4P98A 1M2KA 3TBHA 1CK4A 5JCOC 4NK4A 2CNLA 1L7DA 1Q7GA 1ZM9A 4XB1A 4B3BA 1ZCBA 4IJ6A 5CVDA 4GMKA 2I87A 2AUTA 4HVAA 1QF6A 4MV6A 4QQKA 5U4XA 3IB3A 2PLAA 4XSHA 1L9KA 3HYSA 2W2KA 1U7XA 4QVIA 2FSVA 3I09A 4FWIB 3EZNA 2OECA 4OK6A 4Z4QA 3MYRA 5SYNA 3GT4A 4EO4A 4MVJE 4O1HA 2ONJA 1KYVA 3SF8B 1L7OA 3B7GA 3EUWA 3NAQA 5AK5A 9GPBA 7REQB 3MSXA 1L5OA 2R5NA 1IHPA 2QJWA 3WL8A 3OM8A 2HCJB 4OXXA 4YRMA 4LCJA 1ORWA 4J1QA 1C80A 1N2XA 2SBTA 3OZRA 4L9AA 2R6GA 3Q40A 3Q6IA 3RRFA 1N7JA 3O9VA 1SBZA 1E2EA 3PC8A 4UVDA 1R6UA 2I3AA 3T3DA 1BD4A 4RBNA 5B3AA 4HNUA 5DCYA 1K27A 1QRUA 4J7CA 3K09A 2E6UX 1BEZA 2DYKA 4M9CA 2L17A